data_2R2N
# 
_entry.id   2R2N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2R2N         
RCSB  RCSB044347   
WWPDB D_1000044347 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2qlr 
_pdbx_database_related.details        'Crystal structure of human kynurenine aminotransferase II' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2R2N 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Han, Q.'      1 
'Robinson, H.' 2 
'Li, J.'       3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human kynurenine aminotransferase II.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                3567 
_citation.page_last                 3573 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18056995 
_citation.pdbx_database_id_DOI      10.1074/jbc.M708358200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Han, Q.'      1 
primary 'Robinson, H.' 2 
primary 'Li, J.'       3 
# 
_cell.entry_id           2R2N 
_cell.length_a           70.843 
_cell.length_b           109.360 
_cell.length_c           119.354 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2R2N 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial' 47400.434 4    '2.6.1.7, 2.6.1.39' ? ? ? 
2 non-polymer syn "4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE"                      248.173   4    ?                   ? ? ? 
3 non-polymer syn '(2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid'            208.214   4    ?                   ? ? ? 
4 non-polymer syn GLYCEROL                                                       92.094    6    ?                   ? ? ? 
5 water       nat water                                                          18.015    1341 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KAT/AadAT, Kynurenine--oxoglutarate transaminase II, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, 2-aminoadipate transaminase, 2- aminoadipate aminotransferase, Alpha-aminoadipate aminotransferase, AadAT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 LYS n 
1 241 PHE n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LYS n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTYB 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2R2N A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 2R2N B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
3 1 2R2N C 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
4 1 2R2N D 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                             ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                            ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                          ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                     ?                               'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                            ?                               'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                           ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                     ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                             ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer         . GLYCEROL                                            'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking' y HISTIDINE                                           ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                               ?                               'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                          ?                               'C6 H13 N O2'    
131.173 
KYN 'L-peptide linking' n '(2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid' L-KYNURENINE                    'C10 H12 N2 O3'  
208.214 
LEU 'L-peptide linking' y LEUCINE                                             ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                              ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                          ?                               'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                       ?                               'C9 H11 N O2'    
165.189 
PMP non-polymer         . "4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE"           "PYRIDOXAMINE-5'-PHOSPHATE"     'C8 H13 N2 O5 P' 
248.173 
PRO 'L-peptide linking' y PROLINE                                             ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                              ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                           ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                          ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                            ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                              ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          2R2N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '100 mM Hepes, 15% PEG 10000, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111 Channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0809 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0809 
# 
_reflns.entry_id                     2R2N 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.95 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   132070 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   62.1 
_reflns_shell.Rmerge_I_obs           0.373 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2R2N 
_refine.ls_number_reflns_obs                     116774 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.68 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    93.14 
_refine.ls_R_factor_obs                          0.19568 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19425 
_refine.ls_R_factor_R_free                       0.2228 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6185 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               29.617 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2qlr 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.200 
_refine.pdbx_overall_ESU_R_Free                  0.161 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13330 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         160 
_refine_hist.number_atoms_solvent             1341 
_refine_hist.number_atoms_total               14831 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        26.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.018  0.022  ? 13812 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.796  1.984  ? 18742 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.676  5.000  ? 1696  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.658 24.583 ? 576   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   18.237 15.000 ? 2364  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.484 15.000 ? 64    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.207  0.200  ? 2064  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 10440 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.231  0.200  ? 7209  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.312  0.200  ? 9437  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.165  0.200  ? 1282  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.268  0.200  ? 86    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.139  0.200  ? 27    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.958  1.500  ? 8538  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.710  2.000  ? 13856 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.827  3.000  ? 5274  'X-RAY DIFFRACTION' ? 
r_scangle_it             4.300  4.500  ? 4886  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.949 
_refine_ls_shell.d_res_low                        1.999 
_refine_ls_shell.number_reflns_R_work             5436 
_refine_ls_shell.R_factor_R_work                  0.228 
_refine_ls_shell.percent_reflns_obs               59.53 
_refine_ls_shell.R_factor_R_free                  0.285 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             307 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2R2N 
_struct.title                     'The crystal structure of human kynurenine aminotransferase II in complex with kynurenine' 
_struct.pdbx_descriptor           'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial (E.C.2.6.1.7, 2.6.1.39)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2R2N 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;alpha & beta protein, PLP-dependent transferase, Aminotransferase, Mitochondrion, Multifunctional enzyme, Pyridoxal phosphate, Transit peptide, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 2 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 2   ? ILE A 7   ? ASN A 2   ILE A 7   5 ? 6  
HELX_P HELX_P2  2  THR A 8   ? ALA A 13  ? THR A 8   ALA A 13  1 ? 6  
HELX_P HELX_P3  3  PRO A 18  ? ARG A 20  ? PRO A 18  ARG A 20  5 ? 3  
HELX_P HELX_P4  4  THR A 21  ? GLY A 29  ? THR A 21  GLY A 29  1 ? 9  
HELX_P HELX_P5  5  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P6  6  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P7  7  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P8  8  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P9  9  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P10 10 TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P11 11 PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P12 12 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P13 13 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P14 14 TYR A 233 ? GLN A 237 ? TYR A 233 GLN A 237 5 ? 5  
HELX_P HELX_P15 15 PHE A 246 ? ASP A 250 ? PHE A 246 ASP A 250 5 ? 5  
HELX_P HELX_P16 16 LYS A 278 ? VAL A 290 ? LYS A 278 VAL A 290 1 ? 13 
HELX_P HELX_P17 17 SER A 296 ? LEU A 341 ? SER A 296 LEU A 341 1 ? 46 
HELX_P HELX_P18 18 VAL A 366 ? GLU A 372 ? VAL A 366 GLU A 372 1 ? 7  
HELX_P HELX_P19 19 GLU A 372 ? MET A 377 ? GLU A 372 MET A 377 1 ? 6  
HELX_P HELX_P20 20 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P21 21 SER A 406 ? LEU A 425 ? SER A 406 LEU A 425 1 ? 20 
HELX_P HELX_P22 22 ASN B 2   ? ILE B 7   ? ASN B 2   ILE B 7   5 ? 6  
HELX_P HELX_P23 23 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P24 24 THR B 21  ? ARG B 28  ? THR B 21  ARG B 28  1 ? 8  
HELX_P HELX_P25 25 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P26 26 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P27 27 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P28 28 PRO B 97  ? TYR B 102 ? PRO B 97  TYR B 102 5 ? 6  
HELX_P HELX_P29 29 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P30 30 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P31 31 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P32 32 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P33 33 ARG B 177 ? TRP B 178 ? ARG B 177 TRP B 178 5 ? 2  
HELX_P HELX_P34 34 LYS B 179 ? ASN B 189 ? LYS B 179 ASN B 189 5 ? 11 
HELX_P HELX_P35 35 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P36 36 TYR B 233 ? GLN B 237 ? TYR B 233 GLN B 237 5 ? 5  
HELX_P HELX_P37 37 PHE B 246 ? ASP B 250 ? PHE B 246 ASP B 250 5 ? 5  
HELX_P HELX_P38 38 LYS B 278 ? VAL B 290 ? LYS B 278 VAL B 290 1 ? 13 
HELX_P HELX_P39 39 SER B 296 ? THR B 342 ? SER B 296 THR B 342 1 ? 47 
HELX_P HELX_P40 40 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P41 41 GLU B 372 ? MET B 377 ? GLU B 372 MET B 377 1 ? 6  
HELX_P HELX_P42 42 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P43 43 SER B 406 ? SER B 424 ? SER B 406 SER B 424 1 ? 19 
HELX_P HELX_P44 44 ASN C 2   ? ILE C 7   ? ASN C 2   ILE C 7   5 ? 6  
HELX_P HELX_P45 45 THR C 8   ? ARG C 14  ? THR C 8   ARG C 14  1 ? 7  
HELX_P HELX_P46 46 PRO C 18  ? THR C 21  ? PRO C 18  THR C 21  5 ? 4  
HELX_P HELX_P47 47 MET C 22  ? ARG C 28  ? MET C 22  ARG C 28  1 ? 7  
HELX_P HELX_P48 48 ASN C 42  ? PHE C 46  ? ASN C 42  PHE C 46  5 ? 5  
HELX_P HELX_P49 49 GLY C 64  ? LEU C 72  ? GLY C 64  LEU C 72  1 ? 9  
HELX_P HELX_P50 50 ILE C 80  ? ASN C 96  ? ILE C 80  ASN C 96  1 ? 17 
HELX_P HELX_P51 51 PRO C 103 ? GLY C 107 ? PRO C 103 GLY C 107 5 ? 5  
HELX_P HELX_P52 52 GLY C 116 ? ILE C 129 ? GLY C 116 ILE C 129 1 ? 14 
HELX_P HELX_P53 53 TYR C 142 ? HIS C 150 ? TYR C 142 HIS C 150 1 ? 9  
HELX_P HELX_P54 54 PRO C 151 ? GLY C 153 ? PRO C 151 GLY C 153 5 ? 3  
HELX_P HELX_P55 55 VAL C 167 ? SER C 176 ? VAL C 167 SER C 176 1 ? 10 
HELX_P HELX_P56 56 ARG C 177 ? TRP C 178 ? ARG C 177 TRP C 178 5 ? 2  
HELX_P HELX_P57 57 LYS C 179 ? ASN C 185 ? LYS C 179 ASN C 185 5 ? 7  
HELX_P HELX_P58 58 THR C 209 ? TYR C 223 ? THR C 209 TYR C 223 1 ? 15 
HELX_P HELX_P59 59 TYR C 233 ? GLN C 237 ? TYR C 233 GLN C 237 5 ? 5  
HELX_P HELX_P60 60 PHE C 246 ? ASP C 250 ? PHE C 246 ASP C 250 5 ? 5  
HELX_P HELX_P61 61 LYS C 278 ? SER C 291 ? LYS C 278 SER C 291 1 ? 14 
HELX_P HELX_P62 62 SER C 296 ? THR C 342 ? SER C 296 THR C 342 1 ? 47 
HELX_P HELX_P63 63 VAL C 366 ? MET C 377 ? VAL C 366 MET C 377 1 ? 12 
HELX_P HELX_P64 64 ASN C 385 ? TYR C 388 ? ASN C 385 TYR C 388 5 ? 4  
HELX_P HELX_P65 65 SER C 406 ? LEU C 425 ? SER C 406 LEU C 425 1 ? 20 
HELX_P HELX_P66 66 ASN D 2   ? ILE D 7   ? ASN D 2   ILE D 7   5 ? 6  
HELX_P HELX_P67 67 THR D 8   ? ARG D 14  ? THR D 8   ARG D 14  1 ? 7  
HELX_P HELX_P68 68 PRO D 18  ? MET D 22  ? PRO D 18  MET D 22  5 ? 5  
HELX_P HELX_P69 69 ILE D 25  ? GLY D 29  ? ILE D 25  GLY D 29  5 ? 5  
HELX_P HELX_P70 70 ASN D 42  ? PHE D 46  ? ASN D 42  PHE D 46  5 ? 5  
HELX_P HELX_P71 71 GLY D 64  ? LEU D 72  ? GLY D 64  LEU D 72  1 ? 9  
HELX_P HELX_P72 72 ILE D 80  ? ASN D 96  ? ILE D 80  ASN D 96  1 ? 17 
HELX_P HELX_P73 73 PRO D 103 ? GLY D 107 ? PRO D 103 GLY D 107 5 ? 5  
HELX_P HELX_P74 74 GLY D 116 ? ILE D 129 ? GLY D 116 ILE D 129 1 ? 14 
HELX_P HELX_P75 75 TYR D 142 ? HIS D 150 ? TYR D 142 HIS D 150 1 ? 9  
HELX_P HELX_P76 76 PRO D 151 ? GLY D 153 ? PRO D 151 GLY D 153 5 ? 3  
HELX_P HELX_P77 77 VAL D 167 ? SER D 176 ? VAL D 167 SER D 176 1 ? 10 
HELX_P HELX_P78 78 ARG D 177 ? TRP D 178 ? ARG D 177 TRP D 178 5 ? 2  
HELX_P HELX_P79 79 LYS D 179 ? ASN D 189 ? LYS D 179 ASN D 189 5 ? 11 
HELX_P HELX_P80 80 THR D 209 ? TYR D 223 ? THR D 209 TYR D 223 1 ? 15 
HELX_P HELX_P81 81 TYR D 233 ? GLN D 237 ? TYR D 233 GLN D 237 5 ? 5  
HELX_P HELX_P82 82 PHE D 246 ? ASP D 250 ? PHE D 246 ASP D 250 5 ? 5  
HELX_P HELX_P83 83 LYS D 278 ? SER D 291 ? LYS D 278 SER D 291 1 ? 14 
HELX_P HELX_P84 84 SER D 296 ? THR D 342 ? SER D 296 THR D 342 1 ? 47 
HELX_P HELX_P85 85 VAL D 366 ? GLU D 372 ? VAL D 366 GLU D 372 1 ? 7  
HELX_P HELX_P86 86 GLU D 372 ? MET D 377 ? GLU D 372 MET D 377 1 ? 6  
HELX_P HELX_P87 87 ASN D 385 ? TYR D 388 ? ASN D 385 TYR D 388 5 ? 4  
HELX_P HELX_P88 88 SER D 406 ? GLU D 423 ? SER D 406 GLU D 423 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 17  A . ? SER 17  A PRO 18  A ? PRO 18  A 1 -14.72 
2  GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 6.85   
3  ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 17.24  
4  SER 17  B . ? SER 17  B PRO 18  B ? PRO 18  B 1 -28.70 
5  GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 -2.61  
6  ASN 202 B . ? ASN 202 B PRO 203 B ? PRO 203 B 1 20.25  
7  SER 17  C . ? SER 17  C PRO 18  C ? PRO 18  C 1 -10.15 
8  GLU 139 C . ? GLU 139 C PRO 140 C ? PRO 140 C 1 5.57   
9  ASN 202 C . ? ASN 202 C PRO 203 C ? PRO 203 C 1 15.94  
10 SER 17  D . ? SER 17  D PRO 18  D ? PRO 18  D 1 -10.58 
11 GLU 139 D . ? GLU 139 D PRO 140 D ? PRO 140 D 1 1.02   
12 ASN 202 D . ? ASN 202 D PRO 203 D ? PRO 203 D 1 18.79  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 7 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 7 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 7 ? 
Q ? 2 ? 
R ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
P 6 7 ? parallel      
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
A 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
B 1 ILE A 61  ? PHE A 63  ? ILE A 61  PHE A 63  
B 2 PHE A 48  ? VAL A 55  ? PHE A 48  VAL A 55  
B 3 PHE B 48  ? VAL B 55  ? PHE B 48  VAL B 55  
B 4 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
C 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
C 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
C 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
C 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
C 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
C 6 ASN A 134 ? ASP A 138 ? ASN A 134 ASP A 138 
C 7 ASN A 155 ? VAL A 159 ? ASN A 155 VAL A 159 
D 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
D 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
E 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
E 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
E 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
E 4 LEU A 382 ? PRO A 383 ? LEU A 382 PRO A 383 
F 1 VAL A 379 ? LEU A 380 ? VAL A 379 LEU A 380 
F 2 ILE B 34  ? SER B 35  ? ILE B 34  SER B 35  
G 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
G 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
G 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
G 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
G 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
G 6 ASN B 134 ? ASP B 138 ? ASN B 134 ASP B 138 
G 7 ASN B 155 ? VAL B 159 ? ASN B 155 VAL B 159 
H 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
H 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
I 1 ALA B 345 ? TRP B 347 ? ALA B 345 TRP B 347 
I 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
I 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
I 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
J 1 ILE C 34  ? SER C 35  ? ILE C 34  SER C 35  
J 2 VAL D 379 ? LEU D 380 ? VAL D 379 LEU D 380 
K 1 ILE C 61  ? PHE C 63  ? ILE C 61  PHE C 63  
K 2 PHE C 48  ? VAL C 55  ? PHE C 48  VAL C 55  
K 3 PHE D 48  ? VAL D 55  ? PHE D 48  VAL D 55  
K 4 ILE D 61  ? PHE D 63  ? ILE D 61  PHE D 63  
L 1 MET C 109 ? THR C 114 ? MET C 109 THR C 114 
L 2 GLY C 272 ? PRO C 277 ? GLY C 272 PRO C 277 
L 3 VAL C 255 ? SER C 260 ? VAL C 255 SER C 260 
L 4 LEU C 226 ? ASP C 230 ? LEU C 226 ASP C 230 
L 5 PHE C 193 ? THR C 196 ? PHE C 193 THR C 196 
L 6 ASN C 134 ? ASP C 138 ? ASN C 134 ASP C 138 
L 7 ASN C 155 ? VAL C 159 ? ASN C 155 VAL C 159 
M 1 SER C 161 ? ASP C 162 ? SER C 161 ASP C 162 
M 2 GLY C 165 ? ILE C 166 ? GLY C 165 ILE C 166 
N 1 ALA C 345 ? GLU C 346 ? ALA C 345 GLU C 346 
N 2 PHE C 355 ? VAL C 360 ? PHE C 355 VAL C 360 
N 3 TYR C 397 ? SER C 401 ? TYR C 397 SER C 401 
N 4 LEU C 382 ? PRO C 383 ? LEU C 382 PRO C 383 
O 1 VAL C 379 ? LEU C 380 ? VAL C 379 LEU C 380 
O 2 ILE D 34  ? SER D 35  ? ILE D 34  SER D 35  
P 1 MET D 109 ? THR D 114 ? MET D 109 THR D 114 
P 2 GLY D 272 ? PRO D 277 ? GLY D 272 PRO D 277 
P 3 VAL D 255 ? SER D 260 ? VAL D 255 SER D 260 
P 4 LEU D 226 ? ASP D 230 ? LEU D 226 ASP D 230 
P 5 PHE D 193 ? THR D 196 ? PHE D 193 THR D 196 
P 6 ASN D 134 ? LEU D 137 ? ASN D 134 LEU D 137 
P 7 ASN D 155 ? ASN D 158 ? ASN D 155 ASN D 158 
Q 1 SER D 161 ? ASP D 162 ? SER D 161 ASP D 162 
Q 2 GLY D 165 ? ILE D 166 ? GLY D 165 ILE D 166 
R 1 ALA D 345 ? GLU D 346 ? ALA D 345 GLU D 346 
R 2 PHE D 355 ? VAL D 360 ? PHE D 355 VAL D 360 
R 3 TYR D 397 ? SER D 401 ? TYR D 397 SER D 401 
R 4 LEU D 382 ? PRO D 383 ? LEU D 382 PRO D 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 34  ? N ILE A 34  O LEU B 380 ? O LEU B 380 
B 1 2 O ILE A 61  ? O ILE A 61  N ILE A 53  ? N ILE A 53  
B 2 3 N THR A 54  ? N THR A 54  O LYS B 49  ? O LYS B 49  
B 3 4 N ILE B 53  ? N ILE B 53  O ILE B 61  ? O ILE B 61  
C 1 2 N ASP A 110 ? N ASP A 110 O GLY A 276 ? O GLY A 276 
C 2 3 O PHE A 273 ? O PHE A 273 N ASP A 259 ? N ASP A 259 
C 3 4 O ILE A 256 ? O ILE A 256 N ILE A 227 ? N ILE A 227 
C 4 5 O ILE A 228 ? O ILE A 228 N LEU A 194 ? N LEU A 194 
C 5 6 O TYR A 195 ? O TYR A 195 N LEU A 136 ? N LEU A 136 
C 6 7 N VAL A 135 ? N VAL A 135 O ILE A 157 ? O ILE A 157 
D 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
E 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
E 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
E 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
F 1 2 N LEU A 380 ? N LEU A 380 O ILE B 34  ? O ILE B 34  
G 1 2 N CYS B 112 ? N CYS B 112 O LEU B 274 ? O LEU B 274 
G 2 3 O THR B 275 ? O THR B 275 N ARG B 257 ? N ARG B 257 
G 3 4 O ILE B 256 ? O ILE B 256 N GLU B 229 ? N GLU B 229 
G 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
G 5 6 O TYR B 195 ? O TYR B 195 N LEU B 136 ? N LEU B 136 
G 6 7 N VAL B 135 ? N VAL B 135 O ILE B 157 ? O ILE B 157 
H 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
I 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
I 2 3 N ILE B 358 ? N ILE B 358 O LEU B 398 ? O LEU B 398 
I 3 4 O ARG B 399 ? O ARG B 399 N LEU B 382 ? N LEU B 382 
J 1 2 N ILE C 34  ? N ILE C 34  O LEU D 380 ? O LEU D 380 
K 1 2 O ILE C 61  ? O ILE C 61  N ILE C 53  ? N ILE C 53  
K 2 3 N LYS C 49  ? N LYS C 49  O THR D 54  ? O THR D 54  
K 3 4 N ILE D 53  ? N ILE D 53  O ILE D 61  ? O ILE D 61  
L 1 2 N CYS C 112 ? N CYS C 112 O LEU C 274 ? O LEU C 274 
L 2 3 O THR C 275 ? O THR C 275 N ARG C 257 ? N ARG C 257 
L 3 4 O ALA C 258 ? O ALA C 258 N GLU C 229 ? N GLU C 229 
L 4 5 O ILE C 228 ? O ILE C 228 N LEU C 194 ? N LEU C 194 
L 5 6 O TYR C 195 ? O TYR C 195 N LEU C 136 ? N LEU C 136 
L 6 7 N VAL C 135 ? N VAL C 135 O ILE C 157 ? O ILE C 157 
M 1 2 N ASP C 162 ? N ASP C 162 O GLY C 165 ? O GLY C 165 
N 1 2 N GLU C 346 ? N GLU C 346 O LYS C 359 ? O LYS C 359 
N 2 3 N LEU C 356 ? N LEU C 356 O ALA C 400 ? O ALA C 400 
N 3 4 O ARG C 399 ? O ARG C 399 N LEU C 382 ? N LEU C 382 
O 1 2 N LEU C 380 ? N LEU C 380 O ILE D 34  ? O ILE D 34  
P 1 2 N ASP D 110 ? N ASP D 110 O GLY D 276 ? O GLY D 276 
P 2 3 O THR D 275 ? O THR D 275 N ARG D 257 ? N ARG D 257 
P 3 4 O ILE D 256 ? O ILE D 256 N GLU D 229 ? N GLU D 229 
P 4 5 O ILE D 228 ? O ILE D 228 N LEU D 194 ? N LEU D 194 
P 5 6 O TYR D 195 ? O TYR D 195 N LEU D 136 ? N LEU D 136 
P 6 7 N VAL D 135 ? N VAL D 135 O ILE D 157 ? O ILE D 157 
Q 1 2 N ASP D 162 ? N ASP D 162 O GLY D 165 ? O GLY D 165 
R 1 2 N GLU D 346 ? N GLU D 346 O LYS D 359 ? O LYS D 359 
R 2 3 N LEU D 356 ? N LEU D 356 O ALA D 400 ? O ALA D 400 
R 3 4 O ARG D 399 ? O ARG D 399 N LEU D 382 ? N LEU D 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PMP A 426' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PMP B 426' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PMP C 426' 
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PMP D 426' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE KYN A 427' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE KYN C 427' 
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE KYN A 428' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE KYN C 428' 
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL D 427' 
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL C 429' 
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL D 428' 
BC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL D 429' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL D 430' 
BC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 429' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 SER A 117 ? SER A 117 . ? 1_555 ? 
2   AC1 14 GLN A 118 ? GLN A 118 . ? 1_555 ? 
3   AC1 14 TYR A 142 ? TYR A 142 . ? 1_555 ? 
4   AC1 14 ASN A 202 ? ASN A 202 . ? 1_555 ? 
5   AC1 14 ASP A 230 ? ASP A 230 . ? 1_555 ? 
6   AC1 14 PRO A 232 ? PRO A 232 . ? 1_555 ? 
7   AC1 14 TYR A 233 ? TYR A 233 . ? 1_555 ? 
8   AC1 14 SER A 260 ? SER A 260 . ? 1_555 ? 
9   AC1 14 SER A 262 ? SER A 262 . ? 1_555 ? 
10  AC1 14 LYS A 263 ? LYS A 263 . ? 1_555 ? 
11  AC1 14 ARG A 270 ? ARG A 270 . ? 1_555 ? 
12  AC1 14 HOH S .   ? HOH A 572 . ? 1_555 ? 
13  AC1 14 HOH S .   ? HOH A 661 . ? 1_555 ? 
14  AC1 14 TYR B 74  ? TYR B 74  . ? 1_555 ? 
15  AC2 13 TYR A 74  ? TYR A 74  . ? 1_555 ? 
16  AC2 13 SER B 117 ? SER B 117 . ? 1_555 ? 
17  AC2 13 GLN B 118 ? GLN B 118 . ? 1_555 ? 
18  AC2 13 TYR B 142 ? TYR B 142 . ? 1_555 ? 
19  AC2 13 ASN B 202 ? ASN B 202 . ? 1_555 ? 
20  AC2 13 ASP B 230 ? ASP B 230 . ? 1_555 ? 
21  AC2 13 PRO B 232 ? PRO B 232 . ? 1_555 ? 
22  AC2 13 TYR B 233 ? TYR B 233 . ? 1_555 ? 
23  AC2 13 SER B 260 ? SER B 260 . ? 1_555 ? 
24  AC2 13 SER B 262 ? SER B 262 . ? 1_555 ? 
25  AC2 13 LYS B 263 ? LYS B 263 . ? 1_555 ? 
26  AC2 13 ARG B 270 ? ARG B 270 . ? 1_555 ? 
27  AC2 13 HOH T .   ? HOH B 635 . ? 1_555 ? 
28  AC3 13 SER C 117 ? SER C 117 . ? 1_555 ? 
29  AC3 13 GLN C 118 ? GLN C 118 . ? 1_555 ? 
30  AC3 13 TYR C 142 ? TYR C 142 . ? 1_555 ? 
31  AC3 13 ASN C 202 ? ASN C 202 . ? 1_555 ? 
32  AC3 13 ASP C 230 ? ASP C 230 . ? 1_555 ? 
33  AC3 13 PRO C 232 ? PRO C 232 . ? 1_555 ? 
34  AC3 13 TYR C 233 ? TYR C 233 . ? 1_555 ? 
35  AC3 13 SER C 260 ? SER C 260 . ? 1_555 ? 
36  AC3 13 SER C 262 ? SER C 262 . ? 1_555 ? 
37  AC3 13 LYS C 263 ? LYS C 263 . ? 1_555 ? 
38  AC3 13 ARG C 270 ? ARG C 270 . ? 1_555 ? 
39  AC3 13 HOH U .   ? HOH C 694 . ? 1_555 ? 
40  AC3 13 TYR D 74  ? TYR D 74  . ? 1_555 ? 
41  AC4 14 TYR C 74  ? TYR C 74  . ? 1_555 ? 
42  AC4 14 GLY D 116 ? GLY D 116 . ? 1_555 ? 
43  AC4 14 SER D 117 ? SER D 117 . ? 1_555 ? 
44  AC4 14 GLN D 118 ? GLN D 118 . ? 1_555 ? 
45  AC4 14 TYR D 142 ? TYR D 142 . ? 1_555 ? 
46  AC4 14 ASN D 202 ? ASN D 202 . ? 1_555 ? 
47  AC4 14 ASP D 230 ? ASP D 230 . ? 1_555 ? 
48  AC4 14 PRO D 232 ? PRO D 232 . ? 1_555 ? 
49  AC4 14 TYR D 233 ? TYR D 233 . ? 1_555 ? 
50  AC4 14 SER D 260 ? SER D 260 . ? 1_555 ? 
51  AC4 14 SER D 262 ? SER D 262 . ? 1_555 ? 
52  AC4 14 LYS D 263 ? LYS D 263 . ? 1_555 ? 
53  AC4 14 ARG D 270 ? ARG D 270 . ? 1_555 ? 
54  AC4 14 HOH V .   ? HOH D 667 . ? 1_555 ? 
55  AC5 7  ILE A 19  ? ILE A 19  . ? 1_555 ? 
56  AC5 7  ARG A 20  ? ARG A 20  . ? 1_555 ? 
57  AC5 7  LEU A 293 ? LEU A 293 . ? 1_555 ? 
58  AC5 7  HOH S .   ? HOH A 515 . ? 1_555 ? 
59  AC5 7  SER B 143 ? SER B 143 . ? 1_555 ? 
60  AC5 7  ASN B 202 ? ASN B 202 . ? 1_555 ? 
61  AC5 7  ARG B 399 ? ARG B 399 . ? 1_555 ? 
62  AC6 8  ILE C 19  ? ILE C 19  . ? 1_555 ? 
63  AC6 8  ARG C 20  ? ARG C 20  . ? 1_555 ? 
64  AC6 8  GLY C 39  ? GLY C 39  . ? 1_555 ? 
65  AC6 8  LEU C 40  ? LEU C 40  . ? 1_555 ? 
66  AC6 8  TYR C 74  ? TYR C 74  . ? 1_555 ? 
67  AC6 8  HOH U .   ? HOH C 635 . ? 1_555 ? 
68  AC6 8  ASN D 202 ? ASN D 202 . ? 1_555 ? 
69  AC6 8  ARG D 399 ? ARG D 399 . ? 1_555 ? 
70  AC7 10 TYR A 142 ? TYR A 142 . ? 1_555 ? 
71  AC7 10 ASN A 202 ? ASN A 202 . ? 1_555 ? 
72  AC7 10 ARG A 399 ? ARG A 399 . ? 1_555 ? 
73  AC7 10 HOH S .   ? HOH A 661 . ? 1_555 ? 
74  AC7 10 ILE B 19  ? ILE B 19  . ? 1_555 ? 
75  AC7 10 ARG B 20  ? ARG B 20  . ? 1_555 ? 
76  AC7 10 GLY B 39  ? GLY B 39  . ? 1_555 ? 
77  AC7 10 TYR B 74  ? TYR B 74  . ? 1_555 ? 
78  AC7 10 HOH T .   ? HOH B 453 . ? 1_555 ? 
79  AC7 10 HOH T .   ? HOH B 731 . ? 1_555 ? 
80  AC8 8  ASN C 202 ? ASN C 202 . ? 1_555 ? 
81  AC8 8  ARG C 399 ? ARG C 399 . ? 1_555 ? 
82  AC8 8  HOH U .   ? HOH C 657 . ? 1_555 ? 
83  AC8 8  HOH U .   ? HOH C 703 . ? 1_555 ? 
84  AC8 8  ILE D 19  ? ILE D 19  . ? 1_555 ? 
85  AC8 8  GLY D 39  ? GLY D 39  . ? 1_555 ? 
86  AC8 8  LEU D 40  ? LEU D 40  . ? 1_555 ? 
87  AC8 8  HOH V .   ? HOH D 638 . ? 1_555 ? 
88  AC9 8  PRO D 76  ? PRO D 76  . ? 1_555 ? 
89  AC9 8  SER D 77  ? SER D 77  . ? 1_555 ? 
90  AC9 8  ALA D 78  ? ALA D 78  . ? 1_555 ? 
91  AC9 8  GLY D 79  ? GLY D 79  . ? 1_555 ? 
92  AC9 8  LEU D 84  ? LEU D 84  . ? 1_555 ? 
93  AC9 8  HOH V .   ? HOH D 697 . ? 1_555 ? 
94  AC9 8  HOH V .   ? HOH D 726 . ? 1_555 ? 
95  AC9 8  HOH V .   ? HOH D 762 . ? 1_555 ? 
96  BC1 6  GLU C 56  ? GLU C 56  . ? 1_555 ? 
97  BC1 6  ASN C 57  ? ASN C 57  . ? 1_555 ? 
98  BC1 6  HIS C 318 ? HIS C 318 . ? 1_555 ? 
99  BC1 6  ARG C 321 ? ARG C 321 . ? 1_555 ? 
100 BC1 6  HOH U .   ? HOH C 629 . ? 1_555 ? 
101 BC1 6  HOH U .   ? HOH C 702 . ? 1_555 ? 
102 BC2 7  GLU D 346 ? GLU D 346 . ? 1_555 ? 
103 BC2 7  TRP D 347 ? TRP D 347 . ? 1_555 ? 
104 BC2 7  HIS D 348 ? HIS D 348 . ? 1_555 ? 
105 BC2 7  TRP D 357 ? TRP D 357 . ? 1_555 ? 
106 BC2 7  TYR D 397 ? TYR D 397 . ? 1_555 ? 
107 BC2 7  HOH V .   ? HOH D 535 . ? 1_555 ? 
108 BC2 7  HOH V .   ? HOH D 651 . ? 1_555 ? 
109 BC3 9  MET C 45  ? MET C 45  . ? 1_555 ? 
110 BC3 9  PHE C 46  ? PHE C 46  . ? 1_555 ? 
111 BC3 9  PRO C 47  ? PRO C 47  . ? 1_555 ? 
112 BC3 9  GLU D 56  ? GLU D 56  . ? 1_555 ? 
113 BC3 9  ASN D 57  ? ASN D 57  . ? 1_555 ? 
114 BC3 9  HIS D 318 ? HIS D 318 . ? 1_555 ? 
115 BC3 9  ARG D 321 ? ARG D 321 . ? 1_555 ? 
116 BC3 9  HOH V .   ? HOH D 660 . ? 1_555 ? 
117 BC3 9  HOH V .   ? HOH D 759 . ? 1_555 ? 
118 BC4 6  SER D 207 ? SER D 207 . ? 1_555 ? 
119 BC4 6  LEU D 208 ? LEU D 208 . ? 1_555 ? 
120 BC4 6  THR D 209 ? THR D 209 . ? 1_555 ? 
121 BC4 6  HOH V .   ? HOH D 503 . ? 1_555 ? 
122 BC4 6  HOH V .   ? HOH D 533 . ? 1_555 ? 
123 BC4 6  HOH V .   ? HOH D 555 . ? 1_555 ? 
124 BC5 11 PRO A 43  ? PRO A 43  . ? 1_555 ? 
125 BC5 11 ASN A 44  ? ASN A 44  . ? 1_555 ? 
126 BC5 11 PHE A 46  ? PHE A 46  . ? 1_555 ? 
127 BC5 11 PHE A 48  ? PHE A 48  . ? 1_555 ? 
128 BC5 11 LYS A 49  ? LYS A 49  . ? 1_555 ? 
129 BC5 11 GLU A 65  ? GLU A 65  . ? 1_555 ? 
130 BC5 11 MET A 68  ? MET A 68  . ? 1_555 ? 
131 BC5 11 LYS A 69  ? LYS A 69  . ? 1_555 ? 
132 BC5 11 LEU A 72  ? LEU A 72  . ? 1_555 ? 
133 BC5 11 HOH S .   ? HOH A 478 . ? 1_555 ? 
134 BC5 11 HOH S .   ? HOH A 532 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2R2N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2R2N 
_atom_sites.fract_transf_matrix[1][1]   0.014116 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001155 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009144 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? 34.975  7.077   35.430  1.00 42.81 ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? 35.380  8.425   34.894  1.00 41.79 ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? 34.256  9.048   34.077  1.00 40.31 ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 1   ? 33.840  10.160  34.387  1.00 40.53 ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? 36.706  8.373   34.132  1.00 43.26 ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? 37.218  9.719   33.678  1.00 45.26 ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? 38.869  10.059  34.363  1.00 57.08 ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? 38.491  10.359  36.102  1.00 50.80 ? 1   MET A CE  1 
ATOM   9     N N   . ASN A 1 2   ? 33.753  8.342   33.066  1.00 38.36 ? 2   ASN A N   1 
ATOM   10    C CA  . ASN A 1 2   ? 32.490  8.732   32.408  1.00 36.54 ? 2   ASN A CA  1 
ATOM   11    C C   . ASN A 1 2   ? 31.299  8.109   33.129  1.00 34.77 ? 2   ASN A C   1 
ATOM   12    O O   . ASN A 1 2   ? 30.762  7.089   32.692  1.00 34.30 ? 2   ASN A O   1 
ATOM   13    C CB  . ASN A 1 2   ? 32.457  8.359   30.910  1.00 36.87 ? 2   ASN A CB  1 
ATOM   14    C CG  . ASN A 1 2   ? 31.194  8.887   30.177  1.00 38.29 ? 2   ASN A CG  1 
ATOM   15    O OD1 . ASN A 1 2   ? 30.536  9.835   30.609  1.00 42.74 ? 2   ASN A OD1 1 
ATOM   16    N ND2 . ASN A 1 2   ? 30.885  8.283   29.050  1.00 43.50 ? 2   ASN A ND2 1 
ATOM   17    N N   . TYR A 1 3   ? 30.882  8.696   34.251  1.00 32.99 ? 3   TYR A N   1 
ATOM   18    C CA  . TYR A 1 3   ? 29.829  8.025   35.034  1.00 31.62 ? 3   TYR A CA  1 
ATOM   19    C C   . TYR A 1 3   ? 28.513  7.929   34.295  1.00 31.08 ? 3   TYR A C   1 
ATOM   20    O O   . TYR A 1 3   ? 27.714  7.042   34.578  1.00 30.68 ? 3   TYR A O   1 
ATOM   21    C CB  . TYR A 1 3   ? 29.651  8.628   36.426  1.00 31.01 ? 3   TYR A CB  1 
ATOM   22    C CG  . TYR A 1 3   ? 30.835  8.387   37.305  1.00 28.72 ? 3   TYR A CG  1 
ATOM   23    C CD1 . TYR A 1 3   ? 31.600  9.447   37.753  1.00 27.78 ? 3   TYR A CD1 1 
ATOM   24    C CD2 . TYR A 1 3   ? 31.204  7.087   37.697  1.00 25.78 ? 3   TYR A CD2 1 
ATOM   25    C CE1 . TYR A 1 3   ? 32.687  9.248   38.573  1.00 27.60 ? 3   TYR A CE1 1 
ATOM   26    C CE2 . TYR A 1 3   ? 32.303  6.900   38.516  1.00 26.34 ? 3   TYR A CE2 1 
ATOM   27    C CZ  . TYR A 1 3   ? 33.028  7.970   38.945  1.00 25.89 ? 3   TYR A CZ  1 
ATOM   28    O OH  . TYR A 1 3   ? 34.112  7.798   39.767  1.00 26.48 ? 3   TYR A OH  1 
ATOM   29    N N   . ALA A 1 4   ? 28.319  8.806   33.306  1.00 32.27 ? 4   ALA A N   1 
ATOM   30    C CA  . ALA A 1 4   ? 27.119  8.796   32.474  1.00 32.35 ? 4   ALA A CA  1 
ATOM   31    C C   . ALA A 1 4   ? 26.813  7.487   31.752  1.00 32.87 ? 4   ALA A C   1 
ATOM   32    O O   . ALA A 1 4   ? 25.639  7.189   31.508  1.00 32.06 ? 4   ALA A O   1 
ATOM   33    C CB  . ALA A 1 4   ? 27.131  9.966   31.468  1.00 33.38 ? 4   ALA A CB  1 
ATOM   34    N N   . ARG A 1 5   ? 27.831  6.717   31.353  1.00 34.42 ? 5   ARG A N   1 
ATOM   35    C CA  . ARG A 1 5   ? 27.519  5.429   30.687  1.00 35.32 ? 5   ARG A CA  1 
ATOM   36    C C   . ARG A 1 5   ? 26.956  4.381   31.637  1.00 35.81 ? 5   ARG A C   1 
ATOM   37    O O   . ARG A 1 5   ? 26.334  3.419   31.185  1.00 35.83 ? 5   ARG A O   1 
ATOM   38    C CB  . ARG A 1 5   ? 28.679  4.842   29.863  1.00 36.08 ? 5   ARG A CB  1 
ATOM   39    C CG  . ARG A 1 5   ? 29.984  4.643   30.593  1.00 35.54 ? 5   ARG A CG  1 
ATOM   40    C CD  . ARG A 1 5   ? 31.092  4.195   29.587  1.00 36.51 ? 5   ARG A CD  1 
ATOM   41    N NE  . ARG A 1 5   ? 30.949  2.785   29.254  1.00 33.09 ? 5   ARG A NE  1 
ATOM   42    C CZ  . ARG A 1 5   ? 31.796  1.841   29.633  1.00 34.35 ? 5   ARG A CZ  1 
ATOM   43    N NH1 . ARG A 1 5   ? 31.546  0.590   29.307  1.00 34.02 ? 5   ARG A NH1 1 
ATOM   44    N NH2 . ARG A 1 5   ? 32.902  2.150   30.320  1.00 32.74 ? 5   ARG A NH2 1 
ATOM   45    N N   . PHE A 1 6   ? 27.173  4.562   32.941  1.00 35.46 ? 6   PHE A N   1 
ATOM   46    C CA  . PHE A 1 6   ? 26.667  3.602   33.928  1.00 35.64 ? 6   PHE A CA  1 
ATOM   47    C C   . PHE A 1 6   ? 25.362  4.059   34.604  1.00 35.56 ? 6   PHE A C   1 
ATOM   48    O O   . PHE A 1 6   ? 25.027  3.644   35.730  1.00 35.06 ? 6   PHE A O   1 
ATOM   49    C CB  . PHE A 1 6   ? 27.741  3.272   34.959  1.00 35.09 ? 6   PHE A CB  1 
ATOM   50    C CG  . PHE A 1 6   ? 29.082  2.985   34.367  1.00 35.64 ? 6   PHE A CG  1 
ATOM   51    C CD1 . PHE A 1 6   ? 30.047  3.986   34.304  1.00 36.44 ? 6   PHE A CD1 1 
ATOM   52    C CD2 . PHE A 1 6   ? 29.392  1.711   33.893  1.00 35.05 ? 6   PHE A CD2 1 
ATOM   53    C CE1 . PHE A 1 6   ? 31.302  3.729   33.800  1.00 37.03 ? 6   PHE A CE1 1 
ATOM   54    C CE2 . PHE A 1 6   ? 30.636  1.448   33.363  1.00 35.91 ? 6   PHE A CE2 1 
ATOM   55    C CZ  . PHE A 1 6   ? 31.598  2.455   33.332  1.00 37.06 ? 6   PHE A CZ  1 
ATOM   56    N N   . ILE A 1 7   ? 24.626  4.916   33.900  1.00 34.50 ? 7   ILE A N   1 
ATOM   57    C CA  . ILE A 1 7   ? 23.407  5.493   34.435  1.00 33.89 ? 7   ILE A CA  1 
ATOM   58    C C   . ILE A 1 7   ? 22.374  5.456   33.337  1.00 33.87 ? 7   ILE A C   1 
ATOM   59    O O   . ILE A 1 7   ? 22.567  6.056   32.270  1.00 34.99 ? 7   ILE A O   1 
ATOM   60    C CB  . ILE A 1 7   ? 23.635  6.936   34.924  1.00 33.36 ? 7   ILE A CB  1 
ATOM   61    C CG1 . ILE A 1 7   ? 24.541  6.913   36.149  1.00 32.05 ? 7   ILE A CG1 1 
ATOM   62    C CG2 . ILE A 1 7   ? 22.305  7.618   35.261  1.00 33.34 ? 7   ILE A CG2 1 
ATOM   63    C CD1 . ILE A 1 7   ? 25.183  8.231   36.494  1.00 30.05 ? 7   ILE A CD1 1 
ATOM   64    N N   . THR A 1 8   ? 21.285  4.757   33.604  1.00 32.85 ? 8   THR A N   1 
ATOM   65    C CA  . THR A 1 8   ? 20.217  4.558   32.653  1.00 32.82 ? 8   THR A CA  1 
ATOM   66    C C   . THR A 1 8   ? 19.492  5.888   32.307  1.00 33.21 ? 8   THR A C   1 
ATOM   67    O O   . THR A 1 8   ? 19.776  6.913   32.921  1.00 32.97 ? 8   THR A O   1 
ATOM   68    C CB  . THR A 1 8   ? 19.273  3.564   33.252  1.00 33.20 ? 8   THR A CB  1 
ATOM   69    O OG1 . THR A 1 8   ? 18.705  2.770   32.236  1.00 37.21 ? 8   THR A OG1 1 
ATOM   70    C CG2 . THR A 1 8   ? 18.176  4.233   33.999  1.00 29.89 ? 8   THR A CG2 1 
ATOM   71    N N   . ALA A 1 9   ? 18.578  5.873   31.327  1.00 32.73 ? 9   ALA A N   1 
ATOM   72    C CA  . ALA A 1 9   ? 17.864  7.111   30.970  1.00 33.30 ? 9   ALA A CA  1 
ATOM   73    C C   . ALA A 1 9   ? 16.910  7.478   32.089  1.00 32.62 ? 9   ALA A C   1 
ATOM   74    O O   . ALA A 1 9   ? 16.838  8.640   32.471  1.00 32.52 ? 9   ALA A O   1 
ATOM   75    C CB  . ALA A 1 9   ? 17.109  6.987   29.652  1.00 33.63 ? 9   ALA A CB  1 
ATOM   76    N N   . ALA A 1 10  ? 16.189  6.481   32.605  1.00 32.10 ? 10  ALA A N   1 
ATOM   77    C CA  . ALA A 1 10  ? 15.276  6.704   33.716  1.00 31.23 ? 10  ALA A CA  1 
ATOM   78    C C   . ALA A 1 10  ? 16.028  7.292   34.902  1.00 30.71 ? 10  ALA A C   1 
ATOM   79    O O   . ALA A 1 10  ? 15.612  8.321   35.430  1.00 30.74 ? 10  ALA A O   1 
ATOM   80    C CB  . ALA A 1 10  ? 14.496  5.442   34.067  1.00 31.58 ? 10  ALA A CB  1 
ATOM   81    N N   . SER A 1 11  ? 17.171  6.693   35.257  1.00 30.09 ? 11  SER A N   1 
ATOM   82    C CA  . SER A 1 11  ? 17.983  7.099   36.409  1.00 29.74 ? 11  SER A CA  1 
ATOM   83    C C   . SER A 1 11  ? 18.569  8.509   36.259  1.00 29.72 ? 11  SER A C   1 
ATOM   84    O O   . SER A 1 11  ? 18.550  9.290   37.213  1.00 29.81 ? 11  SER A O   1 
ATOM   85    C CB  . SER A 1 11  ? 19.085  6.064   36.703  1.00 29.05 ? 11  SER A CB  1 
ATOM   86    O OG  . SER A 1 11  ? 19.992  6.506   37.708  1.00 29.30 ? 11  SER A OG  1 
ATOM   87    N N   . ALA A 1 12  ? 19.102  8.823   35.080  1.00 29.74 ? 12  ALA A N   1 
ATOM   88    C CA  . ALA A 1 12  ? 19.568  10.179  34.774  1.00 30.32 ? 12  ALA A CA  1 
ATOM   89    C C   . ALA A 1 12  ? 18.440  11.229  34.897  1.00 30.30 ? 12  ALA A C   1 
ATOM   90    O O   . ALA A 1 12  ? 18.682  12.383  35.256  1.00 31.37 ? 12  ALA A O   1 
ATOM   91    C CB  . ALA A 1 12  ? 20.163  10.216  33.373  1.00 29.83 ? 12  ALA A CB  1 
ATOM   92    N N   . ALA A 1 13  ? 17.217  10.822  34.596  1.00 31.16 ? 13  ALA A N   1 
ATOM   93    C CA  . ALA A 1 13  ? 16.054  11.718  34.659  1.00 32.39 ? 13  ALA A CA  1 
ATOM   94    C C   . ALA A 1 13  ? 15.622  12.130  36.089  1.00 33.70 ? 13  ALA A C   1 
ATOM   95    O O   . ALA A 1 13  ? 14.874  13.114  36.256  1.00 33.19 ? 13  ALA A O   1 
ATOM   96    C CB  . ALA A 1 13  ? 14.892  11.094  33.925  1.00 32.18 ? 13  ALA A CB  1 
ATOM   97    N N   . ARG A 1 14  ? 16.095  11.410  37.110  1.00 33.98 ? 14  ARG A N   1 
ATOM   98    C CA  . ARG A 1 14  ? 15.718  11.709  38.500  1.00 35.31 ? 14  ARG A CA  1 
ATOM   99    C C   . ARG A 1 14  ? 16.180  13.098  38.912  1.00 37.15 ? 14  ARG A C   1 
ATOM   100   O O   . ARG A 1 14  ? 17.275  13.508  38.578  1.00 36.64 ? 14  ARG A O   1 
ATOM   101   C CB  . ARG A 1 14  ? 16.217  10.640  39.489  1.00 33.95 ? 14  ARG A CB  1 
ATOM   102   C CG  . ARG A 1 14  ? 15.688  9.258   39.169  1.00 32.40 ? 14  ARG A CG  1 
ATOM   103   C CD  . ARG A 1 14  ? 15.843  8.244   40.319  1.00 30.83 ? 14  ARG A CD  1 
ATOM   104   N NE  . ARG A 1 14  ? 15.463  6.869   39.917  1.00 26.24 ? 14  ARG A NE  1 
ATOM   105   C CZ  . ARG A 1 14  ? 14.220  6.415   39.806  1.00 23.88 ? 14  ARG A CZ  1 
ATOM   106   N NH1 . ARG A 1 14  ? 13.184  7.183   40.104  1.00 20.71 ? 14  ARG A NH1 1 
ATOM   107   N NH2 . ARG A 1 14  ? 14.000  5.159   39.439  1.00 26.26 ? 14  ARG A NH2 1 
ATOM   108   N N   . ASN A 1 15  ? 15.309  13.799  39.627  1.00 40.52 ? 15  ASN A N   1 
ATOM   109   C CA  . ASN A 1 15  ? 15.568  15.133  40.165  1.00 44.15 ? 15  ASN A CA  1 
ATOM   110   C C   . ASN A 1 15  ? 15.495  15.147  41.695  1.00 46.94 ? 15  ASN A C   1 
ATOM   111   O O   . ASN A 1 15  ? 14.753  14.360  42.289  1.00 47.35 ? 15  ASN A O   1 
ATOM   112   C CB  . ASN A 1 15  ? 14.531  16.136  39.621  1.00 43.53 ? 15  ASN A CB  1 
ATOM   113   C CG  . ASN A 1 15  ? 14.574  16.274  38.115  1.00 43.42 ? 15  ASN A CG  1 
ATOM   114   O OD1 . ASN A 1 15  ? 15.637  16.489  37.522  1.00 44.26 ? 15  ASN A OD1 1 
ATOM   115   N ND2 . ASN A 1 15  ? 13.419  16.148  37.482  1.00 41.19 ? 15  ASN A ND2 1 
ATOM   116   N N   . PRO A 1 16  ? 16.266  16.052  42.332  1.00 50.69 ? 16  PRO A N   1 
ATOM   117   C CA  . PRO A 1 16  ? 16.192  16.496  43.735  1.00 53.63 ? 16  PRO A CA  1 
ATOM   118   C C   . PRO A 1 16  ? 14.872  16.259  44.522  1.00 56.49 ? 16  PRO A C   1 
ATOM   119   O O   . PRO A 1 16  ? 14.773  15.237  45.199  1.00 57.06 ? 16  PRO A O   1 
ATOM   120   C CB  . PRO A 1 16  ? 16.553  17.984  43.627  1.00 53.66 ? 16  PRO A CB  1 
ATOM   121   C CG  . PRO A 1 16  ? 17.517  18.032  42.446  1.00 51.84 ? 16  PRO A CG  1 
ATOM   122   C CD  . PRO A 1 16  ? 17.380  16.740  41.652  1.00 50.62 ? 16  PRO A CD  1 
ATOM   123   N N   . SER A 1 17  ? 13.875  17.145  44.474  1.00 59.71 ? 17  SER A N   1 
ATOM   124   C CA  . SER A 1 17  ? 12.726  16.964  45.421  1.00 62.96 ? 17  SER A CA  1 
ATOM   125   C C   . SER A 1 17  ? 11.333  17.633  45.123  1.00 65.00 ? 17  SER A C   1 
ATOM   126   O O   . SER A 1 17  ? 10.310  16.922  45.067  1.00 65.55 ? 17  SER A O   1 
ATOM   127   C CB  . SER A 1 17  ? 13.180  17.211  46.880  1.00 62.80 ? 17  SER A CB  1 
ATOM   128   O OG  . SER A 1 17  ? 12.434  16.429  47.797  1.00 63.82 ? 17  SER A OG  1 
ATOM   129   N N   . PRO A 1 18  ? 11.271  18.982  44.992  1.00 66.89 ? 18  PRO A N   1 
ATOM   130   C CA  . PRO A 1 18  ? 12.251  20.010  45.359  1.00 68.17 ? 18  PRO A CA  1 
ATOM   131   C C   . PRO A 1 18  ? 12.005  20.495  46.791  1.00 69.56 ? 18  PRO A C   1 
ATOM   132   O O   . PRO A 1 18  ? 12.932  20.486  47.611  1.00 69.60 ? 18  PRO A O   1 
ATOM   133   C CB  . PRO A 1 18  ? 11.983  21.141  44.347  1.00 68.16 ? 18  PRO A CB  1 
ATOM   134   C CG  . PRO A 1 18  ? 10.720  20.732  43.565  1.00 68.01 ? 18  PRO A CG  1 
ATOM   135   C CD  . PRO A 1 18  ? 10.102  19.586  44.329  1.00 67.12 ? 18  PRO A CD  1 
ATOM   136   N N   . ILE A 1 19  ? 10.762  20.906  47.068  1.00 70.90 ? 19  ILE A N   1 
ATOM   137   C CA  . ILE A 1 19  ? 10.282  21.319  48.397  1.00 72.28 ? 19  ILE A CA  1 
ATOM   138   C C   . ILE A 1 19  ? 11.352  21.778  49.382  1.00 73.26 ? 19  ILE A C   1 
ATOM   139   O O   . ILE A 1 19  ? 11.493  22.956  49.677  1.00 73.41 ? 19  ILE A O   1 
ATOM   140   C CB  . ILE A 1 19  ? 9.442   20.207  49.064  1.00 72.07 ? 19  ILE A CB  1 
ATOM   141   C CG1 . ILE A 1 19  ? 7.962   20.446  48.838  1.00 71.93 ? 19  ILE A CG1 1 
ATOM   142   C CG2 . ILE A 1 19  ? 9.701   20.173  50.551  1.00 71.97 ? 19  ILE A CG2 1 
ATOM   143   C CD1 . ILE A 1 19  ? 7.416   19.673  47.698  1.00 71.73 ? 19  ILE A CD1 1 
ATOM   144   N N   . ARG A 1 20  ? 12.087  20.806  49.893  1.00 74.59 ? 20  ARG A N   1 
ATOM   145   C CA  . ARG A 1 20  ? 12.891  20.927  51.131  1.00 75.70 ? 20  ARG A CA  1 
ATOM   146   C C   . ARG A 1 20  ? 14.265  21.641  51.066  1.00 76.15 ? 20  ARG A C   1 
ATOM   147   O O   . ARG A 1 20  ? 15.084  21.493  51.979  1.00 76.18 ? 20  ARG A O   1 
ATOM   148   C CB  . ARG A 1 20  ? 12.983  19.570  51.865  1.00 75.95 ? 20  ARG A CB  1 
ATOM   149   C CG  . ARG A 1 20  ? 11.893  19.385  52.945  1.00 77.00 ? 20  ARG A CG  1 
ATOM   150   C CD  . ARG A 1 20  ? 11.602  17.926  53.320  1.00 78.90 ? 20  ARG A CD  1 
ATOM   151   N NE  . ARG A 1 20  ? 12.787  17.210  53.798  1.00 81.08 ? 20  ARG A NE  1 
ATOM   152   C CZ  . ARG A 1 20  ? 13.359  16.183  53.168  1.00 82.26 ? 20  ARG A CZ  1 
ATOM   153   N NH1 . ARG A 1 20  ? 12.842  15.722  52.030  1.00 83.47 ? 20  ARG A NH1 1 
ATOM   154   N NH2 . ARG A 1 20  ? 14.443  15.602  53.685  1.00 81.63 ? 20  ARG A NH2 1 
ATOM   155   N N   . THR A 1 21  ? 14.499  22.439  50.017  1.00 76.69 ? 21  THR A N   1 
ATOM   156   C CA  . THR A 1 21  ? 15.507  23.521  50.091  1.00 77.00 ? 21  THR A CA  1 
ATOM   157   C C   . THR A 1 21  ? 14.987  24.638  51.017  1.00 76.93 ? 21  THR A C   1 
ATOM   158   O O   . THR A 1 21  ? 15.773  25.379  51.615  1.00 76.93 ? 21  THR A O   1 
ATOM   159   C CB  . THR A 1 21  ? 15.902  24.108  48.701  1.00 77.11 ? 21  THR A CB  1 
ATOM   160   O OG1 . THR A 1 21  ? 14.736  24.295  47.889  1.00 77.16 ? 21  THR A OG1 1 
ATOM   161   C CG2 . THR A 1 21  ? 16.883  23.187  47.972  1.00 77.29 ? 21  THR A CG2 1 
ATOM   162   N N   . MET A 1 22  ? 13.655  24.731  51.125  1.00 76.97 ? 22  MET A N   1 
ATOM   163   C CA  . MET A 1 22  ? 12.965  25.624  52.072  1.00 76.70 ? 22  MET A CA  1 
ATOM   164   C C   . MET A 1 22  ? 13.236  25.284  53.539  1.00 76.37 ? 22  MET A C   1 
ATOM   165   O O   . MET A 1 22  ? 13.833  26.074  54.263  1.00 76.25 ? 22  MET A O   1 
ATOM   166   C CB  . MET A 1 22  ? 11.448  25.634  51.817  1.00 76.72 ? 22  MET A CB  1 
ATOM   167   C CG  . MET A 1 22  ? 10.929  26.881  51.117  1.00 76.94 ? 22  MET A CG  1 
ATOM   168   S SD  . MET A 1 22  ? 11.238  28.386  52.082  1.00 77.13 ? 22  MET A SD  1 
ATOM   169   C CE  . MET A 1 22  ? 10.846  29.647  50.876  1.00 77.44 ? 22  MET A CE  1 
ATOM   170   N N   . THR A 1 23  ? 12.796  24.102  53.966  1.00 76.15 ? 23  THR A N   1 
ATOM   171   C CA  . THR A 1 23  ? 12.943  23.660  55.359  1.00 75.76 ? 23  THR A CA  1 
ATOM   172   C C   . THR A 1 23  ? 14.424  23.464  55.727  1.00 75.42 ? 23  THR A C   1 
ATOM   173   O O   . THR A 1 23  ? 14.796  23.346  56.911  1.00 75.65 ? 23  THR A O   1 
ATOM   174   C CB  . THR A 1 23  ? 12.131  22.374  55.624  1.00 76.05 ? 23  THR A CB  1 
ATOM   175   O OG1 . THR A 1 23  ? 12.787  21.255  55.015  1.00 75.96 ? 23  THR A OG1 1 
ATOM   176   C CG2 . THR A 1 23  ? 10.716  22.507  55.057  1.00 75.62 ? 23  THR A CG2 1 
ATOM   177   N N   . ASP A 1 24  ? 15.254  23.437  54.687  1.00 74.47 ? 24  ASP A N   1 
ATOM   178   C CA  . ASP A 1 24  ? 16.703  23.534  54.797  1.00 73.38 ? 24  ASP A CA  1 
ATOM   179   C C   . ASP A 1 24  ? 17.151  24.917  55.322  1.00 72.40 ? 24  ASP A C   1 
ATOM   180   O O   . ASP A 1 24  ? 17.963  24.991  56.250  1.00 72.25 ? 24  ASP A O   1 
ATOM   181   C CB  . ASP A 1 24  ? 17.312  23.224  53.423  1.00 73.70 ? 24  ASP A CB  1 
ATOM   182   C CG  . ASP A 1 24  ? 18.812  23.430  53.371  1.00 74.25 ? 24  ASP A CG  1 
ATOM   183   O OD1 . ASP A 1 24  ? 19.278  23.963  52.330  1.00 73.94 ? 24  ASP A OD1 1 
ATOM   184   O OD2 . ASP A 1 24  ? 19.511  23.055  54.348  1.00 74.43 ? 24  ASP A OD2 1 
ATOM   185   N N   . ILE A 1 25  ? 16.617  25.997  54.733  1.00 71.11 ? 25  ILE A N   1 
ATOM   186   C CA  . ILE A 1 25  ? 16.890  27.382  55.192  1.00 69.71 ? 25  ILE A CA  1 
ATOM   187   C C   . ILE A 1 25  ? 16.607  27.564  56.692  1.00 68.92 ? 25  ILE A C   1 
ATOM   188   O O   . ILE A 1 25  ? 17.296  28.339  57.372  1.00 68.73 ? 25  ILE A O   1 
ATOM   189   C CB  . ILE A 1 25  ? 16.111  28.473  54.364  1.00 69.70 ? 25  ILE A CB  1 
ATOM   190   C CG1 . ILE A 1 25  ? 16.377  28.334  52.856  1.00 68.99 ? 25  ILE A CG1 1 
ATOM   191   C CG2 . ILE A 1 25  ? 16.489  29.886  54.821  1.00 69.49 ? 25  ILE A CG2 1 
ATOM   192   C CD1 . ILE A 1 25  ? 15.494  29.200  51.972  1.00 67.42 ? 25  ILE A CD1 1 
ATOM   193   N N   . LEU A 1 26  ? 15.602  26.842  57.197  1.00 67.83 ? 26  LEU A N   1 
ATOM   194   C CA  . LEU A 1 26  ? 15.238  26.879  58.622  1.00 66.89 ? 26  LEU A CA  1 
ATOM   195   C C   . LEU A 1 26  ? 16.383  26.428  59.546  1.00 66.48 ? 26  LEU A C   1 
ATOM   196   O O   . LEU A 1 26  ? 16.586  27.025  60.606  1.00 66.23 ? 26  LEU A O   1 
ATOM   197   C CB  . LEU A 1 26  ? 13.960  26.061  58.895  1.00 66.52 ? 26  LEU A CB  1 
ATOM   198   C CG  . LEU A 1 26  ? 13.398  26.109  60.329  1.00 65.74 ? 26  LEU A CG  1 
ATOM   199   C CD1 . LEU A 1 26  ? 12.947  27.513  60.725  1.00 63.52 ? 26  LEU A CD1 1 
ATOM   200   C CD2 . LEU A 1 26  ? 12.270  25.100  60.521  1.00 65.29 ? 26  LEU A CD2 1 
ATOM   201   N N   . SER A 1 27  ? 17.126  25.399  59.117  1.00 66.07 ? 27  SER A N   1 
ATOM   202   C CA  . SER A 1 27  ? 18.270  24.828  59.867  1.00 65.80 ? 27  SER A CA  1 
ATOM   203   C C   . SER A 1 27  ? 19.328  25.843  60.273  1.00 65.16 ? 27  SER A C   1 
ATOM   204   O O   . SER A 1 27  ? 19.871  25.763  61.371  1.00 65.27 ? 27  SER A O   1 
ATOM   205   C CB  . SER A 1 27  ? 18.962  23.706  59.072  1.00 65.96 ? 27  SER A CB  1 
ATOM   206   O OG  . SER A 1 27  ? 18.386  22.426  59.326  1.00 66.95 ? 27  SER A OG  1 
ATOM   207   N N   . ARG A 1 28  ? 19.629  26.788  59.387  1.00 64.47 ? 28  ARG A N   1 
ATOM   208   C CA  . ARG A 1 28  ? 20.700  27.748  59.654  1.00 63.80 ? 28  ARG A CA  1 
ATOM   209   C C   . ARG A 1 28  ? 20.221  29.194  59.883  1.00 63.04 ? 28  ARG A C   1 
ATOM   210   O O   . ARG A 1 28  ? 21.037  30.113  60.007  1.00 62.97 ? 28  ARG A O   1 
ATOM   211   C CB  . ARG A 1 28  ? 21.805  27.651  58.579  1.00 63.99 ? 28  ARG A CB  1 
ATOM   212   C CG  . ARG A 1 28  ? 21.480  28.244  57.226  1.00 64.39 ? 28  ARG A CG  1 
ATOM   213   C CD  . ARG A 1 28  ? 20.859  27.235  56.283  1.00 66.13 ? 28  ARG A CD  1 
ATOM   214   N NE  . ARG A 1 28  ? 20.621  27.823  54.960  1.00 66.99 ? 28  ARG A NE  1 
ATOM   215   C CZ  . ARG A 1 28  ? 21.136  27.373  53.817  1.00 67.23 ? 28  ARG A CZ  1 
ATOM   216   N NH1 . ARG A 1 28  ? 21.924  26.296  53.794  1.00 67.18 ? 28  ARG A NH1 1 
ATOM   217   N NH2 . ARG A 1 28  ? 20.840  27.995  52.685  1.00 67.70 ? 28  ARG A NH2 1 
ATOM   218   N N   . GLY A 1 29  ? 18.902  29.385  59.947  1.00 61.97 ? 29  GLY A N   1 
ATOM   219   C CA  . GLY A 1 29  ? 18.324  30.700  60.217  1.00 60.29 ? 29  GLY A CA  1 
ATOM   220   C C   . GLY A 1 29  ? 18.314  31.058  61.699  1.00 59.32 ? 29  GLY A C   1 
ATOM   221   O O   . GLY A 1 29  ? 18.807  30.286  62.537  1.00 59.28 ? 29  GLY A O   1 
ATOM   222   N N   . PRO A 1 30  ? 17.735  32.228  62.045  1.00 58.00 ? 30  PRO A N   1 
ATOM   223   C CA  . PRO A 1 30  ? 17.632  32.585  63.457  1.00 57.05 ? 30  PRO A CA  1 
ATOM   224   C C   . PRO A 1 30  ? 16.613  31.703  64.165  1.00 55.94 ? 30  PRO A C   1 
ATOM   225   O O   . PRO A 1 30  ? 15.728  31.143  63.525  1.00 55.81 ? 30  PRO A O   1 
ATOM   226   C CB  . PRO A 1 30  ? 17.153  34.041  63.430  1.00 57.11 ? 30  PRO A CB  1 
ATOM   227   C CG  . PRO A 1 30  ? 17.267  34.488  61.985  1.00 57.76 ? 30  PRO A CG  1 
ATOM   228   C CD  . PRO A 1 30  ? 17.146  33.256  61.169  1.00 57.82 ? 30  PRO A CD  1 
ATOM   229   N N   . LYS A 1 31  ? 16.752  31.578  65.479  1.00 54.97 ? 31  LYS A N   1 
ATOM   230   C CA  . LYS A 1 31  ? 15.836  30.776  66.288  1.00 53.68 ? 31  LYS A CA  1 
ATOM   231   C C   . LYS A 1 31  ? 14.431  31.404  66.334  1.00 52.42 ? 31  LYS A C   1 
ATOM   232   O O   . LYS A 1 31  ? 13.480  30.742  66.746  1.00 52.38 ? 31  LYS A O   1 
ATOM   233   C CB  . LYS A 1 31  ? 16.398  30.574  67.701  1.00 54.14 ? 31  LYS A CB  1 
ATOM   234   C CG  . LYS A 1 31  ? 17.597  29.615  67.806  1.00 55.54 ? 31  LYS A CG  1 
ATOM   235   C CD  . LYS A 1 31  ? 17.147  28.166  68.069  1.00 57.42 ? 31  LYS A CD  1 
ATOM   236   C CE  . LYS A 1 31  ? 18.178  27.369  68.889  1.00 57.77 ? 31  LYS A CE  1 
ATOM   237   N NZ  . LYS A 1 31  ? 18.352  27.850  70.300  1.00 57.18 ? 31  LYS A NZ  1 
ATOM   238   N N   . SER A 1 32  ? 14.319  32.665  65.889  1.00 50.24 ? 32  SER A N   1 
ATOM   239   C CA  . SER A 1 32  ? 13.039  33.387  65.786  1.00 48.26 ? 32  SER A CA  1 
ATOM   240   C C   . SER A 1 32  ? 12.271  33.129  64.470  1.00 47.09 ? 32  SER A C   1 
ATOM   241   O O   . SER A 1 32  ? 11.192  33.715  64.248  1.00 47.09 ? 32  SER A O   1 
ATOM   242   C CB  . SER A 1 32  ? 13.257  34.902  65.947  1.00 48.32 ? 32  SER A CB  1 
ATOM   243   O OG  . SER A 1 32  ? 14.094  35.422  64.916  1.00 47.67 ? 32  SER A OG  1 
ATOM   244   N N   . MET A 1 33  ? 12.821  32.276  63.608  1.00 44.87 ? 33  MET A N   1 
ATOM   245   C CA  . MET A 1 33  ? 12.215  32.001  62.300  1.00 43.62 ? 33  MET A CA  1 
ATOM   246   C C   . MET A 1 33  ? 10.954  31.112  62.422  1.00 42.02 ? 33  MET A C   1 
ATOM   247   O O   . MET A 1 33  ? 10.938  30.118  63.148  1.00 42.42 ? 33  MET A O   1 
ATOM   248   C CB  . MET A 1 33  ? 13.259  31.398  61.341  1.00 43.53 ? 33  MET A CB  1 
ATOM   249   C CG  . MET A 1 33  ? 12.798  31.164  59.893  1.00 45.65 ? 33  MET A CG  1 
ATOM   250   S SD  . MET A 1 33  ? 14.153  30.669  58.751  1.00 49.72 ? 33  MET A SD  1 
ATOM   251   C CE  . MET A 1 33  ? 14.913  32.274  58.451  1.00 48.88 ? 33  MET A CE  1 
ATOM   252   N N   . ILE A 1 34  ? 9.902   31.481  61.707  1.00 39.76 ? 34  ILE A N   1 
ATOM   253   C CA  . ILE A 1 34  ? 8.671   30.708  61.703  1.00 37.65 ? 34  ILE A CA  1 
ATOM   254   C C   . ILE A 1 34  ? 8.560   30.021  60.361  1.00 36.67 ? 34  ILE A C   1 
ATOM   255   O O   . ILE A 1 34  ? 8.591   30.675  59.323  1.00 35.99 ? 34  ILE A O   1 
ATOM   256   C CB  . ILE A 1 34  ? 7.425   31.599  61.944  1.00 37.55 ? 34  ILE A CB  1 
ATOM   257   C CG1 . ILE A 1 34  ? 7.496   32.267  63.321  1.00 37.01 ? 34  ILE A CG1 1 
ATOM   258   C CG2 . ILE A 1 34  ? 6.138   30.801  61.855  1.00 37.17 ? 34  ILE A CG2 1 
ATOM   259   C CD1 . ILE A 1 34  ? 6.572   33.462  63.455  1.00 34.95 ? 34  ILE A CD1 1 
ATOM   260   N N   . SER A 1 35  ? 8.463   28.697  60.383  1.00 35.31 ? 35  SER A N   1 
ATOM   261   C CA  . SER A 1 35  ? 8.204   27.951  59.151  1.00 34.15 ? 35  SER A CA  1 
ATOM   262   C C   . SER A 1 35  ? 6.818   27.335  59.118  1.00 32.88 ? 35  SER A C   1 
ATOM   263   O O   . SER A 1 35  ? 6.434   26.555  60.000  1.00 32.09 ? 35  SER A O   1 
ATOM   264   C CB  . SER A 1 35  ? 9.236   26.858  58.920  1.00 34.24 ? 35  SER A CB  1 
ATOM   265   O OG  . SER A 1 35  ? 8.835   26.150  57.774  1.00 33.52 ? 35  SER A OG  1 
ATOM   266   N N   . LEU A 1 36  ? 6.067   27.672  58.082  1.00 32.13 ? 36  LEU A N   1 
ATOM   267   C CA  . LEU A 1 36  ? 4.857   26.930  57.759  1.00 31.15 ? 36  LEU A CA  1 
ATOM   268   C C   . LEU A 1 36  ? 5.091   26.108  56.483  1.00 30.39 ? 36  LEU A C   1 
ATOM   269   O O   . LEU A 1 36  ? 4.154   25.654  55.811  1.00 28.94 ? 36  LEU A O   1 
ATOM   270   C CB  . LEU A 1 36  ? 3.664   27.897  57.622  1.00 31.33 ? 36  LEU A CB  1 
ATOM   271   C CG  . LEU A 1 36  ? 3.324   28.838  58.781  1.00 32.62 ? 36  LEU A CG  1 
ATOM   272   C CD1 . LEU A 1 36  ? 1.909   29.379  58.571  1.00 33.80 ? 36  LEU A CD1 1 
ATOM   273   C CD2 . LEU A 1 36  ? 3.429   28.160  60.146  1.00 32.15 ? 36  LEU A CD2 1 
ATOM   274   N N   . ALA A 1 37  ? 6.364   25.906  56.165  1.00 30.54 ? 37  ALA A N   1 
ATOM   275   C CA  . ALA A 1 37  ? 6.759   25.388  54.866  1.00 30.85 ? 37  ALA A CA  1 
ATOM   276   C C   . ALA A 1 37  ? 6.837   23.850  54.785  1.00 31.12 ? 37  ALA A C   1 
ATOM   277   O O   . ALA A 1 37  ? 6.651   23.256  53.718  1.00 31.27 ? 37  ALA A O   1 
ATOM   278   C CB  . ALA A 1 37  ? 8.104   26.040  54.440  1.00 31.01 ? 37  ALA A CB  1 
ATOM   279   N N   . GLY A 1 38  ? 7.110   23.207  55.913  1.00 31.32 ? 38  GLY A N   1 
ATOM   280   C CA  . GLY A 1 38  ? 7.479   21.799  55.877  1.00 31.54 ? 38  GLY A CA  1 
ATOM   281   C C   . GLY A 1 38  ? 6.309   20.859  55.840  1.00 30.25 ? 38  GLY A C   1 
ATOM   282   O O   . GLY A 1 38  ? 5.164   21.251  56.051  1.00 31.02 ? 38  GLY A O   1 
ATOM   283   N N   . GLY A 1 39  ? 6.599   19.597  55.599  1.00 29.89 ? 39  GLY A N   1 
ATOM   284   C CA  . GLY A 1 39  ? 5.542   18.611  55.495  1.00 27.78 ? 39  GLY A CA  1 
ATOM   285   C C   . GLY A 1 39  ? 5.651   17.586  56.601  1.00 26.94 ? 39  GLY A C   1 
ATOM   286   O O   . GLY A 1 39  ? 5.207   16.439  56.421  1.00 26.40 ? 39  GLY A O   1 
ATOM   287   N N   . LEU A 1 40  ? 6.215   17.966  57.767  1.00 26.53 ? 40  LEU A N   1 
ATOM   288   C CA  . LEU A 1 40  ? 6.335   16.979  58.852  1.00 25.28 ? 40  LEU A CA  1 
ATOM   289   C C   . LEU A 1 40  ? 5.034   16.884  59.641  1.00 23.99 ? 40  LEU A C   1 
ATOM   290   O O   . LEU A 1 40  ? 4.467   17.920  60.022  1.00 23.94 ? 40  LEU A O   1 
ATOM   291   C CB  . LEU A 1 40  ? 7.483   17.297  59.815  1.00 26.36 ? 40  LEU A CB  1 
ATOM   292   C CG  . LEU A 1 40  ? 8.912   17.408  59.290  1.00 26.86 ? 40  LEU A CG  1 
ATOM   293   C CD1 . LEU A 1 40  ? 9.789   18.064  60.371  1.00 28.50 ? 40  LEU A CD1 1 
ATOM   294   C CD2 . LEU A 1 40  ? 9.467   16.049  58.870  1.00 26.25 ? 40  LEU A CD2 1 
ATOM   295   N N   . PRO A 1 41  ? 4.550   15.656  59.917  1.00 22.72 ? 41  PRO A N   1 
ATOM   296   C CA  . PRO A 1 41  ? 3.428   15.577  60.873  1.00 22.20 ? 41  PRO A CA  1 
ATOM   297   C C   . PRO A 1 41  ? 3.866   15.934  62.287  1.00 22.32 ? 41  PRO A C   1 
ATOM   298   O O   . PRO A 1 41  ? 5.051   15.858  62.613  1.00 22.65 ? 41  PRO A O   1 
ATOM   299   C CB  . PRO A 1 41  ? 3.008   14.100  60.825  1.00 22.96 ? 41  PRO A CB  1 
ATOM   300   C CG  . PRO A 1 41  ? 4.206   13.370  60.357  1.00 20.15 ? 41  PRO A CG  1 
ATOM   301   C CD  . PRO A 1 41  ? 5.000   14.314  59.486  1.00 21.79 ? 41  PRO A CD  1 
ATOM   302   N N   . ASN A 1 42  ? 2.919   16.329  63.132  1.00 23.46 ? 42  ASN A N   1 
ATOM   303   C CA  . ASN A 1 42  ? 3.251   16.648  64.510  1.00 22.92 ? 42  ASN A CA  1 
ATOM   304   C C   . ASN A 1 42  ? 3.602   15.360  65.288  1.00 22.45 ? 42  ASN A C   1 
ATOM   305   O O   . ASN A 1 42  ? 2.749   14.472  65.422  1.00 19.83 ? 42  ASN A O   1 
ATOM   306   C CB  . ASN A 1 42  ? 2.082   17.370  65.191  1.00 24.05 ? 42  ASN A CB  1 
ATOM   307   C CG  . ASN A 1 42  ? 2.490   18.006  66.473  1.00 25.44 ? 42  ASN A CG  1 
ATOM   308   O OD1 . ASN A 1 42  ? 3.219   17.405  67.273  1.00 28.40 ? 42  ASN A OD1 1 
ATOM   309   N ND2 . ASN A 1 42  ? 2.073   19.256  66.668  1.00 24.35 ? 42  ASN A ND2 1 
ATOM   310   N N   . PRO A 1 43  ? 4.857   15.259  65.782  1.00 21.17 ? 43  PRO A N   1 
ATOM   311   C CA  . PRO A 1 43  ? 5.304   14.008  66.409  1.00 22.20 ? 43  PRO A CA  1 
ATOM   312   C C   . PRO A 1 43  ? 4.710   13.855  67.796  1.00 23.16 ? 43  PRO A C   1 
ATOM   313   O O   . PRO A 1 43  ? 4.761   12.779  68.363  1.00 22.31 ? 43  PRO A O   1 
ATOM   314   C CB  . PRO A 1 43  ? 6.839   14.158  66.455  1.00 22.31 ? 43  PRO A CB  1 
ATOM   315   C CG  . PRO A 1 43  ? 7.061   15.626  66.633  1.00 21.11 ? 43  PRO A CG  1 
ATOM   316   C CD  . PRO A 1 43  ? 5.923   16.281  65.785  1.00 23.00 ? 43  PRO A CD  1 
ATOM   317   N N   . ASN A 1 44  ? 4.098   14.925  68.321  1.00 23.54 ? 44  ASN A N   1 
ATOM   318   C CA  . ASN A 1 44  ? 3.460   14.843  69.629  1.00 24.40 ? 44  ASN A CA  1 
ATOM   319   C C   . ASN A 1 44  ? 2.250   13.927  69.666  1.00 23.80 ? 44  ASN A C   1 
ATOM   320   O O   . ASN A 1 44  ? 1.849   13.455  70.722  1.00 23.66 ? 44  ASN A O   1 
ATOM   321   C CB  . ASN A 1 44  ? 3.150   16.256  70.146  1.00 24.85 ? 44  ASN A CB  1 
ATOM   322   C CG  . ASN A 1 44  ? 4.407   16.968  70.587  1.00 26.60 ? 44  ASN A CG  1 
ATOM   323   O OD1 . ASN A 1 44  ? 5.058   16.533  71.509  1.00 27.08 ? 44  ASN A OD1 1 
ATOM   324   N ND2 . ASN A 1 44  ? 4.759   18.049  69.918  1.00 31.69 ? 44  ASN A ND2 1 
ATOM   325   N N   . MET A 1 45  ? 1.718   13.616  68.494  1.00 23.85 ? 45  MET A N   1 
ATOM   326   C CA  . MET A 1 45  ? 0.555   12.780  68.351  1.00 22.63 ? 45  MET A CA  1 
ATOM   327   C C   . MET A 1 45  ? 0.912   11.289  68.368  1.00 23.42 ? 45  MET A C   1 
ATOM   328   O O   . MET A 1 45  ? 0.029   10.457  68.576  1.00 23.06 ? 45  MET A O   1 
ATOM   329   C CB  . MET A 1 45  ? -0.114  13.118  67.033  1.00 23.78 ? 45  MET A CB  1 
ATOM   330   C CG  . MET A 1 45  ? -0.711  14.553  66.978  1.00 24.72 ? 45  MET A CG  1 
ATOM   331   S SD  . MET A 1 45  ? -2.072  14.689  68.130  1.00 28.96 ? 45  MET A SD  1 
ATOM   332   C CE  . MET A 1 45  ? -1.363  15.632  69.460  1.00 29.57 ? 45  MET A CE  1 
ATOM   333   N N   . PHE A 1 46  ? 2.184   10.967  68.102  1.00 21.37 ? 46  PHE A N   1 
ATOM   334   C CA  . PHE A 1 46  ? 2.633   9.560   68.037  1.00 21.65 ? 46  PHE A CA  1 
ATOM   335   C C   . PHE A 1 46  ? 2.613   8.934   69.433  1.00 22.83 ? 46  PHE A C   1 
ATOM   336   O O   . PHE A 1 46  ? 3.042   9.591   70.401  1.00 22.27 ? 46  PHE A O   1 
ATOM   337   C CB  . PHE A 1 46  ? 4.026   9.483   67.433  1.00 19.90 ? 46  PHE A CB  1 
ATOM   338   C CG  . PHE A 1 46  ? 4.116   10.033  66.032  1.00 18.84 ? 46  PHE A CG  1 
ATOM   339   C CD1 . PHE A 1 46  ? 2.986   10.029  65.177  1.00 20.03 ? 46  PHE A CD1 1 
ATOM   340   C CD2 . PHE A 1 46  ? 5.303   10.542  65.566  1.00 18.70 ? 46  PHE A CD2 1 
ATOM   341   C CE1 . PHE A 1 46  ? 3.097   10.490  63.844  1.00 19.75 ? 46  PHE A CE1 1 
ATOM   342   C CE2 . PHE A 1 46  ? 5.440   11.021  64.228  1.00 18.69 ? 46  PHE A CE2 1 
ATOM   343   C CZ  . PHE A 1 46  ? 4.330   11.009  63.392  1.00 18.73 ? 46  PHE A CZ  1 
ATOM   344   N N   . PRO A 1 47  ? 2.117   7.673   69.541  1.00 23.30 ? 47  PRO A N   1 
ATOM   345   C CA  . PRO A 1 47  ? 1.833   7.132   70.883  1.00 23.75 ? 47  PRO A CA  1 
ATOM   346   C C   . PRO A 1 47  ? 3.000   6.650   71.751  1.00 23.61 ? 47  PRO A C   1 
ATOM   347   O O   . PRO A 1 47  ? 2.862   6.684   72.972  1.00 24.52 ? 47  PRO A O   1 
ATOM   348   C CB  . PRO A 1 47  ? 0.839   5.996   70.606  1.00 23.37 ? 47  PRO A CB  1 
ATOM   349   C CG  . PRO A 1 47  ? 1.273   5.489   69.211  1.00 23.11 ? 47  PRO A CG  1 
ATOM   350   C CD  . PRO A 1 47  ? 1.701   6.750   68.466  1.00 22.29 ? 47  PRO A CD  1 
ATOM   351   N N   . PHE A 1 48  ? 4.091   6.192   71.133  1.00 24.08 ? 48  PHE A N   1 
ATOM   352   C CA  . PHE A 1 48  ? 5.319   5.751   71.816  1.00 22.89 ? 48  PHE A CA  1 
ATOM   353   C C   . PHE A 1 48  ? 6.071   6.982   72.371  1.00 22.69 ? 48  PHE A C   1 
ATOM   354   O O   . PHE A 1 48  ? 6.398   7.909   71.595  1.00 22.41 ? 48  PHE A O   1 
ATOM   355   C CB  . PHE A 1 48  ? 6.224   4.968   70.812  1.00 22.05 ? 48  PHE A CB  1 
ATOM   356   C CG  . PHE A 1 48  ? 5.482   3.959   69.937  1.00 22.75 ? 48  PHE A CG  1 
ATOM   357   C CD1 . PHE A 1 48  ? 5.065   2.731   70.453  1.00 19.61 ? 48  PHE A CD1 1 
ATOM   358   C CD2 . PHE A 1 48  ? 5.230   4.233   68.596  1.00 23.42 ? 48  PHE A CD2 1 
ATOM   359   C CE1 . PHE A 1 48  ? 4.379   1.804   69.660  1.00 21.27 ? 48  PHE A CE1 1 
ATOM   360   C CE2 . PHE A 1 48  ? 4.519   3.290   67.788  1.00 22.97 ? 48  PHE A CE2 1 
ATOM   361   C CZ  . PHE A 1 48  ? 4.093   2.092   68.340  1.00 18.20 ? 48  PHE A CZ  1 
ATOM   362   N N   . LYS A 1 49  ? 6.408   6.983   73.670  1.00 23.57 ? 49  LYS A N   1 
ATOM   363   C CA  . LYS A 1 49  ? 7.003   8.190   74.305  1.00 23.50 ? 49  LYS A CA  1 
ATOM   364   C C   . LYS A 1 49  ? 8.495   8.075   74.705  1.00 23.49 ? 49  LYS A C   1 
ATOM   365   O O   . LYS A 1 49  ? 9.242   9.055   74.657  1.00 22.44 ? 49  LYS A O   1 
ATOM   366   C CB  . LYS A 1 49  ? 6.127   8.683   75.495  1.00 24.48 ? 49  LYS A CB  1 
ATOM   367   C CG  . LYS A 1 49  ? 4.666   8.940   75.153  1.00 26.21 ? 49  LYS A CG  1 
ATOM   368   C CD  . LYS A 1 49  ? 4.540   9.890   73.955  1.00 26.90 ? 49  LYS A CD  1 
ATOM   369   C CE  . LYS A 1 49  ? 3.170   10.468  73.800  1.00 30.48 ? 49  LYS A CE  1 
ATOM   370   N NZ  . LYS A 1 49  ? 3.230   11.673  72.884  1.00 32.75 ? 49  LYS A NZ  1 
ATOM   371   N N   . THR A 1 50  ? 8.932   6.885   75.111  1.00 23.47 ? 50  THR A N   1 
ATOM   372   C CA  . THR A 1 50  ? 10.320  6.694   75.560  1.00 23.89 ? 50  THR A CA  1 
ATOM   373   C C   . THR A 1 50  ? 10.689  5.254   75.219  1.00 23.86 ? 50  THR A C   1 
ATOM   374   O O   . THR A 1 50  ? 9.799   4.436   74.980  1.00 21.63 ? 50  THR A O   1 
ATOM   375   C CB  . THR A 1 50  ? 10.507  6.896   77.115  1.00 24.28 ? 50  THR A CB  1 
ATOM   376   O OG1 . THR A 1 50  ? 9.941   5.777   77.801  1.00 24.61 ? 50  THR A OG1 1 
ATOM   377   C CG2 . THR A 1 50  ? 9.781   8.144   77.622  1.00 26.03 ? 50  THR A CG2 1 
ATOM   378   N N   . ALA A 1 51  ? 11.990  4.957   75.208  1.00 23.79 ? 51  ALA A N   1 
ATOM   379   C CA  . ALA A 1 51  ? 12.455  3.583   74.984  1.00 24.93 ? 51  ALA A CA  1 
ATOM   380   C C   . ALA A 1 51  ? 13.685  3.381   75.810  1.00 25.08 ? 51  ALA A C   1 
ATOM   381   O O   . ALA A 1 51  ? 14.464  4.310   75.989  1.00 25.89 ? 51  ALA A O   1 
ATOM   382   C CB  . ALA A 1 51  ? 12.792  3.332   73.505  1.00 24.64 ? 51  ALA A CB  1 
ATOM   383   N N   . VAL A 1 52  ? 13.839  2.167   76.323  1.00 25.07 ? 52  VAL A N   1 
ATOM   384   C CA  . VAL A 1 52  ? 15.095  1.748   76.928  1.00 25.40 ? 52  VAL A CA  1 
ATOM   385   C C   . VAL A 1 52  ? 15.457  0.382   76.428  1.00 24.66 ? 52  VAL A C   1 
ATOM   386   O O   . VAL A 1 52  ? 14.665  -0.580  76.491  1.00 25.02 ? 52  VAL A O   1 
ATOM   387   C CB  . VAL A 1 52  ? 15.173  1.897   78.513  1.00 26.34 ? 52  VAL A CB  1 
ATOM   388   C CG1 . VAL A 1 52  ? 13.935  2.582   79.133  1.00 28.09 ? 52  VAL A CG1 1 
ATOM   389   C CG2 . VAL A 1 52  ? 15.573  0.674   79.205  1.00 26.76 ? 52  VAL A CG2 1 
ATOM   390   N N   . ILE A 1 53  ? 16.658  0.307   75.891  1.00 23.37 ? 53  ILE A N   1 
ATOM   391   C CA  . ILE A 1 53  ? 17.093  -0.905  75.206  1.00 24.04 ? 53  ILE A CA  1 
ATOM   392   C C   . ILE A 1 53  ? 18.385  -1.359  75.812  1.00 23.97 ? 53  ILE A C   1 
ATOM   393   O O   . ILE A 1 53  ? 19.342  -0.598  75.843  1.00 24.94 ? 53  ILE A O   1 
ATOM   394   C CB  . ILE A 1 53  ? 17.212  -0.670  73.694  1.00 22.94 ? 53  ILE A CB  1 
ATOM   395   C CG1 . ILE A 1 53  ? 15.802  -0.304  73.158  1.00 22.95 ? 53  ILE A CG1 1 
ATOM   396   C CG2 . ILE A 1 53  ? 17.789  -1.937  73.001  1.00 22.58 ? 53  ILE A CG2 1 
ATOM   397   C CD1 . ILE A 1 53  ? 15.784  0.405   71.845  1.00 25.93 ? 53  ILE A CD1 1 
ATOM   398   N N   . THR A 1 54  ? 18.372  -2.562  76.383  1.00 25.47 ? 54  THR A N   1 
ATOM   399   C CA  . THR A 1 54  ? 19.564  -3.111  77.000  1.00 26.55 ? 54  THR A CA  1 
ATOM   400   C C   . THR A 1 54  ? 20.489  -3.691  75.969  1.00 27.32 ? 54  THR A C   1 
ATOM   401   O O   . THR A 1 54  ? 20.055  -4.179  74.941  1.00 27.46 ? 54  THR A O   1 
ATOM   402   C CB  . THR A 1 54  ? 19.249  -4.170  78.104  1.00 26.61 ? 54  THR A CB  1 
ATOM   403   O OG1 . THR A 1 54  ? 18.518  -5.261  77.530  1.00 27.37 ? 54  THR A OG1 1 
ATOM   404   C CG2 . THR A 1 54  ? 18.423  -3.527  79.196  1.00 26.34 ? 54  THR A CG2 1 
ATOM   405   N N   . VAL A 1 55  ? 21.777  -3.625  76.267  1.00 29.09 ? 55  VAL A N   1 
ATOM   406   C CA  . VAL A 1 55  ? 22.823  -4.069  75.379  1.00 31.60 ? 55  VAL A CA  1 
ATOM   407   C C   . VAL A 1 55  ? 23.760  -5.020  76.132  1.00 33.89 ? 55  VAL A C   1 
ATOM   408   O O   . VAL A 1 55  ? 24.039  -4.814  77.318  1.00 34.19 ? 55  VAL A O   1 
ATOM   409   C CB  . VAL A 1 55  ? 23.619  -2.840  74.819  1.00 31.27 ? 55  VAL A CB  1 
ATOM   410   C CG1 . VAL A 1 55  ? 24.922  -3.292  74.139  1.00 33.14 ? 55  VAL A CG1 1 
ATOM   411   C CG2 . VAL A 1 55  ? 22.740  -2.046  73.832  1.00 30.07 ? 55  VAL A CG2 1 
ATOM   412   N N   . GLU A 1 56  ? 24.241  -6.062  75.454  1.00 37.08 ? 56  GLU A N   1 
ATOM   413   C CA  . GLU A 1 56  ? 25.294  -6.912  76.026  1.00 40.62 ? 56  GLU A CA  1 
ATOM   414   C C   . GLU A 1 56  ? 26.646  -6.304  75.674  1.00 42.21 ? 56  GLU A C   1 
ATOM   415   O O   . GLU A 1 56  ? 26.872  -5.918  74.512  1.00 43.88 ? 56  GLU A O   1 
ATOM   416   C CB  . GLU A 1 56  ? 25.188  -8.344  75.481  1.00 41.13 ? 56  GLU A CB  1 
ATOM   417   C CG  . GLU A 1 56  ? 25.860  -9.428  76.362  1.00 44.33 ? 56  GLU A CG  1 
ATOM   418   C CD  . GLU A 1 56  ? 25.854  -10.796 75.711  1.00 46.32 ? 56  GLU A CD  1 
ATOM   419   O OE1 . GLU A 1 56  ? 25.044  -11.665 76.097  1.00 50.63 ? 56  GLU A OE1 1 
ATOM   420   O OE2 . GLU A 1 56  ? 26.660  -11.006 74.796  1.00 48.03 ? 56  GLU A OE2 1 
ATOM   421   N N   . ASN A 1 57  ? 27.541  -6.231  76.662  1.00 43.98 ? 57  ASN A N   1 
ATOM   422   C CA  . ASN A 1 57  ? 28.915  -5.659  76.532  1.00 45.38 ? 57  ASN A CA  1 
ATOM   423   C C   . ASN A 1 57  ? 28.864  -4.167  76.184  1.00 45.45 ? 57  ASN A C   1 
ATOM   424   O O   . ASN A 1 57  ? 29.565  -3.685  75.289  1.00 46.40 ? 57  ASN A O   1 
ATOM   425   C CB  . ASN A 1 57  ? 29.806  -6.456  75.548  1.00 45.90 ? 57  ASN A CB  1 
ATOM   426   C CG  . ASN A 1 57  ? 30.003  -7.939  75.962  1.00 48.49 ? 57  ASN A CG  1 
ATOM   427   O OD1 . ASN A 1 57  ? 29.828  -8.854  75.146  1.00 51.02 ? 57  ASN A OD1 1 
ATOM   428   N ND2 . ASN A 1 57  ? 30.380  -8.169  77.224  1.00 50.80 ? 57  ASN A ND2 1 
ATOM   429   N N   . GLY A 1 58  ? 28.015  -3.452  76.923  1.00 45.92 ? 58  GLY A N   1 
ATOM   430   C CA  . GLY A 1 58  ? 27.606  -2.077  76.515  1.00 45.51 ? 58  GLY A CA  1 
ATOM   431   C C   . GLY A 1 58  ? 26.565  -1.499  77.472  1.00 45.19 ? 58  GLY A C   1 
ATOM   432   O O   . GLY A 1 58  ? 25.803  -2.226  78.134  1.00 46.13 ? 58  GLY A O   1 
ATOM   433   N N   . LYS A 1 59  ? 26.560  -0.170  77.546  1.00 44.02 ? 59  LYS A N   1 
ATOM   434   C CA  . LYS A 1 59  ? 25.635  0.590   78.361  1.00 42.11 ? 59  LYS A CA  1 
ATOM   435   C C   . LYS A 1 59  ? 24.262  0.553   77.720  1.00 39.81 ? 59  LYS A C   1 
ATOM   436   O O   . LYS A 1 59  ? 24.150  0.576   76.488  1.00 38.89 ? 59  LYS A O   1 
ATOM   437   C CB  . LYS A 1 59  ? 26.119  2.055   78.447  1.00 43.75 ? 59  LYS A CB  1 
ATOM   438   C CG  . LYS A 1 59  ? 26.699  2.428   79.849  1.00 44.79 ? 59  LYS A CG  1 
ATOM   439   C CD  . LYS A 1 59  ? 27.496  3.725   79.842  1.00 47.93 ? 59  LYS A CD  1 
ATOM   440   C CE  . LYS A 1 59  ? 28.723  3.639   78.932  1.00 51.36 ? 59  LYS A CE  1 
ATOM   441   N NZ  . LYS A 1 59  ? 29.593  4.841   79.037  1.00 53.23 ? 59  LYS A NZ  1 
ATOM   442   N N   . THR A 1 60  ? 23.211  0.527   78.544  1.00 37.01 ? 60  THR A N   1 
ATOM   443   C CA  . THR A 1 60  ? 21.858  0.571   77.989  1.00 34.33 ? 60  THR A CA  1 
ATOM   444   C C   . THR A 1 60  ? 21.575  1.848   77.168  1.00 32.95 ? 60  THR A C   1 
ATOM   445   O O   . THR A 1 60  ? 22.114  2.921   77.449  1.00 32.32 ? 60  THR A O   1 
ATOM   446   C CB  . THR A 1 60  ? 20.736  0.230   79.004  1.00 34.95 ? 60  THR A CB  1 
ATOM   447   O OG1 . THR A 1 60  ? 19.976  1.380   79.304  1.00 36.31 ? 60  THR A OG1 1 
ATOM   448   C CG2 . THR A 1 60  ? 21.242  -0.421  80.256  1.00 30.96 ? 60  THR A CG2 1 
ATOM   449   N N   . ILE A 1 61  ? 20.790  1.689   76.108  1.00 30.87 ? 61  ILE A N   1 
ATOM   450   C CA  . ILE A 1 61  ? 20.396  2.801   75.250  1.00 29.60 ? 61  ILE A CA  1 
ATOM   451   C C   . ILE A 1 61  ? 19.028  3.340   75.664  1.00 29.36 ? 61  ILE A C   1 
ATOM   452   O O   . ILE A 1 61  ? 18.072  2.576   75.878  1.00 27.92 ? 61  ILE A O   1 
ATOM   453   C CB  . ILE A 1 61  ? 20.420  2.400   73.751  1.00 29.30 ? 61  ILE A CB  1 
ATOM   454   C CG1 . ILE A 1 61  ? 21.854  2.044   73.346  1.00 27.71 ? 61  ILE A CG1 1 
ATOM   455   C CG2 . ILE A 1 61  ? 19.808  3.518   72.881  1.00 27.86 ? 61  ILE A CG2 1 
ATOM   456   C CD1 . ILE A 1 61  ? 22.018  1.224   72.039  1.00 23.04 ? 61  ILE A CD1 1 
ATOM   457   N N   . GLN A 1 62  ? 18.967  4.652   75.836  1.00 28.37 ? 62  GLN A N   1 
ATOM   458   C CA  . GLN A 1 62  ? 17.758  5.302   76.289  1.00 29.78 ? 62  GLN A CA  1 
ATOM   459   C C   . GLN A 1 62  ? 17.382  6.349   75.268  1.00 28.12 ? 62  GLN A C   1 
ATOM   460   O O   . GLN A 1 62  ? 18.222  7.151   74.888  1.00 28.22 ? 62  GLN A O   1 
ATOM   461   C CB  . GLN A 1 62  ? 17.932  5.946   77.675  1.00 30.68 ? 62  GLN A CB  1 
ATOM   462   C CG  . GLN A 1 62  ? 18.597  5.063   78.688  1.00 35.75 ? 62  GLN A CG  1 
ATOM   463   C CD  . GLN A 1 62  ? 18.162  5.328   80.105  1.00 40.46 ? 62  GLN A CD  1 
ATOM   464   O OE1 . GLN A 1 62  ? 17.987  6.486   80.516  1.00 45.97 ? 62  GLN A OE1 1 
ATOM   465   N NE2 . GLN A 1 62  ? 17.984  4.250   80.877  1.00 42.09 ? 62  GLN A NE2 1 
ATOM   466   N N   . PHE A 1 63  ? 16.135  6.303   74.792  1.00 27.31 ? 63  PHE A N   1 
ATOM   467   C CA  . PHE A 1 63  ? 15.525  7.455   74.107  1.00 27.42 ? 63  PHE A CA  1 
ATOM   468   C C   . PHE A 1 63  ? 14.581  8.202   75.066  1.00 26.87 ? 63  PHE A C   1 
ATOM   469   O O   . PHE A 1 63  ? 13.559  7.667   75.484  1.00 24.98 ? 63  PHE A O   1 
ATOM   470   C CB  . PHE A 1 63  ? 14.721  7.028   72.862  1.00 27.35 ? 63  PHE A CB  1 
ATOM   471   C CG  . PHE A 1 63  ? 15.531  6.347   71.822  1.00 28.17 ? 63  PHE A CG  1 
ATOM   472   C CD1 . PHE A 1 63  ? 16.924  6.335   71.882  1.00 27.67 ? 63  PHE A CD1 1 
ATOM   473   C CD2 . PHE A 1 63  ? 14.905  5.706   70.765  1.00 30.02 ? 63  PHE A CD2 1 
ATOM   474   C CE1 . PHE A 1 63  ? 17.679  5.683   70.898  1.00 30.73 ? 63  PHE A CE1 1 
ATOM   475   C CE2 . PHE A 1 63  ? 15.653  5.056   69.801  1.00 31.91 ? 63  PHE A CE2 1 
ATOM   476   C CZ  . PHE A 1 63  ? 17.028  5.048   69.862  1.00 27.93 ? 63  PHE A CZ  1 
ATOM   477   N N   . GLY A 1 64  ? 14.940  9.426   75.443  1.00 27.24 ? 64  GLY A N   1 
ATOM   478   C CA  . GLY A 1 64  ? 14.037  10.246  76.265  1.00 27.46 ? 64  GLY A CA  1 
ATOM   479   C C   . GLY A 1 64  ? 12.970  10.843  75.372  1.00 27.64 ? 64  GLY A C   1 
ATOM   480   O O   . GLY A 1 64  ? 12.916  10.532  74.159  1.00 28.07 ? 64  GLY A O   1 
ATOM   481   N N   . GLU A 1 65  ? 12.158  11.741  75.921  1.00 26.77 ? 65  GLU A N   1 
ATOM   482   C CA  . GLU A 1 65  ? 10.987  12.240  75.201  1.00 27.17 ? 65  GLU A CA  1 
ATOM   483   C C   . GLU A 1 65  ? 11.390  12.901  73.916  1.00 26.39 ? 65  GLU A C   1 
ATOM   484   O O   . GLU A 1 65  ? 10.739  12.666  72.909  1.00 24.84 ? 65  GLU A O   1 
ATOM   485   C CB  . GLU A 1 65  ? 10.114  13.215  76.013  1.00 27.53 ? 65  GLU A CB  1 
ATOM   486   C CG  . GLU A 1 65  ? 10.072  12.934  77.495  1.00 34.28 ? 65  GLU A CG  1 
ATOM   487   C CD  . GLU A 1 65  ? 9.245   11.730  77.869  1.00 43.52 ? 65  GLU A CD  1 
ATOM   488   O OE1 . GLU A 1 65  ? 9.314   11.319  79.062  1.00 45.16 ? 65  GLU A OE1 1 
ATOM   489   O OE2 . GLU A 1 65  ? 8.506   11.195  76.989  1.00 48.12 ? 65  GLU A OE2 1 
ATOM   490   N N   . GLU A 1 66  ? 12.456  13.711  73.949  1.00 25.63 ? 66  GLU A N   1 
ATOM   491   C CA  . GLU A 1 66  ? 12.878  14.452  72.757  1.00 26.83 ? 66  GLU A CA  1 
ATOM   492   C C   . GLU A 1 66  ? 13.551  13.570  71.701  1.00 25.45 ? 66  GLU A C   1 
ATOM   493   O O   . GLU A 1 66  ? 13.237  13.671  70.522  1.00 24.53 ? 66  GLU A O   1 
ATOM   494   C CB  . GLU A 1 66  ? 13.740  15.659  73.117  1.00 28.16 ? 66  GLU A CB  1 
ATOM   495   C CG  . GLU A 1 66  ? 12.921  16.777  73.826  1.00 32.91 ? 66  GLU A CG  1 
ATOM   496   C CD  . GLU A 1 66  ? 11.805  17.366  72.939  1.00 37.05 ? 66  GLU A CD  1 
ATOM   497   O OE1 . GLU A 1 66  ? 12.064  17.642  71.737  1.00 40.42 ? 66  GLU A OE1 1 
ATOM   498   O OE2 . GLU A 1 66  ? 10.688  17.582  73.466  1.00 39.42 ? 66  GLU A OE2 1 
ATOM   499   N N   . MET A 1 67  ? 14.427  12.673  72.144  1.00 24.82 ? 67  MET A N   1 
ATOM   500   C CA  . MET A 1 67  ? 15.020  11.696  71.261  1.00 24.97 ? 67  MET A CA  1 
ATOM   501   C C   . MET A 1 67  ? 13.965  10.778  70.630  1.00 23.55 ? 67  MET A C   1 
ATOM   502   O O   . MET A 1 67  ? 14.045  10.507  69.438  1.00 24.34 ? 67  MET A O   1 
ATOM   503   C CB  . MET A 1 67  ? 16.097  10.890  71.990  1.00 25.68 ? 67  MET A CB  1 
ATOM   504   C CG  . MET A 1 67  ? 16.882  9.947   71.055  1.00 29.01 ? 67  MET A CG  1 
ATOM   505   S SD  . MET A 1 67  ? 17.777  10.770  69.747  1.00 36.80 ? 67  MET A SD  1 
ATOM   506   C CE  . MET A 1 67  ? 19.034  11.744  70.610  1.00 37.90 ? 67  MET A CE  1 
ATOM   507   N N   . MET A 1 68  ? 12.985  10.315  71.417  1.00 23.50 ? 68  MET A N   1 
ATOM   508   C CA  . MET A 1 68  ? 11.885  9.491   70.869  1.00 23.55 ? 68  MET A CA  1 
ATOM   509   C C   . MET A 1 68  ? 11.130  10.196  69.742  1.00 22.74 ? 68  MET A C   1 
ATOM   510   O O   . MET A 1 68  ? 10.872  9.597   68.699  1.00 20.91 ? 68  MET A O   1 
ATOM   511   C CB  . MET A 1 68  ? 10.888  9.088   71.963  1.00 23.90 ? 68  MET A CB  1 
ATOM   512   C CG  . MET A 1 68  ? 9.803   8.121   71.467  1.00 26.87 ? 68  MET A CG  1 
ATOM   513   S SD  . MET A 1 68  ? 10.375  6.452   70.994  1.00 33.95 ? 68  MET A SD  1 
ATOM   514   C CE  . MET A 1 68  ? 11.683  6.209   72.097  1.00 28.42 ? 68  MET A CE  1 
ATOM   515   N N   . LYS A 1 69  ? 10.788  11.472  69.954  1.00 21.17 ? 69  LYS A N   1 
ATOM   516   C CA  . LYS A 1 69  ? 10.149  12.237  68.915  1.00 20.82 ? 69  LYS A CA  1 
ATOM   517   C C   . LYS A 1 69  ? 10.974  12.253  67.623  1.00 20.32 ? 69  LYS A C   1 
ATOM   518   O O   . LYS A 1 69  ? 10.422  12.122  66.515  1.00 19.04 ? 69  LYS A O   1 
ATOM   519   C CB  . LYS A 1 69  ? 9.781   13.654  69.376  1.00 20.33 ? 69  LYS A CB  1 
ATOM   520   C CG  . LYS A 1 69  ? 8.781   13.672  70.471  1.00 23.24 ? 69  LYS A CG  1 
ATOM   521   C CD  . LYS A 1 69  ? 8.239   15.048  70.722  1.00 28.65 ? 69  LYS A CD  1 
ATOM   522   C CE  . LYS A 1 69  ? 8.950   15.742  71.795  1.00 31.94 ? 69  LYS A CE  1 
ATOM   523   N NZ  . LYS A 1 69  ? 8.299   17.081  72.035  1.00 37.79 ? 69  LYS A NZ  1 
ATOM   524   N N   . ARG A 1 70  ? 12.279  12.376  67.761  1.00 18.68 ? 70  ARG A N   1 
ATOM   525   C CA  . ARG A 1 70  ? 13.154  12.370  66.602  1.00 19.95 ? 70  ARG A CA  1 
ATOM   526   C C   . ARG A 1 70  ? 13.206  10.956  65.932  1.00 18.53 ? 70  ARG A C   1 
ATOM   527   O O   . ARG A 1 70  ? 13.043  10.848  64.691  1.00 19.22 ? 70  ARG A O   1 
ATOM   528   C CB  . ARG A 1 70  ? 14.531  12.839  67.003  1.00 20.28 ? 70  ARG A CB  1 
ATOM   529   C CG  . ARG A 1 70  ? 15.410  12.934  65.837  1.00 23.67 ? 70  ARG A CG  1 
ATOM   530   C CD  . ARG A 1 70  ? 16.832  13.131  66.244  1.00 24.43 ? 70  ARG A CD  1 
ATOM   531   N NE  . ARG A 1 70  ? 17.626  13.041  65.033  1.00 24.87 ? 70  ARG A NE  1 
ATOM   532   C CZ  . ARG A 1 70  ? 18.932  12.823  64.992  1.00 23.99 ? 70  ARG A CZ  1 
ATOM   533   N NH1 . ARG A 1 70  ? 19.637  12.673  66.129  1.00 20.19 ? 70  ARG A NH1 1 
ATOM   534   N NH2 . ARG A 1 70  ? 19.529  12.754  63.808  1.00 19.50 ? 70  ARG A NH2 1 
ATOM   535   N N   . ALA A 1 71  ? 13.304  9.918   66.772  1.00 17.59 ? 71  ALA A N   1 
ATOM   536   C CA  . ALA A 1 71  ? 13.300  8.503   66.350  1.00 17.77 ? 71  ALA A CA  1 
ATOM   537   C C   . ALA A 1 71  ? 12.048  8.129   65.543  1.00 18.00 ? 71  ALA A C   1 
ATOM   538   O O   . ALA A 1 71  ? 12.099  7.193   64.683  1.00 18.13 ? 71  ALA A O   1 
ATOM   539   C CB  . ALA A 1 71  ? 13.361  7.634   67.552  1.00 16.66 ? 71  ALA A CB  1 
ATOM   540   N N   . LEU A 1 72  ? 10.933  8.771   65.915  1.00 16.78 ? 72  LEU A N   1 
ATOM   541   C CA  . LEU A 1 72  ? 9.603   8.556   65.288  1.00 18.09 ? 72  LEU A CA  1 
ATOM   542   C C   . LEU A 1 72  ? 9.252   9.433   64.104  1.00 18.46 ? 72  LEU A C   1 
ATOM   543   O O   . LEU A 1 72  ? 8.140   9.293   63.504  1.00 19.15 ? 72  LEU A O   1 
ATOM   544   C CB  . LEU A 1 72  ? 8.479   8.632   66.344  1.00 17.63 ? 72  LEU A CB  1 
ATOM   545   C CG  . LEU A 1 72  ? 8.572   7.615   67.451  1.00 19.07 ? 72  LEU A CG  1 
ATOM   546   C CD1 . LEU A 1 72  ? 7.530   7.866   68.566  1.00 18.92 ? 72  LEU A CD1 1 
ATOM   547   C CD2 . LEU A 1 72  ? 8.470   6.173   66.880  1.00 17.95 ? 72  LEU A CD2 1 
ATOM   548   N N   . GLN A 1 73  ? 10.178  10.305  63.720  1.00 18.24 ? 73  GLN A N   1 
ATOM   549   C CA  . GLN A 1 73  ? 9.859   11.334  62.724  1.00 17.49 ? 73  GLN A CA  1 
ATOM   550   C C   . GLN A 1 73  ? 10.700  11.095  61.480  1.00 17.19 ? 73  GLN A C   1 
ATOM   551   O O   . GLN A 1 73  ? 11.705  10.411  61.564  1.00 16.32 ? 73  GLN A O   1 
ATOM   552   C CB  . GLN A 1 73  ? 10.075  12.738  63.344  1.00 16.95 ? 73  GLN A CB  1 
ATOM   553   C CG  . GLN A 1 73  ? 9.884   13.922  62.369  1.00 17.13 ? 73  GLN A CG  1 
ATOM   554   C CD  . GLN A 1 73  ? 8.477   14.033  61.887  1.00 21.48 ? 73  GLN A CD  1 
ATOM   555   O OE1 . GLN A 1 73  ? 8.060   13.312  60.968  1.00 20.19 ? 73  GLN A OE1 1 
ATOM   556   N NE2 . GLN A 1 73  ? 7.716   14.931  62.506  1.00 22.53 ? 73  GLN A NE2 1 
ATOM   557   N N   . TYR A 1 74  ? 10.264  11.605  60.320  1.00 17.12 ? 74  TYR A N   1 
ATOM   558   C CA  . TYR A 1 74  ? 11.081  11.614  59.108  1.00 16.50 ? 74  TYR A CA  1 
ATOM   559   C C   . TYR A 1 74  ? 12.504  12.125  59.345  1.00 17.23 ? 74  TYR A C   1 
ATOM   560   O O   . TYR A 1 74  ? 12.788  12.998  60.210  1.00 17.83 ? 74  TYR A O   1 
ATOM   561   C CB  . TYR A 1 74  ? 10.424  12.460  57.985  1.00 17.77 ? 74  TYR A CB  1 
ATOM   562   C CG  . TYR A 1 74  ? 9.070   11.979  57.447  1.00 18.19 ? 74  TYR A CG  1 
ATOM   563   C CD1 . TYR A 1 74  ? 8.952   10.772  56.731  1.00 19.98 ? 74  TYR A CD1 1 
ATOM   564   C CD2 . TYR A 1 74  ? 7.942   12.781  57.563  1.00 20.45 ? 74  TYR A CD2 1 
ATOM   565   C CE1 . TYR A 1 74  ? 7.703   10.375  56.159  1.00 22.21 ? 74  TYR A CE1 1 
ATOM   566   C CE2 . TYR A 1 74  ? 6.688   12.380  57.039  1.00 20.84 ? 74  TYR A CE2 1 
ATOM   567   C CZ  . TYR A 1 74  ? 6.580   11.191  56.336  1.00 21.71 ? 74  TYR A CZ  1 
ATOM   568   O OH  . TYR A 1 74  ? 5.333   10.807  55.828  1.00 23.49 ? 74  TYR A OH  1 
ATOM   569   N N   . SER A 1 75  ? 13.416  11.574  58.567  1.00 16.70 ? 75  SER A N   1 
ATOM   570   C CA  . SER A 1 75  ? 14.807  11.953  58.654  1.00 18.63 ? 75  SER A CA  1 
ATOM   571   C C   . SER A 1 75  ? 15.405  11.930  57.223  1.00 17.94 ? 75  SER A C   1 
ATOM   572   O O   . SER A 1 75  ? 14.723  11.558  56.288  1.00 20.00 ? 75  SER A O   1 
ATOM   573   C CB  . SER A 1 75  ? 15.545  11.033  59.644  1.00 15.75 ? 75  SER A CB  1 
ATOM   574   O OG  . SER A 1 75  ? 15.682  9.681   59.152  1.00 17.02 ? 75  SER A OG  1 
ATOM   575   N N   . PRO A 1 76  ? 16.651  12.388  57.048  1.00 20.97 ? 76  PRO A N   1 
ATOM   576   C CA  . PRO A 1 76  ? 17.207  12.525  55.691  1.00 20.80 ? 76  PRO A CA  1 
ATOM   577   C C   . PRO A 1 76  ? 17.319  11.233  54.886  1.00 21.17 ? 76  PRO A C   1 
ATOM   578   O O   . PRO A 1 76  ? 17.559  10.155  55.445  1.00 18.98 ? 76  PRO A O   1 
ATOM   579   C CB  . PRO A 1 76  ? 18.592  13.119  55.946  1.00 21.61 ? 76  PRO A CB  1 
ATOM   580   C CG  . PRO A 1 76  ? 18.422  13.889  57.218  1.00 21.31 ? 76  PRO A CG  1 
ATOM   581   C CD  . PRO A 1 76  ? 17.594  12.924  58.050  1.00 20.52 ? 76  PRO A CD  1 
ATOM   582   N N   . SER A 1 77  ? 17.138  11.364  53.566  1.00 20.72 ? 77  SER A N   1 
ATOM   583   C CA  . SER A 1 77  ? 17.127  10.187  52.704  1.00 22.86 ? 77  SER A CA  1 
ATOM   584   C C   . SER A 1 77  ? 18.402  9.339   52.768  1.00 22.54 ? 77  SER A C   1 
ATOM   585   O O   . SER A 1 77  ? 18.320  8.120   52.776  1.00 22.49 ? 77  SER A O   1 
ATOM   586   C CB  . SER A 1 77  ? 16.808  10.608  51.269  1.00 22.98 ? 77  SER A CB  1 
ATOM   587   O OG  . SER A 1 77  ? 15.429  10.964  51.247  1.00 28.93 ? 77  SER A OG  1 
ATOM   588   N N   . ALA A 1 78  ? 19.567  9.980   52.814  1.00 21.17 ? 78  ALA A N   1 
ATOM   589   C CA  . ALA A 1 78  ? 20.834  9.223   52.810  1.00 21.62 ? 78  ALA A CA  1 
ATOM   590   C C   . ALA A 1 78  ? 21.183  8.621   54.172  1.00 21.42 ? 78  ALA A C   1 
ATOM   591   O O   . ALA A 1 78  ? 22.132  7.845   54.267  1.00 22.47 ? 78  ALA A O   1 
ATOM   592   C CB  . ALA A 1 78  ? 21.969  10.100  52.341  1.00 21.74 ? 78  ALA A CB  1 
ATOM   593   N N   . GLY A 1 79  ? 20.452  9.004   55.216  1.00 22.01 ? 79  GLY A N   1 
ATOM   594   C CA  . GLY A 1 79  ? 20.713  8.546   56.628  1.00 21.91 ? 79  GLY A CA  1 
ATOM   595   C C   . GLY A 1 79  ? 20.859  9.690   57.618  1.00 22.93 ? 79  GLY A C   1 
ATOM   596   O O   . GLY A 1 79  ? 21.006  10.868  57.215  1.00 22.03 ? 79  GLY A O   1 
ATOM   597   N N   . ILE A 1 80  ? 20.793  9.379   58.909  1.00 22.58 ? 80  ILE A N   1 
ATOM   598   C CA  . ILE A 1 80  ? 20.949  10.410  59.930  1.00 22.46 ? 80  ILE A CA  1 
ATOM   599   C C   . ILE A 1 80  ? 22.420  10.890  59.973  1.00 23.35 ? 80  ILE A C   1 
ATOM   600   O O   . ILE A 1 80  ? 23.334  10.114  59.694  1.00 22.77 ? 80  ILE A O   1 
ATOM   601   C CB  . ILE A 1 80  ? 20.495  9.935   61.317  1.00 21.72 ? 80  ILE A CB  1 
ATOM   602   C CG1 . ILE A 1 80  ? 21.396  8.796   61.842  1.00 22.21 ? 80  ILE A CG1 1 
ATOM   603   C CG2 . ILE A 1 80  ? 18.976  9.653   61.314  1.00 20.42 ? 80  ILE A CG2 1 
ATOM   604   C CD1 . ILE A 1 80  ? 21.174  8.476   63.280  1.00 22.52 ? 80  ILE A CD1 1 
ATOM   605   N N   . PRO A 1 81  ? 22.639  12.187  60.279  1.00 22.91 ? 81  PRO A N   1 
ATOM   606   C CA  . PRO A 1 81  ? 24.001  12.664  60.126  1.00 22.99 ? 81  PRO A CA  1 
ATOM   607   C C   . PRO A 1 81  ? 25.039  11.916  60.926  1.00 22.55 ? 81  PRO A C   1 
ATOM   608   O O   . PRO A 1 81  ? 26.095  11.661  60.376  1.00 23.86 ? 81  PRO A O   1 
ATOM   609   C CB  . PRO A 1 81  ? 23.948  14.143  60.571  1.00 22.13 ? 81  PRO A CB  1 
ATOM   610   C CG  . PRO A 1 81  ? 22.589  14.349  61.184  1.00 25.17 ? 81  PRO A CG  1 
ATOM   611   C CD  . PRO A 1 81  ? 21.689  13.266  60.629  1.00 22.46 ? 81  PRO A CD  1 
ATOM   612   N N   . GLU A 1 82  ? 24.748  11.559  62.174  1.00 21.33 ? 82  GLU A N   1 
ATOM   613   C CA  . GLU A 1 82  ? 25.756  10.928  63.023  1.00 21.54 ? 82  GLU A CA  1 
ATOM   614   C C   . GLU A 1 82  ? 26.088  9.517   62.548  1.00 20.49 ? 82  GLU A C   1 
ATOM   615   O O   . GLU A 1 82  ? 27.193  9.078   62.742  1.00 19.58 ? 82  GLU A O   1 
ATOM   616   C CB  . GLU A 1 82  ? 25.358  10.901  64.495  1.00 22.43 ? 82  GLU A CB  1 
ATOM   617   C CG  . GLU A 1 82  ? 24.012  10.358  64.759  1.00 26.51 ? 82  GLU A CG  1 
ATOM   618   C CD  . GLU A 1 82  ? 22.934  11.427  64.844  1.00 26.70 ? 82  GLU A CD  1 
ATOM   619   O OE1 . GLU A 1 82  ? 22.594  12.068  63.807  1.00 25.98 ? 82  GLU A OE1 1 
ATOM   620   O OE2 . GLU A 1 82  ? 22.390  11.567  65.948  1.00 28.75 ? 82  GLU A OE2 1 
ATOM   621   N N   . LEU A 1 83  ? 25.145  8.833   61.901  1.00 20.12 ? 83  LEU A N   1 
ATOM   622   C CA  . LEU A 1 83  ? 25.454  7.478   61.407  1.00 20.45 ? 83  LEU A CA  1 
ATOM   623   C C   . LEU A 1 83  ? 26.241  7.546   60.078  1.00 20.70 ? 83  LEU A C   1 
ATOM   624   O O   . LEU A 1 83  ? 27.187  6.797   59.869  1.00 22.40 ? 83  LEU A O   1 
ATOM   625   C CB  . LEU A 1 83  ? 24.200  6.610   61.313  1.00 19.75 ? 83  LEU A CB  1 
ATOM   626   C CG  . LEU A 1 83  ? 24.335  5.124   60.871  1.00 21.45 ? 83  LEU A CG  1 
ATOM   627   C CD1 . LEU A 1 83  ? 25.226  4.361   61.877  1.00 21.61 ? 83  LEU A CD1 1 
ATOM   628   C CD2 . LEU A 1 83  ? 22.973  4.461   60.687  1.00 22.83 ? 83  LEU A CD2 1 
ATOM   629   N N   . LEU A 1 84  ? 25.859  8.439   59.180  1.00 22.31 ? 84  LEU A N   1 
ATOM   630   C CA  . LEU A 1 84  ? 26.702  8.675   57.978  1.00 22.78 ? 84  LEU A CA  1 
ATOM   631   C C   . LEU A 1 84  ? 28.138  9.072   58.338  1.00 22.95 ? 84  LEU A C   1 
ATOM   632   O O   . LEU A 1 84  ? 29.065  8.594   57.705  1.00 24.36 ? 84  LEU A O   1 
ATOM   633   C CB  . LEU A 1 84  ? 26.116  9.761   57.085  1.00 23.51 ? 84  LEU A CB  1 
ATOM   634   C CG  . LEU A 1 84  ? 24.874  9.425   56.252  1.00 22.26 ? 84  LEU A CG  1 
ATOM   635   C CD1 . LEU A 1 84  ? 24.302  10.705  55.684  1.00 22.38 ? 84  LEU A CD1 1 
ATOM   636   C CD2 . LEU A 1 84  ? 25.120  8.345   55.147  1.00 21.86 ? 84  LEU A CD2 1 
ATOM   637   N N   . SER A 1 85  ? 28.345  9.940   59.328  1.00 23.67 ? 85  SER A N   1 
ATOM   638   C CA  . SER A 1 85  ? 29.740  10.314  59.610  1.00 24.83 ? 85  SER A CA  1 
ATOM   639   C C   . SER A 1 85  ? 30.536  9.195   60.271  1.00 24.00 ? 85  SER A C   1 
ATOM   640   O O   . SER A 1 85  ? 31.762  9.057   60.028  1.00 24.40 ? 85  SER A O   1 
ATOM   641   C CB  . SER A 1 85  ? 29.859  11.608  60.399  1.00 25.08 ? 85  SER A CB  1 
ATOM   642   O OG  . SER A 1 85  ? 29.335  11.475  61.688  1.00 29.87 ? 85  SER A OG  1 
ATOM   643   N N   . TRP A 1 86  ? 29.872  8.435   61.148  1.00 23.33 ? 86  TRP A N   1 
ATOM   644   C CA  . TRP A 1 86  ? 30.529  7.330   61.862  1.00 23.63 ? 86  TRP A CA  1 
ATOM   645   C C   . TRP A 1 86  ? 30.959  6.289   60.853  1.00 23.57 ? 86  TRP A C   1 
ATOM   646   O O   . TRP A 1 86  ? 32.068  5.754   60.947  1.00 24.16 ? 86  TRP A O   1 
ATOM   647   C CB  . TRP A 1 86  ? 29.604  6.674   62.884  1.00 23.16 ? 86  TRP A CB  1 
ATOM   648   C CG  . TRP A 1 86  ? 30.351  5.885   63.914  1.00 23.62 ? 86  TRP A CG  1 
ATOM   649   C CD1 . TRP A 1 86  ? 30.781  6.340   65.107  1.00 24.72 ? 86  TRP A CD1 1 
ATOM   650   C CD2 . TRP A 1 86  ? 30.783  4.521   63.820  1.00 23.17 ? 86  TRP A CD2 1 
ATOM   651   N NE1 . TRP A 1 86  ? 31.432  5.350   65.791  1.00 23.39 ? 86  TRP A NE1 1 
ATOM   652   C CE2 . TRP A 1 86  ? 31.442  4.214   65.030  1.00 25.30 ? 86  TRP A CE2 1 
ATOM   653   C CE3 . TRP A 1 86  ? 30.679  3.528   62.830  1.00 21.65 ? 86  TRP A CE3 1 
ATOM   654   C CZ2 . TRP A 1 86  ? 32.017  2.950   65.288  1.00 25.12 ? 86  TRP A CZ2 1 
ATOM   655   C CZ3 . TRP A 1 86  ? 31.223  2.265   63.086  1.00 21.50 ? 86  TRP A CZ3 1 
ATOM   656   C CH2 . TRP A 1 86  ? 31.884  1.983   64.307  1.00 24.43 ? 86  TRP A CH2 1 
ATOM   657   N N   . LEU A 1 87  ? 30.074  6.024   59.900  1.00 23.53 ? 87  LEU A N   1 
ATOM   658   C CA  . LEU A 1 87  ? 30.281  5.024   58.840  1.00 24.28 ? 87  LEU A CA  1 
ATOM   659   C C   . LEU A 1 87  ? 31.355  5.465   57.864  1.00 24.74 ? 87  LEU A C   1 
ATOM   660   O O   . LEU A 1 87  ? 32.120  4.658   57.437  1.00 24.63 ? 87  LEU A O   1 
ATOM   661   C CB  . LEU A 1 87  ? 28.978  4.752   58.068  1.00 23.71 ? 87  LEU A CB  1 
ATOM   662   C CG  . LEU A 1 87  ? 28.045  3.571   58.422  1.00 25.71 ? 87  LEU A CG  1 
ATOM   663   C CD1 . LEU A 1 87  ? 28.340  2.907   59.744  1.00 25.79 ? 87  LEU A CD1 1 
ATOM   664   C CD2 . LEU A 1 87  ? 26.517  3.773   58.201  1.00 22.91 ? 87  LEU A CD2 1 
ATOM   665   N N   . LYS A 1 88  ? 31.376  6.752   57.489  1.00 25.58 ? 88  LYS A N   1 
ATOM   666   C CA  . LYS A 1 88  ? 32.391  7.245   56.558  1.00 25.42 ? 88  LYS A CA  1 
ATOM   667   C C   . LYS A 1 88  ? 33.726  7.190   57.229  1.00 25.26 ? 88  LYS A C   1 
ATOM   668   O O   . LYS A 1 88  ? 34.701  6.800   56.588  1.00 24.37 ? 88  LYS A O   1 
ATOM   669   C CB  . LYS A 1 88  ? 32.110  8.665   56.069  1.00 25.42 ? 88  LYS A CB  1 
ATOM   670   C CG  . LYS A 1 88  ? 30.879  8.803   55.246  1.00 28.39 ? 88  LYS A CG  1 
ATOM   671   C CD  . LYS A 1 88  ? 30.723  10.234  54.921  1.00 33.94 ? 88  LYS A CD  1 
ATOM   672   C CE  . LYS A 1 88  ? 29.456  10.488  54.183  1.00 37.30 ? 88  LYS A CE  1 
ATOM   673   N NZ  . LYS A 1 88  ? 29.598  10.091  52.772  1.00 43.93 ? 88  LYS A NZ  1 
ATOM   674   N N   . GLN A 1 89  ? 33.782  7.566   58.512  1.00 24.64 ? 89  GLN A N   1 
ATOM   675   C CA  . GLN A 1 89  ? 35.052  7.495   59.224  1.00 26.42 ? 89  GLN A CA  1 
ATOM   676   C C   . GLN A 1 89  ? 35.519  6.040   59.349  1.00 25.91 ? 89  GLN A C   1 
ATOM   677   O O   . GLN A 1 89  ? 36.715  5.768   59.269  1.00 26.47 ? 89  GLN A O   1 
ATOM   678   C CB  . GLN A 1 89  ? 34.984  8.189   60.602  1.00 27.26 ? 89  GLN A CB  1 
ATOM   679   C CG  . GLN A 1 89  ? 36.389  8.367   61.259  1.00 33.58 ? 89  GLN A CG  1 
ATOM   680   C CD  . GLN A 1 89  ? 37.372  9.082   60.303  1.00 38.41 ? 89  GLN A CD  1 
ATOM   681   O OE1 . GLN A 1 89  ? 38.508  8.648   60.125  1.00 40.03 ? 89  GLN A OE1 1 
ATOM   682   N NE2 . GLN A 1 89  ? 36.898  10.166  59.660  1.00 39.86 ? 89  GLN A NE2 1 
ATOM   683   N N   . LEU A 1 90  ? 34.578  5.107   59.530  1.00 25.18 ? 90  LEU A N   1 
ATOM   684   C CA  . LEU A 1 90  ? 34.925  3.688   59.549  1.00 25.40 ? 90  LEU A CA  1 
ATOM   685   C C   . LEU A 1 90  ? 35.521  3.189   58.208  1.00 24.84 ? 90  LEU A C   1 
ATOM   686   O O   . LEU A 1 90  ? 36.478  2.437   58.202  1.00 25.10 ? 90  LEU A O   1 
ATOM   687   C CB  . LEU A 1 90  ? 33.724  2.823   59.969  1.00 25.31 ? 90  LEU A CB  1 
ATOM   688   C CG  . LEU A 1 90  ? 34.025  1.310   60.040  1.00 25.46 ? 90  LEU A CG  1 
ATOM   689   C CD1 . LEU A 1 90  ? 34.781  1.011   61.344  1.00 23.92 ? 90  LEU A CD1 1 
ATOM   690   C CD2 . LEU A 1 90  ? 32.790  0.415   59.917  1.00 26.42 ? 90  LEU A CD2 1 
ATOM   691   N N   . GLN A 1 91  ? 34.913  3.565   57.090  1.00 25.83 ? 91  GLN A N   1 
ATOM   692   C CA  . GLN A 1 91  ? 35.428  3.215   55.765  1.00 26.95 ? 91  GLN A CA  1 
ATOM   693   C C   . GLN A 1 91  ? 36.872  3.756   55.577  1.00 28.05 ? 91  GLN A C   1 
ATOM   694   O O   . GLN A 1 91  ? 37.747  3.075   55.019  1.00 27.97 ? 91  GLN A O   1 
ATOM   695   C CB  . GLN A 1 91  ? 34.498  3.778   54.698  1.00 26.18 ? 91  GLN A CB  1 
ATOM   696   C CG  . GLN A 1 91  ? 33.073  3.207   54.742  1.00 25.58 ? 91  GLN A CG  1 
ATOM   697   C CD  . GLN A 1 91  ? 33.020  1.696   54.586  1.00 23.26 ? 91  GLN A CD  1 
ATOM   698   O OE1 . GLN A 1 91  ? 32.515  1.202   53.577  1.00 27.94 ? 91  GLN A OE1 1 
ATOM   699   N NE2 . GLN A 1 91  ? 33.532  0.955   55.576  1.00 20.01 ? 91  GLN A NE2 1 
ATOM   700   N N   . ILE A 1 92  ? 37.095  4.977   56.040  1.00 28.61 ? 92  ILE A N   1 
ATOM   701   C CA  . ILE A 1 92  ? 38.443  5.541   56.069  1.00 30.53 ? 92  ILE A CA  1 
ATOM   702   C C   . ILE A 1 92  ? 39.397  4.728   56.970  1.00 31.62 ? 92  ILE A C   1 
ATOM   703   O O   . ILE A 1 92  ? 40.494  4.366   56.540  1.00 31.86 ? 92  ILE A O   1 
ATOM   704   C CB  . ILE A 1 92  ? 38.439  7.022   56.454  1.00 30.31 ? 92  ILE A CB  1 
ATOM   705   C CG1 . ILE A 1 92  ? 37.837  7.855   55.330  1.00 27.62 ? 92  ILE A CG1 1 
ATOM   706   C CG2 . ILE A 1 92  ? 39.877  7.528   56.772  1.00 30.25 ? 92  ILE A CG2 1 
ATOM   707   C CD1 . ILE A 1 92  ? 37.460  9.280   55.761  1.00 25.34 ? 92  ILE A CD1 1 
ATOM   708   N N   . LYS A 1 93  ? 38.996  4.416   58.200  1.00 32.19 ? 93  LYS A N   1 
ATOM   709   C CA  . LYS A 1 93  ? 39.861  3.567   59.012  1.00 33.27 ? 93  LYS A CA  1 
ATOM   710   C C   . LYS A 1 93  ? 40.145  2.248   58.315  1.00 32.88 ? 93  LYS A C   1 
ATOM   711   O O   . LYS A 1 93  ? 41.286  1.820   58.270  1.00 33.78 ? 93  LYS A O   1 
ATOM   712   C CB  . LYS A 1 93  ? 39.293  3.323   60.412  1.00 33.54 ? 93  LYS A CB  1 
ATOM   713   C CG  . LYS A 1 93  ? 38.985  4.608   61.193  1.00 37.11 ? 93  LYS A CG  1 
ATOM   714   C CD  . LYS A 1 93  ? 40.249  5.415   61.584  1.00 40.77 ? 93  LYS A CD  1 
ATOM   715   C CE  . LYS A 1 93  ? 39.839  6.748   62.205  1.00 42.03 ? 93  LYS A CE  1 
ATOM   716   N NZ  . LYS A 1 93  ? 39.151  6.647   63.530  1.00 41.90 ? 93  LYS A NZ  1 
ATOM   717   N N   . LEU A 1 94  ? 39.121  1.633   57.728  1.00 32.32 ? 94  LEU A N   1 
ATOM   718   C CA  . LEU A 1 94  ? 39.226  0.233   57.254  1.00 31.40 ? 94  LEU A CA  1 
ATOM   719   C C   . LEU A 1 94  ? 39.843  0.036   55.886  1.00 31.23 ? 94  LEU A C   1 
ATOM   720   O O   . LEU A 1 94  ? 40.553  -0.949  55.665  1.00 31.36 ? 94  LEU A O   1 
ATOM   721   C CB  . LEU A 1 94  ? 37.874  -0.474  57.293  1.00 29.65 ? 94  LEU A CB  1 
ATOM   722   C CG  . LEU A 1 94  ? 37.431  -1.136  58.604  1.00 32.24 ? 94  LEU A CG  1 
ATOM   723   C CD1 . LEU A 1 94  ? 37.916  -0.389  59.820  1.00 31.37 ? 94  LEU A CD1 1 
ATOM   724   C CD2 . LEU A 1 94  ? 35.910  -1.369  58.661  1.00 30.35 ? 94  LEU A CD2 1 
ATOM   725   N N   . HIS A 1 95  ? 39.554  0.958   54.979  1.00 30.68 ? 95  HIS A N   1 
ATOM   726   C CA  . HIS A 1 95  ? 39.855  0.756   53.585  1.00 30.56 ? 95  HIS A CA  1 
ATOM   727   C C   . HIS A 1 95  ? 40.610  1.944   52.976  1.00 31.24 ? 95  HIS A C   1 
ATOM   728   O O   . HIS A 1 95  ? 41.076  1.849   51.814  1.00 31.47 ? 95  HIS A O   1 
ATOM   729   C CB  . HIS A 1 95  ? 38.557  0.587   52.797  1.00 29.90 ? 95  HIS A CB  1 
ATOM   730   C CG  . HIS A 1 95  ? 37.592  -0.399  53.378  1.00 31.64 ? 95  HIS A CG  1 
ATOM   731   N ND1 . HIS A 1 95  ? 36.305  -0.050  53.749  1.00 34.70 ? 95  HIS A ND1 1 
ATOM   732   C CD2 . HIS A 1 95  ? 37.701  -1.729  53.607  1.00 32.26 ? 95  HIS A CD2 1 
ATOM   733   C CE1 . HIS A 1 95  ? 35.664  -1.123  54.177  1.00 31.51 ? 95  HIS A CE1 1 
ATOM   734   N NE2 . HIS A 1 95  ? 36.487  -2.156  54.103  1.00 34.15 ? 95  HIS A NE2 1 
ATOM   735   N N   . ASN A 1 96  ? 40.681  3.046   53.728  1.00 31.55 ? 96  ASN A N   1 
ATOM   736   C CA  . ASN A 1 96  ? 41.317  4.302   53.299  1.00 32.82 ? 96  ASN A CA  1 
ATOM   737   C C   . ASN A 1 96  ? 41.190  4.467   51.788  1.00 32.94 ? 96  ASN A C   1 
ATOM   738   O O   . ASN A 1 96  ? 42.191  4.393   51.070  1.00 33.30 ? 96  ASN A O   1 
ATOM   739   C CB  . ASN A 1 96  ? 42.804  4.314   53.755  1.00 33.01 ? 96  ASN A CB  1 
ATOM   740   C CG  . ASN A 1 96  ? 43.550  5.613   53.394  1.00 35.64 ? 96  ASN A CG  1 
ATOM   741   O OD1 . ASN A 1 96  ? 42.955  6.694   53.237  1.00 37.41 ? 96  ASN A OD1 1 
ATOM   742   N ND2 . ASN A 1 96  ? 44.881  5.505   53.295  1.00 36.30 ? 96  ASN A ND2 1 
ATOM   743   N N   . PRO A 1 97  ? 39.946  4.639   51.288  1.00 33.28 ? 97  PRO A N   1 
ATOM   744   C CA  . PRO A 1 97  ? 39.697  4.709   49.845  1.00 33.28 ? 97  PRO A CA  1 
ATOM   745   C C   . PRO A 1 97  ? 40.458  5.874   49.192  1.00 34.17 ? 97  PRO A C   1 
ATOM   746   O O   . PRO A 1 97  ? 40.362  6.998   49.675  1.00 34.96 ? 97  PRO A O   1 
ATOM   747   C CB  . PRO A 1 97  ? 38.182  4.949   49.755  1.00 32.95 ? 97  PRO A CB  1 
ATOM   748   C CG  . PRO A 1 97  ? 37.636  4.469   51.084  1.00 32.68 ? 97  PRO A CG  1 
ATOM   749   C CD  . PRO A 1 97  ? 38.707  4.809   52.072  1.00 32.86 ? 97  PRO A CD  1 
ATOM   750   N N   . PRO A 1 98  ? 41.183  5.612   48.083  1.00 34.51 ? 98  PRO A N   1 
ATOM   751   C CA  . PRO A 1 98  ? 42.062  6.589   47.400  1.00 35.01 ? 98  PRO A CA  1 
ATOM   752   C C   . PRO A 1 98  ? 41.303  7.857   47.015  1.00 35.44 ? 98  PRO A C   1 
ATOM   753   O O   . PRO A 1 98  ? 41.861  8.936   46.830  1.00 35.84 ? 98  PRO A O   1 
ATOM   754   C CB  . PRO A 1 98  ? 42.444  5.841   46.127  1.00 35.11 ? 98  PRO A CB  1 
ATOM   755   C CG  . PRO A 1 98  ? 42.391  4.399   46.535  1.00 34.59 ? 98  PRO A CG  1 
ATOM   756   C CD  . PRO A 1 98  ? 41.171  4.323   47.376  1.00 34.13 ? 98  PRO A CD  1 
ATOM   757   N N   . THR A 1 99  ? 40.008  7.684   46.973  1.00 34.94 ? 99  THR A N   1 
ATOM   758   C CA  . THR A 1 99  ? 39.055  8.561   46.368  1.00 35.09 ? 99  THR A CA  1 
ATOM   759   C C   . THR A 1 99  ? 38.440  9.587   47.362  1.00 34.92 ? 99  THR A C   1 
ATOM   760   O O   . THR A 1 99  ? 37.601  10.408  46.978  1.00 34.34 ? 99  THR A O   1 
ATOM   761   C CB  . THR A 1 99  ? 38.005  7.596   45.808  1.00 35.39 ? 99  THR A CB  1 
ATOM   762   O OG1 . THR A 1 99  ? 37.586  7.966   44.490  1.00 38.65 ? 99  THR A OG1 1 
ATOM   763   C CG2 . THR A 1 99  ? 36.858  7.398   46.759  1.00 32.70 ? 99  THR A CG2 1 
ATOM   764   N N   . ILE A 1 100 ? 38.868  9.576   48.625  1.00 34.35 ? 100 ILE A N   1 
ATOM   765   C CA  . ILE A 1 100 ? 38.120  10.361  49.642  1.00 34.41 ? 100 ILE A CA  1 
ATOM   766   C C   . ILE A 1 100 ? 38.137  11.871  49.439  1.00 35.16 ? 100 ILE A C   1 
ATOM   767   O O   . ILE A 1 100 ? 37.172  12.564  49.776  1.00 33.33 ? 100 ILE A O   1 
ATOM   768   C CB  . ILE A 1 100 ? 38.500  9.990   51.085  1.00 34.71 ? 100 ILE A CB  1 
ATOM   769   C CG1 . ILE A 1 100 ? 40.008  10.129  51.314  1.00 34.92 ? 100 ILE A CG1 1 
ATOM   770   C CG2 . ILE A 1 100 ? 38.028  8.520   51.377  1.00 34.00 ? 100 ILE A CG2 1 
ATOM   771   C CD1 . ILE A 1 100 ? 40.394  10.172  52.785  1.00 36.79 ? 100 ILE A CD1 1 
ATOM   772   N N   . HIS A 1 101 ? 39.240  12.373  48.883  1.00 36.03 ? 101 HIS A N   1 
ATOM   773   C CA  . HIS A 1 101 ? 39.402  13.812  48.644  1.00 37.16 ? 101 HIS A CA  1 
ATOM   774   C C   . HIS A 1 101 ? 39.338  14.259  47.160  1.00 37.95 ? 101 HIS A C   1 
ATOM   775   O O   . HIS A 1 101 ? 39.613  15.425  46.855  1.00 38.26 ? 101 HIS A O   1 
ATOM   776   C CB  . HIS A 1 101 ? 40.681  14.299  49.338  1.00 36.97 ? 101 HIS A CB  1 
ATOM   777   C CG  . HIS A 1 101 ? 40.591  14.278  50.834  1.00 39.21 ? 101 HIS A CG  1 
ATOM   778   N ND1 . HIS A 1 101 ? 41.556  13.707  51.639  1.00 41.86 ? 101 HIS A ND1 1 
ATOM   779   C CD2 . HIS A 1 101 ? 39.631  14.740  51.670  1.00 40.73 ? 101 HIS A CD2 1 
ATOM   780   C CE1 . HIS A 1 101 ? 41.207  13.839  52.907  1.00 40.81 ? 101 HIS A CE1 1 
ATOM   781   N NE2 . HIS A 1 101 ? 40.036  14.452  52.954  1.00 42.85 ? 101 HIS A NE2 1 
ATOM   782   N N   . TYR A 1 102 ? 38.952  13.350  46.259  1.00 38.28 ? 102 TYR A N   1 
ATOM   783   C CA  . TYR A 1 102 ? 38.722  13.679  44.844  1.00 38.57 ? 102 TYR A CA  1 
ATOM   784   C C   . TYR A 1 102 ? 37.572  14.686  44.730  1.00 39.34 ? 102 TYR A C   1 
ATOM   785   O O   . TYR A 1 102 ? 36.710  14.740  45.616  1.00 38.69 ? 102 TYR A O   1 
ATOM   786   C CB  . TYR A 1 102 ? 38.311  12.439  44.052  1.00 38.10 ? 102 TYR A CB  1 
ATOM   787   C CG  . TYR A 1 102 ? 39.372  11.384  43.724  1.00 37.06 ? 102 TYR A CG  1 
ATOM   788   C CD1 . TYR A 1 102 ? 39.056  10.360  42.835  1.00 37.11 ? 102 TYR A CD1 1 
ATOM   789   C CD2 . TYR A 1 102 ? 40.664  11.408  44.267  1.00 36.89 ? 102 TYR A CD2 1 
ATOM   790   C CE1 . TYR A 1 102 ? 39.966  9.370   42.506  1.00 37.41 ? 102 TYR A CE1 1 
ATOM   791   C CE2 . TYR A 1 102 ? 41.610  10.405  43.926  1.00 36.39 ? 102 TYR A CE2 1 
ATOM   792   C CZ  . TYR A 1 102 ? 41.229  9.393   43.050  1.00 35.88 ? 102 TYR A CZ  1 
ATOM   793   O OH  . TYR A 1 102 ? 42.077  8.381   42.672  1.00 37.51 ? 102 TYR A OH  1 
ATOM   794   N N   . PRO A 1 103 ? 37.554  15.499  43.647  1.00 39.60 ? 103 PRO A N   1 
ATOM   795   C CA  . PRO A 1 103 ? 36.364  16.307  43.382  1.00 39.70 ? 103 PRO A CA  1 
ATOM   796   C C   . PRO A 1 103 ? 35.154  15.393  43.246  1.00 39.29 ? 103 PRO A C   1 
ATOM   797   O O   . PRO A 1 103 ? 35.325  14.246  42.871  1.00 39.43 ? 103 PRO A O   1 
ATOM   798   C CB  . PRO A 1 103 ? 36.675  16.979  42.034  1.00 39.37 ? 103 PRO A CB  1 
ATOM   799   C CG  . PRO A 1 103 ? 38.167  17.013  41.980  1.00 39.32 ? 103 PRO A CG  1 
ATOM   800   C CD  . PRO A 1 103 ? 38.613  15.734  42.641  1.00 39.65 ? 103 PRO A CD  1 
ATOM   801   N N   . PRO A 1 104 ? 33.950  15.881  43.622  1.00 39.25 ? 104 PRO A N   1 
ATOM   802   C CA  . PRO A 1 104 ? 32.677  15.183  43.437  1.00 38.86 ? 104 PRO A CA  1 
ATOM   803   C C   . PRO A 1 104 ? 32.462  14.590  42.042  1.00 38.36 ? 104 PRO A C   1 
ATOM   804   O O   . PRO A 1 104 ? 32.143  13.409  41.932  1.00 38.02 ? 104 PRO A O   1 
ATOM   805   C CB  . PRO A 1 104 ? 31.650  16.269  43.742  1.00 38.92 ? 104 PRO A CB  1 
ATOM   806   C CG  . PRO A 1 104 ? 32.317  17.057  44.784  1.00 39.94 ? 104 PRO A CG  1 
ATOM   807   C CD  . PRO A 1 104 ? 33.758  17.140  44.362  1.00 38.60 ? 104 PRO A CD  1 
ATOM   808   N N   . SER A 1 105 ? 32.636  15.385  40.986  1.00 37.78 ? 105 SER A N   1 
ATOM   809   C CA  . SER A 1 105 ? 32.449  14.894  39.613  1.00 36.94 ? 105 SER A CA  1 
ATOM   810   C C   . SER A 1 105 ? 33.417  13.763  39.254  1.00 36.51 ? 105 SER A C   1 
ATOM   811   O O   . SER A 1 105 ? 33.179  13.002  38.320  1.00 36.04 ? 105 SER A O   1 
ATOM   812   C CB  . SER A 1 105 ? 32.692  16.030  38.624  1.00 37.45 ? 105 SER A CB  1 
ATOM   813   O OG  . SER A 1 105 ? 34.003  16.537  38.823  1.00 38.33 ? 105 SER A OG  1 
ATOM   814   N N   . GLN A 1 106 ? 34.528  13.679  39.969  1.00 36.68 ? 106 GLN A N   1 
ATOM   815   C CA  . GLN A 1 106 ? 35.524  12.659  39.678  1.00 37.52 ? 106 GLN A CA  1 
ATOM   816   C C   . GLN A 1 106 ? 35.440  11.458  40.637  1.00 36.82 ? 106 GLN A C   1 
ATOM   817   O O   . GLN A 1 106 ? 36.422  10.726  40.818  1.00 36.58 ? 106 GLN A O   1 
ATOM   818   C CB  . GLN A 1 106 ? 36.910  13.277  39.712  1.00 37.71 ? 106 GLN A CB  1 
ATOM   819   C CG  . GLN A 1 106 ? 36.902  14.696  39.214  1.00 42.67 ? 106 GLN A CG  1 
ATOM   820   C CD  . GLN A 1 106 ? 38.142  15.054  38.467  1.00 47.93 ? 106 GLN A CD  1 
ATOM   821   O OE1 . GLN A 1 106 ? 39.225  15.200  39.051  1.00 49.28 ? 106 GLN A OE1 1 
ATOM   822   N NE2 . GLN A 1 106 ? 37.999  15.206  37.154  1.00 50.82 ? 106 GLN A NE2 1 
ATOM   823   N N   . GLY A 1 107 ? 34.269  11.277  41.250  1.00 36.59 ? 107 GLY A N   1 
ATOM   824   C CA  . GLY A 1 107 ? 33.957  10.053  42.034  1.00 35.37 ? 107 GLY A CA  1 
ATOM   825   C C   . GLY A 1 107 ? 34.432  10.074  43.472  1.00 34.66 ? 107 GLY A C   1 
ATOM   826   O O   . GLY A 1 107 ? 34.829  9.038   44.041  1.00 34.72 ? 107 GLY A O   1 
ATOM   827   N N   . GLN A 1 108 ? 34.382  11.252  44.084  1.00 33.52 ? 108 GLN A N   1 
ATOM   828   C CA  . GLN A 1 108 ? 34.740  11.365  45.489  1.00 33.34 ? 108 GLN A CA  1 
ATOM   829   C C   . GLN A 1 108 ? 33.890  10.346  46.287  1.00 32.65 ? 108 GLN A C   1 
ATOM   830   O O   . GLN A 1 108 ? 32.710  10.120  45.961  1.00 32.31 ? 108 GLN A O   1 
ATOM   831   C CB  . GLN A 1 108 ? 34.494  12.775  45.988  1.00 33.68 ? 108 GLN A CB  1 
ATOM   832   C CG  . GLN A 1 108 ? 34.615  12.897  47.480  1.00 35.72 ? 108 GLN A CG  1 
ATOM   833   C CD  . GLN A 1 108 ? 34.576  14.307  47.966  1.00 39.81 ? 108 GLN A CD  1 
ATOM   834   O OE1 . GLN A 1 108 ? 35.421  14.715  48.769  1.00 43.44 ? 108 GLN A OE1 1 
ATOM   835   N NE2 . GLN A 1 108 ? 33.613  15.072  47.491  1.00 39.95 ? 108 GLN A NE2 1 
ATOM   836   N N   . MET A 1 109 ? 34.504  9.703   47.277  1.00 31.23 ? 109 MET A N   1 
ATOM   837   C CA  . MET A 1 109 ? 33.790  8.718   48.102  1.00 30.79 ? 109 MET A CA  1 
ATOM   838   C C   . MET A 1 109 ? 32.582  9.369   48.745  1.00 29.82 ? 109 MET A C   1 
ATOM   839   O O   . MET A 1 109 ? 32.721  10.363  49.500  1.00 29.76 ? 109 MET A O   1 
ATOM   840   C CB  . MET A 1 109 ? 34.672  8.159   49.205  1.00 29.49 ? 109 MET A CB  1 
ATOM   841   C CG  . MET A 1 109 ? 34.119  6.852   49.839  1.00 31.94 ? 109 MET A CG  1 
ATOM   842   S SD  . MET A 1 109 ? 34.867  6.526   51.444  1.00 31.21 ? 109 MET A SD  1 
ATOM   843   C CE  . MET A 1 109 ? 34.249  7.929   52.378  1.00 31.65 ? 109 MET A CE  1 
ATOM   844   N N   . ASP A 1 110 ? 31.419  8.808   48.439  1.00 28.12 ? 110 ASP A N   1 
ATOM   845   C CA  . ASP A 1 110 ? 30.217  9.113   49.176  1.00 26.88 ? 110 ASP A CA  1 
ATOM   846   C C   . ASP A 1 110 ? 29.605  7.813   49.705  1.00 26.23 ? 110 ASP A C   1 
ATOM   847   O O   . ASP A 1 110 ? 29.887  6.712   49.214  1.00 25.69 ? 110 ASP A O   1 
ATOM   848   C CB  . ASP A 1 110 ? 29.188  9.850   48.291  1.00 25.57 ? 110 ASP A CB  1 
ATOM   849   C CG  . ASP A 1 110 ? 28.196  10.683  49.106  1.00 27.35 ? 110 ASP A CG  1 
ATOM   850   O OD1 . ASP A 1 110 ? 28.275  10.703  50.358  1.00 24.77 ? 110 ASP A OD1 1 
ATOM   851   O OD2 . ASP A 1 110 ? 27.293  11.323  48.499  1.00 28.82 ? 110 ASP A OD2 1 
ATOM   852   N N   . LEU A 1 111 ? 28.719  7.955   50.682  1.00 26.10 ? 111 LEU A N   1 
ATOM   853   C CA  . LEU A 1 111 ? 28.145  6.801   51.357  1.00 25.59 ? 111 LEU A CA  1 
ATOM   854   C C   . LEU A 1 111 ? 26.720  7.127   51.748  1.00 25.70 ? 111 LEU A C   1 
ATOM   855   O O   . LEU A 1 111 ? 26.434  8.227   52.222  1.00 24.74 ? 111 LEU A O   1 
ATOM   856   C CB  . LEU A 1 111 ? 28.985  6.461   52.592  1.00 25.05 ? 111 LEU A CB  1 
ATOM   857   C CG  . LEU A 1 111 ? 28.661  5.251   53.498  1.00 25.51 ? 111 LEU A CG  1 
ATOM   858   C CD1 . LEU A 1 111 ? 29.921  4.795   54.137  1.00 23.13 ? 111 LEU A CD1 1 
ATOM   859   C CD2 . LEU A 1 111 ? 27.563  5.482   54.573  1.00 24.33 ? 111 LEU A CD2 1 
ATOM   860   N N   . CYS A 1 112 ? 25.810  6.173   51.538  1.00 25.83 ? 112 CYS A N   1 
ATOM   861   C CA  . CYS A 1 112 ? 24.474  6.299   52.070  1.00 25.29 ? 112 CYS A CA  1 
ATOM   862   C C   . CYS A 1 112 ? 24.056  5.056   52.877  1.00 23.81 ? 112 CYS A C   1 
ATOM   863   O O   . CYS A 1 112 ? 24.436  3.938   52.540  1.00 22.63 ? 112 CYS A O   1 
ATOM   864   C CB  . CYS A 1 112 ? 23.477  6.560   50.944  1.00 26.54 ? 112 CYS A CB  1 
ATOM   865   S SG  . CYS A 1 112 ? 23.414  5.296   49.724  1.00 33.37 ? 112 CYS A SG  1 
ATOM   866   N N   . VAL A 1 113 ? 23.282  5.290   53.945  1.00 22.37 ? 113 VAL A N   1 
ATOM   867   C CA  . VAL A 1 113 ? 22.641  4.230   54.722  1.00 21.49 ? 113 VAL A CA  1 
ATOM   868   C C   . VAL A 1 113 ? 21.475  3.699   53.861  1.00 21.99 ? 113 VAL A C   1 
ATOM   869   O O   . VAL A 1 113 ? 20.708  4.483   53.279  1.00 23.14 ? 113 VAL A O   1 
ATOM   870   C CB  . VAL A 1 113 ? 22.051  4.778   56.051  1.00 20.52 ? 113 VAL A CB  1 
ATOM   871   C CG1 . VAL A 1 113 ? 21.464  3.619   56.910  1.00 18.22 ? 113 VAL A CG1 1 
ATOM   872   C CG2 . VAL A 1 113 ? 23.144  5.530   56.845  1.00 22.99 ? 113 VAL A CG2 1 
ATOM   873   N N   . THR A 1 114 ? 21.364  2.387   53.752  1.00 21.63 ? 114 THR A N   1 
ATOM   874   C CA  . THR A 1 114 ? 20.249  1.792   53.044  1.00 21.71 ? 114 THR A CA  1 
ATOM   875   C C   . THR A 1 114 ? 19.383  0.925   53.972  1.00 22.20 ? 114 THR A C   1 
ATOM   876   O O   . THR A 1 114 ? 19.825  0.520   55.049  1.00 22.04 ? 114 THR A O   1 
ATOM   877   C CB  . THR A 1 114 ? 20.687  1.004   51.803  1.00 21.29 ? 114 THR A CB  1 
ATOM   878   O OG1 . THR A 1 114 ? 21.546  -0.092  52.161  1.00 19.43 ? 114 THR A OG1 1 
ATOM   879   C CG2 . THR A 1 114 ? 21.386  1.941   50.780  1.00 22.59 ? 114 THR A CG2 1 
ATOM   880   N N   . SER A 1 115 ? 18.150  0.653   53.545  1.00 23.15 ? 115 SER A N   1 
ATOM   881   C CA  . SER A 1 115 ? 17.294  -0.292  54.266  1.00 23.89 ? 115 SER A CA  1 
ATOM   882   C C   . SER A 1 115 ? 17.734  -1.726  54.005  1.00 23.08 ? 115 SER A C   1 
ATOM   883   O O   . SER A 1 115 ? 17.063  -2.445  53.286  1.00 23.10 ? 115 SER A O   1 
ATOM   884   C CB  . SER A 1 115 ? 15.815  -0.096  53.874  1.00 23.17 ? 115 SER A CB  1 
ATOM   885   O OG  . SER A 1 115 ? 15.429  1.236   54.183  1.00 27.07 ? 115 SER A OG  1 
ATOM   886   N N   . GLY A 1 116 ? 18.838  -2.142  54.625  1.00 22.58 ? 116 GLY A N   1 
ATOM   887   C CA  . GLY A 1 116 ? 19.537  -3.382  54.258  1.00 22.73 ? 116 GLY A CA  1 
ATOM   888   C C   . GLY A 1 116 ? 20.488  -3.119  53.100  1.00 22.37 ? 116 GLY A C   1 
ATOM   889   O O   . GLY A 1 116 ? 20.232  -2.227  52.304  1.00 22.73 ? 116 GLY A O   1 
ATOM   890   N N   . SER A 1 117 ? 21.571  -3.888  52.988  1.00 22.04 ? 117 SER A N   1 
ATOM   891   C CA  . SER A 1 117 ? 22.498  -3.762  51.859  1.00 21.33 ? 117 SER A CA  1 
ATOM   892   C C   . SER A 1 117 ? 21.844  -4.172  50.554  1.00 22.15 ? 117 SER A C   1 
ATOM   893   O O   . SER A 1 117 ? 22.199  -3.659  49.481  1.00 21.62 ? 117 SER A O   1 
ATOM   894   C CB  . SER A 1 117 ? 23.779  -4.556  52.071  1.00 21.05 ? 117 SER A CB  1 
ATOM   895   O OG  . SER A 1 117 ? 23.585  -5.972  52.051  1.00 22.77 ? 117 SER A OG  1 
ATOM   896   N N   . GLN A 1 118 ? 20.897  -5.107  50.631  1.00 21.72 ? 118 GLN A N   1 
ATOM   897   C CA  . GLN A 1 118 ? 20.261  -5.566  49.409  1.00 22.51 ? 118 GLN A CA  1 
ATOM   898   C C   . GLN A 1 118 ? 19.514  -4.434  48.702  1.00 21.72 ? 118 GLN A C   1 
ATOM   899   O O   . GLN A 1 118 ? 19.363  -4.434  47.455  1.00 20.26 ? 118 GLN A O   1 
ATOM   900   C CB  . GLN A 1 118 ? 19.298  -6.693  49.716  1.00 22.37 ? 118 GLN A CB  1 
ATOM   901   C CG  . GLN A 1 118 ? 18.434  -7.078  48.538  1.00 30.32 ? 118 GLN A CG  1 
ATOM   902   C CD  . GLN A 1 118 ? 18.934  -8.306  47.857  1.00 37.99 ? 118 GLN A CD  1 
ATOM   903   O OE1 . GLN A 1 118 ? 20.139  -8.497  47.717  1.00 40.47 ? 118 GLN A OE1 1 
ATOM   904   N NE2 . GLN A 1 118 ? 18.007  -9.177  47.454  1.00 39.89 ? 118 GLN A NE2 1 
ATOM   905   N N   . GLN A 1 119 ? 19.006  -3.502  49.502  1.00 20.68 ? 119 GLN A N   1 
ATOM   906   C CA  . GLN A 1 119 ? 18.403  -2.298  48.949  1.00 21.37 ? 119 GLN A CA  1 
ATOM   907   C C   . GLN A 1 119 ? 19.408  -1.548  48.107  1.00 20.66 ? 119 GLN A C   1 
ATOM   908   O O   . GLN A 1 119 ? 19.096  -1.207  46.997  1.00 22.03 ? 119 GLN A O   1 
ATOM   909   C CB  . GLN A 1 119 ? 17.793  -1.350  49.983  1.00 20.56 ? 119 GLN A CB  1 
ATOM   910   C CG  . GLN A 1 119 ? 16.862  -0.366  49.261  1.00 22.12 ? 119 GLN A CG  1 
ATOM   911   C CD  . GLN A 1 119 ? 16.436  0.839   50.059  1.00 20.29 ? 119 GLN A CD  1 
ATOM   912   O OE1 . GLN A 1 119 ? 17.111  1.263   50.969  1.00 21.99 ? 119 GLN A OE1 1 
ATOM   913   N NE2 . GLN A 1 119 ? 15.316  1.437   49.656  1.00 20.30 ? 119 GLN A NE2 1 
ATOM   914   N N   . GLY A 1 120 ? 20.603  -1.313  48.641  1.00 20.69 ? 120 GLY A N   1 
ATOM   915   C CA  . GLY A 1 120 ? 21.674  -0.626  47.915  1.00 21.27 ? 120 GLY A CA  1 
ATOM   916   C C   . GLY A 1 120 ? 21.995  -1.315  46.593  1.00 22.95 ? 120 GLY A C   1 
ATOM   917   O O   . GLY A 1 120 ? 22.170  -0.632  45.573  1.00 21.34 ? 120 GLY A O   1 
ATOM   918   N N   . LEU A 1 121 ? 22.080  -2.650  46.610  1.00 22.43 ? 121 LEU A N   1 
ATOM   919   C CA  . LEU A 1 121 ? 22.448  -3.413  45.421  1.00 24.64 ? 121 LEU A CA  1 
ATOM   920   C C   . LEU A 1 121 ? 21.377  -3.331  44.377  1.00 24.79 ? 121 LEU A C   1 
ATOM   921   O O   . LEU A 1 121 ? 21.690  -3.070  43.209  1.00 25.92 ? 121 LEU A O   1 
ATOM   922   C CB  . LEU A 1 121 ? 22.751  -4.893  45.706  1.00 23.94 ? 121 LEU A CB  1 
ATOM   923   C CG  . LEU A 1 121 ? 23.898  -5.200  46.709  1.00 30.01 ? 121 LEU A CG  1 
ATOM   924   C CD1 . LEU A 1 121 ? 23.716  -6.623  47.237  1.00 34.16 ? 121 LEU A CD1 1 
ATOM   925   C CD2 . LEU A 1 121 ? 25.264  -5.122  46.078  1.00 32.08 ? 121 LEU A CD2 1 
ATOM   926   N N   . CYS A 1 122 ? 20.124  -3.534  44.784  1.00 24.04 ? 122 CYS A N   1 
ATOM   927   C CA  . CYS A 1 122 ? 19.002  -3.454  43.846  1.00 25.89 ? 122 CYS A CA  1 
ATOM   928   C C   . CYS A 1 122 ? 18.938  -2.108  43.111  1.00 25.86 ? 122 CYS A C   1 
ATOM   929   O O   . CYS A 1 122 ? 18.778  -2.094  41.896  1.00 25.94 ? 122 CYS A O   1 
ATOM   930   C CB  . CYS A 1 122 ? 17.670  -3.704  44.555  1.00 25.47 ? 122 CYS A CB  1 
ATOM   931   S SG  . CYS A 1 122 ? 16.261  -3.925  43.452  1.00 31.64 ? 122 CYS A SG  1 
ATOM   932   N N   . LYS A 1 123 ? 19.035  -1.000  43.859  1.00 25.89 ? 123 LYS A N   1 
ATOM   933   C CA  . LYS A 1 123 ? 19.042  0.354   43.267  1.00 26.38 ? 123 LYS A CA  1 
ATOM   934   C C   . LYS A 1 123 ? 20.217  0.556   42.292  1.00 26.08 ? 123 LYS A C   1 
ATOM   935   O O   . LYS A 1 123 ? 20.044  1.191   41.222  1.00 24.46 ? 123 LYS A O   1 
ATOM   936   C CB  . LYS A 1 123 ? 19.087  1.423   44.356  1.00 28.06 ? 123 LYS A CB  1 
ATOM   937   C CG  . LYS A 1 123 ? 17.699  1.955   44.789  1.00 31.34 ? 123 LYS A CG  1 
ATOM   938   C CD  . LYS A 1 123 ? 16.734  0.907   45.195  1.00 34.71 ? 123 LYS A CD  1 
ATOM   939   C CE  . LYS A 1 123 ? 15.565  1.562   45.967  1.00 39.09 ? 123 LYS A CE  1 
ATOM   940   N NZ  . LYS A 1 123 ? 14.457  1.935   45.064  1.00 39.10 ? 123 LYS A NZ  1 
ATOM   941   N N   . VAL A 1 124 ? 21.396  0.041   42.688  1.00 25.07 ? 124 VAL A N   1 
ATOM   942   C CA  . VAL A 1 124 ? 22.577  0.005   41.824  1.00 25.13 ? 124 VAL A CA  1 
ATOM   943   C C   . VAL A 1 124 ? 22.341  -0.706  40.526  1.00 24.99 ? 124 VAL A C   1 
ATOM   944   O O   . VAL A 1 124 ? 22.594  -0.106  39.480  1.00 26.03 ? 124 VAL A O   1 
ATOM   945   C CB  . VAL A 1 124 ? 23.866  -0.420  42.566  1.00 24.92 ? 124 VAL A CB  1 
ATOM   946   C CG1 . VAL A 1 124 ? 25.044  -0.754  41.594  1.00 25.45 ? 124 VAL A CG1 1 
ATOM   947   C CG2 . VAL A 1 124 ? 24.262  0.684   43.482  1.00 22.33 ? 124 VAL A CG2 1 
ATOM   948   N N   . PHE A 1 125 ? 21.815  -1.940  40.581  1.00 25.22 ? 125 PHE A N   1 
ATOM   949   C CA  . PHE A 1 125 ? 21.455  -2.706  39.376  1.00 24.15 ? 125 PHE A CA  1 
ATOM   950   C C   . PHE A 1 125 ? 20.462  -1.930  38.521  1.00 24.40 ? 125 PHE A C   1 
ATOM   951   O O   . PHE A 1 125 ? 20.660  -1.802  37.302  1.00 24.01 ? 125 PHE A O   1 
ATOM   952   C CB  . PHE A 1 125 ? 20.852  -4.063  39.737  1.00 23.88 ? 125 PHE A CB  1 
ATOM   953   C CG  . PHE A 1 125 ? 21.821  -5.002  40.448  1.00 22.20 ? 125 PHE A CG  1 
ATOM   954   C CD1 . PHE A 1 125 ? 21.354  -5.924  41.351  1.00 24.74 ? 125 PHE A CD1 1 
ATOM   955   C CD2 . PHE A 1 125 ? 23.195  -4.907  40.251  1.00 24.57 ? 125 PHE A CD2 1 
ATOM   956   C CE1 . PHE A 1 125 ? 22.241  -6.817  42.026  1.00 24.75 ? 125 PHE A CE1 1 
ATOM   957   C CE2 . PHE A 1 125 ? 24.099  -5.770  40.933  1.00 27.26 ? 125 PHE A CE2 1 
ATOM   958   C CZ  . PHE A 1 125 ? 23.613  -6.712  41.826  1.00 27.31 ? 125 PHE A CZ  1 
ATOM   959   N N   . GLU A 1 126 ? 19.412  -1.408  39.163  1.00 23.04 ? 126 GLU A N   1 
ATOM   960   C CA  . GLU A 1 126 ? 18.412  -0.563  38.488  1.00 23.80 ? 126 GLU A CA  1 
ATOM   961   C C   . GLU A 1 126 ? 19.001  0.682   37.838  1.00 23.04 ? 126 GLU A C   1 
ATOM   962   O O   . GLU A 1 126 ? 18.587  1.030   36.742  1.00 24.36 ? 126 GLU A O   1 
ATOM   963   C CB  . GLU A 1 126 ? 17.173  -0.271  39.393  1.00 22.41 ? 126 GLU A CB  1 
ATOM   964   C CG  . GLU A 1 126 ? 16.240  -1.507  39.576  1.00 24.70 ? 126 GLU A CG  1 
ATOM   965   C CD  . GLU A 1 126 ? 15.355  -1.445  40.837  1.00 25.94 ? 126 GLU A CD  1 
ATOM   966   O OE1 . GLU A 1 126 ? 14.436  -2.272  41.016  1.00 28.23 ? 126 GLU A OE1 1 
ATOM   967   O OE2 . GLU A 1 126 ? 15.572  -0.548  41.641  1.00 28.23 ? 126 GLU A OE2 1 
ATOM   968   N N   . MET A 1 127 ? 19.971  1.308   38.496  1.00 23.47 ? 127 MET A N   1 
ATOM   969   C CA  . MET A 1 127 ? 20.677  2.480   38.002  1.00 23.94 ? 127 MET A CA  1 
ATOM   970   C C   . MET A 1 127 ? 21.434  2.207   36.697  1.00 25.99 ? 127 MET A C   1 
ATOM   971   O O   . MET A 1 127 ? 21.522  3.094   35.843  1.00 26.52 ? 127 MET A O   1 
ATOM   972   C CB  . MET A 1 127 ? 21.637  3.024   39.056  1.00 24.34 ? 127 MET A CB  1 
ATOM   973   C CG  . MET A 1 127 ? 22.435  4.286   38.648  1.00 21.19 ? 127 MET A CG  1 
ATOM   974   S SD  . MET A 1 127 ? 23.695  4.644   39.875  1.00 23.34 ? 127 MET A SD  1 
ATOM   975   C CE  . MET A 1 127 ? 24.728  3.153   39.837  1.00 25.63 ? 127 MET A CE  1 
ATOM   976   N N   . ILE A 1 128 ? 21.939  0.980   36.541  1.00 26.45 ? 128 ILE A N   1 
ATOM   977   C CA  . ILE A 1 128 ? 22.912  0.655   35.512  1.00 26.76 ? 128 ILE A CA  1 
ATOM   978   C C   . ILE A 1 128 ? 22.327  0.012   34.280  1.00 27.52 ? 128 ILE A C   1 
ATOM   979   O O   . ILE A 1 128 ? 22.735  0.344   33.182  1.00 27.40 ? 128 ILE A O   1 
ATOM   980   C CB  . ILE A 1 128 ? 24.027  -0.265  36.064  1.00 26.69 ? 128 ILE A CB  1 
ATOM   981   C CG1 . ILE A 1 128 ? 24.768  0.482   37.142  1.00 24.85 ? 128 ILE A CG1 1 
ATOM   982   C CG2 . ILE A 1 128 ? 25.026  -0.653  34.958  1.00 28.05 ? 128 ILE A CG2 1 
ATOM   983   C CD1 . ILE A 1 128 ? 25.781  -0.365  37.904  1.00 22.23 ? 128 ILE A CD1 1 
ATOM   984   N N   . ILE A 1 129 ? 21.379  -0.903  34.483  1.00 28.11 ? 129 ILE A N   1 
ATOM   985   C CA  . ILE A 1 129 ? 21.103  -1.956  33.523  1.00 28.74 ? 129 ILE A CA  1 
ATOM   986   C C   . ILE A 1 129 ? 19.980  -1.663  32.513  1.00 30.19 ? 129 ILE A C   1 
ATOM   987   O O   . ILE A 1 129 ? 18.790  -1.534  32.869  1.00 30.43 ? 129 ILE A O   1 
ATOM   988   C CB  . ILE A 1 129 ? 20.899  -3.334  34.215  1.00 27.70 ? 129 ILE A CB  1 
ATOM   989   C CG1 . ILE A 1 129 ? 22.177  -3.779  34.952  1.00 28.01 ? 129 ILE A CG1 1 
ATOM   990   C CG2 . ILE A 1 129 ? 20.450  -4.381  33.206  1.00 26.76 ? 129 ILE A CG2 1 
ATOM   991   C CD1 . ILE A 1 129 ? 21.924  -4.969  35.895  1.00 27.26 ? 129 ILE A CD1 1 
ATOM   992   N N   . ASN A 1 130 ? 20.383  -1.588  31.245  1.00 30.78 ? 130 ASN A N   1 
ATOM   993   C CA  . ASN A 1 130 ? 19.451  -1.589  30.119  1.00 32.28 ? 130 ASN A CA  1 
ATOM   994   C C   . ASN A 1 130 ? 19.334  -3.019  29.618  1.00 32.74 ? 130 ASN A C   1 
ATOM   995   O O   . ASN A 1 130 ? 20.311  -3.754  29.682  1.00 33.19 ? 130 ASN A O   1 
ATOM   996   C CB  . ASN A 1 130 ? 20.010  -0.714  29.007  1.00 32.61 ? 130 ASN A CB  1 
ATOM   997   C CG  . ASN A 1 130 ? 19.880  0.740   29.309  1.00 34.10 ? 130 ASN A CG  1 
ATOM   998   O OD1 . ASN A 1 130 ? 18.819  1.193   29.756  1.00 33.94 ? 130 ASN A OD1 1 
ATOM   999   N ND2 . ASN A 1 130 ? 20.967  1.491   29.102  1.00 35.36 ? 130 ASN A ND2 1 
ATOM   1000  N N   . PRO A 1 131 ? 18.162  -3.423  29.110  1.00 33.73 ? 131 PRO A N   1 
ATOM   1001  C CA  . PRO A 1 131 ? 18.120  -4.804  28.679  1.00 34.84 ? 131 PRO A CA  1 
ATOM   1002  C C   . PRO A 1 131 ? 19.180  -5.034  27.584  1.00 36.02 ? 131 PRO A C   1 
ATOM   1003  O O   . PRO A 1 131 ? 19.688  -4.057  26.973  1.00 36.31 ? 131 PRO A O   1 
ATOM   1004  C CB  . PRO A 1 131 ? 16.692  -4.963  28.148  1.00 34.99 ? 131 PRO A CB  1 
ATOM   1005  C CG  . PRO A 1 131 ? 15.926  -3.831  28.746  1.00 34.85 ? 131 PRO A CG  1 
ATOM   1006  C CD  . PRO A 1 131 ? 16.886  -2.723  28.856  1.00 33.39 ? 131 PRO A CD  1 
ATOM   1007  N N   . GLY A 1 132 ? 19.579  -6.289  27.406  1.00 36.24 ? 132 GLY A N   1 
ATOM   1008  C CA  . GLY A 1 132 ? 20.719  -6.609  26.534  1.00 35.83 ? 132 GLY A CA  1 
ATOM   1009  C C   . GLY A 1 132 ? 22.117  -6.282  27.054  1.00 35.76 ? 132 GLY A C   1 
ATOM   1010  O O   . GLY A 1 132 ? 23.105  -6.713  26.457  1.00 36.34 ? 132 GLY A O   1 
ATOM   1011  N N   . ASP A 1 133 ? 22.233  -5.516  28.142  1.00 34.76 ? 133 ASP A N   1 
ATOM   1012  C CA  . ASP A 1 133 ? 23.562  -5.210  28.712  1.00 33.32 ? 133 ASP A CA  1 
ATOM   1013  C C   . ASP A 1 133 ? 24.264  -6.485  29.200  1.00 32.41 ? 133 ASP A C   1 
ATOM   1014  O O   . ASP A 1 133 ? 23.607  -7.428  29.661  1.00 33.49 ? 133 ASP A O   1 
ATOM   1015  C CB  . ASP A 1 133 ? 23.484  -4.230  29.886  1.00 33.83 ? 133 ASP A CB  1 
ATOM   1016  C CG  . ASP A 1 133 ? 23.271  -2.766  29.458  1.00 36.18 ? 133 ASP A CG  1 
ATOM   1017  O OD1 . ASP A 1 133 ? 23.551  -2.376  28.288  1.00 36.42 ? 133 ASP A OD1 1 
ATOM   1018  O OD2 . ASP A 1 133 ? 22.838  -1.983  30.332  1.00 37.52 ? 133 ASP A OD2 1 
ATOM   1019  N N   . ASN A 1 134 ? 25.588  -6.492  29.103  1.00 31.64 ? 134 ASN A N   1 
ATOM   1020  C CA  . ASN A 1 134 ? 26.436  -7.622  29.520  1.00 31.27 ? 134 ASN A CA  1 
ATOM   1021  C C   . ASN A 1 134 ? 26.956  -7.327  30.903  1.00 29.71 ? 134 ASN A C   1 
ATOM   1022  O O   . ASN A 1 134 ? 27.498  -6.250  31.149  1.00 30.41 ? 134 ASN A O   1 
ATOM   1023  C CB  . ASN A 1 134 ? 27.658  -7.786  28.597  1.00 31.44 ? 134 ASN A CB  1 
ATOM   1024  C CG  . ASN A 1 134 ? 27.313  -8.352  27.239  1.00 31.43 ? 134 ASN A CG  1 
ATOM   1025  O OD1 . ASN A 1 134 ? 26.400  -9.160  27.088  1.00 31.72 ? 134 ASN A OD1 1 
ATOM   1026  N ND2 . ASN A 1 134 ? 28.053  -7.909  26.225  1.00 34.79 ? 134 ASN A ND2 1 
ATOM   1027  N N   . VAL A 1 135 ? 26.762  -8.275  31.817  1.00 28.95 ? 135 VAL A N   1 
ATOM   1028  C CA  . VAL A 1 135 ? 27.352  -8.173  33.143  1.00 27.98 ? 135 VAL A CA  1 
ATOM   1029  C C   . VAL A 1 135 ? 28.126  -9.447  33.487  1.00 27.49 ? 135 VAL A C   1 
ATOM   1030  O O   . VAL A 1 135 ? 27.791  -10.541 33.054  1.00 26.31 ? 135 VAL A O   1 
ATOM   1031  C CB  . VAL A 1 135 ? 26.292  -7.871  34.267  1.00 27.53 ? 135 VAL A CB  1 
ATOM   1032  C CG1 . VAL A 1 135 ? 25.424  -6.637  33.914  1.00 28.35 ? 135 VAL A CG1 1 
ATOM   1033  C CG2 . VAL A 1 135 ? 25.444  -9.070  34.551  1.00 28.91 ? 135 VAL A CG2 1 
ATOM   1034  N N   . LEU A 1 136 ? 29.154  -9.278  34.291  1.00 28.50 ? 136 LEU A N   1 
ATOM   1035  C CA  . LEU A 1 136 ? 30.046  -10.370 34.647  1.00 29.57 ? 136 LEU A CA  1 
ATOM   1036  C C   . LEU A 1 136 ? 29.798  -10.760 36.103  1.00 29.79 ? 136 LEU A C   1 
ATOM   1037  O O   . LEU A 1 136 ? 29.628  -9.903  36.938  1.00 29.44 ? 136 LEU A O   1 
ATOM   1038  C CB  . LEU A 1 136 ? 31.483  -9.857  34.513  1.00 29.42 ? 136 LEU A CB  1 
ATOM   1039  C CG  . LEU A 1 136 ? 31.985  -9.491  33.110  1.00 29.47 ? 136 LEU A CG  1 
ATOM   1040  C CD1 . LEU A 1 136 ? 33.244  -8.761  33.323  1.00 28.41 ? 136 LEU A CD1 1 
ATOM   1041  C CD2 . LEU A 1 136 ? 32.183  -10.740 32.263  1.00 29.66 ? 136 LEU A CD2 1 
ATOM   1042  N N   . LEU A 1 137 ? 29.795  -12.050 36.392  1.00 30.59 ? 137 LEU A N   1 
ATOM   1043  C CA  . LEU A 1 137 ? 29.878  -12.517 37.763  1.00 31.28 ? 137 LEU A CA  1 
ATOM   1044  C C   . LEU A 1 137 ? 30.223  -14.000 37.838  1.00 30.92 ? 137 LEU A C   1 
ATOM   1045  O O   . LEU A 1 137 ? 30.116  -14.699 36.853  1.00 30.23 ? 137 LEU A O   1 
ATOM   1046  C CB  . LEU A 1 137 ? 28.598  -12.182 38.532  1.00 31.48 ? 137 LEU A CB  1 
ATOM   1047  C CG  . LEU A 1 137 ? 27.365  -13.085 38.593  1.00 34.11 ? 137 LEU A CG  1 
ATOM   1048  C CD1 . LEU A 1 137 ? 26.083  -12.344 38.331  1.00 34.30 ? 137 LEU A CD1 1 
ATOM   1049  C CD2 . LEU A 1 137 ? 27.454  -14.329 37.764  1.00 35.76 ? 137 LEU A CD2 1 
ATOM   1050  N N   . ASP A 1 138 ? 30.635  -14.459 39.014  1.00 31.06 ? 138 ASP A N   1 
ATOM   1051  C CA  . ASP A 1 138 ? 30.984  -15.874 39.237  1.00 31.16 ? 138 ASP A CA  1 
ATOM   1052  C C   . ASP A 1 138 ? 29.820  -16.637 39.826  1.00 31.17 ? 138 ASP A C   1 
ATOM   1053  O O   . ASP A 1 138 ? 29.259  -16.248 40.884  1.00 31.08 ? 138 ASP A O   1 
ATOM   1054  C CB  . ASP A 1 138 ? 32.201  -15.980 40.160  1.00 31.56 ? 138 ASP A CB  1 
ATOM   1055  C CG  . ASP A 1 138 ? 31.982  -15.293 41.506  1.00 33.87 ? 138 ASP A CG  1 
ATOM   1056  O OD1 . ASP A 1 138 ? 31.874  -14.038 41.532  1.00 37.50 ? 138 ASP A OD1 1 
ATOM   1057  O OD2 . ASP A 1 138 ? 31.935  -16.008 42.543  1.00 35.23 ? 138 ASP A OD2 1 
ATOM   1058  N N   . GLU A 1 139 ? 29.409  -17.693 39.124  1.00 30.34 ? 139 GLU A N   1 
ATOM   1059  C CA  . GLU A 1 139 ? 28.485  -18.678 39.677  1.00 30.39 ? 139 GLU A CA  1 
ATOM   1060  C C   . GLU A 1 139 ? 29.315  -19.809 40.308  1.00 30.71 ? 139 GLU A C   1 
ATOM   1061  O O   . GLU A 1 139 ? 30.338  -20.184 39.745  1.00 30.87 ? 139 GLU A O   1 
ATOM   1062  C CB  . GLU A 1 139 ? 27.645  -19.318 38.606  1.00 29.97 ? 139 GLU A CB  1 
ATOM   1063  C CG  . GLU A 1 139 ? 26.744  -18.440 37.794  1.00 32.49 ? 139 GLU A CG  1 
ATOM   1064  C CD  . GLU A 1 139 ? 26.047  -19.270 36.743  1.00 31.55 ? 139 GLU A CD  1 
ATOM   1065  O OE1 . GLU A 1 139 ? 24.821  -19.414 36.788  1.00 36.23 ? 139 GLU A OE1 1 
ATOM   1066  O OE2 . GLU A 1 139 ? 26.717  -19.843 35.879  1.00 39.72 ? 139 GLU A OE2 1 
ATOM   1067  N N   . PRO A 1 140 ? 28.868  -20.374 41.452  1.00 30.50 ? 140 PRO A N   1 
ATOM   1068  C CA  . PRO A 1 140 ? 27.579  -20.128 42.118  1.00 30.39 ? 140 PRO A CA  1 
ATOM   1069  C C   . PRO A 1 140 ? 27.452  -18.712 42.730  1.00 30.18 ? 140 PRO A C   1 
ATOM   1070  O O   . PRO A 1 140 ? 28.413  -18.164 43.278  1.00 29.89 ? 140 PRO A O   1 
ATOM   1071  C CB  . PRO A 1 140 ? 27.510  -21.216 43.216  1.00 29.75 ? 140 PRO A CB  1 
ATOM   1072  C CG  . PRO A 1 140 ? 28.747  -22.019 43.093  1.00 30.62 ? 140 PRO A CG  1 
ATOM   1073  C CD  . PRO A 1 140 ? 29.709  -21.347 42.182  1.00 30.60 ? 140 PRO A CD  1 
ATOM   1074  N N   . ALA A 1 141 ? 26.257  -18.139 42.629  1.00 30.76 ? 141 ALA A N   1 
ATOM   1075  C CA  . ALA A 1 141 ? 26.038  -16.778 43.106  1.00 30.70 ? 141 ALA A CA  1 
ATOM   1076  C C   . ALA A 1 141 ? 24.804  -16.654 43.981  1.00 30.09 ? 141 ALA A C   1 
ATOM   1077  O O   . ALA A 1 141 ? 23.862  -17.439 43.859  1.00 30.37 ? 141 ALA A O   1 
ATOM   1078  C CB  . ALA A 1 141 ? 25.988  -15.786 41.922  1.00 30.12 ? 141 ALA A CB  1 
ATOM   1079  N N   . TYR A 1 142 ? 24.829  -15.653 44.870  1.00 30.60 ? 142 TYR A N   1 
ATOM   1080  C CA  . TYR A 1 142 ? 23.699  -15.351 45.759  1.00 30.77 ? 142 TYR A CA  1 
ATOM   1081  C C   . TYR A 1 142 ? 22.391  -15.304 44.995  1.00 30.79 ? 142 TYR A C   1 
ATOM   1082  O O   . TYR A 1 142 ? 22.262  -14.548 44.037  1.00 30.57 ? 142 TYR A O   1 
ATOM   1083  C CB  . TYR A 1 142 ? 23.964  -14.061 46.549  1.00 31.38 ? 142 TYR A CB  1 
ATOM   1084  C CG  . TYR A 1 142 ? 22.822  -13.583 47.383  1.00 32.47 ? 142 TYR A CG  1 
ATOM   1085  C CD1 . TYR A 1 142 ? 22.464  -12.226 47.379  1.00 32.69 ? 142 TYR A CD1 1 
ATOM   1086  C CD2 . TYR A 1 142 ? 22.068  -14.477 48.163  1.00 33.91 ? 142 TYR A CD2 1 
ATOM   1087  C CE1 . TYR A 1 142 ? 21.390  -11.776 48.135  1.00 33.54 ? 142 TYR A CE1 1 
ATOM   1088  C CE2 . TYR A 1 142 ? 20.992  -14.033 48.911  1.00 34.20 ? 142 TYR A CE2 1 
ATOM   1089  C CZ  . TYR A 1 142 ? 20.671  -12.681 48.897  1.00 34.23 ? 142 TYR A CZ  1 
ATOM   1090  O OH  . TYR A 1 142 ? 19.621  -12.233 49.657  1.00 36.73 ? 142 TYR A OH  1 
ATOM   1091  N N   . SER A 1 143 ? 21.446  -16.151 45.392  1.00 30.31 ? 143 SER A N   1 
ATOM   1092  C CA  . SER A 1 143 ? 20.202  -16.308 44.660  1.00 31.05 ? 143 SER A CA  1 
ATOM   1093  C C   . SER A 1 143 ? 19.385  -15.006 44.595  1.00 30.92 ? 143 SER A C   1 
ATOM   1094  O O   . SER A 1 143 ? 18.662  -14.774 43.608  1.00 30.35 ? 143 SER A O   1 
ATOM   1095  C CB  . SER A 1 143 ? 19.349  -17.408 45.286  1.00 31.37 ? 143 SER A CB  1 
ATOM   1096  O OG  . SER A 1 143 ? 19.182  -17.143 46.662  1.00 34.71 ? 143 SER A OG  1 
ATOM   1097  N N   . GLY A 1 144 ? 19.492  -14.176 45.635  1.00 29.50 ? 144 GLY A N   1 
ATOM   1098  C CA  . GLY A 1 144 ? 18.924  -12.813 45.599  1.00 29.21 ? 144 GLY A CA  1 
ATOM   1099  C C   . GLY A 1 144 ? 19.495  -11.920 44.505  1.00 29.37 ? 144 GLY A C   1 
ATOM   1100  O O   . GLY A 1 144 ? 18.760  -11.128 43.885  1.00 28.91 ? 144 GLY A O   1 
ATOM   1101  N N   . THR A 1 145 ? 20.804  -11.991 44.281  1.00 29.28 ? 145 THR A N   1 
ATOM   1102  C CA  . THR A 1 145 ? 21.374  -11.274 43.148  1.00 31.05 ? 145 THR A CA  1 
ATOM   1103  C C   . THR A 1 145 ? 20.805  -11.736 41.799  1.00 30.22 ? 145 THR A C   1 
ATOM   1104  O O   . THR A 1 145 ? 20.479  -10.905 40.965  1.00 30.33 ? 145 THR A O   1 
ATOM   1105  C CB  . THR A 1 145 ? 22.939  -11.226 43.137  1.00 30.89 ? 145 THR A CB  1 
ATOM   1106  O OG1 . THR A 1 145 ? 23.393  -10.444 42.020  1.00 34.31 ? 145 THR A OG1 1 
ATOM   1107  C CG2 . THR A 1 145 ? 23.544  -12.620 42.968  1.00 35.30 ? 145 THR A CG2 1 
ATOM   1108  N N   . LEU A 1 146 ? 20.703  -13.056 41.599  1.00 29.11 ? 146 LEU A N   1 
ATOM   1109  C CA  . LEU A 1 146 ? 20.263  -13.636 40.338  1.00 28.77 ? 146 LEU A CA  1 
ATOM   1110  C C   . LEU A 1 146 ? 18.812  -13.336 40.080  1.00 28.24 ? 146 LEU A C   1 
ATOM   1111  O O   . LEU A 1 146 ? 18.391  -13.150 38.932  1.00 27.49 ? 146 LEU A O   1 
ATOM   1112  C CB  . LEU A 1 146 ? 20.475  -15.167 40.343  1.00 28.56 ? 146 LEU A CB  1 
ATOM   1113  C CG  . LEU A 1 146 ? 21.900  -15.702 40.541  1.00 26.78 ? 146 LEU A CG  1 
ATOM   1114  C CD1 . LEU A 1 146 ? 21.906  -17.264 40.504  1.00 28.47 ? 146 LEU A CD1 1 
ATOM   1115  C CD2 . LEU A 1 146 ? 22.868  -15.171 39.528  1.00 24.35 ? 146 LEU A CD2 1 
ATOM   1116  N N   . GLN A 1 147 ? 18.038  -13.325 41.151  1.00 27.82 ? 147 GLN A N   1 
ATOM   1117  C CA  . GLN A 1 147 ? 16.617  -13.051 41.034  1.00 29.31 ? 147 GLN A CA  1 
ATOM   1118  C C   . GLN A 1 147 ? 16.374  -11.557 40.807  1.00 28.65 ? 147 GLN A C   1 
ATOM   1119  O O   . GLN A 1 147 ? 15.373  -11.166 40.214  1.00 28.65 ? 147 GLN A O   1 
ATOM   1120  C CB  . GLN A 1 147 ? 15.880  -13.567 42.259  1.00 28.83 ? 147 GLN A CB  1 
ATOM   1121  C CG  . GLN A 1 147 ? 15.789  -15.114 42.332  1.00 33.46 ? 147 GLN A CG  1 
ATOM   1122  C CD  . GLN A 1 147 ? 14.825  -15.758 41.290  1.00 38.15 ? 147 GLN A CD  1 
ATOM   1123  O OE1 . GLN A 1 147 ? 14.653  -15.255 40.160  1.00 40.19 ? 147 GLN A OE1 1 
ATOM   1124  N NE2 . GLN A 1 147 ? 14.212  -16.898 41.676  1.00 39.91 ? 147 GLN A NE2 1 
ATOM   1125  N N   . SER A 1 148 ? 17.310  -10.736 41.274  1.00 29.20 ? 148 SER A N   1 
ATOM   1126  C CA  . SER A 1 148 ? 17.226  -9.304  41.052  1.00 30.30 ? 148 SER A CA  1 
ATOM   1127  C C   . SER A 1 148 ? 17.625  -8.936  39.609  1.00 30.79 ? 148 SER A C   1 
ATOM   1128  O O   . SER A 1 148 ? 16.969  -8.096  38.976  1.00 32.12 ? 148 SER A O   1 
ATOM   1129  C CB  . SER A 1 148 ? 18.121  -8.565  42.027  1.00 29.57 ? 148 SER A CB  1 
ATOM   1130  O OG  . SER A 1 148 ? 18.077  -7.183  41.706  1.00 34.71 ? 148 SER A OG  1 
ATOM   1131  N N   . LEU A 1 149 ? 18.676  -9.581  39.100  1.00 29.73 ? 149 LEU A N   1 
ATOM   1132  C CA  . LEU A 1 149 ? 19.203  -9.318  37.743  1.00 29.94 ? 149 LEU A CA  1 
ATOM   1133  C C   . LEU A 1 149 ? 18.346  -9.849  36.610  1.00 30.88 ? 149 LEU A C   1 
ATOM   1134  O O   . LEU A 1 149 ? 18.284  -9.227  35.553  1.00 33.31 ? 149 LEU A O   1 
ATOM   1135  C CB  . LEU A 1 149 ? 20.643  -9.830  37.580  1.00 28.70 ? 149 LEU A CB  1 
ATOM   1136  C CG  . LEU A 1 149 ? 21.763  -9.197  38.401  1.00 25.56 ? 149 LEU A CG  1 
ATOM   1137  C CD1 . LEU A 1 149 ? 23.070  -10.014 38.272  1.00 24.84 ? 149 LEU A CD1 1 
ATOM   1138  C CD2 . LEU A 1 149 ? 22.016  -7.731  38.074  1.00 26.05 ? 149 LEU A CD2 1 
ATOM   1139  N N   . HIS A 1 150 ? 17.656  -10.963 36.836  1.00 31.56 ? 150 HIS A N   1 
ATOM   1140  C CA  . HIS A 1 150 ? 16.835  -11.632 35.807  1.00 32.11 ? 150 HIS A CA  1 
ATOM   1141  C C   . HIS A 1 150 ? 15.796  -10.717 35.141  1.00 31.72 ? 150 HIS A C   1 
ATOM   1142  O O   . HIS A 1 150 ? 15.792  -10.617 33.912  1.00 31.93 ? 150 HIS A O   1 
ATOM   1143  C CB  . HIS A 1 150 ? 16.174  -12.900 36.390  1.00 32.35 ? 150 HIS A CB  1 
ATOM   1144  C CG  . HIS A 1 150 ? 15.200  -13.579 35.473  1.00 34.30 ? 150 HIS A CG  1 
ATOM   1145  N ND1 . HIS A 1 150 ? 13.843  -13.619 35.733  1.00 37.07 ? 150 HIS A ND1 1 
ATOM   1146  C CD2 . HIS A 1 150 ? 15.382  -14.275 34.320  1.00 34.92 ? 150 HIS A CD2 1 
ATOM   1147  C CE1 . HIS A 1 150 ? 13.228  -14.283 34.766  1.00 37.00 ? 150 HIS A CE1 1 
ATOM   1148  N NE2 . HIS A 1 150 ? 14.141  -14.702 33.903  1.00 37.23 ? 150 HIS A NE2 1 
ATOM   1149  N N   . PRO A 1 151 ? 14.871  -10.091 35.927  1.00 30.90 ? 151 PRO A N   1 
ATOM   1150  C CA  . PRO A 1 151 ? 13.890  -9.248  35.199  1.00 29.95 ? 151 PRO A CA  1 
ATOM   1151  C C   . PRO A 1 151 ? 14.461  -8.011  34.511  1.00 29.79 ? 151 PRO A C   1 
ATOM   1152  O O   . PRO A 1 151 ? 13.753  -7.380  33.723  1.00 30.47 ? 151 PRO A O   1 
ATOM   1153  C CB  . PRO A 1 151 ? 12.866  -8.848  36.284  1.00 30.53 ? 151 PRO A CB  1 
ATOM   1154  C CG  . PRO A 1 151 ? 13.574  -9.062  37.608  1.00 29.30 ? 151 PRO A CG  1 
ATOM   1155  C CD  . PRO A 1 151 ? 14.601  -10.138 37.389  1.00 30.46 ? 151 PRO A CD  1 
ATOM   1156  N N   . LEU A 1 152 ? 15.714  -7.668  34.798  1.00 29.51 ? 152 LEU A N   1 
ATOM   1157  C CA  . LEU A 1 152 ? 16.421  -6.569  34.161  1.00 29.42 ? 152 LEU A CA  1 
ATOM   1158  C C   . LEU A 1 152 ? 16.890  -6.870  32.734  1.00 29.77 ? 152 LEU A C   1 
ATOM   1159  O O   . LEU A 1 152 ? 17.315  -5.955  32.030  1.00 30.72 ? 152 LEU A O   1 
ATOM   1160  C CB  . LEU A 1 152 ? 17.600  -6.097  35.032  1.00 28.54 ? 152 LEU A CB  1 
ATOM   1161  C CG  . LEU A 1 152 ? 17.352  -5.012  36.114  1.00 31.26 ? 152 LEU A CG  1 
ATOM   1162  C CD1 . LEU A 1 152 ? 15.963  -4.970  36.670  1.00 30.93 ? 152 LEU A CD1 1 
ATOM   1163  C CD2 . LEU A 1 152 ? 18.386  -4.977  37.256  1.00 27.75 ? 152 LEU A CD2 1 
ATOM   1164  N N   . GLY A 1 153 ? 16.803  -8.134  32.299  1.00 30.30 ? 153 GLY A N   1 
ATOM   1165  C CA  . GLY A 1 153 ? 17.219  -8.516  30.930  1.00 30.07 ? 153 GLY A CA  1 
ATOM   1166  C C   . GLY A 1 153 ? 18.695  -8.356  30.573  1.00 30.76 ? 153 GLY A C   1 
ATOM   1167  O O   . GLY A 1 153 ? 19.060  -8.287  29.410  1.00 30.88 ? 153 GLY A O   1 
ATOM   1168  N N   . CYS A 1 154 ? 19.579  -8.291  31.552  1.00 30.97 ? 154 CYS A N   1 
ATOM   1169  C CA  . CYS A 1 154 ? 20.989  -8.360  31.200  1.00 31.13 ? 154 CYS A CA  1 
ATOM   1170  C C   . CYS A 1 154 ? 21.362  -9.794  30.758  1.00 31.20 ? 154 CYS A C   1 
ATOM   1171  O O   . CYS A 1 154 ? 20.661  -10.758 31.081  1.00 31.12 ? 154 CYS A O   1 
ATOM   1172  C CB  . CYS A 1 154 ? 21.883  -7.902  32.336  1.00 31.18 ? 154 CYS A CB  1 
ATOM   1173  S SG  . CYS A 1 154 ? 21.360  -8.492  33.926  1.00 31.30 ? 154 CYS A SG  1 
ATOM   1174  N N   . ASN A 1 155 ? 22.448  -9.908  29.995  1.00 32.04 ? 155 ASN A N   1 
ATOM   1175  C CA  . ASN A 1 155 ? 23.080  -11.202 29.759  1.00 33.46 ? 155 ASN A CA  1 
ATOM   1176  C C   . ASN A 1 155 ? 24.115  -11.384 30.817  1.00 32.57 ? 155 ASN A C   1 
ATOM   1177  O O   . ASN A 1 155 ? 25.007  -10.569 30.953  1.00 33.75 ? 155 ASN A O   1 
ATOM   1178  C CB  . ASN A 1 155 ? 23.713  -11.259 28.376  1.00 34.90 ? 155 ASN A CB  1 
ATOM   1179  C CG  . ASN A 1 155 ? 22.700  -11.081 27.296  1.00 36.58 ? 155 ASN A CG  1 
ATOM   1180  O OD1 . ASN A 1 155 ? 21.641  -11.724 27.320  1.00 40.45 ? 155 ASN A OD1 1 
ATOM   1181  N ND2 . ASN A 1 155 ? 22.981  -10.185 26.356  1.00 40.18 ? 155 ASN A ND2 1 
ATOM   1182  N N   . ILE A 1 156 ? 23.967  -12.427 31.611  1.00 32.85 ? 156 ILE A N   1 
ATOM   1183  C CA  . ILE A 1 156 ? 24.967  -12.700 32.636  1.00 33.19 ? 156 ILE A CA  1 
ATOM   1184  C C   . ILE A 1 156 ? 26.072  -13.564 32.062  1.00 33.11 ? 156 ILE A C   1 
ATOM   1185  O O   . ILE A 1 156 ? 25.809  -14.637 31.530  1.00 34.94 ? 156 ILE A O   1 
ATOM   1186  C CB  . ILE A 1 156 ? 24.335  -13.368 33.872  1.00 32.89 ? 156 ILE A CB  1 
ATOM   1187  C CG1 . ILE A 1 156 ? 23.433  -12.352 34.575  1.00 32.31 ? 156 ILE A CG1 1 
ATOM   1188  C CG2 . ILE A 1 156 ? 25.424  -13.698 34.845  1.00 33.73 ? 156 ILE A CG2 1 
ATOM   1189  C CD1 . ILE A 1 156 ? 22.316  -12.989 35.411  1.00 33.66 ? 156 ILE A CD1 1 
ATOM   1190  N N   . ILE A 1 157 ? 27.294  -13.080 32.129  1.00 33.35 ? 157 ILE A N   1 
ATOM   1191  C CA  . ILE A 1 157 ? 28.409  -13.836 31.618  1.00 33.01 ? 157 ILE A CA  1 
ATOM   1192  C C   . ILE A 1 157 ? 29.168  -14.447 32.792  1.00 32.77 ? 157 ILE A C   1 
ATOM   1193  O O   . ILE A 1 157 ? 29.834  -13.735 33.552  1.00 32.32 ? 157 ILE A O   1 
ATOM   1194  C CB  . ILE A 1 157 ? 29.305  -12.940 30.744  1.00 33.60 ? 157 ILE A CB  1 
ATOM   1195  C CG1 . ILE A 1 157 ? 28.514  -12.551 29.479  1.00 32.27 ? 157 ILE A CG1 1 
ATOM   1196  C CG2 . ILE A 1 157 ? 30.601  -13.673 30.391  1.00 32.86 ? 157 ILE A CG2 1 
ATOM   1197  C CD1 . ILE A 1 157 ? 29.228  -11.540 28.591  1.00 36.15 ? 157 ILE A CD1 1 
ATOM   1198  N N   . ASN A 1 158 ? 29.056  -15.762 32.935  1.00 32.41 ? 158 ASN A N   1 
ATOM   1199  C CA  . ASN A 1 158 ? 29.695  -16.441 34.041  1.00 32.00 ? 158 ASN A CA  1 
ATOM   1200  C C   . ASN A 1 158 ? 31.206  -16.422 33.940  1.00 32.22 ? 158 ASN A C   1 
ATOM   1201  O O   . ASN A 1 158 ? 31.785  -16.730 32.882  1.00 33.74 ? 158 ASN A O   1 
ATOM   1202  C CB  . ASN A 1 158 ? 29.153  -17.861 34.245  1.00 32.33 ? 158 ASN A CB  1 
ATOM   1203  C CG  . ASN A 1 158 ? 29.870  -18.594 35.385  1.00 31.99 ? 158 ASN A CG  1 
ATOM   1204  O OD1 . ASN A 1 158 ? 30.162  -18.011 36.429  1.00 31.87 ? 158 ASN A OD1 1 
ATOM   1205  N ND2 . ASN A 1 158 ? 30.194  -19.846 35.164  1.00 31.71 ? 158 ASN A ND2 1 
ATOM   1206  N N   . VAL A 1 159 ? 31.844  -16.020 35.031  1.00 31.49 ? 159 VAL A N   1 
ATOM   1207  C CA  . VAL A 1 159 ? 33.303  -16.010 35.124  1.00 31.61 ? 159 VAL A CA  1 
ATOM   1208  C C   . VAL A 1 159 ? 33.637  -17.212 35.986  1.00 32.26 ? 159 VAL A C   1 
ATOM   1209  O O   . VAL A 1 159 ? 32.899  -17.517 36.936  1.00 31.18 ? 159 VAL A O   1 
ATOM   1210  C CB  . VAL A 1 159 ? 33.843  -14.718 35.742  1.00 32.07 ? 159 VAL A CB  1 
ATOM   1211  C CG1 . VAL A 1 159 ? 35.372  -14.726 35.799  1.00 32.58 ? 159 VAL A CG1 1 
ATOM   1212  C CG2 . VAL A 1 159 ? 33.341  -13.511 34.952  1.00 31.23 ? 159 VAL A CG2 1 
ATOM   1213  N N   . ALA A 1 160 ? 34.717  -17.911 35.634  1.00 32.53 ? 160 ALA A N   1 
ATOM   1214  C CA  . ALA A 1 160 ? 35.114  -19.118 36.349  1.00 33.08 ? 160 ALA A CA  1 
ATOM   1215  C C   . ALA A 1 160 ? 35.722  -18.779 37.709  1.00 33.07 ? 160 ALA A C   1 
ATOM   1216  O O   . ALA A 1 160 ? 36.421  -17.759 37.891  1.00 33.75 ? 160 ALA A O   1 
ATOM   1217  C CB  . ALA A 1 160 ? 36.092  -19.961 35.500  1.00 33.02 ? 160 ALA A CB  1 
ATOM   1218  N N   . SER A 1 161 ? 35.461  -19.659 38.664  1.00 33.24 ? 161 SER A N   1 
ATOM   1219  C CA  . SER A 1 161 ? 35.841  -19.428 40.039  1.00 33.01 ? 161 SER A CA  1 
ATOM   1220  C C   . SER A 1 161 ? 36.357  -20.733 40.640  1.00 32.57 ? 161 SER A C   1 
ATOM   1221  O O   . SER A 1 161 ? 36.016  -21.794 40.159  1.00 31.84 ? 161 SER A O   1 
ATOM   1222  C CB  . SER A 1 161 ? 34.641  -18.908 40.855  1.00 33.09 ? 161 SER A CB  1 
ATOM   1223  O OG  . SER A 1 161 ? 33.563  -19.831 40.857  1.00 34.14 ? 161 SER A OG  1 
ATOM   1224  N N   . ASP A 1 162 ? 37.167  -20.644 41.692  1.00 32.51 ? 162 ASP A N   1 
ATOM   1225  C CA  . ASP A 1 162 ? 37.600  -21.854 42.407  1.00 33.00 ? 162 ASP A CA  1 
ATOM   1226  C C   . ASP A 1 162 ? 37.729  -21.522 43.897  1.00 32.91 ? 162 ASP A C   1 
ATOM   1227  O O   . ASP A 1 162 ? 37.173  -20.521 44.341  1.00 33.12 ? 162 ASP A O   1 
ATOM   1228  C CB  . ASP A 1 162 ? 38.937  -22.354 41.828  1.00 32.09 ? 162 ASP A CB  1 
ATOM   1229  C CG  . ASP A 1 162 ? 40.052  -21.352 41.990  1.00 32.07 ? 162 ASP A CG  1 
ATOM   1230  O OD1 . ASP A 1 162 ? 39.916  -20.426 42.816  1.00 33.45 ? 162 ASP A OD1 1 
ATOM   1231  O OD2 . ASP A 1 162 ? 41.079  -21.447 41.281  1.00 32.22 ? 162 ASP A OD2 1 
ATOM   1232  N N   . GLU A 1 163 ? 38.523  -22.297 44.637  1.00 33.45 ? 163 GLU A N   1 
ATOM   1233  C CA  . GLU A 1 163 ? 38.679  -22.129 46.086  1.00 33.85 ? 163 GLU A CA  1 
ATOM   1234  C C   . GLU A 1 163 ? 39.042  -20.715 46.471  1.00 33.40 ? 163 GLU A C   1 
ATOM   1235  O O   . GLU A 1 163 ? 38.881  -20.342 47.619  1.00 33.41 ? 163 GLU A O   1 
ATOM   1236  C CB  . GLU A 1 163 ? 39.811  -23.011 46.665  1.00 34.45 ? 163 GLU A CB  1 
ATOM   1237  C CG  . GLU A 1 163 ? 39.763  -24.442 46.302  1.00 38.28 ? 163 GLU A CG  1 
ATOM   1238  C CD  . GLU A 1 163 ? 40.630  -24.793 45.100  1.00 42.02 ? 163 GLU A CD  1 
ATOM   1239  O OE1 . GLU A 1 163 ? 40.188  -24.566 43.938  1.00 41.06 ? 163 GLU A OE1 1 
ATOM   1240  O OE2 . GLU A 1 163 ? 41.734  -25.340 45.333  1.00 43.61 ? 163 GLU A OE2 1 
ATOM   1241  N N   . SER A 1 164 ? 39.611  -19.966 45.530  1.00 33.41 ? 164 SER A N   1 
ATOM   1242  C CA  . SER A 1 164 ? 40.100  -18.616 45.822  1.00 33.56 ? 164 SER A CA  1 
ATOM   1243  C C   . SER A 1 164 ? 39.321  -17.534 45.108  1.00 32.19 ? 164 SER A C   1 
ATOM   1244  O O   . SER A 1 164 ? 39.814  -16.437 44.918  1.00 32.28 ? 164 SER A O   1 
ATOM   1245  C CB  . SER A 1 164 ? 41.604  -18.524 45.540  1.00 33.89 ? 164 SER A CB  1 
ATOM   1246  O OG  . SER A 1 164 ? 42.267  -19.361 46.463  1.00 35.62 ? 164 SER A OG  1 
ATOM   1247  N N   . GLY A 1 165 ? 38.088  -17.864 44.726  1.00 32.32 ? 165 GLY A N   1 
ATOM   1248  C CA  . GLY A 1 165 ? 37.165  -16.892 44.171  1.00 31.60 ? 165 GLY A CA  1 
ATOM   1249  C C   . GLY A 1 165 ? 37.308  -16.840 42.674  1.00 31.90 ? 165 GLY A C   1 
ATOM   1250  O O   . GLY A 1 165 ? 37.776  -17.803 42.037  1.00 30.73 ? 165 GLY A O   1 
ATOM   1251  N N   . ILE A 1 166 ? 36.914  -15.714 42.089  1.00 30.80 ? 166 ILE A N   1 
ATOM   1252  C CA  . ILE A 1 166 ? 37.027  -15.594 40.657  1.00 31.12 ? 166 ILE A CA  1 
ATOM   1253  C C   . ILE A 1 166 ? 38.470  -15.846 40.158  1.00 30.98 ? 166 ILE A C   1 
ATOM   1254  O O   . ILE A 1 166 ? 39.454  -15.427 40.787  1.00 30.24 ? 166 ILE A O   1 
ATOM   1255  C CB  . ILE A 1 166 ? 36.385  -14.258 40.076  1.00 31.56 ? 166 ILE A CB  1 
ATOM   1256  C CG1 . ILE A 1 166 ? 37.413  -13.208 39.764  1.00 30.84 ? 166 ILE A CG1 1 
ATOM   1257  C CG2 . ILE A 1 166 ? 35.264  -13.731 40.928  1.00 32.37 ? 166 ILE A CG2 1 
ATOM   1258  C CD1 . ILE A 1 166 ? 37.700  -13.138 38.341  1.00 31.57 ? 166 ILE A CD1 1 
ATOM   1259  N N   . VAL A 1 167 ? 38.572  -16.537 39.027  1.00 31.42 ? 167 VAL A N   1 
ATOM   1260  C CA  . VAL A 1 167 ? 39.877  -16.807 38.432  1.00 32.42 ? 167 VAL A CA  1 
ATOM   1261  C C   . VAL A 1 167 ? 40.142  -15.725 37.374  1.00 32.25 ? 167 VAL A C   1 
ATOM   1262  O O   . VAL A 1 167 ? 39.432  -15.654 36.352  1.00 32.84 ? 167 VAL A O   1 
ATOM   1263  C CB  . VAL A 1 167 ? 39.973  -18.228 37.795  1.00 32.27 ? 167 VAL A CB  1 
ATOM   1264  C CG1 . VAL A 1 167 ? 41.405  -18.494 37.322  1.00 34.31 ? 167 VAL A CG1 1 
ATOM   1265  C CG2 . VAL A 1 167 ? 39.532  -19.307 38.783  1.00 32.64 ? 167 VAL A CG2 1 
ATOM   1266  N N   . PRO A 1 168 ? 41.160  -14.892 37.618  1.00 32.35 ? 168 PRO A N   1 
ATOM   1267  C CA  . PRO A 1 168 ? 41.430  -13.743 36.774  1.00 33.61 ? 168 PRO A CA  1 
ATOM   1268  C C   . PRO A 1 168 ? 41.812  -14.094 35.356  1.00 34.85 ? 168 PRO A C   1 
ATOM   1269  O O   . PRO A 1 168 ? 41.589  -13.278 34.474  1.00 35.32 ? 168 PRO A O   1 
ATOM   1270  C CB  . PRO A 1 168 ? 42.584  -13.049 37.474  1.00 32.74 ? 168 PRO A CB  1 
ATOM   1271  C CG  . PRO A 1 168 ? 42.520  -13.528 38.889  1.00 32.39 ? 168 PRO A CG  1 
ATOM   1272  C CD  . PRO A 1 168 ? 42.105  -14.963 38.744  1.00 32.07 ? 168 PRO A CD  1 
ATOM   1273  N N   . ASP A 1 169 ? 42.370  -15.284 35.129  1.00 35.48 ? 169 ASP A N   1 
ATOM   1274  C CA  . ASP A 1 169 ? 42.645  -15.709 33.758  1.00 36.75 ? 169 ASP A CA  1 
ATOM   1275  C C   . ASP A 1 169 ? 41.349  -16.007 32.984  1.00 36.41 ? 169 ASP A C   1 
ATOM   1276  O O   . ASP A 1 169 ? 41.262  -15.763 31.762  1.00 36.32 ? 169 ASP A O   1 
ATOM   1277  C CB  . ASP A 1 169 ? 43.672  -16.847 33.722  1.00 37.17 ? 169 ASP A CB  1 
ATOM   1278  C CG  . ASP A 1 169 ? 45.090  -16.354 34.031  1.00 41.87 ? 169 ASP A CG  1 
ATOM   1279  O OD1 . ASP A 1 169 ? 45.352  -15.140 33.868  1.00 47.32 ? 169 ASP A OD1 1 
ATOM   1280  O OD2 . ASP A 1 169 ? 45.962  -17.159 34.434  1.00 48.04 ? 169 ASP A OD2 1 
ATOM   1281  N N   . SER A 1 170 ? 40.336  -16.498 33.693  1.00 35.20 ? 170 SER A N   1 
ATOM   1282  C CA  . SER A 1 170 ? 39.028  -16.703 33.100  1.00 35.52 ? 170 SER A CA  1 
ATOM   1283  C C   . SER A 1 170 ? 38.416  -15.362 32.690  1.00 35.55 ? 170 SER A C   1 
ATOM   1284  O O   . SER A 1 170 ? 37.869  -15.236 31.581  1.00 36.26 ? 170 SER A O   1 
ATOM   1285  C CB  . SER A 1 170 ? 38.095  -17.397 34.087  1.00 35.30 ? 170 SER A CB  1 
ATOM   1286  O OG  . SER A 1 170 ? 36.800  -17.565 33.523  1.00 34.53 ? 170 SER A OG  1 
ATOM   1287  N N   . LEU A 1 171 ? 38.491  -14.392 33.607  1.00 35.72 ? 171 LEU A N   1 
ATOM   1288  C CA  . LEU A 1 171 ? 38.053  -13.006 33.365  1.00 36.54 ? 171 LEU A CA  1 
ATOM   1289  C C   . LEU A 1 171 ? 38.726  -12.415 32.094  1.00 37.04 ? 171 LEU A C   1 
ATOM   1290  O O   . LEU A 1 171 ? 38.042  -11.975 31.164  1.00 37.24 ? 171 LEU A O   1 
ATOM   1291  C CB  . LEU A 1 171 ? 38.329  -12.111 34.597  1.00 34.41 ? 171 LEU A CB  1 
ATOM   1292  C CG  . LEU A 1 171 ? 37.661  -10.710 34.575  1.00 34.30 ? 171 LEU A CG  1 
ATOM   1293  C CD1 . LEU A 1 171 ? 36.197  -10.805 34.236  1.00 31.05 ? 171 LEU A CD1 1 
ATOM   1294  C CD2 . LEU A 1 171 ? 37.856  -9.963  35.886  1.00 34.51 ? 171 LEU A CD2 1 
ATOM   1295  N N   . ARG A 1 172 ? 40.059  -12.420 32.097  1.00 38.47 ? 172 ARG A N   1 
ATOM   1296  C CA  . ARG A 1 172 ? 40.899  -12.069 30.941  1.00 40.02 ? 172 ARG A CA  1 
ATOM   1297  C C   . ARG A 1 172 ? 40.395  -12.637 29.628  1.00 40.27 ? 172 ARG A C   1 
ATOM   1298  O O   . ARG A 1 172 ? 40.154  -11.891 28.681  1.00 40.65 ? 172 ARG A O   1 
ATOM   1299  C CB  . ARG A 1 172 ? 42.329  -12.510 31.185  1.00 40.50 ? 172 ARG A CB  1 
ATOM   1300  C CG  . ARG A 1 172 ? 43.358  -11.814 30.319  1.00 43.76 ? 172 ARG A CG  1 
ATOM   1301  C CD  . ARG A 1 172 ? 44.768  -11.978 30.871  1.00 48.15 ? 172 ARG A CD  1 
ATOM   1302  N NE  . ARG A 1 172 ? 45.057  -11.006 31.937  1.00 52.11 ? 172 ARG A NE  1 
ATOM   1303  C CZ  . ARG A 1 172 ? 45.095  -11.295 33.242  1.00 52.24 ? 172 ARG A CZ  1 
ATOM   1304  N NH1 . ARG A 1 172 ? 44.886  -12.536 33.668  1.00 52.73 ? 172 ARG A NH1 1 
ATOM   1305  N NH2 . ARG A 1 172 ? 45.360  -10.344 34.127  1.00 50.86 ? 172 ARG A NH2 1 
ATOM   1306  N N   . ASP A 1 173 ? 40.196  -13.953 29.579  1.00 40.52 ? 173 ASP A N   1 
ATOM   1307  C CA  . ASP A 1 173 ? 39.811  -14.615 28.349  1.00 40.63 ? 173 ASP A CA  1 
ATOM   1308  C C   . ASP A 1 173 ? 38.357  -14.358 27.914  1.00 40.07 ? 173 ASP A C   1 
ATOM   1309  O O   . ASP A 1 173 ? 38.016  -14.408 26.707  1.00 39.29 ? 173 ASP A O   1 
ATOM   1310  C CB  . ASP A 1 173 ? 40.172  -16.097 28.424  1.00 41.21 ? 173 ASP A CB  1 
ATOM   1311  C CG  . ASP A 1 173 ? 41.681  -16.307 28.473  1.00 43.19 ? 173 ASP A CG  1 
ATOM   1312  O OD1 . ASP A 1 173 ? 42.162  -16.847 29.480  1.00 43.45 ? 173 ASP A OD1 1 
ATOM   1313  O OD2 . ASP A 1 173 ? 42.397  -15.910 27.517  1.00 45.54 ? 173 ASP A OD2 1 
ATOM   1314  N N   . ILE A 1 174 ? 37.498  -14.080 28.894  1.00 39.00 ? 174 ILE A N   1 
ATOM   1315  C CA  . ILE A 1 174 ? 36.157  -13.595 28.583  1.00 37.93 ? 174 ILE A CA  1 
ATOM   1316  C C   . ILE A 1 174 ? 36.290  -12.209 27.912  1.00 36.96 ? 174 ILE A C   1 
ATOM   1317  O O   . ILE A 1 174 ? 35.684  -11.966 26.876  1.00 37.15 ? 174 ILE A O   1 
ATOM   1318  C CB  . ILE A 1 174 ? 35.237  -13.596 29.863  1.00 37.85 ? 174 ILE A CB  1 
ATOM   1319  C CG1 . ILE A 1 174 ? 34.852  -15.039 30.230  1.00 38.34 ? 174 ILE A CG1 1 
ATOM   1320  C CG2 . ILE A 1 174 ? 33.979  -12.776 29.634  1.00 38.16 ? 174 ILE A CG2 1 
ATOM   1321  C CD1 . ILE A 1 174 ? 34.490  -15.241 31.682  1.00 35.73 ? 174 ILE A CD1 1 
ATOM   1322  N N   . LEU A 1 175 ? 37.144  -11.350 28.463  1.00 35.89 ? 175 LEU A N   1 
ATOM   1323  C CA  . LEU A 1 175 ? 37.191  -9.950  28.066  1.00 36.78 ? 175 LEU A CA  1 
ATOM   1324  C C   . LEU A 1 175 ? 37.877  -9.708  26.733  1.00 38.11 ? 175 LEU A C   1 
ATOM   1325  O O   . LEU A 1 175 ? 37.738  -8.638  26.179  1.00 38.06 ? 175 LEU A O   1 
ATOM   1326  C CB  . LEU A 1 175 ? 37.856  -9.096  29.158  1.00 35.99 ? 175 LEU A CB  1 
ATOM   1327  C CG  . LEU A 1 175 ? 37.030  -8.934  30.456  1.00 34.05 ? 175 LEU A CG  1 
ATOM   1328  C CD1 . LEU A 1 175 ? 37.936  -8.518  31.577  1.00 32.09 ? 175 LEU A CD1 1 
ATOM   1329  C CD2 . LEU A 1 175 ? 35.895  -7.943  30.275  1.00 32.51 ? 175 LEU A CD2 1 
ATOM   1330  N N   . SER A 1 176 ? 38.622  -10.702 26.225  1.00 40.05 ? 176 SER A N   1 
ATOM   1331  C CA  . SER A 1 176 ? 39.253  -10.623 24.894  1.00 40.92 ? 176 SER A CA  1 
ATOM   1332  C C   . SER A 1 176 ? 38.262  -10.783 23.726  1.00 41.89 ? 176 SER A C   1 
ATOM   1333  O O   . SER A 1 176 ? 38.631  -10.619 22.562  1.00 42.14 ? 176 SER A O   1 
ATOM   1334  C CB  . SER A 1 176 ? 40.394  -11.635 24.792  1.00 41.35 ? 176 SER A CB  1 
ATOM   1335  O OG  . SER A 1 176 ? 39.906  -12.947 24.943  1.00 41.18 ? 176 SER A OG  1 
ATOM   1336  N N   . ARG A 1 177 ? 37.022  -11.134 24.051  1.00 42.74 ? 177 ARG A N   1 
ATOM   1337  C CA  . ARG A 1 177 ? 35.857  -10.958 23.194  1.00 44.33 ? 177 ARG A CA  1 
ATOM   1338  C C   . ARG A 1 177 ? 35.689  -9.477  22.713  1.00 45.60 ? 177 ARG A C   1 
ATOM   1339  O O   . ARG A 1 177 ? 34.925  -9.200  21.769  1.00 45.71 ? 177 ARG A O   1 
ATOM   1340  C CB  . ARG A 1 177 ? 34.638  -11.370 24.007  1.00 44.72 ? 177 ARG A CB  1 
ATOM   1341  C CG  . ARG A 1 177 ? 33.384  -11.681 23.236  1.00 47.06 ? 177 ARG A CG  1 
ATOM   1342  C CD  . ARG A 1 177 ? 32.185  -11.246 24.073  1.00 50.57 ? 177 ARG A CD  1 
ATOM   1343  N NE  . ARG A 1 177 ? 31.369  -12.321 24.661  1.00 51.01 ? 177 ARG A NE  1 
ATOM   1344  C CZ  . ARG A 1 177 ? 31.783  -13.232 25.546  1.00 50.93 ? 177 ARG A CZ  1 
ATOM   1345  N NH1 . ARG A 1 177 ? 33.044  -13.279 25.973  1.00 49.86 ? 177 ARG A NH1 1 
ATOM   1346  N NH2 . ARG A 1 177 ? 30.919  -14.127 25.989  1.00 51.01 ? 177 ARG A NH2 1 
ATOM   1347  N N   . TRP A 1 178 ? 36.381  -8.560  23.394  1.00 45.91 ? 178 TRP A N   1 
ATOM   1348  C CA  . TRP A 1 178 ? 36.394  -7.141  23.067  1.00 46.71 ? 178 TRP A CA  1 
ATOM   1349  C C   . TRP A 1 178 ? 37.843  -6.690  23.130  1.00 48.45 ? 178 TRP A C   1 
ATOM   1350  O O   . TRP A 1 178 ? 38.705  -7.449  23.522  1.00 49.97 ? 178 TRP A O   1 
ATOM   1351  C CB  . TRP A 1 178 ? 35.594  -6.329  24.104  1.00 46.23 ? 178 TRP A CB  1 
ATOM   1352  C CG  . TRP A 1 178 ? 34.157  -6.723  24.303  1.00 43.46 ? 178 TRP A CG  1 
ATOM   1353  C CD1 . TRP A 1 178 ? 33.093  -6.308  23.574  1.00 42.14 ? 178 TRP A CD1 1 
ATOM   1354  C CD2 . TRP A 1 178 ? 33.626  -7.586  25.322  1.00 42.13 ? 178 TRP A CD2 1 
ATOM   1355  N NE1 . TRP A 1 178 ? 31.939  -6.873  24.054  1.00 40.85 ? 178 TRP A NE1 1 
ATOM   1356  C CE2 . TRP A 1 178 ? 32.243  -7.662  25.128  1.00 39.79 ? 178 TRP A CE2 1 
ATOM   1357  C CE3 . TRP A 1 178 ? 34.187  -8.314  26.376  1.00 39.06 ? 178 TRP A CE3 1 
ATOM   1358  C CZ2 . TRP A 1 178 ? 31.422  -8.426  25.934  1.00 38.87 ? 178 TRP A CZ2 1 
ATOM   1359  C CZ3 . TRP A 1 178 ? 33.369  -9.062  27.167  1.00 36.97 ? 178 TRP A CZ3 1 
ATOM   1360  C CH2 . TRP A 1 178 ? 32.005  -9.113  26.949  1.00 38.25 ? 178 TRP A CH2 1 
ATOM   1361  N N   . LYS A 1 179 ? 38.119  -5.484  22.675  1.00 50.79 ? 179 LYS A N   1 
ATOM   1362  C CA  . LYS A 1 179 ? 39.279  -4.769  23.161  1.00 51.77 ? 179 LYS A CA  1 
ATOM   1363  C C   . LYS A 1 179 ? 38.750  -3.605  23.931  1.00 52.65 ? 179 LYS A C   1 
ATOM   1364  O O   . LYS A 1 179 ? 37.556  -3.346  23.936  1.00 52.56 ? 179 LYS A O   1 
ATOM   1365  C CB  . LYS A 1 179 ? 40.227  -4.412  22.027  1.00 52.69 ? 179 LYS A CB  1 
ATOM   1366  C CG  . LYS A 1 179 ? 40.163  -2.976  21.562  1.00 53.78 ? 179 LYS A CG  1 
ATOM   1367  C CD  . LYS A 1 179 ? 40.602  -2.846  20.112  1.00 56.98 ? 179 LYS A CD  1 
ATOM   1368  C CE  . LYS A 1 179 ? 41.942  -3.523  19.860  1.00 57.30 ? 179 LYS A CE  1 
ATOM   1369  N NZ  . LYS A 1 179 ? 42.198  -3.751  18.404  1.00 56.13 ? 179 LYS A NZ  1 
ATOM   1370  N N   . PRO A 1 180 ? 39.649  -2.909  24.590  1.00 53.94 ? 180 PRO A N   1 
ATOM   1371  C CA  . PRO A 1 180 ? 39.272  -1.799  25.462  1.00 55.08 ? 180 PRO A CA  1 
ATOM   1372  C C   . PRO A 1 180 ? 38.227  -0.941  24.771  1.00 55.98 ? 180 PRO A C   1 
ATOM   1373  O O   . PRO A 1 180 ? 37.138  -0.721  25.298  1.00 56.36 ? 180 PRO A O   1 
ATOM   1374  C CB  . PRO A 1 180 ? 40.582  -1.053  25.570  1.00 55.38 ? 180 PRO A CB  1 
ATOM   1375  C CG  . PRO A 1 180 ? 41.592  -2.149  25.590  1.00 55.05 ? 180 PRO A CG  1 
ATOM   1376  C CD  . PRO A 1 180 ? 41.082  -3.236  24.710  1.00 53.70 ? 180 PRO A CD  1 
ATOM   1377  N N   . GLU A 1 181 ? 38.570  -0.459  23.589  1.00 56.09 ? 181 GLU A N   1 
ATOM   1378  C CA  . GLU A 1 181 ? 38.235  0.887   23.196  1.00 56.67 ? 181 GLU A CA  1 
ATOM   1379  C C   . GLU A 1 181 ? 36.783  0.887   22.798  1.00 56.34 ? 181 GLU A C   1 
ATOM   1380  O O   . GLU A 1 181 ? 36.080  1.864   22.972  1.00 56.67 ? 181 GLU A O   1 
ATOM   1381  C CB  . GLU A 1 181 ? 39.081  1.289   21.995  1.00 57.13 ? 181 GLU A CB  1 
ATOM   1382  C CG  . GLU A 1 181 ? 40.570  1.183   22.243  1.00 59.11 ? 181 GLU A CG  1 
ATOM   1383  C CD  . GLU A 1 181 ? 41.253  0.258   21.266  1.00 61.48 ? 181 GLU A CD  1 
ATOM   1384  O OE1 . GLU A 1 181 ? 41.434  -0.936  21.591  1.00 61.43 ? 181 GLU A OE1 1 
ATOM   1385  O OE2 . GLU A 1 181 ? 41.615  0.729   20.174  1.00 62.89 ? 181 GLU A OE2 1 
ATOM   1386  N N   . ASP A 1 182 ? 36.360  -0.197  22.173  1.00 55.40 ? 182 ASP A N   1 
ATOM   1387  C CA  . ASP A 1 182 ? 35.257  -0.995  22.641  1.00 55.17 ? 182 ASP A CA  1 
ATOM   1388  C C   . ASP A 1 182 ? 34.396  -0.356  23.734  1.00 54.28 ? 182 ASP A C   1 
ATOM   1389  O O   . ASP A 1 182 ? 33.180  -0.362  23.642  1.00 54.38 ? 182 ASP A O   1 
ATOM   1390  C CB  . ASP A 1 182 ? 35.754  -2.387  23.026  1.00 55.30 ? 182 ASP A CB  1 
ATOM   1391  C CG  . ASP A 1 182 ? 36.370  -3.126  21.850  1.00 56.78 ? 182 ASP A CG  1 
ATOM   1392  O OD1 . ASP A 1 182 ? 37.025  -2.473  21.017  1.00 57.78 ? 182 ASP A OD1 1 
ATOM   1393  O OD2 . ASP A 1 182 ? 36.247  -4.352  21.677  1.00 57.80 ? 182 ASP A OD2 1 
ATOM   1394  N N   . ALA A 1 183 ? 35.030  0.187   24.758  1.00 53.74 ? 183 ALA A N   1 
ATOM   1395  C CA  . ALA A 1 183 ? 34.332  0.585   25.974  1.00 53.74 ? 183 ALA A CA  1 
ATOM   1396  C C   . ALA A 1 183 ? 33.994  2.067   25.975  1.00 53.55 ? 183 ALA A C   1 
ATOM   1397  O O   . ALA A 1 183 ? 32.847  2.446   26.172  1.00 53.53 ? 183 ALA A O   1 
ATOM   1398  C CB  . ALA A 1 183 ? 35.162  0.247   27.177  1.00 53.48 ? 183 ALA A CB  1 
ATOM   1399  N N   . LYS A 1 184 ? 35.013  2.896   25.758  1.00 53.17 ? 184 LYS A N   1 
ATOM   1400  C CA  . LYS A 1 184 ? 34.824  4.247   25.239  1.00 52.65 ? 184 LYS A CA  1 
ATOM   1401  C C   . LYS A 1 184 ? 33.855  4.283   24.085  1.00 51.43 ? 184 LYS A C   1 
ATOM   1402  O O   . LYS A 1 184 ? 33.557  5.329   23.547  1.00 50.81 ? 184 LYS A O   1 
ATOM   1403  C CB  . LYS A 1 184 ? 36.155  4.870   24.834  1.00 52.98 ? 184 LYS A CB  1 
ATOM   1404  C CG  . LYS A 1 184 ? 37.112  5.093   25.994  1.00 54.28 ? 184 LYS A CG  1 
ATOM   1405  C CD  . LYS A 1 184 ? 37.716  3.772   26.484  1.00 54.69 ? 184 LYS A CD  1 
ATOM   1406  C CE  . LYS A 1 184 ? 37.640  3.651   27.996  1.00 53.42 ? 184 LYS A CE  1 
ATOM   1407  N NZ  . LYS A 1 184 ? 36.313  4.079   28.526  1.00 52.38 ? 184 LYS A NZ  1 
ATOM   1408  N N   . ASN A 1 185 ? 33.359  3.121   23.714  1.00 50.67 ? 185 ASN A N   1 
ATOM   1409  C CA  . ASN A 1 185 ? 32.581  2.998   22.504  1.00 50.46 ? 185 ASN A CA  1 
ATOM   1410  C C   . ASN A 1 185 ? 31.363  2.156   22.774  1.00 50.31 ? 185 ASN A C   1 
ATOM   1411  O O   . ASN A 1 185 ? 31.443  0.941   22.897  1.00 50.19 ? 185 ASN A O   1 
ATOM   1412  C CB  . ASN A 1 185 ? 33.442  2.378   21.397  1.00 50.18 ? 185 ASN A CB  1 
ATOM   1413  C CG  . ASN A 1 185 ? 32.796  2.444   20.023  1.00 48.89 ? 185 ASN A CG  1 
ATOM   1414  O OD1 . ASN A 1 185 ? 33.150  1.677   19.146  1.00 44.84 ? 185 ASN A OD1 1 
ATOM   1415  N ND2 . ASN A 1 185 ? 31.877  3.372   19.830  1.00 45.48 ? 185 ASN A ND2 1 
ATOM   1416  N N   . PRO A 1 186 ? 30.228  2.817   22.875  1.00 50.79 ? 186 PRO A N   1 
ATOM   1417  C CA  . PRO A 1 186 ? 28.999  2.192   23.356  1.00 50.82 ? 186 PRO A CA  1 
ATOM   1418  C C   . PRO A 1 186 ? 28.633  0.988   22.526  1.00 50.78 ? 186 PRO A C   1 
ATOM   1419  O O   . PRO A 1 186 ? 29.388  0.637   21.644  1.00 50.52 ? 186 PRO A O   1 
ATOM   1420  C CB  . PRO A 1 186 ? 27.964  3.298   23.192  1.00 50.44 ? 186 PRO A CB  1 
ATOM   1421  C CG  . PRO A 1 186 ? 28.748  4.558   23.104  1.00 50.82 ? 186 PRO A CG  1 
ATOM   1422  C CD  . PRO A 1 186 ? 30.235  4.263   23.115  1.00 50.83 ? 186 PRO A CD  1 
ATOM   1423  N N   . GLN A 1 187 ? 27.500  0.357   22.816  1.00 51.17 ? 187 GLN A N   1 
ATOM   1424  C CA  . GLN A 1 187 ? 26.730  -0.379  21.765  1.00 51.50 ? 187 GLN A CA  1 
ATOM   1425  C C   . GLN A 1 187 ? 27.377  -1.612  21.026  1.00 51.10 ? 187 GLN A C   1 
ATOM   1426  O O   . GLN A 1 187 ? 26.664  -2.396  20.369  1.00 51.39 ? 187 GLN A O   1 
ATOM   1427  C CB  . GLN A 1 187 ? 26.078  0.610   20.775  1.00 51.97 ? 187 GLN A CB  1 
ATOM   1428  C CG  . GLN A 1 187 ? 26.782  0.745   19.399  1.00 53.23 ? 187 GLN A CG  1 
ATOM   1429  C CD  . GLN A 1 187 ? 27.671  1.973   19.271  1.00 52.35 ? 187 GLN A CD  1 
ATOM   1430  O OE1 . GLN A 1 187 ? 27.235  3.116   19.515  1.00 54.77 ? 187 GLN A OE1 1 
ATOM   1431  N NE2 . GLN A 1 187 ? 28.915  1.746   18.853  1.00 54.28 ? 187 GLN A NE2 1 
ATOM   1432  N N   . LYS A 1 188 ? 28.708  -1.679  21.051  1.00 49.69 ? 188 LYS A N   1 
ATOM   1433  C CA  . LYS A 1 188 ? 29.424  -2.948  21.207  1.00 49.00 ? 188 LYS A CA  1 
ATOM   1434  C C   . LYS A 1 188 ? 28.809  -3.806  22.336  1.00 48.00 ? 188 LYS A C   1 
ATOM   1435  O O   . LYS A 1 188 ? 28.547  -5.012  22.157  1.00 48.38 ? 188 LYS A O   1 
ATOM   1436  C CB  . LYS A 1 188 ? 30.865  -2.658  21.623  1.00 49.01 ? 188 LYS A CB  1 
ATOM   1437  C CG  . LYS A 1 188 ? 31.769  -2.375  20.478  1.00 50.67 ? 188 LYS A CG  1 
ATOM   1438  C CD  . LYS A 1 188 ? 33.165  -2.249  20.993  1.00 51.55 ? 188 LYS A CD  1 
ATOM   1439  C CE  . LYS A 1 188 ? 34.093  -1.832  19.837  1.00 54.15 ? 188 LYS A CE  1 
ATOM   1440  N NZ  . LYS A 1 188 ? 33.658  -2.637  18.553  1.00 57.14 ? 188 LYS A NZ  1 
ATOM   1441  N N   . ASN A 1 189 ? 28.589  -3.169  23.494  1.00 45.78 ? 189 ASN A N   1 
ATOM   1442  C CA  . ASN A 1 189 ? 28.178  -3.852  24.736  1.00 43.32 ? 189 ASN A CA  1 
ATOM   1443  C C   . ASN A 1 189 ? 29.326  -4.485  25.502  1.00 40.92 ? 189 ASN A C   1 
ATOM   1444  O O   . ASN A 1 189 ? 29.247  -5.623  25.930  1.00 40.30 ? 189 ASN A O   1 
ATOM   1445  C CB  . ASN A 1 189 ? 27.082  -4.893  24.504  1.00 43.89 ? 189 ASN A CB  1 
ATOM   1446  C CG  . ASN A 1 189 ? 25.977  -4.392  23.602  1.00 47.39 ? 189 ASN A CG  1 
ATOM   1447  O OD1 . ASN A 1 189 ? 25.311  -3.381  23.889  1.00 51.28 ? 189 ASN A OD1 1 
ATOM   1448  N ND2 . ASN A 1 189 ? 25.750  -5.109  22.504  1.00 49.03 ? 189 ASN A ND2 1 
ATOM   1449  N N   . THR A 1 190 ? 30.395  -3.745  25.686  1.00 38.75 ? 190 THR A N   1 
ATOM   1450  C CA  . THR A 1 190 ? 31.365  -4.136  26.666  1.00 37.63 ? 190 THR A CA  1 
ATOM   1451  C C   . THR A 1 190 ? 30.712  -4.156  28.088  1.00 36.54 ? 190 THR A C   1 
ATOM   1452  O O   . THR A 1 190 ? 29.823  -3.346  28.397  1.00 35.72 ? 190 THR A O   1 
ATOM   1453  C CB  . THR A 1 190 ? 32.598  -3.254  26.615  1.00 38.05 ? 190 THR A CB  1 
ATOM   1454  O OG1 . THR A 1 190 ? 32.251  -1.907  27.001  1.00 38.10 ? 190 THR A OG1 1 
ATOM   1455  C CG2 . THR A 1 190 ? 33.171  -3.284  25.194  1.00 36.69 ? 190 THR A CG2 1 
ATOM   1456  N N   . PRO A 1 191 ? 31.157  -5.089  28.943  1.00 34.56 ? 191 PRO A N   1 
ATOM   1457  C CA  . PRO A 1 191 ? 30.411  -5.254  30.199  1.00 33.18 ? 191 PRO A CA  1 
ATOM   1458  C C   . PRO A 1 191 ? 30.349  -3.955  31.062  1.00 31.57 ? 191 PRO A C   1 
ATOM   1459  O O   . PRO A 1 191 ? 31.332  -3.253  31.200  1.00 32.10 ? 191 PRO A O   1 
ATOM   1460  C CB  . PRO A 1 191 ? 31.151  -6.402  30.910  1.00 32.93 ? 191 PRO A CB  1 
ATOM   1461  C CG  . PRO A 1 191 ? 32.068  -7.027  29.866  1.00 33.44 ? 191 PRO A CG  1 
ATOM   1462  C CD  . PRO A 1 191 ? 32.343  -5.965  28.854  1.00 33.80 ? 191 PRO A CD  1 
ATOM   1463  N N   . LYS A 1 192 ? 29.175  -3.651  31.609  1.00 30.73 ? 192 LYS A N   1 
ATOM   1464  C CA  . LYS A 1 192 ? 28.978  -2.500  32.498  1.00 30.11 ? 192 LYS A CA  1 
ATOM   1465  C C   . LYS A 1 192 ? 29.678  -2.713  33.840  1.00 28.90 ? 192 LYS A C   1 
ATOM   1466  O O   . LYS A 1 192 ? 30.277  -1.798  34.382  1.00 28.38 ? 192 LYS A O   1 
ATOM   1467  C CB  . LYS A 1 192 ? 27.465  -2.249  32.720  1.00 30.75 ? 192 LYS A CB  1 
ATOM   1468  C CG  . LYS A 1 192 ? 26.875  -0.938  32.143  1.00 33.68 ? 192 LYS A CG  1 
ATOM   1469  C CD  . LYS A 1 192 ? 27.070  -0.738  30.680  1.00 33.73 ? 192 LYS A CD  1 
ATOM   1470  C CE  . LYS A 1 192 ? 26.187  0.423   30.152  1.00 36.31 ? 192 LYS A CE  1 
ATOM   1471  N NZ  . LYS A 1 192 ? 24.674  0.123   30.053  1.00 36.92 ? 192 LYS A NZ  1 
ATOM   1472  N N   . PHE A 1 193 ? 29.599  -3.934  34.374  1.00 26.60 ? 193 PHE A N   1 
ATOM   1473  C CA  . PHE A 1 193 ? 30.159  -4.174  35.671  1.00 26.43 ? 193 PHE A CA  1 
ATOM   1474  C C   . PHE A 1 193 ? 30.474  -5.656  35.895  1.00 25.36 ? 193 PHE A C   1 
ATOM   1475  O O   . PHE A 1 193 ? 29.985  -6.516  35.171  1.00 25.68 ? 193 PHE A O   1 
ATOM   1476  C CB  . PHE A 1 193 ? 29.209  -3.632  36.781  1.00 26.06 ? 193 PHE A CB  1 
ATOM   1477  C CG  . PHE A 1 193 ? 27.923  -4.419  36.947  1.00 25.31 ? 193 PHE A CG  1 
ATOM   1478  C CD1 . PHE A 1 193 ? 26.714  -3.897  36.522  1.00 25.14 ? 193 PHE A CD1 1 
ATOM   1479  C CD2 . PHE A 1 193 ? 27.919  -5.666  37.576  1.00 26.49 ? 193 PHE A CD2 1 
ATOM   1480  C CE1 . PHE A 1 193 ? 25.508  -4.586  36.719  1.00 26.50 ? 193 PHE A CE1 1 
ATOM   1481  C CE2 . PHE A 1 193 ? 26.757  -6.388  37.757  1.00 26.96 ? 193 PHE A CE2 1 
ATOM   1482  C CZ  . PHE A 1 193 ? 25.521  -5.851  37.356  1.00 25.62 ? 193 PHE A CZ  1 
ATOM   1483  N N   . LEU A 1 194 ? 31.326  -5.902  36.875  1.00 26.33 ? 194 LEU A N   1 
ATOM   1484  C CA  . LEU A 1 194 ? 31.575  -7.251  37.434  1.00 26.03 ? 194 LEU A CA  1 
ATOM   1485  C C   . LEU A 1 194 ? 31.069  -7.211  38.878  1.00 25.00 ? 194 LEU A C   1 
ATOM   1486  O O   . LEU A 1 194 ? 31.465  -6.366  39.652  1.00 26.24 ? 194 LEU A O   1 
ATOM   1487  C CB  . LEU A 1 194 ? 33.062  -7.580  37.432  1.00 25.65 ? 194 LEU A CB  1 
ATOM   1488  C CG  . LEU A 1 194 ? 33.572  -8.713  38.334  1.00 25.28 ? 194 LEU A CG  1 
ATOM   1489  C CD1 . LEU A 1 194 ? 32.939  -10.048 37.933  1.00 27.74 ? 194 LEU A CD1 1 
ATOM   1490  C CD2 . LEU A 1 194 ? 35.066  -8.780  38.131  1.00 27.84 ? 194 LEU A CD2 1 
ATOM   1491  N N   . TYR A 1 195 ? 30.181  -8.130  39.216  1.00 26.37 ? 195 TYR A N   1 
ATOM   1492  C CA  . TYR A 1 195 ? 29.660  -8.231  40.588  1.00 25.67 ? 195 TYR A CA  1 
ATOM   1493  C C   . TYR A 1 195 ? 30.275  -9.461  41.237  1.00 26.83 ? 195 TYR A C   1 
ATOM   1494  O O   . TYR A 1 195 ? 30.355  -10.509 40.604  1.00 25.39 ? 195 TYR A O   1 
ATOM   1495  C CB  . TYR A 1 195 ? 28.152  -8.401  40.538  1.00 25.69 ? 195 TYR A CB  1 
ATOM   1496  C CG  . TYR A 1 195 ? 27.534  -8.997  41.782  1.00 24.67 ? 195 TYR A CG  1 
ATOM   1497  C CD1 . TYR A 1 195 ? 26.901  -8.174  42.709  1.00 23.66 ? 195 TYR A CD1 1 
ATOM   1498  C CD2 . TYR A 1 195 ? 27.567  -10.394 42.025  1.00 24.49 ? 195 TYR A CD2 1 
ATOM   1499  C CE1 . TYR A 1 195 ? 26.281  -8.710  43.881  1.00 23.22 ? 195 TYR A CE1 1 
ATOM   1500  C CE2 . TYR A 1 195 ? 26.994  -10.954 43.220  1.00 24.26 ? 195 TYR A CE2 1 
ATOM   1501  C CZ  . TYR A 1 195 ? 26.350  -10.109 44.122  1.00 24.86 ? 195 TYR A CZ  1 
ATOM   1502  O OH  . TYR A 1 195 ? 25.737  -10.652 45.218  1.00 21.79 ? 195 TYR A OH  1 
ATOM   1503  N N   . THR A 1 196 ? 30.721  -9.326  42.493  1.00 27.78 ? 196 THR A N   1 
ATOM   1504  C CA  . THR A 1 196 ? 31.186  -10.485 43.243  1.00 28.00 ? 196 THR A CA  1 
ATOM   1505  C C   . THR A 1 196 ? 31.028  -10.293 44.750  1.00 28.19 ? 196 THR A C   1 
ATOM   1506  O O   . THR A 1 196 ? 31.071  -9.142  45.263  1.00 26.92 ? 196 THR A O   1 
ATOM   1507  C CB  . THR A 1 196 ? 32.638  -10.867 42.866  1.00 29.32 ? 196 THR A CB  1 
ATOM   1508  O OG1 . THR A 1 196 ? 32.893  -12.246 43.236  1.00 33.76 ? 196 THR A OG1 1 
ATOM   1509  C CG2 . THR A 1 196 ? 33.649  -9.945  43.529  1.00 27.39 ? 196 THR A CG2 1 
ATOM   1510  N N   . VAL A 1 197 ? 30.812  -11.426 45.443  1.00 27.05 ? 197 VAL A N   1 
ATOM   1511  C CA  . VAL A 1 197 ? 30.957  -11.482 46.888  1.00 25.74 ? 197 VAL A CA  1 
ATOM   1512  C C   . VAL A 1 197 ? 32.395  -11.928 47.240  1.00 26.21 ? 197 VAL A C   1 
ATOM   1513  O O   . VAL A 1 197 ? 32.709  -13.142 47.153  1.00 26.52 ? 197 VAL A O   1 
ATOM   1514  C CB  . VAL A 1 197 ? 29.845  -12.387 47.488  1.00 24.71 ? 197 VAL A CB  1 
ATOM   1515  C CG1 . VAL A 1 197 ? 29.963  -12.508 49.001  1.00 22.24 ? 197 VAL A CG1 1 
ATOM   1516  C CG2 . VAL A 1 197 ? 28.483  -11.863 47.077  1.00 24.66 ? 197 VAL A CG2 1 
ATOM   1517  N N   . PRO A 1 198 ? 33.286  -10.967 47.611  1.00 26.33 ? 198 PRO A N   1 
ATOM   1518  C CA  . PRO A 1 198 ? 34.691  -11.343 47.731  1.00 26.66 ? 198 PRO A CA  1 
ATOM   1519  C C   . PRO A 1 198 ? 35.060  -12.159 48.991  1.00 26.47 ? 198 PRO A C   1 
ATOM   1520  O O   . PRO A 1 198 ? 36.083  -12.834 48.989  1.00 26.63 ? 198 PRO A O   1 
ATOM   1521  C CB  . PRO A 1 198 ? 35.420  -10.005 47.693  1.00 26.55 ? 198 PRO A CB  1 
ATOM   1522  C CG  . PRO A 1 198 ? 34.439  -9.036  48.280  1.00 27.64 ? 198 PRO A CG  1 
ATOM   1523  C CD  . PRO A 1 198 ? 33.091  -9.518  47.841  1.00 26.57 ? 198 PRO A CD  1 
ATOM   1524  N N   . ASN A 1 199 ? 34.243  -12.078 50.040  1.00 26.33 ? 199 ASN A N   1 
ATOM   1525  C CA  . ASN A 1 199 ? 34.482  -12.760 51.310  1.00 26.02 ? 199 ASN A CA  1 
ATOM   1526  C C   . ASN A 1 199 ? 33.348  -13.706 51.663  1.00 25.96 ? 199 ASN A C   1 
ATOM   1527  O O   . ASN A 1 199 ? 32.164  -13.313 51.678  1.00 25.16 ? 199 ASN A O   1 
ATOM   1528  C CB  . ASN A 1 199 ? 34.689  -11.742 52.431  1.00 26.28 ? 199 ASN A CB  1 
ATOM   1529  C CG  . ASN A 1 199 ? 36.003  -11.011 52.296  1.00 26.66 ? 199 ASN A CG  1 
ATOM   1530  O OD1 . ASN A 1 199 ? 37.060  -11.633 52.396  1.00 26.57 ? 199 ASN A OD1 1 
ATOM   1531  N ND2 . ASN A 1 199 ? 35.950  -9.692  52.054  1.00 23.02 ? 199 ASN A ND2 1 
ATOM   1532  N N   . GLY A 1 200 ? 33.706  -14.966 51.904  1.00 26.06 ? 200 GLY A N   1 
ATOM   1533  C CA  . GLY A 1 200 ? 32.724  -16.007 52.253  1.00 26.19 ? 200 GLY A CA  1 
ATOM   1534  C C   . GLY A 1 200 ? 31.504  -16.022 51.335  1.00 25.87 ? 200 GLY A C   1 
ATOM   1535  O O   . GLY A 1 200 ? 30.384  -15.816 51.772  1.00 24.97 ? 200 GLY A O   1 
ATOM   1536  N N   . ASN A 1 201 ? 31.719  -16.259 50.052  1.00 26.49 ? 201 ASN A N   1 
ATOM   1537  C CA  . ASN A 1 201 ? 30.615  -16.217 49.096  1.00 27.44 ? 201 ASN A CA  1 
ATOM   1538  C C   . ASN A 1 201 ? 29.427  -17.103 49.521  1.00 27.42 ? 201 ASN A C   1 
ATOM   1539  O O   . ASN A 1 201 ? 29.613  -18.209 50.039  1.00 26.80 ? 201 ASN A O   1 
ATOM   1540  C CB  . ASN A 1 201 ? 31.125  -16.576 47.690  1.00 28.43 ? 201 ASN A CB  1 
ATOM   1541  C CG  . ASN A 1 201 ? 30.017  -16.613 46.636  1.00 30.82 ? 201 ASN A CG  1 
ATOM   1542  O OD1 . ASN A 1 201 ? 29.804  -17.633 45.990  1.00 38.43 ? 201 ASN A OD1 1 
ATOM   1543  N ND2 . ASN A 1 201 ? 29.313  -15.515 46.470  1.00 33.25 ? 201 ASN A ND2 1 
ATOM   1544  N N   . ASN A 1 202 ? 28.209  -16.596 49.321  1.00 26.13 ? 202 ASN A N   1 
ATOM   1545  C CA  . ASN A 1 202 ? 27.001  -17.378 49.490  1.00 27.14 ? 202 ASN A CA  1 
ATOM   1546  C C   . ASN A 1 202 ? 26.661  -17.924 48.109  1.00 25.88 ? 202 ASN A C   1 
ATOM   1547  O O   . ASN A 1 202 ? 26.301  -17.162 47.254  1.00 26.51 ? 202 ASN A O   1 
ATOM   1548  C CB  . ASN A 1 202 ? 25.861  -16.473 50.011  1.00 26.65 ? 202 ASN A CB  1 
ATOM   1549  C CG  . ASN A 1 202 ? 24.562  -17.214 50.215  1.00 26.87 ? 202 ASN A CG  1 
ATOM   1550  O OD1 . ASN A 1 202 ? 24.471  -18.432 50.026  1.00 26.35 ? 202 ASN A OD1 1 
ATOM   1551  N ND2 . ASN A 1 202 ? 23.541  -16.480 50.646  1.00 25.19 ? 202 ASN A ND2 1 
ATOM   1552  N N   . PRO A 1 203 ? 26.738  -19.262 47.881  1.00 25.99 ? 203 PRO A N   1 
ATOM   1553  C CA  . PRO A 1 203 ? 26.783  -20.380 48.807  1.00 24.64 ? 203 PRO A CA  1 
ATOM   1554  C C   . PRO A 1 203 ? 28.142  -21.040 49.126  1.00 24.48 ? 203 PRO A C   1 
ATOM   1555  O O   . PRO A 1 203 ? 28.152  -21.938 49.948  1.00 23.18 ? 203 PRO A O   1 
ATOM   1556  C CB  . PRO A 1 203 ? 25.924  -21.415 48.079  1.00 24.02 ? 203 PRO A CB  1 
ATOM   1557  C CG  . PRO A 1 203 ? 26.361  -21.224 46.569  1.00 24.53 ? 203 PRO A CG  1 
ATOM   1558  C CD  . PRO A 1 203 ? 26.741  -19.730 46.472  1.00 25.83 ? 203 PRO A CD  1 
ATOM   1559  N N   . THR A 1 204 ? 29.244  -20.638 48.488  1.00 24.99 ? 204 THR A N   1 
ATOM   1560  C CA  . THR A 1 204 ? 30.459  -21.501 48.458  1.00 25.75 ? 204 THR A CA  1 
ATOM   1561  C C   . THR A 1 204 ? 31.372  -21.377 49.661  1.00 25.70 ? 204 THR A C   1 
ATOM   1562  O O   . THR A 1 204 ? 32.151  -22.274 49.925  1.00 25.98 ? 204 THR A O   1 
ATOM   1563  C CB  . THR A 1 204 ? 31.341  -21.273 47.216  1.00 25.56 ? 204 THR A CB  1 
ATOM   1564  O OG1 . THR A 1 204 ? 31.856  -19.932 47.234  1.00 27.62 ? 204 THR A OG1 1 
ATOM   1565  C CG2 . THR A 1 204 ? 30.548  -21.494 45.967  1.00 27.47 ? 204 THR A CG2 1 
ATOM   1566  N N   . GLY A 1 205 ? 31.296  -20.256 50.373  1.00 24.63 ? 205 GLY A N   1 
ATOM   1567  C CA  . GLY A 1 205 ? 32.248  -19.973 51.439  1.00 23.69 ? 205 GLY A CA  1 
ATOM   1568  C C   . GLY A 1 205 ? 33.644  -19.552 51.010  1.00 23.92 ? 205 GLY A C   1 
ATOM   1569  O O   . GLY A 1 205 ? 34.493  -19.281 51.879  1.00 24.22 ? 205 GLY A O   1 
ATOM   1570  N N   . ASN A 1 206 ? 33.908  -19.501 49.692  1.00 23.98 ? 206 ASN A N   1 
ATOM   1571  C CA  . ASN A 1 206 ? 35.237  -19.145 49.165  1.00 25.98 ? 206 ASN A CA  1 
ATOM   1572  C C   . ASN A 1 206 ? 35.509  -17.636 49.234  1.00 26.40 ? 206 ASN A C   1 
ATOM   1573  O O   . ASN A 1 206 ? 34.604  -16.858 49.043  1.00 27.30 ? 206 ASN A O   1 
ATOM   1574  C CB  . ASN A 1 206 ? 35.419  -19.642 47.712  1.00 24.47 ? 206 ASN A CB  1 
ATOM   1575  C CG  . ASN A 1 206 ? 35.206  -21.151 47.569  1.00 25.48 ? 206 ASN A CG  1 
ATOM   1576  O OD1 . ASN A 1 206 ? 34.632  -21.640 46.590  1.00 27.15 ? 206 ASN A OD1 1 
ATOM   1577  N ND2 . ASN A 1 206 ? 35.635  -21.871 48.536  1.00 22.99 ? 206 ASN A ND2 1 
ATOM   1578  N N   . SER A 1 207 ? 36.746  -17.229 49.532  1.00 28.40 ? 207 SER A N   1 
ATOM   1579  C CA  . SER A 1 207 ? 37.097  -15.813 49.532  1.00 28.56 ? 207 SER A CA  1 
ATOM   1580  C C   . SER A 1 207 ? 38.207  -15.491 48.496  1.00 30.27 ? 207 SER A C   1 
ATOM   1581  O O   . SER A 1 207 ? 39.131  -16.307 48.286  1.00 29.47 ? 207 SER A O   1 
ATOM   1582  C CB  . SER A 1 207 ? 37.502  -15.363 50.930  1.00 29.26 ? 207 SER A CB  1 
ATOM   1583  O OG  . SER A 1 207 ? 36.409  -15.407 51.836  1.00 25.20 ? 207 SER A OG  1 
ATOM   1584  N N   . LEU A 1 208 ? 38.083  -14.327 47.836  1.00 29.97 ? 208 LEU A N   1 
ATOM   1585  C CA  . LEU A 1 208 ? 39.126  -13.805 46.980  1.00 31.46 ? 208 LEU A CA  1 
ATOM   1586  C C   . LEU A 1 208 ? 40.381  -13.510 47.740  1.00 31.77 ? 208 LEU A C   1 
ATOM   1587  O O   . LEU A 1 208 ? 40.347  -13.127 48.914  1.00 32.53 ? 208 LEU A O   1 
ATOM   1588  C CB  . LEU A 1 208 ? 38.675  -12.542 46.213  1.00 32.00 ? 208 LEU A CB  1 
ATOM   1589  C CG  . LEU A 1 208 ? 38.104  -12.783 44.823  1.00 33.67 ? 208 LEU A CG  1 
ATOM   1590  C CD1 . LEU A 1 208 ? 37.340  -11.556 44.224  1.00 35.04 ? 208 LEU A CD1 1 
ATOM   1591  C CD2 . LEU A 1 208 ? 39.241  -13.192 43.882  1.00 35.83 ? 208 LEU A CD2 1 
ATOM   1592  N N   . THR A 1 209 ? 41.513  -13.724 47.076  1.00 32.18 ? 209 THR A N   1 
ATOM   1593  C CA  . THR A 1 209 ? 42.783  -13.349 47.633  1.00 32.37 ? 209 THR A CA  1 
ATOM   1594  C C   . THR A 1 209 ? 43.038  -11.912 47.147  1.00 33.25 ? 209 THR A C   1 
ATOM   1595  O O   . THR A 1 209 ? 42.429  -11.448 46.160  1.00 32.38 ? 209 THR A O   1 
ATOM   1596  C CB  . THR A 1 209 ? 43.933  -14.313 47.178  1.00 32.56 ? 209 THR A CB  1 
ATOM   1597  O OG1 . THR A 1 209 ? 44.104  -14.228 45.761  1.00 31.81 ? 209 THR A OG1 1 
ATOM   1598  C CG2 . THR A 1 209 ? 43.634  -15.800 47.547  1.00 32.65 ? 209 THR A CG2 1 
ATOM   1599  N N   . SER A 1 210 ? 43.947  -11.241 47.839  1.00 34.75 ? 210 SER A N   1 
ATOM   1600  C CA  . SER A 1 210 ? 44.419  -9.900  47.546  1.00 36.60 ? 210 SER A CA  1 
ATOM   1601  C C   . SER A 1 210 ? 45.144  -9.818  46.177  1.00 37.71 ? 210 SER A C   1 
ATOM   1602  O O   . SER A 1 210 ? 44.890  -8.906  45.386  1.00 38.08 ? 210 SER A O   1 
ATOM   1603  C CB  . SER A 1 210 ? 45.323  -9.460  48.697  1.00 36.75 ? 210 SER A CB  1 
ATOM   1604  O OG  . SER A 1 210 ? 45.998  -8.245  48.435  1.00 39.57 ? 210 SER A OG  1 
ATOM   1605  N N   . GLU A 1 211 ? 45.994  -10.798 45.869  1.00 38.67 ? 211 GLU A N   1 
ATOM   1606  C CA  . GLU A 1 211 ? 46.700  -10.811 44.580  1.00 39.03 ? 211 GLU A CA  1 
ATOM   1607  C C   . GLU A 1 211 ? 45.697  -10.866 43.467  1.00 38.18 ? 211 GLU A C   1 
ATOM   1608  O O   . GLU A 1 211 ? 45.818  -10.119 42.491  1.00 38.17 ? 211 GLU A O   1 
ATOM   1609  C CB  . GLU A 1 211 ? 47.656  -12.005 44.464  1.00 39.51 ? 211 GLU A CB  1 
ATOM   1610  C CG  . GLU A 1 211 ? 48.888  -11.906 45.343  1.00 44.36 ? 211 GLU A CG  1 
ATOM   1611  C CD  . GLU A 1 211 ? 48.612  -12.143 46.838  1.00 50.51 ? 211 GLU A CD  1 
ATOM   1612  O OE1 . GLU A 1 211 ? 47.480  -12.582 47.216  1.00 51.95 ? 211 GLU A OE1 1 
ATOM   1613  O OE2 . GLU A 1 211 ? 49.552  -11.888 47.636  1.00 51.87 ? 211 GLU A OE2 1 
ATOM   1614  N N   . ARG A 1 212 ? 44.676  -11.709 43.634  1.00 37.06 ? 212 ARG A N   1 
ATOM   1615  C CA  . ARG A 1 212 ? 43.632  -11.859 42.608  1.00 35.89 ? 212 ARG A CA  1 
ATOM   1616  C C   . ARG A 1 212 ? 42.727  -10.625 42.466  1.00 35.74 ? 212 ARG A C   1 
ATOM   1617  O O   . ARG A 1 212 ? 42.292  -10.282 41.356  1.00 35.76 ? 212 ARG A O   1 
ATOM   1618  C CB  . ARG A 1 212 ? 42.784  -13.103 42.843  1.00 35.05 ? 212 ARG A CB  1 
ATOM   1619  C CG  . ARG A 1 212 ? 43.405  -14.416 42.393  1.00 35.21 ? 212 ARG A CG  1 
ATOM   1620  C CD  . ARG A 1 212 ? 42.435  -15.532 42.540  1.00 34.25 ? 212 ARG A CD  1 
ATOM   1621  N NE  . ARG A 1 212 ? 43.016  -16.843 42.229  1.00 31.78 ? 212 ARG A NE  1 
ATOM   1622  C CZ  . ARG A 1 212 ? 42.304  -17.916 41.927  1.00 32.17 ? 212 ARG A CZ  1 
ATOM   1623  N NH1 . ARG A 1 212 ? 40.975  -17.831 41.872  1.00 28.87 ? 212 ARG A NH1 1 
ATOM   1624  N NH2 . ARG A 1 212 ? 42.910  -19.086 41.671  1.00 29.43 ? 212 ARG A NH2 1 
ATOM   1625  N N   . LYS A 1 213 ? 42.428  -9.989  43.590  1.00 35.33 ? 213 LYS A N   1 
ATOM   1626  C CA  . LYS A 1 213 ? 41.757  -8.710  43.613  1.00 34.70 ? 213 LYS A CA  1 
ATOM   1627  C C   . LYS A 1 213 ? 42.526  -7.650  42.797  1.00 35.58 ? 213 LYS A C   1 
ATOM   1628  O O   . LYS A 1 213 ? 41.916  -6.951  42.013  1.00 34.84 ? 213 LYS A O   1 
ATOM   1629  C CB  . LYS A 1 213 ? 41.579  -8.243  45.048  1.00 34.71 ? 213 LYS A CB  1 
ATOM   1630  C CG  . LYS A 1 213 ? 40.436  -8.958  45.779  1.00 34.25 ? 213 LYS A CG  1 
ATOM   1631  C CD  . LYS A 1 213 ? 40.183  -8.268  47.067  1.00 32.14 ? 213 LYS A CD  1 
ATOM   1632  C CE  . LYS A 1 213 ? 39.095  -8.981  47.801  1.00 30.36 ? 213 LYS A CE  1 
ATOM   1633  N NZ  . LYS A 1 213 ? 39.016  -8.565  49.235  1.00 25.76 ? 213 LYS A NZ  1 
ATOM   1634  N N   . LYS A 1 214 ? 43.840  -7.525  43.013  1.00 36.07 ? 214 LYS A N   1 
ATOM   1635  C CA  . LYS A 1 214 ? 44.700  -6.655  42.187  1.00 37.40 ? 214 LYS A CA  1 
ATOM   1636  C C   . LYS A 1 214 ? 44.617  -6.936  40.660  1.00 37.41 ? 214 LYS A C   1 
ATOM   1637  O O   . LYS A 1 214 ? 44.482  -5.989  39.871  1.00 37.91 ? 214 LYS A O   1 
ATOM   1638  C CB  . LYS A 1 214 ? 46.155  -6.684  42.679  1.00 38.31 ? 214 LYS A CB  1 
ATOM   1639  C CG  . LYS A 1 214 ? 46.422  -6.025  44.049  1.00 39.56 ? 214 LYS A CG  1 
ATOM   1640  C CD  . LYS A 1 214 ? 47.914  -6.069  44.369  1.00 43.60 ? 214 LYS A CD  1 
ATOM   1641  C CE  . LYS A 1 214 ? 48.201  -6.086  45.885  1.00 45.52 ? 214 LYS A CE  1 
ATOM   1642  N NZ  . LYS A 1 214 ? 49.608  -6.480  46.166  1.00 47.45 ? 214 LYS A NZ  1 
ATOM   1643  N N   . GLU A 1 215 ? 44.650  -8.216  40.249  1.00 36.72 ? 215 GLU A N   1 
ATOM   1644  C CA  . GLU A 1 215 ? 44.482  -8.581  38.829  1.00 36.45 ? 215 GLU A CA  1 
ATOM   1645  C C   . GLU A 1 215 ? 43.110  -8.206  38.234  1.00 34.90 ? 215 GLU A C   1 
ATOM   1646  O O   . GLU A 1 215 ? 43.017  -7.695  37.114  1.00 34.97 ? 215 GLU A O   1 
ATOM   1647  C CB  . GLU A 1 215 ? 44.746  -10.075 38.563  1.00 36.98 ? 215 GLU A CB  1 
ATOM   1648  C CG  . GLU A 1 215 ? 46.172  -10.550 38.715  1.00 40.46 ? 215 GLU A CG  1 
ATOM   1649  C CD  . GLU A 1 215 ? 46.307  -12.039 38.364  1.00 45.49 ? 215 GLU A CD  1 
ATOM   1650  O OE1 . GLU A 1 215 ? 46.519  -12.862 39.298  1.00 47.47 ? 215 GLU A OE1 1 
ATOM   1651  O OE2 . GLU A 1 215 ? 46.141  -12.387 37.164  1.00 46.73 ? 215 GLU A OE2 1 
ATOM   1652  N N   . ILE A 1 216 ? 42.050  -8.487  38.977  1.00 33.36 ? 216 ILE A N   1 
ATOM   1653  C CA  . ILE A 1 216 ? 40.692  -8.122  38.604  1.00 31.21 ? 216 ILE A CA  1 
ATOM   1654  C C   . ILE A 1 216 ? 40.567  -6.600  38.436  1.00 30.67 ? 216 ILE A C   1 
ATOM   1655  O O   . ILE A 1 216 ? 39.993  -6.128  37.441  1.00 30.60 ? 216 ILE A O   1 
ATOM   1656  C CB  . ILE A 1 216 ? 39.670  -8.628  39.669  1.00 31.21 ? 216 ILE A CB  1 
ATOM   1657  C CG1 . ILE A 1 216 ? 39.745  -10.150 39.800  1.00 32.53 ? 216 ILE A CG1 1 
ATOM   1658  C CG2 . ILE A 1 216 ? 38.252  -8.154  39.313  1.00 31.18 ? 216 ILE A CG2 1 
ATOM   1659  C CD1 . ILE A 1 216 ? 39.451  -10.705 41.236  1.00 30.17 ? 216 ILE A CD1 1 
ATOM   1660  N N   . TYR A 1 217 ? 41.076  -5.849  39.407  1.00 29.66 ? 217 TYR A N   1 
ATOM   1661  C CA  . TYR A 1 217 ? 41.064  -4.392  39.325  1.00 31.29 ? 217 TYR A CA  1 
ATOM   1662  C C   . TYR A 1 217 ? 41.721  -3.873  38.032  1.00 32.81 ? 217 TYR A C   1 
ATOM   1663  O O   . TYR A 1 217 ? 41.193  -2.978  37.361  1.00 32.12 ? 217 TYR A O   1 
ATOM   1664  C CB  . TYR A 1 217 ? 41.696  -3.737  40.554  1.00 30.73 ? 217 TYR A CB  1 
ATOM   1665  C CG  . TYR A 1 217 ? 41.322  -2.264  40.671  1.00 32.18 ? 217 TYR A CG  1 
ATOM   1666  C CD1 . TYR A 1 217 ? 40.144  -1.869  41.332  1.00 32.60 ? 217 TYR A CD1 1 
ATOM   1667  C CD2 . TYR A 1 217 ? 42.121  -1.269  40.085  1.00 33.02 ? 217 TYR A CD2 1 
ATOM   1668  C CE1 . TYR A 1 217 ? 39.767  -0.503  41.422  1.00 33.59 ? 217 TYR A CE1 1 
ATOM   1669  C CE2 . TYR A 1 217 ? 41.757  0.110   40.155  1.00 33.33 ? 217 TYR A CE2 1 
ATOM   1670  C CZ  . TYR A 1 217 ? 40.582  0.480   40.826  1.00 34.18 ? 217 TYR A CZ  1 
ATOM   1671  O OH  . TYR A 1 217 ? 40.232  1.811   40.893  1.00 31.95 ? 217 TYR A OH  1 
ATOM   1672  N N   . GLU A 1 218 ? 42.866  -4.463  37.691  1.00 35.04 ? 218 GLU A N   1 
ATOM   1673  C CA  . GLU A 1 218 ? 43.607  -4.152  36.446  1.00 36.66 ? 218 GLU A CA  1 
ATOM   1674  C C   . GLU A 1 218 ? 42.746  -4.405  35.193  1.00 36.48 ? 218 GLU A C   1 
ATOM   1675  O O   . GLU A 1 218 ? 42.706  -3.591  34.263  1.00 37.89 ? 218 GLU A O   1 
ATOM   1676  C CB  . GLU A 1 218 ? 44.944  -4.932  36.450  1.00 36.98 ? 218 GLU A CB  1 
ATOM   1677  C CG  . GLU A 1 218 ? 45.238  -5.778  35.193  1.00 42.58 ? 218 GLU A CG  1 
ATOM   1678  C CD  . GLU A 1 218 ? 45.742  -7.219  35.503  1.00 46.88 ? 218 GLU A CD  1 
ATOM   1679  O OE1 . GLU A 1 218 ? 45.046  -8.184  35.113  1.00 46.27 ? 218 GLU A OE1 1 
ATOM   1680  O OE2 . GLU A 1 218 ? 46.828  -7.390  36.118  1.00 48.75 ? 218 GLU A OE2 1 
ATOM   1681  N N   . LEU A 1 219 ? 42.060  -5.543  35.183  1.00 36.36 ? 219 LEU A N   1 
ATOM   1682  C CA  . LEU A 1 219 ? 41.110  -5.856  34.123  1.00 35.97 ? 219 LEU A CA  1 
ATOM   1683  C C   . LEU A 1 219 ? 39.986  -4.826  34.067  1.00 36.60 ? 219 LEU A C   1 
ATOM   1684  O O   . LEU A 1 219 ? 39.496  -4.487  32.990  1.00 36.60 ? 219 LEU A O   1 
ATOM   1685  C CB  . LEU A 1 219 ? 40.529  -7.258  34.320  1.00 35.96 ? 219 LEU A CB  1 
ATOM   1686  C CG  . LEU A 1 219 ? 41.383  -8.422  33.815  1.00 36.35 ? 219 LEU A CG  1 
ATOM   1687  C CD1 . LEU A 1 219 ? 40.927  -9.733  34.439  1.00 37.04 ? 219 LEU A CD1 1 
ATOM   1688  C CD2 . LEU A 1 219 ? 41.338  -8.503  32.297  1.00 33.79 ? 219 LEU A CD2 1 
ATOM   1689  N N   . ALA A 1 220 ? 39.583  -4.333  35.233  1.00 36.35 ? 220 ALA A N   1 
ATOM   1690  C CA  . ALA A 1 220 ? 38.423  -3.446  35.331  1.00 36.76 ? 220 ALA A CA  1 
ATOM   1691  C C   . ALA A 1 220 ? 38.740  -2.117  34.683  1.00 36.63 ? 220 ALA A C   1 
ATOM   1692  O O   . ALA A 1 220 ? 37.911  -1.606  33.933  1.00 36.87 ? 220 ALA A O   1 
ATOM   1693  C CB  . ALA A 1 220 ? 37.958  -3.254  36.800  1.00 36.49 ? 220 ALA A CB  1 
ATOM   1694  N N   . ARG A 1 221 ? 39.928  -1.583  34.953  1.00 37.27 ? 221 ARG A N   1 
ATOM   1695  C CA  . ARG A 1 221 ? 40.397  -0.365  34.266  1.00 39.24 ? 221 ARG A CA  1 
ATOM   1696  C C   . ARG A 1 221 ? 40.632  -0.533  32.763  1.00 39.24 ? 221 ARG A C   1 
ATOM   1697  O O   . ARG A 1 221 ? 40.244  0.329   31.977  1.00 38.94 ? 221 ARG A O   1 
ATOM   1698  C CB  . ARG A 1 221 ? 41.600  0.322   34.935  1.00 39.97 ? 221 ARG A CB  1 
ATOM   1699  C CG  . ARG A 1 221 ? 42.471  -0.513  35.840  1.00 43.91 ? 221 ARG A CG  1 
ATOM   1700  C CD  . ARG A 1 221 ? 43.860  0.151   36.018  1.00 49.95 ? 221 ARG A CD  1 
ATOM   1701  N NE  . ARG A 1 221 ? 44.478  0.527   34.729  1.00 54.05 ? 221 ARG A NE  1 
ATOM   1702  C CZ  . ARG A 1 221 ? 45.099  -0.317  33.885  1.00 55.51 ? 221 ARG A CZ  1 
ATOM   1703  N NH1 . ARG A 1 221 ? 45.207  -1.623  34.170  1.00 55.47 ? 221 ARG A NH1 1 
ATOM   1704  N NH2 . ARG A 1 221 ? 45.611  0.143   32.731  1.00 55.19 ? 221 ARG A NH2 1 
ATOM   1705  N N   . LYS A 1 222 ? 41.228  -1.656  32.370  1.00 39.63 ? 222 LYS A N   1 
ATOM   1706  C CA  . LYS A 1 222 ? 41.487  -1.964  30.956  1.00 39.14 ? 222 LYS A CA  1 
ATOM   1707  C C   . LYS A 1 222 ? 40.221  -1.982  30.109  1.00 39.07 ? 222 LYS A C   1 
ATOM   1708  O O   . LYS A 1 222 ? 40.188  -1.422  29.010  1.00 39.17 ? 222 LYS A O   1 
ATOM   1709  C CB  . LYS A 1 222 ? 42.216  -3.305  30.833  1.00 39.38 ? 222 LYS A CB  1 
ATOM   1710  C CG  . LYS A 1 222 ? 42.695  -3.647  29.419  1.00 40.34 ? 222 LYS A CG  1 
ATOM   1711  C CD  . LYS A 1 222 ? 43.731  -4.785  29.436  1.00 42.06 ? 222 LYS A CD  1 
ATOM   1712  C CE  . LYS A 1 222 ? 43.968  -5.346  28.033  1.00 44.82 ? 222 LYS A CE  1 
ATOM   1713  N NZ  . LYS A 1 222 ? 45.045  -6.371  28.038  1.00 45.33 ? 222 LYS A NZ  1 
ATOM   1714  N N   . TYR A 1 223 ? 39.178  -2.640  30.600  1.00 38.61 ? 223 TYR A N   1 
ATOM   1715  C CA  . TYR A 1 223 ? 37.926  -2.717  29.853  1.00 37.90 ? 223 TYR A CA  1 
ATOM   1716  C C   . TYR A 1 223 ? 36.896  -1.715  30.368  1.00 36.93 ? 223 TYR A C   1 
ATOM   1717  O O   . TYR A 1 223 ? 35.749  -1.734  29.956  1.00 37.06 ? 223 TYR A O   1 
ATOM   1718  C CB  . TYR A 1 223 ? 37.406  -4.153  29.811  1.00 38.94 ? 223 TYR A CB  1 
ATOM   1719  C CG  . TYR A 1 223 ? 38.331  -5.054  29.013  1.00 41.08 ? 223 TYR A CG  1 
ATOM   1720  C CD1 . TYR A 1 223 ? 38.104  -5.271  27.654  1.00 42.43 ? 223 TYR A CD1 1 
ATOM   1721  C CD2 . TYR A 1 223 ? 39.444  -5.655  29.609  1.00 41.88 ? 223 TYR A CD2 1 
ATOM   1722  C CE1 . TYR A 1 223 ? 38.947  -6.062  26.903  1.00 44.34 ? 223 TYR A CE1 1 
ATOM   1723  C CE2 . TYR A 1 223 ? 40.298  -6.455  28.861  1.00 42.93 ? 223 TYR A CE2 1 
ATOM   1724  C CZ  . TYR A 1 223 ? 40.038  -6.649  27.511  1.00 44.14 ? 223 TYR A CZ  1 
ATOM   1725  O OH  . TYR A 1 223 ? 40.853  -7.444  26.758  1.00 44.94 ? 223 TYR A OH  1 
ATOM   1726  N N   . ASP A 1 224 ? 37.359  -0.824  31.236  1.00 36.85 ? 224 ASP A N   1 
ATOM   1727  C CA  . ASP A 1 224 ? 36.560  0.235   31.875  1.00 37.31 ? 224 ASP A CA  1 
ATOM   1728  C C   . ASP A 1 224 ? 35.183  -0.239  32.317  1.00 36.58 ? 224 ASP A C   1 
ATOM   1729  O O   . ASP A 1 224 ? 34.156  0.229   31.792  1.00 37.20 ? 224 ASP A O   1 
ATOM   1730  C CB  . ASP A 1 224 ? 36.457  1.470   30.973  1.00 37.76 ? 224 ASP A CB  1 
ATOM   1731  C CG  . ASP A 1 224 ? 35.978  2.706   31.729  1.00 40.72 ? 224 ASP A CG  1 
ATOM   1732  O OD1 . ASP A 1 224 ? 36.535  2.994   32.820  1.00 42.63 ? 224 ASP A OD1 1 
ATOM   1733  O OD2 . ASP A 1 224 ? 35.049  3.389   31.216  1.00 42.63 ? 224 ASP A OD2 1 
ATOM   1734  N N   . PHE A 1 225 ? 35.157  -1.209  33.243  1.00 35.11 ? 225 PHE A N   1 
ATOM   1735  C CA  . PHE A 1 225 ? 33.904  -1.591  33.887  1.00 33.08 ? 225 PHE A CA  1 
ATOM   1736  C C   . PHE A 1 225 ? 33.874  -1.276  35.380  1.00 31.42 ? 225 PHE A C   1 
ATOM   1737  O O   . PHE A 1 225 ? 34.908  -1.060  36.001  1.00 30.77 ? 225 PHE A O   1 
ATOM   1738  C CB  . PHE A 1 225 ? 33.488  -3.050  33.592  1.00 34.35 ? 225 PHE A CB  1 
ATOM   1739  C CG  . PHE A 1 225 ? 34.534  -4.115  33.942  1.00 35.36 ? 225 PHE A CG  1 
ATOM   1740  C CD1 . PHE A 1 225 ? 34.747  -4.518  35.270  1.00 32.25 ? 225 PHE A CD1 1 
ATOM   1741  C CD2 . PHE A 1 225 ? 35.219  -4.793  32.920  1.00 34.77 ? 225 PHE A CD2 1 
ATOM   1742  C CE1 . PHE A 1 225 ? 35.653  -5.524  35.566  1.00 31.85 ? 225 PHE A CE1 1 
ATOM   1743  C CE2 . PHE A 1 225 ? 36.132  -5.801  33.212  1.00 34.51 ? 225 PHE A CE2 1 
ATOM   1744  C CZ  . PHE A 1 225 ? 36.366  -6.167  34.522  1.00 31.68 ? 225 PHE A CZ  1 
ATOM   1745  N N   . LEU A 1 226 ? 32.668  -1.241  35.940  1.00 30.09 ? 226 LEU A N   1 
ATOM   1746  C CA  . LEU A 1 226 ? 32.485  -1.046  37.379  1.00 29.61 ? 226 LEU A CA  1 
ATOM   1747  C C   . LEU A 1 226 ? 32.798  -2.347  38.100  1.00 28.55 ? 226 LEU A C   1 
ATOM   1748  O O   . LEU A 1 226 ? 32.654  -3.391  37.527  1.00 28.55 ? 226 LEU A O   1 
ATOM   1749  C CB  . LEU A 1 226 ? 31.025  -0.632  37.684  1.00 29.05 ? 226 LEU A CB  1 
ATOM   1750  C CG  . LEU A 1 226 ? 30.668  0.849   37.939  1.00 31.08 ? 226 LEU A CG  1 
ATOM   1751  C CD1 . LEU A 1 226 ? 31.543  1.791   37.223  1.00 26.74 ? 226 LEU A CD1 1 
ATOM   1752  C CD2 . LEU A 1 226 ? 29.183  1.114   37.640  1.00 30.10 ? 226 LEU A CD2 1 
ATOM   1753  N N   . ILE A 1 227 ? 33.270  -2.266  39.343  1.00 28.03 ? 227 ILE A N   1 
ATOM   1754  C CA  . ILE A 1 227 ? 33.247  -3.455  40.205  1.00 27.78 ? 227 ILE A CA  1 
ATOM   1755  C C   . ILE A 1 227 ? 32.184  -3.251  41.286  1.00 27.56 ? 227 ILE A C   1 
ATOM   1756  O O   . ILE A 1 227 ? 32.211  -2.267  42.041  1.00 27.74 ? 227 ILE A O   1 
ATOM   1757  C CB  . ILE A 1 227 ? 34.615  -3.740  40.847  1.00 27.66 ? 227 ILE A CB  1 
ATOM   1758  C CG1 . ILE A 1 227 ? 35.630  -4.155  39.768  1.00 26.64 ? 227 ILE A CG1 1 
ATOM   1759  C CG2 . ILE A 1 227 ? 34.534  -4.860  41.907  1.00 25.69 ? 227 ILE A CG2 1 
ATOM   1760  C CD1 . ILE A 1 227 ? 37.012  -4.013  40.265  1.00 23.11 ? 227 ILE A CD1 1 
ATOM   1761  N N   . ILE A 1 228 ? 31.242  -4.180  41.380  1.00 27.55 ? 228 ILE A N   1 
ATOM   1762  C CA  . ILE A 1 228 ? 30.371  -4.097  42.543  1.00 26.89 ? 228 ILE A CA  1 
ATOM   1763  C C   . ILE A 1 228 ? 30.716  -5.119  43.561  1.00 26.22 ? 228 ILE A C   1 
ATOM   1764  O O   . ILE A 1 228 ? 30.575  -6.335  43.341  1.00 26.25 ? 228 ILE A O   1 
ATOM   1765  C CB  . ILE A 1 228 ? 28.895  -3.910  42.209  1.00 27.91 ? 228 ILE A CB  1 
ATOM   1766  C CG1 . ILE A 1 228 ? 27.973  -4.396  43.334  1.00 26.44 ? 228 ILE A CG1 1 
ATOM   1767  C CG2 . ILE A 1 228 ? 28.575  -4.402  40.840  1.00 30.81 ? 228 ILE A CG2 1 
ATOM   1768  C CD1 . ILE A 1 228 ? 26.547  -3.990  43.141  1.00 32.93 ? 228 ILE A CD1 1 
ATOM   1769  N N   . GLU A 1 229 ? 31.277  -4.606  44.641  1.00 26.06 ? 229 GLU A N   1 
ATOM   1770  C CA  . GLU A 1 229 ? 31.781  -5.410  45.720  1.00 24.73 ? 229 GLU A CA  1 
ATOM   1771  C C   . GLU A 1 229 ? 30.677  -5.533  46.773  1.00 24.44 ? 229 GLU A C   1 
ATOM   1772  O O   . GLU A 1 229 ? 30.545  -4.665  47.641  1.00 24.54 ? 229 GLU A O   1 
ATOM   1773  C CB  . GLU A 1 229 ? 33.002  -4.684  46.298  1.00 26.46 ? 229 GLU A CB  1 
ATOM   1774  C CG  . GLU A 1 229 ? 33.733  -5.452  47.394  1.00 26.45 ? 229 GLU A CG  1 
ATOM   1775  C CD  . GLU A 1 229 ? 34.967  -4.719  47.857  1.00 26.27 ? 229 GLU A CD  1 
ATOM   1776  O OE1 . GLU A 1 229 ? 35.982  -5.410  48.018  1.00 31.17 ? 229 GLU A OE1 1 
ATOM   1777  O OE2 . GLU A 1 229 ? 34.962  -3.473  48.023  1.00 22.83 ? 229 GLU A OE2 1 
ATOM   1778  N N   . ASP A 1 230 ? 29.902  -6.618  46.685  1.00 24.37 ? 230 ASP A N   1 
ATOM   1779  C CA  . ASP A 1 230 ? 28.866  -6.979  47.655  1.00 23.92 ? 230 ASP A CA  1 
ATOM   1780  C C   . ASP A 1 230 ? 29.511  -7.807  48.752  1.00 23.72 ? 230 ASP A C   1 
ATOM   1781  O O   . ASP A 1 230 ? 29.824  -9.002  48.559  1.00 22.50 ? 230 ASP A O   1 
ATOM   1782  C CB  . ASP A 1 230 ? 27.738  -7.743  46.925  1.00 23.70 ? 230 ASP A CB  1 
ATOM   1783  C CG  . ASP A 1 230 ? 26.606  -8.202  47.850  1.00 23.39 ? 230 ASP A CG  1 
ATOM   1784  O OD1 . ASP A 1 230 ? 26.389  -7.562  48.888  1.00 24.49 ? 230 ASP A OD1 1 
ATOM   1785  O OD2 . ASP A 1 230 ? 25.878  -9.180  47.504  1.00 27.37 ? 230 ASP A OD2 1 
ATOM   1786  N N   . ASP A 1 231 ? 29.744  -7.164  49.906  1.00 23.87 ? 231 ASP A N   1 
ATOM   1787  C CA  . ASP A 1 231 ? 30.610  -7.741  50.936  1.00 23.57 ? 231 ASP A CA  1 
ATOM   1788  C C   . ASP A 1 231 ? 29.924  -7.874  52.314  1.00 22.31 ? 231 ASP A C   1 
ATOM   1789  O O   . ASP A 1 231 ? 30.397  -7.312  53.291  1.00 22.66 ? 231 ASP A O   1 
ATOM   1790  C CB  . ASP A 1 231 ? 31.891  -6.872  51.041  1.00 23.55 ? 231 ASP A CB  1 
ATOM   1791  C CG  . ASP A 1 231 ? 33.139  -7.679  51.351  1.00 25.42 ? 231 ASP A CG  1 
ATOM   1792  O OD1 . ASP A 1 231 ? 33.030  -8.927  51.546  1.00 25.88 ? 231 ASP A OD1 1 
ATOM   1793  O OD2 . ASP A 1 231 ? 34.239  -7.051  51.387  1.00 25.80 ? 231 ASP A OD2 1 
ATOM   1794  N N   . PRO A 1 232 ? 28.789  -8.591  52.388  1.00 21.94 ? 232 PRO A N   1 
ATOM   1795  C CA  . PRO A 1 232 ? 28.074  -8.675  53.656  1.00 21.41 ? 232 PRO A CA  1 
ATOM   1796  C C   . PRO A 1 232 ? 28.768  -9.597  54.701  1.00 21.70 ? 232 PRO A C   1 
ATOM   1797  O O   . PRO A 1 232 ? 28.422  -9.566  55.868  1.00 22.10 ? 232 PRO A O   1 
ATOM   1798  C CB  . PRO A 1 232 ? 26.713  -9.215  53.237  1.00 21.24 ? 232 PRO A CB  1 
ATOM   1799  C CG  . PRO A 1 232 ? 26.988  -10.017 52.051  1.00 21.78 ? 232 PRO A CG  1 
ATOM   1800  C CD  . PRO A 1 232 ? 28.095  -9.336  51.323  1.00 21.58 ? 232 PRO A CD  1 
ATOM   1801  N N   . TYR A 1 233 ? 29.736  -10.407 54.262  1.00 21.47 ? 233 TYR A N   1 
ATOM   1802  C CA  . TYR A 1 233 ? 30.462  -11.279 55.176  1.00 22.23 ? 233 TYR A CA  1 
ATOM   1803  C C   . TYR A 1 233 ? 31.843  -10.713 55.391  1.00 22.72 ? 233 TYR A C   1 
ATOM   1804  O O   . TYR A 1 233 ? 32.758  -11.420 55.787  1.00 23.64 ? 233 TYR A O   1 
ATOM   1805  C CB  . TYR A 1 233 ? 30.479  -12.729 54.644  1.00 20.84 ? 233 TYR A CB  1 
ATOM   1806  C CG  . TYR A 1 233 ? 29.085  -13.266 54.357  1.00 22.49 ? 233 TYR A CG  1 
ATOM   1807  C CD1 . TYR A 1 233 ? 28.596  -13.327 53.056  1.00 22.49 ? 233 TYR A CD1 1 
ATOM   1808  C CD2 . TYR A 1 233 ? 28.234  -13.661 55.393  1.00 20.46 ? 233 TYR A CD2 1 
ATOM   1809  C CE1 . TYR A 1 233 ? 27.322  -13.799 52.788  1.00 22.46 ? 233 TYR A CE1 1 
ATOM   1810  C CE2 . TYR A 1 233 ? 26.952  -14.124 55.124  1.00 23.46 ? 233 TYR A CE2 1 
ATOM   1811  C CZ  . TYR A 1 233 ? 26.512  -14.188 53.823  1.00 22.92 ? 233 TYR A CZ  1 
ATOM   1812  O OH  . TYR A 1 233 ? 25.242  -14.628 53.559  1.00 26.27 ? 233 TYR A OH  1 
ATOM   1813  N N   . TYR A 1 234 ? 31.992  -9.398  55.146  1.00 23.08 ? 234 TYR A N   1 
ATOM   1814  C CA  . TYR A 1 234 ? 33.271  -8.756  55.314  1.00 23.33 ? 234 TYR A CA  1 
ATOM   1815  C C   . TYR A 1 234 ? 33.723  -8.811  56.740  1.00 23.47 ? 234 TYR A C   1 
ATOM   1816  O O   . TYR A 1 234 ? 34.921  -8.947  56.980  1.00 23.85 ? 234 TYR A O   1 
ATOM   1817  C CB  . TYR A 1 234 ? 33.313  -7.298  54.776  1.00 23.65 ? 234 TYR A CB  1 
ATOM   1818  C CG  . TYR A 1 234 ? 34.608  -6.596  55.142  1.00 24.67 ? 234 TYR A CG  1 
ATOM   1819  C CD1 . TYR A 1 234 ? 35.779  -6.804  54.389  1.00 23.32 ? 234 TYR A CD1 1 
ATOM   1820  C CD2 . TYR A 1 234 ? 34.678  -5.751  56.236  1.00 22.12 ? 234 TYR A CD2 1 
ATOM   1821  C CE1 . TYR A 1 234 ? 36.970  -6.183  54.737  1.00 24.78 ? 234 TYR A CE1 1 
ATOM   1822  C CE2 . TYR A 1 234 ? 35.847  -5.130  56.598  1.00 22.22 ? 234 TYR A CE2 1 
ATOM   1823  C CZ  . TYR A 1 234 ? 36.993  -5.336  55.833  1.00 26.75 ? 234 TYR A CZ  1 
ATOM   1824  O OH  . TYR A 1 234 ? 38.176  -4.748  56.198  1.00 25.31 ? 234 TYR A OH  1 
ATOM   1825  N N   . PHE A 1 235 ? 32.799  -8.706  57.704  1.00 23.54 ? 235 PHE A N   1 
ATOM   1826  C CA  . PHE A 1 235 ? 33.205  -8.767  59.114  1.00 23.03 ? 235 PHE A CA  1 
ATOM   1827  C C   . PHE A 1 235 ? 33.079  -10.194 59.681  1.00 24.08 ? 235 PHE A C   1 
ATOM   1828  O O   . PHE A 1 235 ? 32.980  -10.377 60.881  1.00 23.78 ? 235 PHE A O   1 
ATOM   1829  C CB  . PHE A 1 235 ? 32.385  -7.792  59.986  1.00 22.67 ? 235 PHE A CB  1 
ATOM   1830  C CG  . PHE A 1 235 ? 32.667  -6.325  59.710  1.00 21.54 ? 235 PHE A CG  1 
ATOM   1831  C CD1 . PHE A 1 235 ? 33.841  -5.734  60.156  1.00 22.75 ? 235 PHE A CD1 1 
ATOM   1832  C CD2 . PHE A 1 235 ? 31.764  -5.548  58.999  1.00 21.59 ? 235 PHE A CD2 1 
ATOM   1833  C CE1 . PHE A 1 235 ? 34.095  -4.345  59.877  1.00 23.48 ? 235 PHE A CE1 1 
ATOM   1834  C CE2 . PHE A 1 235 ? 32.003  -4.159  58.705  1.00 18.86 ? 235 PHE A CE2 1 
ATOM   1835  C CZ  . PHE A 1 235 ? 33.156  -3.581  59.143  1.00 21.88 ? 235 PHE A CZ  1 
ATOM   1836  N N   . LEU A 1 236 ? 33.107  -11.200 58.825  1.00 24.96 ? 236 LEU A N   1 
ATOM   1837  C CA  . LEU A 1 236 ? 33.068  -12.582 59.300  1.00 26.16 ? 236 LEU A CA  1 
ATOM   1838  C C   . LEU A 1 236 ? 34.206  -13.406 58.672  1.00 26.98 ? 236 LEU A C   1 
ATOM   1839  O O   . LEU A 1 236 ? 33.991  -14.577 58.339  1.00 27.86 ? 236 LEU A O   1 
ATOM   1840  C CB  . LEU A 1 236 ? 31.711  -13.206 58.958  1.00 26.42 ? 236 LEU A CB  1 
ATOM   1841  C CG  . LEU A 1 236 ? 30.550  -13.150 59.963  1.00 27.51 ? 236 LEU A CG  1 
ATOM   1842  C CD1 . LEU A 1 236 ? 29.966  -11.788 60.009  1.00 30.67 ? 236 LEU A CD1 1 
ATOM   1843  C CD2 . LEU A 1 236 ? 29.459  -14.110 59.503  1.00 25.77 ? 236 LEU A CD2 1 
ATOM   1844  N N   . GLN A 1 237 ? 35.394  -12.809 58.495  1.00 26.74 ? 237 GLN A N   1 
ATOM   1845  C CA  . GLN A 1 237 ? 36.549  -13.540 57.954  1.00 28.09 ? 237 GLN A CA  1 
ATOM   1846  C C   . GLN A 1 237 ? 37.297  -14.277 59.066  1.00 28.79 ? 237 GLN A C   1 
ATOM   1847  O O   . GLN A 1 237 ? 37.590  -13.712 60.106  1.00 28.41 ? 237 GLN A O   1 
ATOM   1848  C CB  . GLN A 1 237 ? 37.510  -12.620 57.200  1.00 28.13 ? 237 GLN A CB  1 
ATOM   1849  C CG  . GLN A 1 237 ? 36.873  -11.815 56.083  1.00 26.77 ? 237 GLN A CG  1 
ATOM   1850  C CD  . GLN A 1 237 ? 37.788  -10.692 55.596  1.00 30.01 ? 237 GLN A CD  1 
ATOM   1851  O OE1 . GLN A 1 237 ? 37.410  -9.525  55.616  1.00 32.68 ? 237 GLN A OE1 1 
ATOM   1852  N NE2 . GLN A 1 237 ? 39.005  -11.039 55.191  1.00 27.65 ? 237 GLN A NE2 1 
ATOM   1853  N N   . PHE A 1 238 ? 37.588  -15.549 58.839  1.00 30.43 ? 238 PHE A N   1 
ATOM   1854  C CA  . PHE A 1 238 ? 38.209  -16.368 59.858  1.00 32.19 ? 238 PHE A CA  1 
ATOM   1855  C C   . PHE A 1 238 ? 39.693  -16.120 60.032  1.00 33.84 ? 238 PHE A C   1 
ATOM   1856  O O   . PHE A 1 238 ? 40.243  -16.339 61.135  1.00 34.69 ? 238 PHE A O   1 
ATOM   1857  C CB  . PHE A 1 238 ? 37.888  -17.836 59.593  1.00 32.26 ? 238 PHE A CB  1 
ATOM   1858  C CG  . PHE A 1 238 ? 36.412  -18.092 59.541  1.00 29.71 ? 238 PHE A CG  1 
ATOM   1859  C CD1 . PHE A 1 238 ? 35.844  -18.743 58.465  1.00 27.10 ? 238 PHE A CD1 1 
ATOM   1860  C CD2 . PHE A 1 238 ? 35.591  -17.615 60.557  1.00 28.18 ? 238 PHE A CD2 1 
ATOM   1861  C CE1 . PHE A 1 238 ? 34.481  -18.972 58.409  1.00 29.74 ? 238 PHE A CE1 1 
ATOM   1862  C CE2 . PHE A 1 238 ? 34.208  -17.810 60.482  1.00 28.12 ? 238 PHE A CE2 1 
ATOM   1863  C CZ  . PHE A 1 238 ? 33.661  -18.499 59.429  1.00 26.36 ? 238 PHE A CZ  1 
ATOM   1864  N N   . ASN A 1 239 ? 40.341  -15.687 58.954  1.00 35.26 ? 239 ASN A N   1 
ATOM   1865  C CA  . ASN A 1 239 ? 41.676  -15.116 59.051  1.00 36.91 ? 239 ASN A CA  1 
ATOM   1866  C C   . ASN A 1 239 ? 41.612  -13.735 59.715  1.00 38.31 ? 239 ASN A C   1 
ATOM   1867  O O   . ASN A 1 239 ? 40.997  -12.795 59.172  1.00 39.22 ? 239 ASN A O   1 
ATOM   1868  C CB  . ASN A 1 239 ? 42.320  -14.997 57.670  1.00 36.36 ? 239 ASN A CB  1 
ATOM   1869  C CG  . ASN A 1 239 ? 43.839  -14.905 57.741  1.00 37.72 ? 239 ASN A CG  1 
ATOM   1870  O OD1 . ASN A 1 239 ? 44.402  -14.371 58.699  1.00 33.93 ? 239 ASN A OD1 1 
ATOM   1871  N ND2 . ASN A 1 239 ? 44.506  -15.428 56.718  1.00 37.57 ? 239 ASN A ND2 1 
ATOM   1872  N N   . LYS A 1 240 ? 42.264  -13.605 60.869  1.00 38.33 ? 240 LYS A N   1 
ATOM   1873  C CA  . LYS A 1 240 ? 42.275  -12.345 61.598  1.00 39.26 ? 240 LYS A CA  1 
ATOM   1874  C C   . LYS A 1 240 ? 42.942  -11.166 60.856  1.00 39.40 ? 240 LYS A C   1 
ATOM   1875  O O   . LYS A 1 240 ? 42.662  -9.996  61.154  1.00 39.92 ? 240 LYS A O   1 
ATOM   1876  C CB  . LYS A 1 240 ? 42.854  -12.553 63.008  1.00 39.94 ? 240 LYS A CB  1 
ATOM   1877  C CG  . LYS A 1 240 ? 41.876  -13.304 63.954  1.00 39.28 ? 240 LYS A CG  1 
ATOM   1878  C CD  . LYS A 1 240 ? 40.393  -13.000 63.596  1.00 39.59 ? 240 LYS A CD  1 
ATOM   1879  C CE  . LYS A 1 240 ? 39.447  -13.919 64.314  1.00 39.81 ? 240 LYS A CE  1 
ATOM   1880  N NZ  . LYS A 1 240 ? 39.699  -13.920 65.803  1.00 43.50 ? 240 LYS A NZ  1 
ATOM   1881  N N   . PHE A 1 241 ? 43.766  -11.482 59.859  1.00 39.15 ? 241 PHE A N   1 
ATOM   1882  C CA  . PHE A 1 241 ? 44.176  -10.496 58.853  1.00 38.60 ? 241 PHE A CA  1 
ATOM   1883  C C   . PHE A 1 241 ? 43.165  -10.385 57.691  1.00 37.21 ? 241 PHE A C   1 
ATOM   1884  O O   . PHE A 1 241 ? 43.092  -11.249 56.819  1.00 36.72 ? 241 PHE A O   1 
ATOM   1885  C CB  . PHE A 1 241 ? 45.617  -10.775 58.384  1.00 40.05 ? 241 PHE A CB  1 
ATOM   1886  C CG  . PHE A 1 241 ? 46.623  -10.672 59.500  1.00 42.72 ? 241 PHE A CG  1 
ATOM   1887  C CD1 . PHE A 1 241 ? 46.871  -11.769 60.342  1.00 46.00 ? 241 PHE A CD1 1 
ATOM   1888  C CD2 . PHE A 1 241 ? 47.267  -9.460  59.764  1.00 46.09 ? 241 PHE A CD2 1 
ATOM   1889  C CE1 . PHE A 1 241 ? 47.784  -11.666 61.420  1.00 48.05 ? 241 PHE A CE1 1 
ATOM   1890  C CE2 . PHE A 1 241 ? 48.192  -9.343  60.835  1.00 48.10 ? 241 PHE A CE2 1 
ATOM   1891  C CZ  . PHE A 1 241 ? 48.450  -10.449 61.658  1.00 47.07 ? 241 PHE A CZ  1 
ATOM   1892  N N   . ARG A 1 242 ? 42.368  -9.319  57.699  1.00 35.38 ? 242 ARG A N   1 
ATOM   1893  C CA  . ARG A 1 242 ? 41.340  -9.140  56.685  1.00 33.91 ? 242 ARG A CA  1 
ATOM   1894  C C   . ARG A 1 242 ? 42.035  -8.851  55.354  1.00 34.31 ? 242 ARG A C   1 
ATOM   1895  O O   . ARG A 1 242 ? 42.991  -8.095  55.321  1.00 34.90 ? 242 ARG A O   1 
ATOM   1896  C CB  . ARG A 1 242 ? 40.377  -7.999  57.066  1.00 32.72 ? 242 ARG A CB  1 
ATOM   1897  C CG  . ARG A 1 242 ? 39.332  -8.364  58.125  1.00 31.33 ? 242 ARG A CG  1 
ATOM   1898  C CD  . ARG A 1 242 ? 38.392  -7.204  58.482  1.00 30.90 ? 242 ARG A CD  1 
ATOM   1899  N NE  . ARG A 1 242 ? 39.101  -5.942  58.671  1.00 29.46 ? 242 ARG A NE  1 
ATOM   1900  C CZ  . ARG A 1 242 ? 39.670  -5.551  59.812  1.00 31.53 ? 242 ARG A CZ  1 
ATOM   1901  N NH1 . ARG A 1 242 ? 39.612  -6.319  60.888  1.00 30.78 ? 242 ARG A NH1 1 
ATOM   1902  N NH2 . ARG A 1 242 ? 40.311  -4.392  59.877  1.00 28.34 ? 242 ARG A NH2 1 
ATOM   1903  N N   . VAL A 1 243 ? 41.578  -9.464  54.268  1.00 34.06 ? 243 VAL A N   1 
ATOM   1904  C CA  . VAL A 1 243 ? 42.147  -9.159  52.946  1.00 33.80 ? 243 VAL A CA  1 
ATOM   1905  C C   . VAL A 1 243 ? 41.700  -7.749  52.445  1.00 33.07 ? 243 VAL A C   1 
ATOM   1906  O O   . VAL A 1 243 ? 40.516  -7.374  52.579  1.00 32.40 ? 243 VAL A O   1 
ATOM   1907  C CB  . VAL A 1 243 ? 42.002  -10.374 51.924  1.00 33.74 ? 243 VAL A CB  1 
ATOM   1908  C CG1 . VAL A 1 243 ? 40.831  -11.270 52.237  1.00 36.68 ? 243 VAL A CG1 1 
ATOM   1909  C CG2 . VAL A 1 243 ? 42.051  -9.967  50.421  1.00 33.46 ? 243 VAL A CG2 1 
ATOM   1910  N N   . PRO A 1 244 ? 42.658  -6.949  51.912  1.00 32.77 ? 244 PRO A N   1 
ATOM   1911  C CA  . PRO A 1 244 ? 42.308  -5.676  51.305  1.00 31.79 ? 244 PRO A CA  1 
ATOM   1912  C C   . PRO A 1 244 ? 41.100  -5.790  50.397  1.00 30.63 ? 244 PRO A C   1 
ATOM   1913  O O   . PRO A 1 244 ? 40.937  -6.773  49.671  1.00 30.83 ? 244 PRO A O   1 
ATOM   1914  C CB  . PRO A 1 244 ? 43.554  -5.342  50.482  1.00 32.43 ? 244 PRO A CB  1 
ATOM   1915  C CG  . PRO A 1 244 ? 44.655  -5.857  51.357  1.00 33.15 ? 244 PRO A CG  1 
ATOM   1916  C CD  . PRO A 1 244 ? 44.111  -7.193  51.818  1.00 32.47 ? 244 PRO A CD  1 
ATOM   1917  N N   . THR A 1 245 ? 40.243  -4.786  50.474  1.00 29.66 ? 245 THR A N   1 
ATOM   1918  C CA  . THR A 1 245 ? 39.032  -4.714  49.690  1.00 29.45 ? 245 THR A CA  1 
ATOM   1919  C C   . THR A 1 245 ? 39.237  -4.062  48.331  1.00 29.52 ? 245 THR A C   1 
ATOM   1920  O O   . THR A 1 245 ? 40.207  -3.326  48.139  1.00 30.57 ? 245 THR A O   1 
ATOM   1921  C CB  . THR A 1 245 ? 37.942  -3.928  50.447  1.00 30.27 ? 245 THR A CB  1 
ATOM   1922  O OG1 . THR A 1 245 ? 38.284  -2.538  50.576  1.00 27.89 ? 245 THR A OG1 1 
ATOM   1923  C CG2 . THR A 1 245 ? 37.748  -4.528  51.815  1.00 28.77 ? 245 THR A CG2 1 
ATOM   1924  N N   . PHE A 1 246 ? 38.336  -4.317  47.386  1.00 28.18 ? 246 PHE A N   1 
ATOM   1925  C CA  . PHE A 1 246 ? 38.406  -3.563  46.136  1.00 28.66 ? 246 PHE A CA  1 
ATOM   1926  C C   . PHE A 1 246 ? 38.344  -2.063  46.409  1.00 28.82 ? 246 PHE A C   1 
ATOM   1927  O O   . PHE A 1 246 ? 39.103  -1.311  45.830  1.00 29.67 ? 246 PHE A O   1 
ATOM   1928  C CB  . PHE A 1 246 ? 37.315  -3.979  45.158  1.00 28.51 ? 246 PHE A CB  1 
ATOM   1929  C CG  . PHE A 1 246 ? 37.547  -5.319  44.522  1.00 28.15 ? 246 PHE A CG  1 
ATOM   1930  C CD1 . PHE A 1 246 ? 36.729  -6.412  44.838  1.00 27.88 ? 246 PHE A CD1 1 
ATOM   1931  C CD2 . PHE A 1 246 ? 38.551  -5.480  43.570  1.00 28.02 ? 246 PHE A CD2 1 
ATOM   1932  C CE1 . PHE A 1 246 ? 36.914  -7.658  44.221  1.00 27.41 ? 246 PHE A CE1 1 
ATOM   1933  C CE2 . PHE A 1 246 ? 38.760  -6.711  42.955  1.00 22.33 ? 246 PHE A CE2 1 
ATOM   1934  C CZ  . PHE A 1 246 ? 37.937  -7.805  43.255  1.00 28.69 ? 246 PHE A CZ  1 
ATOM   1935  N N   . LEU A 1 247 ? 37.505  -1.642  47.365  1.00 28.55 ? 247 LEU A N   1 
ATOM   1936  C CA  . LEU A 1 247 ? 37.406  -0.211  47.712  1.00 28.13 ? 247 LEU A CA  1 
ATOM   1937  C C   . LEU A 1 247 ? 38.744  0.388   48.179  1.00 28.07 ? 247 LEU A C   1 
ATOM   1938  O O   . LEU A 1 247 ? 39.045  1.549   47.831  1.00 27.30 ? 247 LEU A O   1 
ATOM   1939  C CB  . LEU A 1 247 ? 36.282  0.069   48.735  1.00 27.73 ? 247 LEU A CB  1 
ATOM   1940  C CG  . LEU A 1 247 ? 36.147  1.530   49.190  1.00 27.61 ? 247 LEU A CG  1 
ATOM   1941  C CD1 . LEU A 1 247 ? 35.469  2.350   48.111  1.00 26.74 ? 247 LEU A CD1 1 
ATOM   1942  C CD2 . LEU A 1 247 ? 35.423  1.677   50.563  1.00 28.29 ? 247 LEU A CD2 1 
ATOM   1943  N N   . SER A 1 248 ? 39.534  -0.387  48.941  1.00 27.59 ? 248 SER A N   1 
ATOM   1944  C CA  . SER A 1 248 ? 40.886  0.062   49.357  1.00 28.90 ? 248 SER A CA  1 
ATOM   1945  C C   . SER A 1 248 ? 41.880  0.296   48.195  1.00 29.80 ? 248 SER A C   1 
ATOM   1946  O O   . SER A 1 248 ? 42.885  0.978   48.372  1.00 30.26 ? 248 SER A O   1 
ATOM   1947  C CB  . SER A 1 248 ? 41.542  -0.893  50.360  1.00 28.37 ? 248 SER A CB  1 
ATOM   1948  O OG  . SER A 1 248 ? 41.943  -2.093  49.735  1.00 28.73 ? 248 SER A OG  1 
ATOM   1949  N N   . MET A 1 249 ? 41.601  -0.255  47.031  1.00 30.74 ? 249 MET A N   1 
ATOM   1950  C CA  . MET A 1 249 ? 42.511  -0.046  45.900  1.00 32.92 ? 249 MET A CA  1 
ATOM   1951  C C   . MET A 1 249 ? 41.851  0.739   44.745  1.00 33.10 ? 249 MET A C   1 
ATOM   1952  O O   . MET A 1 249 ? 42.341  0.704   43.609  1.00 33.46 ? 249 MET A O   1 
ATOM   1953  C CB  . MET A 1 249 ? 43.153  -1.378  45.455  1.00 32.71 ? 249 MET A CB  1 
ATOM   1954  C CG  . MET A 1 249 ? 42.203  -2.416  44.924  1.00 34.57 ? 249 MET A CG  1 
ATOM   1955  S SD  . MET A 1 249 ? 42.706  -4.184  44.968  1.00 39.52 ? 249 MET A SD  1 
ATOM   1956  C CE  . MET A 1 249 ? 41.784  -4.625  43.569  1.00 37.86 ? 249 MET A CE  1 
ATOM   1957  N N   . ASP A 1 250 ? 40.748  1.446   45.044  1.00 32.96 ? 250 ASP A N   1 
ATOM   1958  C CA  . ASP A 1 250 ? 39.905  2.035   43.988  1.00 32.93 ? 250 ASP A CA  1 
ATOM   1959  C C   . ASP A 1 250 ? 40.435  3.405   43.595  1.00 33.75 ? 250 ASP A C   1 
ATOM   1960  O O   . ASP A 1 250 ? 39.789  4.435   43.839  1.00 33.14 ? 250 ASP A O   1 
ATOM   1961  C CB  . ASP A 1 250 ? 38.433  2.152   44.385  1.00 31.45 ? 250 ASP A CB  1 
ATOM   1962  C CG  . ASP A 1 250 ? 37.539  2.537   43.210  1.00 31.26 ? 250 ASP A CG  1 
ATOM   1963  O OD1 . ASP A 1 250 ? 37.886  2.310   42.027  1.00 27.89 ? 250 ASP A OD1 1 
ATOM   1964  O OD2 . ASP A 1 250 ? 36.475  3.106   43.455  1.00 30.26 ? 250 ASP A OD2 1 
ATOM   1965  N N   . VAL A 1 251 ? 41.609  3.406   42.963  1.00 33.53 ? 251 VAL A N   1 
ATOM   1966  C CA  . VAL A 1 251 ? 42.230  4.669   42.609  1.00 33.67 ? 251 VAL A CA  1 
ATOM   1967  C C   . VAL A 1 251 ? 41.473  5.408   41.483  1.00 33.12 ? 251 VAL A C   1 
ATOM   1968  O O   . VAL A 1 251 ? 41.657  6.611   41.327  1.00 34.00 ? 251 VAL A O   1 
ATOM   1969  C CB  . VAL A 1 251 ? 43.767  4.478   42.329  1.00 33.69 ? 251 VAL A CB  1 
ATOM   1970  C CG1 . VAL A 1 251 ? 43.980  3.767   40.997  1.00 34.33 ? 251 VAL A CG1 1 
ATOM   1971  C CG2 . VAL A 1 251 ? 44.467  5.806   42.380  1.00 35.55 ? 251 VAL A CG2 1 
ATOM   1972  N N   . ASP A 1 252 ? 40.596  4.700   40.752  1.00 32.60 ? 252 ASP A N   1 
ATOM   1973  C CA  . ASP A 1 252 ? 39.855  5.239   39.596  1.00 32.05 ? 252 ASP A CA  1 
ATOM   1974  C C   . ASP A 1 252 ? 38.448  5.735   39.891  1.00 31.64 ? 252 ASP A C   1 
ATOM   1975  O O   . ASP A 1 252 ? 37.842  6.373   39.029  1.00 31.28 ? 252 ASP A O   1 
ATOM   1976  C CB  . ASP A 1 252 ? 39.638  4.182   38.510  1.00 32.62 ? 252 ASP A CB  1 
ATOM   1977  C CG  . ASP A 1 252 ? 40.926  3.677   37.874  1.00 34.94 ? 252 ASP A CG  1 
ATOM   1978  O OD1 . ASP A 1 252 ? 42.007  4.262   38.112  1.00 36.71 ? 252 ASP A OD1 1 
ATOM   1979  O OD2 . ASP A 1 252 ? 40.814  2.669   37.143  1.00 36.47 ? 252 ASP A OD2 1 
ATOM   1980  N N   . GLY A 1 253 ? 37.916  5.391   41.057  1.00 30.41 ? 253 GLY A N   1 
ATOM   1981  C CA  . GLY A 1 253 ? 36.526  5.668   41.399  1.00 29.54 ? 253 GLY A CA  1 
ATOM   1982  C C   . GLY A 1 253 ? 35.605  4.754   40.639  1.00 28.33 ? 253 GLY A C   1 
ATOM   1983  O O   . GLY A 1 253 ? 34.566  5.172   40.169  1.00 30.13 ? 253 GLY A O   1 
ATOM   1984  N N   . ARG A 1 254 ? 35.970  3.482   40.508  1.00 28.36 ? 254 ARG A N   1 
ATOM   1985  C CA  . ARG A 1 254 ? 35.130  2.544   39.776  1.00 27.38 ? 254 ARG A CA  1 
ATOM   1986  C C   . ARG A 1 254 ? 34.514  1.438   40.633  1.00 26.63 ? 254 ARG A C   1 
ATOM   1987  O O   . ARG A 1 254 ? 33.907  0.524   40.086  1.00 26.31 ? 254 ARG A O   1 
ATOM   1988  C CB  . ARG A 1 254 ? 35.884  1.915   38.588  1.00 27.97 ? 254 ARG A CB  1 
ATOM   1989  C CG  . ARG A 1 254 ? 37.054  1.004   38.986  1.00 28.09 ? 254 ARG A CG  1 
ATOM   1990  C CD  . ARG A 1 254 ? 37.716  0.316   37.758  1.00 30.03 ? 254 ARG A CD  1 
ATOM   1991  N NE  . ARG A 1 254 ? 38.241  1.299   36.816  1.00 25.78 ? 254 ARG A NE  1 
ATOM   1992  C CZ  . ARG A 1 254 ? 37.643  1.699   35.696  1.00 29.31 ? 254 ARG A CZ  1 
ATOM   1993  N NH1 . ARG A 1 254 ? 36.474  1.215   35.337  1.00 27.00 ? 254 ARG A NH1 1 
ATOM   1994  N NH2 . ARG A 1 254 ? 38.231  2.604   34.923  1.00 31.95 ? 254 ARG A NH2 1 
ATOM   1995  N N   . VAL A 1 255 ? 34.670  1.510   41.958  1.00 26.73 ? 255 VAL A N   1 
ATOM   1996  C CA  . VAL A 1 255 ? 34.071  0.499   42.839  1.00 25.96 ? 255 VAL A CA  1 
ATOM   1997  C C   . VAL A 1 255 ? 32.822  1.043   43.538  1.00 26.01 ? 255 VAL A C   1 
ATOM   1998  O O   . VAL A 1 255 ? 32.815  2.192   44.033  1.00 26.20 ? 255 VAL A O   1 
ATOM   1999  C CB  . VAL A 1 255 ? 35.101  -0.034  43.875  1.00 26.63 ? 255 VAL A CB  1 
ATOM   2000  C CG1 . VAL A 1 255 ? 34.432  -0.873  44.955  1.00 26.97 ? 255 VAL A CG1 1 
ATOM   2001  C CG2 . VAL A 1 255 ? 36.185  -0.872  43.148  1.00 24.20 ? 255 VAL A CG2 1 
ATOM   2002  N N   . ILE A 1 256 ? 31.785  0.216   43.580  1.00 25.10 ? 256 ILE A N   1 
ATOM   2003  C CA  . ILE A 1 256 ? 30.648  0.441   44.455  1.00 25.64 ? 256 ILE A CA  1 
ATOM   2004  C C   . ILE A 1 256 ? 30.645  -0.708  45.480  1.00 25.52 ? 256 ILE A C   1 
ATOM   2005  O O   . ILE A 1 256 ? 30.651  -1.884  45.095  1.00 25.84 ? 256 ILE A O   1 
ATOM   2006  C CB  . ILE A 1 256 ? 29.319  0.402   43.665  1.00 25.03 ? 256 ILE A CB  1 
ATOM   2007  C CG1 . ILE A 1 256 ? 29.271  1.527   42.599  1.00 25.41 ? 256 ILE A CG1 1 
ATOM   2008  C CG2 . ILE A 1 256 ? 28.147  0.455   44.650  1.00 26.43 ? 256 ILE A CG2 1 
ATOM   2009  C CD1 . ILE A 1 256 ? 28.172  1.358   41.560  1.00 26.11 ? 256 ILE A CD1 1 
ATOM   2010  N N   . ARG A 1 257 ? 30.591  -0.376  46.765  1.00 25.94 ? 257 ARG A N   1 
ATOM   2011  C CA  . ARG A 1 257 ? 30.770  -1.377  47.805  1.00 25.54 ? 257 ARG A CA  1 
ATOM   2012  C C   . ARG A 1 257 ? 29.515  -1.428  48.659  1.00 26.27 ? 257 ARG A C   1 
ATOM   2013  O O   . ARG A 1 257 ? 29.120  -0.413  49.200  1.00 25.91 ? 257 ARG A O   1 
ATOM   2014  C CB  . ARG A 1 257 ? 31.987  -1.051  48.690  1.00 26.50 ? 257 ARG A CB  1 
ATOM   2015  C CG  . ARG A 1 257 ? 31.952  -1.845  49.997  1.00 23.13 ? 257 ARG A CG  1 
ATOM   2016  C CD  . ARG A 1 257 ? 33.036  -1.657  51.077  1.00 28.15 ? 257 ARG A CD  1 
ATOM   2017  N NE  . ARG A 1 257 ? 33.912  -2.785  50.879  1.00 35.04 ? 257 ARG A NE  1 
ATOM   2018  C CZ  . ARG A 1 257 ? 34.035  -3.903  51.583  1.00 28.39 ? 257 ARG A CZ  1 
ATOM   2019  N NH1 . ARG A 1 257 ? 33.452  -4.157  52.767  1.00 26.92 ? 257 ARG A NH1 1 
ATOM   2020  N NH2 . ARG A 1 257 ? 34.842  -4.782  51.055  1.00 27.86 ? 257 ARG A NH2 1 
ATOM   2021  N N   . ALA A 1 258 ? 28.888  -2.599  48.777  1.00 25.96 ? 258 ALA A N   1 
ATOM   2022  C CA  . ALA A 1 258 ? 27.791  -2.755  49.730  1.00 24.79 ? 258 ALA A CA  1 
ATOM   2023  C C   . ALA A 1 258 ? 28.296  -3.422  51.026  1.00 25.16 ? 258 ALA A C   1 
ATOM   2024  O O   . ALA A 1 258 ? 28.945  -4.469  50.985  1.00 24.69 ? 258 ALA A O   1 
ATOM   2025  C CB  . ALA A 1 258 ? 26.711  -3.547  49.120  1.00 25.33 ? 258 ALA A CB  1 
ATOM   2026  N N   . ASP A 1 259 ? 27.997  -2.812  52.174  1.00 23.83 ? 259 ASP A N   1 
ATOM   2027  C CA  . ASP A 1 259 ? 28.331  -3.407  53.471  1.00 24.63 ? 259 ASP A CA  1 
ATOM   2028  C C   . ASP A 1 259 ? 27.021  -3.724  54.187  1.00 23.84 ? 259 ASP A C   1 
ATOM   2029  O O   . ASP A 1 259 ? 26.022  -3.047  53.952  1.00 23.39 ? 259 ASP A O   1 
ATOM   2030  C CB  . ASP A 1 259 ? 29.084  -2.417  54.349  1.00 24.22 ? 259 ASP A CB  1 
ATOM   2031  C CG  . ASP A 1 259 ? 30.598  -2.390  54.090  1.00 27.76 ? 259 ASP A CG  1 
ATOM   2032  O OD1 . ASP A 1 259 ? 31.343  -3.276  54.597  1.00 26.81 ? 259 ASP A OD1 1 
ATOM   2033  O OD2 . ASP A 1 259 ? 31.053  -1.427  53.425  1.00 27.83 ? 259 ASP A OD2 1 
ATOM   2034  N N   . SER A 1 260 ? 27.051  -4.707  55.092  1.00 24.57 ? 260 SER A N   1 
ATOM   2035  C CA  . SER A 1 260 ? 25.861  -5.120  55.830  1.00 24.01 ? 260 SER A CA  1 
ATOM   2036  C C   . SER A 1 260 ? 26.149  -5.226  57.316  1.00 23.74 ? 260 SER A C   1 
ATOM   2037  O O   . SER A 1 260 ? 27.259  -5.636  57.742  1.00 22.50 ? 260 SER A O   1 
ATOM   2038  C CB  . SER A 1 260 ? 25.304  -6.447  55.282  1.00 25.89 ? 260 SER A CB  1 
ATOM   2039  O OG  . SER A 1 260 ? 24.057  -6.733  55.895  1.00 26.74 ? 260 SER A OG  1 
ATOM   2040  N N   . PHE A 1 261 ? 25.162  -4.805  58.093  1.00 21.62 ? 261 PHE A N   1 
ATOM   2041  C CA  . PHE A 1 261 ? 25.133  -5.091  59.516  1.00 22.78 ? 261 PHE A CA  1 
ATOM   2042  C C   . PHE A 1 261 ? 24.248  -6.301  59.842  1.00 21.79 ? 261 PHE A C   1 
ATOM   2043  O O   . PHE A 1 261 ? 24.029  -6.589  61.013  1.00 21.63 ? 261 PHE A O   1 
ATOM   2044  C CB  . PHE A 1 261 ? 24.625  -3.870  60.265  1.00 23.39 ? 261 PHE A CB  1 
ATOM   2045  C CG  . PHE A 1 261 ? 25.674  -2.778  60.437  1.00 25.99 ? 261 PHE A CG  1 
ATOM   2046  C CD1 . PHE A 1 261 ? 27.042  -3.095  60.477  1.00 28.85 ? 261 PHE A CD1 1 
ATOM   2047  C CD2 . PHE A 1 261 ? 25.293  -1.454  60.568  1.00 27.87 ? 261 PHE A CD2 1 
ATOM   2048  C CE1 . PHE A 1 261 ? 28.001  -2.107  60.661  1.00 29.55 ? 261 PHE A CE1 1 
ATOM   2049  C CE2 . PHE A 1 261 ? 26.251  -0.438  60.745  1.00 29.46 ? 261 PHE A CE2 1 
ATOM   2050  C CZ  . PHE A 1 261 ? 27.613  -0.777  60.812  1.00 28.20 ? 261 PHE A CZ  1 
ATOM   2051  N N   . SER A 1 262 ? 23.743  -6.987  58.811  1.00 22.64 ? 262 SER A N   1 
ATOM   2052  C CA  . SER A 1 262 ? 22.748  -8.068  58.981  1.00 23.99 ? 262 SER A CA  1 
ATOM   2053  C C   . SER A 1 262 ? 23.312  -9.286  59.692  1.00 24.93 ? 262 SER A C   1 
ATOM   2054  O O   . SER A 1 262 ? 22.596  -9.954  60.425  1.00 26.61 ? 262 SER A O   1 
ATOM   2055  C CB  . SER A 1 262 ? 22.186  -8.511  57.645  1.00 23.01 ? 262 SER A CB  1 
ATOM   2056  O OG  . SER A 1 262 ? 21.444  -7.471  57.046  1.00 21.20 ? 262 SER A OG  1 
ATOM   2057  N N   . LYS A 1 263 ? 24.591  -9.572  59.482  1.00 25.58 ? 263 LYS A N   1 
ATOM   2058  C CA  . LYS A 1 263 ? 25.227  -10.746 60.128  1.00 26.88 ? 263 LYS A CA  1 
ATOM   2059  C C   . LYS A 1 263 ? 25.805  -10.433 61.492  1.00 27.37 ? 263 LYS A C   1 
ATOM   2060  O O   . LYS A 1 263 ? 26.020  -11.337 62.311  1.00 28.88 ? 263 LYS A O   1 
ATOM   2061  C CB  . LYS A 1 263 ? 26.321  -11.325 59.224  1.00 27.80 ? 263 LYS A CB  1 
ATOM   2062  C CG  . LYS A 1 263 ? 25.769  -12.131 58.078  1.00 29.24 ? 263 LYS A CG  1 
ATOM   2063  C CD  . LYS A 1 263 ? 25.178  -11.260 57.028  1.00 34.19 ? 263 LYS A CD  1 
ATOM   2064  C CE  . LYS A 1 263 ? 24.020  -11.972 56.357  1.00 36.17 ? 263 LYS A CE  1 
ATOM   2065  N NZ  . LYS A 1 263 ? 23.629  -11.172 55.187  1.00 37.86 ? 263 LYS A NZ  1 
ATOM   2066  N N   . ILE A 1 264 ? 26.050  -9.157  61.767  1.00 26.54 ? 264 ILE A N   1 
ATOM   2067  C CA  . ILE A 1 264 ? 26.781  -8.848  62.992  1.00 26.43 ? 264 ILE A CA  1 
ATOM   2068  C C   . ILE A 1 264 ? 25.996  -8.076  64.039  1.00 25.22 ? 264 ILE A C   1 
ATOM   2069  O O   . ILE A 1 264 ? 26.246  -8.257  65.222  1.00 26.39 ? 264 ILE A O   1 
ATOM   2070  C CB  . ILE A 1 264 ? 28.164  -8.192  62.754  1.00 26.61 ? 264 ILE A CB  1 
ATOM   2071  C CG1 . ILE A 1 264 ? 28.052  -6.921  61.893  1.00 28.17 ? 264 ILE A CG1 1 
ATOM   2072  C CG2 . ILE A 1 264 ? 29.153  -9.203  62.118  1.00 25.38 ? 264 ILE A CG2 1 
ATOM   2073  C CD1 . ILE A 1 264 ? 29.310  -6.032  62.003  1.00 27.53 ? 264 ILE A CD1 1 
ATOM   2074  N N   . ILE A 1 265 ? 25.040  -7.255  63.612  1.00 23.93 ? 265 ILE A N   1 
ATOM   2075  C CA  . ILE A 1 265 ? 24.338  -6.393  64.552  1.00 23.40 ? 265 ILE A CA  1 
ATOM   2076  C C   . ILE A 1 265 ? 22.849  -6.653  64.552  1.00 22.75 ? 265 ILE A C   1 
ATOM   2077  O O   . ILE A 1 265 ? 22.243  -6.772  65.618  1.00 23.52 ? 265 ILE A O   1 
ATOM   2078  C CB  . ILE A 1 265 ? 24.646  -4.896  64.299  1.00 23.47 ? 265 ILE A CB  1 
ATOM   2079  C CG1 . ILE A 1 265 ? 26.076  -4.588  64.781  1.00 26.52 ? 265 ILE A CG1 1 
ATOM   2080  C CG2 . ILE A 1 265 ? 23.681  -3.989  65.107  1.00 25.35 ? 265 ILE A CG2 1 
ATOM   2081  C CD1 . ILE A 1 265 ? 26.586  -3.224  64.439  1.00 26.84 ? 265 ILE A CD1 1 
ATOM   2082  N N   . SER A 1 266 ? 22.275  -6.740  63.359  1.00 21.27 ? 266 SER A N   1 
ATOM   2083  C CA  . SER A 1 266 ? 20.899  -7.134  63.164  1.00 21.53 ? 266 SER A CA  1 
ATOM   2084  C C   . SER A 1 266 ? 20.497  -7.184  61.716  1.00 22.13 ? 266 SER A C   1 
ATOM   2085  O O   . SER A 1 266 ? 20.677  -6.209  60.955  1.00 22.13 ? 266 SER A O   1 
ATOM   2086  C CB  . SER A 1 266 ? 19.938  -6.193  63.901  1.00 21.63 ? 266 SER A CB  1 
ATOM   2087  O OG  . SER A 1 266 ? 18.614  -6.478  63.535  1.00 19.38 ? 266 SER A OG  1 
ATOM   2088  N N   . SER A 1 267 ? 19.923  -8.324  61.337  1.00 20.82 ? 267 SER A N   1 
ATOM   2089  C CA  . SER A 1 267 ? 19.295  -8.454  60.036  1.00 20.18 ? 267 SER A CA  1 
ATOM   2090  C C   . SER A 1 267 ? 17.882  -7.843  59.966  1.00 20.58 ? 267 SER A C   1 
ATOM   2091  O O   . SER A 1 267 ? 17.473  -7.317  58.919  1.00 20.79 ? 267 SER A O   1 
ATOM   2092  C CB  . SER A 1 267 ? 19.237  -9.952  59.670  1.00 18.66 ? 267 SER A CB  1 
ATOM   2093  O OG  . SER A 1 267 ? 18.801  -10.717 60.813  1.00 19.97 ? 267 SER A OG  1 
ATOM   2094  N N   . GLY A 1 268 ? 17.106  -7.997  61.044  1.00 20.85 ? 268 GLY A N   1 
ATOM   2095  C CA  . GLY A 1 268 ? 15.699  -7.560  61.062  1.00 19.91 ? 268 GLY A CA  1 
ATOM   2096  C C   . GLY A 1 268 ? 15.530  -6.049  61.136  1.00 20.88 ? 268 GLY A C   1 
ATOM   2097  O O   . GLY A 1 268 ? 14.496  -5.523  60.730  1.00 20.26 ? 268 GLY A O   1 
ATOM   2098  N N   . LEU A 1 269 ? 16.531  -5.350  61.651  1.00 18.73 ? 269 LEU A N   1 
ATOM   2099  C CA  . LEU A 1 269 ? 16.483  -3.881  61.636  1.00 20.24 ? 269 LEU A CA  1 
ATOM   2100  C C   . LEU A 1 269 ? 16.633  -3.227  60.250  1.00 20.75 ? 269 LEU A C   1 
ATOM   2101  O O   . LEU A 1 269 ? 16.337  -2.042  60.118  1.00 23.08 ? 269 LEU A O   1 
ATOM   2102  C CB  . LEU A 1 269 ? 17.542  -3.274  62.561  1.00 19.63 ? 269 LEU A CB  1 
ATOM   2103  C CG  . LEU A 1 269 ? 17.418  -3.459  64.065  1.00 19.11 ? 269 LEU A CG  1 
ATOM   2104  C CD1 . LEU A 1 269 ? 18.579  -2.727  64.691  1.00 16.89 ? 269 LEU A CD1 1 
ATOM   2105  C CD2 . LEU A 1 269 ? 16.102  -3.013  64.698  1.00 17.43 ? 269 LEU A CD2 1 
ATOM   2106  N N   . ARG A 1 270 ? 17.117  -3.964  59.248  1.00 21.19 ? 270 ARG A N   1 
ATOM   2107  C CA  . ARG A 1 270 ? 17.184  -3.480  57.829  1.00 21.56 ? 270 ARG A CA  1 
ATOM   2108  C C   . ARG A 1 270 ? 18.050  -2.200  57.741  1.00 23.14 ? 270 ARG A C   1 
ATOM   2109  O O   . ARG A 1 270 ? 17.558  -1.120  57.413  1.00 21.85 ? 270 ARG A O   1 
ATOM   2110  C CB  . ARG A 1 270 ? 15.789  -3.217  57.232  1.00 21.72 ? 270 ARG A CB  1 
ATOM   2111  C CG  . ARG A 1 270 ? 14.785  -4.419  57.292  1.00 24.31 ? 270 ARG A CG  1 
ATOM   2112  C CD  . ARG A 1 270 ? 15.544  -5.745  56.973  1.00 24.78 ? 270 ARG A CD  1 
ATOM   2113  N NE  . ARG A 1 270 ? 16.072  -5.798  55.626  1.00 25.81 ? 270 ARG A NE  1 
ATOM   2114  C CZ  . ARG A 1 270 ? 17.283  -6.272  55.281  1.00 23.85 ? 270 ARG A CZ  1 
ATOM   2115  N NH1 . ARG A 1 270 ? 18.153  -6.753  56.168  1.00 19.75 ? 270 ARG A NH1 1 
ATOM   2116  N NH2 . ARG A 1 270 ? 17.630  -6.278  54.014  1.00 21.37 ? 270 ARG A NH2 1 
ATOM   2117  N N   . ILE A 1 271 ? 19.329  -2.357  58.061  1.00 22.96 ? 271 ILE A N   1 
ATOM   2118  C CA  . ILE A 1 271 ? 20.273  -1.261  57.953  1.00 24.70 ? 271 ILE A CA  1 
ATOM   2119  C C   . ILE A 1 271 ? 21.554  -1.791  57.355  1.00 24.51 ? 271 ILE A C   1 
ATOM   2120  O O   . ILE A 1 271 ? 22.287  -2.571  57.998  1.00 26.91 ? 271 ILE A O   1 
ATOM   2121  C CB  . ILE A 1 271 ? 20.582  -0.567  59.355  1.00 24.99 ? 271 ILE A CB  1 
ATOM   2122  C CG1 . ILE A 1 271 ? 19.313  -0.048  60.039  1.00 22.65 ? 271 ILE A CG1 1 
ATOM   2123  C CG2 . ILE A 1 271 ? 21.636  0.536   59.227  1.00 26.24 ? 271 ILE A CG2 1 
ATOM   2124  C CD1 . ILE A 1 271 ? 18.776  1.255   59.558  1.00 24.63 ? 271 ILE A CD1 1 
ATOM   2125  N N   . GLY A 1 272 ? 21.843  -1.359  56.132  1.00 23.46 ? 272 GLY A N   1 
ATOM   2126  C CA  . GLY A 1 272 ? 23.146  -1.583  55.519  1.00 21.27 ? 272 GLY A CA  1 
ATOM   2127  C C   . GLY A 1 272 ? 23.679  -0.249  55.008  1.00 22.62 ? 272 GLY A C   1 
ATOM   2128  O O   . GLY A 1 272 ? 23.075  0.834   55.261  1.00 20.34 ? 272 GLY A O   1 
ATOM   2129  N N   . PHE A 1 273 ? 24.798  -0.301  54.291  1.00 22.09 ? 273 PHE A N   1 
ATOM   2130  C CA  . PHE A 1 273 ? 25.325  0.934   53.680  1.00 21.73 ? 273 PHE A CA  1 
ATOM   2131  C C   . PHE A 1 273 ? 26.073  0.664   52.381  1.00 22.83 ? 273 PHE A C   1 
ATOM   2132  O O   . PHE A 1 273 ? 26.618  -0.426  52.184  1.00 23.82 ? 273 PHE A O   1 
ATOM   2133  C CB  . PHE A 1 273 ? 26.131  1.795   54.672  1.00 20.64 ? 273 PHE A CB  1 
ATOM   2134  C CG  . PHE A 1 273 ? 27.232  1.073   55.404  1.00 21.63 ? 273 PHE A CG  1 
ATOM   2135  C CD1 . PHE A 1 273 ? 26.923  0.192   56.447  1.00 22.22 ? 273 PHE A CD1 1 
ATOM   2136  C CD2 . PHE A 1 273 ? 28.572  1.321   55.104  1.00 21.04 ? 273 PHE A CD2 1 
ATOM   2137  C CE1 . PHE A 1 273 ? 27.930  -0.473  57.151  1.00 24.84 ? 273 PHE A CE1 1 
ATOM   2138  C CE2 . PHE A 1 273 ? 29.584  0.674   55.801  1.00 26.50 ? 273 PHE A CE2 1 
ATOM   2139  C CZ  . PHE A 1 273 ? 29.261  -0.212  56.851  1.00 21.95 ? 273 PHE A CZ  1 
ATOM   2140  N N   . LEU A 1 274 ? 26.059  1.666   51.502  1.00 21.41 ? 274 LEU A N   1 
ATOM   2141  C CA  . LEU A 1 274 ? 26.592  1.599   50.163  1.00 21.81 ? 274 LEU A CA  1 
ATOM   2142  C C   . LEU A 1 274 ? 27.623  2.728   50.068  1.00 22.53 ? 274 LEU A C   1 
ATOM   2143  O O   . LEU A 1 274 ? 27.363  3.848   50.541  1.00 21.32 ? 274 LEU A O   1 
ATOM   2144  C CB  . LEU A 1 274 ? 25.431  1.844   49.185  1.00 22.51 ? 274 LEU A CB  1 
ATOM   2145  C CG  . LEU A 1 274 ? 25.612  1.590   47.689  1.00 24.34 ? 274 LEU A CG  1 
ATOM   2146  C CD1 . LEU A 1 274 ? 25.886  0.068   47.449  1.00 22.30 ? 274 LEU A CD1 1 
ATOM   2147  C CD2 . LEU A 1 274 ? 24.334  2.054   46.960  1.00 22.49 ? 274 LEU A CD2 1 
ATOM   2148  N N   . THR A 1 275 ? 28.815  2.412   49.546  1.00 22.97 ? 275 THR A N   1 
ATOM   2149  C CA  . THR A 1 275 ? 29.956  3.346   49.471  1.00 22.66 ? 275 THR A CA  1 
ATOM   2150  C C   . THR A 1 275 ? 30.359  3.340   47.996  1.00 23.94 ? 275 THR A C   1 
ATOM   2151  O O   . THR A 1 275 ? 30.280  2.276   47.314  1.00 23.57 ? 275 THR A O   1 
ATOM   2152  C CB  . THR A 1 275 ? 31.144  2.897   50.379  1.00 24.61 ? 275 THR A CB  1 
ATOM   2153  O OG1 . THR A 1 275 ? 30.671  2.648   51.725  1.00 25.19 ? 275 THR A OG1 1 
ATOM   2154  C CG2 . THR A 1 275 ? 32.266  3.977   50.443  1.00 21.38 ? 275 THR A CG2 1 
ATOM   2155  N N   . GLY A 1 276 ? 30.698  4.513   47.469  1.00 22.16 ? 276 GLY A N   1 
ATOM   2156  C CA  . GLY A 1 276 ? 31.202  4.576   46.125  1.00 23.64 ? 276 GLY A CA  1 
ATOM   2157  C C   . GLY A 1 276 ? 31.224  6.007   45.619  1.00 24.06 ? 276 GLY A C   1 
ATOM   2158  O O   . GLY A 1 276 ? 31.068  6.951   46.384  1.00 24.21 ? 276 GLY A O   1 
ATOM   2159  N N   . PRO A 1 277 ? 31.414  6.159   44.309  1.00 25.44 ? 277 PRO A N   1 
ATOM   2160  C CA  . PRO A 1 277 ? 31.587  7.465   43.689  1.00 25.00 ? 277 PRO A CA  1 
ATOM   2161  C C   . PRO A 1 277 ? 30.341  8.346   43.828  1.00 25.66 ? 277 PRO A C   1 
ATOM   2162  O O   . PRO A 1 277 ? 29.242  7.928   43.415  1.00 24.18 ? 277 PRO A O   1 
ATOM   2163  C CB  . PRO A 1 277 ? 31.824  7.115   42.197  1.00 25.38 ? 277 PRO A CB  1 
ATOM   2164  C CG  . PRO A 1 277 ? 32.231  5.649   42.191  1.00 24.66 ? 277 PRO A CG  1 
ATOM   2165  C CD  . PRO A 1 277 ? 31.462  5.050   43.326  1.00 24.08 ? 277 PRO A CD  1 
ATOM   2166  N N   . LYS A 1 278 ? 30.544  9.571   44.338  1.00 26.55 ? 278 LYS A N   1 
ATOM   2167  C CA  . LYS A 1 278 ? 29.478  10.584  44.522  1.00 26.97 ? 278 LYS A CA  1 
ATOM   2168  C C   . LYS A 1 278 ? 28.389  10.661  43.442  1.00 27.42 ? 278 LYS A C   1 
ATOM   2169  O O   . LYS A 1 278 ? 27.201  10.606  43.798  1.00 28.52 ? 278 LYS A O   1 
ATOM   2170  C CB  . LYS A 1 278 ? 30.071  11.986  44.813  1.00 28.05 ? 278 LYS A CB  1 
ATOM   2171  C CG  . LYS A 1 278 ? 29.134  12.977  45.537  1.00 27.78 ? 278 LYS A CG  1 
ATOM   2172  C CD  . LYS A 1 278 ? 29.934  14.082  46.277  1.00 29.92 ? 278 LYS A CD  1 
ATOM   2173  C CE  . LYS A 1 278 ? 29.007  14.965  47.126  1.00 33.08 ? 278 LYS A CE  1 
ATOM   2174  N NZ  . LYS A 1 278 ? 29.387  16.433  47.167  1.00 30.56 ? 278 LYS A NZ  1 
ATOM   2175  N N   . PRO A 1 279 ? 28.744  10.769  42.121  1.00 27.82 ? 279 PRO A N   1 
ATOM   2176  C CA  . PRO A 1 279 ? 27.628  10.827  41.142  1.00 26.45 ? 279 PRO A CA  1 
ATOM   2177  C C   . PRO A 1 279 ? 26.761  9.568   41.071  1.00 26.44 ? 279 PRO A C   1 
ATOM   2178  O O   . PRO A 1 279 ? 25.573  9.638   40.669  1.00 25.42 ? 279 PRO A O   1 
ATOM   2179  C CB  . PRO A 1 279 ? 28.351  11.056  39.779  1.00 26.92 ? 279 PRO A CB  1 
ATOM   2180  C CG  . PRO A 1 279 ? 29.702  11.591  40.146  1.00 26.51 ? 279 PRO A CG  1 
ATOM   2181  C CD  . PRO A 1 279 ? 30.053  10.895  41.434  1.00 27.33 ? 279 PRO A CD  1 
ATOM   2182  N N   . LEU A 1 280 ? 27.343  8.406   41.392  1.00 25.23 ? 280 LEU A N   1 
ATOM   2183  C CA  . LEU A 1 280 ? 26.564  7.163   41.435  1.00 24.81 ? 280 LEU A CA  1 
ATOM   2184  C C   . LEU A 1 280 ? 25.748  6.998   42.742  1.00 24.19 ? 280 LEU A C   1 
ATOM   2185  O O   . LEU A 1 280 ? 24.617  6.534   42.722  1.00 24.85 ? 280 LEU A O   1 
ATOM   2186  C CB  . LEU A 1 280 ? 27.471  5.937   41.191  1.00 25.55 ? 280 LEU A CB  1 
ATOM   2187  C CG  . LEU A 1 280 ? 28.167  5.913   39.813  1.00 25.56 ? 280 LEU A CG  1 
ATOM   2188  C CD1 . LEU A 1 280 ? 28.874  4.583   39.580  1.00 26.49 ? 280 LEU A CD1 1 
ATOM   2189  C CD2 . LEU A 1 280 ? 27.178  6.155   38.681  1.00 23.86 ? 280 LEU A CD2 1 
ATOM   2190  N N   . ILE A 1 281 ? 26.326  7.365   43.871  1.00 23.32 ? 281 ILE A N   1 
ATOM   2191  C CA  . ILE A 1 281 ? 25.573  7.308   45.102  1.00 23.89 ? 281 ILE A CA  1 
ATOM   2192  C C   . ILE A 1 281 ? 24.350  8.279   44.995  1.00 24.97 ? 281 ILE A C   1 
ATOM   2193  O O   . ILE A 1 281 ? 23.221  7.947   45.396  1.00 23.30 ? 281 ILE A O   1 
ATOM   2194  C CB  . ILE A 1 281 ? 26.547  7.564   46.304  1.00 23.37 ? 281 ILE A CB  1 
ATOM   2195  C CG1 . ILE A 1 281 ? 27.612  6.428   46.413  1.00 24.91 ? 281 ILE A CG1 1 
ATOM   2196  C CG2 . ILE A 1 281 ? 25.816  7.854   47.644  1.00 23.62 ? 281 ILE A CG2 1 
ATOM   2197  C CD1 . ILE A 1 281 ? 27.051  4.947   46.487  1.00 24.76 ? 281 ILE A CD1 1 
ATOM   2198  N N   . GLU A 1 282 ? 24.574  9.453   44.387  1.00 24.33 ? 282 GLU A N   1 
ATOM   2199  C CA  . GLU A 1 282 ? 23.510  10.437  44.187  1.00 25.08 ? 282 GLU A CA  1 
ATOM   2200  C C   . GLU A 1 282 ? 22.296  9.860   43.445  1.00 24.68 ? 282 GLU A C   1 
ATOM   2201  O O   . GLU A 1 282 ? 21.162  10.045  43.871  1.00 24.91 ? 282 GLU A O   1 
ATOM   2202  C CB  . GLU A 1 282 ? 24.044  11.667  43.425  1.00 25.60 ? 282 GLU A CB  1 
ATOM   2203  C CG  . GLU A 1 282 ? 22.936  12.695  43.170  1.00 28.75 ? 282 GLU A CG  1 
ATOM   2204  C CD  . GLU A 1 282 ? 23.326  13.779  42.167  1.00 33.50 ? 282 GLU A CD  1 
ATOM   2205  O OE1 . GLU A 1 282 ? 24.267  14.558  42.472  1.00 35.61 ? 282 GLU A OE1 1 
ATOM   2206  O OE2 . GLU A 1 282 ? 22.693  13.821  41.075  1.00 35.67 ? 282 GLU A OE2 1 
ATOM   2207  N N   . ARG A 1 283 ? 22.517  9.139   42.351  1.00 24.07 ? 283 ARG A N   1 
ATOM   2208  C CA  . ARG A 1 283 ? 21.406  8.449   41.669  1.00 23.95 ? 283 ARG A CA  1 
ATOM   2209  C C   . ARG A 1 283 ? 20.605  7.464   42.595  1.00 23.42 ? 283 ARG A C   1 
ATOM   2210  O O   . ARG A 1 283 ? 19.373  7.353   42.479  1.00 21.88 ? 283 ARG A O   1 
ATOM   2211  C CB  . ARG A 1 283 ? 21.896  7.702   40.412  1.00 24.78 ? 283 ARG A CB  1 
ATOM   2212  C CG  . ARG A 1 283 ? 22.629  8.566   39.339  1.00 27.18 ? 283 ARG A CG  1 
ATOM   2213  C CD  . ARG A 1 283 ? 22.335  10.095  39.444  1.00 31.28 ? 283 ARG A CD  1 
ATOM   2214  N NE  . ARG A 1 283 ? 21.084  10.473  38.817  1.00 29.58 ? 283 ARG A NE  1 
ATOM   2215  C CZ  . ARG A 1 283 ? 20.511  11.682  38.895  1.00 25.90 ? 283 ARG A CZ  1 
ATOM   2216  N NH1 . ARG A 1 283 ? 21.048  12.712  39.550  1.00 23.29 ? 283 ARG A NH1 1 
ATOM   2217  N NH2 . ARG A 1 283 ? 19.375  11.866  38.269  1.00 27.25 ? 283 ARG A NH2 1 
ATOM   2218  N N   . VAL A 1 284 ? 21.291  6.714   43.465  1.00 23.45 ? 284 VAL A N   1 
ATOM   2219  C CA  . VAL A 1 284 ? 20.551  5.749   44.338  1.00 23.10 ? 284 VAL A CA  1 
ATOM   2220  C C   . VAL A 1 284 ? 19.755  6.477   45.425  1.00 22.60 ? 284 VAL A C   1 
ATOM   2221  O O   . VAL A 1 284 ? 18.616  6.096   45.733  1.00 22.43 ? 284 VAL A O   1 
ATOM   2222  C CB  . VAL A 1 284 ? 21.412  4.536   44.923  1.00 24.20 ? 284 VAL A CB  1 
ATOM   2223  C CG1 . VAL A 1 284 ? 22.302  3.835   43.809  1.00 19.18 ? 284 VAL A CG1 1 
ATOM   2224  C CG2 . VAL A 1 284 ? 22.279  4.958   46.100  1.00 28.96 ? 284 VAL A CG2 1 
ATOM   2225  N N   . ILE A 1 285 ? 20.331  7.557   45.957  1.00 22.05 ? 285 ILE A N   1 
ATOM   2226  C CA  . ILE A 1 285 ? 19.615  8.432   46.913  1.00 21.63 ? 285 ILE A CA  1 
ATOM   2227  C C   . ILE A 1 285 ? 18.330  8.998   46.300  1.00 22.55 ? 285 ILE A C   1 
ATOM   2228  O O   . ILE A 1 285 ? 17.258  8.959   46.913  1.00 22.45 ? 285 ILE A O   1 
ATOM   2229  C CB  . ILE A 1 285 ? 20.570  9.518   47.490  1.00 21.92 ? 285 ILE A CB  1 
ATOM   2230  C CG1 . ILE A 1 285 ? 21.696  8.852   48.283  1.00 19.56 ? 285 ILE A CG1 1 
ATOM   2231  C CG2 . ILE A 1 285 ? 19.837  10.600  48.329  1.00 20.93 ? 285 ILE A CG2 1 
ATOM   2232  C CD1 . ILE A 1 285 ? 22.909  9.827   48.632  1.00 19.82 ? 285 ILE A CD1 1 
ATOM   2233  N N   . LEU A 1 286 ? 18.397  9.467   45.052  1.00 22.74 ? 286 LEU A N   1 
ATOM   2234  C CA  . LEU A 1 286 ? 17.165  9.995   44.408  1.00 22.63 ? 286 LEU A CA  1 
ATOM   2235  C C   . LEU A 1 286 ? 16.102  8.916   44.223  1.00 22.47 ? 286 LEU A C   1 
ATOM   2236  O O   . LEU A 1 286 ? 14.902  9.173   44.433  1.00 22.82 ? 286 LEU A O   1 
ATOM   2237  C CB  . LEU A 1 286 ? 17.483  10.722  43.103  1.00 21.59 ? 286 LEU A CB  1 
ATOM   2238  C CG  . LEU A 1 286 ? 18.403  11.933  43.243  1.00 23.94 ? 286 LEU A CG  1 
ATOM   2239  C CD1 . LEU A 1 286 ? 18.768  12.408  41.819  1.00 23.09 ? 286 LEU A CD1 1 
ATOM   2240  C CD2 . LEU A 1 286 ? 17.701  13.030  44.039  1.00 26.25 ? 286 LEU A CD2 1 
ATOM   2241  N N   . HIS A 1 287 ? 16.521  7.706   43.834  1.00 21.82 ? 287 HIS A N   1 
ATOM   2242  C CA  . HIS A 1 287 ? 15.576  6.596   43.751  1.00 21.49 ? 287 HIS A CA  1 
ATOM   2243  C C   . HIS A 1 287 ? 15.037  6.235   45.136  1.00 21.59 ? 287 HIS A C   1 
ATOM   2244  O O   . HIS A 1 287 ? 13.841  6.014   45.291  1.00 20.72 ? 287 HIS A O   1 
ATOM   2245  C CB  . HIS A 1 287 ? 16.210  5.366   43.086  1.00 21.96 ? 287 HIS A CB  1 
ATOM   2246  C CG  . HIS A 1 287 ? 15.226  4.349   42.606  1.00 23.21 ? 287 HIS A CG  1 
ATOM   2247  N ND1 . HIS A 1 287 ? 15.589  3.302   41.777  1.00 25.07 ? 287 HIS A ND1 1 
ATOM   2248  C CD2 . HIS A 1 287 ? 13.895  4.222   42.813  1.00 24.21 ? 287 HIS A CD2 1 
ATOM   2249  C CE1 . HIS A 1 287 ? 14.526  2.558   41.525  1.00 26.71 ? 287 HIS A CE1 1 
ATOM   2250  N NE2 . HIS A 1 287 ? 13.488  3.089   42.149  1.00 27.61 ? 287 HIS A NE2 1 
ATOM   2251  N N   . ILE A 1 288 ? 15.887  6.180   46.155  1.00 22.39 ? 288 ILE A N   1 
ATOM   2252  C CA  . ILE A 1 288 ? 15.301  5.950   47.477  1.00 24.11 ? 288 ILE A CA  1 
ATOM   2253  C C   . ILE A 1 288 ? 14.376  7.073   47.954  1.00 23.68 ? 288 ILE A C   1 
ATOM   2254  O O   . ILE A 1 288 ? 13.347  6.796   48.591  1.00 23.06 ? 288 ILE A O   1 
ATOM   2255  C CB  . ILE A 1 288 ? 16.276  5.439   48.608  1.00 25.73 ? 288 ILE A CB  1 
ATOM   2256  C CG1 . ILE A 1 288 ? 16.741  6.549   49.524  1.00 27.07 ? 288 ILE A CG1 1 
ATOM   2257  C CG2 . ILE A 1 288 ? 17.393  4.432   48.146  1.00 25.22 ? 288 ILE A CG2 1 
ATOM   2258  C CD1 . ILE A 1 288 ? 15.975  6.549   50.713  1.00 28.58 ? 288 ILE A CD1 1 
ATOM   2259  N N   . GLN A 1 289 ? 14.705  8.327   47.625  1.00 23.25 ? 289 GLN A N   1 
ATOM   2260  C CA  . GLN A 1 289 ? 13.822  9.477   47.973  1.00 23.88 ? 289 GLN A CA  1 
ATOM   2261  C C   . GLN A 1 289 ? 12.421  9.284   47.436  1.00 22.31 ? 289 GLN A C   1 
ATOM   2262  O O   . GLN A 1 289 ? 11.480  9.789   47.970  1.00 23.28 ? 289 GLN A O   1 
ATOM   2263  C CB  . GLN A 1 289 ? 14.349  10.827  47.427  1.00 23.07 ? 289 GLN A CB  1 
ATOM   2264  C CG  . GLN A 1 289 ? 15.573  11.323  48.126  1.00 27.90 ? 289 GLN A CG  1 
ATOM   2265  C CD  . GLN A 1 289 ? 15.922  12.766  47.773  1.00 29.96 ? 289 GLN A CD  1 
ATOM   2266  O OE1 . GLN A 1 289 ? 15.786  13.188  46.630  1.00 33.58 ? 289 GLN A OE1 1 
ATOM   2267  N NE2 . GLN A 1 289 ? 16.428  13.511  48.753  1.00 33.55 ? 289 GLN A NE2 1 
ATOM   2268  N N   . VAL A 1 290 ? 12.276  8.558   46.352  1.00 22.48 ? 290 VAL A N   1 
ATOM   2269  C CA  . VAL A 1 290 ? 10.924  8.289   45.845  1.00 21.88 ? 290 VAL A CA  1 
ATOM   2270  C C   . VAL A 1 290 ? 10.363  6.887   46.232  1.00 22.75 ? 290 VAL A C   1 
ATOM   2271  O O   . VAL A 1 290 ? 9.235   6.525   45.880  1.00 20.68 ? 290 VAL A O   1 
ATOM   2272  C CB  . VAL A 1 290 ? 10.817  8.616   44.331  1.00 23.14 ? 290 VAL A CB  1 
ATOM   2273  C CG1 . VAL A 1 290 ? 11.099  10.124  44.102  1.00 21.77 ? 290 VAL A CG1 1 
ATOM   2274  C CG2 . VAL A 1 290 ? 11.760  7.767   43.492  1.00 20.16 ? 290 VAL A CG2 1 
ATOM   2275  N N   . SER A 1 291 ? 11.147  6.096   46.971  1.00 23.87 ? 291 SER A N   1 
ATOM   2276  C CA  . SER A 1 291 ? 10.663  4.764   47.356  1.00 24.69 ? 291 SER A CA  1 
ATOM   2277  C C   . SER A 1 291 ? 10.557  4.597   48.866  1.00 24.70 ? 291 SER A C   1 
ATOM   2278  O O   . SER A 1 291 ? 9.507   4.880   49.427  1.00 27.60 ? 291 SER A O   1 
ATOM   2279  C CB  . SER A 1 291 ? 11.427  3.635   46.656  1.00 25.50 ? 291 SER A CB  1 
ATOM   2280  O OG  . SER A 1 291 ? 12.813  3.725   46.894  1.00 28.10 ? 291 SER A OG  1 
ATOM   2281  N N   . THR A 1 292 ? 11.620  4.223   49.557  1.00 23.76 ? 292 THR A N   1 
ATOM   2282  C CA  . THR A 1 292 ? 11.498  4.103   51.023  1.00 22.36 ? 292 THR A CA  1 
ATOM   2283  C C   . THR A 1 292 ? 11.525  5.468   51.778  1.00 21.89 ? 292 THR A C   1 
ATOM   2284  O O   . THR A 1 292 ? 11.123  5.521   52.936  1.00 19.97 ? 292 THR A O   1 
ATOM   2285  C CB  . THR A 1 292 ? 12.549  3.220   51.598  1.00 21.89 ? 292 THR A CB  1 
ATOM   2286  O OG1 . THR A 1 292 ? 13.824  3.598   51.057  1.00 22.09 ? 292 THR A OG1 1 
ATOM   2287  C CG2 . THR A 1 292 ? 12.272  1.797   51.288  1.00 21.45 ? 292 THR A CG2 1 
ATOM   2288  N N   . LEU A 1 293 ? 11.941  6.525   51.072  1.00 21.69 ? 293 LEU A N   1 
ATOM   2289  C CA  . LEU A 1 293 ? 12.151  7.872   51.585  1.00 22.84 ? 293 LEU A CA  1 
ATOM   2290  C C   . LEU A 1 293 ? 13.414  7.960   52.417  1.00 22.46 ? 293 LEU A C   1 
ATOM   2291  O O   . LEU A 1 293 ? 14.250  8.806   52.164  1.00 21.87 ? 293 LEU A O   1 
ATOM   2292  C CB  . LEU A 1 293 ? 10.941  8.410   52.377  1.00 23.52 ? 293 LEU A CB  1 
ATOM   2293  C CG  . LEU A 1 293 ? 9.624   8.754   51.678  1.00 25.20 ? 293 LEU A CG  1 
ATOM   2294  C CD1 . LEU A 1 293 ? 8.790   9.659   52.619  1.00 26.27 ? 293 LEU A CD1 1 
ATOM   2295  C CD2 . LEU A 1 293 ? 9.840   9.476   50.363  1.00 28.56 ? 293 LEU A CD2 1 
ATOM   2296  N N   . HIS A 1 294 ? 13.555  7.044   53.380  1.00 22.11 ? 294 HIS A N   1 
ATOM   2297  C CA  . HIS A 1 294 ? 14.730  6.947   54.212  1.00 21.42 ? 294 HIS A CA  1 
ATOM   2298  C C   . HIS A 1 294 ? 14.704  5.613   55.023  1.00 21.49 ? 294 HIS A C   1 
ATOM   2299  O O   . HIS A 1 294 ? 13.668  4.989   55.129  1.00 22.19 ? 294 HIS A O   1 
ATOM   2300  C CB  . HIS A 1 294 ? 14.795  8.176   55.129  1.00 20.95 ? 294 HIS A CB  1 
ATOM   2301  C CG  . HIS A 1 294 ? 13.748  8.210   56.201  1.00 21.94 ? 294 HIS A CG  1 
ATOM   2302  N ND1 . HIS A 1 294 ? 12.603  8.978   56.117  1.00 26.50 ? 294 HIS A ND1 1 
ATOM   2303  C CD2 . HIS A 1 294 ? 13.698  7.595   57.403  1.00 19.33 ? 294 HIS A CD2 1 
ATOM   2304  C CE1 . HIS A 1 294 ? 11.885  8.812   57.213  1.00 18.07 ? 294 HIS A CE1 1 
ATOM   2305  N NE2 . HIS A 1 294 ? 12.535  7.986   58.009  1.00 24.40 ? 294 HIS A NE2 1 
ATOM   2306  N N   . PRO A 1 295 ? 15.844  5.191   55.606  1.00 21.85 ? 295 PRO A N   1 
ATOM   2307  C CA  . PRO A 1 295 ? 15.762  4.051   56.545  1.00 21.43 ? 295 PRO A CA  1 
ATOM   2308  C C   . PRO A 1 295 ? 15.142  4.477   57.896  1.00 20.81 ? 295 PRO A C   1 
ATOM   2309  O O   . PRO A 1 295 ? 15.278  5.643   58.305  1.00 19.38 ? 295 PRO A O   1 
ATOM   2310  C CB  . PRO A 1 295 ? 17.223  3.656   56.762  1.00 20.39 ? 295 PRO A CB  1 
ATOM   2311  C CG  . PRO A 1 295 ? 18.010  4.400   55.713  1.00 23.37 ? 295 PRO A CG  1 
ATOM   2312  C CD  . PRO A 1 295 ? 17.227  5.669   55.472  1.00 21.36 ? 295 PRO A CD  1 
ATOM   2313  N N   . SER A 1 296 ? 14.538  3.506   58.582  1.00 21.33 ? 296 SER A N   1 
ATOM   2314  C CA  . SER A 1 296 ? 13.901  3.743   59.881  1.00 21.46 ? 296 SER A CA  1 
ATOM   2315  C C   . SER A 1 296 ? 14.786  4.649   60.692  1.00 20.73 ? 296 SER A C   1 
ATOM   2316  O O   . SER A 1 296 ? 15.949  4.328   60.979  1.00 22.03 ? 296 SER A O   1 
ATOM   2317  C CB  . SER A 1 296 ? 13.675  2.449   60.651  1.00 20.83 ? 296 SER A CB  1 
ATOM   2318  O OG  . SER A 1 296 ? 13.216  2.738   61.970  1.00 22.54 ? 296 SER A OG  1 
ATOM   2319  N N   . THR A 1 297 ? 14.259  5.793   61.098  1.00 21.30 ? 297 THR A N   1 
ATOM   2320  C CA  . THR A 1 297 ? 15.111  6.654   61.959  1.00 19.65 ? 297 THR A CA  1 
ATOM   2321  C C   . THR A 1 297 ? 15.361  6.122   63.384  1.00 18.80 ? 297 THR A C   1 
ATOM   2322  O O   . THR A 1 297 ? 16.461  6.157   63.857  1.00 16.55 ? 297 THR A O   1 
ATOM   2323  C CB  . THR A 1 297 ? 14.823  8.164   61.791  1.00 21.58 ? 297 THR A CB  1 
ATOM   2324  O OG1 . THR A 1 297 ? 15.168  8.918   62.961  1.00 23.46 ? 297 THR A OG1 1 
ATOM   2325  C CG2 . THR A 1 297 ? 13.457  8.454   61.269  1.00 16.32 ? 297 THR A CG2 1 
ATOM   2326  N N   . PHE A 1 298 ? 14.342  5.522   63.988  1.00 19.67 ? 298 PHE A N   1 
ATOM   2327  C CA  . PHE A 1 298 ? 14.480  4.743   65.244  1.00 17.52 ? 298 PHE A CA  1 
ATOM   2328  C C   . PHE A 1 298 ? 15.623  3.719   65.132  1.00 17.93 ? 298 PHE A C   1 
ATOM   2329  O O   . PHE A 1 298 ? 16.520  3.662   66.011  1.00 16.76 ? 298 PHE A O   1 
ATOM   2330  C CB  . PHE A 1 298 ? 13.148  4.025   65.500  1.00 18.47 ? 298 PHE A CB  1 
ATOM   2331  C CG  . PHE A 1 298 ? 12.986  3.517   66.890  1.00 19.38 ? 298 PHE A CG  1 
ATOM   2332  C CD1 . PHE A 1 298 ? 13.571  2.327   67.275  1.00 24.11 ? 298 PHE A CD1 1 
ATOM   2333  C CD2 . PHE A 1 298 ? 12.210  4.216   67.814  1.00 25.37 ? 298 PHE A CD2 1 
ATOM   2334  C CE1 . PHE A 1 298 ? 13.409  1.835   68.539  1.00 24.95 ? 298 PHE A CE1 1 
ATOM   2335  C CE2 . PHE A 1 298 ? 12.036  3.713   69.110  1.00 25.47 ? 298 PHE A CE2 1 
ATOM   2336  C CZ  . PHE A 1 298 ? 12.640  2.514   69.448  1.00 22.56 ? 298 PHE A CZ  1 
ATOM   2337  N N   . ASN A 1 299 ? 15.611  2.894   64.075  1.00 16.15 ? 299 ASN A N   1 
ATOM   2338  C CA  . ASN A 1 299 ? 16.654  1.830   63.933  1.00 16.80 ? 299 ASN A CA  1 
ATOM   2339  C C   . ASN A 1 299 ? 18.084  2.405   63.740  1.00 17.81 ? 299 ASN A C   1 
ATOM   2340  O O   . ASN A 1 299 ? 19.049  1.947   64.403  1.00 18.77 ? 299 ASN A O   1 
ATOM   2341  C CB  . ASN A 1 299 ? 16.311  0.765   62.865  1.00 17.05 ? 299 ASN A CB  1 
ATOM   2342  C CG  . ASN A 1 299 ? 14.948  0.057   63.083  1.00 17.04 ? 299 ASN A CG  1 
ATOM   2343  O OD1 . ASN A 1 299 ? 14.460  -0.620  62.155  1.00 23.37 ? 299 ASN A OD1 1 
ATOM   2344  N ND2 . ASN A 1 299 ? 14.351  0.160   64.276  1.00 15.73 ? 299 ASN A ND2 1 
ATOM   2345  N N   . GLN A 1 300 ? 18.227  3.425   62.884  1.00 18.63 ? 300 GLN A N   1 
ATOM   2346  C CA  . GLN A 1 300 ? 19.495  4.185   62.761  1.00 19.18 ? 300 GLN A CA  1 
ATOM   2347  C C   . GLN A 1 300 ? 20.002  4.736   64.101  1.00 19.31 ? 300 GLN A C   1 
ATOM   2348  O O   . GLN A 1 300 ? 21.187  4.612   64.429  1.00 21.28 ? 300 GLN A O   1 
ATOM   2349  C CB  . GLN A 1 300 ? 19.348  5.315   61.780  1.00 19.53 ? 300 GLN A CB  1 
ATOM   2350  C CG  . GLN A 1 300 ? 19.145  4.883   60.342  1.00 18.23 ? 300 GLN A CG  1 
ATOM   2351  C CD  . GLN A 1 300 ? 19.178  6.067   59.431  1.00 21.06 ? 300 GLN A CD  1 
ATOM   2352  O OE1 . GLN A 1 300 ? 20.261  6.564   59.101  1.00 21.30 ? 300 GLN A OE1 1 
ATOM   2353  N NE2 . GLN A 1 300 ? 17.996  6.546   59.018  1.00 18.22 ? 300 GLN A NE2 1 
ATOM   2354  N N   . LEU A 1 301 ? 19.107  5.326   64.885  1.00 20.31 ? 301 LEU A N   1 
ATOM   2355  C CA  . LEU A 1 301 ? 19.473  5.854   66.207  1.00 20.84 ? 301 LEU A CA  1 
ATOM   2356  C C   . LEU A 1 301 ? 19.931  4.763   67.143  1.00 20.98 ? 301 LEU A C   1 
ATOM   2357  O O   . LEU A 1 301 ? 20.913  4.935   67.834  1.00 21.64 ? 301 LEU A O   1 
ATOM   2358  C CB  . LEU A 1 301 ? 18.309  6.625   66.835  1.00 21.23 ? 301 LEU A CB  1 
ATOM   2359  C CG  . LEU A 1 301 ? 18.182  8.151   66.810  1.00 22.26 ? 301 LEU A CG  1 
ATOM   2360  C CD1 . LEU A 1 301 ? 19.130  8.887   65.921  1.00 22.85 ? 301 LEU A CD1 1 
ATOM   2361  C CD2 . LEU A 1 301 ? 16.701  8.603   66.673  1.00 22.09 ? 301 LEU A CD2 1 
ATOM   2362  N N   . MET A 1 302 ? 19.234  3.624   67.156  1.00 21.19 ? 302 MET A N   1 
ATOM   2363  C CA  . MET A 1 302 ? 19.663  2.501   67.995  1.00 20.54 ? 302 MET A CA  1 
ATOM   2364  C C   . MET A 1 302 ? 21.088  2.057   67.609  1.00 20.19 ? 302 MET A C   1 
ATOM   2365  O O   . MET A 1 302 ? 21.942  1.868   68.444  1.00 20.51 ? 302 MET A O   1 
ATOM   2366  C CB  . MET A 1 302 ? 18.714  1.317   67.826  1.00 20.90 ? 302 MET A CB  1 
ATOM   2367  C CG  . MET A 1 302 ? 17.275  1.462   68.336  1.00 22.15 ? 302 MET A CG  1 
ATOM   2368  S SD  . MET A 1 302 ? 16.358  0.014   67.727  1.00 25.43 ? 302 MET A SD  1 
ATOM   2369  C CE  . MET A 1 302 ? 17.356  -1.286  68.498  1.00 17.61 ? 302 MET A CE  1 
ATOM   2370  N N   . ILE A 1 303 ? 21.330  1.878   66.324  1.00 20.77 ? 303 ILE A N   1 
ATOM   2371  C CA  . ILE A 1 303 ? 22.649  1.489   65.818  1.00 20.03 ? 303 ILE A CA  1 
ATOM   2372  C C   . ILE A 1 303 ? 23.698  2.568   66.061  1.00 20.40 ? 303 ILE A C   1 
ATOM   2373  O O   . ILE A 1 303 ? 24.770  2.285   66.554  1.00 17.99 ? 303 ILE A O   1 
ATOM   2374  C CB  . ILE A 1 303 ? 22.576  1.006   64.363  1.00 20.98 ? 303 ILE A CB  1 
ATOM   2375  C CG1 . ILE A 1 303 ? 21.873  -0.353  64.353  1.00 20.34 ? 303 ILE A CG1 1 
ATOM   2376  C CG2 . ILE A 1 303 ? 24.000  0.875   63.700  1.00 22.88 ? 303 ILE A CG2 1 
ATOM   2377  C CD1 . ILE A 1 303 ? 21.590  -0.900  62.952  1.00 26.26 ? 303 ILE A CD1 1 
ATOM   2378  N N   . SER A 1 304 ? 23.354  3.811   65.764  1.00 21.00 ? 304 SER A N   1 
ATOM   2379  C CA  . SER A 1 304 ? 24.348  4.876   65.873  1.00 22.08 ? 304 SER A CA  1 
ATOM   2380  C C   . SER A 1 304 ? 24.728  5.062   67.329  1.00 21.57 ? 304 SER A C   1 
ATOM   2381  O O   . SER A 1 304 ? 25.896  5.224   67.631  1.00 22.65 ? 304 SER A O   1 
ATOM   2382  C CB  . SER A 1 304 ? 23.846  6.188   65.244  1.00 22.36 ? 304 SER A CB  1 
ATOM   2383  O OG  . SER A 1 304 ? 24.798  7.226   65.429  1.00 22.18 ? 304 SER A OG  1 
ATOM   2384  N N   . GLN A 1 305 ? 23.764  5.025   68.254  1.00 21.53 ? 305 GLN A N   1 
ATOM   2385  C CA  . GLN A 1 305 ? 24.116  5.167   69.673  1.00 21.86 ? 305 GLN A CA  1 
ATOM   2386  C C   . GLN A 1 305 ? 24.967  4.009   70.209  1.00 21.17 ? 305 GLN A C   1 
ATOM   2387  O O   . GLN A 1 305 ? 25.913  4.211   70.966  1.00 20.89 ? 305 GLN A O   1 
ATOM   2388  C CB  . GLN A 1 305 ? 22.892  5.455   70.530  1.00 22.17 ? 305 GLN A CB  1 
ATOM   2389  C CG  . GLN A 1 305 ? 22.468  6.953   70.350  1.00 27.92 ? 305 GLN A CG  1 
ATOM   2390  C CD  . GLN A 1 305 ? 21.056  7.289   70.846  1.00 30.37 ? 305 GLN A CD  1 
ATOM   2391  O OE1 . GLN A 1 305 ? 20.322  8.092   70.219  1.00 34.55 ? 305 GLN A OE1 1 
ATOM   2392  N NE2 . GLN A 1 305 ? 20.687  6.719   71.996  1.00 30.00 ? 305 GLN A NE2 1 
ATOM   2393  N N   . LEU A 1 306 ? 24.638  2.801   69.780  1.00 21.12 ? 306 LEU A N   1 
ATOM   2394  C CA  . LEU A 1 306 ? 25.437  1.603   70.055  1.00 21.37 ? 306 LEU A CA  1 
ATOM   2395  C C   . LEU A 1 306 ? 26.878  1.790   69.591  1.00 20.74 ? 306 LEU A C   1 
ATOM   2396  O O   . LEU A 1 306 ? 27.800  1.645   70.381  1.00 21.33 ? 306 LEU A O   1 
ATOM   2397  C CB  . LEU A 1 306 ? 24.816  0.361   69.382  1.00 21.07 ? 306 LEU A CB  1 
ATOM   2398  C CG  . LEU A 1 306 ? 25.634  -0.934  69.465  1.00 22.31 ? 306 LEU A CG  1 
ATOM   2399  C CD1 . LEU A 1 306 ? 25.437  -1.623  70.835  1.00 20.37 ? 306 LEU A CD1 1 
ATOM   2400  C CD2 . LEU A 1 306 ? 25.235  -1.844  68.318  1.00 20.37 ? 306 LEU A CD2 1 
ATOM   2401  N N   . LEU A 1 307 ? 27.036  2.173   68.326  1.00 20.88 ? 307 LEU A N   1 
ATOM   2402  C CA  . LEU A 1 307 ? 28.324  2.312   67.671  1.00 22.14 ? 307 LEU A CA  1 
ATOM   2403  C C   . LEU A 1 307 ? 29.141  3.416   68.345  1.00 22.79 ? 307 LEU A C   1 
ATOM   2404  O O   . LEU A 1 307 ? 30.309  3.222   68.612  1.00 23.45 ? 307 LEU A O   1 
ATOM   2405  C CB  . LEU A 1 307 ? 28.085  2.646   66.190  1.00 21.41 ? 307 LEU A CB  1 
ATOM   2406  C CG  . LEU A 1 307 ? 28.182  1.564   65.110  1.00 22.67 ? 307 LEU A CG  1 
ATOM   2407  C CD1 . LEU A 1 307 ? 28.076  0.127   65.601  1.00 22.35 ? 307 LEU A CD1 1 
ATOM   2408  C CD2 . LEU A 1 307 ? 27.326  1.832   63.847  1.00 21.77 ? 307 LEU A CD2 1 
ATOM   2409  N N   . HIS A 1 308 ? 28.503  4.544   68.661  1.00 23.71 ? 308 HIS A N   1 
ATOM   2410  C CA  . HIS A 1 308 ? 29.229  5.654   69.314  1.00 24.57 ? 308 HIS A CA  1 
ATOM   2411  C C   . HIS A 1 308 ? 29.689  5.356   70.737  1.00 25.79 ? 308 HIS A C   1 
ATOM   2412  O O   . HIS A 1 308 ? 30.766  5.801   71.139  1.00 25.48 ? 308 HIS A O   1 
ATOM   2413  C CB  . HIS A 1 308 ? 28.428  6.951   69.281  1.00 24.73 ? 308 HIS A CB  1 
ATOM   2414  C CG  . HIS A 1 308 ? 28.494  7.672   67.969  1.00 23.47 ? 308 HIS A CG  1 
ATOM   2415  N ND1 . HIS A 1 308 ? 27.672  7.366   66.904  1.00 25.96 ? 308 HIS A ND1 1 
ATOM   2416  C CD2 . HIS A 1 308 ? 29.290  8.691   67.553  1.00 20.83 ? 308 HIS A CD2 1 
ATOM   2417  C CE1 . HIS A 1 308 ? 27.961  8.171   65.890  1.00 25.38 ? 308 HIS A CE1 1 
ATOM   2418  N NE2 . HIS A 1 308 ? 28.938  8.982   66.262  1.00 19.34 ? 308 HIS A NE2 1 
ATOM   2419  N N   . GLU A 1 309 ? 28.872  4.635   71.510  1.00 26.66 ? 309 GLU A N   1 
ATOM   2420  C CA  . GLU A 1 309 ? 29.273  4.260   72.877  1.00 27.98 ? 309 GLU A CA  1 
ATOM   2421  C C   . GLU A 1 309 ? 30.374  3.213   72.874  1.00 27.28 ? 309 GLU A C   1 
ATOM   2422  O O   . GLU A 1 309 ? 31.279  3.282   73.690  1.00 27.50 ? 309 GLU A O   1 
ATOM   2423  C CB  . GLU A 1 309 ? 28.055  3.865   73.753  1.00 29.19 ? 309 GLU A CB  1 
ATOM   2424  C CG  . GLU A 1 309 ? 27.959  4.630   75.143  1.00 36.41 ? 309 GLU A CG  1 
ATOM   2425  C CD  . GLU A 1 309 ? 27.990  6.214   75.097  1.00 44.44 ? 309 GLU A CD  1 
ATOM   2426  O OE1 . GLU A 1 309 ? 28.056  6.788   76.213  1.00 48.50 ? 309 GLU A OE1 1 
ATOM   2427  O OE2 . GLU A 1 309 ? 27.951  6.904   74.013  1.00 46.67 ? 309 GLU A OE2 1 
ATOM   2428  N N   . TRP A 1 310 ? 30.336  2.273   71.927  1.00 27.37 ? 310 TRP A N   1 
ATOM   2429  C CA  . TRP A 1 310 ? 31.398  1.279   71.750  1.00 26.81 ? 310 TRP A CA  1 
ATOM   2430  C C   . TRP A 1 310 ? 32.692  1.910   71.264  1.00 28.21 ? 310 TRP A C   1 
ATOM   2431  O O   . TRP A 1 310 ? 33.776  1.466   71.614  1.00 28.35 ? 310 TRP A O   1 
ATOM   2432  C CB  . TRP A 1 310 ? 31.028  0.290   70.634  1.00 25.59 ? 310 TRP A CB  1 
ATOM   2433  C CG  . TRP A 1 310 ? 30.350  -0.939  71.095  1.00 24.78 ? 310 TRP A CG  1 
ATOM   2434  C CD1 . TRP A 1 310 ? 30.205  -1.381  72.388  1.00 27.27 ? 310 TRP A CD1 1 
ATOM   2435  C CD2 . TRP A 1 310 ? 29.750  -1.936  70.255  1.00 24.76 ? 310 TRP A CD2 1 
ATOM   2436  N NE1 . TRP A 1 310 ? 29.536  -2.602  72.400  1.00 26.71 ? 310 TRP A NE1 1 
ATOM   2437  C CE2 . TRP A 1 310 ? 29.251  -2.961  71.102  1.00 24.76 ? 310 TRP A CE2 1 
ATOM   2438  C CE3 . TRP A 1 310 ? 29.586  -2.061  68.863  1.00 22.37 ? 310 TRP A CE3 1 
ATOM   2439  C CZ2 . TRP A 1 310 ? 28.571  -4.083  70.602  1.00 25.44 ? 310 TRP A CZ2 1 
ATOM   2440  C CZ3 . TRP A 1 310 ? 28.904  -3.182  68.371  1.00 19.92 ? 310 TRP A CZ3 1 
ATOM   2441  C CH2 . TRP A 1 310 ? 28.410  -4.172  69.246  1.00 22.06 ? 310 TRP A CH2 1 
ATOM   2442  N N   . GLY A 1 311 ? 32.569  2.886   70.366  1.00 28.88 ? 311 GLY A N   1 
ATOM   2443  C CA  . GLY A 1 311 ? 33.732  3.381   69.652  1.00 30.03 ? 311 GLY A CA  1 
ATOM   2444  C C   . GLY A 1 311 ? 34.203  2.333   68.671  1.00 31.73 ? 311 GLY A C   1 
ATOM   2445  O O   . GLY A 1 311 ? 33.745  1.175   68.657  1.00 30.75 ? 311 GLY A O   1 
ATOM   2446  N N   . GLU A 1 312 ? 35.154  2.715   67.840  1.00 34.01 ? 312 GLU A N   1 
ATOM   2447  C CA  . GLU A 1 312 ? 35.700  1.769   66.864  1.00 35.82 ? 312 GLU A CA  1 
ATOM   2448  C C   . GLU A 1 312 ? 36.353  0.552   67.577  1.00 35.71 ? 312 GLU A C   1 
ATOM   2449  O O   . GLU A 1 312 ? 36.382  -0.547  67.025  1.00 35.77 ? 312 GLU A O   1 
ATOM   2450  C CB  . GLU A 1 312 ? 36.615  2.556   65.946  1.00 36.85 ? 312 GLU A CB  1 
ATOM   2451  C CG  . GLU A 1 312 ? 37.617  1.844   65.098  1.00 41.58 ? 312 GLU A CG  1 
ATOM   2452  C CD  . GLU A 1 312 ? 38.683  2.839   64.629  1.00 48.69 ? 312 GLU A CD  1 
ATOM   2453  O OE1 . GLU A 1 312 ? 39.879  2.627   64.942  1.00 49.72 ? 312 GLU A OE1 1 
ATOM   2454  O OE2 . GLU A 1 312 ? 38.305  3.874   64.001  1.00 51.66 ? 312 GLU A OE2 1 
ATOM   2455  N N   . GLU A 1 313 ? 36.787  0.741   68.826  1.00 35.40 ? 313 GLU A N   1 
ATOM   2456  C CA  . GLU A 1 313 ? 37.330  -0.349  69.619  1.00 36.23 ? 313 GLU A CA  1 
ATOM   2457  C C   . GLU A 1 313 ? 36.277  -1.377  70.016  1.00 34.93 ? 313 GLU A C   1 
ATOM   2458  O O   . GLU A 1 313 ? 36.466  -2.587  69.789  1.00 35.02 ? 313 GLU A O   1 
ATOM   2459  C CB  . GLU A 1 313 ? 38.067  0.152   70.865  1.00 36.53 ? 313 GLU A CB  1 
ATOM   2460  C CG  . GLU A 1 313 ? 39.556  0.053   70.764  1.00 42.31 ? 313 GLU A CG  1 
ATOM   2461  C CD  . GLU A 1 313 ? 40.203  1.326   70.235  1.00 48.02 ? 313 GLU A CD  1 
ATOM   2462  O OE1 . GLU A 1 313 ? 40.107  1.603   69.006  1.00 51.22 ? 313 GLU A OE1 1 
ATOM   2463  O OE2 . GLU A 1 313 ? 40.819  2.048   71.063  1.00 51.42 ? 313 GLU A OE2 1 
ATOM   2464  N N   . GLY A 1 314 ? 35.183  -0.895  70.611  1.00 33.23 ? 314 GLY A N   1 
ATOM   2465  C CA  . GLY A 1 314 ? 34.082  -1.745  71.038  1.00 30.81 ? 314 GLY A CA  1 
ATOM   2466  C C   . GLY A 1 314 ? 33.477  -2.449  69.831  1.00 29.93 ? 314 GLY A C   1 
ATOM   2467  O O   . GLY A 1 314 ? 33.077  -3.628  69.917  1.00 27.22 ? 314 GLY A O   1 
ATOM   2468  N N   . PHE A 1 315 ? 33.418  -1.729  68.703  1.00 28.04 ? 315 PHE A N   1 
ATOM   2469  C CA  . PHE A 1 315 ? 32.909  -2.299  67.455  1.00 27.98 ? 315 PHE A CA  1 
ATOM   2470  C C   . PHE A 1 315 ? 33.766  -3.484  66.985  1.00 28.73 ? 315 PHE A C   1 
ATOM   2471  O O   . PHE A 1 315 ? 33.256  -4.582  66.740  1.00 28.61 ? 315 PHE A O   1 
ATOM   2472  C CB  . PHE A 1 315 ? 32.811  -1.259  66.339  1.00 27.54 ? 315 PHE A CB  1 
ATOM   2473  C CG  . PHE A 1 315 ? 32.384  -1.852  65.023  1.00 27.46 ? 315 PHE A CG  1 
ATOM   2474  C CD1 . PHE A 1 315 ? 31.088  -2.336  64.841  1.00 24.77 ? 315 PHE A CD1 1 
ATOM   2475  C CD2 . PHE A 1 315 ? 33.288  -1.969  63.981  1.00 26.77 ? 315 PHE A CD2 1 
ATOM   2476  C CE1 . PHE A 1 315 ? 30.717  -2.887  63.649  1.00 28.15 ? 315 PHE A CE1 1 
ATOM   2477  C CE2 . PHE A 1 315 ? 32.908  -2.544  62.748  1.00 26.64 ? 315 PHE A CE2 1 
ATOM   2478  C CZ  . PHE A 1 315 ? 31.633  -2.998  62.584  1.00 25.99 ? 315 PHE A CZ  1 
ATOM   2479  N N   . MET A 1 316 ? 35.058  -3.243  66.843  1.00 28.71 ? 316 MET A N   1 
ATOM   2480  C CA  . MET A 1 316 ? 36.011  -4.282  66.447  1.00 31.28 ? 316 MET A CA  1 
ATOM   2481  C C   . MET A 1 316 ? 36.104  -5.455  67.442  1.00 30.17 ? 316 MET A C   1 
ATOM   2482  O O   . MET A 1 316 ? 36.306  -6.612  67.035  1.00 30.72 ? 316 MET A O   1 
ATOM   2483  C CB  . MET A 1 316 ? 37.399  -3.654  66.228  1.00 31.02 ? 316 MET A CB  1 
ATOM   2484  C CG  . MET A 1 316 ? 37.889  -3.650  64.777  1.00 37.34 ? 316 MET A CG  1 
ATOM   2485  S SD  . MET A 1 316 ? 36.725  -3.232  63.440  1.00 43.87 ? 316 MET A SD  1 
ATOM   2486  C CE  . MET A 1 316 ? 36.392  -1.517  63.857  1.00 44.55 ? 316 MET A CE  1 
ATOM   2487  N N   . ALA A 1 317 ? 35.952  -5.138  68.727  1.00 29.29 ? 317 ALA A N   1 
ATOM   2488  C CA  . ALA A 1 317 ? 35.944  -6.123  69.797  1.00 29.70 ? 317 ALA A CA  1 
ATOM   2489  C C   . ALA A 1 317 ? 34.721  -7.005  69.640  1.00 29.94 ? 317 ALA A C   1 
ATOM   2490  O O   . ALA A 1 317 ? 34.778  -8.207  69.895  1.00 30.71 ? 317 ALA A O   1 
ATOM   2491  C CB  . ALA A 1 317 ? 35.928  -5.457  71.147  1.00 29.21 ? 317 ALA A CB  1 
ATOM   2492  N N   . HIS A 1 318 ? 33.614  -6.405  69.220  1.00 28.60 ? 318 HIS A N   1 
ATOM   2493  C CA  . HIS A 1 318 ? 32.417  -7.165  68.974  1.00 27.31 ? 318 HIS A CA  1 
ATOM   2494  C C   . HIS A 1 318 ? 32.574  -8.052  67.721  1.00 26.72 ? 318 HIS A C   1 
ATOM   2495  O O   . HIS A 1 318 ? 32.234  -9.239  67.793  1.00 26.77 ? 318 HIS A O   1 
ATOM   2496  C CB  . HIS A 1 318 ? 31.197  -6.253  68.863  1.00 27.12 ? 318 HIS A CB  1 
ATOM   2497  C CG  . HIS A 1 318 ? 29.953  -6.958  68.418  1.00 25.25 ? 318 HIS A CG  1 
ATOM   2498  N ND1 . HIS A 1 318 ? 29.493  -6.900  67.123  1.00 28.77 ? 318 HIS A ND1 1 
ATOM   2499  C CD2 . HIS A 1 318 ? 29.070  -7.728  69.090  1.00 24.55 ? 318 HIS A CD2 1 
ATOM   2500  C CE1 . HIS A 1 318 ? 28.387  -7.613  67.010  1.00 22.33 ? 318 HIS A CE1 1 
ATOM   2501  N NE2 . HIS A 1 318 ? 28.107  -8.123  68.189  1.00 23.13 ? 318 HIS A NE2 1 
ATOM   2502  N N   . VAL A 1 319 ? 33.074  -7.529  66.595  1.00 26.35 ? 319 VAL A N   1 
ATOM   2503  C CA  . VAL A 1 319 ? 33.147  -8.391  65.417  1.00 26.47 ? 319 VAL A CA  1 
ATOM   2504  C C   . VAL A 1 319 ? 34.094  -9.568  65.665  1.00 27.89 ? 319 VAL A C   1 
ATOM   2505  O O   . VAL A 1 319 ? 33.880  -10.669 65.139  1.00 25.83 ? 319 VAL A O   1 
ATOM   2506  C CB  . VAL A 1 319 ? 33.443  -7.720  64.031  1.00 27.44 ? 319 VAL A CB  1 
ATOM   2507  C CG1 . VAL A 1 319 ? 32.747  -6.368  63.828  1.00 24.15 ? 319 VAL A CG1 1 
ATOM   2508  C CG2 . VAL A 1 319 ? 34.941  -7.832  63.573  1.00 27.21 ? 319 VAL A CG2 1 
ATOM   2509  N N   . ASP A 1 320 ? 35.119  -9.312  66.483  1.00 27.70 ? 320 ASP A N   1 
ATOM   2510  C CA  . ASP A 1 320 ? 36.064  -10.344 66.880  1.00 30.01 ? 320 ASP A CA  1 
ATOM   2511  C C   . ASP A 1 320 ? 35.392  -11.479 67.638  1.00 29.38 ? 320 ASP A C   1 
ATOM   2512  O O   . ASP A 1 320 ? 35.601  -12.630 67.309  1.00 29.70 ? 320 ASP A O   1 
ATOM   2513  C CB  . ASP A 1 320 ? 37.167  -9.749  67.727  1.00 31.03 ? 320 ASP A CB  1 
ATOM   2514  C CG  . ASP A 1 320 ? 38.520  -10.065 67.180  1.00 36.92 ? 320 ASP A CG  1 
ATOM   2515  O OD1 . ASP A 1 320 ? 39.034  -11.192 67.438  1.00 38.27 ? 320 ASP A OD1 1 
ATOM   2516  O OD2 . ASP A 1 320 ? 39.064  -9.176  66.478  1.00 40.68 ? 320 ASP A OD2 1 
ATOM   2517  N N   . ARG A 1 321 ? 34.576  -11.154 68.641  1.00 29.22 ? 321 ARG A N   1 
ATOM   2518  C CA  . ARG A 1 321 ? 33.861  -12.183 69.373  1.00 28.65 ? 321 ARG A CA  1 
ATOM   2519  C C   . ARG A 1 321 ? 32.847  -12.934 68.499  1.00 28.22 ? 321 ARG A C   1 
ATOM   2520  O O   . ARG A 1 321 ? 32.621  -14.120 68.713  1.00 27.22 ? 321 ARG A O   1 
ATOM   2521  C CB  . ARG A 1 321 ? 33.140  -11.611 70.597  1.00 29.07 ? 321 ARG A CB  1 
ATOM   2522  C CG  . ARG A 1 321 ? 34.002  -10.936 71.627  1.00 31.94 ? 321 ARG A CG  1 
ATOM   2523  C CD  . ARG A 1 321 ? 33.188  -10.569 72.886  1.00 35.03 ? 321 ARG A CD  1 
ATOM   2524  N NE  . ARG A 1 321 ? 32.188  -9.529  72.644  1.00 37.65 ? 321 ARG A NE  1 
ATOM   2525  C CZ  . ARG A 1 321 ? 32.448  -8.224  72.678  1.00 39.41 ? 321 ARG A CZ  1 
ATOM   2526  N NH1 . ARG A 1 321 ? 33.680  -7.812  72.937  1.00 39.68 ? 321 ARG A NH1 1 
ATOM   2527  N NH2 . ARG A 1 321 ? 31.485  -7.329  72.443  1.00 39.38 ? 321 ARG A NH2 1 
ATOM   2528  N N   . VAL A 1 322 ? 32.200  -12.262 67.541  1.00 25.90 ? 322 VAL A N   1 
ATOM   2529  C CA  . VAL A 1 322 ? 31.288  -13.009 66.662  1.00 26.05 ? 322 VAL A CA  1 
ATOM   2530  C C   . VAL A 1 322 ? 31.995  -13.914 65.644  1.00 25.64 ? 322 VAL A C   1 
ATOM   2531  O O   . VAL A 1 322 ? 31.481  -15.013 65.342  1.00 25.38 ? 322 VAL A O   1 
ATOM   2532  C CB  . VAL A 1 322 ? 30.060  -12.188 66.090  1.00 27.08 ? 322 VAL A CB  1 
ATOM   2533  C CG1 . VAL A 1 322 ? 30.249  -10.741 66.236  1.00 27.82 ? 322 VAL A CG1 1 
ATOM   2534  C CG2 . VAL A 1 322 ? 29.647  -12.615 64.643  1.00 25.59 ? 322 VAL A CG2 1 
ATOM   2535  N N   . ILE A 1 323 ? 33.154  -13.464 65.148  1.00 25.30 ? 323 ILE A N   1 
ATOM   2536  C CA  . ILE A 1 323 ? 33.993  -14.280 64.280  1.00 26.33 ? 323 ILE A CA  1 
ATOM   2537  C C   . ILE A 1 323 ? 34.417  -15.530 65.042  1.00 26.61 ? 323 ILE A C   1 
ATOM   2538  O O   . ILE A 1 323 ? 34.340  -16.654 64.499  1.00 24.91 ? 323 ILE A O   1 
ATOM   2539  C CB  . ILE A 1 323 ? 35.299  -13.582 63.766  1.00 26.19 ? 323 ILE A CB  1 
ATOM   2540  C CG1 . ILE A 1 323 ? 34.983  -12.473 62.745  1.00 26.55 ? 323 ILE A CG1 1 
ATOM   2541  C CG2 . ILE A 1 323 ? 36.257  -14.657 63.126  1.00 26.64 ? 323 ILE A CG2 1 
ATOM   2542  C CD1 . ILE A 1 323 ? 36.215  -11.623 62.303  1.00 24.99 ? 323 ILE A CD1 1 
ATOM   2543  N N   . ASP A 1 324 ? 34.853  -15.309 66.286  1.00 26.51 ? 324 ASP A N   1 
ATOM   2544  C CA  . ASP A 1 324 ? 35.209  -16.404 67.170  1.00 27.94 ? 324 ASP A CA  1 
ATOM   2545  C C   . ASP A 1 324 ? 34.080  -17.399 67.285  1.00 27.04 ? 324 ASP A C   1 
ATOM   2546  O O   . ASP A 1 324 ? 34.345  -18.605 67.208  1.00 27.29 ? 324 ASP A O   1 
ATOM   2547  C CB  . ASP A 1 324 ? 35.647  -15.926 68.543  1.00 29.15 ? 324 ASP A CB  1 
ATOM   2548  C CG  . ASP A 1 324 ? 37.091  -15.438 68.553  1.00 31.57 ? 324 ASP A CG  1 
ATOM   2549  O OD1 . ASP A 1 324 ? 37.801  -15.586 67.537  1.00 35.43 ? 324 ASP A OD1 1 
ATOM   2550  O OD2 . ASP A 1 324 ? 37.514  -14.889 69.585  1.00 35.51 ? 324 ASP A OD2 1 
ATOM   2551  N N   . PHE A 1 325 ? 32.841  -16.919 67.404  1.00 24.51 ? 325 PHE A N   1 
ATOM   2552  C CA  . PHE A 1 325 ? 31.685  -17.816 67.467  1.00 24.80 ? 325 PHE A CA  1 
ATOM   2553  C C   . PHE A 1 325 ? 31.446  -18.619 66.184  1.00 24.44 ? 325 PHE A C   1 
ATOM   2554  O O   . PHE A 1 325 ? 31.271  -19.855 66.217  1.00 22.86 ? 325 PHE A O   1 
ATOM   2555  C CB  . PHE A 1 325 ? 30.388  -17.083 67.851  1.00 24.87 ? 325 PHE A CB  1 
ATOM   2556  C CG  . PHE A 1 325 ? 29.157  -17.944 67.687  1.00 24.19 ? 325 PHE A CG  1 
ATOM   2557  C CD1 . PHE A 1 325 ? 28.777  -18.834 68.682  1.00 24.00 ? 325 PHE A CD1 1 
ATOM   2558  C CD2 . PHE A 1 325 ? 28.385  -17.868 66.533  1.00 25.36 ? 325 PHE A CD2 1 
ATOM   2559  C CE1 . PHE A 1 325 ? 27.678  -19.649 68.525  1.00 25.81 ? 325 PHE A CE1 1 
ATOM   2560  C CE2 . PHE A 1 325 ? 27.275  -18.685 66.370  1.00 21.79 ? 325 PHE A CE2 1 
ATOM   2561  C CZ  . PHE A 1 325 ? 26.918  -19.570 67.376  1.00 24.26 ? 325 PHE A CZ  1 
ATOM   2562  N N   . TYR A 1 326 ? 31.407  -17.910 65.057  1.00 24.21 ? 326 TYR A N   1 
ATOM   2563  C CA  . TYR A 1 326 ? 31.267  -18.560 63.742  1.00 24.44 ? 326 TYR A CA  1 
ATOM   2564  C C   . TYR A 1 326 ? 32.422  -19.477 63.359  1.00 24.99 ? 326 TYR A C   1 
ATOM   2565  O O   . TYR A 1 326 ? 32.241  -20.423 62.600  1.00 24.93 ? 326 TYR A O   1 
ATOM   2566  C CB  . TYR A 1 326 ? 31.062  -17.526 62.644  1.00 24.70 ? 326 TYR A CB  1 
ATOM   2567  C CG  . TYR A 1 326 ? 29.653  -17.027 62.592  1.00 24.69 ? 326 TYR A CG  1 
ATOM   2568  C CD1 . TYR A 1 326 ? 28.690  -17.707 61.853  1.00 24.20 ? 326 TYR A CD1 1 
ATOM   2569  C CD2 . TYR A 1 326 ? 29.274  -15.869 63.288  1.00 26.78 ? 326 TYR A CD2 1 
ATOM   2570  C CE1 . TYR A 1 326 ? 27.384  -17.265 61.793  1.00 24.60 ? 326 TYR A CE1 1 
ATOM   2571  C CE2 . TYR A 1 326 ? 27.943  -15.420 63.253  1.00 22.13 ? 326 TYR A CE2 1 
ATOM   2572  C CZ  . TYR A 1 326 ? 27.027  -16.117 62.482  1.00 22.93 ? 326 TYR A CZ  1 
ATOM   2573  O OH  . TYR A 1 326 ? 25.740  -15.731 62.433  1.00 23.60 ? 326 TYR A OH  1 
ATOM   2574  N N   . SER A 1 327 ? 33.617  -19.175 63.838  1.00 25.40 ? 327 SER A N   1 
ATOM   2575  C CA  . SER A 1 327 ? 34.767  -20.021 63.543  1.00 26.99 ? 327 SER A CA  1 
ATOM   2576  C C   . SER A 1 327 ? 34.644  -21.352 64.293  1.00 26.78 ? 327 SER A C   1 
ATOM   2577  O O   . SER A 1 327 ? 35.012  -22.405 63.765  1.00 26.97 ? 327 SER A O   1 
ATOM   2578  C CB  . SER A 1 327 ? 36.056  -19.329 63.947  1.00 26.69 ? 327 SER A CB  1 
ATOM   2579  O OG  . SER A 1 327 ? 37.178  -20.083 63.506  1.00 32.07 ? 327 SER A OG  1 
ATOM   2580  N N   . ASN A 1 328 ? 34.148  -21.304 65.533  1.00 27.23 ? 328 ASN A N   1 
ATOM   2581  C CA  . ASN A 1 328 ? 33.895  -22.551 66.270  1.00 27.22 ? 328 ASN A CA  1 
ATOM   2582  C C   . ASN A 1 328 ? 32.782  -23.359 65.638  1.00 26.07 ? 328 ASN A C   1 
ATOM   2583  O O   . ASN A 1 328 ? 32.860  -24.586 65.583  1.00 26.01 ? 328 ASN A O   1 
ATOM   2584  C CB  . ASN A 1 328 ? 33.544  -22.267 67.718  1.00 27.99 ? 328 ASN A CB  1 
ATOM   2585  C CG  . ASN A 1 328 ? 34.750  -21.897 68.544  1.00 33.09 ? 328 ASN A CG  1 
ATOM   2586  O OD1 . ASN A 1 328 ? 34.695  -20.953 69.347  1.00 38.06 ? 328 ASN A OD1 1 
ATOM   2587  N ND2 . ASN A 1 328 ? 35.848  -22.656 68.383  1.00 36.94 ? 328 ASN A ND2 1 
ATOM   2588  N N   . GLN A 1 329 ? 31.749  -22.674 65.145  1.00 25.35 ? 329 GLN A N   1 
ATOM   2589  C CA  . GLN A 1 329 ? 30.686  -23.369 64.379  1.00 24.78 ? 329 GLN A CA  1 
ATOM   2590  C C   . GLN A 1 329 ? 31.252  -24.031 63.110  1.00 24.20 ? 329 GLN A C   1 
ATOM   2591  O O   . GLN A 1 329 ? 30.945  -25.182 62.782  1.00 25.55 ? 329 GLN A O   1 
ATOM   2592  C CB  . GLN A 1 329 ? 29.562  -22.382 64.041  1.00 24.98 ? 329 GLN A CB  1 
ATOM   2593  C CG  . GLN A 1 329 ? 28.771  -21.836 65.224  1.00 23.15 ? 329 GLN A CG  1 
ATOM   2594  C CD  . GLN A 1 329 ? 27.899  -22.890 65.880  1.00 27.27 ? 329 GLN A CD  1 
ATOM   2595  O OE1 . GLN A 1 329 ? 28.192  -23.321 66.983  1.00 28.95 ? 329 GLN A OE1 1 
ATOM   2596  N NE2 . GLN A 1 329 ? 26.830  -23.309 65.206  1.00 25.95 ? 329 GLN A NE2 1 
ATOM   2597  N N   . LYS A 1 330 ? 32.107  -23.310 62.415  1.00 24.31 ? 330 LYS A N   1 
ATOM   2598  C CA  . LYS A 1 330 ? 32.798  -23.829 61.243  1.00 24.90 ? 330 LYS A CA  1 
ATOM   2599  C C   . LYS A 1 330 ? 33.594  -25.129 61.540  1.00 25.08 ? 330 LYS A C   1 
ATOM   2600  O O   . LYS A 1 330 ? 33.470  -26.148 60.830  1.00 23.26 ? 330 LYS A O   1 
ATOM   2601  C CB  . LYS A 1 330 ? 33.736  -22.773 60.682  1.00 24.55 ? 330 LYS A CB  1 
ATOM   2602  C CG  . LYS A 1 330 ? 34.400  -23.203 59.373  1.00 26.88 ? 330 LYS A CG  1 
ATOM   2603  C CD  . LYS A 1 330 ? 35.672  -22.449 59.132  1.00 31.75 ? 330 LYS A CD  1 
ATOM   2604  C CE  . LYS A 1 330 ? 36.709  -22.810 60.152  1.00 32.91 ? 330 LYS A CE  1 
ATOM   2605  N NZ  . LYS A 1 330 ? 37.688  -21.709 60.328  1.00 38.87 ? 330 LYS A NZ  1 
ATOM   2606  N N   . ASP A 1 331 ? 34.408  -25.060 62.577  1.00 25.28 ? 331 ASP A N   1 
ATOM   2607  C CA  . ASP A 1 331 ? 35.178  -26.211 63.025  1.00 25.94 ? 331 ASP A CA  1 
ATOM   2608  C C   . ASP A 1 331 ? 34.261  -27.388 63.304  1.00 25.16 ? 331 ASP A C   1 
ATOM   2609  O O   . ASP A 1 331 ? 34.580  -28.521 62.924  1.00 25.48 ? 331 ASP A O   1 
ATOM   2610  C CB  . ASP A 1 331 ? 35.977  -25.837 64.279  1.00 25.46 ? 331 ASP A CB  1 
ATOM   2611  C CG  . ASP A 1 331 ? 37.099  -24.848 63.992  1.00 28.35 ? 331 ASP A CG  1 
ATOM   2612  O OD1 . ASP A 1 331 ? 37.471  -24.582 62.807  1.00 29.07 ? 331 ASP A OD1 1 
ATOM   2613  O OD2 . ASP A 1 331 ? 37.657  -24.363 64.981  1.00 30.01 ? 331 ASP A OD2 1 
ATOM   2614  N N   . ALA A 1 332 ? 33.094  -27.123 63.912  1.00 24.81 ? 332 ALA A N   1 
ATOM   2615  C CA  . ALA A 1 332 ? 32.192  -28.205 64.301  1.00 23.77 ? 332 ALA A CA  1 
ATOM   2616  C C   . ALA A 1 332 ? 31.525  -28.852 63.082  1.00 23.97 ? 332 ALA A C   1 
ATOM   2617  O O   . ALA A 1 332 ? 31.315  -30.075 63.058  1.00 23.44 ? 332 ALA A O   1 
ATOM   2618  C CB  . ALA A 1 332 ? 31.143  -27.746 65.349  1.00 24.27 ? 332 ALA A CB  1 
ATOM   2619  N N   . ILE A 1 333 ? 31.194  -28.047 62.073  1.00 22.18 ? 333 ILE A N   1 
ATOM   2620  C CA  . ILE A 1 333 ? 30.572  -28.588 60.881  1.00 22.08 ? 333 ILE A CA  1 
ATOM   2621  C C   . ILE A 1 333 ? 31.587  -29.330 59.994  1.00 23.01 ? 333 ILE A C   1 
ATOM   2622  O O   . ILE A 1 333 ? 31.237  -30.338 59.344  1.00 21.72 ? 333 ILE A O   1 
ATOM   2623  C CB  . ILE A 1 333 ? 29.693  -27.539 60.072  1.00 21.80 ? 333 ILE A CB  1 
ATOM   2624  C CG1 . ILE A 1 333 ? 28.707  -28.308 59.193  1.00 21.29 ? 333 ILE A CG1 1 
ATOM   2625  C CG2 . ILE A 1 333 ? 30.553  -26.588 59.250  1.00 22.18 ? 333 ILE A CG2 1 
ATOM   2626  C CD1 . ILE A 1 333 ? 27.611  -27.480 58.513  1.00 20.43 ? 333 ILE A CD1 1 
ATOM   2627  N N   . LEU A 1 334 ? 32.821  -28.812 59.956  1.00 22.96 ? 334 LEU A N   1 
ATOM   2628  C CA  . LEU A 1 334 ? 33.957  -29.518 59.315  1.00 23.97 ? 334 LEU A CA  1 
ATOM   2629  C C   . LEU A 1 334 ? 34.189  -30.891 59.985  1.00 23.77 ? 334 LEU A C   1 
ATOM   2630  O O   . LEU A 1 334 ? 34.384  -31.892 59.302  1.00 22.83 ? 334 LEU A O   1 
ATOM   2631  C CB  . LEU A 1 334 ? 35.225  -28.673 59.432  1.00 24.25 ? 334 LEU A CB  1 
ATOM   2632  C CG  . LEU A 1 334 ? 35.657  -27.821 58.242  1.00 26.52 ? 334 LEU A CG  1 
ATOM   2633  C CD1 . LEU A 1 334 ? 34.587  -27.562 57.236  1.00 26.70 ? 334 LEU A CD1 1 
ATOM   2634  C CD2 . LEU A 1 334 ? 36.351  -26.570 58.664  1.00 24.34 ? 334 LEU A CD2 1 
ATOM   2635  N N   . ALA A 1 335 ? 34.151  -30.917 61.313  1.00 23.21 ? 335 ALA A N   1 
ATOM   2636  C CA  . ALA A 1 335 ? 34.349  -32.171 62.054  1.00 23.87 ? 335 ALA A CA  1 
ATOM   2637  C C   . ALA A 1 335 ? 33.241  -33.186 61.767  1.00 23.74 ? 335 ALA A C   1 
ATOM   2638  O O   . ALA A 1 335 ? 33.514  -34.377 61.649  1.00 23.82 ? 335 ALA A O   1 
ATOM   2639  C CB  . ALA A 1 335 ? 34.469  -31.908 63.569  1.00 24.30 ? 335 ALA A CB  1 
ATOM   2640  N N   . ALA A 1 336 ? 31.996  -32.712 61.675  1.00 23.32 ? 336 ALA A N   1 
ATOM   2641  C CA  . ALA A 1 336 ? 30.859  -33.539 61.268  1.00 22.88 ? 336 ALA A CA  1 
ATOM   2642  C C   . ALA A 1 336 ? 30.998  -34.079 59.843  1.00 22.98 ? 336 ALA A C   1 
ATOM   2643  O O   . ALA A 1 336 ? 30.781  -35.262 59.621  1.00 22.93 ? 336 ALA A O   1 
ATOM   2644  C CB  . ALA A 1 336 ? 29.574  -32.788 61.423  1.00 23.81 ? 336 ALA A CB  1 
ATOM   2645  N N   . ALA A 1 337 ? 31.342  -33.209 58.889  1.00 21.81 ? 337 ALA A N   1 
ATOM   2646  C CA  . ALA A 1 337 ? 31.605  -33.596 57.515  1.00 22.83 ? 337 ALA A CA  1 
ATOM   2647  C C   . ALA A 1 337 ? 32.748  -34.650 57.410  1.00 23.17 ? 337 ALA A C   1 
ATOM   2648  O O   . ALA A 1 337 ? 32.591  -35.632 56.686  1.00 23.15 ? 337 ALA A O   1 
ATOM   2649  C CB  . ALA A 1 337 ? 31.916  -32.346 56.614  1.00 21.72 ? 337 ALA A CB  1 
ATOM   2650  N N   . ASP A 1 338 ? 33.863  -34.440 58.119  1.00 22.73 ? 338 ASP A N   1 
ATOM   2651  C CA  . ASP A 1 338 ? 34.978  -35.378 58.055  1.00 25.24 ? 338 ASP A CA  1 
ATOM   2652  C C   . ASP A 1 338 ? 34.559  -36.732 58.581  1.00 24.98 ? 338 ASP A C   1 
ATOM   2653  O O   . ASP A 1 338 ? 34.893  -37.748 57.984  1.00 25.96 ? 338 ASP A O   1 
ATOM   2654  C CB  . ASP A 1 338 ? 36.179  -34.887 58.884  1.00 24.48 ? 338 ASP A CB  1 
ATOM   2655  C CG  . ASP A 1 338 ? 36.980  -33.772 58.184  1.00 27.11 ? 338 ASP A CG  1 
ATOM   2656  O OD1 . ASP A 1 338 ? 37.215  -33.803 56.950  1.00 28.19 ? 338 ASP A OD1 1 
ATOM   2657  O OD2 . ASP A 1 338 ? 37.428  -32.887 58.911  1.00 29.74 ? 338 ASP A OD2 1 
ATOM   2658  N N   . LYS A 1 339 ? 33.823  -36.707 59.694  1.00 25.64 ? 339 LYS A N   1 
ATOM   2659  C CA  . LYS A 1 339 ? 33.310  -37.882 60.365  1.00 25.20 ? 339 LYS A CA  1 
ATOM   2660  C C   . LYS A 1 339 ? 32.449  -38.768 59.463  1.00 25.13 ? 339 LYS A C   1 
ATOM   2661  O O   . LYS A 1 339 ? 32.652  -39.976 59.447  1.00 24.55 ? 339 LYS A O   1 
ATOM   2662  C CB  . LYS A 1 339 ? 32.471  -37.482 61.581  1.00 26.08 ? 339 LYS A CB  1 
ATOM   2663  C CG  . LYS A 1 339 ? 32.057  -38.669 62.475  1.00 25.50 ? 339 LYS A CG  1 
ATOM   2664  C CD  . LYS A 1 339 ? 31.594  -38.220 63.847  1.00 24.63 ? 339 LYS A CD  1 
ATOM   2665  C CE  . LYS A 1 339 ? 31.129  -39.425 64.667  1.00 22.25 ? 339 LYS A CE  1 
ATOM   2666  N NZ  . LYS A 1 339 ? 30.215  -38.988 65.808  1.00 20.74 ? 339 LYS A NZ  1 
ATOM   2667  N N   . TRP A 1 340 ? 31.471  -38.168 58.776  1.00 23.57 ? 340 TRP A N   1 
ATOM   2668  C CA  . TRP A 1 340 ? 30.419  -38.937 58.084  1.00 23.66 ? 340 TRP A CA  1 
ATOM   2669  C C   . TRP A 1 340 ? 30.563  -39.007 56.580  1.00 24.68 ? 340 TRP A C   1 
ATOM   2670  O O   . TRP A 1 340 ? 30.144  -39.980 55.950  1.00 24.03 ? 340 TRP A O   1 
ATOM   2671  C CB  . TRP A 1 340 ? 29.030  -38.402 58.465  1.00 23.29 ? 340 TRP A CB  1 
ATOM   2672  C CG  . TRP A 1 340 ? 28.740  -38.683 59.875  1.00 20.54 ? 340 TRP A CG  1 
ATOM   2673  C CD1 . TRP A 1 340 ? 28.687  -37.787 60.909  1.00 20.68 ? 340 TRP A CD1 1 
ATOM   2674  C CD2 . TRP A 1 340 ? 28.533  -39.973 60.440  1.00 22.11 ? 340 TRP A CD2 1 
ATOM   2675  N NE1 . TRP A 1 340 ? 28.421  -38.455 62.098  1.00 19.64 ? 340 TRP A NE1 1 
ATOM   2676  C CE2 . TRP A 1 340 ? 28.292  -39.794 61.830  1.00 21.55 ? 340 TRP A CE2 1 
ATOM   2677  C CE3 . TRP A 1 340 ? 28.458  -41.271 59.898  1.00 21.21 ? 340 TRP A CE3 1 
ATOM   2678  C CZ2 . TRP A 1 340 ? 28.039  -40.876 62.693  1.00 22.21 ? 340 TRP A CZ2 1 
ATOM   2679  C CZ3 . TRP A 1 340 ? 28.199  -42.341 60.770  1.00 24.49 ? 340 TRP A CZ3 1 
ATOM   2680  C CH2 . TRP A 1 340 ? 28.014  -42.137 62.140  1.00 21.54 ? 340 TRP A CH2 1 
ATOM   2681  N N   . LEU A 1 341 ? 31.177  -37.981 56.020  1.00 25.71 ? 341 LEU A N   1 
ATOM   2682  C CA  . LEU A 1 341 ? 31.278  -37.807 54.588  1.00 29.27 ? 341 LEU A CA  1 
ATOM   2683  C C   . LEU A 1 341 ? 32.724  -38.208 54.238  1.00 31.10 ? 341 LEU A C   1 
ATOM   2684  O O   . LEU A 1 341 ? 33.671  -38.072 55.024  1.00 32.26 ? 341 LEU A O   1 
ATOM   2685  C CB  . LEU A 1 341 ? 30.868  -36.368 54.199  1.00 28.86 ? 341 LEU A CB  1 
ATOM   2686  C CG  . LEU A 1 341 ? 29.382  -36.087 53.895  1.00 29.95 ? 341 LEU A CG  1 
ATOM   2687  C CD1 . LEU A 1 341 ? 28.345  -36.960 54.594  1.00 31.29 ? 341 LEU A CD1 1 
ATOM   2688  C CD2 . LEU A 1 341 ? 29.031  -34.588 54.092  1.00 29.61 ? 341 LEU A CD2 1 
ATOM   2689  N N   . THR A 1 342 ? 32.899  -38.877 53.136  1.00 33.86 ? 342 THR A N   1 
ATOM   2690  C CA  . THR A 1 342 ? 33.678  -40.144 53.378  1.00 34.54 ? 342 THR A CA  1 
ATOM   2691  C C   . THR A 1 342 ? 34.829  -40.404 52.515  1.00 34.50 ? 342 THR A C   1 
ATOM   2692  O O   . THR A 1 342 ? 35.669  -41.267 52.843  1.00 37.47 ? 342 THR A O   1 
ATOM   2693  C CB  . THR A 1 342 ? 32.727  -41.424 53.364  1.00 35.92 ? 342 THR A CB  1 
ATOM   2694  O OG1 . THR A 1 342 ? 32.262  -41.786 54.709  1.00 33.69 ? 342 THR A OG1 1 
ATOM   2695  C CG2 . THR A 1 342 ? 33.387  -42.665 52.573  1.00 36.18 ? 342 THR A CG2 1 
ATOM   2696  N N   . GLY A 1 343 ? 34.937  -39.608 51.465  1.00 32.30 ? 343 GLY A N   1 
ATOM   2697  C CA  . GLY A 1 343 ? 35.059  -40.183 50.144  1.00 30.38 ? 343 GLY A CA  1 
ATOM   2698  C C   . GLY A 1 343 ? 33.619  -40.307 49.617  1.00 29.92 ? 343 GLY A C   1 
ATOM   2699  O O   . GLY A 1 343 ? 33.380  -40.993 48.618  1.00 28.62 ? 343 GLY A O   1 
ATOM   2700  N N   . LEU A 1 344 ? 32.657  -39.676 50.324  1.00 28.28 ? 344 LEU A N   1 
ATOM   2701  C CA  . LEU A 1 344 ? 31.287  -39.556 49.854  1.00 27.33 ? 344 LEU A CA  1 
ATOM   2702  C C   . LEU A 1 344 ? 31.036  -38.200 49.175  1.00 25.78 ? 344 LEU A C   1 
ATOM   2703  O O   . LEU A 1 344 ? 30.191  -38.075 48.319  1.00 24.95 ? 344 LEU A O   1 
ATOM   2704  C CB  . LEU A 1 344 ? 30.301  -39.748 51.026  1.00 28.94 ? 344 LEU A CB  1 
ATOM   2705  C CG  . LEU A 1 344 ? 29.539  -41.072 51.212  1.00 29.39 ? 344 LEU A CG  1 
ATOM   2706  C CD1 . LEU A 1 344 ? 30.359  -42.229 50.693  1.00 31.08 ? 344 LEU A CD1 1 
ATOM   2707  C CD2 . LEU A 1 344 ? 29.051  -41.291 52.630  1.00 27.58 ? 344 LEU A CD2 1 
ATOM   2708  N N   . ALA A 1 345 ? 31.803  -37.201 49.553  1.00 25.75 ? 345 ALA A N   1 
ATOM   2709  C CA  . ALA A 1 345 ? 31.542  -35.832 49.135  1.00 25.53 ? 345 ALA A CA  1 
ATOM   2710  C C   . ALA A 1 345 ? 32.828  -35.089 49.264  1.00 25.76 ? 345 ALA A C   1 
ATOM   2711  O O   . ALA A 1 345 ? 33.757  -35.604 49.876  1.00 25.57 ? 345 ALA A O   1 
ATOM   2712  C CB  . ALA A 1 345 ? 30.480  -35.216 50.036  1.00 25.35 ? 345 ALA A CB  1 
ATOM   2713  N N   . GLU A 1 346 ? 32.904  -33.885 48.681  1.00 25.67 ? 346 GLU A N   1 
ATOM   2714  C CA  . GLU A 1 346 ? 34.093  -33.046 48.760  1.00 26.48 ? 346 GLU A CA  1 
ATOM   2715  C C   . GLU A 1 346 ? 33.623  -31.625 49.058  1.00 25.44 ? 346 GLU A C   1 
ATOM   2716  O O   . GLU A 1 346 ? 32.535  -31.234 48.641  1.00 25.78 ? 346 GLU A O   1 
ATOM   2717  C CB  . GLU A 1 346 ? 34.851  -33.000 47.419  1.00 27.37 ? 346 GLU A CB  1 
ATOM   2718  C CG  . GLU A 1 346 ? 35.271  -34.328 46.852  1.00 34.07 ? 346 GLU A CG  1 
ATOM   2719  C CD  . GLU A 1 346 ? 35.330  -34.290 45.323  1.00 42.03 ? 346 GLU A CD  1 
ATOM   2720  O OE1 . GLU A 1 346 ? 36.421  -34.567 44.779  1.00 45.13 ? 346 GLU A OE1 1 
ATOM   2721  O OE2 . GLU A 1 346 ? 34.297  -33.975 44.677  1.00 45.12 ? 346 GLU A OE2 1 
ATOM   2722  N N   . TRP A 1 347 ? 34.432  -30.875 49.787  1.00 24.53 ? 347 TRP A N   1 
ATOM   2723  C CA  . TRP A 1 347 ? 34.111  -29.516 50.202  1.00 24.44 ? 347 TRP A CA  1 
ATOM   2724  C C   . TRP A 1 347 ? 35.420  -28.785 50.465  1.00 25.27 ? 347 TRP A C   1 
ATOM   2725  O O   . TRP A 1 347 ? 36.386  -29.388 50.911  1.00 24.99 ? 347 TRP A O   1 
ATOM   2726  C CB  . TRP A 1 347 ? 33.272  -29.505 51.496  1.00 24.06 ? 347 TRP A CB  1 
ATOM   2727  C CG  . TRP A 1 347 ? 33.894  -30.290 52.615  1.00 25.86 ? 347 TRP A CG  1 
ATOM   2728  C CD1 . TRP A 1 347 ? 34.763  -29.830 53.568  1.00 25.67 ? 347 TRP A CD1 1 
ATOM   2729  C CD2 . TRP A 1 347 ? 33.727  -31.695 52.863  1.00 25.60 ? 347 TRP A CD2 1 
ATOM   2730  N NE1 . TRP A 1 347 ? 35.132  -30.862 54.410  1.00 27.66 ? 347 TRP A NE1 1 
ATOM   2731  C CE2 . TRP A 1 347 ? 34.518  -32.017 53.989  1.00 28.50 ? 347 TRP A CE2 1 
ATOM   2732  C CE3 . TRP A 1 347 ? 32.977  -32.710 52.243  1.00 26.30 ? 347 TRP A CE3 1 
ATOM   2733  C CZ2 . TRP A 1 347 ? 34.591  -33.330 54.513  1.00 28.93 ? 347 TRP A CZ2 1 
ATOM   2734  C CZ3 . TRP A 1 347 ? 33.041  -34.008 52.758  1.00 27.85 ? 347 TRP A CZ3 1 
ATOM   2735  C CH2 . TRP A 1 347 ? 33.847  -34.300 53.892  1.00 27.78 ? 347 TRP A CH2 1 
ATOM   2736  N N   . HIS A 1 348 ? 35.426  -27.471 50.239  1.00 25.56 ? 348 HIS A N   1 
ATOM   2737  C CA  . HIS A 1 348 ? 36.492  -26.608 50.707  1.00 26.00 ? 348 HIS A CA  1 
ATOM   2738  C C   . HIS A 1 348 ? 36.148  -26.046 52.091  1.00 26.71 ? 348 HIS A C   1 
ATOM   2739  O O   . HIS A 1 348 ? 34.977  -25.865 52.448  1.00 26.49 ? 348 HIS A O   1 
ATOM   2740  C CB  . HIS A 1 348 ? 36.743  -25.443 49.715  1.00 26.32 ? 348 HIS A CB  1 
ATOM   2741  C CG  . HIS A 1 348 ? 37.080  -25.892 48.323  1.00 26.22 ? 348 HIS A CG  1 
ATOM   2742  N ND1 . HIS A 1 348 ? 38.249  -26.558 48.016  1.00 29.08 ? 348 HIS A ND1 1 
ATOM   2743  C CD2 . HIS A 1 348 ? 36.399  -25.768 47.157  1.00 30.56 ? 348 HIS A CD2 1 
ATOM   2744  C CE1 . HIS A 1 348 ? 38.264  -26.842 46.724  1.00 30.74 ? 348 HIS A CE1 1 
ATOM   2745  N NE2 . HIS A 1 348 ? 37.147  -26.378 46.180  1.00 30.33 ? 348 HIS A NE2 1 
ATOM   2746  N N   . VAL A 1 349 ? 37.179  -25.754 52.862  1.00 26.34 ? 349 VAL A N   1 
ATOM   2747  C CA  . VAL A 1 349 ? 37.009  -25.029 54.110  1.00 27.45 ? 349 VAL A CA  1 
ATOM   2748  C C   . VAL A 1 349 ? 36.574  -23.586 53.804  1.00 26.58 ? 349 VAL A C   1 
ATOM   2749  O O   . VAL A 1 349 ? 37.255  -22.900 53.036  1.00 28.05 ? 349 VAL A O   1 
ATOM   2750  C CB  . VAL A 1 349 ? 38.296  -25.062 54.949  1.00 26.87 ? 349 VAL A CB  1 
ATOM   2751  C CG1 . VAL A 1 349 ? 39.444  -24.555 54.130  1.00 30.81 ? 349 VAL A CG1 1 
ATOM   2752  C CG2 . VAL A 1 349 ? 38.154  -24.219 56.233  1.00 25.76 ? 349 VAL A CG2 1 
ATOM   2753  N N   . PRO A 1 350 ? 35.436  -23.134 54.394  1.00 26.10 ? 350 PRO A N   1 
ATOM   2754  C CA  . PRO A 1 350 ? 34.938  -21.754 54.251  1.00 25.31 ? 350 PRO A CA  1 
ATOM   2755  C C   . PRO A 1 350 ? 35.968  -20.786 54.806  1.00 25.62 ? 350 PRO A C   1 
ATOM   2756  O O   . PRO A 1 350 ? 36.522  -21.039 55.906  1.00 23.82 ? 350 PRO A O   1 
ATOM   2757  C CB  . PRO A 1 350 ? 33.732  -21.723 55.188  1.00 25.59 ? 350 PRO A CB  1 
ATOM   2758  C CG  . PRO A 1 350 ? 33.293  -23.131 55.285  1.00 25.14 ? 350 PRO A CG  1 
ATOM   2759  C CD  . PRO A 1 350 ? 34.578  -23.912 55.297  1.00 25.62 ? 350 PRO A CD  1 
ATOM   2760  N N   . ALA A 1 351 ? 36.242  -19.709 54.065  1.00 25.70 ? 351 ALA A N   1 
ATOM   2761  C CA  . ALA A 1 351 ? 37.214  -18.721 54.516  1.00 26.35 ? 351 ALA A CA  1 
ATOM   2762  C C   . ALA A 1 351 ? 36.531  -17.591 55.302  1.00 26.20 ? 351 ALA A C   1 
ATOM   2763  O O   . ALA A 1 351 ? 37.193  -16.850 56.047  1.00 27.70 ? 351 ALA A O   1 
ATOM   2764  C CB  . ALA A 1 351 ? 38.006  -18.192 53.373  1.00 26.32 ? 351 ALA A CB  1 
ATOM   2765  N N   . ALA A 1 352 ? 35.202  -17.484 55.165  1.00 26.19 ? 352 ALA A N   1 
ATOM   2766  C CA  . ALA A 1 352 ? 34.420  -16.490 55.894  1.00 25.01 ? 352 ALA A CA  1 
ATOM   2767  C C   . ALA A 1 352 ? 32.968  -16.891 55.833  1.00 24.37 ? 352 ALA A C   1 
ATOM   2768  O O   . ALA A 1 352 ? 32.611  -17.822 55.132  1.00 23.81 ? 352 ALA A O   1 
ATOM   2769  C CB  . ALA A 1 352 ? 34.623  -15.063 55.262  1.00 24.36 ? 352 ALA A CB  1 
ATOM   2770  N N   . GLY A 1 353 ? 32.122  -16.195 56.589  1.00 24.39 ? 353 GLY A N   1 
ATOM   2771  C CA  . GLY A 1 353 ? 30.703  -16.368 56.451  1.00 23.06 ? 353 GLY A CA  1 
ATOM   2772  C C   . GLY A 1 353 ? 30.115  -17.508 57.262  1.00 23.33 ? 353 GLY A C   1 
ATOM   2773  O O   . GLY A 1 353 ? 30.588  -17.819 58.367  1.00 23.58 ? 353 GLY A O   1 
ATOM   2774  N N   . MET A 1 354 ? 29.048  -18.102 56.732  1.00 22.26 ? 354 MET A N   1 
ATOM   2775  C CA  . MET A 1 354 ? 28.288  -19.052 57.516  1.00 23.28 ? 354 MET A CA  1 
ATOM   2776  C C   . MET A 1 354 ? 27.800  -20.261 56.759  1.00 21.38 ? 354 MET A C   1 
ATOM   2777  O O   . MET A 1 354 ? 26.909  -20.948 57.253  1.00 19.58 ? 354 MET A O   1 
ATOM   2778  C CB  . MET A 1 354 ? 27.115  -18.356 58.241  1.00 24.00 ? 354 MET A CB  1 
ATOM   2779  C CG  . MET A 1 354 ? 26.142  -17.633 57.342  1.00 26.64 ? 354 MET A CG  1 
ATOM   2780  S SD  . MET A 1 354 ? 24.978  -16.554 58.266  1.00 32.32 ? 354 MET A SD  1 
ATOM   2781  C CE  . MET A 1 354 ? 26.091  -15.313 58.881  1.00 36.21 ? 354 MET A CE  1 
ATOM   2782  N N   . PHE A 1 355 ? 28.370  -20.527 55.575  1.00 20.72 ? 355 PHE A N   1 
ATOM   2783  C CA  . PHE A 1 355 ? 27.954  -21.702 54.806  1.00 20.66 ? 355 PHE A CA  1 
ATOM   2784  C C   . PHE A 1 355 ? 29.099  -22.631 54.401  1.00 21.06 ? 355 PHE A C   1 
ATOM   2785  O O   . PHE A 1 355 ? 30.203  -22.180 54.075  1.00 19.40 ? 355 PHE A O   1 
ATOM   2786  C CB  . PHE A 1 355 ? 27.194  -21.292 53.550  1.00 21.49 ? 355 PHE A CB  1 
ATOM   2787  C CG  . PHE A 1 355 ? 26.049  -20.346 53.807  1.00 20.45 ? 355 PHE A CG  1 
ATOM   2788  C CD1 . PHE A 1 355 ? 24.864  -20.794 54.391  1.00 22.61 ? 355 PHE A CD1 1 
ATOM   2789  C CD2 . PHE A 1 355 ? 26.143  -18.995 53.437  1.00 23.01 ? 355 PHE A CD2 1 
ATOM   2790  C CE1 . PHE A 1 355 ? 23.782  -19.907 54.624  1.00 19.77 ? 355 PHE A CE1 1 
ATOM   2791  C CE2 . PHE A 1 355 ? 25.064  -18.104 53.654  1.00 21.79 ? 355 PHE A CE2 1 
ATOM   2792  C CZ  . PHE A 1 355 ? 23.905  -18.541 54.249  1.00 19.54 ? 355 PHE A CZ  1 
ATOM   2793  N N   . LEU A 1 356 ? 28.784  -23.933 54.431  1.00 22.50 ? 356 LEU A N   1 
ATOM   2794  C CA  . LEU A 1 356 ? 29.593  -24.995 53.863  1.00 22.25 ? 356 LEU A CA  1 
ATOM   2795  C C   . LEU A 1 356 ? 29.011  -25.464 52.540  1.00 23.02 ? 356 LEU A C   1 
ATOM   2796  O O   . LEU A 1 356 ? 27.823  -25.751 52.463  1.00 24.41 ? 356 LEU A O   1 
ATOM   2797  C CB  . LEU A 1 356 ? 29.663  -26.150 54.869  1.00 22.55 ? 356 LEU A CB  1 
ATOM   2798  C CG  . LEU A 1 356 ? 30.585  -27.332 54.500  1.00 21.93 ? 356 LEU A CG  1 
ATOM   2799  C CD1 . LEU A 1 356 ? 32.060  -26.872 54.402  1.00 18.13 ? 356 LEU A CD1 1 
ATOM   2800  C CD2 . LEU A 1 356 ? 30.413  -28.511 55.482  1.00 20.01 ? 356 LEU A CD2 1 
ATOM   2801  N N   . TRP A 1 357 ? 29.835  -25.551 51.497  1.00 22.16 ? 357 TRP A N   1 
ATOM   2802  C CA  . TRP A 1 357 ? 29.356  -25.944 50.184  1.00 22.75 ? 357 TRP A CA  1 
ATOM   2803  C C   . TRP A 1 357 ? 29.904  -27.342 49.922  1.00 22.11 ? 357 TRP A C   1 
ATOM   2804  O O   . TRP A 1 357 ? 31.097  -27.540 49.880  1.00 23.35 ? 357 TRP A O   1 
ATOM   2805  C CB  . TRP A 1 357 ? 29.902  -24.952 49.151  1.00 22.12 ? 357 TRP A CB  1 
ATOM   2806  C CG  . TRP A 1 357 ? 29.482  -25.026 47.719  1.00 21.36 ? 357 TRP A CG  1 
ATOM   2807  C CD1 . TRP A 1 357 ? 30.318  -25.088 46.649  1.00 21.67 ? 357 TRP A CD1 1 
ATOM   2808  C CD2 . TRP A 1 357 ? 28.141  -24.918 47.179  1.00 22.43 ? 357 TRP A CD2 1 
ATOM   2809  N NE1 . TRP A 1 357 ? 29.584  -25.061 45.465  1.00 24.15 ? 357 TRP A NE1 1 
ATOM   2810  C CE2 . TRP A 1 357 ? 28.252  -24.967 45.769  1.00 21.26 ? 357 TRP A CE2 1 
ATOM   2811  C CE3 . TRP A 1 357 ? 26.871  -24.827 47.748  1.00 20.33 ? 357 TRP A CE3 1 
ATOM   2812  C CZ2 . TRP A 1 357 ? 27.132  -24.885 44.912  1.00 23.83 ? 357 TRP A CZ2 1 
ATOM   2813  C CZ3 . TRP A 1 357 ? 25.744  -24.762 46.889  1.00 21.57 ? 357 TRP A CZ3 1 
ATOM   2814  C CH2 . TRP A 1 357 ? 25.898  -24.799 45.488  1.00 21.15 ? 357 TRP A CH2 1 
ATOM   2815  N N   . ILE A 1 358 ? 29.013  -28.296 49.774  1.00 23.32 ? 358 ILE A N   1 
ATOM   2816  C CA  . ILE A 1 358 ? 29.353  -29.738 49.682  1.00 23.53 ? 358 ILE A CA  1 
ATOM   2817  C C   . ILE A 1 358 ? 29.020  -30.312 48.311  1.00 24.14 ? 358 ILE A C   1 
ATOM   2818  O O   . ILE A 1 358 ? 27.845  -30.294 47.876  1.00 23.30 ? 358 ILE A O   1 
ATOM   2819  C CB  . ILE A 1 358 ? 28.608  -30.550 50.766  1.00 23.85 ? 358 ILE A CB  1 
ATOM   2820  C CG1 . ILE A 1 358 ? 29.017  -30.085 52.163  1.00 23.08 ? 358 ILE A CG1 1 
ATOM   2821  C CG2 . ILE A 1 358 ? 28.802  -32.086 50.572  1.00 24.98 ? 358 ILE A CG2 1 
ATOM   2822  C CD1 . ILE A 1 358 ? 27.958  -30.383 53.270  1.00 21.12 ? 358 ILE A CD1 1 
ATOM   2823  N N   . LYS A 1 359 ? 30.040  -30.830 47.622  1.00 24.03 ? 359 LYS A N   1 
ATOM   2824  C CA  . LYS A 1 359 ? 29.796  -31.562 46.367  1.00 25.29 ? 359 LYS A CA  1 
ATOM   2825  C C   . LYS A 1 359 ? 29.602  -33.054 46.641  1.00 26.42 ? 359 LYS A C   1 
ATOM   2826  O O   . LYS A 1 359 ? 30.519  -33.706 47.156  1.00 26.26 ? 359 LYS A O   1 
ATOM   2827  C CB  . LYS A 1 359 ? 30.973  -31.362 45.421  1.00 25.87 ? 359 LYS A CB  1 
ATOM   2828  C CG  . LYS A 1 359 ? 30.800  -31.990 44.052  1.00 26.90 ? 359 LYS A CG  1 
ATOM   2829  C CD  . LYS A 1 359 ? 31.939  -31.564 43.167  1.00 32.18 ? 359 LYS A CD  1 
ATOM   2830  C CE  . LYS A 1 359 ? 31.849  -32.205 41.808  1.00 36.72 ? 359 LYS A CE  1 
ATOM   2831  N NZ  . LYS A 1 359 ? 30.980  -31.410 40.914  1.00 42.08 ? 359 LYS A NZ  1 
ATOM   2832  N N   . VAL A 1 360 ? 28.421  -33.586 46.317  1.00 26.16 ? 360 VAL A N   1 
ATOM   2833  C CA  . VAL A 1 360 ? 28.120  -34.992 46.537  1.00 27.00 ? 360 VAL A CA  1 
ATOM   2834  C C   . VAL A 1 360 ? 28.707  -35.812 45.381  1.00 28.00 ? 360 VAL A C   1 
ATOM   2835  O O   . VAL A 1 360 ? 28.445  -35.515 44.220  1.00 27.75 ? 360 VAL A O   1 
ATOM   2836  C CB  . VAL A 1 360 ? 26.575  -35.237 46.716  1.00 27.10 ? 360 VAL A CB  1 
ATOM   2837  C CG1 . VAL A 1 360 ? 26.258  -36.735 46.871  1.00 25.86 ? 360 VAL A CG1 1 
ATOM   2838  C CG2 . VAL A 1 360 ? 26.039  -34.430 47.935  1.00 26.06 ? 360 VAL A CG2 1 
ATOM   2839  N N   . LYS A 1 361 ? 29.517  -36.835 45.689  1.00 28.09 ? 361 LYS A N   1 
ATOM   2840  C CA  . LYS A 1 361 ? 30.138  -37.633 44.620  1.00 29.22 ? 361 LYS A CA  1 
ATOM   2841  C C   . LYS A 1 361 ? 29.133  -38.623 44.059  1.00 29.15 ? 361 LYS A C   1 
ATOM   2842  O O   . LYS A 1 361 ? 28.309  -39.159 44.794  1.00 28.14 ? 361 LYS A O   1 
ATOM   2843  C CB  . LYS A 1 361 ? 31.389  -38.372 45.115  1.00 29.70 ? 361 LYS A CB  1 
ATOM   2844  C CG  . LYS A 1 361 ? 32.554  -37.454 45.457  1.00 31.69 ? 361 LYS A CG  1 
ATOM   2845  C CD  . LYS A 1 361 ? 33.911  -38.134 45.228  1.00 37.79 ? 361 LYS A CD  1 
ATOM   2846  C CE  . LYS A 1 361 ? 34.421  -38.793 46.510  1.00 40.72 ? 361 LYS A CE  1 
ATOM   2847  N NZ  . LYS A 1 361 ? 35.438  -39.887 46.225  1.00 43.09 ? 361 LYS A NZ  1 
ATOM   2848  N N   . GLY A 1 362 ? 29.208  -38.858 42.747  1.00 30.11 ? 362 GLY A N   1 
ATOM   2849  C CA  . GLY A 1 362 ? 28.436  -39.923 42.105  1.00 30.08 ? 362 GLY A CA  1 
ATOM   2850  C C   . GLY A 1 362 ? 26.932  -39.700 42.038  1.00 30.88 ? 362 GLY A C   1 
ATOM   2851  O O   . GLY A 1 362 ? 26.174  -40.646 41.824  1.00 30.27 ? 362 GLY A O   1 
ATOM   2852  N N   . ILE A 1 363 ? 26.487  -38.457 42.226  1.00 31.22 ? 363 ILE A N   1 
ATOM   2853  C CA  . ILE A 1 363 ? 25.046  -38.113 42.128  1.00 32.11 ? 363 ILE A CA  1 
ATOM   2854  C C   . ILE A 1 363 ? 24.982  -36.835 41.314  1.00 32.90 ? 363 ILE A C   1 
ATOM   2855  O O   . ILE A 1 363 ? 25.613  -35.851 41.668  1.00 33.37 ? 363 ILE A O   1 
ATOM   2856  C CB  . ILE A 1 363 ? 24.347  -37.977 43.510  1.00 30.89 ? 363 ILE A CB  1 
ATOM   2857  C CG1 . ILE A 1 363 ? 24.493  -39.297 44.279  1.00 32.89 ? 363 ILE A CG1 1 
ATOM   2858  C CG2 . ILE A 1 363 ? 22.844  -37.661 43.326  1.00 33.24 ? 363 ILE A CG2 1 
ATOM   2859  C CD1 . ILE A 1 363 ? 23.789  -39.435 45.667  1.00 29.07 ? 363 ILE A CD1 1 
ATOM   2860  N N   . ASN A 1 364 ? 24.294  -36.855 40.181  1.00 33.53 ? 364 ASN A N   1 
ATOM   2861  C CA  . ASN A 1 364 ? 24.436  -35.707 39.323  1.00 34.97 ? 364 ASN A CA  1 
ATOM   2862  C C   . ASN A 1 364 ? 23.480  -34.550 39.659  1.00 34.82 ? 364 ASN A C   1 
ATOM   2863  O O   . ASN A 1 364 ? 23.791  -33.398 39.374  1.00 34.56 ? 364 ASN A O   1 
ATOM   2864  C CB  . ASN A 1 364 ? 24.496  -36.101 37.834  1.00 35.47 ? 364 ASN A CB  1 
ATOM   2865  C CG  . ASN A 1 364 ? 23.175  -35.936 37.127  1.00 37.98 ? 364 ASN A CG  1 
ATOM   2866  O OD1 . ASN A 1 364 ? 23.069  -35.227 36.105  1.00 38.17 ? 364 ASN A OD1 1 
ATOM   2867  N ND2 . ASN A 1 364 ? 22.157  -36.575 37.660  1.00 41.85 ? 364 ASN A ND2 1 
ATOM   2868  N N   . ASP A 1 365 ? 22.340  -34.875 40.282  1.00 36.00 ? 365 ASP A N   1 
ATOM   2869  C CA  . ASP A 1 365 ? 21.453  -33.873 40.893  1.00 35.42 ? 365 ASP A CA  1 
ATOM   2870  C C   . ASP A 1 365 ? 20.961  -34.298 42.293  1.00 34.97 ? 365 ASP A C   1 
ATOM   2871  O O   . ASP A 1 365 ? 20.502  -35.396 42.500  1.00 34.53 ? 365 ASP A O   1 
ATOM   2872  C CB  . ASP A 1 365 ? 20.262  -33.526 39.975  1.00 36.35 ? 365 ASP A CB  1 
ATOM   2873  C CG  . ASP A 1 365 ? 19.451  -32.345 40.511  1.00 38.02 ? 365 ASP A CG  1 
ATOM   2874  O OD1 . ASP A 1 365 ? 18.361  -32.592 41.052  1.00 41.00 ? 365 ASP A OD1 1 
ATOM   2875  O OD2 . ASP A 1 365 ? 19.930  -31.181 40.446  1.00 41.17 ? 365 ASP A OD2 1 
ATOM   2876  N N   . VAL A 1 366 ? 21.029  -33.386 43.241  1.00 34.91 ? 366 VAL A N   1 
ATOM   2877  C CA  . VAL A 1 366 ? 20.789  -33.707 44.627  1.00 35.27 ? 366 VAL A CA  1 
ATOM   2878  C C   . VAL A 1 366 ? 19.387  -33.267 45.120  1.00 35.57 ? 366 VAL A C   1 
ATOM   2879  O O   . VAL A 1 366 ? 19.079  -33.364 46.309  1.00 34.24 ? 366 VAL A O   1 
ATOM   2880  C CB  . VAL A 1 366 ? 21.978  -33.181 45.513  1.00 35.33 ? 366 VAL A CB  1 
ATOM   2881  C CG1 . VAL A 1 366 ? 22.044  -31.659 45.484  1.00 36.44 ? 366 VAL A CG1 1 
ATOM   2882  C CG2 . VAL A 1 366 ? 21.865  -33.659 46.947  1.00 36.56 ? 366 VAL A CG2 1 
ATOM   2883  N N   . LYS A 1 367 ? 18.520  -32.837 44.199  1.00 36.31 ? 367 LYS A N   1 
ATOM   2884  C CA  . LYS A 1 367 ? 17.177  -32.382 44.592  1.00 37.86 ? 367 LYS A CA  1 
ATOM   2885  C C   . LYS A 1 367 ? 16.286  -33.507 45.119  1.00 37.55 ? 367 LYS A C   1 
ATOM   2886  O O   . LYS A 1 367 ? 15.673  -33.364 46.154  1.00 37.20 ? 367 LYS A O   1 
ATOM   2887  C CB  . LYS A 1 367 ? 16.475  -31.609 43.462  1.00 38.46 ? 367 LYS A CB  1 
ATOM   2888  C CG  . LYS A 1 367 ? 15.417  -30.625 43.981  1.00 40.28 ? 367 LYS A CG  1 
ATOM   2889  C CD  . LYS A 1 367 ? 15.613  -29.200 43.414  1.00 43.63 ? 367 LYS A CD  1 
ATOM   2890  C CE  . LYS A 1 367 ? 15.690  -29.169 41.870  1.00 45.74 ? 367 LYS A CE  1 
ATOM   2891  N NZ  . LYS A 1 367 ? 14.695  -30.074 41.216  1.00 45.48 ? 367 LYS A NZ  1 
ATOM   2892  N N   . GLU A 1 368 ? 16.218  -34.633 44.428  1.00 38.24 ? 368 GLU A N   1 
ATOM   2893  C CA  . GLU A 1 368 ? 15.517  -35.774 44.985  1.00 39.21 ? 368 GLU A CA  1 
ATOM   2894  C C   . GLU A 1 368 ? 16.086  -36.230 46.334  1.00 38.67 ? 368 GLU A C   1 
ATOM   2895  O O   . GLU A 1 368 ? 15.314  -36.449 47.289  1.00 38.32 ? 368 GLU A O   1 
ATOM   2896  C CB  . GLU A 1 368 ? 15.463  -36.927 43.993  1.00 40.68 ? 368 GLU A CB  1 
ATOM   2897  C CG  . GLU A 1 368 ? 14.106  -37.046 43.242  1.00 46.17 ? 368 GLU A CG  1 
ATOM   2898  C CD  . GLU A 1 368 ? 13.712  -35.793 42.407  1.00 52.80 ? 368 GLU A CD  1 
ATOM   2899  O OE1 . GLU A 1 368 ? 12.512  -35.408 42.451  1.00 54.21 ? 368 GLU A OE1 1 
ATOM   2900  O OE2 . GLU A 1 368 ? 14.581  -35.214 41.695  1.00 55.58 ? 368 GLU A OE2 1 
ATOM   2901  N N   . LEU A 1 369 ? 17.417  -36.336 46.431  1.00 37.03 ? 369 LEU A N   1 
ATOM   2902  C CA  . LEU A 1 369 ? 18.071  -36.769 47.674  1.00 36.57 ? 369 LEU A CA  1 
ATOM   2903  C C   . LEU A 1 369 ? 17.622  -35.935 48.874  1.00 36.03 ? 369 LEU A C   1 
ATOM   2904  O O   . LEU A 1 369 ? 17.435  -36.474 49.962  1.00 35.28 ? 369 LEU A O   1 
ATOM   2905  C CB  . LEU A 1 369 ? 19.595  -36.684 47.558  1.00 35.83 ? 369 LEU A CB  1 
ATOM   2906  C CG  . LEU A 1 369 ? 20.498  -36.885 48.797  1.00 36.43 ? 369 LEU A CG  1 
ATOM   2907  C CD1 . LEU A 1 369 ? 20.269  -38.224 49.426  1.00 36.36 ? 369 LEU A CD1 1 
ATOM   2908  C CD2 . LEU A 1 369 ? 21.959  -36.782 48.429  1.00 34.86 ? 369 LEU A CD2 1 
ATOM   2909  N N   . ILE A 1 370 ? 17.496  -34.626 48.639  1.00 35.98 ? 370 ILE A N   1 
ATOM   2910  C CA  . ILE A 1 370 ? 17.212  -33.604 49.652  1.00 37.37 ? 370 ILE A CA  1 
ATOM   2911  C C   . ILE A 1 370 ? 15.716  -33.284 49.739  1.00 37.78 ? 370 ILE A C   1 
ATOM   2912  O O   . ILE A 1 370 ? 15.133  -33.372 50.821  1.00 38.22 ? 370 ILE A O   1 
ATOM   2913  C CB  . ILE A 1 370 ? 18.034  -32.303 49.376  1.00 36.93 ? 370 ILE A CB  1 
ATOM   2914  C CG1 . ILE A 1 370 ? 19.541  -32.539 49.556  1.00 37.66 ? 370 ILE A CG1 1 
ATOM   2915  C CG2 . ILE A 1 370 ? 17.542  -31.165 50.220  1.00 39.61 ? 370 ILE A CG2 1 
ATOM   2916  C CD1 . ILE A 1 370 ? 20.008  -33.048 50.956  1.00 37.59 ? 370 ILE A CD1 1 
ATOM   2917  N N   . GLU A 1 371 ? 15.088  -32.948 48.610  1.00 38.61 ? 371 GLU A N   1 
ATOM   2918  C CA  . GLU A 1 371 ? 13.651  -32.590 48.589  1.00 40.84 ? 371 GLU A CA  1 
ATOM   2919  C C   . GLU A 1 371 ? 12.751  -33.750 49.041  1.00 40.55 ? 371 GLU A C   1 
ATOM   2920  O O   . GLU A 1 371 ? 11.738  -33.521 49.686  1.00 41.00 ? 371 GLU A O   1 
ATOM   2921  C CB  . GLU A 1 371 ? 13.201  -32.118 47.191  1.00 41.39 ? 371 GLU A CB  1 
ATOM   2922  C CG  . GLU A 1 371 ? 11.674  -31.939 47.050  1.00 46.37 ? 371 GLU A CG  1 
ATOM   2923  C CD  . GLU A 1 371 ? 11.083  -32.437 45.721  1.00 50.06 ? 371 GLU A CD  1 
ATOM   2924  O OE1 . GLU A 1 371 ? 11.553  -31.988 44.646  1.00 51.38 ? 371 GLU A OE1 1 
ATOM   2925  O OE2 . GLU A 1 371 ? 10.134  -33.265 45.766  1.00 52.15 ? 371 GLU A OE2 1 
ATOM   2926  N N   . GLU A 1 372 ? 13.130  -34.982 48.691  1.00 40.34 ? 372 GLU A N   1 
ATOM   2927  C CA  . GLU A 1 372 ? 12.344  -36.172 48.993  1.00 40.32 ? 372 GLU A CA  1 
ATOM   2928  C C   . GLU A 1 372 ? 12.907  -37.007 50.141  1.00 39.21 ? 372 GLU A C   1 
ATOM   2929  O O   . GLU A 1 372 ? 12.224  -37.207 51.162  1.00 39.66 ? 372 GLU A O   1 
ATOM   2930  C CB  . GLU A 1 372 ? 12.130  -37.026 47.726  1.00 40.60 ? 372 GLU A CB  1 
ATOM   2931  C CG  . GLU A 1 372 ? 11.354  -36.226 46.624  1.00 44.74 ? 372 GLU A CG  1 
ATOM   2932  C CD  . GLU A 1 372 ? 11.055  -37.001 45.326  1.00 47.94 ? 372 GLU A CD  1 
ATOM   2933  O OE1 . GLU A 1 372 ? 11.057  -38.258 45.328  1.00 48.44 ? 372 GLU A OE1 1 
ATOM   2934  O OE2 . GLU A 1 372 ? 10.794  -36.328 44.297  1.00 50.40 ? 372 GLU A OE2 1 
ATOM   2935  N N   . LYS A 1 373 ? 14.141  -37.488 49.995  1.00 37.29 ? 373 LYS A N   1 
ATOM   2936  C CA  . LYS A 1 373 ? 14.686  -38.464 50.960  1.00 35.38 ? 373 LYS A CA  1 
ATOM   2937  C C   . LYS A 1 373 ? 15.076  -37.872 52.314  1.00 33.94 ? 373 LYS A C   1 
ATOM   2938  O O   . LYS A 1 373 ? 14.666  -38.371 53.368  1.00 33.08 ? 373 LYS A O   1 
ATOM   2939  C CB  . LYS A 1 373 ? 15.864  -39.235 50.367  1.00 35.57 ? 373 LYS A CB  1 
ATOM   2940  C CG  . LYS A 1 373 ? 15.537  -40.050 49.137  1.00 36.24 ? 373 LYS A CG  1 
ATOM   2941  C CD  . LYS A 1 373 ? 16.726  -40.939 48.808  1.00 39.39 ? 373 LYS A CD  1 
ATOM   2942  C CE  . LYS A 1 373 ? 16.500  -41.726 47.525  1.00 41.54 ? 373 LYS A CE  1 
ATOM   2943  N NZ  . LYS A 1 373 ? 17.254  -43.022 47.540  1.00 46.03 ? 373 LYS A NZ  1 
ATOM   2944  N N   . ALA A 1 374 ? 15.871  -36.810 52.284  1.00 32.19 ? 374 ALA A N   1 
ATOM   2945  C CA  . ALA A 1 374 ? 16.334  -36.184 53.519  1.00 31.50 ? 374 ALA A CA  1 
ATOM   2946  C C   . ALA A 1 374 ? 15.186  -35.537 54.315  1.00 31.29 ? 374 ALA A C   1 
ATOM   2947  O O   . ALA A 1 374 ? 15.121  -35.678 55.555  1.00 29.07 ? 374 ALA A O   1 
ATOM   2948  C CB  . ALA A 1 374 ? 17.467  -35.169 53.229  1.00 30.33 ? 374 ALA A CB  1 
ATOM   2949  N N   . VAL A 1 375 ? 14.265  -34.861 53.624  1.00 31.83 ? 375 VAL A N   1 
ATOM   2950  C CA  . VAL A 1 375 ? 13.100  -34.292 54.339  1.00 33.23 ? 375 VAL A CA  1 
ATOM   2951  C C   . VAL A 1 375 ? 12.331  -35.357 55.117  1.00 33.76 ? 375 VAL A C   1 
ATOM   2952  O O   . VAL A 1 375 ? 11.883  -35.093 56.228  1.00 33.43 ? 375 VAL A O   1 
ATOM   2953  C CB  . VAL A 1 375 ? 12.088  -33.506 53.466  1.00 33.89 ? 375 VAL A CB  1 
ATOM   2954  C CG1 . VAL A 1 375 ? 12.768  -32.408 52.662  1.00 36.15 ? 375 VAL A CG1 1 
ATOM   2955  C CG2 . VAL A 1 375 ? 11.279  -34.461 52.567  1.00 34.70 ? 375 VAL A CG2 1 
ATOM   2956  N N   . LYS A 1 376 ? 12.215  -36.560 54.551  1.00 35.37 ? 376 LYS A N   1 
ATOM   2957  C CA  . LYS A 1 376 ? 11.472  -37.660 55.197  1.00 36.29 ? 376 LYS A CA  1 
ATOM   2958  C C   . LYS A 1 376 ? 12.157  -38.113 56.476  1.00 35.89 ? 376 LYS A C   1 
ATOM   2959  O O   . LYS A 1 376 ? 11.495  -38.534 57.411  1.00 36.63 ? 376 LYS A O   1 
ATOM   2960  C CB  . LYS A 1 376 ? 11.318  -38.857 54.265  1.00 37.27 ? 376 LYS A CB  1 
ATOM   2961  C CG  . LYS A 1 376 ? 10.056  -38.882 53.425  1.00 40.24 ? 376 LYS A CG  1 
ATOM   2962  C CD  . LYS A 1 376 ? 9.606   -40.321 53.194  1.00 46.15 ? 376 LYS A CD  1 
ATOM   2963  C CE  . LYS A 1 376 ? 10.323  -40.981 52.006  1.00 48.47 ? 376 LYS A CE  1 
ATOM   2964  N NZ  . LYS A 1 376 ? 9.888   -42.406 51.821  1.00 52.62 ? 376 LYS A NZ  1 
ATOM   2965  N N   . MET A 1 377 ? 13.489  -38.028 56.508  1.00 35.22 ? 377 MET A N   1 
ATOM   2966  C CA  . MET A 1 377 ? 14.273  -38.334 57.714  1.00 35.13 ? 377 MET A CA  1 
ATOM   2967  C C   . MET A 1 377 ? 14.482  -37.119 58.627  1.00 34.24 ? 377 MET A C   1 
ATOM   2968  O O   . MET A 1 377 ? 15.309  -37.162 59.559  1.00 33.53 ? 377 MET A O   1 
ATOM   2969  C CB  . MET A 1 377 ? 15.627  -38.919 57.331  1.00 35.68 ? 377 MET A CB  1 
ATOM   2970  C CG  . MET A 1 377 ? 15.581  -40.179 56.484  1.00 40.59 ? 377 MET A CG  1 
ATOM   2971  S SD  . MET A 1 377 ? 15.432  -41.694 57.457  1.00 50.63 ? 377 MET A SD  1 
ATOM   2972  C CE  . MET A 1 377 ? 16.553  -41.424 58.842  1.00 46.67 ? 377 MET A CE  1 
ATOM   2973  N N   . GLY A 1 378 ? 13.762  -36.037 58.337  1.00 32.89 ? 378 GLY A N   1 
ATOM   2974  C CA  . GLY A 1 378 ? 13.785  -34.839 59.184  1.00 32.51 ? 378 GLY A CA  1 
ATOM   2975  C C   . GLY A 1 378 ? 15.060  -34.032 59.138  1.00 32.66 ? 378 GLY A C   1 
ATOM   2976  O O   . GLY A 1 378 ? 15.426  -33.410 60.127  1.00 32.18 ? 378 GLY A O   1 
ATOM   2977  N N   . VAL A 1 379 ? 15.745  -34.012 57.993  1.00 31.84 ? 379 VAL A N   1 
ATOM   2978  C CA  . VAL A 1 379 ? 17.007  -33.265 57.899  1.00 32.53 ? 379 VAL A CA  1 
ATOM   2979  C C   . VAL A 1 379 ? 16.977  -32.430 56.614  1.00 32.99 ? 379 VAL A C   1 
ATOM   2980  O O   . VAL A 1 379 ? 16.622  -32.934 55.551  1.00 31.73 ? 379 VAL A O   1 
ATOM   2981  C CB  . VAL A 1 379 ? 18.258  -34.165 57.961  1.00 31.80 ? 379 VAL A CB  1 
ATOM   2982  C CG1 . VAL A 1 379 ? 18.428  -34.820 59.353  1.00 31.44 ? 379 VAL A CG1 1 
ATOM   2983  C CG2 . VAL A 1 379 ? 18.190  -35.243 56.919  1.00 34.19 ? 379 VAL A CG2 1 
ATOM   2984  N N   . LEU A 1 380 ? 17.262  -31.135 56.756  1.00 33.42 ? 380 LEU A N   1 
ATOM   2985  C CA  . LEU A 1 380 ? 17.177  -30.198 55.648  1.00 34.12 ? 380 LEU A CA  1 
ATOM   2986  C C   . LEU A 1 380 ? 18.554  -29.597 55.342  1.00 33.71 ? 380 LEU A C   1 
ATOM   2987  O O   . LEU A 1 380 ? 19.219  -29.069 56.231  1.00 33.86 ? 380 LEU A O   1 
ATOM   2988  C CB  . LEU A 1 380 ? 16.162  -29.079 55.938  1.00 35.10 ? 380 LEU A CB  1 
ATOM   2989  C CG  . LEU A 1 380 ? 14.670  -29.355 56.196  1.00 35.87 ? 380 LEU A CG  1 
ATOM   2990  C CD1 . LEU A 1 380 ? 13.886  -28.095 56.013  1.00 38.08 ? 380 LEU A CD1 1 
ATOM   2991  C CD2 . LEU A 1 380 ? 14.128  -30.420 55.277  1.00 38.98 ? 380 LEU A CD2 1 
ATOM   2992  N N   . MET A 1 381 ? 19.003  -29.748 54.095  1.00 33.59 ? 381 MET A N   1 
ATOM   2993  C CA  . MET A 1 381 ? 20.094  -28.931 53.567  1.00 33.02 ? 381 MET A CA  1 
ATOM   2994  C C   . MET A 1 381 ? 19.583  -28.312 52.276  1.00 31.70 ? 381 MET A C   1 
ATOM   2995  O O   . MET A 1 381 ? 18.532  -28.701 51.780  1.00 31.54 ? 381 MET A O   1 
ATOM   2996  C CB  . MET A 1 381 ? 21.355  -29.751 53.318  1.00 34.14 ? 381 MET A CB  1 
ATOM   2997  C CG  . MET A 1 381 ? 21.659  -30.840 54.383  1.00 35.84 ? 381 MET A CG  1 
ATOM   2998  S SD  . MET A 1 381 ? 23.436  -30.983 54.625  1.00 40.76 ? 381 MET A SD  1 
ATOM   2999  C CE  . MET A 1 381 ? 24.058  -30.512 53.032  1.00 42.55 ? 381 MET A CE  1 
ATOM   3000  N N   . LEU A 1 382 ? 20.296  -27.339 51.742  1.00 30.34 ? 382 LEU A N   1 
ATOM   3001  C CA  . LEU A 1 382 ? 19.807  -26.651 50.563  1.00 29.82 ? 382 LEU A CA  1 
ATOM   3002  C C   . LEU A 1 382 ? 20.489  -27.099 49.253  1.00 28.91 ? 382 LEU A C   1 
ATOM   3003  O O   . LEU A 1 382 ? 21.690  -26.925 49.100  1.00 28.03 ? 382 LEU A O   1 
ATOM   3004  C CB  . LEU A 1 382 ? 19.984  -25.160 50.751  1.00 29.85 ? 382 LEU A CB  1 
ATOM   3005  C CG  . LEU A 1 382 ? 19.208  -24.243 49.805  1.00 32.23 ? 382 LEU A CG  1 
ATOM   3006  C CD1 . LEU A 1 382 ? 17.737  -24.445 50.024  1.00 30.91 ? 382 LEU A CD1 1 
ATOM   3007  C CD2 . LEU A 1 382 ? 19.568  -22.784 50.119  1.00 28.06 ? 382 LEU A CD2 1 
ATOM   3008  N N   . PRO A 1 383 ? 19.707  -27.622 48.295  1.00 28.42 ? 383 PRO A N   1 
ATOM   3009  C CA  . PRO A 1 383 ? 20.256  -27.964 46.963  1.00 28.50 ? 383 PRO A CA  1 
ATOM   3010  C C   . PRO A 1 383 ? 20.891  -26.753 46.256  1.00 27.92 ? 383 PRO A C   1 
ATOM   3011  O O   . PRO A 1 383 ? 20.469  -25.599 46.458  1.00 27.38 ? 383 PRO A O   1 
ATOM   3012  C CB  . PRO A 1 383 ? 19.040  -28.515 46.190  1.00 27.39 ? 383 PRO A CB  1 
ATOM   3013  C CG  . PRO A 1 383 ? 18.057  -28.944 47.310  1.00 29.21 ? 383 PRO A CG  1 
ATOM   3014  C CD  . PRO A 1 383 ? 18.270  -27.949 48.405  1.00 28.99 ? 383 PRO A CD  1 
ATOM   3015  N N   . GLY A 1 384 ? 21.900  -27.033 45.444  1.00 27.13 ? 384 GLY A N   1 
ATOM   3016  C CA  . GLY A 1 384 ? 22.702  -25.998 44.806  1.00 26.99 ? 384 GLY A CA  1 
ATOM   3017  C C   . GLY A 1 384 ? 22.034  -25.285 43.633  1.00 27.48 ? 384 GLY A C   1 
ATOM   3018  O O   . GLY A 1 384 ? 22.533  -24.235 43.205  1.00 26.22 ? 384 GLY A O   1 
ATOM   3019  N N   . ASN A 1 385 ? 20.944  -25.863 43.106  1.00 28.12 ? 385 ASN A N   1 
ATOM   3020  C CA  . ASN A 1 385 ? 20.265  -25.355 41.883  1.00 30.79 ? 385 ASN A CA  1 
ATOM   3021  C C   . ASN A 1 385 ? 19.986  -23.855 41.896  1.00 30.65 ? 385 ASN A C   1 
ATOM   3022  O O   . ASN A 1 385 ? 20.184  -23.207 40.872  1.00 31.42 ? 385 ASN A O   1 
ATOM   3023  C CB  . ASN A 1 385 ? 18.962  -26.126 41.565  1.00 31.50 ? 385 ASN A CB  1 
ATOM   3024  C CG  . ASN A 1 385 ? 19.086  -27.624 41.822  1.00 36.30 ? 385 ASN A CG  1 
ATOM   3025  O OD1 . ASN A 1 385 ? 19.179  -28.044 42.974  1.00 40.46 ? 385 ASN A OD1 1 
ATOM   3026  N ND2 . ASN A 1 385 ? 19.079  -28.442 40.751  1.00 37.81 ? 385 ASN A ND2 1 
ATOM   3027  N N   . ALA A 1 386 ? 19.591  -23.326 43.064  1.00 30.41 ? 386 ALA A N   1 
ATOM   3028  C CA  . ALA A 1 386 ? 19.222  -21.917 43.299  1.00 30.86 ? 386 ALA A CA  1 
ATOM   3029  C C   . ALA A 1 386 ? 20.317  -20.890 43.054  1.00 30.53 ? 386 ALA A C   1 
ATOM   3030  O O   . ALA A 1 386 ? 20.059  -19.689 42.929  1.00 31.01 ? 386 ALA A O   1 
ATOM   3031  C CB  . ALA A 1 386 ? 18.741  -21.772 44.751  1.00 30.39 ? 386 ALA A CB  1 
ATOM   3032  N N   . PHE A 1 387 ? 21.552  -21.351 43.051  1.00 29.72 ? 387 PHE A N   1 
ATOM   3033  C CA  . PHE A 1 387 ? 22.676  -20.454 42.986  1.00 29.33 ? 387 PHE A CA  1 
ATOM   3034  C C   . PHE A 1 387 ? 23.256  -20.320 41.576  1.00 29.91 ? 387 PHE A C   1 
ATOM   3035  O O   . PHE A 1 387 ? 24.312  -19.714 41.380  1.00 30.10 ? 387 PHE A O   1 
ATOM   3036  C CB  . PHE A 1 387 ? 23.695  -20.865 44.061  1.00 28.67 ? 387 PHE A CB  1 
ATOM   3037  C CG  . PHE A 1 387 ? 23.092  -20.891 45.439  1.00 27.32 ? 387 PHE A CG  1 
ATOM   3038  C CD1 . PHE A 1 387 ? 22.628  -22.083 45.985  1.00 26.95 ? 387 PHE A CD1 1 
ATOM   3039  C CD2 . PHE A 1 387 ? 22.935  -19.697 46.174  1.00 24.16 ? 387 PHE A CD2 1 
ATOM   3040  C CE1 . PHE A 1 387 ? 22.022  -22.116 47.238  1.00 27.06 ? 387 PHE A CE1 1 
ATOM   3041  C CE2 . PHE A 1 387 ? 22.352  -19.723 47.421  1.00 25.84 ? 387 PHE A CE2 1 
ATOM   3042  C CZ  . PHE A 1 387 ? 21.885  -20.931 47.959  1.00 26.55 ? 387 PHE A CZ  1 
ATOM   3043  N N   . TYR A 1 388 ? 22.517  -20.820 40.588  1.00 30.15 ? 388 TYR A N   1 
ATOM   3044  C CA  . TYR A 1 388 ? 22.953  -20.735 39.191  1.00 30.56 ? 388 TYR A CA  1 
ATOM   3045  C C   . TYR A 1 388 ? 21.919  -19.943 38.376  1.00 31.19 ? 388 TYR A C   1 
ATOM   3046  O O   . TYR A 1 388 ? 20.725  -19.970 38.690  1.00 29.90 ? 388 TYR A O   1 
ATOM   3047  C CB  . TYR A 1 388 ? 23.193  -22.158 38.612  1.00 30.08 ? 388 TYR A CB  1 
ATOM   3048  C CG  . TYR A 1 388 ? 24.310  -22.880 39.338  1.00 29.59 ? 388 TYR A CG  1 
ATOM   3049  C CD1 . TYR A 1 388 ? 25.643  -22.771 38.916  1.00 27.51 ? 388 TYR A CD1 1 
ATOM   3050  C CD2 . TYR A 1 388 ? 24.039  -23.631 40.492  1.00 29.63 ? 388 TYR A CD2 1 
ATOM   3051  C CE1 . TYR A 1 388 ? 26.677  -23.424 39.608  1.00 28.85 ? 388 TYR A CE1 1 
ATOM   3052  C CE2 . TYR A 1 388 ? 25.057  -24.274 41.193  1.00 29.46 ? 388 TYR A CE2 1 
ATOM   3053  C CZ  . TYR A 1 388 ? 26.370  -24.179 40.742  1.00 29.56 ? 388 TYR A CZ  1 
ATOM   3054  O OH  . TYR A 1 388 ? 27.355  -24.822 41.452  1.00 30.43 ? 388 TYR A OH  1 
ATOM   3055  N N   . VAL A 1 389 ? 22.390  -19.225 37.358  1.00 32.85 ? 389 VAL A N   1 
ATOM   3056  C CA  . VAL A 1 389 ? 21.518  -18.451 36.445  1.00 34.84 ? 389 VAL A CA  1 
ATOM   3057  C C   . VAL A 1 389 ? 20.504  -19.391 35.829  1.00 35.93 ? 389 VAL A C   1 
ATOM   3058  O O   . VAL A 1 389 ? 19.307  -19.097 35.811  1.00 36.38 ? 389 VAL A O   1 
ATOM   3059  C CB  . VAL A 1 389 ? 22.327  -17.700 35.353  1.00 35.11 ? 389 VAL A CB  1 
ATOM   3060  C CG1 . VAL A 1 389 ? 21.448  -16.790 34.535  1.00 36.72 ? 389 VAL A CG1 1 
ATOM   3061  C CG2 . VAL A 1 389 ? 23.472  -16.880 35.965  1.00 34.59 ? 389 VAL A CG2 1 
ATOM   3062  N N   . ASP A 1 390 ? 20.980  -20.546 35.350  1.00 36.97 ? 390 ASP A N   1 
ATOM   3063  C CA  . ASP A 1 390 ? 20.086  -21.640 34.951  1.00 37.42 ? 390 ASP A CA  1 
ATOM   3064  C C   . ASP A 1 390 ? 19.869  -22.641 36.110  1.00 38.05 ? 390 ASP A C   1 
ATOM   3065  O O   . ASP A 1 390 ? 20.691  -23.560 36.332  1.00 38.12 ? 390 ASP A O   1 
ATOM   3066  C CB  . ASP A 1 390 ? 20.641  -22.322 33.691  1.00 38.14 ? 390 ASP A CB  1 
ATOM   3067  C CG  . ASP A 1 390 ? 19.825  -23.525 33.263  1.00 39.32 ? 390 ASP A CG  1 
ATOM   3068  O OD1 . ASP A 1 390 ? 20.398  -24.396 32.577  1.00 41.03 ? 390 ASP A OD1 1 
ATOM   3069  O OD2 . ASP A 1 390 ? 18.628  -23.609 33.624  1.00 39.63 ? 390 ASP A OD2 1 
ATOM   3070  N N   . SER A 1 391 ? 18.755  -22.473 36.834  1.00 37.49 ? 391 SER A N   1 
ATOM   3071  C CA  . SER A 1 391 ? 18.446  -23.287 38.007  1.00 38.22 ? 391 SER A CA  1 
ATOM   3072  C C   . SER A 1 391 ? 17.790  -24.614 37.645  1.00 38.79 ? 391 SER A C   1 
ATOM   3073  O O   . SER A 1 391 ? 17.559  -25.459 38.523  1.00 39.41 ? 391 SER A O   1 
ATOM   3074  C CB  . SER A 1 391 ? 17.569  -22.513 39.016  1.00 38.50 ? 391 SER A CB  1 
ATOM   3075  O OG  . SER A 1 391 ? 16.315  -22.139 38.440  1.00 38.23 ? 391 SER A OG  1 
ATOM   3076  N N   . SER A 1 392 ? 17.488  -24.805 36.361  1.00 38.13 ? 392 SER A N   1 
ATOM   3077  C CA  . SER A 1 392 ? 16.925  -26.066 35.899  1.00 38.27 ? 392 SER A CA  1 
ATOM   3078  C C   . SER A 1 392 ? 18.003  -27.140 35.727  1.00 37.12 ? 392 SER A C   1 
ATOM   3079  O O   . SER A 1 392 ? 17.702  -28.332 35.708  1.00 38.08 ? 392 SER A O   1 
ATOM   3080  C CB  . SER A 1 392 ? 16.173  -25.873 34.586  1.00 38.11 ? 392 SER A CB  1 
ATOM   3081  O OG  . SER A 1 392 ? 17.077  -25.393 33.590  1.00 40.50 ? 392 SER A OG  1 
ATOM   3082  N N   . ALA A 1 393 ? 19.248  -26.713 35.580  1.00 36.21 ? 393 ALA A N   1 
ATOM   3083  C CA  . ALA A 1 393 ? 20.359  -27.635 35.356  1.00 35.30 ? 393 ALA A CA  1 
ATOM   3084  C C   . ALA A 1 393 ? 20.652  -28.454 36.626  1.00 34.95 ? 393 ALA A C   1 
ATOM   3085  O O   . ALA A 1 393 ? 20.492  -27.946 37.749  1.00 34.80 ? 393 ALA A O   1 
ATOM   3086  C CB  . ALA A 1 393 ? 21.585  -26.870 34.909  1.00 34.21 ? 393 ALA A CB  1 
ATOM   3087  N N   . PRO A 1 394 ? 21.051  -29.737 36.455  1.00 34.92 ? 394 PRO A N   1 
ATOM   3088  C CA  . PRO A 1 394 ? 21.414  -30.617 37.566  1.00 33.68 ? 394 PRO A CA  1 
ATOM   3089  C C   . PRO A 1 394 ? 22.512  -30.027 38.433  1.00 32.83 ? 394 PRO A C   1 
ATOM   3090  O O   . PRO A 1 394 ? 23.414  -29.401 37.903  1.00 32.89 ? 394 PRO A O   1 
ATOM   3091  C CB  . PRO A 1 394 ? 21.953  -31.864 36.850  1.00 34.19 ? 394 PRO A CB  1 
ATOM   3092  C CG  . PRO A 1 394 ? 21.206  -31.900 35.558  1.00 34.87 ? 394 PRO A CG  1 
ATOM   3093  C CD  . PRO A 1 394 ? 21.163  -30.440 35.154  1.00 34.85 ? 394 PRO A CD  1 
ATOM   3094  N N   . SER A 1 395 ? 22.421  -30.184 39.758  1.00 31.09 ? 395 SER A N   1 
ATOM   3095  C CA  . SER A 1 395 ? 23.491  -29.751 40.663  1.00 29.64 ? 395 SER A CA  1 
ATOM   3096  C C   . SER A 1 395 ? 23.793  -30.833 41.704  1.00 28.74 ? 395 SER A C   1 
ATOM   3097  O O   . SER A 1 395 ? 22.889  -31.288 42.393  1.00 29.10 ? 395 SER A O   1 
ATOM   3098  C CB  . SER A 1 395 ? 23.132  -28.465 41.404  1.00 29.58 ? 395 SER A CB  1 
ATOM   3099  O OG  . SER A 1 395 ? 24.201  -28.123 42.267  1.00 28.96 ? 395 SER A OG  1 
ATOM   3100  N N   . PRO A 1 396 ? 25.066  -31.257 41.802  1.00 28.18 ? 396 PRO A N   1 
ATOM   3101  C CA  . PRO A 1 396 ? 25.502  -32.218 42.815  1.00 27.26 ? 396 PRO A CA  1 
ATOM   3102  C C   . PRO A 1 396 ? 25.837  -31.558 44.165  1.00 26.35 ? 396 PRO A C   1 
ATOM   3103  O O   . PRO A 1 396 ? 26.381  -32.220 45.046  1.00 25.53 ? 396 PRO A O   1 
ATOM   3104  C CB  . PRO A 1 396 ? 26.791  -32.795 42.192  1.00 28.21 ? 396 PRO A CB  1 
ATOM   3105  C CG  . PRO A 1 396 ? 27.365  -31.631 41.470  1.00 28.02 ? 396 PRO A CG  1 
ATOM   3106  C CD  . PRO A 1 396 ? 26.160  -30.904 40.873  1.00 27.82 ? 396 PRO A CD  1 
ATOM   3107  N N   . TYR A 1 397 ? 25.525  -30.269 44.318  1.00 24.15 ? 397 TYR A N   1 
ATOM   3108  C CA  . TYR A 1 397 ? 25.990  -29.530 45.483  1.00 24.37 ? 397 TYR A CA  1 
ATOM   3109  C C   . TYR A 1 397 ? 24.877  -29.261 46.465  1.00 24.56 ? 397 TYR A C   1 
ATOM   3110  O O   . TYR A 1 397 ? 23.703  -29.092 46.062  1.00 24.22 ? 397 TYR A O   1 
ATOM   3111  C CB  . TYR A 1 397 ? 26.543  -28.177 45.070  1.00 24.67 ? 397 TYR A CB  1 
ATOM   3112  C CG  . TYR A 1 397 ? 27.881  -28.205 44.415  1.00 24.46 ? 397 TYR A CG  1 
ATOM   3113  C CD1 . TYR A 1 397 ? 27.982  -28.256 43.037  1.00 25.52 ? 397 TYR A CD1 1 
ATOM   3114  C CD2 . TYR A 1 397 ? 29.056  -28.168 45.175  1.00 26.38 ? 397 TYR A CD2 1 
ATOM   3115  C CE1 . TYR A 1 397 ? 29.231  -28.242 42.391  1.00 25.95 ? 397 TYR A CE1 1 
ATOM   3116  C CE2 . TYR A 1 397 ? 30.309  -28.137 44.542  1.00 26.93 ? 397 TYR A CE2 1 
ATOM   3117  C CZ  . TYR A 1 397 ? 30.366  -28.205 43.149  1.00 27.89 ? 397 TYR A CZ  1 
ATOM   3118  O OH  . TYR A 1 397 ? 31.575  -28.198 42.505  1.00 31.95 ? 397 TYR A OH  1 
ATOM   3119  N N   . LEU A 1 398 ? 25.282  -29.160 47.727  1.00 24.38 ? 398 LEU A N   1 
ATOM   3120  C CA  . LEU A 1 398 ? 24.426  -28.889 48.881  1.00 26.05 ? 398 LEU A CA  1 
ATOM   3121  C C   . LEU A 1 398 ? 25.015  -27.700 49.606  1.00 25.51 ? 398 LEU A C   1 
ATOM   3122  O O   . LEU A 1 398 ? 26.216  -27.708 49.875  1.00 25.90 ? 398 LEU A O   1 
ATOM   3123  C CB  . LEU A 1 398 ? 24.469  -30.073 49.869  1.00 26.52 ? 398 LEU A CB  1 
ATOM   3124  C CG  . LEU A 1 398 ? 23.672  -31.276 49.436  1.00 30.71 ? 398 LEU A CG  1 
ATOM   3125  C CD1 . LEU A 1 398 ? 23.773  -32.441 50.443  1.00 28.80 ? 398 LEU A CD1 1 
ATOM   3126  C CD2 . LEU A 1 398 ? 22.241  -30.773 49.305  1.00 32.27 ? 398 LEU A CD2 1 
ATOM   3127  N N   . ARG A 1 399 ? 24.196  -26.693 49.925  1.00 24.78 ? 399 ARG A N   1 
ATOM   3128  C CA  . ARG A 1 399 ? 24.575  -25.677 50.931  1.00 24.66 ? 399 ARG A CA  1 
ATOM   3129  C C   . ARG A 1 399 ? 24.147  -26.082 52.368  1.00 24.32 ? 399 ARG A C   1 
ATOM   3130  O O   . ARG A 1 399 ? 22.983  -26.353 52.643  1.00 22.55 ? 399 ARG A O   1 
ATOM   3131  C CB  . ARG A 1 399 ? 23.983  -24.292 50.594  1.00 23.66 ? 399 ARG A CB  1 
ATOM   3132  C CG  . ARG A 1 399 ? 24.707  -23.152 51.274  1.00 24.22 ? 399 ARG A CG  1 
ATOM   3133  C CD  . ARG A 1 399 ? 23.920  -21.842 51.110  1.00 23.15 ? 399 ARG A CD  1 
ATOM   3134  N NE  . ARG A 1 399 ? 22.660  -21.837 51.881  1.00 23.08 ? 399 ARG A NE  1 
ATOM   3135  C CZ  . ARG A 1 399 ? 21.775  -20.828 51.855  1.00 23.30 ? 399 ARG A CZ  1 
ATOM   3136  N NH1 . ARG A 1 399 ? 21.995  -19.772 51.094  1.00 22.09 ? 399 ARG A NH1 1 
ATOM   3137  N NH2 . ARG A 1 399 ? 20.661  -20.892 52.569  1.00 23.57 ? 399 ARG A NH2 1 
ATOM   3138  N N   . ALA A 1 400 ? 25.099  -26.102 53.291  1.00 24.92 ? 400 ALA A N   1 
ATOM   3139  C CA  . ALA A 1 400 ? 24.747  -26.349 54.688  1.00 25.18 ? 400 ALA A CA  1 
ATOM   3140  C C   . ALA A 1 400 ? 25.168  -25.163 55.550  1.00 25.39 ? 400 ALA A C   1 
ATOM   3141  O O   . ALA A 1 400 ? 26.340  -24.711 55.495  1.00 23.77 ? 400 ALA A O   1 
ATOM   3142  C CB  . ALA A 1 400 ? 25.363  -27.661 55.190  1.00 25.10 ? 400 ALA A CB  1 
ATOM   3143  N N   . SER A 1 401 ? 24.217  -24.659 56.338  1.00 25.02 ? 401 SER A N   1 
ATOM   3144  C CA  . SER A 1 401 ? 24.507  -23.532 57.242  1.00 25.17 ? 401 SER A CA  1 
ATOM   3145  C C   . SER A 1 401 ? 25.061  -23.999 58.570  1.00 23.96 ? 401 SER A C   1 
ATOM   3146  O O   . SER A 1 401 ? 24.555  -24.957 59.177  1.00 23.59 ? 401 SER A O   1 
ATOM   3147  C CB  . SER A 1 401 ? 23.262  -22.683 57.537  1.00 26.92 ? 401 SER A CB  1 
ATOM   3148  O OG  . SER A 1 401 ? 23.639  -21.501 58.302  1.00 29.38 ? 401 SER A OG  1 
ATOM   3149  N N   . PHE A 1 402 ? 26.092  -23.309 59.025  1.00 23.32 ? 402 PHE A N   1 
ATOM   3150  C CA  . PHE A 1 402 ? 26.632  -23.544 60.364  1.00 23.80 ? 402 PHE A CA  1 
ATOM   3151  C C   . PHE A 1 402 ? 26.416  -22.421 61.384  1.00 24.46 ? 402 PHE A C   1 
ATOM   3152  O O   . PHE A 1 402 ? 27.030  -22.434 62.443  1.00 25.38 ? 402 PHE A O   1 
ATOM   3153  C CB  . PHE A 1 402 ? 28.124  -23.945 60.324  1.00 23.44 ? 402 PHE A CB  1 
ATOM   3154  C CG  . PHE A 1 402 ? 29.036  -22.983 59.589  1.00 22.24 ? 402 PHE A CG  1 
ATOM   3155  C CD1 . PHE A 1 402 ? 29.602  -21.887 60.235  1.00 21.68 ? 402 PHE A CD1 1 
ATOM   3156  C CD2 . PHE A 1 402 ? 29.424  -23.249 58.287  1.00 21.45 ? 402 PHE A CD2 1 
ATOM   3157  C CE1 . PHE A 1 402 ? 30.526  -21.053 59.584  1.00 24.18 ? 402 PHE A CE1 1 
ATOM   3158  C CE2 . PHE A 1 402 ? 30.308  -22.418 57.621  1.00 22.38 ? 402 PHE A CE2 1 
ATOM   3159  C CZ  . PHE A 1 402 ? 30.873  -21.326 58.260  1.00 23.92 ? 402 PHE A CZ  1 
ATOM   3160  N N   . SER A 1 403 ? 25.549  -21.465 61.078  1.00 24.56 ? 403 SER A N   1 
ATOM   3161  C CA  . SER A 1 403 ? 25.326  -20.343 61.985  1.00 25.85 ? 403 SER A CA  1 
ATOM   3162  C C   . SER A 1 403 ? 24.753  -20.753 63.353  1.00 26.32 ? 403 SER A C   1 
ATOM   3163  O O   . SER A 1 403 ? 25.095  -20.156 64.376  1.00 26.50 ? 403 SER A O   1 
ATOM   3164  C CB  . SER A 1 403 ? 24.435  -19.294 61.312  1.00 25.87 ? 403 SER A CB  1 
ATOM   3165  O OG  . SER A 1 403 ? 23.101  -19.783 61.272  1.00 28.17 ? 403 SER A OG  1 
ATOM   3166  N N   . SER A 1 404 ? 23.905  -21.790 63.391  1.00 27.72 ? 404 SER A N   1 
ATOM   3167  C CA  . SER A 1 404 ? 23.070  -22.027 64.597  1.00 28.24 ? 404 SER A CA  1 
ATOM   3168  C C   . SER A 1 404 ? 23.068  -23.437 65.211  1.00 28.24 ? 404 SER A C   1 
ATOM   3169  O O   . SER A 1 404 ? 22.786  -23.604 66.405  1.00 28.84 ? 404 SER A O   1 
ATOM   3170  C CB  . SER A 1 404 ? 21.622  -21.641 64.259  1.00 27.76 ? 404 SER A CB  1 
ATOM   3171  O OG  . SER A 1 404 ? 21.601  -20.338 63.670  1.00 32.55 ? 404 SER A OG  1 
ATOM   3172  N N   . ALA A 1 405 ? 23.326  -24.448 64.381  1.00 27.20 ? 405 ALA A N   1 
ATOM   3173  C CA  . ALA A 1 405 ? 23.104  -25.832 64.788  1.00 26.82 ? 405 ALA A CA  1 
ATOM   3174  C C   . ALA A 1 405 ? 24.126  -26.227 65.848  1.00 26.53 ? 405 ALA A C   1 
ATOM   3175  O O   . ALA A 1 405 ? 25.275  -25.806 65.779  1.00 26.32 ? 405 ALA A O   1 
ATOM   3176  C CB  . ALA A 1 405 ? 23.170  -26.749 63.566  1.00 26.23 ? 405 ALA A CB  1 
ATOM   3177  N N   . SER A 1 406 ? 23.703  -26.987 66.852  1.00 26.71 ? 406 SER A N   1 
ATOM   3178  C CA  . SER A 1 406 ? 24.645  -27.504 67.836  1.00 27.67 ? 406 SER A CA  1 
ATOM   3179  C C   . SER A 1 406 ? 25.536  -28.605 67.179  1.00 29.98 ? 406 SER A C   1 
ATOM   3180  O O   . SER A 1 406 ? 25.191  -29.135 66.103  1.00 28.40 ? 406 SER A O   1 
ATOM   3181  C CB  . SER A 1 406 ? 23.878  -28.112 69.001  1.00 27.59 ? 406 SER A CB  1 
ATOM   3182  O OG  . SER A 1 406 ? 23.267  -29.327 68.606  1.00 25.19 ? 406 SER A OG  1 
ATOM   3183  N N   . PRO A 1 407 ? 26.677  -28.964 67.831  1.00 31.03 ? 407 PRO A N   1 
ATOM   3184  C CA  . PRO A 1 407 ? 27.452  -30.089 67.299  1.00 31.76 ? 407 PRO A CA  1 
ATOM   3185  C C   . PRO A 1 407 ? 26.635  -31.381 67.190  1.00 32.44 ? 407 PRO A C   1 
ATOM   3186  O O   . PRO A 1 407 ? 26.789  -32.130 66.217  1.00 33.84 ? 407 PRO A O   1 
ATOM   3187  C CB  . PRO A 1 407 ? 28.602  -30.241 68.312  1.00 32.13 ? 407 PRO A CB  1 
ATOM   3188  C CG  . PRO A 1 407 ? 28.745  -28.833 68.915  1.00 32.07 ? 407 PRO A CG  1 
ATOM   3189  C CD  . PRO A 1 407 ? 27.312  -28.360 69.025  1.00 31.04 ? 407 PRO A CD  1 
ATOM   3190  N N   . GLU A 1 408 ? 25.771  -31.636 68.167  1.00 32.05 ? 408 GLU A N   1 
ATOM   3191  C CA  . GLU A 1 408 ? 24.937  -32.815 68.174  1.00 32.47 ? 408 GLU A CA  1 
ATOM   3192  C C   . GLU A 1 408 ? 24.016  -32.831 66.951  1.00 31.59 ? 408 GLU A C   1 
ATOM   3193  O O   . GLU A 1 408 ? 23.832  -33.879 66.301  1.00 32.38 ? 408 GLU A O   1 
ATOM   3194  C CB  . GLU A 1 408 ? 24.101  -32.897 69.465  1.00 33.08 ? 408 GLU A CB  1 
ATOM   3195  C CG  . GLU A 1 408 ? 24.927  -33.080 70.775  1.00 36.10 ? 408 GLU A CG  1 
ATOM   3196  C CD  . GLU A 1 408 ? 25.615  -31.810 71.306  1.00 40.02 ? 408 GLU A CD  1 
ATOM   3197  O OE1 . GLU A 1 408 ? 25.368  -30.668 70.839  1.00 36.21 ? 408 GLU A OE1 1 
ATOM   3198  O OE2 . GLU A 1 408 ? 26.442  -31.976 72.224  1.00 43.38 ? 408 GLU A OE2 1 
ATOM   3199  N N   . GLN A 1 409 ? 23.401  -31.698 66.639  1.00 29.66 ? 409 GLN A N   1 
ATOM   3200  C CA  . GLN A 1 409 ? 22.478  -31.735 65.527  1.00 28.34 ? 409 GLN A CA  1 
ATOM   3201  C C   . GLN A 1 409 ? 23.200  -31.768 64.148  1.00 27.24 ? 409 GLN A C   1 
ATOM   3202  O O   . GLN A 1 409 ? 22.690  -32.383 63.214  1.00 25.58 ? 409 GLN A O   1 
ATOM   3203  C CB  . GLN A 1 409 ? 21.295  -30.774 65.701  1.00 30.49 ? 409 GLN A CB  1 
ATOM   3204  C CG  . GLN A 1 409 ? 21.539  -29.370 65.481  1.00 33.02 ? 409 GLN A CG  1 
ATOM   3205  C CD  . GLN A 1 409 ? 20.495  -28.487 66.150  1.00 34.48 ? 409 GLN A CD  1 
ATOM   3206  O OE1 . GLN A 1 409 ? 20.824  -27.406 66.564  1.00 30.26 ? 409 GLN A OE1 1 
ATOM   3207  N NE2 . GLN A 1 409 ? 19.241  -28.949 66.245  1.00 34.43 ? 409 GLN A NE2 1 
ATOM   3208  N N   . MET A 1 410 ? 24.409  -31.197 64.060  1.00 24.75 ? 410 MET A N   1 
ATOM   3209  C CA  . MET A 1 410 ? 25.256  -31.384 62.860  1.00 25.53 ? 410 MET A CA  1 
ATOM   3210  C C   . MET A 1 410 ? 25.649  -32.857 62.667  1.00 24.86 ? 410 MET A C   1 
ATOM   3211  O O   . MET A 1 410 ? 25.671  -33.318 61.542  1.00 25.42 ? 410 MET A O   1 
ATOM   3212  C CB  . MET A 1 410 ? 26.528  -30.563 62.896  1.00 25.51 ? 410 MET A CB  1 
ATOM   3213  C CG  . MET A 1 410 ? 26.358  -29.058 62.707  1.00 25.33 ? 410 MET A CG  1 
ATOM   3214  S SD  . MET A 1 410 ? 27.862  -28.260 63.282  1.00 29.08 ? 410 MET A SD  1 
ATOM   3215  C CE  . MET A 1 410 ? 27.485  -26.554 62.916  1.00 20.35 ? 410 MET A CE  1 
ATOM   3216  N N   . ASP A 1 411 ? 25.982  -33.550 63.761  1.00 24.75 ? 411 ASP A N   1 
ATOM   3217  C CA  . ASP A 1 411 ? 26.379  -34.975 63.753  1.00 25.65 ? 411 ASP A CA  1 
ATOM   3218  C C   . ASP A 1 411 ? 25.258  -35.849 63.240  1.00 24.78 ? 411 ASP A C   1 
ATOM   3219  O O   . ASP A 1 411 ? 25.438  -36.649 62.324  1.00 25.14 ? 411 ASP A O   1 
ATOM   3220  C CB  . ASP A 1 411 ? 26.802  -35.420 65.181  1.00 25.10 ? 411 ASP A CB  1 
ATOM   3221  C CG  . ASP A 1 411 ? 27.333  -36.891 65.241  1.00 29.36 ? 411 ASP A CG  1 
ATOM   3222  O OD1 . ASP A 1 411 ? 26.574  -37.810 65.664  1.00 31.28 ? 411 ASP A OD1 1 
ATOM   3223  O OD2 . ASP A 1 411 ? 28.518  -37.128 64.903  1.00 26.99 ? 411 ASP A OD2 1 
ATOM   3224  N N   . VAL A 1 412 ? 24.068  -35.662 63.795  1.00 25.12 ? 412 VAL A N   1 
ATOM   3225  C CA  . VAL A 1 412 ? 22.888  -36.355 63.293  1.00 24.02 ? 412 VAL A CA  1 
ATOM   3226  C C   . VAL A 1 412 ? 22.557  -36.062 61.841  1.00 23.42 ? 412 VAL A C   1 
ATOM   3227  O O   . VAL A 1 412 ? 22.320  -36.996 61.062  1.00 23.24 ? 412 VAL A O   1 
ATOM   3228  C CB  . VAL A 1 412 ? 21.651  -36.110 64.197  1.00 25.71 ? 412 VAL A CB  1 
ATOM   3229  C CG1 . VAL A 1 412 ? 20.373  -36.720 63.583  1.00 24.20 ? 412 VAL A CG1 1 
ATOM   3230  C CG2 . VAL A 1 412 ? 21.914  -36.722 65.545  1.00 25.60 ? 412 VAL A CG2 1 
ATOM   3231  N N   . ALA A 1 413 ? 22.571  -34.788 61.437  1.00 22.69 ? 413 ALA A N   1 
ATOM   3232  C CA  . ALA A 1 413 ? 22.231  -34.441 60.042  1.00 21.74 ? 413 ALA A CA  1 
ATOM   3233  C C   . ALA A 1 413 ? 23.178  -35.033 58.991  1.00 21.74 ? 413 ALA A C   1 
ATOM   3234  O O   . ALA A 1 413 ? 22.750  -35.366 57.882  1.00 22.04 ? 413 ALA A O   1 
ATOM   3235  C CB  . ALA A 1 413 ? 22.175  -32.909 59.863  1.00 20.98 ? 413 ALA A CB  1 
ATOM   3236  N N   . PHE A 1 414 ? 24.461  -35.087 59.324  1.00 21.88 ? 414 PHE A N   1 
ATOM   3237  C CA  . PHE A 1 414 ? 25.529  -35.621 58.440  1.00 22.57 ? 414 PHE A CA  1 
ATOM   3238  C C   . PHE A 1 414 ? 25.588  -37.135 58.447  1.00 23.62 ? 414 PHE A C   1 
ATOM   3239  O O   . PHE A 1 414 ? 25.889  -37.756 57.432  1.00 25.07 ? 414 PHE A O   1 
ATOM   3240  C CB  . PHE A 1 414 ? 26.905  -35.032 58.810  1.00 22.04 ? 414 PHE A CB  1 
ATOM   3241  C CG  . PHE A 1 414 ? 27.146  -33.670 58.220  1.00 24.08 ? 414 PHE A CG  1 
ATOM   3242  C CD1 . PHE A 1 414 ? 26.600  -32.545 58.798  1.00 29.68 ? 414 PHE A CD1 1 
ATOM   3243  C CD2 . PHE A 1 414 ? 27.884  -33.518 57.066  1.00 27.45 ? 414 PHE A CD2 1 
ATOM   3244  C CE1 . PHE A 1 414 ? 26.803  -31.278 58.241  1.00 30.67 ? 414 PHE A CE1 1 
ATOM   3245  C CE2 . PHE A 1 414 ? 28.088  -32.250 56.504  1.00 30.93 ? 414 PHE A CE2 1 
ATOM   3246  C CZ  . PHE A 1 414 ? 27.532  -31.142 57.073  1.00 28.01 ? 414 PHE A CZ  1 
ATOM   3247  N N   . GLN A 1 415 ? 25.233  -37.761 59.546  1.00 25.63 ? 415 GLN A N   1 
ATOM   3248  C CA  . GLN A 1 415 ? 25.124  -39.213 59.464  1.00 27.48 ? 415 GLN A CA  1 
ATOM   3249  C C   . GLN A 1 415 ? 23.898  -39.616 58.637  1.00 26.29 ? 415 GLN A C   1 
ATOM   3250  O O   . GLN A 1 415 ? 23.950  -40.603 57.927  1.00 24.92 ? 415 GLN A O   1 
ATOM   3251  C CB  . GLN A 1 415 ? 25.101  -39.870 60.841  1.00 29.39 ? 415 GLN A CB  1 
ATOM   3252  C CG  . GLN A 1 415 ? 23.951  -39.525 61.681  1.00 34.01 ? 415 GLN A CG  1 
ATOM   3253  C CD  . GLN A 1 415 ? 23.270  -40.786 62.226  1.00 41.49 ? 415 GLN A CD  1 
ATOM   3254  O OE1 . GLN A 1 415 ? 22.720  -41.590 61.462  1.00 42.86 ? 415 GLN A OE1 1 
ATOM   3255  N NE2 . GLN A 1 415 ? 23.312  -40.958 63.555  1.00 40.69 ? 415 GLN A NE2 1 
ATOM   3256  N N   . VAL A 1 416 ? 22.804  -38.842 58.739  1.00 25.75 ? 416 VAL A N   1 
ATOM   3257  C CA  . VAL A 1 416 ? 21.596  -39.145 57.973  1.00 25.54 ? 416 VAL A CA  1 
ATOM   3258  C C   . VAL A 1 416 ? 21.899  -38.901 56.500  1.00 24.94 ? 416 VAL A C   1 
ATOM   3259  O O   . VAL A 1 416 ? 21.603  -39.767 55.642  1.00 25.29 ? 416 VAL A O   1 
ATOM   3260  C CB  . VAL A 1 416 ? 20.345  -38.331 58.463  1.00 25.38 ? 416 VAL A CB  1 
ATOM   3261  C CG1 . VAL A 1 416 ? 19.236  -38.353 57.454  1.00 27.37 ? 416 VAL A CG1 1 
ATOM   3262  C CG2 . VAL A 1 416 ? 19.825  -38.820 59.792  1.00 27.08 ? 416 VAL A CG2 1 
ATOM   3263  N N   . LEU A 1 417 ? 22.483  -37.742 56.202  1.00 23.29 ? 417 LEU A N   1 
ATOM   3264  C CA  . LEU A 1 417 ? 22.968  -37.452 54.851  1.00 24.19 ? 417 LEU A CA  1 
ATOM   3265  C C   . LEU A 1 417 ? 23.832  -38.558 54.243  1.00 24.04 ? 417 LEU A C   1 
ATOM   3266  O O   . LEU A 1 417 ? 23.530  -39.002 53.166  1.00 24.72 ? 417 LEU A O   1 
ATOM   3267  C CB  . LEU A 1 417 ? 23.791  -36.166 54.810  1.00 23.71 ? 417 LEU A CB  1 
ATOM   3268  C CG  . LEU A 1 417 ? 23.697  -35.208 53.605  1.00 26.45 ? 417 LEU A CG  1 
ATOM   3269  C CD1 . LEU A 1 417 ? 25.021  -34.449 53.359  1.00 26.09 ? 417 LEU A CD1 1 
ATOM   3270  C CD2 . LEU A 1 417 ? 23.174  -35.766 52.288  1.00 26.69 ? 417 LEU A CD2 1 
ATOM   3271  N N   . ALA A 1 418 ? 24.918  -38.948 54.910  1.00 24.14 ? 418 ALA A N   1 
ATOM   3272  C CA  . ALA A 1 418 ? 25.810  -40.028 54.431  1.00 25.20 ? 418 ALA A CA  1 
ATOM   3273  C C   . ALA A 1 418 ? 25.036  -41.304 54.091  1.00 25.47 ? 418 ALA A C   1 
ATOM   3274  O O   . ALA A 1 418 ? 25.317  -41.944 53.097  1.00 26.13 ? 418 ALA A O   1 
ATOM   3275  C CB  . ALA A 1 418 ? 26.884  -40.335 55.472  1.00 24.83 ? 418 ALA A CB  1 
ATOM   3276  N N   . GLN A 1 419 ? 24.055  -41.657 54.922  1.00 26.34 ? 419 GLN A N   1 
ATOM   3277  C CA  . GLN A 1 419 ? 23.258  -42.879 54.738  1.00 27.55 ? 419 GLN A CA  1 
ATOM   3278  C C   . GLN A 1 419 ? 22.442  -42.755 53.455  1.00 26.91 ? 419 GLN A C   1 
ATOM   3279  O O   . GLN A 1 419 ? 22.452  -43.666 52.629  1.00 27.61 ? 419 GLN A O   1 
ATOM   3280  C CB  . GLN A 1 419 ? 22.367  -43.117 55.970  1.00 28.52 ? 419 GLN A CB  1 
ATOM   3281  C CG  . GLN A 1 419 ? 21.384  -44.275 55.901  1.00 31.81 ? 419 GLN A CG  1 
ATOM   3282  C CD  . GLN A 1 419 ? 20.210  -44.107 56.885  1.00 38.18 ? 419 GLN A CD  1 
ATOM   3283  O OE1 . GLN A 1 419 ? 20.383  -43.621 58.023  1.00 41.16 ? 419 GLN A OE1 1 
ATOM   3284  N NE2 . GLN A 1 419 ? 18.994  -44.486 56.437  1.00 41.63 ? 419 GLN A NE2 1 
ATOM   3285  N N   . LEU A 1 420 ? 21.781  -41.612 53.251  1.00 26.02 ? 420 LEU A N   1 
ATOM   3286  C CA  . LEU A 1 420 ? 20.939  -41.452 52.085  1.00 26.12 ? 420 LEU A CA  1 
ATOM   3287  C C   . LEU A 1 420 ? 21.750  -41.347 50.797  1.00 25.38 ? 420 LEU A C   1 
ATOM   3288  O O   . LEU A 1 420 ? 21.309  -41.797 49.712  1.00 25.87 ? 420 LEU A O   1 
ATOM   3289  C CB  . LEU A 1 420 ? 20.021  -40.239 52.248  1.00 26.47 ? 420 LEU A CB  1 
ATOM   3290  C CG  . LEU A 1 420 ? 18.980  -40.382 53.362  1.00 27.07 ? 420 LEU A CG  1 
ATOM   3291  C CD1 . LEU A 1 420 ? 18.462  -38.998 53.751  1.00 26.92 ? 420 LEU A CD1 1 
ATOM   3292  C CD2 . LEU A 1 420 ? 17.855  -41.314 52.906  1.00 28.78 ? 420 LEU A CD2 1 
ATOM   3293  N N   . ILE A 1 421 ? 22.909  -40.726 50.908  1.00 25.09 ? 421 ILE A N   1 
ATOM   3294  C CA  . ILE A 1 421 ? 23.875  -40.690 49.793  1.00 25.59 ? 421 ILE A CA  1 
ATOM   3295  C C   . ILE A 1 421 ? 24.211  -42.151 49.416  1.00 26.80 ? 421 ILE A C   1 
ATOM   3296  O O   . ILE A 1 421 ? 23.959  -42.586 48.289  1.00 25.81 ? 421 ILE A O   1 
ATOM   3297  C CB  . ILE A 1 421 ? 25.145  -39.904 50.160  1.00 24.72 ? 421 ILE A CB  1 
ATOM   3298  C CG1 . ILE A 1 421 ? 24.857  -38.399 50.187  1.00 22.21 ? 421 ILE A CG1 1 
ATOM   3299  C CG2 . ILE A 1 421 ? 26.294  -40.157 49.146  1.00 25.43 ? 421 ILE A CG2 1 
ATOM   3300  C CD1 . ILE A 1 421 ? 26.057  -37.564 50.668  1.00 23.03 ? 421 ILE A CD1 1 
ATOM   3301  N N   . LYS A 1 422 ? 24.685  -42.921 50.388  1.00 26.76 ? 422 LYS A N   1 
ATOM   3302  C CA  . LYS A 1 422 ? 25.031  -44.298 50.075  1.00 29.69 ? 422 LYS A CA  1 
ATOM   3303  C C   . LYS A 1 422 ? 23.843  -45.112 49.556  1.00 31.92 ? 422 LYS A C   1 
ATOM   3304  O O   . LYS A 1 422 ? 24.021  -45.957 48.693  1.00 30.97 ? 422 LYS A O   1 
ATOM   3305  C CB  . LYS A 1 422 ? 25.698  -44.952 51.259  1.00 28.38 ? 422 LYS A CB  1 
ATOM   3306  C CG  . LYS A 1 422 ? 27.097  -44.393 51.436  1.00 28.85 ? 422 LYS A CG  1 
ATOM   3307  C CD  . LYS A 1 422 ? 27.791  -45.034 52.620  1.00 26.14 ? 422 LYS A CD  1 
ATOM   3308  C CE  . LYS A 1 422 ? 27.172  -44.573 53.900  1.00 25.78 ? 422 LYS A CE  1 
ATOM   3309  N NZ  . LYS A 1 422 ? 27.831  -45.256 55.062  1.00 25.95 ? 422 LYS A NZ  1 
ATOM   3310  N N   . GLU A 1 423 ? 22.641  -44.817 50.061  1.00 33.96 ? 423 GLU A N   1 
ATOM   3311  C CA  . GLU A 1 423 ? 21.419  -45.476 49.592  1.00 36.94 ? 423 GLU A CA  1 
ATOM   3312  C C   . GLU A 1 423 ? 21.044  -45.099 48.166  1.00 37.58 ? 423 GLU A C   1 
ATOM   3313  O O   . GLU A 1 423 ? 20.246  -45.791 47.539  1.00 38.76 ? 423 GLU A O   1 
ATOM   3314  C CB  . GLU A 1 423 ? 20.235  -45.183 50.529  1.00 37.18 ? 423 GLU A CB  1 
ATOM   3315  C CG  . GLU A 1 423 ? 20.235  -46.019 51.817  1.00 38.99 ? 423 GLU A CG  1 
ATOM   3316  C CD  . GLU A 1 423 ? 19.117  -45.633 52.769  1.00 42.01 ? 423 GLU A CD  1 
ATOM   3317  O OE1 . GLU A 1 423 ? 18.307  -44.738 52.411  1.00 41.39 ? 423 GLU A OE1 1 
ATOM   3318  O OE2 . GLU A 1 423 ? 19.037  -46.239 53.869  1.00 43.46 ? 423 GLU A OE2 1 
ATOM   3319  N N   . SER A 1 424 ? 21.604  -43.999 47.670  1.00 38.10 ? 424 SER A N   1 
ATOM   3320  C CA  . SER A 1 424 ? 21.251  -43.448 46.369  1.00 38.79 ? 424 SER A CA  1 
ATOM   3321  C C   . SER A 1 424 ? 22.288  -43.737 45.294  1.00 39.44 ? 424 SER A C   1 
ATOM   3322  O O   . SER A 1 424 ? 22.066  -43.366 44.144  1.00 39.45 ? 424 SER A O   1 
ATOM   3323  C CB  . SER A 1 424 ? 21.078  -41.911 46.444  1.00 38.36 ? 424 SER A CB  1 
ATOM   3324  O OG  . SER A 1 424 ? 20.300  -41.520 47.557  1.00 39.47 ? 424 SER A OG  1 
ATOM   3325  N N   . LEU A 1 425 ? 23.436  -44.320 45.662  1.00 39.84 ? 425 LEU A N   1 
ATOM   3326  C CA  . LEU A 1 425 ? 24.505  -44.604 44.679  1.00 40.40 ? 425 LEU A CA  1 
ATOM   3327  C C   . LEU A 1 425 ? 24.270  -45.920 43.942  1.00 40.65 ? 425 LEU A C   1 
ATOM   3328  O O   . LEU A 1 425 ? 23.571  -46.819 44.461  1.00 41.39 ? 425 LEU A O   1 
ATOM   3329  C CB  . LEU A 1 425 ? 25.881  -44.646 45.348  1.00 40.85 ? 425 LEU A CB  1 
ATOM   3330  C CG  . LEU A 1 425 ? 26.451  -43.431 46.084  1.00 41.47 ? 425 LEU A CG  1 
ATOM   3331  C CD1 . LEU A 1 425 ? 27.708  -43.865 46.837  1.00 41.68 ? 425 LEU A CD1 1 
ATOM   3332  C CD2 . LEU A 1 425 ? 26.761  -42.294 45.113  1.00 41.41 ? 425 LEU A CD2 1 
ATOM   3333  N N   . MET B 1 1   ? -11.455 -9.545  35.064  1.00 41.79 ? 1   MET B N   1 
ATOM   3334  C CA  . MET B 1 1   ? -10.451 -8.710  34.309  1.00 41.17 ? 1   MET B CA  1 
ATOM   3335  C C   . MET B 1 1   ? -9.019  -9.220  34.196  1.00 40.03 ? 1   MET B C   1 
ATOM   3336  O O   . MET B 1 1   ? -8.602  -10.163 34.865  1.00 40.78 ? 1   MET B O   1 
ATOM   3337  C CB  . MET B 1 1   ? -10.412 -7.261  34.787  1.00 41.54 ? 1   MET B CB  1 
ATOM   3338  C CG  . MET B 1 1   ? -9.887  -7.014  36.197  1.00 41.24 ? 1   MET B CG  1 
ATOM   3339  S SD  . MET B 1 1   ? -10.257 -5.264  36.503  1.00 40.69 ? 1   MET B SD  1 
ATOM   3340  C CE  . MET B 1 1   ? -8.708  -4.450  36.143  1.00 33.76 ? 1   MET B CE  1 
ATOM   3341  N N   . ASN B 1 2   ? -8.290  -8.519  33.336  1.00 38.64 ? 2   ASN B N   1 
ATOM   3342  C CA  . ASN B 1 2   ? -7.053  -8.974  32.727  1.00 37.54 ? 2   ASN B CA  1 
ATOM   3343  C C   . ASN B 1 2   ? -5.869  -8.233  33.332  1.00 35.89 ? 2   ASN B C   1 
ATOM   3344  O O   . ASN B 1 2   ? -5.402  -7.230  32.810  1.00 35.02 ? 2   ASN B O   1 
ATOM   3345  C CB  . ASN B 1 2   ? -7.159  -8.759  31.192  1.00 38.37 ? 2   ASN B CB  1 
ATOM   3346  C CG  . ASN B 1 2   ? -5.893  -9.121  30.441  1.00 38.34 ? 2   ASN B CG  1 
ATOM   3347  O OD1 . ASN B 1 2   ? -5.725  -8.711  29.298  1.00 41.17 ? 2   ASN B OD1 1 
ATOM   3348  N ND2 . ASN B 1 2   ? -4.998  -9.884  31.071  1.00 38.31 ? 2   ASN B ND2 1 
ATOM   3349  N N   . TYR B 1 3   ? -5.381  -8.767  34.451  1.00 34.29 ? 3   TYR B N   1 
ATOM   3350  C CA  . TYR B 1 3   ? -4.294  -8.140  35.207  1.00 32.64 ? 3   TYR B CA  1 
ATOM   3351  C C   . TYR B 1 3   ? -2.970  -8.053  34.457  1.00 32.35 ? 3   TYR B C   1 
ATOM   3352  O O   . TYR B 1 3   ? -2.177  -7.138  34.706  1.00 31.07 ? 3   TYR B O   1 
ATOM   3353  C CB  . TYR B 1 3   ? -4.125  -8.834  36.570  1.00 31.36 ? 3   TYR B CB  1 
ATOM   3354  C CG  . TYR B 1 3   ? -5.303  -8.574  37.475  1.00 28.94 ? 3   TYR B CG  1 
ATOM   3355  C CD1 . TYR B 1 3   ? -6.055  -9.625  38.010  1.00 27.53 ? 3   TYR B CD1 1 
ATOM   3356  C CD2 . TYR B 1 3   ? -5.667  -7.263  37.802  1.00 29.62 ? 3   TYR B CD2 1 
ATOM   3357  C CE1 . TYR B 1 3   ? -7.149  -9.377  38.853  1.00 29.54 ? 3   TYR B CE1 1 
ATOM   3358  C CE2 . TYR B 1 3   ? -6.746  -7.002  38.637  1.00 28.97 ? 3   TYR B CE2 1 
ATOM   3359  C CZ  . TYR B 1 3   ? -7.475  -8.052  39.163  1.00 28.03 ? 3   TYR B CZ  1 
ATOM   3360  O OH  . TYR B 1 3   ? -8.542  -7.762  39.958  1.00 29.75 ? 3   TYR B OH  1 
ATOM   3361  N N   . ALA B 1 4   ? -2.745  -8.970  33.513  1.00 32.20 ? 4   ALA B N   1 
ATOM   3362  C CA  . ALA B 1 4   ? -1.493  -8.967  32.727  1.00 32.06 ? 4   ALA B CA  1 
ATOM   3363  C C   . ALA B 1 4   ? -1.252  -7.644  32.004  1.00 32.37 ? 4   ALA B C   1 
ATOM   3364  O O   . ALA B 1 4   ? -0.098  -7.251  31.811  1.00 31.78 ? 4   ALA B O   1 
ATOM   3365  C CB  . ALA B 1 4   ? -1.476  -10.132 31.734  1.00 33.49 ? 4   ALA B CB  1 
ATOM   3366  N N   . ARG B 1 5   ? -2.339  -6.958  31.619  1.00 32.85 ? 5   ARG B N   1 
ATOM   3367  C CA  . ARG B 1 5   ? -2.280  -5.618  30.981  1.00 33.61 ? 5   ARG B CA  1 
ATOM   3368  C C   . ARG B 1 5   ? -1.496  -4.619  31.823  1.00 33.60 ? 5   ARG B C   1 
ATOM   3369  O O   . ARG B 1 5   ? -0.795  -3.747  31.294  1.00 34.29 ? 5   ARG B O   1 
ATOM   3370  C CB  . ARG B 1 5   ? -3.682  -4.976  30.836  1.00 33.03 ? 5   ARG B CB  1 
ATOM   3371  C CG  . ARG B 1 5   ? -4.563  -5.399  29.682  1.00 35.73 ? 5   ARG B CG  1 
ATOM   3372  C CD  . ARG B 1 5   ? -5.913  -4.616  29.779  1.00 35.92 ? 5   ARG B CD  1 
ATOM   3373  N NE  . ARG B 1 5   ? -5.755  -3.179  29.543  1.00 37.08 ? 5   ARG B NE  1 
ATOM   3374  C CZ  . ARG B 1 5   ? -6.556  -2.238  30.045  1.00 35.82 ? 5   ARG B CZ  1 
ATOM   3375  N NH1 . ARG B 1 5   ? -6.358  -0.947  29.767  1.00 31.46 ? 5   ARG B NH1 1 
ATOM   3376  N NH2 . ARG B 1 5   ? -7.552  -2.596  30.831  1.00 36.85 ? 5   ARG B NH2 1 
ATOM   3377  N N   . PHE B 1 6   ? -1.693  -4.705  33.136  1.00 32.80 ? 6   PHE B N   1 
ATOM   3378  C CA  . PHE B 1 6   ? -1.121  -3.712  34.044  1.00 32.29 ? 6   PHE B CA  1 
ATOM   3379  C C   . PHE B 1 6   ? 0.181   -4.158  34.703  1.00 32.91 ? 6   PHE B C   1 
ATOM   3380  O O   . PHE B 1 6   ? 0.528   -3.693  35.803  1.00 33.52 ? 6   PHE B O   1 
ATOM   3381  C CB  . PHE B 1 6   ? -2.146  -3.331  35.111  1.00 31.42 ? 6   PHE B CB  1 
ATOM   3382  C CG  . PHE B 1 6   ? -3.528  -3.098  34.581  1.00 30.24 ? 6   PHE B CG  1 
ATOM   3383  C CD1 . PHE B 1 6   ? -4.483  -4.117  34.637  1.00 31.07 ? 6   PHE B CD1 1 
ATOM   3384  C CD2 . PHE B 1 6   ? -3.896  -1.847  34.047  1.00 29.03 ? 6   PHE B CD2 1 
ATOM   3385  C CE1 . PHE B 1 6   ? -5.792  -3.893  34.154  1.00 31.84 ? 6   PHE B CE1 1 
ATOM   3386  C CE2 . PHE B 1 6   ? -5.175  -1.622  33.578  1.00 28.45 ? 6   PHE B CE2 1 
ATOM   3387  C CZ  . PHE B 1 6   ? -6.129  -2.624  33.636  1.00 27.33 ? 6   PHE B CZ  1 
ATOM   3388  N N   . ILE B 1 7   ? 0.902   -5.065  34.044  1.00 31.80 ? 7   ILE B N   1 
ATOM   3389  C CA  . ILE B 1 7   ? 2.136   -5.617  34.586  1.00 31.09 ? 7   ILE B CA  1 
ATOM   3390  C C   . ILE B 1 7   ? 3.236   -5.517  33.524  1.00 31.09 ? 7   ILE B C   1 
ATOM   3391  O O   . ILE B 1 7   ? 3.098   -6.009  32.412  1.00 29.88 ? 7   ILE B O   1 
ATOM   3392  C CB  . ILE B 1 7   ? 1.946   -7.099  35.039  1.00 31.18 ? 7   ILE B CB  1 
ATOM   3393  C CG1 . ILE B 1 7   ? 1.083   -7.168  36.311  1.00 30.43 ? 7   ILE B CG1 1 
ATOM   3394  C CG2 . ILE B 1 7   ? 3.278   -7.771  35.348  1.00 28.95 ? 7   ILE B CG2 1 
ATOM   3395  C CD1 . ILE B 1 7   ? 0.502   -8.552  36.612  1.00 29.33 ? 7   ILE B CD1 1 
ATOM   3396  N N   . THR B 1 8   ? 4.327   -4.862  33.872  1.00 29.91 ? 8   THR B N   1 
ATOM   3397  C CA  . THR B 1 8   ? 5.463   -4.729  32.965  1.00 31.07 ? 8   THR B CA  1 
ATOM   3398  C C   . THR B 1 8   ? 6.055   -6.129  32.589  1.00 30.91 ? 8   THR B C   1 
ATOM   3399  O O   . THR B 1 8   ? 5.693   -7.142  33.188  1.00 29.42 ? 8   THR B O   1 
ATOM   3400  C CB  . THR B 1 8   ? 6.477   -3.782  33.610  1.00 30.80 ? 8   THR B CB  1 
ATOM   3401  O OG1 . THR B 1 8   ? 6.120   -2.425  33.280  1.00 32.33 ? 8   THR B OG1 1 
ATOM   3402  C CG2 . THR B 1 8   ? 7.821   -4.024  33.173  1.00 34.86 ? 8   THR B CG2 1 
ATOM   3403  N N   . ALA B 1 9   ? 6.936   -6.158  31.583  1.00 31.09 ? 9   ALA B N   1 
ATOM   3404  C CA  . ALA B 1 9   ? 7.649   -7.372  31.211  1.00 30.21 ? 9   ALA B CA  1 
ATOM   3405  C C   . ALA B 1 9   ? 8.707   -7.707  32.258  1.00 29.78 ? 9   ALA B C   1 
ATOM   3406  O O   . ALA B 1 9   ? 8.858   -8.882  32.614  1.00 29.02 ? 9   ALA B O   1 
ATOM   3407  C CB  . ALA B 1 9   ? 8.280   -7.193  29.853  1.00 31.26 ? 9   ALA B CB  1 
ATOM   3408  N N   . ALA B 1 10  ? 9.442   -6.691  32.730  1.00 28.54 ? 10  ALA B N   1 
ATOM   3409  C CA  . ALA B 1 10  ? 10.262  -6.836  33.961  1.00 28.85 ? 10  ALA B CA  1 
ATOM   3410  C C   . ALA B 1 10  ? 9.456   -7.369  35.160  1.00 28.61 ? 10  ALA B C   1 
ATOM   3411  O O   . ALA B 1 10  ? 9.832   -8.403  35.771  1.00 29.24 ? 10  ALA B O   1 
ATOM   3412  C CB  . ALA B 1 10  ? 10.987  -5.549  34.314  1.00 29.01 ? 10  ALA B CB  1 
ATOM   3413  N N   . SER B 1 11  ? 8.343   -6.710  35.490  1.00 27.09 ? 11  SER B N   1 
ATOM   3414  C CA  . SER B 1 11  ? 7.501   -7.162  36.613  1.00 25.70 ? 11  SER B CA  1 
ATOM   3415  C C   . SER B 1 11  ? 7.008   -8.606  36.429  1.00 26.66 ? 11  SER B C   1 
ATOM   3416  O O   . SER B 1 11  ? 7.191   -9.450  37.319  1.00 25.72 ? 11  SER B O   1 
ATOM   3417  C CB  . SER B 1 11  ? 6.313   -6.224  36.814  1.00 25.69 ? 11  SER B CB  1 
ATOM   3418  O OG  . SER B 1 11  ? 5.587   -6.633  37.945  1.00 22.66 ? 11  SER B OG  1 
ATOM   3419  N N   . ALA B 1 12  ? 6.426   -8.894  35.254  1.00 27.30 ? 12  ALA B N   1 
ATOM   3420  C CA  . ALA B 1 12  ? 5.982   -10.240 34.907  1.00 28.00 ? 12  ALA B CA  1 
ATOM   3421  C C   . ALA B 1 12  ? 7.091   -11.317 34.958  1.00 28.22 ? 12  ALA B C   1 
ATOM   3422  O O   . ALA B 1 12  ? 6.802   -12.474 35.228  1.00 28.79 ? 12  ALA B O   1 
ATOM   3423  C CB  . ALA B 1 12  ? 5.309   -10.226 33.540  1.00 28.50 ? 12  ALA B CB  1 
ATOM   3424  N N   . ALA B 1 13  ? 8.342   -10.923 34.741  1.00 29.29 ? 13  ALA B N   1 
ATOM   3425  C CA  . ALA B 1 13  ? 9.495   -11.826 34.789  1.00 30.11 ? 13  ALA B CA  1 
ATOM   3426  C C   . ALA B 1 13  ? 9.930   -12.214 36.214  1.00 31.46 ? 13  ALA B C   1 
ATOM   3427  O O   . ALA B 1 13  ? 10.677  -13.197 36.393  1.00 29.95 ? 13  ALA B O   1 
ATOM   3428  C CB  . ALA B 1 13  ? 10.670  -11.220 34.057  1.00 29.76 ? 13  ALA B CB  1 
ATOM   3429  N N   . ARG B 1 14  ? 9.513   -11.435 37.226  1.00 30.65 ? 14  ARG B N   1 
ATOM   3430  C CA  . ARG B 1 14  ? 9.934   -11.733 38.594  1.00 30.70 ? 14  ARG B CA  1 
ATOM   3431  C C   . ARG B 1 14  ? 9.456   -13.108 39.034  1.00 32.46 ? 14  ARG B C   1 
ATOM   3432  O O   . ARG B 1 14  ? 8.327   -13.514 38.741  1.00 31.12 ? 14  ARG B O   1 
ATOM   3433  C CB  . ARG B 1 14  ? 9.424   -10.697 39.603  1.00 29.03 ? 14  ARG B CB  1 
ATOM   3434  C CG  . ARG B 1 14  ? 9.887   -9.325  39.326  1.00 25.94 ? 14  ARG B CG  1 
ATOM   3435  C CD  . ARG B 1 14  ? 9.756   -8.389  40.526  1.00 20.77 ? 14  ARG B CD  1 
ATOM   3436  N NE  . ARG B 1 14  ? 10.072  -7.025  40.098  1.00 21.10 ? 14  ARG B NE  1 
ATOM   3437  C CZ  . ARG B 1 14  ? 11.292  -6.515  39.976  1.00 18.29 ? 14  ARG B CZ  1 
ATOM   3438  N NH1 . ARG B 1 14  ? 12.360  -7.221  40.307  1.00 25.05 ? 14  ARG B NH1 1 
ATOM   3439  N NH2 . ARG B 1 14  ? 11.459  -5.256  39.543  1.00 20.48 ? 14  ARG B NH2 1 
ATOM   3440  N N   . ASN B 1 15  ? 10.321  -13.777 39.782  1.00 35.27 ? 15  ASN B N   1 
ATOM   3441  C CA  . ASN B 1 15  ? 10.080  -15.117 40.305  1.00 39.96 ? 15  ASN B CA  1 
ATOM   3442  C C   . ASN B 1 15  ? 9.973   -15.150 41.813  1.00 43.27 ? 15  ASN B C   1 
ATOM   3443  O O   . ASN B 1 15  ? 10.703  -14.406 42.508  1.00 43.55 ? 15  ASN B O   1 
ATOM   3444  C CB  . ASN B 1 15  ? 11.220  -16.043 39.897  1.00 39.00 ? 15  ASN B CB  1 
ATOM   3445  C CG  . ASN B 1 15  ? 11.165  -16.403 38.448  1.00 40.69 ? 15  ASN B CG  1 
ATOM   3446  O OD1 . ASN B 1 15  ? 10.091  -16.685 37.921  1.00 40.56 ? 15  ASN B OD1 1 
ATOM   3447  N ND2 . ASN B 1 15  ? 12.326  -16.385 37.777  1.00 39.40 ? 15  ASN B ND2 1 
ATOM   3448  N N   . PRO B 1 16  ? 9.087   -16.026 42.338  1.00 47.10 ? 16  PRO B N   1 
ATOM   3449  C CA  . PRO B 1 16  ? 9.006   -16.216 43.785  1.00 49.80 ? 16  PRO B CA  1 
ATOM   3450  C C   . PRO B 1 16  ? 10.276  -16.800 44.392  1.00 52.89 ? 16  PRO B C   1 
ATOM   3451  O O   . PRO B 1 16  ? 10.775  -16.265 45.384  1.00 53.56 ? 16  PRO B O   1 
ATOM   3452  C CB  . PRO B 1 16  ? 7.850   -17.216 43.944  1.00 49.76 ? 16  PRO B CB  1 
ATOM   3453  C CG  . PRO B 1 16  ? 7.762   -17.911 42.629  1.00 48.44 ? 16  PRO B CG  1 
ATOM   3454  C CD  . PRO B 1 16  ? 8.088   -16.849 41.629  1.00 47.40 ? 16  PRO B CD  1 
ATOM   3455  N N   . SER B 1 17  ? 10.807  -17.838 43.736  1.00 56.12 ? 17  SER B N   1 
ATOM   3456  C CA  . SER B 1 17  ? 11.596  -18.926 44.357  1.00 59.44 ? 17  SER B CA  1 
ATOM   3457  C C   . SER B 1 17  ? 12.818  -18.534 45.247  1.00 61.61 ? 17  SER B C   1 
ATOM   3458  O O   . SER B 1 17  ? 12.715  -17.632 46.092  1.00 61.69 ? 17  SER B O   1 
ATOM   3459  C CB  . SER B 1 17  ? 11.974  -19.929 43.250  1.00 59.43 ? 17  SER B CB  1 
ATOM   3460  O OG  . SER B 1 17  ? 12.496  -19.266 42.104  1.00 59.88 ? 17  SER B OG  1 
ATOM   3461  N N   . PRO B 1 18  ? 13.947  -19.271 45.139  1.00 63.79 ? 18  PRO B N   1 
ATOM   3462  C CA  . PRO B 1 18  ? 14.155  -20.676 44.778  1.00 65.30 ? 18  PRO B CA  1 
ATOM   3463  C C   . PRO B 1 18  ? 14.557  -21.515 46.006  1.00 66.93 ? 18  PRO B C   1 
ATOM   3464  O O   . PRO B 1 18  ? 14.936  -22.692 45.868  1.00 67.19 ? 18  PRO B O   1 
ATOM   3465  C CB  . PRO B 1 18  ? 15.315  -20.591 43.780  1.00 65.05 ? 18  PRO B CB  1 
ATOM   3466  C CG  . PRO B 1 18  ? 16.051  -19.263 44.153  1.00 65.01 ? 18  PRO B CG  1 
ATOM   3467  C CD  . PRO B 1 18  ? 15.241  -18.571 45.233  1.00 63.84 ? 18  PRO B CD  1 
ATOM   3468  N N   . ILE B 1 19  ? 14.434  -20.907 47.189  1.00 68.61 ? 19  ILE B N   1 
ATOM   3469  C CA  . ILE B 1 19  ? 15.048  -21.404 48.424  1.00 70.21 ? 19  ILE B CA  1 
ATOM   3470  C C   . ILE B 1 19  ? 14.032  -21.760 49.515  1.00 71.49 ? 19  ILE B C   1 
ATOM   3471  O O   . ILE B 1 19  ? 14.077  -22.860 50.082  1.00 71.67 ? 19  ILE B O   1 
ATOM   3472  C CB  . ILE B 1 19  ? 16.097  -20.370 48.979  1.00 70.05 ? 19  ILE B CB  1 
ATOM   3473  C CG1 . ILE B 1 19  ? 17.372  -20.375 48.122  1.00 69.17 ? 19  ILE B CG1 1 
ATOM   3474  C CG2 . ILE B 1 19  ? 16.417  -20.618 50.469  1.00 69.97 ? 19  ILE B CG2 1 
ATOM   3475  C CD1 . ILE B 1 19  ? 18.472  -19.442 48.633  1.00 67.73 ? 19  ILE B CD1 1 
ATOM   3476  N N   . ARG B 1 20  ? 13.116  -20.833 49.796  1.00 73.31 ? 20  ARG B N   1 
ATOM   3477  C CA  . ARG B 1 20  ? 12.294  -20.895 51.017  1.00 74.82 ? 20  ARG B CA  1 
ATOM   3478  C C   . ARG B 1 20  ? 10.993  -21.720 50.914  1.00 75.45 ? 20  ARG B C   1 
ATOM   3479  O O   . ARG B 1 20  ? 9.970   -21.412 51.539  1.00 75.56 ? 20  ARG B O   1 
ATOM   3480  C CB  . ARG B 1 20  ? 12.076  -19.483 51.591  1.00 75.05 ? 20  ARG B CB  1 
ATOM   3481  C CG  . ARG B 1 20  ? 13.370  -18.841 52.105  1.00 76.23 ? 20  ARG B CG  1 
ATOM   3482  C CD  . ARG B 1 20  ? 13.108  -17.797 53.198  1.00 78.95 ? 20  ARG B CD  1 
ATOM   3483  N NE  . ARG B 1 20  ? 14.300  -17.311 53.917  1.00 80.60 ? 20  ARG B NE  1 
ATOM   3484  C CZ  . ARG B 1 20  ? 15.483  -17.931 54.030  1.00 81.52 ? 20  ARG B CZ  1 
ATOM   3485  N NH1 . ARG B 1 20  ? 15.712  -19.115 53.469  1.00 81.37 ? 20  ARG B NH1 1 
ATOM   3486  N NH2 . ARG B 1 20  ? 16.458  -17.353 54.725  1.00 82.26 ? 20  ARG B NH2 1 
ATOM   3487  N N   . THR B 1 21  ? 11.062  -22.786 50.117  1.00 76.20 ? 21  THR B N   1 
ATOM   3488  C CA  . THR B 1 21  ? 10.161  -23.929 50.262  1.00 76.72 ? 21  THR B CA  1 
ATOM   3489  C C   . THR B 1 21  ? 10.722  -24.811 51.393  1.00 76.93 ? 21  THR B C   1 
ATOM   3490  O O   . THR B 1 21  ? 10.047  -25.725 51.886  1.00 76.94 ? 21  THR B O   1 
ATOM   3491  C CB  . THR B 1 21  ? 10.021  -24.743 48.942  1.00 76.75 ? 21  THR B CB  1 
ATOM   3492  O OG1 . THR B 1 21  ? 11.258  -25.411 48.643  1.00 77.22 ? 21  THR B OG1 1 
ATOM   3493  C CG2 . THR B 1 21  ? 9.630   -23.832 47.766  1.00 76.72 ? 21  THR B CG2 1 
ATOM   3494  N N   . MET B 1 22  ? 11.963  -24.512 51.797  1.00 77.24 ? 22  MET B N   1 
ATOM   3495  C CA  . MET B 1 22  ? 12.632  -25.184 52.916  1.00 77.27 ? 22  MET B CA  1 
ATOM   3496  C C   . MET B 1 22  ? 12.140  -24.672 54.269  1.00 77.26 ? 22  MET B C   1 
ATOM   3497  O O   . MET B 1 22  ? 11.951  -25.468 55.195  1.00 77.34 ? 22  MET B O   1 
ATOM   3498  C CB  . MET B 1 22  ? 14.158  -25.052 52.817  1.00 77.48 ? 22  MET B CB  1 
ATOM   3499  C CG  . MET B 1 22  ? 14.795  -25.792 51.639  1.00 78.17 ? 22  MET B CG  1 
ATOM   3500  S SD  . MET B 1 22  ? 14.794  -27.598 51.751  1.00 79.79 ? 22  MET B SD  1 
ATOM   3501  C CE  . MET B 1 22  ? 15.036  -28.016 50.022  1.00 79.40 ? 22  MET B CE  1 
ATOM   3502  N N   . THR B 1 23  ? 11.938  -23.355 54.392  1.00 77.22 ? 23  THR B N   1 
ATOM   3503  C CA  . THR B 1 23  ? 11.306  -22.798 55.603  1.00 77.19 ? 23  THR B CA  1 
ATOM   3504  C C   . THR B 1 23  ? 9.846   -23.234 55.694  1.00 76.94 ? 23  THR B C   1 
ATOM   3505  O O   . THR B 1 23  ? 9.315   -23.409 56.791  1.00 77.18 ? 23  THR B O   1 
ATOM   3506  C CB  . THR B 1 23  ? 11.432  -21.241 55.742  1.00 77.33 ? 23  THR B CB  1 
ATOM   3507  O OG1 . THR B 1 23  ? 10.756  -20.807 56.934  1.00 76.81 ? 23  THR B OG1 1 
ATOM   3508  C CG2 . THR B 1 23  ? 10.835  -20.508 54.545  1.00 77.60 ? 23  THR B CG2 1 
ATOM   3509  N N   . ASP B 1 24  ? 9.227   -23.413 54.526  1.00 76.62 ? 24  ASP B N   1 
ATOM   3510  C CA  . ASP B 1 24  ? 7.875   -23.962 54.376  1.00 76.49 ? 24  ASP B CA  1 
ATOM   3511  C C   . ASP B 1 24  ? 7.710   -25.246 55.208  1.00 75.93 ? 24  ASP B C   1 
ATOM   3512  O O   . ASP B 1 24  ? 6.903   -25.294 56.152  1.00 75.67 ? 24  ASP B O   1 
ATOM   3513  C CB  . ASP B 1 24  ? 7.616   -24.244 52.879  1.00 76.66 ? 24  ASP B CB  1 
ATOM   3514  C CG  . ASP B 1 24  ? 6.136   -24.269 52.506  1.00 77.37 ? 24  ASP B CG  1 
ATOM   3515  O OD1 . ASP B 1 24  ? 5.357   -25.028 53.127  1.00 78.45 ? 24  ASP B OD1 1 
ATOM   3516  O OD2 . ASP B 1 24  ? 5.759   -23.548 51.553  1.00 77.03 ? 24  ASP B OD2 1 
ATOM   3517  N N   . ILE B 1 25  ? 8.506   -26.262 54.869  1.00 75.23 ? 25  ILE B N   1 
ATOM   3518  C CA  . ILE B 1 25  ? 8.381   -27.591 55.473  1.00 74.66 ? 25  ILE B CA  1 
ATOM   3519  C C   . ILE B 1 25  ? 8.786   -27.634 56.952  1.00 74.20 ? 25  ILE B C   1 
ATOM   3520  O O   . ILE B 1 25  ? 8.192   -28.395 57.736  1.00 74.04 ? 25  ILE B O   1 
ATOM   3521  C CB  . ILE B 1 25  ? 9.100   -28.700 54.629  1.00 74.68 ? 25  ILE B CB  1 
ATOM   3522  C CG1 . ILE B 1 25  ? 8.767   -30.103 55.157  1.00 74.44 ? 25  ILE B CG1 1 
ATOM   3523  C CG2 . ILE B 1 25  ? 10.594  -28.471 54.556  1.00 74.46 ? 25  ILE B CG2 1 
ATOM   3524  C CD1 . ILE B 1 25  ? 7.460   -30.671 54.638  1.00 74.27 ? 25  ILE B CD1 1 
ATOM   3525  N N   . LEU B 1 26  ? 9.759   -26.796 57.328  1.00 73.40 ? 26  LEU B N   1 
ATOM   3526  C CA  . LEU B 1 26  ? 10.217  -26.719 58.724  1.00 72.70 ? 26  LEU B CA  1 
ATOM   3527  C C   . LEU B 1 26  ? 9.088   -26.348 59.701  1.00 71.99 ? 26  LEU B C   1 
ATOM   3528  O O   . LEU B 1 26  ? 8.913   -27.022 60.721  1.00 71.79 ? 26  LEU B O   1 
ATOM   3529  C CB  . LEU B 1 26  ? 11.428  -25.777 58.887  1.00 72.76 ? 26  LEU B CB  1 
ATOM   3530  C CG  . LEU B 1 26  ? 12.046  -25.707 60.295  1.00 72.45 ? 26  LEU B CG  1 
ATOM   3531  C CD1 . LEU B 1 26  ? 12.728  -27.011 60.686  1.00 71.35 ? 26  LEU B CD1 1 
ATOM   3532  C CD2 . LEU B 1 26  ? 13.011  -24.535 60.423  1.00 72.95 ? 26  LEU B CD2 1 
ATOM   3533  N N   . SER B 1 27  ? 8.329   -25.299 59.367  1.00 71.20 ? 27  SER B N   1 
ATOM   3534  C CA  . SER B 1 27  ? 7.207   -24.820 60.192  1.00 70.42 ? 27  SER B CA  1 
ATOM   3535  C C   . SER B 1 27  ? 6.208   -25.928 60.522  1.00 69.60 ? 27  SER B C   1 
ATOM   3536  O O   . SER B 1 27  ? 5.892   -26.162 61.694  1.00 69.49 ? 27  SER B O   1 
ATOM   3537  C CB  . SER B 1 27  ? 6.462   -23.680 59.488  1.00 70.54 ? 27  SER B CB  1 
ATOM   3538  O OG  . SER B 1 27  ? 7.348   -22.651 59.097  1.00 71.26 ? 27  SER B OG  1 
ATOM   3539  N N   . ARG B 1 28  ? 5.734   -26.604 59.473  1.00 68.28 ? 28  ARG B N   1 
ATOM   3540  C CA  . ARG B 1 28  ? 4.709   -27.649 59.581  1.00 67.02 ? 28  ARG B CA  1 
ATOM   3541  C C   . ARG B 1 28  ? 5.277   -29.070 59.793  1.00 65.82 ? 28  ARG B C   1 
ATOM   3542  O O   . ARG B 1 28  ? 4.550   -30.070 59.659  1.00 65.66 ? 28  ARG B O   1 
ATOM   3543  C CB  . ARG B 1 28  ? 3.751   -27.587 58.373  1.00 67.11 ? 28  ARG B CB  1 
ATOM   3544  C CG  . ARG B 1 28  ? 4.433   -27.228 57.066  1.00 68.10 ? 28  ARG B CG  1 
ATOM   3545  C CD  . ARG B 1 28  ? 3.447   -27.056 55.918  1.00 69.41 ? 28  ARG B CD  1 
ATOM   3546  N NE  . ARG B 1 28  ? 4.112   -26.967 54.609  1.00 71.02 ? 28  ARG B NE  1 
ATOM   3547  C CZ  . ARG B 1 28  ? 4.649   -27.994 53.937  1.00 71.86 ? 28  ARG B CZ  1 
ATOM   3548  N NH1 . ARG B 1 28  ? 5.219   -27.778 52.750  1.00 72.23 ? 28  ARG B NH1 1 
ATOM   3549  N NH2 . ARG B 1 28  ? 4.623   -29.235 54.429  1.00 71.62 ? 28  ARG B NH2 1 
ATOM   3550  N N   . GLY B 1 29  ? 6.567   -29.150 60.141  1.00 64.19 ? 29  GLY B N   1 
ATOM   3551  C CA  . GLY B 1 29  ? 7.210   -30.426 60.502  1.00 62.13 ? 29  GLY B CA  1 
ATOM   3552  C C   . GLY B 1 29  ? 7.337   -30.626 62.007  1.00 60.65 ? 29  GLY B C   1 
ATOM   3553  O O   . GLY B 1 29  ? 6.971   -29.739 62.781  1.00 60.32 ? 29  GLY B O   1 
ATOM   3554  N N   . PRO B 1 30  ? 7.877   -31.787 62.438  1.00 59.44 ? 30  PRO B N   1 
ATOM   3555  C CA  . PRO B 1 30  ? 7.995   -32.095 63.876  1.00 58.34 ? 30  PRO B CA  1 
ATOM   3556  C C   . PRO B 1 30  ? 9.082   -31.238 64.509  1.00 57.29 ? 30  PRO B C   1 
ATOM   3557  O O   . PRO B 1 30  ? 9.929   -30.699 63.793  1.00 57.08 ? 30  PRO B O   1 
ATOM   3558  C CB  . PRO B 1 30  ? 8.411   -33.572 63.901  1.00 58.14 ? 30  PRO B CB  1 
ATOM   3559  C CG  . PRO B 1 30  ? 8.274   -34.065 62.471  1.00 58.83 ? 30  PRO B CG  1 
ATOM   3560  C CD  . PRO B 1 30  ? 8.443   -32.860 61.602  1.00 59.24 ? 30  PRO B CD  1 
ATOM   3561  N N   . LYS B 1 31  ? 9.056   -31.100 65.833  1.00 56.12 ? 31  LYS B N   1 
ATOM   3562  C CA  . LYS B 1 31  ? 10.069  -30.293 66.528  1.00 54.67 ? 31  LYS B CA  1 
ATOM   3563  C C   . LYS B 1 31  ? 11.469  -30.916 66.417  1.00 53.16 ? 31  LYS B C   1 
ATOM   3564  O O   . LYS B 1 31  ? 12.474  -30.215 66.561  1.00 53.23 ? 31  LYS B O   1 
ATOM   3565  C CB  . LYS B 1 31  ? 9.703   -30.084 67.995  1.00 55.18 ? 31  LYS B CB  1 
ATOM   3566  C CG  . LYS B 1 31  ? 8.894   -28.832 68.270  1.00 57.05 ? 31  LYS B CG  1 
ATOM   3567  C CD  . LYS B 1 31  ? 7.428   -29.149 68.589  1.00 59.01 ? 31  LYS B CD  1 
ATOM   3568  C CE  . LYS B 1 31  ? 6.788   -27.986 69.380  1.00 60.42 ? 31  LYS B CE  1 
ATOM   3569  N NZ  . LYS B 1 31  ? 5.277   -27.995 69.370  1.00 61.13 ? 31  LYS B NZ  1 
ATOM   3570  N N   . SER B 1 32  ? 11.513  -32.223 66.138  1.00 50.72 ? 32  SER B N   1 
ATOM   3571  C CA  . SER B 1 32  ? 12.759  -32.974 66.043  1.00 48.34 ? 32  SER B CA  1 
ATOM   3572  C C   . SER B 1 32  ? 13.497  -32.749 64.713  1.00 46.87 ? 32  SER B C   1 
ATOM   3573  O O   . SER B 1 32  ? 14.650  -33.192 64.572  1.00 46.95 ? 32  SER B O   1 
ATOM   3574  C CB  . SER B 1 32  ? 12.526  -34.473 66.303  1.00 48.16 ? 32  SER B CB  1 
ATOM   3575  O OG  . SER B 1 32  ? 11.790  -35.096 65.263  1.00 48.12 ? 32  SER B OG  1 
ATOM   3576  N N   . MET B 1 33  ? 12.847  -32.059 63.766  1.00 43.98 ? 33  MET B N   1 
ATOM   3577  C CA  . MET B 1 33  ? 13.441  -31.734 62.464  1.00 42.46 ? 33  MET B CA  1 
ATOM   3578  C C   . MET B 1 33  ? 14.679  -30.806 62.576  1.00 40.62 ? 33  MET B C   1 
ATOM   3579  O O   . MET B 1 33  ? 14.650  -29.781 63.275  1.00 40.61 ? 33  MET B O   1 
ATOM   3580  C CB  . MET B 1 33  ? 12.378  -31.132 61.525  1.00 43.18 ? 33  MET B CB  1 
ATOM   3581  C CG  . MET B 1 33  ? 12.851  -30.769 60.107  1.00 45.12 ? 33  MET B CG  1 
ATOM   3582  S SD  . MET B 1 33  ? 11.459  -30.436 58.964  1.00 49.74 ? 33  MET B SD  1 
ATOM   3583  C CE  . MET B 1 33  ? 11.021  -32.109 58.456  1.00 47.98 ? 33  MET B CE  1 
ATOM   3584  N N   . ILE B 1 34  ? 15.743  -31.171 61.858  1.00 37.17 ? 34  ILE B N   1 
ATOM   3585  C CA  . ILE B 1 34  ? 17.007  -30.433 61.835  1.00 34.39 ? 34  ILE B CA  1 
ATOM   3586  C C   . ILE B 1 34  ? 17.194  -29.761 60.480  1.00 33.86 ? 34  ILE B C   1 
ATOM   3587  O O   . ILE B 1 34  ? 17.180  -30.422 59.440  1.00 32.41 ? 34  ILE B O   1 
ATOM   3588  C CB  . ILE B 1 34  ? 18.210  -31.389 62.089  1.00 34.03 ? 34  ILE B CB  1 
ATOM   3589  C CG1 . ILE B 1 34  ? 18.105  -32.025 63.470  1.00 32.62 ? 34  ILE B CG1 1 
ATOM   3590  C CG2 . ILE B 1 34  ? 19.546  -30.665 61.897  1.00 32.83 ? 34  ILE B CG2 1 
ATOM   3591  C CD1 . ILE B 1 34  ? 19.006  -33.261 63.659  1.00 34.01 ? 34  ILE B CD1 1 
ATOM   3592  N N   . SER B 1 35  ? 17.354  -28.440 60.494  1.00 32.50 ? 35  SER B N   1 
ATOM   3593  C CA  . SER B 1 35  ? 17.615  -27.720 59.271  1.00 31.26 ? 35  SER B CA  1 
ATOM   3594  C C   . SER B 1 35  ? 18.975  -27.058 59.230  1.00 31.13 ? 35  SER B C   1 
ATOM   3595  O O   . SER B 1 35  ? 19.342  -26.307 60.137  1.00 30.30 ? 35  SER B O   1 
ATOM   3596  C CB  . SER B 1 35  ? 16.569  -26.648 59.021  1.00 30.75 ? 35  SER B CB  1 
ATOM   3597  O OG  . SER B 1 35  ? 16.868  -26.080 57.762  1.00 28.04 ? 35  SER B OG  1 
ATOM   3598  N N   . LEU B 1 36  ? 19.695  -27.306 58.141  1.00 29.90 ? 36  LEU B N   1 
ATOM   3599  C CA  . LEU B 1 36  ? 20.893  -26.541 57.842  1.00 29.17 ? 36  LEU B CA  1 
ATOM   3600  C C   . LEU B 1 36  ? 20.677  -25.795 56.529  1.00 28.92 ? 36  LEU B C   1 
ATOM   3601  O O   . LEU B 1 36  ? 21.637  -25.368 55.890  1.00 28.39 ? 36  LEU B O   1 
ATOM   3602  C CB  . LEU B 1 36  ? 22.103  -27.490 57.727  1.00 30.02 ? 36  LEU B CB  1 
ATOM   3603  C CG  . LEU B 1 36  ? 22.312  -28.555 58.811  1.00 28.05 ? 36  LEU B CG  1 
ATOM   3604  C CD1 . LEU B 1 36  ? 23.579  -29.408 58.535  1.00 29.83 ? 36  LEU B CD1 1 
ATOM   3605  C CD2 . LEU B 1 36  ? 22.398  -27.926 60.198  1.00 24.84 ? 36  LEU B CD2 1 
ATOM   3606  N N   . ALA B 1 37  ? 19.412  -25.654 56.120  1.00 28.52 ? 37  ALA B N   1 
ATOM   3607  C CA  . ALA B 1 37  ? 19.076  -25.176 54.773  1.00 28.02 ? 37  ALA B CA  1 
ATOM   3608  C C   . ALA B 1 37  ? 18.879  -23.652 54.692  1.00 28.41 ? 37  ALA B C   1 
ATOM   3609  O O   . ALA B 1 37  ? 18.895  -23.083 53.597  1.00 28.06 ? 37  ALA B O   1 
ATOM   3610  C CB  . ALA B 1 37  ? 17.793  -25.892 54.262  1.00 28.79 ? 37  ALA B CB  1 
ATOM   3611  N N   . GLY B 1 38  ? 18.678  -23.005 55.848  1.00 28.67 ? 38  GLY B N   1 
ATOM   3612  C CA  . GLY B 1 38  ? 18.319  -21.589 55.881  1.00 28.67 ? 38  GLY B CA  1 
ATOM   3613  C C   . GLY B 1 38  ? 19.490  -20.648 55.948  1.00 28.80 ? 38  GLY B C   1 
ATOM   3614  O O   . GLY B 1 38  ? 20.602  -21.055 56.260  1.00 29.02 ? 38  GLY B O   1 
ATOM   3615  N N   . GLY B 1 39  ? 19.249  -19.376 55.661  1.00 28.33 ? 39  GLY B N   1 
ATOM   3616  C CA  . GLY B 1 39  ? 20.348  -18.426 55.620  1.00 27.76 ? 39  GLY B CA  1 
ATOM   3617  C C   . GLY B 1 39  ? 20.299  -17.374 56.699  1.00 27.93 ? 39  GLY B C   1 
ATOM   3618  O O   . GLY B 1 39  ? 20.940  -16.317 56.581  1.00 29.13 ? 39  GLY B O   1 
ATOM   3619  N N   . LEU B 1 40  ? 19.567  -17.675 57.774  1.00 27.53 ? 40  LEU B N   1 
ATOM   3620  C CA  . LEU B 1 40  ? 19.434  -16.785 58.922  1.00 26.84 ? 40  LEU B CA  1 
ATOM   3621  C C   . LEU B 1 40  ? 20.734  -16.725 59.728  1.00 26.53 ? 40  LEU B C   1 
ATOM   3622  O O   . LEU B 1 40  ? 21.279  -17.789 60.119  1.00 27.60 ? 40  LEU B O   1 
ATOM   3623  C CB  . LEU B 1 40  ? 18.319  -17.308 59.828  1.00 26.85 ? 40  LEU B CB  1 
ATOM   3624  C CG  . LEU B 1 40  ? 16.887  -17.298 59.273  1.00 29.48 ? 40  LEU B CG  1 
ATOM   3625  C CD1 . LEU B 1 40  ? 15.935  -17.828 60.308  1.00 29.66 ? 40  LEU B CD1 1 
ATOM   3626  C CD2 . LEU B 1 40  ? 16.489  -15.866 58.902  1.00 30.31 ? 40  LEU B CD2 1 
ATOM   3627  N N   . PRO B 1 41  ? 21.234  -15.513 60.024  1.00 24.97 ? 41  PRO B N   1 
ATOM   3628  C CA  . PRO B 1 41  ? 22.376  -15.460 60.953  1.00 24.78 ? 41  PRO B CA  1 
ATOM   3629  C C   . PRO B 1 41  ? 21.869  -15.771 62.378  1.00 24.07 ? 41  PRO B C   1 
ATOM   3630  O O   . PRO B 1 41  ? 20.665  -15.656 62.644  1.00 24.46 ? 41  PRO B O   1 
ATOM   3631  C CB  . PRO B 1 41  ? 22.875  -14.001 60.831  1.00 24.82 ? 41  PRO B CB  1 
ATOM   3632  C CG  . PRO B 1 41  ? 21.659  -13.215 60.421  1.00 23.83 ? 41  PRO B CG  1 
ATOM   3633  C CD  . PRO B 1 41  ? 20.804  -14.163 59.580  1.00 24.84 ? 41  PRO B CD  1 
ATOM   3634  N N   . ASN B 1 42  ? 22.782  -16.193 63.244  1.00 24.83 ? 42  ASN B N   1 
ATOM   3635  C CA  . ASN B 1 42  ? 22.523  -16.514 64.645  1.00 24.97 ? 42  ASN B CA  1 
ATOM   3636  C C   . ASN B 1 42  ? 22.154  -15.204 65.392  1.00 25.28 ? 42  ASN B C   1 
ATOM   3637  O O   . ASN B 1 42  ? 23.006  -14.312 65.539  1.00 24.10 ? 42  ASN B O   1 
ATOM   3638  C CB  . ASN B 1 42  ? 23.783  -17.155 65.255  1.00 23.71 ? 42  ASN B CB  1 
ATOM   3639  C CG  . ASN B 1 42  ? 23.528  -17.826 66.605  1.00 27.45 ? 42  ASN B CG  1 
ATOM   3640  O OD1 . ASN B 1 42  ? 23.923  -18.985 66.812  1.00 29.59 ? 42  ASN B OD1 1 
ATOM   3641  N ND2 . ASN B 1 42  ? 22.832  -17.139 67.506  1.00 21.65 ? 42  ASN B ND2 1 
ATOM   3642  N N   . PRO B 1 43  ? 20.905  -15.106 65.885  1.00 26.18 ? 43  PRO B N   1 
ATOM   3643  C CA  . PRO B 1 43  ? 20.443  -13.868 66.526  1.00 26.81 ? 43  PRO B CA  1 
ATOM   3644  C C   . PRO B 1 43  ? 21.113  -13.649 67.902  1.00 26.79 ? 43  PRO B C   1 
ATOM   3645  O O   . PRO B 1 43  ? 21.114  -12.543 68.418  1.00 26.82 ? 43  PRO B O   1 
ATOM   3646  C CB  . PRO B 1 43  ? 18.954  -14.110 66.671  1.00 27.76 ? 43  PRO B CB  1 
ATOM   3647  C CG  . PRO B 1 43  ? 18.829  -15.576 66.829  1.00 27.08 ? 43  PRO B CG  1 
ATOM   3648  C CD  . PRO B 1 43  ? 19.865  -16.150 65.915  1.00 27.52 ? 43  PRO B CD  1 
ATOM   3649  N N   . ASN B 1 44  ? 21.694  -14.695 68.477  1.00 25.79 ? 44  ASN B N   1 
ATOM   3650  C CA  . ASN B 1 44  ? 22.352  -14.594 69.780  1.00 26.51 ? 44  ASN B CA  1 
ATOM   3651  C C   . ASN B 1 44  ? 23.560  -13.703 69.789  1.00 25.67 ? 44  ASN B C   1 
ATOM   3652  O O   . ASN B 1 44  ? 23.930  -13.217 70.841  1.00 26.52 ? 44  ASN B O   1 
ATOM   3653  C CB  . ASN B 1 44  ? 22.715  -15.989 70.344  1.00 27.05 ? 44  ASN B CB  1 
ATOM   3654  C CG  . ASN B 1 44  ? 21.506  -16.767 70.792  1.00 28.86 ? 44  ASN B CG  1 
ATOM   3655  O OD1 . ASN B 1 44  ? 20.664  -16.266 71.528  1.00 32.35 ? 44  ASN B OD1 1 
ATOM   3656  N ND2 . ASN B 1 44  ? 21.430  -18.011 70.384  1.00 33.48 ? 44  ASN B ND2 1 
ATOM   3657  N N   . MET B 1 45  ? 24.157  -13.485 68.616  1.00 24.15 ? 45  MET B N   1 
ATOM   3658  C CA  . MET B 1 45  ? 25.299  -12.597 68.430  1.00 23.76 ? 45  MET B CA  1 
ATOM   3659  C C   . MET B 1 45  ? 24.928  -11.112 68.487  1.00 22.84 ? 45  MET B C   1 
ATOM   3660  O O   . MET B 1 45  ? 25.790  -10.281 68.709  1.00 22.81 ? 45  MET B O   1 
ATOM   3661  C CB  . MET B 1 45  ? 25.964  -12.889 67.068  1.00 23.59 ? 45  MET B CB  1 
ATOM   3662  C CG  . MET B 1 45  ? 26.601  -14.297 66.955  1.00 26.34 ? 45  MET B CG  1 
ATOM   3663  S SD  . MET B 1 45  ? 27.946  -14.468 68.130  1.00 28.50 ? 45  MET B SD  1 
ATOM   3664  C CE  . MET B 1 45  ? 27.155  -15.456 69.415  1.00 27.73 ? 45  MET B CE  1 
ATOM   3665  N N   . PHE B 1 46  ? 23.649  -10.791 68.279  1.00 21.54 ? 46  PHE B N   1 
ATOM   3666  C CA  . PHE B 1 46  ? 23.192  -9.387  68.194  1.00 20.40 ? 46  PHE B CA  1 
ATOM   3667  C C   . PHE B 1 46  ? 23.165  -8.728  69.533  1.00 19.95 ? 46  PHE B C   1 
ATOM   3668  O O   . PHE B 1 46  ? 22.718  -9.367  70.508  1.00 18.91 ? 46  PHE B O   1 
ATOM   3669  C CB  . PHE B 1 46  ? 21.796  -9.312  67.566  1.00 19.63 ? 46  PHE B CB  1 
ATOM   3670  C CG  . PHE B 1 46  ? 21.748  -9.850  66.180  1.00 19.87 ? 46  PHE B CG  1 
ATOM   3671  C CD1 . PHE B 1 46  ? 20.558  -10.375 65.651  1.00 19.27 ? 46  PHE B CD1 1 
ATOM   3672  C CD2 . PHE B 1 46  ? 22.914  -9.846  65.382  1.00 19.91 ? 46  PHE B CD2 1 
ATOM   3673  C CE1 . PHE B 1 46  ? 20.528  -10.839 64.345  1.00 21.17 ? 46  PHE B CE1 1 
ATOM   3674  C CE2 . PHE B 1 46  ? 22.882  -10.351 64.077  1.00 18.66 ? 46  PHE B CE2 1 
ATOM   3675  C CZ  . PHE B 1 46  ? 21.694  -10.828 63.566  1.00 20.80 ? 46  PHE B CZ  1 
ATOM   3676  N N   . PRO B 1 47  ? 23.647  -7.466  69.594  1.00 20.25 ? 47  PRO B N   1 
ATOM   3677  C CA  . PRO B 1 47  ? 23.974  -6.809  70.897  1.00 20.78 ? 47  PRO B CA  1 
ATOM   3678  C C   . PRO B 1 47  ? 22.818  -6.278  71.733  1.00 21.67 ? 47  PRO B C   1 
ATOM   3679  O O   . PRO B 1 47  ? 22.949  -6.279  72.956  1.00 22.97 ? 47  PRO B O   1 
ATOM   3680  C CB  . PRO B 1 47  ? 25.006  -5.717  70.497  1.00 21.50 ? 47  PRO B CB  1 
ATOM   3681  C CG  . PRO B 1 47  ? 24.612  -5.296  69.123  1.00 20.85 ? 47  PRO B CG  1 
ATOM   3682  C CD  . PRO B 1 47  ? 24.073  -6.639  68.450  1.00 18.61 ? 47  PRO B CD  1 
ATOM   3683  N N   . PHE B 1 48  ? 21.701  -5.873  71.102  1.00 20.39 ? 48  PHE B N   1 
ATOM   3684  C CA  . PHE B 1 48  ? 20.475  -5.476  71.785  1.00 20.92 ? 48  PHE B CA  1 
ATOM   3685  C C   . PHE B 1 48  ? 19.763  -6.685  72.366  1.00 21.22 ? 48  PHE B C   1 
ATOM   3686  O O   . PHE B 1 48  ? 19.545  -7.690  71.647  1.00 20.37 ? 48  PHE B O   1 
ATOM   3687  C CB  . PHE B 1 48  ? 19.527  -4.755  70.810  1.00 20.52 ? 48  PHE B CB  1 
ATOM   3688  C CG  . PHE B 1 48  ? 20.232  -3.737  69.937  1.00 21.87 ? 48  PHE B CG  1 
ATOM   3689  C CD1 . PHE B 1 48  ? 20.505  -4.013  68.579  1.00 20.94 ? 48  PHE B CD1 1 
ATOM   3690  C CD2 . PHE B 1 48  ? 20.642  -2.519  70.469  1.00 19.52 ? 48  PHE B CD2 1 
ATOM   3691  C CE1 . PHE B 1 48  ? 21.172  -3.058  67.758  1.00 18.89 ? 48  PHE B CE1 1 
ATOM   3692  C CE2 . PHE B 1 48  ? 21.316  -1.539  69.638  1.00 20.73 ? 48  PHE B CE2 1 
ATOM   3693  C CZ  . PHE B 1 48  ? 21.571  -1.820  68.308  1.00 18.90 ? 48  PHE B CZ  1 
ATOM   3694  N N   . LYS B 1 49  ? 19.374  -6.582  73.643  1.00 22.07 ? 49  LYS B N   1 
ATOM   3695  C CA  . LYS B 1 49  ? 18.838  -7.766  74.387  1.00 22.84 ? 49  LYS B CA  1 
ATOM   3696  C C   . LYS B 1 49  ? 17.345  -7.720  74.815  1.00 22.94 ? 49  LYS B C   1 
ATOM   3697  O O   . LYS B 1 49  ? 16.652  -8.718  74.735  1.00 23.21 ? 49  LYS B O   1 
ATOM   3698  C CB  . LYS B 1 49  ? 19.760  -8.104  75.576  1.00 23.39 ? 49  LYS B CB  1 
ATOM   3699  C CG  . LYS B 1 49  ? 21.199  -8.430  75.151  1.00 23.54 ? 49  LYS B CG  1 
ATOM   3700  C CD  . LYS B 1 49  ? 21.230  -9.649  74.201  1.00 26.04 ? 49  LYS B CD  1 
ATOM   3701  C CE  . LYS B 1 49  ? 22.609  -9.842  73.567  1.00 25.59 ? 49  LYS B CE  1 
ATOM   3702  N NZ  . LYS B 1 49  ? 22.684  -11.026 72.610  1.00 27.07 ? 49  LYS B NZ  1 
ATOM   3703  N N   . THR B 1 50  ? 16.857  -6.550  75.224  1.00 22.41 ? 50  THR B N   1 
ATOM   3704  C CA  . THR B 1 50  ? 15.452  -6.339  75.628  1.00 23.77 ? 50  THR B CA  1 
ATOM   3705  C C   . THR B 1 50  ? 15.066  -4.895  75.322  1.00 23.16 ? 50  THR B C   1 
ATOM   3706  O O   . THR B 1 50  ? 15.937  -4.046  75.180  1.00 24.08 ? 50  THR B O   1 
ATOM   3707  C CB  . THR B 1 50  ? 15.204  -6.514  77.166  1.00 23.59 ? 50  THR B CB  1 
ATOM   3708  O OG1 . THR B 1 50  ? 15.825  -5.423  77.859  1.00 25.62 ? 50  THR B OG1 1 
ATOM   3709  C CG2 . THR B 1 50  ? 15.710  -7.863  77.710  1.00 23.42 ? 50  THR B CG2 1 
ATOM   3710  N N   . ALA B 1 51  ? 13.767  -4.617  75.242  1.00 24.24 ? 51  ALA B N   1 
ATOM   3711  C CA  . ALA B 1 51  ? 13.281  -3.251  74.984  1.00 24.08 ? 51  ALA B CA  1 
ATOM   3712  C C   . ALA B 1 51  ? 12.079  -2.985  75.873  1.00 23.40 ? 51  ALA B C   1 
ATOM   3713  O O   . ALA B 1 51  ? 11.278  -3.872  76.109  1.00 23.45 ? 51  ALA B O   1 
ATOM   3714  C CB  . ALA B 1 51  ? 12.900  -3.044  73.522  1.00 24.80 ? 51  ALA B CB  1 
ATOM   3715  N N   . VAL B 1 52  ? 12.005  -1.773  76.398  1.00 23.65 ? 52  VAL B N   1 
ATOM   3716  C CA  . VAL B 1 52  ? 10.828  -1.300  77.104  1.00 23.43 ? 52  VAL B CA  1 
ATOM   3717  C C   . VAL B 1 52  ? 10.398  -0.004  76.444  1.00 22.96 ? 52  VAL B C   1 
ATOM   3718  O O   . VAL B 1 52  ? 11.165  0.932   76.396  1.00 23.85 ? 52  VAL B O   1 
ATOM   3719  C CB  . VAL B 1 52  ? 11.109  -1.094  78.611  1.00 24.32 ? 52  VAL B CB  1 
ATOM   3720  C CG1 . VAL B 1 52  ? 9.894   -0.513  79.301  1.00 22.19 ? 52  VAL B CG1 1 
ATOM   3721  C CG2 . VAL B 1 52  ? 11.526  -2.467  79.271  1.00 24.06 ? 52  VAL B CG2 1 
ATOM   3722  N N   . ILE B 1 53  ? 9.170   0.059   75.941  1.00 22.95 ? 53  ILE B N   1 
ATOM   3723  C CA  . ILE B 1 53  ? 8.750   1.258   75.216  1.00 23.43 ? 53  ILE B CA  1 
ATOM   3724  C C   . ILE B 1 53  ? 7.425   1.733   75.776  1.00 22.76 ? 53  ILE B C   1 
ATOM   3725  O O   . ILE B 1 53  ? 6.428   1.020   75.696  1.00 23.44 ? 53  ILE B O   1 
ATOM   3726  C CB  . ILE B 1 53  ? 8.653   1.011   73.691  1.00 22.97 ? 53  ILE B CB  1 
ATOM   3727  C CG1 . ILE B 1 53  ? 10.034  0.611   73.127  1.00 23.44 ? 53  ILE B CG1 1 
ATOM   3728  C CG2 . ILE B 1 53  ? 8.077   2.267   73.000  1.00 22.62 ? 53  ILE B CG2 1 
ATOM   3729  C CD1 . ILE B 1 53  ? 9.969   -0.148  71.790  1.00 23.98 ? 53  ILE B CD1 1 
ATOM   3730  N N   . THR B 1 54  ? 7.432   2.921   76.355  1.00 22.75 ? 54  THR B N   1 
ATOM   3731  C CA  . THR B 1 54  ? 6.218   3.478   76.962  1.00 23.71 ? 54  THR B CA  1 
ATOM   3732  C C   . THR B 1 54  ? 5.292   4.023   75.910  1.00 23.62 ? 54  THR B C   1 
ATOM   3733  O O   . THR B 1 54  ? 5.729   4.534   74.874  1.00 23.56 ? 54  THR B O   1 
ATOM   3734  C CB  . THR B 1 54  ? 6.534   4.549   78.015  1.00 23.69 ? 54  THR B CB  1 
ATOM   3735  O OG1 . THR B 1 54  ? 7.170   5.681   77.376  1.00 23.94 ? 54  THR B OG1 1 
ATOM   3736  C CG2 . THR B 1 54  ? 7.476   3.930   79.075  1.00 21.67 ? 54  THR B CG2 1 
ATOM   3737  N N   . VAL B 1 55  ? 4.013   3.931   76.212  1.00 24.81 ? 55  VAL B N   1 
ATOM   3738  C CA  . VAL B 1 55  ? 2.939   4.336   75.329  1.00 27.38 ? 55  VAL B CA  1 
ATOM   3739  C C   . VAL B 1 55  ? 1.981   5.287   76.066  1.00 29.23 ? 55  VAL B C   1 
ATOM   3740  O O   . VAL B 1 55  ? 1.549   5.007   77.193  1.00 29.58 ? 55  VAL B O   1 
ATOM   3741  C CB  . VAL B 1 55  ? 2.132   3.078   74.893  1.00 26.54 ? 55  VAL B CB  1 
ATOM   3742  C CG1 . VAL B 1 55  ? 0.851   3.457   74.245  1.00 29.08 ? 55  VAL B CG1 1 
ATOM   3743  C CG2 . VAL B 1 55  ? 2.939   2.222   73.941  1.00 26.95 ? 55  VAL B CG2 1 
ATOM   3744  N N   . GLU B 1 56  ? 1.618   6.389   75.428  1.00 31.03 ? 56  GLU B N   1 
ATOM   3745  C CA  . GLU B 1 56  ? 0.592   7.242   75.997  1.00 34.46 ? 56  GLU B CA  1 
ATOM   3746  C C   . GLU B 1 56  ? -0.796  6.679   75.678  1.00 35.55 ? 56  GLU B C   1 
ATOM   3747  O O   . GLU B 1 56  ? -1.099  6.343   74.500  1.00 36.88 ? 56  GLU B O   1 
ATOM   3748  C CB  . GLU B 1 56  ? 0.715   8.650   75.456  1.00 34.03 ? 56  GLU B CB  1 
ATOM   3749  C CG  . GLU B 1 56  ? -0.277  9.617   76.106  1.00 38.76 ? 56  GLU B CG  1 
ATOM   3750  C CD  . GLU B 1 56  ? 0.102   11.048  75.909  1.00 43.33 ? 56  GLU B CD  1 
ATOM   3751  O OE1 . GLU B 1 56  ? 1.148   11.463  76.469  1.00 48.02 ? 56  GLU B OE1 1 
ATOM   3752  O OE2 . GLU B 1 56  ? -0.649  11.760  75.203  1.00 43.40 ? 56  GLU B OE2 1 
ATOM   3753  N N   . ASN B 1 57  ? -1.650  6.628   76.701  1.00 37.00 ? 57  ASN B N   1 
ATOM   3754  C CA  . ASN B 1 57  ? -3.029  6.066   76.587  1.00 37.99 ? 57  ASN B CA  1 
ATOM   3755  C C   . ASN B 1 57  ? -2.902  4.578   76.259  1.00 37.27 ? 57  ASN B C   1 
ATOM   3756  O O   . ASN B 1 57  ? -3.585  4.026   75.375  1.00 36.99 ? 57  ASN B O   1 
ATOM   3757  C CB  . ASN B 1 57  ? -3.878  6.791   75.509  1.00 39.46 ? 57  ASN B CB  1 
ATOM   3758  C CG  . ASN B 1 57  ? -4.652  8.009   76.057  1.00 42.12 ? 57  ASN B CG  1 
ATOM   3759  O OD1 . ASN B 1 57  ? -4.088  9.096   76.234  1.00 43.39 ? 57  ASN B OD1 1 
ATOM   3760  N ND2 . ASN B 1 57  ? -5.965  7.831   76.279  1.00 43.19 ? 57  ASN B ND2 1 
ATOM   3761  N N   . GLY B 1 58  ? -1.981  3.945   76.980  1.00 36.91 ? 58  GLY B N   1 
ATOM   3762  C CA  . GLY B 1 58  ? -1.527  2.641   76.612  1.00 35.59 ? 58  GLY B CA  1 
ATOM   3763  C C   . GLY B 1 58  ? -0.606  1.966   77.601  1.00 34.57 ? 58  GLY B C   1 
ATOM   3764  O O   . GLY B 1 58  ? 0.016   2.576   78.508  1.00 34.68 ? 58  GLY B O   1 
ATOM   3765  N N   . LYS B 1 59  ? -0.522  0.671   77.408  1.00 33.99 ? 59  LYS B N   1 
ATOM   3766  C CA  . LYS B 1 59  ? 0.270   -0.130  78.287  1.00 33.12 ? 59  LYS B CA  1 
ATOM   3767  C C   . LYS B 1 59  ? 1.618   -0.275  77.624  1.00 31.51 ? 59  LYS B C   1 
ATOM   3768  O O   . LYS B 1 59  ? 1.717   -0.267  76.371  1.00 29.64 ? 59  LYS B O   1 
ATOM   3769  C CB  . LYS B 1 59  ? -0.460  -1.437  78.598  1.00 33.84 ? 59  LYS B CB  1 
ATOM   3770  C CG  . LYS B 1 59  ? 0.068   -2.674  78.029  1.00 36.79 ? 59  LYS B CG  1 
ATOM   3771  C CD  . LYS B 1 59  ? -0.033  -3.727  79.116  1.00 40.98 ? 59  LYS B CD  1 
ATOM   3772  C CE  . LYS B 1 59  ? -0.154  -5.115  78.550  1.00 44.55 ? 59  LYS B CE  1 
ATOM   3773  N NZ  . LYS B 1 59  ? -1.598  -5.452  78.274  1.00 47.98 ? 59  LYS B NZ  1 
ATOM   3774  N N   . THR B 1 60  ? 2.660   -0.351  78.454  1.00 29.89 ? 60  THR B N   1 
ATOM   3775  C CA  . THR B 1 60  ? 3.985   -0.319  77.916  1.00 30.01 ? 60  THR B CA  1 
ATOM   3776  C C   . THR B 1 60  ? 4.340   -1.597  77.147  1.00 29.67 ? 60  THR B C   1 
ATOM   3777  O O   . THR B 1 60  ? 3.929   -2.703  77.513  1.00 29.32 ? 60  THR B O   1 
ATOM   3778  C CB  . THR B 1 60  ? 5.104   0.108   78.930  1.00 29.40 ? 60  THR B CB  1 
ATOM   3779  O OG1 . THR B 1 60  ? 5.899   -1.011  79.305  1.00 32.88 ? 60  THR B OG1 1 
ATOM   3780  C CG2 . THR B 1 60  ? 4.558   0.802   80.087  1.00 25.77 ? 60  THR B CG2 1 
ATOM   3781  N N   . ILE B 1 61  ? 5.068   -1.395  76.056  1.00 28.93 ? 61  ILE B N   1 
ATOM   3782  C CA  . ILE B 1 61  ? 5.523   -2.474  75.189  1.00 28.66 ? 61  ILE B CA  1 
ATOM   3783  C C   . ILE B 1 61  ? 6.859   -3.033  75.673  1.00 27.68 ? 61  ILE B C   1 
ATOM   3784  O O   . ILE B 1 61  ? 7.850   -2.292  75.877  1.00 27.01 ? 61  ILE B O   1 
ATOM   3785  C CB  . ILE B 1 61  ? 5.550   -2.041  73.690  1.00 29.20 ? 61  ILE B CB  1 
ATOM   3786  C CG1 . ILE B 1 61  ? 4.131   -1.634  73.276  1.00 28.31 ? 61  ILE B CG1 1 
ATOM   3787  C CG2 . ILE B 1 61  ? 6.086   -3.195  72.812  1.00 28.34 ? 61  ILE B CG2 1 
ATOM   3788  C CD1 . ILE B 1 61  ? 4.013   -0.884  71.915  1.00 27.67 ? 61  ILE B CD1 1 
ATOM   3789  N N   . GLN B 1 62  ? 6.853   -4.339  75.915  1.00 26.23 ? 62  GLN B N   1 
ATOM   3790  C CA  . GLN B 1 62  ? 8.028   -5.024  76.418  1.00 27.87 ? 62  GLN B CA  1 
ATOM   3791  C C   . GLN B 1 62  ? 8.440   -6.098  75.424  1.00 27.37 ? 62  GLN B C   1 
ATOM   3792  O O   . GLN B 1 62  ? 7.615   -6.893  75.038  1.00 27.41 ? 62  GLN B O   1 
ATOM   3793  C CB  . GLN B 1 62  ? 7.753   -5.605  77.795  1.00 28.02 ? 62  GLN B CB  1 
ATOM   3794  C CG  . GLN B 1 62  ? 7.392   -4.498  78.801  1.00 33.89 ? 62  GLN B CG  1 
ATOM   3795  C CD  . GLN B 1 62  ? 8.056   -4.669  80.150  1.00 39.67 ? 62  GLN B CD  1 
ATOM   3796  O OE1 . GLN B 1 62  ? 8.665   -5.700  80.434  1.00 43.07 ? 62  GLN B OE1 1 
ATOM   3797  N NE2 . GLN B 1 62  ? 7.944   -3.651  80.992  1.00 40.49 ? 62  GLN B NE2 1 
ATOM   3798  N N   . PHE B 1 63  ? 9.684   -6.039  74.942  1.00 26.57 ? 63  PHE B N   1 
ATOM   3799  C CA  . PHE B 1 63  ? 10.259  -7.128  74.161  1.00 26.88 ? 63  PHE B CA  1 
ATOM   3800  C C   . PHE B 1 63  ? 11.224  -7.841  75.085  1.00 26.88 ? 63  PHE B C   1 
ATOM   3801  O O   . PHE B 1 63  ? 12.275  -7.312  75.376  1.00 25.51 ? 63  PHE B O   1 
ATOM   3802  C CB  . PHE B 1 63  ? 11.094  -6.623  72.992  1.00 27.46 ? 63  PHE B CB  1 
ATOM   3803  C CG  . PHE B 1 63  ? 10.333  -5.955  71.915  1.00 27.20 ? 63  PHE B CG  1 
ATOM   3804  C CD1 . PHE B 1 63  ? 11.035  -5.353  70.878  1.00 27.03 ? 63  PHE B CD1 1 
ATOM   3805  C CD2 . PHE B 1 63  ? 8.944   -5.916  71.896  1.00 27.87 ? 63  PHE B CD2 1 
ATOM   3806  C CE1 . PHE B 1 63  ? 10.361  -4.723  69.838  1.00 31.37 ? 63  PHE B CE1 1 
ATOM   3807  C CE2 . PHE B 1 63  ? 8.266   -5.257  70.860  1.00 29.99 ? 63  PHE B CE2 1 
ATOM   3808  C CZ  . PHE B 1 63  ? 8.972   -4.680  69.814  1.00 28.35 ? 63  PHE B CZ  1 
ATOM   3809  N N   . GLY B 1 64  ? 10.850  -9.015  75.598  1.00 27.54 ? 64  GLY B N   1 
ATOM   3810  C CA  . GLY B 1 64  ? 11.812  -9.784  76.395  1.00 27.26 ? 64  GLY B CA  1 
ATOM   3811  C C   . GLY B 1 64  ? 12.863  -10.416 75.500  1.00 28.43 ? 64  GLY B C   1 
ATOM   3812  O O   . GLY B 1 64  ? 12.909  -10.173 74.263  1.00 27.51 ? 64  GLY B O   1 
ATOM   3813  N N   . GLU B 1 65  ? 13.708  -11.250 76.106  1.00 28.24 ? 65  GLU B N   1 
ATOM   3814  C CA  . GLU B 1 65  ? 14.875  -11.758 75.409  1.00 29.31 ? 65  GLU B CA  1 
ATOM   3815  C C   . GLU B 1 65  ? 14.507  -12.503 74.129  1.00 27.87 ? 65  GLU B C   1 
ATOM   3816  O O   . GLU B 1 65  ? 15.180  -12.334 73.116  1.00 25.95 ? 65  GLU B O   1 
ATOM   3817  C CB  . GLU B 1 65  ? 15.766  -12.620 76.317  1.00 29.94 ? 65  GLU B CB  1 
ATOM   3818  C CG  . GLU B 1 65  ? 15.681  -12.260 77.784  1.00 36.85 ? 65  GLU B CG  1 
ATOM   3819  C CD  . GLU B 1 65  ? 16.855  -11.463 78.280  1.00 44.14 ? 65  GLU B CD  1 
ATOM   3820  O OE1 . GLU B 1 65  ? 16.679  -10.758 79.300  1.00 46.25 ? 65  GLU B OE1 1 
ATOM   3821  O OE2 . GLU B 1 65  ? 17.960  -11.545 77.671  1.00 48.20 ? 65  GLU B OE2 1 
ATOM   3822  N N   . GLU B 1 66  ? 13.446  -13.311 74.181  1.00 28.11 ? 66  GLU B N   1 
ATOM   3823  C CA  . GLU B 1 66  ? 13.022  -14.093 73.012  1.00 29.46 ? 66  GLU B CA  1 
ATOM   3824  C C   . GLU B 1 66  ? 12.351  -13.244 71.914  1.00 28.04 ? 66  GLU B C   1 
ATOM   3825  O O   . GLU B 1 66  ? 12.626  -13.451 70.722  1.00 27.90 ? 66  GLU B O   1 
ATOM   3826  C CB  . GLU B 1 66  ? 12.150  -15.300 73.423  1.00 30.23 ? 66  GLU B CB  1 
ATOM   3827  C CG  . GLU B 1 66  ? 12.247  -16.518 72.490  1.00 34.91 ? 66  GLU B CG  1 
ATOM   3828  C CD  . GLU B 1 66  ? 13.682  -17.119 72.327  1.00 40.80 ? 66  GLU B CD  1 
ATOM   3829  O OE1 . GLU B 1 66  ? 13.925  -17.674 71.235  1.00 42.95 ? 66  GLU B OE1 1 
ATOM   3830  O OE2 . GLU B 1 66  ? 14.553  -17.039 73.248  1.00 40.55 ? 66  GLU B OE2 1 
ATOM   3831  N N   . MET B 1 67  ? 11.487  -12.308 72.310  1.00 26.93 ? 67  MET B N   1 
ATOM   3832  C CA  . MET B 1 67  ? 10.832  -11.395 71.358  1.00 25.59 ? 67  MET B CA  1 
ATOM   3833  C C   . MET B 1 67  ? 11.841  -10.441 70.689  1.00 24.79 ? 67  MET B C   1 
ATOM   3834  O O   . MET B 1 67  ? 11.677  -10.095 69.520  1.00 24.50 ? 67  MET B O   1 
ATOM   3835  C CB  . MET B 1 67  ? 9.719   -10.579 72.045  1.00 26.20 ? 67  MET B CB  1 
ATOM   3836  C CG  . MET B 1 67  ? 8.925   -9.632  71.096  1.00 25.54 ? 67  MET B CG  1 
ATOM   3837  S SD  . MET B 1 67  ? 7.908   -10.474 69.915  1.00 32.03 ? 67  MET B SD  1 
ATOM   3838  C CE  . MET B 1 67  ? 6.510   -11.059 70.928  1.00 31.17 ? 67  MET B CE  1 
ATOM   3839  N N   . MET B 1 68  ? 12.849  -9.991  71.438  1.00 24.13 ? 68  MET B N   1 
ATOM   3840  C CA  . MET B 1 68  ? 13.922  -9.180  70.856  1.00 24.45 ? 68  MET B CA  1 
ATOM   3841  C C   . MET B 1 68  ? 14.734  -9.934  69.784  1.00 24.68 ? 68  MET B C   1 
ATOM   3842  O O   . MET B 1 68  ? 14.986  -9.398  68.726  1.00 23.89 ? 68  MET B O   1 
ATOM   3843  C CB  . MET B 1 68  ? 14.860  -8.647  71.952  1.00 24.81 ? 68  MET B CB  1 
ATOM   3844  C CG  . MET B 1 68  ? 16.064  -7.933  71.417  1.00 23.90 ? 68  MET B CG  1 
ATOM   3845  S SD  . MET B 1 68  ? 15.588  -6.342  70.718  1.00 31.30 ? 68  MET B SD  1 
ATOM   3846  C CE  . MET B 1 68  ? 15.184  -5.440  72.160  1.00 27.02 ? 68  MET B CE  1 
ATOM   3847  N N   . LYS B 1 69  ? 15.164  -11.164 70.071  1.00 22.69 ? 69  LYS B N   1 
ATOM   3848  C CA  . LYS B 1 69  ? 15.766  -11.984 69.036  1.00 22.22 ? 69  LYS B CA  1 
ATOM   3849  C C   . LYS B 1 69  ? 14.911  -12.053 67.728  1.00 21.65 ? 69  LYS B C   1 
ATOM   3850  O O   . LYS B 1 69  ? 15.447  -12.066 66.613  1.00 20.48 ? 69  LYS B O   1 
ATOM   3851  C CB  . LYS B 1 69  ? 16.093  -13.375 69.584  1.00 22.97 ? 69  LYS B CB  1 
ATOM   3852  C CG  . LYS B 1 69  ? 17.418  -13.410 70.382  1.00 25.61 ? 69  LYS B CG  1 
ATOM   3853  C CD  . LYS B 1 69  ? 17.418  -14.503 71.439  1.00 31.18 ? 69  LYS B CD  1 
ATOM   3854  C CE  . LYS B 1 69  ? 17.419  -15.849 70.849  1.00 35.56 ? 69  LYS B CE  1 
ATOM   3855  N NZ  . LYS B 1 69  ? 17.405  -16.944 71.882  1.00 40.43 ? 69  LYS B NZ  1 
ATOM   3856  N N   . ARG B 1 70  ? 13.593  -12.145 67.879  1.00 21.06 ? 70  ARG B N   1 
ATOM   3857  C CA  . ARG B 1 70  ? 12.719  -12.160 66.744  1.00 19.94 ? 70  ARG B CA  1 
ATOM   3858  C C   . ARG B 1 70  ? 12.738  -10.770 66.033  1.00 20.40 ? 70  ARG B C   1 
ATOM   3859  O O   . ARG B 1 70  ? 12.824  -10.694 64.806  1.00 20.62 ? 70  ARG B O   1 
ATOM   3860  C CB  . ARG B 1 70  ? 11.306  -12.527 67.195  1.00 19.67 ? 70  ARG B CB  1 
ATOM   3861  C CG  . ARG B 1 70  ? 10.360  -12.639 66.013  1.00 18.92 ? 70  ARG B CG  1 
ATOM   3862  C CD  . ARG B 1 70  ? 8.926   -12.927 66.384  1.00 21.14 ? 70  ARG B CD  1 
ATOM   3863  N NE  . ARG B 1 70  ? 8.100   -12.839 65.180  1.00 21.03 ? 70  ARG B NE  1 
ATOM   3864  C CZ  . ARG B 1 70  ? 6.783   -12.613 65.177  1.00 20.68 ? 70  ARG B CZ  1 
ATOM   3865  N NH1 . ARG B 1 70  ? 6.141   -12.458 66.329  1.00 16.06 ? 70  ARG B NH1 1 
ATOM   3866  N NH2 . ARG B 1 70  ? 6.126   -12.521 64.019  1.00 18.23 ? 70  ARG B NH2 1 
ATOM   3867  N N   . ALA B 1 71  ? 12.683  -9.700  66.844  1.00 19.04 ? 71  ALA B N   1 
ATOM   3868  C CA  . ALA B 1 71  ? 12.693  -8.311  66.367  1.00 19.43 ? 71  ALA B CA  1 
ATOM   3869  C C   . ALA B 1 71  ? 13.980  -7.977  65.613  1.00 19.09 ? 71  ALA B C   1 
ATOM   3870  O O   . ALA B 1 71  ? 13.991  -7.094  64.749  1.00 19.42 ? 71  ALA B O   1 
ATOM   3871  C CB  . ALA B 1 71  ? 12.505  -7.367  67.578  1.00 16.86 ? 71  ALA B CB  1 
ATOM   3872  N N   . LEU B 1 72  ? 15.080  -8.653  65.979  1.00 18.31 ? 72  LEU B N   1 
ATOM   3873  C CA  . LEU B 1 72  ? 16.380  -8.367  65.339  1.00 18.19 ? 72  LEU B CA  1 
ATOM   3874  C C   . LEU B 1 72  ? 16.670  -9.251  64.126  1.00 17.75 ? 72  LEU B C   1 
ATOM   3875  O O   . LEU B 1 72  ? 17.714  -9.085  63.489  1.00 17.50 ? 72  LEU B O   1 
ATOM   3876  C CB  . LEU B 1 72  ? 17.540  -8.459  66.363  1.00 17.89 ? 72  LEU B CB  1 
ATOM   3877  C CG  . LEU B 1 72  ? 17.408  -7.480  67.536  1.00 17.88 ? 72  LEU B CG  1 
ATOM   3878  C CD1 . LEU B 1 72  ? 18.558  -7.669  68.493  1.00 19.62 ? 72  LEU B CD1 1 
ATOM   3879  C CD2 . LEU B 1 72  ? 17.324  -6.012  67.014  1.00 17.19 ? 72  LEU B CD2 1 
ATOM   3880  N N   . GLN B 1 73  ? 15.745  -10.157 63.807  1.00 17.94 ? 73  GLN B N   1 
ATOM   3881  C CA  . GLN B 1 73  ? 15.975  -11.214 62.813  1.00 18.28 ? 73  GLN B CA  1 
ATOM   3882  C C   . GLN B 1 73  ? 15.171  -10.963 61.548  1.00 18.64 ? 73  GLN B C   1 
ATOM   3883  O O   . GLN B 1 73  ? 14.128  -10.302 61.596  1.00 20.04 ? 73  GLN B O   1 
ATOM   3884  C CB  . GLN B 1 73  ? 15.627  -12.605 63.426  1.00 17.09 ? 73  GLN B CB  1 
ATOM   3885  C CG  . GLN B 1 73  ? 15.843  -13.814 62.502  1.00 17.19 ? 73  GLN B CG  1 
ATOM   3886  C CD  . GLN B 1 73  ? 17.289  -13.947 62.089  1.00 20.72 ? 73  GLN B CD  1 
ATOM   3887  O OE1 . GLN B 1 73  ? 17.785  -13.221 61.216  1.00 20.03 ? 73  GLN B OE1 1 
ATOM   3888  N NE2 . GLN B 1 73  ? 17.987  -14.877 62.726  1.00 22.02 ? 73  GLN B NE2 1 
ATOM   3889  N N   . TYR B 1 74  ? 15.618  -11.503 60.413  1.00 19.55 ? 74  TYR B N   1 
ATOM   3890  C CA  . TYR B 1 74  ? 14.808  -11.473 59.192  1.00 19.24 ? 74  TYR B CA  1 
ATOM   3891  C C   . TYR B 1 74  ? 13.379  -11.958 59.458  1.00 20.04 ? 74  TYR B C   1 
ATOM   3892  O O   . TYR B 1 74  ? 13.132  -12.803 60.327  1.00 19.58 ? 74  TYR B O   1 
ATOM   3893  C CB  . TYR B 1 74  ? 15.441  -12.326 58.069  1.00 18.14 ? 74  TYR B CB  1 
ATOM   3894  C CG  . TYR B 1 74  ? 16.769  -11.874 57.463  1.00 19.25 ? 74  TYR B CG  1 
ATOM   3895  C CD1 . TYR B 1 74  ? 16.880  -10.673 56.731  1.00 18.37 ? 74  TYR B CD1 1 
ATOM   3896  C CD2 . TYR B 1 74  ? 17.894  -12.681 57.549  1.00 17.69 ? 74  TYR B CD2 1 
ATOM   3897  C CE1 . TYR B 1 74  ? 18.115  -10.295 56.122  1.00 20.73 ? 74  TYR B CE1 1 
ATOM   3898  C CE2 . TYR B 1 74  ? 19.119  -12.293 56.998  1.00 19.40 ? 74  TYR B CE2 1 
ATOM   3899  C CZ  . TYR B 1 74  ? 19.219  -11.107 56.269  1.00 18.48 ? 74  TYR B CZ  1 
ATOM   3900  O OH  . TYR B 1 74  ? 20.417  -10.764 55.679  1.00 21.79 ? 74  TYR B OH  1 
ATOM   3901  N N   . SER B 1 75  ? 12.422  -11.404 58.721  1.00 19.98 ? 75  SER B N   1 
ATOM   3902  C CA  . SER B 1 75  ? 11.024  -11.821 58.834  1.00 19.94 ? 75  SER B CA  1 
ATOM   3903  C C   . SER B 1 75  ? 10.431  -11.850 57.405  1.00 20.19 ? 75  SER B C   1 
ATOM   3904  O O   . SER B 1 75  ? 11.116  -11.451 56.450  1.00 21.63 ? 75  SER B O   1 
ATOM   3905  C CB  . SER B 1 75  ? 10.237  -10.869 59.771  1.00 18.51 ? 75  SER B CB  1 
ATOM   3906  O OG  . SER B 1 75  ? 10.233  -9.552  59.208  1.00 20.43 ? 75  SER B OG  1 
ATOM   3907  N N   . PRO B 1 76  ? 9.187   -12.333 57.234  1.00 21.13 ? 76  PRO B N   1 
ATOM   3908  C CA  . PRO B 1 76  ? 8.607   -12.474 55.863  1.00 21.37 ? 76  PRO B CA  1 
ATOM   3909  C C   . PRO B 1 76  ? 8.465   -11.164 55.024  1.00 22.65 ? 76  PRO B C   1 
ATOM   3910  O O   . PRO B 1 76  ? 8.211   -10.080 55.570  1.00 20.14 ? 76  PRO B O   1 
ATOM   3911  C CB  . PRO B 1 76  ? 7.212   -13.049 56.132  1.00 20.07 ? 76  PRO B CB  1 
ATOM   3912  C CG  . PRO B 1 76  ? 7.346   -13.731 57.517  1.00 22.10 ? 76  PRO B CG  1 
ATOM   3913  C CD  . PRO B 1 76  ? 8.253   -12.824 58.281  1.00 21.88 ? 76  PRO B CD  1 
ATOM   3914  N N   . SER B 1 77  ? 8.567   -11.306 53.690  1.00 21.88 ? 77  SER B N   1 
ATOM   3915  C CA  . SER B 1 77  ? 8.549   -10.155 52.789  1.00 23.24 ? 77  SER B CA  1 
ATOM   3916  C C   . SER B 1 77  ? 7.310   -9.274  52.888  1.00 23.12 ? 77  SER B C   1 
ATOM   3917  O O   . SER B 1 77  ? 7.421   -8.051  52.838  1.00 22.66 ? 77  SER B O   1 
ATOM   3918  C CB  . SER B 1 77  ? 8.744   -10.613 51.349  1.00 23.85 ? 77  SER B CB  1 
ATOM   3919  O OG  . SER B 1 77  ? 10.098  -10.987 51.156  1.00 27.42 ? 77  SER B OG  1 
ATOM   3920  N N   . ALA B 1 78  ? 6.135   -9.900  53.050  1.00 23.00 ? 78  ALA B N   1 
ATOM   3921  C CA  . ALA B 1 78  ? 4.886   -9.166  53.048  1.00 23.40 ? 78  ALA B CA  1 
ATOM   3922  C C   . ALA B 1 78  ? 4.542   -8.554  54.399  1.00 23.11 ? 78  ALA B C   1 
ATOM   3923  O O   . ALA B 1 78  ? 3.607   -7.757  54.483  1.00 22.41 ? 78  ALA B O   1 
ATOM   3924  C CB  . ALA B 1 78  ? 3.736   -10.055 52.583  1.00 24.01 ? 78  ALA B CB  1 
ATOM   3925  N N   . GLY B 1 79  ? 5.270   -8.944  55.438  1.00 23.40 ? 79  GLY B N   1 
ATOM   3926  C CA  . GLY B 1 79  ? 5.081   -8.439  56.821  1.00 22.39 ? 79  GLY B CA  1 
ATOM   3927  C C   . GLY B 1 79  ? 4.990   -9.561  57.848  1.00 21.94 ? 79  GLY B C   1 
ATOM   3928  O O   . GLY B 1 79  ? 4.844   -10.737 57.473  1.00 22.50 ? 79  GLY B O   1 
ATOM   3929  N N   . ILE B 1 80  ? 5.107   -9.250  59.155  1.00 22.24 ? 80  ILE B N   1 
ATOM   3930  C CA  . ILE B 1 80  ? 4.920   -10.291 60.197  1.00 20.73 ? 80  ILE B CA  1 
ATOM   3931  C C   . ILE B 1 80  ? 3.429   -10.749 60.160  1.00 21.41 ? 80  ILE B C   1 
ATOM   3932  O O   . ILE B 1 80  ? 2.564   -9.958  59.856  1.00 22.21 ? 80  ILE B O   1 
ATOM   3933  C CB  . ILE B 1 80  ? 5.399   -9.819  61.596  1.00 20.36 ? 80  ILE B CB  1 
ATOM   3934  C CG1 . ILE B 1 80  ? 4.571   -8.623  62.141  1.00 17.50 ? 80  ILE B CG1 1 
ATOM   3935  C CG2 . ILE B 1 80  ? 6.858   -9.375  61.460  1.00 21.90 ? 80  ILE B CG2 1 
ATOM   3936  C CD1 . ILE B 1 80  ? 4.810   -8.257  63.638  1.00 19.32 ? 80  ILE B CD1 1 
ATOM   3937  N N   . PRO B 1 81  ? 3.136   -12.055 60.413  1.00 21.75 ? 81  PRO B N   1 
ATOM   3938  C CA  . PRO B 1 81  ? 1.760   -12.506 60.220  1.00 21.46 ? 81  PRO B CA  1 
ATOM   3939  C C   . PRO B 1 81  ? 0.765   -11.802 61.119  1.00 21.51 ? 81  PRO B C   1 
ATOM   3940  O O   . PRO B 1 81  ? -0.350  -11.617 60.696  1.00 22.00 ? 81  PRO B O   1 
ATOM   3941  C CB  . PRO B 1 81  ? 1.806   -13.998 60.615  1.00 20.97 ? 81  PRO B CB  1 
ATOM   3942  C CG  . PRO B 1 81  ? 3.035   -14.093 61.474  1.00 22.69 ? 81  PRO B CG  1 
ATOM   3943  C CD  . PRO B 1 81  ? 3.998   -13.172 60.815  1.00 19.95 ? 81  PRO B CD  1 
ATOM   3944  N N   . GLU B 1 82  ? 1.137   -11.432 62.346  1.00 21.29 ? 82  GLU B N   1 
ATOM   3945  C CA  . GLU B 1 82  ? 0.114   -10.822 63.223  1.00 22.10 ? 82  GLU B CA  1 
ATOM   3946  C C   . GLU B 1 82  ? -0.268  -9.417  62.780  1.00 20.18 ? 82  GLU B C   1 
ATOM   3947  O O   . GLU B 1 82  ? -1.387  -8.992  63.039  1.00 20.52 ? 82  GLU B O   1 
ATOM   3948  C CB  . GLU B 1 82  ? 0.443   -10.883 64.724  1.00 22.50 ? 82  GLU B CB  1 
ATOM   3949  C CG  . GLU B 1 82  ? 1.771   -10.352 65.192  1.00 24.88 ? 82  GLU B CG  1 
ATOM   3950  C CD  . GLU B 1 82  ? 2.929   -11.338 65.073  1.00 29.24 ? 82  GLU B CD  1 
ATOM   3951  O OE1 . GLU B 1 82  ? 3.235   -11.779 63.931  1.00 25.44 ? 82  GLU B OE1 1 
ATOM   3952  O OE2 . GLU B 1 82  ? 3.577   -11.634 66.120  1.00 33.15 ? 82  GLU B OE2 1 
ATOM   3953  N N   . LEU B 1 83  ? 0.642   -8.720  62.106  1.00 19.29 ? 83  LEU B N   1 
ATOM   3954  C CA  . LEU B 1 83  ? 0.349   -7.381  61.613  1.00 19.39 ? 83  LEU B CA  1 
ATOM   3955  C C   . LEU B 1 83  ? -0.511  -7.471  60.359  1.00 19.63 ? 83  LEU B C   1 
ATOM   3956  O O   . LEU B 1 83  ? -1.462  -6.706  60.154  1.00 18.68 ? 83  LEU B O   1 
ATOM   3957  C CB  . LEU B 1 83  ? 1.632   -6.607  61.285  1.00 19.63 ? 83  LEU B CB  1 
ATOM   3958  C CG  . LEU B 1 83  ? 1.666   -5.087  61.471  1.00 23.04 ? 83  LEU B CG  1 
ATOM   3959  C CD1 . LEU B 1 83  ? 2.672   -4.367  60.600  1.00 18.82 ? 83  LEU B CD1 1 
ATOM   3960  C CD2 . LEU B 1 83  ? 0.316   -4.390  61.505  1.00 24.05 ? 83  LEU B CD2 1 
ATOM   3961  N N   . LEU B 1 84  ? -0.145  -8.382  59.486  1.00 20.41 ? 84  LEU B N   1 
ATOM   3962  C CA  . LEU B 1 84  ? -0.964  -8.615  58.282  1.00 21.25 ? 84  LEU B CA  1 
ATOM   3963  C C   . LEU B 1 84  ? -2.398  -8.941  58.632  1.00 20.82 ? 84  LEU B C   1 
ATOM   3964  O O   . LEU B 1 84  ? -3.315  -8.381  58.054  1.00 24.42 ? 84  LEU B O   1 
ATOM   3965  C CB  . LEU B 1 84  ? -0.413  -9.772  57.486  1.00 22.06 ? 84  LEU B CB  1 
ATOM   3966  C CG  . LEU B 1 84  ? 0.446   -9.590  56.240  1.00 24.78 ? 84  LEU B CG  1 
ATOM   3967  C CD1 . LEU B 1 84  ? 0.503   -8.184  55.672  1.00 23.57 ? 84  LEU B CD1 1 
ATOM   3968  C CD2 . LEU B 1 84  ? 1.775   -10.203 56.497  1.00 23.22 ? 84  LEU B CD2 1 
ATOM   3969  N N   . SER B 1 85  ? -2.604  -9.878  59.540  1.00 21.78 ? 85  SER B N   1 
ATOM   3970  C CA  . SER B 1 85  ? -3.958  -10.267 59.853  1.00 22.65 ? 85  SER B CA  1 
ATOM   3971  C C   . SER B 1 85  ? -4.730  -9.124  60.522  1.00 21.55 ? 85  SER B C   1 
ATOM   3972  O O   . SER B 1 85  ? -5.878  -8.914  60.201  1.00 22.61 ? 85  SER B O   1 
ATOM   3973  C CB  . SER B 1 85  ? -3.975  -11.524 60.724  1.00 23.02 ? 85  SER B CB  1 
ATOM   3974  O OG  . SER B 1 85  ? -3.385  -11.217 61.973  1.00 28.02 ? 85  SER B OG  1 
ATOM   3975  N N   . TRP B 1 86  ? -4.111  -8.411  61.465  1.00 22.07 ? 86  TRP B N   1 
ATOM   3976  C CA  . TRP B 1 86  ? -4.717  -7.213  62.073  1.00 22.54 ? 86  TRP B CA  1 
ATOM   3977  C C   . TRP B 1 86  ? -5.144  -6.197  60.992  1.00 22.73 ? 86  TRP B C   1 
ATOM   3978  O O   . TRP B 1 86  ? -6.284  -5.720  60.967  1.00 23.46 ? 86  TRP B O   1 
ATOM   3979  C CB  . TRP B 1 86  ? -3.750  -6.559  63.099  1.00 22.54 ? 86  TRP B CB  1 
ATOM   3980  C CG  . TRP B 1 86  ? -4.502  -5.731  64.112  1.00 21.81 ? 86  TRP B CG  1 
ATOM   3981  C CD1 . TRP B 1 86  ? -4.939  -6.138  65.341  1.00 23.98 ? 86  TRP B CD1 1 
ATOM   3982  C CD2 . TRP B 1 86  ? -4.955  -4.379  63.953  1.00 22.32 ? 86  TRP B CD2 1 
ATOM   3983  N NE1 . TRP B 1 86  ? -5.619  -5.122  65.975  1.00 23.42 ? 86  TRP B NE1 1 
ATOM   3984  C CE2 . TRP B 1 86  ? -5.670  -4.035  65.142  1.00 24.01 ? 86  TRP B CE2 1 
ATOM   3985  C CE3 . TRP B 1 86  ? -4.857  -3.431  62.920  1.00 23.60 ? 86  TRP B CE3 1 
ATOM   3986  C CZ2 . TRP B 1 86  ? -6.243  -2.765  65.340  1.00 24.79 ? 86  TRP B CZ2 1 
ATOM   3987  C CZ3 . TRP B 1 86  ? -5.449  -2.177  63.101  1.00 23.68 ? 86  TRP B CZ3 1 
ATOM   3988  C CH2 . TRP B 1 86  ? -6.131  -1.848  64.314  1.00 24.86 ? 86  TRP B CH2 1 
ATOM   3989  N N   . LEU B 1 87  ? -4.224  -5.895  60.084  1.00 22.77 ? 87  LEU B N   1 
ATOM   3990  C CA  . LEU B 1 87  ? -4.468  -4.954  59.006  1.00 23.38 ? 87  LEU B CA  1 
ATOM   3991  C C   . LEU B 1 87  ? -5.552  -5.399  58.031  1.00 22.10 ? 87  LEU B C   1 
ATOM   3992  O O   . LEU B 1 87  ? -6.330  -4.586  57.607  1.00 22.24 ? 87  LEU B O   1 
ATOM   3993  C CB  . LEU B 1 87  ? -3.140  -4.675  58.263  1.00 24.41 ? 87  LEU B CB  1 
ATOM   3994  C CG  . LEU B 1 87  ? -2.332  -3.399  58.597  1.00 26.86 ? 87  LEU B CG  1 
ATOM   3995  C CD1 . LEU B 1 87  ? -2.738  -2.613  59.834  1.00 26.18 ? 87  LEU B CD1 1 
ATOM   3996  C CD2 . LEU B 1 87  ? -0.807  -3.480  58.462  1.00 24.30 ? 87  LEU B CD2 1 
ATOM   3997  N N   . LYS B 1 88  ? -5.569  -6.679  57.641  1.00 23.48 ? 88  LYS B N   1 
ATOM   3998  C CA  . LYS B 1 88  ? -6.620  -7.216  56.747  1.00 22.60 ? 88  LYS B CA  1 
ATOM   3999  C C   . LYS B 1 88  ? -7.983  -7.162  57.435  1.00 23.68 ? 88  LYS B C   1 
ATOM   4000  O O   . LYS B 1 88  ? -8.987  -6.787  56.811  1.00 24.46 ? 88  LYS B O   1 
ATOM   4001  C CB  . LYS B 1 88  ? -6.291  -8.638  56.245  1.00 22.26 ? 88  LYS B CB  1 
ATOM   4002  C CG  . LYS B 1 88  ? -5.139  -8.683  55.210  1.00 22.40 ? 88  LYS B CG  1 
ATOM   4003  C CD  . LYS B 1 88  ? -4.739  -10.113 54.903  1.00 27.08 ? 88  LYS B CD  1 
ATOM   4004  C CE  . LYS B 1 88  ? -3.785  -10.232 53.690  1.00 27.23 ? 88  LYS B CE  1 
ATOM   4005  N NZ  . LYS B 1 88  ? -3.431  -11.681 53.421  1.00 26.33 ? 88  LYS B NZ  1 
ATOM   4006  N N   . GLN B 1 89  ? -8.026  -7.521  58.711  1.00 24.33 ? 89  GLN B N   1 
ATOM   4007  C CA  . GLN B 1 89  ? -9.285  -7.399  59.483  1.00 25.70 ? 89  GLN B CA  1 
ATOM   4008  C C   . GLN B 1 89  ? -9.763  -5.947  59.580  1.00 25.32 ? 89  GLN B C   1 
ATOM   4009  O O   . GLN B 1 89  ? -10.967 -5.687  59.449  1.00 26.10 ? 89  GLN B O   1 
ATOM   4010  C CB  . GLN B 1 89  ? -9.189  -8.043  60.869  1.00 25.34 ? 89  GLN B CB  1 
ATOM   4011  C CG  . GLN B 1 89  ? -10.537 -8.104  61.630  1.00 32.47 ? 89  GLN B CG  1 
ATOM   4012  C CD  . GLN B 1 89  ? -11.655 -8.727  60.781  1.00 37.27 ? 89  GLN B CD  1 
ATOM   4013  O OE1 . GLN B 1 89  ? -12.738 -8.158  60.639  1.00 40.07 ? 89  GLN B OE1 1 
ATOM   4014  N NE2 . GLN B 1 89  ? -11.364 -9.882  60.170  1.00 40.90 ? 89  GLN B NE2 1 
ATOM   4015  N N   . LEU B 1 90  ? -8.828  -5.015  59.773  1.00 25.51 ? 90  LEU B N   1 
ATOM   4016  C CA  . LEU B 1 90  ? -9.133  -3.567  59.741  1.00 26.25 ? 90  LEU B CA  1 
ATOM   4017  C C   . LEU B 1 90  ? -9.814  -3.137  58.427  1.00 27.33 ? 90  LEU B C   1 
ATOM   4018  O O   . LEU B 1 90  ? -10.823 -2.410  58.423  1.00 26.70 ? 90  LEU B O   1 
ATOM   4019  C CB  . LEU B 1 90  ? -7.843  -2.716  59.967  1.00 26.73 ? 90  LEU B CB  1 
ATOM   4020  C CG  . LEU B 1 90  ? -7.996  -1.168  60.015  1.00 26.61 ? 90  LEU B CG  1 
ATOM   4021  C CD1 . LEU B 1 90  ? -8.466  -0.723  61.394  1.00 25.11 ? 90  LEU B CD1 1 
ATOM   4022  C CD2 . LEU B 1 90  ? -6.708  -0.401  59.637  1.00 26.75 ? 90  LEU B CD2 1 
ATOM   4023  N N   . GLN B 1 91  ? -9.237  -3.576  57.308  1.00 27.20 ? 91  GLN B N   1 
ATOM   4024  C CA  . GLN B 1 91  ? -9.734  -3.215  56.000  1.00 27.91 ? 91  GLN B CA  1 
ATOM   4025  C C   . GLN B 1 91  ? -11.144 -3.756  55.788  1.00 29.57 ? 91  GLN B C   1 
ATOM   4026  O O   . GLN B 1 91  ? -12.027 -3.079  55.233  1.00 29.81 ? 91  GLN B O   1 
ATOM   4027  C CB  . GLN B 1 91  ? -8.785  -3.745  54.931  1.00 27.87 ? 91  GLN B CB  1 
ATOM   4028  C CG  . GLN B 1 91  ? -7.362  -3.151  54.958  1.00 23.95 ? 91  GLN B CG  1 
ATOM   4029  C CD  . GLN B 1 91  ? -7.316  -1.616  54.888  1.00 23.07 ? 91  GLN B CD  1 
ATOM   4030  O OE1 . GLN B 1 91  ? -7.675  -0.908  55.854  1.00 20.47 ? 91  GLN B OE1 1 
ATOM   4031  N NE2 . GLN B 1 91  ? -6.813  -1.096  53.768  1.00 24.23 ? 91  GLN B NE2 1 
ATOM   4032  N N   . ILE B 1 92  ? -11.359 -4.987  56.226  1.00 31.07 ? 92  ILE B N   1 
ATOM   4033  C CA  . ILE B 1 92  ? -12.705 -5.552  56.244  1.00 32.26 ? 92  ILE B CA  1 
ATOM   4034  C C   . ILE B 1 92  ? -13.672 -4.654  57.038  1.00 32.79 ? 92  ILE B C   1 
ATOM   4035  O O   . ILE B 1 92  ? -14.751 -4.284  56.540  1.00 33.58 ? 92  ILE B O   1 
ATOM   4036  C CB  . ILE B 1 92  ? -12.692 -7.002  56.775  1.00 32.04 ? 92  ILE B CB  1 
ATOM   4037  C CG1 . ILE B 1 92  ? -11.924 -7.902  55.783  1.00 33.43 ? 92  ILE B CG1 1 
ATOM   4038  C CG2 . ILE B 1 92  ? -14.138 -7.500  57.022  1.00 32.59 ? 92  ILE B CG2 1 
ATOM   4039  C CD1 . ILE B 1 92  ? -11.534 -9.294  56.288  1.00 32.50 ? 92  ILE B CD1 1 
ATOM   4040  N N   . LYS B 1 93  ? -13.278 -4.277  58.250  1.00 33.02 ? 93  LYS B N   1 
ATOM   4041  C CA  . LYS B 1 93  ? -14.144 -3.440  59.095  1.00 33.81 ? 93  LYS B CA  1 
ATOM   4042  C C   . LYS B 1 93  ? -14.366 -2.069  58.525  1.00 32.94 ? 93  LYS B C   1 
ATOM   4043  O O   . LYS B 1 93  ? -15.472 -1.527  58.632  1.00 33.39 ? 93  LYS B O   1 
ATOM   4044  C CB  . LYS B 1 93  ? -13.611 -3.290  60.525  1.00 34.19 ? 93  LYS B CB  1 
ATOM   4045  C CG  . LYS B 1 93  ? -13.567 -4.570  61.331  1.00 39.60 ? 93  LYS B CG  1 
ATOM   4046  C CD  . LYS B 1 93  ? -14.947 -5.015  61.839  1.00 45.15 ? 93  LYS B CD  1 
ATOM   4047  C CE  . LYS B 1 93  ? -14.821 -6.314  62.613  1.00 47.25 ? 93  LYS B CE  1 
ATOM   4048  N NZ  . LYS B 1 93  ? -14.209 -6.156  63.966  1.00 50.58 ? 93  LYS B NZ  1 
ATOM   4049  N N   . LEU B 1 94  ? -13.331 -1.491  57.932  1.00 32.07 ? 94  LEU B N   1 
ATOM   4050  C CA  . LEU B 1 94  ? -13.418 -0.105  57.494  1.00 31.88 ? 94  LEU B CA  1 
ATOM   4051  C C   . LEU B 1 94  ? -14.024 0.053   56.122  1.00 31.47 ? 94  LEU B C   1 
ATOM   4052  O O   . LEU B 1 94  ? -14.673 1.064   55.842  1.00 32.16 ? 94  LEU B O   1 
ATOM   4053  C CB  . LEU B 1 94  ? -12.059 0.593   57.521  1.00 31.62 ? 94  LEU B CB  1 
ATOM   4054  C CG  . LEU B 1 94  ? -11.486 0.974   58.880  1.00 32.63 ? 94  LEU B CG  1 
ATOM   4055  C CD1 . LEU B 1 94  ? -10.224 1.742   58.663  1.00 32.39 ? 94  LEU B CD1 1 
ATOM   4056  C CD2 . LEU B 1 94  ? -12.479 1.777   59.730  1.00 35.43 ? 94  LEU B CD2 1 
ATOM   4057  N N   . HIS B 1 95  ? -13.814 -0.940  55.277  1.00 29.78 ? 95  HIS B N   1 
ATOM   4058  C CA  . HIS B 1 95  ? -14.050 -0.758  53.873  1.00 29.37 ? 95  HIS B CA  1 
ATOM   4059  C C   . HIS B 1 95  ? -14.879 -1.881  53.294  1.00 29.54 ? 95  HIS B C   1 
ATOM   4060  O O   . HIS B 1 95  ? -15.408 -1.738  52.195  1.00 29.18 ? 95  HIS B O   1 
ATOM   4061  C CB  . HIS B 1 95  ? -12.710 -0.693  53.118  1.00 28.63 ? 95  HIS B CB  1 
ATOM   4062  C CG  . HIS B 1 95  ? -11.774 0.350   53.637  1.00 28.65 ? 95  HIS B CG  1 
ATOM   4063  N ND1 . HIS B 1 95  ? -12.089 1.689   53.640  1.00 28.20 ? 95  HIS B ND1 1 
ATOM   4064  C CD2 . HIS B 1 95  ? -10.523 0.253   54.155  1.00 26.92 ? 95  HIS B CD2 1 
ATOM   4065  C CE1 . HIS B 1 95  ? -11.067 2.376   54.136  1.00 31.50 ? 95  HIS B CE1 1 
ATOM   4066  N NE2 . HIS B 1 95  ? -10.108 1.526   54.457  1.00 25.63 ? 95  HIS B NE2 1 
ATOM   4067  N N   . ASN B 1 96  ? -14.969 -2.981  54.040  1.00 29.67 ? 96  ASN B N   1 
ATOM   4068  C CA  . ASN B 1 96  ? -15.605 -4.203  53.575  1.00 31.45 ? 96  ASN B CA  1 
ATOM   4069  C C   . ASN B 1 96  ? -15.520 -4.414  52.046  1.00 31.84 ? 96  ASN B C   1 
ATOM   4070  O O   . ASN B 1 96  ? -16.539 -4.405  51.356  1.00 32.03 ? 96  ASN B O   1 
ATOM   4071  C CB  . ASN B 1 96  ? -17.054 -4.253  54.082  1.00 31.91 ? 96  ASN B CB  1 
ATOM   4072  C CG  . ASN B 1 96  ? -17.711 -5.595  53.829  1.00 34.68 ? 96  ASN B CG  1 
ATOM   4073  O OD1 . ASN B 1 96  ? -17.068 -6.648  53.903  1.00 36.07 ? 96  ASN B OD1 1 
ATOM   4074  N ND2 . ASN B 1 96  ? -18.998 -5.562  53.512  1.00 37.63 ? 96  ASN B ND2 1 
ATOM   4075  N N   . PRO B 1 97  ? -14.294 -4.606  51.507  1.00 31.66 ? 97  PRO B N   1 
ATOM   4076  C CA  . PRO B 1 97  ? -14.158 -4.641  50.034  1.00 31.81 ? 97  PRO B CA  1 
ATOM   4077  C C   . PRO B 1 97  ? -14.940 -5.819  49.413  1.00 32.71 ? 97  PRO B C   1 
ATOM   4078  O O   . PRO B 1 97  ? -14.921 -6.917  49.973  1.00 32.99 ? 97  PRO B O   1 
ATOM   4079  C CB  . PRO B 1 97  ? -12.655 -4.844  49.836  1.00 31.58 ? 97  PRO B CB  1 
ATOM   4080  C CG  . PRO B 1 97  ? -12.037 -4.406  51.144  1.00 30.26 ? 97  PRO B CG  1 
ATOM   4081  C CD  . PRO B 1 97  ? -12.994 -4.828  52.176  1.00 30.99 ? 97  PRO B CD  1 
ATOM   4082  N N   . PRO B 1 98  ? -15.657 -5.586  48.288  1.00 32.81 ? 98  PRO B N   1 
ATOM   4083  C CA  . PRO B 1 98  ? -16.484 -6.633  47.633  1.00 33.17 ? 98  PRO B CA  1 
ATOM   4084  C C   . PRO B 1 98  ? -15.692 -7.909  47.301  1.00 33.49 ? 98  PRO B C   1 
ATOM   4085  O O   . PRO B 1 98  ? -16.218 -9.023  47.268  1.00 34.44 ? 98  PRO B O   1 
ATOM   4086  C CB  . PRO B 1 98  ? -16.926 -5.943  46.346  1.00 32.80 ? 98  PRO B CB  1 
ATOM   4087  C CG  . PRO B 1 98  ? -16.950 -4.467  46.708  1.00 33.19 ? 98  PRO B CG  1 
ATOM   4088  C CD  . PRO B 1 98  ? -15.720 -4.310  47.559  1.00 32.81 ? 98  PRO B CD  1 
ATOM   4089  N N   . THR B 1 99  ? -14.408 -7.693  47.119  1.00 33.17 ? 99  THR B N   1 
ATOM   4090  C CA  . THR B 1 99  ? -13.422 -8.580  46.555  1.00 33.43 ? 99  THR B CA  1 
ATOM   4091  C C   . THR B 1 99  ? -12.802 -9.592  47.586  1.00 33.36 ? 99  THR B C   1 
ATOM   4092  O O   . THR B 1 99  ? -12.038 -10.500 47.226  1.00 32.87 ? 99  THR B O   1 
ATOM   4093  C CB  . THR B 1 99  ? -12.386 -7.579  46.005  1.00 33.46 ? 99  THR B CB  1 
ATOM   4094  O OG1 . THR B 1 99  ? -11.975 -7.884  44.671  1.00 38.42 ? 99  THR B OG1 1 
ATOM   4095  C CG2 . THR B 1 99  ? -11.260 -7.380  46.941  1.00 30.65 ? 99  THR B CG2 1 
ATOM   4096  N N   . ILE B 1 100 ? -13.153 -9.470  48.862  1.00 33.35 ? 100 ILE B N   1 
ATOM   4097  C CA  . ILE B 1 100 ? -12.496 -10.316 49.874  1.00 34.22 ? 100 ILE B CA  1 
ATOM   4098  C C   . ILE B 1 100 ? -12.565 -11.832 49.673  1.00 34.75 ? 100 ILE B C   1 
ATOM   4099  O O   . ILE B 1 100 ? -11.607 -12.512 50.022  1.00 34.05 ? 100 ILE B O   1 
ATOM   4100  C CB  . ILE B 1 100 ? -12.868 -9.945  51.355  1.00 34.56 ? 100 ILE B CB  1 
ATOM   4101  C CG1 . ILE B 1 100 ? -14.323 -10.302 51.695  1.00 34.09 ? 100 ILE B CG1 1 
ATOM   4102  C CG2 . ILE B 1 100 ? -12.536 -8.490  51.652  1.00 34.39 ? 100 ILE B CG2 1 
ATOM   4103  C CD1 . ILE B 1 100 ? -14.596 -10.301 53.181  1.00 34.85 ? 100 ILE B CD1 1 
ATOM   4104  N N   . HIS B 1 101 ? -13.678 -12.350 49.121  1.00 35.61 ? 101 HIS B N   1 
ATOM   4105  C CA  . HIS B 1 101 ? -13.847 -13.810 48.897  1.00 36.32 ? 101 HIS B CA  1 
ATOM   4106  C C   . HIS B 1 101 ? -13.790 -14.245 47.432  1.00 36.87 ? 101 HIS B C   1 
ATOM   4107  O O   . HIS B 1 101 ? -14.265 -15.333 47.086  1.00 37.55 ? 101 HIS B O   1 
ATOM   4108  C CB  . HIS B 1 101 ? -15.113 -14.368 49.587  1.00 36.70 ? 101 HIS B CB  1 
ATOM   4109  C CG  . HIS B 1 101 ? -15.108 -14.212 51.081  1.00 36.44 ? 101 HIS B CG  1 
ATOM   4110  N ND1 . HIS B 1 101 ? -16.164 -13.666 51.779  1.00 38.38 ? 101 HIS B ND1 1 
ATOM   4111  C CD2 . HIS B 1 101 ? -14.159 -14.499 52.006  1.00 37.21 ? 101 HIS B CD2 1 
ATOM   4112  C CE1 . HIS B 1 101 ? -15.878 -13.648 53.072  1.00 37.76 ? 101 HIS B CE1 1 
ATOM   4113  N NE2 . HIS B 1 101 ? -14.666 -14.145 53.235  1.00 35.79 ? 101 HIS B NE2 1 
ATOM   4114  N N   . TYR B 1 102 ? -13.220 -13.403 46.569  1.00 36.87 ? 102 TYR B N   1 
ATOM   4115  C CA  . TYR B 1 102 ? -13.023 -13.773 45.169  1.00 36.82 ? 102 TYR B CA  1 
ATOM   4116  C C   . TYR B 1 102 ? -11.899 -14.784 45.109  1.00 37.71 ? 102 TYR B C   1 
ATOM   4117  O O   . TYR B 1 102 ? -11.051 -14.835 46.031  1.00 36.83 ? 102 TYR B O   1 
ATOM   4118  C CB  . TYR B 1 102 ? -12.652 -12.565 44.296  1.00 36.13 ? 102 TYR B CB  1 
ATOM   4119  C CG  . TYR B 1 102 ? -13.757 -11.547 44.029  1.00 34.79 ? 102 TYR B CG  1 
ATOM   4120  C CD1 . TYR B 1 102 ? -13.541 -10.501 43.141  1.00 32.65 ? 102 TYR B CD1 1 
ATOM   4121  C CD2 . TYR B 1 102 ? -15.020 -11.649 44.631  1.00 32.93 ? 102 TYR B CD2 1 
ATOM   4122  C CE1 . TYR B 1 102 ? -14.520 -9.543  42.901  1.00 34.66 ? 102 TYR B CE1 1 
ATOM   4123  C CE2 . TYR B 1 102 ? -16.029 -10.695 44.388  1.00 34.10 ? 102 TYR B CE2 1 
ATOM   4124  C CZ  . TYR B 1 102 ? -15.761 -9.646  43.517  1.00 34.65 ? 102 TYR B CZ  1 
ATOM   4125  O OH  . TYR B 1 102 ? -16.709 -8.683  43.258  1.00 34.05 ? 102 TYR B OH  1 
ATOM   4126  N N   . PRO B 1 103 ? -11.886 -15.616 44.045  1.00 38.06 ? 103 PRO B N   1 
ATOM   4127  C CA  . PRO B 1 103 ? -10.692 -16.401 43.745  1.00 38.34 ? 103 PRO B CA  1 
ATOM   4128  C C   . PRO B 1 103 ? -9.471  -15.491 43.544  1.00 38.10 ? 103 PRO B C   1 
ATOM   4129  O O   . PRO B 1 103 ? -9.616  -14.402 42.994  1.00 38.44 ? 103 PRO B O   1 
ATOM   4130  C CB  . PRO B 1 103 ? -11.059 -17.077 42.412  1.00 38.00 ? 103 PRO B CB  1 
ATOM   4131  C CG  . PRO B 1 103 ? -12.487 -17.233 42.462  1.00 38.06 ? 103 PRO B CG  1 
ATOM   4132  C CD  . PRO B 1 103 ? -12.972 -15.932 43.095  1.00 38.55 ? 103 PRO B CD  1 
ATOM   4133  N N   . PRO B 1 104 ? -8.282  -15.931 43.989  1.00 38.32 ? 104 PRO B N   1 
ATOM   4134  C CA  . PRO B 1 104 ? -7.043  -15.182 43.810  1.00 38.53 ? 104 PRO B CA  1 
ATOM   4135  C C   . PRO B 1 104 ? -6.824  -14.637 42.399  1.00 38.66 ? 104 PRO B C   1 
ATOM   4136  O O   . PRO B 1 104 ? -6.456  -13.482 42.258  1.00 38.21 ? 104 PRO B O   1 
ATOM   4137  C CB  . PRO B 1 104 ? -5.969  -16.211 44.174  1.00 38.58 ? 104 PRO B CB  1 
ATOM   4138  C CG  . PRO B 1 104 ? -6.612  -16.975 45.263  1.00 39.27 ? 104 PRO B CG  1 
ATOM   4139  C CD  . PRO B 1 104 ? -8.048  -17.155 44.768  1.00 38.98 ? 104 PRO B CD  1 
ATOM   4140  N N   . SER B 1 105 ? -7.053  -15.456 41.374  1.00 39.10 ? 105 SER B N   1 
ATOM   4141  C CA  . SER B 1 105 ? -6.775  -15.068 39.987  1.00 39.49 ? 105 SER B CA  1 
ATOM   4142  C C   . SER B 1 105 ? -7.706  -13.950 39.534  1.00 39.96 ? 105 SER B C   1 
ATOM   4143  O O   . SER B 1 105 ? -7.380  -13.180 38.619  1.00 40.54 ? 105 SER B O   1 
ATOM   4144  C CB  . SER B 1 105 ? -6.939  -16.257 39.061  1.00 39.85 ? 105 SER B CB  1 
ATOM   4145  O OG  . SER B 1 105 ? -8.304  -16.607 39.002  1.00 39.93 ? 105 SER B OG  1 
ATOM   4146  N N   . GLN B 1 106 ? -8.867  -13.884 40.170  1.00 39.67 ? 106 GLN B N   1 
ATOM   4147  C CA  . GLN B 1 106 ? -9.771  -12.757 40.028  1.00 40.23 ? 106 GLN B CA  1 
ATOM   4148  C C   . GLN B 1 106 ? -9.302  -11.748 41.108  1.00 39.74 ? 106 GLN B C   1 
ATOM   4149  O O   . GLN B 1 106 ? -8.172  -11.827 41.581  1.00 40.86 ? 106 GLN B O   1 
ATOM   4150  C CB  . GLN B 1 106 ? -11.224 -13.248 40.125  1.00 40.53 ? 106 GLN B CB  1 
ATOM   4151  C CG  . GLN B 1 106 ? -11.515 -14.325 39.043  1.00 42.26 ? 106 GLN B CG  1 
ATOM   4152  C CD  . GLN B 1 106 ? -12.835 -15.095 39.211  1.00 47.20 ? 106 GLN B CD  1 
ATOM   4153  O OE1 . GLN B 1 106 ? -12.882 -16.313 38.984  1.00 48.91 ? 106 GLN B OE1 1 
ATOM   4154  N NE2 . GLN B 1 106 ? -13.909 -14.393 39.583  1.00 47.01 ? 106 GLN B NE2 1 
ATOM   4155  N N   . GLY B 1 107 ? -10.074 -10.778 41.517  1.00 39.01 ? 107 GLY B N   1 
ATOM   4156  C CA  . GLY B 1 107 ? -9.358  -9.752  42.289  1.00 37.12 ? 107 GLY B CA  1 
ATOM   4157  C C   . GLY B 1 107 ? -9.074  -9.920  43.776  1.00 35.05 ? 107 GLY B C   1 
ATOM   4158  O O   . GLY B 1 107 ? -9.002  -8.915  44.462  1.00 34.54 ? 107 GLY B O   1 
ATOM   4159  N N   . GLN B 1 108 ? -8.902  -11.150 44.279  1.00 33.38 ? 108 GLN B N   1 
ATOM   4160  C CA  . GLN B 1 108 ? -9.048  -11.386 45.726  1.00 31.40 ? 108 GLN B CA  1 
ATOM   4161  C C   . GLN B 1 108 ? -8.256  -10.345 46.481  1.00 31.23 ? 108 GLN B C   1 
ATOM   4162  O O   . GLN B 1 108 ? -7.093  -10.133 46.191  1.00 31.42 ? 108 GLN B O   1 
ATOM   4163  C CB  . GLN B 1 108 ? -8.653  -12.793 46.206  1.00 31.26 ? 108 GLN B CB  1 
ATOM   4164  C CG  . GLN B 1 108 ? -9.083  -13.016 47.682  1.00 29.31 ? 108 GLN B CG  1 
ATOM   4165  C CD  . GLN B 1 108 ? -8.877  -14.407 48.239  1.00 33.12 ? 108 GLN B CD  1 
ATOM   4166  O OE1 . GLN B 1 108 ? -9.622  -14.841 49.141  1.00 37.77 ? 108 GLN B OE1 1 
ATOM   4167  N NE2 . GLN B 1 108 ? -7.863  -15.099 47.764  1.00 29.11 ? 108 GLN B NE2 1 
ATOM   4168  N N   . MET B 1 109 ? -8.888  -9.684  47.455  1.00 30.22 ? 109 MET B N   1 
ATOM   4169  C CA  . MET B 1 109 ? -8.154  -8.676  48.233  1.00 29.78 ? 109 MET B CA  1 
ATOM   4170  C C   . MET B 1 109 ? -6.911  -9.264  48.855  1.00 28.69 ? 109 MET B C   1 
ATOM   4171  O O   . MET B 1 109 ? -6.980  -10.312 49.496  1.00 28.47 ? 109 MET B O   1 
ATOM   4172  C CB  . MET B 1 109 ? -8.994  -8.111  49.360  1.00 29.68 ? 109 MET B CB  1 
ATOM   4173  C CG  . MET B 1 109 ? -8.427  -6.781  49.888  1.00 30.79 ? 109 MET B CG  1 
ATOM   4174  S SD  . MET B 1 109 ? -9.168  -6.484  51.491  1.00 32.91 ? 109 MET B SD  1 
ATOM   4175  C CE  . MET B 1 109 ? -8.089  -7.397  52.589  1.00 36.09 ? 109 MET B CE  1 
ATOM   4176  N N   . ASP B 1 110 ? -5.790  -8.578  48.664  1.00 27.80 ? 110 ASP B N   1 
ATOM   4177  C CA  . ASP B 1 110 ? -4.601  -8.905  49.375  1.00 26.90 ? 110 ASP B CA  1 
ATOM   4178  C C   . ASP B 1 110 ? -3.991  -7.662  50.012  1.00 25.77 ? 110 ASP B C   1 
ATOM   4179  O O   . ASP B 1 110 ? -4.394  -6.518  49.723  1.00 26.97 ? 110 ASP B O   1 
ATOM   4180  C CB  . ASP B 1 110 ? -3.597  -9.642  48.457  1.00 26.19 ? 110 ASP B CB  1 
ATOM   4181  C CG  . ASP B 1 110 ? -2.611  -10.537 49.245  1.00 28.70 ? 110 ASP B CG  1 
ATOM   4182  O OD1 . ASP B 1 110 ? -2.702  -10.643 50.498  1.00 23.91 ? 110 ASP B OD1 1 
ATOM   4183  O OD2 . ASP B 1 110 ? -1.722  -11.144 48.608  1.00 30.19 ? 110 ASP B OD2 1 
ATOM   4184  N N   . LEU B 1 111 ? -3.012  -7.885  50.876  1.00 24.47 ? 111 LEU B N   1 
ATOM   4185  C CA  . LEU B 1 111 ? -2.392  -6.792  51.623  1.00 23.29 ? 111 LEU B CA  1 
ATOM   4186  C C   . LEU B 1 111 ? -0.939  -7.118  51.942  1.00 23.57 ? 111 LEU B C   1 
ATOM   4187  O O   . LEU B 1 111 ? -0.616  -8.245  52.331  1.00 22.49 ? 111 LEU B O   1 
ATOM   4188  C CB  . LEU B 1 111 ? -3.184  -6.509  52.907  1.00 22.98 ? 111 LEU B CB  1 
ATOM   4189  C CG  . LEU B 1 111 ? -2.861  -5.254  53.748  1.00 21.90 ? 111 LEU B CG  1 
ATOM   4190  C CD1 . LEU B 1 111 ? -4.045  -4.948  54.518  1.00 16.40 ? 111 LEU B CD1 1 
ATOM   4191  C CD2 . LEU B 1 111 ? -1.633  -5.392  54.752  1.00 22.38 ? 111 LEU B CD2 1 
ATOM   4192  N N   . CYS B 1 112 ? -0.091  -6.094  51.782  1.00 23.13 ? 112 CYS B N   1 
ATOM   4193  C CA  . CYS B 1 112 ? 1.345   -6.138  51.933  1.00 23.89 ? 112 CYS B CA  1 
ATOM   4194  C C   . CYS B 1 112 ? 1.717   -4.972  52.870  1.00 23.73 ? 112 CYS B C   1 
ATOM   4195  O O   . CYS B 1 112 ? 1.335   -3.828  52.600  1.00 23.21 ? 112 CYS B O   1 
ATOM   4196  C CB  . CYS B 1 112 ? 2.008   -5.889  50.543  1.00 24.70 ? 112 CYS B CB  1 
ATOM   4197  S SG  . CYS B 1 112 ? 3.746   -6.199  50.564  1.00 33.47 ? 112 CYS B SG  1 
ATOM   4198  N N   . VAL B 1 113 ? 2.431   -5.259  53.958  1.00 22.75 ? 113 VAL B N   1 
ATOM   4199  C CA  . VAL B 1 113 ? 3.102   -4.223  54.752  1.00 22.69 ? 113 VAL B CA  1 
ATOM   4200  C C   . VAL B 1 113 ? 4.318   -3.666  53.961  1.00 22.28 ? 113 VAL B C   1 
ATOM   4201  O O   . VAL B 1 113 ? 5.141   -4.421  53.437  1.00 22.56 ? 113 VAL B O   1 
ATOM   4202  C CB  . VAL B 1 113 ? 3.519   -4.745  56.161  1.00 21.60 ? 113 VAL B CB  1 
ATOM   4203  C CG1 . VAL B 1 113 ? 4.093   -3.613  56.998  1.00 24.84 ? 113 VAL B CG1 1 
ATOM   4204  C CG2 . VAL B 1 113 ? 2.333   -5.355  56.897  1.00 23.62 ? 113 VAL B CG2 1 
ATOM   4205  N N   . THR B 1 114 ? 4.415   -2.345  53.828  1.00 22.13 ? 114 THR B N   1 
ATOM   4206  C CA  . THR B 1 114 ? 5.548   -1.772  53.088  1.00 22.18 ? 114 THR B CA  1 
ATOM   4207  C C   . THR B 1 114 ? 6.394   -0.881  53.994  1.00 22.25 ? 114 THR B C   1 
ATOM   4208  O O   . THR B 1 114 ? 5.955   -0.532  55.082  1.00 22.21 ? 114 THR B O   1 
ATOM   4209  C CB  . THR B 1 114 ? 5.039   -0.986  51.878  1.00 22.71 ? 114 THR B CB  1 
ATOM   4210  O OG1 . THR B 1 114 ? 4.162   0.060   52.333  1.00 22.32 ? 114 THR B OG1 1 
ATOM   4211  C CG2 . THR B 1 114 ? 4.273   -1.967  50.905  1.00 23.58 ? 114 THR B CG2 1 
ATOM   4212  N N   . SER B 1 115 ? 7.590   -0.506  53.528  1.00 22.57 ? 115 SER B N   1 
ATOM   4213  C CA  . SER B 1 115 ? 8.476   0.393   54.245  1.00 23.04 ? 115 SER B CA  1 
ATOM   4214  C C   . SER B 1 115 ? 8.065   1.835   53.970  1.00 22.12 ? 115 SER B C   1 
ATOM   4215  O O   . SER B 1 115 ? 8.722   2.551   53.232  1.00 22.67 ? 115 SER B O   1 
ATOM   4216  C CB  . SER B 1 115 ? 9.948   0.123   53.915  1.00 22.31 ? 115 SER B CB  1 
ATOM   4217  O OG  . SER B 1 115 ? 10.318  -1.200  54.344  1.00 26.48 ? 115 SER B OG  1 
ATOM   4218  N N   . GLY B 1 116 ? 6.952   2.227   54.601  1.00 21.77 ? 116 GLY B N   1 
ATOM   4219  C CA  . GLY B 1 116 ? 6.228   3.412   54.309  1.00 21.89 ? 116 GLY B CA  1 
ATOM   4220  C C   . GLY B 1 116 ? 5.288   3.167   53.146  1.00 23.37 ? 116 GLY B C   1 
ATOM   4221  O O   . GLY B 1 116 ? 5.536   2.306   52.302  1.00 21.94 ? 116 GLY B O   1 
ATOM   4222  N N   . SER B 1 117 ? 4.218   3.948   53.070  1.00 22.53 ? 117 SER B N   1 
ATOM   4223  C CA  . SER B 1 117 ? 3.288   3.797   51.975  1.00 22.67 ? 117 SER B CA  1 
ATOM   4224  C C   . SER B 1 117 ? 3.872   4.232   50.637  1.00 23.57 ? 117 SER B C   1 
ATOM   4225  O O   . SER B 1 117 ? 3.488   3.700   49.607  1.00 23.77 ? 117 SER B O   1 
ATOM   4226  C CB  . SER B 1 117 ? 1.974   4.497   52.254  1.00 22.17 ? 117 SER B CB  1 
ATOM   4227  O OG  . SER B 1 117 ? 2.101   5.895   52.153  1.00 25.29 ? 117 SER B OG  1 
ATOM   4228  N N   . GLN B 1 118 ? 4.792   5.194   50.645  1.00 22.96 ? 118 GLN B N   1 
ATOM   4229  C CA  . GLN B 1 118 ? 5.437   5.603   49.412  1.00 23.49 ? 118 GLN B CA  1 
ATOM   4230  C C   . GLN B 1 118 ? 6.232   4.449   48.776  1.00 23.38 ? 118 GLN B C   1 
ATOM   4231  O O   . GLN B 1 118 ? 6.357   4.399   47.573  1.00 24.80 ? 118 GLN B O   1 
ATOM   4232  C CB  . GLN B 1 118 ? 6.372   6.800   49.640  1.00 24.07 ? 118 GLN B CB  1 
ATOM   4233  C CG  . GLN B 1 118 ? 7.195   7.202   48.391  1.00 30.81 ? 118 GLN B CG  1 
ATOM   4234  C CD  . GLN B 1 118 ? 6.322   7.784   47.293  1.00 39.94 ? 118 GLN B CD  1 
ATOM   4235  O OE1 . GLN B 1 118 ? 5.411   8.567   47.570  1.00 43.16 ? 118 GLN B OE1 1 
ATOM   4236  N NE2 . GLN B 1 118 ? 6.607   7.420   46.026  1.00 43.41 ? 118 GLN B NE2 1 
ATOM   4237  N N   . GLN B 1 119 ? 6.786   3.525   49.559  1.00 23.20 ? 119 GLN B N   1 
ATOM   4238  C CA  . GLN B 1 119 ? 7.434   2.345   48.931  1.00 22.57 ? 119 GLN B CA  1 
ATOM   4239  C C   . GLN B 1 119 ? 6.476   1.522   48.077  1.00 22.65 ? 119 GLN B C   1 
ATOM   4240  O O   . GLN B 1 119 ? 6.869   1.083   47.010  1.00 23.04 ? 119 GLN B O   1 
ATOM   4241  C CB  . GLN B 1 119 ? 8.103   1.392   49.914  1.00 20.37 ? 119 GLN B CB  1 
ATOM   4242  C CG  . GLN B 1 119 ? 8.898   0.309   49.161  1.00 20.99 ? 119 GLN B CG  1 
ATOM   4243  C CD  . GLN B 1 119 ? 9.290   -0.852  50.025  1.00 22.52 ? 119 GLN B CD  1 
ATOM   4244  O OE1 . GLN B 1 119 ? 8.605   -1.181  50.988  1.00 21.61 ? 119 GLN B OE1 1 
ATOM   4245  N NE2 . GLN B 1 119 ? 10.388  -1.478  49.685  1.00 21.39 ? 119 GLN B NE2 1 
ATOM   4246  N N   . GLY B 1 120 ? 5.273   1.266   48.599  1.00 22.70 ? 120 GLY B N   1 
ATOM   4247  C CA  . GLY B 1 120 ? 4.231   0.516   47.884  1.00 23.73 ? 120 GLY B CA  1 
ATOM   4248  C C   . GLY B 1 120 ? 3.750   1.224   46.627  1.00 24.29 ? 120 GLY B C   1 
ATOM   4249  O O   . GLY B 1 120 ? 3.578   0.592   45.578  1.00 24.34 ? 120 GLY B O   1 
ATOM   4250  N N   . LEU B 1 121 ? 3.516   2.528   46.728  1.00 24.31 ? 121 LEU B N   1 
ATOM   4251  C CA  . LEU B 1 121 ? 3.208   3.348   45.555  1.00 24.21 ? 121 LEU B CA  1 
ATOM   4252  C C   . LEU B 1 121 ? 4.290   3.296   44.488  1.00 23.93 ? 121 LEU B C   1 
ATOM   4253  O O   . LEU B 1 121 ? 4.010   3.094   43.290  1.00 24.51 ? 121 LEU B O   1 
ATOM   4254  C CB  . LEU B 1 121 ? 2.982   4.806   45.952  1.00 24.74 ? 121 LEU B CB  1 
ATOM   4255  C CG  . LEU B 1 121 ? 1.782   5.116   46.816  1.00 26.99 ? 121 LEU B CG  1 
ATOM   4256  C CD1 . LEU B 1 121 ? 1.916   6.551   47.348  1.00 34.04 ? 121 LEU B CD1 1 
ATOM   4257  C CD2 . LEU B 1 121 ? 0.492   4.932   46.019  1.00 31.52 ? 121 LEU B CD2 1 
ATOM   4258  N N   . CYS B 1 122 ? 5.533   3.450   44.902  1.00 24.09 ? 122 CYS B N   1 
ATOM   4259  C CA  . CYS B 1 122 ? 6.609   3.465   43.932  1.00 24.22 ? 122 CYS B CA  1 
ATOM   4260  C C   . CYS B 1 122 ? 6.706   2.146   43.172  1.00 24.31 ? 122 CYS B C   1 
ATOM   4261  O O   . CYS B 1 122 ? 6.988   2.153   41.958  1.00 24.00 ? 122 CYS B O   1 
ATOM   4262  C CB  . CYS B 1 122 ? 7.931   3.828   44.601  1.00 25.83 ? 122 CYS B CB  1 
ATOM   4263  S SG  . CYS B 1 122 ? 9.363   3.905   43.494  1.00 29.59 ? 122 CYS B SG  1 
ATOM   4264  N N   . LYS B 1 123 ? 6.439   1.027   43.850  1.00 24.64 ? 123 LYS B N   1 
ATOM   4265  C CA  . LYS B 1 123 ? 6.534   -0.307  43.207  1.00 24.59 ? 123 LYS B CA  1 
ATOM   4266  C C   . LYS B 1 123 ? 5.326   -0.604  42.312  1.00 24.87 ? 123 LYS B C   1 
ATOM   4267  O O   . LYS B 1 123 ? 5.430   -1.312  41.297  1.00 24.09 ? 123 LYS B O   1 
ATOM   4268  C CB  . LYS B 1 123 ? 6.745   -1.369  44.251  1.00 24.86 ? 123 LYS B CB  1 
ATOM   4269  C CG  . LYS B 1 123 ? 8.161   -1.216  44.861  1.00 28.06 ? 123 LYS B CG  1 
ATOM   4270  C CD  . LYS B 1 123 ? 8.662   -2.457  45.500  1.00 34.80 ? 123 LYS B CD  1 
ATOM   4271  C CE  . LYS B 1 123 ? 9.993   -2.191  46.224  1.00 36.58 ? 123 LYS B CE  1 
ATOM   4272  N NZ  . LYS B 1 123 ? 11.060  -1.733  45.272  1.00 37.66 ? 123 LYS B NZ  1 
ATOM   4273  N N   . VAL B 1 124 ? 4.177   -0.067  42.710  1.00 23.72 ? 124 VAL B N   1 
ATOM   4274  C CA  . VAL B 1 124 ? 3.011   -0.083  41.851  1.00 23.41 ? 124 VAL B CA  1 
ATOM   4275  C C   . VAL B 1 124 ? 3.261   0.668   40.522  1.00 23.40 ? 124 VAL B C   1 
ATOM   4276  O O   . VAL B 1 124 ? 3.101   0.084   39.452  1.00 22.30 ? 124 VAL B O   1 
ATOM   4277  C CB  . VAL B 1 124 ? 1.773   0.408   42.582  1.00 23.03 ? 124 VAL B CB  1 
ATOM   4278  C CG1 . VAL B 1 124 ? 0.611   0.602   41.579  1.00 22.68 ? 124 VAL B CG1 1 
ATOM   4279  C CG2 . VAL B 1 124 ? 1.426   -0.591  43.708  1.00 21.20 ? 124 VAL B CG2 1 
ATOM   4280  N N   . PHE B 1 125 ? 3.675   1.940   40.607  1.00 25.11 ? 125 PHE B N   1 
ATOM   4281  C CA  . PHE B 1 125 ? 4.118   2.708   39.446  1.00 24.53 ? 125 PHE B CA  1 
ATOM   4282  C C   . PHE B 1 125 ? 5.120   1.895   38.578  1.00 26.00 ? 125 PHE B C   1 
ATOM   4283  O O   . PHE B 1 125 ? 4.948   1.831   37.342  1.00 24.64 ? 125 PHE B O   1 
ATOM   4284  C CB  . PHE B 1 125 ? 4.701   4.095   39.826  1.00 24.86 ? 125 PHE B CB  1 
ATOM   4285  C CG  . PHE B 1 125 ? 3.724   5.027   40.581  1.00 23.34 ? 125 PHE B CG  1 
ATOM   4286  C CD1 . PHE B 1 125 ? 4.214   6.074   41.375  1.00 27.97 ? 125 PHE B CD1 1 
ATOM   4287  C CD2 . PHE B 1 125 ? 2.337   4.875   40.480  1.00 26.69 ? 125 PHE B CD2 1 
ATOM   4288  C CE1 . PHE B 1 125 ? 3.333   6.945   42.111  1.00 26.53 ? 125 PHE B CE1 1 
ATOM   4289  C CE2 . PHE B 1 125 ? 1.454   5.736   41.211  1.00 25.08 ? 125 PHE B CE2 1 
ATOM   4290  C CZ  . PHE B 1 125 ? 1.958   6.767   42.010  1.00 25.44 ? 125 PHE B CZ  1 
ATOM   4291  N N   . GLU B 1 126 ? 6.176   1.346   39.207  1.00 25.55 ? 126 GLU B N   1 
ATOM   4292  C CA  . GLU B 1 126 ? 7.187   0.538   38.499  1.00 26.60 ? 126 GLU B CA  1 
ATOM   4293  C C   . GLU B 1 126 ? 6.615   -0.724  37.841  1.00 26.95 ? 126 GLU B C   1 
ATOM   4294  O O   . GLU B 1 126 ? 6.982   -1.052  36.701  1.00 27.17 ? 126 GLU B O   1 
ATOM   4295  C CB  . GLU B 1 126 ? 8.371   0.209   39.406  1.00 26.12 ? 126 GLU B CB  1 
ATOM   4296  C CG  . GLU B 1 126 ? 9.247   1.445   39.671  1.00 27.62 ? 126 GLU B CG  1 
ATOM   4297  C CD  . GLU B 1 126 ? 10.105  1.319   40.916  1.00 27.60 ? 126 GLU B CD  1 
ATOM   4298  O OE1 . GLU B 1 126 ? 11.016  2.163   41.113  1.00 29.37 ? 126 GLU B OE1 1 
ATOM   4299  O OE2 . GLU B 1 126 ? 9.861   0.390   41.706  1.00 30.85 ? 126 GLU B OE2 1 
ATOM   4300  N N   . MET B 1 127 ? 5.714   -1.396  38.553  1.00 26.35 ? 127 MET B N   1 
ATOM   4301  C CA  . MET B 1 127 ? 4.997   -2.580  38.065  1.00 27.52 ? 127 MET B CA  1 
ATOM   4302  C C   . MET B 1 127 ? 4.181   -2.349  36.805  1.00 28.47 ? 127 MET B C   1 
ATOM   4303  O O   . MET B 1 127 ? 4.118   -3.238  35.966  1.00 28.18 ? 127 MET B O   1 
ATOM   4304  C CB  . MET B 1 127 ? 4.098   -3.158  39.173  1.00 26.90 ? 127 MET B CB  1 
ATOM   4305  C CG  . MET B 1 127 ? 3.176   -4.306  38.777  1.00 27.13 ? 127 MET B CG  1 
ATOM   4306  S SD  . MET B 1 127 ? 1.896   -4.647  40.002  1.00 25.07 ? 127 MET B SD  1 
ATOM   4307  C CE  . MET B 1 127 ? 0.934   -3.123  39.918  1.00 24.95 ? 127 MET B CE  1 
ATOM   4308  N N   . ILE B 1 128 ? 3.595   -1.156  36.653  1.00 29.48 ? 128 ILE B N   1 
ATOM   4309  C CA  . ILE B 1 128 ? 2.615   -0.882  35.592  1.00 28.80 ? 128 ILE B CA  1 
ATOM   4310  C C   . ILE B 1 128 ? 3.211   -0.173  34.384  1.00 29.36 ? 128 ILE B C   1 
ATOM   4311  O O   . ILE B 1 128 ? 2.900   -0.528  33.256  1.00 29.18 ? 128 ILE B O   1 
ATOM   4312  C CB  . ILE B 1 128 ? 1.474   0.035   36.094  1.00 29.16 ? 128 ILE B CB  1 
ATOM   4313  C CG1 . ILE B 1 128 ? 0.719   -0.626  37.241  1.00 27.27 ? 128 ILE B CG1 1 
ATOM   4314  C CG2 . ILE B 1 128 ? 0.535   0.389   34.956  1.00 28.61 ? 128 ILE B CG2 1 
ATOM   4315  C CD1 . ILE B 1 128 ? -0.063  0.384   38.081  1.00 24.90 ? 128 ILE B CD1 1 
ATOM   4316  N N   . ILE B 1 129 ? 4.043   0.833   34.633  1.00 29.87 ? 129 ILE B N   1 
ATOM   4317  C CA  . ILE B 1 129 ? 4.353   1.847   33.630  1.00 29.68 ? 129 ILE B CA  1 
ATOM   4318  C C   . ILE B 1 129 ? 5.462   1.488   32.635  1.00 30.08 ? 129 ILE B C   1 
ATOM   4319  O O   . ILE B 1 129 ? 6.582   1.238   33.030  1.00 30.74 ? 129 ILE B O   1 
ATOM   4320  C CB  . ILE B 1 129 ? 4.686   3.196   34.303  1.00 28.65 ? 129 ILE B CB  1 
ATOM   4321  C CG1 . ILE B 1 129 ? 3.490   3.688   35.117  1.00 27.74 ? 129 ILE B CG1 1 
ATOM   4322  C CG2 . ILE B 1 129 ? 5.134   4.250   33.258  1.00 27.69 ? 129 ILE B CG2 1 
ATOM   4323  C CD1 . ILE B 1 129 ? 3.832   4.921   35.911  1.00 23.31 ? 129 ILE B CD1 1 
ATOM   4324  N N   . ASN B 1 130 ? 5.111   1.488   31.347  1.00 30.82 ? 130 ASN B N   1 
ATOM   4325  C CA  . ASN B 1 130 ? 6.048   1.531   30.223  1.00 31.26 ? 130 ASN B CA  1 
ATOM   4326  C C   . ASN B 1 130 ? 6.132   2.951   29.689  1.00 31.77 ? 130 ASN B C   1 
ATOM   4327  O O   . ASN B 1 130 ? 5.100   3.641   29.640  1.00 32.69 ? 130 ASN B O   1 
ATOM   4328  C CB  . ASN B 1 130 ? 5.561   0.628   29.082  1.00 30.72 ? 130 ASN B CB  1 
ATOM   4329  C CG  . ASN B 1 130 ? 5.639   -0.832  29.436  1.00 31.53 ? 130 ASN B CG  1 
ATOM   4330  O OD1 . ASN B 1 130 ? 6.654   -1.292  29.962  1.00 31.46 ? 130 ASN B OD1 1 
ATOM   4331  N ND2 . ASN B 1 130 ? 4.560   -1.562  29.202  1.00 27.25 ? 130 ASN B ND2 1 
ATOM   4332  N N   . PRO B 1 131 ? 7.337   3.382   29.255  1.00 31.95 ? 131 PRO B N   1 
ATOM   4333  C CA  . PRO B 1 131 ? 7.525   4.739   28.721  1.00 32.81 ? 131 PRO B CA  1 
ATOM   4334  C C   . PRO B 1 131 ? 6.523   5.037   27.592  1.00 33.43 ? 131 PRO B C   1 
ATOM   4335  O O   . PRO B 1 131 ? 6.305   4.193   26.735  1.00 33.87 ? 131 PRO B O   1 
ATOM   4336  C CB  . PRO B 1 131 ? 8.960   4.729   28.214  1.00 32.47 ? 131 PRO B CB  1 
ATOM   4337  C CG  . PRO B 1 131 ? 9.622   3.549   28.873  1.00 32.48 ? 131 PRO B CG  1 
ATOM   4338  C CD  . PRO B 1 131 ? 8.580   2.581   29.244  1.00 31.70 ? 131 PRO B CD  1 
ATOM   4339  N N   . GLY B 1 132 ? 5.851   6.182   27.652  1.00 34.26 ? 132 GLY B N   1 
ATOM   4340  C CA  . GLY B 1 132 ? 4.766   6.464   26.704  1.00 34.21 ? 132 GLY B CA  1 
ATOM   4341  C C   . GLY B 1 132 ? 3.361   6.118   27.173  1.00 34.42 ? 132 GLY B C   1 
ATOM   4342  O O   . GLY B 1 132 ? 2.394   6.587   26.560  1.00 35.80 ? 132 GLY B O   1 
ATOM   4343  N N   . ASP B 1 133 ? 3.222   5.296   28.227  1.00 33.10 ? 133 ASP B N   1 
ATOM   4344  C CA  . ASP B 1 133 ? 1.895   4.954   28.766  1.00 32.45 ? 133 ASP B CA  1 
ATOM   4345  C C   . ASP B 1 133 ? 1.124   6.241   29.190  1.00 31.75 ? 133 ASP B C   1 
ATOM   4346  O O   . ASP B 1 133 ? 1.720   7.197   29.640  1.00 32.13 ? 133 ASP B O   1 
ATOM   4347  C CB  . ASP B 1 133 ? 1.994   3.990   29.971  1.00 31.88 ? 133 ASP B CB  1 
ATOM   4348  C CG  . ASP B 1 133 ? 2.112   2.485   29.564  1.00 33.77 ? 133 ASP B CG  1 
ATOM   4349  O OD1 . ASP B 1 133 ? 1.859   2.119   28.390  1.00 32.67 ? 133 ASP B OD1 1 
ATOM   4350  O OD2 . ASP B 1 133 ? 2.459   1.658   30.438  1.00 32.28 ? 133 ASP B OD2 1 
ATOM   4351  N N   . ASN B 1 134 ? -0.192  6.248   29.033  1.00 31.59 ? 134 ASN B N   1 
ATOM   4352  C CA  . ASN B 1 134 ? -1.007  7.346   29.559  1.00 31.42 ? 134 ASN B CA  1 
ATOM   4353  C C   . ASN B 1 134 ? -1.480  7.059   30.958  1.00 30.52 ? 134 ASN B C   1 
ATOM   4354  O O   . ASN B 1 134 ? -1.895  5.926   31.274  1.00 31.45 ? 134 ASN B O   1 
ATOM   4355  C CB  . ASN B 1 134 ? -2.222  7.632   28.682  1.00 31.43 ? 134 ASN B CB  1 
ATOM   4356  C CG  . ASN B 1 134 ? -1.855  8.321   27.391  1.00 31.98 ? 134 ASN B CG  1 
ATOM   4357  O OD1 . ASN B 1 134 ? -0.942  9.141   27.336  1.00 28.80 ? 134 ASN B OD1 1 
ATOM   4358  N ND2 . ASN B 1 134 ? -2.588  7.990   26.331  1.00 34.24 ? 134 ASN B ND2 1 
ATOM   4359  N N   . VAL B 1 135 ? -1.391  8.078   31.804  1.00 29.44 ? 135 VAL B N   1 
ATOM   4360  C CA  . VAL B 1 135 ? -1.845  7.970   33.171  1.00 29.01 ? 135 VAL B CA  1 
ATOM   4361  C C   . VAL B 1 135 ? -2.551  9.267   33.547  1.00 29.86 ? 135 VAL B C   1 
ATOM   4362  O O   . VAL B 1 135 ? -2.252  10.338  33.024  1.00 31.35 ? 135 VAL B O   1 
ATOM   4363  C CB  . VAL B 1 135 ? -0.699  7.679   34.189  1.00 29.74 ? 135 VAL B CB  1 
ATOM   4364  C CG1 . VAL B 1 135 ? 0.098   6.348   33.839  1.00 27.30 ? 135 VAL B CG1 1 
ATOM   4365  C CG2 . VAL B 1 135 ? 0.211   8.852   34.324  1.00 29.36 ? 135 VAL B CG2 1 
ATOM   4366  N N   . LEU B 1 136 ? -3.468  9.155   34.491  1.00 29.34 ? 136 LEU B N   1 
ATOM   4367  C CA  . LEU B 1 136 ? -4.400  10.212  34.798  1.00 29.17 ? 136 LEU B CA  1 
ATOM   4368  C C   . LEU B 1 136 ? -4.190  10.599  36.262  1.00 28.83 ? 136 LEU B C   1 
ATOM   4369  O O   . LEU B 1 136 ? -4.118  9.739   37.112  1.00 26.23 ? 136 LEU B O   1 
ATOM   4370  C CB  . LEU B 1 136 ? -5.828  9.679   34.603  1.00 28.30 ? 136 LEU B CB  1 
ATOM   4371  C CG  . LEU B 1 136 ? -6.249  9.263   33.177  1.00 28.82 ? 136 LEU B CG  1 
ATOM   4372  C CD1 . LEU B 1 136 ? -7.494  8.416   33.253  1.00 30.61 ? 136 LEU B CD1 1 
ATOM   4373  C CD2 . LEU B 1 136 ? -6.475  10.485  32.320  1.00 27.54 ? 136 LEU B CD2 1 
ATOM   4374  N N   . LEU B 1 137 ? -4.129  11.901  36.533  1.00 29.18 ? 137 LEU B N   1 
ATOM   4375  C CA  . LEU B 1 137 ? -4.240  12.404  37.897  1.00 29.25 ? 137 LEU B CA  1 
ATOM   4376  C C   . LEU B 1 137 ? -4.704  13.873  37.936  1.00 29.89 ? 137 LEU B C   1 
ATOM   4377  O O   . LEU B 1 137 ? -4.775  14.537  36.909  1.00 28.89 ? 137 LEU B O   1 
ATOM   4378  C CB  . LEU B 1 137 ? -2.911  12.256  38.650  1.00 29.29 ? 137 LEU B CB  1 
ATOM   4379  C CG  . LEU B 1 137 ? -1.597  12.827  38.085  1.00 30.20 ? 137 LEU B CG  1 
ATOM   4380  C CD1 . LEU B 1 137 ? -1.429  14.347  38.261  1.00 31.54 ? 137 LEU B CD1 1 
ATOM   4381  C CD2 . LEU B 1 137 ? -0.424  12.126  38.709  1.00 28.73 ? 137 LEU B CD2 1 
ATOM   4382  N N   . ASP B 1 138 ? -4.979  14.373  39.148  1.00 30.32 ? 138 ASP B N   1 
ATOM   4383  C CA  . ASP B 1 138 ? -5.314  15.772  39.316  1.00 30.50 ? 138 ASP B CA  1 
ATOM   4384  C C   . ASP B 1 138 ? -4.133  16.572  39.789  1.00 31.10 ? 138 ASP B C   1 
ATOM   4385  O O   . ASP B 1 138 ? -3.418  16.155  40.710  1.00 32.41 ? 138 ASP B O   1 
ATOM   4386  C CB  . ASP B 1 138 ? -6.556  15.948  40.219  1.00 30.46 ? 138 ASP B CB  1 
ATOM   4387  C CG  . ASP B 1 138 ? -6.472  15.157  41.522  1.00 30.82 ? 138 ASP B CG  1 
ATOM   4388  O OD1 . ASP B 1 138 ? -6.450  13.892  41.520  1.00 28.49 ? 138 ASP B OD1 1 
ATOM   4389  O OD2 . ASP B 1 138 ? -6.443  15.820  42.568  1.00 29.57 ? 138 ASP B OD2 1 
ATOM   4390  N N   . GLU B 1 139 ? -3.893  17.706  39.126  1.00 30.81 ? 139 GLU B N   1 
ATOM   4391  C CA  . GLU B 1 139 ? -2.902  18.692  39.582  1.00 31.02 ? 139 GLU B CA  1 
ATOM   4392  C C   . GLU B 1 139 ? -3.694  19.801  40.292  1.00 30.92 ? 139 GLU B C   1 
ATOM   4393  O O   . GLU B 1 139 ? -4.843  20.050  39.903  1.00 30.36 ? 139 GLU B O   1 
ATOM   4394  C CB  . GLU B 1 139 ? -2.120  19.281  38.409  1.00 31.36 ? 139 GLU B CB  1 
ATOM   4395  C CG  . GLU B 1 139 ? -0.917  18.445  37.953  1.00 32.32 ? 139 GLU B CG  1 
ATOM   4396  C CD  . GLU B 1 139 ? -0.354  18.940  36.638  1.00 33.88 ? 139 GLU B CD  1 
ATOM   4397  O OE1 . GLU B 1 139 ? 0.669   19.641  36.624  1.00 35.94 ? 139 GLU B OE1 1 
ATOM   4398  O OE2 . GLU B 1 139 ? -0.949  18.632  35.598  1.00 40.42 ? 139 GLU B OE2 1 
ATOM   4399  N N   . PRO B 1 140 ? -3.123  20.412  41.359  1.00 30.20 ? 140 PRO B N   1 
ATOM   4400  C CA  . PRO B 1 140 ? -1.825  20.067  41.933  1.00 29.85 ? 140 PRO B CA  1 
ATOM   4401  C C   . PRO B 1 140 ? -1.811  18.722  42.679  1.00 29.50 ? 140 PRO B C   1 
ATOM   4402  O O   . PRO B 1 140 ? -2.849  18.261  43.197  1.00 29.08 ? 140 PRO B O   1 
ATOM   4403  C CB  . PRO B 1 140 ? -1.531  21.233  42.891  1.00 29.81 ? 140 PRO B CB  1 
ATOM   4404  C CG  . PRO B 1 140 ? -2.836  21.717  43.294  1.00 29.64 ? 140 PRO B CG  1 
ATOM   4405  C CD  . PRO B 1 140 ? -3.746  21.551  42.085  1.00 30.75 ? 140 PRO B CD  1 
ATOM   4406  N N   . ALA B 1 141 ? -0.632  18.107  42.703  1.00 29.42 ? 141 ALA B N   1 
ATOM   4407  C CA  . ALA B 1 141 ? -0.461  16.794  43.256  1.00 29.74 ? 141 ALA B CA  1 
ATOM   4408  C C   . ALA B 1 141 ? 0.822   16.715  44.089  1.00 30.58 ? 141 ALA B C   1 
ATOM   4409  O O   . ALA B 1 141 ? 1.723   17.541  43.971  1.00 30.79 ? 141 ALA B O   1 
ATOM   4410  C CB  . ALA B 1 141 ? -0.420  15.762  42.120  1.00 30.48 ? 141 ALA B CB  1 
ATOM   4411  N N   . TYR B 1 142 ? 0.885   15.708  44.947  1.00 30.27 ? 142 TYR B N   1 
ATOM   4412  C CA  . TYR B 1 142 ? 2.027   15.498  45.804  1.00 30.75 ? 142 TYR B CA  1 
ATOM   4413  C C   . TYR B 1 142 ? 3.317   15.429  44.981  1.00 31.15 ? 142 TYR B C   1 
ATOM   4414  O O   . TYR B 1 142 ? 3.404   14.719  43.974  1.00 31.37 ? 142 TYR B O   1 
ATOM   4415  C CB  . TYR B 1 142 ? 1.787   14.250  46.678  1.00 31.60 ? 142 TYR B CB  1 
ATOM   4416  C CG  . TYR B 1 142 ? 2.986   13.717  47.414  1.00 32.84 ? 142 TYR B CG  1 
ATOM   4417  C CD1 . TYR B 1 142 ? 3.778   14.560  48.157  1.00 34.20 ? 142 TYR B CD1 1 
ATOM   4418  C CD2 . TYR B 1 142 ? 3.318   12.350  47.375  1.00 33.87 ? 142 TYR B CD2 1 
ATOM   4419  C CE1 . TYR B 1 142 ? 4.877   14.091  48.844  1.00 33.89 ? 142 TYR B CE1 1 
ATOM   4420  C CE2 . TYR B 1 142 ? 4.420   11.877  48.066  1.00 35.23 ? 142 TYR B CE2 1 
ATOM   4421  C CZ  . TYR B 1 142 ? 5.189   12.776  48.804  1.00 34.22 ? 142 TYR B CZ  1 
ATOM   4422  O OH  . TYR B 1 142 ? 6.307   12.405  49.538  1.00 39.55 ? 142 TYR B OH  1 
ATOM   4423  N N   . SER B 1 143 ? 4.295   16.214  45.409  1.00 30.87 ? 143 SER B N   1 
ATOM   4424  C CA  . SER B 1 143 ? 5.561   16.328  44.732  1.00 31.87 ? 143 SER B CA  1 
ATOM   4425  C C   . SER B 1 143 ? 6.275   14.991  44.613  1.00 31.73 ? 143 SER B C   1 
ATOM   4426  O O   . SER B 1 143 ? 6.921   14.718  43.594  1.00 31.23 ? 143 SER B O   1 
ATOM   4427  C CB  . SER B 1 143 ? 6.446   17.312  45.476  1.00 31.74 ? 143 SER B CB  1 
ATOM   4428  O OG  . SER B 1 143 ? 6.285   17.132  46.877  1.00 36.10 ? 143 SER B OG  1 
ATOM   4429  N N   . GLY B 1 144 ? 6.178   14.162  45.644  1.00 31.07 ? 144 GLY B N   1 
ATOM   4430  C CA  . GLY B 1 144 ? 6.883   12.876  45.597  1.00 30.68 ? 144 GLY B CA  1 
ATOM   4431  C C   . GLY B 1 144 ? 6.327   11.962  44.516  1.00 30.53 ? 144 GLY B C   1 
ATOM   4432  O O   . GLY B 1 144 ? 7.075   11.230  43.843  1.00 30.81 ? 144 GLY B O   1 
ATOM   4433  N N   . THR B 1 145 ? 5.014   11.988  44.331  1.00 30.82 ? 145 THR B N   1 
ATOM   4434  C CA  . THR B 1 145 ? 4.433   11.213  43.259  1.00 30.49 ? 145 THR B CA  1 
ATOM   4435  C C   . THR B 1 145 ? 4.864   11.753  41.876  1.00 30.71 ? 145 THR B C   1 
ATOM   4436  O O   . THR B 1 145 ? 5.203   10.954  40.976  1.00 30.03 ? 145 THR B O   1 
ATOM   4437  C CB  . THR B 1 145 ? 2.914   10.877  43.483  1.00 31.08 ? 145 THR B CB  1 
ATOM   4438  O OG1 . THR B 1 145 ? 2.189   10.805  42.235  1.00 31.55 ? 145 THR B OG1 1 
ATOM   4439  C CG2 . THR B 1 145 ? 2.276   11.872  44.363  1.00 35.63 ? 145 THR B CG2 1 
ATOM   4440  N N   . LEU B 1 146 ? 4.950   13.087  41.739  1.00 29.79 ? 146 LEU B N   1 
ATOM   4441  C CA  . LEU B 1 146 ? 5.375   13.688  40.462  1.00 29.54 ? 146 LEU B CA  1 
ATOM   4442  C C   . LEU B 1 146 ? 6.834   13.330  40.175  1.00 28.87 ? 146 LEU B C   1 
ATOM   4443  O O   . LEU B 1 146 ? 7.211   13.037  39.026  1.00 27.74 ? 146 LEU B O   1 
ATOM   4444  C CB  . LEU B 1 146 ? 5.161   15.228  40.438  1.00 29.51 ? 146 LEU B CB  1 
ATOM   4445  C CG  . LEU B 1 146 ? 3.700   15.710  40.486  1.00 28.82 ? 146 LEU B CG  1 
ATOM   4446  C CD1 . LEU B 1 146 ? 3.624   17.237  40.399  1.00 30.75 ? 146 LEU B CD1 1 
ATOM   4447  C CD2 . LEU B 1 146 ? 2.835   15.112  39.380  1.00 28.69 ? 146 LEU B CD2 1 
ATOM   4448  N N   . GLN B 1 147 ? 7.647   13.349  41.221  1.00 27.88 ? 147 GLN B N   1 
ATOM   4449  C CA  . GLN B 1 147 ? 9.064   13.009  41.088  1.00 29.36 ? 147 GLN B CA  1 
ATOM   4450  C C   . GLN B 1 147 ? 9.323   11.505  40.872  1.00 28.77 ? 147 GLN B C   1 
ATOM   4451  O O   . GLN B 1 147 ? 10.314  11.131  40.232  1.00 29.30 ? 147 GLN B O   1 
ATOM   4452  C CB  . GLN B 1 147 ? 9.889   13.601  42.227  1.00 29.18 ? 147 GLN B CB  1 
ATOM   4453  C CG  . GLN B 1 147 ? 9.961   15.138  42.185  1.00 33.54 ? 147 GLN B CG  1 
ATOM   4454  C CD  . GLN B 1 147 ? 10.896  15.749  41.087  1.00 40.22 ? 147 GLN B CD  1 
ATOM   4455  O OE1 . GLN B 1 147 ? 10.937  15.315  39.904  1.00 41.43 ? 147 GLN B OE1 1 
ATOM   4456  N NE2 . GLN B 1 147 ? 11.633  16.801  41.488  1.00 42.88 ? 147 GLN B NE2 1 
ATOM   4457  N N   . SER B 1 148 ? 8.392   10.671  41.336  1.00 28.79 ? 148 SER B N   1 
ATOM   4458  C CA  . SER B 1 148 ? 8.394   9.235   41.067  1.00 28.11 ? 148 SER B CA  1 
ATOM   4459  C C   . SER B 1 148 ? 7.985   8.916   39.611  1.00 28.56 ? 148 SER B C   1 
ATOM   4460  O O   . SER B 1 148 ? 8.622   8.105   38.957  1.00 29.07 ? 148 SER B O   1 
ATOM   4461  C CB  . SER B 1 148 ? 7.480   8.529   42.056  1.00 27.76 ? 148 SER B CB  1 
ATOM   4462  O OG  . SER B 1 148 ? 7.836   7.164   42.114  1.00 30.80 ? 148 SER B OG  1 
ATOM   4463  N N   . LEU B 1 149 ? 6.943   9.571   39.097  1.00 28.42 ? 149 LEU B N   1 
ATOM   4464  C CA  . LEU B 1 149 ? 6.396   9.270   37.767  1.00 29.04 ? 149 LEU B CA  1 
ATOM   4465  C C   . LEU B 1 149 ? 7.190   9.794   36.593  1.00 29.82 ? 149 LEU B C   1 
ATOM   4466  O O   . LEU B 1 149 ? 7.119   9.212   35.491  1.00 31.47 ? 149 LEU B O   1 
ATOM   4467  C CB  . LEU B 1 149 ? 4.945   9.753   37.625  1.00 28.13 ? 149 LEU B CB  1 
ATOM   4468  C CG  . LEU B 1 149 ? 3.896   9.081   38.501  1.00 26.84 ? 149 LEU B CG  1 
ATOM   4469  C CD1 . LEU B 1 149 ? 2.596   9.844   38.341  1.00 28.53 ? 149 LEU B CD1 1 
ATOM   4470  C CD2 . LEU B 1 149 ? 3.708   7.620   38.098  1.00 27.76 ? 149 LEU B CD2 1 
ATOM   4471  N N   . HIS B 1 150 ? 7.924   10.884  36.807  1.00 31.25 ? 150 HIS B N   1 
ATOM   4472  C CA  . HIS B 1 150 ? 8.655   11.582  35.733  1.00 31.79 ? 150 HIS B CA  1 
ATOM   4473  C C   . HIS B 1 150 ? 9.674   10.663  35.049  1.00 31.63 ? 150 HIS B C   1 
ATOM   4474  O O   . HIS B 1 150 ? 9.658   10.550  33.804  1.00 30.44 ? 150 HIS B O   1 
ATOM   4475  C CB  . HIS B 1 150 ? 9.316   12.862  36.274  1.00 32.31 ? 150 HIS B CB  1 
ATOM   4476  C CG  . HIS B 1 150 ? 10.383  13.446  35.380  1.00 34.67 ? 150 HIS B CG  1 
ATOM   4477  N ND1 . HIS B 1 150 ? 11.713  13.523  35.756  1.00 34.51 ? 150 HIS B ND1 1 
ATOM   4478  C CD2 . HIS B 1 150 ? 10.311  14.014  34.150  1.00 36.69 ? 150 HIS B CD2 1 
ATOM   4479  C CE1 . HIS B 1 150 ? 12.413  14.094  34.793  1.00 34.91 ? 150 HIS B CE1 1 
ATOM   4480  N NE2 . HIS B 1 150 ? 11.591  14.391  33.801  1.00 37.30 ? 150 HIS B NE2 1 
ATOM   4481  N N   . PRO B 1 151 ? 10.534  9.966   35.849  1.00 31.19 ? 151 PRO B N   1 
ATOM   4482  C CA  . PRO B 1 151 ? 11.593  9.152   35.242  1.00 31.45 ? 151 PRO B CA  1 
ATOM   4483  C C   . PRO B 1 151 ? 11.067  7.920   34.534  1.00 31.14 ? 151 PRO B C   1 
ATOM   4484  O O   . PRO B 1 151 ? 11.786  7.320   33.768  1.00 32.46 ? 151 PRO B O   1 
ATOM   4485  C CB  . PRO B 1 151 ? 12.470  8.733   36.444  1.00 31.26 ? 151 PRO B CB  1 
ATOM   4486  C CG  . PRO B 1 151 ? 12.021  9.552   37.582  1.00 31.93 ? 151 PRO B CG  1 
ATOM   4487  C CD  . PRO B 1 151 ? 10.575  9.845   37.316  1.00 31.33 ? 151 PRO B CD  1 
ATOM   4488  N N   . LEU B 1 152 ? 9.823   7.547   34.798  1.00 30.90 ? 152 LEU B N   1 
ATOM   4489  C CA  . LEU B 1 152 ? 9.189   6.413   34.152  1.00 30.22 ? 152 LEU B CA  1 
ATOM   4490  C C   . LEU B 1 152 ? 8.677   6.751   32.741  1.00 30.68 ? 152 LEU B C   1 
ATOM   4491  O O   . LEU B 1 152 ? 8.224   5.878   31.976  1.00 29.48 ? 152 LEU B O   1 
ATOM   4492  C CB  . LEU B 1 152 ? 8.078   5.857   35.061  1.00 30.14 ? 152 LEU B CB  1 
ATOM   4493  C CG  . LEU B 1 152 ? 8.479   5.089   36.345  1.00 28.90 ? 152 LEU B CG  1 
ATOM   4494  C CD1 . LEU B 1 152 ? 9.402   3.875   36.110  1.00 25.32 ? 152 LEU B CD1 1 
ATOM   4495  C CD2 . LEU B 1 152 ? 9.183   6.003   37.243  1.00 32.74 ? 152 LEU B CD2 1 
ATOM   4496  N N   . GLY B 1 153 ? 8.774   8.036   32.407  1.00 31.16 ? 153 GLY B N   1 
ATOM   4497  C CA  . GLY B 1 153 ? 8.453   8.534   31.070  1.00 31.47 ? 153 GLY B CA  1 
ATOM   4498  C C   . GLY B 1 153 ? 7.012   8.325   30.648  1.00 32.31 ? 153 GLY B C   1 
ATOM   4499  O O   . GLY B 1 153 ? 6.734   8.146   29.459  1.00 32.96 ? 153 GLY B O   1 
ATOM   4500  N N   . CYS B 1 154 ? 6.080   8.326   31.604  1.00 31.51 ? 154 CYS B N   1 
ATOM   4501  C CA  . CYS B 1 154 ? 4.676   8.259   31.213  1.00 31.28 ? 154 CYS B CA  1 
ATOM   4502  C C   . CYS B 1 154 ? 4.201   9.657   30.795  1.00 30.75 ? 154 CYS B C   1 
ATOM   4503  O O   . CYS B 1 154 ? 4.879   10.641  31.095  1.00 29.69 ? 154 CYS B O   1 
ATOM   4504  C CB  . CYS B 1 154 ? 3.786   7.651   32.310  1.00 30.67 ? 154 CYS B CB  1 
ATOM   4505  S SG  . CYS B 1 154 ? 3.980   8.427   33.909  1.00 33.22 ? 154 CYS B SG  1 
ATOM   4506  N N   . ASN B 1 155 ? 3.058   9.716   30.087  1.00 30.23 ? 155 ASN B N   1 
ATOM   4507  C CA  . ASN B 1 155 ? 2.370   10.968  29.818  1.00 30.70 ? 155 ASN B CA  1 
ATOM   4508  C C   . ASN B 1 155 ? 1.311   11.176  30.879  1.00 29.60 ? 155 ASN B C   1 
ATOM   4509  O O   . ASN B 1 155 ? 0.364   10.423  30.965  1.00 29.98 ? 155 ASN B O   1 
ATOM   4510  C CB  . ASN B 1 155 ? 1.682   10.962  28.443  1.00 32.08 ? 155 ASN B CB  1 
ATOM   4511  C CG  . ASN B 1 155 ? 1.137   12.351  28.049  1.00 35.47 ? 155 ASN B CG  1 
ATOM   4512  O OD1 . ASN B 1 155 ? 0.018   12.461  27.529  1.00 37.10 ? 155 ASN B OD1 1 
ATOM   4513  N ND2 . ASN B 1 155 ? 1.939   13.421  28.292  1.00 36.96 ? 155 ASN B ND2 1 
ATOM   4514  N N   . ILE B 1 156 ? 1.498   12.179  31.716  1.00 29.99 ? 156 ILE B N   1 
ATOM   4515  C CA  . ILE B 1 156 ? 0.475   12.560  32.682  1.00 29.72 ? 156 ILE B CA  1 
ATOM   4516  C C   . ILE B 1 156 ? -0.569  13.456  31.998  1.00 30.08 ? 156 ILE B C   1 
ATOM   4517  O O   . ILE B 1 156 ? -0.240  14.505  31.472  1.00 31.29 ? 156 ILE B O   1 
ATOM   4518  C CB  . ILE B 1 156 ? 1.106   13.226  33.939  1.00 30.05 ? 156 ILE B CB  1 
ATOM   4519  C CG1 . ILE B 1 156 ? 2.108   12.256  34.594  1.00 27.73 ? 156 ILE B CG1 1 
ATOM   4520  C CG2 . ILE B 1 156 ? 0.009   13.584  34.952  1.00 28.02 ? 156 ILE B CG2 1 
ATOM   4521  C CD1 . ILE B 1 156 ? 3.033   12.872  35.637  1.00 30.71 ? 156 ILE B CD1 1 
ATOM   4522  N N   . ILE B 1 157 ? -1.811  13.000  31.970  1.00 30.32 ? 157 ILE B N   1 
ATOM   4523  C CA  . ILE B 1 157 ? -2.943  13.799  31.519  1.00 28.99 ? 157 ILE B CA  1 
ATOM   4524  C C   . ILE B 1 157 ? -3.608  14.352  32.771  1.00 29.34 ? 157 ILE B C   1 
ATOM   4525  O O   . ILE B 1 157 ? -4.086  13.574  33.591  1.00 29.37 ? 157 ILE B O   1 
ATOM   4526  C CB  . ILE B 1 157 ? -3.946  12.911  30.747  1.00 29.34 ? 157 ILE B CB  1 
ATOM   4527  C CG1 . ILE B 1 157 ? -3.284  12.241  29.515  1.00 28.62 ? 157 ILE B CG1 1 
ATOM   4528  C CG2 . ILE B 1 157 ? -5.224  13.710  30.360  1.00 27.42 ? 157 ILE B CG2 1 
ATOM   4529  C CD1 . ILE B 1 157 ? -4.119  11.053  28.987  1.00 26.83 ? 157 ILE B CD1 1 
ATOM   4530  N N   . ASN B 1 158 ? -3.583  15.677  32.953  1.00 29.06 ? 158 ASN B N   1 
ATOM   4531  C CA  . ASN B 1 158 ? -4.224  16.322  34.073  1.00 30.01 ? 158 ASN B CA  1 
ATOM   4532  C C   . ASN B 1 158 ? -5.745  16.229  33.939  1.00 30.57 ? 158 ASN B C   1 
ATOM   4533  O O   . ASN B 1 158 ? -6.309  16.393  32.841  1.00 31.91 ? 158 ASN B O   1 
ATOM   4534  C CB  . ASN B 1 158 ? -3.790  17.793  34.183  1.00 30.50 ? 158 ASN B CB  1 
ATOM   4535  C CG  . ASN B 1 158 ? -4.418  18.499  35.373  1.00 32.95 ? 158 ASN B CG  1 
ATOM   4536  O OD1 . ASN B 1 158 ? -4.712  17.865  36.386  1.00 37.53 ? 158 ASN B OD1 1 
ATOM   4537  N ND2 . ASN B 1 158 ? -4.628  19.809  35.263  1.00 32.74 ? 158 ASN B ND2 1 
ATOM   4538  N N   . VAL B 1 159 ? -6.401  15.909  35.047  1.00 30.26 ? 159 VAL B N   1 
ATOM   4539  C CA  . VAL B 1 159 ? -7.855  15.812  35.110  1.00 30.18 ? 159 VAL B CA  1 
ATOM   4540  C C   . VAL B 1 159 ? -8.218  17.033  35.957  1.00 30.78 ? 159 VAL B C   1 
ATOM   4541  O O   . VAL B 1 159 ? -7.493  17.369  36.903  1.00 29.61 ? 159 VAL B O   1 
ATOM   4542  C CB  . VAL B 1 159 ? -8.323  14.502  35.780  1.00 29.94 ? 159 VAL B CB  1 
ATOM   4543  C CG1 . VAL B 1 159 ? -9.836  14.461  35.894  1.00 31.22 ? 159 VAL B CG1 1 
ATOM   4544  C CG2 . VAL B 1 159 ? -7.810  13.248  35.020  1.00 31.12 ? 159 VAL B CG2 1 
ATOM   4545  N N   . ALA B 1 160 ? -9.291  17.729  35.591  1.00 31.44 ? 160 ALA B N   1 
ATOM   4546  C CA  . ALA B 1 160 ? -9.691  18.957  36.309  1.00 31.57 ? 160 ALA B CA  1 
ATOM   4547  C C   . ALA B 1 160 ? -10.181 18.651  37.712  1.00 31.73 ? 160 ALA B C   1 
ATOM   4548  O O   . ALA B 1 160 ? -10.793 17.611  37.955  1.00 32.27 ? 160 ALA B O   1 
ATOM   4549  C CB  . ALA B 1 160 ? -10.782 19.730  35.518  1.00 31.53 ? 160 ALA B CB  1 
ATOM   4550  N N   . SER B 1 161 ? -9.932  19.577  38.632  1.00 32.24 ? 161 SER B N   1 
ATOM   4551  C CA  . SER B 1 161 ? -10.344 19.396  40.030  1.00 33.12 ? 161 SER B CA  1 
ATOM   4552  C C   . SER B 1 161 ? -10.763 20.719  40.640  1.00 33.60 ? 161 SER B C   1 
ATOM   4553  O O   . SER B 1 161 ? -10.295 21.786  40.219  1.00 33.87 ? 161 SER B O   1 
ATOM   4554  C CB  . SER B 1 161 ? -9.189  18.871  40.852  1.00 32.36 ? 161 SER B CB  1 
ATOM   4555  O OG  . SER B 1 161 ? -8.071  19.691  40.595  1.00 32.22 ? 161 SER B OG  1 
ATOM   4556  N N   . ASP B 1 162 ? -11.617 20.637  41.653  1.00 34.20 ? 162 ASP B N   1 
ATOM   4557  C CA  . ASP B 1 162 ? -12.067 21.837  42.349  1.00 35.08 ? 162 ASP B CA  1 
ATOM   4558  C C   . ASP B 1 162 ? -12.112 21.539  43.848  1.00 35.24 ? 162 ASP B C   1 
ATOM   4559  O O   . ASP B 1 162 ? -11.467 20.582  44.300  1.00 34.26 ? 162 ASP B O   1 
ATOM   4560  C CB  . ASP B 1 162 ? -13.438 22.284  41.810  1.00 35.03 ? 162 ASP B CB  1 
ATOM   4561  C CG  . ASP B 1 162 ? -14.503 21.213  41.942  1.00 35.36 ? 162 ASP B CG  1 
ATOM   4562  O OD1 . ASP B 1 162 ? -14.371 20.330  42.805  1.00 37.11 ? 162 ASP B OD1 1 
ATOM   4563  O OD2 . ASP B 1 162 ? -15.493 21.239  41.186  1.00 33.51 ? 162 ASP B OD2 1 
ATOM   4564  N N   . GLU B 1 163 ? -12.888 22.328  44.600  1.00 35.14 ? 163 GLU B N   1 
ATOM   4565  C CA  . GLU B 1 163 ? -13.055 22.141  46.050  1.00 35.72 ? 163 GLU B CA  1 
ATOM   4566  C C   . GLU B 1 163 ? -13.406 20.703  46.426  1.00 34.23 ? 163 GLU B C   1 
ATOM   4567  O O   . GLU B 1 163 ? -13.088 20.282  47.524  1.00 33.88 ? 163 GLU B O   1 
ATOM   4568  C CB  . GLU B 1 163 ? -14.180 23.026  46.649  1.00 36.29 ? 163 GLU B CB  1 
ATOM   4569  C CG  . GLU B 1 163 ? -14.228 24.450  46.205  1.00 40.99 ? 163 GLU B CG  1 
ATOM   4570  C CD  . GLU B 1 163 ? -15.134 24.673  45.008  1.00 44.82 ? 163 GLU B CD  1 
ATOM   4571  O OE1 . GLU B 1 163 ? -14.768 24.256  43.903  1.00 46.45 ? 163 GLU B OE1 1 
ATOM   4572  O OE2 . GLU B 1 163 ? -16.208 25.296  45.165  1.00 47.93 ? 163 GLU B OE2 1 
ATOM   4573  N N   . SER B 1 164 ? -14.130 20.004  45.552  1.00 33.55 ? 164 SER B N   1 
ATOM   4574  C CA  . SER B 1 164 ? -14.561 18.619  45.804  1.00 33.53 ? 164 SER B CA  1 
ATOM   4575  C C   . SER B 1 164 ? -13.708 17.501  45.139  1.00 32.92 ? 164 SER B C   1 
ATOM   4576  O O   . SER B 1 164 ? -14.144 16.365  45.019  1.00 32.16 ? 164 SER B O   1 
ATOM   4577  C CB  . SER B 1 164 ? -16.045 18.473  45.422  1.00 33.83 ? 164 SER B CB  1 
ATOM   4578  O OG  . SER B 1 164 ? -16.858 19.112  46.389  1.00 34.92 ? 164 SER B OG  1 
ATOM   4579  N N   . GLY B 1 165 ? -12.492 17.831  44.729  1.00 33.14 ? 165 GLY B N   1 
ATOM   4580  C CA  . GLY B 1 165 ? -11.544 16.837  44.218  1.00 33.97 ? 165 GLY B CA  1 
ATOM   4581  C C   . GLY B 1 165 ? -11.642 16.767  42.709  1.00 33.95 ? 165 GLY B C   1 
ATOM   4582  O O   . GLY B 1 165 ? -12.122 17.717  42.095  1.00 34.08 ? 165 GLY B O   1 
ATOM   4583  N N   . ILE B 1 166 ? -11.201 15.660  42.096  1.00 33.66 ? 166 ILE B N   1 
ATOM   4584  C CA  . ILE B 1 166 ? -11.346 15.560  40.645  1.00 33.56 ? 166 ILE B CA  1 
ATOM   4585  C C   . ILE B 1 166 ? -12.825 15.761  40.226  1.00 33.18 ? 166 ILE B C   1 
ATOM   4586  O O   . ILE B 1 166 ? -13.755 15.249  40.885  1.00 33.76 ? 166 ILE B O   1 
ATOM   4587  C CB  . ILE B 1 166 ? -10.744 14.240  39.943  1.00 33.61 ? 166 ILE B CB  1 
ATOM   4588  C CG1 . ILE B 1 166 ? -11.863 13.375  39.348  1.00 33.03 ? 166 ILE B CG1 1 
ATOM   4589  C CG2 . ILE B 1 166 ? -9.683  13.454  40.766  1.00 34.09 ? 166 ILE B CG2 1 
ATOM   4590  C CD1 . ILE B 1 166 ? -11.361 12.252  38.460  1.00 36.80 ? 166 ILE B CD1 1 
ATOM   4591  N N   . VAL B 1 167 ? -13.025 16.489  39.125  1.00 33.44 ? 167 VAL B N   1 
ATOM   4592  C CA  . VAL B 1 167 ? -14.359 16.733  38.555  1.00 33.93 ? 167 VAL B CA  1 
ATOM   4593  C C   . VAL B 1 167 ? -14.659 15.589  37.575  1.00 34.50 ? 167 VAL B C   1 
ATOM   4594  O O   . VAL B 1 167 ? -13.961 15.443  36.589  1.00 34.12 ? 167 VAL B O   1 
ATOM   4595  C CB  . VAL B 1 167 ? -14.428 18.106  37.786  1.00 33.73 ? 167 VAL B CB  1 
ATOM   4596  C CG1 . VAL B 1 167 ? -15.879 18.413  37.310  1.00 35.23 ? 167 VAL B CG1 1 
ATOM   4597  C CG2 . VAL B 1 167 ? -13.885 19.253  38.644  1.00 32.84 ? 167 VAL B CG2 1 
ATOM   4598  N N   . PRO B 1 168 ? -15.675 14.758  37.854  1.00 35.56 ? 168 PRO B N   1 
ATOM   4599  C CA  . PRO B 1 168 ? -15.943 13.675  36.894  1.00 36.76 ? 168 PRO B CA  1 
ATOM   4600  C C   . PRO B 1 168 ? -16.283 14.097  35.439  1.00 38.50 ? 168 PRO B C   1 
ATOM   4601  O O   . PRO B 1 168 ? -16.004 13.318  34.510  1.00 39.26 ? 168 PRO B O   1 
ATOM   4602  C CB  . PRO B 1 168 ? -17.099 12.911  37.550  1.00 36.67 ? 168 PRO B CB  1 
ATOM   4603  C CG  . PRO B 1 168 ? -16.975 13.278  39.051  1.00 36.14 ? 168 PRO B CG  1 
ATOM   4604  C CD  . PRO B 1 168 ? -16.576 14.699  39.016  1.00 34.93 ? 168 PRO B CD  1 
ATOM   4605  N N   . ASP B 1 169 ? -16.877 15.282  35.220  1.00 38.44 ? 169 ASP B N   1 
ATOM   4606  C CA  . ASP B 1 169 ? -17.105 15.752  33.839  1.00 39.63 ? 169 ASP B CA  1 
ATOM   4607  C C   . ASP B 1 169 ? -15.798 15.856  33.073  1.00 38.71 ? 169 ASP B C   1 
ATOM   4608  O O   . ASP B 1 169 ? -15.725 15.455  31.917  1.00 37.62 ? 169 ASP B O   1 
ATOM   4609  C CB  . ASP B 1 169 ? -17.773 17.133  33.762  1.00 39.94 ? 169 ASP B CB  1 
ATOM   4610  C CG  . ASP B 1 169 ? -19.216 17.102  34.100  1.00 42.16 ? 169 ASP B CG  1 
ATOM   4611  O OD1 . ASP B 1 169 ? -19.797 15.999  34.126  1.00 44.11 ? 169 ASP B OD1 1 
ATOM   4612  O OD2 . ASP B 1 169 ? -19.767 18.205  34.365  1.00 46.98 ? 169 ASP B OD2 1 
ATOM   4613  N N   . SER B 1 170 ? -14.790 16.420  33.732  1.00 38.56 ? 170 SER B N   1 
ATOM   4614  C CA  . SER B 1 170 ? -13.449 16.555  33.156  1.00 38.98 ? 170 SER B CA  1 
ATOM   4615  C C   . SER B 1 170 ? -12.845 15.184  32.826  1.00 39.16 ? 170 SER B C   1 
ATOM   4616  O O   . SER B 1 170 ? -12.322 14.986  31.717  1.00 39.89 ? 170 SER B O   1 
ATOM   4617  C CB  . SER B 1 170 ? -12.544 17.350  34.083  1.00 38.64 ? 170 SER B CB  1 
ATOM   4618  O OG  . SER B 1 170 ? -11.186 17.239  33.683  1.00 37.48 ? 170 SER B OG  1 
ATOM   4619  N N   . LEU B 1 171 ? -12.947 14.239  33.761  1.00 38.75 ? 171 LEU B N   1 
ATOM   4620  C CA  . LEU B 1 171 ? -12.507 12.856  33.489  1.00 38.93 ? 171 LEU B CA  1 
ATOM   4621  C C   . LEU B 1 171 ? -13.297 12.205  32.329  1.00 39.28 ? 171 LEU B C   1 
ATOM   4622  O O   . LEU B 1 171 ? -12.717 11.604  31.431  1.00 38.70 ? 171 LEU B O   1 
ATOM   4623  C CB  . LEU B 1 171 ? -12.597 11.967  34.750  1.00 38.30 ? 171 LEU B CB  1 
ATOM   4624  C CG  . LEU B 1 171 ? -11.959 10.561  34.623  1.00 38.52 ? 171 LEU B CG  1 
ATOM   4625  C CD1 . LEU B 1 171 ? -10.449 10.646  34.282  1.00 35.25 ? 171 LEU B CD1 1 
ATOM   4626  C CD2 . LEU B 1 171 ? -12.208 9.699   35.862  1.00 36.53 ? 171 LEU B CD2 1 
ATOM   4627  N N   . ARG B 1 172 ? -14.623 12.307  32.374  1.00 39.86 ? 172 ARG B N   1 
ATOM   4628  C CA  . ARG B 1 172 ? -15.469 11.761  31.315  1.00 40.82 ? 172 ARG B CA  1 
ATOM   4629  C C   . ARG B 1 172 ? -15.089 12.301  29.940  1.00 40.57 ? 172 ARG B C   1 
ATOM   4630  O O   . ARG B 1 172 ? -14.955 11.543  28.979  1.00 40.88 ? 172 ARG B O   1 
ATOM   4631  C CB  . ARG B 1 172 ? -16.924 12.095  31.599  1.00 40.70 ? 172 ARG B CB  1 
ATOM   4632  C CG  . ARG B 1 172 ? -17.928 11.378  30.748  1.00 42.77 ? 172 ARG B CG  1 
ATOM   4633  C CD  . ARG B 1 172 ? -19.329 11.754  31.192  1.00 48.53 ? 172 ARG B CD  1 
ATOM   4634  N NE  . ARG B 1 172 ? -19.641 11.162  32.504  1.00 52.28 ? 172 ARG B NE  1 
ATOM   4635  C CZ  . ARG B 1 172 ? -19.583 11.796  33.680  1.00 53.78 ? 172 ARG B CZ  1 
ATOM   4636  N NH1 . ARG B 1 172 ? -19.234 13.082  33.764  1.00 54.97 ? 172 ARG B NH1 1 
ATOM   4637  N NH2 . ARG B 1 172 ? -19.889 11.135  34.785  1.00 53.67 ? 172 ARG B NH2 1 
ATOM   4638  N N   . ASP B 1 173 ? -14.921 13.611  29.866  1.00 40.64 ? 173 ASP B N   1 
ATOM   4639  C CA  . ASP B 1 173 ? -14.558 14.298  28.645  1.00 41.23 ? 173 ASP B CA  1 
ATOM   4640  C C   . ASP B 1 173 ? -13.183 13.856  28.121  1.00 40.42 ? 173 ASP B C   1 
ATOM   4641  O O   . ASP B 1 173 ? -13.002 13.678  26.908  1.00 40.03 ? 173 ASP B O   1 
ATOM   4642  C CB  . ASP B 1 173 ? -14.617 15.823  28.855  1.00 41.58 ? 173 ASP B CB  1 
ATOM   4643  C CG  . ASP B 1 173 ? -16.070 16.342  29.096  1.00 45.25 ? 173 ASP B CG  1 
ATOM   4644  O OD1 . ASP B 1 173 ? -17.048 15.543  29.187  1.00 47.10 ? 173 ASP B OD1 1 
ATOM   4645  O OD2 . ASP B 1 173 ? -16.239 17.576  29.203  1.00 51.30 ? 173 ASP B OD2 1 
ATOM   4646  N N   . ILE B 1 174 ? -12.227 13.671  29.023  1.00 39.85 ? 174 ILE B N   1 
ATOM   4647  C CA  . ILE B 1 174 ? -10.871 13.223  28.634  1.00 39.33 ? 174 ILE B CA  1 
ATOM   4648  C C   . ILE B 1 174 ? -10.938 11.816  28.026  1.00 39.00 ? 174 ILE B C   1 
ATOM   4649  O O   . ILE B 1 174 ? -10.303 11.540  27.002  1.00 39.20 ? 174 ILE B O   1 
ATOM   4650  C CB  . ILE B 1 174 ? -9.842  13.313  29.827  1.00 39.49 ? 174 ILE B CB  1 
ATOM   4651  C CG1 . ILE B 1 174 ? -9.502  14.769  30.128  1.00 39.73 ? 174 ILE B CG1 1 
ATOM   4652  C CG2 . ILE B 1 174 ? -8.542  12.571  29.509  1.00 38.04 ? 174 ILE B CG2 1 
ATOM   4653  C CD1 . ILE B 1 174 ? -9.157  15.027  31.570  1.00 39.15 ? 174 ILE B CD1 1 
ATOM   4654  N N   . LEU B 1 175 ? -11.750 10.951  28.620  1.00 38.21 ? 175 LEU B N   1 
ATOM   4655  C CA  . LEU B 1 175 ? -11.826 9.563   28.168  1.00 37.93 ? 175 LEU B CA  1 
ATOM   4656  C C   . LEU B 1 175 ? -12.548 9.386   26.824  1.00 38.55 ? 175 LEU B C   1 
ATOM   4657  O O   . LEU B 1 175 ? -12.370 8.353   26.166  1.00 38.77 ? 175 LEU B O   1 
ATOM   4658  C CB  . LEU B 1 175 ? -12.446 8.684   29.246  1.00 37.94 ? 175 LEU B CB  1 
ATOM   4659  C CG  . LEU B 1 175 ? -11.596 8.558   30.525  1.00 37.48 ? 175 LEU B CG  1 
ATOM   4660  C CD1 . LEU B 1 175 ? -12.444 8.027   31.670  1.00 33.16 ? 175 LEU B CD1 1 
ATOM   4661  C CD2 . LEU B 1 175 ? -10.353 7.660   30.287  1.00 35.30 ? 175 LEU B CD2 1 
ATOM   4662  N N   . SER B 1 176 ? -13.330 10.387  26.398  1.00 38.90 ? 176 SER B N   1 
ATOM   4663  C CA  . SER B 1 176 ? -14.041 10.287  25.115  1.00 39.15 ? 176 SER B CA  1 
ATOM   4664  C C   . SER B 1 176 ? -13.114 10.333  23.883  1.00 39.68 ? 176 SER B C   1 
ATOM   4665  O O   . SER B 1 176 ? -13.573 10.089  22.760  1.00 39.91 ? 176 SER B O   1 
ATOM   4666  C CB  . SER B 1 176 ? -15.225 11.273  25.010  1.00 38.93 ? 176 SER B CB  1 
ATOM   4667  O OG  . SER B 1 176 ? -14.834 12.611  25.272  1.00 38.22 ? 176 SER B OG  1 
ATOM   4668  N N   . ARG B 1 177 ? -11.830 10.658  24.094  1.00 40.12 ? 177 ARG B N   1 
ATOM   4669  C CA  . ARG B 1 177 ? -10.789 10.488  23.072  1.00 41.39 ? 177 ARG B CA  1 
ATOM   4670  C C   . ARG B 1 177 ? -10.717 9.032   22.579  1.00 41.47 ? 177 ARG B C   1 
ATOM   4671  O O   . ARG B 1 177 ? -10.299 8.777   21.449  1.00 42.09 ? 177 ARG B O   1 
ATOM   4672  C CB  . ARG B 1 177 ? -9.417  10.815  23.643  1.00 41.69 ? 177 ARG B CB  1 
ATOM   4673  C CG  . ARG B 1 177 ? -9.074  12.257  23.748  1.00 44.44 ? 177 ARG B CG  1 
ATOM   4674  C CD  . ARG B 1 177 ? -8.085  12.454  24.897  1.00 47.54 ? 177 ARG B CD  1 
ATOM   4675  N NE  . ARG B 1 177 ? -6.818  11.767  24.641  1.00 50.95 ? 177 ARG B NE  1 
ATOM   4676  C CZ  . ARG B 1 177 ? -5.640  12.161  25.129  1.00 51.28 ? 177 ARG B CZ  1 
ATOM   4677  N NH1 . ARG B 1 177 ? -5.575  13.244  25.907  1.00 48.89 ? 177 ARG B NH1 1 
ATOM   4678  N NH2 . ARG B 1 177 ? -4.530  11.475  24.836  1.00 49.55 ? 177 ARG B NH2 1 
ATOM   4679  N N   . TRP B 1 178 ? -11.104 8.092   23.440  1.00 41.18 ? 178 TRP B N   1 
ATOM   4680  C CA  . TRP B 1 178 ? -11.071 6.653   23.143  1.00 41.52 ? 178 TRP B CA  1 
ATOM   4681  C C   . TRP B 1 178 ? -12.516 6.137   23.094  1.00 41.53 ? 178 TRP B C   1 
ATOM   4682  O O   . TRP B 1 178 ? -13.433 6.813   23.569  1.00 40.99 ? 178 TRP B O   1 
ATOM   4683  C CB  . TRP B 1 178 ? -10.254 5.890   24.230  1.00 41.52 ? 178 TRP B CB  1 
ATOM   4684  C CG  . TRP B 1 178 ? -9.145  6.703   24.904  1.00 42.70 ? 178 TRP B CG  1 
ATOM   4685  C CD1 . TRP B 1 178 ? -9.262  7.534   26.013  1.00 43.03 ? 178 TRP B CD1 1 
ATOM   4686  C CD2 . TRP B 1 178 ? -7.773  6.754   24.527  1.00 44.78 ? 178 TRP B CD2 1 
ATOM   4687  N NE1 . TRP B 1 178 ? -8.044  8.109   26.316  1.00 43.80 ? 178 TRP B NE1 1 
ATOM   4688  C CE2 . TRP B 1 178 ? -7.116  7.643   25.422  1.00 44.61 ? 178 TRP B CE2 1 
ATOM   4689  C CE3 . TRP B 1 178 ? -7.030  6.148   23.513  1.00 45.34 ? 178 TRP B CE3 1 
ATOM   4690  C CZ2 . TRP B 1 178 ? -5.770  7.928   25.324  1.00 45.92 ? 178 TRP B CZ2 1 
ATOM   4691  C CZ3 . TRP B 1 178 ? -5.689  6.448   23.408  1.00 47.34 ? 178 TRP B CZ3 1 
ATOM   4692  C CH2 . TRP B 1 178 ? -5.070  7.328   24.304  1.00 48.14 ? 178 TRP B CH2 1 
ATOM   4693  N N   . LYS B 1 179 ? -12.739 4.958   22.513  1.00 41.34 ? 179 LYS B N   1 
ATOM   4694  C CA  . LYS B 1 179 ? -13.977 4.232   22.782  1.00 41.62 ? 179 LYS B CA  1 
ATOM   4695  C C   . LYS B 1 179 ? -13.626 3.247   23.897  1.00 40.87 ? 179 LYS B C   1 
ATOM   4696  O O   . LYS B 1 179 ? -12.462 2.862   24.022  1.00 40.47 ? 179 LYS B O   1 
ATOM   4697  C CB  . LYS B 1 179 ? -14.504 3.470   21.540  1.00 41.97 ? 179 LYS B CB  1 
ATOM   4698  C CG  . LYS B 1 179 ? -15.063 4.327   20.348  1.00 45.71 ? 179 LYS B CG  1 
ATOM   4699  C CD  . LYS B 1 179 ? -16.502 4.924   20.564  1.00 49.65 ? 179 LYS B CD  1 
ATOM   4700  C CE  . LYS B 1 179 ? -17.582 3.896   20.986  1.00 52.19 ? 179 LYS B CE  1 
ATOM   4701  N NZ  . LYS B 1 179 ? -17.952 2.908   19.912  1.00 52.79 ? 179 LYS B NZ  1 
ATOM   4702  N N   . PRO B 1 180 ? -14.623 2.828   24.703  1.00 40.61 ? 180 PRO B N   1 
ATOM   4703  C CA  . PRO B 1 180 ? -14.426 1.863   25.798  1.00 40.74 ? 180 PRO B CA  1 
ATOM   4704  C C   . PRO B 1 180 ? -13.708 0.577   25.360  1.00 41.01 ? 180 PRO B C   1 
ATOM   4705  O O   . PRO B 1 180 ? -12.872 0.045   26.120  1.00 41.01 ? 180 PRO B O   1 
ATOM   4706  C CB  . PRO B 1 180 ? -15.860 1.534   26.248  1.00 40.54 ? 180 PRO B CB  1 
ATOM   4707  C CG  . PRO B 1 180 ? -16.659 2.694   25.834  1.00 40.46 ? 180 PRO B CG  1 
ATOM   4708  C CD  . PRO B 1 180 ? -16.025 3.269   24.606  1.00 40.72 ? 180 PRO B CD  1 
ATOM   4709  N N   . GLU B 1 181 ? -14.015 0.118   24.140  1.00 41.29 ? 181 GLU B N   1 
ATOM   4710  C CA  . GLU B 1 181 ? -13.431 -1.098  23.536  1.00 41.86 ? 181 GLU B CA  1 
ATOM   4711  C C   . GLU B 1 181 ? -11.924 -1.017  23.282  1.00 41.19 ? 181 GLU B C   1 
ATOM   4712  O O   . GLU B 1 181 ? -11.275 -2.049  23.223  1.00 41.22 ? 181 GLU B O   1 
ATOM   4713  C CB  . GLU B 1 181 ? -14.152 -1.476  22.221  1.00 42.72 ? 181 GLU B CB  1 
ATOM   4714  C CG  . GLU B 1 181 ? -15.674 -1.767  22.366  1.00 45.82 ? 181 GLU B CG  1 
ATOM   4715  C CD  . GLU B 1 181 ? -16.543 -0.511  22.567  1.00 49.19 ? 181 GLU B CD  1 
ATOM   4716  O OE1 . GLU B 1 181 ? -17.631 -0.629  23.194  1.00 51.35 ? 181 GLU B OE1 1 
ATOM   4717  O OE2 . GLU B 1 181 ? -16.144 0.589   22.110  1.00 48.70 ? 181 GLU B OE2 1 
ATOM   4718  N N   . ASP B 1 182 ? -11.385 0.197   23.116  1.00 40.77 ? 182 ASP B N   1 
ATOM   4719  C CA  . ASP B 1 182 ? -9.944  0.432   22.907  1.00 39.75 ? 182 ASP B CA  1 
ATOM   4720  C C   . ASP B 1 182 ? -9.053  -0.038  24.065  1.00 40.37 ? 182 ASP B C   1 
ATOM   4721  O O   . ASP B 1 182 ? -7.829  -0.168  23.886  1.00 40.01 ? 182 ASP B O   1 
ATOM   4722  C CB  . ASP B 1 182 ? -9.658  1.920   22.677  1.00 39.84 ? 182 ASP B CB  1 
ATOM   4723  C CG  . ASP B 1 182 ? -10.309 2.483   21.397  1.00 39.87 ? 182 ASP B CG  1 
ATOM   4724  O OD1 . ASP B 1 182 ? -10.906 1.706   20.610  1.00 38.95 ? 182 ASP B OD1 1 
ATOM   4725  O OD2 . ASP B 1 182 ? -10.215 3.718   21.205  1.00 39.28 ? 182 ASP B OD2 1 
ATOM   4726  N N   . ALA B 1 183 ? -9.657  -0.212  25.251  1.00 40.61 ? 183 ALA B N   1 
ATOM   4727  C CA  . ALA B 1 183 ? -8.965  -0.737  26.437  1.00 41.60 ? 183 ALA B CA  1 
ATOM   4728  C C   . ALA B 1 183 ? -8.519  -2.180  26.212  1.00 42.58 ? 183 ALA B C   1 
ATOM   4729  O O   . ALA B 1 183 ? -7.464  -2.585  26.701  1.00 42.50 ? 183 ALA B O   1 
ATOM   4730  C CB  . ALA B 1 183 ? -9.838  -0.645  27.662  1.00 40.89 ? 183 ALA B CB  1 
ATOM   4731  N N   . LYS B 1 184 ? -9.342  -2.934  25.474  1.00 43.14 ? 184 LYS B N   1 
ATOM   4732  C CA  . LYS B 1 184 ? -9.071  -4.314  25.100  1.00 44.56 ? 184 LYS B CA  1 
ATOM   4733  C C   . LYS B 1 184 ? -7.836  -4.421  24.216  1.00 45.15 ? 184 LYS B C   1 
ATOM   4734  O O   . LYS B 1 184 ? -7.341  -5.515  23.971  1.00 46.25 ? 184 LYS B O   1 
ATOM   4735  C CB  . LYS B 1 184 ? -10.284 -4.928  24.367  1.00 44.59 ? 184 LYS B CB  1 
ATOM   4736  C CG  . LYS B 1 184 ? -11.180 -5.857  25.183  1.00 45.35 ? 184 LYS B CG  1 
ATOM   4737  C CD  . LYS B 1 184 ? -12.212 -5.108  26.047  1.00 48.25 ? 184 LYS B CD  1 
ATOM   4738  C CE  . LYS B 1 184 ? -13.423 -4.533  25.256  1.00 48.50 ? 184 LYS B CE  1 
ATOM   4739  N NZ  . LYS B 1 184 ? -14.349 -3.700  26.138  1.00 45.14 ? 184 LYS B NZ  1 
ATOM   4740  N N   . ASN B 1 185 ? -7.335  -3.287  23.739  1.00 46.17 ? 185 ASN B N   1 
ATOM   4741  C CA  . ASN B 1 185 ? -6.263  -3.280  22.758  1.00 46.38 ? 185 ASN B CA  1 
ATOM   4742  C C   . ASN B 1 185 ? -5.074  -2.350  23.053  1.00 46.38 ? 185 ASN B C   1 
ATOM   4743  O O   . ASN B 1 185 ? -5.187  -1.122  22.901  1.00 47.16 ? 185 ASN B O   1 
ATOM   4744  C CB  . ASN B 1 185 ? -6.845  -2.977  21.375  1.00 46.80 ? 185 ASN B CB  1 
ATOM   4745  C CG  . ASN B 1 185 ? -5.831  -3.162  20.281  1.00 48.27 ? 185 ASN B CG  1 
ATOM   4746  O OD1 . ASN B 1 185 ? -5.840  -2.443  19.269  1.00 49.47 ? 185 ASN B OD1 1 
ATOM   4747  N ND2 . ASN B 1 185 ? -4.923  -4.113  20.481  1.00 48.89 ? 185 ASN B ND2 1 
ATOM   4748  N N   . PRO B 1 186 ? -3.914  -2.933  23.448  1.00 46.55 ? 186 PRO B N   1 
ATOM   4749  C CA  . PRO B 1 186 ? -2.730  -2.205  23.965  1.00 46.02 ? 186 PRO B CA  1 
ATOM   4750  C C   . PRO B 1 186 ? -2.185  -1.040  23.148  1.00 45.67 ? 186 PRO B C   1 
ATOM   4751  O O   . PRO B 1 186 ? -1.716  -0.052  23.718  1.00 44.96 ? 186 PRO B O   1 
ATOM   4752  C CB  . PRO B 1 186 ? -1.664  -3.309  24.058  1.00 46.09 ? 186 PRO B CB  1 
ATOM   4753  C CG  . PRO B 1 186 ? -2.443  -4.535  24.335  1.00 46.83 ? 186 PRO B CG  1 
ATOM   4754  C CD  . PRO B 1 186 ? -3.674  -4.389  23.453  1.00 45.95 ? 186 PRO B CD  1 
ATOM   4755  N N   . GLN B 1 187 ? -2.238  -1.134  21.828  1.00 45.88 ? 187 GLN B N   1 
ATOM   4756  C CA  . GLN B 1 187 ? -1.434  -0.224  20.991  1.00 45.65 ? 187 GLN B CA  1 
ATOM   4757  C C   . GLN B 1 187 ? -1.892  1.246   20.907  1.00 45.67 ? 187 GLN B C   1 
ATOM   4758  O O   . GLN B 1 187 ? -1.063  2.154   20.689  1.00 45.79 ? 187 GLN B O   1 
ATOM   4759  C CB  . GLN B 1 187 ? -1.260  -0.796  19.584  1.00 46.45 ? 187 GLN B CB  1 
ATOM   4760  C CG  . GLN B 1 187 ? -2.533  -1.301  18.961  1.00 45.86 ? 187 GLN B CG  1 
ATOM   4761  C CD  . GLN B 1 187 ? -3.392  -0.222  18.294  1.00 48.03 ? 187 GLN B CD  1 
ATOM   4762  O OE1 . GLN B 1 187 ? -4.622  -0.360  18.247  1.00 46.04 ? 187 GLN B OE1 1 
ATOM   4763  N NE2 . GLN B 1 187 ? -2.759  0.852   17.778  1.00 48.23 ? 187 GLN B NE2 1 
ATOM   4764  N N   . LYS B 1 188 ? -3.190  1.477   21.053  1.00 44.77 ? 188 LYS B N   1 
ATOM   4765  C CA  . LYS B 1 188 ? -3.668  2.849   21.148  1.00 45.12 ? 188 LYS B CA  1 
ATOM   4766  C C   . LYS B 1 188 ? -3.808  3.393   22.578  1.00 43.92 ? 188 LYS B C   1 
ATOM   4767  O O   . LYS B 1 188 ? -4.411  4.445   22.769  1.00 44.50 ? 188 LYS B O   1 
ATOM   4768  C CB  . LYS B 1 188 ? -4.944  3.076   20.331  1.00 46.21 ? 188 LYS B CB  1 
ATOM   4769  C CG  . LYS B 1 188 ? -4.705  3.871   19.006  1.00 48.66 ? 188 LYS B CG  1 
ATOM   4770  C CD  . LYS B 1 188 ? -5.944  4.739   18.597  1.00 51.54 ? 188 LYS B CD  1 
ATOM   4771  C CE  . LYS B 1 188 ? -6.506  5.543   19.811  1.00 53.10 ? 188 LYS B CE  1 
ATOM   4772  N NZ  . LYS B 1 188 ? -7.466  6.633   19.439  1.00 52.97 ? 188 LYS B NZ  1 
ATOM   4773  N N   . ASN B 1 189 ? -3.251  2.690   23.571  1.00 41.89 ? 189 ASN B N   1 
ATOM   4774  C CA  . ASN B 1 189 ? -2.771  3.358   24.783  1.00 40.38 ? 189 ASN B CA  1 
ATOM   4775  C C   . ASN B 1 189 ? -3.877  4.013   25.642  1.00 38.10 ? 189 ASN B C   1 
ATOM   4776  O O   . ASN B 1 189 ? -3.769  5.170   26.013  1.00 38.33 ? 189 ASN B O   1 
ATOM   4777  C CB  . ASN B 1 189 ? -1.738  4.418   24.347  1.00 40.43 ? 189 ASN B CB  1 
ATOM   4778  C CG  . ASN B 1 189 ? -0.687  4.726   25.410  1.00 43.10 ? 189 ASN B CG  1 
ATOM   4779  O OD1 . ASN B 1 189 ? -0.590  4.052   26.445  1.00 46.51 ? 189 ASN B OD1 1 
ATOM   4780  N ND2 . ASN B 1 189 ? 0.130   5.747   25.140  1.00 42.23 ? 189 ASN B ND2 1 
ATOM   4781  N N   . THR B 1 190 ? -4.941  3.285   25.963  1.00 36.77 ? 190 THR B N   1 
ATOM   4782  C CA  . THR B 1 190 ? -5.923  3.838   26.899  1.00 35.09 ? 190 THR B CA  1 
ATOM   4783  C C   . THR B 1 190 ? -5.223  4.007   28.266  1.00 34.19 ? 190 THR B C   1 
ATOM   4784  O O   . THR B 1 190 ? -4.265  3.302   28.559  1.00 32.44 ? 190 THR B O   1 
ATOM   4785  C CB  . THR B 1 190 ? -7.208  2.974   27.012  1.00 35.74 ? 190 THR B CB  1 
ATOM   4786  O OG1 . THR B 1 190 ? -6.868  1.656   27.453  1.00 35.37 ? 190 THR B OG1 1 
ATOM   4787  C CG2 . THR B 1 190 ? -7.970  2.895   25.662  1.00 33.92 ? 190 THR B CG2 1 
ATOM   4788  N N   . PRO B 1 191 ? -5.670  4.972   29.096  1.00 33.41 ? 191 PRO B N   1 
ATOM   4789  C CA  . PRO B 1 191 ? -4.916  5.102   30.371  1.00 32.05 ? 191 PRO B CA  1 
ATOM   4790  C C   . PRO B 1 191 ? -4.841  3.826   31.227  1.00 30.71 ? 191 PRO B C   1 
ATOM   4791  O O   . PRO B 1 191 ? -5.807  3.076   31.304  1.00 31.27 ? 191 PRO B O   1 
ATOM   4792  C CB  . PRO B 1 191 ? -5.642  6.241   31.096  1.00 32.11 ? 191 PRO B CB  1 
ATOM   4793  C CG  . PRO B 1 191 ? -6.304  7.055   29.913  1.00 33.21 ? 191 PRO B CG  1 
ATOM   4794  C CD  . PRO B 1 191 ? -6.751  5.967   28.970  1.00 33.29 ? 191 PRO B CD  1 
ATOM   4795  N N   . LYS B 1 192 ? -3.680  3.604   31.851  1.00 29.15 ? 192 LYS B N   1 
ATOM   4796  C CA  . LYS B 1 192 ? -3.409  2.437   32.706  1.00 29.04 ? 192 LYS B CA  1 
ATOM   4797  C C   . LYS B 1 192 ? -4.111  2.570   34.061  1.00 27.97 ? 192 LYS B C   1 
ATOM   4798  O O   . LYS B 1 192 ? -4.656  1.620   34.608  1.00 26.97 ? 192 LYS B O   1 
ATOM   4799  C CB  . LYS B 1 192 ? -1.899  2.304   32.920  1.00 29.45 ? 192 LYS B CB  1 
ATOM   4800  C CG  . LYS B 1 192 ? -1.099  1.732   31.729  1.00 31.95 ? 192 LYS B CG  1 
ATOM   4801  C CD  . LYS B 1 192 ? -1.643  0.370   31.303  1.00 35.11 ? 192 LYS B CD  1 
ATOM   4802  C CE  . LYS B 1 192 ? -0.565  -0.590  30.865  1.00 38.40 ? 192 LYS B CE  1 
ATOM   4803  N NZ  . LYS B 1 192 ? 0.354   -0.072  29.831  1.00 39.25 ? 192 LYS B NZ  1 
ATOM   4804  N N   . PHE B 1 193 ? -4.093  3.787   34.586  1.00 28.47 ? 193 PHE B N   1 
ATOM   4805  C CA  . PHE B 1 193 ? -4.672  4.033   35.885  1.00 27.15 ? 193 PHE B CA  1 
ATOM   4806  C C   . PHE B 1 193 ? -5.002  5.519   36.057  1.00 26.67 ? 193 PHE B C   1 
ATOM   4807  O O   . PHE B 1 193 ? -4.494  6.385   35.307  1.00 25.91 ? 193 PHE B O   1 
ATOM   4808  C CB  . PHE B 1 193 ? -3.719  3.534   37.007  1.00 26.82 ? 193 PHE B CB  1 
ATOM   4809  C CG  . PHE B 1 193 ? -2.401  4.269   37.102  1.00 26.52 ? 193 PHE B CG  1 
ATOM   4810  C CD1 . PHE B 1 193 ? -1.222  3.662   36.688  1.00 26.58 ? 193 PHE B CD1 1 
ATOM   4811  C CD2 . PHE B 1 193 ? -2.327  5.552   37.653  1.00 27.27 ? 193 PHE B CD2 1 
ATOM   4812  C CE1 . PHE B 1 193 ? 0.003   4.313   36.805  1.00 28.27 ? 193 PHE B CE1 1 
ATOM   4813  C CE2 . PHE B 1 193 ? -1.105  6.229   37.754  1.00 28.82 ? 193 PHE B CE2 1 
ATOM   4814  C CZ  . PHE B 1 193 ? 0.060   5.614   37.336  1.00 27.15 ? 193 PHE B CZ  1 
ATOM   4815  N N   . LEU B 1 194 ? -5.855  5.764   37.052  1.00 25.61 ? 194 LEU B N   1 
ATOM   4816  C CA  . LEU B 1 194 ? -6.124  7.080   37.633  1.00 25.76 ? 194 LEU B CA  1 
ATOM   4817  C C   . LEU B 1 194 ? -5.503  7.056   39.000  1.00 24.67 ? 194 LEU B C   1 
ATOM   4818  O O   . LEU B 1 194 ? -5.776  6.168   39.775  1.00 24.25 ? 194 LEU B O   1 
ATOM   4819  C CB  . LEU B 1 194 ? -7.631  7.301   37.791  1.00 24.74 ? 194 LEU B CB  1 
ATOM   4820  C CG  . LEU B 1 194 ? -8.126  8.534   38.595  1.00 27.54 ? 194 LEU B CG  1 
ATOM   4821  C CD1 . LEU B 1 194 ? -7.571  9.874   38.082  1.00 26.15 ? 194 LEU B CD1 1 
ATOM   4822  C CD2 . LEU B 1 194 ? -9.650  8.576   38.563  1.00 28.23 ? 194 LEU B CD2 1 
ATOM   4823  N N   . TYR B 1 195 ? -4.643  8.022   39.267  1.00 25.40 ? 195 TYR B N   1 
ATOM   4824  C CA  . TYR B 1 195 ? -4.081  8.215   40.585  1.00 25.28 ? 195 TYR B CA  1 
ATOM   4825  C C   . TYR B 1 195 ? -4.769  9.422   41.279  1.00 26.49 ? 195 TYR B C   1 
ATOM   4826  O O   . TYR B 1 195 ? -4.872  10.542  40.695  1.00 25.85 ? 195 TYR B O   1 
ATOM   4827  C CB  . TYR B 1 195 ? -2.581  8.452   40.462  1.00 24.79 ? 195 TYR B CB  1 
ATOM   4828  C CG  . TYR B 1 195 ? -1.937  8.958   41.735  1.00 25.03 ? 195 TYR B CG  1 
ATOM   4829  C CD1 . TYR B 1 195 ? -1.364  8.076   42.674  1.00 23.87 ? 195 TYR B CD1 1 
ATOM   4830  C CD2 . TYR B 1 195 ? -1.913  10.322  42.021  1.00 27.67 ? 195 TYR B CD2 1 
ATOM   4831  C CE1 . TYR B 1 195 ? -0.762  8.573   43.866  1.00 24.61 ? 195 TYR B CE1 1 
ATOM   4832  C CE2 . TYR B 1 195 ? -1.354  10.810  43.205  1.00 25.41 ? 195 TYR B CE2 1 
ATOM   4833  C CZ  . TYR B 1 195 ? -0.786  9.935   44.124  1.00 25.86 ? 195 TYR B CZ  1 
ATOM   4834  O OH  . TYR B 1 195 ? -0.200  10.460  45.267  1.00 25.62 ? 195 TYR B OH  1 
ATOM   4835  N N   . THR B 1 196 ? -5.236  9.220   42.516  1.00 26.72 ? 196 THR B N   1 
ATOM   4836  C CA  . THR B 1 196 ? -5.704  10.371  43.309  1.00 26.58 ? 196 THR B CA  1 
ATOM   4837  C C   . THR B 1 196 ? -5.443  10.213  44.796  1.00 27.24 ? 196 THR B C   1 
ATOM   4838  O O   . THR B 1 196 ? -5.358  9.079   45.298  1.00 27.33 ? 196 THR B O   1 
ATOM   4839  C CB  . THR B 1 196 ? -7.205  10.780  43.006  1.00 27.37 ? 196 THR B CB  1 
ATOM   4840  O OG1 . THR B 1 196 ? -7.453  12.140  43.443  1.00 29.90 ? 196 THR B OG1 1 
ATOM   4841  C CG2 . THR B 1 196 ? -8.193  9.824   43.622  1.00 25.59 ? 196 THR B CG2 1 
ATOM   4842  N N   . VAL B 1 197 ? -5.269  11.364  45.478  1.00 26.35 ? 197 VAL B N   1 
ATOM   4843  C CA  . VAL B 1 197 ? -5.276  11.431  46.943  1.00 24.91 ? 197 VAL B CA  1 
ATOM   4844  C C   . VAL B 1 197 ? -6.686  11.944  47.333  1.00 25.30 ? 197 VAL B C   1 
ATOM   4845  O O   . VAL B 1 197 ? -6.952  13.168  47.221  1.00 24.83 ? 197 VAL B O   1 
ATOM   4846  C CB  . VAL B 1 197 ? -4.119  12.383  47.448  1.00 25.30 ? 197 VAL B CB  1 
ATOM   4847  C CG1 . VAL B 1 197 ? -4.112  12.538  48.976  1.00 25.64 ? 197 VAL B CG1 1 
ATOM   4848  C CG2 . VAL B 1 197 ? -2.777  11.852  46.987  1.00 24.30 ? 197 VAL B CG2 1 
ATOM   4849  N N   . PRO B 1 198 ? -7.595  11.030  47.744  1.00 24.67 ? 198 PRO B N   1 
ATOM   4850  C CA  . PRO B 1 198 ? -9.006  11.362  47.913  1.00 25.67 ? 198 PRO B CA  1 
ATOM   4851  C C   . PRO B 1 198 ? -9.331  12.189  49.145  1.00 25.02 ? 198 PRO B C   1 
ATOM   4852  O O   . PRO B 1 198 ? -10.347 12.863  49.146  1.00 25.47 ? 198 PRO B O   1 
ATOM   4853  C CB  . PRO B 1 198 ? -9.686  9.982   48.049  1.00 25.68 ? 198 PRO B CB  1 
ATOM   4854  C CG  . PRO B 1 198 ? -8.675  9.012   47.653  1.00 26.39 ? 198 PRO B CG  1 
ATOM   4855  C CD  . PRO B 1 198 ? -7.381  9.614   48.072  1.00 24.89 ? 198 PRO B CD  1 
ATOM   4856  N N   . ASN B 1 199 ? -8.482  12.130  50.167  1.00 24.00 ? 199 ASN B N   1 
ATOM   4857  C CA  . ASN B 1 199 ? -8.707  12.881  51.392  1.00 24.07 ? 199 ASN B CA  1 
ATOM   4858  C C   . ASN B 1 199 ? -7.538  13.745  51.686  1.00 24.45 ? 199 ASN B C   1 
ATOM   4859  O O   . ASN B 1 199 ? -6.408  13.248  51.746  1.00 25.08 ? 199 ASN B O   1 
ATOM   4860  C CB  . ASN B 1 199 ? -8.942  11.936  52.574  1.00 22.66 ? 199 ASN B CB  1 
ATOM   4861  C CG  . ASN B 1 199 ? -10.213 11.134  52.439  1.00 20.78 ? 199 ASN B CG  1 
ATOM   4862  O OD1 . ASN B 1 199 ? -11.309 11.690  52.411  1.00 23.56 ? 199 ASN B OD1 1 
ATOM   4863  N ND2 . ASN B 1 199 ? -10.084 9.820   52.366  1.00 19.81 ? 199 ASN B ND2 1 
ATOM   4864  N N   . GLY B 1 200 ? -7.816  15.036  51.885  1.00 25.49 ? 200 GLY B N   1 
ATOM   4865  C CA  . GLY B 1 200 ? -6.831  16.056  52.207  1.00 25.17 ? 200 GLY B CA  1 
ATOM   4866  C C   . GLY B 1 200 ? -5.643  16.065  51.286  1.00 25.54 ? 200 GLY B C   1 
ATOM   4867  O O   . GLY B 1 200 ? -4.505  15.927  51.743  1.00 25.67 ? 200 GLY B O   1 
ATOM   4868  N N   . ASN B 1 201 ? -5.904  16.234  49.994  1.00 26.34 ? 201 ASN B N   1 
ATOM   4869  C CA  . ASN B 1 201 ? -4.851  16.262  48.990  1.00 27.84 ? 201 ASN B CA  1 
ATOM   4870  C C   . ASN B 1 201 ? -3.690  17.166  49.448  1.00 27.98 ? 201 ASN B C   1 
ATOM   4871  O O   . ASN B 1 201 ? -3.879  18.245  50.039  1.00 27.42 ? 201 ASN B O   1 
ATOM   4872  C CB  . ASN B 1 201 ? -5.432  16.699  47.641  1.00 29.35 ? 201 ASN B CB  1 
ATOM   4873  C CG  . ASN B 1 201 ? -4.392  16.707  46.502  1.00 32.77 ? 201 ASN B CG  1 
ATOM   4874  O OD1 . ASN B 1 201 ? -4.303  17.670  45.733  1.00 37.00 ? 201 ASN B OD1 1 
ATOM   4875  N ND2 . ASN B 1 201 ? -3.640  15.633  46.385  1.00 30.59 ? 201 ASN B ND2 1 
ATOM   4876  N N   . ASN B 1 202 ? -2.483  16.697  49.218  1.00 27.06 ? 202 ASN B N   1 
ATOM   4877  C CA  . ASN B 1 202 ? -1.311  17.506  49.451  1.00 28.10 ? 202 ASN B CA  1 
ATOM   4878  C C   . ASN B 1 202 ? -0.914  17.986  48.047  1.00 27.74 ? 202 ASN B C   1 
ATOM   4879  O O   . ASN B 1 202 ? -0.481  17.166  47.226  1.00 27.20 ? 202 ASN B O   1 
ATOM   4880  C CB  . ASN B 1 202 ? -0.237  16.619  50.082  1.00 27.63 ? 202 ASN B CB  1 
ATOM   4881  C CG  . ASN B 1 202 ? 1.120   17.298  50.193  1.00 28.71 ? 202 ASN B CG  1 
ATOM   4882  O OD1 . ASN B 1 202 ? 1.250   18.511  50.013  1.00 28.71 ? 202 ASN B OD1 1 
ATOM   4883  N ND2 . ASN B 1 202 ? 2.143   16.505  50.533  1.00 27.50 ? 202 ASN B ND2 1 
ATOM   4884  N N   . PRO B 1 203 ? -0.999  19.312  47.780  1.00 27.61 ? 203 PRO B N   1 
ATOM   4885  C CA  . PRO B 1 203 ? -1.031  20.408  48.735  1.00 26.75 ? 203 PRO B CA  1 
ATOM   4886  C C   . PRO B 1 203 ? -2.397  21.043  49.024  1.00 26.99 ? 203 PRO B C   1 
ATOM   4887  O O   . PRO B 1 203 ? -2.449  21.977  49.796  1.00 27.33 ? 203 PRO B O   1 
ATOM   4888  C CB  . PRO B 1 203 ? -0.176  21.442  48.022  1.00 26.57 ? 203 PRO B CB  1 
ATOM   4889  C CG  . PRO B 1 203 ? -0.698  21.313  46.554  1.00 26.63 ? 203 PRO B CG  1 
ATOM   4890  C CD  . PRO B 1 203 ? -1.071  19.839  46.391  1.00 27.57 ? 203 PRO B CD  1 
ATOM   4891  N N   . THR B 1 204 ? -3.496  20.555  48.447  1.00 26.96 ? 204 THR B N   1 
ATOM   4892  C CA  . THR B 1 204 ? -4.716  21.395  48.450  1.00 26.83 ? 204 THR B CA  1 
ATOM   4893  C C   . THR B 1 204 ? -5.650  21.376  49.669  1.00 27.00 ? 204 THR B C   1 
ATOM   4894  O O   . THR B 1 204 ? -6.366  22.358  49.880  1.00 27.66 ? 204 THR B O   1 
ATOM   4895  C CB  . THR B 1 204 ? -5.611  21.184  47.222  1.00 25.93 ? 204 THR B CB  1 
ATOM   4896  O OG1 . THR B 1 204 ? -6.263  19.929  47.332  1.00 26.19 ? 204 THR B OG1 1 
ATOM   4897  C CG2 . THR B 1 204 ? -4.825  21.312  45.922  1.00 23.53 ? 204 THR B CG2 1 
ATOM   4898  N N   . GLY B 1 205 ? -5.668  20.273  50.426  1.00 25.50 ? 205 GLY B N   1 
ATOM   4899  C CA  . GLY B 1 205 ? -6.648  20.045  51.473  1.00 25.22 ? 205 GLY B CA  1 
ATOM   4900  C C   . GLY B 1 205 ? -8.040  19.556  51.064  1.00 26.31 ? 205 GLY B C   1 
ATOM   4901  O O   . GLY B 1 205 ? -8.885  19.289  51.947  1.00 25.66 ? 205 GLY B O   1 
ATOM   4902  N N   . ASN B 1 206 ? -8.308  19.440  49.756  1.00 25.87 ? 206 ASN B N   1 
ATOM   4903  C CA  . ASN B 1 206 ? -9.668  19.083  49.274  1.00 27.02 ? 206 ASN B CA  1 
ATOM   4904  C C   . ASN B 1 206 ? -9.874  17.580  49.289  1.00 27.26 ? 206 ASN B C   1 
ATOM   4905  O O   . ASN B 1 206 ? -8.918  16.835  49.102  1.00 27.59 ? 206 ASN B O   1 
ATOM   4906  C CB  . ASN B 1 206 ? -9.942  19.560  47.823  1.00 26.80 ? 206 ASN B CB  1 
ATOM   4907  C CG  . ASN B 1 206 ? -9.661  21.030  47.594  1.00 28.04 ? 206 ASN B CG  1 
ATOM   4908  O OD1 . ASN B 1 206 ? -9.204  21.412  46.505  1.00 31.17 ? 206 ASN B OD1 1 
ATOM   4909  N ND2 . ASN B 1 206 ? -9.954  21.871  48.577  1.00 22.62 ? 206 ASN B ND2 1 
ATOM   4910  N N   . SER B 1 207 ? -11.109 17.138  49.531  1.00 28.00 ? 207 SER B N   1 
ATOM   4911  C CA  . SER B 1 207 ? -11.432 15.730  49.497  1.00 29.28 ? 207 SER B CA  1 
ATOM   4912  C C   . SER B 1 207 ? -12.535 15.436  48.477  1.00 30.20 ? 207 SER B C   1 
ATOM   4913  O O   . SER B 1 207 ? -13.466 16.239  48.322  1.00 29.58 ? 207 SER B O   1 
ATOM   4914  C CB  . SER B 1 207 ? -11.872 15.238  50.894  1.00 29.12 ? 207 SER B CB  1 
ATOM   4915  O OG  . SER B 1 207 ? -10.838 15.485  51.830  1.00 28.10 ? 207 SER B OG  1 
ATOM   4916  N N   . LEU B 1 208 ? -12.456 14.250  47.847  1.00 30.16 ? 208 LEU B N   1 
ATOM   4917  C CA  . LEU B 1 208 ? -13.538 13.748  47.014  1.00 30.38 ? 208 LEU B CA  1 
ATOM   4918  C C   . LEU B 1 208 ? -14.778 13.509  47.835  1.00 30.41 ? 208 LEU B C   1 
ATOM   4919  O O   . LEU B 1 208 ? -14.685 13.162  49.005  1.00 29.53 ? 208 LEU B O   1 
ATOM   4920  C CB  . LEU B 1 208 ? -13.123 12.462  46.261  1.00 30.10 ? 208 LEU B CB  1 
ATOM   4921  C CG  . LEU B 1 208 ? -12.401 12.649  44.915  1.00 32.09 ? 208 LEU B CG  1 
ATOM   4922  C CD1 . LEU B 1 208 ? -11.793 11.308  44.423  1.00 31.24 ? 208 LEU B CD1 1 
ATOM   4923  C CD2 . LEU B 1 208 ? -13.372 13.181  43.829  1.00 31.45 ? 208 LEU B CD2 1 
ATOM   4924  N N   . THR B 1 209 ? -15.941 13.715  47.217  1.00 30.32 ? 209 THR B N   1 
ATOM   4925  C CA  . THR B 1 209 ? -17.218 13.373  47.814  1.00 31.18 ? 209 THR B CA  1 
ATOM   4926  C C   . THR B 1 209 ? -17.533 11.945  47.423  1.00 31.65 ? 209 THR B C   1 
ATOM   4927  O O   . THR B 1 209 ? -16.887 11.412  46.523  1.00 31.20 ? 209 THR B O   1 
ATOM   4928  C CB  . THR B 1 209 ? -18.319 14.261  47.266  1.00 31.96 ? 209 THR B CB  1 
ATOM   4929  O OG1 . THR B 1 209 ? -18.227 14.254  45.836  1.00 31.17 ? 209 THR B OG1 1 
ATOM   4930  C CG2 . THR B 1 209 ? -18.143 15.709  47.771  1.00 32.19 ? 209 THR B CG2 1 
ATOM   4931  N N   . SER B 1 210 ? -18.535 11.345  48.070  1.00 32.75 ? 210 SER B N   1 
ATOM   4932  C CA  . SER B 1 210 ? -18.916 9.937   47.857  1.00 34.84 ? 210 SER B CA  1 
ATOM   4933  C C   . SER B 1 210 ? -19.539 9.705   46.496  1.00 36.00 ? 210 SER B C   1 
ATOM   4934  O O   . SER B 1 210 ? -19.332 8.643   45.875  1.00 36.54 ? 210 SER B O   1 
ATOM   4935  C CB  . SER B 1 210 ? -19.908 9.483   48.929  1.00 34.94 ? 210 SER B CB  1 
ATOM   4936  O OG  . SER B 1 210 ? -20.326 8.160   48.659  1.00 39.01 ? 210 SER B OG  1 
ATOM   4937  N N   . GLU B 1 211 ? -20.299 10.712  46.053  1.00 36.21 ? 211 GLU B N   1 
ATOM   4938  C CA  . GLU B 1 211 ? -21.007 10.705  44.777  1.00 36.79 ? 211 GLU B CA  1 
ATOM   4939  C C   . GLU B 1 211 ? -20.024 10.855  43.619  1.00 35.15 ? 211 GLU B C   1 
ATOM   4940  O O   . GLU B 1 211 ? -20.152 10.155  42.612  1.00 35.49 ? 211 GLU B O   1 
ATOM   4941  C CB  . GLU B 1 211 ? -22.043 11.837  44.736  1.00 36.86 ? 211 GLU B CB  1 
ATOM   4942  C CG  . GLU B 1 211 ? -22.980 11.898  45.954  1.00 42.59 ? 211 GLU B CG  1 
ATOM   4943  C CD  . GLU B 1 211 ? -22.510 12.896  47.035  1.00 48.75 ? 211 GLU B CD  1 
ATOM   4944  O OE1 . GLU B 1 211 ? -21.534 12.610  47.779  1.00 49.29 ? 211 GLU B OE1 1 
ATOM   4945  O OE2 . GLU B 1 211 ? -23.142 13.975  47.146  1.00 51.71 ? 211 GLU B OE2 1 
ATOM   4946  N N   . ARG B 1 212 ? -19.039 11.739  43.747  1.00 34.22 ? 212 ARG B N   1 
ATOM   4947  C CA  . ARG B 1 212 ? -18.006 11.819  42.707  1.00 33.77 ? 212 ARG B CA  1 
ATOM   4948  C C   . ARG B 1 212 ? -17.189 10.510  42.608  1.00 34.03 ? 212 ARG B C   1 
ATOM   4949  O O   . ARG B 1 212 ? -16.915 10.044  41.494  1.00 33.74 ? 212 ARG B O   1 
ATOM   4950  C CB  . ARG B 1 212 ? -17.082 13.013  42.864  1.00 34.23 ? 212 ARG B CB  1 
ATOM   4951  C CG  . ARG B 1 212 ? -17.711 14.344  42.597  1.00 34.01 ? 212 ARG B CG  1 
ATOM   4952  C CD  . ARG B 1 212 ? -16.668 15.425  42.578  1.00 32.14 ? 212 ARG B CD  1 
ATOM   4953  N NE  . ARG B 1 212 ? -17.287 16.699  42.213  1.00 30.17 ? 212 ARG B NE  1 
ATOM   4954  C CZ  . ARG B 1 212 ? -16.635 17.821  41.973  1.00 30.60 ? 212 ARG B CZ  1 
ATOM   4955  N NH1 . ARG B 1 212 ? -15.304 17.855  42.013  1.00 33.14 ? 212 ARG B NH1 1 
ATOM   4956  N NH2 . ARG B 1 212 ? -17.323 18.924  41.674  1.00 31.03 ? 212 ARG B NH2 1 
ATOM   4957  N N   . LYS B 1 213 ? -16.819 9.933   43.757  1.00 33.84 ? 213 LYS B N   1 
ATOM   4958  C CA  . LYS B 1 213 ? -16.186 8.611   43.803  1.00 34.26 ? 213 LYS B CA  1 
ATOM   4959  C C   . LYS B 1 213 ? -16.948 7.566   42.970  1.00 34.07 ? 213 LYS B C   1 
ATOM   4960  O O   . LYS B 1 213 ? -16.346 6.927   42.121  1.00 33.94 ? 213 LYS B O   1 
ATOM   4961  C CB  . LYS B 1 213 ? -15.994 8.116   45.244  1.00 33.26 ? 213 LYS B CB  1 
ATOM   4962  C CG  . LYS B 1 213 ? -14.929 8.898   46.026  1.00 34.29 ? 213 LYS B CG  1 
ATOM   4963  C CD  . LYS B 1 213 ? -14.619 8.252   47.358  1.00 30.78 ? 213 LYS B CD  1 
ATOM   4964  C CE  . LYS B 1 213 ? -13.386 8.884   47.972  1.00 28.81 ? 213 LYS B CE  1 
ATOM   4965  N NZ  . LYS B 1 213 ? -13.243 8.579   49.448  1.00 24.68 ? 213 LYS B NZ  1 
ATOM   4966  N N   . LYS B 1 214 ? -18.254 7.416   43.193  1.00 35.28 ? 214 LYS B N   1 
ATOM   4967  C CA  . LYS B 1 214 ? -19.084 6.490   42.391  1.00 36.25 ? 214 LYS B CA  1 
ATOM   4968  C C   . LYS B 1 214 ? -18.997 6.742   40.865  1.00 36.78 ? 214 LYS B C   1 
ATOM   4969  O O   . LYS B 1 214 ? -18.795 5.785   40.105  1.00 37.50 ? 214 LYS B O   1 
ATOM   4970  C CB  . LYS B 1 214 ? -20.543 6.500   42.854  1.00 36.44 ? 214 LYS B CB  1 
ATOM   4971  C CG  . LYS B 1 214 ? -20.787 5.913   44.228  1.00 36.90 ? 214 LYS B CG  1 
ATOM   4972  C CD  . LYS B 1 214 ? -22.280 5.869   44.546  1.00 39.37 ? 214 LYS B CD  1 
ATOM   4973  C CE  . LYS B 1 214 ? -22.549 5.674   46.034  1.00 42.13 ? 214 LYS B CE  1 
ATOM   4974  N NZ  . LYS B 1 214 ? -22.341 6.908   46.863  1.00 44.18 ? 214 LYS B NZ  1 
ATOM   4975  N N   . GLU B 1 215 ? -19.100 8.012   40.433  1.00 36.98 ? 215 GLU B N   1 
ATOM   4976  C CA  . GLU B 1 215 ? -18.975 8.403   39.008  1.00 36.96 ? 215 GLU B CA  1 
ATOM   4977  C C   . GLU B 1 215 ? -17.592 8.095   38.462  1.00 36.22 ? 215 GLU B C   1 
ATOM   4978  O O   . GLU B 1 215 ? -17.466 7.664   37.331  1.00 36.70 ? 215 GLU B O   1 
ATOM   4979  C CB  . GLU B 1 215 ? -19.266 9.894   38.789  1.00 37.34 ? 215 GLU B CB  1 
ATOM   4980  C CG  . GLU B 1 215 ? -20.728 10.330  39.040  1.00 41.90 ? 215 GLU B CG  1 
ATOM   4981  C CD  . GLU B 1 215 ? -20.880 11.857  39.187  1.00 46.15 ? 215 GLU B CD  1 
ATOM   4982  O OE1 . GLU B 1 215 ? -21.272 12.336  40.288  1.00 49.46 ? 215 GLU B OE1 1 
ATOM   4983  O OE2 . GLU B 1 215 ? -20.582 12.584  38.210  1.00 48.52 ? 215 GLU B OE2 1 
ATOM   4984  N N   . ILE B 1 216 ? -16.557 8.328   39.269  1.00 35.18 ? 216 ILE B N   1 
ATOM   4985  C CA  . ILE B 1 216 ? -15.170 8.060   38.888  1.00 33.74 ? 216 ILE B CA  1 
ATOM   4986  C C   . ILE B 1 216 ? -14.929 6.549   38.754  1.00 33.51 ? 216 ILE B C   1 
ATOM   4987  O O   . ILE B 1 216 ? -14.303 6.117   37.782  1.00 32.50 ? 216 ILE B O   1 
ATOM   4988  C CB  . ILE B 1 216 ? -14.182 8.676   39.883  1.00 34.11 ? 216 ILE B CB  1 
ATOM   4989  C CG1 . ILE B 1 216 ? -14.231 10.197  39.786  1.00 32.41 ? 216 ILE B CG1 1 
ATOM   4990  C CG2 . ILE B 1 216 ? -12.755 8.190   39.627  1.00 31.83 ? 216 ILE B CG2 1 
ATOM   4991  C CD1 . ILE B 1 216 ? -13.711 10.857  41.019  1.00 31.28 ? 216 ILE B CD1 1 
ATOM   4992  N N   . TYR B 1 217 ? -15.466 5.765   39.696  1.00 32.59 ? 217 TYR B N   1 
ATOM   4993  C CA  . TYR B 1 217 ? -15.440 4.308   39.601  1.00 32.88 ? 217 TYR B CA  1 
ATOM   4994  C C   . TYR B 1 217 ? -16.199 3.772   38.364  1.00 34.31 ? 217 TYR B C   1 
ATOM   4995  O O   . TYR B 1 217 ? -15.726 2.854   37.674  1.00 33.61 ? 217 TYR B O   1 
ATOM   4996  C CB  . TYR B 1 217 ? -15.945 3.642   40.874  1.00 32.87 ? 217 TYR B CB  1 
ATOM   4997  C CG  . TYR B 1 217 ? -15.598 2.175   40.914  1.00 32.25 ? 217 TYR B CG  1 
ATOM   4998  C CD1 . TYR B 1 217 ? -14.407 1.757   41.502  1.00 32.61 ? 217 TYR B CD1 1 
ATOM   4999  C CD2 . TYR B 1 217 ? -16.444 1.194   40.331  1.00 31.50 ? 217 TYR B CD2 1 
ATOM   5000  C CE1 . TYR B 1 217 ? -14.030 0.399   41.534  1.00 29.74 ? 217 TYR B CE1 1 
ATOM   5001  C CE2 . TYR B 1 217 ? -16.079 -0.190  40.355  1.00 31.22 ? 217 TYR B CE2 1 
ATOM   5002  C CZ  . TYR B 1 217 ? -14.853 -0.561  40.962  1.00 32.09 ? 217 TYR B CZ  1 
ATOM   5003  O OH  . TYR B 1 217 ? -14.431 -1.868  41.035  1.00 31.06 ? 217 TYR B OH  1 
ATOM   5004  N N   . GLU B 1 218 ? -17.363 4.346   38.086  1.00 35.70 ? 218 GLU B N   1 
ATOM   5005  C CA  . GLU B 1 218 ? -18.122 4.040   36.860  1.00 37.35 ? 218 GLU B CA  1 
ATOM   5006  C C   . GLU B 1 218 ? -17.257 4.227   35.602  1.00 37.08 ? 218 GLU B C   1 
ATOM   5007  O O   . GLU B 1 218 ? -17.262 3.383   34.703  1.00 37.31 ? 218 GLU B O   1 
ATOM   5008  C CB  . GLU B 1 218 ? -19.376 4.922   36.796  1.00 37.79 ? 218 GLU B CB  1 
ATOM   5009  C CG  . GLU B 1 218 ? -19.533 5.746   35.472  1.00 41.24 ? 218 GLU B CG  1 
ATOM   5010  C CD  . GLU B 1 218 ? -20.226 7.115   35.676  1.00 43.41 ? 218 GLU B CD  1 
ATOM   5011  O OE1 . GLU B 1 218 ? -19.615 8.151   35.301  1.00 41.32 ? 218 GLU B OE1 1 
ATOM   5012  O OE2 . GLU B 1 218 ? -21.364 7.147   36.232  1.00 47.69 ? 218 GLU B OE2 1 
ATOM   5013  N N   . LEU B 1 219 ? -16.513 5.338   35.556  1.00 37.12 ? 219 LEU B N   1 
ATOM   5014  C CA  . LEU B 1 219 ? -15.615 5.655   34.442  1.00 36.40 ? 219 LEU B CA  1 
ATOM   5015  C C   . LEU B 1 219 ? -14.484 4.627   34.314  1.00 37.05 ? 219 LEU B C   1 
ATOM   5016  O O   . LEU B 1 219 ? -14.155 4.184   33.199  1.00 36.46 ? 219 LEU B O   1 
ATOM   5017  C CB  . LEU B 1 219 ? -15.056 7.076   34.587  1.00 36.12 ? 219 LEU B CB  1 
ATOM   5018  C CG  . LEU B 1 219 ? -15.693 8.232   33.770  1.00 36.84 ? 219 LEU B CG  1 
ATOM   5019  C CD1 . LEU B 1 219 ? -16.955 7.845   32.972  1.00 34.49 ? 219 LEU B CD1 1 
ATOM   5020  C CD2 . LEU B 1 219 ? -15.956 9.440   34.633  1.00 34.52 ? 219 LEU B CD2 1 
ATOM   5021  N N   . ALA B 1 220 ? -13.911 4.235   35.453  1.00 36.52 ? 220 ALA B N   1 
ATOM   5022  C CA  . ALA B 1 220 ? -12.832 3.240   35.486  1.00 36.89 ? 220 ALA B CA  1 
ATOM   5023  C C   . ALA B 1 220 ? -13.276 1.881   34.974  1.00 36.70 ? 220 ALA B C   1 
ATOM   5024  O O   . ALA B 1 220 ? -12.509 1.187   34.308  1.00 36.82 ? 220 ALA B O   1 
ATOM   5025  C CB  . ALA B 1 220 ? -12.254 3.104   36.916  1.00 36.45 ? 220 ALA B CB  1 
ATOM   5026  N N   . ARG B 1 221 ? -14.490 1.476   35.332  1.00 36.58 ? 221 ARG B N   1 
ATOM   5027  C CA  . ARG B 1 221 ? -15.066 0.242   34.794  1.00 37.25 ? 221 ARG B CA  1 
ATOM   5028  C C   . ARG B 1 221 ? -15.308 0.372   33.288  1.00 37.58 ? 221 ARG B C   1 
ATOM   5029  O O   . ARG B 1 221 ? -15.032 -0.563  32.508  1.00 37.17 ? 221 ARG B O   1 
ATOM   5030  C CB  . ARG B 1 221 ? -16.379 -0.056  35.480  1.00 37.95 ? 221 ARG B CB  1 
ATOM   5031  C CG  . ARG B 1 221 ? -17.132 -1.199  34.887  1.00 39.49 ? 221 ARG B CG  1 
ATOM   5032  C CD  . ARG B 1 221 ? -18.430 -1.363  35.640  1.00 46.07 ? 221 ARG B CD  1 
ATOM   5033  N NE  . ARG B 1 221 ? -18.266 -2.202  36.825  1.00 48.60 ? 221 ARG B NE  1 
ATOM   5034  C CZ  . ARG B 1 221 ? -19.245 -2.505  37.667  1.00 49.26 ? 221 ARG B CZ  1 
ATOM   5035  N NH1 . ARG B 1 221 ? -20.469 -2.019  37.493  1.00 49.48 ? 221 ARG B NH1 1 
ATOM   5036  N NH2 . ARG B 1 221 ? -18.988 -3.275  38.705  1.00 50.91 ? 221 ARG B NH2 1 
ATOM   5037  N N   . LYS B 1 222 ? -15.800 1.547   32.891  1.00 37.15 ? 222 LYS B N   1 
ATOM   5038  C CA  . LYS B 1 222 ? -16.173 1.818   31.501  1.00 37.77 ? 222 LYS B CA  1 
ATOM   5039  C C   . LYS B 1 222 ? -14.969 1.774   30.555  1.00 36.98 ? 222 LYS B C   1 
ATOM   5040  O O   . LYS B 1 222 ? -15.037 1.178   29.477  1.00 37.76 ? 222 LYS B O   1 
ATOM   5041  C CB  . LYS B 1 222 ? -16.923 3.150   31.385  1.00 36.95 ? 222 LYS B CB  1 
ATOM   5042  C CG  . LYS B 1 222 ? -17.299 3.496   29.977  1.00 39.77 ? 222 LYS B CG  1 
ATOM   5043  C CD  . LYS B 1 222 ? -18.397 4.519   29.870  1.00 39.71 ? 222 LYS B CD  1 
ATOM   5044  C CE  . LYS B 1 222 ? -18.745 4.669   28.406  1.00 40.65 ? 222 LYS B CE  1 
ATOM   5045  N NZ  . LYS B 1 222 ? -19.662 5.807   28.161  1.00 40.65 ? 222 LYS B NZ  1 
ATOM   5046  N N   . TYR B 1 223 ? -13.870 2.389   30.970  1.00 36.48 ? 223 TYR B N   1 
ATOM   5047  C CA  . TYR B 1 223 ? -12.645 2.435   30.156  1.00 35.83 ? 223 TYR B CA  1 
ATOM   5048  C C   . TYR B 1 223 ? -11.579 1.476   30.691  1.00 35.01 ? 223 TYR B C   1 
ATOM   5049  O O   . TYR B 1 223 ? -10.437 1.514   30.258  1.00 35.02 ? 223 TYR B O   1 
ATOM   5050  C CB  . TYR B 1 223 ? -12.125 3.866   30.056  1.00 35.69 ? 223 TYR B CB  1 
ATOM   5051  C CG  . TYR B 1 223 ? -13.091 4.735   29.250  1.00 37.30 ? 223 TYR B CG  1 
ATOM   5052  C CD1 . TYR B 1 223 ? -12.842 5.034   27.903  1.00 37.21 ? 223 TYR B CD1 1 
ATOM   5053  C CD2 . TYR B 1 223 ? -14.274 5.196   29.817  1.00 35.76 ? 223 TYR B CD2 1 
ATOM   5054  C CE1 . TYR B 1 223 ? -13.719 5.801   27.171  1.00 38.15 ? 223 TYR B CE1 1 
ATOM   5055  C CE2 . TYR B 1 223 ? -15.179 5.958   29.079  1.00 37.59 ? 223 TYR B CE2 1 
ATOM   5056  C CZ  . TYR B 1 223 ? -14.902 6.250   27.763  1.00 37.82 ? 223 TYR B CZ  1 
ATOM   5057  O OH  . TYR B 1 223 ? -15.796 7.005   27.056  1.00 35.85 ? 223 TYR B OH  1 
ATOM   5058  N N   . ASP B 1 224 ? -11.997 0.616   31.620  1.00 34.20 ? 224 ASP B N   1 
ATOM   5059  C CA  . ASP B 1 224 ? -11.163 -0.406  32.244  1.00 33.84 ? 224 ASP B CA  1 
ATOM   5060  C C   . ASP B 1 224 ? -9.720  0.032   32.556  1.00 33.14 ? 224 ASP B C   1 
ATOM   5061  O O   . ASP B 1 224 ? -8.749  -0.505  31.986  1.00 31.97 ? 224 ASP B O   1 
ATOM   5062  C CB  . ASP B 1 224 ? -11.203 -1.710  31.424  1.00 34.58 ? 224 ASP B CB  1 
ATOM   5063  C CG  . ASP B 1 224 ? -10.497 -2.866  32.135  1.00 37.17 ? 224 ASP B CG  1 
ATOM   5064  O OD1 . ASP B 1 224 ? -10.865 -3.184  33.301  1.00 38.25 ? 224 ASP B OD1 1 
ATOM   5065  O OD2 . ASP B 1 224 ? -9.569  -3.444  31.518  1.00 39.22 ? 224 ASP B OD2 1 
ATOM   5066  N N   . PHE B 1 225 ? -9.595  1.044   33.432  1.00 31.78 ? 225 PHE B N   1 
ATOM   5067  C CA  . PHE B 1 225 ? -8.326  1.370   34.081  1.00 30.11 ? 225 PHE B CA  1 
ATOM   5068  C C   . PHE B 1 225 ? -8.398  1.098   35.582  1.00 29.26 ? 225 PHE B C   1 
ATOM   5069  O O   . PHE B 1 225 ? -9.466  0.922   36.142  1.00 29.56 ? 225 PHE B O   1 
ATOM   5070  C CB  . PHE B 1 225 ? -7.879  2.815   33.838  1.00 29.79 ? 225 PHE B CB  1 
ATOM   5071  C CG  . PHE B 1 225 ? -8.928  3.870   34.155  1.00 32.09 ? 225 PHE B CG  1 
ATOM   5072  C CD1 . PHE B 1 225 ? -9.030  4.444   35.451  1.00 32.48 ? 225 PHE B CD1 1 
ATOM   5073  C CD2 . PHE B 1 225 ? -9.772  4.347   33.146  1.00 31.63 ? 225 PHE B CD2 1 
ATOM   5074  C CE1 . PHE B 1 225 ? -9.990  5.449   35.724  1.00 31.26 ? 225 PHE B CE1 1 
ATOM   5075  C CE2 . PHE B 1 225 ? -10.732 5.364   33.402  1.00 30.51 ? 225 PHE B CE2 1 
ATOM   5076  C CZ  . PHE B 1 225 ? -10.849 5.913   34.677  1.00 30.57 ? 225 PHE B CZ  1 
ATOM   5077  N N   . LEU B 1 226 ? -7.238  1.061   36.211  1.00 27.68 ? 226 LEU B N   1 
ATOM   5078  C CA  . LEU B 1 226 ? -7.120  0.872   37.651  1.00 27.01 ? 226 LEU B CA  1 
ATOM   5079  C C   . LEU B 1 226 ? -7.302  2.238   38.339  1.00 26.26 ? 226 LEU B C   1 
ATOM   5080  O O   . LEU B 1 226 ? -6.972  3.270   37.765  1.00 25.02 ? 226 LEU B O   1 
ATOM   5081  C CB  . LEU B 1 226 ? -5.688  0.407   37.953  1.00 26.03 ? 226 LEU B CB  1 
ATOM   5082  C CG  . LEU B 1 226 ? -5.281  -1.090  38.040  1.00 28.38 ? 226 LEU B CG  1 
ATOM   5083  C CD1 . LEU B 1 226 ? -6.192  -2.004  37.352  1.00 26.39 ? 226 LEU B CD1 1 
ATOM   5084  C CD2 . LEU B 1 226 ? -3.841  -1.332  37.657  1.00 22.85 ? 226 LEU B CD2 1 
ATOM   5085  N N   . ILE B 1 227 ? -7.732  2.216   39.596  1.00 26.55 ? 227 ILE B N   1 
ATOM   5086  C CA  . ILE B 1 227 ? -7.630  3.415   40.444  1.00 26.68 ? 227 ILE B CA  1 
ATOM   5087  C C   . ILE B 1 227 ? -6.559  3.177   41.498  1.00 27.19 ? 227 ILE B C   1 
ATOM   5088  O O   . ILE B 1 227 ? -6.633  2.207   42.292  1.00 26.41 ? 227 ILE B O   1 
ATOM   5089  C CB  . ILE B 1 227 ? -8.976  3.772   41.137  1.00 27.11 ? 227 ILE B CB  1 
ATOM   5090  C CG1 . ILE B 1 227 ? -10.041 4.158   40.096  1.00 26.35 ? 227 ILE B CG1 1 
ATOM   5091  C CG2 . ILE B 1 227 ? -8.825  4.929   42.168  1.00 25.65 ? 227 ILE B CG2 1 
ATOM   5092  C CD1 . ILE B 1 227 ? -11.407 3.839   40.591  1.00 26.73 ? 227 ILE B CD1 1 
ATOM   5093  N N   . ILE B 1 228 ? -5.555  4.040   41.513  1.00 26.92 ? 228 ILE B N   1 
ATOM   5094  C CA  . ILE B 1 228 ? -4.684  4.006   42.641  1.00 26.96 ? 228 ILE B CA  1 
ATOM   5095  C C   . ILE B 1 228 ? -5.019  5.064   43.707  1.00 26.57 ? 228 ILE B C   1 
ATOM   5096  O O   . ILE B 1 228 ? -4.930  6.287   43.488  1.00 26.63 ? 228 ILE B O   1 
ATOM   5097  C CB  . ILE B 1 228 ? -3.154  3.698   42.311  1.00 28.54 ? 228 ILE B CB  1 
ATOM   5098  C CG1 . ILE B 1 228 ? -2.230  4.774   42.767  1.00 28.15 ? 228 ILE B CG1 1 
ATOM   5099  C CG2 . ILE B 1 228 ? -2.892  3.127   40.870  1.00 27.80 ? 228 ILE B CG2 1 
ATOM   5100  C CD1 . ILE B 1 228 ? -1.782  4.488   44.090  1.00 32.81 ? 228 ILE B CD1 1 
ATOM   5101  N N   . GLU B 1 229 ? -5.478  4.547   44.835  1.00 26.10 ? 229 GLU B N   1 
ATOM   5102  C CA  . GLU B 1 229 ? -6.055  5.317   45.927  1.00 25.74 ? 229 GLU B CA  1 
ATOM   5103  C C   . GLU B 1 229 ? -4.933  5.513   46.939  1.00 24.84 ? 229 GLU B C   1 
ATOM   5104  O O   . GLU B 1 229 ? -4.685  4.646   47.761  1.00 24.92 ? 229 GLU B O   1 
ATOM   5105  C CB  . GLU B 1 229 ? -7.224  4.504   46.528  1.00 26.00 ? 229 GLU B CB  1 
ATOM   5106  C CG  . GLU B 1 229 ? -7.959  5.211   47.659  1.00 27.22 ? 229 GLU B CG  1 
ATOM   5107  C CD  . GLU B 1 229 ? -9.327  4.625   47.968  1.00 28.20 ? 229 GLU B CD  1 
ATOM   5108  O OE1 . GLU B 1 229 ? -9.474  3.401   48.205  1.00 29.07 ? 229 GLU B OE1 1 
ATOM   5109  O OE2 . GLU B 1 229 ? -10.287 5.424   48.001  1.00 31.53 ? 229 GLU B OE2 1 
ATOM   5110  N N   . ASP B 1 230 ? -4.220  6.627   46.816  1.00 24.42 ? 230 ASP B N   1 
ATOM   5111  C CA  . ASP B 1 230 ? -3.184  7.014   47.765  1.00 23.46 ? 230 ASP B CA  1 
ATOM   5112  C C   . ASP B 1 230 ? -3.820  7.865   48.866  1.00 22.96 ? 230 ASP B C   1 
ATOM   5113  O O   . ASP B 1 230 ? -4.087  9.083   48.680  1.00 22.55 ? 230 ASP B O   1 
ATOM   5114  C CB  . ASP B 1 230 ? -2.051  7.746   47.019  1.00 23.04 ? 230 ASP B CB  1 
ATOM   5115  C CG  . ASP B 1 230 ? -0.872  8.127   47.931  1.00 21.97 ? 230 ASP B CG  1 
ATOM   5116  O OD1 . ASP B 1 230 ? -0.729  7.543   49.031  1.00 25.29 ? 230 ASP B OD1 1 
ATOM   5117  O OD2 . ASP B 1 230 ? -0.103  9.043   47.553  1.00 23.07 ? 230 ASP B OD2 1 
ATOM   5118  N N   . ASP B 1 231 ? -4.028  7.230   50.018  1.00 21.93 ? 231 ASP B N   1 
ATOM   5119  C CA  . ASP B 1 231 ? -4.898  7.772   51.032  1.00 23.08 ? 231 ASP B CA  1 
ATOM   5120  C C   . ASP B 1 231 ? -4.210  7.898   52.428  1.00 22.52 ? 231 ASP B C   1 
ATOM   5121  O O   . ASP B 1 231 ? -4.729  7.410   53.413  1.00 22.28 ? 231 ASP B O   1 
ATOM   5122  C CB  . ASP B 1 231 ? -6.198  6.906   51.046  1.00 22.62 ? 231 ASP B CB  1 
ATOM   5123  C CG  . ASP B 1 231 ? -7.457  7.707   51.409  1.00 24.57 ? 231 ASP B CG  1 
ATOM   5124  O OD1 . ASP B 1 231 ? -7.363  8.918   51.761  1.00 23.47 ? 231 ASP B OD1 1 
ATOM   5125  O OD2 . ASP B 1 231 ? -8.531  7.086   51.371  1.00 22.72 ? 231 ASP B OD2 1 
ATOM   5126  N N   . PRO B 1 232 ? -3.073  8.628   52.506  1.00 21.78 ? 232 PRO B N   1 
ATOM   5127  C CA  . PRO B 1 232 ? -2.370  8.758   53.802  1.00 22.53 ? 232 PRO B CA  1 
ATOM   5128  C C   . PRO B 1 232 ? -3.042  9.662   54.843  1.00 22.59 ? 232 PRO B C   1 
ATOM   5129  O O   . PRO B 1 232 ? -2.675  9.625   56.016  1.00 22.64 ? 232 PRO B O   1 
ATOM   5130  C CB  . PRO B 1 232 ? -0.991  9.303   53.400  1.00 22.44 ? 232 PRO B CB  1 
ATOM   5131  C CG  . PRO B 1 232 ? -1.217  10.042  52.152  1.00 22.03 ? 232 PRO B CG  1 
ATOM   5132  C CD  . PRO B 1 232 ? -2.394  9.409   51.444  1.00 22.27 ? 232 PRO B CD  1 
ATOM   5133  N N   . TYR B 1 233 ? -4.044  10.430  54.424  1.00 23.44 ? 233 TYR B N   1 
ATOM   5134  C CA  . TYR B 1 233 ? -4.783  11.326  55.334  1.00 23.03 ? 233 TYR B CA  1 
ATOM   5135  C C   . TYR B 1 233 ? -6.180  10.792  55.539  1.00 23.07 ? 233 TYR B C   1 
ATOM   5136  O O   . TYR B 1 233 ? -7.089  11.502  56.023  1.00 22.66 ? 233 TYR B O   1 
ATOM   5137  C CB  . TYR B 1 233 ? -4.815  12.793  54.799  1.00 23.47 ? 233 TYR B CB  1 
ATOM   5138  C CG  . TYR B 1 233 ? -3.426  13.317  54.434  1.00 24.36 ? 233 TYR B CG  1 
ATOM   5139  C CD1 . TYR B 1 233 ? -2.518  13.657  55.427  1.00 23.53 ? 233 TYR B CD1 1 
ATOM   5140  C CD2 . TYR B 1 233 ? -3.013  13.410  53.094  1.00 25.57 ? 233 TYR B CD2 1 
ATOM   5141  C CE1 . TYR B 1 233 ? -1.252  14.100  55.114  1.00 23.18 ? 233 TYR B CE1 1 
ATOM   5142  C CE2 . TYR B 1 233 ? -1.727  13.866  52.764  1.00 22.64 ? 233 TYR B CE2 1 
ATOM   5143  C CZ  . TYR B 1 233 ? -0.864  14.194  53.803  1.00 25.44 ? 233 TYR B CZ  1 
ATOM   5144  O OH  . TYR B 1 233 ? 0.410   14.616  53.567  1.00 26.92 ? 233 TYR B OH  1 
ATOM   5145  N N   . TYR B 1 234 ? -6.371  9.530   55.176  1.00 22.26 ? 234 TYR B N   1 
ATOM   5146  C CA  . TYR B 1 234 ? -7.621  8.863   55.423  1.00 22.95 ? 234 TYR B CA  1 
ATOM   5147  C C   . TYR B 1 234 ? -8.010  8.924   56.903  1.00 23.49 ? 234 TYR B C   1 
ATOM   5148  O O   . TYR B 1 234 ? -9.202  9.027   57.220  1.00 24.98 ? 234 TYR B O   1 
ATOM   5149  C CB  . TYR B 1 234 ? -7.563  7.395   54.981  1.00 22.24 ? 234 TYR B CB  1 
ATOM   5150  C CG  . TYR B 1 234 ? -8.827  6.721   55.302  1.00 22.66 ? 234 TYR B CG  1 
ATOM   5151  C CD1 . TYR B 1 234 ? -9.963  6.925   54.520  1.00 22.59 ? 234 TYR B CD1 1 
ATOM   5152  C CD2 . TYR B 1 234 ? -8.927  5.908   56.418  1.00 23.42 ? 234 TYR B CD2 1 
ATOM   5153  C CE1 . TYR B 1 234 ? -11.156 6.319   54.849  1.00 23.04 ? 234 TYR B CE1 1 
ATOM   5154  C CE2 . TYR B 1 234 ? -10.108 5.290   56.754  1.00 26.56 ? 234 TYR B CE2 1 
ATOM   5155  C CZ  . TYR B 1 234 ? -11.221 5.509   55.980  1.00 26.05 ? 234 TYR B CZ  1 
ATOM   5156  O OH  . TYR B 1 234 ? -12.379 4.896   56.365  1.00 26.31 ? 234 TYR B OH  1 
ATOM   5157  N N   . PHE B 1 235 ? -7.035  8.796   57.802  1.00 22.81 ? 235 PHE B N   1 
ATOM   5158  C CA  . PHE B 1 235 ? -7.370  8.879   59.243  1.00 24.35 ? 235 PHE B CA  1 
ATOM   5159  C C   . PHE B 1 235 ? -7.310  10.310  59.808  1.00 24.75 ? 235 PHE B C   1 
ATOM   5160  O O   . PHE B 1 235 ? -7.323  10.501  61.022  1.00 23.77 ? 235 PHE B O   1 
ATOM   5161  C CB  . PHE B 1 235 ? -6.514  7.914   60.066  1.00 23.85 ? 235 PHE B CB  1 
ATOM   5162  C CG  . PHE B 1 235 ? -6.750  6.458   59.737  1.00 25.11 ? 235 PHE B CG  1 
ATOM   5163  C CD1 . PHE B 1 235 ? -5.745  5.705   59.117  1.00 24.30 ? 235 PHE B CD1 1 
ATOM   5164  C CD2 . PHE B 1 235 ? -7.977  5.854   60.025  1.00 23.75 ? 235 PHE B CD2 1 
ATOM   5165  C CE1 . PHE B 1 235 ? -5.947  4.339   58.805  1.00 22.72 ? 235 PHE B CE1 1 
ATOM   5166  C CE2 . PHE B 1 235 ? -8.206  4.488   59.729  1.00 25.22 ? 235 PHE B CE2 1 
ATOM   5167  C CZ  . PHE B 1 235 ? -7.189  3.738   59.101  1.00 23.00 ? 235 PHE B CZ  1 
ATOM   5168  N N   . LEU B 1 236 ? -7.285  11.315  58.919  1.00 25.05 ? 236 LEU B N   1 
ATOM   5169  C CA  . LEU B 1 236 ? -7.239  12.709  59.344  1.00 26.14 ? 236 LEU B CA  1 
ATOM   5170  C C   . LEU B 1 236 ? -8.385  13.538  58.726  1.00 26.35 ? 236 LEU B C   1 
ATOM   5171  O O   . LEU B 1 236 ? -8.210  14.717  58.407  1.00 27.13 ? 236 LEU B O   1 
ATOM   5172  C CB  . LEU B 1 236 ? -5.851  13.300  59.025  1.00 27.01 ? 236 LEU B CB  1 
ATOM   5173  C CG  . LEU B 1 236 ? -4.821  13.679  60.099  1.00 31.03 ? 236 LEU B CG  1 
ATOM   5174  C CD1 . LEU B 1 236 ? -4.689  12.649  61.161  1.00 31.95 ? 236 LEU B CD1 1 
ATOM   5175  C CD2 . LEU B 1 236 ? -3.428  14.013  59.510  1.00 28.79 ? 236 LEU B CD2 1 
ATOM   5176  N N   . GLN B 1 237 ? -9.557  12.925  58.575  1.00 25.58 ? 237 GLN B N   1 
ATOM   5177  C CA  . GLN B 1 237 ? -10.701 13.620  58.018  1.00 26.02 ? 237 GLN B CA  1 
ATOM   5178  C C   . GLN B 1 237 ? -11.386 14.384  59.159  1.00 27.03 ? 237 GLN B C   1 
ATOM   5179  O O   . GLN B 1 237 ? -11.685 13.825  60.197  1.00 26.00 ? 237 GLN B O   1 
ATOM   5180  C CB  . GLN B 1 237 ? -11.691 12.638  57.332  1.00 25.08 ? 237 GLN B CB  1 
ATOM   5181  C CG  . GLN B 1 237 ? -11.064 11.785  56.196  1.00 24.52 ? 237 GLN B CG  1 
ATOM   5182  C CD  . GLN B 1 237 ? -12.020 10.741  55.607  1.00 26.42 ? 237 GLN B CD  1 
ATOM   5183  O OE1 . GLN B 1 237 ? -11.674 9.553   55.469  1.00 26.59 ? 237 GLN B OE1 1 
ATOM   5184  N NE2 . GLN B 1 237 ? -13.210 11.175  55.246  1.00 23.92 ? 237 GLN B NE2 1 
ATOM   5185  N N   . PHE B 1 238 ? -11.631 15.661  58.945  1.00 28.49 ? 238 PHE B N   1 
ATOM   5186  C CA  . PHE B 1 238 ? -12.302 16.483  59.938  1.00 30.73 ? 238 PHE B CA  1 
ATOM   5187  C C   . PHE B 1 238 ? -13.791 16.173  60.120  1.00 32.70 ? 238 PHE B C   1 
ATOM   5188  O O   . PHE B 1 238 ? -14.299 16.186  61.261  1.00 34.43 ? 238 PHE B O   1 
ATOM   5189  C CB  . PHE B 1 238 ? -12.033 17.949  59.626  1.00 30.10 ? 238 PHE B CB  1 
ATOM   5190  C CG  . PHE B 1 238 ? -10.569 18.258  59.553  1.00 27.76 ? 238 PHE B CG  1 
ATOM   5191  C CD1 . PHE B 1 238 ? -10.035 18.954  58.471  1.00 25.70 ? 238 PHE B CD1 1 
ATOM   5192  C CD2 . PHE B 1 238 ? -9.711  17.800  60.550  1.00 26.47 ? 238 PHE B CD2 1 
ATOM   5193  C CE1 . PHE B 1 238 ? -8.695  19.215  58.416  1.00 26.33 ? 238 PHE B CE1 1 
ATOM   5194  C CE2 . PHE B 1 238 ? -8.380  18.050  60.484  1.00 23.60 ? 238 PHE B CE2 1 
ATOM   5195  C CZ  . PHE B 1 238 ? -7.865  18.743  59.432  1.00 25.87 ? 238 PHE B CZ  1 
ATOM   5196  N N   . ASN B 1 239 ? -14.486 15.901  59.022  1.00 34.34 ? 239 ASN B N   1 
ATOM   5197  C CA  . ASN B 1 239 ? -15.841 15.391  59.095  1.00 36.33 ? 239 ASN B CA  1 
ATOM   5198  C C   . ASN B 1 239 ? -15.736 13.985  59.667  1.00 37.62 ? 239 ASN B C   1 
ATOM   5199  O O   . ASN B 1 239 ? -15.030 13.145  59.104  1.00 38.63 ? 239 ASN B O   1 
ATOM   5200  C CB  . ASN B 1 239 ? -16.472 15.382  57.700  1.00 37.16 ? 239 ASN B CB  1 
ATOM   5201  C CG  . ASN B 1 239 ? -17.965 15.069  57.723  1.00 38.69 ? 239 ASN B CG  1 
ATOM   5202  O OD1 . ASN B 1 239 ? -18.474 14.487  58.687  1.00 38.57 ? 239 ASN B OD1 1 
ATOM   5203  N ND2 . ASN B 1 239 ? -18.678 15.470  56.656  1.00 37.90 ? 239 ASN B ND2 1 
ATOM   5204  N N   . LYS B 1 240 ? -16.387 13.716  60.800  1.00 37.91 ? 240 LYS B N   1 
ATOM   5205  C CA  . LYS B 1 240 ? -16.122 12.444  61.474  1.00 38.60 ? 240 LYS B CA  1 
ATOM   5206  C C   . LYS B 1 240 ? -16.954 11.236  60.960  1.00 38.67 ? 240 LYS B C   1 
ATOM   5207  O O   . LYS B 1 240 ? -16.763 10.116  61.416  1.00 39.31 ? 240 LYS B O   1 
ATOM   5208  C CB  . LYS B 1 240 ? -16.051 12.608  63.013  1.00 39.44 ? 240 LYS B CB  1 
ATOM   5209  C CG  . LYS B 1 240 ? -14.842 13.497  63.447  1.00 40.85 ? 240 LYS B CG  1 
ATOM   5210  C CD  . LYS B 1 240 ? -14.542 13.460  64.948  1.00 45.87 ? 240 LYS B CD  1 
ATOM   5211  C CE  . LYS B 1 240 ? -13.870 12.136  65.297  1.00 47.81 ? 240 LYS B CE  1 
ATOM   5212  N NZ  . LYS B 1 240 ? -13.641 11.947  66.763  1.00 48.00 ? 240 LYS B NZ  1 
ATOM   5213  N N   . PHE B 1 241 ? -17.834 11.490  59.984  1.00 38.26 ? 241 PHE B N   1 
ATOM   5214  C CA  . PHE B 1 241 ? -18.401 10.462  59.127  1.00 37.53 ? 241 PHE B CA  1 
ATOM   5215  C C   . PHE B 1 241 ? -17.508 10.357  57.874  1.00 36.11 ? 241 PHE B C   1 
ATOM   5216  O O   . PHE B 1 241 ? -17.490 11.261  57.026  1.00 34.99 ? 241 PHE B O   1 
ATOM   5217  C CB  . PHE B 1 241 ? -19.871 10.778  58.776  1.00 38.84 ? 241 PHE B CB  1 
ATOM   5218  C CG  . PHE B 1 241 ? -20.800 10.804  59.983  1.00 41.94 ? 241 PHE B CG  1 
ATOM   5219  C CD1 . PHE B 1 241 ? -20.980 11.989  60.719  1.00 44.26 ? 241 PHE B CD1 1 
ATOM   5220  C CD2 . PHE B 1 241 ? -21.484 9.644   60.388  1.00 44.60 ? 241 PHE B CD2 1 
ATOM   5221  C CE1 . PHE B 1 241 ? -21.831 12.027  61.861  1.00 43.20 ? 241 PHE B CE1 1 
ATOM   5222  C CE2 . PHE B 1 241 ? -22.349 9.667   61.523  1.00 45.28 ? 241 PHE B CE2 1 
ATOM   5223  C CZ  . PHE B 1 241 ? -22.512 10.872  62.258  1.00 44.12 ? 241 PHE B CZ  1 
ATOM   5224  N N   . ARG B 1 242 ? -16.718 9.284   57.799  1.00 34.71 ? 242 ARG B N   1 
ATOM   5225  C CA  . ARG B 1 242 ? -15.687 9.168   56.742  1.00 34.18 ? 242 ARG B CA  1 
ATOM   5226  C C   . ARG B 1 242 ? -16.344 8.824   55.418  1.00 33.65 ? 242 ARG B C   1 
ATOM   5227  O O   . ARG B 1 242 ? -17.213 7.962   55.368  1.00 33.37 ? 242 ARG B O   1 
ATOM   5228  C CB  . ARG B 1 242 ? -14.660 8.084   57.072  1.00 34.14 ? 242 ARG B CB  1 
ATOM   5229  C CG  . ARG B 1 242 ? -13.579 8.487   58.041  1.00 35.12 ? 242 ARG B CG  1 
ATOM   5230  C CD  . ARG B 1 242 ? -12.828 7.231   58.494  1.00 39.54 ? 242 ARG B CD  1 
ATOM   5231  N NE  . ARG B 1 242 ? -13.207 7.001   59.867  1.00 43.08 ? 242 ARG B NE  1 
ATOM   5232  C CZ  . ARG B 1 242 ? -13.848 5.952   60.358  1.00 43.48 ? 242 ARG B CZ  1 
ATOM   5233  N NH1 . ARG B 1 242 ? -14.179 4.897   59.625  1.00 42.26 ? 242 ARG B NH1 1 
ATOM   5234  N NH2 . ARG B 1 242 ? -14.116 5.975   61.649  1.00 43.17 ? 242 ARG B NH2 1 
ATOM   5235  N N   . VAL B 1 243 ? -15.948 9.515   54.355  1.00 33.22 ? 243 VAL B N   1 
ATOM   5236  C CA  . VAL B 1 243 ? -16.460 9.177   53.034  1.00 33.51 ? 243 VAL B CA  1 
ATOM   5237  C C   . VAL B 1 243 ? -15.986 7.763   52.578  1.00 32.70 ? 243 VAL B C   1 
ATOM   5238  O O   . VAL B 1 243 ? -14.824 7.399   52.782  1.00 32.01 ? 243 VAL B O   1 
ATOM   5239  C CB  . VAL B 1 243 ? -16.328 10.350  51.975  1.00 33.37 ? 243 VAL B CB  1 
ATOM   5240  C CG1 . VAL B 1 243 ? -15.172 11.293  52.273  1.00 36.82 ? 243 VAL B CG1 1 
ATOM   5241  C CG2 . VAL B 1 243 ? -16.341 9.851   50.528  1.00 33.72 ? 243 VAL B CG2 1 
ATOM   5242  N N   . PRO B 1 244 ? -16.923 6.951   52.025  1.00 32.09 ? 244 PRO B N   1 
ATOM   5243  C CA  . PRO B 1 244 ? -16.620 5.658   51.425  1.00 30.95 ? 244 PRO B CA  1 
ATOM   5244  C C   . PRO B 1 244 ? -15.369 5.703   50.526  1.00 30.00 ? 244 PRO B C   1 
ATOM   5245  O O   . PRO B 1 244 ? -15.170 6.653   49.785  1.00 29.88 ? 244 PRO B O   1 
ATOM   5246  C CB  . PRO B 1 244 ? -17.893 5.363   50.629  1.00 32.37 ? 244 PRO B CB  1 
ATOM   5247  C CG  . PRO B 1 244 ? -18.987 5.925   51.582  1.00 33.08 ? 244 PRO B CG  1 
ATOM   5248  C CD  . PRO B 1 244 ? -18.369 7.247   51.972  1.00 32.01 ? 244 PRO B CD  1 
ATOM   5249  N N   . THR B 1 245 ? -14.503 4.705   50.638  1.00 28.92 ? 245 THR B N   1 
ATOM   5250  C CA  . THR B 1 245 ? -13.290 4.660   49.822  1.00 27.41 ? 245 THR B CA  1 
ATOM   5251  C C   . THR B 1 245 ? -13.584 3.996   48.492  1.00 27.23 ? 245 THR B C   1 
ATOM   5252  O O   . THR B 1 245 ? -14.618 3.299   48.370  1.00 26.63 ? 245 THR B O   1 
ATOM   5253  C CB  . THR B 1 245 ? -12.185 3.890   50.514  1.00 28.15 ? 245 THR B CB  1 
ATOM   5254  O OG1 . THR B 1 245 ? -12.627 2.540   50.752  1.00 27.76 ? 245 THR B OG1 1 
ATOM   5255  C CG2 . THR B 1 245 ? -11.830 4.594   51.836  1.00 26.39 ? 245 THR B CG2 1 
ATOM   5256  N N   . PHE B 1 246 ? -12.704 4.235   47.513  1.00 25.55 ? 246 PHE B N   1 
ATOM   5257  C CA  . PHE B 1 246 ? -12.700 3.464   46.271  1.00 27.49 ? 246 PHE B CA  1 
ATOM   5258  C C   . PHE B 1 246 ? -12.610 1.961   46.553  1.00 27.48 ? 246 PHE B C   1 
ATOM   5259  O O   . PHE B 1 246 ? -13.315 1.145   45.927  1.00 28.74 ? 246 PHE B O   1 
ATOM   5260  C CB  . PHE B 1 246 ? -11.555 3.932   45.363  1.00 26.81 ? 246 PHE B CB  1 
ATOM   5261  C CG  . PHE B 1 246 ? -11.799 5.269   44.702  1.00 27.37 ? 246 PHE B CG  1 
ATOM   5262  C CD1 . PHE B 1 246 ? -11.004 6.380   45.011  1.00 24.47 ? 246 PHE B CD1 1 
ATOM   5263  C CD2 . PHE B 1 246 ? -12.804 5.396   43.744  1.00 26.11 ? 246 PHE B CD2 1 
ATOM   5264  C CE1 . PHE B 1 246 ? -11.215 7.616   44.394  1.00 26.69 ? 246 PHE B CE1 1 
ATOM   5265  C CE2 . PHE B 1 246 ? -13.044 6.621   43.107  1.00 23.91 ? 246 PHE B CE2 1 
ATOM   5266  C CZ  . PHE B 1 246 ? -12.241 7.746   43.420  1.00 27.75 ? 246 PHE B CZ  1 
ATOM   5267  N N   . LEU B 1 247 ? -11.786 1.600   47.542  1.00 27.04 ? 247 LEU B N   1 
ATOM   5268  C CA  . LEU B 1 247 ? -11.637 0.195   47.922  1.00 26.41 ? 247 LEU B CA  1 
ATOM   5269  C C   . LEU B 1 247 ? -12.968 -0.385  48.357  1.00 27.70 ? 247 LEU B C   1 
ATOM   5270  O O   . LEU B 1 247 ? -13.256 -1.539  48.033  1.00 26.79 ? 247 LEU B O   1 
ATOM   5271  C CB  . LEU B 1 247 ? -10.598 -0.016  49.024  1.00 25.72 ? 247 LEU B CB  1 
ATOM   5272  C CG  . LEU B 1 247 ? -10.422 -1.481  49.444  1.00 25.99 ? 247 LEU B CG  1 
ATOM   5273  C CD1 . LEU B 1 247 ? -9.827  -2.266  48.269  1.00 22.00 ? 247 LEU B CD1 1 
ATOM   5274  C CD2 . LEU B 1 247 ? -9.515  -1.593  50.725  1.00 26.39 ? 247 LEU B CD2 1 
ATOM   5275  N N   . SER B 1 248 ? -13.783 0.432   49.045  1.00 28.60 ? 248 SER B N   1 
ATOM   5276  C CA  . SER B 1 248 ? -15.075 -0.023  49.559  1.00 30.15 ? 248 SER B CA  1 
ATOM   5277  C C   . SER B 1 248 ? -16.107 -0.306  48.469  1.00 29.84 ? 248 SER B C   1 
ATOM   5278  O O   . SER B 1 248 ? -17.049 -1.098  48.690  1.00 30.86 ? 248 SER B O   1 
ATOM   5279  C CB  . SER B 1 248 ? -15.663 0.943   50.612  1.00 29.75 ? 248 SER B CB  1 
ATOM   5280  O OG  . SER B 1 248 ? -16.112 2.152   50.033  1.00 29.70 ? 248 SER B OG  1 
ATOM   5281  N N   . MET B 1 249 ? -15.929 0.312   47.317  1.00 30.35 ? 249 MET B N   1 
ATOM   5282  C CA  . MET B 1 249 ? -16.840 0.095   46.177  1.00 31.23 ? 249 MET B CA  1 
ATOM   5283  C C   . MET B 1 249 ? -16.249 -0.809  45.073  1.00 31.46 ? 249 MET B C   1 
ATOM   5284  O O   . MET B 1 249 ? -16.837 -0.971  43.993  1.00 32.27 ? 249 MET B O   1 
ATOM   5285  C CB  . MET B 1 249 ? -17.334 1.436   45.605  1.00 31.51 ? 249 MET B CB  1 
ATOM   5286  C CG  . MET B 1 249 ? -16.292 2.413   45.235  1.00 33.03 ? 249 MET B CG  1 
ATOM   5287  S SD  . MET B 1 249 ? -16.862 4.105   44.946  1.00 40.00 ? 249 MET B SD  1 
ATOM   5288  C CE  . MET B 1 249 ? -17.243 4.646   46.609  1.00 38.71 ? 249 MET B CE  1 
ATOM   5289  N N   . ASP B 1 250 ? -15.106 -1.426  45.360  1.00 31.41 ? 250 ASP B N   1 
ATOM   5290  C CA  . ASP B 1 250 ? -14.311 -2.051  44.305  1.00 31.22 ? 250 ASP B CA  1 
ATOM   5291  C C   . ASP B 1 250 ? -14.780 -3.447  43.918  1.00 31.06 ? 250 ASP B C   1 
ATOM   5292  O O   . ASP B 1 250 ? -14.109 -4.444  44.173  1.00 30.00 ? 250 ASP B O   1 
ATOM   5293  C CB  . ASP B 1 250 ? -12.826 -2.054  44.651  1.00 30.50 ? 250 ASP B CB  1 
ATOM   5294  C CG  . ASP B 1 250 ? -11.967 -2.609  43.516  1.00 30.11 ? 250 ASP B CG  1 
ATOM   5295  O OD1 . ASP B 1 250 ? -12.351 -2.465  42.330  1.00 29.48 ? 250 ASP B OD1 1 
ATOM   5296  O OD2 . ASP B 1 250 ? -10.922 -3.217  43.804  1.00 27.67 ? 250 ASP B OD2 1 
ATOM   5297  N N   . VAL B 1 251 ? -15.928 -3.499  43.254  1.00 31.50 ? 251 VAL B N   1 
ATOM   5298  C CA  . VAL B 1 251 ? -16.528 -4.766  42.893  1.00 32.48 ? 251 VAL B CA  1 
ATOM   5299  C C   . VAL B 1 251 ? -15.788 -5.483  41.727  1.00 32.37 ? 251 VAL B C   1 
ATOM   5300  O O   . VAL B 1 251 ? -15.805 -6.712  41.665  1.00 32.49 ? 251 VAL B O   1 
ATOM   5301  C CB  . VAL B 1 251 ? -18.031 -4.584  42.632  1.00 32.69 ? 251 VAL B CB  1 
ATOM   5302  C CG1 . VAL B 1 251 ? -18.241 -3.713  41.404  1.00 33.47 ? 251 VAL B CG1 1 
ATOM   5303  C CG2 . VAL B 1 251 ? -18.708 -5.945  42.469  1.00 36.96 ? 251 VAL B CG2 1 
ATOM   5304  N N   . ASP B 1 252 ? -15.107 -4.717  40.866  1.00 31.97 ? 252 ASP B N   1 
ATOM   5305  C CA  . ASP B 1 252 ? -14.255 -5.277  39.775  1.00 33.14 ? 252 ASP B CA  1 
ATOM   5306  C C   . ASP B 1 252 ? -12.860 -5.797  40.172  1.00 32.25 ? 252 ASP B C   1 
ATOM   5307  O O   . ASP B 1 252 ? -12.256 -6.585  39.436  1.00 32.96 ? 252 ASP B O   1 
ATOM   5308  C CB  . ASP B 1 252 ? -14.061 -4.273  38.629  1.00 32.45 ? 252 ASP B CB  1 
ATOM   5309  C CG  . ASP B 1 252 ? -15.368 -3.812  38.012  1.00 34.95 ? 252 ASP B CG  1 
ATOM   5310  O OD1 . ASP B 1 252 ? -16.442 -4.368  38.332  1.00 39.02 ? 252 ASP B OD1 1 
ATOM   5311  O OD2 . ASP B 1 252 ? -15.329 -2.855  37.228  1.00 35.43 ? 252 ASP B OD2 1 
ATOM   5312  N N   . GLY B 1 253 ? -12.332 -5.351  41.306  1.00 31.90 ? 253 GLY B N   1 
ATOM   5313  C CA  . GLY B 1 253 ? -10.941 -5.654  41.650  1.00 30.55 ? 253 GLY B CA  1 
ATOM   5314  C C   . GLY B 1 253 ? -9.968  -4.786  40.874  1.00 30.11 ? 253 GLY B C   1 
ATOM   5315  O O   . GLY B 1 253 ? -8.928  -5.238  40.417  1.00 31.18 ? 253 GLY B O   1 
ATOM   5316  N N   . ARG B 1 254 ? -10.293 -3.515  40.720  1.00 29.59 ? 254 ARG B N   1 
ATOM   5317  C CA  . ARG B 1 254 ? -9.421  -2.598  39.964  1.00 28.04 ? 254 ARG B CA  1 
ATOM   5318  C C   . ARG B 1 254 ? -8.808  -1.509  40.854  1.00 27.23 ? 254 ARG B C   1 
ATOM   5319  O O   . ARG B 1 254 ? -8.218  -0.559  40.374  1.00 26.82 ? 254 ARG B O   1 
ATOM   5320  C CB  . ARG B 1 254 ? -10.192 -1.956  38.794  1.00 28.46 ? 254 ARG B CB  1 
ATOM   5321  C CG  . ARG B 1 254 ? -11.321 -0.974  39.180  1.00 27.83 ? 254 ARG B CG  1 
ATOM   5322  C CD  . ARG B 1 254 ? -11.987 -0.318  37.949  1.00 29.11 ? 254 ARG B CD  1 
ATOM   5323  N NE  . ARG B 1 254 ? -12.678 -1.304  37.141  1.00 28.02 ? 254 ARG B NE  1 
ATOM   5324  C CZ  . ARG B 1 254 ? -12.176 -1.880  36.057  1.00 29.69 ? 254 ARG B CZ  1 
ATOM   5325  N NH1 . ARG B 1 254 ? -10.946 -1.571  35.615  1.00 23.02 ? 254 ARG B NH1 1 
ATOM   5326  N NH2 . ARG B 1 254 ? -12.917 -2.797  35.427  1.00 30.33 ? 254 ARG B NH2 1 
ATOM   5327  N N   . VAL B 1 255 ? -8.967  -1.629  42.160  1.00 27.14 ? 255 VAL B N   1 
ATOM   5328  C CA  . VAL B 1 255 ? -8.390  -0.604  43.040  1.00 26.04 ? 255 VAL B CA  1 
ATOM   5329  C C   . VAL B 1 255 ? -7.116  -1.060  43.751  1.00 25.47 ? 255 VAL B C   1 
ATOM   5330  O O   . VAL B 1 255 ? -7.073  -2.140  44.313  1.00 25.25 ? 255 VAL B O   1 
ATOM   5331  C CB  . VAL B 1 255 ? -9.451  -0.123  44.062  1.00 27.21 ? 255 VAL B CB  1 
ATOM   5332  C CG1 . VAL B 1 255 ? -8.798  0.760   45.178  1.00 26.98 ? 255 VAL B CG1 1 
ATOM   5333  C CG2 . VAL B 1 255 ? -10.580 0.638   43.342  1.00 25.72 ? 255 VAL B CG2 1 
ATOM   5334  N N   . ILE B 1 256 ? -6.075  -0.239  43.708  1.00 25.45 ? 256 ILE B N   1 
ATOM   5335  C CA  . ILE B 1 256 ? -4.915  -0.412  44.583  1.00 25.96 ? 256 ILE B CA  1 
ATOM   5336  C C   . ILE B 1 256 ? -4.894  0.753   45.603  1.00 25.73 ? 256 ILE B C   1 
ATOM   5337  O O   . ILE B 1 256 ? -4.906  1.918   45.197  1.00 24.78 ? 256 ILE B O   1 
ATOM   5338  C CB  . ILE B 1 256 ? -3.562  -0.433  43.799  1.00 26.19 ? 256 ILE B CB  1 
ATOM   5339  C CG1 . ILE B 1 256 ? -3.452  -1.667  42.878  1.00 26.76 ? 256 ILE B CG1 1 
ATOM   5340  C CG2 . ILE B 1 256 ? -2.368  -0.357  44.764  1.00 25.47 ? 256 ILE B CG2 1 
ATOM   5341  C CD1 . ILE B 1 256 ? -2.327  -1.559  41.859  1.00 21.77 ? 256 ILE B CD1 1 
ATOM   5342  N N   . ARG B 1 257 ? -4.900  0.411   46.900  1.00 25.95 ? 257 ARG B N   1 
ATOM   5343  C CA  . ARG B 1 257 ? -5.026  1.381   48.003  1.00 24.84 ? 257 ARG B CA  1 
ATOM   5344  C C   . ARG B 1 257 ? -3.750  1.452   48.816  1.00 24.27 ? 257 ARG B C   1 
ATOM   5345  O O   . ARG B 1 257 ? -3.245  0.434   49.258  1.00 23.66 ? 257 ARG B O   1 
ATOM   5346  C CB  . ARG B 1 257 ? -6.227  1.032   48.930  1.00 25.98 ? 257 ARG B CB  1 
ATOM   5347  C CG  . ARG B 1 257 ? -6.154  1.775   50.289  1.00 26.89 ? 257 ARG B CG  1 
ATOM   5348  C CD  . ARG B 1 257 ? -7.306  1.533   51.298  1.00 29.93 ? 257 ARG B CD  1 
ATOM   5349  N NE  . ARG B 1 257 ? -8.141  2.688   51.078  1.00 38.56 ? 257 ARG B NE  1 
ATOM   5350  C CZ  . ARG B 1 257 ? -8.215  3.833   51.749  1.00 32.78 ? 257 ARG B CZ  1 
ATOM   5351  N NH1 . ARG B 1 257 ? -7.675  4.080   52.953  1.00 32.75 ? 257 ARG B NH1 1 
ATOM   5352  N NH2 . ARG B 1 257 ? -8.976  4.738   51.182  1.00 34.97 ? 257 ARG B NH2 1 
ATOM   5353  N N   . ALA B 1 258 ? -3.201  2.655   49.006  1.00 23.63 ? 258 ALA B N   1 
ATOM   5354  C CA  . ALA B 1 258 ? -2.067  2.808   49.922  1.00 22.72 ? 258 ALA B CA  1 
ATOM   5355  C C   . ALA B 1 258 ? -2.548  3.540   51.162  1.00 23.50 ? 258 ALA B C   1 
ATOM   5356  O O   . ALA B 1 258 ? -3.155  4.624   51.053  1.00 23.84 ? 258 ALA B O   1 
ATOM   5357  C CB  . ALA B 1 258 ? -0.916  3.573   49.258  1.00 22.24 ? 258 ALA B CB  1 
ATOM   5358  N N   . ASP B 1 259 ? -2.257  2.930   52.322  1.00 24.04 ? 259 ASP B N   1 
ATOM   5359  C CA  . ASP B 1 259 ? -2.464  3.495   53.639  1.00 23.02 ? 259 ASP B CA  1 
ATOM   5360  C C   . ASP B 1 259 ? -1.142  3.743   54.337  1.00 23.58 ? 259 ASP B C   1 
ATOM   5361  O O   . ASP B 1 259 ? -0.150  3.031   54.136  1.00 23.10 ? 259 ASP B O   1 
ATOM   5362  C CB  . ASP B 1 259 ? -3.213  2.500   54.499  1.00 22.92 ? 259 ASP B CB  1 
ATOM   5363  C CG  . ASP B 1 259 ? -4.678  2.452   54.183  1.00 25.64 ? 259 ASP B CG  1 
ATOM   5364  O OD1 . ASP B 1 259 ? -5.411  3.341   54.682  1.00 26.57 ? 259 ASP B OD1 1 
ATOM   5365  O OD2 . ASP B 1 259 ? -5.085  1.488   53.481  1.00 25.84 ? 259 ASP B OD2 1 
ATOM   5366  N N   . SER B 1 260 ? -1.165  4.705   55.245  1.00 23.70 ? 260 SER B N   1 
ATOM   5367  C CA  . SER B 1 260 ? 0.052   5.112   55.925  1.00 23.35 ? 260 SER B CA  1 
ATOM   5368  C C   . SER B 1 260 ? -0.263  5.262   57.408  1.00 22.97 ? 260 SER B C   1 
ATOM   5369  O O   . SER B 1 260 ? -1.334  5.698   57.765  1.00 24.04 ? 260 SER B O   1 
ATOM   5370  C CB  . SER B 1 260 ? 0.511   6.443   55.315  1.00 22.90 ? 260 SER B CB  1 
ATOM   5371  O OG  . SER B 1 260 ? 1.704   6.896   55.950  1.00 28.17 ? 260 SER B OG  1 
ATOM   5372  N N   . PHE B 1 261 ? 0.660   4.860   58.254  1.00 22.62 ? 261 PHE B N   1 
ATOM   5373  C CA  . PHE B 1 261 ? 0.606   5.199   59.663  1.00 22.85 ? 261 PHE B CA  1 
ATOM   5374  C C   . PHE B 1 261 ? 1.462   6.422   59.954  1.00 21.72 ? 261 PHE B C   1 
ATOM   5375  O O   . PHE B 1 261 ? 1.614   6.826   61.110  1.00 21.46 ? 261 PHE B O   1 
ATOM   5376  C CB  . PHE B 1 261 ? 1.043   3.996   60.489  1.00 23.59 ? 261 PHE B CB  1 
ATOM   5377  C CG  . PHE B 1 261 ? -0.029  2.943   60.635  1.00 24.61 ? 261 PHE B CG  1 
ATOM   5378  C CD1 . PHE B 1 261 ? -1.373  3.279   60.622  1.00 27.97 ? 261 PHE B CD1 1 
ATOM   5379  C CD2 . PHE B 1 261 ? 0.305   1.621   60.839  1.00 28.84 ? 261 PHE B CD2 1 
ATOM   5380  C CE1 . PHE B 1 261 ? -2.369  2.299   60.777  1.00 29.14 ? 261 PHE B CE1 1 
ATOM   5381  C CE2 . PHE B 1 261 ? -0.674  0.669   61.037  1.00 27.35 ? 261 PHE B CE2 1 
ATOM   5382  C CZ  . PHE B 1 261 ? -2.011  1.010   60.987  1.00 29.78 ? 261 PHE B CZ  1 
ATOM   5383  N N   . SER B 1 262 ? 2.021   7.007   58.897  1.00 21.18 ? 262 SER B N   1 
ATOM   5384  C CA  . SER B 1 262 ? 3.034   8.045   59.047  1.00 22.09 ? 262 SER B CA  1 
ATOM   5385  C C   . SER B 1 262 ? 2.546   9.272   59.789  1.00 22.48 ? 262 SER B C   1 
ATOM   5386  O O   . SER B 1 262 ? 3.328   9.902   60.505  1.00 22.59 ? 262 SER B O   1 
ATOM   5387  C CB  . SER B 1 262 ? 3.570   8.487   57.695  1.00 21.76 ? 262 SER B CB  1 
ATOM   5388  O OG  . SER B 1 262 ? 4.429   7.473   57.218  1.00 22.53 ? 262 SER B OG  1 
ATOM   5389  N N   . LYS B 1 263 ? 1.282   9.621   59.552  1.00 23.82 ? 263 LYS B N   1 
ATOM   5390  C CA  . LYS B 1 263 ? 0.664   10.828  60.128  1.00 25.37 ? 263 LYS B CA  1 
ATOM   5391  C C   . LYS B 1 263 ? 0.086   10.571  61.508  1.00 25.63 ? 263 LYS B C   1 
ATOM   5392  O O   . LYS B 1 263 ? 0.000   11.488  62.336  1.00 27.29 ? 263 LYS B O   1 
ATOM   5393  C CB  . LYS B 1 263 ? -0.446  11.361  59.209  1.00 25.80 ? 263 LYS B CB  1 
ATOM   5394  C CG  . LYS B 1 263 ? -0.016  11.603  57.745  1.00 25.04 ? 263 LYS B CG  1 
ATOM   5395  C CD  . LYS B 1 263 ? 1.351   12.239  57.662  1.00 31.51 ? 263 LYS B CD  1 
ATOM   5396  C CE  . LYS B 1 263 ? 1.777   12.464  56.208  1.00 32.49 ? 263 LYS B CE  1 
ATOM   5397  N NZ  . LYS B 1 263 ? 2.043   11.189  55.488  1.00 34.97 ? 263 LYS B NZ  1 
ATOM   5398  N N   . ILE B 1 264 ? -0.308  9.327   61.783  1.00 25.10 ? 264 ILE B N   1 
ATOM   5399  C CA  . ILE B 1 264 ? -1.011  9.058   63.029  1.00 24.29 ? 264 ILE B CA  1 
ATOM   5400  C C   . ILE B 1 264 ? -0.199  8.285   64.082  1.00 23.61 ? 264 ILE B C   1 
ATOM   5401  O O   . ILE B 1 264 ? -0.458  8.431   65.283  1.00 24.00 ? 264 ILE B O   1 
ATOM   5402  C CB  . ILE B 1 264 ? -2.381  8.365   62.809  1.00 25.18 ? 264 ILE B CB  1 
ATOM   5403  C CG1 . ILE B 1 264 ? -2.283  7.182   61.828  1.00 25.88 ? 264 ILE B CG1 1 
ATOM   5404  C CG2 . ILE B 1 264 ? -3.438  9.367   62.299  1.00 25.39 ? 264 ILE B CG2 1 
ATOM   5405  C CD1 . ILE B 1 264 ? -3.389  6.193   62.041  1.00 29.17 ? 264 ILE B CD1 1 
ATOM   5406  N N   . ILE B 1 265 ? 0.766   7.483   63.655  1.00 20.78 ? 265 ILE B N   1 
ATOM   5407  C CA  . ILE B 1 265 ? 1.455   6.599   64.581  1.00 20.13 ? 265 ILE B CA  1 
ATOM   5408  C C   . ILE B 1 265 ? 2.968   6.839   64.577  1.00 19.83 ? 265 ILE B C   1 
ATOM   5409  O O   . ILE B 1 265 ? 3.589   6.937   65.652  1.00 19.25 ? 265 ILE B O   1 
ATOM   5410  C CB  . ILE B 1 265 ? 1.079   5.066   64.360  1.00 20.73 ? 265 ILE B CB  1 
ATOM   5411  C CG1 . ILE B 1 265 ? -0.364  4.766   64.868  1.00 23.73 ? 265 ILE B CG1 1 
ATOM   5412  C CG2 . ILE B 1 265 ? 2.064   4.152   65.080  1.00 20.06 ? 265 ILE B CG2 1 
ATOM   5413  C CD1 . ILE B 1 265 ? -1.057  3.569   64.140  1.00 23.74 ? 265 ILE B CD1 1 
ATOM   5414  N N   . SER B 1 266 ? 3.557   6.892   63.385  1.00 17.32 ? 266 SER B N   1 
ATOM   5415  C CA  . SER B 1 266 ? 4.966   7.212   63.209  1.00 19.19 ? 266 SER B CA  1 
ATOM   5416  C C   . SER B 1 266 ? 5.380   7.272   61.748  1.00 19.49 ? 266 SER B C   1 
ATOM   5417  O O   . SER B 1 266 ? 5.224   6.290   60.985  1.00 20.48 ? 266 SER B O   1 
ATOM   5418  C CB  . SER B 1 266 ? 5.925   6.261   63.942  1.00 19.03 ? 266 SER B CB  1 
ATOM   5419  O OG  . SER B 1 266 ? 7.304   6.594   63.651  1.00 18.63 ? 266 SER B OG  1 
ATOM   5420  N N   . SER B 1 267 ? 5.905   8.431   61.381  1.00 19.12 ? 267 SER B N   1 
ATOM   5421  C CA  . SER B 1 267 ? 6.570   8.580   60.103  1.00 19.38 ? 267 SER B CA  1 
ATOM   5422  C C   . SER B 1 267 ? 7.965   7.963   60.045  1.00 18.93 ? 267 SER B C   1 
ATOM   5423  O O   . SER B 1 267 ? 8.370   7.462   58.978  1.00 19.38 ? 267 SER B O   1 
ATOM   5424  C CB  . SER B 1 267 ? 6.620   10.064  59.731  1.00 19.61 ? 267 SER B CB  1 
ATOM   5425  O OG  . SER B 1 267 ? 7.049   10.822  60.843  1.00 23.21 ? 267 SER B OG  1 
ATOM   5426  N N   . GLY B 1 268 ? 8.723   8.055   61.144  1.00 17.40 ? 268 GLY B N   1 
ATOM   5427  C CA  . GLY B 1 268 ? 10.115  7.655   61.126  1.00 18.51 ? 268 GLY B CA  1 
ATOM   5428  C C   . GLY B 1 268 ? 10.323  6.146   61.186  1.00 19.41 ? 268 GLY B C   1 
ATOM   5429  O O   . GLY B 1 268 ? 11.413  5.664   60.851  1.00 20.11 ? 268 GLY B O   1 
ATOM   5430  N N   . LEU B 1 269 ? 9.297   5.411   61.636  1.00 18.55 ? 269 LEU B N   1 
ATOM   5431  C CA  . LEU B 1 269 ? 9.338   3.949   61.626  1.00 18.46 ? 269 LEU B CA  1 
ATOM   5432  C C   . LEU B 1 269 ? 9.203   3.317   60.235  1.00 19.35 ? 269 LEU B C   1 
ATOM   5433  O O   . LEU B 1 269 ? 9.508   2.146   60.090  1.00 20.54 ? 269 LEU B O   1 
ATOM   5434  C CB  . LEU B 1 269 ? 8.308   3.336   62.602  1.00 19.32 ? 269 LEU B CB  1 
ATOM   5435  C CG  . LEU B 1 269 ? 8.401   3.584   64.096  1.00 19.64 ? 269 LEU B CG  1 
ATOM   5436  C CD1 . LEU B 1 269 ? 7.196   2.928   64.812  1.00 23.30 ? 269 LEU B CD1 1 
ATOM   5437  C CD2 . LEU B 1 269 ? 9.705   3.079   64.669  1.00 19.42 ? 269 LEU B CD2 1 
ATOM   5438  N N   . ARG B 1 270 ? 8.741   4.067   59.232  1.00 20.31 ? 270 ARG B N   1 
ATOM   5439  C CA  . ARG B 1 270 ? 8.629   3.577   57.841  1.00 20.39 ? 270 ARG B CA  1 
ATOM   5440  C C   . ARG B 1 270 ? 7.768   2.284   57.808  1.00 21.88 ? 270 ARG B C   1 
ATOM   5441  O O   . ARG B 1 270 ? 8.258   1.221   57.445  1.00 21.26 ? 270 ARG B O   1 
ATOM   5442  C CB  . ARG B 1 270 ? 10.011  3.358   57.201  1.00 20.63 ? 270 ARG B CB  1 
ATOM   5443  C CG  . ARG B 1 270 ? 10.971  4.625   57.122  1.00 20.31 ? 270 ARG B CG  1 
ATOM   5444  C CD  . ARG B 1 270 ? 10.202  5.940   56.710  1.00 21.27 ? 270 ARG B CD  1 
ATOM   5445  N NE  . ARG B 1 270 ? 9.607   5.893   55.382  1.00 26.10 ? 270 ARG B NE  1 
ATOM   5446  C CZ  . ARG B 1 270 ? 8.429   6.430   55.057  1.00 23.61 ? 270 ARG B CZ  1 
ATOM   5447  N NH1 . ARG B 1 270 ? 7.653   7.032   55.969  1.00 21.79 ? 270 ARG B NH1 1 
ATOM   5448  N NH2 . ARG B 1 270 ? 7.975   6.300   53.810  1.00 24.23 ? 270 ARG B NH2 1 
ATOM   5449  N N   . ILE B 1 271 ? 6.502   2.408   58.216  1.00 21.99 ? 271 ILE B N   1 
ATOM   5450  C CA  . ILE B 1 271 ? 5.525   1.324   58.098  1.00 23.40 ? 271 ILE B CA  1 
ATOM   5451  C C   . ILE B 1 271 ? 4.214   1.833   57.487  1.00 22.71 ? 271 ILE B C   1 
ATOM   5452  O O   . ILE B 1 271 ? 3.530   2.683   58.069  1.00 23.82 ? 271 ILE B O   1 
ATOM   5453  C CB  . ILE B 1 271 ? 5.182   0.680   59.490  1.00 24.46 ? 271 ILE B CB  1 
ATOM   5454  C CG1 . ILE B 1 271 ? 6.427   0.111   60.183  1.00 24.08 ? 271 ILE B CG1 1 
ATOM   5455  C CG2 . ILE B 1 271 ? 4.018   -0.366  59.357  1.00 25.41 ? 271 ILE B CG2 1 
ATOM   5456  C CD1 . ILE B 1 271 ? 7.195   -0.988  59.417  1.00 27.39 ? 271 ILE B CD1 1 
ATOM   5457  N N   . GLY B 1 272 ? 3.868   1.322   56.317  1.00 21.68 ? 272 GLY B N   1 
ATOM   5458  C CA  . GLY B 1 272 ? 2.566   1.616   55.679  1.00 20.52 ? 272 GLY B CA  1 
ATOM   5459  C C   . GLY B 1 272 ? 2.067   0.294   55.105  1.00 19.92 ? 272 GLY B C   1 
ATOM   5460  O O   . GLY B 1 272 ? 2.631   -0.763  55.402  1.00 18.64 ? 272 GLY B O   1 
ATOM   5461  N N   . PHE B 1 273 ? 0.985   0.319   54.332  1.00 20.08 ? 273 PHE B N   1 
ATOM   5462  C CA  . PHE B 1 273 ? 0.494   -0.931  53.778  1.00 20.58 ? 273 PHE B CA  1 
ATOM   5463  C C   . PHE B 1 273 ? -0.271  -0.711  52.486  1.00 21.93 ? 273 PHE B C   1 
ATOM   5464  O O   . PHE B 1 273 ? -0.807  0.385   52.215  1.00 23.19 ? 273 PHE B O   1 
ATOM   5465  C CB  . PHE B 1 273 ? -0.304  -1.795  54.789  1.00 20.12 ? 273 PHE B CB  1 
ATOM   5466  C CG  . PHE B 1 273 ? -1.379  -1.041  55.559  1.00 22.06 ? 273 PHE B CG  1 
ATOM   5467  C CD1 . PHE B 1 273 ? -1.038  -0.177  56.598  1.00 19.57 ? 273 PHE B CD1 1 
ATOM   5468  C CD2 . PHE B 1 273 ? -2.737  -1.192  55.241  1.00 24.38 ? 273 PHE B CD2 1 
ATOM   5469  C CE1 . PHE B 1 273 ? -2.023  0.498   57.306  1.00 22.22 ? 273 PHE B CE1 1 
ATOM   5470  C CE2 . PHE B 1 273 ? -3.719  -0.530  55.968  1.00 21.83 ? 273 PHE B CE2 1 
ATOM   5471  C CZ  . PHE B 1 273 ? -3.370  0.311   56.996  1.00 20.71 ? 273 PHE B CZ  1 
ATOM   5472  N N   . LEU B 1 274 ? -0.281  -1.753  51.670  1.00 20.94 ? 274 LEU B N   1 
ATOM   5473  C CA  . LEU B 1 274 ? -0.809  -1.680  50.341  1.00 21.63 ? 274 LEU B CA  1 
ATOM   5474  C C   . LEU B 1 274 ? -1.865  -2.795  50.235  1.00 21.94 ? 274 LEU B C   1 
ATOM   5475  O O   . LEU B 1 274 ? -1.624  -3.957  50.629  1.00 21.67 ? 274 LEU B O   1 
ATOM   5476  C CB  . LEU B 1 274 ? 0.356   -1.832  49.344  1.00 22.28 ? 274 LEU B CB  1 
ATOM   5477  C CG  . LEU B 1 274 ? 0.133   -1.563  47.840  1.00 26.84 ? 274 LEU B CG  1 
ATOM   5478  C CD1 . LEU B 1 274 ? -0.058  -0.044  47.583  1.00 24.85 ? 274 LEU B CD1 1 
ATOM   5479  C CD2 . LEU B 1 274 ? 1.321   -2.142  47.002  1.00 24.50 ? 274 LEU B CD2 1 
ATOM   5480  N N   . THR B 1 275 ? -3.041  -2.407  49.759  1.00 22.59 ? 275 THR B N   1 
ATOM   5481  C CA  . THR B 1 275 ? -4.209  -3.270  49.665  1.00 23.46 ? 275 THR B CA  1 
ATOM   5482  C C   . THR B 1 275 ? -4.655  -3.265  48.212  1.00 24.19 ? 275 THR B C   1 
ATOM   5483  O O   . THR B 1 275 ? -4.754  -2.208  47.604  1.00 25.09 ? 275 THR B O   1 
ATOM   5484  C CB  . THR B 1 275 ? -5.348  -2.781  50.622  1.00 23.74 ? 275 THR B CB  1 
ATOM   5485  O OG1 . THR B 1 275 ? -4.812  -2.619  51.941  1.00 25.10 ? 275 THR B OG1 1 
ATOM   5486  C CG2 . THR B 1 275 ? -6.540  -3.800  50.686  1.00 19.57 ? 275 THR B CG2 1 
ATOM   5487  N N   . GLY B 1 276 ? -4.876  -4.449  47.639  1.00 25.72 ? 276 GLY B N   1 
ATOM   5488  C CA  . GLY B 1 276 ? -5.261  -4.580  46.243  1.00 25.55 ? 276 GLY B CA  1 
ATOM   5489  C C   . GLY B 1 276 ? -5.412  -6.022  45.760  1.00 26.27 ? 276 GLY B C   1 
ATOM   5490  O O   . GLY B 1 276 ? -5.250  -6.968  46.519  1.00 26.26 ? 276 GLY B O   1 
ATOM   5491  N N   . PRO B 1 277 ? -5.687  -6.189  44.462  1.00 27.20 ? 277 PRO B N   1 
ATOM   5492  C CA  . PRO B 1 277 ? -5.946  -7.502  43.842  1.00 26.77 ? 277 PRO B CA  1 
ATOM   5493  C C   . PRO B 1 277 ? -4.730  -8.399  44.025  1.00 26.75 ? 277 PRO B C   1 
ATOM   5494  O O   . PRO B 1 277 ? -3.621  -7.962  43.739  1.00 24.97 ? 277 PRO B O   1 
ATOM   5495  C CB  . PRO B 1 277 ? -6.131  -7.150  42.359  1.00 26.69 ? 277 PRO B CB  1 
ATOM   5496  C CG  . PRO B 1 277 ? -6.458  -5.643  42.360  1.00 28.01 ? 277 PRO B CG  1 
ATOM   5497  C CD  . PRO B 1 277 ? -5.696  -5.083  43.478  1.00 26.83 ? 277 PRO B CD  1 
ATOM   5498  N N   . LYS B 1 278 ? -4.931  -9.643  44.495  1.00 26.81 ? 278 LYS B N   1 
ATOM   5499  C CA  . LYS B 1 278 ? -3.779  -10.561 44.780  1.00 27.79 ? 278 LYS B CA  1 
ATOM   5500  C C   . LYS B 1 278 ? -2.686  -10.629 43.680  1.00 26.49 ? 278 LYS B C   1 
ATOM   5501  O O   . LYS B 1 278 ? -1.497  -10.559 43.979  1.00 26.29 ? 278 LYS B O   1 
ATOM   5502  C CB  . LYS B 1 278 ? -4.303  -11.955 45.180  1.00 28.24 ? 278 LYS B CB  1 
ATOM   5503  C CG  . LYS B 1 278 ? -3.370  -13.087 44.901  1.00 32.63 ? 278 LYS B CG  1 
ATOM   5504  C CD  . LYS B 1 278 ? -2.858  -13.709 46.162  1.00 35.85 ? 278 LYS B CD  1 
ATOM   5505  C CE  . LYS B 1 278 ? -1.646  -14.605 45.824  1.00 40.84 ? 278 LYS B CE  1 
ATOM   5506  N NZ  . LYS B 1 278 ? -1.741  -15.209 44.447  1.00 39.48 ? 278 LYS B NZ  1 
ATOM   5507  N N   . PRO B 1 279 ? -3.079  -10.728 42.389  1.00 27.17 ? 279 PRO B N   1 
ATOM   5508  C CA  . PRO B 1 279 ? -2.035  -10.763 41.359  1.00 26.15 ? 279 PRO B CA  1 
ATOM   5509  C C   . PRO B 1 279 ? -1.116  -9.555  41.319  1.00 25.53 ? 279 PRO B C   1 
ATOM   5510  O O   . PRO B 1 279 ? 0.068   -9.701  41.001  1.00 24.94 ? 279 PRO B O   1 
ATOM   5511  C CB  . PRO B 1 279 ? -2.835  -10.885 40.050  1.00 26.79 ? 279 PRO B CB  1 
ATOM   5512  C CG  . PRO B 1 279 ? -4.132  -11.475 40.463  1.00 27.46 ? 279 PRO B CG  1 
ATOM   5513  C CD  . PRO B 1 279 ? -4.423  -10.859 41.796  1.00 26.14 ? 279 PRO B CD  1 
ATOM   5514  N N   . LEU B 1 280 ? -1.633  -8.360  41.607  1.00 24.52 ? 280 LEU B N   1 
ATOM   5515  C CA  . LEU B 1 280 ? -0.753  -7.178  41.557  1.00 23.95 ? 280 LEU B CA  1 
ATOM   5516  C C   . LEU B 1 280 ? 0.034   -6.998  42.884  1.00 22.86 ? 280 LEU B C   1 
ATOM   5517  O O   . LEU B 1 280 ? 1.176   -6.610  42.865  1.00 22.63 ? 280 LEU B O   1 
ATOM   5518  C CB  . LEU B 1 280 ? -1.560  -5.910  41.286  1.00 24.75 ? 280 LEU B CB  1 
ATOM   5519  C CG  . LEU B 1 280 ? -2.180  -5.618  39.907  1.00 27.43 ? 280 LEU B CG  1 
ATOM   5520  C CD1 . LEU B 1 280 ? -1.425  -6.216  38.737  1.00 26.93 ? 280 LEU B CD1 1 
ATOM   5521  C CD2 . LEU B 1 280 ? -3.574  -6.128  39.917  1.00 32.12 ? 280 LEU B CD2 1 
ATOM   5522  N N   . ILE B 1 281 ? -0.608  -7.257  44.019  1.00 22.33 ? 281 ILE B N   1 
ATOM   5523  C CA  . ILE B 1 281 ? 0.109   -7.240  45.301  1.00 23.03 ? 281 ILE B CA  1 
ATOM   5524  C C   . ILE B 1 281 ? 1.300   -8.208  45.185  1.00 23.64 ? 281 ILE B C   1 
ATOM   5525  O O   . ILE B 1 281 ? 2.445   -7.874  45.547  1.00 24.37 ? 281 ILE B O   1 
ATOM   5526  C CB  . ILE B 1 281 ? -0.851  -7.616  46.468  1.00 22.15 ? 281 ILE B CB  1 
ATOM   5527  C CG1 . ILE B 1 281 ? -1.879  -6.470  46.669  1.00 24.68 ? 281 ILE B CG1 1 
ATOM   5528  C CG2 . ILE B 1 281 ? -0.083  -7.877  47.758  1.00 21.97 ? 281 ILE B CG2 1 
ATOM   5529  C CD1 . ILE B 1 281 ? -1.239  -5.148  47.249  1.00 25.40 ? 281 ILE B CD1 1 
ATOM   5530  N N   . GLU B 1 282 ? 1.040   -9.370  44.588  1.00 24.36 ? 282 GLU B N   1 
ATOM   5531  C CA  . GLU B 1 282 ? 2.085   -10.388 44.396  1.00 26.21 ? 282 GLU B CA  1 
ATOM   5532  C C   . GLU B 1 282 ? 3.304   -9.856  43.625  1.00 25.59 ? 282 GLU B C   1 
ATOM   5533  O O   . GLU B 1 282 ? 4.443   -10.126 43.974  1.00 25.71 ? 282 GLU B O   1 
ATOM   5534  C CB  . GLU B 1 282 ? 1.501   -11.637 43.708  1.00 26.04 ? 282 GLU B CB  1 
ATOM   5535  C CG  . GLU B 1 282 ? 2.534   -12.722 43.452  1.00 30.90 ? 282 GLU B CG  1 
ATOM   5536  C CD  . GLU B 1 282 ? 1.984   -13.868 42.590  1.00 36.44 ? 282 GLU B CD  1 
ATOM   5537  O OE1 . GLU B 1 282 ? 0.921   -14.455 42.940  1.00 42.29 ? 282 GLU B OE1 1 
ATOM   5538  O OE2 . GLU B 1 282 ? 2.635   -14.190 41.586  1.00 40.41 ? 282 GLU B OE2 1 
ATOM   5539  N N   . ARG B 1 283 ? 3.058   -9.060  42.605  1.00 25.79 ? 283 ARG B N   1 
ATOM   5540  C CA  . ARG B 1 283 ? 4.143   -8.483  41.797  1.00 25.17 ? 283 ARG B CA  1 
ATOM   5541  C C   . ARG B 1 283 ? 4.955   -7.495  42.615  1.00 24.77 ? 283 ARG B C   1 
ATOM   5542  O O   . ARG B 1 283 ? 6.176   -7.410  42.459  1.00 24.92 ? 283 ARG B O   1 
ATOM   5543  C CB  . ARG B 1 283 ? 3.541   -7.745  40.595  1.00 26.03 ? 283 ARG B CB  1 
ATOM   5544  C CG  . ARG B 1 283 ? 3.262   -8.528  39.314  1.00 27.11 ? 283 ARG B CG  1 
ATOM   5545  C CD  . ARG B 1 283 ? 3.230   -10.042 39.477  1.00 33.27 ? 283 ARG B CD  1 
ATOM   5546  N NE  . ARG B 1 283 ? 4.489   -10.578 39.044  1.00 34.23 ? 283 ARG B NE  1 
ATOM   5547  C CZ  . ARG B 1 283 ? 4.879   -11.842 39.123  1.00 33.29 ? 283 ARG B CZ  1 
ATOM   5548  N NH1 . ARG B 1 283 ? 4.123   -12.810 39.655  1.00 34.32 ? 283 ARG B NH1 1 
ATOM   5549  N NH2 . ARG B 1 283 ? 6.059   -12.118 38.647  1.00 32.39 ? 283 ARG B NH2 1 
ATOM   5550  N N   . VAL B 1 284 ? 4.282   -6.729  43.484  1.00 24.60 ? 284 VAL B N   1 
ATOM   5551  C CA  . VAL B 1 284 ? 5.020   -5.793  44.362  1.00 23.24 ? 284 VAL B CA  1 
ATOM   5552  C C   . VAL B 1 284 ? 5.761   -6.506  45.488  1.00 22.00 ? 284 VAL B C   1 
ATOM   5553  O O   . VAL B 1 284 ? 6.910   -6.139  45.754  1.00 21.62 ? 284 VAL B O   1 
ATOM   5554  C CB  . VAL B 1 284 ? 4.256   -4.457  44.766  1.00 24.97 ? 284 VAL B CB  1 
ATOM   5555  C CG1 . VAL B 1 284 ? 2.749   -4.546  44.583  1.00 28.10 ? 284 VAL B CG1 1 
ATOM   5556  C CG2 . VAL B 1 284 ? 4.648   -3.916  46.177  1.00 21.70 ? 284 VAL B CG2 1 
ATOM   5557  N N   . ILE B 1 285 ? 5.153   -7.548  46.082  1.00 20.79 ? 285 ILE B N   1 
ATOM   5558  C CA  . ILE B 1 285 ? 5.906   -8.415  47.020  1.00 22.27 ? 285 ILE B CA  1 
ATOM   5559  C C   . ILE B 1 285 ? 7.243   -8.943  46.474  1.00 21.50 ? 285 ILE B C   1 
ATOM   5560  O O   . ILE B 1 285 ? 8.263   -8.919  47.181  1.00 23.25 ? 285 ILE B O   1 
ATOM   5561  C CB  . ILE B 1 285 ? 5.050   -9.563  47.618  1.00 21.46 ? 285 ILE B CB  1 
ATOM   5562  C CG1 . ILE B 1 285 ? 3.975   -8.987  48.546  1.00 20.37 ? 285 ILE B CG1 1 
ATOM   5563  C CG2 . ILE B 1 285 ? 5.924   -10.592 48.415  1.00 24.52 ? 285 ILE B CG2 1 
ATOM   5564  C CD1 . ILE B 1 285 ? 2.826   -9.925  48.704  1.00 15.64 ? 285 ILE B CD1 1 
ATOM   5565  N N   . LEU B 1 286 ? 7.228   -9.436  45.242  1.00 21.32 ? 286 LEU B N   1 
ATOM   5566  C CA  . LEU B 1 286 ? 8.431   -9.968  44.585  1.00 22.19 ? 286 LEU B CA  1 
ATOM   5567  C C   . LEU B 1 286 ? 9.503   -8.896  44.366  1.00 21.99 ? 286 LEU B C   1 
ATOM   5568  O O   . LEU B 1 286 ? 10.701  -9.191  44.463  1.00 20.35 ? 286 LEU B O   1 
ATOM   5569  C CB  . LEU B 1 286 ? 8.087   -10.688 43.275  1.00 21.58 ? 286 LEU B CB  1 
ATOM   5570  C CG  . LEU B 1 286 ? 7.206   -11.938 43.463  1.00 26.82 ? 286 LEU B CG  1 
ATOM   5571  C CD1 . LEU B 1 286 ? 6.885   -12.646 42.098  1.00 26.66 ? 286 LEU B CD1 1 
ATOM   5572  C CD2 . LEU B 1 286 ? 7.765   -12.917 44.516  1.00 27.95 ? 286 LEU B CD2 1 
ATOM   5573  N N   . HIS B 1 287 ? 9.082   -7.663  44.046  1.00 22.10 ? 287 HIS B N   1 
ATOM   5574  C CA  . HIS B 1 287 ? 10.036  -6.551  43.896  1.00 22.87 ? 287 HIS B CA  1 
ATOM   5575  C C   . HIS B 1 287 ? 10.637  -6.180  45.268  1.00 22.07 ? 287 HIS B C   1 
ATOM   5576  O O   . HIS B 1 287 ? 11.828  -5.979  45.400  1.00 22.22 ? 287 HIS B O   1 
ATOM   5577  C CB  . HIS B 1 287 ? 9.344   -5.331  43.245  1.00 22.40 ? 287 HIS B CB  1 
ATOM   5578  C CG  . HIS B 1 287 ? 10.282  -4.309  42.692  1.00 26.49 ? 287 HIS B CG  1 
ATOM   5579  N ND1 . HIS B 1 287 ? 9.858   -3.304  41.842  1.00 27.48 ? 287 HIS B ND1 1 
ATOM   5580  C CD2 . HIS B 1 287 ? 11.621  -4.134  42.849  1.00 27.56 ? 287 HIS B CD2 1 
ATOM   5581  C CE1 . HIS B 1 287 ? 10.887  -2.534  41.536  1.00 26.84 ? 287 HIS B CE1 1 
ATOM   5582  N NE2 . HIS B 1 287 ? 11.966  -3.016  42.130  1.00 26.08 ? 287 HIS B NE2 1 
ATOM   5583  N N   . ILE B 1 288 ? 9.800   -6.131  46.299  1.00 21.97 ? 288 ILE B N   1 
ATOM   5584  C CA  . ILE B 1 288 ? 10.299  -5.983  47.667  1.00 22.45 ? 288 ILE B CA  1 
ATOM   5585  C C   . ILE B 1 288 ? 11.305  -7.098  48.056  1.00 22.90 ? 288 ILE B C   1 
ATOM   5586  O O   . ILE B 1 288 ? 12.352  -6.805  48.669  1.00 21.58 ? 288 ILE B O   1 
ATOM   5587  C CB  . ILE B 1 288 ? 9.134   -5.856  48.672  1.00 23.43 ? 288 ILE B CB  1 
ATOM   5588  C CG1 . ILE B 1 288 ? 8.334   -4.555  48.399  1.00 20.74 ? 288 ILE B CG1 1 
ATOM   5589  C CG2 . ILE B 1 288 ? 9.626   -5.895  50.136  1.00 23.91 ? 288 ILE B CG2 1 
ATOM   5590  C CD1 . ILE B 1 288 ? 7.009   -4.501  49.085  1.00 18.98 ? 288 ILE B CD1 1 
ATOM   5591  N N   . GLN B 1 289 ? 11.000  -8.362  47.721  1.00 22.80 ? 289 GLN B N   1 
ATOM   5592  C CA  . GLN B 1 289 ? 11.928  -9.467  48.070  1.00 23.79 ? 289 GLN B CA  1 
ATOM   5593  C C   . GLN B 1 289 ? 13.340  -9.262  47.545  1.00 23.67 ? 289 GLN B C   1 
ATOM   5594  O O   . GLN B 1 289 ? 14.304  -9.734  48.145  1.00 24.57 ? 289 GLN B O   1 
ATOM   5595  C CB  . GLN B 1 289 ? 11.435  -10.856 47.606  1.00 23.39 ? 289 GLN B CB  1 
ATOM   5596  C CG  . GLN B 1 289 ? 10.112  -11.253 48.163  1.00 26.61 ? 289 GLN B CG  1 
ATOM   5597  C CD  . GLN B 1 289 ? 9.764   -12.712 47.872  1.00 31.85 ? 289 GLN B CD  1 
ATOM   5598  O OE1 . GLN B 1 289 ? 10.210  -13.285 46.880  1.00 32.84 ? 289 GLN B OE1 1 
ATOM   5599  N NE2 . GLN B 1 289 ? 8.965   -13.318 48.758  1.00 32.20 ? 289 GLN B NE2 1 
ATOM   5600  N N   . VAL B 1 290 ? 13.471  -8.570  46.416  1.00 23.69 ? 290 VAL B N   1 
ATOM   5601  C CA  . VAL B 1 290 ? 14.799  -8.291  45.908  1.00 22.43 ? 290 VAL B CA  1 
ATOM   5602  C C   . VAL B 1 290 ? 15.323  -6.898  46.248  1.00 22.04 ? 290 VAL B C   1 
ATOM   5603  O O   . VAL B 1 290 ? 16.403  -6.531  45.809  1.00 22.02 ? 290 VAL B O   1 
ATOM   5604  C CB  . VAL B 1 290 ? 14.931  -8.589  44.395  1.00 22.58 ? 290 VAL B CB  1 
ATOM   5605  C CG1 . VAL B 1 290 ? 14.701  -10.075 44.114  1.00 23.19 ? 290 VAL B CG1 1 
ATOM   5606  C CG2 . VAL B 1 290 ? 14.035  -7.691  43.536  1.00 22.02 ? 290 VAL B CG2 1 
ATOM   5607  N N   . SER B 1 291 ? 14.578  -6.127  47.038  1.00 21.23 ? 291 SER B N   1 
ATOM   5608  C CA  . SER B 1 291 ? 15.026  -4.763  47.361  1.00 21.90 ? 291 SER B CA  1 
ATOM   5609  C C   . SER B 1 291 ? 15.192  -4.578  48.874  1.00 20.43 ? 291 SER B C   1 
ATOM   5610  O O   . SER B 1 291 ? 16.250  -4.914  49.420  1.00 21.80 ? 291 SER B O   1 
ATOM   5611  C CB  . SER B 1 291 ? 14.170  -3.696  46.676  1.00 21.23 ? 291 SER B CB  1 
ATOM   5612  O OG  . SER B 1 291 ? 12.819  -3.751  47.122  1.00 27.94 ? 291 SER B OG  1 
ATOM   5613  N N   . THR B 1 292 ? 14.148  -4.166  49.580  1.00 20.80 ? 292 THR B N   1 
ATOM   5614  C CA  . THR B 1 292 ? 14.238  -4.061  51.037  1.00 18.95 ? 292 THR B CA  1 
ATOM   5615  C C   . THR B 1 292 ? 14.226  -5.411  51.799  1.00 19.16 ? 292 THR B C   1 
ATOM   5616  O O   . THR B 1 292 ? 14.587  -5.415  52.961  1.00 18.40 ? 292 THR B O   1 
ATOM   5617  C CB  . THR B 1 292 ? 13.158  -3.168  51.627  1.00 18.61 ? 292 THR B CB  1 
ATOM   5618  O OG1 . THR B 1 292 ? 11.878  -3.536  51.095  1.00 20.19 ? 292 THR B OG1 1 
ATOM   5619  C CG2 . THR B 1 292 ? 13.448  -1.732  51.292  1.00 20.35 ? 292 THR B CG2 1 
ATOM   5620  N N   . LEU B 1 293 ? 13.768  -6.492  51.129  1.00 20.27 ? 293 LEU B N   1 
ATOM   5621  C CA  . LEU B 1 293 ? 13.502  -7.835  51.681  1.00 20.91 ? 293 LEU B CA  1 
ATOM   5622  C C   . LEU B 1 293 ? 12.176  -7.876  52.485  1.00 20.65 ? 293 LEU B C   1 
ATOM   5623  O O   . LEU B 1 293 ? 11.311  -8.697  52.202  1.00 19.18 ? 293 LEU B O   1 
ATOM   5624  C CB  . LEU B 1 293 ? 14.697  -8.417  52.487  1.00 21.92 ? 293 LEU B CB  1 
ATOM   5625  C CG  . LEU B 1 293 ? 16.081  -8.540  51.819  1.00 25.40 ? 293 LEU B CG  1 
ATOM   5626  C CD1 . LEU B 1 293 ? 17.123  -9.225  52.769  1.00 27.63 ? 293 LEU B CD1 1 
ATOM   5627  C CD2 . LEU B 1 293 ? 16.045  -9.286  50.518  1.00 28.19 ? 293 LEU B CD2 1 
ATOM   5628  N N   . HIS B 1 294 ? 12.014  -6.927  53.412  1.00 19.75 ? 294 HIS B N   1 
ATOM   5629  C CA  . HIS B 1 294 ? 10.874  -6.872  54.301  1.00 19.71 ? 294 HIS B CA  1 
ATOM   5630  C C   . HIS B 1 294 ? 10.957  -5.564  55.140  1.00 19.64 ? 294 HIS B C   1 
ATOM   5631  O O   . HIS B 1 294 ? 12.050  -4.983  55.250  1.00 18.44 ? 294 HIS B O   1 
ATOM   5632  C CB  . HIS B 1 294 ? 10.914  -8.139  55.187  1.00 20.15 ? 294 HIS B CB  1 
ATOM   5633  C CG  . HIS B 1 294 ? 12.006  -8.136  56.219  1.00 19.54 ? 294 HIS B CG  1 
ATOM   5634  N ND1 . HIS B 1 294 ? 13.141  -8.916  56.120  1.00 24.68 ? 294 HIS B ND1 1 
ATOM   5635  C CD2 . HIS B 1 294 ? 12.080  -7.518  57.417  1.00 18.03 ? 294 HIS B CD2 1 
ATOM   5636  C CE1 . HIS B 1 294 ? 13.893  -8.736  57.192  1.00 19.46 ? 294 HIS B CE1 1 
ATOM   5637  N NE2 . HIS B 1 294 ? 13.275  -7.878  57.986  1.00 24.15 ? 294 HIS B NE2 1 
ATOM   5638  N N   . PRO B 1 295 ? 9.812   -5.080  55.709  1.00 19.37 ? 295 PRO B N   1 
ATOM   5639  C CA  . PRO B 1 295 ? 9.885   -3.890  56.597  1.00 19.03 ? 295 PRO B CA  1 
ATOM   5640  C C   . PRO B 1 295 ? 10.564  -4.269  57.914  1.00 18.79 ? 295 PRO B C   1 
ATOM   5641  O O   . PRO B 1 295 ? 10.503  -5.439  58.321  1.00 18.55 ? 295 PRO B O   1 
ATOM   5642  C CB  . PRO B 1 295 ? 8.406   -3.547  56.844  1.00 17.73 ? 295 PRO B CB  1 
ATOM   5643  C CG  . PRO B 1 295 ? 7.635   -4.294  55.750  1.00 19.13 ? 295 PRO B CG  1 
ATOM   5644  C CD  . PRO B 1 295 ? 8.417   -5.538  55.557  1.00 20.17 ? 295 PRO B CD  1 
ATOM   5645  N N   . SER B 1 296 ? 11.174  -3.300  58.587  1.00 19.68 ? 296 SER B N   1 
ATOM   5646  C CA  . SER B 1 296 ? 11.895  -3.591  59.834  1.00 19.79 ? 296 SER B CA  1 
ATOM   5647  C C   . SER B 1 296 ? 11.072  -4.482  60.749  1.00 18.52 ? 296 SER B C   1 
ATOM   5648  O O   . SER B 1 296 ? 9.956   -4.152  61.089  1.00 17.69 ? 296 SER B O   1 
ATOM   5649  C CB  . SER B 1 296 ? 12.187  -2.290  60.585  1.00 20.73 ? 296 SER B CB  1 
ATOM   5650  O OG  . SER B 1 296 ? 12.356  -2.540  61.962  1.00 22.70 ? 296 SER B OG  1 
ATOM   5651  N N   . THR B 1 297 ? 11.604  -5.611  61.168  1.00 19.08 ? 297 THR B N   1 
ATOM   5652  C CA  . THR B 1 297 ? 10.702  -6.466  62.002  1.00 19.05 ? 297 THR B CA  1 
ATOM   5653  C C   . THR B 1 297 ? 10.516  -5.926  63.422  1.00 18.27 ? 297 THR B C   1 
ATOM   5654  O O   . THR B 1 297 ? 9.461   -6.059  64.001  1.00 18.12 ? 297 THR B O   1 
ATOM   5655  C CB  . THR B 1 297 ? 10.982  -8.006  61.820  1.00 21.22 ? 297 THR B CB  1 
ATOM   5656  O OG1 . THR B 1 297 ? 10.625  -8.784  62.981  1.00 23.03 ? 297 THR B OG1 1 
ATOM   5657  C CG2 . THR B 1 297 ? 12.316  -8.257  61.358  1.00 17.67 ? 297 THR B CG2 1 
ATOM   5658  N N   . PHE B 1 298 ? 11.515  -5.219  63.923  1.00 18.73 ? 298 PHE B N   1 
ATOM   5659  C CA  . PHE B 1 298 ? 11.399  -4.477  65.191  1.00 19.37 ? 298 PHE B CA  1 
ATOM   5660  C C   . PHE B 1 298 ? 10.216  -3.508  65.163  1.00 18.93 ? 298 PHE B C   1 
ATOM   5661  O O   . PHE B 1 298 ? 9.406   -3.529  66.058  1.00 20.23 ? 298 PHE B O   1 
ATOM   5662  C CB  . PHE B 1 298 ? 12.749  -3.769  65.480  1.00 19.50 ? 298 PHE B CB  1 
ATOM   5663  C CG  . PHE B 1 298 ? 12.921  -3.286  66.906  1.00 22.62 ? 298 PHE B CG  1 
ATOM   5664  C CD1 . PHE B 1 298 ? 12.294  -2.129  67.352  1.00 24.52 ? 298 PHE B CD1 1 
ATOM   5665  C CD2 . PHE B 1 298 ? 13.753  -3.971  67.788  1.00 26.16 ? 298 PHE B CD2 1 
ATOM   5666  C CE1 . PHE B 1 298 ? 12.481  -1.663  68.681  1.00 23.20 ? 298 PHE B CE1 1 
ATOM   5667  C CE2 . PHE B 1 298 ? 13.918  -3.537  69.102  1.00 23.61 ? 298 PHE B CE2 1 
ATOM   5668  C CZ  . PHE B 1 298 ? 13.274  -2.379  69.536  1.00 25.60 ? 298 PHE B CZ  1 
ATOM   5669  N N   . ASN B 1 299 ? 10.110  -2.668  64.123  1.00 19.48 ? 299 ASN B N   1 
ATOM   5670  C CA  . ASN B 1 299 ? 9.111   -1.606  64.067  1.00 19.10 ? 299 ASN B CA  1 
ATOM   5671  C C   . ASN B 1 299 ? 7.721   -2.204  63.802  1.00 19.47 ? 299 ASN B C   1 
ATOM   5672  O O   . ASN B 1 299 ? 6.745   -1.721  64.327  1.00 18.67 ? 299 ASN B O   1 
ATOM   5673  C CB  . ASN B 1 299 ? 9.422   -0.553  62.998  1.00 18.77 ? 299 ASN B CB  1 
ATOM   5674  C CG  . ASN B 1 299 ? 10.798  0.122   63.168  1.00 17.25 ? 299 ASN B CG  1 
ATOM   5675  O OD1 . ASN B 1 299 ? 11.270  0.771   62.234  1.00 22.90 ? 299 ASN B OD1 1 
ATOM   5676  N ND2 . ASN B 1 299 ? 11.451  -0.064  64.309  1.00 14.21 ? 299 ASN B ND2 1 
ATOM   5677  N N   . GLN B 1 300 ? 7.641   -3.256  62.981  1.00 19.23 ? 300 GLN B N   1 
ATOM   5678  C CA  . GLN B 1 300 ? 6.396   -3.995  62.843  1.00 18.98 ? 300 GLN B CA  1 
ATOM   5679  C C   . GLN B 1 300 ? 5.888   -4.560  64.169  1.00 18.99 ? 300 GLN B C   1 
ATOM   5680  O O   . GLN B 1 300 ? 4.707   -4.423  64.474  1.00 19.37 ? 300 GLN B O   1 
ATOM   5681  C CB  . GLN B 1 300 ? 6.554   -5.122  61.863  1.00 20.07 ? 300 GLN B CB  1 
ATOM   5682  C CG  . GLN B 1 300 ? 6.457   -4.689  60.428  1.00 22.00 ? 300 GLN B CG  1 
ATOM   5683  C CD  . GLN B 1 300 ? 6.424   -5.900  59.552  1.00 20.55 ? 300 GLN B CD  1 
ATOM   5684  O OE1 . GLN B 1 300 ? 5.383   -6.498  59.406  1.00 17.85 ? 300 GLN B OE1 1 
ATOM   5685  N NE2 . GLN B 1 300 ? 7.581   -6.324  59.039  1.00 19.10 ? 300 GLN B NE2 1 
ATOM   5686  N N   . LEU B 1 301 ? 6.766   -5.169  64.952  1.00 18.29 ? 301 LEU B N   1 
ATOM   5687  C CA  . LEU B 1 301 ? 6.386   -5.678  66.294  1.00 20.19 ? 301 LEU B CA  1 
ATOM   5688  C C   . LEU B 1 301 ? 5.903   -4.562  67.264  1.00 20.42 ? 301 LEU B C   1 
ATOM   5689  O O   . LEU B 1 301 ? 4.925   -4.736  68.048  1.00 20.99 ? 301 LEU B O   1 
ATOM   5690  C CB  . LEU B 1 301 ? 7.596   -6.421  66.896  1.00 19.86 ? 301 LEU B CB  1 
ATOM   5691  C CG  . LEU B 1 301 ? 7.740   -7.957  66.888  1.00 23.46 ? 301 LEU B CG  1 
ATOM   5692  C CD1 . LEU B 1 301 ? 6.554   -8.829  66.388  1.00 23.16 ? 301 LEU B CD1 1 
ATOM   5693  C CD2 . LEU B 1 301 ? 9.061   -8.418  66.364  1.00 19.70 ? 301 LEU B CD2 1 
ATOM   5694  N N   . MET B 1 302 ? 6.589   -3.419  67.255  1.00 21.15 ? 302 MET B N   1 
ATOM   5695  C CA  . MET B 1 302 ? 6.105   -2.254  68.038  1.00 20.63 ? 302 MET B CA  1 
ATOM   5696  C C   . MET B 1 302 ? 4.686   -1.867  67.665  1.00 20.52 ? 302 MET B C   1 
ATOM   5697  O O   . MET B 1 302 ? 3.821   -1.721  68.526  1.00 20.36 ? 302 MET B O   1 
ATOM   5698  C CB  . MET B 1 302 ? 6.979   -1.018  67.841  1.00 21.91 ? 302 MET B CB  1 
ATOM   5699  C CG  . MET B 1 302 ? 8.443   -1.123  68.310  1.00 21.94 ? 302 MET B CG  1 
ATOM   5700  S SD  . MET B 1 302 ? 9.393   0.393   67.815  1.00 26.74 ? 302 MET B SD  1 
ATOM   5701  C CE  . MET B 1 302 ? 8.348   1.716   68.462  1.00 22.00 ? 302 MET B CE  1 
ATOM   5702  N N   . ILE B 1 303 ? 4.438   -1.707  66.374  1.00 20.74 ? 303 ILE B N   1 
ATOM   5703  C CA  . ILE B 1 303 ? 3.129   -1.316  65.931  1.00 19.99 ? 303 ILE B CA  1 
ATOM   5704  C C   . ILE B 1 303 ? 2.109   -2.430  66.208  1.00 19.91 ? 303 ILE B C   1 
ATOM   5705  O O   . ILE B 1 303 ? 1.052   -2.163  66.744  1.00 18.13 ? 303 ILE B O   1 
ATOM   5706  C CB  . ILE B 1 303 ? 3.116   -0.795  64.479  1.00 20.83 ? 303 ILE B CB  1 
ATOM   5707  C CG1 . ILE B 1 303 ? 3.882   0.544   64.418  1.00 18.07 ? 303 ILE B CG1 1 
ATOM   5708  C CG2 . ILE B 1 303 ? 1.689   -0.586  64.014  1.00 21.33 ? 303 ILE B CG2 1 
ATOM   5709  C CD1 . ILE B 1 303 ? 4.399   0.854   63.040  1.00 20.80 ? 303 ILE B CD1 1 
ATOM   5710  N N   . SER B 1 304 ? 2.465   -3.670  65.884  1.00 19.33 ? 304 SER B N   1 
ATOM   5711  C CA  . SER B 1 304 ? 1.512   -4.775  66.076  1.00 20.22 ? 304 SER B CA  1 
ATOM   5712  C C   . SER B 1 304 ? 1.108   -4.896  67.557  1.00 18.71 ? 304 SER B C   1 
ATOM   5713  O O   . SER B 1 304 ? -0.057  -5.066  67.873  1.00 19.84 ? 304 SER B O   1 
ATOM   5714  C CB  . SER B 1 304 ? 2.122   -6.071  65.562  1.00 19.26 ? 304 SER B CB  1 
ATOM   5715  O OG  . SER B 1 304 ? 1.198   -7.132  65.707  1.00 21.32 ? 304 SER B OG  1 
ATOM   5716  N N   . GLN B 1 305 ? 2.049   -4.740  68.476  1.00 20.15 ? 305 GLN B N   1 
ATOM   5717  C CA  . GLN B 1 305 ? 1.729   -4.905  69.895  1.00 21.43 ? 305 GLN B CA  1 
ATOM   5718  C C   . GLN B 1 305 ? 0.853   -3.775  70.421  1.00 21.62 ? 305 GLN B C   1 
ATOM   5719  O O   . GLN B 1 305 ? -0.043  -4.014  71.255  1.00 22.72 ? 305 GLN B O   1 
ATOM   5720  C CB  . GLN B 1 305 ? 3.012   -5.120  70.732  1.00 23.67 ? 305 GLN B CB  1 
ATOM   5721  C CG  . GLN B 1 305 ? 3.626   -6.487  70.335  1.00 27.63 ? 305 GLN B CG  1 
ATOM   5722  C CD  . GLN B 1 305 ? 4.834   -6.902  71.104  1.00 33.91 ? 305 GLN B CD  1 
ATOM   5723  O OE1 . GLN B 1 305 ? 5.599   -7.779  70.645  1.00 38.94 ? 305 GLN B OE1 1 
ATOM   5724  N NE2 . GLN B 1 305 ? 5.011   -6.337  72.289  1.00 30.88 ? 305 GLN B NE2 1 
ATOM   5725  N N   . LEU B 1 306 ? 1.091   -2.568  69.905  1.00 20.67 ? 306 LEU B N   1 
ATOM   5726  C CA  . LEU B 1 306 ? 0.309   -1.389  70.214  1.00 20.83 ? 306 LEU B CA  1 
ATOM   5727  C C   . LEU B 1 306 ? -1.126  -1.620  69.764  1.00 20.40 ? 306 LEU B C   1 
ATOM   5728  O O   . LEU B 1 306 ? -2.075  -1.473  70.560  1.00 19.04 ? 306 LEU B O   1 
ATOM   5729  C CB  . LEU B 1 306 ? 0.904   -0.139  69.551  1.00 20.10 ? 306 LEU B CB  1 
ATOM   5730  C CG  . LEU B 1 306 ? 0.092   1.162   69.609  1.00 23.16 ? 306 LEU B CG  1 
ATOM   5731  C CD1 . LEU B 1 306 ? 0.470   1.899   70.872  1.00 22.80 ? 306 LEU B CD1 1 
ATOM   5732  C CD2 . LEU B 1 306 ? 0.364   2.059   68.344  1.00 22.39 ? 306 LEU B CD2 1 
ATOM   5733  N N   . LEU B 1 307 ? -1.261  -2.052  68.523  1.00 19.92 ? 307 LEU B N   1 
ATOM   5734  C CA  . LEU B 1 307 ? -2.575  -2.253  67.874  1.00 20.79 ? 307 LEU B CA  1 
ATOM   5735  C C   . LEU B 1 307 ? -3.400  -3.341  68.547  1.00 21.32 ? 307 LEU B C   1 
ATOM   5736  O O   . LEU B 1 307 ? -4.639  -3.188  68.749  1.00 21.94 ? 307 LEU B O   1 
ATOM   5737  C CB  . LEU B 1 307 ? -2.344  -2.584  66.391  1.00 20.46 ? 307 LEU B CB  1 
ATOM   5738  C CG  . LEU B 1 307 ? -2.458  -1.408  65.387  1.00 23.08 ? 307 LEU B CG  1 
ATOM   5739  C CD1 . LEU B 1 307 ? -2.425  -0.005  66.020  1.00 25.45 ? 307 LEU B CD1 1 
ATOM   5740  C CD2 . LEU B 1 307 ? -1.641  -1.586  64.118  1.00 20.39 ? 307 LEU B CD2 1 
ATOM   5741  N N   . HIS B 1 308 ? -2.739  -4.442  68.864  1.00 22.12 ? 308 HIS B N   1 
ATOM   5742  C CA  . HIS B 1 308 ? -3.418  -5.553  69.533  1.00 24.04 ? 308 HIS B CA  1 
ATOM   5743  C C   . HIS B 1 308 ? -3.896  -5.184  70.940  1.00 25.39 ? 308 HIS B C   1 
ATOM   5744  O O   . HIS B 1 308 ? -5.020  -5.520  71.327  1.00 25.29 ? 308 HIS B O   1 
ATOM   5745  C CB  . HIS B 1 308 ? -2.589  -6.837  69.487  1.00 23.32 ? 308 HIS B CB  1 
ATOM   5746  C CG  . HIS B 1 308 ? -2.535  -7.462  68.118  1.00 25.14 ? 308 HIS B CG  1 
ATOM   5747  N ND1 . HIS B 1 308 ? -3.382  -8.489  67.737  1.00 25.83 ? 308 HIS B ND1 1 
ATOM   5748  C CD2 . HIS B 1 308 ? -1.763  -7.186  67.032  1.00 21.74 ? 308 HIS B CD2 1 
ATOM   5749  C CE1 . HIS B 1 308 ? -3.117  -8.835  66.492  1.00 21.61 ? 308 HIS B CE1 1 
ATOM   5750  N NE2 . HIS B 1 308 ? -2.143  -8.060  66.039  1.00 26.43 ? 308 HIS B NE2 1 
ATOM   5751  N N   . GLU B 1 309 ? -3.081  -4.454  71.684  1.00 26.31 ? 309 GLU B N   1 
ATOM   5752  C CA  . GLU B 1 309 ? -3.509  -4.043  73.014  1.00 28.31 ? 309 GLU B CA  1 
ATOM   5753  C C   . GLU B 1 309 ? -4.620  -3.009  72.950  1.00 27.69 ? 309 GLU B C   1 
ATOM   5754  O O   . GLU B 1 309 ? -5.579  -3.064  73.741  1.00 27.60 ? 309 GLU B O   1 
ATOM   5755  C CB  . GLU B 1 309 ? -2.327  -3.612  73.897  1.00 29.72 ? 309 GLU B CB  1 
ATOM   5756  C CG  . GLU B 1 309 ? -2.342  -4.371  75.273  1.00 37.56 ? 309 GLU B CG  1 
ATOM   5757  C CD  . GLU B 1 309 ? -1.954  -5.889  75.155  1.00 46.23 ? 309 GLU B CD  1 
ATOM   5758  O OE1 . GLU B 1 309 ? -0.844  -6.262  75.611  1.00 48.71 ? 309 GLU B OE1 1 
ATOM   5759  O OE2 . GLU B 1 309 ? -2.741  -6.713  74.605  1.00 48.45 ? 309 GLU B OE2 1 
ATOM   5760  N N   . TRP B 1 310 ? -4.532  -2.086  71.988  1.00 26.89 ? 310 TRP B N   1 
ATOM   5761  C CA  . TRP B 1 310 ? -5.599  -1.108  71.788  1.00 27.80 ? 310 TRP B CA  1 
ATOM   5762  C C   . TRP B 1 310 ? -6.875  -1.779  71.269  1.00 28.87 ? 310 TRP B C   1 
ATOM   5763  O O   . TRP B 1 310 ? -7.995  -1.406  71.641  1.00 28.59 ? 310 TRP B O   1 
ATOM   5764  C CB  . TRP B 1 310 ? -5.186  -0.069  70.745  1.00 27.79 ? 310 TRP B CB  1 
ATOM   5765  C CG  . TRP B 1 310 ? -4.495  1.130   71.267  1.00 27.40 ? 310 TRP B CG  1 
ATOM   5766  C CD1 . TRP B 1 310 ? -4.351  1.492   72.556  1.00 27.38 ? 310 TRP B CD1 1 
ATOM   5767  C CD2 . TRP B 1 310 ? -3.869  2.158   70.482  1.00 26.95 ? 310 TRP B CD2 1 
ATOM   5768  N NE1 . TRP B 1 310 ? -3.657  2.672   72.645  1.00 26.86 ? 310 TRP B NE1 1 
ATOM   5769  C CE2 . TRP B 1 310 ? -3.349  3.107   71.386  1.00 28.25 ? 310 TRP B CE2 1 
ATOM   5770  C CE3 . TRP B 1 310 ? -3.679  2.354   69.109  1.00 25.11 ? 310 TRP B CE3 1 
ATOM   5771  C CZ2 . TRP B 1 310 ? -2.678  4.268   70.961  1.00 28.82 ? 310 TRP B CZ2 1 
ATOM   5772  C CZ3 . TRP B 1 310 ? -2.993  3.511   68.686  1.00 27.41 ? 310 TRP B CZ3 1 
ATOM   5773  C CH2 . TRP B 1 310 ? -2.495  4.437   69.613  1.00 26.11 ? 310 TRP B CH2 1 
ATOM   5774  N N   . GLY B 1 311 ? -6.705  -2.753  70.377  1.00 28.53 ? 311 GLY B N   1 
ATOM   5775  C CA  . GLY B 1 311 ? -7.844  -3.292  69.666  1.00 30.91 ? 311 GLY B CA  1 
ATOM   5776  C C   . GLY B 1 311 ? -8.395  -2.251  68.706  1.00 32.32 ? 311 GLY B C   1 
ATOM   5777  O O   . GLY B 1 311 ? -7.936  -1.083  68.687  1.00 32.66 ? 311 GLY B O   1 
ATOM   5778  N N   . GLU B 1 312 ? -9.390  -2.650  67.916  1.00 32.56 ? 312 GLU B N   1 
ATOM   5779  C CA  . GLU B 1 312 ? -10.008 -1.736  66.978  1.00 34.34 ? 312 GLU B CA  1 
ATOM   5780  C C   . GLU B 1 312 ? -10.577 -0.455  67.655  1.00 34.21 ? 312 GLU B C   1 
ATOM   5781  O O   . GLU B 1 312 ? -10.420 0.652   67.117  1.00 33.42 ? 312 GLU B O   1 
ATOM   5782  C CB  . GLU B 1 312 ? -11.020 -2.484  66.087  1.00 35.19 ? 312 GLU B CB  1 
ATOM   5783  C CG  . GLU B 1 312 ? -10.459 -2.825  64.682  1.00 37.59 ? 312 GLU B CG  1 
ATOM   5784  C CD  . GLU B 1 312 ? -11.020 -4.115  64.030  1.00 42.65 ? 312 GLU B CD  1 
ATOM   5785  O OE1 . GLU B 1 312 ? -10.275 -4.736  63.236  1.00 44.39 ? 312 GLU B OE1 1 
ATOM   5786  O OE2 . GLU B 1 312 ? -12.190 -4.511  64.284  1.00 47.77 ? 312 GLU B OE2 1 
ATOM   5787  N N   . GLU B 1 313 ? -11.168 -0.614  68.846  1.00 33.89 ? 313 GLU B N   1 
ATOM   5788  C CA  . GLU B 1 313 ? -11.685 0.511   69.646  1.00 33.81 ? 313 GLU B CA  1 
ATOM   5789  C C   . GLU B 1 313 ? -10.586 1.515   70.085  1.00 32.49 ? 313 GLU B C   1 
ATOM   5790  O O   . GLU B 1 313 ? -10.762 2.756   69.991  1.00 32.94 ? 313 GLU B O   1 
ATOM   5791  C CB  . GLU B 1 313 ? -12.442 -0.027  70.869  1.00 34.24 ? 313 GLU B CB  1 
ATOM   5792  C CG  . GLU B 1 313 ? -13.476 0.932   71.463  1.00 38.15 ? 313 GLU B CG  1 
ATOM   5793  C CD  . GLU B 1 313 ? -14.395 0.279   72.520  1.00 44.07 ? 313 GLU B CD  1 
ATOM   5794  O OE1 . GLU B 1 313 ? -14.450 -0.981  72.608  1.00 47.05 ? 313 GLU B OE1 1 
ATOM   5795  O OE2 . GLU B 1 313 ? -15.076 1.039   73.266  1.00 47.50 ? 313 GLU B OE2 1 
ATOM   5796  N N   . GLY B 1 314 ? -9.465  0.991   70.570  1.00 30.54 ? 314 GLY B N   1 
ATOM   5797  C CA  . GLY B 1 314 ? -8.338  1.837   71.022  1.00 28.49 ? 314 GLY B CA  1 
ATOM   5798  C C   . GLY B 1 314 ? -7.712  2.568   69.840  1.00 26.63 ? 314 GLY B C   1 
ATOM   5799  O O   . GLY B 1 314 ? -7.250  3.714   69.966  1.00 23.94 ? 314 GLY B O   1 
ATOM   5800  N N   . PHE B 1 315 ? -7.661  1.881   68.697  1.00 26.42 ? 315 PHE B N   1 
ATOM   5801  C CA  . PHE B 1 315 ? -7.054  2.455   67.500  1.00 26.18 ? 315 PHE B CA  1 
ATOM   5802  C C   . PHE B 1 315 ? -7.902  3.672   67.030  1.00 26.41 ? 315 PHE B C   1 
ATOM   5803  O O   . PHE B 1 315 ? -7.394  4.803   66.875  1.00 25.73 ? 315 PHE B O   1 
ATOM   5804  C CB  . PHE B 1 315 ? -6.853  1.399   66.402  1.00 25.71 ? 315 PHE B CB  1 
ATOM   5805  C CG  . PHE B 1 315 ? -6.437  1.992   65.104  1.00 26.53 ? 315 PHE B CG  1 
ATOM   5806  C CD1 . PHE B 1 315 ? -5.170  2.505   64.949  1.00 24.76 ? 315 PHE B CD1 1 
ATOM   5807  C CD2 . PHE B 1 315 ? -7.358  2.129   64.059  1.00 26.16 ? 315 PHE B CD2 1 
ATOM   5808  C CE1 . PHE B 1 315 ? -4.799  3.101   63.767  1.00 27.91 ? 315 PHE B CE1 1 
ATOM   5809  C CE2 . PHE B 1 315 ? -6.985  2.721   62.862  1.00 28.18 ? 315 PHE B CE2 1 
ATOM   5810  C CZ  . PHE B 1 315 ? -5.714  3.212   62.715  1.00 28.19 ? 315 PHE B CZ  1 
ATOM   5811  N N   . MET B 1 316 ? -9.206  3.456   66.922  1.00 26.24 ? 316 MET B N   1 
ATOM   5812  C CA  . MET B 1 316 ? -10.088 4.494   66.449  1.00 27.62 ? 316 MET B CA  1 
ATOM   5813  C C   . MET B 1 316 ? -10.243 5.671   67.435  1.00 26.86 ? 316 MET B C   1 
ATOM   5814  O O   . MET B 1 316 ? -10.435 6.817   66.992  1.00 27.44 ? 316 MET B O   1 
ATOM   5815  C CB  . MET B 1 316 ? -11.442 3.897   66.048  1.00 28.73 ? 316 MET B CB  1 
ATOM   5816  C CG  . MET B 1 316 ? -11.406 2.923   64.872  1.00 31.87 ? 316 MET B CG  1 
ATOM   5817  S SD  . MET B 1 316 ? -10.682 3.551   63.346  1.00 38.75 ? 316 MET B SD  1 
ATOM   5818  C CE  . MET B 1 316 ? -11.862 4.777   62.858  1.00 39.16 ? 316 MET B CE  1 
ATOM   5819  N N   . ALA B 1 317 ? -10.174 5.390   68.747  1.00 25.26 ? 317 ALA B N   1 
ATOM   5820  C CA  . ALA B 1 317 ? -10.119 6.423   69.785  1.00 25.16 ? 317 ALA B CA  1 
ATOM   5821  C C   . ALA B 1 317 ? -8.900  7.322   69.574  1.00 24.69 ? 317 ALA B C   1 
ATOM   5822  O O   . ALA B 1 317 ? -8.989  8.546   69.674  1.00 24.38 ? 317 ALA B O   1 
ATOM   5823  C CB  . ALA B 1 317 ? -10.035 5.775   71.195  1.00 25.18 ? 317 ALA B CB  1 
ATOM   5824  N N   . HIS B 1 318 ? -7.760  6.686   69.307  1.00 23.52 ? 318 HIS B N   1 
ATOM   5825  C CA  . HIS B 1 318 ? -6.519  7.398   69.036  1.00 22.94 ? 318 HIS B CA  1 
ATOM   5826  C C   . HIS B 1 318 ? -6.705  8.249   67.812  1.00 22.55 ? 318 HIS B C   1 
ATOM   5827  O O   . HIS B 1 318 ? -6.403  9.435   67.850  1.00 22.85 ? 318 HIS B O   1 
ATOM   5828  C CB  . HIS B 1 318 ? -5.354  6.422   68.859  1.00 22.33 ? 318 HIS B CB  1 
ATOM   5829  C CG  . HIS B 1 318 ? -4.112  7.063   68.312  1.00 21.60 ? 318 HIS B CG  1 
ATOM   5830  N ND1 . HIS B 1 318 ? -3.333  7.919   69.051  1.00 23.28 ? 318 HIS B ND1 1 
ATOM   5831  C CD2 . HIS B 1 318 ? -3.542  7.007   67.084  1.00 23.42 ? 318 HIS B CD2 1 
ATOM   5832  C CE1 . HIS B 1 318 ? -2.329  8.359   68.305  1.00 23.79 ? 318 HIS B CE1 1 
ATOM   5833  N NE2 . HIS B 1 318 ? -2.415  7.790   67.118  1.00 22.66 ? 318 HIS B NE2 1 
ATOM   5834  N N   . VAL B 1 319 ? -7.295  7.690   66.761  1.00 23.52 ? 319 VAL B N   1 
ATOM   5835  C CA  . VAL B 1 319 ? -7.497  8.488   65.559  1.00 25.11 ? 319 VAL B CA  1 
ATOM   5836  C C   . VAL B 1 319 ? -8.444  9.692   65.765  1.00 25.51 ? 319 VAL B C   1 
ATOM   5837  O O   . VAL B 1 319 ? -8.195  10.769  65.212  1.00 24.90 ? 319 VAL B O   1 
ATOM   5838  C CB  . VAL B 1 319 ? -7.683  7.709   64.207  1.00 25.45 ? 319 VAL B CB  1 
ATOM   5839  C CG1 . VAL B 1 319 ? -7.566  6.236   64.308  1.00 27.62 ? 319 VAL B CG1 1 
ATOM   5840  C CG2 . VAL B 1 319 ? -8.844  8.236   63.352  1.00 23.96 ? 319 VAL B CG2 1 
ATOM   5841  N N   . ASP B 1 320 ? -9.451  9.507   66.623  1.00 26.91 ? 320 ASP B N   1 
ATOM   5842  C CA  . ASP B 1 320 ? -10.357 10.586  67.078  1.00 27.07 ? 320 ASP B CA  1 
ATOM   5843  C C   . ASP B 1 320 ? -9.544  11.703  67.778  1.00 26.30 ? 320 ASP B C   1 
ATOM   5844  O O   . ASP B 1 320 ? -9.699  12.888  67.472  1.00 25.95 ? 320 ASP B O   1 
ATOM   5845  C CB  . ASP B 1 320 ? -11.354 10.024  68.093  1.00 28.55 ? 320 ASP B CB  1 
ATOM   5846  C CG  . ASP B 1 320 ? -12.557 9.339   67.462  1.00 35.60 ? 320 ASP B CG  1 
ATOM   5847  O OD1 . ASP B 1 320 ? -12.825 9.533   66.251  1.00 41.61 ? 320 ASP B OD1 1 
ATOM   5848  O OD2 . ASP B 1 320 ? -13.277 8.616   68.214  1.00 40.76 ? 320 ASP B OD2 1 
ATOM   5849  N N   . ARG B 1 321 ? -8.690  11.329  68.734  1.00 24.96 ? 321 ARG B N   1 
ATOM   5850  C CA  . ARG B 1 321 ? -7.860  12.303  69.454  1.00 24.60 ? 321 ARG B CA  1 
ATOM   5851  C C   . ARG B 1 321 ? -6.883  13.077  68.534  1.00 24.19 ? 321 ARG B C   1 
ATOM   5852  O O   . ARG B 1 321 ? -6.710  14.316  68.648  1.00 22.09 ? 321 ARG B O   1 
ATOM   5853  C CB  . ARG B 1 321 ? -7.082  11.648  70.597  1.00 26.17 ? 321 ARG B CB  1 
ATOM   5854  C CG  . ARG B 1 321 ? -7.915  11.105  71.768  1.00 26.79 ? 321 ARG B CG  1 
ATOM   5855  C CD  . ARG B 1 321 ? -7.013  10.735  72.970  1.00 27.77 ? 321 ARG B CD  1 
ATOM   5856  N NE  . ARG B 1 321 ? -6.030  9.682   72.647  1.00 28.76 ? 321 ARG B NE  1 
ATOM   5857  C CZ  . ARG B 1 321 ? -6.297  8.366   72.642  1.00 27.24 ? 321 ARG B CZ  1 
ATOM   5858  N NH1 . ARG B 1 321 ? -7.516  7.922   72.947  1.00 29.67 ? 321 ARG B NH1 1 
ATOM   5859  N NH2 . ARG B 1 321 ? -5.355  7.495   72.329  1.00 25.61 ? 321 ARG B NH2 1 
ATOM   5860  N N   . VAL B 1 322 ? -6.204  12.366  67.643  1.00 22.73 ? 322 VAL B N   1 
ATOM   5861  C CA  . VAL B 1 322 ? -5.375  13.106  66.690  1.00 22.54 ? 322 VAL B CA  1 
ATOM   5862  C C   . VAL B 1 322 ? -6.203  14.008  65.726  1.00 22.33 ? 322 VAL B C   1 
ATOM   5863  O O   . VAL B 1 322 ? -5.795  15.160  65.445  1.00 22.95 ? 322 VAL B O   1 
ATOM   5864  C CB  . VAL B 1 322 ? -4.292  12.233  66.026  1.00 22.45 ? 322 VAL B CB  1 
ATOM   5865  C CG1 . VAL B 1 322 ? -4.826  10.924  65.728  1.00 26.31 ? 322 VAL B CG1 1 
ATOM   5866  C CG2 . VAL B 1 322 ? -3.777  12.916  64.753  1.00 18.31 ? 322 VAL B CG2 1 
ATOM   5867  N N   . ILE B 1 323 ? -7.345  13.518  65.248  1.00 22.18 ? 323 ILE B N   1 
ATOM   5868  C CA  . ILE B 1 323 ? -8.253  14.362  64.438  1.00 23.51 ? 323 ILE B CA  1 
ATOM   5869  C C   . ILE B 1 323 ? -8.607  15.661  65.186  1.00 24.44 ? 323 ILE B C   1 
ATOM   5870  O O   . ILE B 1 323 ? -8.511  16.778  64.635  1.00 23.79 ? 323 ILE B O   1 
ATOM   5871  C CB  . ILE B 1 323 ? -9.582  13.623  63.961  1.00 23.75 ? 323 ILE B CB  1 
ATOM   5872  C CG1 . ILE B 1 323 ? -9.298  12.529  62.927  1.00 26.03 ? 323 ILE B CG1 1 
ATOM   5873  C CG2 . ILE B 1 323 ? -10.594 14.618  63.260  1.00 22.54 ? 323 ILE B CG2 1 
ATOM   5874  C CD1 . ILE B 1 323 ? -10.444 11.504  62.777  1.00 26.18 ? 323 ILE B CD1 1 
ATOM   5875  N N   . ASP B 1 324 ? -9.016  15.514  66.439  1.00 25.56 ? 324 ASP B N   1 
ATOM   5876  C CA  . ASP B 1 324 ? -9.406  16.676  67.234  1.00 26.56 ? 324 ASP B CA  1 
ATOM   5877  C C   . ASP B 1 324 ? -8.248  17.662  67.319  1.00 26.66 ? 324 ASP B C   1 
ATOM   5878  O O   . ASP B 1 324 ? -8.449  18.867  67.174  1.00 26.57 ? 324 ASP B O   1 
ATOM   5879  C CB  . ASP B 1 324 ? -9.978  16.240  68.602  1.00 27.66 ? 324 ASP B CB  1 
ATOM   5880  C CG  . ASP B 1 324 ? -11.400 15.628  68.474  1.00 30.62 ? 324 ASP B CG  1 
ATOM   5881  O OD1 . ASP B 1 324 ? -12.081 15.815  67.417  1.00 35.37 ? 324 ASP B OD1 1 
ATOM   5882  O OD2 . ASP B 1 324 ? -11.851 14.965  69.421  1.00 35.08 ? 324 ASP B OD2 1 
ATOM   5883  N N   . PHE B 1 325 ? -7.027  17.154  67.490  1.00 25.31 ? 325 PHE B N   1 
ATOM   5884  C CA  . PHE B 1 325 ? -5.859  18.030  67.452  1.00 25.39 ? 325 PHE B CA  1 
ATOM   5885  C C   . PHE B 1 325 ? -5.665  18.782  66.132  1.00 25.63 ? 325 PHE B C   1 
ATOM   5886  O O   . PHE B 1 325 ? -5.424  19.997  66.143  1.00 24.52 ? 325 PHE B O   1 
ATOM   5887  C CB  . PHE B 1 325 ? -4.563  17.299  67.795  1.00 25.73 ? 325 PHE B CB  1 
ATOM   5888  C CG  . PHE B 1 325 ? -3.357  18.154  67.638  1.00 23.96 ? 325 PHE B CG  1 
ATOM   5889  C CD1 . PHE B 1 325 ? -2.980  19.010  68.641  1.00 25.88 ? 325 PHE B CD1 1 
ATOM   5890  C CD2 . PHE B 1 325 ? -2.611  18.120  66.452  1.00 25.28 ? 325 PHE B CD2 1 
ATOM   5891  C CE1 . PHE B 1 325 ? -1.887  19.805  68.488  1.00 27.04 ? 325 PHE B CE1 1 
ATOM   5892  C CE2 . PHE B 1 325 ? -1.515  18.893  66.294  1.00 24.32 ? 325 PHE B CE2 1 
ATOM   5893  C CZ  . PHE B 1 325 ? -1.151  19.762  67.317  1.00 25.16 ? 325 PHE B CZ  1 
ATOM   5894  N N   . TYR B 1 326 ? -5.741  18.062  65.008  1.00 25.23 ? 326 TYR B N   1 
ATOM   5895  C CA  . TYR B 1 326 ? -5.463  18.689  63.711  1.00 25.17 ? 326 TYR B CA  1 
ATOM   5896  C C   . TYR B 1 326 ? -6.611  19.610  63.309  1.00 25.05 ? 326 TYR B C   1 
ATOM   5897  O O   . TYR B 1 326 ? -6.409  20.589  62.609  1.00 25.37 ? 326 TYR B O   1 
ATOM   5898  C CB  . TYR B 1 326 ? -5.192  17.639  62.629  1.00 24.67 ? 326 TYR B CB  1 
ATOM   5899  C CG  . TYR B 1 326 ? -3.751  17.186  62.596  1.00 25.40 ? 326 TYR B CG  1 
ATOM   5900  C CD1 . TYR B 1 326 ? -2.818  17.827  61.764  1.00 25.16 ? 326 TYR B CD1 1 
ATOM   5901  C CD2 . TYR B 1 326 ? -3.322  16.079  63.354  1.00 22.07 ? 326 TYR B CD2 1 
ATOM   5902  C CE1 . TYR B 1 326 ? -1.484  17.388  61.696  1.00 24.21 ? 326 TYR B CE1 1 
ATOM   5903  C CE2 . TYR B 1 326 ? -1.975  15.634  63.314  1.00 22.06 ? 326 TYR B CE2 1 
ATOM   5904  C CZ  . TYR B 1 326 ? -1.074  16.284  62.469  1.00 23.77 ? 326 TYR B CZ  1 
ATOM   5905  O OH  . TYR B 1 326 ? 0.258   15.921  62.412  1.00 24.85 ? 326 TYR B OH  1 
ATOM   5906  N N   . SER B 1 327 ? -7.809  19.288  63.781  1.00 25.54 ? 327 SER B N   1 
ATOM   5907  C CA  . SER B 1 327 ? -8.979  20.115  63.571  1.00 26.84 ? 327 SER B CA  1 
ATOM   5908  C C   . SER B 1 327 ? -8.804  21.463  64.285  1.00 25.88 ? 327 SER B C   1 
ATOM   5909  O O   . SER B 1 327 ? -9.170  22.492  63.756  1.00 26.43 ? 327 SER B O   1 
ATOM   5910  C CB  . SER B 1 327 ? -10.233 19.433  64.095  1.00 27.00 ? 327 SER B CB  1 
ATOM   5911  O OG  . SER B 1 327 ? -11.389 20.158  63.663  1.00 31.34 ? 327 SER B OG  1 
ATOM   5912  N N   . ASN B 1 328 ? -8.245  21.435  65.486  1.00 25.84 ? 328 ASN B N   1 
ATOM   5913  C CA  . ASN B 1 328 ? -7.997  22.676  66.202  1.00 25.28 ? 328 ASN B CA  1 
ATOM   5914  C C   . ASN B 1 328 ? -6.916  23.507  65.537  1.00 24.51 ? 328 ASN B C   1 
ATOM   5915  O O   . ASN B 1 328 ? -7.049  24.730  65.446  1.00 23.28 ? 328 ASN B O   1 
ATOM   5916  C CB  . ASN B 1 328 ? -7.722  22.402  67.673  1.00 27.65 ? 328 ASN B CB  1 
ATOM   5917  C CG  . ASN B 1 328 ? -9.018  22.230  68.488  1.00 31.01 ? 328 ASN B CG  1 
ATOM   5918  O OD1 . ASN B 1 328 ? -9.296  21.160  69.023  1.00 37.50 ? 328 ASN B OD1 1 
ATOM   5919  N ND2 . ASN B 1 328 ? -9.806  23.295  68.573  1.00 33.98 ? 328 ASN B ND2 1 
ATOM   5920  N N   . GLN B 1 329 ? -5.877  22.851  65.018  1.00 23.87 ? 329 GLN B N   1 
ATOM   5921  C CA  . GLN B 1 329 ? -4.866  23.562  64.211  1.00 23.87 ? 329 GLN B CA  1 
ATOM   5922  C C   . GLN B 1 329 ? -5.534  24.156  62.960  1.00 23.02 ? 329 GLN B C   1 
ATOM   5923  O O   . GLN B 1 329 ? -5.329  25.324  62.639  1.00 24.54 ? 329 GLN B O   1 
ATOM   5924  C CB  . GLN B 1 329 ? -3.683  22.631  63.839  1.00 23.45 ? 329 GLN B CB  1 
ATOM   5925  C CG  . GLN B 1 329 ? -2.995  21.994  65.039  1.00 21.81 ? 329 GLN B CG  1 
ATOM   5926  C CD  . GLN B 1 329 ? -2.124  23.030  65.743  1.00 23.28 ? 329 GLN B CD  1 
ATOM   5927  O OE1 . GLN B 1 329 ? -2.381  23.384  66.865  1.00 24.82 ? 329 GLN B OE1 1 
ATOM   5928  N NE2 . GLN B 1 329 ? -1.111  23.538  65.051  1.00 24.10 ? 329 GLN B NE2 1 
ATOM   5929  N N   . LYS B 1 330 ? -6.319  23.372  62.237  1.00 22.37 ? 330 LYS B N   1 
ATOM   5930  C CA  . LYS B 1 330 ? -7.040  23.932  61.079  1.00 22.25 ? 330 LYS B CA  1 
ATOM   5931  C C   . LYS B 1 330 ? -7.801  25.227  61.476  1.00 22.15 ? 330 LYS B C   1 
ATOM   5932  O O   . LYS B 1 330 ? -7.690  26.243  60.795  1.00 20.14 ? 330 LYS B O   1 
ATOM   5933  C CB  . LYS B 1 330 ? -7.964  22.901  60.427  1.00 23.19 ? 330 LYS B CB  1 
ATOM   5934  C CG  . LYS B 1 330 ? -8.914  23.481  59.384  1.00 26.33 ? 330 LYS B CG  1 
ATOM   5935  C CD  . LYS B 1 330 ? -10.233 22.711  59.289  1.00 27.53 ? 330 LYS B CD  1 
ATOM   5936  C CE  . LYS B 1 330 ? -10.792 22.387  60.644  1.00 29.27 ? 330 LYS B CE  1 
ATOM   5937  N NZ  . LYS B 1 330 ? -12.238 22.292  60.672  1.00 31.83 ? 330 LYS B NZ  1 
ATOM   5938  N N   . ASP B 1 331 ? -8.523  25.187  62.594  1.00 23.36 ? 331 ASP B N   1 
ATOM   5939  C CA  . ASP B 1 331 ? -9.341  26.334  63.029  1.00 24.90 ? 331 ASP B CA  1 
ATOM   5940  C C   . ASP B 1 331 ? -8.460  27.562  63.292  1.00 24.16 ? 331 ASP B C   1 
ATOM   5941  O O   . ASP B 1 331 ? -8.794  28.679  62.935  1.00 23.00 ? 331 ASP B O   1 
ATOM   5942  C CB  . ASP B 1 331 ? -10.106 25.984  64.288  1.00 25.01 ? 331 ASP B CB  1 
ATOM   5943  C CG  . ASP B 1 331 ? -11.241 25.021  64.046  1.00 29.66 ? 331 ASP B CG  1 
ATOM   5944  O OD1 . ASP B 1 331 ? -11.673 24.820  62.888  1.00 33.06 ? 331 ASP B OD1 1 
ATOM   5945  O OD2 . ASP B 1 331 ? -11.749 24.470  65.044  1.00 36.30 ? 331 ASP B OD2 1 
ATOM   5946  N N   . ALA B 1 332 ? -7.300  27.319  63.895  1.00 24.15 ? 332 ALA B N   1 
ATOM   5947  C CA  . ALA B 1 332 ? -6.374  28.365  64.232  1.00 23.10 ? 332 ALA B CA  1 
ATOM   5948  C C   . ALA B 1 332 ? -5.753  28.980  62.972  1.00 24.00 ? 332 ALA B C   1 
ATOM   5949  O O   . ALA B 1 332 ? -5.642  30.200  62.854  1.00 22.99 ? 332 ALA B O   1 
ATOM   5950  C CB  . ALA B 1 332 ? -5.304  27.819  65.186  1.00 25.15 ? 332 ALA B CB  1 
ATOM   5951  N N   . ILE B 1 333 ? -5.382  28.158  61.989  1.00 23.24 ? 333 ILE B N   1 
ATOM   5952  C CA  . ILE B 1 333 ? -4.807  28.724  60.781  1.00 22.88 ? 333 ILE B CA  1 
ATOM   5953  C C   . ILE B 1 333 ? -5.871  29.415  59.908  1.00 24.51 ? 333 ILE B C   1 
ATOM   5954  O O   . ILE B 1 333 ? -5.576  30.445  59.230  1.00 25.65 ? 333 ILE B O   1 
ATOM   5955  C CB  . ILE B 1 333 ? -3.978  27.681  59.930  1.00 22.44 ? 333 ILE B CB  1 
ATOM   5956  C CG1 . ILE B 1 333 ? -2.955  28.422  59.078  1.00 20.78 ? 333 ILE B CG1 1 
ATOM   5957  C CG2 . ILE B 1 333 ? -4.907  26.808  59.091  1.00 18.55 ? 333 ILE B CG2 1 
ATOM   5958  C CD1 . ILE B 1 333 ? -1.872  27.499  58.348  1.00 20.63 ? 333 ILE B CD1 1 
ATOM   5959  N N   . LEU B 1 334 ? -7.091  28.878  59.910  1.00 25.71 ? 334 LEU B N   1 
ATOM   5960  C CA  . LEU B 1 334 ? -8.186  29.560  59.184  1.00 26.88 ? 334 LEU B CA  1 
ATOM   5961  C C   . LEU B 1 334 ? -8.462  30.956  59.781  1.00 27.20 ? 334 LEU B C   1 
ATOM   5962  O O   . LEU B 1 334 ? -8.649  31.928  59.062  1.00 27.07 ? 334 LEU B O   1 
ATOM   5963  C CB  . LEU B 1 334 ? -9.431  28.709  59.248  1.00 27.03 ? 334 LEU B CB  1 
ATOM   5964  C CG  . LEU B 1 334 ? -9.875  27.917  58.015  1.00 29.06 ? 334 LEU B CG  1 
ATOM   5965  C CD1 . LEU B 1 334 ? -8.819  27.792  56.902  1.00 27.43 ? 334 LEU B CD1 1 
ATOM   5966  C CD2 . LEU B 1 334 ? -10.487 26.590  58.413  1.00 28.97 ? 334 LEU B CD2 1 
ATOM   5967  N N   . ALA B 1 335 ? -8.445  31.025  61.106  1.00 26.89 ? 335 ALA B N   1 
ATOM   5968  C CA  . ALA B 1 335 ? -8.646  32.264  61.838  1.00 26.77 ? 335 ALA B CA  1 
ATOM   5969  C C   . ALA B 1 335 ? -7.554  33.285  61.545  1.00 26.70 ? 335 ALA B C   1 
ATOM   5970  O O   . ALA B 1 335 ? -7.827  34.483  61.445  1.00 26.15 ? 335 ALA B O   1 
ATOM   5971  C CB  . ALA B 1 335 ? -8.711  31.965  63.330  1.00 27.31 ? 335 ALA B CB  1 
ATOM   5972  N N   . ALA B 1 336 ? -6.307  32.819  61.440  1.00 25.90 ? 336 ALA B N   1 
ATOM   5973  C CA  . ALA B 1 336 ? -5.194  33.690  61.080  1.00 25.48 ? 336 ALA B CA  1 
ATOM   5974  C C   . ALA B 1 336 ? -5.327  34.212  59.643  1.00 25.24 ? 336 ALA B C   1 
ATOM   5975  O O   . ALA B 1 336 ? -5.076  35.399  59.387  1.00 25.27 ? 336 ALA B O   1 
ATOM   5976  C CB  . ALA B 1 336 ? -3.862  32.972  61.270  1.00 25.10 ? 336 ALA B CB  1 
ATOM   5977  N N   . ALA B 1 337 ? -5.693  33.326  58.711  1.00 24.47 ? 337 ALA B N   1 
ATOM   5978  C CA  . ALA B 1 337 ? -5.907  33.720  57.297  1.00 25.18 ? 337 ALA B CA  1 
ATOM   5979  C C   . ALA B 1 337 ? -7.038  34.758  57.199  1.00 24.93 ? 337 ALA B C   1 
ATOM   5980  O O   . ALA B 1 337 ? -6.924  35.768  56.477  1.00 25.10 ? 337 ALA B O   1 
ATOM   5981  C CB  . ALA B 1 337 ? -6.205  32.465  56.394  1.00 24.46 ? 337 ALA B CB  1 
ATOM   5982  N N   . ASP B 1 338 ? -8.121  34.508  57.928  1.00 24.68 ? 338 ASP B N   1 
ATOM   5983  C CA  . ASP B 1 338 ? -9.273  35.406  57.911  1.00 25.74 ? 338 ASP B CA  1 
ATOM   5984  C C   . ASP B 1 338 ? -8.860  36.735  58.504  1.00 25.25 ? 338 ASP B C   1 
ATOM   5985  O O   . ASP B 1 338 ? -9.224  37.783  57.997  1.00 26.82 ? 338 ASP B O   1 
ATOM   5986  C CB  . ASP B 1 338 ? -10.440 34.851  58.738  1.00 25.27 ? 338 ASP B CB  1 
ATOM   5987  C CG  . ASP B 1 338 ? -11.250 33.822  57.994  1.00 27.54 ? 338 ASP B CG  1 
ATOM   5988  O OD1 . ASP B 1 338 ? -11.892 33.017  58.676  1.00 28.70 ? 338 ASP B OD1 1 
ATOM   5989  O OD2 . ASP B 1 338 ? -11.274 33.820  56.742  1.00 29.08 ? 338 ASP B OD2 1 
ATOM   5990  N N   . LYS B 1 339 ? -8.062  36.688  59.564  1.00 25.23 ? 339 LYS B N   1 
ATOM   5991  C CA  . LYS B 1 339 ? -7.599  37.886  60.196  1.00 24.17 ? 339 LYS B CA  1 
ATOM   5992  C C   . LYS B 1 339 ? -6.798  38.825  59.263  1.00 24.52 ? 339 LYS B C   1 
ATOM   5993  O O   . LYS B 1 339 ? -6.988  40.053  59.294  1.00 23.80 ? 339 LYS B O   1 
ATOM   5994  C CB  . LYS B 1 339 ? -6.793  37.551  61.462  1.00 24.70 ? 339 LYS B CB  1 
ATOM   5995  C CG  . LYS B 1 339 ? -6.270  38.785  62.243  1.00 22.00 ? 339 LYS B CG  1 
ATOM   5996  C CD  . LYS B 1 339 ? -5.853  38.419  63.646  1.00 25.77 ? 339 LYS B CD  1 
ATOM   5997  C CE  . LYS B 1 339 ? -5.217  39.622  64.315  1.00 27.24 ? 339 LYS B CE  1 
ATOM   5998  N NZ  . LYS B 1 339 ? -4.565  39.236  65.592  1.00 27.07 ? 339 LYS B NZ  1 
ATOM   5999  N N   . TRP B 1 340 ? -5.859  38.265  58.507  1.00 23.97 ? 340 TRP B N   1 
ATOM   6000  C CA  . TRP B 1 340 ? -4.844  39.080  57.879  1.00 23.62 ? 340 TRP B CA  1 
ATOM   6001  C C   . TRP B 1 340 ? -5.009  39.156  56.384  1.00 23.73 ? 340 TRP B C   1 
ATOM   6002  O O   . TRP B 1 340 ? -4.697  40.180  55.772  1.00 24.49 ? 340 TRP B O   1 
ATOM   6003  C CB  . TRP B 1 340 ? -3.452  38.559  58.234  1.00 23.59 ? 340 TRP B CB  1 
ATOM   6004  C CG  . TRP B 1 340 ? -3.150  38.805  59.639  1.00 24.09 ? 340 TRP B CG  1 
ATOM   6005  C CD1 . TRP B 1 340 ? -3.121  37.884  60.642  1.00 24.36 ? 340 TRP B CD1 1 
ATOM   6006  C CD2 . TRP B 1 340 ? -2.890  40.087  60.247  1.00 24.93 ? 340 TRP B CD2 1 
ATOM   6007  N NE1 . TRP B 1 340 ? -2.807  38.509  61.843  1.00 26.79 ? 340 TRP B NE1 1 
ATOM   6008  C CE2 . TRP B 1 340 ? -2.677  39.858  61.628  1.00 24.13 ? 340 TRP B CE2 1 
ATOM   6009  C CE3 . TRP B 1 340 ? -2.781  41.402  59.750  1.00 24.38 ? 340 TRP B CE3 1 
ATOM   6010  C CZ2 . TRP B 1 340 ? -2.392  40.894  62.527  1.00 25.23 ? 340 TRP B CZ2 1 
ATOM   6011  C CZ3 . TRP B 1 340 ? -2.489  42.455  60.663  1.00 23.84 ? 340 TRP B CZ3 1 
ATOM   6012  C CH2 . TRP B 1 340 ? -2.297  42.187  62.025  1.00 24.37 ? 340 TRP B CH2 1 
ATOM   6013  N N   . LEU B 1 341 ? -5.561  38.096  55.823  1.00 22.64 ? 341 LEU B N   1 
ATOM   6014  C CA  . LEU B 1 341 ? -5.498  37.869  54.390  1.00 23.81 ? 341 LEU B CA  1 
ATOM   6015  C C   . LEU B 1 341 ? -6.813  38.152  53.660  1.00 24.15 ? 341 LEU B C   1 
ATOM   6016  O O   . LEU B 1 341 ? -6.869  38.036  52.429  1.00 22.74 ? 341 LEU B O   1 
ATOM   6017  C CB  . LEU B 1 341 ? -5.095  36.406  54.130  1.00 23.30 ? 341 LEU B CB  1 
ATOM   6018  C CG  . LEU B 1 341 ? -3.668  36.005  53.746  1.00 26.71 ? 341 LEU B CG  1 
ATOM   6019  C CD1 . LEU B 1 341 ? -2.603  36.803  54.373  1.00 26.77 ? 341 LEU B CD1 1 
ATOM   6020  C CD2 . LEU B 1 341 ? -3.462  34.556  54.047  1.00 23.23 ? 341 LEU B CD2 1 
ATOM   6021  N N   . THR B 1 342 ? -7.883  38.476  54.387  1.00 24.76 ? 342 THR B N   1 
ATOM   6022  C CA  . THR B 1 342 ? -9.165  38.669  53.689  1.00 26.96 ? 342 THR B CA  1 
ATOM   6023  C C   . THR B 1 342 ? -9.030  39.803  52.672  1.00 27.84 ? 342 THR B C   1 
ATOM   6024  O O   . THR B 1 342 ? -8.470  40.869  52.970  1.00 28.24 ? 342 THR B O   1 
ATOM   6025  C CB  . THR B 1 342 ? -10.349 38.968  54.642  1.00 26.58 ? 342 THR B CB  1 
ATOM   6026  O OG1 . THR B 1 342 ? -10.019 40.098  55.411  1.00 33.41 ? 342 THR B OG1 1 
ATOM   6027  C CG2 . THR B 1 342 ? -10.576 37.848  55.611  1.00 25.10 ? 342 THR B CG2 1 
ATOM   6028  N N   . GLY B 1 343 ? -9.555  39.569  51.470  1.00 28.90 ? 343 GLY B N   1 
ATOM   6029  C CA  . GLY B 1 343 ? -9.393  40.496  50.362  1.00 30.09 ? 343 GLY B CA  1 
ATOM   6030  C C   . GLY B 1 343 ? -8.099  40.411  49.564  1.00 30.45 ? 343 GLY B C   1 
ATOM   6031  O O   . GLY B 1 343 ? -8.044  40.907  48.424  1.00 31.27 ? 343 GLY B O   1 
ATOM   6032  N N   . LEU B 1 344 ? -7.088  39.764  50.140  1.00 29.87 ? 344 LEU B N   1 
ATOM   6033  C CA  . LEU B 1 344 ? -5.762  39.617  49.529  1.00 29.39 ? 344 LEU B CA  1 
ATOM   6034  C C   . LEU B 1 344 ? -5.434  38.220  48.981  1.00 29.20 ? 344 LEU B C   1 
ATOM   6035  O O   . LEU B 1 344 ? -4.463  38.067  48.260  1.00 27.65 ? 344 LEU B O   1 
ATOM   6036  C CB  . LEU B 1 344 ? -4.682  39.925  50.565  1.00 30.50 ? 344 LEU B CB  1 
ATOM   6037  C CG  . LEU B 1 344 ? -4.685  41.243  51.306  1.00 30.44 ? 344 LEU B CG  1 
ATOM   6038  C CD1 . LEU B 1 344 ? -3.469  41.263  52.192  1.00 25.84 ? 344 LEU B CD1 1 
ATOM   6039  C CD2 . LEU B 1 344 ? -4.665  42.387  50.250  1.00 29.68 ? 344 LEU B CD2 1 
ATOM   6040  N N   . ALA B 1 345 ? -6.205  37.213  49.377  1.00 28.37 ? 345 ALA B N   1 
ATOM   6041  C CA  . ALA B 1 345 ? -5.951  35.827  48.971  1.00 28.79 ? 345 ALA B CA  1 
ATOM   6042  C C   . ALA B 1 345 ? -7.231  35.070  49.140  1.00 28.99 ? 345 ALA B C   1 
ATOM   6043  O O   . ALA B 1 345 ? -8.115  35.540  49.842  1.00 30.15 ? 345 ALA B O   1 
ATOM   6044  C CB  . ALA B 1 345 ? -4.841  35.183  49.859  1.00 27.66 ? 345 ALA B CB  1 
ATOM   6045  N N   . GLU B 1 346 ? -7.319  33.889  48.525  1.00 28.68 ? 346 GLU B N   1 
ATOM   6046  C CA  . GLU B 1 346 ? -8.481  33.009  48.635  1.00 29.14 ? 346 GLU B CA  1 
ATOM   6047  C C   . GLU B 1 346 ? -8.043  31.567  48.914  1.00 28.12 ? 346 GLU B C   1 
ATOM   6048  O O   . GLU B 1 346 ? -6.999  31.146  48.454  1.00 27.77 ? 346 GLU B O   1 
ATOM   6049  C CB  . GLU B 1 346 ? -9.267  33.012  47.339  1.00 29.95 ? 346 GLU B CB  1 
ATOM   6050  C CG  . GLU B 1 346 ? -9.721  34.383  46.915  1.00 34.47 ? 346 GLU B CG  1 
ATOM   6051  C CD  . GLU B 1 346 ? -10.328 34.369  45.559  1.00 41.66 ? 346 GLU B CD  1 
ATOM   6052  O OE1 . GLU B 1 346 ? -11.560 34.598  45.492  1.00 45.44 ? 346 GLU B OE1 1 
ATOM   6053  O OE2 . GLU B 1 346 ? -9.584  34.106  44.573  1.00 44.67 ? 346 GLU B OE2 1 
ATOM   6054  N N   . TRP B 1 347 ? -8.843  30.850  49.689  1.00 27.82 ? 347 TRP B N   1 
ATOM   6055  C CA  . TRP B 1 347 ? -8.518  29.484  50.150  1.00 27.30 ? 347 TRP B CA  1 
ATOM   6056  C C   . TRP B 1 347 ? -9.836  28.768  50.424  1.00 27.75 ? 347 TRP B C   1 
ATOM   6057  O O   . TRP B 1 347 ? -10.870 29.412  50.740  1.00 27.81 ? 347 TRP B O   1 
ATOM   6058  C CB  . TRP B 1 347 ? -7.619  29.495  51.419  1.00 27.12 ? 347 TRP B CB  1 
ATOM   6059  C CG  . TRP B 1 347 ? -8.236  30.256  52.568  1.00 27.54 ? 347 TRP B CG  1 
ATOM   6060  C CD1 . TRP B 1 347 ? -9.042  29.763  53.561  1.00 25.34 ? 347 TRP B CD1 1 
ATOM   6061  C CD2 . TRP B 1 347 ? -8.138  31.673  52.791  1.00 27.62 ? 347 TRP B CD2 1 
ATOM   6062  N NE1 . TRP B 1 347 ? -9.421  30.783  54.415  1.00 26.85 ? 347 TRP B NE1 1 
ATOM   6063  C CE2 . TRP B 1 347 ? -8.887  31.966  53.958  1.00 28.40 ? 347 TRP B CE2 1 
ATOM   6064  C CE3 . TRP B 1 347 ? -7.457  32.711  52.139  1.00 24.41 ? 347 TRP B CE3 1 
ATOM   6065  C CZ2 . TRP B 1 347 ? -9.004  33.276  54.468  1.00 28.31 ? 347 TRP B CZ2 1 
ATOM   6066  C CZ3 . TRP B 1 347 ? -7.554  34.009  52.651  1.00 27.38 ? 347 TRP B CZ3 1 
ATOM   6067  C CH2 . TRP B 1 347 ? -8.327  34.280  53.805  1.00 29.00 ? 347 TRP B CH2 1 
ATOM   6068  N N   . HIS B 1 348 ? -9.819  27.446  50.270  1.00 26.91 ? 348 HIS B N   1 
ATOM   6069  C CA  . HIS B 1 348 ? -10.905 26.595  50.698  1.00 27.45 ? 348 HIS B CA  1 
ATOM   6070  C C   . HIS B 1 348 ? -10.523 26.030  52.057  1.00 27.04 ? 348 HIS B C   1 
ATOM   6071  O O   . HIS B 1 348 ? -9.338  25.788  52.307  1.00 26.65 ? 348 HIS B O   1 
ATOM   6072  C CB  . HIS B 1 348 ? -11.096 25.434  49.707  1.00 27.87 ? 348 HIS B CB  1 
ATOM   6073  C CG  . HIS B 1 348 ? -11.320 25.874  48.293  1.00 29.55 ? 348 HIS B CG  1 
ATOM   6074  N ND1 . HIS B 1 348 ? -12.448 26.552  47.904  1.00 31.15 ? 348 HIS B ND1 1 
ATOM   6075  C CD2 . HIS B 1 348 ? -10.582 25.695  47.175  1.00 31.28 ? 348 HIS B CD2 1 
ATOM   6076  C CE1 . HIS B 1 348 ? -12.383 26.805  46.609  1.00 33.46 ? 348 HIS B CE1 1 
ATOM   6077  N NE2 . HIS B 1 348 ? -11.262 26.287  46.139  1.00 32.54 ? 348 HIS B NE2 1 
ATOM   6078  N N   . VAL B 1 349 ? -11.510 25.788  52.915  1.00 26.43 ? 349 VAL B N   1 
ATOM   6079  C CA  . VAL B 1 349 ? -11.216 25.128  54.192  1.00 26.86 ? 349 VAL B CA  1 
ATOM   6080  C C   . VAL B 1 349 ? -10.818 23.664  53.893  1.00 25.66 ? 349 VAL B C   1 
ATOM   6081  O O   . VAL B 1 349 ? -11.515 22.968  53.139  1.00 24.97 ? 349 VAL B O   1 
ATOM   6082  C CB  . VAL B 1 349 ? -12.355 25.241  55.307  1.00 27.38 ? 349 VAL B CB  1 
ATOM   6083  C CG1 . VAL B 1 349 ? -13.006 26.666  55.352  1.00 26.91 ? 349 VAL B CG1 1 
ATOM   6084  C CG2 . VAL B 1 349 ? -13.421 24.190  55.120  1.00 29.51 ? 349 VAL B CG2 1 
ATOM   6085  N N   . PRO B 1 350 ? -9.683  23.215  54.464  1.00 25.27 ? 350 PRO B N   1 
ATOM   6086  C CA  . PRO B 1 350 ? -9.191  21.845  54.323  1.00 25.46 ? 350 PRO B CA  1 
ATOM   6087  C C   . PRO B 1 350 ? -10.225 20.918  54.879  1.00 25.96 ? 350 PRO B C   1 
ATOM   6088  O O   . PRO B 1 350 ? -10.767 21.198  55.955  1.00 26.01 ? 350 PRO B O   1 
ATOM   6089  C CB  . PRO B 1 350 ? -7.944  21.824  55.213  1.00 25.61 ? 350 PRO B CB  1 
ATOM   6090  C CG  . PRO B 1 350 ? -7.476  23.231  55.244  1.00 26.32 ? 350 PRO B CG  1 
ATOM   6091  C CD  . PRO B 1 350 ? -8.788  24.030  55.296  1.00 25.91 ? 350 PRO B CD  1 
ATOM   6092  N N   . ALA B 1 351 ? -10.536 19.849  54.135  1.00 25.88 ? 351 ALA B N   1 
ATOM   6093  C CA  . ALA B 1 351 ? -11.492 18.833  54.554  1.00 24.89 ? 351 ALA B CA  1 
ATOM   6094  C C   . ALA B 1 351 ? -10.817 17.720  55.346  1.00 24.87 ? 351 ALA B C   1 
ATOM   6095  O O   . ALA B 1 351 ? -11.465 16.982  56.063  1.00 24.50 ? 351 ALA B O   1 
ATOM   6096  C CB  . ALA B 1 351 ? -12.215 18.255  53.329  1.00 25.98 ? 351 ALA B CB  1 
ATOM   6097  N N   . ALA B 1 352 ? -9.494  17.627  55.252  1.00 24.46 ? 352 ALA B N   1 
ATOM   6098  C CA  . ALA B 1 352 ? -8.744  16.610  56.003  1.00 24.27 ? 352 ALA B CA  1 
ATOM   6099  C C   . ALA B 1 352 ? -7.287  16.990  55.912  1.00 23.19 ? 352 ALA B C   1 
ATOM   6100  O O   . ALA B 1 352 ? -6.938  17.860  55.116  1.00 24.71 ? 352 ALA B O   1 
ATOM   6101  C CB  . ALA B 1 352 ? -8.983  15.187  55.391  1.00 23.53 ? 352 ALA B CB  1 
ATOM   6102  N N   . GLY B 1 353 ? -6.432  16.369  56.723  1.00 22.19 ? 353 GLY B N   1 
ATOM   6103  C CA  . GLY B 1 353 ? -4.999  16.458  56.505  1.00 21.54 ? 353 GLY B CA  1 
ATOM   6104  C C   . GLY B 1 353 ? -4.330  17.599  57.270  1.00 23.16 ? 353 GLY B C   1 
ATOM   6105  O O   . GLY B 1 353 ? -4.773  17.965  58.352  1.00 23.34 ? 353 GLY B O   1 
ATOM   6106  N N   . MET B 1 354 ? -3.265  18.158  56.713  1.00 22.48 ? 354 MET B N   1 
ATOM   6107  C CA  . MET B 1 354 ? -2.519  19.167  57.437  1.00 25.06 ? 354 MET B CA  1 
ATOM   6108  C C   . MET B 1 354 ? -2.052  20.378  56.656  1.00 23.49 ? 354 MET B C   1 
ATOM   6109  O O   . MET B 1 354 ? -1.155  21.080  57.105  1.00 24.15 ? 354 MET B O   1 
ATOM   6110  C CB  . MET B 1 354 ? -1.341  18.527  58.190  1.00 24.62 ? 354 MET B CB  1 
ATOM   6111  C CG  . MET B 1 354 ? -0.341  17.774  57.325  1.00 28.24 ? 354 MET B CG  1 
ATOM   6112  S SD  . MET B 1 354 ? 0.764   16.678  58.310  1.00 30.98 ? 354 MET B SD  1 
ATOM   6113  C CE  . MET B 1 354 ? -0.369  15.395  58.767  1.00 33.22 ? 354 MET B CE  1 
ATOM   6114  N N   . PHE B 1 355 ? -2.641  20.624  55.500  1.00 23.64 ? 355 PHE B N   1 
ATOM   6115  C CA  . PHE B 1 355 ? -2.189  21.730  54.673  1.00 23.07 ? 355 PHE B CA  1 
ATOM   6116  C C   . PHE B 1 355 ? -3.335  22.663  54.308  1.00 23.02 ? 355 PHE B C   1 
ATOM   6117  O O   . PHE B 1 355 ? -4.462  22.215  54.078  1.00 21.70 ? 355 PHE B O   1 
ATOM   6118  C CB  . PHE B 1 355 ? -1.461  21.221  53.402  1.00 23.89 ? 355 PHE B CB  1 
ATOM   6119  C CG  . PHE B 1 355 ? -0.281  20.359  53.697  1.00 23.22 ? 355 PHE B CG  1 
ATOM   6120  C CD1 . PHE B 1 355 ? 0.855   20.903  54.275  1.00 23.08 ? 355 PHE B CD1 1 
ATOM   6121  C CD2 . PHE B 1 355 ? -0.290  19.012  53.367  1.00 24.78 ? 355 PHE B CD2 1 
ATOM   6122  C CE1 . PHE B 1 355 ? 1.973   20.096  54.571  1.00 28.05 ? 355 PHE B CE1 1 
ATOM   6123  C CE2 . PHE B 1 355 ? 0.818   18.193  53.641  1.00 26.73 ? 355 PHE B CE2 1 
ATOM   6124  C CZ  . PHE B 1 355 ? 1.942   18.731  54.276  1.00 25.28 ? 355 PHE B CZ  1 
ATOM   6125  N N   . LEU B 1 356 ? -3.023  23.962  54.307  1.00 22.69 ? 356 LEU B N   1 
ATOM   6126  C CA  . LEU B 1 356 ? -3.901  24.999  53.781  1.00 22.21 ? 356 LEU B CA  1 
ATOM   6127  C C   . LEU B 1 356 ? -3.347  25.548  52.450  1.00 22.48 ? 356 LEU B C   1 
ATOM   6128  O O   . LEU B 1 356 ? -2.168  25.909  52.365  1.00 21.09 ? 356 LEU B O   1 
ATOM   6129  C CB  . LEU B 1 356 ? -4.025  26.126  54.817  1.00 23.11 ? 356 LEU B CB  1 
ATOM   6130  C CG  . LEU B 1 356 ? -4.825  27.357  54.374  1.00 23.54 ? 356 LEU B CG  1 
ATOM   6131  C CD1 . LEU B 1 356 ? -6.299  26.984  54.155  1.00 20.72 ? 356 LEU B CD1 1 
ATOM   6132  C CD2 . LEU B 1 356 ? -4.613  28.466  55.390  1.00 21.85 ? 356 LEU B CD2 1 
ATOM   6133  N N   . TRP B 1 357 ? -4.194  25.629  51.416  1.00 21.33 ? 357 TRP B N   1 
ATOM   6134  C CA  . TRP B 1 357 ? -3.701  26.018  50.097  1.00 21.01 ? 357 TRP B CA  1 
ATOM   6135  C C   . TRP B 1 357 ? -4.278  27.402  49.753  1.00 21.53 ? 357 TRP B C   1 
ATOM   6136  O O   . TRP B 1 357 ? -5.481  27.575  49.691  1.00 21.32 ? 357 TRP B O   1 
ATOM   6137  C CB  . TRP B 1 357 ? -4.164  24.949  49.115  1.00 19.73 ? 357 TRP B CB  1 
ATOM   6138  C CG  . TRP B 1 357 ? -3.790  25.003  47.659  1.00 21.17 ? 357 TRP B CG  1 
ATOM   6139  C CD1 . TRP B 1 357 ? -4.675  25.043  46.595  1.00 20.85 ? 357 TRP B CD1 1 
ATOM   6140  C CD2 . TRP B 1 357 ? -2.476  24.916  47.080  1.00 19.51 ? 357 TRP B CD2 1 
ATOM   6141  N NE1 . TRP B 1 357 ? -3.983  24.971  45.401  1.00 19.46 ? 357 TRP B NE1 1 
ATOM   6142  C CE2 . TRP B 1 357 ? -2.639  24.922  45.661  1.00 19.63 ? 357 TRP B CE2 1 
ATOM   6143  C CE3 . TRP B 1 357 ? -1.187  24.841  47.611  1.00 18.89 ? 357 TRP B CE3 1 
ATOM   6144  C CZ2 . TRP B 1 357 ? -1.554  24.839  44.764  1.00 18.71 ? 357 TRP B CZ2 1 
ATOM   6145  C CZ3 . TRP B 1 357 ? -0.107  24.784  46.714  1.00 20.47 ? 357 TRP B CZ3 1 
ATOM   6146  C CH2 . TRP B 1 357 ? -0.301  24.769  45.311  1.00 18.32 ? 357 TRP B CH2 1 
ATOM   6147  N N   . ILE B 1 358 ? -3.392  28.367  49.592  1.00 22.22 ? 358 ILE B N   1 
ATOM   6148  C CA  . ILE B 1 358 ? -3.740  29.794  49.538  1.00 24.80 ? 358 ILE B CA  1 
ATOM   6149  C C   . ILE B 1 358 ? -3.390  30.331  48.173  1.00 24.86 ? 358 ILE B C   1 
ATOM   6150  O O   . ILE B 1 358 ? -2.236  30.257  47.760  1.00 24.25 ? 358 ILE B O   1 
ATOM   6151  C CB  . ILE B 1 358 ? -2.937  30.589  50.614  1.00 25.20 ? 358 ILE B CB  1 
ATOM   6152  C CG1 . ILE B 1 358 ? -3.320  30.146  52.041  1.00 26.30 ? 358 ILE B CG1 1 
ATOM   6153  C CG2 . ILE B 1 358 ? -3.115  32.110  50.463  1.00 27.31 ? 358 ILE B CG2 1 
ATOM   6154  C CD1 . ILE B 1 358 ? -2.300  30.644  53.113  1.00 22.49 ? 358 ILE B CD1 1 
ATOM   6155  N N   . LYS B 1 359 ? -4.377  30.862  47.458  1.00 26.55 ? 359 LYS B N   1 
ATOM   6156  C CA  . LYS B 1 359 ? -4.089  31.566  46.208  1.00 28.65 ? 359 LYS B CA  1 
ATOM   6157  C C   . LYS B 1 359 ? -3.968  33.074  46.447  1.00 29.81 ? 359 LYS B C   1 
ATOM   6158  O O   . LYS B 1 359 ? -4.944  33.716  46.873  1.00 29.35 ? 359 LYS B O   1 
ATOM   6159  C CB  . LYS B 1 359 ? -5.195  31.276  45.201  1.00 28.96 ? 359 LYS B CB  1 
ATOM   6160  C CG  . LYS B 1 359 ? -4.925  31.784  43.766  1.00 30.83 ? 359 LYS B CG  1 
ATOM   6161  C CD  . LYS B 1 359 ? -6.269  31.698  43.053  1.00 35.65 ? 359 LYS B CD  1 
ATOM   6162  C CE  . LYS B 1 359 ? -6.149  31.704  41.533  1.00 37.75 ? 359 LYS B CE  1 
ATOM   6163  N NZ  . LYS B 1 359 ? -5.406  32.905  41.118  1.00 40.19 ? 359 LYS B NZ  1 
ATOM   6164  N N   . VAL B 1 360 ? -2.802  33.660  46.187  1.00 30.60 ? 360 VAL B N   1 
ATOM   6165  C CA  . VAL B 1 360 ? -2.680  35.080  46.439  1.00 32.70 ? 360 VAL B CA  1 
ATOM   6166  C C   . VAL B 1 360 ? -3.242  35.871  45.261  1.00 34.28 ? 360 VAL B C   1 
ATOM   6167  O O   . VAL B 1 360 ? -3.126  35.456  44.105  1.00 34.24 ? 360 VAL B O   1 
ATOM   6168  C CB  . VAL B 1 360 ? -1.272  35.557  46.868  1.00 32.99 ? 360 VAL B CB  1 
ATOM   6169  C CG1 . VAL B 1 360 ? -0.522  34.471  47.675  1.00 30.28 ? 360 VAL B CG1 1 
ATOM   6170  C CG2 . VAL B 1 360 ? -0.480  36.028  45.687  1.00 35.77 ? 360 VAL B CG2 1 
ATOM   6171  N N   . LYS B 1 361 ? -3.890  36.990  45.568  1.00 35.01 ? 361 LYS B N   1 
ATOM   6172  C CA  . LYS B 1 361 ? -4.676  37.672  44.544  1.00 36.46 ? 361 LYS B CA  1 
ATOM   6173  C C   . LYS B 1 361 ? -3.921  38.359  43.423  1.00 37.50 ? 361 LYS B C   1 
ATOM   6174  O O   . LYS B 1 361 ? -4.080  37.996  42.255  1.00 40.06 ? 361 LYS B O   1 
ATOM   6175  C CB  . LYS B 1 361 ? -5.782  38.532  45.147  1.00 35.77 ? 361 LYS B CB  1 
ATOM   6176  C CG  . LYS B 1 361 ? -7.052  37.684  45.321  1.00 37.03 ? 361 LYS B CG  1 
ATOM   6177  C CD  . LYS B 1 361 ? -8.152  38.341  46.141  1.00 38.20 ? 361 LYS B CD  1 
ATOM   6178  C CE  . LYS B 1 361 ? -8.754  39.575  45.435  1.00 39.72 ? 361 LYS B CE  1 
ATOM   6179  N NZ  . LYS B 1 361 ? -10.031 40.016  46.149  1.00 39.34 ? 361 LYS B NZ  1 
ATOM   6180  N N   . GLY B 1 362 ? -3.115  39.356  43.700  1.00 37.95 ? 362 GLY B N   1 
ATOM   6181  C CA  . GLY B 1 362 ? -2.716  40.157  42.518  1.00 38.53 ? 362 GLY B CA  1 
ATOM   6182  C C   . GLY B 1 362 ? -1.343  39.837  41.977  1.00 38.96 ? 362 GLY B C   1 
ATOM   6183  O O   . GLY B 1 362 ? -0.687  40.707  41.391  1.00 39.53 ? 362 GLY B O   1 
ATOM   6184  N N   . ILE B 1 363 ? -0.898  38.598  42.190  1.00 38.72 ? 363 ILE B N   1 
ATOM   6185  C CA  . ILE B 1 363 ? 0.488   38.212  41.944  1.00 39.44 ? 363 ILE B CA  1 
ATOM   6186  C C   . ILE B 1 363 ? 0.453   36.911  41.164  1.00 39.59 ? 363 ILE B C   1 
ATOM   6187  O O   . ILE B 1 363 ? -0.122  35.930  41.630  1.00 40.24 ? 363 ILE B O   1 
ATOM   6188  C CB  . ILE B 1 363 ? 1.268   38.046  43.276  1.00 38.70 ? 363 ILE B CB  1 
ATOM   6189  C CG1 . ILE B 1 363 ? 1.146   39.324  44.122  1.00 39.40 ? 363 ILE B CG1 1 
ATOM   6190  C CG2 . ILE B 1 363 ? 2.731   37.699  43.015  1.00 40.25 ? 363 ILE B CG2 1 
ATOM   6191  C CD1 . ILE B 1 363 ? 1.683   39.227  45.528  1.00 38.47 ? 363 ILE B CD1 1 
ATOM   6192  N N   . ASN B 1 364 ? 1.011   36.925  39.956  1.00 40.02 ? 364 ASN B N   1 
ATOM   6193  C CA  . ASN B 1 364 ? 0.983   35.760  39.071  1.00 40.36 ? 364 ASN B CA  1 
ATOM   6194  C C   . ASN B 1 364 ? 1.935   34.640  39.493  1.00 39.95 ? 364 ASN B C   1 
ATOM   6195  O O   . ASN B 1 364 ? 1.648   33.463  39.257  1.00 39.44 ? 364 ASN B O   1 
ATOM   6196  C CB  . ASN B 1 364 ? 1.262   36.164  37.623  1.00 41.37 ? 364 ASN B CB  1 
ATOM   6197  C CG  . ASN B 1 364 ? 0.194   37.087  37.047  1.00 44.01 ? 364 ASN B CG  1 
ATOM   6198  O OD1 . ASN B 1 364 ? 0.518   38.025  36.301  1.00 47.62 ? 364 ASN B OD1 1 
ATOM   6199  N ND2 . ASN B 1 364 ? -1.083  36.839  37.398  1.00 45.43 ? 364 ASN B ND2 1 
ATOM   6200  N N   . ASP B 1 365 ? 3.057   35.007  40.105  1.00 39.38 ? 365 ASP B N   1 
ATOM   6201  C CA  . ASP B 1 365 ? 4.002   34.012  40.620  1.00 39.03 ? 365 ASP B CA  1 
ATOM   6202  C C   . ASP B 1 365 ? 4.540   34.409  41.987  1.00 38.83 ? 365 ASP B C   1 
ATOM   6203  O O   . ASP B 1 365 ? 5.166   35.459  42.166  1.00 37.55 ? 365 ASP B O   1 
ATOM   6204  C CB  . ASP B 1 365 ? 5.150   33.764  39.642  1.00 39.45 ? 365 ASP B CB  1 
ATOM   6205  C CG  . ASP B 1 365 ? 6.164   32.765  40.183  1.00 42.51 ? 365 ASP B CG  1 
ATOM   6206  O OD1 . ASP B 1 365 ? 7.293   33.217  40.481  1.00 47.51 ? 365 ASP B OD1 1 
ATOM   6207  O OD2 . ASP B 1 365 ? 5.839   31.545  40.334  1.00 45.68 ? 365 ASP B OD2 1 
ATOM   6208  N N   . VAL B 1 366 ? 4.310   33.524  42.942  1.00 38.78 ? 366 VAL B N   1 
ATOM   6209  C CA  . VAL B 1 366 ? 4.597   33.775  44.346  1.00 39.07 ? 366 VAL B CA  1 
ATOM   6210  C C   . VAL B 1 366 ? 6.047   33.432  44.748  1.00 39.30 ? 366 VAL B C   1 
ATOM   6211  O O   . VAL B 1 366 ? 6.454   33.610  45.911  1.00 38.30 ? 366 VAL B O   1 
ATOM   6212  C CB  . VAL B 1 366 ? 3.560   33.007  45.207  1.00 39.24 ? 366 VAL B CB  1 
ATOM   6213  C CG1 . VAL B 1 366 ? 3.893   31.531  45.264  1.00 38.64 ? 366 VAL B CG1 1 
ATOM   6214  C CG2 . VAL B 1 366 ? 3.489   33.584  46.577  1.00 41.40 ? 366 VAL B CG2 1 
ATOM   6215  N N   . LYS B 1 367 ? 6.844   32.991  43.774  1.00 39.60 ? 367 LYS B N   1 
ATOM   6216  C CA  . LYS B 1 367 ? 8.218   32.567  44.051  1.00 40.36 ? 367 LYS B CA  1 
ATOM   6217  C C   . LYS B 1 367 ? 9.081   33.677  44.682  1.00 39.66 ? 367 LYS B C   1 
ATOM   6218  O O   . LYS B 1 367 ? 9.674   33.444  45.710  1.00 39.38 ? 367 LYS B O   1 
ATOM   6219  C CB  . LYS B 1 367 ? 8.868   31.954  42.798  1.00 41.47 ? 367 LYS B CB  1 
ATOM   6220  C CG  . LYS B 1 367 ? 10.292  31.415  42.957  1.00 43.27 ? 367 LYS B CG  1 
ATOM   6221  C CD  . LYS B 1 367 ? 11.120  31.872  41.740  1.00 47.59 ? 367 LYS B CD  1 
ATOM   6222  C CE  . LYS B 1 367 ? 12.205  30.901  41.331  1.00 51.22 ? 367 LYS B CE  1 
ATOM   6223  N NZ  . LYS B 1 367 ? 11.709  29.883  40.348  1.00 51.39 ? 367 LYS B NZ  1 
ATOM   6224  N N   . GLU B 1 368 ? 9.106   34.883  44.123  1.00 39.02 ? 368 GLU B N   1 
ATOM   6225  C CA  . GLU B 1 368 ? 9.911   35.971  44.707  1.00 40.11 ? 368 GLU B CA  1 
ATOM   6226  C C   . GLU B 1 368 ? 9.394   36.433  46.076  1.00 39.13 ? 368 GLU B C   1 
ATOM   6227  O O   . GLU B 1 368 ? 10.190  36.733  46.967  1.00 39.23 ? 368 GLU B O   1 
ATOM   6228  C CB  . GLU B 1 368 ? 10.045  37.165  43.748  1.00 40.43 ? 368 GLU B CB  1 
ATOM   6229  C CG  . GLU B 1 368 ? 10.877  36.870  42.451  1.00 46.33 ? 368 GLU B CG  1 
ATOM   6230  C CD  . GLU B 1 368 ? 10.234  35.834  41.498  1.00 51.93 ? 368 GLU B CD  1 
ATOM   6231  O OE1 . GLU B 1 368 ? 8.970   35.718  41.493  1.00 54.71 ? 368 GLU B OE1 1 
ATOM   6232  O OE2 . GLU B 1 368 ? 10.995  35.143  40.754  1.00 52.66 ? 368 GLU B OE2 1 
ATOM   6233  N N   . LEU B 1 369 ? 8.070   36.471  46.231  1.00 38.04 ? 369 LEU B N   1 
ATOM   6234  C CA  . LEU B 1 369 ? 7.429   36.876  47.475  1.00 37.42 ? 369 LEU B CA  1 
ATOM   6235  C C   . LEU B 1 369 ? 7.866   35.963  48.575  1.00 37.15 ? 369 LEU B C   1 
ATOM   6236  O O   . LEU B 1 369 ? 8.228   36.410  49.650  1.00 35.29 ? 369 LEU B O   1 
ATOM   6237  C CB  . LEU B 1 369 ? 5.910   36.795  47.363  1.00 37.72 ? 369 LEU B CB  1 
ATOM   6238  C CG  . LEU B 1 369 ? 5.094   36.995  48.646  1.00 38.23 ? 369 LEU B CG  1 
ATOM   6239  C CD1 . LEU B 1 369 ? 5.219   38.420  49.137  1.00 38.80 ? 369 LEU B CD1 1 
ATOM   6240  C CD2 . LEU B 1 369 ? 3.640   36.649  48.408  1.00 38.10 ? 369 LEU B CD2 1 
ATOM   6241  N N   . ILE B 1 370 ? 7.807   34.667  48.291  1.00 37.65 ? 370 ILE B N   1 
ATOM   6242  C CA  . ILE B 1 370 ? 8.140   33.656  49.271  1.00 38.69 ? 370 ILE B CA  1 
ATOM   6243  C C   . ILE B 1 370 ? 9.645   33.373  49.390  1.00 39.18 ? 370 ILE B C   1 
ATOM   6244  O O   . ILE B 1 370 ? 10.179  33.432  50.492  1.00 39.02 ? 370 ILE B O   1 
ATOM   6245  C CB  . ILE B 1 370 ? 7.348   32.357  49.022  1.00 38.25 ? 370 ILE B CB  1 
ATOM   6246  C CG1 . ILE B 1 370 ? 5.841   32.618  49.138  1.00 39.50 ? 370 ILE B CG1 1 
ATOM   6247  C CG2 . ILE B 1 370 ? 7.750   31.343  50.001  1.00 39.19 ? 370 ILE B CG2 1 
ATOM   6248  C CD1 . ILE B 1 370 ? 5.380   33.086  50.544  1.00 40.93 ? 370 ILE B CD1 1 
ATOM   6249  N N   . GLU B 1 371 ? 10.323  33.094  48.272  1.00 40.20 ? 371 GLU B N   1 
ATOM   6250  C CA  . GLU B 1 371 ? 11.752  32.700  48.321  1.00 42.17 ? 371 GLU B CA  1 
ATOM   6251  C C   . GLU B 1 371 ? 12.692  33.845  48.721  1.00 41.96 ? 371 GLU B C   1 
ATOM   6252  O O   . GLU B 1 371 ? 13.754  33.601  49.300  1.00 42.78 ? 371 GLU B O   1 
ATOM   6253  C CB  . GLU B 1 371 ? 12.227  32.018  47.015  1.00 42.51 ? 371 GLU B CB  1 
ATOM   6254  C CG  . GLU B 1 371 ? 12.284  32.948  45.767  1.00 46.57 ? 371 GLU B CG  1 
ATOM   6255  C CD  . GLU B 1 371 ? 13.375  32.599  44.716  1.00 52.06 ? 371 GLU B CD  1 
ATOM   6256  O OE1 . GLU B 1 371 ? 14.176  31.649  44.934  1.00 53.97 ? 371 GLU B OE1 1 
ATOM   6257  O OE2 . GLU B 1 371 ? 13.422  33.288  43.663  1.00 54.24 ? 371 GLU B OE2 1 
ATOM   6258  N N   . GLU B 1 372 ? 12.301  35.088  48.426  1.00 41.48 ? 372 GLU B N   1 
ATOM   6259  C CA  . GLU B 1 372 ? 13.139  36.247  48.717  1.00 40.67 ? 372 GLU B CA  1 
ATOM   6260  C C   . GLU B 1 372 ? 12.614  37.069  49.891  1.00 39.58 ? 372 GLU B C   1 
ATOM   6261  O O   . GLU B 1 372 ? 13.259  37.113  50.928  1.00 39.84 ? 372 GLU B O   1 
ATOM   6262  C CB  . GLU B 1 372 ? 13.359  37.114  47.465  1.00 41.13 ? 372 GLU B CB  1 
ATOM   6263  C CG  . GLU B 1 372 ? 13.856  36.316  46.224  1.00 44.30 ? 372 GLU B CG  1 
ATOM   6264  C CD  . GLU B 1 372 ? 14.302  37.208  45.055  1.00 49.65 ? 372 GLU B CD  1 
ATOM   6265  O OE1 . GLU B 1 372 ? 15.340  37.904  45.195  1.00 51.65 ? 372 GLU B OE1 1 
ATOM   6266  O OE2 . GLU B 1 372 ? 13.626  37.217  43.985  1.00 50.28 ? 372 GLU B OE2 1 
ATOM   6267  N N   . LYS B 1 373 ? 11.441  37.687  49.743  1.00 38.17 ? 373 LYS B N   1 
ATOM   6268  C CA  . LYS B 1 373 ? 10.920  38.649  50.738  1.00 36.72 ? 373 LYS B CA  1 
ATOM   6269  C C   . LYS B 1 373 ? 10.495  38.012  52.069  1.00 35.32 ? 373 LYS B C   1 
ATOM   6270  O O   . LYS B 1 373 ? 10.921  38.459  53.145  1.00 35.18 ? 373 LYS B O   1 
ATOM   6271  C CB  . LYS B 1 373 ? 9.777   39.497  50.148  1.00 36.49 ? 373 LYS B CB  1 
ATOM   6272  C CG  . LYS B 1 373 ? 10.106  40.247  48.840  1.00 37.16 ? 373 LYS B CG  1 
ATOM   6273  C CD  . LYS B 1 373 ? 8.798   40.731  48.209  1.00 39.09 ? 373 LYS B CD  1 
ATOM   6274  C CE  . LYS B 1 373 ? 8.955   41.658  46.996  1.00 41.40 ? 373 LYS B CE  1 
ATOM   6275  N NZ  . LYS B 1 373 ? 8.836   43.121  47.339  1.00 44.11 ? 373 LYS B NZ  1 
ATOM   6276  N N   . ALA B 1 374 ? 9.677   36.959  52.001  1.00 34.58 ? 374 ALA B N   1 
ATOM   6277  C CA  . ALA B 1 374 ? 9.223   36.288  53.236  1.00 33.81 ? 374 ALA B CA  1 
ATOM   6278  C C   . ALA B 1 374 ? 10.401  35.698  54.015  1.00 33.67 ? 374 ALA B C   1 
ATOM   6279  O O   . ALA B 1 374 ? 10.533  35.938  55.222  1.00 31.91 ? 374 ALA B O   1 
ATOM   6280  C CB  . ALA B 1 374 ? 8.167   35.228  52.944  1.00 32.87 ? 374 ALA B CB  1 
ATOM   6281  N N   . VAL B 1 375 ? 11.251  34.948  53.314  1.00 33.81 ? 375 VAL B N   1 
ATOM   6282  C CA  . VAL B 1 375 ? 12.501  34.434  53.900  1.00 35.03 ? 375 VAL B CA  1 
ATOM   6283  C C   . VAL B 1 375 ? 13.248  35.535  54.677  1.00 35.18 ? 375 VAL B C   1 
ATOM   6284  O O   . VAL B 1 375 ? 13.628  35.320  55.822  1.00 35.87 ? 375 VAL B O   1 
ATOM   6285  C CB  . VAL B 1 375 ? 13.454  33.752  52.842  1.00 35.42 ? 375 VAL B CB  1 
ATOM   6286  C CG1 . VAL B 1 375 ? 14.822  33.365  53.471  1.00 35.50 ? 375 VAL B CG1 1 
ATOM   6287  C CG2 . VAL B 1 375 ? 12.825  32.495  52.253  1.00 34.71 ? 375 VAL B CG2 1 
ATOM   6288  N N   . LYS B 1 376 ? 13.417  36.714  54.080  1.00 36.16 ? 376 LYS B N   1 
ATOM   6289  C CA  . LYS B 1 376 ? 14.156  37.807  54.746  1.00 37.48 ? 376 LYS B CA  1 
ATOM   6290  C C   . LYS B 1 376 ? 13.458  38.353  55.984  1.00 37.21 ? 376 LYS B C   1 
ATOM   6291  O O   . LYS B 1 376 ? 14.100  38.887  56.882  1.00 37.70 ? 376 LYS B O   1 
ATOM   6292  C CB  . LYS B 1 376 ? 14.453  38.943  53.784  1.00 37.84 ? 376 LYS B CB  1 
ATOM   6293  C CG  . LYS B 1 376 ? 15.683  38.730  52.901  1.00 42.23 ? 376 LYS B CG  1 
ATOM   6294  C CD  . LYS B 1 376 ? 15.755  39.812  51.809  1.00 43.80 ? 376 LYS B CD  1 
ATOM   6295  C CE  . LYS B 1 376 ? 15.454  39.263  50.406  1.00 46.33 ? 376 LYS B CE  1 
ATOM   6296  N NZ  . LYS B 1 376 ? 16.655  38.619  49.783  1.00 47.49 ? 376 LYS B NZ  1 
ATOM   6297  N N   . MET B 1 377 ? 12.138  38.217  56.018  1.00 37.87 ? 377 MET B N   1 
ATOM   6298  C CA  . MET B 1 377 ? 11.322  38.607  57.180  1.00 37.76 ? 377 MET B CA  1 
ATOM   6299  C C   . MET B 1 377 ? 11.189  37.467  58.169  1.00 36.62 ? 377 MET B C   1 
ATOM   6300  O O   . MET B 1 377 ? 10.527  37.615  59.204  1.00 35.76 ? 377 MET B O   1 
ATOM   6301  C CB  . MET B 1 377 ? 9.934   39.012  56.735  1.00 38.43 ? 377 MET B CB  1 
ATOM   6302  C CG  . MET B 1 377 ? 9.895   40.122  55.734  1.00 42.91 ? 377 MET B CG  1 
ATOM   6303  S SD  . MET B 1 377 ? 9.875   41.725  56.521  1.00 50.53 ? 377 MET B SD  1 
ATOM   6304  C CE  . MET B 1 377 ? 8.318   41.657  57.396  1.00 49.48 ? 377 MET B CE  1 
ATOM   6305  N N   . GLY B 1 378 ? 11.787  36.323  57.832  1.00 35.72 ? 378 GLY B N   1 
ATOM   6306  C CA  . GLY B 1 378 ? 11.825  35.168  58.741  1.00 35.29 ? 378 GLY B CA  1 
ATOM   6307  C C   . GLY B 1 378 ? 10.590  34.291  58.825  1.00 35.02 ? 378 GLY B C   1 
ATOM   6308  O O   . GLY B 1 378 ? 10.299  33.698  59.881  1.00 35.07 ? 378 GLY B O   1 
ATOM   6309  N N   . VAL B 1 379 ? 9.844   34.209  57.725  1.00 33.97 ? 379 VAL B N   1 
ATOM   6310  C CA  . VAL B 1 379 ? 8.676   33.349  57.691  1.00 33.63 ? 379 VAL B CA  1 
ATOM   6311  C C   . VAL B 1 379 ? 8.750   32.497  56.438  1.00 33.30 ? 379 VAL B C   1 
ATOM   6312  O O   . VAL B 1 379 ? 9.028   33.009  55.349  1.00 32.75 ? 379 VAL B O   1 
ATOM   6313  C CB  . VAL B 1 379 ? 7.302   34.105  57.818  1.00 33.31 ? 379 VAL B CB  1 
ATOM   6314  C CG1 . VAL B 1 379 ? 7.299   35.077  59.023  1.00 32.96 ? 379 VAL B CG1 1 
ATOM   6315  C CG2 . VAL B 1 379 ? 6.973   34.842  56.586  1.00 35.56 ? 379 VAL B CG2 1 
ATOM   6316  N N   . LEU B 1 380 ? 8.519   31.195  56.593  1.00 32.71 ? 380 LEU B N   1 
ATOM   6317  C CA  . LEU B 1 380 ? 8.573   30.323  55.435  1.00 32.75 ? 380 LEU B CA  1 
ATOM   6318  C C   . LEU B 1 380 ? 7.202   29.735  55.117  1.00 32.81 ? 380 LEU B C   1 
ATOM   6319  O O   . LEU B 1 380 ? 6.473   29.251  56.013  1.00 31.18 ? 380 LEU B O   1 
ATOM   6320  C CB  . LEU B 1 380 ? 9.661   29.247  55.579  1.00 33.55 ? 380 LEU B CB  1 
ATOM   6321  C CG  . LEU B 1 380 ? 11.040  29.610  56.165  1.00 34.14 ? 380 LEU B CG  1 
ATOM   6322  C CD1 . LEU B 1 380 ? 11.821  28.354  56.435  1.00 32.48 ? 380 LEU B CD1 1 
ATOM   6323  C CD2 . LEU B 1 380 ? 11.862  30.578  55.279  1.00 36.67 ? 380 LEU B CD2 1 
ATOM   6324  N N   . MET B 1 381 ? 6.804   29.859  53.852  1.00 32.39 ? 381 MET B N   1 
ATOM   6325  C CA  . MET B 1 381 ? 5.721   29.028  53.343  1.00 32.99 ? 381 MET B CA  1 
ATOM   6326  C C   . MET B 1 381 ? 6.222   28.404  52.050  1.00 32.18 ? 381 MET B C   1 
ATOM   6327  O O   . MET B 1 381 ? 7.312   28.743  51.588  1.00 32.24 ? 381 MET B O   1 
ATOM   6328  C CB  . MET B 1 381 ? 4.440   29.821  53.173  1.00 33.62 ? 381 MET B CB  1 
ATOM   6329  C CG  . MET B 1 381 ? 4.122   30.759  54.368  1.00 37.19 ? 381 MET B CG  1 
ATOM   6330  S SD  . MET B 1 381 ? 2.395   31.227  54.605  1.00 44.55 ? 381 MET B SD  1 
ATOM   6331  C CE  . MET B 1 381 ? 1.606   30.916  53.041  1.00 41.29 ? 381 MET B CE  1 
ATOM   6332  N N   . LEU B 1 382 ? 5.465   27.479  51.480  1.00 32.13 ? 382 LEU B N   1 
ATOM   6333  C CA  . LEU B 1 382 ? 5.957   26.754  50.313  1.00 32.07 ? 382 LEU B CA  1 
ATOM   6334  C C   . LEU B 1 382 ? 5.287   27.205  49.025  1.00 31.84 ? 382 LEU B C   1 
ATOM   6335  O O   . LEU B 1 382 ? 4.068   27.084  48.910  1.00 31.67 ? 382 LEU B O   1 
ATOM   6336  C CB  . LEU B 1 382 ? 5.716   25.262  50.494  1.00 32.10 ? 382 LEU B CB  1 
ATOM   6337  C CG  . LEU B 1 382 ? 6.475   24.311  49.583  1.00 33.76 ? 382 LEU B CG  1 
ATOM   6338  C CD1 . LEU B 1 382 ? 7.957   24.420  49.871  1.00 36.17 ? 382 LEU B CD1 1 
ATOM   6339  C CD2 . LEU B 1 382 ? 5.990   22.908  49.877  1.00 35.82 ? 382 LEU B CD2 1 
ATOM   6340  N N   . PRO B 1 383 ? 6.087   27.675  48.028  1.00 32.44 ? 383 PRO B N   1 
ATOM   6341  C CA  . PRO B 1 383 ? 5.513   28.066  46.730  1.00 31.58 ? 383 PRO B CA  1 
ATOM   6342  C C   . PRO B 1 383 ? 4.815   26.898  46.075  1.00 31.43 ? 383 PRO B C   1 
ATOM   6343  O O   . PRO B 1 383 ? 5.216   25.750  46.261  1.00 30.37 ? 383 PRO B O   1 
ATOM   6344  C CB  . PRO B 1 383 ? 6.729   28.519  45.918  1.00 32.11 ? 383 PRO B CB  1 
ATOM   6345  C CG  . PRO B 1 383 ? 7.760   28.955  46.983  1.00 33.19 ? 383 PRO B CG  1 
ATOM   6346  C CD  . PRO B 1 383 ? 7.553   27.902  48.065  1.00 32.13 ? 383 PRO B CD  1 
ATOM   6347  N N   . GLY B 1 384 ? 3.745   27.191  45.341  1.00 30.39 ? 384 GLY B N   1 
ATOM   6348  C CA  . GLY B 1 384 ? 2.935   26.161  44.727  1.00 29.80 ? 384 GLY B CA  1 
ATOM   6349  C C   . GLY B 1 384 ? 3.514   25.429  43.533  1.00 30.09 ? 384 GLY B C   1 
ATOM   6350  O O   . GLY B 1 384 ? 2.968   24.393  43.142  1.00 29.06 ? 384 GLY B O   1 
ATOM   6351  N N   . ASN B 1 385 ? 4.602   25.944  42.953  1.00 31.24 ? 385 ASN B N   1 
ATOM   6352  C CA  . ASN B 1 385 ? 5.149   25.408  41.675  1.00 33.47 ? 385 ASN B CA  1 
ATOM   6353  C C   . ASN B 1 385 ? 5.531   23.947  41.740  1.00 33.61 ? 385 ASN B C   1 
ATOM   6354  O O   . ASN B 1 385 ? 5.485   23.251  40.736  1.00 34.24 ? 385 ASN B O   1 
ATOM   6355  C CB  . ASN B 1 385 ? 6.398   26.149  41.190  1.00 34.22 ? 385 ASN B CB  1 
ATOM   6356  C CG  . ASN B 1 385 ? 6.439   27.590  41.607  1.00 38.26 ? 385 ASN B CG  1 
ATOM   6357  O OD1 . ASN B 1 385 ? 6.744   27.898  42.757  1.00 42.28 ? 385 ASN B OD1 1 
ATOM   6358  N ND2 . ASN B 1 385 ? 6.185   28.494  40.664  1.00 44.35 ? 385 ASN B ND2 1 
ATOM   6359  N N   . ALA B 1 386 ? 5.908   23.494  42.929  1.00 33.91 ? 386 ALA B N   1 
ATOM   6360  C CA  . ALA B 1 386 ? 6.483   22.177  43.113  1.00 33.83 ? 386 ALA B CA  1 
ATOM   6361  C C   . ALA B 1 386 ? 5.465   21.074  42.954  1.00 33.39 ? 386 ALA B C   1 
ATOM   6362  O O   . ALA B 1 386 ? 5.839   19.911  42.880  1.00 33.53 ? 386 ALA B O   1 
ATOM   6363  C CB  . ALA B 1 386 ? 7.146   22.090  44.474  1.00 34.32 ? 386 ALA B CB  1 
ATOM   6364  N N   . PHE B 1 387 ? 4.179   21.446  42.895  1.00 32.55 ? 387 PHE B N   1 
ATOM   6365  C CA  . PHE B 1 387 ? 3.068   20.484  42.873  1.00 31.43 ? 387 PHE B CA  1 
ATOM   6366  C C   . PHE B 1 387 ? 2.430   20.285  41.510  1.00 30.72 ? 387 PHE B C   1 
ATOM   6367  O O   . PHE B 1 387 ? 1.355   19.718  41.398  1.00 29.53 ? 387 PHE B O   1 
ATOM   6368  C CB  . PHE B 1 387 ? 2.019   20.886  43.934  1.00 31.97 ? 387 PHE B CB  1 
ATOM   6369  C CG  . PHE B 1 387 ? 2.594   20.968  45.308  1.00 33.08 ? 387 PHE B CG  1 
ATOM   6370  C CD1 . PHE B 1 387 ? 2.771   19.804  46.069  1.00 31.82 ? 387 PHE B CD1 1 
ATOM   6371  C CD2 . PHE B 1 387 ? 3.062   22.179  45.811  1.00 32.84 ? 387 PHE B CD2 1 
ATOM   6372  C CE1 . PHE B 1 387 ? 3.349   19.869  47.335  1.00 34.45 ? 387 PHE B CE1 1 
ATOM   6373  C CE2 . PHE B 1 387 ? 3.661   22.247  47.081  1.00 34.02 ? 387 PHE B CE2 1 
ATOM   6374  C CZ  . PHE B 1 387 ? 3.806   21.082  47.838  1.00 31.53 ? 387 PHE B CZ  1 
ATOM   6375  N N   . TYR B 1 388 ? 3.123   20.756  40.476  1.00 30.00 ? 388 TYR B N   1 
ATOM   6376  C CA  . TYR B 1 388 ? 2.670   20.656  39.092  1.00 28.81 ? 388 TYR B CA  1 
ATOM   6377  C C   . TYR B 1 388 ? 3.719   19.916  38.273  1.00 28.89 ? 388 TYR B C   1 
ATOM   6378  O O   . TYR B 1 388 ? 4.909   19.993  38.588  1.00 26.88 ? 388 TYR B O   1 
ATOM   6379  C CB  . TYR B 1 388 ? 2.455   22.063  38.511  1.00 28.28 ? 388 TYR B CB  1 
ATOM   6380  C CG  . TYR B 1 388 ? 1.347   22.791  39.207  1.00 26.76 ? 388 TYR B CG  1 
ATOM   6381  C CD1 . TYR B 1 388 ? 1.614   23.600  40.333  1.00 24.74 ? 388 TYR B CD1 1 
ATOM   6382  C CD2 . TYR B 1 388 ? 0.024   22.656  38.766  1.00 25.84 ? 388 TYR B CD2 1 
ATOM   6383  C CE1 . TYR B 1 388 ? 0.586   24.279  40.991  1.00 24.19 ? 388 TYR B CE1 1 
ATOM   6384  C CE2 . TYR B 1 388 ? -1.016  23.312  39.425  1.00 25.21 ? 388 TYR B CE2 1 
ATOM   6385  C CZ  . TYR B 1 388 ? -0.732  24.123  40.526  1.00 27.48 ? 388 TYR B CZ  1 
ATOM   6386  O OH  . TYR B 1 388 ? -1.778  24.758  41.166  1.00 27.73 ? 388 TYR B OH  1 
ATOM   6387  N N   . VAL B 1 389 ? 3.266   19.188  37.252  1.00 30.29 ? 389 VAL B N   1 
ATOM   6388  C CA  . VAL B 1 389 ? 4.159   18.441  36.339  1.00 33.04 ? 389 VAL B CA  1 
ATOM   6389  C C   . VAL B 1 389 ? 5.168   19.423  35.742  1.00 34.31 ? 389 VAL B C   1 
ATOM   6390  O O   . VAL B 1 389 ? 6.380   19.192  35.764  1.00 35.22 ? 389 VAL B O   1 
ATOM   6391  C CB  . VAL B 1 389 ? 3.352   17.693  35.226  1.00 33.23 ? 389 VAL B CB  1 
ATOM   6392  C CG1 . VAL B 1 389 ? 4.275   17.128  34.142  1.00 35.00 ? 389 VAL B CG1 1 
ATOM   6393  C CG2 . VAL B 1 389 ? 2.494   16.592  35.823  1.00 33.58 ? 389 VAL B CG2 1 
ATOM   6394  N N   . ASP B 1 390 ? 4.672   20.566  35.282  1.00 35.61 ? 390 ASP B N   1 
ATOM   6395  C CA  . ASP B 1 390 ? 5.537   21.631  34.825  1.00 36.46 ? 390 ASP B CA  1 
ATOM   6396  C C   . ASP B 1 390 ? 5.739   22.640  35.957  1.00 36.54 ? 390 ASP B C   1 
ATOM   6397  O O   . ASP B 1 390 ? 4.991   23.626  36.095  1.00 36.22 ? 390 ASP B O   1 
ATOM   6398  C CB  . ASP B 1 390 ? 4.960   22.267  33.537  1.00 36.94 ? 390 ASP B CB  1 
ATOM   6399  C CG  . ASP B 1 390 ? 5.710   23.523  33.092  1.00 38.20 ? 390 ASP B CG  1 
ATOM   6400  O OD1 . ASP B 1 390 ? 6.869   23.761  33.540  1.00 39.82 ? 390 ASP B OD1 1 
ATOM   6401  O OD2 . ASP B 1 390 ? 5.118   24.275  32.291  1.00 37.13 ? 390 ASP B OD2 1 
ATOM   6402  N N   . SER B 1 391 ? 6.762   22.380  36.760  1.00 36.64 ? 391 SER B N   1 
ATOM   6403  C CA  . SER B 1 391 ? 7.079   23.201  37.914  1.00 37.80 ? 391 SER B CA  1 
ATOM   6404  C C   . SER B 1 391 ? 7.589   24.590  37.526  1.00 37.77 ? 391 SER B C   1 
ATOM   6405  O O   . SER B 1 391 ? 7.639   25.498  38.362  1.00 38.57 ? 391 SER B O   1 
ATOM   6406  C CB  . SER B 1 391 ? 8.058   22.477  38.865  1.00 37.69 ? 391 SER B CB  1 
ATOM   6407  O OG  . SER B 1 391 ? 9.326   22.246  38.259  1.00 38.49 ? 391 SER B OG  1 
ATOM   6408  N N   . SER B 1 392 ? 7.909   24.779  36.252  1.00 37.97 ? 392 SER B N   1 
ATOM   6409  C CA  . SER B 1 392 ? 8.509   26.036  35.791  1.00 37.75 ? 392 SER B CA  1 
ATOM   6410  C C   . SER B 1 392 ? 7.465   27.107  35.483  1.00 37.61 ? 392 SER B C   1 
ATOM   6411  O O   . SER B 1 392 ? 7.800   28.295  35.364  1.00 37.61 ? 392 SER B O   1 
ATOM   6412  C CB  . SER B 1 392 ? 9.382   25.795  34.555  1.00 38.48 ? 392 SER B CB  1 
ATOM   6413  O OG  . SER B 1 392 ? 8.617   26.030  33.387  1.00 38.43 ? 392 SER B OG  1 
ATOM   6414  N N   . ALA B 1 393 ? 6.211   26.690  35.327  1.00 36.94 ? 393 ALA B N   1 
ATOM   6415  C CA  . ALA B 1 393 ? 5.121   27.647  35.124  1.00 37.10 ? 393 ALA B CA  1 
ATOM   6416  C C   . ALA B 1 393 ? 4.869   28.472  36.400  1.00 36.49 ? 393 ALA B C   1 
ATOM   6417  O O   . ALA B 1 393 ? 4.988   27.953  37.502  1.00 36.51 ? 393 ALA B O   1 
ATOM   6418  C CB  . ALA B 1 393 ? 3.860   26.929  34.688  1.00 36.15 ? 393 ALA B CB  1 
ATOM   6419  N N   . PRO B 1 394 ? 4.551   29.774  36.251  1.00 36.78 ? 394 PRO B N   1 
ATOM   6420  C CA  . PRO B 1 394 ? 4.161   30.578  37.401  1.00 35.60 ? 394 PRO B CA  1 
ATOM   6421  C C   . PRO B 1 394 ? 2.991   30.018  38.224  1.00 34.56 ? 394 PRO B C   1 
ATOM   6422  O O   . PRO B 1 394 ? 2.013   29.493  37.682  1.00 34.48 ? 394 PRO B O   1 
ATOM   6423  C CB  . PRO B 1 394 ? 3.769   31.918  36.765  1.00 35.70 ? 394 PRO B CB  1 
ATOM   6424  C CG  . PRO B 1 394 ? 4.620   31.986  35.533  1.00 37.02 ? 394 PRO B CG  1 
ATOM   6425  C CD  . PRO B 1 394 ? 4.599   30.588  35.014  1.00 36.91 ? 394 PRO B CD  1 
ATOM   6426  N N   . SER B 1 395 ? 3.120   30.141  39.542  1.00 33.01 ? 395 SER B N   1 
ATOM   6427  C CA  . SER B 1 395 ? 2.060   29.779  40.463  1.00 31.51 ? 395 SER B CA  1 
ATOM   6428  C C   . SER B 1 395 ? 1.842   30.896  41.471  1.00 30.52 ? 395 SER B C   1 
ATOM   6429  O O   . SER B 1 395 ? 2.802   31.355  42.078  1.00 31.08 ? 395 SER B O   1 
ATOM   6430  C CB  . SER B 1 395 ? 2.430   28.508  41.223  1.00 31.68 ? 395 SER B CB  1 
ATOM   6431  O OG  . SER B 1 395 ? 1.335   28.070  41.989  1.00 31.25 ? 395 SER B OG  1 
ATOM   6432  N N   . PRO B 1 396 ? 0.579   31.327  41.655  1.00 29.65 ? 396 PRO B N   1 
ATOM   6433  C CA  . PRO B 1 396 ? 0.167   32.289  42.695  1.00 28.70 ? 396 PRO B CA  1 
ATOM   6434  C C   . PRO B 1 396 ? -0.265  31.606  44.016  1.00 28.21 ? 396 PRO B C   1 
ATOM   6435  O O   . PRO B 1 396 ? -0.781  32.267  44.922  1.00 26.29 ? 396 PRO B O   1 
ATOM   6436  C CB  . PRO B 1 396 ? -1.045  32.966  42.028  1.00 29.14 ? 396 PRO B CB  1 
ATOM   6437  C CG  . PRO B 1 396 ? -1.674  31.817  41.304  1.00 29.39 ? 396 PRO B CG  1 
ATOM   6438  C CD  . PRO B 1 396 ? -0.552  30.990  40.769  1.00 28.81 ? 396 PRO B CD  1 
ATOM   6439  N N   . TYR B 1 397 ? -0.080  30.293  44.097  1.00 27.55 ? 397 TYR B N   1 
ATOM   6440  C CA  . TYR B 1 397 ? -0.473  29.513  45.258  1.00 27.52 ? 397 TYR B CA  1 
ATOM   6441  C C   . TYR B 1 397 ? 0.675   29.243  46.218  1.00 28.02 ? 397 TYR B C   1 
ATOM   6442  O O   . TYR B 1 397 ? 1.832   29.138  45.821  1.00 27.15 ? 397 TYR B O   1 
ATOM   6443  C CB  . TYR B 1 397 ? -1.032  28.160  44.825  1.00 28.09 ? 397 TYR B CB  1 
ATOM   6444  C CG  . TYR B 1 397 ? -2.395  28.182  44.208  1.00 27.44 ? 397 TYR B CG  1 
ATOM   6445  C CD1 . TYR B 1 397 ? -3.532  28.046  45.007  1.00 30.26 ? 397 TYR B CD1 1 
ATOM   6446  C CD2 . TYR B 1 397 ? -2.563  28.268  42.815  1.00 28.00 ? 397 TYR B CD2 1 
ATOM   6447  C CE1 . TYR B 1 397 ? -4.799  28.022  44.436  1.00 27.83 ? 397 TYR B CE1 1 
ATOM   6448  C CE2 . TYR B 1 397 ? -3.850  28.223  42.236  1.00 26.28 ? 397 TYR B CE2 1 
ATOM   6449  C CZ  . TYR B 1 397 ? -4.937  28.125  43.054  1.00 28.57 ? 397 TYR B CZ  1 
ATOM   6450  O OH  . TYR B 1 397 ? -6.211  28.089  42.525  1.00 32.45 ? 397 TYR B OH  1 
ATOM   6451  N N   . LEU B 1 398 ? 0.296   29.087  47.482  1.00 28.54 ? 398 LEU B N   1 
ATOM   6452  C CA  . LEU B 1 398 ? 1.161   28.895  48.618  1.00 28.63 ? 398 LEU B CA  1 
ATOM   6453  C C   . LEU B 1 398 ? 0.610   27.723  49.394  1.00 27.80 ? 398 LEU B C   1 
ATOM   6454  O O   . LEU B 1 398 ? -0.593  27.650  49.598  1.00 27.83 ? 398 LEU B O   1 
ATOM   6455  C CB  . LEU B 1 398 ? 1.063   30.106  49.563  1.00 29.24 ? 398 LEU B CB  1 
ATOM   6456  C CG  . LEU B 1 398 ? 1.898   31.292  49.154  1.00 32.45 ? 398 LEU B CG  1 
ATOM   6457  C CD1 . LEU B 1 398 ? 1.765   32.448  50.162  1.00 33.12 ? 398 LEU B CD1 1 
ATOM   6458  C CD2 . LEU B 1 398 ? 3.337   30.751  49.066  1.00 36.67 ? 398 LEU B CD2 1 
ATOM   6459  N N   . ARG B 1 399 ? 1.483   26.836  49.849  1.00 26.47 ? 399 ARG B N   1 
ATOM   6460  C CA  . ARG B 1 399 ? 1.111   25.830  50.840  1.00 26.86 ? 399 ARG B CA  1 
ATOM   6461  C C   . ARG B 1 399 ? 1.581   26.192  52.248  1.00 26.17 ? 399 ARG B C   1 
ATOM   6462  O O   . ARG B 1 399 ? 2.760   26.391  52.474  1.00 27.28 ? 399 ARG B O   1 
ATOM   6463  C CB  . ARG B 1 399 ? 1.644   24.434  50.438  1.00 26.44 ? 399 ARG B CB  1 
ATOM   6464  C CG  . ARG B 1 399 ? 1.058   23.297  51.308  1.00 27.29 ? 399 ARG B CG  1 
ATOM   6465  C CD  . ARG B 1 399 ? 1.805   22.016  51.010  1.00 29.31 ? 399 ARG B CD  1 
ATOM   6466  N NE  . ARG B 1 399 ? 3.051   21.938  51.764  1.00 25.94 ? 399 ARG B NE  1 
ATOM   6467  C CZ  . ARG B 1 399 ? 3.838   20.866  51.793  1.00 25.81 ? 399 ARG B CZ  1 
ATOM   6468  N NH1 . ARG B 1 399 ? 3.533   19.797  51.082  1.00 23.45 ? 399 ARG B NH1 1 
ATOM   6469  N NH2 . ARG B 1 399 ? 4.947   20.888  52.517  1.00 26.27 ? 399 ARG B NH2 1 
ATOM   6470  N N   . ALA B 1 400 ? 0.656   26.262  53.209  1.00 26.65 ? 400 ALA B N   1 
ATOM   6471  C CA  . ALA B 1 400 ? 1.036   26.493  54.630  1.00 25.94 ? 400 ALA B CA  1 
ATOM   6472  C C   . ALA B 1 400 ? 0.646   25.271  55.466  1.00 25.90 ? 400 ALA B C   1 
ATOM   6473  O O   . ALA B 1 400 ? -0.512  24.839  55.419  1.00 25.30 ? 400 ALA B O   1 
ATOM   6474  C CB  . ALA B 1 400 ? 0.346   27.766  55.197  1.00 26.79 ? 400 ALA B CB  1 
ATOM   6475  N N   . SER B 1 401 ? 1.596   24.718  56.226  1.00 25.53 ? 401 SER B N   1 
ATOM   6476  C CA  . SER B 1 401 ? 1.272   23.585  57.109  1.00 25.56 ? 401 SER B CA  1 
ATOM   6477  C C   . SER B 1 401 ? 0.729   24.115  58.426  1.00 25.45 ? 401 SER B C   1 
ATOM   6478  O O   . SER B 1 401 ? 1.258   25.089  58.990  1.00 25.48 ? 401 SER B O   1 
ATOM   6479  C CB  . SER B 1 401 ? 2.467   22.651  57.377  1.00 25.83 ? 401 SER B CB  1 
ATOM   6480  O OG  . SER B 1 401 ? 2.106   21.629  58.368  1.00 26.52 ? 401 SER B OG  1 
ATOM   6481  N N   . PHE B 1 402 ? -0.341  23.483  58.876  1.00 24.98 ? 402 PHE B N   1 
ATOM   6482  C CA  . PHE B 1 402 ? -0.882  23.705  60.191  1.00 25.70 ? 402 PHE B CA  1 
ATOM   6483  C C   . PHE B 1 402 ? -0.643  22.540  61.191  1.00 26.29 ? 402 PHE B C   1 
ATOM   6484  O O   . PHE B 1 402 ? -1.295  22.473  62.237  1.00 26.67 ? 402 PHE B O   1 
ATOM   6485  C CB  . PHE B 1 402 ? -2.378  24.124  60.100  1.00 25.40 ? 402 PHE B CB  1 
ATOM   6486  C CG  . PHE B 1 402 ? -3.301  23.106  59.445  1.00 24.66 ? 402 PHE B CG  1 
ATOM   6487  C CD1 . PHE B 1 402 ? -3.763  21.979  60.132  1.00 23.58 ? 402 PHE B CD1 1 
ATOM   6488  C CD2 . PHE B 1 402 ? -3.749  23.313  58.138  1.00 24.68 ? 402 PHE B CD2 1 
ATOM   6489  C CE1 . PHE B 1 402 ? -4.675  21.083  59.511  1.00 20.83 ? 402 PHE B CE1 1 
ATOM   6490  C CE2 . PHE B 1 402 ? -4.628  22.467  57.535  1.00 17.23 ? 402 PHE B CE2 1 
ATOM   6491  C CZ  . PHE B 1 402 ? -5.094  21.324  58.208  1.00 21.51 ? 402 PHE B CZ  1 
ATOM   6492  N N   . SER B 1 403 ? 0.332   21.656  60.936  1.00 25.51 ? 403 SER B N   1 
ATOM   6493  C CA  . SER B 1 403 ? 0.539   20.541  61.867  1.00 26.82 ? 403 SER B CA  1 
ATOM   6494  C C   . SER B 1 403 ? 1.130   20.920  63.227  1.00 27.15 ? 403 SER B C   1 
ATOM   6495  O O   . SER B 1 403 ? 0.842   20.241  64.231  1.00 26.83 ? 403 SER B O   1 
ATOM   6496  C CB  . SER B 1 403 ? 1.415   19.446  61.264  1.00 25.87 ? 403 SER B CB  1 
ATOM   6497  O OG  . SER B 1 403 ? 2.661   20.010  60.965  1.00 27.78 ? 403 SER B OG  1 
ATOM   6498  N N   . SER B 1 404 ? 1.916   22.000  63.265  1.00 27.49 ? 404 SER B N   1 
ATOM   6499  C CA  . SER B 1 404 ? 2.811   22.260  64.391  1.00 29.26 ? 404 SER B CA  1 
ATOM   6500  C C   . SER B 1 404 ? 2.731   23.651  65.010  1.00 28.86 ? 404 SER B C   1 
ATOM   6501  O O   . SER B 1 404 ? 2.889   23.794  66.218  1.00 28.85 ? 404 SER B O   1 
ATOM   6502  C CB  . SER B 1 404 ? 4.266   22.025  63.963  1.00 28.61 ? 404 SER B CB  1 
ATOM   6503  O OG  . SER B 1 404 ? 4.451   20.666  63.593  1.00 36.04 ? 404 SER B OG  1 
ATOM   6504  N N   . ALA B 1 405 ? 2.556   24.669  64.167  1.00 28.29 ? 405 ALA B N   1 
ATOM   6505  C CA  . ALA B 1 405 ? 2.721   26.044  64.609  1.00 28.37 ? 405 ALA B CA  1 
ATOM   6506  C C   . ALA B 1 405 ? 1.667   26.368  65.648  1.00 28.14 ? 405 ALA B C   1 
ATOM   6507  O O   . ALA B 1 405 ? 0.527   25.904  65.573  1.00 27.47 ? 405 ALA B O   1 
ATOM   6508  C CB  . ALA B 1 405 ? 2.661   27.023  63.407  1.00 28.24 ? 405 ALA B CB  1 
ATOM   6509  N N   . SER B 1 406 ? 2.065   27.143  66.635  1.00 28.79 ? 406 SER B N   1 
ATOM   6510  C CA  . SER B 1 406 ? 1.143   27.658  67.640  1.00 29.84 ? 406 SER B CA  1 
ATOM   6511  C C   . SER B 1 406 ? 0.245   28.759  67.039  1.00 31.14 ? 406 SER B C   1 
ATOM   6512  O O   . SER B 1 406 ? 0.594   29.331  66.008  1.00 30.93 ? 406 SER B O   1 
ATOM   6513  C CB  . SER B 1 406 ? 1.938   28.251  68.809  1.00 29.92 ? 406 SER B CB  1 
ATOM   6514  O OG  . SER B 1 406 ? 2.567   29.445  68.403  1.00 28.98 ? 406 SER B OG  1 
ATOM   6515  N N   . PRO B 1 407 ? -0.904  29.076  67.686  1.00 32.13 ? 407 PRO B N   1 
ATOM   6516  C CA  . PRO B 1 407 ? -1.686  30.198  67.150  1.00 32.26 ? 407 PRO B CA  1 
ATOM   6517  C C   . PRO B 1 407 ? -0.926  31.517  67.035  1.00 32.70 ? 407 PRO B C   1 
ATOM   6518  O O   . PRO B 1 407 ? -1.207  32.273  66.115  1.00 32.00 ? 407 PRO B O   1 
ATOM   6519  C CB  . PRO B 1 407 ? -2.863  30.327  68.135  1.00 33.05 ? 407 PRO B CB  1 
ATOM   6520  C CG  . PRO B 1 407 ? -2.970  28.940  68.777  1.00 32.14 ? 407 PRO B CG  1 
ATOM   6521  C CD  . PRO B 1 407 ? -1.542  28.480  68.885  1.00 31.42 ? 407 PRO B CD  1 
ATOM   6522  N N   . GLU B 1 408 ? 0.029   31.796  67.934  1.00 32.52 ? 408 GLU B N   1 
ATOM   6523  C CA  . GLU B 1 408 ? 0.811   33.022  67.844  1.00 33.13 ? 408 GLU B CA  1 
ATOM   6524  C C   . GLU B 1 408 ? 1.782   33.041  66.645  1.00 31.99 ? 408 GLU B C   1 
ATOM   6525  O O   . GLU B 1 408 ? 1.890   34.054  65.904  1.00 29.99 ? 408 GLU B O   1 
ATOM   6526  C CB  . GLU B 1 408 ? 1.510   33.384  69.185  1.00 34.08 ? 408 GLU B CB  1 
ATOM   6527  C CG  . GLU B 1 408 ? 1.692   32.257  70.203  1.00 38.67 ? 408 GLU B CG  1 
ATOM   6528  C CD  . GLU B 1 408 ? 0.398   31.838  70.898  1.00 43.26 ? 408 GLU B CD  1 
ATOM   6529  O OE1 . GLU B 1 408 ? -0.201  32.677  71.610  1.00 45.95 ? 408 GLU B OE1 1 
ATOM   6530  O OE2 . GLU B 1 408 ? -0.022  30.668  70.734  1.00 42.78 ? 408 GLU B OE2 1 
ATOM   6531  N N   . GLN B 1 409 ? 2.463   31.912  66.429  1.00 29.85 ? 409 GLN B N   1 
ATOM   6532  C CA  . GLN B 1 409 ? 3.250   31.736  65.213  1.00 27.59 ? 409 GLN B CA  1 
ATOM   6533  C C   . GLN B 1 409 ? 2.416   31.928  63.941  1.00 26.43 ? 409 GLN B C   1 
ATOM   6534  O O   . GLN B 1 409 ? 2.863   32.594  63.016  1.00 25.02 ? 409 GLN B O   1 
ATOM   6535  C CB  . GLN B 1 409 ? 3.949   30.365  65.217  1.00 28.26 ? 409 GLN B CB  1 
ATOM   6536  C CG  . GLN B 1 409 ? 5.138   30.301  66.193  1.00 27.39 ? 409 GLN B CG  1 
ATOM   6537  C CD  . GLN B 1 409 ? 5.723   28.914  66.295  1.00 29.50 ? 409 GLN B CD  1 
ATOM   6538  O OE1 . GLN B 1 409 ? 5.019   27.940  66.189  1.00 28.51 ? 409 GLN B OE1 1 
ATOM   6539  N NE2 . GLN B 1 409 ? 7.024   28.830  66.483  1.00 30.54 ? 409 GLN B NE2 1 
ATOM   6540  N N   . MET B 1 410 ? 1.220   31.356  63.882  1.00 24.40 ? 410 MET B N   1 
ATOM   6541  C CA  . MET B 1 410 ? 0.386   31.544  62.685  1.00 25.60 ? 410 MET B CA  1 
ATOM   6542  C C   . MET B 1 410 ? 0.018   33.019  62.558  1.00 26.15 ? 410 MET B C   1 
ATOM   6543  O O   . MET B 1 410 ? 0.031   33.559  61.457  1.00 24.73 ? 410 MET B O   1 
ATOM   6544  C CB  . MET B 1 410 ? -0.881  30.704  62.725  1.00 24.82 ? 410 MET B CB  1 
ATOM   6545  C CG  . MET B 1 410 ? -0.622  29.202  62.623  1.00 25.42 ? 410 MET B CG  1 
ATOM   6546  S SD  . MET B 1 410 ? -2.101  28.392  63.174  1.00 29.23 ? 410 MET B SD  1 
ATOM   6547  C CE  . MET B 1 410 ? -1.614  26.651  62.905  1.00 22.85 ? 410 MET B CE  1 
ATOM   6548  N N   . ASP B 1 411 ? -0.304  33.661  63.691  1.00 26.16 ? 411 ASP B N   1 
ATOM   6549  C CA  . ASP B 1 411 ? -0.676  35.087  63.651  1.00 27.74 ? 411 ASP B CA  1 
ATOM   6550  C C   . ASP B 1 411 ? 0.403   35.959  63.045  1.00 27.53 ? 411 ASP B C   1 
ATOM   6551  O O   . ASP B 1 411 ? 0.133   36.756  62.156  1.00 27.74 ? 411 ASP B O   1 
ATOM   6552  C CB  . ASP B 1 411 ? -1.064  35.597  65.054  1.00 27.77 ? 411 ASP B CB  1 
ATOM   6553  C CG  . ASP B 1 411 ? -1.678  37.022  65.032  1.00 30.29 ? 411 ASP B CG  1 
ATOM   6554  O OD1 . ASP B 1 411 ? -1.015  37.962  65.538  1.00 32.79 ? 411 ASP B OD1 1 
ATOM   6555  O OD2 . ASP B 1 411 ? -2.834  37.182  64.554  1.00 30.36 ? 411 ASP B OD2 1 
ATOM   6556  N N   . VAL B 1 412 ? 1.626   35.838  63.550  1.00 28.25 ? 412 VAL B N   1 
ATOM   6557  C CA  . VAL B 1 412 ? 2.732   36.654  63.109  1.00 28.12 ? 412 VAL B CA  1 
ATOM   6558  C C   . VAL B 1 412 ? 3.145   36.347  61.667  1.00 27.56 ? 412 VAL B C   1 
ATOM   6559  O O   . VAL B 1 412 ? 3.476   37.249  60.915  1.00 28.03 ? 412 VAL B O   1 
ATOM   6560  C CB  . VAL B 1 412 ? 3.968   36.525  64.063  1.00 29.02 ? 412 VAL B CB  1 
ATOM   6561  C CG1 . VAL B 1 412 ? 5.278   37.001  63.345  1.00 28.08 ? 412 VAL B CG1 1 
ATOM   6562  C CG2 . VAL B 1 412 ? 3.719   37.330  65.334  1.00 28.42 ? 412 VAL B CG2 1 
ATOM   6563  N N   . ALA B 1 413 ? 3.104   35.075  61.285  1.00 26.61 ? 413 ALA B N   1 
ATOM   6564  C CA  . ALA B 1 413 ? 3.426   34.681  59.914  1.00 25.72 ? 413 ALA B CA  1 
ATOM   6565  C C   . ALA B 1 413 ? 2.427   35.218  58.885  1.00 25.30 ? 413 ALA B C   1 
ATOM   6566  O O   . ALA B 1 413 ? 2.834   35.620  57.815  1.00 25.43 ? 413 ALA B O   1 
ATOM   6567  C CB  . ALA B 1 413 ? 3.528   33.141  59.803  1.00 25.30 ? 413 ALA B CB  1 
ATOM   6568  N N   . PHE B 1 414 ? 1.127   35.190  59.176  1.00 25.20 ? 414 PHE B N   1 
ATOM   6569  C CA  . PHE B 1 414 ? 0.146   35.703  58.204  1.00 25.66 ? 414 PHE B CA  1 
ATOM   6570  C C   . PHE B 1 414 ? 0.124   37.242  58.187  1.00 25.01 ? 414 PHE B C   1 
ATOM   6571  O O   . PHE B 1 414 ? -0.096  37.835  57.155  1.00 25.83 ? 414 PHE B O   1 
ATOM   6572  C CB  . PHE B 1 414 ? -1.256  35.136  58.473  1.00 26.85 ? 414 PHE B CB  1 
ATOM   6573  C CG  . PHE B 1 414 ? -1.459  33.727  57.932  1.00 29.66 ? 414 PHE B CG  1 
ATOM   6574  C CD1 . PHE B 1 414 ? -0.909  32.627  58.571  1.00 33.63 ? 414 PHE B CD1 1 
ATOM   6575  C CD2 . PHE B 1 414 ? -2.163  33.520  56.773  1.00 32.35 ? 414 PHE B CD2 1 
ATOM   6576  C CE1 . PHE B 1 414 ? -1.083  31.337  58.051  1.00 34.87 ? 414 PHE B CE1 1 
ATOM   6577  C CE2 . PHE B 1 414 ? -2.339  32.217  56.250  1.00 35.61 ? 414 PHE B CE2 1 
ATOM   6578  C CZ  . PHE B 1 414 ? -1.787  31.142  56.885  1.00 33.61 ? 414 PHE B CZ  1 
ATOM   6579  N N   . GLN B 1 415 ? 0.343   37.862  59.331  1.00 25.46 ? 415 GLN B N   1 
ATOM   6580  C CA  . GLN B 1 415 ? 0.556   39.319  59.423  1.00 25.76 ? 415 GLN B CA  1 
ATOM   6581  C C   . GLN B 1 415 ? 1.714   39.771  58.519  1.00 25.20 ? 415 GLN B C   1 
ATOM   6582  O O   . GLN B 1 415 ? 1.555   40.700  57.723  1.00 25.04 ? 415 GLN B O   1 
ATOM   6583  C CB  . GLN B 1 415 ? 0.814   39.730  60.862  1.00 25.85 ? 415 GLN B CB  1 
ATOM   6584  C CG  . GLN B 1 415 ? 1.412   41.154  60.960  1.00 30.75 ? 415 GLN B CG  1 
ATOM   6585  C CD  . GLN B 1 415 ? 2.389   41.292  62.111  1.00 38.81 ? 415 GLN B CD  1 
ATOM   6586  O OE1 . GLN B 1 415 ? 2.026   41.076  63.281  1.00 43.31 ? 415 GLN B OE1 1 
ATOM   6587  N NE2 . GLN B 1 415 ? 3.643   41.654  61.795  1.00 39.52 ? 415 GLN B NE2 1 
ATOM   6588  N N   . VAL B 1 416 ? 2.865   39.081  58.622  1.00 25.47 ? 416 VAL B N   1 
ATOM   6589  C CA  . VAL B 1 416 ? 4.046   39.325  57.742  1.00 24.73 ? 416 VAL B CA  1 
ATOM   6590  C C   . VAL B 1 416 ? 3.733   39.048  56.275  1.00 24.73 ? 416 VAL B C   1 
ATOM   6591  O O   . VAL B 1 416 ? 3.993   39.913  55.400  1.00 24.59 ? 416 VAL B O   1 
ATOM   6592  C CB  . VAL B 1 416 ? 5.240   38.466  58.192  1.00 25.63 ? 416 VAL B CB  1 
ATOM   6593  C CG1 . VAL B 1 416 ? 6.353   38.396  57.097  1.00 24.46 ? 416 VAL B CG1 1 
ATOM   6594  C CG2 . VAL B 1 416 ? 5.789   38.962  59.539  1.00 26.01 ? 416 VAL B CG2 1 
ATOM   6595  N N   . LEU B 1 417 ? 3.133   37.888  55.998  1.00 24.33 ? 417 LEU B N   1 
ATOM   6596  C CA  . LEU B 1 417 ? 2.760   37.538  54.617  1.00 25.43 ? 417 LEU B CA  1 
ATOM   6597  C C   . LEU B 1 417 ? 1.864   38.622  54.047  1.00 26.21 ? 417 LEU B C   1 
ATOM   6598  O O   . LEU B 1 417 ? 2.121   39.113  52.954  1.00 27.71 ? 417 LEU B O   1 
ATOM   6599  C CB  . LEU B 1 417 ? 1.999   36.210  54.533  1.00 25.15 ? 417 LEU B CB  1 
ATOM   6600  C CG  . LEU B 1 417 ? 1.912   35.319  53.265  1.00 26.33 ? 417 LEU B CG  1 
ATOM   6601  C CD1 . LEU B 1 417 ? 0.562   34.682  53.130  1.00 26.90 ? 417 LEU B CD1 1 
ATOM   6602  C CD2 . LEU B 1 417 ? 2.336   35.898  51.919  1.00 22.35 ? 417 LEU B CD2 1 
ATOM   6603  N N   . ALA B 1 418 ? 0.790   38.963  54.762  1.00 26.19 ? 418 ALA B N   1 
ATOM   6604  C CA  . ALA B 1 418 ? -0.153  40.028  54.303  1.00 27.12 ? 418 ALA B CA  1 
ATOM   6605  C C   . ALA B 1 418 ? 0.556   41.313  53.896  1.00 27.51 ? 418 ALA B C   1 
ATOM   6606  O O   . ALA B 1 418 ? 0.243   41.898  52.874  1.00 28.10 ? 418 ALA B O   1 
ATOM   6607  C CB  . ALA B 1 418 ? -1.207  40.326  55.385  1.00 26.09 ? 418 ALA B CB  1 
ATOM   6608  N N   . GLN B 1 419 ? 1.509   41.744  54.710  1.00 28.10 ? 419 GLN B N   1 
ATOM   6609  C CA  . GLN B 1 419 ? 2.227   42.978  54.478  1.00 29.53 ? 419 GLN B CA  1 
ATOM   6610  C C   . GLN B 1 419 ? 3.091   42.885  53.221  1.00 29.00 ? 419 GLN B C   1 
ATOM   6611  O O   . GLN B 1 419 ? 3.138   43.827  52.436  1.00 29.50 ? 419 GLN B O   1 
ATOM   6612  C CB  . GLN B 1 419 ? 3.120   43.290  55.674  1.00 29.73 ? 419 GLN B CB  1 
ATOM   6613  C CG  . GLN B 1 419 ? 4.137   44.402  55.390  1.00 32.52 ? 419 GLN B CG  1 
ATOM   6614  C CD  . GLN B 1 419 ? 5.472   44.109  56.027  1.00 39.56 ? 419 GLN B CD  1 
ATOM   6615  O OE1 . GLN B 1 419 ? 5.529   43.491  57.099  1.00 43.27 ? 419 GLN B OE1 1 
ATOM   6616  N NE2 . GLN B 1 419 ? 6.559   44.527  55.373  1.00 40.43 ? 419 GLN B NE2 1 
ATOM   6617  N N   . LEU B 1 420 ? 3.762   41.748  53.035  1.00 28.16 ? 420 LEU B N   1 
ATOM   6618  C CA  . LEU B 1 420 ? 4.577   41.544  51.856  1.00 27.87 ? 420 LEU B CA  1 
ATOM   6619  C C   . LEU B 1 420 ? 3.759   41.449  50.583  1.00 27.91 ? 420 LEU B C   1 
ATOM   6620  O O   . LEU B 1 420 ? 4.201   41.921  49.521  1.00 28.30 ? 420 LEU B O   1 
ATOM   6621  C CB  . LEU B 1 420 ? 5.443   40.286  52.018  1.00 28.25 ? 420 LEU B CB  1 
ATOM   6622  C CG  . LEU B 1 420 ? 6.502   40.452  53.082  1.00 27.62 ? 420 LEU B CG  1 
ATOM   6623  C CD1 . LEU B 1 420 ? 7.227   39.152  53.275  1.00 29.00 ? 420 LEU B CD1 1 
ATOM   6624  C CD2 . LEU B 1 420 ? 7.448   41.618  52.724  1.00 31.95 ? 420 LEU B CD2 1 
ATOM   6625  N N   . ILE B 1 421 ? 2.595   40.810  50.663  1.00 28.10 ? 421 ILE B N   1 
ATOM   6626  C CA  . ILE B 1 421 ? 1.631   40.810  49.539  1.00 28.67 ? 421 ILE B CA  1 
ATOM   6627  C C   . ILE B 1 421 ? 1.276   42.238  49.124  1.00 30.19 ? 421 ILE B C   1 
ATOM   6628  O O   . ILE B 1 421 ? 1.313   42.582  47.923  1.00 30.37 ? 421 ILE B O   1 
ATOM   6629  C CB  . ILE B 1 421 ? 0.311   40.035  49.866  1.00 29.06 ? 421 ILE B CB  1 
ATOM   6630  C CG1 . ILE B 1 421 ? 0.552   38.520  49.903  1.00 25.51 ? 421 ILE B CG1 1 
ATOM   6631  C CG2 . ILE B 1 421 ? -0.823  40.408  48.838  1.00 26.85 ? 421 ILE B CG2 1 
ATOM   6632  C CD1 . ILE B 1 421 ? -0.567  37.750  50.575  1.00 28.64 ? 421 ILE B CD1 1 
ATOM   6633  N N   . LYS B 1 422 ? 0.968   43.076  50.108  1.00 30.59 ? 422 LYS B N   1 
ATOM   6634  C CA  . LYS B 1 422 ? 0.575   44.454  49.805  1.00 32.50 ? 422 LYS B CA  1 
ATOM   6635  C C   . LYS B 1 422 ? 1.739   45.269  49.273  1.00 33.86 ? 422 LYS B C   1 
ATOM   6636  O O   . LYS B 1 422 ? 1.550   46.107  48.404  1.00 34.39 ? 422 LYS B O   1 
ATOM   6637  C CB  . LYS B 1 422 ? -0.101  45.116  51.006  1.00 31.67 ? 422 LYS B CB  1 
ATOM   6638  C CG  . LYS B 1 422 ? -1.534  44.589  51.186  1.00 31.90 ? 422 LYS B CG  1 
ATOM   6639  C CD  . LYS B 1 422 ? -2.305  45.256  52.334  1.00 30.82 ? 422 LYS B CD  1 
ATOM   6640  C CE  . LYS B 1 422 ? -1.746  44.830  53.670  1.00 31.86 ? 422 LYS B CE  1 
ATOM   6641  N NZ  . LYS B 1 422 ? -2.510  45.513  54.772  1.00 28.22 ? 422 LYS B NZ  1 
ATOM   6642  N N   . GLU B 1 423 ? 2.946   44.990  49.758  1.00 35.91 ? 423 GLU B N   1 
ATOM   6643  C CA  . GLU B 1 423 ? 4.169   45.611  49.213  1.00 38.14 ? 423 GLU B CA  1 
ATOM   6644  C C   . GLU B 1 423 ? 4.557   45.120  47.797  1.00 38.89 ? 423 GLU B C   1 
ATOM   6645  O O   . GLU B 1 423 ? 5.382   45.734  47.137  1.00 39.16 ? 423 GLU B O   1 
ATOM   6646  C CB  . GLU B 1 423 ? 5.329   45.465  50.203  1.00 37.97 ? 423 GLU B CB  1 
ATOM   6647  C CG  . GLU B 1 423 ? 5.178   46.387  51.386  1.00 40.72 ? 423 GLU B CG  1 
ATOM   6648  C CD  . GLU B 1 423 ? 6.115   46.074  52.548  1.00 43.92 ? 423 GLU B CD  1 
ATOM   6649  O OE1 . GLU B 1 423 ? 7.032   45.251  52.376  1.00 43.68 ? 423 GLU B OE1 1 
ATOM   6650  O OE2 . GLU B 1 423 ? 5.935   46.688  53.631  1.00 46.36 ? 423 GLU B OE2 1 
ATOM   6651  N N   . SER B 1 424 ? 3.923   44.046  47.341  1.00 40.37 ? 424 SER B N   1 
ATOM   6652  C CA  . SER B 1 424 ? 4.240   43.402  46.058  1.00 42.22 ? 424 SER B CA  1 
ATOM   6653  C C   . SER B 1 424 ? 3.149   43.580  45.007  1.00 43.08 ? 424 SER B C   1 
ATOM   6654  O O   . SER B 1 424 ? 3.178   42.926  43.950  1.00 44.33 ? 424 SER B O   1 
ATOM   6655  C CB  . SER B 1 424 ? 4.476   41.892  46.264  1.00 42.30 ? 424 SER B CB  1 
ATOM   6656  O OG  . SER B 1 424 ? 5.442   41.617  47.284  1.00 43.50 ? 424 SER B OG  1 
ATOM   6657  N N   . LEU B 1 425 ? 2.158   44.418  45.297  1.00 43.72 ? 425 LEU B N   1 
ATOM   6658  C CA  . LEU B 1 425 ? 1.054   44.620  44.357  1.00 43.87 ? 425 LEU B CA  1 
ATOM   6659  C C   . LEU B 1 425 ? 1.382   45.770  43.419  1.00 44.72 ? 425 LEU B C   1 
ATOM   6660  O O   . LEU B 1 425 ? 1.410   45.583  42.203  1.00 45.34 ? 425 LEU B O   1 
ATOM   6661  C CB  . LEU B 1 425 ? -0.260  44.885  45.084  1.00 43.82 ? 425 LEU B CB  1 
ATOM   6662  C CG  . LEU B 1 425 ? -0.888  43.719  45.838  1.00 42.26 ? 425 LEU B CG  1 
ATOM   6663  C CD1 . LEU B 1 425 ? -2.041  44.253  46.653  1.00 41.34 ? 425 LEU B CD1 1 
ATOM   6664  C CD2 . LEU B 1 425 ? -1.372  42.633  44.900  1.00 41.56 ? 425 LEU B CD2 1 
ATOM   6665  O OXT . LEU B 1 425 ? 1.648   46.891  43.862  1.00 44.77 ? 425 LEU B OXT 1 
ATOM   6666  N N   . MET C 1 1   ? -14.150 3.596   94.920  1.00 33.57 ? 1   MET C N   1 
ATOM   6667  C CA  . MET C 1 1   ? -14.486 2.207   94.547  1.00 32.34 ? 1   MET C CA  1 
ATOM   6668  C C   . MET C 1 1   ? -13.410 1.600   93.651  1.00 30.81 ? 1   MET C C   1 
ATOM   6669  O O   . MET C 1 1   ? -13.046 0.449   93.872  1.00 30.89 ? 1   MET C O   1 
ATOM   6670  C CB  . MET C 1 1   ? -15.920 2.093   93.969  1.00 33.98 ? 1   MET C CB  1 
ATOM   6671  C CG  . MET C 1 1   ? -16.185 0.797   93.218  1.00 35.31 ? 1   MET C CG  1 
ATOM   6672  S SD  . MET C 1 1   ? -17.612 -0.149  93.872  1.00 48.73 ? 1   MET C SD  1 
ATOM   6673  C CE  . MET C 1 1   ? -17.368 -0.081  95.655  1.00 44.38 ? 1   MET C CE  1 
ATOM   6674  N N   . ASN C 1 2   ? -12.917 2.352   92.664  1.00 28.93 ? 2   ASN C N   1 
ATOM   6675  C CA  . ASN C 1 2   ? -11.680 1.990   91.949  1.00 27.91 ? 2   ASN C CA  1 
ATOM   6676  C C   . ASN C 1 2   ? -10.461 2.749   92.513  1.00 26.67 ? 2   ASN C C   1 
ATOM   6677  O O   . ASN C 1 2   ? -10.072 3.826   92.032  1.00 25.80 ? 2   ASN C O   1 
ATOM   6678  C CB  . ASN C 1 2   ? -11.801 2.192   90.417  1.00 28.53 ? 2   ASN C CB  1 
ATOM   6679  C CG  . ASN C 1 2   ? -10.482 1.973   89.695  1.00 29.65 ? 2   ASN C CG  1 
ATOM   6680  O OD1 . ASN C 1 2   ? -10.196 2.637   88.710  1.00 37.83 ? 2   ASN C OD1 1 
ATOM   6681  N ND2 . ASN C 1 2   ? -9.664  1.057   90.187  1.00 28.20 ? 2   ASN C ND2 1 
ATOM   6682  N N   . TYR C 1 3   ? -9.872  2.181   93.560  1.00 24.90 ? 3   TYR C N   1 
ATOM   6683  C CA  . TYR C 1 3   ? -8.860  2.901   94.335  1.00 23.25 ? 3   TYR C CA  1 
ATOM   6684  C C   . TYR C 1 3   ? -7.552  3.062   93.611  1.00 22.96 ? 3   TYR C C   1 
ATOM   6685  O O   . TYR C 1 3   ? -6.771  3.985   93.927  1.00 22.40 ? 3   TYR C O   1 
ATOM   6686  C CB  . TYR C 1 3   ? -8.633  2.246   95.721  1.00 22.90 ? 3   TYR C CB  1 
ATOM   6687  C CG  . TYR C 1 3   ? -9.825  2.436   96.668  1.00 19.33 ? 3   TYR C CG  1 
ATOM   6688  C CD1 . TYR C 1 3   ? -10.548 1.348   97.128  1.00 20.46 ? 3   TYR C CD1 1 
ATOM   6689  C CD2 . TYR C 1 3   ? -10.220 3.708   97.076  1.00 18.66 ? 3   TYR C CD2 1 
ATOM   6690  C CE1 . TYR C 1 3   ? -11.649 1.497   97.991  1.00 22.14 ? 3   TYR C CE1 1 
ATOM   6691  C CE2 . TYR C 1 3   ? -11.325 3.871   97.926  1.00 18.60 ? 3   TYR C CE2 1 
ATOM   6692  C CZ  . TYR C 1 3   ? -12.019 2.772   98.385  1.00 21.05 ? 3   TYR C CZ  1 
ATOM   6693  O OH  . TYR C 1 3   ? -13.088 2.943   99.210  1.00 20.29 ? 3   TYR C OH  1 
ATOM   6694  N N   . ALA C 1 4   ? -7.314  2.198   92.623  1.00 22.60 ? 4   ALA C N   1 
ATOM   6695  C CA  . ALA C 1 4   ? -6.050  2.214   91.849  1.00 22.17 ? 4   ALA C CA  1 
ATOM   6696  C C   . ALA C 1 4   ? -5.831  3.544   91.167  1.00 23.58 ? 4   ALA C C   1 
ATOM   6697  O O   . ALA C 1 4   ? -4.691  3.978   90.912  1.00 23.57 ? 4   ALA C O   1 
ATOM   6698  C CB  . ALA C 1 4   ? -6.033  1.083   90.833  1.00 22.59 ? 4   ALA C CB  1 
ATOM   6699  N N   . ARG C 1 5   ? -6.922  4.226   90.856  1.00 23.78 ? 5   ARG C N   1 
ATOM   6700  C CA  . ARG C 1 5   ? -6.808  5.504   90.182  1.00 25.87 ? 5   ARG C CA  1 
ATOM   6701  C C   . ARG C 1 5   ? -6.384  6.685   91.061  1.00 25.00 ? 5   ARG C C   1 
ATOM   6702  O O   . ARG C 1 5   ? -6.026  7.764   90.544  1.00 25.84 ? 5   ARG C O   1 
ATOM   6703  C CB  . ARG C 1 5   ? -8.095  5.810   89.378  1.00 27.28 ? 5   ARG C CB  1 
ATOM   6704  C CG  . ARG C 1 5   ? -9.315  6.091   90.184  1.00 30.38 ? 5   ARG C CG  1 
ATOM   6705  C CD  . ARG C 1 5   ? -10.458 6.536   89.243  1.00 36.01 ? 5   ARG C CD  1 
ATOM   6706  N NE  . ARG C 1 5   ? -10.263 7.935   88.900  1.00 38.74 ? 5   ARG C NE  1 
ATOM   6707  C CZ  . ARG C 1 5   ? -11.101 8.907   89.230  1.00 36.38 ? 5   ARG C CZ  1 
ATOM   6708  N NH1 . ARG C 1 5   ? -10.828 10.161  88.889  1.00 35.22 ? 5   ARG C NH1 1 
ATOM   6709  N NH2 . ARG C 1 5   ? -12.217 8.608   89.878  1.00 38.83 ? 5   ARG C NH2 1 
ATOM   6710  N N   . PHE C 1 6   ? -6.430  6.490   92.381  1.00 24.06 ? 6   PHE C N   1 
ATOM   6711  C CA  . PHE C 1 6   ? -5.916  7.460   93.332  1.00 24.36 ? 6   PHE C CA  1 
ATOM   6712  C C   . PHE C 1 6   ? -4.582  7.020   93.965  1.00 24.91 ? 6   PHE C C   1 
ATOM   6713  O O   . PHE C 1 6   ? -4.175  7.527   95.037  1.00 25.19 ? 6   PHE C O   1 
ATOM   6714  C CB  . PHE C 1 6   ? -6.961  7.662   94.420  1.00 23.46 ? 6   PHE C CB  1 
ATOM   6715  C CG  . PHE C 1 6   ? -8.337  7.945   93.869  1.00 22.61 ? 6   PHE C CG  1 
ATOM   6716  C CD1 . PHE C 1 6   ? -9.257  6.903   93.723  1.00 21.78 ? 6   PHE C CD1 1 
ATOM   6717  C CD2 . PHE C 1 6   ? -8.702  9.253   93.499  1.00 19.04 ? 6   PHE C CD2 1 
ATOM   6718  C CE1 . PHE C 1 6   ? -10.557 7.154   93.243  1.00 21.70 ? 6   PHE C CE1 1 
ATOM   6719  C CE2 . PHE C 1 6   ? -9.972  9.515   92.985  1.00 19.79 ? 6   PHE C CE2 1 
ATOM   6720  C CZ  . PHE C 1 6   ? -10.893 8.475   92.851  1.00 17.96 ? 6   PHE C CZ  1 
ATOM   6721  N N   . ILE C 1 7   ? -3.936  6.050   93.327  1.00 23.38 ? 7   ILE C N   1 
ATOM   6722  C CA  . ILE C 1 7   ? -2.687  5.466   93.837  1.00 22.98 ? 7   ILE C CA  1 
ATOM   6723  C C   . ILE C 1 7   ? -1.650  5.541   92.717  1.00 24.28 ? 7   ILE C C   1 
ATOM   6724  O O   . ILE C 1 7   ? -1.799  4.931   91.635  1.00 25.14 ? 7   ILE C O   1 
ATOM   6725  C CB  . ILE C 1 7   ? -2.864  4.029   94.285  1.00 22.70 ? 7   ILE C CB  1 
ATOM   6726  C CG1 . ILE C 1 7   ? -3.787  3.970   95.518  1.00 21.42 ? 7   ILE C CG1 1 
ATOM   6727  C CG2 . ILE C 1 7   ? -1.510  3.409   94.593  1.00 20.99 ? 7   ILE C CG2 1 
ATOM   6728  C CD1 . ILE C 1 7   ? -4.124  2.597   96.036  1.00 18.39 ? 7   ILE C CD1 1 
ATOM   6729  N N   . THR C 1 8   ? -0.602  6.292   92.988  1.00 22.62 ? 8   THR C N   1 
ATOM   6730  C CA  . THR C 1 8   ? 0.483   6.448   92.035  1.00 23.51 ? 8   THR C CA  1 
ATOM   6731  C C   . THR C 1 8   ? 1.257   5.114   91.799  1.00 22.99 ? 8   THR C C   1 
ATOM   6732  O O   . THR C 1 8   ? 1.202   4.210   92.623  1.00 21.76 ? 8   THR C O   1 
ATOM   6733  C CB  . THR C 1 8   ? 1.384   7.549   92.576  1.00 23.61 ? 8   THR C CB  1 
ATOM   6734  O OG1 . THR C 1 8   ? 1.724   8.430   91.531  1.00 31.45 ? 8   THR C OG1 1 
ATOM   6735  C CG2 . THR C 1 8   ? 2.653   7.027   93.153  1.00 18.61 ? 8   THR C CG2 1 
ATOM   6736  N N   . ALA C 1 9   ? 2.009   5.035   90.694  1.00 22.99 ? 9   ALA C N   1 
ATOM   6737  C CA  . ALA C 1 9   ? 2.769   3.832   90.359  1.00 22.61 ? 9   ALA C CA  1 
ATOM   6738  C C   . ALA C 1 9   ? 3.782   3.518   91.455  1.00 21.69 ? 9   ALA C C   1 
ATOM   6739  O O   . ALA C 1 9   ? 3.922   2.375   91.825  1.00 21.72 ? 9   ALA C O   1 
ATOM   6740  C CB  . ALA C 1 9   ? 3.460   3.997   89.026  1.00 22.58 ? 9   ALA C CB  1 
ATOM   6741  N N   . ALA C 1 10  ? 4.448   4.539   91.976  1.00 21.70 ? 10  ALA C N   1 
ATOM   6742  C CA  . ALA C 1 10  ? 5.408   4.341   93.081  1.00 22.73 ? 10  ALA C CA  1 
ATOM   6743  C C   . ALA C 1 10  ? 4.690   3.847   94.345  1.00 21.98 ? 10  ALA C C   1 
ATOM   6744  O O   . ALA C 1 10  ? 5.152   2.905   94.999  1.00 22.83 ? 10  ALA C O   1 
ATOM   6745  C CB  . ALA C 1 10  ? 6.188   5.627   93.361  1.00 23.26 ? 10  ALA C CB  1 
ATOM   6746  N N   . SER C 1 11  ? 3.550   4.469   94.653  1.00 20.09 ? 11  SER C N   1 
ATOM   6747  C CA  . SER C 1 11  ? 2.754   4.093   95.805  1.00 19.33 ? 11  SER C CA  1 
ATOM   6748  C C   . SER C 1 11  ? 2.268   2.647   95.657  1.00 20.36 ? 11  SER C C   1 
ATOM   6749  O O   . SER C 1 11  ? 2.359   1.851   96.599  1.00 20.18 ? 11  SER C O   1 
ATOM   6750  C CB  . SER C 1 11  ? 1.599   5.052   96.045  1.00 19.61 ? 11  SER C CB  1 
ATOM   6751  O OG  . SER C 1 11  ? 0.847   4.665   97.197  1.00 17.06 ? 11  SER C OG  1 
ATOM   6752  N N   . ALA C 1 12  ? 1.771   2.302   94.470  1.00 20.95 ? 12  ALA C N   1 
ATOM   6753  C CA  . ALA C 1 12  ? 1.357   0.924   94.204  1.00 21.68 ? 12  ALA C CA  1 
ATOM   6754  C C   . ALA C 1 12  ? 2.504   -0.090  94.332  1.00 22.09 ? 12  ALA C C   1 
ATOM   6755  O O   . ALA C 1 12  ? 2.284   -1.235  94.717  1.00 23.63 ? 12  ALA C O   1 
ATOM   6756  C CB  . ALA C 1 12  ? 0.709   0.849   92.814  1.00 21.93 ? 12  ALA C CB  1 
ATOM   6757  N N   . ALA C 1 13  ? 3.720   0.341   94.006  1.00 23.57 ? 13  ALA C N   1 
ATOM   6758  C CA  . ALA C 1 13  ? 4.904   -0.525  94.024  1.00 24.39 ? 13  ALA C CA  1 
ATOM   6759  C C   . ALA C 1 13  ? 5.373   -0.900  95.429  1.00 24.71 ? 13  ALA C C   1 
ATOM   6760  O O   . ALA C 1 13  ? 6.076   -1.901  95.587  1.00 23.82 ? 13  ALA C O   1 
ATOM   6761  C CB  . ALA C 1 13  ? 6.052   0.109   93.225  1.00 24.49 ? 13  ALA C CB  1 
ATOM   6762  N N   . ARG C 1 14  ? 4.932   -0.153  96.446  1.00 24.53 ? 14  ARG C N   1 
ATOM   6763  C CA  . ARG C 1 14  ? 5.294   -0.457  97.849  1.00 25.81 ? 14  ARG C CA  1 
ATOM   6764  C C   . ARG C 1 14  ? 4.837   -1.844  98.335  1.00 28.34 ? 14  ARG C C   1 
ATOM   6765  O O   . ARG C 1 14  ? 3.663   -2.231  98.178  1.00 26.23 ? 14  ARG C O   1 
ATOM   6766  C CB  . ARG C 1 14  ? 4.748   0.625   98.813  1.00 23.88 ? 14  ARG C CB  1 
ATOM   6767  C CG  . ARG C 1 14  ? 5.344   1.987   98.546  1.00 22.77 ? 14  ARG C CG  1 
ATOM   6768  C CD  . ARG C 1 14  ? 5.032   2.985   99.666  1.00 17.83 ? 14  ARG C CD  1 
ATOM   6769  N NE  . ARG C 1 14  ? 5.400   4.347   99.240  1.00 15.93 ? 14  ARG C NE  1 
ATOM   6770  C CZ  . ARG C 1 14  ? 6.635   4.840   99.255  1.00 18.04 ? 14  ARG C CZ  1 
ATOM   6771  N NH1 . ARG C 1 14  ? 7.635   4.080   99.678  1.00 13.13 ? 14  ARG C NH1 1 
ATOM   6772  N NH2 . ARG C 1 14  ? 6.876   6.097   98.861  1.00 21.41 ? 14  ARG C NH2 1 
ATOM   6773  N N   . ASN C 1 15  ? 5.790   -2.585  98.904  1.00 32.55 ? 15  ASN C N   1 
ATOM   6774  C CA  . ASN C 1 15  ? 5.531   -3.935  99.401  1.00 38.30 ? 15  ASN C CA  1 
ATOM   6775  C C   . ASN C 1 15  ? 5.511   -3.957  100.919 1.00 42.57 ? 15  ASN C C   1 
ATOM   6776  O O   . ASN C 1 15  ? 6.287   -3.230  101.561 1.00 42.21 ? 15  ASN C O   1 
ATOM   6777  C CB  . ASN C 1 15  ? 6.578   -4.934  98.894  1.00 37.86 ? 15  ASN C CB  1 
ATOM   6778  C CG  . ASN C 1 15  ? 6.513   -5.135  97.405  1.00 37.79 ? 15  ASN C CG  1 
ATOM   6779  O OD1 . ASN C 1 15  ? 5.438   -5.239  96.810  1.00 40.05 ? 15  ASN C OD1 1 
ATOM   6780  N ND2 . ASN C 1 15  ? 7.665   -5.170  96.785  1.00 40.18 ? 15  ASN C ND2 1 
ATOM   6781  N N   . PRO C 1 16  ? 4.600   -4.765  101.497 1.00 47.69 ? 16  PRO C N   1 
ATOM   6782  C CA  . PRO C 1 16  ? 4.438   -4.878  102.934 1.00 52.03 ? 16  PRO C CA  1 
ATOM   6783  C C   . PRO C 1 16  ? 5.723   -5.290  103.625 1.00 56.73 ? 16  PRO C C   1 
ATOM   6784  O O   . PRO C 1 16  ? 6.162   -4.625  104.582 1.00 58.23 ? 16  PRO C O   1 
ATOM   6785  C CB  . PRO C 1 16  ? 3.396   -6.010  103.092 1.00 51.28 ? 16  PRO C CB  1 
ATOM   6786  C CG  . PRO C 1 16  ? 3.383   -6.713  101.799 1.00 50.20 ? 16  PRO C CG  1 
ATOM   6787  C CD  . PRO C 1 16  ? 3.634   -5.624  100.787 1.00 48.31 ? 16  PRO C CD  1 
ATOM   6788  N N   . SER C 1 17  ? 6.331   -6.349  103.084 1.00 61.49 ? 17  SER C N   1 
ATOM   6789  C CA  . SER C 1 17  ? 7.127   -7.310  103.852 1.00 65.87 ? 17  SER C CA  1 
ATOM   6790  C C   . SER C 1 17  ? 8.457   -6.717  104.320 1.00 68.57 ? 17  SER C C   1 
ATOM   6791  O O   . SER C 1 17  ? 8.679   -5.513  104.156 1.00 69.72 ? 17  SER C O   1 
ATOM   6792  C CB  . SER C 1 17  ? 7.348   -8.576  102.987 1.00 65.89 ? 17  SER C CB  1 
ATOM   6793  O OG  . SER C 1 17  ? 6.109   -9.188  102.640 1.00 66.87 ? 17  SER C OG  1 
ATOM   6794  N N   . PRO C 1 18  ? 9.358   -7.556  104.875 1.00 70.82 ? 18  PRO C N   1 
ATOM   6795  C CA  . PRO C 1 18  ? 9.247   -8.959  105.311 1.00 72.29 ? 18  PRO C CA  1 
ATOM   6796  C C   . PRO C 1 18  ? 9.219   -9.166  106.836 1.00 74.06 ? 18  PRO C C   1 
ATOM   6797  O O   . PRO C 1 18  ? 8.124   -9.328  107.414 1.00 74.45 ? 18  PRO C O   1 
ATOM   6798  C CB  . PRO C 1 18  ? 10.519  -9.586  104.715 1.00 72.16 ? 18  PRO C CB  1 
ATOM   6799  C CG  . PRO C 1 18  ? 11.461  -8.351  104.367 1.00 71.69 ? 18  PRO C CG  1 
ATOM   6800  C CD  . PRO C 1 18  ? 10.762  -7.122  104.924 1.00 71.02 ? 18  PRO C CD  1 
ATOM   6801  N N   . ILE C 1 19  ? 10.403  -9.193  107.444 1.00 76.05 ? 19  ILE C N   1 
ATOM   6802  C CA  . ILE C 1 19  ? 10.585  -9.474  108.871 1.00 77.76 ? 19  ILE C CA  1 
ATOM   6803  C C   . ILE C 1 19  ? 9.325   -9.744  109.708 1.00 79.22 ? 19  ILE C C   1 
ATOM   6804  O O   . ILE C 1 19  ? 9.014   -10.901 109.978 1.00 79.44 ? 19  ILE C O   1 
ATOM   6805  C CB  . ILE C 1 19  ? 11.506  -8.422  109.526 1.00 77.65 ? 19  ILE C CB  1 
ATOM   6806  C CG1 . ILE C 1 19  ? 12.959  -8.625  109.085 1.00 77.20 ? 19  ILE C CG1 1 
ATOM   6807  C CG2 . ILE C 1 19  ? 11.404  -8.481  111.038 1.00 77.37 ? 19  ILE C CG2 1 
ATOM   6808  C CD1 . ILE C 1 19  ? 13.287  -8.094  107.729 1.00 75.15 ? 19  ILE C CD1 1 
ATOM   6809  N N   . ARG C 1 20  ? 8.565   -8.719  110.078 1.00 80.88 ? 20  ARG C N   1 
ATOM   6810  C CA  . ARG C 1 20  ? 7.664   -8.824  111.233 1.00 82.38 ? 20  ARG C CA  1 
ATOM   6811  C C   . ARG C 1 20  ? 6.513   -9.840  111.116 1.00 83.20 ? 20  ARG C C   1 
ATOM   6812  O O   . ARG C 1 20  ? 5.719   -10.017 112.045 1.00 83.41 ? 20  ARG C O   1 
ATOM   6813  C CB  . ARG C 1 20  ? 7.141   -7.443  111.643 1.00 82.57 ? 20  ARG C CB  1 
ATOM   6814  C CG  . ARG C 1 20  ? 6.409   -6.683  110.541 1.00 83.19 ? 20  ARG C CG  1 
ATOM   6815  C CD  . ARG C 1 20  ? 6.673   -5.200  110.551 1.00 84.69 ? 20  ARG C CD  1 
ATOM   6816  N NE  . ARG C 1 20  ? 6.889   -4.679  109.208 1.00 87.09 ? 20  ARG C NE  1 
ATOM   6817  C CZ  . ARG C 1 20  ? 8.082   -4.459  108.659 1.00 87.77 ? 20  ARG C CZ  1 
ATOM   6818  N NH1 . ARG C 1 20  ? 9.203   -4.720  109.336 1.00 88.50 ? 20  ARG C NH1 1 
ATOM   6819  N NH2 . ARG C 1 20  ? 8.150   -3.979  107.422 1.00 86.72 ? 20  ARG C NH2 1 
ATOM   6820  N N   . THR C 1 21  ? 6.418   -10.503 109.971 1.00 84.12 ? 21  THR C N   1 
ATOM   6821  C CA  . THR C 1 21  ? 5.568   -11.698 109.835 1.00 84.71 ? 21  THR C CA  1 
ATOM   6822  C C   . THR C 1 21  ? 6.331   -12.971 110.278 1.00 84.89 ? 21  THR C C   1 
ATOM   6823  O O   . THR C 1 21  ? 5.948   -14.096 109.938 1.00 85.09 ? 21  THR C O   1 
ATOM   6824  C CB  . THR C 1 21  ? 4.959   -11.830 108.406 1.00 84.93 ? 21  THR C CB  1 
ATOM   6825  O OG1 . THR C 1 21  ? 5.968   -11.562 107.409 1.00 84.86 ? 21  THR C OG1 1 
ATOM   6826  C CG2 . THR C 1 21  ? 3.787   -10.837 108.236 1.00 85.41 ? 21  THR C CG2 1 
ATOM   6827  N N   . MET C 1 22  ? 7.430   -12.751 111.012 1.00 84.79 ? 22  MET C N   1 
ATOM   6828  C CA  . MET C 1 22  ? 8.060   -13.742 111.882 1.00 84.59 ? 22  MET C CA  1 
ATOM   6829  C C   . MET C 1 22  ? 7.589   -13.476 113.310 1.00 84.17 ? 22  MET C C   1 
ATOM   6830  O O   . MET C 1 22  ? 6.943   -14.337 113.921 1.00 84.31 ? 22  MET C O   1 
ATOM   6831  C CB  . MET C 1 22  ? 9.593   -13.629 111.836 1.00 84.79 ? 22  MET C CB  1 
ATOM   6832  C CG  . MET C 1 22  ? 10.263  -14.400 110.711 1.00 85.64 ? 22  MET C CG  1 
ATOM   6833  S SD  . MET C 1 22  ? 10.138  -16.195 110.896 1.00 87.02 ? 22  MET C SD  1 
ATOM   6834  C CE  . MET C 1 22  ? 10.703  -16.735 109.178 1.00 85.93 ? 22  MET C CE  1 
ATOM   6835  N N   . THR C 1 23  ? 7.979   -12.314 113.824 1.00 83.45 ? 23  THR C N   1 
ATOM   6836  C CA  . THR C 1 23  ? 7.454   -11.752 115.056 1.00 82.74 ? 23  THR C CA  1 
ATOM   6837  C C   . THR C 1 23  ? 5.968   -11.961 115.186 1.00 81.97 ? 23  THR C C   1 
ATOM   6838  O O   . THR C 1 23  ? 5.444   -12.142 116.280 1.00 81.95 ? 23  THR C O   1 
ATOM   6839  C CB  . THR C 1 23  ? 7.707   -10.253 115.087 1.00 83.07 ? 23  THR C CB  1 
ATOM   6840  O OG1 . THR C 1 23  ? 9.093   -10.012 115.328 1.00 82.51 ? 23  THR C OG1 1 
ATOM   6841  C CG2 . THR C 1 23  ? 7.006   -9.636  116.295 1.00 83.46 ? 23  THR C CG2 1 
ATOM   6842  N N   . ASP C 1 24  ? 5.276   -11.912 114.064 1.00 80.55 ? 24  ASP C N   1 
ATOM   6843  C CA  . ASP C 1 24  ? 3.839   -12.247 114.141 1.00 79.46 ? 24  ASP C CA  1 
ATOM   6844  C C   . ASP C 1 24  ? 3.621   -13.669 114.724 1.00 78.31 ? 24  ASP C C   1 
ATOM   6845  O O   . ASP C 1 24  ? 2.856   -13.838 115.691 1.00 78.14 ? 24  ASP C O   1 
ATOM   6846  C CB  . ASP C 1 24  ? 3.199   -12.100 112.739 1.00 79.68 ? 24  ASP C CB  1 
ATOM   6847  C CG  . ASP C 1 24  ? 2.033   -13.072 112.491 1.00 80.29 ? 24  ASP C CG  1 
ATOM   6848  O OD1 . ASP C 1 24  ? 2.099   -13.846 111.502 1.00 80.75 ? 24  ASP C OD1 1 
ATOM   6849  O OD2 . ASP C 1 24  ? 1.053   -13.060 113.269 1.00 81.14 ? 24  ASP C OD2 1 
ATOM   6850  N N   . ILE C 1 25  ? 4.294   -14.673 114.132 1.00 76.73 ? 25  ILE C N   1 
ATOM   6851  C CA  . ILE C 1 25  ? 4.232   -16.080 114.591 1.00 75.07 ? 25  ILE C CA  1 
ATOM   6852  C C   . ILE C 1 25  ? 4.492   -16.193 116.099 1.00 74.12 ? 25  ILE C C   1 
ATOM   6853  O O   . ILE C 1 25  ? 3.795   -16.944 116.798 1.00 74.12 ? 25  ILE C O   1 
ATOM   6854  C CB  . ILE C 1 25  ? 5.219   -17.015 113.801 1.00 75.01 ? 25  ILE C CB  1 
ATOM   6855  C CG1 . ILE C 1 25  ? 4.878   -17.035 112.288 1.00 74.91 ? 25  ILE C CG1 1 
ATOM   6856  C CG2 . ILE C 1 25  ? 5.226   -18.439 114.395 1.00 74.37 ? 25  ILE C CG2 1 
ATOM   6857  C CD1 . ILE C 1 25  ? 5.968   -17.637 111.377 1.00 73.39 ? 25  ILE C CD1 1 
ATOM   6858  N N   . LEU C 1 26  ? 5.479   -15.434 116.587 1.00 72.59 ? 26  LEU C N   1 
ATOM   6859  C CA  . LEU C 1 26  ? 5.860   -15.444 118.007 1.00 71.31 ? 26  LEU C CA  1 
ATOM   6860  C C   . LEU C 1 26  ? 4.729   -14.950 118.916 1.00 70.49 ? 26  LEU C C   1 
ATOM   6861  O O   . LEU C 1 26  ? 4.500   -15.522 119.991 1.00 70.34 ? 26  LEU C O   1 
ATOM   6862  C CB  . LEU C 1 26  ? 7.159   -14.639 118.249 1.00 71.06 ? 26  LEU C CB  1 
ATOM   6863  C CG  . LEU C 1 26  ? 7.781   -14.615 119.662 1.00 70.10 ? 26  LEU C CG  1 
ATOM   6864  C CD1 . LEU C 1 26  ? 8.287   -15.984 120.117 1.00 68.60 ? 26  LEU C CD1 1 
ATOM   6865  C CD2 . LEU C 1 26  ? 8.900   -13.589 119.748 1.00 70.04 ? 26  LEU C CD2 1 
ATOM   6866  N N   . SER C 1 27  ? 4.027   -13.909 118.460 1.00 69.30 ? 27  SER C N   1 
ATOM   6867  C CA  . SER C 1 27  ? 2.923   -13.276 119.196 1.00 68.14 ? 27  SER C CA  1 
ATOM   6868  C C   . SER C 1 27  ? 1.879   -14.262 119.714 1.00 67.21 ? 27  SER C C   1 
ATOM   6869  O O   . SER C 1 27  ? 1.354   -14.093 120.822 1.00 67.32 ? 27  SER C O   1 
ATOM   6870  C CB  . SER C 1 27  ? 2.219   -12.248 118.300 1.00 68.59 ? 27  SER C CB  1 
ATOM   6871  O OG  . SER C 1 27  ? 2.988   -11.072 118.109 1.00 68.77 ? 27  SER C OG  1 
ATOM   6872  N N   . ARG C 1 28  ? 1.578   -15.288 118.915 1.00 65.81 ? 28  ARG C N   1 
ATOM   6873  C CA  . ARG C 1 28  ? 0.470   -16.202 119.212 1.00 64.39 ? 28  ARG C CA  1 
ATOM   6874  C C   . ARG C 1 28  ? 0.890   -17.680 119.329 1.00 62.94 ? 28  ARG C C   1 
ATOM   6875  O O   . ARG C 1 28  ? 0.049   -18.584 119.288 1.00 62.69 ? 28  ARG C O   1 
ATOM   6876  C CB  . ARG C 1 28  ? -0.678  -15.999 118.196 1.00 64.88 ? 28  ARG C CB  1 
ATOM   6877  C CG  . ARG C 1 28  ? -0.535  -16.713 116.852 1.00 65.47 ? 28  ARG C CG  1 
ATOM   6878  C CD  . ARG C 1 28  ? 0.443   -16.017 115.920 1.00 68.17 ? 28  ARG C CD  1 
ATOM   6879  N NE  . ARG C 1 28  ? 0.419   -16.588 114.569 1.00 69.33 ? 28  ARG C NE  1 
ATOM   6880  C CZ  . ARG C 1 28  ? -0.254  -16.069 113.539 1.00 70.38 ? 28  ARG C CZ  1 
ATOM   6881  N NH1 . ARG C 1 28  ? -0.977  -14.949 113.685 1.00 70.58 ? 28  ARG C NH1 1 
ATOM   6882  N NH2 . ARG C 1 28  ? -0.200  -16.667 112.352 1.00 70.04 ? 28  ARG C NH2 1 
ATOM   6883  N N   . GLY C 1 29  ? 2.196   -17.909 119.473 1.00 61.13 ? 29  GLY C N   1 
ATOM   6884  C CA  . GLY C 1 29  ? 2.737   -19.245 119.681 1.00 58.84 ? 29  GLY C CA  1 
ATOM   6885  C C   . GLY C 1 29  ? 2.755   -19.628 121.152 1.00 57.10 ? 29  GLY C C   1 
ATOM   6886  O O   . GLY C 1 29  ? 2.197   -18.905 121.984 1.00 56.98 ? 29  GLY C O   1 
ATOM   6887  N N   . PRO C 1 30  ? 3.412   -20.763 121.484 1.00 55.79 ? 30  PRO C N   1 
ATOM   6888  C CA  . PRO C 1 30  ? 3.592   -21.205 122.879 1.00 54.66 ? 30  PRO C CA  1 
ATOM   6889  C C   . PRO C 1 30  ? 4.539   -20.274 123.637 1.00 53.74 ? 30  PRO C C   1 
ATOM   6890  O O   . PRO C 1 30  ? 5.412   -19.648 123.025 1.00 53.85 ? 30  PRO C O   1 
ATOM   6891  C CB  . PRO C 1 30  ? 4.222   -22.597 122.728 1.00 54.62 ? 30  PRO C CB  1 
ATOM   6892  C CG  . PRO C 1 30  ? 3.977   -22.997 121.303 1.00 54.96 ? 30  PRO C CG  1 
ATOM   6893  C CD  . PRO C 1 30  ? 4.025   -21.717 120.541 1.00 55.36 ? 30  PRO C CD  1 
ATOM   6894  N N   . LYS C 1 31  ? 4.376   -20.182 124.955 1.00 52.38 ? 31  LYS C N   1 
ATOM   6895  C CA  . LYS C 1 31  ? 5.222   -19.312 125.763 1.00 51.14 ? 31  LYS C CA  1 
ATOM   6896  C C   . LYS C 1 31  ? 6.701   -19.783 125.746 1.00 49.80 ? 31  LYS C C   1 
ATOM   6897  O O   . LYS C 1 31  ? 7.615   -18.992 126.029 1.00 50.10 ? 31  LYS C O   1 
ATOM   6898  C CB  . LYS C 1 31  ? 4.688   -19.223 127.193 1.00 51.68 ? 31  LYS C CB  1 
ATOM   6899  C CG  . LYS C 1 31  ? 4.961   -17.905 127.891 1.00 53.24 ? 31  LYS C CG  1 
ATOM   6900  C CD  . LYS C 1 31  ? 3.672   -17.109 128.089 1.00 57.33 ? 31  LYS C CD  1 
ATOM   6901  C CE  . LYS C 1 31  ? 3.633   -16.453 129.480 1.00 58.73 ? 31  LYS C CE  1 
ATOM   6902  N NZ  . LYS C 1 31  ? 2.242   -16.194 129.992 1.00 59.70 ? 31  LYS C NZ  1 
ATOM   6903  N N   . SER C 1 32  ? 6.917   -21.052 125.383 1.00 47.52 ? 32  SER C N   1 
ATOM   6904  C CA  . SER C 1 32  ? 8.256   -21.670 125.333 1.00 45.74 ? 32  SER C CA  1 
ATOM   6905  C C   . SER C 1 32  ? 9.070   -21.371 124.051 1.00 44.18 ? 32  SER C C   1 
ATOM   6906  O O   . SER C 1 32  ? 10.275  -21.725 123.980 1.00 44.29 ? 32  SER C O   1 
ATOM   6907  C CB  . SER C 1 32  ? 8.139   -23.182 125.510 1.00 45.59 ? 32  SER C CB  1 
ATOM   6908  O OG  . SER C 1 32  ? 7.365   -23.743 124.468 1.00 46.74 ? 32  SER C OG  1 
ATOM   6909  N N   . MET C 1 33  ? 8.423   -20.736 123.065 1.00 41.04 ? 33  MET C N   1 
ATOM   6910  C CA  . MET C 1 33  ? 9.059   -20.380 121.775 1.00 39.43 ? 33  MET C CA  1 
ATOM   6911  C C   . MET C 1 33  ? 10.304  -19.491 121.964 1.00 36.90 ? 33  MET C C   1 
ATOM   6912  O O   . MET C 1 33  ? 10.356  -18.638 122.844 1.00 36.00 ? 33  MET C O   1 
ATOM   6913  C CB  . MET C 1 33  ? 8.050   -19.714 120.820 1.00 39.57 ? 33  MET C CB  1 
ATOM   6914  C CG  . MET C 1 33  ? 8.482   -19.600 119.336 1.00 42.52 ? 33  MET C CG  1 
ATOM   6915  S SD  . MET C 1 33  ? 7.164   -19.160 118.121 1.00 48.46 ? 33  MET C SD  1 
ATOM   6916  C CE  . MET C 1 33  ? 6.187   -20.666 118.129 1.00 47.22 ? 33  MET C CE  1 
ATOM   6917  N N   . ILE C 1 34  ? 11.306  -19.717 121.129 1.00 34.43 ? 34  ILE C N   1 
ATOM   6918  C CA  . ILE C 1 34  ? 12.529  -18.940 121.182 1.00 32.00 ? 34  ILE C CA  1 
ATOM   6919  C C   . ILE C 1 34  ? 12.698  -18.264 119.830 1.00 30.15 ? 34  ILE C C   1 
ATOM   6920  O O   . ILE C 1 34  ? 12.721  -18.925 118.798 1.00 29.55 ? 34  ILE C O   1 
ATOM   6921  C CB  . ILE C 1 34  ? 13.763  -19.846 121.499 1.00 32.00 ? 34  ILE C CB  1 
ATOM   6922  C CG1 . ILE C 1 34  ? 13.568  -20.567 122.849 1.00 32.20 ? 34  ILE C CG1 1 
ATOM   6923  C CG2 . ILE C 1 34  ? 15.088  -19.003 121.476 1.00 31.25 ? 34  ILE C CG2 1 
ATOM   6924  C CD1 . ILE C 1 34  ? 14.579  -21.707 123.121 1.00 30.58 ? 34  ILE C CD1 1 
ATOM   6925  N N   . SER C 1 35  ? 12.795  -16.949 119.819 1.00 28.74 ? 35  SER C N   1 
ATOM   6926  C CA  . SER C 1 35  ? 13.065  -16.286 118.554 1.00 27.90 ? 35  SER C CA  1 
ATOM   6927  C C   . SER C 1 35  ? 14.419  -15.568 118.572 1.00 27.11 ? 35  SER C C   1 
ATOM   6928  O O   . SER C 1 35  ? 14.719  -14.816 119.490 1.00 26.05 ? 35  SER C O   1 
ATOM   6929  C CB  . SER C 1 35  ? 11.963  -15.296 118.168 1.00 27.94 ? 35  SER C CB  1 
ATOM   6930  O OG  . SER C 1 35  ? 12.332  -14.634 116.953 1.00 25.55 ? 35  SER C OG  1 
ATOM   6931  N N   . LEU C 1 36  ? 15.197  -15.817 117.533 1.00 26.44 ? 36  LEU C N   1 
ATOM   6932  C CA  . LEU C 1 36  ? 16.407  -15.074 117.224 1.00 26.62 ? 36  LEU C CA  1 
ATOM   6933  C C   . LEU C 1 36  ? 16.208  -14.377 115.868 1.00 25.73 ? 36  LEU C C   1 
ATOM   6934  O O   . LEU C 1 36  ? 17.152  -13.979 115.189 1.00 25.32 ? 36  LEU C O   1 
ATOM   6935  C CB  . LEU C 1 36  ? 17.598  -16.042 117.140 1.00 25.85 ? 36  LEU C CB  1 
ATOM   6936  C CG  . LEU C 1 36  ? 17.962  -16.979 118.311 1.00 28.18 ? 36  LEU C CG  1 
ATOM   6937  C CD1 . LEU C 1 36  ? 19.392  -17.547 118.163 1.00 26.51 ? 36  LEU C CD1 1 
ATOM   6938  C CD2 . LEU C 1 36  ? 17.870  -16.287 119.631 1.00 22.85 ? 36  LEU C CD2 1 
ATOM   6939  N N   . ALA C 1 37  ? 14.952  -14.234 115.477 1.00 25.79 ? 37  ALA C N   1 
ATOM   6940  C CA  . ALA C 1 37  ? 14.610  -13.714 114.169 1.00 24.34 ? 37  ALA C CA  1 
ATOM   6941  C C   . ALA C 1 37  ? 14.380  -12.194 114.140 1.00 24.10 ? 37  ALA C C   1 
ATOM   6942  O O   . ALA C 1 37  ? 14.438  -11.604 113.076 1.00 22.71 ? 37  ALA C O   1 
ATOM   6943  C CB  . ALA C 1 37  ? 13.343  -14.448 113.640 1.00 24.82 ? 37  ALA C CB  1 
ATOM   6944  N N   . GLY C 1 38  ? 14.095  -11.576 115.288 1.00 24.21 ? 38  GLY C N   1 
ATOM   6945  C CA  . GLY C 1 38  ? 13.731  -10.152 115.303 1.00 24.45 ? 38  GLY C CA  1 
ATOM   6946  C C   . GLY C 1 38  ? 14.892  -9.169  115.255 1.00 24.68 ? 38  GLY C C   1 
ATOM   6947  O O   . GLY C 1 38  ? 16.037  -9.524  115.458 1.00 25.18 ? 38  GLY C O   1 
ATOM   6948  N N   . GLY C 1 39  ? 14.584  -7.917  114.973 1.00 23.14 ? 39  GLY C N   1 
ATOM   6949  C CA  . GLY C 1 39  ? 15.595  -6.900  114.864 1.00 23.37 ? 39  GLY C CA  1 
ATOM   6950  C C   . GLY C 1 39  ? 15.508  -5.887  115.959 1.00 23.67 ? 39  GLY C C   1 
ATOM   6951  O O   . GLY C 1 39  ? 15.955  -4.748  115.789 1.00 24.06 ? 39  GLY C O   1 
ATOM   6952  N N   . LEU C 1 40  ? 14.944  -6.289  117.101 1.00 23.11 ? 40  LEU C N   1 
ATOM   6953  C CA  . LEU C 1 40  ? 14.830  -5.373  118.242 1.00 22.70 ? 40  LEU C CA  1 
ATOM   6954  C C   . LEU C 1 40  ? 16.162  -5.307  118.998 1.00 22.16 ? 40  LEU C C   1 
ATOM   6955  O O   . LEU C 1 40  ? 16.716  -6.355  119.319 1.00 23.92 ? 40  LEU C O   1 
ATOM   6956  C CB  . LEU C 1 40  ? 13.748  -5.879  119.204 1.00 21.12 ? 40  LEU C CB  1 
ATOM   6957  C CG  . LEU C 1 40  ? 12.350  -6.087  118.611 1.00 23.01 ? 40  LEU C CG  1 
ATOM   6958  C CD1 . LEU C 1 40  ? 11.466  -6.736  119.673 1.00 27.37 ? 40  LEU C CD1 1 
ATOM   6959  C CD2 . LEU C 1 40  ? 11.736  -4.761  118.136 1.00 24.87 ? 40  LEU C CD2 1 
ATOM   6960  N N   . PRO C 1 41  ? 16.654  -4.087  119.330 1.00 20.35 ? 41  PRO C N   1 
ATOM   6961  C CA  . PRO C 1 41  ? 17.769  -3.990  120.237 1.00 19.39 ? 41  PRO C CA  1 
ATOM   6962  C C   . PRO C 1 41  ? 17.297  -4.339  121.671 1.00 19.98 ? 41  PRO C C   1 
ATOM   6963  O O   . PRO C 1 41  ? 16.088  -4.287  121.964 1.00 18.59 ? 41  PRO C O   1 
ATOM   6964  C CB  . PRO C 1 41  ? 18.185  -2.512  120.118 1.00 20.09 ? 41  PRO C CB  1 
ATOM   6965  C CG  . PRO C 1 41  ? 16.926  -1.782  119.777 1.00 18.75 ? 41  PRO C CG  1 
ATOM   6966  C CD  . PRO C 1 41  ? 16.169  -2.751  118.895 1.00 20.01 ? 41  PRO C CD  1 
ATOM   6967  N N   . ASN C 1 42  ? 18.245  -4.668  122.550 1.00 19.01 ? 42  ASN C N   1 
ATOM   6968  C CA  . ASN C 1 42  ? 17.913  -4.995  123.927 1.00 19.80 ? 42  ASN C CA  1 
ATOM   6969  C C   . ASN C 1 42  ? 17.498  -3.706  124.661 1.00 18.87 ? 42  ASN C C   1 
ATOM   6970  O O   . ASN C 1 42  ? 18.340  -2.820  124.848 1.00 18.85 ? 42  ASN C O   1 
ATOM   6971  C CB  . ASN C 1 42  ? 19.109  -5.592  124.623 1.00 19.31 ? 42  ASN C CB  1 
ATOM   6972  C CG  . ASN C 1 42  ? 18.747  -6.245  125.916 1.00 22.35 ? 42  ASN C CG  1 
ATOM   6973  O OD1 . ASN C 1 42  ? 18.092  -5.641  126.769 1.00 22.19 ? 42  ASN C OD1 1 
ATOM   6974  N ND2 . ASN C 1 42  ? 19.107  -7.534  126.054 1.00 18.02 ? 42  ASN C ND2 1 
ATOM   6975  N N   . PRO C 1 43  ? 16.240  -3.635  125.126 1.00 17.95 ? 43  PRO C N   1 
ATOM   6976  C CA  . PRO C 1 43  ? 15.773  -2.376  125.743 1.00 18.78 ? 43  PRO C CA  1 
ATOM   6977  C C   . PRO C 1 43  ? 16.328  -2.189  127.192 1.00 19.02 ? 43  PRO C C   1 
ATOM   6978  O O   . PRO C 1 43  ? 16.230  -1.106  127.770 1.00 18.02 ? 43  PRO C O   1 
ATOM   6979  C CB  . PRO C 1 43  ? 14.253  -2.528  125.699 1.00 16.90 ? 43  PRO C CB  1 
ATOM   6980  C CG  . PRO C 1 43  ? 14.033  -3.995  125.989 1.00 17.64 ? 43  PRO C CG  1 
ATOM   6981  C CD  . PRO C 1 43  ? 15.155  -4.650  125.094 1.00 19.75 ? 43  PRO C CD  1 
ATOM   6982  N N   . ASN C 1 44  ? 16.977  -3.215  127.741 1.00 20.16 ? 44  ASN C N   1 
ATOM   6983  C CA  . ASN C 1 44  ? 17.633  -3.080  129.039 1.00 21.15 ? 44  ASN C CA  1 
ATOM   6984  C C   . ASN C 1 44  ? 18.861  -2.172  129.016 1.00 20.96 ? 44  ASN C C   1 
ATOM   6985  O O   . ASN C 1 44  ? 19.254  -1.683  130.046 1.00 21.17 ? 44  ASN C O   1 
ATOM   6986  C CB  . ASN C 1 44  ? 17.998  -4.454  129.648 1.00 22.40 ? 44  ASN C CB  1 
ATOM   6987  C CG  . ASN C 1 44  ? 16.781  -5.265  130.032 1.00 25.21 ? 44  ASN C CG  1 
ATOM   6988  O OD1 . ASN C 1 44  ? 16.107  -4.988  131.047 1.00 26.48 ? 44  ASN C OD1 1 
ATOM   6989  N ND2 . ASN C 1 44  ? 16.479  -6.272  129.227 1.00 24.83 ? 44  ASN C ND2 1 
ATOM   6990  N N   . MET C 1 45  ? 19.454  -1.922  127.846 1.00 20.97 ? 45  MET C N   1 
ATOM   6991  C CA  . MET C 1 45  ? 20.590  -1.006  127.754 1.00 20.40 ? 45  MET C CA  1 
ATOM   6992  C C   . MET C 1 45  ? 20.134  0.472   127.753 1.00 19.97 ? 45  MET C C   1 
ATOM   6993  O O   . MET C 1 45  ? 20.939  1.377   127.952 1.00 20.75 ? 45  MET C O   1 
ATOM   6994  C CB  . MET C 1 45  ? 21.354  -1.246  126.445 1.00 20.96 ? 45  MET C CB  1 
ATOM   6995  C CG  . MET C 1 45  ? 22.118  -2.593  126.351 1.00 21.27 ? 45  MET C CG  1 
ATOM   6996  S SD  . MET C 1 45  ? 23.127  -3.078  127.719 1.00 29.16 ? 45  MET C SD  1 
ATOM   6997  C CE  . MET C 1 45  ? 24.186  -1.749  128.164 1.00 32.43 ? 45  MET C CE  1 
ATOM   6998  N N   . PHE C 1 46  ? 18.862  0.712   127.481 1.00 19.43 ? 46  PHE C N   1 
ATOM   6999  C CA  . PHE C 1 46  ? 18.352  2.108   127.441 1.00 18.38 ? 46  PHE C CA  1 
ATOM   7000  C C   . PHE C 1 46  ? 18.440  2.752   128.841 1.00 18.42 ? 46  PHE C C   1 
ATOM   7001  O O   . PHE C 1 46  ? 18.119  2.109   129.828 1.00 18.88 ? 46  PHE C O   1 
ATOM   7002  C CB  . PHE C 1 46  ? 16.959  2.124   126.843 1.00 17.76 ? 46  PHE C CB  1 
ATOM   7003  C CG  . PHE C 1 46  ? 16.896  1.564   125.445 1.00 17.80 ? 46  PHE C CG  1 
ATOM   7004  C CD1 . PHE C 1 46  ? 18.032  1.564   124.615 1.00 20.39 ? 46  PHE C CD1 1 
ATOM   7005  C CD2 . PHE C 1 46  ? 15.705  1.033   124.939 1.00 18.17 ? 46  PHE C CD2 1 
ATOM   7006  C CE1 . PHE C 1 46  ? 17.984  1.045   123.303 1.00 16.64 ? 46  PHE C CE1 1 
ATOM   7007  C CE2 . PHE C 1 46  ? 15.647  0.556   123.612 1.00 17.82 ? 46  PHE C CE2 1 
ATOM   7008  C CZ  . PHE C 1 46  ? 16.780  0.534   122.820 1.00 19.06 ? 46  PHE C CZ  1 
ATOM   7009  N N   . PRO C 1 47  ? 18.902  4.027   128.930 1.00 18.13 ? 47  PRO C N   1 
ATOM   7010  C CA  . PRO C 1 47  ? 19.123  4.639   130.269 1.00 18.18 ? 47  PRO C CA  1 
ATOM   7011  C C   . PRO C 1 47  ? 17.881  5.155   131.028 1.00 17.93 ? 47  PRO C C   1 
ATOM   7012  O O   . PRO C 1 47  ? 17.952  5.241   132.227 1.00 18.30 ? 47  PRO C O   1 
ATOM   7013  C CB  . PRO C 1 47  ? 20.156  5.735   130.003 1.00 16.56 ? 47  PRO C CB  1 
ATOM   7014  C CG  . PRO C 1 47  ? 19.869  6.161   128.503 1.00 17.96 ? 47  PRO C CG  1 
ATOM   7015  C CD  . PRO C 1 47  ? 19.354  4.876   127.815 1.00 17.54 ? 47  PRO C CD  1 
ATOM   7016  N N   . PHE C 1 48  ? 16.772  5.467   130.350 1.00 16.91 ? 48  PHE C N   1 
ATOM   7017  C CA  . PHE C 1 48  ? 15.546  5.927   131.039 1.00 16.07 ? 48  PHE C CA  1 
ATOM   7018  C C   . PHE C 1 48  ? 14.879  4.688   131.622 1.00 15.96 ? 48  PHE C C   1 
ATOM   7019  O O   . PHE C 1 48  ? 14.712  3.695   130.910 1.00 16.85 ? 48  PHE C O   1 
ATOM   7020  C CB  . PHE C 1 48  ? 14.595  6.640   130.056 1.00 16.22 ? 48  PHE C CB  1 
ATOM   7021  C CG  . PHE C 1 48  ? 15.292  7.680   129.188 1.00 17.74 ? 48  PHE C CG  1 
ATOM   7022  C CD1 . PHE C 1 48  ? 15.678  8.921   129.724 1.00 17.94 ? 48  PHE C CD1 1 
ATOM   7023  C CD2 . PHE C 1 48  ? 15.578  7.402   127.842 1.00 20.07 ? 48  PHE C CD2 1 
ATOM   7024  C CE1 . PHE C 1 48  ? 16.310  9.910   128.905 1.00 16.62 ? 48  PHE C CE1 1 
ATOM   7025  C CE2 . PHE C 1 48  ? 16.220  8.337   127.033 1.00 16.71 ? 48  PHE C CE2 1 
ATOM   7026  C CZ  . PHE C 1 48  ? 16.592  9.602   127.580 1.00 17.22 ? 48  PHE C CZ  1 
ATOM   7027  N N   . LYS C 1 49  ? 14.522  4.729   132.902 1.00 16.28 ? 49  LYS C N   1 
ATOM   7028  C CA  . LYS C 1 49  ? 14.019  3.521   133.607 1.00 17.44 ? 49  LYS C CA  1 
ATOM   7029  C C   . LYS C 1 49  ? 12.561  3.544   134.100 1.00 18.51 ? 49  LYS C C   1 
ATOM   7030  O O   . LYS C 1 49  ? 11.897  2.512   134.080 1.00 17.34 ? 49  LYS C O   1 
ATOM   7031  C CB  . LYS C 1 49  ? 14.935  3.130   134.765 1.00 17.94 ? 49  LYS C CB  1 
ATOM   7032  C CG  . LYS C 1 49  ? 16.352  2.848   134.351 1.00 17.46 ? 49  LYS C CG  1 
ATOM   7033  C CD  . LYS C 1 49  ? 16.394  1.670   133.393 1.00 19.12 ? 49  LYS C CD  1 
ATOM   7034  C CE  . LYS C 1 49  ? 17.778  1.488   132.859 1.00 20.19 ? 49  LYS C CE  1 
ATOM   7035  N NZ  . LYS C 1 49  ? 17.827  0.192   132.090 1.00 21.92 ? 49  LYS C NZ  1 
ATOM   7036  N N   . THR C 1 50  ? 12.087  4.706   134.556 1.00 18.27 ? 50  THR C N   1 
ATOM   7037  C CA  . THR C 1 50  ? 10.706  4.853   135.000 1.00 20.32 ? 50  THR C CA  1 
ATOM   7038  C C   . THR C 1 50  ? 10.215  6.254   134.631 1.00 19.73 ? 50  THR C C   1 
ATOM   7039  O O   . THR C 1 50  ? 11.029  7.155   134.495 1.00 20.02 ? 50  THR C O   1 
ATOM   7040  C CB  . THR C 1 50  ? 10.518  4.660   136.543 1.00 21.51 ? 50  THR C CB  1 
ATOM   7041  O OG1 . THR C 1 50  ? 11.224  5.681   137.241 1.00 20.61 ? 50  THR C OG1 1 
ATOM   7042  C CG2 . THR C 1 50  ? 11.034  3.293   137.062 1.00 22.73 ? 50  THR C CG2 1 
ATOM   7043  N N   . ALA C 1 51  ? 8.896   6.450   134.490 1.00 19.42 ? 51  ALA C N   1 
ATOM   7044  C CA  . ALA C 1 51  ? 8.371   7.825   134.245 1.00 18.93 ? 51  ALA C CA  1 
ATOM   7045  C C   . ALA C 1 51  ? 7.171   8.049   135.143 1.00 18.88 ? 51  ALA C C   1 
ATOM   7046  O O   . ALA C 1 51  ? 6.352   7.136   135.331 1.00 19.76 ? 51  ALA C O   1 
ATOM   7047  C CB  . ALA C 1 51  ? 7.917   8.033   132.775 1.00 17.37 ? 51  ALA C CB  1 
ATOM   7048  N N   . VAL C 1 52  ? 7.049   9.267   135.636 1.00 17.17 ? 52  VAL C N   1 
ATOM   7049  C CA  . VAL C 1 52  ? 5.822   9.708   136.315 1.00 18.79 ? 52  VAL C CA  1 
ATOM   7050  C C   . VAL C 1 52  ? 5.387   11.048  135.753 1.00 18.40 ? 52  VAL C C   1 
ATOM   7051  O O   . VAL C 1 52  ? 6.130   12.011  135.790 1.00 18.24 ? 52  VAL C O   1 
ATOM   7052  C CB  . VAL C 1 52  ? 5.880   9.645   137.853 1.00 20.46 ? 52  VAL C CB  1 
ATOM   7053  C CG1 . VAL C 1 52  ? 7.214   10.063  138.390 1.00 23.94 ? 52  VAL C CG1 1 
ATOM   7054  C CG2 . VAL C 1 52  ? 4.763   10.404  138.486 1.00 17.34 ? 52  VAL C CG2 1 
ATOM   7055  N N   . ILE C 1 53  ? 4.184   11.066  135.189 1.00 17.37 ? 53  ILE C N   1 
ATOM   7056  C CA  . ILE C 1 53  ? 3.692   12.235  134.475 1.00 19.42 ? 53  ILE C CA  1 
ATOM   7057  C C   . ILE C 1 53  ? 2.384   12.648  135.136 1.00 18.14 ? 53  ILE C C   1 
ATOM   7058  O O   . ILE C 1 53  ? 1.467   11.851  135.187 1.00 19.03 ? 53  ILE C O   1 
ATOM   7059  C CB  . ILE C 1 53  ? 3.517   11.930  132.954 1.00 18.90 ? 53  ILE C CB  1 
ATOM   7060  C CG1 . ILE C 1 53  ? 4.897   11.554  132.393 1.00 20.92 ? 53  ILE C CG1 1 
ATOM   7061  C CG2 . ILE C 1 53  ? 2.904   13.165  132.229 1.00 19.19 ? 53  ILE C CG2 1 
ATOM   7062  C CD1 . ILE C 1 53  ? 4.957   10.974  130.970 1.00 22.71 ? 53  ILE C CD1 1 
ATOM   7063  N N   . THR C 1 54  ? 2.336   13.870  135.667 1.00 18.97 ? 54  THR C N   1 
ATOM   7064  C CA  . THR C 1 54  ? 1.112   14.357  136.344 1.00 19.75 ? 54  THR C CA  1 
ATOM   7065  C C   . THR C 1 54  ? 0.145   14.865  135.316 1.00 20.14 ? 54  THR C C   1 
ATOM   7066  O O   . THR C 1 54  ? 0.576   15.377  134.264 1.00 20.74 ? 54  THR C O   1 
ATOM   7067  C CB  . THR C 1 54  ? 1.399   15.427  137.436 1.00 19.75 ? 54  THR C CB  1 
ATOM   7068  O OG1 . THR C 1 54  ? 2.075   16.538  136.839 1.00 20.96 ? 54  THR C OG1 1 
ATOM   7069  C CG2 . THR C 1 54  ? 2.343   14.827  138.562 1.00 17.86 ? 54  THR C CG2 1 
ATOM   7070  N N   . VAL C 1 55  ? -1.150  14.719  135.614 1.00 20.01 ? 55  VAL C N   1 
ATOM   7071  C CA  . VAL C 1 55  ? -2.258  15.131  134.734 1.00 21.35 ? 55  VAL C CA  1 
ATOM   7072  C C   . VAL C 1 55  ? -3.228  16.010  135.519 1.00 23.22 ? 55  VAL C C   1 
ATOM   7073  O O   . VAL C 1 55  ? -3.577  15.678  136.668 1.00 21.34 ? 55  VAL C O   1 
ATOM   7074  C CB  . VAL C 1 55  ? -2.983  13.896  134.157 1.00 20.97 ? 55  VAL C CB  1 
ATOM   7075  C CG1 . VAL C 1 55  ? -4.214  14.238  133.331 1.00 20.53 ? 55  VAL C CG1 1 
ATOM   7076  C CG2 . VAL C 1 55  ? -2.026  13.046  133.293 1.00 18.96 ? 55  VAL C CG2 1 
ATOM   7077  N N   . GLU C 1 56  ? -3.554  17.175  134.961 1.00 25.23 ? 56  GLU C N   1 
ATOM   7078  C CA  . GLU C 1 56  ? -4.619  18.003  135.530 1.00 28.71 ? 56  GLU C CA  1 
ATOM   7079  C C   . GLU C 1 56  ? -5.967  17.379  135.117 1.00 29.59 ? 56  GLU C C   1 
ATOM   7080  O O   . GLU C 1 56  ? -6.137  16.946  133.977 1.00 30.88 ? 56  GLU C O   1 
ATOM   7081  C CB  . GLU C 1 56  ? -4.476  19.477  135.105 1.00 29.16 ? 56  GLU C CB  1 
ATOM   7082  C CG  . GLU C 1 56  ? -5.373  19.966  134.004 1.00 33.12 ? 56  GLU C CG  1 
ATOM   7083  C CD  . GLU C 1 56  ? -5.404  21.514  133.867 1.00 36.04 ? 56  GLU C CD  1 
ATOM   7084  O OE1 . GLU C 1 56  ? -5.704  22.224  134.880 1.00 35.97 ? 56  GLU C OE1 1 
ATOM   7085  O OE2 . GLU C 1 56  ? -5.129  22.010  132.730 1.00 38.71 ? 56  GLU C OE2 1 
ATOM   7086  N N   . ASN C 1 57  ? -6.882  17.292  136.068 1.00 31.05 ? 57  ASN C N   1 
ATOM   7087  C CA  . ASN C 1 57  ? -8.184  16.592  135.947 1.00 32.03 ? 57  ASN C CA  1 
ATOM   7088  C C   . ASN C 1 57  ? -8.118  15.137  135.494 1.00 31.96 ? 57  ASN C C   1 
ATOM   7089  O O   . ASN C 1 57  ? -9.038  14.662  134.787 1.00 31.12 ? 57  ASN C O   1 
ATOM   7090  C CB  . ASN C 1 57  ? -9.209  17.351  135.094 1.00 33.43 ? 57  ASN C CB  1 
ATOM   7091  C CG  . ASN C 1 57  ? -9.503  18.732  135.612 1.00 36.54 ? 57  ASN C CG  1 
ATOM   7092  O OD1 . ASN C 1 57  ? -9.893  18.922  136.775 1.00 41.03 ? 57  ASN C OD1 1 
ATOM   7093  N ND2 . ASN C 1 57  ? -9.339  19.718  134.737 1.00 38.23 ? 57  ASN C ND2 1 
ATOM   7094  N N   . GLY C 1 58  ? -7.060  14.445  135.947 1.00 31.44 ? 58  GLY C N   1 
ATOM   7095  C CA  . GLY C 1 58  ? -6.827  13.027  135.665 1.00 31.52 ? 58  GLY C CA  1 
ATOM   7096  C C   . GLY C 1 58  ? -5.828  12.378  136.640 1.00 30.46 ? 58  GLY C C   1 
ATOM   7097  O O   . GLY C 1 58  ? -5.190  13.038  137.458 1.00 30.61 ? 58  GLY C O   1 
ATOM   7098  N N   . LYS C 1 59  ? -5.730  11.059  136.538 1.00 30.14 ? 59  LYS C N   1 
ATOM   7099  C CA  . LYS C 1 59  ? -4.857  10.234  137.350 1.00 27.99 ? 59  LYS C CA  1 
ATOM   7100  C C   . LYS C 1 59  ? -3.428  10.397  136.838 1.00 26.72 ? 59  LYS C C   1 
ATOM   7101  O O   . LYS C 1 59  ? -3.213  10.492  135.610 1.00 24.49 ? 59  LYS C O   1 
ATOM   7102  C CB  . LYS C 1 59  ? -5.301  8.789   137.150 1.00 28.77 ? 59  LYS C CB  1 
ATOM   7103  C CG  . LYS C 1 59  ? -4.816  7.837   138.229 1.00 31.39 ? 59  LYS C CG  1 
ATOM   7104  C CD  . LYS C 1 59  ? -5.193  6.405   137.896 1.00 35.76 ? 59  LYS C CD  1 
ATOM   7105  C CE  . LYS C 1 59  ? -4.690  5.445   138.981 1.00 38.35 ? 59  LYS C CE  1 
ATOM   7106  N NZ  . LYS C 1 59  ? -4.925  4.006   138.644 1.00 38.77 ? 59  LYS C NZ  1 
ATOM   7107  N N   . THR C 1 60  ? -2.444  10.364  137.745 1.00 25.61 ? 60  THR C N   1 
ATOM   7108  C CA  . THR C 1 60  ? -1.077  10.527  137.296 1.00 25.25 ? 60  THR C CA  1 
ATOM   7109  C C   . THR C 1 60  ? -0.677  9.289   136.519 1.00 24.29 ? 60  THR C C   1 
ATOM   7110  O O   . THR C 1 60  ? -1.155  8.178   136.811 1.00 23.60 ? 60  THR C O   1 
ATOM   7111  C CB  . THR C 1 60  ? -0.061  10.917  138.389 1.00 25.26 ? 60  THR C CB  1 
ATOM   7112  O OG1 . THR C 1 60  ? 0.665   9.772   138.822 1.00 31.82 ? 60  THR C OG1 1 
ATOM   7113  C CG2 . THR C 1 60  ? -0.706  11.519  139.509 1.00 22.14 ? 60  THR C CG2 1 
ATOM   7114  N N   . ILE C 1 61  ? 0.103   9.515   135.468 1.00 23.11 ? 61  ILE C N   1 
ATOM   7115  C CA  . ILE C 1 61  ? 0.523   8.442   134.582 1.00 22.94 ? 61  ILE C CA  1 
ATOM   7116  C C   . ILE C 1 61  ? 1.902   7.933   135.019 1.00 22.05 ? 61  ILE C C   1 
ATOM   7117  O O   . ILE C 1 61  ? 2.782   8.708   135.322 1.00 21.97 ? 61  ILE C O   1 
ATOM   7118  C CB  . ILE C 1 61  ? 0.521   8.914   133.105 1.00 22.25 ? 61  ILE C CB  1 
ATOM   7119  C CG1 . ILE C 1 61  ? -0.949  9.054   132.641 1.00 21.14 ? 61  ILE C CG1 1 
ATOM   7120  C CG2 . ILE C 1 61  ? 1.263   7.873   132.204 1.00 22.50 ? 61  ILE C CG2 1 
ATOM   7121  C CD1 . ILE C 1 61  ? -1.144  9.997   131.459 1.00 18.13 ? 61  ILE C CD1 1 
ATOM   7122  N N   . GLN C 1 62  ? 2.028   6.626   135.109 1.00 21.98 ? 62  GLN C N   1 
ATOM   7123  C CA  . GLN C 1 62  ? 3.235   6.007   135.610 1.00 23.77 ? 62  GLN C CA  1 
ATOM   7124  C C   . GLN C 1 62  ? 3.655   4.910   134.641 1.00 22.53 ? 62  GLN C C   1 
ATOM   7125  O O   . GLN C 1 62  ? 2.838   4.016   134.304 1.00 21.18 ? 62  GLN C O   1 
ATOM   7126  C CB  . GLN C 1 62  ? 2.995   5.415   136.985 1.00 24.29 ? 62  GLN C CB  1 
ATOM   7127  C CG  . GLN C 1 62  ? 2.805   6.453   138.060 1.00 30.87 ? 62  GLN C CG  1 
ATOM   7128  C CD  . GLN C 1 62  ? 2.874   5.868   139.433 1.00 38.78 ? 62  GLN C CD  1 
ATOM   7129  O OE1 . GLN C 1 62  ? 3.844   5.203   139.784 1.00 43.66 ? 62  GLN C OE1 1 
ATOM   7130  N NE2 . GLN C 1 62  ? 1.824   6.093   140.233 1.00 42.97 ? 62  GLN C NE2 1 
ATOM   7131  N N   . PHE C 1 63  ? 4.914   4.975   134.190 1.00 21.42 ? 63  PHE C N   1 
ATOM   7132  C CA  . PHE C 1 63  ? 5.515   3.838   133.472 1.00 20.14 ? 63  PHE C CA  1 
ATOM   7133  C C   . PHE C 1 63  ? 6.493   3.197   134.442 1.00 21.57 ? 63  PHE C C   1 
ATOM   7134  O O   . PHE C 1 63  ? 7.535   3.796   134.759 1.00 18.75 ? 63  PHE C O   1 
ATOM   7135  C CB  . PHE C 1 63  ? 6.354   4.281   132.265 1.00 20.83 ? 63  PHE C CB  1 
ATOM   7136  C CG  . PHE C 1 63  ? 5.593   4.977   131.209 1.00 20.37 ? 63  PHE C CG  1 
ATOM   7137  C CD1 . PHE C 1 63  ? 4.201   4.950   131.179 1.00 20.78 ? 63  PHE C CD1 1 
ATOM   7138  C CD2 . PHE C 1 63  ? 6.279   5.642   130.188 1.00 21.45 ? 63  PHE C CD2 1 
ATOM   7139  C CE1 . PHE C 1 63  ? 3.499   5.594   130.135 1.00 23.70 ? 63  PHE C CE1 1 
ATOM   7140  C CE2 . PHE C 1 63  ? 5.584   6.301   129.169 1.00 23.92 ? 63  PHE C CE2 1 
ATOM   7141  C CZ  . PHE C 1 63  ? 4.209   6.293   129.153 1.00 20.19 ? 63  PHE C CZ  1 
ATOM   7142  N N   . GLY C 1 64  ? 6.182   1.988   134.908 1.00 21.12 ? 64  GLY C N   1 
ATOM   7143  C CA  . GLY C 1 64  ? 7.124   1.239   135.756 1.00 22.34 ? 64  GLY C CA  1 
ATOM   7144  C C   . GLY C 1 64  ? 8.162   0.620   134.842 1.00 22.33 ? 64  GLY C C   1 
ATOM   7145  O O   . GLY C 1 64  ? 8.202   0.960   133.658 1.00 22.35 ? 64  GLY C O   1 
ATOM   7146  N N   . GLU C 1 65  ? 8.997   -0.280  135.379 1.00 23.44 ? 65  GLU C N   1 
ATOM   7147  C CA  . GLU C 1 65  ? 10.101  -0.880  134.621 1.00 23.25 ? 65  GLU C CA  1 
ATOM   7148  C C   . GLU C 1 65  ? 9.705   -1.490  133.297 1.00 23.21 ? 65  GLU C C   1 
ATOM   7149  O O   . GLU C 1 65  ? 10.394  -1.243  132.290 1.00 21.79 ? 65  GLU C O   1 
ATOM   7150  C CB  . GLU C 1 65  ? 10.862  -1.944  135.427 1.00 24.95 ? 65  GLU C CB  1 
ATOM   7151  C CG  . GLU C 1 65  ? 11.005  -1.645  136.899 1.00 33.00 ? 65  GLU C CG  1 
ATOM   7152  C CD  . GLU C 1 65  ? 11.630  -0.298  137.180 1.00 40.26 ? 65  GLU C CD  1 
ATOM   7153  O OE1 . GLU C 1 65  ? 12.272  0.249   136.253 1.00 44.27 ? 65  GLU C OE1 1 
ATOM   7154  O OE2 . GLU C 1 65  ? 11.503  0.210   138.335 1.00 43.28 ? 65  GLU C OE2 1 
ATOM   7155  N N   . GLU C 1 66  ? 8.664   -2.323  133.292 1.00 20.83 ? 66  GLU C N   1 
ATOM   7156  C CA  . GLU C 1 66  ? 8.317   -3.057  132.059 1.00 22.34 ? 66  GLU C CA  1 
ATOM   7157  C C   . GLU C 1 66  ? 7.673   -2.154  131.027 1.00 20.55 ? 66  GLU C C   1 
ATOM   7158  O O   . GLU C 1 66  ? 7.996   -2.261  129.836 1.00 19.97 ? 66  GLU C O   1 
ATOM   7159  C CB  . GLU C 1 66  ? 7.404   -4.263  132.330 1.00 23.28 ? 66  GLU C CB  1 
ATOM   7160  C CG  . GLU C 1 66  ? 8.143   -5.415  133.046 1.00 26.44 ? 66  GLU C CG  1 
ATOM   7161  C CD  . GLU C 1 66  ? 9.432   -5.835  132.332 1.00 32.48 ? 66  GLU C CD  1 
ATOM   7162  O OE1 . GLU C 1 66  ? 10.525  -5.806  132.971 1.00 30.90 ? 66  GLU C OE1 1 
ATOM   7163  O OE2 . GLU C 1 66  ? 9.345   -6.148  131.119 1.00 36.68 ? 66  GLU C OE2 1 
ATOM   7164  N N   . MET C 1 67  ? 6.732   -1.320  131.478 1.00 18.71 ? 67  MET C N   1 
ATOM   7165  C CA  . MET C 1 67  ? 6.081   -0.372  130.597 1.00 19.54 ? 67  MET C CA  1 
ATOM   7166  C C   . MET C 1 67  ? 7.107   0.584   129.980 1.00 17.80 ? 67  MET C C   1 
ATOM   7167  O O   . MET C 1 67  ? 6.991   0.950   128.805 1.00 19.04 ? 67  MET C O   1 
ATOM   7168  C CB  . MET C 1 67  ? 4.977   0.394   131.359 1.00 20.07 ? 67  MET C CB  1 
ATOM   7169  C CG  . MET C 1 67  ? 4.243   1.425   130.519 1.00 24.21 ? 67  MET C CG  1 
ATOM   7170  S SD  . MET C 1 67  ? 3.281   0.650   129.226 1.00 28.33 ? 67  MET C SD  1 
ATOM   7171  C CE  . MET C 1 67  ? 2.006   -0.199  130.158 1.00 31.34 ? 67  MET C CE  1 
ATOM   7172  N N   . MET C 1 68  ? 8.088   0.995   130.764 1.00 17.28 ? 68  MET C N   1 
ATOM   7173  C CA  . MET C 1 68  ? 9.087   1.917   130.280 1.00 16.25 ? 68  MET C CA  1 
ATOM   7174  C C   . MET C 1 68  ? 9.910   1.286   129.168 1.00 17.56 ? 68  MET C C   1 
ATOM   7175  O O   . MET C 1 68  ? 10.095  1.877   128.129 1.00 17.70 ? 68  MET C O   1 
ATOM   7176  C CB  . MET C 1 68  ? 9.990   2.404   131.399 1.00 16.92 ? 68  MET C CB  1 
ATOM   7177  C CG  . MET C 1 68  ? 11.096  3.283   130.922 1.00 18.21 ? 68  MET C CG  1 
ATOM   7178  S SD  . MET C 1 68  ? 10.571  4.791   130.097 1.00 28.47 ? 68  MET C SD  1 
ATOM   7179  C CE  . MET C 1 68  ? 9.611   5.489   131.362 1.00 15.02 ? 68  MET C CE  1 
ATOM   7180  N N   . LYS C 1 69  ? 10.389  0.074   129.387 1.00 15.92 ? 69  LYS C N   1 
ATOM   7181  C CA  . LYS C 1 69  ? 11.051  -0.630  128.285 1.00 18.11 ? 69  LYS C CA  1 
ATOM   7182  C C   . LYS C 1 69  ? 10.203  -0.756  127.017 1.00 17.33 ? 69  LYS C C   1 
ATOM   7183  O O   . LYS C 1 69  ? 10.713  -0.666  125.917 1.00 18.32 ? 69  LYS C O   1 
ATOM   7184  C CB  . LYS C 1 69  ? 11.575  -1.995  128.723 1.00 18.27 ? 69  LYS C CB  1 
ATOM   7185  C CG  . LYS C 1 69  ? 12.416  -1.928  129.970 1.00 22.01 ? 69  LYS C CG  1 
ATOM   7186  C CD  . LYS C 1 69  ? 13.107  -3.262  130.200 1.00 27.32 ? 69  LYS C CD  1 
ATOM   7187  C CE  . LYS C 1 69  ? 12.225  -4.237  130.857 1.00 28.77 ? 69  LYS C CE  1 
ATOM   7188  N NZ  . LYS C 1 69  ? 13.128  -5.077  131.736 1.00 34.42 ? 69  LYS C NZ  1 
ATOM   7189  N N   . ARG C 1 70  ? 8.915   -0.967  127.169 1.00 16.89 ? 70  ARG C N   1 
ATOM   7190  C CA  . ARG C 1 70  ? 8.034   -0.926  126.002 1.00 16.20 ? 70  ARG C CA  1 
ATOM   7191  C C   . ARG C 1 70  ? 7.972   0.472   125.321 1.00 15.48 ? 70  ARG C C   1 
ATOM   7192  O O   . ARG C 1 70  ? 8.021   0.575   124.080 1.00 15.50 ? 70  ARG C O   1 
ATOM   7193  C CB  . ARG C 1 70  ? 6.649   -1.422  126.405 1.00 15.61 ? 70  ARG C CB  1 
ATOM   7194  C CG  . ARG C 1 70  ? 5.607   -1.281  125.243 1.00 16.36 ? 70  ARG C CG  1 
ATOM   7195  C CD  . ARG C 1 70  ? 4.265   -1.859  125.564 1.00 18.38 ? 70  ARG C CD  1 
ATOM   7196  N NE  . ARG C 1 70  ? 3.391   -1.733  124.402 1.00 17.83 ? 70  ARG C NE  1 
ATOM   7197  C CZ  . ARG C 1 70  ? 2.071   -1.547  124.481 1.00 19.09 ? 70  ARG C CZ  1 
ATOM   7198  N NH1 . ARG C 1 70  ? 1.469   -1.466  125.675 1.00 14.49 ? 70  ARG C NH1 1 
ATOM   7199  N NH2 . ARG C 1 70  ? 1.368   -1.418  123.368 1.00 13.53 ? 70  ARG C NH2 1 
ATOM   7200  N N   . ALA C 1 71  ? 7.805   1.523   126.130 1.00 15.13 ? 71  ALA C N   1 
ATOM   7201  C CA  . ALA C 1 71  ? 7.828   2.922   125.663 1.00 13.69 ? 71  ALA C CA  1 
ATOM   7202  C C   . ALA C 1 71  ? 9.093   3.303   124.873 1.00 13.51 ? 71  ALA C C   1 
ATOM   7203  O O   . ALA C 1 71  ? 9.071   4.181   124.010 1.00 13.00 ? 71  ALA C O   1 
ATOM   7204  C CB  . ALA C 1 71  ? 7.650   3.874   126.910 1.00 13.92 ? 71  ALA C CB  1 
ATOM   7205  N N   . LEU C 1 72  ? 10.216  2.710   125.275 1.00 13.07 ? 72  LEU C N   1 
ATOM   7206  C CA  . LEU C 1 72  ? 11.495  2.960   124.650 1.00 14.54 ? 72  LEU C CA  1 
ATOM   7207  C C   . LEU C 1 72  ? 11.864  2.046   123.498 1.00 14.89 ? 72  LEU C C   1 
ATOM   7208  O O   . LEU C 1 72  ? 12.928  2.232   122.892 1.00 16.13 ? 72  LEU C O   1 
ATOM   7209  C CB  . LEU C 1 72  ? 12.613  2.927   125.715 1.00 12.64 ? 72  LEU C CB  1 
ATOM   7210  C CG  . LEU C 1 72  ? 12.456  3.921   126.880 1.00 17.07 ? 72  LEU C CG  1 
ATOM   7211  C CD1 . LEU C 1 72  ? 13.734  3.765   127.756 1.00 15.90 ? 72  LEU C CD1 1 
ATOM   7212  C CD2 . LEU C 1 72  ? 12.250  5.401   126.376 1.00 11.48 ? 72  LEU C CD2 1 
ATOM   7213  N N   . GLN C 1 73  ? 10.967  1.107   123.161 1.00 15.74 ? 73  GLN C N   1 
ATOM   7214  C CA  . GLN C 1 73  ? 11.238  0.138   122.114 1.00 15.13 ? 73  GLN C CA  1 
ATOM   7215  C C   . GLN C 1 73  ? 10.360  0.368   120.872 1.00 14.48 ? 73  GLN C C   1 
ATOM   7216  O O   . GLN C 1 73  ? 9.317   1.040   120.932 1.00 13.96 ? 73  GLN C O   1 
ATOM   7217  C CB  . GLN C 1 73  ? 11.017  -1.282  122.744 1.00 16.68 ? 73  GLN C CB  1 
ATOM   7218  C CG  . GLN C 1 73  ? 11.208  -2.484  121.769 1.00 17.63 ? 73  GLN C CG  1 
ATOM   7219  C CD  . GLN C 1 73  ? 12.607  -2.537  121.297 1.00 18.52 ? 73  GLN C CD  1 
ATOM   7220  O OE1 . GLN C 1 73  ? 13.003  -1.772  120.404 1.00 17.35 ? 73  GLN C OE1 1 
ATOM   7221  N NE2 . GLN C 1 73  ? 13.384  -3.430  121.885 1.00 19.06 ? 73  GLN C NE2 1 
ATOM   7222  N N   . TYR C 1 74  ? 10.813  -0.129  119.727 1.00 15.54 ? 74  TYR C N   1 
ATOM   7223  C CA  . TYR C 1 74  ? 10.034  -0.117  118.502 1.00 14.85 ? 74  TYR C CA  1 
ATOM   7224  C C   . TYR C 1 74  ? 8.656   -0.649  118.720 1.00 16.11 ? 74  TYR C C   1 
ATOM   7225  O O   . TYR C 1 74  ? 8.437   -1.518  119.578 1.00 14.54 ? 74  TYR C O   1 
ATOM   7226  C CB  . TYR C 1 74  ? 10.697  -0.990  117.440 1.00 14.77 ? 74  TYR C CB  1 
ATOM   7227  C CG  . TYR C 1 74  ? 12.035  -0.502  116.850 1.00 18.53 ? 74  TYR C CG  1 
ATOM   7228  C CD1 . TYR C 1 74  ? 12.115  0.674   116.076 1.00 15.97 ? 74  TYR C CD1 1 
ATOM   7229  C CD2 . TYR C 1 74  ? 13.209  -1.264  117.034 1.00 14.33 ? 74  TYR C CD2 1 
ATOM   7230  C CE1 . TYR C 1 74  ? 13.330  1.072   115.474 1.00 18.62 ? 74  TYR C CE1 1 
ATOM   7231  C CE2 . TYR C 1 74  ? 14.439  -0.851  116.490 1.00 17.39 ? 74  TYR C CE2 1 
ATOM   7232  C CZ  . TYR C 1 74  ? 14.487  0.309   115.697 1.00 19.34 ? 74  TYR C CZ  1 
ATOM   7233  O OH  . TYR C 1 74  ? 15.686  0.658   115.125 1.00 17.43 ? 74  TYR C OH  1 
ATOM   7234  N N   . SER C 1 75  ? 7.719   -0.206  117.880 1.00 15.04 ? 75  SER C N   1 
ATOM   7235  C CA  . SER C 1 75  ? 6.350   -0.685  117.996 1.00 15.71 ? 75  SER C CA  1 
ATOM   7236  C C   . SER C 1 75  ? 5.677   -0.674  116.585 1.00 14.85 ? 75  SER C C   1 
ATOM   7237  O O   . SER C 1 75  ? 6.300   -0.210  115.618 1.00 15.93 ? 75  SER C O   1 
ATOM   7238  C CB  . SER C 1 75  ? 5.600   0.186   119.008 1.00 14.95 ? 75  SER C CB  1 
ATOM   7239  O OG  . SER C 1 75  ? 5.440   1.515   118.522 1.00 18.36 ? 75  SER C OG  1 
ATOM   7240  N N   . PRO C 1 76  ? 4.419   -1.174  116.453 1.00 16.78 ? 76  PRO C N   1 
ATOM   7241  C CA  . PRO C 1 76  ? 3.881   -1.307  115.105 1.00 17.58 ? 76  PRO C CA  1 
ATOM   7242  C C   . PRO C 1 76  ? 3.779   0.008   114.307 1.00 18.71 ? 76  PRO C C   1 
ATOM   7243  O O   . PRO C 1 76  ? 3.373   1.032   114.849 1.00 19.57 ? 76  PRO C O   1 
ATOM   7244  C CB  . PRO C 1 76  ? 2.460   -1.870  115.353 1.00 17.78 ? 76  PRO C CB  1 
ATOM   7245  C CG  . PRO C 1 76  ? 2.543   -2.551  116.698 1.00 18.63 ? 76  PRO C CG  1 
ATOM   7246  C CD  . PRO C 1 76  ? 3.452   -1.658  117.466 1.00 15.96 ? 76  PRO C CD  1 
ATOM   7247  N N   . SER C 1 77  ? 4.071   -0.076  113.009 1.00 19.09 ? 77  SER C N   1 
ATOM   7248  C CA  . SER C 1 77  ? 4.049   1.071   112.117 1.00 20.13 ? 77  SER C CA  1 
ATOM   7249  C C   . SER C 1 77  ? 2.729   1.879   112.170 1.00 19.53 ? 77  SER C C   1 
ATOM   7250  O O   . SER C 1 77  ? 2.781   3.095   112.141 1.00 17.84 ? 77  SER C O   1 
ATOM   7251  C CB  . SER C 1 77  ? 4.351   0.641   110.655 1.00 19.99 ? 77  SER C CB  1 
ATOM   7252  O OG  . SER C 1 77  ? 5.709   0.186   110.506 1.00 26.38 ? 77  SER C OG  1 
ATOM   7253  N N   . ALA C 1 78  ? 1.566   1.200   112.277 1.00 18.06 ? 78  ALA C N   1 
ATOM   7254  C CA  . ALA C 1 78  ? 0.257   1.886   112.336 1.00 17.08 ? 78  ALA C CA  1 
ATOM   7255  C C   . ALA C 1 78  ? -0.123  2.444   113.713 1.00 17.01 ? 78  ALA C C   1 
ATOM   7256  O O   . ALA C 1 78  ? -1.142  3.135   113.853 1.00 17.55 ? 78  ALA C O   1 
ATOM   7257  C CB  . ALA C 1 78  ? -0.871  0.944   111.796 1.00 19.03 ? 78  ALA C CB  1 
ATOM   7258  N N   . GLY C 1 79  ? 0.685   2.175   114.729 1.00 16.67 ? 79  GLY C N   1 
ATOM   7259  C CA  . GLY C 1 79  ? 0.414   2.666   116.066 1.00 15.19 ? 79  GLY C CA  1 
ATOM   7260  C C   . GLY C 1 79  ? 0.243   1.499   117.015 1.00 17.42 ? 79  GLY C C   1 
ATOM   7261  O O   . GLY C 1 79  ? 0.084   0.348   116.571 1.00 15.95 ? 79  GLY C O   1 
ATOM   7262  N N   . ILE C 1 80  ? 0.334   1.767   118.323 1.00 16.36 ? 80  ILE C N   1 
ATOM   7263  C CA  . ILE C 1 80  ? 0.142   0.701   119.315 1.00 16.40 ? 80  ILE C CA  1 
ATOM   7264  C C   . ILE C 1 80  ? -1.332  0.261   119.348 1.00 15.32 ? 80  ILE C C   1 
ATOM   7265  O O   . ILE C 1 80  ? -2.230  1.077   119.132 1.00 16.23 ? 80  ILE C O   1 
ATOM   7266  C CB  . ILE C 1 80  ? 0.559   1.153   120.705 1.00 14.54 ? 80  ILE C CB  1 
ATOM   7267  C CG1 . ILE C 1 80  ? -0.301  2.354   121.119 1.00 16.26 ? 80  ILE C CG1 1 
ATOM   7268  C CG2 . ILE C 1 80  ? 2.077   1.561   120.678 1.00 17.61 ? 80  ILE C CG2 1 
ATOM   7269  C CD1 . ILE C 1 80  ? -0.195  2.743   122.553 1.00 16.52 ? 80  ILE C CD1 1 
ATOM   7270  N N   . PRO C 1 81  ? -1.582  -1.033  119.630 1.00 15.56 ? 81  PRO C N   1 
ATOM   7271  C CA  . PRO C 1 81  ? -2.952  -1.568  119.475 1.00 16.55 ? 81  PRO C CA  1 
ATOM   7272  C C   . PRO C 1 81  ? -3.959  -0.878  120.336 1.00 17.09 ? 81  PRO C C   1 
ATOM   7273  O O   . PRO C 1 81  ? -5.039  -0.631  119.855 1.00 18.12 ? 81  PRO C O   1 
ATOM   7274  C CB  . PRO C 1 81  ? -2.837  -3.063  119.907 1.00 16.33 ? 81  PRO C CB  1 
ATOM   7275  C CG  . PRO C 1 81  ? -1.373  -3.177  120.504 1.00 17.84 ? 81  PRO C CG  1 
ATOM   7276  C CD  . PRO C 1 81  ? -0.597  -2.102  119.878 1.00 14.69 ? 81  PRO C CD  1 
ATOM   7277  N N   . GLU C 1 82  ? -3.619  -0.587  121.579 1.00 16.97 ? 82  GLU C N   1 
ATOM   7278  C CA  . GLU C 1 82  ? -4.588  0.110   122.446 1.00 19.21 ? 82  GLU C CA  1 
ATOM   7279  C C   . GLU C 1 82  ? -4.990  1.534   122.008 1.00 17.59 ? 82  GLU C C   1 
ATOM   7280  O O   . GLU C 1 82  ? -6.129  1.900   122.207 1.00 16.07 ? 82  GLU C O   1 
ATOM   7281  C CB  . GLU C 1 82  ? -4.280  -0.004  123.952 1.00 20.83 ? 82  GLU C CB  1 
ATOM   7282  C CG  . GLU C 1 82  ? -2.953  0.538   124.466 1.00 25.16 ? 82  GLU C CG  1 
ATOM   7283  C CD  . GLU C 1 82  ? -1.762  -0.422  124.337 1.00 27.54 ? 82  GLU C CD  1 
ATOM   7284  O OE1 . GLU C 1 82  ? -1.392  -0.802  123.203 1.00 20.36 ? 82  GLU C OE1 1 
ATOM   7285  O OE2 . GLU C 1 82  ? -1.135  -0.728  125.376 1.00 31.23 ? 82  GLU C OE2 1 
ATOM   7286  N N   . LEU C 1 83  ? -4.091  2.299   121.376 1.00 17.20 ? 83  LEU C N   1 
ATOM   7287  C CA  . LEU C 1 83  ? -4.484  3.606   120.845 1.00 17.40 ? 83  LEU C CA  1 
ATOM   7288  C C   . LEU C 1 83  ? -5.297  3.516   119.559 1.00 17.40 ? 83  LEU C C   1 
ATOM   7289  O O   . LEU C 1 83  ? -6.298  4.254   119.374 1.00 16.89 ? 83  LEU C O   1 
ATOM   7290  C CB  . LEU C 1 83  ? -3.256  4.510   120.636 1.00 16.29 ? 83  LEU C CB  1 
ATOM   7291  C CG  . LEU C 1 83  ? -3.506  5.930   120.192 1.00 18.83 ? 83  LEU C CG  1 
ATOM   7292  C CD1 . LEU C 1 83  ? -4.451  6.616   121.229 1.00 19.22 ? 83  LEU C CD1 1 
ATOM   7293  C CD2 . LEU C 1 83  ? -2.152  6.635   120.074 1.00 17.80 ? 83  LEU C CD2 1 
ATOM   7294  N N   . LEU C 1 84  ? -4.865  2.640   118.668 1.00 18.16 ? 84  LEU C N   1 
ATOM   7295  C CA  . LEU C 1 84  ? -5.663  2.301   117.456 1.00 18.75 ? 84  LEU C CA  1 
ATOM   7296  C C   . LEU C 1 84  ? -7.071  1.874   117.824 1.00 20.17 ? 84  LEU C C   1 
ATOM   7297  O O   . LEU C 1 84  ? -8.014  2.302   117.209 1.00 20.42 ? 84  LEU C O   1 
ATOM   7298  C CB  . LEU C 1 84  ? -5.005  1.188   116.637 1.00 19.52 ? 84  LEU C CB  1 
ATOM   7299  C CG  . LEU C 1 84  ? -3.810  1.601   115.775 1.00 19.35 ? 84  LEU C CG  1 
ATOM   7300  C CD1 . LEU C 1 84  ? -3.145  0.326   115.273 1.00 17.47 ? 84  LEU C CD1 1 
ATOM   7301  C CD2 . LEU C 1 84  ? -4.148  2.647   114.661 1.00 19.66 ? 84  LEU C CD2 1 
ATOM   7302  N N   . SER C 1 85  ? -7.232  0.989   118.818 1.00 20.80 ? 85  SER C N   1 
ATOM   7303  C CA  . SER C 1 85  ? -8.609  0.576   119.067 1.00 20.19 ? 85  SER C CA  1 
ATOM   7304  C C   . SER C 1 85  ? -9.418  1.697   119.724 1.00 19.90 ? 85  SER C C   1 
ATOM   7305  O O   . SER C 1 85  ? -10.606 1.818   119.448 1.00 19.20 ? 85  SER C O   1 
ATOM   7306  C CB  . SER C 1 85  ? -8.710  -0.694  119.888 1.00 20.43 ? 85  SER C CB  1 
ATOM   7307  O OG  . SER C 1 85  ? -8.030  -0.532  121.094 1.00 24.08 ? 85  SER C OG  1 
ATOM   7308  N N   . TRP C 1 86  ? -8.783  2.477   120.607 1.00 17.99 ? 86  TRP C N   1 
ATOM   7309  C CA  . TRP C 1 86  ? -9.485  3.589   121.281 1.00 19.26 ? 86  TRP C CA  1 
ATOM   7310  C C   . TRP C 1 86  ? -9.961  4.607   120.219 1.00 18.86 ? 86  TRP C C   1 
ATOM   7311  O O   . TRP C 1 86  ? -11.108 5.034   120.224 1.00 18.60 ? 86  TRP C O   1 
ATOM   7312  C CB  . TRP C 1 86  ? -8.580  4.269   122.318 1.00 17.25 ? 86  TRP C CB  1 
ATOM   7313  C CG  . TRP C 1 86  ? -9.369  5.148   123.328 1.00 18.15 ? 86  TRP C CG  1 
ATOM   7314  C CD1 . TRP C 1 86  ? -9.816  4.762   124.553 1.00 19.00 ? 86  TRP C CD1 1 
ATOM   7315  C CD2 . TRP C 1 86  ? -9.825  6.514   123.150 1.00 17.40 ? 86  TRP C CD2 1 
ATOM   7316  N NE1 . TRP C 1 86  ? -10.474 5.793   125.165 1.00 20.90 ? 86  TRP C NE1 1 
ATOM   7317  C CE2 . TRP C 1 86  ? -10.520 6.872   124.323 1.00 20.85 ? 86  TRP C CE2 1 
ATOM   7318  C CE3 . TRP C 1 86  ? -9.695  7.460   122.129 1.00 18.92 ? 86  TRP C CE3 1 
ATOM   7319  C CZ2 . TRP C 1 86  ? -11.077 8.157   124.518 1.00 21.89 ? 86  TRP C CZ2 1 
ATOM   7320  C CZ3 . TRP C 1 86  ? -10.265 8.729   122.300 1.00 17.59 ? 86  TRP C CZ3 1 
ATOM   7321  C CH2 . TRP C 1 86  ? -10.945 9.065   123.489 1.00 20.92 ? 86  TRP C CH2 1 
ATOM   7322  N N   . LEU C 1 87  ? -9.079  4.897   119.266 1.00 18.56 ? 87  LEU C N   1 
ATOM   7323  C CA  . LEU C 1 87  ? -9.335  5.864   118.205 1.00 18.86 ? 87  LEU C CA  1 
ATOM   7324  C C   . LEU C 1 87  ? -10.372 5.355   117.197 1.00 18.31 ? 87  LEU C C   1 
ATOM   7325  O O   . LEU C 1 87  ? -11.266 6.096   116.826 1.00 17.24 ? 87  LEU C O   1 
ATOM   7326  C CB  . LEU C 1 87  ? -8.035  6.215   117.490 1.00 19.62 ? 87  LEU C CB  1 
ATOM   7327  C CG  . LEU C 1 87  ? -7.220  7.464   117.849 1.00 22.63 ? 87  LEU C CG  1 
ATOM   7328  C CD1 . LEU C 1 87  ? -7.584  8.301   119.116 1.00 22.96 ? 87  LEU C CD1 1 
ATOM   7329  C CD2 . LEU C 1 87  ? -5.668  7.311   117.672 1.00 18.26 ? 87  LEU C CD2 1 
ATOM   7330  N N   . LYS C 1 88  ? -10.293 4.065   116.832 1.00 17.55 ? 88  LYS C N   1 
ATOM   7331  C CA  . LYS C 1 88  ? -11.309 3.482   115.988 1.00 18.17 ? 88  LYS C CA  1 
ATOM   7332  C C   . LYS C 1 88  ? -12.675 3.561   116.652 1.00 19.10 ? 88  LYS C C   1 
ATOM   7333  O O   . LYS C 1 88  ? -13.661 3.903   115.992 1.00 19.96 ? 88  LYS C O   1 
ATOM   7334  C CB  . LYS C 1 88  ? -10.957 2.058   115.581 1.00 17.55 ? 88  LYS C CB  1 
ATOM   7335  C CG  . LYS C 1 88  ? -9.936  1.998   114.471 1.00 17.84 ? 88  LYS C CG  1 
ATOM   7336  C CD  . LYS C 1 88  ? -9.565  0.579   114.166 1.00 22.10 ? 88  LYS C CD  1 
ATOM   7337  C CE  . LYS C 1 88  ? -8.550  0.553   112.973 1.00 21.12 ? 88  LYS C CE  1 
ATOM   7338  N NZ  . LYS C 1 88  ? -8.195  -0.863  112.781 1.00 23.94 ? 88  LYS C NZ  1 
ATOM   7339  N N   . GLN C 1 89  ? -12.744 3.290   117.956 1.00 19.31 ? 89  GLN C N   1 
ATOM   7340  C CA  . GLN C 1 89  ? -14.046 3.350   118.634 1.00 20.83 ? 89  GLN C CA  1 
ATOM   7341  C C   . GLN C 1 89  ? -14.577 4.768   118.810 1.00 20.25 ? 89  GLN C C   1 
ATOM   7342  O O   . GLN C 1 89  ? -15.776 4.951   118.881 1.00 19.73 ? 89  GLN C O   1 
ATOM   7343  C CB  . GLN C 1 89  ? -13.975 2.698   120.020 1.00 22.22 ? 89  GLN C CB  1 
ATOM   7344  C CG  . GLN C 1 89  ? -15.351 2.551   120.668 1.00 27.09 ? 89  GLN C CG  1 
ATOM   7345  C CD  . GLN C 1 89  ? -16.315 1.778   119.750 1.00 33.25 ? 89  GLN C CD  1 
ATOM   7346  O OE1 . GLN C 1 89  ? -17.389 2.292   119.386 1.00 33.87 ? 89  GLN C OE1 1 
ATOM   7347  N NE2 . GLN C 1 89  ? -15.887 0.558   119.314 1.00 30.32 ? 89  GLN C NE2 1 
ATOM   7348  N N   . LEU C 1 90  ? -13.683 5.741   118.981 1.00 19.63 ? 90  LEU C N   1 
ATOM   7349  C CA  . LEU C 1 90  ? -14.051 7.150   118.955 1.00 19.37 ? 90  LEU C CA  1 
ATOM   7350  C C   . LEU C 1 90  ? -14.682 7.541   117.619 1.00 20.25 ? 90  LEU C C   1 
ATOM   7351  O O   . LEU C 1 90  ? -15.719 8.246   117.582 1.00 19.79 ? 90  LEU C O   1 
ATOM   7352  C CB  . LEU C 1 90  ? -12.812 8.032   119.205 1.00 20.70 ? 90  LEU C CB  1 
ATOM   7353  C CG  . LEU C 1 90  ? -13.085 9.546   119.416 1.00 20.86 ? 90  LEU C CG  1 
ATOM   7354  C CD1 . LEU C 1 90  ? -13.712 9.765   120.824 1.00 20.23 ? 90  LEU C CD1 1 
ATOM   7355  C CD2 . LEU C 1 90  ? -11.792 10.327  119.241 1.00 22.98 ? 90  LEU C CD2 1 
ATOM   7356  N N   . GLN C 1 91  ? -14.062 7.104   116.522 1.00 20.04 ? 91  GLN C N   1 
ATOM   7357  C CA  . GLN C 1 91  ? -14.557 7.448   115.205 1.00 20.88 ? 91  GLN C CA  1 
ATOM   7358  C C   . GLN C 1 91  ? -15.963 6.896   115.002 1.00 21.34 ? 91  GLN C C   1 
ATOM   7359  O O   . GLN C 1 91  ? -16.843 7.590   114.501 1.00 22.08 ? 91  GLN C O   1 
ATOM   7360  C CB  . GLN C 1 91  ? -13.603 6.987   114.091 1.00 20.58 ? 91  GLN C CB  1 
ATOM   7361  C CG  . GLN C 1 91  ? -12.208 7.575   114.183 1.00 20.84 ? 91  GLN C CG  1 
ATOM   7362  C CD  . GLN C 1 91  ? -12.118 9.092   113.971 1.00 22.14 ? 91  GLN C CD  1 
ATOM   7363  O OE1 . GLN C 1 91  ? -11.477 9.561   112.994 1.00 26.58 ? 91  GLN C OE1 1 
ATOM   7364  N NE2 . GLN C 1 91  ? -12.682 9.861   114.886 1.00 17.24 ? 91  GLN C NE2 1 
ATOM   7365  N N   . ILE C 1 92  ? -16.159 5.651   115.391 1.00 23.15 ? 92  ILE C N   1 
ATOM   7366  C CA  . ILE C 1 92  ? -17.476 5.018   115.344 1.00 24.95 ? 92  ILE C CA  1 
ATOM   7367  C C   . ILE C 1 92  ? -18.468 5.807   116.169 1.00 26.25 ? 92  ILE C C   1 
ATOM   7368  O O   . ILE C 1 92  ? -19.558 6.085   115.685 1.00 27.97 ? 92  ILE C O   1 
ATOM   7369  C CB  . ILE C 1 92  ? -17.433 3.514   115.762 1.00 24.77 ? 92  ILE C CB  1 
ATOM   7370  C CG1 . ILE C 1 92  ? -16.524 2.750   114.792 1.00 25.00 ? 92  ILE C CG1 1 
ATOM   7371  C CG2 . ILE C 1 92  ? -18.885 2.896   115.852 1.00 26.91 ? 92  ILE C CG2 1 
ATOM   7372  C CD1 . ILE C 1 92  ? -16.541 1.221   114.927 1.00 26.55 ? 92  ILE C CD1 1 
ATOM   7373  N N   . LYS C 1 93  ? -18.086 6.225   117.377 1.00 27.10 ? 93  LYS C N   1 
ATOM   7374  C CA  . LYS C 1 93  ? -19.020 6.959   118.237 1.00 28.69 ? 93  LYS C CA  1 
ATOM   7375  C C   . LYS C 1 93  ? -19.380 8.319   117.684 1.00 27.68 ? 93  LYS C C   1 
ATOM   7376  O O   . LYS C 1 93  ? -20.539 8.705   117.757 1.00 27.80 ? 93  LYS C O   1 
ATOM   7377  C CB  . LYS C 1 93  ? -18.493 7.125   119.685 1.00 29.44 ? 93  LYS C CB  1 
ATOM   7378  C CG  . LYS C 1 93  ? -18.211 5.783   120.410 1.00 36.40 ? 93  LYS C CG  1 
ATOM   7379  C CD  . LYS C 1 93  ? -19.206 5.506   121.534 1.00 42.06 ? 93  LYS C CD  1 
ATOM   7380  C CE  . LYS C 1 93  ? -19.155 4.037   121.918 1.00 45.28 ? 93  LYS C CE  1 
ATOM   7381  N NZ  . LYS C 1 93  ? -18.296 3.752   123.120 1.00 45.47 ? 93  LYS C NZ  1 
ATOM   7382  N N   . LEU C 1 94  ? -18.387 9.043   117.162 1.00 26.37 ? 94  LEU C N   1 
ATOM   7383  C CA  . LEU C 1 94  ? -18.536 10.445  116.760 1.00 26.59 ? 94  LEU C CA  1 
ATOM   7384  C C   . LEU C 1 94  ? -19.112 10.652  115.367 1.00 26.46 ? 94  LEU C C   1 
ATOM   7385  O O   . LEU C 1 94  ? -19.744 11.686  115.096 1.00 27.31 ? 94  LEU C O   1 
ATOM   7386  C CB  . LEU C 1 94  ? -17.177 11.158  116.825 1.00 26.02 ? 94  LEU C CB  1 
ATOM   7387  C CG  . LEU C 1 94  ? -16.743 11.891  118.111 1.00 27.88 ? 94  LEU C CG  1 
ATOM   7388  C CD1 . LEU C 1 94  ? -17.426 11.403  119.378 1.00 29.70 ? 94  LEU C CD1 1 
ATOM   7389  C CD2 . LEU C 1 94  ? -15.230 12.000  118.238 1.00 28.45 ? 94  LEU C CD2 1 
ATOM   7390  N N   . HIS C 1 95  ? -18.842 9.696   114.488 1.00 25.48 ? 95  HIS C N   1 
ATOM   7391  C CA  . HIS C 1 95  ? -19.104 9.821   113.047 1.00 24.80 ? 95  HIS C CA  1 
ATOM   7392  C C   . HIS C 1 95  ? -19.801 8.617   112.490 1.00 24.62 ? 95  HIS C C   1 
ATOM   7393  O O   . HIS C 1 95  ? -20.293 8.662   111.372 1.00 25.94 ? 95  HIS C O   1 
ATOM   7394  C CB  . HIS C 1 95  ? -17.785 10.014  112.258 1.00 23.31 ? 95  HIS C CB  1 
ATOM   7395  C CG  . HIS C 1 95  ? -16.893 11.072  112.829 1.00 18.91 ? 95  HIS C CG  1 
ATOM   7396  N ND1 . HIS C 1 95  ? -15.620 10.796  113.322 1.00 21.82 ? 95  HIS C ND1 1 
ATOM   7397  C CD2 . HIS C 1 95  ? -17.081 12.397  113.005 1.00 17.61 ? 95  HIS C CD2 1 
ATOM   7398  C CE1 . HIS C 1 95  ? -15.068 11.913  113.760 1.00 16.20 ? 95  HIS C CE1 1 
ATOM   7399  N NE2 . HIS C 1 95  ? -15.945 12.888  113.624 1.00 22.16 ? 95  HIS C NE2 1 
ATOM   7400  N N   . ASN C 1 96  ? -19.858 7.533   113.254 1.00 24.82 ? 96  ASN C N   1 
ATOM   7401  C CA  . ASN C 1 96  ? -20.431 6.281   112.765 1.00 24.43 ? 96  ASN C CA  1 
ATOM   7402  C C   . ASN C 1 96  ? -20.278 6.110   111.261 1.00 24.42 ? 96  ASN C C   1 
ATOM   7403  O O   . ASN C 1 96  ? -21.301 6.151   110.518 1.00 24.64 ? 96  ASN C O   1 
ATOM   7404  C CB  . ASN C 1 96  ? -21.928 6.201   113.159 1.00 25.75 ? 96  ASN C CB  1 
ATOM   7405  C CG  . ASN C 1 96  ? -22.519 4.824   112.926 1.00 28.58 ? 96  ASN C CG  1 
ATOM   7406  O OD1 . ASN C 1 96  ? -23.690 4.687   112.608 1.00 33.12 ? 96  ASN C OD1 1 
ATOM   7407  N ND2 . ASN C 1 96  ? -21.709 3.798   113.088 1.00 31.06 ? 96  ASN C ND2 1 
ATOM   7408  N N   . PRO C 1 97  ? -19.026 5.925   110.777 1.00 23.44 ? 97  PRO C N   1 
ATOM   7409  C CA  . PRO C 1 97  ? -18.857 5.870   109.297 1.00 21.98 ? 97  PRO C CA  1 
ATOM   7410  C C   . PRO C 1 97  ? -19.599 4.723   108.634 1.00 22.69 ? 97  PRO C C   1 
ATOM   7411  O O   . PRO C 1 97  ? -19.471 3.556   109.080 1.00 23.57 ? 97  PRO C O   1 
ATOM   7412  C CB  . PRO C 1 97  ? -17.338 5.671   109.110 1.00 21.73 ? 97  PRO C CB  1 
ATOM   7413  C CG  . PRO C 1 97  ? -16.713 6.097   110.455 1.00 20.85 ? 97  PRO C CG  1 
ATOM   7414  C CD  . PRO C 1 97  ? -17.734 5.752   111.506 1.00 22.22 ? 97  PRO C CD  1 
ATOM   7415  N N   . PRO C 1 98  ? -20.346 5.009   107.537 1.00 21.80 ? 98  PRO C N   1 
ATOM   7416  C CA  . PRO C 1 98  ? -21.135 3.953   106.888 1.00 21.95 ? 98  PRO C CA  1 
ATOM   7417  C C   . PRO C 1 98  ? -20.263 2.819   106.401 1.00 22.43 ? 98  PRO C C   1 
ATOM   7418  O O   . PRO C 1 98  ? -20.758 1.718   106.096 1.00 22.93 ? 98  PRO C O   1 
ATOM   7419  C CB  . PRO C 1 98  ? -21.735 4.675   105.662 1.00 22.31 ? 98  PRO C CB  1 
ATOM   7420  C CG  . PRO C 1 98  ? -21.811 6.058   106.079 1.00 21.06 ? 98  PRO C CG  1 
ATOM   7421  C CD  . PRO C 1 98  ? -20.479 6.269   106.799 1.00 20.67 ? 98  PRO C CD  1 
ATOM   7422  N N   . THR C 1 99  ? -18.963 3.060   106.392 1.00 21.78 ? 99  THR C N   1 
ATOM   7423  C CA  . THR C 1 99  ? -18.002 2.142   105.807 1.00 23.23 ? 99  THR C CA  1 
ATOM   7424  C C   . THR C 1 99  ? -17.400 1.100   106.775 1.00 22.96 ? 99  THR C C   1 
ATOM   7425  O O   . THR C 1 99  ? -16.615 0.228   106.369 1.00 22.58 ? 99  THR C O   1 
ATOM   7426  C CB  . THR C 1 99  ? -16.912 2.993   105.219 1.00 24.10 ? 99  THR C CB  1 
ATOM   7427  O OG1 . THR C 1 99  ? -16.265 2.274   104.167 1.00 31.74 ? 99  THR C OG1 1 
ATOM   7428  C CG2 . THR C 1 99  ? -15.950 3.457   106.342 1.00 19.89 ? 99  THR C CG2 1 
ATOM   7429  N N   . ILE C 1 100 ? -17.778 1.174   108.043 1.00 21.95 ? 100 ILE C N   1 
ATOM   7430  C CA  . ILE C 1 100 ? -17.145 0.320   109.073 1.00 22.49 ? 100 ILE C CA  1 
ATOM   7431  C C   . ILE C 1 100 ? -17.172 -1.224  108.849 1.00 23.19 ? 100 ILE C C   1 
ATOM   7432  O O   . ILE C 1 100 ? -16.263 -1.915  109.276 1.00 22.95 ? 100 ILE C O   1 
ATOM   7433  C CB  . ILE C 1 100 ? -17.609 0.714   110.506 1.00 22.51 ? 100 ILE C CB  1 
ATOM   7434  C CG1 . ILE C 1 100 ? -19.134 0.514   110.687 1.00 22.93 ? 100 ILE C CG1 1 
ATOM   7435  C CG2 . ILE C 1 100 ? -17.125 2.183   110.829 1.00 23.26 ? 100 ILE C CG2 1 
ATOM   7436  C CD1 . ILE C 1 100 ? -19.656 0.635   112.183 1.00 26.15 ? 100 ILE C CD1 1 
ATOM   7437  N N   . HIS C 1 101 ? -18.202 -1.769  108.186 1.00 24.88 ? 101 HIS C N   1 
ATOM   7438  C CA  . HIS C 1 101 ? -18.307 -3.238  108.019 1.00 25.51 ? 101 HIS C CA  1 
ATOM   7439  C C   . HIS C 1 101 ? -18.294 -3.650  106.527 1.00 26.41 ? 101 HIS C C   1 
ATOM   7440  O O   . HIS C 1 101 ? -18.642 -4.776  106.176 1.00 24.13 ? 101 HIS C O   1 
ATOM   7441  C CB  . HIS C 1 101 ? -19.524 -3.807  108.792 1.00 26.66 ? 101 HIS C CB  1 
ATOM   7442  C CG  . HIS C 1 101 ? -19.431 -3.629  110.288 1.00 27.86 ? 101 HIS C CG  1 
ATOM   7443  N ND1 . HIS C 1 101 ? -20.440 -3.070  111.052 1.00 29.17 ? 101 HIS C ND1 1 
ATOM   7444  C CD2 . HIS C 1 101 ? -18.411 -3.865  111.143 1.00 27.26 ? 101 HIS C CD2 1 
ATOM   7445  C CE1 . HIS C 1 101 ? -20.054 -3.000  112.313 1.00 27.86 ? 101 HIS C CE1 1 
ATOM   7446  N NE2 . HIS C 1 101 ? -18.824 -3.478  112.394 1.00 28.35 ? 101 HIS C NE2 1 
ATOM   7447  N N   . TYR C 1 102 ? -17.899 -2.727  105.655 1.00 26.49 ? 102 TYR C N   1 
ATOM   7448  C CA  . TYR C 1 102 ? -17.662 -3.069  104.254 1.00 27.47 ? 102 TYR C CA  1 
ATOM   7449  C C   . TYR C 1 102 ? -16.498 -4.033  104.194 1.00 28.63 ? 102 TYR C C   1 
ATOM   7450  O O   . TYR C 1 102 ? -15.641 -4.010  105.079 1.00 27.96 ? 102 TYR C O   1 
ATOM   7451  C CB  . TYR C 1 102 ? -17.286 -1.838  103.445 1.00 26.38 ? 102 TYR C CB  1 
ATOM   7452  C CG  . TYR C 1 102 ? -18.384 -0.848  103.185 1.00 26.56 ? 102 TYR C CG  1 
ATOM   7453  C CD1 . TYR C 1 102 ? -18.172 0.192   102.294 1.00 26.12 ? 102 TYR C CD1 1 
ATOM   7454  C CD2 . TYR C 1 102 ? -19.654 -0.947  103.810 1.00 28.34 ? 102 TYR C CD2 1 
ATOM   7455  C CE1 . TYR C 1 102 ? -19.141 1.101   102.027 1.00 25.30 ? 102 TYR C CE1 1 
ATOM   7456  C CE2 . TYR C 1 102 ? -20.655 -0.021  103.537 1.00 27.08 ? 102 TYR C CE2 1 
ATOM   7457  C CZ  . TYR C 1 102 ? -20.373 1.001   102.639 1.00 25.35 ? 102 TYR C CZ  1 
ATOM   7458  O OH  . TYR C 1 102 ? -21.303 1.951   102.337 1.00 24.21 ? 102 TYR C OH  1 
ATOM   7459  N N   . PRO C 1 103 ? -16.462 -4.899  103.156 1.00 29.47 ? 103 PRO C N   1 
ATOM   7460  C CA  . PRO C 1 103 ? -15.231 -5.662  102.910 1.00 29.43 ? 103 PRO C CA  1 
ATOM   7461  C C   . PRO C 1 103 ? -14.006 -4.723  102.748 1.00 28.97 ? 103 PRO C C   1 
ATOM   7462  O O   . PRO C 1 103 ? -14.169 -3.578  102.293 1.00 27.63 ? 103 PRO C O   1 
ATOM   7463  C CB  . PRO C 1 103 ? -15.519 -6.385  101.596 1.00 29.76 ? 103 PRO C CB  1 
ATOM   7464  C CG  . PRO C 1 103 ? -17.040 -6.511  101.552 1.00 29.98 ? 103 PRO C CG  1 
ATOM   7465  C CD  . PRO C 1 103 ? -17.525 -5.207  102.164 1.00 30.80 ? 103 PRO C CD  1 
ATOM   7466  N N   . PRO C 1 104 ? -12.796 -5.198  103.116 1.00 28.08 ? 104 PRO C N   1 
ATOM   7467  C CA  . PRO C 1 104 ? -11.605 -4.366  102.951 1.00 28.46 ? 104 PRO C CA  1 
ATOM   7468  C C   . PRO C 1 104 ? -11.452 -3.744  101.573 1.00 28.21 ? 104 PRO C C   1 
ATOM   7469  O O   . PRO C 1 104 ? -11.239 -2.535  101.474 1.00 26.67 ? 104 PRO C O   1 
ATOM   7470  C CB  . PRO C 1 104 ? -10.441 -5.337  103.244 1.00 29.09 ? 104 PRO C CB  1 
ATOM   7471  C CG  . PRO C 1 104 ? -10.999 -6.282  104.223 1.00 28.12 ? 104 PRO C CG  1 
ATOM   7472  C CD  . PRO C 1 104 ? -12.456 -6.497  103.735 1.00 29.21 ? 104 PRO C CD  1 
ATOM   7473  N N   . SER C 1 105 ? -11.579 -4.548  100.516 1.00 27.99 ? 105 SER C N   1 
ATOM   7474  C CA  . SER C 1 105 ? -11.265 -4.094  99.154  1.00 27.91 ? 105 SER C CA  1 
ATOM   7475  C C   . SER C 1 105 ? -12.226 -3.027  98.690  1.00 27.41 ? 105 SER C C   1 
ATOM   7476  O O   . SER C 1 105 ? -11.912 -2.310  97.753  1.00 28.71 ? 105 SER C O   1 
ATOM   7477  C CB  . SER C 1 105 ? -11.329 -5.269  98.165  1.00 28.39 ? 105 SER C CB  1 
ATOM   7478  O OG  . SER C 1 105 ? -12.660 -5.756  98.133  1.00 30.56 ? 105 SER C OG  1 
ATOM   7479  N N   . GLN C 1 106 ? -13.381 -2.930  99.355  1.00 26.41 ? 106 GLN C N   1 
ATOM   7480  C CA  . GLN C 1 106 ? -14.407 -1.934  99.078  1.00 26.58 ? 106 GLN C CA  1 
ATOM   7481  C C   . GLN C 1 106 ? -14.322 -0.755  100.045 1.00 25.77 ? 106 GLN C C   1 
ATOM   7482  O O   . GLN C 1 106 ? -15.299 -0.037  100.220 1.00 27.25 ? 106 GLN C O   1 
ATOM   7483  C CB  . GLN C 1 106 ? -15.798 -2.553  99.192  1.00 26.53 ? 106 GLN C CB  1 
ATOM   7484  C CG  . GLN C 1 106 ? -15.994 -3.699  98.181  1.00 30.23 ? 106 GLN C CG  1 
ATOM   7485  C CD  . GLN C 1 106 ? -17.319 -4.418  98.305  1.00 33.56 ? 106 GLN C CD  1 
ATOM   7486  O OE1 . GLN C 1 106 ? -18.162 -4.103  99.166  1.00 35.18 ? 106 GLN C OE1 1 
ATOM   7487  N NE2 . GLN C 1 106 ? -17.514 -5.410  97.432  1.00 37.44 ? 106 GLN C NE2 1 
ATOM   7488  N N   . GLY C 1 107 ? -13.183 -0.578  100.718 1.00 25.20 ? 107 GLY C N   1 
ATOM   7489  C CA  . GLY C 1 107 ? -12.990 0.649   101.507 1.00 25.03 ? 107 GLY C CA  1 
ATOM   7490  C C   . GLY C 1 107 ? -13.446 0.642   102.949 1.00 24.65 ? 107 GLY C C   1 
ATOM   7491  O O   . GLY C 1 107 ? -13.780 1.717   103.511 1.00 24.35 ? 107 GLY C O   1 
ATOM   7492  N N   . GLN C 1 108 ? -13.428 -0.546  103.566 1.00 23.40 ? 108 GLN C N   1 
ATOM   7493  C CA  . GLN C 1 108 ? -13.722 -0.651  105.021 1.00 23.78 ? 108 GLN C CA  1 
ATOM   7494  C C   . GLN C 1 108 ? -12.886 0.388   105.787 1.00 22.99 ? 108 GLN C C   1 
ATOM   7495  O O   . GLN C 1 108 ? -11.714 0.595   105.458 1.00 23.96 ? 108 GLN C O   1 
ATOM   7496  C CB  . GLN C 1 108 ? -13.420 -2.034  105.575 1.00 22.48 ? 108 GLN C CB  1 
ATOM   7497  C CG  . GLN C 1 108 ? -13.817 -2.186  107.036 1.00 24.45 ? 108 GLN C CG  1 
ATOM   7498  C CD  . GLN C 1 108 ? -13.608 -3.579  107.609 1.00 29.43 ? 108 GLN C CD  1 
ATOM   7499  O OE1 . GLN C 1 108 ? -14.297 -3.980  108.575 1.00 35.62 ? 108 GLN C OE1 1 
ATOM   7500  N NE2 . GLN C 1 108 ? -12.666 -4.302  107.075 1.00 22.30 ? 108 GLN C NE2 1 
ATOM   7501  N N   . MET C 1 109 ? -13.487 1.029   106.790 1.00 21.80 ? 109 MET C N   1 
ATOM   7502  C CA  . MET C 1 109 ? -12.803 2.079   107.553 1.00 21.05 ? 109 MET C CA  1 
ATOM   7503  C C   . MET C 1 109 ? -11.569 1.456   108.189 1.00 20.67 ? 109 MET C C   1 
ATOM   7504  O O   . MET C 1 109 ? -11.651 0.366   108.766 1.00 19.10 ? 109 MET C O   1 
ATOM   7505  C CB  . MET C 1 109 ? -13.667 2.620   108.664 1.00 19.21 ? 109 MET C CB  1 
ATOM   7506  C CG  . MET C 1 109 ? -13.009 3.828   109.424 1.00 24.14 ? 109 MET C CG  1 
ATOM   7507  S SD  . MET C 1 109 ? -13.881 4.234   110.959 1.00 27.46 ? 109 MET C SD  1 
ATOM   7508  C CE  . MET C 1 109 ? -13.396 2.903   112.048 1.00 26.85 ? 109 MET C CE  1 
ATOM   7509  N N   . ASP C 1 110 ? -10.442 2.135   108.011 1.00 19.78 ? 110 ASP C N   1 
ATOM   7510  C CA  . ASP C 1 110 ? -9.197  1.781   108.670 1.00 20.27 ? 110 ASP C CA  1 
ATOM   7511  C C   . ASP C 1 110 ? -8.647  3.079   109.221 1.00 20.09 ? 110 ASP C C   1 
ATOM   7512  O O   . ASP C 1 110 ? -9.152  4.159   108.858 1.00 21.03 ? 110 ASP C O   1 
ATOM   7513  C CB  . ASP C 1 110 ? -8.191  1.096   107.718 1.00 20.82 ? 110 ASP C CB  1 
ATOM   7514  C CG  . ASP C 1 110 ? -7.204  0.186   108.475 1.00 23.09 ? 110 ASP C CG  1 
ATOM   7515  O OD1 . ASP C 1 110 ? -7.223  0.188   109.746 1.00 24.77 ? 110 ASP C OD1 1 
ATOM   7516  O OD2 . ASP C 1 110 ? -6.400  -0.521  107.823 1.00 26.19 ? 110 ASP C OD2 1 
ATOM   7517  N N   . LEU C 1 111 ? -7.679  2.975   110.132 1.00 19.12 ? 111 LEU C N   1 
ATOM   7518  C CA  . LEU C 1 111 ? -7.127  4.127   110.835 1.00 18.79 ? 111 LEU C CA  1 
ATOM   7519  C C   . LEU C 1 111 ? -5.649  3.862   111.138 1.00 19.30 ? 111 LEU C C   1 
ATOM   7520  O O   . LEU C 1 111 ? -5.263  2.745   111.550 1.00 17.67 ? 111 LEU C O   1 
ATOM   7521  C CB  . LEU C 1 111 ? -7.917  4.397   112.144 1.00 17.96 ? 111 LEU C CB  1 
ATOM   7522  C CG  . LEU C 1 111 ? -7.614  5.668   112.964 1.00 18.03 ? 111 LEU C CG  1 
ATOM   7523  C CD1 . LEU C 1 111 ? -8.862  6.069   113.752 1.00 15.82 ? 111 LEU C CD1 1 
ATOM   7524  C CD2 . LEU C 1 111 ? -6.408  5.500   113.926 1.00 16.30 ? 111 LEU C CD2 1 
ATOM   7525  N N   . CYS C 1 112 ? -4.799  4.873   110.943 1.00 19.66 ? 112 CYS C N   1 
ATOM   7526  C CA  . CYS C 1 112 ? -3.441  4.740   111.476 1.00 20.45 ? 112 CYS C CA  1 
ATOM   7527  C C   . CYS C 1 112 ? -3.059  5.991   112.258 1.00 20.47 ? 112 CYS C C   1 
ATOM   7528  O O   . CYS C 1 112 ? -3.484  7.099   111.938 1.00 21.09 ? 112 CYS C O   1 
ATOM   7529  C CB  . CYS C 1 112 ? -2.419  4.418   110.365 1.00 21.45 ? 112 CYS C CB  1 
ATOM   7530  S SG  . CYS C 1 112 ? -2.435  5.613   109.113 1.00 27.17 ? 112 CYS C SG  1 
ATOM   7531  N N   . VAL C 1 113 ? -2.309  5.783   113.324 1.00 20.55 ? 113 VAL C N   1 
ATOM   7532  C CA  . VAL C 1 113 ? -1.705  6.853   114.089 1.00 19.54 ? 113 VAL C CA  1 
ATOM   7533  C C   . VAL C 1 113 ? -0.558  7.368   113.185 1.00 19.19 ? 113 VAL C C   1 
ATOM   7534  O O   . VAL C 1 113 ? 0.156   6.559   112.586 1.00 19.20 ? 113 VAL C O   1 
ATOM   7535  C CB  . VAL C 1 113 ? -1.100  6.305   115.416 1.00 19.40 ? 113 VAL C CB  1 
ATOM   7536  C CG1 . VAL C 1 113 ? -0.435  7.428   116.277 1.00 17.67 ? 113 VAL C CG1 1 
ATOM   7537  C CG2 . VAL C 1 113 ? -2.172  5.481   116.235 1.00 19.94 ? 113 VAL C CG2 1 
ATOM   7538  N N   . THR C 1 114 ? -0.390  8.691   113.123 1.00 17.93 ? 114 THR C N   1 
ATOM   7539  C CA  . THR C 1 114 ? 0.679   9.333   112.361 1.00 18.96 ? 114 THR C CA  1 
ATOM   7540  C C   . THR C 1 114 ? 1.477   10.295  113.277 1.00 19.68 ? 114 THR C C   1 
ATOM   7541  O O   . THR C 1 114 ? 1.043   10.623  114.391 1.00 19.50 ? 114 THR C O   1 
ATOM   7542  C CB  . THR C 1 114 ? 0.087   10.146  111.174 1.00 19.39 ? 114 THR C CB  1 
ATOM   7543  O OG1 . THR C 1 114 ? -0.797  11.114  111.719 1.00 19.60 ? 114 THR C OG1 1 
ATOM   7544  C CG2 . THR C 1 114 ? -0.720  9.236   110.218 1.00 17.19 ? 114 THR C CG2 1 
ATOM   7545  N N   . SER C 1 115 ? 2.637   10.727  112.809 1.00 19.47 ? 115 SER C N   1 
ATOM   7546  C CA  . SER C 1 115 ? 3.502   11.568  113.623 1.00 19.72 ? 115 SER C CA  1 
ATOM   7547  C C   . SER C 1 115 ? 3.067   12.990  113.374 1.00 19.59 ? 115 SER C C   1 
ATOM   7548  O O   . SER C 1 115 ? 3.760   13.758  112.696 1.00 19.50 ? 115 SER C O   1 
ATOM   7549  C CB  . SER C 1 115 ? 4.997   11.314  113.321 1.00 18.58 ? 115 SER C CB  1 
ATOM   7550  O OG  . SER C 1 115 ? 5.354   9.958   113.676 1.00 22.25 ? 115 SER C OG  1 
ATOM   7551  N N   . GLY C 1 116 ? 1.915   13.340  113.957 1.00 18.81 ? 116 GLY C N   1 
ATOM   7552  C CA  . GLY C 1 116 ? 1.193   14.578  113.636 1.00 19.84 ? 116 GLY C CA  1 
ATOM   7553  C C   . GLY C 1 116 ? 0.204   14.329  112.530 1.00 19.78 ? 116 GLY C C   1 
ATOM   7554  O O   . GLY C 1 116 ? 0.437   13.435  111.701 1.00 20.19 ? 116 GLY C O   1 
ATOM   7555  N N   . SER C 1 117 ? -0.852  15.139  112.433 1.00 19.54 ? 117 SER C N   1 
ATOM   7556  C CA  . SER C 1 117 ? -1.788  14.986  111.318 1.00 19.67 ? 117 SER C CA  1 
ATOM   7557  C C   . SER C 1 117 ? -1.139  15.322  109.972 1.00 19.77 ? 117 SER C C   1 
ATOM   7558  O O   . SER C 1 117 ? -1.497  14.775  108.933 1.00 19.38 ? 117 SER C O   1 
ATOM   7559  C CB  . SER C 1 117 ? -3.087  15.767  111.524 1.00 20.33 ? 117 SER C CB  1 
ATOM   7560  O OG  . SER C 1 117 ? -2.924  17.176  111.331 1.00 20.55 ? 117 SER C OG  1 
ATOM   7561  N N   . GLN C 1 118 ? -0.176  16.224  109.994 1.00 19.30 ? 118 GLN C N   1 
ATOM   7562  C CA  . GLN C 1 118 ? 0.386   16.708  108.759 1.00 19.29 ? 118 GLN C CA  1 
ATOM   7563  C C   . GLN C 1 118 ? 1.136   15.547  108.059 1.00 19.11 ? 118 GLN C C   1 
ATOM   7564  O O   . GLN C 1 118 ? 1.282   15.548  106.842 1.00 18.46 ? 118 GLN C O   1 
ATOM   7565  C CB  . GLN C 1 118 ? 1.344   17.837  109.069 1.00 19.50 ? 118 GLN C CB  1 
ATOM   7566  C CG  . GLN C 1 118 ? 2.003   18.429  107.841 1.00 24.75 ? 118 GLN C CG  1 
ATOM   7567  C CD  . GLN C 1 118 ? 1.273   19.640  107.420 1.00 30.80 ? 118 GLN C CD  1 
ATOM   7568  O OE1 . GLN C 1 118 ? 0.683   19.649  106.352 1.00 37.00 ? 118 GLN C OE1 1 
ATOM   7569  N NE2 . GLN C 1 118 ? 1.257   20.673  108.284 1.00 32.74 ? 118 GLN C NE2 1 
ATOM   7570  N N   . GLN C 1 119 ? 1.621   14.574  108.834 1.00 19.29 ? 119 GLN C N   1 
ATOM   7571  C CA  . GLN C 1 119 ? 2.325   13.455  108.233 1.00 20.45 ? 119 GLN C CA  1 
ATOM   7572  C C   . GLN C 1 119 ? 1.374   12.608  107.415 1.00 20.20 ? 119 GLN C C   1 
ATOM   7573  O O   . GLN C 1 119 ? 1.728   12.226  106.290 1.00 21.51 ? 119 GLN C O   1 
ATOM   7574  C CB  . GLN C 1 119 ? 3.088   12.570  109.232 1.00 19.79 ? 119 GLN C CB  1 
ATOM   7575  C CG  . GLN C 1 119 ? 3.936   11.540  108.485 1.00 20.01 ? 119 GLN C CG  1 
ATOM   7576  C CD  . GLN C 1 119 ? 4.419   10.385  109.339 1.00 19.82 ? 119 GLN C CD  1 
ATOM   7577  O OE1 . GLN C 1 119 ? 3.724   9.903   110.224 1.00 17.36 ? 119 GLN C OE1 1 
ATOM   7578  N NE2 . GLN C 1 119 ? 5.624   9.946   109.077 1.00 18.35 ? 119 GLN C NE2 1 
ATOM   7579  N N   . GLY C 1 120 ? 0.202   12.298  107.979 1.00 19.31 ? 120 GLY C N   1 
ATOM   7580  C CA  . GLY C 1 120 ? -0.898  11.646  107.240 1.00 19.91 ? 120 GLY C CA  1 
ATOM   7581  C C   . GLY C 1 120 ? -1.224  12.377  105.945 1.00 19.51 ? 120 GLY C C   1 
ATOM   7582  O O   . GLY C 1 120 ? -1.223  11.777  104.878 1.00 19.08 ? 120 GLY C O   1 
ATOM   7583  N N   . LEU C 1 121 ? -1.466  13.680  106.038 1.00 19.62 ? 121 LEU C N   1 
ATOM   7584  C CA  . LEU C 1 121 ? -1.835  14.469  104.874 1.00 20.01 ? 121 LEU C CA  1 
ATOM   7585  C C   . LEU C 1 121 ? -0.768  14.433  103.778 1.00 20.24 ? 121 LEU C C   1 
ATOM   7586  O O   . LEU C 1 121 ? -1.080  14.213  102.594 1.00 17.45 ? 121 LEU C O   1 
ATOM   7587  C CB  . LEU C 1 121 ? -2.092  15.928  105.255 1.00 21.93 ? 121 LEU C CB  1 
ATOM   7588  C CG  . LEU C 1 121 ? -3.360  16.154  106.052 1.00 24.63 ? 121 LEU C CG  1 
ATOM   7589  C CD1 . LEU C 1 121 ? -3.224  17.509  106.677 1.00 28.65 ? 121 LEU C CD1 1 
ATOM   7590  C CD2 . LEU C 1 121 ? -4.536  16.084  105.127 1.00 29.30 ? 121 LEU C CD2 1 
ATOM   7591  N N   . CYS C 1 122 ? 0.476   14.679  104.180 1.00 19.20 ? 122 CYS C N   1 
ATOM   7592  C CA  . CYS C 1 122 ? 1.574   14.655  103.249 1.00 19.51 ? 122 CYS C CA  1 
ATOM   7593  C C   . CYS C 1 122 ? 1.700   13.291  102.555 1.00 18.95 ? 122 CYS C C   1 
ATOM   7594  O O   . CYS C 1 122 ? 1.871   13.262  101.340 1.00 19.64 ? 122 CYS C O   1 
ATOM   7595  C CB  . CYS C 1 122 ? 2.880   15.006  103.977 1.00 20.26 ? 122 CYS C CB  1 
ATOM   7596  S SG  . CYS C 1 122 ? 4.364   15.090  102.908 1.00 25.82 ? 122 CYS C SG  1 
ATOM   7597  N N   . LYS C 1 123 ? 1.644   12.180  103.292 1.00 18.08 ? 123 LYS C N   1 
ATOM   7598  C CA  . LYS C 1 123 ? 1.761   10.837  102.654 1.00 18.58 ? 123 LYS C CA  1 
ATOM   7599  C C   . LYS C 1 123 ? 0.555   10.596  101.696 1.00 18.46 ? 123 LYS C C   1 
ATOM   7600  O O   . LYS C 1 123 ? 0.691   9.927   100.684 1.00 18.36 ? 123 LYS C O   1 
ATOM   7601  C CB  . LYS C 1 123 ? 1.784   9.687   103.656 1.00 18.07 ? 123 LYS C CB  1 
ATOM   7602  C CG  . LYS C 1 123 ? 2.928   9.671   104.701 1.00 21.99 ? 123 LYS C CG  1 
ATOM   7603  C CD  . LYS C 1 123 ? 4.306   9.673   104.093 1.00 24.01 ? 123 LYS C CD  1 
ATOM   7604  C CE  . LYS C 1 123 ? 5.323   9.303   105.175 1.00 30.16 ? 123 LYS C CE  1 
ATOM   7605  N NZ  . LYS C 1 123 ? 6.680   9.455   104.606 1.00 34.09 ? 123 LYS C NZ  1 
ATOM   7606  N N   . VAL C 1 124 ? -0.595  11.164  102.037 1.00 17.17 ? 124 VAL C N   1 
ATOM   7607  C CA  . VAL C 1 124 ? -1.792  11.053  101.201 1.00 18.36 ? 124 VAL C CA  1 
ATOM   7608  C C   . VAL C 1 124 ? -1.609  11.778  99.852  1.00 18.27 ? 124 VAL C C   1 
ATOM   7609  O O   . VAL C 1 124 ? -1.817  11.198  98.797  1.00 19.54 ? 124 VAL C O   1 
ATOM   7610  C CB  . VAL C 1 124 ? -3.040  11.499  101.969 1.00 17.04 ? 124 VAL C CB  1 
ATOM   7611  C CG1 . VAL C 1 124 ? -4.197  11.797  101.028 1.00 20.73 ? 124 VAL C CG1 1 
ATOM   7612  C CG2 . VAL C 1 124 ? -3.471  10.425  102.981 1.00 17.26 ? 124 VAL C CG2 1 
ATOM   7613  N N   . PHE C 1 125 ? -1.191  13.041  99.903  1.00 19.84 ? 125 PHE C N   1 
ATOM   7614  C CA  . PHE C 1 125 ? -0.816  13.792  98.720  1.00 19.50 ? 125 PHE C CA  1 
ATOM   7615  C C   . PHE C 1 125 ? 0.234   13.070  97.875  1.00 20.48 ? 125 PHE C C   1 
ATOM   7616  O O   . PHE C 1 125 ? 0.061   13.012  96.669  1.00 21.63 ? 125 PHE C O   1 
ATOM   7617  C CB  . PHE C 1 125 ? -0.285  15.170  99.105  1.00 19.25 ? 125 PHE C CB  1 
ATOM   7618  C CG  . PHE C 1 125 ? -1.296  16.045  99.844  1.00 15.67 ? 125 PHE C CG  1 
ATOM   7619  C CD1 . PHE C 1 125 ? -0.846  17.017  100.713 1.00 16.28 ? 125 PHE C CD1 1 
ATOM   7620  C CD2 . PHE C 1 125 ? -2.689  15.894  99.643  1.00 16.97 ? 125 PHE C CD2 1 
ATOM   7621  C CE1 . PHE C 1 125 ? -1.730  17.843  101.423 1.00 17.14 ? 125 PHE C CE1 1 
ATOM   7622  C CE2 . PHE C 1 125 ? -3.603  16.704  100.347 1.00 18.02 ? 125 PHE C CE2 1 
ATOM   7623  C CZ  . PHE C 1 125 ? -3.116  17.673  101.262 1.00 21.95 ? 125 PHE C CZ  1 
ATOM   7624  N N   . GLU C 1 126 ? 1.301   12.541  98.508  1.00 20.00 ? 126 GLU C N   1 
ATOM   7625  C CA  . GLU C 1 126 ? 2.337   11.727  97.798  1.00 20.75 ? 126 GLU C CA  1 
ATOM   7626  C C   . GLU C 1 126 ? 1.760   10.489  97.142  1.00 18.99 ? 126 GLU C C   1 
ATOM   7627  O O   . GLU C 1 126 ? 2.098   10.175  96.003  1.00 19.68 ? 126 GLU C O   1 
ATOM   7628  C CB  . GLU C 1 126 ? 3.548   11.406  98.706  1.00 19.29 ? 126 GLU C CB  1 
ATOM   7629  C CG  . GLU C 1 126 ? 4.275   12.693  99.075  1.00 22.23 ? 126 GLU C CG  1 
ATOM   7630  C CD  . GLU C 1 126 ? 5.191   12.552  100.283 1.00 25.19 ? 126 GLU C CD  1 
ATOM   7631  O OE1 . GLU C 1 126 ? 6.170   13.311  100.371 1.00 29.54 ? 126 GLU C OE1 1 
ATOM   7632  O OE2 . GLU C 1 126 ? 4.936   11.694  101.159 1.00 27.38 ? 126 GLU C OE2 1 
ATOM   7633  N N   . MET C 1 127 ? 0.843   9.830   97.835  1.00 19.05 ? 127 MET C N   1 
ATOM   7634  C CA  . MET C 1 127 ? 0.173   8.608   97.342  1.00 18.86 ? 127 MET C CA  1 
ATOM   7635  C C   . MET C 1 127 ? -0.591  8.855   96.034  1.00 20.17 ? 127 MET C C   1 
ATOM   7636  O O   . MET C 1 127 ? -0.543  8.029   95.096  1.00 21.90 ? 127 MET C O   1 
ATOM   7637  C CB  . MET C 1 127 ? -0.826  8.119   98.367  1.00 17.07 ? 127 MET C CB  1 
ATOM   7638  C CG  . MET C 1 127 ? -1.593  6.818   97.978  1.00 18.49 ? 127 MET C CG  1 
ATOM   7639  S SD  . MET C 1 127 ? -2.872  6.445   99.195  1.00 20.28 ? 127 MET C SD  1 
ATOM   7640  C CE  . MET C 1 127 ? -4.066  7.805   99.085  1.00 16.43 ? 127 MET C CE  1 
ATOM   7641  N N   . ILE C 1 128 ? -1.255  10.004  95.960  1.00 19.85 ? 128 ILE C N   1 
ATOM   7642  C CA  . ILE C 1 128 ? -2.226  10.277  94.907  1.00 19.76 ? 128 ILE C CA  1 
ATOM   7643  C C   . ILE C 1 128 ? -1.635  10.991  93.662  1.00 20.67 ? 128 ILE C C   1 
ATOM   7644  O O   . ILE C 1 128 ? -1.934  10.647  92.501  1.00 21.30 ? 128 ILE C O   1 
ATOM   7645  C CB  . ILE C 1 128 ? -3.426  11.055  95.473  1.00 19.93 ? 128 ILE C CB  1 
ATOM   7646  C CG1 . ILE C 1 128 ? -4.134  10.231  96.552  1.00 17.17 ? 128 ILE C CG1 1 
ATOM   7647  C CG2 . ILE C 1 128 ? -4.478  11.381  94.355  1.00 21.87 ? 128 ILE C CG2 1 
ATOM   7648  C CD1 . ILE C 1 128 ? -5.104  11.152  97.396  1.00 14.90 ? 128 ILE C CD1 1 
ATOM   7649  N N   . ILE C 1 129 ? -0.790  11.977  93.897  1.00 21.37 ? 129 ILE C N   1 
ATOM   7650  C CA  . ILE C 1 129 ? -0.547  13.004  92.895  1.00 21.74 ? 129 ILE C CA  1 
ATOM   7651  C C   . ILE C 1 129 ? 0.582   12.643  91.899  1.00 23.11 ? 129 ILE C C   1 
ATOM   7652  O O   . ILE C 1 129 ? 1.705   12.412  92.311  1.00 23.86 ? 129 ILE C O   1 
ATOM   7653  C CB  . ILE C 1 129 ? -0.309  14.403  93.574  1.00 21.02 ? 129 ILE C CB  1 
ATOM   7654  C CG1 . ILE C 1 129 ? -1.588  14.869  94.296  1.00 21.50 ? 129 ILE C CG1 1 
ATOM   7655  C CG2 . ILE C 1 129 ? 0.190   15.438  92.558  1.00 20.84 ? 129 ILE C CG2 1 
ATOM   7656  C CD1 . ILE C 1 129 ? -1.395  16.088  95.302  1.00 21.11 ? 129 ILE C CD1 1 
ATOM   7657  N N   . ASN C 1 130 ? 0.231   12.595  90.613  1.00 23.32 ? 130 ASN C N   1 
ATOM   7658  C CA  . ASN C 1 130 ? 1.175   12.666  89.498  1.00 24.22 ? 130 ASN C CA  1 
ATOM   7659  C C   . ASN C 1 130 ? 1.271   14.106  88.997  1.00 24.82 ? 130 ASN C C   1 
ATOM   7660  O O   . ASN C 1 130 ? 0.274   14.852  89.055  1.00 27.03 ? 130 ASN C O   1 
ATOM   7661  C CB  . ASN C 1 130 ? 0.677   11.772  88.368  1.00 23.63 ? 130 ASN C CB  1 
ATOM   7662  C CG  . ASN C 1 130 ? 0.526   10.340  88.774  1.00 23.86 ? 130 ASN C CG  1 
ATOM   7663  O OD1 . ASN C 1 130 ? 1.421   9.749   89.365  1.00 24.56 ? 130 ASN C OD1 1 
ATOM   7664  N ND2 . ASN C 1 130 ? -0.629  9.762   88.479  1.00 22.31 ? 130 ASN C ND2 1 
ATOM   7665  N N   . PRO C 1 131 ? 2.452   14.533  88.489  1.00 25.80 ? 131 PRO C N   1 
ATOM   7666  C CA  . PRO C 1 131 ? 2.497   15.875  87.884  1.00 25.86 ? 131 PRO C CA  1 
ATOM   7667  C C   . PRO C 1 131 ? 1.364   16.124  86.841  1.00 25.68 ? 131 PRO C C   1 
ATOM   7668  O O   . PRO C 1 131 ? 0.988   15.213  86.057  1.00 24.88 ? 131 PRO C O   1 
ATOM   7669  C CB  . PRO C 1 131 ? 3.889   15.931  87.224  1.00 26.23 ? 131 PRO C CB  1 
ATOM   7670  C CG  . PRO C 1 131 ? 4.757   14.918  88.041  1.00 25.49 ? 131 PRO C CG  1 
ATOM   7671  C CD  . PRO C 1 131 ? 3.770   13.847  88.472  1.00 26.72 ? 131 PRO C CD  1 
ATOM   7672  N N   . GLY C 1 132 ? 0.791   17.324  86.880  1.00 25.05 ? 132 GLY C N   1 
ATOM   7673  C CA  . GLY C 1 132 ? -0.290  17.679  85.963  1.00 25.61 ? 132 GLY C CA  1 
ATOM   7674  C C   . GLY C 1 132 ? -1.663  17.203  86.414  1.00 25.94 ? 132 GLY C C   1 
ATOM   7675  O O   . GLY C 1 132 ? -2.658  17.533  85.766  1.00 25.67 ? 132 GLY C O   1 
ATOM   7676  N N   . ASP C 1 133 ? -1.742  16.467  87.540  1.00 25.21 ? 133 ASP C N   1 
ATOM   7677  C CA  . ASP C 1 133 ? -3.053  16.111  88.111  1.00 24.48 ? 133 ASP C CA  1 
ATOM   7678  C C   . ASP C 1 133 ? -3.809  17.353  88.594  1.00 24.33 ? 133 ASP C C   1 
ATOM   7679  O O   . ASP C 1 133 ? -3.198  18.297  89.105  1.00 24.69 ? 133 ASP C O   1 
ATOM   7680  C CB  . ASP C 1 133 ? -2.932  15.126  89.274  1.00 25.56 ? 133 ASP C CB  1 
ATOM   7681  C CG  . ASP C 1 133 ? -2.700  13.680  88.830  1.00 27.38 ? 133 ASP C CG  1 
ATOM   7682  O OD1 . ASP C 1 133 ? -2.640  13.389  87.591  1.00 27.65 ? 133 ASP C OD1 1 
ATOM   7683  O OD2 . ASP C 1 133 ? -2.569  12.826  89.743  1.00 28.47 ? 133 ASP C OD2 1 
ATOM   7684  N N   . ASN C 1 134 ? -5.132  17.366  88.402  1.00 24.10 ? 134 ASN C N   1 
ATOM   7685  C CA  . ASN C 1 134 ? -5.949  18.489  88.883  1.00 23.74 ? 134 ASN C CA  1 
ATOM   7686  C C   . ASN C 1 134 ? -6.444  18.171  90.265  1.00 22.88 ? 134 ASN C C   1 
ATOM   7687  O O   . ASN C 1 134 ? -6.941  17.080  90.506  1.00 22.48 ? 134 ASN C O   1 
ATOM   7688  C CB  . ASN C 1 134 ? -7.137  18.762  87.954  1.00 23.24 ? 134 ASN C CB  1 
ATOM   7689  C CG  . ASN C 1 134 ? -6.703  19.347  86.630  1.00 24.74 ? 134 ASN C CG  1 
ATOM   7690  O OD1 . ASN C 1 134 ? -5.899  20.296  86.587  1.00 25.61 ? 134 ASN C OD1 1 
ATOM   7691  N ND2 . ASN C 1 134 ? -7.204  18.764  85.536  1.00 27.85 ? 134 ASN C ND2 1 
ATOM   7692  N N   . VAL C 1 135 ? -6.276  19.123  91.173  1.00 22.52 ? 135 VAL C N   1 
ATOM   7693  C CA  . VAL C 1 135 ? -6.815  18.999  92.521  1.00 22.60 ? 135 VAL C CA  1 
ATOM   7694  C C   . VAL C 1 135 ? -7.606  20.282  92.836  1.00 23.07 ? 135 VAL C C   1 
ATOM   7695  O O   . VAL C 1 135 ? -7.306  21.365  92.308  1.00 23.12 ? 135 VAL C O   1 
ATOM   7696  C CB  . VAL C 1 135 ? -5.670  18.697  93.606  1.00 23.00 ? 135 VAL C CB  1 
ATOM   7697  C CG1 . VAL C 1 135 ? -4.757  17.569  93.183  1.00 21.34 ? 135 VAL C CG1 1 
ATOM   7698  C CG2 . VAL C 1 135 ? -4.821  19.912  93.840  1.00 24.36 ? 135 VAL C CG2 1 
ATOM   7699  N N   . LEU C 1 136 ? -8.575  20.151  93.740  1.00 22.07 ? 136 LEU C N   1 
ATOM   7700  C CA  . LEU C 1 136 ? -9.485  21.203  94.076  1.00 21.88 ? 136 LEU C CA  1 
ATOM   7701  C C   . LEU C 1 136 ? -9.290  21.659  95.522  1.00 22.45 ? 136 LEU C C   1 
ATOM   7702  O O   . LEU C 1 136 ? -9.187  20.827  96.435  1.00 20.76 ? 136 LEU C O   1 
ATOM   7703  C CB  . LEU C 1 136 ? -10.903 20.663  93.930  1.00 21.35 ? 136 LEU C CB  1 
ATOM   7704  C CG  . LEU C 1 136 ? -11.264 20.202  92.503  1.00 23.26 ? 136 LEU C CG  1 
ATOM   7705  C CD1 . LEU C 1 136 ? -12.519 19.368  92.595  1.00 22.27 ? 136 LEU C CD1 1 
ATOM   7706  C CD2 . LEU C 1 136 ? -11.472 21.494  91.701  1.00 24.07 ? 136 LEU C CD2 1 
ATOM   7707  N N   . LEU C 1 137 ? -9.204  22.957  95.738  1.00 22.78 ? 137 LEU C N   1 
ATOM   7708  C CA  . LEU C 1 137 ? -9.321  23.466  97.082  1.00 24.95 ? 137 LEU C CA  1 
ATOM   7709  C C   . LEU C 1 137 ? -9.786  24.918  97.167  1.00 25.71 ? 137 LEU C C   1 
ATOM   7710  O O   . LEU C 1 137 ? -9.764  25.622  96.183  1.00 24.77 ? 137 LEU C O   1 
ATOM   7711  C CB  . LEU C 1 137 ? -8.066  23.170  97.903  1.00 24.61 ? 137 LEU C CB  1 
ATOM   7712  C CG  . LEU C 1 137 ? -6.801  24.018  97.959  1.00 28.74 ? 137 LEU C CG  1 
ATOM   7713  C CD1 . LEU C 1 137 ? -5.540  23.227  97.863  1.00 28.25 ? 137 LEU C CD1 1 
ATOM   7714  C CD2 . LEU C 1 137 ? -6.769  25.205  97.062  1.00 30.14 ? 137 LEU C CD2 1 
ATOM   7715  N N   . ASP C 1 138 ? -10.223 25.336  98.350  1.00 26.07 ? 138 ASP C N   1 
ATOM   7716  C CA  . ASP C 1 138 ? -10.581 26.734  98.590  1.00 26.85 ? 138 ASP C CA  1 
ATOM   7717  C C   . ASP C 1 138 ? -9.405  27.520  99.155  1.00 26.31 ? 138 ASP C C   1 
ATOM   7718  O O   . ASP C 1 138 ? -8.815  27.146  100.174 1.00 25.97 ? 138 ASP C O   1 
ATOM   7719  C CB  . ASP C 1 138 ? -11.837 26.852  99.488  1.00 26.56 ? 138 ASP C CB  1 
ATOM   7720  C CG  . ASP C 1 138 ? -11.688 26.139  100.861 1.00 30.72 ? 138 ASP C CG  1 
ATOM   7721  O OD1 . ASP C 1 138 ? -11.299 24.934  100.909 1.00 26.52 ? 138 ASP C OD1 1 
ATOM   7722  O OD2 . ASP C 1 138 ? -11.999 26.796  101.896 1.00 30.60 ? 138 ASP C OD2 1 
ATOM   7723  N N   . GLU C 1 139 ? -9.080  28.629  98.496  1.00 25.23 ? 139 GLU C N   1 
ATOM   7724  C CA  . GLU C 1 139 ? -8.147  29.609  99.041  1.00 25.47 ? 139 GLU C CA  1 
ATOM   7725  C C   . GLU C 1 139 ? -8.945  30.738  99.703  1.00 24.87 ? 139 GLU C C   1 
ATOM   7726  O O   . GLU C 1 139 ? -9.947  31.154  99.152  1.00 24.17 ? 139 GLU C O   1 
ATOM   7727  C CB  . GLU C 1 139 ? -7.354  30.249  97.919  1.00 25.66 ? 139 GLU C CB  1 
ATOM   7728  C CG  . GLU C 1 139 ? -6.220  29.422  97.343  1.00 26.97 ? 139 GLU C CG  1 
ATOM   7729  C CD  . GLU C 1 139 ? -5.718  30.107  96.098  1.00 28.92 ? 139 GLU C CD  1 
ATOM   7730  O OE1 . GLU C 1 139 ? -4.667  30.757  96.142  1.00 25.15 ? 139 GLU C OE1 1 
ATOM   7731  O OE2 . GLU C 1 139 ? -6.437  30.069  95.073  1.00 34.02 ? 139 GLU C OE2 1 
ATOM   7732  N N   . PRO C 1 140 ? -8.452  31.300  100.827 1.00 24.26 ? 140 PRO C N   1 
ATOM   7733  C CA  . PRO C 1 140 ? -7.142  31.027  101.456 1.00 24.10 ? 140 PRO C CA  1 
ATOM   7734  C C   . PRO C 1 140 ? -7.117  29.645  102.097 1.00 23.64 ? 140 PRO C C   1 
ATOM   7735  O O   . PRO C 1 140 ? -8.162  29.147  102.582 1.00 22.58 ? 140 PRO C O   1 
ATOM   7736  C CB  . PRO C 1 140 ? -7.007  32.123  102.527 1.00 23.86 ? 140 PRO C CB  1 
ATOM   7737  C CG  . PRO C 1 140 ? -8.210  32.956  102.411 1.00 25.01 ? 140 PRO C CG  1 
ATOM   7738  C CD  . PRO C 1 140 ? -9.227  32.297  101.599 1.00 24.52 ? 140 PRO C CD  1 
ATOM   7739  N N   . ALA C 1 141 ? -5.922  29.045  102.081 1.00 23.84 ? 141 ALA C N   1 
ATOM   7740  C CA  . ALA C 1 141 ? -5.736  27.641  102.416 1.00 23.71 ? 141 ALA C CA  1 
ATOM   7741  C C   . ALA C 1 141 ? -4.599  27.571  103.402 1.00 24.18 ? 141 ALA C C   1 
ATOM   7742  O O   . ALA C 1 141 ? -3.746  28.454  103.435 1.00 23.78 ? 141 ALA C O   1 
ATOM   7743  C CB  . ALA C 1 141 ? -5.361  26.848  101.142 1.00 23.79 ? 141 ALA C CB  1 
ATOM   7744  N N   . TYR C 1 142 ? -4.562  26.511  104.199 1.00 24.24 ? 142 TYR C N   1 
ATOM   7745  C CA  . TYR C 1 142 ? -3.454  26.340  105.108 1.00 24.84 ? 142 TYR C CA  1 
ATOM   7746  C C   . TYR C 1 142 ? -2.118  26.302  104.344 1.00 24.56 ? 142 TYR C C   1 
ATOM   7747  O O   . TYR C 1 142 ? -1.950  25.544  103.378 1.00 23.70 ? 142 TYR C O   1 
ATOM   7748  C CB  . TYR C 1 142 ? -3.698  25.088  105.955 1.00 25.87 ? 142 TYR C CB  1 
ATOM   7749  C CG  . TYR C 1 142 ? -2.505  24.602  106.707 1.00 26.46 ? 142 TYR C CG  1 
ATOM   7750  C CD1 . TYR C 1 142 ? -2.060  23.293  106.553 1.00 30.96 ? 142 TYR C CD1 1 
ATOM   7751  C CD2 . TYR C 1 142 ? -1.815  25.437  107.581 1.00 30.33 ? 142 TYR C CD2 1 
ATOM   7752  C CE1 . TYR C 1 142 ? -0.945  22.830  107.250 1.00 30.37 ? 142 TYR C CE1 1 
ATOM   7753  C CE2 . TYR C 1 142 ? -0.712  24.988  108.274 1.00 30.47 ? 142 TYR C CE2 1 
ATOM   7754  C CZ  . TYR C 1 142 ? -0.288  23.697  108.115 1.00 31.40 ? 142 TYR C CZ  1 
ATOM   7755  O OH  . TYR C 1 142 ? 0.819   23.259  108.819 1.00 34.30 ? 142 TYR C OH  1 
ATOM   7756  N N   . SER C 1 143 ? -1.172  27.125  104.761 1.00 24.48 ? 143 SER C N   1 
ATOM   7757  C CA  . SER C 1 143 ? 0.050   27.265  104.002 1.00 25.78 ? 143 SER C CA  1 
ATOM   7758  C C   . SER C 1 143 ? 0.903   26.013  103.968 1.00 25.79 ? 143 SER C C   1 
ATOM   7759  O O   . SER C 1 143 ? 1.535   25.762  102.946 1.00 26.00 ? 143 SER C O   1 
ATOM   7760  C CB  . SER C 1 143 ? 0.887   28.453  104.458 1.00 25.66 ? 143 SER C CB  1 
ATOM   7761  O OG  . SER C 1 143 ? 1.198   28.307  105.805 1.00 30.37 ? 143 SER C OG  1 
ATOM   7762  N N   . GLY C 1 144 ? 0.917   25.238  105.049 1.00 24.61 ? 144 GLY C N   1 
ATOM   7763  C CA  . GLY C 1 144 ? 1.618   23.945  105.062 1.00 24.90 ? 144 GLY C CA  1 
ATOM   7764  C C   . GLY C 1 144 ? 1.077   22.982  104.005 1.00 24.45 ? 144 GLY C C   1 
ATOM   7765  O O   . GLY C 1 144 ? 1.845   22.172  103.432 1.00 25.12 ? 144 GLY C O   1 
ATOM   7766  N N   . THR C 1 145 ? -0.224  23.044  103.713 1.00 22.82 ? 145 THR C N   1 
ATOM   7767  C CA  . THR C 1 145 ? -0.734  22.203  102.627 1.00 22.27 ? 145 THR C CA  1 
ATOM   7768  C C   . THR C 1 145 ? -0.304  22.709  101.244 1.00 21.19 ? 145 THR C C   1 
ATOM   7769  O O   . THR C 1 145 ? 0.060   21.915  100.383 1.00 20.51 ? 145 THR C O   1 
ATOM   7770  C CB  . THR C 1 145 ? -2.248  22.005  102.664 1.00 22.42 ? 145 THR C CB  1 
ATOM   7771  O OG1 . THR C 1 145 ? -2.874  23.284  102.651 1.00 32.70 ? 145 THR C OG1 1 
ATOM   7772  C CG2 . THR C 1 145 ? -2.676  21.333  103.911 1.00 21.69 ? 145 THR C CG2 1 
ATOM   7773  N N   . LEU C 1 146 ? -0.360  24.031  101.034 1.00 20.73 ? 146 LEU C N   1 
ATOM   7774  C CA  . LEU C 1 146 ? 0.082   24.628  99.795  1.00 20.45 ? 146 LEU C CA  1 
ATOM   7775  C C   . LEU C 1 146 ? 1.525   24.324  99.501  1.00 20.67 ? 146 LEU C C   1 
ATOM   7776  O O   . LEU C 1 146 ? 1.857   24.076  98.354  1.00 19.31 ? 146 LEU C O   1 
ATOM   7777  C CB  . LEU C 1 146 ? -0.122  26.169  99.772  1.00 21.01 ? 146 LEU C CB  1 
ATOM   7778  C CG  . LEU C 1 146 ? -1.589  26.620  99.899  1.00 19.09 ? 146 LEU C CG  1 
ATOM   7779  C CD1 . LEU C 1 146 ? -1.716  28.126  99.968  1.00 19.60 ? 146 LEU C CD1 1 
ATOM   7780  C CD2 . LEU C 1 146 ? -2.420  26.023  98.734  1.00 20.51 ? 146 LEU C CD2 1 
ATOM   7781  N N   . GLN C 1 147 ? 2.382   24.413  100.527 1.00 19.64 ? 147 GLN C N   1 
ATOM   7782  C CA  . GLN C 1 147 ? 3.807   24.118  100.364 1.00 21.38 ? 147 GLN C CA  1 
ATOM   7783  C C   . GLN C 1 147 ? 4.024   22.627  100.086 1.00 20.04 ? 147 GLN C C   1 
ATOM   7784  O O   . GLN C 1 147 ? 4.973   22.244  99.391  1.00 20.30 ? 147 GLN C O   1 
ATOM   7785  C CB  . GLN C 1 147 ? 4.590   24.492  101.616 1.00 21.22 ? 147 GLN C CB  1 
ATOM   7786  C CG  . GLN C 1 147 ? 4.503   25.975  102.004 1.00 30.33 ? 147 GLN C CG  1 
ATOM   7787  C CD  . GLN C 1 147 ? 5.376   26.853  101.130 1.00 38.82 ? 147 GLN C CD  1 
ATOM   7788  O OE1 . GLN C 1 147 ? 6.598   26.649  101.024 1.00 45.05 ? 147 GLN C OE1 1 
ATOM   7789  N NE2 . GLN C 1 147 ? 4.762   27.832  100.488 1.00 40.46 ? 147 GLN C NE2 1 
ATOM   7790  N N   . SER C 1 148 ? 3.159   21.803  100.665 1.00 19.03 ? 148 SER C N   1 
ATOM   7791  C CA  . SER C 1 148 ? 3.206   20.378  100.412 1.00 20.41 ? 148 SER C CA  1 
ATOM   7792  C C   . SER C 1 148 ? 2.838   20.043  98.960  1.00 19.51 ? 148 SER C C   1 
ATOM   7793  O O   . SER C 1 148 ? 3.452   19.152  98.317  1.00 21.24 ? 148 SER C O   1 
ATOM   7794  C CB  . SER C 1 148 ? 2.318   19.650  101.403 1.00 18.38 ? 148 SER C CB  1 
ATOM   7795  O OG  . SER C 1 148 ? 2.593   18.272  101.307 1.00 27.58 ? 148 SER C OG  1 
ATOM   7796  N N   . LEU C 1 149 ? 1.843   20.749  98.430  1.00 20.13 ? 149 LEU C N   1 
ATOM   7797  C CA  . LEU C 1 149 ? 1.309   20.481  97.073  1.00 19.89 ? 149 LEU C CA  1 
ATOM   7798  C C   . LEU C 1 149 ? 2.115   21.048  95.920  1.00 21.68 ? 149 LEU C C   1 
ATOM   7799  O O   . LEU C 1 149 ? 2.147   20.472  94.805  1.00 23.62 ? 149 LEU C O   1 
ATOM   7800  C CB  . LEU C 1 149 ? -0.131  20.999  96.976  1.00 19.69 ? 149 LEU C CB  1 
ATOM   7801  C CG  . LEU C 1 149 ? -1.219  20.285  97.797  1.00 18.77 ? 149 LEU C CG  1 
ATOM   7802  C CD1 . LEU C 1 149 ? -2.480  21.151  97.713  1.00 18.71 ? 149 LEU C CD1 1 
ATOM   7803  C CD2 . LEU C 1 149 ? -1.521  18.800  97.329  1.00 17.28 ? 149 LEU C CD2 1 
ATOM   7804  N N   . HIS C 1 150 ? 2.768   22.169  96.188  1.00 22.92 ? 150 HIS C N   1 
ATOM   7805  C CA  . HIS C 1 150 ? 3.619   22.834  95.191  1.00 23.69 ? 150 HIS C CA  1 
ATOM   7806  C C   . HIS C 1 150 ? 4.692   21.917  94.514  1.00 22.75 ? 150 HIS C C   1 
ATOM   7807  O O   . HIS C 1 150 ? 4.719   21.813  93.285  1.00 22.13 ? 150 HIS C O   1 
ATOM   7808  C CB  . HIS C 1 150 ? 4.197   24.141  95.749  1.00 23.39 ? 150 HIS C CB  1 
ATOM   7809  C CG  . HIS C 1 150 ? 5.234   24.758  94.847  1.00 27.50 ? 150 HIS C CG  1 
ATOM   7810  N ND1 . HIS C 1 150 ? 6.587   24.725  95.132  1.00 29.50 ? 150 HIS C ND1 1 
ATOM   7811  C CD2 . HIS C 1 150 ? 5.116   25.363  93.639  1.00 30.26 ? 150 HIS C CD2 1 
ATOM   7812  C CE1 . HIS C 1 150 ? 7.254   25.325  94.156  1.00 31.86 ? 150 HIS C CE1 1 
ATOM   7813  N NE2 . HIS C 1 150 ? 6.386   25.712  93.233  1.00 31.81 ? 150 HIS C NE2 1 
ATOM   7814  N N   . PRO C 1 151 ? 5.565   21.224  95.296  1.00 22.75 ? 151 PRO C N   1 
ATOM   7815  C CA  . PRO C 1 151 ? 6.589   20.393  94.580  1.00 22.53 ? 151 PRO C CA  1 
ATOM   7816  C C   . PRO C 1 151 ? 6.053   19.198  93.808  1.00 23.25 ? 151 PRO C C   1 
ATOM   7817  O O   . PRO C 1 151 ? 6.746   18.636  92.985  1.00 23.10 ? 151 PRO C O   1 
ATOM   7818  C CB  . PRO C 1 151 ? 7.506   19.871  95.707  1.00 22.23 ? 151 PRO C CB  1 
ATOM   7819  C CG  . PRO C 1 151 ? 7.177   20.729  96.905  1.00 23.48 ? 151 PRO C CG  1 
ATOM   7820  C CD  . PRO C 1 151 ? 5.743   21.181  96.759  1.00 22.39 ? 151 PRO C CD  1 
ATOM   7821  N N   . LEU C 1 152 ? 4.846   18.775  94.130  1.00 23.69 ? 152 LEU C N   1 
ATOM   7822  C CA  . LEU C 1 152 ? 4.205   17.654  93.477  1.00 23.79 ? 152 LEU C CA  1 
ATOM   7823  C C   . LEU C 1 152 ? 3.718   17.934  92.042  1.00 24.33 ? 152 LEU C C   1 
ATOM   7824  O O   . LEU C 1 152 ? 3.308   17.018  91.335  1.00 23.76 ? 152 LEU C O   1 
ATOM   7825  C CB  . LEU C 1 152 ? 3.049   17.184  94.367  1.00 23.89 ? 152 LEU C CB  1 
ATOM   7826  C CG  . LEU C 1 152 ? 3.295   16.143  95.471  1.00 25.92 ? 152 LEU C CG  1 
ATOM   7827  C CD1 . LEU C 1 152 ? 4.743   15.926  95.902  1.00 28.29 ? 152 LEU C CD1 1 
ATOM   7828  C CD2 . LEU C 1 152 ? 2.291   16.106  96.708  1.00 20.14 ? 152 LEU C CD2 1 
ATOM   7829  N N   . GLY C 1 153 ? 3.763   19.181  91.611  1.00 24.44 ? 153 GLY C N   1 
ATOM   7830  C CA  . GLY C 1 153 ? 3.365   19.503  90.236  1.00 25.97 ? 153 GLY C CA  1 
ATOM   7831  C C   . GLY C 1 153 ? 1.901   19.371  89.845  1.00 26.68 ? 153 GLY C C   1 
ATOM   7832  O O   . GLY C 1 153 ? 1.586   19.248  88.664  1.00 26.34 ? 153 GLY C O   1 
ATOM   7833  N N   . CYS C 1 154 ? 1.003   19.380  90.823  1.00 27.40 ? 154 CYS C N   1 
ATOM   7834  C CA  . CYS C 1 154 ? -0.423  19.313  90.524  1.00 28.01 ? 154 CYS C CA  1 
ATOM   7835  C C   . CYS C 1 154 ? -0.869  20.724  90.153  1.00 27.76 ? 154 CYS C C   1 
ATOM   7836  O O   . CYS C 1 154 ? -0.174  21.693  90.469  1.00 28.63 ? 154 CYS C O   1 
ATOM   7837  C CB  . CYS C 1 154 ? -1.257  18.766  91.696  1.00 27.13 ? 154 CYS C CB  1 
ATOM   7838  S SG  . CYS C 1 154 ? -1.028  19.617  93.243  1.00 29.78 ? 154 CYS C SG  1 
ATOM   7839  N N   . ASN C 1 155 ? -1.972  20.803  89.415  1.00 26.85 ? 155 ASN C N   1 
ATOM   7840  C CA  . ASN C 1 155 ? -2.691  22.045  89.163  1.00 26.05 ? 155 ASN C CA  1 
ATOM   7841  C C   . ASN C 1 155 ? -3.767  22.212  90.207  1.00 25.29 ? 155 ASN C C   1 
ATOM   7842  O O   . ASN C 1 155 ? -4.740  21.470  90.224  1.00 25.96 ? 155 ASN C O   1 
ATOM   7843  C CB  . ASN C 1 155 ? -3.430  21.957  87.829  1.00 26.58 ? 155 ASN C CB  1 
ATOM   7844  C CG  . ASN C 1 155 ? -2.507  21.743  86.659  1.00 29.27 ? 155 ASN C CG  1 
ATOM   7845  O OD1 . ASN C 1 155 ? -1.585  22.535  86.420  1.00 29.13 ? 155 ASN C OD1 1 
ATOM   7846  N ND2 . ASN C 1 155 ? -2.758  20.667  85.898  1.00 34.45 ? 155 ASN C ND2 1 
ATOM   7847  N N   . ILE C 1 156 ? -3.613  23.202  91.059  1.00 24.92 ? 156 ILE C N   1 
ATOM   7848  C CA  . ILE C 1 156 ? -4.585  23.479  92.099  1.00 24.91 ? 156 ILE C CA  1 
ATOM   7849  C C   . ILE C 1 156 ? -5.647  24.379  91.487  1.00 24.81 ? 156 ILE C C   1 
ATOM   7850  O O   . ILE C 1 156 ? -5.320  25.429  90.943  1.00 26.00 ? 156 ILE C O   1 
ATOM   7851  C CB  . ILE C 1 156 ? -3.904  24.199  93.279  1.00 25.29 ? 156 ILE C CB  1 
ATOM   7852  C CG1 . ILE C 1 156 ? -2.850  23.289  93.916  1.00 24.92 ? 156 ILE C CG1 1 
ATOM   7853  C CG2 . ILE C 1 156 ? -4.936  24.559  94.371  1.00 26.49 ? 156 ILE C CG2 1 
ATOM   7854  C CD1 . ILE C 1 156 ? -2.048  24.008  94.971  1.00 23.67 ? 156 ILE C CD1 1 
ATOM   7855  N N   . ILE C 1 157 ? -6.898  23.945  91.516  1.00 24.63 ? 157 ILE C N   1 
ATOM   7856  C CA  . ILE C 1 157 ? -8.010  24.759  91.061  1.00 24.46 ? 157 ILE C CA  1 
ATOM   7857  C C   . ILE C 1 157 ? -8.805  25.309  92.234  1.00 24.83 ? 157 ILE C C   1 
ATOM   7858  O O   . ILE C 1 157 ? -9.377  24.541  93.023  1.00 24.58 ? 157 ILE C O   1 
ATOM   7859  C CB  . ILE C 1 157 ? -8.925  23.934  90.192  1.00 24.99 ? 157 ILE C CB  1 
ATOM   7860  C CG1 . ILE C 1 157 ? -8.165  23.446  88.941  1.00 25.93 ? 157 ILE C CG1 1 
ATOM   7861  C CG2 . ILE C 1 157 ? -10.195 24.757  89.825  1.00 26.34 ? 157 ILE C CG2 1 
ATOM   7862  C CD1 . ILE C 1 157 ? -8.998  22.460  88.160  1.00 27.07 ? 157 ILE C CD1 1 
ATOM   7863  N N   . ASN C 1 158 ? -8.888  26.639  92.323  1.00 25.59 ? 158 ASN C N   1 
ATOM   7864  C CA  . ASN C 1 158 ? -9.527  27.299  93.443  1.00 25.79 ? 158 ASN C CA  1 
ATOM   7865  C C   . ASN C 1 158 ? -11.047 27.202  93.400  1.00 26.41 ? 158 ASN C C   1 
ATOM   7866  O O   . ASN C 1 158 ? -11.672 27.579  92.392  1.00 26.28 ? 158 ASN C O   1 
ATOM   7867  C CB  . ASN C 1 158 ? -9.095  28.768  93.475  1.00 27.52 ? 158 ASN C CB  1 
ATOM   7868  C CG  . ASN C 1 158 ? -9.537  29.482  94.732  1.00 29.15 ? 158 ASN C CG  1 
ATOM   7869  O OD1 . ASN C 1 158 ? -9.563  28.890  95.809  1.00 31.29 ? 158 ASN C OD1 1 
ATOM   7870  N ND2 . ASN C 1 158 ? -9.891  30.762  94.606  1.00 29.67 ? 158 ASN C ND2 1 
ATOM   7871  N N   . VAL C 1 159 ? -11.652 26.707  94.475  1.00 25.51 ? 159 VAL C N   1 
ATOM   7872  C CA  . VAL C 1 159 ? -13.086 26.650  94.554  1.00 26.21 ? 159 VAL C CA  1 
ATOM   7873  C C   . VAL C 1 159 ? -13.452 27.915  95.331  1.00 26.92 ? 159 VAL C C   1 
ATOM   7874  O O   . VAL C 1 159 ? -12.761 28.249  96.297  1.00 26.48 ? 159 VAL C O   1 
ATOM   7875  C CB  . VAL C 1 159 ? -13.551 25.389  95.298  1.00 26.85 ? 159 VAL C CB  1 
ATOM   7876  C CG1 . VAL C 1 159 ? -15.071 25.329  95.330  1.00 25.29 ? 159 VAL C CG1 1 
ATOM   7877  C CG2 . VAL C 1 159 ? -12.971 24.109  94.646  1.00 27.74 ? 159 VAL C CG2 1 
ATOM   7878  N N   . ALA C 1 160 ? -14.509 28.629  94.910  1.00 27.32 ? 160 ALA C N   1 
ATOM   7879  C CA  . ALA C 1 160 ? -14.973 29.800  95.674  1.00 27.21 ? 160 ALA C CA  1 
ATOM   7880  C C   . ALA C 1 160 ? -15.465 29.426  97.091  1.00 27.31 ? 160 ALA C C   1 
ATOM   7881  O O   . ALA C 1 160 ? -16.087 28.363  97.312  1.00 28.13 ? 160 ALA C O   1 
ATOM   7882  C CB  . ALA C 1 160 ? -16.037 30.599  94.917  1.00 25.65 ? 160 ALA C CB  1 
ATOM   7883  N N   . SER C 1 161 ? -15.193 30.317  98.035  1.00 28.38 ? 161 SER C N   1 
ATOM   7884  C CA  . SER C 1 161 ? -15.551 30.098  99.451  1.00 29.34 ? 161 SER C CA  1 
ATOM   7885  C C   . SER C 1 161 ? -16.078 31.405  100.046 1.00 29.48 ? 161 SER C C   1 
ATOM   7886  O O   . SER C 1 161 ? -15.646 32.462  99.624  1.00 28.61 ? 161 SER C O   1 
ATOM   7887  C CB  . SER C 1 161 ? -14.304 29.673  100.234 1.00 29.38 ? 161 SER C CB  1 
ATOM   7888  O OG  . SER C 1 161 ? -13.357 30.739  100.327 1.00 30.76 ? 161 SER C OG  1 
ATOM   7889  N N   . ASP C 1 162 ? -16.978 31.330  101.033 1.00 29.44 ? 162 ASP C N   1 
ATOM   7890  C CA  . ASP C 1 162 ? -17.449 32.558  101.708 1.00 29.54 ? 162 ASP C CA  1 
ATOM   7891  C C   . ASP C 1 162 ? -17.372 32.341  103.192 1.00 29.13 ? 162 ASP C C   1 
ATOM   7892  O O   . ASP C 1 162 ? -16.612 31.488  103.615 1.00 29.39 ? 162 ASP C O   1 
ATOM   7893  C CB  . ASP C 1 162 ? -18.864 32.990  101.235 1.00 28.80 ? 162 ASP C CB  1 
ATOM   7894  C CG  . ASP C 1 162 ? -19.921 31.883  101.353 1.00 28.71 ? 162 ASP C CG  1 
ATOM   7895  O OD1 . ASP C 1 162 ? -19.738 30.888  102.096 1.00 26.45 ? 162 ASP C OD1 1 
ATOM   7896  O OD2 . ASP C 1 162 ? -20.983 32.008  100.692 1.00 27.36 ? 162 ASP C OD2 1 
ATOM   7897  N N   . GLU C 1 163 ? -18.178 33.051  103.986 1.00 29.59 ? 163 GLU C N   1 
ATOM   7898  C CA  . GLU C 1 163 ? -18.237 32.834  105.445 1.00 30.32 ? 163 GLU C CA  1 
ATOM   7899  C C   . GLU C 1 163 ? -18.702 31.441  105.854 1.00 30.00 ? 163 GLU C C   1 
ATOM   7900  O O   . GLU C 1 163 ? -18.459 31.031  106.995 1.00 29.19 ? 163 GLU C O   1 
ATOM   7901  C CB  . GLU C 1 163 ? -19.152 33.856  106.147 1.00 31.15 ? 163 GLU C CB  1 
ATOM   7902  C CG  . GLU C 1 163 ? -19.205 35.193  105.483 1.00 37.80 ? 163 GLU C CG  1 
ATOM   7903  C CD  . GLU C 1 163 ? -20.300 35.326  104.428 1.00 44.15 ? 163 GLU C CD  1 
ATOM   7904  O OE1 . GLU C 1 163 ? -19.953 35.323  103.207 1.00 44.25 ? 163 GLU C OE1 1 
ATOM   7905  O OE2 . GLU C 1 163 ? -21.488 35.461  104.838 1.00 44.94 ? 163 GLU C OE2 1 
ATOM   7906  N N   . SER C 1 164 ? -19.396 30.734  104.948 1.00 29.76 ? 164 SER C N   1 
ATOM   7907  C CA  . SER C 1 164 ? -19.863 29.363  105.186 1.00 29.05 ? 164 SER C CA  1 
ATOM   7908  C C   . SER C 1 164 ? -18.982 28.243  104.559 1.00 28.42 ? 164 SER C C   1 
ATOM   7909  O O   . SER C 1 164 ? -19.412 27.096  104.445 1.00 27.65 ? 164 SER C O   1 
ATOM   7910  C CB  . SER C 1 164 ? -21.309 29.222  104.683 1.00 29.37 ? 164 SER C CB  1 
ATOM   7911  O OG  . SER C 1 164 ? -22.229 29.862  105.544 1.00 31.49 ? 164 SER C OG  1 
ATOM   7912  N N   . GLY C 1 165 ? -17.766 28.580  104.160 1.00 27.35 ? 165 GLY C N   1 
ATOM   7913  C CA  . GLY C 1 165 ? -16.837 27.590  103.635 1.00 27.26 ? 165 GLY C CA  1 
ATOM   7914  C C   . GLY C 1 165 ? -16.910 27.590  102.127 1.00 26.58 ? 165 GLY C C   1 
ATOM   7915  O O   . GLY C 1 165 ? -17.330 28.584  101.521 1.00 25.89 ? 165 GLY C O   1 
ATOM   7916  N N   . ILE C 1 166 ? -16.523 26.489  101.490 1.00 25.73 ? 166 ILE C N   1 
ATOM   7917  C CA  . ILE C 1 166 ? -16.589 26.487  100.030 1.00 25.11 ? 166 ILE C CA  1 
ATOM   7918  C C   . ILE C 1 166 ? -18.073 26.539  99.572  1.00 24.74 ? 166 ILE C C   1 
ATOM   7919  O O   . ILE C 1 166 ? -18.988 26.001  100.239 1.00 22.31 ? 166 ILE C O   1 
ATOM   7920  C CB  . ILE C 1 166 ? -15.813 25.297  99.324  1.00 26.02 ? 166 ILE C CB  1 
ATOM   7921  C CG1 . ILE C 1 166 ? -16.692 24.100  99.186  1.00 24.90 ? 166 ILE C CG1 1 
ATOM   7922  C CG2 . ILE C 1 166 ? -14.554 24.892  100.038 1.00 26.55 ? 166 ILE C CG2 1 
ATOM   7923  C CD1 . ILE C 1 166 ? -17.320 23.974  97.853  1.00 30.74 ? 166 ILE C CD1 1 
ATOM   7924  N N   . VAL C 1 167 ? -18.273 27.199  98.433  1.00 25.00 ? 167 VAL C N   1 
ATOM   7925  C CA  . VAL C 1 167 ? -19.591 27.431  97.876  1.00 25.39 ? 167 VAL C CA  1 
ATOM   7926  C C   . VAL C 1 167 ? -19.895 26.287  96.908  1.00 25.28 ? 167 VAL C C   1 
ATOM   7927  O O   . VAL C 1 167 ? -19.217 26.146  95.896  1.00 26.19 ? 167 VAL C O   1 
ATOM   7928  C CB  . VAL C 1 167 ? -19.658 28.792  97.131  1.00 24.58 ? 167 VAL C CB  1 
ATOM   7929  C CG1 . VAL C 1 167 ? -21.099 29.023  96.514  1.00 25.03 ? 167 VAL C CG1 1 
ATOM   7930  C CG2 . VAL C 1 167 ? -19.242 29.939  98.066  1.00 23.53 ? 167 VAL C CG2 1 
ATOM   7931  N N   . PRO C 1 168 ? -20.879 25.433  97.237  1.00 26.89 ? 168 PRO C N   1 
ATOM   7932  C CA  . PRO C 1 168 ? -21.139 24.276  96.350  1.00 27.37 ? 168 PRO C CA  1 
ATOM   7933  C C   . PRO C 1 168 ? -21.416 24.633  94.878  1.00 29.14 ? 168 PRO C C   1 
ATOM   7934  O O   . PRO C 1 168 ? -20.962 23.909  93.971  1.00 29.34 ? 168 PRO C O   1 
ATOM   7935  C CB  . PRO C 1 168 ? -22.324 23.585  97.019  1.00 28.12 ? 168 PRO C CB  1 
ATOM   7936  C CG  . PRO C 1 168 ? -22.219 23.964  98.470  1.00 26.42 ? 168 PRO C CG  1 
ATOM   7937  C CD  . PRO C 1 168 ? -21.725 25.398  98.446  1.00 25.89 ? 168 PRO C CD  1 
ATOM   7938  N N   . ASP C 1 169 ? -22.114 25.752  94.625  1.00 29.67 ? 169 ASP C N   1 
ATOM   7939  C CA  . ASP C 1 169 ? -22.351 26.199  93.230  1.00 30.37 ? 169 ASP C CA  1 
ATOM   7940  C C   . ASP C 1 169 ? -21.067 26.509  92.473  1.00 29.17 ? 169 ASP C C   1 
ATOM   7941  O O   . ASP C 1 169 ? -21.009 26.350  91.247  1.00 30.06 ? 169 ASP C O   1 
ATOM   7942  C CB  . ASP C 1 169 ? -23.258 27.439  93.159  1.00 30.88 ? 169 ASP C CB  1 
ATOM   7943  C CG  . ASP C 1 169 ? -24.714 27.140  93.473  1.00 35.10 ? 169 ASP C CG  1 
ATOM   7944  O OD1 . ASP C 1 169 ? -25.100 25.958  93.611  1.00 39.46 ? 169 ASP C OD1 1 
ATOM   7945  O OD2 . ASP C 1 169 ? -25.507 28.111  93.552  1.00 40.72 ? 169 ASP C OD2 1 
ATOM   7946  N N   . SER C 1 170 ? -20.038 26.969  93.177  1.00 28.98 ? 170 SER C N   1 
ATOM   7947  C CA  . SER C 1 170 ? -18.739 27.194  92.525  1.00 27.34 ? 170 SER C CA  1 
ATOM   7948  C C   . SER C 1 170 ? -18.033 25.870  92.155  1.00 27.09 ? 170 SER C C   1 
ATOM   7949  O O   . SER C 1 170 ? -17.448 25.738  91.048  1.00 25.67 ? 170 SER C O   1 
ATOM   7950  C CB  . SER C 1 170 ? -17.868 28.080  93.397  1.00 27.20 ? 170 SER C CB  1 
ATOM   7951  O OG  . SER C 1 170 ? -16.518 28.066  92.974  1.00 27.05 ? 170 SER C OG  1 
ATOM   7952  N N   . LEU C 1 171 ? -18.089 24.905  93.085  1.00 26.66 ? 171 LEU C N   1 
ATOM   7953  C CA  . LEU C 1 171 ? -17.644 23.526  92.842  1.00 27.13 ? 171 LEU C CA  1 
ATOM   7954  C C   . LEU C 1 171 ? -18.346 22.931  91.585  1.00 27.63 ? 171 LEU C C   1 
ATOM   7955  O O   . LEU C 1 171 ? -17.692 22.498  90.621  1.00 27.37 ? 171 LEU C O   1 
ATOM   7956  C CB  . LEU C 1 171 ? -17.892 22.652  94.092  1.00 25.85 ? 171 LEU C CB  1 
ATOM   7957  C CG  . LEU C 1 171 ? -17.320 21.210  94.066  1.00 26.39 ? 171 LEU C CG  1 
ATOM   7958  C CD1 . LEU C 1 171 ? -15.840 21.116  93.580  1.00 23.73 ? 171 LEU C CD1 1 
ATOM   7959  C CD2 . LEU C 1 171 ? -17.460 20.579  95.424  1.00 23.78 ? 171 LEU C CD2 1 
ATOM   7960  N N   . ARG C 1 172 ? -19.674 22.945  91.617  1.00 28.78 ? 172 ARG C N   1 
ATOM   7961  C CA  . ARG C 1 172 ? -20.511 22.510  90.504  1.00 31.21 ? 172 ARG C CA  1 
ATOM   7962  C C   . ARG C 1 172 ? -20.004 23.156  89.210  1.00 31.50 ? 172 ARG C C   1 
ATOM   7963  O O   . ARG C 1 172 ? -19.696 22.451  88.229  1.00 31.23 ? 172 ARG C O   1 
ATOM   7964  C CB  . ARG C 1 172 ? -21.960 22.931  90.778  1.00 31.12 ? 172 ARG C CB  1 
ATOM   7965  C CG  . ARG C 1 172 ? -22.987 21.952  90.282  1.00 35.65 ? 172 ARG C CG  1 
ATOM   7966  C CD  . ARG C 1 172 ? -24.355 22.211  90.905  1.00 42.18 ? 172 ARG C CD  1 
ATOM   7967  N NE  . ARG C 1 172 ? -24.569 21.491  92.178  1.00 46.28 ? 172 ARG C NE  1 
ATOM   7968  C CZ  . ARG C 1 172 ? -24.728 22.080  93.362  1.00 46.28 ? 172 ARG C CZ  1 
ATOM   7969  N NH1 . ARG C 1 172 ? -24.685 23.401  93.465  1.00 47.45 ? 172 ARG C NH1 1 
ATOM   7970  N NH2 . ARG C 1 172 ? -24.931 21.348  94.442  1.00 47.91 ? 172 ARG C NH2 1 
ATOM   7971  N N   . ASP C 1 173 ? -19.852 24.485  89.241  1.00 31.83 ? 173 ASP C N   1 
ATOM   7972  C CA  . ASP C 1 173 ? -19.570 25.244  88.032  1.00 32.11 ? 173 ASP C CA  1 
ATOM   7973  C C   . ASP C 1 173 ? -18.276 24.760  87.432  1.00 31.71 ? 173 ASP C C   1 
ATOM   7974  O O   . ASP C 1 173 ? -18.243 24.420  86.258  1.00 31.14 ? 173 ASP C O   1 
ATOM   7975  C CB  . ASP C 1 173 ? -19.510 26.767  88.298  1.00 32.70 ? 173 ASP C CB  1 
ATOM   7976  C CG  . ASP C 1 173 ? -20.901 27.411  88.385  1.00 36.05 ? 173 ASP C CG  1 
ATOM   7977  O OD1 . ASP C 1 173 ? -21.916 26.680  88.397  1.00 39.28 ? 173 ASP C OD1 1 
ATOM   7978  O OD2 . ASP C 1 173 ? -20.977 28.661  88.468  1.00 41.98 ? 173 ASP C OD2 1 
ATOM   7979  N N   . ILE C 1 174 ? -17.213 24.710  88.239  1.00 31.49 ? 174 ILE C N   1 
ATOM   7980  C CA  . ILE C 1 174 ? -15.934 24.283  87.704  1.00 32.21 ? 174 ILE C CA  1 
ATOM   7981  C C   . ILE C 1 174 ? -15.930 22.798  87.259  1.00 30.67 ? 174 ILE C C   1 
ATOM   7982  O O   . ILE C 1 174 ? -15.272 22.474  86.279  1.00 30.66 ? 174 ILE C O   1 
ATOM   7983  C CB  . ILE C 1 174 ? -14.671 24.640  88.600  1.00 32.88 ? 174 ILE C CB  1 
ATOM   7984  C CG1 . ILE C 1 174 ? -14.314 23.511  89.537  1.00 33.86 ? 174 ILE C CG1 1 
ATOM   7985  C CG2 . ILE C 1 174 ? -14.740 26.015  89.265  1.00 33.34 ? 174 ILE C CG2 1 
ATOM   7986  C CD1 . ILE C 1 174 ? -13.195 22.690  88.999  1.00 38.84 ? 174 ILE C CD1 1 
ATOM   7987  N N   . LEU C 1 175 ? -16.661 21.915  87.953  1.00 29.63 ? 175 LEU C N   1 
ATOM   7988  C CA  . LEU C 1 175 ? -16.709 20.502  87.527  1.00 28.99 ? 175 LEU C CA  1 
ATOM   7989  C C   . LEU C 1 175 ? -17.434 20.306  86.182  1.00 29.94 ? 175 LEU C C   1 
ATOM   7990  O O   . LEU C 1 175 ? -17.210 19.294  85.496  1.00 29.67 ? 175 LEU C O   1 
ATOM   7991  C CB  . LEU C 1 175 ? -17.324 19.593  88.599  1.00 27.42 ? 175 LEU C CB  1 
ATOM   7992  C CG  . LEU C 1 175 ? -16.477 19.407  89.888  1.00 25.81 ? 175 LEU C CG  1 
ATOM   7993  C CD1 . LEU C 1 175 ? -17.355 18.985  91.040  1.00 24.50 ? 175 LEU C CD1 1 
ATOM   7994  C CD2 . LEU C 1 175 ? -15.306 18.408  89.701  1.00 22.82 ? 175 LEU C CD2 1 
ATOM   7995  N N   . SER C 1 176 ? -18.288 21.272  85.824  1.00 30.80 ? 176 SER C N   1 
ATOM   7996  C CA  . SER C 1 176 ? -19.106 21.233  84.571  1.00 31.67 ? 176 SER C CA  1 
ATOM   7997  C C   . SER C 1 176 ? -18.260 21.244  83.302  1.00 32.75 ? 176 SER C C   1 
ATOM   7998  O O   . SER C 1 176 ? -18.760 20.932  82.213  1.00 33.66 ? 176 SER C O   1 
ATOM   7999  C CB  . SER C 1 176 ? -20.108 22.399  84.535  1.00 30.98 ? 176 SER C CB  1 
ATOM   8000  O OG  . SER C 1 176 ? -19.468 23.636  84.182  1.00 29.78 ? 176 SER C OG  1 
ATOM   8001  N N   . ARG C 1 177 ? -16.981 21.582  83.425  1.00 34.07 ? 177 ARG C N   1 
ATOM   8002  C CA  . ARG C 1 177 ? -16.089 21.487  82.274  1.00 35.23 ? 177 ARG C CA  1 
ATOM   8003  C C   . ARG C 1 177 ? -15.721 20.028  81.897  1.00 35.62 ? 177 ARG C C   1 
ATOM   8004  O O   . ARG C 1 177 ? -15.301 19.764  80.766  1.00 36.07 ? 177 ARG C O   1 
ATOM   8005  C CB  . ARG C 1 177 ? -14.851 22.339  82.477  1.00 36.04 ? 177 ARG C CB  1 
ATOM   8006  C CG  . ARG C 1 177 ? -13.744 21.641  83.200  1.00 38.24 ? 177 ARG C CG  1 
ATOM   8007  C CD  . ARG C 1 177 ? -12.927 22.680  83.886  1.00 43.65 ? 177 ARG C CD  1 
ATOM   8008  N NE  . ARG C 1 177 ? -11.507 22.407  83.737  1.00 45.81 ? 177 ARG C NE  1 
ATOM   8009  C CZ  . ARG C 1 177 ? -10.546 23.102  84.353  1.00 46.11 ? 177 ARG C CZ  1 
ATOM   8010  N NH1 . ARG C 1 177 ? -10.880 24.117  85.177  1.00 40.20 ? 177 ARG C NH1 1 
ATOM   8011  N NH2 . ARG C 1 177 ? -9.261  22.768  84.135  1.00 41.73 ? 177 ARG C NH2 1 
ATOM   8012  N N   . TRP C 1 178 ? -15.899 19.096  82.830  1.00 35.21 ? 178 TRP C N   1 
ATOM   8013  C CA  . TRP C 1 178 ? -15.778 17.679  82.529  1.00 35.73 ? 178 TRP C CA  1 
ATOM   8014  C C   . TRP C 1 178 ? -17.186 17.113  82.485  1.00 35.50 ? 178 TRP C C   1 
ATOM   8015  O O   . TRP C 1 178 ? -18.111 17.743  82.975  1.00 34.08 ? 178 TRP C O   1 
ATOM   8016  C CB  . TRP C 1 178 ? -14.955 16.964  83.610  1.00 35.89 ? 178 TRP C CB  1 
ATOM   8017  C CG  . TRP C 1 178 ? -13.948 17.840  84.337  1.00 38.04 ? 178 TRP C CG  1 
ATOM   8018  C CD1 . TRP C 1 178 ? -14.180 18.689  85.422  1.00 39.37 ? 178 TRP C CD1 1 
ATOM   8019  C CD2 . TRP C 1 178 ? -12.568 17.929  84.067  1.00 37.34 ? 178 TRP C CD2 1 
ATOM   8020  N NE1 . TRP C 1 178 ? -13.018 19.302  85.804  1.00 38.92 ? 178 TRP C NE1 1 
ATOM   8021  C CE2 . TRP C 1 178 ? -12.013 18.852  84.987  1.00 39.43 ? 178 TRP C CE2 1 
ATOM   8022  C CE3 . TRP C 1 178 ? -11.744 17.336  83.123  1.00 37.07 ? 178 TRP C CE3 1 
ATOM   8023  C CZ2 . TRP C 1 178 ? -10.674 19.178  84.988  1.00 40.14 ? 178 TRP C CZ2 1 
ATOM   8024  C CZ3 . TRP C 1 178 ? -10.430 17.664  83.118  1.00 41.13 ? 178 TRP C CZ3 1 
ATOM   8025  C CH2 . TRP C 1 178 ? -9.897  18.577  84.041  1.00 43.06 ? 178 TRP C CH2 1 
ATOM   8026  N N   . LYS C 1 179 ? -17.362 15.949  81.867  1.00 36.61 ? 179 LYS C N   1 
ATOM   8027  C CA  . LYS C 1 179 ? -18.588 15.173  82.077  1.00 36.74 ? 179 LYS C CA  1 
ATOM   8028  C C   . LYS C 1 179 ? -18.315 14.093  83.107  1.00 35.80 ? 179 LYS C C   1 
ATOM   8029  O O   . LYS C 1 179 ? -17.178 13.651  83.241  1.00 34.55 ? 179 LYS C O   1 
ATOM   8030  C CB  . LYS C 1 179 ? -19.164 14.569  80.786  1.00 37.72 ? 179 LYS C CB  1 
ATOM   8031  C CG  . LYS C 1 179 ? -18.229 14.463  79.617  1.00 40.04 ? 179 LYS C CG  1 
ATOM   8032  C CD  . LYS C 1 179 ? -19.023 14.390  78.324  1.00 45.50 ? 179 LYS C CD  1 
ATOM   8033  C CE  . LYS C 1 179 ? -19.296 15.790  77.740  1.00 49.45 ? 179 LYS C CE  1 
ATOM   8034  N NZ  . LYS C 1 179 ? -20.400 15.762  76.722  1.00 47.89 ? 179 LYS C NZ  1 
ATOM   8035  N N   . PRO C 1 180 ? -19.361 13.692  83.864  1.00 36.14 ? 180 PRO C N   1 
ATOM   8036  C CA  . PRO C 1 180 ? -19.197 12.680  84.905  1.00 35.59 ? 180 PRO C CA  1 
ATOM   8037  C C   . PRO C 1 180 ? -18.387 11.462  84.447  1.00 36.18 ? 180 PRO C C   1 
ATOM   8038  O O   . PRO C 1 180 ? -17.492 10.991  85.181  1.00 35.59 ? 180 PRO C O   1 
ATOM   8039  C CB  . PRO C 1 180 ? -20.644 12.326  85.277  1.00 36.26 ? 180 PRO C CB  1 
ATOM   8040  C CG  . PRO C 1 180 ? -21.392 13.622  85.068  1.00 35.55 ? 180 PRO C CG  1 
ATOM   8041  C CD  . PRO C 1 180 ? -20.755 14.194  83.802  1.00 35.98 ? 180 PRO C CD  1 
ATOM   8042  N N   . GLU C 1 181 ? -18.618 10.991  83.219  1.00 35.62 ? 181 GLU C N   1 
ATOM   8043  C CA  . GLU C 1 181 ? -17.945 9.769   82.776  1.00 35.44 ? 181 GLU C CA  1 
ATOM   8044  C C   . GLU C 1 181 ? -16.452 9.951   82.463  1.00 34.34 ? 181 GLU C C   1 
ATOM   8045  O O   . GLU C 1 181 ? -15.742 8.960   82.324  1.00 33.32 ? 181 GLU C O   1 
ATOM   8046  C CB  . GLU C 1 181 ? -18.681 9.121   81.584  1.00 36.75 ? 181 GLU C CB  1 
ATOM   8047  C CG  . GLU C 1 181 ? -18.669 9.964   80.318  1.00 38.70 ? 181 GLU C CG  1 
ATOM   8048  C CD  . GLU C 1 181 ? -19.921 10.846  80.151  1.00 44.64 ? 181 GLU C CD  1 
ATOM   8049  O OE1 . GLU C 1 181 ? -20.555 11.273  81.178  1.00 43.76 ? 181 GLU C OE1 1 
ATOM   8050  O OE2 . GLU C 1 181 ? -20.257 11.105  78.967  1.00 44.61 ? 181 GLU C OE2 1 
ATOM   8051  N N   . ASP C 1 182 ? -15.976 11.197  82.377  1.00 33.28 ? 182 ASP C N   1 
ATOM   8052  C CA  . ASP C 1 182 ? -14.554 11.462  82.109  1.00 33.41 ? 182 ASP C CA  1 
ATOM   8053  C C   . ASP C 1 182 ? -13.624 10.913  83.218  1.00 33.16 ? 182 ASP C C   1 
ATOM   8054  O O   . ASP C 1 182 ? -12.417 10.685  82.987  1.00 32.66 ? 182 ASP C O   1 
ATOM   8055  C CB  . ASP C 1 182 ? -14.276 12.961  81.903  1.00 34.01 ? 182 ASP C CB  1 
ATOM   8056  C CG  . ASP C 1 182 ? -14.909 13.530  80.635  1.00 34.21 ? 182 ASP C CG  1 
ATOM   8057  O OD1 . ASP C 1 182 ? -15.206 12.750  79.708  1.00 33.17 ? 182 ASP C OD1 1 
ATOM   8058  O OD2 . ASP C 1 182 ? -15.091 14.782  80.581  1.00 35.14 ? 182 ASP C OD2 1 
ATOM   8059  N N   . ALA C 1 183 ? -14.212 10.705  84.401  1.00 33.25 ? 183 ALA C N   1 
ATOM   8060  C CA  . ALA C 1 183 ? -13.547 10.167  85.584  1.00 34.26 ? 183 ALA C CA  1 
ATOM   8061  C C   . ALA C 1 183 ? -13.097 8.744   85.340  1.00 35.39 ? 183 ALA C C   1 
ATOM   8062  O O   . ALA C 1 183 ? -12.117 8.289   85.930  1.00 34.64 ? 183 ALA C O   1 
ATOM   8063  C CB  . ALA C 1 183 ? -14.475 10.212  86.760  1.00 33.75 ? 183 ALA C CB  1 
ATOM   8064  N N   . LYS C 1 184 ? -13.820 8.048   84.466  1.00 36.89 ? 184 LYS C N   1 
ATOM   8065  C CA  . LYS C 1 184 ? -13.463 6.679   84.088  1.00 40.22 ? 184 LYS C CA  1 
ATOM   8066  C C   . LYS C 1 184 ? -12.389 6.654   83.014  1.00 41.57 ? 184 LYS C C   1 
ATOM   8067  O O   . LYS C 1 184 ? -11.719 5.636   82.824  1.00 42.14 ? 184 LYS C O   1 
ATOM   8068  C CB  . LYS C 1 184 ? -14.693 5.902   83.604  1.00 39.77 ? 184 LYS C CB  1 
ATOM   8069  C CG  . LYS C 1 184 ? -15.736 5.653   84.680  1.00 42.63 ? 184 LYS C CG  1 
ATOM   8070  C CD  . LYS C 1 184 ? -16.767 4.610   84.235  1.00 47.50 ? 184 LYS C CD  1 
ATOM   8071  C CE  . LYS C 1 184 ? -17.979 5.213   83.470  1.00 50.20 ? 184 LYS C CE  1 
ATOM   8072  N NZ  . LYS C 1 184 ? -18.971 4.136   83.046  1.00 49.13 ? 184 LYS C NZ  1 
ATOM   8073  N N   . ASN C 1 185 ? -12.234 7.785   82.326  1.00 42.85 ? 185 ASN C N   1 
ATOM   8074  C CA  . ASN C 1 185 ? -11.403 7.901   81.128  1.00 44.82 ? 185 ASN C CA  1 
ATOM   8075  C C   . ASN C 1 185 ? -9.959  8.158   81.543  1.00 46.34 ? 185 ASN C C   1 
ATOM   8076  O O   . ASN C 1 185 ? -9.659  9.240   82.080  1.00 45.98 ? 185 ASN C O   1 
ATOM   8077  C CB  . ASN C 1 185 ? -11.914 9.052   80.244  1.00 44.42 ? 185 ASN C CB  1 
ATOM   8078  C CG  . ASN C 1 185 ? -11.267 9.096   78.849  1.00 45.28 ? 185 ASN C CG  1 
ATOM   8079  O OD1 . ASN C 1 185 ? -10.061 8.866   78.670  1.00 44.55 ? 185 ASN C OD1 1 
ATOM   8080  N ND2 . ASN C 1 185 ? -12.086 9.431   77.850  1.00 44.79 ? 185 ASN C ND2 1 
ATOM   8081  N N   . PRO C 1 186 ? -9.057  7.181   81.250  1.00 47.60 ? 186 PRO C N   1 
ATOM   8082  C CA  . PRO C 1 186 ? -7.701  7.156   81.774  1.00 48.55 ? 186 PRO C CA  1 
ATOM   8083  C C   . PRO C 1 186 ? -7.298  8.530   82.317  1.00 48.56 ? 186 PRO C C   1 
ATOM   8084  O O   . PRO C 1 186 ? -7.059  8.659   83.519  1.00 49.39 ? 186 PRO C O   1 
ATOM   8085  C CB  . PRO C 1 186 ? -6.879  6.725   80.543  1.00 48.88 ? 186 PRO C CB  1 
ATOM   8086  C CG  . PRO C 1 186 ? -7.832  5.713   79.833  1.00 49.18 ? 186 PRO C CG  1 
ATOM   8087  C CD  . PRO C 1 186 ? -9.269  6.049   80.321  1.00 47.85 ? 186 PRO C CD  1 
ATOM   8088  N N   . GLN C 1 187 ? -7.226  9.537   81.442  1.00 47.94 ? 187 GLN C N   1 
ATOM   8089  C CA  . GLN C 1 187 ? -7.194  10.941  81.871  1.00 46.63 ? 187 GLN C CA  1 
ATOM   8090  C C   . GLN C 1 187 ? -7.790  11.890  80.794  1.00 45.13 ? 187 GLN C C   1 
ATOM   8091  O O   . GLN C 1 187 ? -7.153  12.328  79.814  1.00 45.08 ? 187 GLN C O   1 
ATOM   8092  C CB  . GLN C 1 187 ? -5.815  11.415  82.379  1.00 46.93 ? 187 GLN C CB  1 
ATOM   8093  C CG  . GLN C 1 187 ? -5.308  10.780  83.695  1.00 48.54 ? 187 GLN C CG  1 
ATOM   8094  C CD  . GLN C 1 187 ? -5.913  11.376  84.992  1.00 50.18 ? 187 GLN C CD  1 
ATOM   8095  O OE1 . GLN C 1 187 ? -7.082  11.126  85.344  1.00 51.84 ? 187 GLN C OE1 1 
ATOM   8096  N NE2 . GLN C 1 187 ? -5.098  12.140  85.712  1.00 50.81 ? 187 GLN C NE2 1 
ATOM   8097  N N   . LYS C 1 188 ? -9.070  12.126  80.987  1.00 42.73 ? 188 LYS C N   1 
ATOM   8098  C CA  . LYS C 1 188 ? -9.652  13.411  80.728  1.00 40.16 ? 188 LYS C CA  1 
ATOM   8099  C C   . LYS C 1 188 ? -9.230  14.310  81.912  1.00 38.37 ? 188 LYS C C   1 
ATOM   8100  O O   . LYS C 1 188 ? -9.717  15.437  82.069  1.00 37.67 ? 188 LYS C O   1 
ATOM   8101  C CB  . LYS C 1 188 ? -11.158 13.239  80.629  1.00 40.45 ? 188 LYS C CB  1 
ATOM   8102  C CG  . LYS C 1 188 ? -11.636 12.698  79.276  1.00 40.29 ? 188 LYS C CG  1 
ATOM   8103  C CD  . LYS C 1 188 ? -12.025 13.869  78.384  1.00 42.72 ? 188 LYS C CD  1 
ATOM   8104  C CE  . LYS C 1 188 ? -12.602 13.450  77.042  1.00 44.50 ? 188 LYS C CE  1 
ATOM   8105  N NZ  . LYS C 1 188 ? -11.504 13.252  76.031  1.00 47.31 ? 188 LYS C NZ  1 
ATOM   8106  N N   . ASN C 1 189 ? -8.278  13.809  82.713  1.00 36.13 ? 189 ASN C N   1 
ATOM   8107  C CA  . ASN C 1 189 ? -7.708  14.525  83.862  1.00 33.76 ? 189 ASN C CA  1 
ATOM   8108  C C   . ASN C 1 189 ? -8.742  15.108  84.832  1.00 31.61 ? 189 ASN C C   1 
ATOM   8109  O O   . ASN C 1 189 ? -8.620  16.259  85.270  1.00 31.66 ? 189 ASN C O   1 
ATOM   8110  C CB  . ASN C 1 189 ? -6.711  15.614  83.408  1.00 34.62 ? 189 ASN C CB  1 
ATOM   8111  C CG  . ASN C 1 189 ? -5.444  15.641  84.264  1.00 37.91 ? 189 ASN C CG  1 
ATOM   8112  O OD1 . ASN C 1 189 ? -5.111  14.654  84.944  1.00 42.03 ? 189 ASN C OD1 1 
ATOM   8113  N ND2 . ASN C 1 189 ? -4.725  16.771  84.234  1.00 38.59 ? 189 ASN C ND2 1 
ATOM   8114  N N   . THR C 1 190 ? -9.773  14.336  85.152  1.00 30.00 ? 190 THR C N   1 
ATOM   8115  C CA  . THR C 1 190 ? -10.756 14.821  86.130  1.00 28.23 ? 190 THR C CA  1 
ATOM   8116  C C   . THR C 1 190 ? -10.066 14.997  87.522  1.00 27.42 ? 190 THR C C   1 
ATOM   8117  O O   . THR C 1 190 ? -9.085  14.293  87.820  1.00 26.36 ? 190 THR C O   1 
ATOM   8118  C CB  . THR C 1 190 ? -11.979 13.914  86.202  1.00 28.56 ? 190 THR C CB  1 
ATOM   8119  O OG1 . THR C 1 190 ? -11.572 12.580  86.517  1.00 28.89 ? 190 THR C OG1 1 
ATOM   8120  C CG2 . THR C 1 190 ? -12.780 13.950  84.860  1.00 25.27 ? 190 THR C CG2 1 
ATOM   8121  N N   . PRO C 1 191 ? -10.539 15.963  88.357  1.00 26.17 ? 191 PRO C N   1 
ATOM   8122  C CA  . PRO C 1 191 ? -9.883  16.078  89.673  1.00 25.16 ? 191 PRO C CA  1 
ATOM   8123  C C   . PRO C 1 191 ? -9.783  14.774  90.475  1.00 24.51 ? 191 PRO C C   1 
ATOM   8124  O O   . PRO C 1 191 ? -10.731 13.943  90.505  1.00 25.22 ? 191 PRO C O   1 
ATOM   8125  C CB  . PRO C 1 191 ? -10.715 17.159  90.400  1.00 24.98 ? 191 PRO C CB  1 
ATOM   8126  C CG  . PRO C 1 191 ? -11.222 18.029  89.266  1.00 27.13 ? 191 PRO C CG  1 
ATOM   8127  C CD  . PRO C 1 191 ? -11.582 16.994  88.185  1.00 25.81 ? 191 PRO C CD  1 
ATOM   8128  N N   . LYS C 1 192 ? -8.597  14.572  91.045  1.00 23.40 ? 192 LYS C N   1 
ATOM   8129  C CA  . LYS C 1 192 ? -8.322  13.421  91.904  1.00 23.49 ? 192 LYS C CA  1 
ATOM   8130  C C   . LYS C 1 192 ? -9.010  13.596  93.276  1.00 21.87 ? 192 LYS C C   1 
ATOM   8131  O O   . LYS C 1 192 ? -9.535  12.636  93.809  1.00 21.04 ? 192 LYS C O   1 
ATOM   8132  C CB  . LYS C 1 192 ? -6.800  13.244  92.089  1.00 23.21 ? 192 LYS C CB  1 
ATOM   8133  C CG  . LYS C 1 192 ? -6.231  12.043  91.237  1.00 27.93 ? 192 LYS C CG  1 
ATOM   8134  C CD  . LYS C 1 192 ? -5.986  12.334  89.823  1.00 30.40 ? 192 LYS C CD  1 
ATOM   8135  C CE  . LYS C 1 192 ? -5.548  11.027  89.089  1.00 31.78 ? 192 LYS C CE  1 
ATOM   8136  N NZ  . LYS C 1 192 ? -4.116  10.665  89.336  1.00 32.28 ? 192 LYS C NZ  1 
ATOM   8137  N N   . PHE C 1 193 ? -9.001  14.826  93.806  1.00 21.68 ? 193 PHE C N   1 
ATOM   8138  C CA  . PHE C 1 193 ? -9.538  15.128  95.156  1.00 19.33 ? 193 PHE C CA  1 
ATOM   8139  C C   . PHE C 1 193 ? -9.898  16.566  95.374  1.00 19.72 ? 193 PHE C C   1 
ATOM   8140  O O   . PHE C 1 193 ? -9.326  17.449  94.733  1.00 20.22 ? 193 PHE C O   1 
ATOM   8141  C CB  . PHE C 1 193 ? -8.619  14.657  96.321  1.00 20.13 ? 193 PHE C CB  1 
ATOM   8142  C CG  . PHE C 1 193 ? -7.259  15.352  96.448  1.00 17.04 ? 193 PHE C CG  1 
ATOM   8143  C CD1 . PHE C 1 193 ? -6.121  14.704  96.026  1.00 22.02 ? 193 PHE C CD1 1 
ATOM   8144  C CD2 . PHE C 1 193 ? -7.122  16.629  97.009  1.00 17.41 ? 193 PHE C CD2 1 
ATOM   8145  C CE1 . PHE C 1 193 ? -4.866  15.258  96.195  1.00 17.79 ? 193 PHE C CE1 1 
ATOM   8146  C CE2 . PHE C 1 193 ? -5.881  17.223  97.204  1.00 21.69 ? 193 PHE C CE2 1 
ATOM   8147  C CZ  . PHE C 1 193 ? -4.734  16.538  96.792  1.00 21.00 ? 193 PHE C CZ  1 
ATOM   8148  N N   . LEU C 1 194 ? -10.845 16.784  96.292  1.00 18.96 ? 194 LEU C N   1 
ATOM   8149  C CA  . LEU C 1 194 ? -11.049 18.093  96.914  1.00 19.29 ? 194 LEU C CA  1 
ATOM   8150  C C   . LEU C 1 194 ? -10.434 18.029  98.321  1.00 18.52 ? 194 LEU C C   1 
ATOM   8151  O O   . LEU C 1 194 ? -10.662 17.072  99.062  1.00 18.92 ? 194 LEU C O   1 
ATOM   8152  C CB  . LEU C 1 194 ? -12.543 18.419  96.993  1.00 18.92 ? 194 LEU C CB  1 
ATOM   8153  C CG  . LEU C 1 194 ? -12.949 19.593  97.891  1.00 18.54 ? 194 LEU C CG  1 
ATOM   8154  C CD1 . LEU C 1 194 ? -12.743 20.928  97.188  1.00 19.47 ? 194 LEU C CD1 1 
ATOM   8155  C CD2 . LEU C 1 194 ? -14.382 19.426  98.308  1.00 24.83 ? 194 LEU C CD2 1 
ATOM   8156  N N   . TYR C 1 195 ? -9.649  19.046  98.658  1.00 19.25 ? 195 TYR C N   1 
ATOM   8157  C CA  . TYR C 1 195 ? -9.112  19.226  99.998  1.00 19.62 ? 195 TYR C CA  1 
ATOM   8158  C C   . TYR C 1 195 ? -9.824  20.391  100.674 1.00 20.16 ? 195 TYR C C   1 
ATOM   8159  O O   . TYR C 1 195 ? -9.976  21.467  100.088 1.00 20.86 ? 195 TYR C O   1 
ATOM   8160  C CB  . TYR C 1 195 ? -7.615  19.503  99.911  1.00 18.36 ? 195 TYR C CB  1 
ATOM   8161  C CG  . TYR C 1 195 ? -7.018  20.062  101.178 1.00 20.62 ? 195 TYR C CG  1 
ATOM   8162  C CD1 . TYR C 1 195 ? -6.456  19.214  102.142 1.00 19.08 ? 195 TYR C CD1 1 
ATOM   8163  C CD2 . TYR C 1 195 ? -6.994  21.437  101.410 1.00 19.43 ? 195 TYR C CD2 1 
ATOM   8164  C CE1 . TYR C 1 195 ? -5.903  19.742  103.316 1.00 21.39 ? 195 TYR C CE1 1 
ATOM   8165  C CE2 . TYR C 1 195 ? -6.477  21.966  102.601 1.00 21.13 ? 195 TYR C CE2 1 
ATOM   8166  C CZ  . TYR C 1 195 ? -5.933  21.095  103.536 1.00 18.39 ? 195 TYR C CZ  1 
ATOM   8167  O OH  . TYR C 1 195 ? -5.393  21.550  104.687 1.00 19.99 ? 195 TYR C OH  1 
ATOM   8168  N N   . THR C 1 196 ? -10.287 20.200  101.899 1.00 21.25 ? 196 THR C N   1 
ATOM   8169  C CA  . THR C 1 196 ? -10.777 21.356  102.666 1.00 21.41 ? 196 THR C CA  1 
ATOM   8170  C C   . THR C 1 196 ? -10.569 21.146  104.141 1.00 21.17 ? 196 THR C C   1 
ATOM   8171  O O   . THR C 1 196 ? -10.437 20.009  104.606 1.00 19.71 ? 196 THR C O   1 
ATOM   8172  C CB  . THR C 1 196 ? -12.297 21.710  102.290 1.00 23.02 ? 196 THR C CB  1 
ATOM   8173  O OG1 . THR C 1 196 ? -12.663 23.033  102.747 1.00 26.53 ? 196 THR C OG1 1 
ATOM   8174  C CG2 . THR C 1 196 ? -13.271 20.680  102.807 1.00 23.58 ? 196 THR C CG2 1 
ATOM   8175  N N   . VAL C 1 197 ? -10.545 22.254  104.875 1.00 20.04 ? 197 VAL C N   1 
ATOM   8176  C CA  . VAL C 1 197 ? -10.546 22.205  106.316 1.00 19.70 ? 197 VAL C CA  1 
ATOM   8177  C C   . VAL C 1 197 ? -11.915 22.706  106.754 1.00 20.37 ? 197 VAL C C   1 
ATOM   8178  O O   . VAL C 1 197 ? -12.181 23.908  106.657 1.00 22.64 ? 197 VAL C O   1 
ATOM   8179  C CB  . VAL C 1 197 ? -9.422  23.113  106.871 1.00 19.48 ? 197 VAL C CB  1 
ATOM   8180  C CG1 . VAL C 1 197 ? -9.576  23.331  108.414 1.00 18.34 ? 197 VAL C CG1 1 
ATOM   8181  C CG2 . VAL C 1 197 ? -8.040  22.595  106.421 1.00 18.81 ? 197 VAL C CG2 1 
ATOM   8182  N N   . PRO C 1 198 ? -12.808 21.796  107.149 1.00 21.20 ? 198 PRO C N   1 
ATOM   8183  C CA  . PRO C 1 198 ? -14.216 22.184  107.238 1.00 22.02 ? 198 PRO C CA  1 
ATOM   8184  C C   . PRO C 1 198 ? -14.587 23.003  108.464 1.00 21.67 ? 198 PRO C C   1 
ATOM   8185  O O   . PRO C 1 198 ? -15.652 23.619  108.447 1.00 21.36 ? 198 PRO C O   1 
ATOM   8186  C CB  . PRO C 1 198 ? -14.966 20.831  107.307 1.00 22.76 ? 198 PRO C CB  1 
ATOM   8187  C CG  . PRO C 1 198 ? -13.942 19.786  107.060 1.00 23.78 ? 198 PRO C CG  1 
ATOM   8188  C CD  . PRO C 1 198 ? -12.616 20.365  107.442 1.00 21.21 ? 198 PRO C CD  1 
ATOM   8189  N N   . ASN C 1 199 ? -13.743 22.988  109.501 1.00 20.44 ? 199 ASN C N   1 
ATOM   8190  C CA  . ASN C 1 199 ? -14.032 23.679  110.762 1.00 21.06 ? 199 ASN C CA  1 
ATOM   8191  C C   . ASN C 1 199 ? -12.864 24.564  111.103 1.00 20.74 ? 199 ASN C C   1 
ATOM   8192  O O   . ASN C 1 199 ? -11.717 24.078  111.137 1.00 19.77 ? 199 ASN C O   1 
ATOM   8193  C CB  . ASN C 1 199 ? -14.259 22.693  111.927 1.00 19.86 ? 199 ASN C CB  1 
ATOM   8194  C CG  . ASN C 1 199 ? -15.493 21.862  111.744 1.00 20.92 ? 199 ASN C CG  1 
ATOM   8195  O OD1 . ASN C 1 199 ? -16.618 22.362  111.812 1.00 24.48 ? 199 ASN C OD1 1 
ATOM   8196  N ND2 . ASN C 1 199 ? -15.297 20.576  111.463 1.00 14.31 ? 199 ASN C ND2 1 
ATOM   8197  N N   . GLY C 1 200 ? -13.131 25.864  111.248 1.00 20.85 ? 200 GLY C N   1 
ATOM   8198  C CA  . GLY C 1 200 ? -12.088 26.805  111.660 1.00 20.67 ? 200 GLY C CA  1 
ATOM   8199  C C   . GLY C 1 200 ? -10.934 26.868  110.689 1.00 21.23 ? 200 GLY C C   1 
ATOM   8200  O O   . GLY C 1 200 ? -9.784  26.866  111.091 1.00 20.66 ? 200 GLY C O   1 
ATOM   8201  N N   . ASN C 1 201 ? -11.234 26.975  109.401 1.00 21.12 ? 201 ASN C N   1 
ATOM   8202  C CA  . ASN C 1 201 ? -10.155 27.002  108.403 1.00 22.55 ? 201 ASN C CA  1 
ATOM   8203  C C   . ASN C 1 201 ? -9.016  27.913  108.889 1.00 21.92 ? 201 ASN C C   1 
ATOM   8204  O O   . ASN C 1 201 ? -9.223  29.022  109.442 1.00 21.43 ? 201 ASN C O   1 
ATOM   8205  C CB  . ASN C 1 201 ? -10.682 27.482  107.048 1.00 22.01 ? 201 ASN C CB  1 
ATOM   8206  C CG  . ASN C 1 201 ? -9.652  27.352  105.897 1.00 26.10 ? 201 ASN C CG  1 
ATOM   8207  O OD1 . ASN C 1 201 ? -9.580  28.213  105.012 1.00 29.00 ? 201 ASN C OD1 1 
ATOM   8208  N ND2 . ASN C 1 201 ? -8.913  26.275  105.885 1.00 26.85 ? 201 ASN C ND2 1 
ATOM   8209  N N   . ASN C 1 202 ? -7.807  27.432  108.692 1.00 19.90 ? 202 ASN C N   1 
ATOM   8210  C CA  . ASN C 1 202 ? -6.654  28.257  108.878 1.00 20.69 ? 202 ASN C CA  1 
ATOM   8211  C C   . ASN C 1 202 ? -6.325  28.821  107.478 1.00 21.22 ? 202 ASN C C   1 
ATOM   8212  O O   . ASN C 1 202 ? -5.941  28.062  106.561 1.00 20.22 ? 202 ASN C O   1 
ATOM   8213  C CB  . ASN C 1 202 ? -5.541  27.406  109.499 1.00 20.62 ? 202 ASN C CB  1 
ATOM   8214  C CG  . ASN C 1 202 ? -4.206  28.152  109.647 1.00 21.81 ? 202 ASN C CG  1 
ATOM   8215  O OD1 . ASN C 1 202 ? -4.102  29.352  109.382 1.00 22.74 ? 202 ASN C OD1 1 
ATOM   8216  N ND2 . ASN C 1 202 ? -3.172  27.420  110.105 1.00 21.74 ? 202 ASN C ND2 1 
ATOM   8217  N N   . PRO C 1 203 ? -6.408  30.165  107.299 1.00 20.79 ? 203 PRO C N   1 
ATOM   8218  C CA  . PRO C 1 203 ? -6.465  31.250  108.261 1.00 21.20 ? 203 PRO C CA  1 
ATOM   8219  C C   . PRO C 1 203 ? -7.811  31.912  108.541 1.00 21.31 ? 203 PRO C C   1 
ATOM   8220  O O   . PRO C 1 203 ? -7.864  32.787  109.400 1.00 21.82 ? 203 PRO C O   1 
ATOM   8221  C CB  . PRO C 1 203 ? -5.552  32.264  107.601 1.00 22.03 ? 203 PRO C CB  1 
ATOM   8222  C CG  . PRO C 1 203 ? -5.979  32.171  106.113 1.00 20.69 ? 203 PRO C CG  1 
ATOM   8223  C CD  . PRO C 1 203 ? -6.298  30.693  105.920 1.00 21.61 ? 203 PRO C CD  1 
ATOM   8224  N N   . THR C 1 204 ? -8.886  31.470  107.880 1.00 20.87 ? 204 THR C N   1 
ATOM   8225  C CA  . THR C 1 204 ? -10.114 32.277  107.836 1.00 21.57 ? 204 THR C CA  1 
ATOM   8226  C C   . THR C 1 204 ? -10.979 32.238  109.065 1.00 20.99 ? 204 THR C C   1 
ATOM   8227  O O   . THR C 1 204 ? -11.753 33.165  109.266 1.00 21.13 ? 204 THR C O   1 
ATOM   8228  C CB  . THR C 1 204 ? -11.079 31.956  106.629 1.00 20.74 ? 204 THR C CB  1 
ATOM   8229  O OG1 . THR C 1 204 ? -11.629 30.652  106.791 1.00 21.96 ? 204 THR C OG1 1 
ATOM   8230  C CG2 . THR C 1 204 ? -10.374 32.046  105.278 1.00 20.00 ? 204 THR C CG2 1 
ATOM   8231  N N   . GLY C 1 205 ? -10.913 31.150  109.833 1.00 20.46 ? 205 GLY C N   1 
ATOM   8232  C CA  . GLY C 1 205 ? -11.822 30.959  110.932 1.00 21.59 ? 205 GLY C CA  1 
ATOM   8233  C C   . GLY C 1 205 ? -13.205 30.422  110.579 1.00 21.99 ? 205 GLY C C   1 
ATOM   8234  O O   . GLY C 1 205 ? -14.004 30.152  111.491 1.00 22.39 ? 205 GLY C O   1 
ATOM   8235  N N   . ASN C 1 206 ? -13.514 30.303  109.287 1.00 23.22 ? 206 ASN C N   1 
ATOM   8236  C CA  . ASN C 1 206 ? -14.874 29.876  108.853 1.00 24.19 ? 206 ASN C CA  1 
ATOM   8237  C C   . ASN C 1 206 ? -15.081 28.365  108.763 1.00 23.64 ? 206 ASN C C   1 
ATOM   8238  O O   . ASN C 1 206 ? -14.126 27.605  108.557 1.00 22.74 ? 206 ASN C O   1 
ATOM   8239  C CB  . ASN C 1 206 ? -15.264 30.457  107.476 1.00 25.21 ? 206 ASN C CB  1 
ATOM   8240  C CG  . ASN C 1 206 ? -15.001 31.955  107.348 1.00 28.35 ? 206 ASN C CG  1 
ATOM   8241  O OD1 . ASN C 1 206 ? -15.311 32.750  108.226 1.00 28.94 ? 206 ASN C OD1 1 
ATOM   8242  N ND2 . ASN C 1 206 ? -14.435 32.339  106.208 1.00 26.79 ? 206 ASN C ND2 1 
ATOM   8243  N N   . SER C 1 207 ? -16.344 27.954  108.828 1.00 23.26 ? 207 SER C N   1 
ATOM   8244  C CA  . SER C 1 207 ? -16.712 26.529  108.790 1.00 23.20 ? 207 SER C CA  1 
ATOM   8245  C C   . SER C 1 207 ? -17.835 26.253  107.774 1.00 23.12 ? 207 SER C C   1 
ATOM   8246  O O   . SER C 1 207 ? -18.731 27.086  107.552 1.00 22.09 ? 207 SER C O   1 
ATOM   8247  C CB  . SER C 1 207 ? -17.171 26.055  110.180 1.00 23.20 ? 207 SER C CB  1 
ATOM   8248  O OG  . SER C 1 207 ? -16.163 26.192  111.169 1.00 22.61 ? 207 SER C OG  1 
ATOM   8249  N N   . LEU C 1 208 ? -17.804 25.037  107.234 1.00 22.66 ? 208 LEU C N   1 
ATOM   8250  C CA  . LEU C 1 208 ? -18.839 24.505  106.395 1.00 22.82 ? 208 LEU C CA  1 
ATOM   8251  C C   . LEU C 1 208 ? -20.098 24.216  107.204 1.00 23.79 ? 208 LEU C C   1 
ATOM   8252  O O   . LEU C 1 208 ? -20.038 23.870  108.397 1.00 23.22 ? 208 LEU C O   1 
ATOM   8253  C CB  . LEU C 1 208 ? -18.340 23.219  105.697 1.00 23.94 ? 208 LEU C CB  1 
ATOM   8254  C CG  . LEU C 1 208 ? -17.641 23.346  104.343 1.00 24.51 ? 208 LEU C CG  1 
ATOM   8255  C CD1 . LEU C 1 208 ? -17.098 21.998  103.870 1.00 20.37 ? 208 LEU C CD1 1 
ATOM   8256  C CD2 . LEU C 1 208 ? -18.509 23.988  103.268 1.00 23.59 ? 208 LEU C CD2 1 
ATOM   8257  N N   . THR C 1 209 ? -21.242 24.377  106.554 1.00 22.75 ? 209 THR C N   1 
ATOM   8258  C CA  . THR C 1 209 ? -22.479 23.969  107.144 1.00 23.53 ? 209 THR C CA  1 
ATOM   8259  C C   . THR C 1 209 ? -22.760 22.520  106.759 1.00 23.60 ? 209 THR C C   1 
ATOM   8260  O O   . THR C 1 209 ? -22.235 22.026  105.752 1.00 24.74 ? 209 THR C O   1 
ATOM   8261  C CB  . THR C 1 209 ? -23.611 24.891  106.639 1.00 24.00 ? 209 THR C CB  1 
ATOM   8262  O OG1 . THR C 1 209 ? -23.675 24.758  105.224 1.00 23.63 ? 209 THR C OG1 1 
ATOM   8263  C CG2 . THR C 1 209 ? -23.264 26.364  106.960 1.00 25.54 ? 209 THR C CG2 1 
ATOM   8264  N N   . SER C 1 210 ? -23.636 21.866  107.511 1.00 24.26 ? 210 SER C N   1 
ATOM   8265  C CA  . SER C 1 210 ? -24.136 20.511  107.183 1.00 25.59 ? 210 SER C CA  1 
ATOM   8266  C C   . SER C 1 210 ? -24.759 20.444  105.760 1.00 26.52 ? 210 SER C C   1 
ATOM   8267  O O   . SER C 1 210 ? -24.492 19.495  105.017 1.00 26.09 ? 210 SER C O   1 
ATOM   8268  C CB  . SER C 1 210 ? -25.156 20.068  108.246 1.00 25.37 ? 210 SER C CB  1 
ATOM   8269  O OG  . SER C 1 210 ? -25.680 18.761  107.995 1.00 27.52 ? 210 SER C OG  1 
ATOM   8270  N N   . GLU C 1 211 ? -25.565 21.458  105.381 1.00 26.72 ? 211 GLU C N   1 
ATOM   8271  C CA  . GLU C 1 211 ? -26.192 21.498  104.056 1.00 27.75 ? 211 GLU C CA  1 
ATOM   8272  C C   . GLU C 1 211 ? -25.166 21.481  102.925 1.00 26.79 ? 211 GLU C C   1 
ATOM   8273  O O   . GLU C 1 211 ? -25.313 20.716  101.965 1.00 27.39 ? 211 GLU C O   1 
ATOM   8274  C CB  . GLU C 1 211 ? -27.119 22.741  103.883 1.00 28.13 ? 211 GLU C CB  1 
ATOM   8275  C CG  . GLU C 1 211 ? -28.117 22.951  105.028 1.00 34.35 ? 211 GLU C CG  1 
ATOM   8276  C CD  . GLU C 1 211 ? -27.462 23.510  106.330 1.00 41.09 ? 211 GLU C CD  1 
ATOM   8277  O OE1 . GLU C 1 211 ? -27.297 22.738  107.294 1.00 44.01 ? 211 GLU C OE1 1 
ATOM   8278  O OE2 . GLU C 1 211 ? -27.138 24.725  106.395 1.00 47.61 ? 211 GLU C OE2 1 
ATOM   8279  N N   . ARG C 1 212 ? -24.156 22.341  103.032 1.00 25.91 ? 212 ARG C N   1 
ATOM   8280  C CA  . ARG C 1 212 ? -23.064 22.432  102.046 1.00 25.87 ? 212 ARG C CA  1 
ATOM   8281  C C   . ARG C 1 212 ? -22.192 21.156  101.935 1.00 26.25 ? 212 ARG C C   1 
ATOM   8282  O O   . ARG C 1 212 ? -21.757 20.794  100.822 1.00 26.69 ? 212 ARG C O   1 
ATOM   8283  C CB  . ARG C 1 212 ? -22.179 23.618  102.367 1.00 25.34 ? 212 ARG C CB  1 
ATOM   8284  C CG  . ARG C 1 212 ? -22.866 24.951  102.072 1.00 26.16 ? 212 ARG C CG  1 
ATOM   8285  C CD  . ARG C 1 212 ? -21.902 26.036  101.973 1.00 26.34 ? 212 ARG C CD  1 
ATOM   8286  N NE  . ARG C 1 212 ? -22.582 27.276  101.618 1.00 28.12 ? 212 ARG C NE  1 
ATOM   8287  C CZ  . ARG C 1 212 ? -21.942 28.396  101.351 1.00 27.51 ? 212 ARG C CZ  1 
ATOM   8288  N NH1 . ARG C 1 212 ? -20.624 28.393  101.388 1.00 27.42 ? 212 ARG C NH1 1 
ATOM   8289  N NH2 . ARG C 1 212 ? -22.619 29.517  101.039 1.00 27.04 ? 212 ARG C NH2 1 
ATOM   8290  N N   . LYS C 1 213 ? -21.931 20.493  103.066 1.00 25.40 ? 213 LYS C N   1 
ATOM   8291  C CA  . LYS C 1 213 ? -21.271 19.173  103.030 1.00 25.39 ? 213 LYS C CA  1 
ATOM   8292  C C   . LYS C 1 213 ? -22.034 18.116  102.243 1.00 25.46 ? 213 LYS C C   1 
ATOM   8293  O O   . LYS C 1 213 ? -21.429 17.428  101.445 1.00 24.49 ? 213 LYS C O   1 
ATOM   8294  C CB  . LYS C 1 213 ? -20.957 18.654  104.433 1.00 25.28 ? 213 LYS C CB  1 
ATOM   8295  C CG  . LYS C 1 213 ? -19.857 19.449  105.114 1.00 24.41 ? 213 LYS C CG  1 
ATOM   8296  C CD  . LYS C 1 213 ? -19.779 19.117  106.589 1.00 22.23 ? 213 LYS C CD  1 
ATOM   8297  C CE  . LYS C 1 213 ? -18.484 19.569  107.224 1.00 20.53 ? 213 LYS C CE  1 
ATOM   8298  N NZ  . LYS C 1 213 ? -18.443 19.089  108.708 1.00 18.89 ? 213 LYS C NZ  1 
ATOM   8299  N N   . LYS C 1 214 ? -23.352 18.009  102.465 1.00 26.80 ? 214 LYS C N   1 
ATOM   8300  C CA  . LYS C 1 214 ? -24.213 17.108  101.701 1.00 27.63 ? 214 LYS C CA  1 
ATOM   8301  C C   . LYS C 1 214 ? -24.065 17.364  100.196 1.00 27.12 ? 214 LYS C C   1 
ATOM   8302  O O   . LYS C 1 214 ? -23.803 16.433  99.446  1.00 26.87 ? 214 LYS C O   1 
ATOM   8303  C CB  . LYS C 1 214 ? -25.678 17.198  102.176 1.00 28.42 ? 214 LYS C CB  1 
ATOM   8304  C CG  . LYS C 1 214 ? -25.913 16.815  103.681 1.00 28.21 ? 214 LYS C CG  1 
ATOM   8305  C CD  . LYS C 1 214 ? -27.434 16.832  104.013 1.00 34.52 ? 214 LYS C CD  1 
ATOM   8306  C CE  . LYS C 1 214 ? -27.804 16.642  105.530 1.00 35.86 ? 214 LYS C CE  1 
ATOM   8307  N NZ  . LYS C 1 214 ? -29.323 16.436  105.757 1.00 34.56 ? 214 LYS C NZ  1 
ATOM   8308  N N   . GLU C 1 215 ? -24.175 18.632  99.765  1.00 27.94 ? 215 GLU C N   1 
ATOM   8309  C CA  . GLU C 1 215 ? -24.036 19.014  98.345  1.00 28.95 ? 215 GLU C CA  1 
ATOM   8310  C C   . GLU C 1 215 ? -22.647 18.738  97.741  1.00 27.91 ? 215 GLU C C   1 
ATOM   8311  O O   . GLU C 1 215 ? -22.528 18.305  96.585  1.00 28.83 ? 215 GLU C O   1 
ATOM   8312  C CB  . GLU C 1 215 ? -24.394 20.497  98.127  1.00 28.73 ? 215 GLU C CB  1 
ATOM   8313  C CG  . GLU C 1 215 ? -25.861 20.785  98.352  1.00 32.88 ? 215 GLU C CG  1 
ATOM   8314  C CD  . GLU C 1 215 ? -26.212 22.250  98.117  1.00 39.15 ? 215 GLU C CD  1 
ATOM   8315  O OE1 . GLU C 1 215 ? -27.093 22.741  98.850  1.00 41.64 ? 215 GLU C OE1 1 
ATOM   8316  O OE2 . GLU C 1 215 ? -25.614 22.895  97.223  1.00 39.62 ? 215 GLU C OE2 1 
ATOM   8317  N N   . ILE C 1 216 ? -21.608 19.021  98.515  1.00 27.23 ? 216 ILE C N   1 
ATOM   8318  C CA  . ILE C 1 216 ? -20.230 18.783  98.098  1.00 25.66 ? 216 ILE C CA  1 
ATOM   8319  C C   . ILE C 1 216 ? -19.969 17.270  97.966  1.00 25.22 ? 216 ILE C C   1 
ATOM   8320  O O   . ILE C 1 216 ? -19.325 16.845  96.998  1.00 24.71 ? 216 ILE C O   1 
ATOM   8321  C CB  . ILE C 1 216 ? -19.236 19.438  99.096  1.00 25.59 ? 216 ILE C CB  1 
ATOM   8322  C CG1 . ILE C 1 216 ? -19.298 20.973  98.984  1.00 24.60 ? 216 ILE C CG1 1 
ATOM   8323  C CG2 . ILE C 1 216 ? -17.796 18.949  98.858  1.00 23.72 ? 216 ILE C CG2 1 
ATOM   8324  C CD1 . ILE C 1 216 ? -18.897 21.661  100.291 1.00 21.05 ? 216 ILE C CD1 1 
ATOM   8325  N N   . TYR C 1 217 ? -20.486 16.487  98.922  1.00 24.84 ? 217 TYR C N   1 
ATOM   8326  C CA  . TYR C 1 217 ? -20.361 15.024  98.881  1.00 24.70 ? 217 TYR C CA  1 
ATOM   8327  C C   . TYR C 1 217 ? -21.016 14.422  97.619  1.00 25.19 ? 217 TYR C C   1 
ATOM   8328  O O   . TYR C 1 217 ? -20.461 13.500  96.993  1.00 23.54 ? 217 TYR C O   1 
ATOM   8329  C CB  . TYR C 1 217 ? -20.911 14.349  100.151 1.00 24.87 ? 217 TYR C CB  1 
ATOM   8330  C CG  . TYR C 1 217 ? -20.493 12.867  100.218 1.00 25.88 ? 217 TYR C CG  1 
ATOM   8331  C CD1 . TYR C 1 217 ? -19.298 12.478  100.845 1.00 27.02 ? 217 TYR C CD1 1 
ATOM   8332  C CD2 . TYR C 1 217 ? -21.260 11.869  99.591  1.00 26.09 ? 217 TYR C CD2 1 
ATOM   8333  C CE1 . TYR C 1 217 ? -18.876 11.107  100.853 1.00 25.80 ? 217 TYR C CE1 1 
ATOM   8334  C CE2 . TYR C 1 217 ? -20.849 10.528  99.588  1.00 24.68 ? 217 TYR C CE2 1 
ATOM   8335  C CZ  . TYR C 1 217 ? -19.665 10.152  100.224 1.00 25.63 ? 217 TYR C CZ  1 
ATOM   8336  O OH  . TYR C 1 217 ? -19.293 8.821   100.226 1.00 26.14 ? 217 TYR C OH  1 
ATOM   8337  N N   . GLU C 1 218 ? -22.218 14.912  97.288  1.00 25.73 ? 218 GLU C N   1 
ATOM   8338  C CA  . GLU C 1 218 ? -22.933 14.509  96.048  1.00 26.47 ? 218 GLU C CA  1 
ATOM   8339  C C   . GLU C 1 218 ? -22.156 14.791  94.757  1.00 26.98 ? 218 GLU C C   1 
ATOM   8340  O O   . GLU C 1 218 ? -22.148 13.953  93.845  1.00 27.61 ? 218 GLU C O   1 
ATOM   8341  C CB  . GLU C 1 218 ? -24.343 15.129  95.976  1.00 25.56 ? 218 GLU C CB  1 
ATOM   8342  C CG  . GLU C 1 218 ? -25.197 14.813  97.184  1.00 30.77 ? 218 GLU C CG  1 
ATOM   8343  C CD  . GLU C 1 218 ? -26.693 14.918  96.915  1.00 38.81 ? 218 GLU C CD  1 
ATOM   8344  O OE1 . GLU C 1 218 ? -27.092 15.154  95.743  1.00 38.82 ? 218 GLU C OE1 1 
ATOM   8345  O OE2 . GLU C 1 218 ? -27.470 14.758  97.898  1.00 43.00 ? 218 GLU C OE2 1 
ATOM   8346  N N   . LEU C 1 219 ? -21.515 15.962  94.688  1.00 26.99 ? 219 LEU C N   1 
ATOM   8347  C CA  . LEU C 1 219 ? -20.579 16.312  93.605  1.00 27.27 ? 219 LEU C CA  1 
ATOM   8348  C C   . LEU C 1 219 ? -19.342 15.382  93.523  1.00 27.35 ? 219 LEU C C   1 
ATOM   8349  O O   . LEU C 1 219 ? -18.910 15.013  92.422  1.00 27.52 ? 219 LEU C O   1 
ATOM   8350  C CB  . LEU C 1 219 ? -20.102 17.758  93.754  1.00 27.95 ? 219 LEU C CB  1 
ATOM   8351  C CG  . LEU C 1 219 ? -20.709 18.995  93.046  1.00 30.25 ? 219 LEU C CG  1 
ATOM   8352  C CD1 . LEU C 1 219 ? -21.444 18.674  91.725  1.00 30.26 ? 219 LEU C CD1 1 
ATOM   8353  C CD2 . LEU C 1 219 ? -21.525 19.873  93.963  1.00 31.96 ? 219 LEU C CD2 1 
ATOM   8354  N N   . ALA C 1 220 ? -18.775 15.045  94.679  1.00 25.96 ? 220 ALA C N   1 
ATOM   8355  C CA  . ALA C 1 220 ? -17.648 14.118  94.767  1.00 26.97 ? 220 ALA C CA  1 
ATOM   8356  C C   . ALA C 1 220 ? -18.039 12.738  94.240  1.00 26.18 ? 220 ALA C C   1 
ATOM   8357  O O   . ALA C 1 220 ? -17.224 12.078  93.609  1.00 26.47 ? 220 ALA C O   1 
ATOM   8358  C CB  . ALA C 1 220 ? -17.122 14.005  96.211  1.00 25.09 ? 220 ALA C CB  1 
ATOM   8359  N N   . ARG C 1 221 ? -19.273 12.308  94.507  1.00 26.63 ? 221 ARG C N   1 
ATOM   8360  C CA  . ARG C 1 221 ? -19.773 11.036  93.956  1.00 27.27 ? 221 ARG C CA  1 
ATOM   8361  C C   . ARG C 1 221 ? -19.943 11.142  92.455  1.00 26.99 ? 221 ARG C C   1 
ATOM   8362  O O   . ARG C 1 221 ? -19.457 10.308  91.715  1.00 26.74 ? 221 ARG C O   1 
ATOM   8363  C CB  . ARG C 1 221 ? -21.115 10.645  94.546  1.00 27.16 ? 221 ARG C CB  1 
ATOM   8364  C CG  . ARG C 1 221 ? -21.139 10.671  96.032  1.00 33.75 ? 221 ARG C CG  1 
ATOM   8365  C CD  . ARG C 1 221 ? -22.584 10.773  96.531  1.00 39.70 ? 221 ARG C CD  1 
ATOM   8366  N NE  . ARG C 1 221 ? -23.088 9.508   97.068  1.00 41.94 ? 221 ARG C NE  1 
ATOM   8367  C CZ  . ARG C 1 221 ? -23.429 8.466   96.333  1.00 42.82 ? 221 ARG C CZ  1 
ATOM   8368  N NH1 . ARG C 1 221 ? -23.295 8.501   95.012  1.00 44.65 ? 221 ARG C NH1 1 
ATOM   8369  N NH2 . ARG C 1 221 ? -23.887 7.388   96.932  1.00 44.49 ? 221 ARG C NH2 1 
ATOM   8370  N N   . LYS C 1 222 ? -20.670 12.175  92.021  1.00 27.70 ? 222 LYS C N   1 
ATOM   8371  C CA  . LYS C 1 222 ? -20.981 12.393  90.596  1.00 27.88 ? 222 LYS C CA  1 
ATOM   8372  C C   . LYS C 1 222 ? -19.732 12.397  89.707  1.00 27.00 ? 222 LYS C C   1 
ATOM   8373  O O   . LYS C 1 222 ? -19.694 11.744  88.660  1.00 26.49 ? 222 LYS C O   1 
ATOM   8374  C CB  . LYS C 1 222 ? -21.693 13.731  90.426  1.00 27.62 ? 222 LYS C CB  1 
ATOM   8375  C CG  . LYS C 1 222 ? -22.322 13.896  89.039  1.00 29.51 ? 222 LYS C CG  1 
ATOM   8376  C CD  . LYS C 1 222 ? -23.069 15.220  88.935  1.00 28.09 ? 222 LYS C CD  1 
ATOM   8377  C CE  . LYS C 1 222 ? -23.431 15.522  87.468  1.00 29.60 ? 222 LYS C CE  1 
ATOM   8378  N NZ  . LYS C 1 222 ? -24.367 16.716  87.388  1.00 27.84 ? 222 LYS C NZ  1 
ATOM   8379  N N   . TYR C 1 223 ? -18.714 13.132  90.133  1.00 25.72 ? 223 TYR C N   1 
ATOM   8380  C CA  . TYR C 1 223 ? -17.481 13.228  89.357  1.00 26.21 ? 223 TYR C CA  1 
ATOM   8381  C C   . TYR C 1 223 ? -16.375 12.297  89.898  1.00 25.85 ? 223 TYR C C   1 
ATOM   8382  O O   . TYR C 1 223 ? -15.242 12.374  89.472  1.00 24.29 ? 223 TYR C O   1 
ATOM   8383  C CB  . TYR C 1 223 ? -17.005 14.690  89.288  1.00 26.43 ? 223 TYR C CB  1 
ATOM   8384  C CG  . TYR C 1 223 ? -17.967 15.577  88.514  1.00 28.30 ? 223 TYR C CG  1 
ATOM   8385  C CD1 . TYR C 1 223 ? -17.845 15.733  87.106  1.00 26.54 ? 223 TYR C CD1 1 
ATOM   8386  C CD2 . TYR C 1 223 ? -19.012 16.222  89.157  1.00 27.58 ? 223 TYR C CD2 1 
ATOM   8387  C CE1 . TYR C 1 223 ? -18.736 16.542  86.391  1.00 29.42 ? 223 TYR C CE1 1 
ATOM   8388  C CE2 . TYR C 1 223 ? -19.906 17.024  88.450  1.00 29.01 ? 223 TYR C CE2 1 
ATOM   8389  C CZ  . TYR C 1 223 ? -19.761 17.176  87.070  1.00 27.86 ? 223 TYR C CZ  1 
ATOM   8390  O OH  . TYR C 1 223 ? -20.644 17.976  86.407  1.00 26.92 ? 223 TYR C OH  1 
ATOM   8391  N N   . ASP C 1 224 ? -16.744 11.395  90.807  1.00 25.74 ? 224 ASP C N   1 
ATOM   8392  C CA  . ASP C 1 224 ? -15.811 10.435  91.430  1.00 26.16 ? 224 ASP C CA  1 
ATOM   8393  C C   . ASP C 1 224 ? -14.420 10.954  91.839  1.00 25.20 ? 224 ASP C C   1 
ATOM   8394  O O   . ASP C 1 224 ? -13.364 10.526  91.294  1.00 24.83 ? 224 ASP C O   1 
ATOM   8395  C CB  . ASP C 1 224 ? -15.692 9.164   90.575  1.00 27.10 ? 224 ASP C CB  1 
ATOM   8396  C CG  . ASP C 1 224 ? -14.996 8.028   91.315  1.00 30.09 ? 224 ASP C CG  1 
ATOM   8397  O OD1 . ASP C 1 224 ? -15.203 7.908   92.557  1.00 30.15 ? 224 ASP C OD1 1 
ATOM   8398  O OD2 . ASP C 1 224 ? -14.237 7.263   90.656  1.00 32.82 ? 224 ASP C OD2 1 
ATOM   8399  N N   . PHE C 1 225 ? -14.407 11.894  92.800  1.00 24.32 ? 225 PHE C N   1 
ATOM   8400  C CA  . PHE C 1 225 ? -13.149 12.276  93.413  1.00 23.04 ? 225 PHE C CA  1 
ATOM   8401  C C   . PHE C 1 225 ? -13.168 12.051  94.924  1.00 21.43 ? 225 PHE C C   1 
ATOM   8402  O O   . PHE C 1 225 ? -14.221 11.874  95.542  1.00 21.74 ? 225 PHE C O   1 
ATOM   8403  C CB  . PHE C 1 225 ? -12.721 13.694  93.026  1.00 22.71 ? 225 PHE C CB  1 
ATOM   8404  C CG  . PHE C 1 225 ? -13.747 14.759  93.349  1.00 25.49 ? 225 PHE C CG  1 
ATOM   8405  C CD1 . PHE C 1 225 ? -13.894 15.252  94.670  1.00 25.64 ? 225 PHE C CD1 1 
ATOM   8406  C CD2 . PHE C 1 225 ? -14.557 15.291  92.337  1.00 23.48 ? 225 PHE C CD2 1 
ATOM   8407  C CE1 . PHE C 1 225 ? -14.837 16.258  94.965  1.00 25.57 ? 225 PHE C CE1 1 
ATOM   8408  C CE2 . PHE C 1 225 ? -15.471 16.294  92.637  1.00 24.00 ? 225 PHE C CE2 1 
ATOM   8409  C CZ  . PHE C 1 225 ? -15.636 16.762  93.938  1.00 25.11 ? 225 PHE C CZ  1 
ATOM   8410  N N   . LEU C 1 226 ? -11.986 11.993  95.501  1.00 21.23 ? 226 LEU C N   1 
ATOM   8411  C CA  . LEU C 1 226 ? -11.833 11.822  96.935  1.00 20.21 ? 226 LEU C CA  1 
ATOM   8412  C C   . LEU C 1 226 ? -12.103 13.179  97.626  1.00 20.23 ? 226 LEU C C   1 
ATOM   8413  O O   . LEU C 1 226 ? -11.886 14.261  97.040  1.00 18.40 ? 226 LEU C O   1 
ATOM   8414  C CB  . LEU C 1 226 ? -10.393 11.361  97.200  1.00 21.27 ? 226 LEU C CB  1 
ATOM   8415  C CG  . LEU C 1 226 ? -9.972  9.880   97.385  1.00 22.70 ? 226 LEU C CG  1 
ATOM   8416  C CD1 . LEU C 1 226 ? -10.962 8.829   96.932  1.00 21.86 ? 226 LEU C CD1 1 
ATOM   8417  C CD2 . LEU C 1 226 ? -8.504  9.590   97.035  1.00 19.46 ? 226 LEU C CD2 1 
ATOM   8418  N N   . ILE C 1 227 ? -12.540 13.100  98.884  1.00 19.57 ? 227 ILE C N   1 
ATOM   8419  C CA  . ILE C 1 227 ? -12.567 14.260  99.738  1.00 19.96 ? 227 ILE C CA  1 
ATOM   8420  C C   . ILE C 1 227 ? -11.510 14.040  100.823 1.00 20.12 ? 227 ILE C C   1 
ATOM   8421  O O   . ILE C 1 227 ? -11.541 13.057  101.570 1.00 20.10 ? 227 ILE C O   1 
ATOM   8422  C CB  . ILE C 1 227 ? -13.955 14.495  100.382 1.00 19.94 ? 227 ILE C CB  1 
ATOM   8423  C CG1 . ILE C 1 227 ? -14.986 14.824  99.277  1.00 17.44 ? 227 ILE C CG1 1 
ATOM   8424  C CG2 . ILE C 1 227 ? -13.880 15.659  101.358 1.00 19.06 ? 227 ILE C CG2 1 
ATOM   8425  C CD1 . ILE C 1 227 ? -16.452 14.665  99.746  1.00 16.99 ? 227 ILE C CD1 1 
ATOM   8426  N N   . ILE C 1 228 ? -10.567 14.957  100.886 1.00 20.68 ? 228 ILE C N   1 
ATOM   8427  C CA  . ILE C 1 228 ? -9.672  14.959  102.017 1.00 20.84 ? 228 ILE C CA  1 
ATOM   8428  C C   . ILE C 1 228 ? -10.111 16.002  103.036 1.00 19.78 ? 228 ILE C C   1 
ATOM   8429  O O   . ILE C 1 228 ? -10.029 17.223  102.829 1.00 20.60 ? 228 ILE C O   1 
ATOM   8430  C CB  . ILE C 1 228 ? -8.224  14.970  101.584 1.00 22.03 ? 228 ILE C CB  1 
ATOM   8431  C CG1 . ILE C 1 228 ? -7.272  15.281  102.753 1.00 22.62 ? 228 ILE C CG1 1 
ATOM   8432  C CG2 . ILE C 1 228 ? -8.065  15.776  100.369 1.00 26.06 ? 228 ILE C CG2 1 
ATOM   8433  C CD1 . ILE C 1 228 ? -7.104  14.092  103.655 1.00 28.96 ? 228 ILE C CD1 1 
ATOM   8434  N N   . GLU C 1 229 ? -10.632 15.466  104.114 1.00 18.33 ? 229 GLU C N   1 
ATOM   8435  C CA  . GLU C 1 229 ? -11.245 16.218  105.176 1.00 18.16 ? 229 GLU C CA  1 
ATOM   8436  C C   . GLU C 1 229 ? -10.127 16.444  106.215 1.00 18.35 ? 229 GLU C C   1 
ATOM   8437  O O   . GLU C 1 229 ? -9.873  15.570  107.030 1.00 17.70 ? 229 GLU C O   1 
ATOM   8438  C CB  . GLU C 1 229 ? -12.376 15.348  105.760 1.00 17.59 ? 229 GLU C CB  1 
ATOM   8439  C CG  . GLU C 1 229 ? -13.017 15.996  106.932 1.00 19.84 ? 229 GLU C CG  1 
ATOM   8440  C CD  . GLU C 1 229 ? -14.305 15.355  107.360 1.00 20.64 ? 229 GLU C CD  1 
ATOM   8441  O OE1 . GLU C 1 229 ? -15.267 16.133  107.503 1.00 22.68 ? 229 GLU C OE1 1 
ATOM   8442  O OE2 . GLU C 1 229 ? -14.366 14.116  107.564 1.00 21.81 ? 229 GLU C OE2 1 
ATOM   8443  N N   . ASP C 1 230 ? -9.461  17.599  106.158 1.00 17.61 ? 230 ASP C N   1 
ATOM   8444  C CA  . ASP C 1 230 ? -8.357  17.887  107.104 1.00 19.05 ? 230 ASP C CA  1 
ATOM   8445  C C   . ASP C 1 230 ? -8.967  18.698  108.242 1.00 18.62 ? 230 ASP C C   1 
ATOM   8446  O O   . ASP C 1 230 ? -9.365  19.866  108.039 1.00 17.94 ? 230 ASP C O   1 
ATOM   8447  C CB  . ASP C 1 230 ? -7.262  18.668  106.386 1.00 19.24 ? 230 ASP C CB  1 
ATOM   8448  C CG  . ASP C 1 230 ? -6.095  19.074  107.304 1.00 18.87 ? 230 ASP C CG  1 
ATOM   8449  O OD1 . ASP C 1 230 ? -5.913  18.476  108.396 1.00 24.03 ? 230 ASP C OD1 1 
ATOM   8450  O OD2 . ASP C 1 230 ? -5.390  20.049  106.906 1.00 23.83 ? 230 ASP C OD2 1 
ATOM   8451  N N   . ASP C 1 231 ? -9.100  18.083  109.422 1.00 18.20 ? 231 ASP C N   1 
ATOM   8452  C CA  . ASP C 1 231 ? -10.015 18.634  110.403 1.00 18.10 ? 231 ASP C CA  1 
ATOM   8453  C C   . ASP C 1 231 ? -9.354  18.806  111.804 1.00 17.80 ? 231 ASP C C   1 
ATOM   8454  O O   . ASP C 1 231 ? -9.880  18.318  112.797 1.00 17.81 ? 231 ASP C O   1 
ATOM   8455  C CB  . ASP C 1 231 ? -11.293 17.735  110.440 1.00 17.21 ? 231 ASP C CB  1 
ATOM   8456  C CG  . ASP C 1 231 ? -12.602 18.485  110.737 1.00 17.53 ? 231 ASP C CG  1 
ATOM   8457  O OD1 . ASP C 1 231 ? -12.651 19.724  111.017 1.00 22.57 ? 231 ASP C OD1 1 
ATOM   8458  O OD2 . ASP C 1 231 ? -13.680 17.816  110.637 1.00 16.19 ? 231 ASP C OD2 1 
ATOM   8459  N N   . PRO C 1 232 ? -8.248  19.579  111.884 1.00 18.66 ? 232 PRO C N   1 
ATOM   8460  C CA  . PRO C 1 232 ? -7.541  19.693  113.151 1.00 18.43 ? 232 PRO C CA  1 
ATOM   8461  C C   . PRO C 1 232 ? -8.221  20.565  114.204 1.00 20.01 ? 232 PRO C C   1 
ATOM   8462  O O   . PRO C 1 232 ? -7.885  20.472  115.400 1.00 19.12 ? 232 PRO C O   1 
ATOM   8463  C CB  . PRO C 1 232 ? -6.188  20.243  112.751 1.00 18.50 ? 232 PRO C CB  1 
ATOM   8464  C CG  . PRO C 1 232 ? -6.459  21.047  111.557 1.00 18.91 ? 232 PRO C CG  1 
ATOM   8465  C CD  . PRO C 1 232 ? -7.567  20.346  110.816 1.00 17.42 ? 232 PRO C CD  1 
ATOM   8466  N N   . TYR C 1 233 ? -9.219  21.344  113.773 1.00 19.36 ? 233 TYR C N   1 
ATOM   8467  C CA  . TYR C 1 233 ? -9.997  22.138  114.722 1.00 20.34 ? 233 TYR C CA  1 
ATOM   8468  C C   . TYR C 1 233 ? -11.378 21.563  114.893 1.00 20.10 ? 233 TYR C C   1 
ATOM   8469  O O   . TYR C 1 233 ? -12.259 22.269  115.394 1.00 21.15 ? 233 TYR C O   1 
ATOM   8470  C CB  . TYR C 1 233 ? -10.101 23.606  114.217 1.00 20.85 ? 233 TYR C CB  1 
ATOM   8471  C CG  . TYR C 1 233 ? -8.730  24.164  113.882 1.00 21.37 ? 233 TYR C CG  1 
ATOM   8472  C CD1 . TYR C 1 233 ? -8.314  24.292  112.565 1.00 22.49 ? 233 TYR C CD1 1 
ATOM   8473  C CD2 . TYR C 1 233 ? -7.837  24.525  114.893 1.00 22.10 ? 233 TYR C CD2 1 
ATOM   8474  C CE1 . TYR C 1 233 ? -7.039  24.771  112.254 1.00 20.54 ? 233 TYR C CE1 1 
ATOM   8475  C CE2 . TYR C 1 233 ? -6.578  25.012  114.591 1.00 18.98 ? 233 TYR C CE2 1 
ATOM   8476  C CZ  . TYR C 1 233 ? -6.197  25.107  113.255 1.00 24.44 ? 233 TYR C CZ  1 
ATOM   8477  O OH  . TYR C 1 233 ? -4.974  25.547  112.913 1.00 25.03 ? 233 TYR C OH  1 
ATOM   8478  N N   . TYR C 1 234 ? -11.573 20.290  114.526 1.00 19.12 ? 234 TYR C N   1 
ATOM   8479  C CA  . TYR C 1 234 ? -12.854 19.602  114.731 1.00 19.26 ? 234 TYR C CA  1 
ATOM   8480  C C   . TYR C 1 234 ? -13.307 19.696  116.207 1.00 19.52 ? 234 TYR C C   1 
ATOM   8481  O O   . TYR C 1 234 ? -14.528 19.799  116.475 1.00 19.29 ? 234 TYR C O   1 
ATOM   8482  C CB  . TYR C 1 234 ? -12.846 18.116  114.276 1.00 18.49 ? 234 TYR C CB  1 
ATOM   8483  C CG  . TYR C 1 234 ? -14.133 17.383  114.616 1.00 16.91 ? 234 TYR C CG  1 
ATOM   8484  C CD1 . TYR C 1 234 ? -15.293 17.543  113.836 1.00 18.76 ? 234 TYR C CD1 1 
ATOM   8485  C CD2 . TYR C 1 234 ? -14.204 16.530  115.743 1.00 16.40 ? 234 TYR C CD2 1 
ATOM   8486  C CE1 . TYR C 1 234 ? -16.501 16.873  114.179 1.00 16.35 ? 234 TYR C CE1 1 
ATOM   8487  C CE2 . TYR C 1 234 ? -15.377 15.878  116.102 1.00 16.76 ? 234 TYR C CE2 1 
ATOM   8488  C CZ  . TYR C 1 234 ? -16.510 16.040  115.300 1.00 19.04 ? 234 TYR C CZ  1 
ATOM   8489  O OH  . TYR C 1 234 ? -17.641 15.394  115.636 1.00 19.08 ? 234 TYR C OH  1 
ATOM   8490  N N   . PHE C 1 235 ? -12.335 19.674  117.131 1.00 18.57 ? 235 PHE C N   1 
ATOM   8491  C CA  . PHE C 1 235 ? -12.629 19.629  118.548 1.00 21.25 ? 235 PHE C CA  1 
ATOM   8492  C C   . PHE C 1 235 ? -12.566 21.026  119.154 1.00 22.97 ? 235 PHE C C   1 
ATOM   8493  O O   . PHE C 1 235 ? -12.482 21.189  120.397 1.00 23.10 ? 235 PHE C O   1 
ATOM   8494  C CB  . PHE C 1 235 ? -11.673 18.701  119.324 1.00 21.96 ? 235 PHE C CB  1 
ATOM   8495  C CG  . PHE C 1 235 ? -11.916 17.204  119.082 1.00 20.78 ? 235 PHE C CG  1 
ATOM   8496  C CD1 . PHE C 1 235 ? -13.059 16.587  119.552 1.00 20.65 ? 235 PHE C CD1 1 
ATOM   8497  C CD2 . PHE C 1 235 ? -10.968 16.443  118.405 1.00 21.47 ? 235 PHE C CD2 1 
ATOM   8498  C CE1 . PHE C 1 235 ? -13.261 15.175  119.320 1.00 22.80 ? 235 PHE C CE1 1 
ATOM   8499  C CE2 . PHE C 1 235 ? -11.153 15.087  118.147 1.00 21.10 ? 235 PHE C CE2 1 
ATOM   8500  C CZ  . PHE C 1 235 ? -12.317 14.459  118.613 1.00 20.30 ? 235 PHE C CZ  1 
ATOM   8501  N N   . LEU C 1 236 ? -12.647 22.030  118.286 1.00 23.23 ? 236 LEU C N   1 
ATOM   8502  C CA  . LEU C 1 236 ? -12.651 23.431  118.733 1.00 24.17 ? 236 LEU C CA  1 
ATOM   8503  C C   . LEU C 1 236 ? -13.782 24.276  118.146 1.00 23.75 ? 236 LEU C C   1 
ATOM   8504  O O   . LEU C 1 236 ? -13.596 25.445  117.882 1.00 25.13 ? 236 LEU C O   1 
ATOM   8505  C CB  . LEU C 1 236 ? -11.304 24.040  118.390 1.00 24.13 ? 236 LEU C CB  1 
ATOM   8506  C CG  . LEU C 1 236 ? -10.333 24.487  119.487 1.00 26.74 ? 236 LEU C CG  1 
ATOM   8507  C CD1 . LEU C 1 236 ? -10.271 23.560  120.650 1.00 29.77 ? 236 LEU C CD1 1 
ATOM   8508  C CD2 . LEU C 1 236 ? -8.929  24.767  118.935 1.00 26.09 ? 236 LEU C CD2 1 
ATOM   8509  N N   . GLN C 1 237 ? -14.948 23.675  117.933 1.00 24.03 ? 237 GLN C N   1 
ATOM   8510  C CA  . GLN C 1 237 ? -16.090 24.346  117.300 1.00 23.59 ? 237 GLN C CA  1 
ATOM   8511  C C   . GLN C 1 237 ? -16.842 25.130  118.391 1.00 24.96 ? 237 GLN C C   1 
ATOM   8512  O O   . GLN C 1 237 ? -17.108 24.603  119.451 1.00 24.62 ? 237 GLN C O   1 
ATOM   8513  C CB  . GLN C 1 237 ? -17.004 23.314  116.627 1.00 22.66 ? 237 GLN C CB  1 
ATOM   8514  C CG  . GLN C 1 237 ? -16.332 22.543  115.464 1.00 20.28 ? 237 GLN C CG  1 
ATOM   8515  C CD  . GLN C 1 237 ? -17.197 21.471  114.882 1.00 20.41 ? 237 GLN C CD  1 
ATOM   8516  O OE1 . GLN C 1 237 ? -16.781 20.314  114.802 1.00 19.21 ? 237 GLN C OE1 1 
ATOM   8517  N NE2 . GLN C 1 237 ? -18.434 21.822  114.494 1.00 15.43 ? 237 GLN C NE2 1 
ATOM   8518  N N   . PHE C 1 238 ? -17.161 26.390  118.141 1.00 26.79 ? 238 PHE C N   1 
ATOM   8519  C CA  . PHE C 1 238 ? -17.775 27.205  119.193 1.00 29.62 ? 238 PHE C CA  1 
ATOM   8520  C C   . PHE C 1 238 ? -19.239 26.917  119.414 1.00 32.38 ? 238 PHE C C   1 
ATOM   8521  O O   . PHE C 1 238 ? -19.728 27.051  120.550 1.00 34.53 ? 238 PHE C O   1 
ATOM   8522  C CB  . PHE C 1 238 ? -17.462 28.681  119.007 1.00 28.51 ? 238 PHE C CB  1 
ATOM   8523  C CG  . PHE C 1 238 ? -15.998 28.949  118.977 1.00 25.50 ? 238 PHE C CG  1 
ATOM   8524  C CD1 . PHE C 1 238 ? -15.420 29.590  117.915 1.00 24.88 ? 238 PHE C CD1 1 
ATOM   8525  C CD2 . PHE C 1 238 ? -15.182 28.507  120.027 1.00 25.03 ? 238 PHE C CD2 1 
ATOM   8526  C CE1 . PHE C 1 238 ? -14.014 29.818  117.877 1.00 25.97 ? 238 PHE C CE1 1 
ATOM   8527  C CE2 . PHE C 1 238 ? -13.799 28.702  119.991 1.00 22.52 ? 238 PHE C CE2 1 
ATOM   8528  C CZ  . PHE C 1 238 ? -13.214 29.355  118.920 1.00 23.33 ? 238 PHE C CZ  1 
ATOM   8529  N N   . ASN C 1 239 ? -19.915 26.475  118.353 1.00 35.48 ? 239 ASN C N   1 
ATOM   8530  C CA  . ASN C 1 239 ? -21.214 25.821  118.475 1.00 38.55 ? 239 ASN C CA  1 
ATOM   8531  C C   . ASN C 1 239 ? -21.006 24.443  119.082 1.00 39.37 ? 239 ASN C C   1 
ATOM   8532  O O   . ASN C 1 239 ? -20.442 23.556  118.410 1.00 40.81 ? 239 ASN C O   1 
ATOM   8533  C CB  . ASN C 1 239 ? -21.814 25.593  117.089 1.00 39.50 ? 239 ASN C CB  1 
ATOM   8534  C CG  . ASN C 1 239 ? -23.259 25.987  117.004 1.00 42.58 ? 239 ASN C CG  1 
ATOM   8535  O OD1 . ASN C 1 239 ? -23.636 26.749  116.105 1.00 47.27 ? 239 ASN C OD1 1 
ATOM   8536  N ND2 . ASN C 1 239 ? -24.087 25.481  117.925 1.00 45.43 ? 239 ASN C ND2 1 
ATOM   8537  N N   . LYS C 1 240 ? -21.465 24.242  120.314 1.00 39.10 ? 240 LYS C N   1 
ATOM   8538  C CA  . LYS C 1 240 ? -21.434 22.911  120.911 1.00 39.75 ? 240 LYS C CA  1 
ATOM   8539  C C   . LYS C 1 240 ? -22.622 22.046  120.448 1.00 38.30 ? 240 LYS C C   1 
ATOM   8540  O O   . LYS C 1 240 ? -23.182 21.299  121.241 1.00 39.25 ? 240 LYS C O   1 
ATOM   8541  C CB  . LYS C 1 240 ? -21.321 22.945  122.470 1.00 40.73 ? 240 LYS C CB  1 
ATOM   8542  C CG  . LYS C 1 240 ? -20.303 23.980  123.040 1.00 42.04 ? 240 LYS C CG  1 
ATOM   8543  C CD  . LYS C 1 240 ? -19.602 23.457  124.286 1.00 42.88 ? 240 LYS C CD  1 
ATOM   8544  C CE  . LYS C 1 240 ? -19.307 24.615  125.247 1.00 42.77 ? 240 LYS C CE  1 
ATOM   8545  N NZ  . LYS C 1 240 ? -18.161 24.276  126.131 1.00 41.29 ? 240 LYS C NZ  1 
ATOM   8546  N N   . PHE C 1 241 ? -23.025 22.217  119.189 1.00 36.54 ? 241 PHE C N   1 
ATOM   8547  C CA  . PHE C 1 241 ? -23.578 21.149  118.370 1.00 35.27 ? 241 PHE C CA  1 
ATOM   8548  C C   . PHE C 1 241 ? -22.633 21.013  117.165 1.00 32.99 ? 241 PHE C C   1 
ATOM   8549  O O   . PHE C 1 241 ? -22.682 21.852  116.263 1.00 33.25 ? 241 PHE C O   1 
ATOM   8550  C CB  . PHE C 1 241 ? -24.983 21.517  117.903 1.00 36.85 ? 241 PHE C CB  1 
ATOM   8551  C CG  . PHE C 1 241 ? -26.067 21.143  118.882 1.00 39.77 ? 241 PHE C CG  1 
ATOM   8552  C CD1 . PHE C 1 241 ? -26.555 22.076  119.790 1.00 44.12 ? 241 PHE C CD1 1 
ATOM   8553  C CD2 . PHE C 1 241 ? -26.597 19.851  118.900 1.00 44.09 ? 241 PHE C CD2 1 
ATOM   8554  C CE1 . PHE C 1 241 ? -27.556 21.727  120.706 1.00 44.78 ? 241 PHE C CE1 1 
ATOM   8555  C CE2 . PHE C 1 241 ? -27.607 19.493  119.833 1.00 43.16 ? 241 PHE C CE2 1 
ATOM   8556  C CZ  . PHE C 1 241 ? -28.078 20.426  120.714 1.00 43.55 ? 241 PHE C CZ  1 
ATOM   8557  N N   . ARG C 1 242 ? -21.762 20.002  117.156 1.00 29.74 ? 242 ARG C N   1 
ATOM   8558  C CA  . ARG C 1 242 ? -20.776 19.844  116.052 1.00 28.69 ? 242 ARG C CA  1 
ATOM   8559  C C   . ARG C 1 242 ? -21.470 19.432  114.756 1.00 28.41 ? 242 ARG C C   1 
ATOM   8560  O O   . ARG C 1 242 ? -22.333 18.568  114.754 1.00 28.99 ? 242 ARG C O   1 
ATOM   8561  C CB  . ARG C 1 242 ? -19.676 18.806  116.371 1.00 27.00 ? 242 ARG C CB  1 
ATOM   8562  C CG  . ARG C 1 242 ? -18.815 19.152  117.578 1.00 25.92 ? 242 ARG C CG  1 
ATOM   8563  C CD  . ARG C 1 242 ? -17.720 18.120  117.890 1.00 25.58 ? 242 ARG C CD  1 
ATOM   8564  N NE  . ARG C 1 242 ? -18.266 16.779  118.122 1.00 23.25 ? 242 ARG C NE  1 
ATOM   8565  C CZ  . ARG C 1 242 ? -18.835 16.328  119.242 1.00 24.28 ? 242 ARG C CZ  1 
ATOM   8566  N NH1 . ARG C 1 242 ? -18.930 17.076  120.353 1.00 22.17 ? 242 ARG C NH1 1 
ATOM   8567  N NH2 . ARG C 1 242 ? -19.307 15.090  119.237 1.00 20.01 ? 242 ARG C NH2 1 
ATOM   8568  N N   . VAL C 1 243 ? -21.087 20.049  113.652 1.00 28.30 ? 243 VAL C N   1 
ATOM   8569  C CA  . VAL C 1 243 ? -21.688 19.702  112.378 1.00 28.56 ? 243 VAL C CA  1 
ATOM   8570  C C   . VAL C 1 243 ? -21.178 18.310  111.949 1.00 27.46 ? 243 VAL C C   1 
ATOM   8571  O O   . VAL C 1 243 ? -20.016 18.001  112.200 1.00 25.06 ? 243 VAL C O   1 
ATOM   8572  C CB  . VAL C 1 243 ? -21.537 20.879  111.362 1.00 29.04 ? 243 VAL C CB  1 
ATOM   8573  C CG1 . VAL C 1 243 ? -20.543 21.932  111.889 1.00 30.81 ? 243 VAL C CG1 1 
ATOM   8574  C CG2 . VAL C 1 243 ? -21.292 20.437  109.903 1.00 30.21 ? 243 VAL C CG2 1 
ATOM   8575  N N   . PRO C 1 244 ? -22.071 17.471  111.364 1.00 26.42 ? 244 PRO C N   1 
ATOM   8576  C CA  . PRO C 1 244 ? -21.681 16.160  110.866 1.00 26.24 ? 244 PRO C CA  1 
ATOM   8577  C C   . PRO C 1 244 ? -20.502 16.273  109.915 1.00 23.99 ? 244 PRO C C   1 
ATOM   8578  O O   . PRO C 1 244 ? -20.457 17.179  109.105 1.00 24.86 ? 244 PRO C O   1 
ATOM   8579  C CB  . PRO C 1 244 ? -22.920 15.700  110.074 1.00 26.69 ? 244 PRO C CB  1 
ATOM   8580  C CG  . PRO C 1 244 ? -24.065 16.399  110.716 1.00 26.33 ? 244 PRO C CG  1 
ATOM   8581  C CD  . PRO C 1 244 ? -23.503 17.745  111.101 1.00 27.91 ? 244 PRO C CD  1 
ATOM   8582  N N   . THR C 1 245 ? -19.566 15.345  109.996 1.00 23.06 ? 245 THR C N   1 
ATOM   8583  C CA  . THR C 1 245 ? -18.384 15.372  109.142 1.00 20.91 ? 245 THR C CA  1 
ATOM   8584  C C   . THR C 1 245 ? -18.614 14.725  107.769 1.00 20.99 ? 245 THR C C   1 
ATOM   8585  O O   . THR C 1 245 ? -19.583 13.975  107.568 1.00 22.19 ? 245 THR C O   1 
ATOM   8586  C CB  . THR C 1 245 ? -17.203 14.700  109.833 1.00 20.25 ? 245 THR C CB  1 
ATOM   8587  O OG1 . THR C 1 245 ? -17.490 13.309  110.011 1.00 19.71 ? 245 THR C OG1 1 
ATOM   8588  C CG2 . THR C 1 245 ? -16.956 15.357  111.210 1.00 19.13 ? 245 THR C CG2 1 
ATOM   8589  N N   . PHE C 1 246 ? -17.737 15.003  106.813 1.00 20.81 ? 246 PHE C N   1 
ATOM   8590  C CA  . PHE C 1 246 ? -17.737 14.216  105.542 1.00 20.80 ? 246 PHE C CA  1 
ATOM   8591  C C   . PHE C 1 246 ? -17.632 12.701  105.774 1.00 20.33 ? 246 PHE C C   1 
ATOM   8592  O O   . PHE C 1 246 ? -18.283 11.904  105.095 1.00 20.94 ? 246 PHE C O   1 
ATOM   8593  C CB  . PHE C 1 246 ? -16.624 14.676  104.597 1.00 20.56 ? 246 PHE C CB  1 
ATOM   8594  C CG  . PHE C 1 246 ? -16.893 15.990  103.949 1.00 21.11 ? 246 PHE C CG  1 
ATOM   8595  C CD1 . PHE C 1 246 ? -16.107 17.114  104.270 1.00 17.58 ? 246 PHE C CD1 1 
ATOM   8596  C CD2 . PHE C 1 246 ? -17.873 16.095  102.964 1.00 18.04 ? 246 PHE C CD2 1 
ATOM   8597  C CE1 . PHE C 1 246 ? -16.352 18.329  103.692 1.00 23.75 ? 246 PHE C CE1 1 
ATOM   8598  C CE2 . PHE C 1 246 ? -18.114 17.302  102.347 1.00 20.39 ? 246 PHE C CE2 1 
ATOM   8599  C CZ  . PHE C 1 246 ? -17.350 18.435  102.688 1.00 19.94 ? 246 PHE C CZ  1 
ATOM   8600  N N   . LEU C 1 247 ? -16.846 12.296  106.755 1.00 21.25 ? 247 LEU C N   1 
ATOM   8601  C CA  . LEU C 1 247 ? -16.654 10.850  107.028 1.00 21.67 ? 247 LEU C CA  1 
ATOM   8602  C C   . LEU C 1 247 ? -17.965 10.185  107.471 1.00 22.43 ? 247 LEU C C   1 
ATOM   8603  O O   . LEU C 1 247 ? -18.277 9.046   107.054 1.00 22.02 ? 247 LEU C O   1 
ATOM   8604  C CB  . LEU C 1 247 ? -15.567 10.629  108.100 1.00 21.96 ? 247 LEU C CB  1 
ATOM   8605  C CG  . LEU C 1 247 ? -15.306 9.165   108.528 1.00 20.28 ? 247 LEU C CG  1 
ATOM   8606  C CD1 . LEU C 1 247 ? -14.677 8.437   107.395 1.00 18.30 ? 247 LEU C CD1 1 
ATOM   8607  C CD2 . LEU C 1 247 ? -14.370 9.153   109.771 1.00 21.54 ? 247 LEU C CD2 1 
ATOM   8608  N N   . SER C 1 248 ? -18.731 10.895  108.301 1.00 22.18 ? 248 SER C N   1 
ATOM   8609  C CA  . SER C 1 248 ? -20.022 10.382  108.742 1.00 23.28 ? 248 SER C CA  1 
ATOM   8610  C C   . SER C 1 248 ? -21.006 10.258  107.588 1.00 24.02 ? 248 SER C C   1 
ATOM   8611  O O   . SER C 1 248 ? -22.004 9.582   107.721 1.00 25.06 ? 248 SER C O   1 
ATOM   8612  C CB  . SER C 1 248 ? -20.665 11.268  109.812 1.00 22.60 ? 248 SER C CB  1 
ATOM   8613  O OG  . SER C 1 248 ? -21.051 12.514  109.281 1.00 21.56 ? 248 SER C OG  1 
ATOM   8614  N N   . MET C 1 249 ? -20.710 10.925  106.482 1.00 24.71 ? 249 MET C N   1 
ATOM   8615  C CA  . MET C 1 249 ? -21.519 10.892  105.263 1.00 25.81 ? 249 MET C CA  1 
ATOM   8616  C C   . MET C 1 249 ? -21.033 9.867   104.233 1.00 25.12 ? 249 MET C C   1 
ATOM   8617  O O   . MET C 1 249 ? -21.621 9.752   103.163 1.00 24.05 ? 249 MET C O   1 
ATOM   8618  C CB  . MET C 1 249 ? -21.375 12.253  104.577 1.00 26.66 ? 249 MET C CB  1 
ATOM   8619  C CG  . MET C 1 249 ? -22.597 13.021  104.466 1.00 29.72 ? 249 MET C CG  1 
ATOM   8620  S SD  . MET C 1 249 ? -22.047 14.651  103.983 1.00 32.06 ? 249 MET C SD  1 
ATOM   8621  C CE  . MET C 1 249 ? -22.354 15.455  105.522 1.00 30.32 ? 249 MET C CE  1 
ATOM   8622  N N   . ASP C 1 250 ? -19.951 9.148   104.545 1.00 25.05 ? 250 ASP C N   1 
ATOM   8623  C CA  . ASP C 1 250 ? -19.156 8.537   103.485 1.00 25.29 ? 250 ASP C CA  1 
ATOM   8624  C C   . ASP C 1 250 ? -19.606 7.154   103.079 1.00 24.74 ? 250 ASP C C   1 
ATOM   8625  O O   . ASP C 1 250 ? -18.873 6.178   103.277 1.00 22.59 ? 250 ASP C O   1 
ATOM   8626  C CB  . ASP C 1 250 ? -17.662 8.517   103.865 1.00 25.13 ? 250 ASP C CB  1 
ATOM   8627  C CG  . ASP C 1 250 ? -16.775 8.082   102.707 1.00 26.59 ? 250 ASP C CG  1 
ATOM   8628  O OD1 . ASP C 1 250 ? -17.186 8.219   101.530 1.00 22.67 ? 250 ASP C OD1 1 
ATOM   8629  O OD2 . ASP C 1 250 ? -15.675 7.574   102.975 1.00 21.98 ? 250 ASP C OD2 1 
ATOM   8630  N N   . VAL C 1 251 ? -20.789 7.080   102.459 1.00 25.50 ? 251 VAL C N   1 
ATOM   8631  C CA  . VAL C 1 251 ? -21.336 5.829   101.989 1.00 25.19 ? 251 VAL C CA  1 
ATOM   8632  C C   . VAL C 1 251 ? -20.492 5.136   100.904 1.00 25.07 ? 251 VAL C C   1 
ATOM   8633  O O   . VAL C 1 251 ? -20.474 3.901   100.825 1.00 24.49 ? 251 VAL C O   1 
ATOM   8634  C CB  . VAL C 1 251 ? -22.869 5.945   101.607 1.00 27.97 ? 251 VAL C CB  1 
ATOM   8635  C CG1 . VAL C 1 251 ? -23.122 7.056   100.620 1.00 29.35 ? 251 VAL C CG1 1 
ATOM   8636  C CG2 . VAL C 1 251 ? -23.368 4.623   101.045 1.00 30.46 ? 251 VAL C CG2 1 
ATOM   8637  N N   . ASP C 1 252 ? -19.746 5.912   100.119 1.00 23.37 ? 252 ASP C N   1 
ATOM   8638  C CA  . ASP C 1 252 ? -18.939 5.347   99.020  1.00 23.34 ? 252 ASP C CA  1 
ATOM   8639  C C   . ASP C 1 252 ? -17.529 4.924   99.407  1.00 22.40 ? 252 ASP C C   1 
ATOM   8640  O O   . ASP C 1 252 ? -16.872 4.223   98.617  1.00 23.50 ? 252 ASP C O   1 
ATOM   8641  C CB  . ASP C 1 252 ? -18.759 6.333   97.876  1.00 23.49 ? 252 ASP C CB  1 
ATOM   8642  C CG  . ASP C 1 252 ? -20.063 6.839   97.283  1.00 27.43 ? 252 ASP C CG  1 
ATOM   8643  O OD1 . ASP C 1 252 ? -21.127 6.199   97.435  1.00 29.49 ? 252 ASP C OD1 1 
ATOM   8644  O OD2 . ASP C 1 252 ? -19.984 7.913   96.653  1.00 29.40 ? 252 ASP C OD2 1 
ATOM   8645  N N   . GLY C 1 253 ? -17.033 5.371   100.566 1.00 20.99 ? 253 GLY C N   1 
ATOM   8646  C CA  . GLY C 1 253 ? -15.605 5.180   100.927 1.00 19.19 ? 253 GLY C CA  1 
ATOM   8647  C C   . GLY C 1 253 ? -14.713 6.044   100.056 1.00 18.37 ? 253 GLY C C   1 
ATOM   8648  O O   . GLY C 1 253 ? -13.682 5.587   99.533  1.00 18.69 ? 253 GLY C O   1 
ATOM   8649  N N   . ARG C 1 254 ? -15.100 7.317   99.875  1.00 18.81 ? 254 ARG C N   1 
ATOM   8650  C CA  . ARG C 1 254 ? -14.250 8.256   99.142  1.00 18.50 ? 254 ARG C CA  1 
ATOM   8651  C C   . ARG C 1 254 ? -13.663 9.315   100.078 1.00 20.16 ? 254 ARG C C   1 
ATOM   8652  O O   . ARG C 1 254 ? -13.086 10.262  99.618  1.00 21.38 ? 254 ARG C O   1 
ATOM   8653  C CB  . ARG C 1 254 ? -15.015 8.919   97.984  1.00 19.76 ? 254 ARG C CB  1 
ATOM   8654  C CG  . ARG C 1 254 ? -16.263 9.779   98.372  1.00 17.46 ? 254 ARG C CG  1 
ATOM   8655  C CD  . ARG C 1 254 ? -16.886 10.459  97.126  1.00 19.74 ? 254 ARG C CD  1 
ATOM   8656  N NE  . ARG C 1 254 ? -17.567 9.461   96.298  1.00 19.29 ? 254 ARG C NE  1 
ATOM   8657  C CZ  . ARG C 1 254 ? -17.045 8.906   95.209  1.00 19.63 ? 254 ARG C CZ  1 
ATOM   8658  N NH1 . ARG C 1 254 ? -15.844 9.280   94.752  1.00 18.93 ? 254 ARG C NH1 1 
ATOM   8659  N NH2 . ARG C 1 254 ? -17.741 7.990   94.563  1.00 19.77 ? 254 ARG C NH2 1 
ATOM   8660  N N   . VAL C 1 255 ? -13.844 9.182   101.392 1.00 20.15 ? 255 VAL C N   1 
ATOM   8661  C CA  . VAL C 1 255 ? -13.343 10.239  102.287 1.00 19.94 ? 255 VAL C CA  1 
ATOM   8662  C C   . VAL C 1 255 ? -12.101 9.742   103.007 1.00 19.33 ? 255 VAL C C   1 
ATOM   8663  O O   . VAL C 1 255 ? -12.058 8.613   103.488 1.00 20.06 ? 255 VAL C O   1 
ATOM   8664  C CB  . VAL C 1 255 ? -14.395 10.761  103.276 1.00 20.52 ? 255 VAL C CB  1 
ATOM   8665  C CG1 . VAL C 1 255 ? -13.742 11.760  104.306 1.00 18.92 ? 255 VAL C CG1 1 
ATOM   8666  C CG2 . VAL C 1 255 ? -15.588 11.392  102.499 1.00 16.15 ? 255 VAL C CG2 1 
ATOM   8667  N N   . ILE C 1 256 ? -11.073 10.568  103.019 1.00 19.70 ? 256 ILE C N   1 
ATOM   8668  C CA  . ILE C 1 256 ? -9.907  10.374  103.917 1.00 19.03 ? 256 ILE C CA  1 
ATOM   8669  C C   . ILE C 1 256 ? -9.884  11.539  104.900 1.00 20.55 ? 256 ILE C C   1 
ATOM   8670  O O   . ILE C 1 256 ? -9.799  12.707  104.512 1.00 21.21 ? 256 ILE C O   1 
ATOM   8671  C CB  . ILE C 1 256 ? -8.564  10.414  103.146 1.00 19.25 ? 256 ILE C CB  1 
ATOM   8672  C CG1 . ILE C 1 256 ? -8.517  9.301   102.095 1.00 19.90 ? 256 ILE C CG1 1 
ATOM   8673  C CG2 . ILE C 1 256 ? -7.372  10.189  104.068 1.00 18.83 ? 256 ILE C CG2 1 
ATOM   8674  C CD1 . ILE C 1 256 ? -7.405  9.458   101.120 1.00 18.92 ? 256 ILE C CD1 1 
ATOM   8675  N N   . ARG C 1 257 ? -9.963  11.215  106.183 1.00 19.03 ? 257 ARG C N   1 
ATOM   8676  C CA  . ARG C 1 257 ? -10.085 12.219  107.209 1.00 18.38 ? 257 ARG C CA  1 
ATOM   8677  C C   . ARG C 1 257 ? -8.775  12.300  107.994 1.00 17.47 ? 257 ARG C C   1 
ATOM   8678  O O   . ARG C 1 257 ? -8.240  11.298  108.382 1.00 17.78 ? 257 ARG C O   1 
ATOM   8679  C CB  . ARG C 1 257 ? -11.252 11.871  108.138 1.00 17.78 ? 257 ARG C CB  1 
ATOM   8680  C CG  . ARG C 1 257 ? -11.218 12.741  109.418 1.00 16.40 ? 257 ARG C CG  1 
ATOM   8681  C CD  . ARG C 1 257 ? -12.454 12.504  110.267 1.00 22.20 ? 257 ARG C CD  1 
ATOM   8682  N NE  . ARG C 1 257 ? -12.490 13.363  111.443 1.00 24.87 ? 257 ARG C NE  1 
ATOM   8683  C CZ  . ARG C 1 257 ? -13.016 14.590  111.494 1.00 23.32 ? 257 ARG C CZ  1 
ATOM   8684  N NH1 . ARG C 1 257 ? -13.598 15.139  110.429 1.00 23.84 ? 257 ARG C NH1 1 
ATOM   8685  N NH2 . ARG C 1 257 ? -12.954 15.274  112.622 1.00 22.44 ? 257 ARG C NH2 1 
ATOM   8686  N N   . ALA C 1 258 ? -8.258  13.494  108.207 1.00 17.92 ? 258 ALA C N   1 
ATOM   8687  C CA  . ALA C 1 258 ? -7.161  13.667  109.143 1.00 17.12 ? 258 ALA C CA  1 
ATOM   8688  C C   . ALA C 1 258 ? -7.620  14.351  110.440 1.00 18.59 ? 258 ALA C C   1 
ATOM   8689  O O   . ALA C 1 258 ? -8.203  15.430  110.403 1.00 19.32 ? 258 ALA C O   1 
ATOM   8690  C CB  . ALA C 1 258 ? -6.034  14.399  108.490 1.00 18.71 ? 258 ALA C CB  1 
ATOM   8691  N N   . ASP C 1 259 ? -7.364  13.706  111.580 1.00 17.88 ? 259 ASP C N   1 
ATOM   8692  C CA  . ASP C 1 259 ? -7.591  14.315  112.903 1.00 18.45 ? 259 ASP C CA  1 
ATOM   8693  C C   . ASP C 1 259 ? -6.278  14.642  113.590 1.00 19.54 ? 259 ASP C C   1 
ATOM   8694  O O   . ASP C 1 259 ? -5.253  14.001  113.327 1.00 19.33 ? 259 ASP C O   1 
ATOM   8695  C CB  . ASP C 1 259 ? -8.371  13.357  113.775 1.00 17.88 ? 259 ASP C CB  1 
ATOM   8696  C CG  . ASP C 1 259 ? -9.871  13.304  113.417 1.00 20.59 ? 259 ASP C CG  1 
ATOM   8697  O OD1 . ASP C 1 259 ? -10.633 14.154  113.926 1.00 19.60 ? 259 ASP C OD1 1 
ATOM   8698  O OD2 . ASP C 1 259 ? -10.291 12.358  112.704 1.00 22.44 ? 259 ASP C OD2 1 
ATOM   8699  N N   . SER C 1 260 ? -6.314  15.619  114.499 1.00 20.64 ? 260 SER C N   1 
ATOM   8700  C CA  . SER C 1 260 ? -5.109  16.095  115.196 1.00 21.49 ? 260 SER C CA  1 
ATOM   8701  C C   . SER C 1 260 ? -5.344  16.140  116.700 1.00 21.28 ? 260 SER C C   1 
ATOM   8702  O O   . SER C 1 260 ? -6.375  16.536  117.149 1.00 22.13 ? 260 SER C O   1 
ATOM   8703  C CB  . SER C 1 260 ? -4.754  17.529  114.720 1.00 22.92 ? 260 SER C CB  1 
ATOM   8704  O OG  . SER C 1 260 ? -3.486  17.919  115.225 1.00 24.52 ? 260 SER C OG  1 
ATOM   8705  N N   . PHE C 1 261 ? -4.356  15.752  117.480 1.00 21.28 ? 261 PHE C N   1 
ATOM   8706  C CA  . PHE C 1 261 ? -4.361  16.073  118.878 1.00 21.13 ? 261 PHE C CA  1 
ATOM   8707  C C   . PHE C 1 261 ? -3.630  17.346  119.225 1.00 20.29 ? 261 PHE C C   1 
ATOM   8708  O O   . PHE C 1 261 ? -3.466  17.653  120.401 1.00 19.47 ? 261 PHE C O   1 
ATOM   8709  C CB  . PHE C 1 261 ? -3.742  14.899  119.646 1.00 22.80 ? 261 PHE C CB  1 
ATOM   8710  C CG  . PHE C 1 261 ? -4.702  13.729  119.843 1.00 23.59 ? 261 PHE C CG  1 
ATOM   8711  C CD1 . PHE C 1 261 ? -6.026  13.951  120.208 1.00 26.01 ? 261 PHE C CD1 1 
ATOM   8712  C CD2 . PHE C 1 261 ? -4.272  12.431  119.650 1.00 26.86 ? 261 PHE C CD2 1 
ATOM   8713  C CE1 . PHE C 1 261 ? -6.910  12.870  120.421 1.00 29.02 ? 261 PHE C CE1 1 
ATOM   8714  C CE2 . PHE C 1 261 ? -5.132  11.361  119.867 1.00 30.79 ? 261 PHE C CE2 1 
ATOM   8715  C CZ  . PHE C 1 261 ? -6.452  11.585  120.256 1.00 26.09 ? 261 PHE C CZ  1 
ATOM   8716  N N   . SER C 1 262 ? -3.163  18.083  118.216 1.00 19.78 ? 262 SER C N   1 
ATOM   8717  C CA  . SER C 1 262 ? -2.136  19.114  118.467 1.00 19.48 ? 262 SER C CA  1 
ATOM   8718  C C   . SER C 1 262 ? -2.706  20.329  119.155 1.00 20.76 ? 262 SER C C   1 
ATOM   8719  O O   . SER C 1 262 ? -1.988  21.015  119.908 1.00 19.80 ? 262 SER C O   1 
ATOM   8720  C CB  . SER C 1 262 ? -1.489  19.564  117.149 1.00 20.27 ? 262 SER C CB  1 
ATOM   8721  O OG  . SER C 1 262 ? -0.711  18.491  116.626 1.00 18.83 ? 262 SER C OG  1 
ATOM   8722  N N   . LYS C 1 263 ? -3.984  20.610  118.871 1.00 20.80 ? 263 LYS C N   1 
ATOM   8723  C CA  . LYS C 1 263 ? -4.681  21.770  119.437 1.00 22.15 ? 263 LYS C CA  1 
ATOM   8724  C C   . LYS C 1 263 ? -5.275  21.457  120.800 1.00 22.76 ? 263 LYS C C   1 
ATOM   8725  O O   . LYS C 1 263 ? -5.499  22.362  121.582 1.00 24.05 ? 263 LYS C O   1 
ATOM   8726  C CB  . LYS C 1 263 ? -5.784  22.229  118.473 1.00 23.18 ? 263 LYS C CB  1 
ATOM   8727  C CG  . LYS C 1 263 ? -5.304  22.962  117.208 1.00 25.06 ? 263 LYS C CG  1 
ATOM   8728  C CD  . LYS C 1 263 ? -4.098  22.394  116.544 1.00 33.25 ? 263 LYS C CD  1 
ATOM   8729  C CE  . LYS C 1 263 ? -3.575  23.353  115.494 1.00 37.93 ? 263 LYS C CE  1 
ATOM   8730  N NZ  . LYS C 1 263 ? -2.208  22.996  115.077 1.00 41.29 ? 263 LYS C NZ  1 
ATOM   8731  N N   . ILE C 1 264 ? -5.535  20.186  121.117 1.00 22.26 ? 264 ILE C N   1 
ATOM   8732  C CA  . ILE C 1 264 ? -6.215  19.910  122.390 1.00 22.87 ? 264 ILE C CA  1 
ATOM   8733  C C   . ILE C 1 264 ? -5.420  19.119  123.424 1.00 22.61 ? 264 ILE C C   1 
ATOM   8734  O O   . ILE C 1 264 ? -5.726  19.211  124.629 1.00 21.28 ? 264 ILE C O   1 
ATOM   8735  C CB  . ILE C 1 264 ? -7.576  19.207  122.189 1.00 23.23 ? 264 ILE C CB  1 
ATOM   8736  C CG1 . ILE C 1 264 ? -7.455  18.023  121.230 1.00 24.75 ? 264 ILE C CG1 1 
ATOM   8737  C CG2 . ILE C 1 264 ? -8.675  20.187  121.650 1.00 24.39 ? 264 ILE C CG2 1 
ATOM   8738  C CD1 . ILE C 1 264 ? -8.702  17.094  121.291 1.00 29.16 ? 264 ILE C CD1 1 
ATOM   8739  N N   . ILE C 1 265 ? -4.449  18.298  122.975 1.00 21.10 ? 265 ILE C N   1 
ATOM   8740  C CA  . ILE C 1 265 ? -3.692  17.475  123.911 1.00 20.33 ? 265 ILE C CA  1 
ATOM   8741  C C   . ILE C 1 265 ? -2.193  17.750  123.908 1.00 18.41 ? 265 ILE C C   1 
ATOM   8742  O O   . ILE C 1 265 ? -1.566  17.843  124.954 1.00 18.91 ? 265 ILE C O   1 
ATOM   8743  C CB  . ILE C 1 265 ? -4.000  15.931  123.707 1.00 21.80 ? 265 ILE C CB  1 
ATOM   8744  C CG1 . ILE C 1 265 ? -5.445  15.614  124.109 1.00 23.61 ? 265 ILE C CG1 1 
ATOM   8745  C CG2 . ILE C 1 265 ? -3.066  15.061  124.473 1.00 21.78 ? 265 ILE C CG2 1 
ATOM   8746  C CD1 . ILE C 1 265 ? -5.888  14.281  123.729 1.00 32.02 ? 265 ILE C CD1 1 
ATOM   8747  N N   . SER C 1 266 ? -1.613  17.855  122.726 1.00 16.78 ? 266 SER C N   1 
ATOM   8748  C CA  . SER C 1 266 ? -0.250  18.288  122.602 1.00 15.70 ? 266 SER C CA  1 
ATOM   8749  C C   . SER C 1 266 ? 0.143   18.331  121.168 1.00 15.58 ? 266 SER C C   1 
ATOM   8750  O O   . SER C 1 266 ? 0.019   17.331  120.447 1.00 14.62 ? 266 SER C O   1 
ATOM   8751  C CB  . SER C 1 266 ? 0.733   17.313  123.264 1.00 14.96 ? 266 SER C CB  1 
ATOM   8752  O OG  . SER C 1 266 ? 2.049   17.733  122.954 1.00 16.65 ? 266 SER C OG  1 
ATOM   8753  N N   . SER C 1 267 ? 0.728   19.470  120.795 1.00 16.37 ? 267 SER C N   1 
ATOM   8754  C CA  . SER C 1 267 ? 1.316   19.643  119.475 1.00 15.16 ? 267 SER C CA  1 
ATOM   8755  C C   . SER C 1 267 ? 2.700   19.060  119.364 1.00 15.32 ? 267 SER C C   1 
ATOM   8756  O O   . SER C 1 267 ? 3.117   18.560  118.287 1.00 14.12 ? 267 SER C O   1 
ATOM   8757  C CB  . SER C 1 267 ? 1.324   21.145  119.098 1.00 15.03 ? 267 SER C CB  1 
ATOM   8758  O OG  . SER C 1 267 ? 1.821   21.950  120.163 1.00 17.57 ? 267 SER C OG  1 
ATOM   8759  N N   . GLY C 1 268 ? 3.463   19.177  120.446 1.00 14.85 ? 268 GLY C N   1 
ATOM   8760  C CA  . GLY C 1 268 ? 4.818   18.753  120.388 1.00 15.41 ? 268 GLY C CA  1 
ATOM   8761  C C   . GLY C 1 268 ? 5.054   17.250  120.532 1.00 16.74 ? 268 GLY C C   1 
ATOM   8762  O O   . GLY C 1 268 ? 6.153   16.801  120.231 1.00 17.81 ? 268 GLY C O   1 
ATOM   8763  N N   . LEU C 1 269 ? 4.072   16.505  121.027 1.00 15.34 ? 269 LEU C N   1 
ATOM   8764  C CA  . LEU C 1 269 ? 4.134   15.022  121.016 1.00 15.71 ? 269 LEU C CA  1 
ATOM   8765  C C   . LEU C 1 269 ? 4.066   14.413  119.597 1.00 16.20 ? 269 LEU C C   1 
ATOM   8766  O O   . LEU C 1 269 ? 4.460   13.277  119.430 1.00 17.06 ? 269 LEU C O   1 
ATOM   8767  C CB  . LEU C 1 269 ? 3.073   14.378  121.910 1.00 16.05 ? 269 LEU C CB  1 
ATOM   8768  C CG  . LEU C 1 269 ? 3.224   14.678  123.410 1.00 15.45 ? 269 LEU C CG  1 
ATOM   8769  C CD1 . LEU C 1 269 ? 2.073   14.059  124.192 1.00 20.81 ? 269 LEU C CD1 1 
ATOM   8770  C CD2 . LEU C 1 269 ? 4.537   14.197  123.927 1.00 18.85 ? 269 LEU C CD2 1 
ATOM   8771  N N   . ARG C 1 270 ? 3.572   15.167  118.607 1.00 15.62 ? 270 ARG C N   1 
ATOM   8772  C CA  . ARG C 1 270 ? 3.515   14.720  117.215 1.00 16.54 ? 270 ARG C CA  1 
ATOM   8773  C C   . ARG C 1 270 ? 2.708   13.397  117.145 1.00 17.58 ? 270 ARG C C   1 
ATOM   8774  O O   . ARG C 1 270 ? 3.266   12.371  116.823 1.00 17.72 ? 270 ARG C O   1 
ATOM   8775  C CB  . ARG C 1 270 ? 4.933   14.489  116.662 1.00 17.14 ? 270 ARG C CB  1 
ATOM   8776  C CG  . ARG C 1 270 ? 5.862   15.782  116.568 1.00 15.59 ? 270 ARG C CG  1 
ATOM   8777  C CD  . ARG C 1 270 ? 5.036   17.019  116.231 1.00 18.43 ? 270 ARG C CD  1 
ATOM   8778  N NE  . ARG C 1 270 ? 4.587   17.047  114.870 1.00 20.95 ? 270 ARG C NE  1 
ATOM   8779  C CZ  . ARG C 1 270 ? 3.410   17.525  114.498 1.00 12.16 ? 270 ARG C CZ  1 
ATOM   8780  N NH1 . ARG C 1 270 ? 2.552   18.028  115.380 1.00 12.76 ? 270 ARG C NH1 1 
ATOM   8781  N NH2 . ARG C 1 270 ? 3.108   17.522  113.231 1.00 17.10 ? 270 ARG C NH2 1 
ATOM   8782  N N   . ILE C 1 271 ? 1.415   13.475  117.458 1.00 19.27 ? 271 ILE C N   1 
ATOM   8783  C CA  . ILE C 1 271 ? 0.475   12.358  117.338 1.00 19.90 ? 271 ILE C CA  1 
ATOM   8784  C C   . ILE C 1 271 ? -0.796  12.891  116.734 1.00 19.81 ? 271 ILE C C   1 
ATOM   8785  O O   . ILE C 1 271 ? -1.492  13.733  117.339 1.00 22.89 ? 271 ILE C O   1 
ATOM   8786  C CB  . ILE C 1 271 ? 0.113   11.717  118.724 1.00 20.64 ? 271 ILE C CB  1 
ATOM   8787  C CG1 . ILE C 1 271 ? 1.370   11.235  119.472 1.00 19.28 ? 271 ILE C CG1 1 
ATOM   8788  C CG2 . ILE C 1 271 ? -1.008  10.626  118.577 1.00 19.85 ? 271 ILE C CG2 1 
ATOM   8789  C CD1 . ILE C 1 271 ? 2.261   10.159  118.815 1.00 22.12 ? 271 ILE C CD1 1 
ATOM   8790  N N   . GLY C 1 272 ? -1.098  12.403  115.537 1.00 19.56 ? 272 GLY C N   1 
ATOM   8791  C CA  . GLY C 1 272 ? -2.385  12.602  114.841 1.00 16.85 ? 272 GLY C CA  1 
ATOM   8792  C C   . GLY C 1 272 ? -2.893  11.250  114.357 1.00 16.63 ? 272 GLY C C   1 
ATOM   8793  O O   . GLY C 1 272 ? -2.332  10.186  114.679 1.00 14.14 ? 272 GLY C O   1 
ATOM   8794  N N   . PHE C 1 273 ? -3.978  11.268  113.594 1.00 16.57 ? 273 PHE C N   1 
ATOM   8795  C CA  . PHE C 1 273 ? -4.464  10.029  113.039 1.00 16.12 ? 273 PHE C CA  1 
ATOM   8796  C C   . PHE C 1 273 ? -5.231  10.273  111.765 1.00 17.55 ? 273 PHE C C   1 
ATOM   8797  O O   . PHE C 1 273 ? -5.785  11.365  111.588 1.00 18.40 ? 273 PHE C O   1 
ATOM   8798  C CB  . PHE C 1 273 ? -5.239  9.185   114.067 1.00 16.87 ? 273 PHE C CB  1 
ATOM   8799  C CG  . PHE C 1 273 ? -6.385  9.902   114.782 1.00 14.92 ? 273 PHE C CG  1 
ATOM   8800  C CD1 . PHE C 1 273 ? -6.170  10.764  115.871 1.00 15.12 ? 273 PHE C CD1 1 
ATOM   8801  C CD2 . PHE C 1 273 ? -7.698  9.664   114.376 1.00 18.99 ? 273 PHE C CD2 1 
ATOM   8802  C CE1 . PHE C 1 273 ? -7.274  11.383  116.544 1.00 16.51 ? 273 PHE C CE1 1 
ATOM   8803  C CE2 . PHE C 1 273 ? -8.777  10.251  115.021 1.00 16.30 ? 273 PHE C CE2 1 
ATOM   8804  C CZ  . PHE C 1 273 ? -8.568  11.095  116.143 1.00 18.59 ? 273 PHE C CZ  1 
ATOM   8805  N N   . LEU C 1 274 ? -5.200  9.270   110.872 1.00 16.74 ? 274 LEU C N   1 
ATOM   8806  C CA  . LEU C 1 274 ? -5.775  9.321   109.553 1.00 17.39 ? 274 LEU C CA  1 
ATOM   8807  C C   . LEU C 1 274 ? -6.764  8.143   109.477 1.00 17.84 ? 274 LEU C C   1 
ATOM   8808  O O   . LEU C 1 274 ? -6.446  6.999   109.858 1.00 15.42 ? 274 LEU C O   1 
ATOM   8809  C CB  . LEU C 1 274 ? -4.642  9.190   108.507 1.00 19.02 ? 274 LEU C CB  1 
ATOM   8810  C CG  . LEU C 1 274 ? -4.872  9.414   107.017 1.00 22.23 ? 274 LEU C CG  1 
ATOM   8811  C CD1 . LEU C 1 274 ? -5.128  10.884  106.773 1.00 20.84 ? 274 LEU C CD1 1 
ATOM   8812  C CD2 . LEU C 1 274 ? -3.629  8.962   106.249 1.00 19.28 ? 274 LEU C CD2 1 
ATOM   8813  N N   . THR C 1 275 ? -7.964  8.447   109.021 1.00 16.85 ? 275 THR C N   1 
ATOM   8814  C CA  . THR C 1 275 ? -9.053  7.476   108.891 1.00 17.64 ? 275 THR C CA  1 
ATOM   8815  C C   . THR C 1 275 ? -9.501  7.504   107.410 1.00 17.98 ? 275 THR C C   1 
ATOM   8816  O O   . THR C 1 275 ? -9.609  8.580   106.856 1.00 16.60 ? 275 THR C O   1 
ATOM   8817  C CB  . THR C 1 275 ? -10.271 7.903   109.750 1.00 18.00 ? 275 THR C CB  1 
ATOM   8818  O OG1 . THR C 1 275 ? -9.850  8.193   111.095 1.00 18.14 ? 275 THR C OG1 1 
ATOM   8819  C CG2 . THR C 1 275 ? -11.322 6.798   109.798 1.00 18.03 ? 275 THR C CG2 1 
ATOM   8820  N N   . GLY C 1 276 ? -9.703  6.340   106.788 1.00 16.72 ? 276 GLY C N   1 
ATOM   8821  C CA  . GLY C 1 276 ? -10.064 6.298   105.365 1.00 18.52 ? 276 GLY C CA  1 
ATOM   8822  C C   . GLY C 1 276 ? -10.232 4.855   104.947 1.00 19.49 ? 276 GLY C C   1 
ATOM   8823  O O   . GLY C 1 276 ? -10.069 3.963   105.792 1.00 18.25 ? 276 GLY C O   1 
ATOM   8824  N N   . PRO C 1 277 ? -10.509 4.623   103.638 1.00 20.58 ? 277 PRO C N   1 
ATOM   8825  C CA  . PRO C 1 277 ? -10.703 3.304   103.052 1.00 20.95 ? 277 PRO C CA  1 
ATOM   8826  C C   . PRO C 1 277 ? -9.451  2.474   103.309 1.00 21.52 ? 277 PRO C C   1 
ATOM   8827  O O   . PRO C 1 277 ? -8.339  2.946   103.087 1.00 20.44 ? 277 PRO C O   1 
ATOM   8828  C CB  . PRO C 1 277 ? -10.788 3.607   101.548 1.00 20.44 ? 277 PRO C CB  1 
ATOM   8829  C CG  . PRO C 1 277 ? -11.233 5.077   101.481 1.00 22.03 ? 277 PRO C CG  1 
ATOM   8830  C CD  . PRO C 1 277 ? -10.572 5.693   102.626 1.00 21.02 ? 277 PRO C CD  1 
ATOM   8831  N N   . LYS C 1 278 ? -9.631  1.229   103.741 1.00 22.23 ? 278 LYS C N   1 
ATOM   8832  C CA  . LYS C 1 278 ? -8.514  0.346   103.999 1.00 21.69 ? 278 LYS C CA  1 
ATOM   8833  C C   . LYS C 1 278 ? -7.410  0.359   102.902 1.00 21.37 ? 278 LYS C C   1 
ATOM   8834  O O   . LYS C 1 278 ? -6.216  0.463   103.223 1.00 20.45 ? 278 LYS C O   1 
ATOM   8835  C CB  . LYS C 1 278 ? -9.053  -1.061  104.241 1.00 21.98 ? 278 LYS C CB  1 
ATOM   8836  C CG  . LYS C 1 278 ? -7.982  -2.126  104.447 1.00 25.77 ? 278 LYS C CG  1 
ATOM   8837  C CD  . LYS C 1 278 ? -8.099  -2.665  105.851 1.00 31.77 ? 278 LYS C CD  1 
ATOM   8838  C CE  . LYS C 1 278 ? -9.476  -3.333  106.210 1.00 33.15 ? 278 LYS C CE  1 
ATOM   8839  N NZ  . LYS C 1 278 ? -9.903  -3.031  107.645 1.00 34.39 ? 278 LYS C NZ  1 
ATOM   8840  N N   . PRO C 1 279 ? -7.785  0.245   101.615 1.00 21.73 ? 279 PRO C N   1 
ATOM   8841  C CA  . PRO C 1 279 ? -6.706  0.209   100.580 1.00 21.35 ? 279 PRO C CA  1 
ATOM   8842  C C   . PRO C 1 279 ? -5.797  1.444   100.532 1.00 20.64 ? 279 PRO C C   1 
ATOM   8843  O O   . PRO C 1 279 ? -4.630  1.330   100.203 1.00 20.30 ? 279 PRO C O   1 
ATOM   8844  C CB  . PRO C 1 279 ? -7.510  0.115   99.261  1.00 21.76 ? 279 PRO C CB  1 
ATOM   8845  C CG  . PRO C 1 279 ? -8.780  -0.560  99.661  1.00 21.60 ? 279 PRO C CG  1 
ATOM   8846  C CD  . PRO C 1 279 ? -9.114  -0.021  101.006 1.00 21.10 ? 279 PRO C CD  1 
ATOM   8847  N N   . LEU C 1 280 ? -6.361  2.610   100.835 1.00 19.83 ? 280 LEU C N   1 
ATOM   8848  C CA  . LEU C 1 280 ? -5.625  3.892   100.840 1.00 19.45 ? 280 LEU C CA  1 
ATOM   8849  C C   . LEU C 1 280 ? -4.756  4.038   102.096 1.00 19.35 ? 280 LEU C C   1 
ATOM   8850  O O   . LEU C 1 280 ? -3.590  4.409   102.001 1.00 19.54 ? 280 LEU C O   1 
ATOM   8851  C CB  . LEU C 1 280 ? -6.618  5.058   100.714 1.00 18.23 ? 280 LEU C CB  1 
ATOM   8852  C CG  . LEU C 1 280 ? -7.410  5.065   99.363  1.00 16.80 ? 280 LEU C CG  1 
ATOM   8853  C CD1 . LEU C 1 280 ? -8.070  6.407   99.188  1.00 15.17 ? 280 LEU C CD1 1 
ATOM   8854  C CD2 . LEU C 1 280 ? -6.502  4.865   98.141  1.00 16.70 ? 280 LEU C CD2 1 
ATOM   8855  N N   . ILE C 1 281 ? -5.339  3.743   103.252 1.00 19.66 ? 281 ILE C N   1 
ATOM   8856  C CA  . ILE C 1 281 ? -4.616  3.715   104.533 1.00 19.96 ? 281 ILE C CA  1 
ATOM   8857  C C   . ILE C 1 281 ? -3.420  2.789   104.466 1.00 20.67 ? 281 ILE C C   1 
ATOM   8858  O O   . ILE C 1 281 ? -2.319  3.129   104.940 1.00 18.37 ? 281 ILE C O   1 
ATOM   8859  C CB  . ILE C 1 281 ? -5.533  3.355   105.742 1.00 19.89 ? 281 ILE C CB  1 
ATOM   8860  C CG1 . ILE C 1 281 ? -6.650  4.419   105.950 1.00 20.22 ? 281 ILE C CG1 1 
ATOM   8861  C CG2 . ILE C 1 281 ? -4.698  3.197   107.011 1.00 19.20 ? 281 ILE C CG2 1 
ATOM   8862  C CD1 . ILE C 1 281 ? -6.182  5.820   106.384 1.00 22.26 ? 281 ILE C CD1 1 
ATOM   8863  N N   . GLU C 1 282 ? -3.627  1.628   103.850 1.00 21.02 ? 282 GLU C N   1 
ATOM   8864  C CA  . GLU C 1 282 ? -2.546  0.665   103.609 1.00 21.33 ? 282 GLU C CA  1 
ATOM   8865  C C   . GLU C 1 282 ? -1.367  1.272   102.860 1.00 19.98 ? 282 GLU C C   1 
ATOM   8866  O O   . GLU C 1 282 ? -0.247  1.016   103.208 1.00 19.16 ? 282 GLU C O   1 
ATOM   8867  C CB  . GLU C 1 282 ? -3.071  -0.544  102.807 1.00 21.22 ? 282 GLU C CB  1 
ATOM   8868  C CG  . GLU C 1 282 ? -1.970  -1.571  102.418 1.00 25.67 ? 282 GLU C CG  1 
ATOM   8869  C CD  . GLU C 1 282 ? -2.500  -2.695  101.512 1.00 30.66 ? 282 GLU C CD  1 
ATOM   8870  O OE1 . GLU C 1 282 ? -3.658  -3.131  101.723 1.00 35.14 ? 282 GLU C OE1 1 
ATOM   8871  O OE2 . GLU C 1 282 ? -1.776  -3.096  100.564 1.00 34.25 ? 282 GLU C OE2 1 
ATOM   8872  N N   . ARG C 1 283 ? -1.609  2.037   101.791 1.00 20.60 ? 283 ARG C N   1 
ATOM   8873  C CA  . ARG C 1 283 ? -0.499  2.675   101.072 1.00 20.38 ? 283 ARG C CA  1 
ATOM   8874  C C   . ARG C 1 283 ? 0.268   3.668   101.970 1.00 21.16 ? 283 ARG C C   1 
ATOM   8875  O O   . ARG C 1 283 ? 1.500   3.790   101.858 1.00 19.79 ? 283 ARG C O   1 
ATOM   8876  C CB  . ARG C 1 283 ? -0.934  3.345   99.740  1.00 21.25 ? 283 ARG C CB  1 
ATOM   8877  C CG  . ARG C 1 283 ? -1.623  2.414   98.686  1.00 25.38 ? 283 ARG C CG  1 
ATOM   8878  C CD  . ARG C 1 283 ? -1.372  0.875   98.920  1.00 30.80 ? 283 ARG C CD  1 
ATOM   8879  N NE  . ARG C 1 283 ? -0.104  0.568   98.376  1.00 30.88 ? 283 ARG C NE  1 
ATOM   8880  C CZ  . ARG C 1 283 ? 0.500   -0.609  98.347  1.00 27.76 ? 283 ARG C CZ  1 
ATOM   8881  N NH1 . ARG C 1 283 ? -0.010  -1.733  98.860  1.00 29.08 ? 283 ARG C NH1 1 
ATOM   8882  N NH2 . ARG C 1 283 ? 1.655   -0.616  97.746  1.00 23.60 ? 283 ARG C NH2 1 
ATOM   8883  N N   . VAL C 1 284 ? -0.449  4.370   102.861 1.00 19.99 ? 284 VAL C N   1 
ATOM   8884  C CA  . VAL C 1 284 ? 0.246   5.338   103.702 1.00 18.72 ? 284 VAL C CA  1 
ATOM   8885  C C   . VAL C 1 284 ? 1.027   4.678   104.821 1.00 18.27 ? 284 VAL C C   1 
ATOM   8886  O O   . VAL C 1 284 ? 2.153   5.065   105.067 1.00 16.49 ? 284 VAL C O   1 
ATOM   8887  C CB  . VAL C 1 284 ? -0.578  6.643   104.124 1.00 19.89 ? 284 VAL C CB  1 
ATOM   8888  C CG1 . VAL C 1 284 ? -1.914  6.798   103.454 1.00 21.40 ? 284 VAL C CG1 1 
ATOM   8889  C CG2 . VAL C 1 284 ? -0.504  7.001   105.658 1.00 16.71 ? 284 VAL C CG2 1 
ATOM   8890  N N   . ILE C 1 285 ? 0.476   3.594   105.379 1.00 17.19 ? 285 ILE C N   1 
ATOM   8891  C CA  . ILE C 1 285 ? 1.248   2.779   106.321 1.00 18.03 ? 285 ILE C CA  1 
ATOM   8892  C C   . ILE C 1 285 ? 2.563   2.257   105.723 1.00 17.29 ? 285 ILE C C   1 
ATOM   8893  O O   . ILE C 1 285 ? 3.628   2.381   106.339 1.00 19.05 ? 285 ILE C O   1 
ATOM   8894  C CB  . ILE C 1 285 ? 0.361   1.652   106.950 1.00 18.01 ? 285 ILE C CB  1 
ATOM   8895  C CG1 . ILE C 1 285 ? -0.769  2.252   107.816 1.00 16.13 ? 285 ILE C CG1 1 
ATOM   8896  C CG2 . ILE C 1 285 ? 1.196   0.636   107.702 1.00 18.20 ? 285 ILE C CG2 1 
ATOM   8897  C CD1 . ILE C 1 285 ? -1.845  1.179   108.106 1.00 19.72 ? 285 ILE C CD1 1 
ATOM   8898  N N   . LEU C 1 286 ? 2.504   1.751   104.499 1.00 17.83 ? 286 LEU C N   1 
ATOM   8899  C CA  . LEU C 1 286 ? 3.682   1.238   103.823 1.00 17.06 ? 286 LEU C CA  1 
ATOM   8900  C C   . LEU C 1 286 ? 4.747   2.340   103.612 1.00 17.73 ? 286 LEU C C   1 
ATOM   8901  O O   . LEU C 1 286 ? 5.931   2.079   103.748 1.00 16.08 ? 286 LEU C O   1 
ATOM   8902  C CB  . LEU C 1 286 ? 3.299   0.568   102.513 1.00 17.71 ? 286 LEU C CB  1 
ATOM   8903  C CG  . LEU C 1 286 ? 2.603   -0.818  102.633 1.00 20.16 ? 286 LEU C CG  1 
ATOM   8904  C CD1 . LEU C 1 286 ? 2.425   -1.525  101.257 1.00 19.25 ? 286 LEU C CD1 1 
ATOM   8905  C CD2 . LEU C 1 286 ? 3.399   -1.728  103.583 1.00 23.13 ? 286 LEU C CD2 1 
ATOM   8906  N N   . HIS C 1 287 ? 4.334   3.566   103.299 1.00 15.95 ? 287 HIS C N   1 
ATOM   8907  C CA  . HIS C 1 287 ? 5.299   4.651   103.156 1.00 17.30 ? 287 HIS C CA  1 
ATOM   8908  C C   . HIS C 1 287 ? 5.822   5.035   104.554 1.00 18.44 ? 287 HIS C C   1 
ATOM   8909  O O   . HIS C 1 287 ? 7.014   5.241   104.765 1.00 19.23 ? 287 HIS C O   1 
ATOM   8910  C CB  . HIS C 1 287 ? 4.584   5.861   102.507 1.00 17.57 ? 287 HIS C CB  1 
ATOM   8911  C CG  . HIS C 1 287 ? 5.501   6.913   101.988 1.00 20.55 ? 287 HIS C CG  1 
ATOM   8912  N ND1 . HIS C 1 287 ? 5.038   7.990   101.257 1.00 22.65 ? 287 HIS C ND1 1 
ATOM   8913  C CD2 . HIS C 1 287 ? 6.853   7.057   102.078 1.00 19.16 ? 287 HIS C CD2 1 
ATOM   8914  C CE1 . HIS C 1 287 ? 6.062   8.760   100.923 1.00 21.47 ? 287 HIS C CE1 1 
ATOM   8915  N NE2 . HIS C 1 287 ? 7.173   8.215   101.404 1.00 20.86 ? 287 HIS C NE2 1 
ATOM   8916  N N   . ILE C 1 288 ? 4.933   5.053   105.548 1.00 18.72 ? 288 ILE C N   1 
ATOM   8917  C CA  . ILE C 1 288 ? 5.414   5.296   106.920 1.00 18.34 ? 288 ILE C CA  1 
ATOM   8918  C C   . ILE C 1 288 ? 6.461   4.255   107.317 1.00 18.18 ? 288 ILE C C   1 
ATOM   8919  O O   . ILE C 1 288 ? 7.489   4.581   107.943 1.00 18.21 ? 288 ILE C O   1 
ATOM   8920  C CB  . ILE C 1 288 ? 4.234   5.393   107.923 1.00 18.48 ? 288 ILE C CB  1 
ATOM   8921  C CG1 . ILE C 1 288 ? 3.455   6.724   107.685 1.00 19.85 ? 288 ILE C CG1 1 
ATOM   8922  C CG2 . ILE C 1 288 ? 4.720   5.180   109.416 1.00 14.27 ? 288 ILE C CG2 1 
ATOM   8923  C CD1 . ILE C 1 288 ? 2.124   6.807   108.457 1.00 21.30 ? 288 ILE C CD1 1 
ATOM   8924  N N   . GLN C 1 289 ? 6.204   2.991   106.974 1.00 18.24 ? 289 GLN C N   1 
ATOM   8925  C CA  . GLN C 1 289 ? 7.132   1.914   107.306 1.00 19.32 ? 289 GLN C CA  1 
ATOM   8926  C C   . GLN C 1 289 ? 8.565   2.151   106.821 1.00 19.36 ? 289 GLN C C   1 
ATOM   8927  O O   . GLN C 1 289 ? 9.486   1.615   107.398 1.00 19.52 ? 289 GLN C O   1 
ATOM   8928  C CB  . GLN C 1 289 ? 6.692   0.574   106.689 1.00 19.64 ? 289 GLN C CB  1 
ATOM   8929  C CG  . GLN C 1 289 ? 5.608   -0.048  107.435 1.00 24.65 ? 289 GLN C CG  1 
ATOM   8930  C CD  . GLN C 1 289 ? 5.238   -1.457  106.964 1.00 29.32 ? 289 GLN C CD  1 
ATOM   8931  O OE1 . GLN C 1 289 ? 5.902   -2.053  106.110 1.00 30.13 ? 289 GLN C OE1 1 
ATOM   8932  N NE2 . GLN C 1 289 ? 4.159   -2.007  107.559 1.00 30.66 ? 289 GLN C NE2 1 
ATOM   8933  N N   . VAL C 1 290 ? 8.730   2.831   105.694 1.00 19.14 ? 290 VAL C N   1 
ATOM   8934  C CA  . VAL C 1 290 ? 10.083  3.130   105.188 1.00 19.75 ? 290 VAL C CA  1 
ATOM   8935  C C   . VAL C 1 290 ? 10.598  4.543   105.530 1.00 19.63 ? 290 VAL C C   1 
ATOM   8936  O O   . VAL C 1 290 ? 11.712  4.896   105.145 1.00 18.66 ? 290 VAL C O   1 
ATOM   8937  C CB  . VAL C 1 290 ? 10.236  2.774   103.658 1.00 19.60 ? 290 VAL C CB  1 
ATOM   8938  C CG1 . VAL C 1 290 ? 10.024  1.229   103.433 1.00 21.42 ? 290 VAL C CG1 1 
ATOM   8939  C CG2 . VAL C 1 290 ? 9.271   3.553   102.827 1.00 20.82 ? 290 VAL C CG2 1 
ATOM   8940  N N   . SER C 1 291 ? 9.817   5.327   106.278 1.00 19.53 ? 291 SER C N   1 
ATOM   8941  C CA  . SER C 1 291 ? 10.268  6.659   106.726 1.00 19.88 ? 291 SER C CA  1 
ATOM   8942  C C   . SER C 1 291 ? 10.375  6.771   108.258 1.00 19.36 ? 291 SER C C   1 
ATOM   8943  O O   . SER C 1 291 ? 11.407  6.434   108.820 1.00 19.66 ? 291 SER C O   1 
ATOM   8944  C CB  . SER C 1 291 ? 9.496   7.824   106.119 1.00 20.79 ? 291 SER C CB  1 
ATOM   8945  O OG  . SER C 1 291 ? 8.089   7.675   106.252 1.00 24.37 ? 291 SER C OG  1 
ATOM   8946  N N   . THR C 1 292 ? 9.319   7.144   108.957 1.00 19.08 ? 292 THR C N   1 
ATOM   8947  C CA  . THR C 1 292 ? 9.468   7.286   110.426 1.00 17.01 ? 292 THR C CA  1 
ATOM   8948  C C   . THR C 1 292 ? 9.467   5.920   111.156 1.00 17.81 ? 292 THR C C   1 
ATOM   8949  O O   . THR C 1 292 ? 9.910   5.842   112.344 1.00 17.06 ? 292 THR C O   1 
ATOM   8950  C CB  . THR C 1 292 ? 8.383   8.184   111.012 1.00 18.69 ? 292 THR C CB  1 
ATOM   8951  O OG1 . THR C 1 292 ? 7.127   7.835   110.419 1.00 17.02 ? 292 THR C OG1 1 
ATOM   8952  C CG2 . THR C 1 292 ? 8.685   9.615   110.667 1.00 16.57 ? 292 THR C CG2 1 
ATOM   8953  N N   . LEU C 1 293 ? 8.970   4.894   110.453 1.00 16.72 ? 293 LEU C N   1 
ATOM   8954  C CA  . LEU C 1 293 ? 8.767   3.514   110.957 1.00 18.27 ? 293 LEU C CA  1 
ATOM   8955  C C   . LEU C 1 293 ? 7.504   3.444   111.778 1.00 18.38 ? 293 LEU C C   1 
ATOM   8956  O O   . LEU C 1 293 ? 6.661   2.589   111.532 1.00 17.84 ? 293 LEU C O   1 
ATOM   8957  C CB  . LEU C 1 293 ? 9.947   2.964   111.781 1.00 19.47 ? 293 LEU C CB  1 
ATOM   8958  C CG  . LEU C 1 293 ? 11.308  2.869   111.127 1.00 21.97 ? 293 LEU C CG  1 
ATOM   8959  C CD1 . LEU C 1 293 ? 12.122  1.892   112.053 1.00 25.57 ? 293 LEU C CD1 1 
ATOM   8960  C CD2 . LEU C 1 293 ? 11.182  2.311   109.739 1.00 27.86 ? 293 LEU C CD2 1 
ATOM   8961  N N   . HIS C 1 294 ? 7.367   4.388   112.699 1.00 17.37 ? 294 HIS C N   1 
ATOM   8962  C CA  . HIS C 1 294 ? 6.193   4.487   113.528 1.00 17.91 ? 294 HIS C CA  1 
ATOM   8963  C C   . HIS C 1 294 ? 6.230   5.764   114.395 1.00 17.82 ? 294 HIS C C   1 
ATOM   8964  O O   . HIS C 1 294 ? 7.304   6.341   114.611 1.00 17.95 ? 294 HIS C O   1 
ATOM   8965  C CB  . HIS C 1 294 ? 6.067   3.222   114.414 1.00 16.67 ? 294 HIS C CB  1 
ATOM   8966  C CG  . HIS C 1 294 ? 7.126   3.118   115.458 1.00 16.14 ? 294 HIS C CG  1 
ATOM   8967  N ND1 . HIS C 1 294 ? 8.228   2.294   115.334 1.00 19.82 ? 294 HIS C ND1 1 
ATOM   8968  C CD2 . HIS C 1 294 ? 7.261   3.747   116.643 1.00 13.79 ? 294 HIS C CD2 1 
ATOM   8969  C CE1 . HIS C 1 294 ? 9.004   2.434   116.398 1.00 15.80 ? 294 HIS C CE1 1 
ATOM   8970  N NE2 . HIS C 1 294 ? 8.433   3.303   117.208 1.00 19.10 ? 294 HIS C NE2 1 
ATOM   8971  N N   . PRO C 1 295 ? 5.062   6.147   115.002 1.00 17.88 ? 295 PRO C N   1 
ATOM   8972  C CA  . PRO C 1 295 ? 5.073   7.292   115.925 1.00 17.74 ? 295 PRO C CA  1 
ATOM   8973  C C   . PRO C 1 295 ? 5.742   6.898   117.244 1.00 18.54 ? 295 PRO C C   1 
ATOM   8974  O O   . PRO C 1 295 ? 5.775   5.733   117.587 1.00 16.61 ? 295 PRO C O   1 
ATOM   8975  C CB  . PRO C 1 295 ? 3.574   7.599   116.163 1.00 17.88 ? 295 PRO C CB  1 
ATOM   8976  C CG  . PRO C 1 295 ? 2.817   6.799   115.111 1.00 17.28 ? 295 PRO C CG  1 
ATOM   8977  C CD  . PRO C 1 295 ? 3.717   5.558   114.904 1.00 18.11 ? 295 PRO C CD  1 
ATOM   8978  N N   . SER C 1 296 ? 6.284   7.883   117.958 1.00 17.46 ? 296 SER C N   1 
ATOM   8979  C CA  . SER C 1 296 ? 6.993   7.630   119.182 1.00 17.67 ? 296 SER C CA  1 
ATOM   8980  C C   . SER C 1 296 ? 6.134   6.724   120.060 1.00 17.44 ? 296 SER C C   1 
ATOM   8981  O O   . SER C 1 296 ? 4.996   7.048   120.350 1.00 16.68 ? 296 SER C O   1 
ATOM   8982  C CB  . SER C 1 296 ? 7.239   8.922   119.940 1.00 17.95 ? 296 SER C CB  1 
ATOM   8983  O OG  . SER C 1 296 ? 7.593   8.658   121.283 1.00 20.30 ? 296 SER C OG  1 
ATOM   8984  N N   . THR C 1 297 ? 6.684   5.589   120.480 1.00 17.24 ? 297 THR C N   1 
ATOM   8985  C CA  . THR C 1 297 ? 5.840   4.699   121.287 1.00 16.49 ? 297 THR C CA  1 
ATOM   8986  C C   . THR C 1 297 ? 5.571   5.266   122.677 1.00 15.35 ? 297 THR C C   1 
ATOM   8987  O O   . THR C 1 297 ? 4.451   5.195   123.155 1.00 14.19 ? 297 THR C O   1 
ATOM   8988  C CB  . THR C 1 297 ? 6.224   3.154   121.169 1.00 19.63 ? 297 THR C CB  1 
ATOM   8989  O OG1 . THR C 1 297 ? 5.906   2.349   122.323 1.00 21.23 ? 297 THR C OG1 1 
ATOM   8990  C CG2 . THR C 1 297 ? 7.510   2.859   120.553 1.00 12.26 ? 297 THR C CG2 1 
ATOM   8991  N N   . PHE C 1 298 ? 6.593   5.893   123.270 1.00 15.62 ? 298 PHE C N   1 
ATOM   8992  C CA  . PHE C 1 298 ? 6.458   6.662   124.509 1.00 15.38 ? 298 PHE C CA  1 
ATOM   8993  C C   . PHE C 1 298 ? 5.264   7.620   124.461 1.00 14.32 ? 298 PHE C C   1 
ATOM   8994  O O   . PHE C 1 298 ? 4.369   7.609   125.343 1.00 13.49 ? 298 PHE C O   1 
ATOM   8995  C CB  . PHE C 1 298 ? 7.803   7.400   124.778 1.00 14.69 ? 298 PHE C CB  1 
ATOM   8996  C CG  . PHE C 1 298 ? 7.982   7.914   126.216 1.00 18.42 ? 298 PHE C CG  1 
ATOM   8997  C CD1 . PHE C 1 298 ? 7.373   9.103   126.629 1.00 20.19 ? 298 PHE C CD1 1 
ATOM   8998  C CD2 . PHE C 1 298 ? 8.809   7.253   127.127 1.00 18.77 ? 298 PHE C CD2 1 
ATOM   8999  C CE1 . PHE C 1 298 ? 7.557   9.615   127.921 1.00 18.35 ? 298 PHE C CE1 1 
ATOM   9000  C CE2 . PHE C 1 298 ? 8.965   7.750   128.459 1.00 17.41 ? 298 PHE C CE2 1 
ATOM   9001  C CZ  . PHE C 1 298 ? 8.328   8.927   128.831 1.00 15.89 ? 298 PHE C CZ  1 
ATOM   9002  N N   . ASN C 1 299 ? 5.232   8.455   123.445 1.00 14.07 ? 299 ASN C N   1 
ATOM   9003  C CA  . ASN C 1 299 ? 4.176   9.503   123.335 1.00 15.47 ? 299 ASN C CA  1 
ATOM   9004  C C   . ASN C 1 299 ? 2.760   8.932   123.106 1.00 17.02 ? 299 ASN C C   1 
ATOM   9005  O O   . ASN C 1 299 ? 1.772   9.467   123.631 1.00 16.18 ? 299 ASN C O   1 
ATOM   9006  C CB  . ASN C 1 299 ? 4.497   10.459  122.199 1.00 15.51 ? 299 ASN C CB  1 
ATOM   9007  C CG  . ASN C 1 299 ? 5.794   11.233  122.405 1.00 15.94 ? 299 ASN C CG  1 
ATOM   9008  O OD1 . ASN C 1 299 ? 6.234   11.964  121.480 1.00 16.68 ? 299 ASN C OD1 1 
ATOM   9009  N ND2 . ASN C 1 299 ? 6.413   11.107  123.591 1.00 13.93 ? 299 ASN C ND2 1 
ATOM   9010  N N   . GLN C 1 300 ? 2.674   7.849   122.320 1.00 16.78 ? 300 GLN C N   1 
ATOM   9011  C CA  . GLN C 1 300 ? 1.426   7.101   122.140 1.00 17.23 ? 300 GLN C CA  1 
ATOM   9012  C C   . GLN C 1 300 ? 0.963   6.495   123.481 1.00 17.36 ? 300 GLN C C   1 
ATOM   9013  O O   . GLN C 1 300 ? -0.202  6.609   123.840 1.00 17.02 ? 300 GLN C O   1 
ATOM   9014  C CB  . GLN C 1 300 ? 1.672   5.966   121.159 1.00 17.50 ? 300 GLN C CB  1 
ATOM   9015  C CG  . GLN C 1 300 ? 1.526   6.386   119.726 1.00 16.04 ? 300 GLN C CG  1 
ATOM   9016  C CD  . GLN C 1 300 ? 1.507   5.185   118.856 1.00 18.88 ? 300 GLN C CD  1 
ATOM   9017  O OE1 . GLN C 1 300 ? 0.441   4.619   118.587 1.00 19.78 ? 300 GLN C OE1 1 
ATOM   9018  N NE2 . GLN C 1 300 ? 2.670   4.785   118.387 1.00 15.28 ? 300 GLN C NE2 1 
ATOM   9019  N N   . LEU C 1 301 ? 1.881   5.861   124.219 1.00 17.10 ? 301 LEU C N   1 
ATOM   9020  C CA  . LEU C 1 301 ? 1.529   5.364   125.563 1.00 16.86 ? 301 LEU C CA  1 
ATOM   9021  C C   . LEU C 1 301 ? 1.062   6.467   126.510 1.00 16.78 ? 301 LEU C C   1 
ATOM   9022  O O   . LEU C 1 301 ? 0.108   6.259   127.231 1.00 16.28 ? 301 LEU C O   1 
ATOM   9023  C CB  . LEU C 1 301 ? 2.646   4.548   126.201 1.00 17.27 ? 301 LEU C CB  1 
ATOM   9024  C CG  . LEU C 1 301 ? 2.846   3.187   125.523 1.00 19.93 ? 301 LEU C CG  1 
ATOM   9025  C CD1 . LEU C 1 301 ? 4.158   2.595   125.881 1.00 17.54 ? 301 LEU C CD1 1 
ATOM   9026  C CD2 . LEU C 1 301 ? 1.704   2.207   125.818 1.00 20.87 ? 301 LEU C CD2 1 
ATOM   9027  N N   . MET C 1 302 ? 1.678   7.646   126.498 1.00 16.58 ? 302 MET C N   1 
ATOM   9028  C CA  . MET C 1 302 ? 1.190   8.769   127.349 1.00 17.19 ? 302 MET C CA  1 
ATOM   9029  C C   . MET C 1 302 ? -0.262  9.123   127.005 1.00 17.64 ? 302 MET C C   1 
ATOM   9030  O O   . MET C 1 302 ? -1.127  9.261   127.901 1.00 17.75 ? 302 MET C O   1 
ATOM   9031  C CB  . MET C 1 302 ? 2.043   10.020  127.146 1.00 16.46 ? 302 MET C CB  1 
ATOM   9032  C CG  . MET C 1 302 ? 3.491   9.960   127.673 1.00 18.10 ? 302 MET C CG  1 
ATOM   9033  S SD  . MET C 1 302 ? 4.366   11.447  127.107 1.00 23.76 ? 302 MET C SD  1 
ATOM   9034  C CE  . MET C 1 302 ? 3.437   12.779  127.881 1.00 21.22 ? 302 MET C CE  1 
ATOM   9035  N N   . ILE C 1 303 ? -0.508  9.307   125.713 1.00 16.08 ? 303 ILE C N   1 
ATOM   9036  C CA  . ILE C 1 303 ? -1.862  9.649   125.216 1.00 17.02 ? 303 ILE C CA  1 
ATOM   9037  C C   . ILE C 1 303 ? -2.896  8.531   125.436 1.00 16.39 ? 303 ILE C C   1 
ATOM   9038  O O   . ILE C 1 303 ? -3.990  8.768   125.985 1.00 16.41 ? 303 ILE C O   1 
ATOM   9039  C CB  . ILE C 1 303 ? -1.813  10.172  123.767 1.00 17.92 ? 303 ILE C CB  1 
ATOM   9040  C CG1 . ILE C 1 303 ? -1.033  11.499  123.758 1.00 17.25 ? 303 ILE C CG1 1 
ATOM   9041  C CG2 . ILE C 1 303 ? -3.200  10.485  123.245 1.00 17.87 ? 303 ILE C CG2 1 
ATOM   9042  C CD1 . ILE C 1 303 ? -0.650  11.896  122.391 1.00 18.87 ? 303 ILE C CD1 1 
ATOM   9043  N N   . SER C 1 304 ? -2.539  7.292   125.091 1.00 15.42 ? 304 SER C N   1 
ATOM   9044  C CA  . SER C 1 304 ? -3.523  6.213   125.220 1.00 17.41 ? 304 SER C CA  1 
ATOM   9045  C C   . SER C 1 304 ? -3.881  5.969   126.708 1.00 16.59 ? 304 SER C C   1 
ATOM   9046  O O   . SER C 1 304 ? -5.018  5.654   127.035 1.00 17.52 ? 304 SER C O   1 
ATOM   9047  C CB  . SER C 1 304 ? -3.009  4.918   124.557 1.00 16.78 ? 304 SER C CB  1 
ATOM   9048  O OG  . SER C 1 304 ? -3.826  3.806   124.859 1.00 18.83 ? 304 SER C OG  1 
ATOM   9049  N N   . GLN C 1 305 ? -2.935  6.132   127.609 1.00 17.08 ? 305 GLN C N   1 
ATOM   9050  C CA  . GLN C 1 305 ? -3.256  5.919   129.034 1.00 18.77 ? 305 GLN C CA  1 
ATOM   9051  C C   . GLN C 1 305 ? -4.112  7.040   129.617 1.00 18.29 ? 305 GLN C C   1 
ATOM   9052  O O   . GLN C 1 305 ? -4.976  6.809   130.502 1.00 18.51 ? 305 GLN C O   1 
ATOM   9053  C CB  . GLN C 1 305 ? -1.973  5.711   129.830 1.00 18.93 ? 305 GLN C CB  1 
ATOM   9054  C CG  . GLN C 1 305 ? -1.429  4.337   129.463 1.00 22.73 ? 305 GLN C CG  1 
ATOM   9055  C CD  . GLN C 1 305 ? -0.144  3.952   130.151 1.00 27.97 ? 305 GLN C CD  1 
ATOM   9056  O OE1 . GLN C 1 305 ? 0.601   3.070   129.665 1.00 31.38 ? 305 GLN C OE1 1 
ATOM   9057  N NE2 . GLN C 1 305 ? 0.115   4.556   131.287 1.00 23.02 ? 305 GLN C NE2 1 
ATOM   9058  N N   . LEU C 1 306 ? -3.854  8.245   129.125 1.00 16.51 ? 306 LEU C N   1 
ATOM   9059  C CA  . LEU C 1 306 ? -4.657  9.408   129.474 1.00 17.39 ? 306 LEU C CA  1 
ATOM   9060  C C   . LEU C 1 306 ? -6.094  9.196   129.024 1.00 16.36 ? 306 LEU C C   1 
ATOM   9061  O O   . LEU C 1 306 ? -7.019  9.344   129.796 1.00 15.48 ? 306 LEU C O   1 
ATOM   9062  C CB  . LEU C 1 306 ? -4.067  10.687  128.859 1.00 17.46 ? 306 LEU C CB  1 
ATOM   9063  C CG  . LEU C 1 306 ? -4.964  11.939  128.930 1.00 18.55 ? 306 LEU C CG  1 
ATOM   9064  C CD1 . LEU C 1 306 ? -4.765  12.614  130.270 1.00 17.85 ? 306 LEU C CD1 1 
ATOM   9065  C CD2 . LEU C 1 306 ? -4.652  12.910  127.749 1.00 18.52 ? 306 LEU C CD2 1 
ATOM   9066  N N   . LEU C 1 307 ? -6.238  8.828   127.755 1.00 16.79 ? 307 LEU C N   1 
ATOM   9067  C CA  . LEU C 1 307 ? -7.514  8.616   127.128 1.00 17.15 ? 307 LEU C CA  1 
ATOM   9068  C C   . LEU C 1 307 ? -8.293  7.472   127.761 1.00 16.77 ? 307 LEU C C   1 
ATOM   9069  O O   . LEU C 1 307 ? -9.463  7.608   127.947 1.00 18.22 ? 307 LEU C O   1 
ATOM   9070  C CB  . LEU C 1 307 ? -7.296  8.362   125.636 1.00 16.80 ? 307 LEU C CB  1 
ATOM   9071  C CG  . LEU C 1 307 ? -7.399  9.520   124.636 1.00 20.89 ? 307 LEU C CG  1 
ATOM   9072  C CD1 . LEU C 1 307 ? -7.209  10.899  125.184 1.00 25.41 ? 307 LEU C CD1 1 
ATOM   9073  C CD2 . LEU C 1 307 ? -6.710  9.256   123.240 1.00 20.75 ? 307 LEU C CD2 1 
ATOM   9074  N N   . HIS C 1 308 ? -7.655  6.349   128.072 1.00 17.75 ? 308 HIS C N   1 
ATOM   9075  C CA  . HIS C 1 308 ? -8.382  5.208   128.657 1.00 18.49 ? 308 HIS C CA  1 
ATOM   9076  C C   . HIS C 1 308 ? -8.811  5.511   130.078 1.00 18.51 ? 308 HIS C C   1 
ATOM   9077  O O   . HIS C 1 308 ? -9.880  5.090   130.540 1.00 17.95 ? 308 HIS C O   1 
ATOM   9078  C CB  . HIS C 1 308 ? -7.544  3.925   128.602 1.00 17.72 ? 308 HIS C CB  1 
ATOM   9079  C CG  . HIS C 1 308 ? -7.517  3.268   127.255 1.00 20.19 ? 308 HIS C CG  1 
ATOM   9080  N ND1 . HIS C 1 308 ? -6.619  3.605   126.260 1.00 19.58 ? 308 HIS C ND1 1 
ATOM   9081  C CD2 . HIS C 1 308 ? -8.242  2.237   126.769 1.00 15.37 ? 308 HIS C CD2 1 
ATOM   9082  C CE1 . HIS C 1 308 ? -6.827  2.839   125.206 1.00 19.40 ? 308 HIS C CE1 1 
ATOM   9083  N NE2 . HIS C 1 308 ? -7.792  1.983   125.499 1.00 19.66 ? 308 HIS C NE2 1 
ATOM   9084  N N   . GLU C 1 309 ? -8.015  6.301   130.768 1.00 18.27 ? 309 GLU C N   1 
ATOM   9085  C CA  . GLU C 1 309 ? -8.389  6.664   132.144 1.00 20.06 ? 309 GLU C CA  1 
ATOM   9086  C C   . GLU C 1 309 ? -9.528  7.668   132.233 1.00 19.09 ? 309 GLU C C   1 
ATOM   9087  O O   . GLU C 1 309 ? -10.411 7.551   133.085 1.00 18.97 ? 309 GLU C O   1 
ATOM   9088  C CB  . GLU C 1 309 ? -7.180  7.195   132.893 1.00 19.32 ? 309 GLU C CB  1 
ATOM   9089  C CG  . GLU C 1 309 ? -7.407  7.177   134.376 1.00 27.36 ? 309 GLU C CG  1 
ATOM   9090  C CD  . GLU C 1 309 ? -7.318  5.770   134.940 1.00 36.95 ? 309 GLU C CD  1 
ATOM   9091  O OE1 . GLU C 1 309 ? -8.220  5.419   135.715 1.00 43.85 ? 309 GLU C OE1 1 
ATOM   9092  O OE2 . GLU C 1 309 ? -6.364  5.007   134.590 1.00 42.49 ? 309 GLU C OE2 1 
ATOM   9093  N N   . TRP C 1 310 ? -9.488  8.676   131.364 1.00 19.38 ? 310 TRP C N   1 
ATOM   9094  C CA  . TRP C 1 310 ? -10.580 9.631   131.190 1.00 21.11 ? 310 TRP C CA  1 
ATOM   9095  C C   . TRP C 1 310 ? -11.834 8.965   130.654 1.00 21.65 ? 310 TRP C C   1 
ATOM   9096  O O   . TRP C 1 310 ? -12.950 9.363   131.011 1.00 22.95 ? 310 TRP C O   1 
ATOM   9097  C CB  . TRP C 1 310 ? -10.197 10.714  130.151 1.00 19.75 ? 310 TRP C CB  1 
ATOM   9098  C CG  . TRP C 1 310 ? -9.489  11.901  130.682 1.00 22.23 ? 310 TRP C CG  1 
ATOM   9099  C CD1 . TRP C 1 310 ? -9.289  12.230  132.000 1.00 22.56 ? 310 TRP C CD1 1 
ATOM   9100  C CD2 . TRP C 1 310 ? -8.907  12.957  129.905 1.00 21.80 ? 310 TRP C CD2 1 
ATOM   9101  N NE1 . TRP C 1 310 ? -8.606  13.434  132.081 1.00 24.18 ? 310 TRP C NE1 1 
ATOM   9102  C CE2 . TRP C 1 310 ? -8.345  13.884  130.806 1.00 24.28 ? 310 TRP C CE2 1 
ATOM   9103  C CE3 . TRP C 1 310 ? -8.780  13.191  128.519 1.00 22.99 ? 310 TRP C CE3 1 
ATOM   9104  C CZ2 . TRP C 1 310 ? -7.679  15.053  130.372 1.00 22.40 ? 310 TRP C CZ2 1 
ATOM   9105  C CZ3 . TRP C 1 310 ? -8.150  14.346  128.093 1.00 22.07 ? 310 TRP C CZ3 1 
ATOM   9106  C CH2 . TRP C 1 310 ? -7.605  15.273  129.031 1.00 20.55 ? 310 TRP C CH2 1 
ATOM   9107  N N   . GLY C 1 311 ? -11.649 8.001   129.743 1.00 22.05 ? 311 GLY C N   1 
ATOM   9108  C CA  . GLY C 1 311 ? -12.769 7.448   128.996 1.00 22.90 ? 311 GLY C CA  1 
ATOM   9109  C C   . GLY C 1 311 ? -13.299 8.513   128.029 1.00 24.74 ? 311 GLY C C   1 
ATOM   9110  O O   . GLY C 1 311 ? -12.854 9.683   128.028 1.00 22.45 ? 311 GLY C O   1 
ATOM   9111  N N   . GLU C 1 312 ? -14.285 8.143   127.228 1.00 26.07 ? 312 GLU C N   1 
ATOM   9112  C CA  . GLU C 1 312 ? -14.842 9.113   126.283 1.00 29.10 ? 312 GLU C CA  1 
ATOM   9113  C C   . GLU C 1 312 ? -15.461 10.321  126.954 1.00 29.05 ? 312 GLU C C   1 
ATOM   9114  O O   . GLU C 1 312 ? -15.352 11.442  126.438 1.00 29.77 ? 312 GLU C O   1 
ATOM   9115  C CB  . GLU C 1 312 ? -15.758 8.438   125.249 1.00 29.33 ? 312 GLU C CB  1 
ATOM   9116  C CG  . GLU C 1 312 ? -14.936 8.085   123.979 1.00 35.50 ? 312 GLU C CG  1 
ATOM   9117  C CD  . GLU C 1 312 ? -15.351 6.788   123.239 1.00 42.72 ? 312 GLU C CD  1 
ATOM   9118  O OE1 . GLU C 1 312 ? -16.559 6.445   123.228 1.00 42.26 ? 312 GLU C OE1 1 
ATOM   9119  O OE2 . GLU C 1 312 ? -14.438 6.131   122.645 1.00 45.96 ? 312 GLU C OE2 1 
ATOM   9120  N N   . GLU C 1 313 ? -16.062 10.082  128.118 1.00 28.71 ? 313 GLU C N   1 
ATOM   9121  C CA  . GLU C 1 313 ? -16.629 11.111  128.952 1.00 29.85 ? 313 GLU C CA  1 
ATOM   9122  C C   . GLU C 1 313 ? -15.587 12.136  129.407 1.00 28.21 ? 313 GLU C C   1 
ATOM   9123  O O   . GLU C 1 313 ? -15.822 13.341  129.288 1.00 29.00 ? 313 GLU C O   1 
ATOM   9124  C CB  . GLU C 1 313 ? -17.304 10.460  130.186 1.00 30.79 ? 313 GLU C CB  1 
ATOM   9125  C CG  . GLU C 1 313 ? -17.984 11.417  131.160 1.00 36.76 ? 313 GLU C CG  1 
ATOM   9126  C CD  . GLU C 1 313 ? -19.438 11.822  130.748 1.00 45.34 ? 313 GLU C CD  1 
ATOM   9127  O OE1 . GLU C 1 313 ? -19.797 13.031  130.887 1.00 46.73 ? 313 GLU C OE1 1 
ATOM   9128  O OE2 . GLU C 1 313 ? -20.221 10.930  130.310 1.00 48.36 ? 313 GLU C OE2 1 
ATOM   9129  N N   . GLY C 1 314 ? -14.482 11.655  129.985 1.00 25.64 ? 314 GLY C N   1 
ATOM   9130  C CA  . GLY C 1 314 ? -13.407 12.515  130.436 1.00 22.64 ? 314 GLY C CA  1 
ATOM   9131  C C   . GLY C 1 314 ? -12.779 13.266  129.274 1.00 21.99 ? 314 GLY C C   1 
ATOM   9132  O O   . GLY C 1 314 ? -12.365 14.429  129.423 1.00 21.16 ? 314 GLY C O   1 
ATOM   9133  N N   . PHE C 1 315 ? -12.703 12.605  128.119 1.00 20.96 ? 315 PHE C N   1 
ATOM   9134  C CA  . PHE C 1 315 ? -12.148 13.229  126.918 1.00 21.15 ? 315 PHE C CA  1 
ATOM   9135  C C   . PHE C 1 315 ? -13.030 14.404  126.463 1.00 21.70 ? 315 PHE C C   1 
ATOM   9136  O O   . PHE C 1 315 ? -12.558 15.538  126.263 1.00 20.92 ? 315 PHE C O   1 
ATOM   9137  C CB  . PHE C 1 315 ? -12.019 12.195  125.792 1.00 21.35 ? 315 PHE C CB  1 
ATOM   9138  C CG  . PHE C 1 315 ? -11.617 12.794  124.495 1.00 22.29 ? 315 PHE C CG  1 
ATOM   9139  C CD1 . PHE C 1 315 ? -10.341 13.304  124.332 1.00 18.19 ? 315 PHE C CD1 1 
ATOM   9140  C CD2 . PHE C 1 315 ? -12.529 12.879  123.436 1.00 20.62 ? 315 PHE C CD2 1 
ATOM   9141  C CE1 . PHE C 1 315 ? -9.959  13.905  123.106 1.00 19.89 ? 315 PHE C CE1 1 
ATOM   9142  C CE2 . PHE C 1 315 ? -12.150 13.471  122.202 1.00 20.36 ? 315 PHE C CE2 1 
ATOM   9143  C CZ  . PHE C 1 315 ? -10.873 13.976  122.036 1.00 22.67 ? 315 PHE C CZ  1 
ATOM   9144  N N   . MET C 1 316 ? -14.328 14.128  126.324 1.00 22.63 ? 316 MET C N   1 
ATOM   9145  C CA  . MET C 1 316 ? -15.240 15.152  125.815 1.00 24.05 ? 316 MET C CA  1 
ATOM   9146  C C   . MET C 1 316 ? -15.410 16.303  126.804 1.00 23.73 ? 316 MET C C   1 
ATOM   9147  O O   . MET C 1 316 ? -15.572 17.431  126.364 1.00 23.12 ? 316 MET C O   1 
ATOM   9148  C CB  . MET C 1 316 ? -16.584 14.560  125.413 1.00 24.48 ? 316 MET C CB  1 
ATOM   9149  C CG  . MET C 1 316 ? -16.530 13.648  124.184 1.00 27.36 ? 316 MET C CG  1 
ATOM   9150  S SD  . MET C 1 316 ? -15.728 14.165  122.631 1.00 35.89 ? 316 MET C SD  1 
ATOM   9151  C CE  . MET C 1 316 ? -16.778 15.441  121.978 1.00 36.36 ? 316 MET C CE  1 
ATOM   9152  N N   . ALA C 1 317 ? -15.359 16.006  128.115 1.00 24.01 ? 317 ALA C N   1 
ATOM   9153  C CA  . ALA C 1 317 ? -15.290 17.045  129.183 1.00 24.53 ? 317 ALA C CA  1 
ATOM   9154  C C   . ALA C 1 317 ? -14.081 17.966  129.020 1.00 24.83 ? 317 ALA C C   1 
ATOM   9155  O O   . ALA C 1 317 ? -14.184 19.193  129.200 1.00 25.28 ? 317 ALA C O   1 
ATOM   9156  C CB  . ALA C 1 317 ? -15.274 16.399  130.574 1.00 24.55 ? 317 ALA C CB  1 
ATOM   9157  N N   . HIS C 1 318 ? -12.922 17.376  128.720 1.00 22.77 ? 318 HIS C N   1 
ATOM   9158  C CA  . HIS C 1 318 ? -11.718 18.149  128.477 1.00 21.11 ? 318 HIS C CA  1 
ATOM   9159  C C   . HIS C 1 318 ? -11.899 19.018  127.228 1.00 21.20 ? 318 HIS C C   1 
ATOM   9160  O O   . HIS C 1 318 ? -11.593 20.210  127.240 1.00 20.48 ? 318 HIS C O   1 
ATOM   9161  C CB  . HIS C 1 318 ? -10.482 17.228  128.342 1.00 21.05 ? 318 HIS C CB  1 
ATOM   9162  C CG  . HIS C 1 318 ? -9.267  17.938  127.823 1.00 18.33 ? 318 HIS C CG  1 
ATOM   9163  N ND1 . HIS C 1 318 ? -8.867  17.864  126.507 1.00 19.97 ? 318 HIS C ND1 1 
ATOM   9164  C CD2 . HIS C 1 318 ? -8.387  18.767  128.438 1.00 16.57 ? 318 HIS C CD2 1 
ATOM   9165  C CE1 . HIS C 1 318 ? -7.760  18.578  126.342 1.00 17.59 ? 318 HIS C CE1 1 
ATOM   9166  N NE2 . HIS C 1 318 ? -7.473  19.166  127.492 1.00 21.63 ? 318 HIS C NE2 1 
ATOM   9167  N N   . VAL C 1 319 ? -12.434 18.452  126.150 1.00 22.28 ? 319 VAL C N   1 
ATOM   9168  C CA  . VAL C 1 319 ? -12.620 19.275  124.945 1.00 23.00 ? 319 VAL C CA  1 
ATOM   9169  C C   . VAL C 1 319 ? -13.595 20.448  125.181 1.00 23.30 ? 319 VAL C C   1 
ATOM   9170  O O   . VAL C 1 319 ? -13.341 21.555  124.699 1.00 20.74 ? 319 VAL C O   1 
ATOM   9171  C CB  . VAL C 1 319 ? -12.791 18.523  123.552 1.00 25.09 ? 319 VAL C CB  1 
ATOM   9172  C CG1 . VAL C 1 319 ? -12.441 17.022  123.548 1.00 24.26 ? 319 VAL C CG1 1 
ATOM   9173  C CG2 . VAL C 1 319 ? -14.086 18.945  122.730 1.00 22.93 ? 319 VAL C CG2 1 
ATOM   9174  N N   . ASP C 1 320 ? -14.657 20.205  125.968 1.00 23.31 ? 320 ASP C N   1 
ATOM   9175  C CA  . ASP C 1 320 ? -15.563 21.286  126.363 1.00 24.37 ? 320 ASP C CA  1 
ATOM   9176  C C   . ASP C 1 320 ? -14.829 22.367  127.148 1.00 24.07 ? 320 ASP C C   1 
ATOM   9177  O O   . ASP C 1 320 ? -15.074 23.535  126.914 1.00 24.37 ? 320 ASP C O   1 
ATOM   9178  C CB  . ASP C 1 320 ? -16.706 20.762  127.214 1.00 26.35 ? 320 ASP C CB  1 
ATOM   9179  C CG  . ASP C 1 320 ? -17.816 20.162  126.387 1.00 31.72 ? 320 ASP C CG  1 
ATOM   9180  O OD1 . ASP C 1 320 ? -17.949 20.502  125.176 1.00 38.53 ? 320 ASP C OD1 1 
ATOM   9181  O OD2 . ASP C 1 320 ? -18.590 19.364  126.962 1.00 39.91 ? 320 ASP C OD2 1 
ATOM   9182  N N   . ARG C 1 321 ? -13.943 21.998  128.077 1.00 22.93 ? 321 ARG C N   1 
ATOM   9183  C CA  . ARG C 1 321 ? -13.224 23.020  128.825 1.00 23.92 ? 321 ARG C CA  1 
ATOM   9184  C C   . ARG C 1 321 ? -12.305 23.808  127.888 1.00 23.42 ? 321 ARG C C   1 
ATOM   9185  O O   . ARG C 1 321 ? -12.194 25.064  127.974 1.00 23.91 ? 321 ARG C O   1 
ATOM   9186  C CB  . ARG C 1 321 ? -12.359 22.432  129.926 1.00 25.14 ? 321 ARG C CB  1 
ATOM   9187  C CG  . ARG C 1 321 ? -13.020 21.968  131.219 1.00 26.00 ? 321 ARG C CG  1 
ATOM   9188  C CD  . ARG C 1 321 ? -11.915 21.235  132.079 1.00 28.58 ? 321 ARG C CD  1 
ATOM   9189  N NE  . ARG C 1 321 ? -12.486 19.966  132.446 1.00 37.60 ? 321 ARG C NE  1 
ATOM   9190  C CZ  . ARG C 1 321 ? -11.978 18.754  132.313 1.00 35.64 ? 321 ARG C CZ  1 
ATOM   9191  N NH1 . ARG C 1 321 ? -10.736 18.485  131.870 1.00 33.02 ? 321 ARG C NH1 1 
ATOM   9192  N NH2 . ARG C 1 321 ? -12.763 17.787  132.709 1.00 39.25 ? 321 ARG C NH2 1 
ATOM   9193  N N   . VAL C 1 322 ? -11.605 23.124  126.996 1.00 21.98 ? 322 VAL C N   1 
ATOM   9194  C CA  . VAL C 1 322 ? -10.796 23.914  126.086 1.00 20.85 ? 322 VAL C CA  1 
ATOM   9195  C C   . VAL C 1 322 ? -11.612 24.779  125.087 1.00 19.38 ? 322 VAL C C   1 
ATOM   9196  O O   . VAL C 1 322 ? -11.211 25.893  124.815 1.00 19.56 ? 322 VAL C O   1 
ATOM   9197  C CB  . VAL C 1 322 ? -9.483  23.200  125.500 1.00 22.71 ? 322 VAL C CB  1 
ATOM   9198  C CG1 . VAL C 1 322 ? -9.339  21.772  125.880 1.00 21.27 ? 322 VAL C CG1 1 
ATOM   9199  C CG2 . VAL C 1 322 ? -9.220  23.527  124.047 1.00 21.16 ? 322 VAL C CG2 1 
ATOM   9200  N N   . ILE C 1 323 ? -12.743 24.268  124.598 1.00 19.42 ? 323 ILE C N   1 
ATOM   9201  C CA  . ILE C 1 323 ? -13.663 25.080  123.765 1.00 19.97 ? 323 ILE C CA  1 
ATOM   9202  C C   . ILE C 1 323 ? -14.083 26.355  124.537 1.00 20.01 ? 323 ILE C C   1 
ATOM   9203  O O   . ILE C 1 323 ? -13.957 27.472  124.018 1.00 20.25 ? 323 ILE C O   1 
ATOM   9204  C CB  . ILE C 1 323 ? -14.883 24.299  123.355 1.00 19.87 ? 323 ILE C CB  1 
ATOM   9205  C CG1 . ILE C 1 323 ? -14.504 23.272  122.284 1.00 20.16 ? 323 ILE C CG1 1 
ATOM   9206  C CG2 . ILE C 1 323 ? -15.947 25.252  122.761 1.00 22.23 ? 323 ILE C CG2 1 
ATOM   9207  C CD1 . ILE C 1 323 ? -15.604 22.298  122.017 1.00 25.29 ? 323 ILE C CD1 1 
ATOM   9208  N N   . ASP C 1 324 ? -14.526 26.180  125.779 1.00 20.79 ? 324 ASP C N   1 
ATOM   9209  C CA  . ASP C 1 324 ? -14.841 27.324  126.628 1.00 22.71 ? 324 ASP C CA  1 
ATOM   9210  C C   . ASP C 1 324 ? -13.713 28.342  126.695 1.00 21.62 ? 324 ASP C C   1 
ATOM   9211  O O   . ASP C 1 324 ? -13.962 29.544  126.577 1.00 21.64 ? 324 ASP C O   1 
ATOM   9212  C CB  . ASP C 1 324 ? -15.194 26.885  128.027 1.00 23.34 ? 324 ASP C CB  1 
ATOM   9213  C CG  . ASP C 1 324 ? -16.655 26.395  128.154 1.00 28.19 ? 324 ASP C CG  1 
ATOM   9214  O OD1 . ASP C 1 324 ? -17.058 26.063  129.288 1.00 33.92 ? 324 ASP C OD1 1 
ATOM   9215  O OD2 . ASP C 1 324 ? -17.394 26.337  127.139 1.00 33.21 ? 324 ASP C OD2 1 
ATOM   9216  N N   . PHE C 1 325 ? -12.490 27.877  126.893 1.00 20.97 ? 325 PHE C N   1 
ATOM   9217  C CA  . PHE C 1 325 ? -11.329 28.799  126.956 1.00 20.99 ? 325 PHE C CA  1 
ATOM   9218  C C   . PHE C 1 325 ? -11.111 29.541  125.627 1.00 21.88 ? 325 PHE C C   1 
ATOM   9219  O O   . PHE C 1 325 ? -10.986 30.789  125.584 1.00 19.95 ? 325 PHE C O   1 
ATOM   9220  C CB  . PHE C 1 325 ? -10.024 28.093  127.341 1.00 20.94 ? 325 PHE C CB  1 
ATOM   9221  C CG  . PHE C 1 325 ? -8.798  28.984  127.164 1.00 20.32 ? 325 PHE C CG  1 
ATOM   9222  C CD1 . PHE C 1 325 ? -8.433  29.894  128.157 1.00 23.33 ? 325 PHE C CD1 1 
ATOM   9223  C CD2 . PHE C 1 325 ? -8.038  28.923  125.989 1.00 21.48 ? 325 PHE C CD2 1 
ATOM   9224  C CE1 . PHE C 1 325 ? -7.330  30.715  127.989 1.00 24.17 ? 325 PHE C CE1 1 
ATOM   9225  C CE2 . PHE C 1 325 ? -6.949  29.732  125.803 1.00 18.91 ? 325 PHE C CE2 1 
ATOM   9226  C CZ  . PHE C 1 325 ? -6.596  30.657  126.816 1.00 22.22 ? 325 PHE C CZ  1 
ATOM   9227  N N   . TYR C 1 326 ? -11.058 28.783  124.535 1.00 22.07 ? 326 TYR C N   1 
ATOM   9228  C CA  . TYR C 1 326 ? -10.871 29.418  123.217 1.00 23.13 ? 326 TYR C CA  1 
ATOM   9229  C C   . TYR C 1 326 ? -12.033 30.337  122.874 1.00 23.89 ? 326 TYR C C   1 
ATOM   9230  O O   . TYR C 1 326 ? -11.854 31.341  122.166 1.00 24.43 ? 326 TYR C O   1 
ATOM   9231  C CB  . TYR C 1 326 ? -10.627 28.385  122.127 1.00 23.02 ? 326 TYR C CB  1 
ATOM   9232  C CG  . TYR C 1 326 ? -9.191  27.917  122.095 1.00 24.73 ? 326 TYR C CG  1 
ATOM   9233  C CD1 . TYR C 1 326 ? -8.247  28.583  121.323 1.00 28.09 ? 326 TYR C CD1 1 
ATOM   9234  C CD2 . TYR C 1 326 ? -8.776  26.803  122.823 1.00 27.42 ? 326 TYR C CD2 1 
ATOM   9235  C CE1 . TYR C 1 326 ? -6.937  28.168  121.267 1.00 27.58 ? 326 TYR C CE1 1 
ATOM   9236  C CE2 . TYR C 1 326 ? -7.411  26.379  122.799 1.00 21.12 ? 326 TYR C CE2 1 
ATOM   9237  C CZ  . TYR C 1 326 ? -6.525  27.053  122.001 1.00 25.35 ? 326 TYR C CZ  1 
ATOM   9238  O OH  . TYR C 1 326 ? -5.204  26.655  121.928 1.00 25.09 ? 326 TYR C OH  1 
ATOM   9239  N N   . SER C 1 327 ? -13.214 29.996  123.378 1.00 24.00 ? 327 SER C N   1 
ATOM   9240  C CA  . SER C 1 327 ? -14.371 30.824  123.149 1.00 25.37 ? 327 SER C CA  1 
ATOM   9241  C C   . SER C 1 327 ? -14.199 32.187  123.855 1.00 24.35 ? 327 SER C C   1 
ATOM   9242  O O   . SER C 1 327 ? -14.375 33.223  123.255 1.00 23.35 ? 327 SER C O   1 
ATOM   9243  C CB  . SER C 1 327 ? -15.655 30.095  123.527 1.00 26.68 ? 327 SER C CB  1 
ATOM   9244  O OG  . SER C 1 327 ? -16.784 30.820  123.014 1.00 30.63 ? 327 SER C OG  1 
ATOM   9245  N N   . ASN C 1 328 ? -13.762 32.177  125.105 1.00 24.09 ? 328 ASN C N   1 
ATOM   9246  C CA  . ASN C 1 328 ? -13.471 33.423  125.813 1.00 24.26 ? 328 ASN C CA  1 
ATOM   9247  C C   . ASN C 1 328 ? -12.359 34.245  125.180 1.00 22.99 ? 328 ASN C C   1 
ATOM   9248  O O   . ASN C 1 328 ? -12.430 35.469  125.171 1.00 21.66 ? 328 ASN C O   1 
ATOM   9249  C CB  . ASN C 1 328 ? -13.149 33.132  127.284 1.00 25.78 ? 328 ASN C CB  1 
ATOM   9250  C CG  . ASN C 1 328 ? -14.404 32.793  128.102 1.00 30.30 ? 328 ASN C CG  1 
ATOM   9251  O OD1 . ASN C 1 328 ? -14.360 31.931  128.967 1.00 33.31 ? 328 ASN C OD1 1 
ATOM   9252  N ND2 . ASN C 1 328 ? -15.520 33.466  127.814 1.00 33.98 ? 328 ASN C ND2 1 
ATOM   9253  N N   . GLN C 1 329 ? -11.344 33.573  124.644 1.00 20.42 ? 329 GLN C N   1 
ATOM   9254  C CA  . GLN C 1 329 ? -10.273 34.261  123.931 1.00 21.32 ? 329 GLN C CA  1 
ATOM   9255  C C   . GLN C 1 329 ? -10.821 34.926  122.645 1.00 19.96 ? 329 GLN C C   1 
ATOM   9256  O O   . GLN C 1 329 ? -10.457 36.055  122.325 1.00 21.13 ? 329 GLN C O   1 
ATOM   9257  C CB  . GLN C 1 329 ? -9.122  33.272  123.608 1.00 19.70 ? 329 GLN C CB  1 
ATOM   9258  C CG  . GLN C 1 329 ? -8.341  32.785  124.823 1.00 21.70 ? 329 GLN C CG  1 
ATOM   9259  C CD  . GLN C 1 329 ? -7.442  33.844  125.380 1.00 22.34 ? 329 GLN C CD  1 
ATOM   9260  O OE1 . GLN C 1 329 ? -7.673  34.361  126.465 1.00 22.47 ? 329 GLN C OE1 1 
ATOM   9261  N NE2 . GLN C 1 329 ? -6.450  34.242  124.597 1.00 19.50 ? 329 GLN C NE2 1 
ATOM   9262  N N   . LYS C 1 330 ? -11.687 34.217  121.929 1.00 19.77 ? 330 LYS C N   1 
ATOM   9263  C CA  . LYS C 1 330 ? -12.353 34.718  120.732 1.00 20.13 ? 330 LYS C CA  1 
ATOM   9264  C C   . LYS C 1 330 ? -13.224 35.959  121.034 1.00 20.59 ? 330 LYS C C   1 
ATOM   9265  O O   . LYS C 1 330 ? -13.145 36.969  120.323 1.00 20.02 ? 330 LYS C O   1 
ATOM   9266  C CB  . LYS C 1 330 ? -13.236 33.643  120.136 1.00 21.02 ? 330 LYS C CB  1 
ATOM   9267  C CG  . LYS C 1 330 ? -13.788 34.004  118.804 1.00 22.45 ? 330 LYS C CG  1 
ATOM   9268  C CD  . LYS C 1 330 ? -14.992 33.163  118.370 1.00 24.25 ? 330 LYS C CD  1 
ATOM   9269  C CE  . LYS C 1 330 ? -16.344 33.706  118.905 1.00 27.64 ? 330 LYS C CE  1 
ATOM   9270  N NZ  . LYS C 1 330 ? -17.002 32.974  120.071 1.00 24.77 ? 330 LYS C NZ  1 
ATOM   9271  N N   . ASP C 1 331 ? -14.049 35.868  122.069 1.00 19.90 ? 331 ASP C N   1 
ATOM   9272  C CA  . ASP C 1 331 ? -14.791 37.068  122.527 1.00 20.46 ? 331 ASP C CA  1 
ATOM   9273  C C   . ASP C 1 331 ? -13.856 38.258  122.736 1.00 20.51 ? 331 ASP C C   1 
ATOM   9274  O O   . ASP C 1 331 ? -14.141 39.386  122.247 1.00 20.07 ? 331 ASP C O   1 
ATOM   9275  C CB  . ASP C 1 331 ? -15.568 36.763  123.798 1.00 20.33 ? 331 ASP C CB  1 
ATOM   9276  C CG  . ASP C 1 331 ? -16.698 35.810  123.557 1.00 23.21 ? 331 ASP C CG  1 
ATOM   9277  O OD1 . ASP C 1 331 ? -17.119 35.639  122.385 1.00 26.33 ? 331 ASP C OD1 1 
ATOM   9278  O OD2 . ASP C 1 331 ? -17.191 35.240  124.532 1.00 32.23 ? 331 ASP C OD2 1 
ATOM   9279  N N   . ALA C 1 332 ? -12.754 38.013  123.463 1.00 19.39 ? 332 ALA C N   1 
ATOM   9280  C CA  . ALA C 1 332 ? -11.778 39.045  123.726 1.00 19.23 ? 332 ALA C CA  1 
ATOM   9281  C C   . ALA C 1 332 ? -11.164 39.693  122.514 1.00 18.93 ? 332 ALA C C   1 
ATOM   9282  O O   . ALA C 1 332 ? -10.990 40.922  122.470 1.00 19.41 ? 332 ALA C O   1 
ATOM   9283  C CB  . ALA C 1 332 ? -10.639 38.555  124.729 1.00 19.49 ? 332 ALA C CB  1 
ATOM   9284  N N   . ILE C 1 333 ? -10.762 38.896  121.536 1.00 18.08 ? 333 ILE C N   1 
ATOM   9285  C CA  . ILE C 1 333 ? -10.119 39.500  120.382 1.00 17.53 ? 333 ILE C CA  1 
ATOM   9286  C C   . ILE C 1 333 ? -11.137 40.276  119.508 1.00 18.12 ? 333 ILE C C   1 
ATOM   9287  O O   . ILE C 1 333 ? -10.814 41.355  118.923 1.00 17.99 ? 333 ILE C O   1 
ATOM   9288  C CB  . ILE C 1 333 ? -9.279  38.430  119.552 1.00 16.33 ? 333 ILE C CB  1 
ATOM   9289  C CG1 . ILE C 1 333 ? -8.284  39.186  118.689 1.00 14.56 ? 333 ILE C CG1 1 
ATOM   9290  C CG2 . ILE C 1 333 ? -10.220 37.509  118.714 1.00 18.09 ? 333 ILE C CG2 1 
ATOM   9291  C CD1 . ILE C 1 333 ? -7.287  38.241  117.929 1.00 15.63 ? 333 ILE C CD1 1 
ATOM   9292  N N   . LEU C 1 334 ? -12.371 39.765  119.460 1.00 18.63 ? 334 LEU C N   1 
ATOM   9293  C CA  . LEU C 1 334 ? -13.495 40.464  118.814 1.00 20.12 ? 334 LEU C CA  1 
ATOM   9294  C C   . LEU C 1 334 ? -13.786 41.799  119.463 1.00 20.87 ? 334 LEU C C   1 
ATOM   9295  O O   . LEU C 1 334 ? -13.997 42.780  118.760 1.00 21.66 ? 334 LEU C O   1 
ATOM   9296  C CB  . LEU C 1 334 ? -14.783 39.624  118.831 1.00 21.21 ? 334 LEU C CB  1 
ATOM   9297  C CG  . LEU C 1 334 ? -15.262 38.803  117.594 1.00 22.33 ? 334 LEU C CG  1 
ATOM   9298  C CD1 . LEU C 1 334 ? -14.357 38.699  116.376 1.00 24.28 ? 334 LEU C CD1 1 
ATOM   9299  C CD2 . LEU C 1 334 ? -15.904 37.453  117.965 1.00 15.30 ? 334 LEU C CD2 1 
ATOM   9300  N N   . ALA C 1 335 ? -13.835 41.822  120.797 1.00 20.63 ? 335 ALA C N   1 
ATOM   9301  C CA  . ALA C 1 335 ? -13.966 43.064  121.552 1.00 19.91 ? 335 ALA C CA  1 
ATOM   9302  C C   . ALA C 1 335 ? -12.853 44.054  121.184 1.00 19.65 ? 335 ALA C C   1 
ATOM   9303  O O   . ALA C 1 335 ? -13.132 45.247  120.928 1.00 19.72 ? 335 ALA C O   1 
ATOM   9304  C CB  . ALA C 1 335 ? -13.993 42.795  123.031 1.00 19.31 ? 335 ALA C CB  1 
ATOM   9305  N N   . ALA C 1 336 ? -11.600 43.585  121.143 1.00 19.28 ? 336 ALA C N   1 
ATOM   9306  C CA  . ALA C 1 336 ? -10.489 44.428  120.715 1.00 18.55 ? 336 ALA C CA  1 
ATOM   9307  C C   . ALA C 1 336 ? -10.616 44.977  119.264 1.00 17.66 ? 336 ALA C C   1 
ATOM   9308  O O   . ALA C 1 336 ? -10.291 46.148  118.957 1.00 17.26 ? 336 ALA C O   1 
ATOM   9309  C CB  . ALA C 1 336 ? -9.179  43.689  120.915 1.00 19.91 ? 336 ALA C CB  1 
ATOM   9310  N N   . ALA C 1 337 ? -11.059 44.142  118.361 1.00 17.20 ? 337 ALA C N   1 
ATOM   9311  C CA  . ALA C 1 337 ? -11.156 44.538  116.962 1.00 18.48 ? 337 ALA C CA  1 
ATOM   9312  C C   . ALA C 1 337 ? -12.265 45.576  116.857 1.00 17.95 ? 337 ALA C C   1 
ATOM   9313  O O   . ALA C 1 337 ? -12.115 46.589  116.171 1.00 18.77 ? 337 ALA C O   1 
ATOM   9314  C CB  . ALA C 1 337 ? -11.466 43.302  116.036 1.00 18.33 ? 337 ALA C CB  1 
ATOM   9315  N N   . ASP C 1 338 ? -13.391 45.302  117.527 1.00 17.98 ? 338 ASP C N   1 
ATOM   9316  C CA  . ASP C 1 338 ? -14.516 46.262  117.525 1.00 18.89 ? 338 ASP C CA  1 
ATOM   9317  C C   . ASP C 1 338 ? -14.065 47.599  118.091 1.00 18.01 ? 338 ASP C C   1 
ATOM   9318  O O   . ASP C 1 338 ? -14.337 48.672  117.538 1.00 17.98 ? 338 ASP C O   1 
ATOM   9319  C CB  . ASP C 1 338 ? -15.636 45.752  118.419 1.00 18.54 ? 338 ASP C CB  1 
ATOM   9320  C CG  . ASP C 1 338 ? -16.514 44.656  117.739 1.00 21.60 ? 338 ASP C CG  1 
ATOM   9321  O OD1 . ASP C 1 338 ? -16.540 44.485  116.505 1.00 26.02 ? 338 ASP C OD1 1 
ATOM   9322  O OD2 . ASP C 1 338 ? -17.217 43.977  118.471 1.00 26.21 ? 338 ASP C OD2 1 
ATOM   9323  N N   . LYS C 1 339 ? -13.427 47.530  119.242 1.00 16.83 ? 339 LYS C N   1 
ATOM   9324  C CA  . LYS C 1 339 ? -12.870 48.735  119.864 1.00 16.21 ? 339 LYS C CA  1 
ATOM   9325  C C   . LYS C 1 339 ? -11.970 49.609  118.967 1.00 17.00 ? 339 LYS C C   1 
ATOM   9326  O O   . LYS C 1 339 ? -12.161 50.841  118.902 1.00 17.70 ? 339 LYS C O   1 
ATOM   9327  C CB  . LYS C 1 339 ? -12.157 48.345  121.146 1.00 15.23 ? 339 LYS C CB  1 
ATOM   9328  C CG  . LYS C 1 339 ? -11.663 49.565  121.990 1.00 14.81 ? 339 LYS C CG  1 
ATOM   9329  C CD  . LYS C 1 339 ? -11.195 49.085  123.365 1.00 15.06 ? 339 LYS C CD  1 
ATOM   9330  C CE  . LYS C 1 339 ? -10.587 50.241  124.113 1.00 18.57 ? 339 LYS C CE  1 
ATOM   9331  N NZ  . LYS C 1 339 ? -9.689  49.833  125.322 1.00 15.59 ? 339 LYS C NZ  1 
ATOM   9332  N N   . TRP C 1 340 ? -10.977 49.013  118.311 1.00 15.98 ? 340 TRP C N   1 
ATOM   9333  C CA  . TRP C 1 340 ? -9.993  49.791  117.551 1.00 17.42 ? 340 TRP C CA  1 
ATOM   9334  C C   . TRP C 1 340 ? -10.164 49.903  116.030 1.00 18.01 ? 340 TRP C C   1 
ATOM   9335  O O   . TRP C 1 340 ? -9.708  50.879  115.415 1.00 18.70 ? 340 TRP C O   1 
ATOM   9336  C CB  . TRP C 1 340 ? -8.574  49.271  117.858 1.00 17.90 ? 340 TRP C CB  1 
ATOM   9337  C CG  . TRP C 1 340 ? -8.265  49.505  119.312 1.00 18.61 ? 340 TRP C CG  1 
ATOM   9338  C CD1 . TRP C 1 340 ? -8.196  48.564  120.297 1.00 19.28 ? 340 TRP C CD1 1 
ATOM   9339  C CD2 . TRP C 1 340 ? -8.042  50.769  119.931 1.00 19.54 ? 340 TRP C CD2 1 
ATOM   9340  N NE1 . TRP C 1 340 ? -7.925  49.168  121.521 1.00 22.13 ? 340 TRP C NE1 1 
ATOM   9341  C CE2 . TRP C 1 340 ? -7.828  50.525  121.322 1.00 20.07 ? 340 TRP C CE2 1 
ATOM   9342  C CE3 . TRP C 1 340 ? -7.951  52.087  119.443 1.00 21.57 ? 340 TRP C CE3 1 
ATOM   9343  C CZ2 . TRP C 1 340 ? -7.533  51.558  122.241 1.00 21.89 ? 340 TRP C CZ2 1 
ATOM   9344  C CZ3 . TRP C 1 340 ? -7.695  53.143  120.371 1.00 21.85 ? 340 TRP C CZ3 1 
ATOM   9345  C CH2 . TRP C 1 340 ? -7.480  52.864  121.750 1.00 23.47 ? 340 TRP C CH2 1 
ATOM   9346  N N   . LEU C 1 341 ? -10.788 48.905  115.420 1.00 17.43 ? 341 LEU C N   1 
ATOM   9347  C CA  . LEU C 1 341 ? -10.730 48.765  113.969 1.00 18.85 ? 341 LEU C CA  1 
ATOM   9348  C C   . LEU C 1 341 ? -12.046 49.055  113.255 1.00 19.58 ? 341 LEU C C   1 
ATOM   9349  O O   . LEU C 1 341 ? -12.153 48.865  112.034 1.00 19.72 ? 341 LEU C O   1 
ATOM   9350  C CB  . LEU C 1 341 ? -10.252 47.326  113.599 1.00 18.68 ? 341 LEU C CB  1 
ATOM   9351  C CG  . LEU C 1 341 ? -8.827  46.936  114.003 1.00 21.09 ? 341 LEU C CG  1 
ATOM   9352  C CD1 . LEU C 1 341 ? -8.483  45.486  113.549 1.00 23.55 ? 341 LEU C CD1 1 
ATOM   9353  C CD2 . LEU C 1 341 ? -7.814  47.928  113.421 1.00 22.74 ? 341 LEU C CD2 1 
ATOM   9354  N N   . THR C 1 342 ? -13.083 49.434  113.988 1.00 20.21 ? 342 THR C N   1 
ATOM   9355  C CA  . THR C 1 342 ? -14.384 49.671  113.339 1.00 21.29 ? 342 THR C CA  1 
ATOM   9356  C C   . THR C 1 342 ? -14.197 50.709  112.251 1.00 23.48 ? 342 THR C C   1 
ATOM   9357  O O   . THR C 1 342 ? -13.683 51.815  112.497 1.00 24.19 ? 342 THR C O   1 
ATOM   9358  C CB  . THR C 1 342 ? -15.412 50.151  114.373 1.00 21.95 ? 342 THR C CB  1 
ATOM   9359  O OG1 . THR C 1 342 ? -15.595 49.119  115.351 1.00 21.42 ? 342 THR C OG1 1 
ATOM   9360  C CG2 . THR C 1 342 ? -16.741 50.518  113.732 1.00 22.72 ? 342 THR C CG2 1 
ATOM   9361  N N   . GLY C 1 343 ? -14.602 50.370  111.042 1.00 23.77 ? 343 GLY C N   1 
ATOM   9362  C CA  . GLY C 1 343 ? -14.468 51.369  109.968 1.00 25.36 ? 343 GLY C CA  1 
ATOM   9363  C C   . GLY C 1 343 ? -13.116 51.334  109.278 1.00 24.34 ? 343 GLY C C   1 
ATOM   9364  O O   . GLY C 1 343 ? -13.016 51.823  108.182 1.00 24.17 ? 343 GLY C O   1 
ATOM   9365  N N   . LEU C 1 344 ? -12.115 50.687  109.887 1.00 22.91 ? 344 LEU C N   1 
ATOM   9366  C CA  . LEU C 1 344 ? -10.792 50.453  109.247 1.00 21.42 ? 344 LEU C CA  1 
ATOM   9367  C C   . LEU C 1 344 ? -10.627 49.039  108.625 1.00 19.23 ? 344 LEU C C   1 
ATOM   9368  O O   . LEU C 1 344 ? -9.765  48.817  107.820 1.00 17.10 ? 344 LEU C O   1 
ATOM   9369  C CB  . LEU C 1 344 ? -9.720  50.617  110.308 1.00 22.00 ? 344 LEU C CB  1 
ATOM   9370  C CG  . LEU C 1 344 ? -9.131  52.006  110.654 1.00 24.96 ? 344 LEU C CG  1 
ATOM   9371  C CD1 . LEU C 1 344 ? -9.870  53.174  110.072 1.00 22.29 ? 344 LEU C CD1 1 
ATOM   9372  C CD2 . LEU C 1 344 ? -8.933  52.162  112.113 1.00 18.67 ? 344 LEU C CD2 1 
ATOM   9373  N N   . ALA C 1 345 ? -11.442 48.081  109.034 1.00 18.67 ? 345 ALA C N   1 
ATOM   9374  C CA  . ALA C 1 345 ? -11.191 46.692  108.645 1.00 19.31 ? 345 ALA C CA  1 
ATOM   9375  C C   . ALA C 1 345 ? -12.472 45.959  108.756 1.00 19.68 ? 345 ALA C C   1 
ATOM   9376  O O   . ALA C 1 345 ? -13.409 46.479  109.353 1.00 19.73 ? 345 ALA C O   1 
ATOM   9377  C CB  . ALA C 1 345 ? -10.141 46.041  109.597 1.00 18.87 ? 345 ALA C CB  1 
ATOM   9378  N N   . GLU C 1 346 ? -12.513 44.731  108.243 1.00 19.28 ? 346 GLU C N   1 
ATOM   9379  C CA  . GLU C 1 346 ? -13.724 43.931  108.329 1.00 21.46 ? 346 GLU C CA  1 
ATOM   9380  C C   . GLU C 1 346 ? -13.326 42.498  108.613 1.00 21.13 ? 346 GLU C C   1 
ATOM   9381  O O   . GLU C 1 346 ? -12.208 42.102  108.256 1.00 20.20 ? 346 GLU C O   1 
ATOM   9382  C CB  . GLU C 1 346 ? -14.464 43.924  107.007 1.00 22.03 ? 346 GLU C CB  1 
ATOM   9383  C CG  . GLU C 1 346 ? -15.086 45.261  106.617 1.00 29.95 ? 346 GLU C CG  1 
ATOM   9384  C CD  . GLU C 1 346 ? -15.454 45.294  105.161 1.00 37.28 ? 346 GLU C CD  1 
ATOM   9385  O OE1 . GLU C 1 346 ? -16.638 45.562  104.871 1.00 44.10 ? 346 GLU C OE1 1 
ATOM   9386  O OE2 . GLU C 1 346 ? -14.576 45.030  104.305 1.00 40.61 ? 346 GLU C OE2 1 
ATOM   9387  N N   . TRP C 1 347 ? -14.213 41.758  109.286 1.00 21.21 ? 347 TRP C N   1 
ATOM   9388  C CA  . TRP C 1 347 ? -13.930 40.362  109.712 1.00 21.50 ? 347 TRP C CA  1 
ATOM   9389  C C   . TRP C 1 347 ? -15.238 39.615  109.998 1.00 23.03 ? 347 TRP C C   1 
ATOM   9390  O O   . TRP C 1 347 ? -16.219 40.206  110.470 1.00 24.09 ? 347 TRP C O   1 
ATOM   9391  C CB  . TRP C 1 347 ? -13.033 40.325  110.986 1.00 20.84 ? 347 TRP C CB  1 
ATOM   9392  C CG  . TRP C 1 347 ? -13.621 41.081  112.153 1.00 19.92 ? 347 TRP C CG  1 
ATOM   9393  C CD1 . TRP C 1 347 ? -14.409 40.572  113.147 1.00 18.82 ? 347 TRP C CD1 1 
ATOM   9394  C CD2 . TRP C 1 347 ? -13.496 42.480  112.418 1.00 20.78 ? 347 TRP C CD2 1 
ATOM   9395  N NE1 . TRP C 1 347 ? -14.778 41.566  114.018 1.00 18.66 ? 347 TRP C NE1 1 
ATOM   9396  C CE2 . TRP C 1 347 ? -14.226 42.745  113.601 1.00 20.57 ? 347 TRP C CE2 1 
ATOM   9397  C CE3 . TRP C 1 347 ? -12.836 43.546  111.764 1.00 20.16 ? 347 TRP C CE3 1 
ATOM   9398  C CZ2 . TRP C 1 347 ? -14.348 44.029  114.140 1.00 19.36 ? 347 TRP C CZ2 1 
ATOM   9399  C CZ3 . TRP C 1 347 ? -12.943 44.834  112.316 1.00 23.27 ? 347 TRP C CZ3 1 
ATOM   9400  C CH2 . TRP C 1 347 ? -13.699 45.052  113.495 1.00 19.67 ? 347 TRP C CH2 1 
ATOM   9401  N N   . HIS C 1 348 ? -15.230 38.310  109.751 1.00 23.04 ? 348 HIS C N   1 
ATOM   9402  C CA  . HIS C 1 348 ? -16.299 37.415  110.141 1.00 23.96 ? 348 HIS C CA  1 
ATOM   9403  C C   . HIS C 1 348 ? -15.980 36.854  111.519 1.00 23.13 ? 348 HIS C C   1 
ATOM   9404  O O   . HIS C 1 348 ? -14.808 36.751  111.859 1.00 23.64 ? 348 HIS C O   1 
ATOM   9405  C CB  . HIS C 1 348 ? -16.381 36.290  109.126 1.00 23.24 ? 348 HIS C CB  1 
ATOM   9406  C CG  . HIS C 1 348 ? -16.655 36.770  107.732 1.00 27.29 ? 348 HIS C CG  1 
ATOM   9407  N ND1 . HIS C 1 348 ? -17.805 37.440  107.396 1.00 29.17 ? 348 HIS C ND1 1 
ATOM   9408  C CD2 . HIS C 1 348 ? -15.934 36.662  106.582 1.00 30.92 ? 348 HIS C CD2 1 
ATOM   9409  C CE1 . HIS C 1 348 ? -17.777 37.745  106.107 1.00 31.29 ? 348 HIS C CE1 1 
ATOM   9410  N NE2 . HIS C 1 348 ? -16.663 37.263  105.586 1.00 30.59 ? 348 HIS C NE2 1 
ATOM   9411  N N   . VAL C 1 349 ? -17.011 36.549  112.308 1.00 21.62 ? 349 VAL C N   1 
ATOM   9412  C CA  . VAL C 1 349 ? -16.822 35.813  113.555 1.00 22.58 ? 349 VAL C CA  1 
ATOM   9413  C C   . VAL C 1 349 ? -16.390 34.374  113.227 1.00 22.24 ? 349 VAL C C   1 
ATOM   9414  O O   . VAL C 1 349 ? -17.100 33.687  112.526 1.00 21.22 ? 349 VAL C O   1 
ATOM   9415  C CB  . VAL C 1 349 ? -18.081 35.833  114.474 1.00 22.56 ? 349 VAL C CB  1 
ATOM   9416  C CG1 . VAL C 1 349 ? -19.384 35.449  113.693 1.00 27.82 ? 349 VAL C CG1 1 
ATOM   9417  C CG2 . VAL C 1 349 ? -17.934 34.928  115.693 1.00 23.50 ? 349 VAL C CG2 1 
ATOM   9418  N N   . PRO C 1 350 ? -15.226 33.949  113.761 1.00 22.40 ? 350 PRO C N   1 
ATOM   9419  C CA  . PRO C 1 350 ? -14.703 32.595  113.645 1.00 22.64 ? 350 PRO C CA  1 
ATOM   9420  C C   . PRO C 1 350 ? -15.688 31.602  114.250 1.00 23.48 ? 350 PRO C C   1 
ATOM   9421  O O   . PRO C 1 350 ? -16.168 31.793  115.385 1.00 22.56 ? 350 PRO C O   1 
ATOM   9422  C CB  . PRO C 1 350 ? -13.449 32.633  114.521 1.00 21.56 ? 350 PRO C CB  1 
ATOM   9423  C CG  . PRO C 1 350 ? -13.068 34.064  114.566 1.00 24.77 ? 350 PRO C CG  1 
ATOM   9424  C CD  . PRO C 1 350 ? -14.336 34.797  114.588 1.00 21.98 ? 350 PRO C CD  1 
ATOM   9425  N N   . ALA C 1 351 ? -15.969 30.545  113.496 1.00 23.07 ? 351 ALA C N   1 
ATOM   9426  C CA  . ALA C 1 351 ? -16.926 29.551  113.893 1.00 22.88 ? 351 ALA C CA  1 
ATOM   9427  C C   . ALA C 1 351 ? -16.236 28.500  114.780 1.00 23.47 ? 351 ALA C C   1 
ATOM   9428  O O   . ALA C 1 351 ? -16.877 27.808  115.617 1.00 21.14 ? 351 ALA C O   1 
ATOM   9429  C CB  . ALA C 1 351 ? -17.519 28.901  112.648 1.00 22.31 ? 351 ALA C CB  1 
ATOM   9430  N N   . ALA C 1 352 ? -14.919 28.414  114.618 1.00 21.59 ? 352 ALA C N   1 
ATOM   9431  C CA  . ALA C 1 352 ? -14.162 27.361  115.252 1.00 21.97 ? 352 ALA C CA  1 
ATOM   9432  C C   . ALA C 1 352 ? -12.709 27.772  115.267 1.00 21.75 ? 352 ALA C C   1 
ATOM   9433  O O   . ALA C 1 352 ? -12.316 28.685  114.544 1.00 21.32 ? 352 ALA C O   1 
ATOM   9434  C CB  . ALA C 1 352 ? -14.322 26.062  114.479 1.00 20.64 ? 352 ALA C CB  1 
ATOM   9435  N N   . GLY C 1 353 ? -11.909 27.065  116.062 1.00 21.76 ? 353 GLY C N   1 
ATOM   9436  C CA  . GLY C 1 353 ? -10.434 27.205  116.014 1.00 20.96 ? 353 GLY C CA  1 
ATOM   9437  C C   . GLY C 1 353 ? -9.846  28.384  116.762 1.00 22.15 ? 353 GLY C C   1 
ATOM   9438  O O   . GLY C 1 353 ? -10.337 28.767  117.845 1.00 22.70 ? 353 GLY C O   1 
ATOM   9439  N N   . MET C 1 354 ? -8.784  28.959  116.210 1.00 21.18 ? 354 MET C N   1 
ATOM   9440  C CA  . MET C 1 354 ? -7.999  29.942  116.955 1.00 21.97 ? 354 MET C CA  1 
ATOM   9441  C C   . MET C 1 354 ? -7.522  31.179  116.201 1.00 20.13 ? 354 MET C C   1 
ATOM   9442  O O   . MET C 1 354 ? -6.700  31.906  116.725 1.00 19.86 ? 354 MET C O   1 
ATOM   9443  C CB  . MET C 1 354 ? -6.780  29.270  117.632 1.00 22.87 ? 354 MET C CB  1 
ATOM   9444  C CG  . MET C 1 354 ? -5.813  28.519  116.682 1.00 24.60 ? 354 MET C CG  1 
ATOM   9445  S SD  . MET C 1 354 ? -4.554  27.508  117.643 1.00 30.16 ? 354 MET C SD  1 
ATOM   9446  C CE  . MET C 1 354 ? -5.587  26.405  118.552 1.00 28.25 ? 354 MET C CE  1 
ATOM   9447  N N   . PHE C 1 355 ? -8.041  31.430  114.997 1.00 19.28 ? 355 PHE C N   1 
ATOM   9448  C CA  . PHE C 1 355 ? -7.582  32.567  114.199 1.00 17.23 ? 355 PHE C CA  1 
ATOM   9449  C C   . PHE C 1 355 ? -8.716  33.539  113.840 1.00 17.49 ? 355 PHE C C   1 
ATOM   9450  O O   . PHE C 1 355 ? -9.850  33.112  113.566 1.00 15.85 ? 355 PHE C O   1 
ATOM   9451  C CB  . PHE C 1 355 ? -6.910  32.079  112.882 1.00 17.20 ? 355 PHE C CB  1 
ATOM   9452  C CG  . PHE C 1 355 ? -5.684  31.239  113.103 1.00 17.95 ? 355 PHE C CG  1 
ATOM   9453  C CD1 . PHE C 1 355 ? -4.564  31.777  113.728 1.00 16.15 ? 355 PHE C CD1 1 
ATOM   9454  C CD2 . PHE C 1 355 ? -5.670  29.893  112.762 1.00 21.71 ? 355 PHE C CD2 1 
ATOM   9455  C CE1 . PHE C 1 355 ? -3.425  30.957  113.977 1.00 21.42 ? 355 PHE C CE1 1 
ATOM   9456  C CE2 . PHE C 1 355 ? -4.558  29.103  113.005 1.00 23.42 ? 355 PHE C CE2 1 
ATOM   9457  C CZ  . PHE C 1 355 ? -3.443  29.634  113.626 1.00 21.11 ? 355 PHE C CZ  1 
ATOM   9458  N N   . LEU C 1 356 ? -8.371  34.832  113.839 1.00 17.16 ? 356 LEU C N   1 
ATOM   9459  C CA  . LEU C 1 356 ? -9.254  35.911  113.372 1.00 18.74 ? 356 LEU C CA  1 
ATOM   9460  C C   . LEU C 1 356 ? -8.661  36.411  112.055 1.00 18.68 ? 356 LEU C C   1 
ATOM   9461  O O   . LEU C 1 356 ? -7.444  36.654  111.962 1.00 20.67 ? 356 LEU C O   1 
ATOM   9462  C CB  . LEU C 1 356 ? -9.337  37.039  114.409 1.00 19.34 ? 356 LEU C CB  1 
ATOM   9463  C CG  . LEU C 1 356 ? -10.191 38.268  113.984 1.00 20.36 ? 356 LEU C CG  1 
ATOM   9464  C CD1 . LEU C 1 356 ? -11.612 37.836  113.734 1.00 19.34 ? 356 LEU C CD1 1 
ATOM   9465  C CD2 . LEU C 1 356 ? -10.165 39.360  114.974 1.00 16.29 ? 356 LEU C CD2 1 
ATOM   9466  N N   . TRP C 1 357 ? -9.484  36.507  111.015 1.00 18.59 ? 357 TRP C N   1 
ATOM   9467  C CA  . TRP C 1 357 ? -8.991  36.851  109.684 1.00 18.50 ? 357 TRP C CA  1 
ATOM   9468  C C   . TRP C 1 357 ? -9.534  38.227  109.370 1.00 18.71 ? 357 TRP C C   1 
ATOM   9469  O O   . TRP C 1 357 ? -10.737 38.404  109.223 1.00 21.12 ? 357 TRP C O   1 
ATOM   9470  C CB  . TRP C 1 357 ? -9.549  35.842  108.695 1.00 17.76 ? 357 TRP C CB  1 
ATOM   9471  C CG  . TRP C 1 357 ? -9.185  35.900  107.227 1.00 16.99 ? 357 TRP C CG  1 
ATOM   9472  C CD1 . TRP C 1 357 ? -10.079 35.919  106.175 1.00 15.23 ? 357 TRP C CD1 1 
ATOM   9473  C CD2 . TRP C 1 357 ? -7.866  35.762  106.627 1.00 15.84 ? 357 TRP C CD2 1 
ATOM   9474  N NE1 . TRP C 1 357 ? -9.384  35.869  104.956 1.00 15.26 ? 357 TRP C NE1 1 
ATOM   9475  C CE2 . TRP C 1 357 ? -8.038  35.783  105.207 1.00 18.16 ? 357 TRP C CE2 1 
ATOM   9476  C CE3 . TRP C 1 357 ? -6.564  35.675  107.144 1.00 17.54 ? 357 TRP C CE3 1 
ATOM   9477  C CZ2 . TRP C 1 357 ? -6.933  35.691  104.282 1.00 17.26 ? 357 TRP C CZ2 1 
ATOM   9478  C CZ3 . TRP C 1 357 ? -5.468  35.609  106.212 1.00 15.56 ? 357 TRP C CZ3 1 
ATOM   9479  C CH2 . TRP C 1 357 ? -5.678  35.601  104.801 1.00 14.48 ? 357 TRP C CH2 1 
ATOM   9480  N N   . ILE C 1 358 ? -8.651  39.179  109.218 1.00 18.64 ? 358 ILE C N   1 
ATOM   9481  C CA  . ILE C 1 358 ? -9.038  40.566  109.159 1.00 18.33 ? 358 ILE C CA  1 
ATOM   9482  C C   . ILE C 1 358 ? -8.693  41.167  107.810 1.00 19.57 ? 358 ILE C C   1 
ATOM   9483  O O   . ILE C 1 358 ? -7.520  41.195  107.428 1.00 20.04 ? 358 ILE C O   1 
ATOM   9484  C CB  . ILE C 1 358 ? -8.280  41.360  110.212 1.00 18.40 ? 358 ILE C CB  1 
ATOM   9485  C CG1 . ILE C 1 358 ? -8.606  40.839  111.630 1.00 18.57 ? 358 ILE C CG1 1 
ATOM   9486  C CG2 . ILE C 1 358 ? -8.588  42.866  110.066 1.00 19.27 ? 358 ILE C CG2 1 
ATOM   9487  C CD1 . ILE C 1 358 ? -7.579  41.264  112.714 1.00 15.97 ? 358 ILE C CD1 1 
ATOM   9488  N N   . LYS C 1 359 ? -9.699  41.703  107.125 1.00 19.44 ? 359 LYS C N   1 
ATOM   9489  C CA  . LYS C 1 359 ? -9.443  42.446  105.896 1.00 20.20 ? 359 LYS C CA  1 
ATOM   9490  C C   . LYS C 1 359 ? -9.342  43.940  106.154 1.00 21.15 ? 359 LYS C C   1 
ATOM   9491  O O   . LYS C 1 359 ? -10.370 44.596  106.478 1.00 20.53 ? 359 LYS C O   1 
ATOM   9492  C CB  . LYS C 1 359 ? -10.552 42.200  104.863 1.00 19.94 ? 359 LYS C CB  1 
ATOM   9493  C CG  . LYS C 1 359 ? -10.240 42.850  103.493 1.00 23.36 ? 359 LYS C CG  1 
ATOM   9494  C CD  . LYS C 1 359 ? -11.328 42.482  102.493 1.00 29.01 ? 359 LYS C CD  1 
ATOM   9495  C CE  . LYS C 1 359 ? -10.972 42.993  101.096 1.00 30.05 ? 359 LYS C CE  1 
ATOM   9496  N NZ  . LYS C 1 359 ? -12.200 42.840  100.287 1.00 31.34 ? 359 LYS C NZ  1 
ATOM   9497  N N   . VAL C 1 360 ? -8.131  44.475  106.015 1.00 21.62 ? 360 VAL C N   1 
ATOM   9498  C CA  . VAL C 1 360 ? -7.859  45.920  106.176 1.00 23.70 ? 360 VAL C CA  1 
ATOM   9499  C C   . VAL C 1 360 ? -8.406  46.741  104.978 1.00 25.40 ? 360 VAL C C   1 
ATOM   9500  O O   . VAL C 1 360 ? -8.149  46.404  103.813 1.00 25.47 ? 360 VAL C O   1 
ATOM   9501  C CB  . VAL C 1 360 ? -6.329  46.176  106.355 1.00 24.31 ? 360 VAL C CB  1 
ATOM   9502  C CG1 . VAL C 1 360 ? -6.028  47.681  106.566 1.00 24.08 ? 360 VAL C CG1 1 
ATOM   9503  C CG2 . VAL C 1 360 ? -5.739  45.315  107.504 1.00 25.40 ? 360 VAL C CG2 1 
ATOM   9504  N N   . LYS C 1 361 ? -9.221  47.767  105.250 1.00 26.68 ? 361 LYS C N   1 
ATOM   9505  C CA  . LYS C 1 361 ? -9.730  48.644  104.157 1.00 27.97 ? 361 LYS C CA  1 
ATOM   9506  C C   . LYS C 1 361 ? -8.653  49.623  103.705 1.00 27.84 ? 361 LYS C C   1 
ATOM   9507  O O   . LYS C 1 361 ? -7.822  50.096  104.503 1.00 28.06 ? 361 LYS C O   1 
ATOM   9508  C CB  . LYS C 1 361 ? -10.996 49.439  104.548 1.00 27.91 ? 361 LYS C CB  1 
ATOM   9509  C CG  . LYS C 1 361 ? -12.183 48.604  104.957 1.00 28.52 ? 361 LYS C CG  1 
ATOM   9510  C CD  . LYS C 1 361 ? -13.361 49.469  105.530 1.00 32.63 ? 361 LYS C CD  1 
ATOM   9511  C CE  . LYS C 1 361 ? -14.509 48.554  106.076 1.00 32.16 ? 361 LYS C CE  1 
ATOM   9512  N NZ  . LYS C 1 361 ? -15.466 49.154  107.143 1.00 35.34 ? 361 LYS C NZ  1 
ATOM   9513  N N   . GLY C 1 362 ? -8.660  49.929  102.422 1.00 28.46 ? 362 GLY C N   1 
ATOM   9514  C CA  . GLY C 1 362 ? -7.764  50.989  101.924 1.00 29.90 ? 362 GLY C CA  1 
ATOM   9515  C C   . GLY C 1 362 ? -6.267  50.672  101.928 1.00 30.28 ? 362 GLY C C   1 
ATOM   9516  O O   . GLY C 1 362 ? -5.469  51.568  101.808 1.00 30.04 ? 362 GLY C O   1 
ATOM   9517  N N   . ILE C 1 363 ? -5.898  49.401  102.077 1.00 31.47 ? 363 ILE C N   1 
ATOM   9518  C CA  . ILE C 1 363 ? -4.508  48.936  101.980 1.00 32.84 ? 363 ILE C CA  1 
ATOM   9519  C C   . ILE C 1 363 ? -4.569  47.733  101.008 1.00 33.69 ? 363 ILE C C   1 
ATOM   9520  O O   . ILE C 1 363 ? -5.302  46.755  101.242 1.00 35.21 ? 363 ILE C O   1 
ATOM   9521  C CB  . ILE C 1 363 ? -3.902  48.533  103.375 1.00 33.01 ? 363 ILE C CB  1 
ATOM   9522  C CG1 . ILE C 1 363 ? -4.031  49.667  104.410 1.00 34.42 ? 363 ILE C CG1 1 
ATOM   9523  C CG2 . ILE C 1 363 ? -2.428  48.127  103.287 1.00 33.31 ? 363 ILE C CG2 1 
ATOM   9524  C CD1 . ILE C 1 363 ? -3.088  50.850  104.250 1.00 36.51 ? 363 ILE C CD1 1 
ATOM   9525  N N   . ASN C 1 364 ? -3.859  47.858  99.889  1.00 34.07 ? 364 ASN C N   1 
ATOM   9526  C CA  . ASN C 1 364 ? -3.781  46.829  98.828  1.00 33.73 ? 364 ASN C CA  1 
ATOM   9527  C C   . ASN C 1 364 ? -3.017  45.582  99.321  1.00 32.19 ? 364 ASN C C   1 
ATOM   9528  O O   . ASN C 1 364 ? -3.406  44.446  99.054  1.00 31.43 ? 364 ASN C O   1 
ATOM   9529  C CB  . ASN C 1 364 ? -3.033  47.465  97.645  1.00 33.76 ? 364 ASN C CB  1 
ATOM   9530  C CG  . ASN C 1 364 ? -3.041  46.609  96.379  1.00 36.41 ? 364 ASN C CG  1 
ATOM   9531  O OD1 . ASN C 1 364 ? -1.977  46.278  95.836  1.00 35.60 ? 364 ASN C OD1 1 
ATOM   9532  N ND2 . ASN C 1 364 ? -4.235  46.316  95.860  1.00 39.07 ? 364 ASN C ND2 1 
ATOM   9533  N N   . ASP C 1 365 ? -1.942  45.830  100.063 1.00 31.95 ? 365 ASP C N   1 
ATOM   9534  C CA  . ASP C 1 365 ? -0.936  44.828  100.442 1.00 31.79 ? 365 ASP C CA  1 
ATOM   9535  C C   . ASP C 1 365 ? -0.392  45.163  101.831 1.00 30.89 ? 365 ASP C C   1 
ATOM   9536  O O   . ASP C 1 365 ? 0.213   46.202  102.053 1.00 29.66 ? 365 ASP C O   1 
ATOM   9537  C CB  . ASP C 1 365 ? 0.184   44.853  99.396  1.00 32.50 ? 365 ASP C CB  1 
ATOM   9538  C CG  . ASP C 1 365 ? 1.179   43.718  99.535  1.00 36.52 ? 365 ASP C CG  1 
ATOM   9539  O OD1 . ASP C 1 365 ? 2.173   43.760  98.743  1.00 42.22 ? 365 ASP C OD1 1 
ATOM   9540  O OD2 . ASP C 1 365 ? 0.975   42.779  100.357 1.00 38.18 ? 365 ASP C OD2 1 
ATOM   9541  N N   . VAL C 1 366 ? -0.600  44.260  102.771 1.00 30.68 ? 366 VAL C N   1 
ATOM   9542  C CA  . VAL C 1 366 ? -0.389  44.572  104.178 1.00 31.18 ? 366 VAL C CA  1 
ATOM   9543  C C   . VAL C 1 366 ? 1.024   44.132  104.659 1.00 31.98 ? 366 VAL C C   1 
ATOM   9544  O O   . VAL C 1 366 ? 1.425   44.359  105.799 1.00 29.88 ? 366 VAL C O   1 
ATOM   9545  C CB  . VAL C 1 366 ? -1.603  43.989  105.002 1.00 31.18 ? 366 VAL C CB  1 
ATOM   9546  C CG1 . VAL C 1 366 ? -1.449  42.506  105.256 1.00 30.41 ? 366 VAL C CG1 1 
ATOM   9547  C CG2 . VAL C 1 366 ? -1.828  44.745  106.270 1.00 34.69 ? 366 VAL C CG2 1 
ATOM   9548  N N   . LYS C 1 367 ? 1.779   43.511  103.750 1.00 33.13 ? 367 LYS C N   1 
ATOM   9549  C CA  . LYS C 1 367 ? 3.115   43.004  104.077 1.00 35.23 ? 367 LYS C CA  1 
ATOM   9550  C C   . LYS C 1 367 ? 4.028   44.122  104.632 1.00 35.04 ? 367 LYS C C   1 
ATOM   9551  O O   . LYS C 1 367 ? 4.593   43.944  105.699 1.00 35.40 ? 367 LYS C O   1 
ATOM   9552  C CB  . LYS C 1 367 ? 3.712   42.240  102.885 1.00 36.06 ? 367 LYS C CB  1 
ATOM   9553  C CG  . LYS C 1 367 ? 4.810   41.236  103.260 1.00 38.74 ? 367 LYS C CG  1 
ATOM   9554  C CD  . LYS C 1 367 ? 4.893   39.987  102.324 1.00 40.85 ? 367 LYS C CD  1 
ATOM   9555  C CE  . LYS C 1 367 ? 4.909   40.313  100.840 1.00 42.42 ? 367 LYS C CE  1 
ATOM   9556  N NZ  . LYS C 1 367 ? 5.760   41.498  100.520 1.00 45.50 ? 367 LYS C NZ  1 
ATOM   9557  N N   . GLU C 1 368 ? 4.097   45.287  103.979 1.00 36.20 ? 368 GLU C N   1 
ATOM   9558  C CA  . GLU C 1 368 ? 4.833   46.450  104.531 1.00 37.18 ? 368 GLU C CA  1 
ATOM   9559  C C   . GLU C 1 368 ? 4.283   46.990  105.861 1.00 37.70 ? 368 GLU C C   1 
ATOM   9560  O O   . GLU C 1 368 ? 5.048   47.286  106.796 1.00 37.49 ? 368 GLU C O   1 
ATOM   9561  C CB  . GLU C 1 368 ? 4.895   47.612  103.525 1.00 38.39 ? 368 GLU C CB  1 
ATOM   9562  C CG  . GLU C 1 368 ? 5.620   48.850  104.059 1.00 40.50 ? 368 GLU C CG  1 
ATOM   9563  C CD  . GLU C 1 368 ? 5.875   49.916  103.005 1.00 45.25 ? 368 GLU C CD  1 
ATOM   9564  O OE1 . GLU C 1 368 ? 4.892   50.573  102.545 1.00 49.38 ? 368 GLU C OE1 1 
ATOM   9565  O OE2 . GLU C 1 368 ? 7.065   50.113  102.651 1.00 47.73 ? 368 GLU C OE2 1 
ATOM   9566  N N   . LEU C 1 369 ? 2.963   47.142  105.952 1.00 36.74 ? 369 LEU C N   1 
ATOM   9567  C CA  . LEU C 1 369 ? 2.383   47.583  107.203 1.00 35.71 ? 369 LEU C CA  1 
ATOM   9568  C C   . LEU C 1 369 ? 2.971   46.733  108.335 1.00 35.28 ? 369 LEU C C   1 
ATOM   9569  O O   . LEU C 1 369 ? 3.456   47.269  109.315 1.00 33.85 ? 369 LEU C O   1 
ATOM   9570  C CB  . LEU C 1 369 ? 0.865   47.476  107.164 1.00 36.29 ? 369 LEU C CB  1 
ATOM   9571  C CG  . LEU C 1 369 ? 0.119   47.989  108.410 1.00 37.82 ? 369 LEU C CG  1 
ATOM   9572  C CD1 . LEU C 1 369 ? 0.037   49.515  108.405 1.00 36.80 ? 369 LEU C CD1 1 
ATOM   9573  C CD2 . LEU C 1 369 ? -1.269  47.363  108.527 1.00 37.35 ? 369 LEU C CD2 1 
ATOM   9574  N N   . ILE C 1 370 ? 2.963   45.413  108.182 1.00 34.76 ? 370 ILE C N   1 
ATOM   9575  C CA  . ILE C 1 370 ? 3.462   44.534  109.253 1.00 36.07 ? 370 ILE C CA  1 
ATOM   9576  C C   . ILE C 1 370 ? 4.980   44.476  109.341 1.00 36.60 ? 370 ILE C C   1 
ATOM   9577  O O   . ILE C 1 370 ? 5.561   44.715  110.409 1.00 36.00 ? 370 ILE C O   1 
ATOM   9578  C CB  . ILE C 1 370 ? 2.923   43.092  109.140 1.00 35.88 ? 370 ILE C CB  1 
ATOM   9579  C CG1 . ILE C 1 370 ? 1.401   43.087  109.209 1.00 36.54 ? 370 ILE C CG1 1 
ATOM   9580  C CG2 . ILE C 1 370 ? 3.532   42.198  110.250 1.00 37.09 ? 370 ILE C CG2 1 
ATOM   9581  C CD1 . ILE C 1 370 ? 0.793   42.130  108.216 1.00 39.98 ? 370 ILE C CD1 1 
ATOM   9582  N N   . GLU C 1 371 ? 5.633   44.157  108.227 1.00 37.80 ? 371 GLU C N   1 
ATOM   9583  C CA  . GLU C 1 371 ? 7.063   43.825  108.313 1.00 39.67 ? 371 GLU C CA  1 
ATOM   9584  C C   . GLU C 1 371 ? 7.937   45.072  108.461 1.00 40.43 ? 371 GLU C C   1 
ATOM   9585  O O   . GLU C 1 371 ? 9.058   44.992  108.974 1.00 41.10 ? 371 GLU C O   1 
ATOM   9586  C CB  . GLU C 1 371 ? 7.498   42.929  107.140 1.00 40.49 ? 371 GLU C CB  1 
ATOM   9587  C CG  . GLU C 1 371 ? 6.546   41.723  106.920 1.00 42.31 ? 371 GLU C CG  1 
ATOM   9588  C CD  . GLU C 1 371 ? 6.941   40.839  105.725 1.00 46.07 ? 371 GLU C CD  1 
ATOM   9589  O OE1 . GLU C 1 371 ? 6.469   39.672  105.673 1.00 46.44 ? 371 GLU C OE1 1 
ATOM   9590  O OE2 . GLU C 1 371 ? 7.703   41.313  104.841 1.00 45.83 ? 371 GLU C OE2 1 
ATOM   9591  N N   . GLU C 1 372 ? 7.414   46.227  108.056 1.00 40.71 ? 372 GLU C N   1 
ATOM   9592  C CA  . GLU C 1 372 ? 8.138   47.492  108.218 1.00 41.44 ? 372 GLU C CA  1 
ATOM   9593  C C   . GLU C 1 372 ? 7.701   48.293  109.444 1.00 40.70 ? 372 GLU C C   1 
ATOM   9594  O O   . GLU C 1 372 ? 8.549   48.732  110.251 1.00 42.02 ? 372 GLU C O   1 
ATOM   9595  C CB  . GLU C 1 372 ? 8.004   48.353  106.971 1.00 41.83 ? 372 GLU C CB  1 
ATOM   9596  C CG  . GLU C 1 372 ? 8.648   47.728  105.739 1.00 45.98 ? 372 GLU C CG  1 
ATOM   9597  C CD  . GLU C 1 372 ? 9.459   48.733  104.932 1.00 50.48 ? 372 GLU C CD  1 
ATOM   9598  O OE1 . GLU C 1 372 ? 10.051  49.669  105.538 1.00 53.57 ? 372 GLU C OE1 1 
ATOM   9599  O OE2 . GLU C 1 372 ? 9.523   48.579  103.697 1.00 52.19 ? 372 GLU C OE2 1 
ATOM   9600  N N   . LYS C 1 373 ? 6.389   48.475  109.602 1.00 38.54 ? 373 LYS C N   1 
ATOM   9601  C CA  . LYS C 1 373 ? 5.884   49.453  110.561 1.00 36.54 ? 373 LYS C CA  1 
ATOM   9602  C C   . LYS C 1 373 ? 5.492   48.848  111.889 1.00 35.89 ? 373 LYS C C   1 
ATOM   9603  O O   . LYS C 1 373 ? 5.899   49.357  112.923 1.00 34.13 ? 373 LYS C O   1 
ATOM   9604  C CB  . LYS C 1 373 ? 4.742   50.269  109.966 1.00 37.39 ? 373 LYS C CB  1 
ATOM   9605  C CG  . LYS C 1 373 ? 5.117   50.995  108.668 1.00 36.96 ? 373 LYS C CG  1 
ATOM   9606  C CD  . LYS C 1 373 ? 4.143   52.133  108.430 1.00 44.47 ? 373 LYS C CD  1 
ATOM   9607  C CE  . LYS C 1 373 ? 3.821   52.356  106.927 1.00 46.80 ? 373 LYS C CE  1 
ATOM   9608  N NZ  . LYS C 1 373 ? 2.952   53.595  106.716 1.00 49.32 ? 373 LYS C NZ  1 
ATOM   9609  N N   . ALA C 1 374 ? 4.728   47.751  111.845 1.00 34.69 ? 374 ALA C N   1 
ATOM   9610  C CA  . ALA C 1 374 ? 4.232   47.111  113.063 1.00 35.22 ? 374 ALA C CA  1 
ATOM   9611  C C   . ALA C 1 374 ? 5.361   46.489  113.868 1.00 35.65 ? 374 ALA C C   1 
ATOM   9612  O O   . ALA C 1 374 ? 5.398   46.689  115.068 1.00 34.44 ? 374 ALA C O   1 
ATOM   9613  C CB  . ALA C 1 374 ? 3.149   46.108  112.775 1.00 34.57 ? 374 ALA C CB  1 
ATOM   9614  N N   . VAL C 1 375 ? 6.298   45.781  113.218 1.00 36.57 ? 375 VAL C N   1 
ATOM   9615  C CA  . VAL C 1 375 ? 7.462   45.257  113.963 1.00 37.97 ? 375 VAL C CA  1 
ATOM   9616  C C   . VAL C 1 375 ? 8.160   46.351  114.759 1.00 38.18 ? 375 VAL C C   1 
ATOM   9617  O O   . VAL C 1 375 ? 8.438   46.156  115.934 1.00 38.89 ? 375 VAL C O   1 
ATOM   9618  C CB  . VAL C 1 375 ? 8.525   44.513  113.102 1.00 37.97 ? 375 VAL C CB  1 
ATOM   9619  C CG1 . VAL C 1 375 ? 8.050   43.132  112.750 1.00 39.51 ? 375 VAL C CG1 1 
ATOM   9620  C CG2 . VAL C 1 375 ? 8.872   45.321  111.863 1.00 38.48 ? 375 VAL C CG2 1 
ATOM   9621  N N   . LYS C 1 376 ? 8.415   47.493  114.123 1.00 39.12 ? 376 LYS C N   1 
ATOM   9622  C CA  . LYS C 1 376 ? 9.072   48.642  114.768 1.00 40.25 ? 376 LYS C CA  1 
ATOM   9623  C C   . LYS C 1 376 ? 8.330   49.179  116.001 1.00 39.73 ? 376 LYS C C   1 
ATOM   9624  O O   . LYS C 1 376 ? 8.924   49.837  116.855 1.00 39.85 ? 376 LYS C O   1 
ATOM   9625  C CB  . LYS C 1 376 ? 9.255   49.776  113.758 1.00 41.18 ? 376 LYS C CB  1 
ATOM   9626  C CG  . LYS C 1 376 ? 10.244  50.853  114.207 1.00 44.31 ? 376 LYS C CG  1 
ATOM   9627  C CD  . LYS C 1 376 ? 11.618  50.724  113.522 1.00 49.50 ? 376 LYS C CD  1 
ATOM   9628  C CE  . LYS C 1 376 ? 11.839  51.890  112.548 1.00 51.11 ? 376 LYS C CE  1 
ATOM   9629  N NZ  . LYS C 1 376 ? 10.705  52.016  111.534 1.00 53.44 ? 376 LYS C NZ  1 
ATOM   9630  N N   . MET C 1 377 ? 7.033   48.892  116.077 1.00 39.26 ? 377 MET C N   1 
ATOM   9631  C CA  . MET C 1 377 ? 6.177   49.274  117.202 1.00 38.44 ? 377 MET C CA  1 
ATOM   9632  C C   . MET C 1 377 ? 5.978   48.131  118.172 1.00 36.82 ? 377 MET C C   1 
ATOM   9633  O O   . MET C 1 377 ? 5.201   48.253  119.107 1.00 36.60 ? 377 MET C O   1 
ATOM   9634  C CB  . MET C 1 377 ? 4.802   49.723  116.705 1.00 39.91 ? 377 MET C CB  1 
ATOM   9635  C CG  . MET C 1 377 ? 4.776   50.959  115.793 1.00 44.47 ? 377 MET C CG  1 
ATOM   9636  S SD  . MET C 1 377 ? 5.137   52.474  116.702 1.00 54.56 ? 377 MET C SD  1 
ATOM   9637  C CE  . MET C 1 377 ? 3.779   52.527  117.891 1.00 51.11 ? 377 MET C CE  1 
ATOM   9638  N N   . GLY C 1 378 ? 6.673   47.013  117.962 1.00 35.24 ? 378 GLY C N   1 
ATOM   9639  C CA  . GLY C 1 378 ? 6.534   45.873  118.855 1.00 32.99 ? 378 GLY C CA  1 
ATOM   9640  C C   . GLY C 1 378 ? 5.280   45.014  118.717 1.00 32.16 ? 378 GLY C C   1 
ATOM   9641  O O   . GLY C 1 378 ? 4.910   44.306  119.647 1.00 31.77 ? 378 GLY C O   1 
ATOM   9642  N N   . VAL C 1 379 ? 4.617   45.029  117.564 1.00 30.40 ? 379 VAL C N   1 
ATOM   9643  C CA  . VAL C 1 379 ? 3.451   44.162  117.425 1.00 29.06 ? 379 VAL C CA  1 
ATOM   9644  C C   . VAL C 1 379 ? 3.493   43.327  116.110 1.00 29.19 ? 379 VAL C C   1 
ATOM   9645  O O   . VAL C 1 379 ? 3.856   43.846  115.042 1.00 27.24 ? 379 VAL C O   1 
ATOM   9646  C CB  . VAL C 1 379 ? 2.106   44.954  117.609 1.00 28.85 ? 379 VAL C CB  1 
ATOM   9647  C CG1 . VAL C 1 379 ? 2.110   45.845  118.881 1.00 24.16 ? 379 VAL C CG1 1 
ATOM   9648  C CG2 . VAL C 1 379 ? 1.838   45.799  116.426 1.00 32.22 ? 379 VAL C CG2 1 
ATOM   9649  N N   . LEU C 1 380 ? 3.152   42.039  116.211 1.00 28.17 ? 380 LEU C N   1 
ATOM   9650  C CA  . LEU C 1 380 ? 3.150   41.167  115.029 1.00 29.16 ? 380 LEU C CA  1 
ATOM   9651  C C   . LEU C 1 380 ? 1.763   40.602  114.758 1.00 28.29 ? 380 LEU C C   1 
ATOM   9652  O O   . LEU C 1 380 ? 1.070   40.138  115.683 1.00 27.37 ? 380 LEU C O   1 
ATOM   9653  C CB  . LEU C 1 380 ? 4.131   39.984  115.172 1.00 29.08 ? 380 LEU C CB  1 
ATOM   9654  C CG  . LEU C 1 380 ? 5.597   40.256  115.543 1.00 31.78 ? 380 LEU C CG  1 
ATOM   9655  C CD1 . LEU C 1 380 ? 6.472   39.007  115.352 1.00 31.80 ? 380 LEU C CD1 1 
ATOM   9656  C CD2 . LEU C 1 380 ? 6.110   41.431  114.711 1.00 32.38 ? 380 LEU C CD2 1 
ATOM   9657  N N   . MET C 1 381 ? 1.366   40.655  113.492 1.00 27.50 ? 381 MET C N   1 
ATOM   9658  C CA  . MET C 1 381 ? 0.274   39.826  112.989 1.00 27.12 ? 381 MET C CA  1 
ATOM   9659  C C   . MET C 1 381 ? 0.713   39.307  111.634 1.00 25.86 ? 381 MET C C   1 
ATOM   9660  O O   . MET C 1 381 ? 1.647   39.833  111.057 1.00 26.37 ? 381 MET C O   1 
ATOM   9661  C CB  . MET C 1 381 ? -1.023  40.610  112.873 1.00 27.99 ? 381 MET C CB  1 
ATOM   9662  C CG  . MET C 1 381 ? -1.494  41.258  114.197 1.00 28.62 ? 381 MET C CG  1 
ATOM   9663  S SD  . MET C 1 381 ? -3.171  41.929  114.049 1.00 31.93 ? 381 MET C SD  1 
ATOM   9664  C CE  . MET C 1 381 ? -4.004  40.719  113.030 1.00 39.19 ? 381 MET C CE  1 
ATOM   9665  N N   . LEU C 1 382 ? 0.063   38.268  111.131 1.00 23.67 ? 382 LEU C N   1 
ATOM   9666  C CA  . LEU C 1 382 ? 0.598   37.608  109.949 1.00 22.76 ? 382 LEU C CA  1 
ATOM   9667  C C   . LEU C 1 382 ? -0.091  38.057  108.655 1.00 22.38 ? 382 LEU C C   1 
ATOM   9668  O O   . LEU C 1 382 ? -1.317  37.902  108.522 1.00 20.39 ? 382 LEU C O   1 
ATOM   9669  C CB  . LEU C 1 382 ? 0.456   36.104  110.129 1.00 22.42 ? 382 LEU C CB  1 
ATOM   9670  C CG  . LEU C 1 382 ? 0.942   35.149  109.058 1.00 24.65 ? 382 LEU C CG  1 
ATOM   9671  C CD1 . LEU C 1 382 ? 2.469   35.197  108.975 1.00 22.97 ? 382 LEU C CD1 1 
ATOM   9672  C CD2 . LEU C 1 382 ? 0.456   33.750  109.428 1.00 23.77 ? 382 LEU C CD2 1 
ATOM   9673  N N   . PRO C 1 383 ? 0.710   38.528  107.659 1.00 23.15 ? 383 PRO C N   1 
ATOM   9674  C CA  . PRO C 1 383 ? 0.157   38.900  106.353 1.00 22.78 ? 383 PRO C CA  1 
ATOM   9675  C C   . PRO C 1 383 ? -0.537  37.737  105.687 1.00 22.81 ? 383 PRO C C   1 
ATOM   9676  O O   . PRO C 1 383 ? -0.142  36.572  105.863 1.00 22.64 ? 383 PRO C O   1 
ATOM   9677  C CB  . PRO C 1 383 ? 1.400   39.336  105.546 1.00 22.31 ? 383 PRO C CB  1 
ATOM   9678  C CG  . PRO C 1 383 ? 2.388   39.753  106.609 1.00 24.76 ? 383 PRO C CG  1 
ATOM   9679  C CD  . PRO C 1 383 ? 2.161   38.735  107.696 1.00 22.93 ? 383 PRO C CD  1 
ATOM   9680  N N   . GLY C 1 384 ? -1.556  38.028  104.892 1.00 21.69 ? 384 GLY C N   1 
ATOM   9681  C CA  . GLY C 1 384 ? -2.354  36.934  104.358 1.00 21.31 ? 384 GLY C CA  1 
ATOM   9682  C C   . GLY C 1 384 ? -1.747  36.195  103.191 1.00 22.05 ? 384 GLY C C   1 
ATOM   9683  O O   . GLY C 1 384 ? -2.292  35.155  102.776 1.00 22.12 ? 384 GLY C O   1 
ATOM   9684  N N   . ASN C 1 385 ? -0.655  36.737  102.643 1.00 23.61 ? 385 ASN C N   1 
ATOM   9685  C CA  . ASN C 1 385 ? 0.013   36.247  101.418 1.00 25.75 ? 385 ASN C CA  1 
ATOM   9686  C C   . ASN C 1 385 ? 0.300   34.755  101.349 1.00 25.68 ? 385 ASN C C   1 
ATOM   9687  O O   . ASN C 1 385 ? 0.254   34.157  100.269 1.00 25.29 ? 385 ASN C O   1 
ATOM   9688  C CB  . ASN C 1 385 ? 1.350   36.990  101.198 1.00 26.94 ? 385 ASN C CB  1 
ATOM   9689  C CG  . ASN C 1 385 ? 1.178   38.497  101.128 1.00 32.00 ? 385 ASN C CG  1 
ATOM   9690  O OD1 . ASN C 1 385 ? 0.774   39.135  102.101 1.00 36.94 ? 385 ASN C OD1 1 
ATOM   9691  N ND2 . ASN C 1 385 ? 1.534   39.086  99.979  1.00 39.35 ? 385 ASN C ND2 1 
ATOM   9692  N N   . ALA C 1 386 ? 0.610   34.163  102.508 1.00 26.09 ? 386 ALA C N   1 
ATOM   9693  C CA  . ALA C 1 386 ? 1.117   32.793  102.612 1.00 26.64 ? 386 ALA C CA  1 
ATOM   9694  C C   . ALA C 1 386 ? 0.022   31.784  102.409 1.00 26.01 ? 386 ALA C C   1 
ATOM   9695  O O   . ALA C 1 386 ? 0.287   30.565  102.321 1.00 26.82 ? 386 ALA C O   1 
ATOM   9696  C CB  . ALA C 1 386 ? 1.733   32.592  104.017 1.00 26.85 ? 386 ALA C CB  1 
ATOM   9697  N N   . PHE C 1 387 ? -1.213  32.272  102.406 1.00 24.79 ? 387 PHE C N   1 
ATOM   9698  C CA  . PHE C 1 387 ? -2.369  31.404  102.285 1.00 23.31 ? 387 PHE C CA  1 
ATOM   9699  C C   . PHE C 1 387 ? -2.975  31.255  100.898 1.00 23.13 ? 387 PHE C C   1 
ATOM   9700  O O   . PHE C 1 387 ? -4.092  30.734  100.762 1.00 23.28 ? 387 PHE C O   1 
ATOM   9701  C CB  . PHE C 1 387 ? -3.397  31.796  103.348 1.00 22.57 ? 387 PHE C CB  1 
ATOM   9702  C CG  . PHE C 1 387 ? -2.807  31.791  104.741 1.00 22.43 ? 387 PHE C CG  1 
ATOM   9703  C CD1 . PHE C 1 387 ? -2.385  32.982  105.337 1.00 23.87 ? 387 PHE C CD1 1 
ATOM   9704  C CD2 . PHE C 1 387 ? -2.602  30.589  105.421 1.00 19.70 ? 387 PHE C CD2 1 
ATOM   9705  C CE1 . PHE C 1 387 ? -1.823  32.999  106.595 1.00 22.16 ? 387 PHE C CE1 1 
ATOM   9706  C CE2 . PHE C 1 387 ? -2.043  30.596  106.714 1.00 21.53 ? 387 PHE C CE2 1 
ATOM   9707  C CZ  . PHE C 1 387 ? -1.625  31.795  107.287 1.00 22.97 ? 387 PHE C CZ  1 
ATOM   9708  N N   . TYR C 1 388 ? -2.231  31.670  99.868  1.00 23.36 ? 388 TYR C N   1 
ATOM   9709  C CA  . TYR C 1 388 ? -2.737  31.600  98.470  1.00 21.09 ? 388 TYR C CA  1 
ATOM   9710  C C   . TYR C 1 388 ? -1.681  30.910  97.648  1.00 22.10 ? 388 TYR C C   1 
ATOM   9711  O O   . TYR C 1 388 ? -0.500  31.006  98.004  1.00 19.23 ? 388 TYR C O   1 
ATOM   9712  C CB  . TYR C 1 388 ? -2.928  33.011  97.948  1.00 21.33 ? 388 TYR C CB  1 
ATOM   9713  C CG  . TYR C 1 388 ? -4.027  33.754  98.683  1.00 20.01 ? 388 TYR C CG  1 
ATOM   9714  C CD1 . TYR C 1 388 ? -5.348  33.645  98.260  1.00 22.76 ? 388 TYR C CD1 1 
ATOM   9715  C CD2 . TYR C 1 388 ? -3.757  34.493  99.820  1.00 19.67 ? 388 TYR C CD2 1 
ATOM   9716  C CE1 . TYR C 1 388 ? -6.379  34.329  98.916  1.00 20.33 ? 388 TYR C CE1 1 
ATOM   9717  C CE2 . TYR C 1 388 ? -4.783  35.196  100.504 1.00 23.43 ? 388 TYR C CE2 1 
ATOM   9718  C CZ  . TYR C 1 388 ? -6.098  35.098  100.034 1.00 22.91 ? 388 TYR C CZ  1 
ATOM   9719  O OH  . TYR C 1 388 ? -7.125  35.769  100.703 1.00 23.92 ? 388 TYR C OH  1 
ATOM   9720  N N   . VAL C 1 389 ? -2.095  30.225  96.578  1.00 21.81 ? 389 VAL C N   1 
ATOM   9721  C CA  . VAL C 1 389 ? -1.125  29.510  95.699  1.00 25.25 ? 389 VAL C CA  1 
ATOM   9722  C C   . VAL C 1 389 ? -0.099  30.522  95.207  1.00 26.62 ? 389 VAL C C   1 
ATOM   9723  O O   . VAL C 1 389 ? 1.097   30.273  95.248  1.00 26.58 ? 389 VAL C O   1 
ATOM   9724  C CB  . VAL C 1 389 ? -1.859  28.806  94.525  1.00 24.91 ? 389 VAL C CB  1 
ATOM   9725  C CG1 . VAL C 1 389 ? -0.883  28.192  93.484  1.00 26.61 ? 389 VAL C CG1 1 
ATOM   9726  C CG2 . VAL C 1 389 ? -2.849  27.735  95.090  1.00 24.98 ? 389 VAL C CG2 1 
ATOM   9727  N N   . ASP C 1 390 ? -0.587  31.700  94.813  1.00 27.48 ? 390 ASP C N   1 
ATOM   9728  C CA  . ASP C 1 390 ? 0.263   32.808  94.386  1.00 28.73 ? 390 ASP C CA  1 
ATOM   9729  C C   . ASP C 1 390 ? 0.521   33.716  95.580  1.00 28.84 ? 390 ASP C C   1 
ATOM   9730  O O   . ASP C 1 390 ? -0.215  34.665  95.826  1.00 27.26 ? 390 ASP C O   1 
ATOM   9731  C CB  . ASP C 1 390 ? -0.450  33.576  93.260  1.00 30.12 ? 390 ASP C CB  1 
ATOM   9732  C CG  . ASP C 1 390 ? 0.386   34.702  92.674  1.00 34.16 ? 390 ASP C CG  1 
ATOM   9733  O OD1 . ASP C 1 390 ? -0.152  35.383  91.776  1.00 36.02 ? 390 ASP C OD1 1 
ATOM   9734  O OD2 . ASP C 1 390 ? 1.547   34.899  93.112  1.00 35.26 ? 390 ASP C OD2 1 
ATOM   9735  N N   . SER C 1 391 ? 1.594   33.431  96.307  1.00 28.88 ? 391 SER C N   1 
ATOM   9736  C CA  . SER C 1 391 ? 1.896   34.148  97.525  1.00 30.56 ? 391 SER C CA  1 
ATOM   9737  C C   . SER C 1 391 ? 2.456   35.532  97.176  1.00 30.76 ? 391 SER C C   1 
ATOM   9738  O O   . SER C 1 391 ? 2.470   36.439  98.001  1.00 30.20 ? 391 SER C O   1 
ATOM   9739  C CB  . SER C 1 391 ? 2.864   33.330  98.405  1.00 30.46 ? 391 SER C CB  1 
ATOM   9740  O OG  . SER C 1 391 ? 4.127   33.189  97.768  1.00 33.87 ? 391 SER C OG  1 
ATOM   9741  N N   . SER C 1 392 ? 2.868   35.683  95.919  1.00 31.60 ? 392 SER C N   1 
ATOM   9742  C CA  . SER C 1 392 ? 3.421   36.937  95.406  1.00 31.74 ? 392 SER C CA  1 
ATOM   9743  C C   . SER C 1 392 ? 2.357   38.013  95.205  1.00 31.09 ? 392 SER C C   1 
ATOM   9744  O O   . SER C 1 392 ? 2.708   39.188  95.125  1.00 31.19 ? 392 SER C O   1 
ATOM   9745  C CB  . SER C 1 392 ? 4.132   36.696  94.054  1.00 32.87 ? 392 SER C CB  1 
ATOM   9746  O OG  . SER C 1 392 ? 5.456   36.199  94.266  1.00 36.20 ? 392 SER C OG  1 
ATOM   9747  N N   . ALA C 1 393 ? 1.083   37.606  95.050  1.00 29.85 ? 393 ALA C N   1 
ATOM   9748  C CA  . ALA C 1 393 ? -0.020  38.553  94.857  1.00 28.77 ? 393 ALA C CA  1 
ATOM   9749  C C   . ALA C 1 393 ? -0.259  39.385  96.139  1.00 28.03 ? 393 ALA C C   1 
ATOM   9750  O O   . ALA C 1 393 ? -0.046  38.894  97.241  1.00 27.71 ? 393 ALA C O   1 
ATOM   9751  C CB  . ALA C 1 393 ? -1.303  37.823  94.432  1.00 27.80 ? 393 ALA C CB  1 
ATOM   9752  N N   . PRO C 1 394 ? -0.728  40.643  95.997  1.00 27.73 ? 394 PRO C N   1 
ATOM   9753  C CA  . PRO C 1 394 ? -0.911  41.394  97.212  1.00 26.42 ? 394 PRO C CA  1 
ATOM   9754  C C   . PRO C 1 394 ? -2.100  40.879  97.991  1.00 24.92 ? 394 PRO C C   1 
ATOM   9755  O O   . PRO C 1 394 ? -3.051  40.318  97.425  1.00 24.48 ? 394 PRO C O   1 
ATOM   9756  C CB  . PRO C 1 394 ? -1.203  42.832  96.718  1.00 26.24 ? 394 PRO C CB  1 
ATOM   9757  C CG  . PRO C 1 394 ? -1.668  42.704  95.402  1.00 28.48 ? 394 PRO C CG  1 
ATOM   9758  C CD  . PRO C 1 394 ? -1.166  41.399  94.806  1.00 27.33 ? 394 PRO C CD  1 
ATOM   9759  N N   . SER C 1 395 ? -2.058  41.123  99.295  1.00 24.58 ? 395 SER C N   1 
ATOM   9760  C CA  . SER C 1 395 ? -3.135  40.746  100.175 1.00 23.53 ? 395 SER C CA  1 
ATOM   9761  C C   . SER C 1 395 ? -3.395  41.802  101.212 1.00 22.90 ? 395 SER C C   1 
ATOM   9762  O O   . SER C 1 395 ? -2.460  42.257  101.866 1.00 22.19 ? 395 SER C O   1 
ATOM   9763  C CB  . SER C 1 395 ? -2.832  39.430  100.859 1.00 23.77 ? 395 SER C CB  1 
ATOM   9764  O OG  . SER C 1 395 ? -3.917  39.084  101.701 1.00 23.58 ? 395 SER C OG  1 
ATOM   9765  N N   . PRO C 1 396 ? -4.686  42.181  101.373 1.00 22.52 ? 396 PRO C N   1 
ATOM   9766  C CA  . PRO C 1 396 ? -5.207  43.095  102.407 1.00 22.41 ? 396 PRO C CA  1 
ATOM   9767  C C   . PRO C 1 396 ? -5.509  42.414  103.746 1.00 22.20 ? 396 PRO C C   1 
ATOM   9768  O O   . PRO C 1 396 ? -6.003  43.075  104.674 1.00 20.71 ? 396 PRO C O   1 
ATOM   9769  C CB  . PRO C 1 396 ? -6.528  43.592  101.790 1.00 22.73 ? 396 PRO C CB  1 
ATOM   9770  C CG  . PRO C 1 396 ? -7.012  42.389  100.988 1.00 23.64 ? 396 PRO C CG  1 
ATOM   9771  C CD  . PRO C 1 396 ? -5.738  41.762  100.411 1.00 22.96 ? 396 PRO C CD  1 
ATOM   9772  N N   . TYR C 1 397 ? -5.288  41.099  103.828 1.00 21.28 ? 397 TYR C N   1 
ATOM   9773  C CA  . TYR C 1 397 ? -5.667  40.343  105.027 1.00 21.52 ? 397 TYR C CA  1 
ATOM   9774  C C   . TYR C 1 397 ? -4.555  40.120  106.013 1.00 21.51 ? 397 TYR C C   1 
ATOM   9775  O O   . TYR C 1 397 ? -3.385  40.023  105.621 1.00 20.88 ? 397 TYR C O   1 
ATOM   9776  C CB  . TYR C 1 397 ? -6.242  38.960  104.651 1.00 21.41 ? 397 TYR C CB  1 
ATOM   9777  C CG  . TYR C 1 397 ? -7.597  39.008  103.970 1.00 21.79 ? 397 TYR C CG  1 
ATOM   9778  C CD1 . TYR C 1 397 ? -7.693  39.013  102.584 1.00 22.75 ? 397 TYR C CD1 1 
ATOM   9779  C CD2 . TYR C 1 397 ? -8.765  39.035  104.709 1.00 21.27 ? 397 TYR C CD2 1 
ATOM   9780  C CE1 . TYR C 1 397 ? -8.926  39.050  101.939 1.00 21.29 ? 397 TYR C CE1 1 
ATOM   9781  C CE2 . TYR C 1 397 ? -10.025 39.050  104.078 1.00 20.99 ? 397 TYR C CE2 1 
ATOM   9782  C CZ  . TYR C 1 397 ? -10.077 39.066  102.692 1.00 24.98 ? 397 TYR C CZ  1 
ATOM   9783  O OH  . TYR C 1 397 ? -11.308 39.084  102.050 1.00 25.64 ? 397 TYR C OH  1 
ATOM   9784  N N   . LEU C 1 398 ? -4.950  40.025  107.290 1.00 21.30 ? 398 LEU C N   1 
ATOM   9785  C CA  . LEU C 1 398 ? -4.061  39.656  108.400 1.00 22.46 ? 398 LEU C CA  1 
ATOM   9786  C C   . LEU C 1 398 ? -4.683  38.526  109.144 1.00 20.78 ? 398 LEU C C   1 
ATOM   9787  O O   . LEU C 1 398 ? -5.906  38.518  109.398 1.00 19.89 ? 398 LEU C O   1 
ATOM   9788  C CB  . LEU C 1 398 ? -3.870  40.786  109.440 1.00 23.89 ? 398 LEU C CB  1 
ATOM   9789  C CG  . LEU C 1 398 ? -3.141  41.993  108.940 1.00 27.89 ? 398 LEU C CG  1 
ATOM   9790  C CD1 . LEU C 1 398 ? -3.546  43.189  109.757 1.00 31.91 ? 398 LEU C CD1 1 
ATOM   9791  C CD2 . LEU C 1 398 ? -1.672  41.715  109.105 1.00 34.35 ? 398 LEU C CD2 1 
ATOM   9792  N N   . ARG C 1 399 ? -3.848  37.564  109.497 1.00 19.12 ? 399 ARG C N   1 
ATOM   9793  C CA  . ARG C 1 399 ? -4.277  36.545  110.417 1.00 19.74 ? 399 ARG C CA  1 
ATOM   9794  C C   . ARG C 1 399 ? -3.851  36.875  111.847 1.00 19.80 ? 399 ARG C C   1 
ATOM   9795  O O   . ARG C 1 399 ? -2.681  37.108  112.091 1.00 20.44 ? 399 ARG C O   1 
ATOM   9796  C CB  . ARG C 1 399 ? -3.722  35.184  109.997 1.00 20.07 ? 399 ARG C CB  1 
ATOM   9797  C CG  . ARG C 1 399 ? -4.292  34.060  110.818 1.00 22.16 ? 399 ARG C CG  1 
ATOM   9798  C CD  . ARG C 1 399 ? -3.536  32.722  110.487 1.00 22.92 ? 399 ARG C CD  1 
ATOM   9799  N NE  . ARG C 1 399 ? -2.270  32.672  111.212 1.00 22.93 ? 399 ARG C NE  1 
ATOM   9800  C CZ  . ARG C 1 399 ? -1.461  31.616  111.232 1.00 22.42 ? 399 ARG C CZ  1 
ATOM   9801  N NH1 . ARG C 1 399 ? -1.781  30.529  110.547 1.00 20.63 ? 399 ARG C NH1 1 
ATOM   9802  N NH2 . ARG C 1 399 ? -0.340  31.655  111.943 1.00 20.30 ? 399 ARG C NH2 1 
ATOM   9803  N N   . ALA C 1 400 ? -4.804  36.952  112.781 1.00 19.79 ? 400 ALA C N   1 
ATOM   9804  C CA  . ALA C 1 400 ? -4.443  37.179  114.194 1.00 20.35 ? 400 ALA C CA  1 
ATOM   9805  C C   . ALA C 1 400 ? -4.829  35.958  115.000 1.00 19.89 ? 400 ALA C C   1 
ATOM   9806  O O   . ALA C 1 400 ? -5.971  35.471  114.910 1.00 20.46 ? 400 ALA C O   1 
ATOM   9807  C CB  . ALA C 1 400 ? -5.120  38.452  114.759 1.00 19.30 ? 400 ALA C CB  1 
ATOM   9808  N N   . SER C 1 401 ? -3.879  35.423  115.760 1.00 21.13 ? 401 SER C N   1 
ATOM   9809  C CA  . SER C 1 401 ? -4.203  34.299  116.646 1.00 20.89 ? 401 SER C CA  1 
ATOM   9810  C C   . SER C 1 401 ? -4.783  34.820  117.954 1.00 20.94 ? 401 SER C C   1 
ATOM   9811  O O   . SER C 1 401 ? -4.232  35.752  118.572 1.00 22.10 ? 401 SER C O   1 
ATOM   9812  C CB  . SER C 1 401 ? -2.998  33.407  116.992 1.00 21.87 ? 401 SER C CB  1 
ATOM   9813  O OG  . SER C 1 401 ? -3.442  32.325  117.855 1.00 22.39 ? 401 SER C OG  1 
ATOM   9814  N N   . PHE C 1 402 ? -5.832  34.161  118.406 1.00 20.03 ? 402 PHE C N   1 
ATOM   9815  C CA  . PHE C 1 402 ? -6.338  34.406  119.755 1.00 20.25 ? 402 PHE C CA  1 
ATOM   9816  C C   . PHE C 1 402 ? -6.066  33.314  120.786 1.00 20.57 ? 402 PHE C C   1 
ATOM   9817  O O   . PHE C 1 402 ? -6.690  33.284  121.835 1.00 20.19 ? 402 PHE C O   1 
ATOM   9818  C CB  . PHE C 1 402 ? -7.806  34.839  119.721 1.00 18.98 ? 402 PHE C CB  1 
ATOM   9819  C CG  . PHE C 1 402 ? -8.730  33.891  118.989 1.00 18.54 ? 402 PHE C CG  1 
ATOM   9820  C CD1 . PHE C 1 402 ? -9.324  32.814  119.658 1.00 18.67 ? 402 PHE C CD1 1 
ATOM   9821  C CD2 . PHE C 1 402 ? -9.078  34.129  117.655 1.00 17.13 ? 402 PHE C CD2 1 
ATOM   9822  C CE1 . PHE C 1 402 ? -10.200 31.972  119.020 1.00 18.35 ? 402 PHE C CE1 1 
ATOM   9823  C CE2 . PHE C 1 402 ? -9.932  33.279  117.017 1.00 14.73 ? 402 PHE C CE2 1 
ATOM   9824  C CZ  . PHE C 1 402 ? -10.510 32.210  117.669 1.00 17.83 ? 402 PHE C CZ  1 
ATOM   9825  N N   . SER C 1 403 ? -5.082  32.439  120.536 1.00 20.50 ? 403 SER C N   1 
ATOM   9826  C CA  . SER C 1 403 ? -4.919  31.274  121.402 1.00 22.06 ? 403 SER C CA  1 
ATOM   9827  C C   . SER C 1 403 ? -4.316  31.654  122.765 1.00 22.69 ? 403 SER C C   1 
ATOM   9828  O O   . SER C 1 403 ? -4.635  31.050  123.767 1.00 22.94 ? 403 SER C O   1 
ATOM   9829  C CB  . SER C 1 403 ? -4.065  30.198  120.713 1.00 21.95 ? 403 SER C CB  1 
ATOM   9830  O OG  . SER C 1 403 ? -2.785  30.732  120.469 1.00 23.43 ? 403 SER C OG  1 
ATOM   9831  N N   . SER C 1 404 ? -3.502  32.699  122.785 1.00 23.21 ? 404 SER C N   1 
ATOM   9832  C CA  . SER C 1 404 ? -2.607  32.948  123.921 1.00 24.39 ? 404 SER C CA  1 
ATOM   9833  C C   . SER C 1 404 ? -2.641  34.329  124.561 1.00 23.78 ? 404 SER C C   1 
ATOM   9834  O O   . SER C 1 404 ? -2.454  34.452  125.756 1.00 23.26 ? 404 SER C O   1 
ATOM   9835  C CB  . SER C 1 404 ? -1.169  32.614  123.469 1.00 24.22 ? 404 SER C CB  1 
ATOM   9836  O OG  . SER C 1 404 ? -1.081  31.189  123.378 1.00 29.06 ? 404 SER C OG  1 
ATOM   9837  N N   . ALA C 1 405 ? -2.848  35.380  123.765 1.00 23.29 ? 405 ALA C N   1 
ATOM   9838  C CA  . ALA C 1 405 ? -2.664  36.736  124.279 1.00 22.49 ? 405 ALA C CA  1 
ATOM   9839  C C   . ALA C 1 405 ? -3.737  37.112  125.295 1.00 22.67 ? 405 ALA C C   1 
ATOM   9840  O O   . ALA C 1 405 ? -4.883  36.678  125.185 1.00 22.39 ? 405 ALA C O   1 
ATOM   9841  C CB  . ALA C 1 405 ? -2.622  37.743  123.132 1.00 23.48 ? 405 ALA C CB  1 
ATOM   9842  N N   . SER C 1 406 ? -3.359  37.906  126.294 1.00 22.07 ? 406 SER C N   1 
ATOM   9843  C CA  . SER C 1 406 ? -4.282  38.349  127.330 1.00 22.71 ? 406 SER C CA  1 
ATOM   9844  C C   . SER C 1 406 ? -5.176  39.483  126.751 1.00 23.42 ? 406 SER C C   1 
ATOM   9845  O O   . SER C 1 406 ? -4.831  40.046  125.725 1.00 23.06 ? 406 SER C O   1 
ATOM   9846  C CB  . SER C 1 406 ? -3.473  38.927  128.489 1.00 22.36 ? 406 SER C CB  1 
ATOM   9847  O OG  . SER C 1 406 ? -2.774  40.064  128.023 1.00 18.93 ? 406 SER C OG  1 
ATOM   9848  N N   . PRO C 1 407 ? -6.324  39.823  127.404 1.00 24.63 ? 407 PRO C N   1 
ATOM   9849  C CA  . PRO C 1 407 ? -7.060  41.013  126.932 1.00 24.91 ? 407 PRO C CA  1 
ATOM   9850  C C   . PRO C 1 407 ? -6.227  42.279  126.820 1.00 25.06 ? 407 PRO C C   1 
ATOM   9851  O O   . PRO C 1 407 ? -6.417  43.033  125.877 1.00 25.83 ? 407 PRO C O   1 
ATOM   9852  C CB  . PRO C 1 407 ? -8.135  41.216  128.003 1.00 25.49 ? 407 PRO C CB  1 
ATOM   9853  C CG  . PRO C 1 407 ? -8.387  39.856  128.520 1.00 25.71 ? 407 PRO C CG  1 
ATOM   9854  C CD  . PRO C 1 407 ? -7.031  39.161  128.515 1.00 23.55 ? 407 PRO C CD  1 
ATOM   9855  N N   . GLU C 1 408 ? -5.320  42.530  127.763 1.00 25.82 ? 408 GLU C N   1 
ATOM   9856  C CA  . GLU C 1 408 ? -4.471  43.716  127.671 1.00 25.84 ? 408 GLU C CA  1 
ATOM   9857  C C   . GLU C 1 408 ? -3.594  43.684  126.432 1.00 25.04 ? 408 GLU C C   1 
ATOM   9858  O O   . GLU C 1 408 ? -3.428  44.691  125.754 1.00 25.29 ? 408 GLU C O   1 
ATOM   9859  C CB  . GLU C 1 408 ? -3.588  43.897  128.913 1.00 27.19 ? 408 GLU C CB  1 
ATOM   9860  C CG  . GLU C 1 408 ? -4.316  43.807  130.253 1.00 31.63 ? 408 GLU C CG  1 
ATOM   9861  C CD  . GLU C 1 408 ? -4.343  42.376  130.778 1.00 37.07 ? 408 GLU C CD  1 
ATOM   9862  O OE1 . GLU C 1 408 ? -5.230  41.614  130.393 1.00 30.27 ? 408 GLU C OE1 1 
ATOM   9863  O OE2 . GLU C 1 408 ? -3.450  42.011  131.588 1.00 46.28 ? 408 GLU C OE2 1 
ATOM   9864  N N   . GLN C 1 409 ? -3.008  42.529  126.145 1.00 24.75 ? 409 GLN C N   1 
ATOM   9865  C CA  . GLN C 1 409 ? -2.140  42.388  124.973 1.00 24.34 ? 409 GLN C CA  1 
ATOM   9866  C C   . GLN C 1 409 ? -2.883  42.639  123.686 1.00 23.62 ? 409 GLN C C   1 
ATOM   9867  O O   . GLN C 1 409 ? -2.322  43.260  122.782 1.00 25.68 ? 409 GLN C O   1 
ATOM   9868  C CB  . GLN C 1 409 ? -1.478  41.002  124.962 1.00 23.90 ? 409 GLN C CB  1 
ATOM   9869  C CG  . GLN C 1 409 ? -0.297  40.961  125.948 1.00 24.44 ? 409 GLN C CG  1 
ATOM   9870  C CD  . GLN C 1 409 ? 0.227   39.565  126.138 1.00 28.71 ? 409 GLN C CD  1 
ATOM   9871  O OE1 . GLN C 1 409 ? -0.519  38.582  126.022 1.00 26.20 ? 409 GLN C OE1 1 
ATOM   9872  N NE2 . GLN C 1 409 ? 1.522   39.461  126.415 1.00 28.08 ? 409 GLN C NE2 1 
ATOM   9873  N N   . MET C 1 410 ? -4.123  42.133  123.597 1.00 23.34 ? 410 MET C N   1 
ATOM   9874  C CA  . MET C 1 410 ? -4.963  42.321  122.396 1.00 23.30 ? 410 MET C CA  1 
ATOM   9875  C C   . MET C 1 410 ? -5.294  43.777  122.282 1.00 21.95 ? 410 MET C C   1 
ATOM   9876  O O   . MET C 1 410 ? -5.279  44.335  121.201 1.00 21.94 ? 410 MET C O   1 
ATOM   9877  C CB  . MET C 1 410 ? -6.239  41.514  122.463 1.00 23.63 ? 410 MET C CB  1 
ATOM   9878  C CG  . MET C 1 410 ? -6.002  40.004  122.466 1.00 24.39 ? 410 MET C CG  1 
ATOM   9879  S SD  . MET C 1 410 ? -7.541  39.140  122.736 1.00 24.55 ? 410 MET C SD  1 
ATOM   9880  C CE  . MET C 1 410 ? -7.070  37.464  122.341 1.00 24.04 ? 410 MET C CE  1 
ATOM   9881  N N   . ASP C 1 411 ? -5.561  44.403  123.418 1.00 22.49 ? 411 ASP C N   1 
ATOM   9882  C CA  . ASP C 1 411 ? -5.839  45.838  123.439 1.00 22.66 ? 411 ASP C CA  1 
ATOM   9883  C C   . ASP C 1 411 ? -4.699  46.648  122.876 1.00 22.08 ? 411 ASP C C   1 
ATOM   9884  O O   . ASP C 1 411 ? -4.922  47.416  121.964 1.00 20.96 ? 411 ASP C O   1 
ATOM   9885  C CB  . ASP C 1 411 ? -6.215  46.315  124.838 1.00 22.38 ? 411 ASP C CB  1 
ATOM   9886  C CG  . ASP C 1 411 ? -6.774  47.728  124.840 1.00 25.24 ? 411 ASP C CG  1 
ATOM   9887  O OD1 . ASP C 1 411 ? -6.176  48.563  125.532 1.00 26.92 ? 411 ASP C OD1 1 
ATOM   9888  O OD2 . ASP C 1 411 ? -7.793  48.009  124.171 1.00 23.02 ? 411 ASP C OD2 1 
ATOM   9889  N N   . VAL C 1 412 ? -3.494  46.504  123.448 1.00 22.33 ? 412 VAL C N   1 
ATOM   9890  C CA  . VAL C 1 412 ? -2.279  47.133  122.914 1.00 22.76 ? 412 VAL C CA  1 
ATOM   9891  C C   . VAL C 1 412 ? -2.034  46.863  121.398 1.00 21.58 ? 412 VAL C C   1 
ATOM   9892  O O   . VAL C 1 412 ? -1.775  47.801  120.614 1.00 19.95 ? 412 VAL C O   1 
ATOM   9893  C CB  . VAL C 1 412 ? -0.967  46.771  123.721 1.00 23.73 ? 412 VAL C CB  1 
ATOM   9894  C CG1 . VAL C 1 412 ? 0.222   47.490  123.080 1.00 26.57 ? 412 VAL C CG1 1 
ATOM   9895  C CG2 . VAL C 1 412 ? -1.096  47.230  125.147 1.00 25.04 ? 412 VAL C CG2 1 
ATOM   9896  N N   . ALA C 1 413 ? -2.146  45.602  120.979 1.00 20.84 ? 413 ALA C N   1 
ATOM   9897  C CA  . ALA C 1 413 ? -1.842  45.259  119.593 1.00 20.23 ? 413 ALA C CA  1 
ATOM   9898  C C   . ALA C 1 413 ? -2.836  45.877  118.586 1.00 20.41 ? 413 ALA C C   1 
ATOM   9899  O O   . ALA C 1 413 ? -2.448  46.300  117.499 1.00 17.97 ? 413 ALA C O   1 
ATOM   9900  C CB  . ALA C 1 413 ? -1.814  43.739  119.428 1.00 19.70 ? 413 ALA C CB  1 
ATOM   9901  N N   . PHE C 1 414 ? -4.117  45.902  118.938 1.00 20.31 ? 414 PHE C N   1 
ATOM   9902  C CA  . PHE C 1 414 ? -5.119  46.444  118.001 1.00 20.68 ? 414 PHE C CA  1 
ATOM   9903  C C   . PHE C 1 414 ? -5.120  47.979  117.948 1.00 21.65 ? 414 PHE C C   1 
ATOM   9904  O O   . PHE C 1 414 ? -5.340  48.557  116.915 1.00 21.62 ? 414 PHE C O   1 
ATOM   9905  C CB  . PHE C 1 414 ? -6.508  45.861  118.316 1.00 21.09 ? 414 PHE C CB  1 
ATOM   9906  C CG  . PHE C 1 414 ? -6.688  44.486  117.763 1.00 20.37 ? 414 PHE C CG  1 
ATOM   9907  C CD1 . PHE C 1 414 ? -6.260  43.389  118.461 1.00 23.43 ? 414 PHE C CD1 1 
ATOM   9908  C CD2 . PHE C 1 414 ? -7.246  44.305  116.528 1.00 26.23 ? 414 PHE C CD2 1 
ATOM   9909  C CE1 . PHE C 1 414 ? -6.392  42.110  117.929 1.00 25.70 ? 414 PHE C CE1 1 
ATOM   9910  C CE2 . PHE C 1 414 ? -7.371  43.009  115.967 1.00 24.52 ? 414 PHE C CE2 1 
ATOM   9911  C CZ  . PHE C 1 414 ? -6.943  41.943  116.650 1.00 25.66 ? 414 PHE C CZ  1 
ATOM   9912  N N   . GLN C 1 415 ? -4.854  48.629  119.071 1.00 23.12 ? 415 GLN C N   1 
ATOM   9913  C CA  . GLN C 1 415 ? -4.635  50.091  119.045 1.00 24.20 ? 415 GLN C CA  1 
ATOM   9914  C C   . GLN C 1 415 ? -3.411  50.472  118.203 1.00 23.38 ? 415 GLN C C   1 
ATOM   9915  O O   . GLN C 1 415 ? -3.479  51.436  117.430 1.00 22.22 ? 415 GLN C O   1 
ATOM   9916  C CB  . GLN C 1 415 ? -4.507  50.678  120.431 1.00 25.94 ? 415 GLN C CB  1 
ATOM   9917  C CG  . GLN C 1 415 ? -3.400  50.192  121.208 1.00 32.52 ? 415 GLN C CG  1 
ATOM   9918  C CD  . GLN C 1 415 ? -2.614  51.312  121.870 1.00 40.51 ? 415 GLN C CD  1 
ATOM   9919  O OE1 . GLN C 1 415 ? -1.878  52.083  121.196 1.00 36.58 ? 415 GLN C OE1 1 
ATOM   9920  N NE2 . GLN C 1 415 ? -2.729  51.381  123.221 1.00 38.58 ? 415 GLN C NE2 1 
ATOM   9921  N N   . VAL C 1 416 ? -2.315  49.710  118.346 1.00 22.94 ? 416 VAL C N   1 
ATOM   9922  C CA  . VAL C 1 416 ? -1.115  49.940  117.530 1.00 23.57 ? 416 VAL C CA  1 
ATOM   9923  C C   . VAL C 1 416 ? -1.413  49.724  116.072 1.00 21.94 ? 416 VAL C C   1 
ATOM   9924  O O   . VAL C 1 416 ? -1.048  50.552  115.250 1.00 22.81 ? 416 VAL C O   1 
ATOM   9925  C CB  . VAL C 1 416 ? 0.152   49.112  117.963 1.00 23.93 ? 416 VAL C CB  1 
ATOM   9926  C CG1 . VAL C 1 416 ? 1.245   49.216  116.890 1.00 25.29 ? 416 VAL C CG1 1 
ATOM   9927  C CG2 . VAL C 1 416 ? 0.686   49.561  119.319 1.00 24.70 ? 416 VAL C CG2 1 
ATOM   9928  N N   . LEU C 1 417 ? -2.104  48.635  115.752 1.00 22.03 ? 417 LEU C N   1 
ATOM   9929  C CA  . LEU C 1 417 ? -2.427  48.307  114.359 1.00 21.85 ? 417 LEU C CA  1 
ATOM   9930  C C   . LEU C 1 417 ? -3.316  49.387  113.760 1.00 20.66 ? 417 LEU C C   1 
ATOM   9931  O O   . LEU C 1 417 ? -3.083  49.812  112.639 1.00 21.24 ? 417 LEU C O   1 
ATOM   9932  C CB  . LEU C 1 417 ? -3.214  46.992  114.266 1.00 21.65 ? 417 LEU C CB  1 
ATOM   9933  C CG  . LEU C 1 417 ? -3.267  46.065  113.034 1.00 24.88 ? 417 LEU C CG  1 
ATOM   9934  C CD1 . LEU C 1 417 ? -4.697  45.513  112.838 1.00 24.50 ? 417 LEU C CD1 1 
ATOM   9935  C CD2 . LEU C 1 417 ? -2.695  46.569  111.729 1.00 26.59 ? 417 LEU C CD2 1 
ATOM   9936  N N   . ALA C 1 418 ? -4.360  49.767  114.499 1.00 18.92 ? 418 ALA C N   1 
ATOM   9937  C CA  . ALA C 1 418 ? -5.285  50.842  114.053 1.00 18.79 ? 418 ALA C CA  1 
ATOM   9938  C C   . ALA C 1 418 ? -4.494  52.102  113.755 1.00 18.68 ? 418 ALA C C   1 
ATOM   9939  O O   . ALA C 1 418 ? -4.720  52.738  112.774 1.00 17.91 ? 418 ALA C O   1 
ATOM   9940  C CB  . ALA C 1 418 ? -6.349  51.128  115.095 1.00 17.17 ? 418 ALA C CB  1 
ATOM   9941  N N   . GLN C 1 419 ? -3.542  52.448  114.615 1.00 20.77 ? 419 GLN C N   1 
ATOM   9942  C CA  . GLN C 1 419 ? -2.793  53.678  114.432 1.00 22.08 ? 419 GLN C CA  1 
ATOM   9943  C C   . GLN C 1 419 ? -2.003  53.642  113.112 1.00 23.00 ? 419 GLN C C   1 
ATOM   9944  O O   . GLN C 1 419 ? -2.069  54.583  112.308 1.00 22.80 ? 419 GLN C O   1 
ATOM   9945  C CB  . GLN C 1 419 ? -1.875  53.917  115.631 1.00 23.52 ? 419 GLN C CB  1 
ATOM   9946  C CG  . GLN C 1 419 ? -0.898  55.050  115.396 1.00 27.32 ? 419 GLN C CG  1 
ATOM   9947  C CD  . GLN C 1 419 ? 0.455   54.855  116.123 1.00 33.60 ? 419 GLN C CD  1 
ATOM   9948  O OE1 . GLN C 1 419 ? 1.515   55.201  115.571 1.00 34.99 ? 419 GLN C OE1 1 
ATOM   9949  N NE2 . GLN C 1 419 ? 0.418   54.320  117.361 1.00 37.16 ? 419 GLN C NE2 1 
ATOM   9950  N N   . LEU C 1 420 ? -1.313  52.522  112.871 1.00 22.02 ? 420 LEU C N   1 
ATOM   9951  C CA  . LEU C 1 420 ? -0.525  52.319  111.656 1.00 21.38 ? 420 LEU C CA  1 
ATOM   9952  C C   . LEU C 1 420 ? -1.378  52.223  110.383 1.00 21.08 ? 420 LEU C C   1 
ATOM   9953  O O   . LEU C 1 420 ? -0.948  52.701  109.352 1.00 22.32 ? 420 LEU C O   1 
ATOM   9954  C CB  . LEU C 1 420 ? 0.385   51.074  111.817 1.00 20.76 ? 420 LEU C CB  1 
ATOM   9955  C CG  . LEU C 1 420 ? 1.454   51.245  112.910 1.00 25.04 ? 420 LEU C CG  1 
ATOM   9956  C CD1 . LEU C 1 420 ? 2.138   49.883  113.231 1.00 28.07 ? 420 LEU C CD1 1 
ATOM   9957  C CD2 . LEU C 1 420 ? 2.488   52.355  112.567 1.00 27.03 ? 420 LEU C CD2 1 
ATOM   9958  N N   . ILE C 1 421 ? -2.557  51.591  110.432 1.00 20.93 ? 421 ILE C N   1 
ATOM   9959  C CA  . ILE C 1 421 ? -3.498  51.629  109.279 1.00 21.36 ? 421 ILE C CA  1 
ATOM   9960  C C   . ILE C 1 421 ? -3.777  53.083  108.919 1.00 21.74 ? 421 ILE C C   1 
ATOM   9961  O O   . ILE C 1 421 ? -3.626  53.504  107.770 1.00 21.82 ? 421 ILE C O   1 
ATOM   9962  C CB  . ILE C 1 421 ? -4.815  50.864  109.591 1.00 21.03 ? 421 ILE C CB  1 
ATOM   9963  C CG1 . ILE C 1 421 ? -4.515  49.356  109.700 1.00 21.31 ? 421 ILE C CG1 1 
ATOM   9964  C CG2 . ILE C 1 421 ? -5.906  51.120  108.525 1.00 20.94 ? 421 ILE C CG2 1 
ATOM   9965  C CD1 . ILE C 1 421 ? -5.623  48.589  110.360 1.00 20.83 ? 421 ILE C CD1 1 
ATOM   9966  N N   . LYS C 1 422 ? -4.170  53.872  109.904 1.00 22.85 ? 422 LYS C N   1 
ATOM   9967  C CA  . LYS C 1 422 ? -4.453  55.296  109.640 1.00 25.62 ? 422 LYS C CA  1 
ATOM   9968  C C   . LYS C 1 422 ? -3.251  56.089  109.148 1.00 26.84 ? 422 LYS C C   1 
ATOM   9969  O O   . LYS C 1 422 ? -3.404  56.921  108.271 1.00 26.66 ? 422 LYS C O   1 
ATOM   9970  C CB  . LYS C 1 422 ? -5.096  55.947  110.867 1.00 25.72 ? 422 LYS C CB  1 
ATOM   9971  C CG  . LYS C 1 422 ? -6.496  55.381  111.096 1.00 26.55 ? 422 LYS C CG  1 
ATOM   9972  C CD  . LYS C 1 422 ? -7.150  55.930  112.353 1.00 26.30 ? 422 LYS C CD  1 
ATOM   9973  C CE  . LYS C 1 422 ? -6.441  55.517  113.563 1.00 29.41 ? 422 LYS C CE  1 
ATOM   9974  N NZ  . LYS C 1 422 ? -7.181  56.152  114.689 1.00 31.52 ? 422 LYS C NZ  1 
ATOM   9975  N N   . GLU C 1 423 ? -2.062  55.830  109.699 1.00 28.23 ? 423 GLU C N   1 
ATOM   9976  C CA  . GLU C 1 423 ? -0.823  56.437  109.178 1.00 30.80 ? 423 GLU C CA  1 
ATOM   9977  C C   . GLU C 1 423 ? -0.483  56.020  107.742 1.00 31.68 ? 423 GLU C C   1 
ATOM   9978  O O   . GLU C 1 423 ? 0.282   56.708  107.070 1.00 31.71 ? 423 GLU C O   1 
ATOM   9979  C CB  . GLU C 1 423 ? 0.374   56.155  110.104 1.00 31.33 ? 423 GLU C CB  1 
ATOM   9980  C CG  . GLU C 1 423 ? 0.224   56.820  111.482 1.00 32.24 ? 423 GLU C CG  1 
ATOM   9981  C CD  . GLU C 1 423 ? 1.398   56.544  112.385 1.00 35.17 ? 423 GLU C CD  1 
ATOM   9982  O OE1 . GLU C 1 423 ? 2.307   55.823  111.957 1.00 36.84 ? 423 GLU C OE1 1 
ATOM   9983  O OE2 . GLU C 1 423 ? 1.412   57.046  113.522 1.00 37.25 ? 423 GLU C OE2 1 
ATOM   9984  N N   . SER C 1 424 ? -1.061  54.909  107.286 1.00 32.51 ? 424 SER C N   1 
ATOM   9985  C CA  . SER C 1 424 ? -0.845  54.399  105.938 1.00 34.61 ? 424 SER C CA  1 
ATOM   9986  C C   . SER C 1 424 ? -1.846  54.908  104.888 1.00 35.16 ? 424 SER C C   1 
ATOM   9987  O O   . SER C 1 424 ? -1.566  54.842  103.679 1.00 35.25 ? 424 SER C O   1 
ATOM   9988  C CB  . SER C 1 424 ? -0.845  52.873  105.963 1.00 34.66 ? 424 SER C CB  1 
ATOM   9989  O OG  . SER C 1 424 ? 0.229   52.422  106.786 1.00 39.72 ? 424 SER C OG  1 
ATOM   9990  N N   . LEU C 1 425 ? -2.996  55.403  105.353 1.00 34.61 ? 425 LEU C N   1 
ATOM   9991  C CA  . LEU C 1 425 ? -4.061  55.868  104.474 1.00 34.20 ? 425 LEU C CA  1 
ATOM   9992  C C   . LEU C 1 425 ? -3.757  57.292  104.002 1.00 35.22 ? 425 LEU C C   1 
ATOM   9993  O O   . LEU C 1 425 ? -3.905  57.593  102.823 1.00 35.27 ? 425 LEU C O   1 
ATOM   9994  C CB  . LEU C 1 425 ? -5.425  55.824  105.184 1.00 33.72 ? 425 LEU C CB  1 
ATOM   9995  C CG  . LEU C 1 425 ? -6.010  54.472  105.650 1.00 30.73 ? 425 LEU C CG  1 
ATOM   9996  C CD1 . LEU C 1 425 ? -7.272  54.676  106.550 1.00 29.71 ? 425 LEU C CD1 1 
ATOM   9997  C CD2 . LEU C 1 425 ? -6.294  53.556  104.475 1.00 27.06 ? 425 LEU C CD2 1 
ATOM   9998  N N   . MET D 1 1   ? 30.817  19.360  94.522  1.00 33.97 ? 1   MET D N   1 
ATOM   9999  C CA  . MET D 1 1   ? 30.709  20.801  94.285  1.00 32.70 ? 1   MET D CA  1 
ATOM   10000 C C   . MET D 1 1   ? 29.371  21.113  93.600  1.00 30.91 ? 1   MET D C   1 
ATOM   10001 O O   . MET D 1 1   ? 28.848  22.185  93.820  1.00 30.55 ? 1   MET D O   1 
ATOM   10002 C CB  . MET D 1 1   ? 31.932  21.376  93.488  1.00 33.48 ? 1   MET D CB  1 
ATOM   10003 C CG  . MET D 1 1   ? 33.103  21.924  94.386  1.00 38.09 ? 1   MET D CG  1 
ATOM   10004 S SD  . MET D 1 1   ? 34.667  22.103  93.426  1.00 46.46 ? 1   MET D SD  1 
ATOM   10005 C CE  . MET D 1 1   ? 35.951  22.108  94.713  1.00 43.43 ? 1   MET D CE  1 
ATOM   10006 N N   . ASN D 1 2   ? 28.821  20.221  92.771  1.00 28.60 ? 2   ASN D N   1 
ATOM   10007 C CA  . ASN D 1 2   ? 27.558  20.556  92.076  1.00 28.06 ? 2   ASN D CA  1 
ATOM   10008 C C   . ASN D 1 2   ? 26.314  19.867  92.674  1.00 26.91 ? 2   ASN D C   1 
ATOM   10009 O O   . ASN D 1 2   ? 25.886  18.790  92.227  1.00 24.90 ? 2   ASN D O   1 
ATOM   10010 C CB  . ASN D 1 2   ? 27.660  20.349  90.543  1.00 28.88 ? 2   ASN D CB  1 
ATOM   10011 C CG  . ASN D 1 2   ? 26.335  20.636  89.793  1.00 30.66 ? 2   ASN D CG  1 
ATOM   10012 O OD1 . ASN D 1 2   ? 26.048  20.005  88.782  1.00 36.99 ? 2   ASN D OD1 1 
ATOM   10013 N ND2 . ASN D 1 2   ? 25.546  21.571  90.281  1.00 29.94 ? 2   ASN D ND2 1 
ATOM   10014 N N   . TYR D 1 3   ? 25.752  20.500  93.699  1.00 25.43 ? 3   TYR D N   1 
ATOM   10015 C CA  . TYR D 1 3   ? 24.679  19.865  94.482  1.00 23.92 ? 3   TYR D CA  1 
ATOM   10016 C C   . TYR D 1 3   ? 23.386  19.667  93.712  1.00 24.57 ? 3   TYR D C   1 
ATOM   10017 O O   . TYR D 1 3   ? 22.707  18.630  93.883  1.00 22.97 ? 3   TYR D O   1 
ATOM   10018 C CB  . TYR D 1 3   ? 24.470  20.605  95.810  1.00 22.57 ? 3   TYR D CB  1 
ATOM   10019 C CG  . TYR D 1 3   ? 25.644  20.361  96.714  1.00 18.78 ? 3   TYR D CG  1 
ATOM   10020 C CD1 . TYR D 1 3   ? 26.441  21.400  97.154  1.00 21.72 ? 3   TYR D CD1 1 
ATOM   10021 C CD2 . TYR D 1 3   ? 25.992  19.055  97.095  1.00 17.92 ? 3   TYR D CD2 1 
ATOM   10022 C CE1 . TYR D 1 3   ? 27.566  21.140  98.028  1.00 19.02 ? 3   TYR D CE1 1 
ATOM   10023 C CE2 . TYR D 1 3   ? 27.113  18.789  97.920  1.00 18.14 ? 3   TYR D CE2 1 
ATOM   10024 C CZ  . TYR D 1 3   ? 27.882  19.831  98.378  1.00 20.45 ? 3   TYR D CZ  1 
ATOM   10025 O OH  . TYR D 1 3   ? 28.983  19.559  99.167  1.00 19.78 ? 3   TYR D OH  1 
ATOM   10026 N N   . ALA D 1 4   ? 23.071  20.631  92.834  1.00 25.07 ? 4   ALA D N   1 
ATOM   10027 C CA  . ALA D 1 4   ? 21.904  20.506  91.941  1.00 25.94 ? 4   ALA D CA  1 
ATOM   10028 C C   . ALA D 1 4   ? 21.768  19.172  91.189  1.00 26.26 ? 4   ALA D C   1 
ATOM   10029 O O   . ALA D 1 4   ? 20.647  18.777  90.862  1.00 26.38 ? 4   ALA D O   1 
ATOM   10030 C CB  . ALA D 1 4   ? 21.803  21.686  90.949  1.00 26.81 ? 4   ALA D CB  1 
ATOM   10031 N N   . ARG D 1 5   ? 22.863  18.459  90.917  1.00 26.95 ? 5   ARG D N   1 
ATOM   10032 C CA  . ARG D 1 5   ? 22.702  17.200  90.167  1.00 27.65 ? 5   ARG D CA  1 
ATOM   10033 C C   . ARG D 1 5   ? 22.109  16.067  91.013  1.00 27.60 ? 5   ARG D C   1 
ATOM   10034 O O   . ARG D 1 5   ? 21.615  15.065  90.491  1.00 28.07 ? 5   ARG D O   1 
ATOM   10035 C CB  . ARG D 1 5   ? 23.983  16.771  89.383  1.00 28.59 ? 5   ARG D CB  1 
ATOM   10036 C CG  . ARG D 1 5   ? 25.254  16.513  90.147  1.00 29.66 ? 5   ARG D CG  1 
ATOM   10037 C CD  . ARG D 1 5   ? 26.333  15.951  89.153  1.00 29.22 ? 5   ARG D CD  1 
ATOM   10038 N NE  . ARG D 1 5   ? 26.063  14.553  88.810  1.00 31.54 ? 5   ARG D NE  1 
ATOM   10039 C CZ  . ARG D 1 5   ? 26.852  13.562  89.199  1.00 31.50 ? 5   ARG D CZ  1 
ATOM   10040 N NH1 . ARG D 1 5   ? 26.572  12.325  88.890  1.00 32.61 ? 5   ARG D NH1 1 
ATOM   10041 N NH2 . ARG D 1 5   ? 27.940  13.834  89.902  1.00 30.92 ? 5   ARG D NH2 1 
ATOM   10042 N N   . PHE D 1 6   ? 22.158  16.264  92.324  1.00 26.65 ? 6   PHE D N   1 
ATOM   10043 C CA  . PHE D 1 6   ? 21.708  15.299  93.316  1.00 26.22 ? 6   PHE D CA  1 
ATOM   10044 C C   . PHE D 1 6   ? 20.359  15.650  93.951  1.00 26.84 ? 6   PHE D C   1 
ATOM   10045 O O   . PHE D 1 6   ? 20.002  15.192  95.085  1.00 27.59 ? 6   PHE D O   1 
ATOM   10046 C CB  . PHE D 1 6   ? 22.776  15.233  94.380  1.00 24.85 ? 6   PHE D CB  1 
ATOM   10047 C CG  . PHE D 1 6   ? 24.153  14.925  93.837  1.00 24.54 ? 6   PHE D CG  1 
ATOM   10048 C CD1 . PHE D 1 6   ? 25.122  15.930  93.754  1.00 22.26 ? 6   PHE D CD1 1 
ATOM   10049 C CD2 . PHE D 1 6   ? 24.484  13.615  93.423  1.00 25.10 ? 6   PHE D CD2 1 
ATOM   10050 C CE1 . PHE D 1 6   ? 26.432  15.639  93.313  1.00 21.95 ? 6   PHE D CE1 1 
ATOM   10051 C CE2 . PHE D 1 6   ? 25.774  13.319  92.974  1.00 25.52 ? 6   PHE D CE2 1 
ATOM   10052 C CZ  . PHE D 1 6   ? 26.741  14.325  92.895  1.00 23.26 ? 6   PHE D CZ  1 
ATOM   10053 N N   . ILE D 1 7   ? 19.620  16.507  93.253  1.00 25.21 ? 7   ILE D N   1 
ATOM   10054 C CA  . ILE D 1 7   ? 18.418  17.092  93.797  1.00 25.18 ? 7   ILE D CA  1 
ATOM   10055 C C   . ILE D 1 7   ? 17.435  17.033  92.660  1.00 25.48 ? 7   ILE D C   1 
ATOM   10056 O O   . ILE D 1 7   ? 17.662  17.590  91.587  1.00 26.27 ? 7   ILE D O   1 
ATOM   10057 C CB  . ILE D 1 7   ? 18.665  18.557  94.315  1.00 24.60 ? 7   ILE D CB  1 
ATOM   10058 C CG1 . ILE D 1 7   ? 19.612  18.528  95.536  1.00 23.78 ? 7   ILE D CG1 1 
ATOM   10059 C CG2 . ILE D 1 7   ? 17.338  19.283  94.687  1.00 22.36 ? 7   ILE D CG2 1 
ATOM   10060 C CD1 . ILE D 1 7   ? 20.118  19.912  96.009  1.00 24.65 ? 7   ILE D CD1 1 
ATOM   10061 N N   . THR D 1 8   ? 16.365  16.315  92.925  1.00 24.13 ? 8   THR D N   1 
ATOM   10062 C CA  . THR D 1 8   ? 15.242  16.098  92.053  1.00 24.12 ? 8   THR D CA  1 
ATOM   10063 C C   . THR D 1 8   ? 14.477  17.437  91.769  1.00 23.21 ? 8   THR D C   1 
ATOM   10064 O O   . THR D 1 8   ? 14.662  18.388  92.485  1.00 21.77 ? 8   THR D O   1 
ATOM   10065 C CB  . THR D 1 8   ? 14.444  15.060  92.832  1.00 24.56 ? 8   THR D CB  1 
ATOM   10066 O OG1 . THR D 1 8   ? 14.200  13.890  92.069  1.00 30.11 ? 8   THR D OG1 1 
ATOM   10067 C CG2 . THR D 1 8   ? 13.244  15.591  93.483  1.00 21.67 ? 8   THR D CG2 1 
ATOM   10068 N N   . ALA D 1 9   ? 13.644  17.517  90.714  1.00 22.28 ? 9   ALA D N   1 
ATOM   10069 C CA  . ALA D 1 9   ? 12.928  18.770  90.438  1.00 22.72 ? 9   ALA D CA  1 
ATOM   10070 C C   . ALA D 1 9   ? 11.916  19.050  91.535  1.00 22.29 ? 9   ALA D C   1 
ATOM   10071 O O   . ALA D 1 9   ? 11.726  20.192  91.913  1.00 23.19 ? 9   ALA D O   1 
ATOM   10072 C CB  . ALA D 1 9   ? 12.215  18.731  89.075  1.00 23.18 ? 9   ALA D CB  1 
ATOM   10073 N N   . ALA D 1 10  ? 11.232  18.024  92.007  1.00 20.50 ? 10  ALA D N   1 
ATOM   10074 C CA  . ALA D 1 10  ? 10.290  18.214  93.100  1.00 21.00 ? 10  ALA D CA  1 
ATOM   10075 C C   . ALA D 1 10  ? 11.069  18.750  94.326  1.00 20.17 ? 10  ALA D C   1 
ATOM   10076 O O   . ALA D 1 10  ? 10.683  19.770  94.889  1.00 19.97 ? 10  ALA D O   1 
ATOM   10077 C CB  . ALA D 1 10  ? 9.588   16.933  93.394  1.00 21.24 ? 10  ALA D CB  1 
ATOM   10078 N N   . SER D 1 11  ? 12.201  18.118  94.666  1.00 19.06 ? 11  SER D N   1 
ATOM   10079 C CA  . SER D 1 11  ? 13.034  18.592  95.800  1.00 20.44 ? 11  SER D CA  1 
ATOM   10080 C C   . SER D 1 11  ? 13.571  20.041  95.653  1.00 20.79 ? 11  SER D C   1 
ATOM   10081 O O   . SER D 1 11  ? 13.438  20.860  96.586  1.00 21.88 ? 11  SER D O   1 
ATOM   10082 C CB  . SER D 1 11  ? 14.157  17.610  96.069  1.00 21.06 ? 11  SER D CB  1 
ATOM   10083 O OG  . SER D 1 11  ? 14.895  17.991  97.216  1.00 21.74 ? 11  SER D OG  1 
ATOM   10084 N N   . ALA D 1 12  ? 14.144  20.362  94.487  1.00 20.43 ? 12  ALA D N   1 
ATOM   10085 C CA  . ALA D 1 12  ? 14.499  21.746  94.140  1.00 20.29 ? 12  ALA D CA  1 
ATOM   10086 C C   . ALA D 1 12  ? 13.339  22.747  94.287  1.00 21.03 ? 12  ALA D C   1 
ATOM   10087 O O   . ALA D 1 12  ? 13.560  23.892  94.658  1.00 20.47 ? 12  ALA D O   1 
ATOM   10088 C CB  . ALA D 1 12  ? 15.076  21.806  92.674  1.00 21.00 ? 12  ALA D CB  1 
ATOM   10089 N N   . ALA D 1 13  ? 12.113  22.300  94.003  1.00 21.72 ? 13  ALA D N   1 
ATOM   10090 C CA  . ALA D 1 13  ? 10.895  23.138  94.085  1.00 23.34 ? 13  ALA D CA  1 
ATOM   10091 C C   . ALA D 1 13  ? 10.419  23.517  95.489  1.00 23.98 ? 13  ALA D C   1 
ATOM   10092 O O   . ALA D 1 13  ? 9.720   24.533  95.653  1.00 24.40 ? 13  ALA D O   1 
ATOM   10093 C CB  . ALA D 1 13  ? 9.730   22.451  93.318  1.00 22.15 ? 13  ALA D CB  1 
ATOM   10094 N N   . ARG D 1 14  ? 10.763  22.722  96.498  1.00 24.48 ? 14  ARG D N   1 
ATOM   10095 C CA  . ARG D 1 14  ? 10.489  23.083  97.910  1.00 25.76 ? 14  ARG D CA  1 
ATOM   10096 C C   . ARG D 1 14  ? 10.965  24.496  98.278  1.00 29.16 ? 14  ARG D C   1 
ATOM   10097 O O   . ARG D 1 14  ? 12.136  24.866  98.068  1.00 27.35 ? 14  ARG D O   1 
ATOM   10098 C CB  . ARG D 1 14  ? 11.100  22.049  98.892  1.00 25.03 ? 14  ARG D CB  1 
ATOM   10099 C CG  . ARG D 1 14  ? 10.658  20.647  98.550  1.00 20.72 ? 14  ARG D CG  1 
ATOM   10100 C CD  . ARG D 1 14  ? 10.827  19.629  99.679  1.00 20.34 ? 14  ARG D CD  1 
ATOM   10101 N NE  . ARG D 1 14  ? 10.478  18.274  99.200  1.00 17.05 ? 14  ARG D NE  1 
ATOM   10102 C CZ  . ARG D 1 14  ? 9.242   17.788  99.220  1.00 18.91 ? 14  ARG D CZ  1 
ATOM   10103 N NH1 . ARG D 1 14  ? 8.255   18.530  99.713  1.00 16.13 ? 14  ARG D NH1 1 
ATOM   10104 N NH2 . ARG D 1 14  ? 8.992   16.568  98.767  1.00 17.91 ? 14  ARG D NH2 1 
ATOM   10105 N N   . ASN D 1 15  ? 10.023  25.266  98.829  1.00 33.17 ? 15  ASN D N   1 
ATOM   10106 C CA  . ASN D 1 15  ? 10.294  26.588  99.396  1.00 37.91 ? 15  ASN D CA  1 
ATOM   10107 C C   . ASN D 1 15  ? 10.294  26.597  100.910 1.00 40.92 ? 15  ASN D C   1 
ATOM   10108 O O   . ASN D 1 15  ? 9.472   25.916  101.529 1.00 41.39 ? 15  ASN D O   1 
ATOM   10109 C CB  . ASN D 1 15  ? 9.282   27.611  98.885  1.00 37.44 ? 15  ASN D CB  1 
ATOM   10110 C CG  . ASN D 1 15  ? 9.355   27.780  97.413  1.00 38.90 ? 15  ASN D CG  1 
ATOM   10111 O OD1 . ASN D 1 15  ? 10.448  27.829  96.830  1.00 40.55 ? 15  ASN D OD1 1 
ATOM   10112 N ND2 . ASN D 1 15  ? 8.197   27.838  96.777  1.00 40.27 ? 15  ASN D ND2 1 
ATOM   10113 N N   . PRO D 1 16  ? 11.216  27.380  101.511 1.00 45.18 ? 16  PRO D N   1 
ATOM   10114 C CA  . PRO D 1 16  ? 11.376  27.544  102.960 1.00 48.31 ? 16  PRO D CA  1 
ATOM   10115 C C   . PRO D 1 16  ? 10.107  27.904  103.704 1.00 51.81 ? 16  PRO D C   1 
ATOM   10116 O O   . PRO D 1 16  ? 9.766   27.244  104.684 1.00 52.36 ? 16  PRO D O   1 
ATOM   10117 C CB  . PRO D 1 16  ? 12.350  28.739  103.079 1.00 47.84 ? 16  PRO D CB  1 
ATOM   10118 C CG  . PRO D 1 16  ? 12.428  29.327  101.730 1.00 46.69 ? 16  PRO D CG  1 
ATOM   10119 C CD  . PRO D 1 16  ? 12.219  28.181  100.790 1.00 45.26 ? 16  PRO D CD  1 
ATOM   10120 N N   . SER D 1 17  ? 9.414   28.924  103.197 1.00 55.69 ? 17  SER D N   1 
ATOM   10121 C CA  . SER D 1 17  ? 8.606   29.836  104.015 1.00 59.86 ? 17  SER D CA  1 
ATOM   10122 C C   . SER D 1 17  ? 7.246   29.258  104.450 1.00 62.21 ? 17  SER D C   1 
ATOM   10123 O O   . SER D 1 17  ? 7.001   28.057  104.286 1.00 63.14 ? 17  SER D O   1 
ATOM   10124 C CB  . SER D 1 17  ? 8.443   31.184  103.275 1.00 59.74 ? 17  SER D CB  1 
ATOM   10125 O OG  . SER D 1 17  ? 9.704   31.751  102.916 1.00 60.26 ? 17  SER D OG  1 
ATOM   10126 N N   . PRO D 1 18  ? 6.360   30.105  105.012 1.00 64.41 ? 18  PRO D N   1 
ATOM   10127 C CA  . PRO D 1 18  ? 6.536   31.493  105.484 1.00 65.97 ? 18  PRO D CA  1 
ATOM   10128 C C   . PRO D 1 18  ? 6.603   31.663  107.015 1.00 67.60 ? 18  PRO D C   1 
ATOM   10129 O O   . PRO D 1 18  ? 7.699   31.854  107.567 1.00 67.70 ? 18  PRO D O   1 
ATOM   10130 C CB  . PRO D 1 18  ? 5.285   32.191  104.928 1.00 65.84 ? 18  PRO D CB  1 
ATOM   10131 C CG  . PRO D 1 18  ? 4.257   31.009  104.678 1.00 65.56 ? 18  PRO D CG  1 
ATOM   10132 C CD  . PRO D 1 18  ? 4.942   29.718  105.067 1.00 64.54 ? 18  PRO D CD  1 
ATOM   10133 N N   . ILE D 1 19  ? 5.429   31.570  107.657 1.00 69.41 ? 19  ILE D N   1 
ATOM   10134 C CA  . ILE D 1 19  ? 5.189   31.832  109.093 1.00 71.21 ? 19  ILE D CA  1 
ATOM   10135 C C   . ILE D 1 19  ? 6.415   32.177  109.968 1.00 72.48 ? 19  ILE D C   1 
ATOM   10136 O O   . ILE D 1 19  ? 6.646   33.355  110.245 1.00 72.68 ? 19  ILE D O   1 
ATOM   10137 C CB  . ILE D 1 19  ? 4.260   30.727  109.733 1.00 71.04 ? 19  ILE D CB  1 
ATOM   10138 C CG1 . ILE D 1 19  ? 2.795   30.926  109.305 1.00 71.16 ? 19  ILE D CG1 1 
ATOM   10139 C CG2 . ILE D 1 19  ? 4.311   30.750  111.273 1.00 71.44 ? 19  ILE D CG2 1 
ATOM   10140 C CD1 . ILE D 1 19  ? 2.463   30.693  107.833 1.00 69.17 ? 19  ILE D CD1 1 
ATOM   10141 N N   . ARG D 1 20  ? 7.198   31.160  110.350 1.00 73.98 ? 20  ARG D N   1 
ATOM   10142 C CA  . ARG D 1 20  ? 8.243   31.242  111.401 1.00 75.17 ? 20  ARG D CA  1 
ATOM   10143 C C   . ARG D 1 20  ? 9.278   32.373  111.292 1.00 75.97 ? 20  ARG D C   1 
ATOM   10144 O O   . ARG D 1 20  ? 9.968   32.688  112.273 1.00 75.96 ? 20  ARG D O   1 
ATOM   10145 C CB  . ARG D 1 20  ? 8.952   29.884  111.542 1.00 75.35 ? 20  ARG D CB  1 
ATOM   10146 C CG  . ARG D 1 20  ? 9.377   29.252  110.211 1.00 75.72 ? 20  ARG D CG  1 
ATOM   10147 C CD  . ARG D 1 20  ? 9.372   27.733  110.284 1.00 76.41 ? 20  ARG D CD  1 
ATOM   10148 N NE  . ARG D 1 20  ? 9.074   27.137  108.984 1.00 77.39 ? 20  ARG D NE  1 
ATOM   10149 C CZ  . ARG D 1 20  ? 7.846   26.845  108.543 1.00 78.05 ? 20  ARG D CZ  1 
ATOM   10150 N NH1 . ARG D 1 20  ? 6.770   27.085  109.297 1.00 77.43 ? 20  ARG D NH1 1 
ATOM   10151 N NH2 . ARG D 1 20  ? 7.694   26.307  107.337 1.00 77.73 ? 20  ARG D NH2 1 
ATOM   10152 N N   . THR D 1 21  ? 9.385   32.971  110.104 1.00 76.93 ? 21  THR D N   1 
ATOM   10153 C CA  . THR D 1 21  ? 10.172  34.195  109.904 1.00 77.57 ? 21  THR D CA  1 
ATOM   10154 C C   . THR D 1 21  ? 9.370   35.471  110.269 1.00 78.01 ? 21  THR D C   1 
ATOM   10155 O O   . THR D 1 21  ? 9.742   36.594  109.899 1.00 78.13 ? 21  THR D O   1 
ATOM   10156 C CB  . THR D 1 21  ? 10.788  34.271  108.484 1.00 77.74 ? 21  THR D CB  1 
ATOM   10157 O OG1 . THR D 1 21  ? 9.819   33.852  107.508 1.00 77.64 ? 21  THR D OG1 1 
ATOM   10158 C CG2 . THR D 1 21  ? 12.038  33.383  108.395 1.00 77.64 ? 21  THR D CG2 1 
ATOM   10159 N N   . MET D 1 22  ? 8.254   35.262  110.974 1.00 78.34 ? 22  MET D N   1 
ATOM   10160 C CA  . MET D 1 22  ? 7.618   36.273  111.811 1.00 78.49 ? 22  MET D CA  1 
ATOM   10161 C C   . MET D 1 22  ? 8.146   36.037  113.215 1.00 78.59 ? 22  MET D C   1 
ATOM   10162 O O   . MET D 1 22  ? 8.900   36.847  113.749 1.00 78.74 ? 22  MET D O   1 
ATOM   10163 C CB  . MET D 1 22  ? 6.089   36.124  111.824 1.00 78.46 ? 22  MET D CB  1 
ATOM   10164 C CG  . MET D 1 22  ? 5.359   36.867  110.727 1.00 78.50 ? 22  MET D CG  1 
ATOM   10165 S SD  . MET D 1 22  ? 5.510   38.651  110.891 1.00 78.48 ? 22  MET D SD  1 
ATOM   10166 C CE  . MET D 1 22  ? 5.580   39.105  109.157 1.00 77.63 ? 22  MET D CE  1 
ATOM   10167 N N   . THR D 1 23  ? 7.766   34.903  113.801 1.00 78.65 ? 23  THR D N   1 
ATOM   10168 C CA  . THR D 1 23  ? 8.141   34.577  115.178 1.00 78.65 ? 23  THR D CA  1 
ATOM   10169 C C   . THR D 1 23  ? 9.632   34.198  115.328 1.00 78.39 ? 23  THR D C   1 
ATOM   10170 O O   . THR D 1 23  ? 10.041  33.608  116.336 1.00 78.49 ? 23  THR D O   1 
ATOM   10171 C CB  . THR D 1 23  ? 7.175   33.525  115.796 1.00 78.92 ? 23  THR D CB  1 
ATOM   10172 O OG1 . THR D 1 23  ? 7.050   32.395  114.914 1.00 79.28 ? 23  THR D OG1 1 
ATOM   10173 C CG2 . THR D 1 23  ? 5.785   34.154  116.036 1.00 78.65 ? 23  THR D CG2 1 
ATOM   10174 N N   . ASP D 1 24  ? 10.427  34.543  114.310 1.00 77.88 ? 24  ASP D N   1 
ATOM   10175 C CA  . ASP D 1 24  ? 11.882  34.618  114.433 1.00 77.24 ? 24  ASP D CA  1 
ATOM   10176 C C   . ASP D 1 24  ? 12.295  36.031  114.894 1.00 76.50 ? 24  ASP D C   1 
ATOM   10177 O O   . ASP D 1 24  ? 13.257  36.189  115.656 1.00 76.59 ? 24  ASP D O   1 
ATOM   10178 C CB  . ASP D 1 24  ? 12.587  34.200  113.120 1.00 77.58 ? 24  ASP D CB  1 
ATOM   10179 C CG  . ASP D 1 24  ? 12.495  35.258  112.000 1.00 78.14 ? 24  ASP D CG  1 
ATOM   10180 O OD1 . ASP D 1 24  ? 13.307  35.178  111.046 1.00 77.85 ? 24  ASP D OD1 1 
ATOM   10181 O OD2 . ASP D 1 24  ? 11.621  36.156  112.053 1.00 79.25 ? 24  ASP D OD2 1 
ATOM   10182 N N   . ILE D 1 25  ? 11.539  37.035  114.429 1.00 75.33 ? 25  ILE D N   1 
ATOM   10183 C CA  . ILE D 1 25  ? 11.715  38.452  114.781 1.00 74.03 ? 25  ILE D CA  1 
ATOM   10184 C C   . ILE D 1 25  ? 11.477  38.658  116.270 1.00 73.46 ? 25  ILE D C   1 
ATOM   10185 O O   . ILE D 1 25  ? 12.160  39.465  116.907 1.00 73.24 ? 25  ILE D O   1 
ATOM   10186 C CB  . ILE D 1 25  ? 10.769  39.385  113.948 1.00 73.77 ? 25  ILE D CB  1 
ATOM   10187 C CG1 . ILE D 1 25  ? 11.137  39.349  112.453 1.00 73.50 ? 25  ILE D CG1 1 
ATOM   10188 C CG2 . ILE D 1 25  ? 10.803  40.821  114.474 1.00 73.71 ? 25  ILE D CG2 1 
ATOM   10189 C CD1 . ILE D 1 25  ? 10.255  40.194  111.536 1.00 72.18 ? 25  ILE D CD1 1 
ATOM   10190 N N   . LEU D 1 26  ? 10.512  37.914  116.812 1.00 72.85 ? 26  LEU D N   1 
ATOM   10191 C CA  . LEU D 1 26  ? 10.162  37.978  118.236 1.00 72.37 ? 26  LEU D CA  1 
ATOM   10192 C C   . LEU D 1 26  ? 11.319  37.535  119.134 1.00 71.86 ? 26  LEU D C   1 
ATOM   10193 O O   . LEU D 1 26  ? 11.617  38.195  120.138 1.00 71.59 ? 26  LEU D O   1 
ATOM   10194 C CB  . LEU D 1 26  ? 8.900   37.140  118.531 1.00 72.41 ? 26  LEU D CB  1 
ATOM   10195 C CG  . LEU D 1 26  ? 8.508   36.872  119.999 1.00 72.33 ? 26  LEU D CG  1 
ATOM   10196 C CD1 . LEU D 1 26  ? 8.084   38.162  120.711 1.00 72.47 ? 26  LEU D CD1 1 
ATOM   10197 C CD2 . LEU D 1 26  ? 7.416   35.804  120.109 1.00 72.02 ? 26  LEU D CD2 1 
ATOM   10198 N N   . SER D 1 27  ? 11.966  36.434  118.738 1.00 71.31 ? 27  SER D N   1 
ATOM   10199 C CA  . SER D 1 27  ? 12.993  35.749  119.534 1.00 70.72 ? 27  SER D CA  1 
ATOM   10200 C C   . SER D 1 27  ? 14.224  36.606  119.830 1.00 70.11 ? 27  SER D C   1 
ATOM   10201 O O   . SER D 1 27  ? 15.016  36.270  120.714 1.00 70.36 ? 27  SER D O   1 
ATOM   10202 C CB  . SER D 1 27  ? 13.438  34.450  118.845 1.00 70.99 ? 27  SER D CB  1 
ATOM   10203 O OG  . SER D 1 27  ? 12.370  33.825  118.149 1.00 71.51 ? 27  SER D OG  1 
ATOM   10204 N N   . ARG D 1 28  ? 14.396  37.701  119.090 1.00 69.09 ? 28  ARG D N   1 
ATOM   10205 C CA  . ARG D 1 28  ? 15.542  38.589  119.316 1.00 68.02 ? 28  ARG D CA  1 
ATOM   10206 C C   . ARG D 1 28  ? 15.152  40.074  119.491 1.00 66.65 ? 28  ARG D C   1 
ATOM   10207 O O   . ARG D 1 28  ? 16.002  40.974  119.392 1.00 66.59 ? 28  ARG D O   1 
ATOM   10208 C CB  . ARG D 1 28  ? 16.615  38.370  118.227 1.00 68.46 ? 28  ARG D CB  1 
ATOM   10209 C CG  . ARG D 1 28  ? 16.500  39.231  116.965 1.00 69.70 ? 28  ARG D CG  1 
ATOM   10210 C CD  . ARG D 1 28  ? 15.218  38.986  116.177 1.00 71.93 ? 28  ARG D CD  1 
ATOM   10211 N NE  . ARG D 1 28  ? 14.838  40.181  115.421 1.00 73.14 ? 28  ARG D NE  1 
ATOM   10212 C CZ  . ARG D 1 28  ? 15.239  40.452  114.180 1.00 74.01 ? 28  ARG D CZ  1 
ATOM   10213 N NH1 . ARG D 1 28  ? 16.030  39.605  113.527 1.00 73.41 ? 28  ARG D NH1 1 
ATOM   10214 N NH2 . ARG D 1 28  ? 14.837  41.574  113.586 1.00 74.93 ? 28  ARG D NH2 1 
ATOM   10215 N N   . GLY D 1 29  ? 13.866  40.314  119.766 1.00 64.90 ? 29  GLY D N   1 
ATOM   10216 C CA  . GLY D 1 29  ? 13.346  41.660  119.994 1.00 62.30 ? 29  GLY D CA  1 
ATOM   10217 C C   . GLY D 1 29  ? 13.167  41.952  121.476 1.00 60.52 ? 29  GLY D C   1 
ATOM   10218 O O   . GLY D 1 29  ? 13.591  41.158  122.322 1.00 60.06 ? 29  GLY D O   1 
ATOM   10219 N N   . PRO D 1 30  ? 12.507  43.081  121.801 1.00 59.20 ? 30  PRO D N   1 
ATOM   10220 C CA  . PRO D 1 30  ? 12.287  43.479  123.196 1.00 57.93 ? 30  PRO D CA  1 
ATOM   10221 C C   . PRO D 1 30  ? 11.302  42.521  123.871 1.00 56.87 ? 30  PRO D C   1 
ATOM   10222 O O   . PRO D 1 30  ? 10.464  41.928  123.189 1.00 56.76 ? 30  PRO D O   1 
ATOM   10223 C CB  . PRO D 1 30  ? 11.676  44.886  123.079 1.00 58.20 ? 30  PRO D CB  1 
ATOM   10224 C CG  . PRO D 1 30  ? 11.809  45.292  121.633 1.00 58.42 ? 30  PRO D CG  1 
ATOM   10225 C CD  . PRO D 1 30  ? 11.880  44.023  120.850 1.00 59.05 ? 30  PRO D CD  1 
ATOM   10226 N N   . LYS D 1 31  ? 11.411  42.337  125.190 1.00 55.68 ? 31  LYS D N   1 
ATOM   10227 C CA  . LYS D 1 31  ? 10.455  41.473  125.896 1.00 54.09 ? 31  LYS D CA  1 
ATOM   10228 C C   . LYS D 1 31  ? 9.027   42.054  125.897 1.00 52.16 ? 31  LYS D C   1 
ATOM   10229 O O   . LYS D 1 31  ? 8.069   41.333  126.197 1.00 52.11 ? 31  LYS D O   1 
ATOM   10230 C CB  . LYS D 1 31  ? 10.915  41.136  127.321 1.00 54.47 ? 31  LYS D CB  1 
ATOM   10231 C CG  . LYS D 1 31  ? 11.354  39.679  127.509 1.00 57.31 ? 31  LYS D CG  1 
ATOM   10232 C CD  . LYS D 1 31  ? 12.871  39.555  127.621 1.00 62.09 ? 31  LYS D CD  1 
ATOM   10233 C CE  . LYS D 1 31  ? 13.301  38.255  128.349 1.00 64.82 ? 31  LYS D CE  1 
ATOM   10234 N NZ  . LYS D 1 31  ? 14.812  38.196  128.598 1.00 65.20 ? 31  LYS D NZ  1 
ATOM   10235 N N   . SER D 1 32  ? 8.903   43.342  125.551 1.00 49.30 ? 32  SER D N   1 
ATOM   10236 C CA  . SER D 1 32  ? 7.613   44.013  125.471 1.00 47.12 ? 32  SER D CA  1 
ATOM   10237 C C   . SER D 1 32  ? 6.838   43.687  124.187 1.00 45.71 ? 32  SER D C   1 
ATOM   10238 O O   . SER D 1 32  ? 5.632   43.998  124.106 1.00 45.68 ? 32  SER D O   1 
ATOM   10239 C CB  . SER D 1 32  ? 7.777   45.531  125.637 1.00 47.07 ? 32  SER D CB  1 
ATOM   10240 O OG  . SER D 1 32  ? 8.508   46.110  124.566 1.00 46.97 ? 32  SER D OG  1 
ATOM   10241 N N   . MET D 1 33  ? 7.518   43.071  123.203 1.00 43.01 ? 33  MET D N   1 
ATOM   10242 C CA  . MET D 1 33  ? 6.920   42.744  121.883 1.00 41.23 ? 33  MET D CA  1 
ATOM   10243 C C   . MET D 1 33  ? 5.699   41.815  122.002 1.00 38.84 ? 33  MET D C   1 
ATOM   10244 O O   . MET D 1 33  ? 5.701   40.831  122.755 1.00 39.13 ? 33  MET D O   1 
ATOM   10245 C CB  . MET D 1 33  ? 7.974   42.169  120.892 1.00 41.55 ? 33  MET D CB  1 
ATOM   10246 C CG  . MET D 1 33  ? 7.431   41.708  119.502 1.00 43.75 ? 33  MET D CG  1 
ATOM   10247 S SD  . MET D 1 33  ? 8.691   41.182  118.266 1.00 46.38 ? 33  MET D SD  1 
ATOM   10248 C CE  . MET D 1 33  ? 9.611   42.709  118.056 1.00 45.93 ? 33  MET D CE  1 
ATOM   10249 N N   . ILE D 1 34  ? 4.650   42.130  121.261 1.00 35.97 ? 34  ILE D N   1 
ATOM   10250 C CA  . ILE D 1 34  ? 3.438   41.319  121.303 1.00 33.49 ? 34  ILE D CA  1 
ATOM   10251 C C   . ILE D 1 34  ? 3.251   40.698  119.931 1.00 31.53 ? 34  ILE D C   1 
ATOM   10252 O O   . ILE D 1 34  ? 3.208   41.403  118.946 1.00 30.65 ? 34  ILE D O   1 
ATOM   10253 C CB  . ILE D 1 34  ? 2.189   42.175  121.671 1.00 33.47 ? 34  ILE D CB  1 
ATOM   10254 C CG1 . ILE D 1 34  ? 2.382   42.862  123.031 1.00 35.27 ? 34  ILE D CG1 1 
ATOM   10255 C CG2 . ILE D 1 34  ? 0.907   41.312  121.658 1.00 34.51 ? 34  ILE D CG2 1 
ATOM   10256 C CD1 . ILE D 1 34  ? 1.403   43.967  123.328 1.00 33.92 ? 34  ILE D CD1 1 
ATOM   10257 N N   . SER D 1 35  ? 3.134   39.381  119.871 1.00 29.67 ? 35  SER D N   1 
ATOM   10258 C CA  . SER D 1 35  ? 2.855   38.721  118.616 1.00 28.48 ? 35  SER D CA  1 
ATOM   10259 C C   . SER D 1 35  ? 1.518   38.002  118.622 1.00 27.55 ? 35  SER D C   1 
ATOM   10260 O O   . SER D 1 35  ? 1.278   37.199  119.484 1.00 27.13 ? 35  SER D O   1 
ATOM   10261 C CB  . SER D 1 35  ? 3.919   37.681  118.265 1.00 28.08 ? 35  SER D CB  1 
ATOM   10262 O OG  . SER D 1 35  ? 3.516   37.105  117.020 1.00 27.99 ? 35  SER D OG  1 
ATOM   10263 N N   . LEU D 1 36  ? 0.686   38.287  117.630 1.00 26.93 ? 36  LEU D N   1 
ATOM   10264 C CA  . LEU D 1 36  ? -0.514  37.489  117.309 1.00 26.03 ? 36  LEU D CA  1 
ATOM   10265 C C   . LEU D 1 36  ? -0.308  36.774  115.974 1.00 25.51 ? 36  LEU D C   1 
ATOM   10266 O O   . LEU D 1 36  ? -1.253  36.334  115.342 1.00 26.11 ? 36  LEU D O   1 
ATOM   10267 C CB  . LEU D 1 36  ? -1.756  38.392  117.189 1.00 26.68 ? 36  LEU D CB  1 
ATOM   10268 C CG  . LEU D 1 36  ? -2.098  39.398  118.284 1.00 26.08 ? 36  LEU D CG  1 
ATOM   10269 C CD1 . LEU D 1 36  ? -3.418  40.142  117.954 1.00 26.12 ? 36  LEU D CD1 1 
ATOM   10270 C CD2 . LEU D 1 36  ? -2.219  38.699  119.622 1.00 26.00 ? 36  LEU D CD2 1 
ATOM   10271 N N   . ALA D 1 37  ? 0.942   36.638  115.571 1.00 24.74 ? 37  ALA D N   1 
ATOM   10272 C CA  . ALA D 1 37  ? 1.295   36.149  114.248 1.00 24.59 ? 37  ALA D CA  1 
ATOM   10273 C C   . ALA D 1 37  ? 1.544   34.640  114.173 1.00 23.65 ? 37  ALA D C   1 
ATOM   10274 O O   . ALA D 1 37  ? 1.526   34.077  113.089 1.00 24.53 ? 37  ALA D O   1 
ATOM   10275 C CB  . ALA D 1 37  ? 2.513   36.920  113.735 1.00 24.73 ? 37  ALA D CB  1 
ATOM   10276 N N   . GLY D 1 38  ? 1.734   33.978  115.305 1.00 23.72 ? 38  GLY D N   1 
ATOM   10277 C CA  . GLY D 1 38  ? 2.084   32.546  115.285 1.00 23.25 ? 38  GLY D CA  1 
ATOM   10278 C C   . GLY D 1 38  ? 0.880   31.641  115.292 1.00 23.80 ? 38  GLY D C   1 
ATOM   10279 O O   . GLY D 1 38  ? -0.225  32.084  115.566 1.00 24.72 ? 38  GLY D O   1 
ATOM   10280 N N   . GLY D 1 39  ? 1.083   30.366  114.971 1.00 22.68 ? 39  GLY D N   1 
ATOM   10281 C CA  . GLY D 1 39  ? 0.004   29.386  114.973 1.00 22.40 ? 39  GLY D CA  1 
ATOM   10282 C C   . GLY D 1 39  ? 0.102   28.366  116.098 1.00 22.49 ? 39  GLY D C   1 
ATOM   10283 O O   . GLY D 1 39  ? -0.306  27.210  115.925 1.00 21.89 ? 39  GLY D O   1 
ATOM   10284 N N   . LEU D 1 40  ? 0.674   28.784  117.233 1.00 22.06 ? 40  LEU D N   1 
ATOM   10285 C CA  . LEU D 1 40  ? 0.874   27.904  118.386 1.00 21.83 ? 40  LEU D CA  1 
ATOM   10286 C C   . LEU D 1 40  ? -0.402  27.864  119.159 1.00 21.38 ? 40  LEU D C   1 
ATOM   10287 O O   . LEU D 1 40  ? -0.955  28.943  119.437 1.00 21.75 ? 40  LEU D O   1 
ATOM   10288 C CB  . LEU D 1 40  ? 1.955   28.453  119.323 1.00 21.94 ? 40  LEU D CB  1 
ATOM   10289 C CG  . LEU D 1 40  ? 3.304   28.708  118.654 1.00 23.68 ? 40  LEU D CG  1 
ATOM   10290 C CD1 . LEU D 1 40  ? 4.325   29.282  119.642 1.00 26.92 ? 40  LEU D CD1 1 
ATOM   10291 C CD2 . LEU D 1 40  ? 3.771   27.319  118.161 1.00 22.88 ? 40  LEU D CD2 1 
ATOM   10292 N N   . PRO D 1 41  ? -0.902  26.651  119.485 1.00 19.55 ? 41  PRO D N   1 
ATOM   10293 C CA  . PRO D 1 41  ? -2.032  26.505  120.424 1.00 19.80 ? 41  PRO D CA  1 
ATOM   10294 C C   . PRO D 1 41  ? -1.575  26.863  121.838 1.00 20.23 ? 41  PRO D C   1 
ATOM   10295 O O   . PRO D 1 41  ? -0.358  26.804  122.141 1.00 19.67 ? 41  PRO D O   1 
ATOM   10296 C CB  . PRO D 1 41  ? -2.416  25.027  120.299 1.00 20.06 ? 41  PRO D CB  1 
ATOM   10297 C CG  . PRO D 1 41  ? -1.175  24.324  119.724 1.00 18.01 ? 41  PRO D CG  1 
ATOM   10298 C CD  . PRO D 1 41  ? -0.463  25.342  118.911 1.00 19.89 ? 41  PRO D CD  1 
ATOM   10299 N N   . ASN D 1 42  ? -2.534  27.262  122.676 1.00 21.01 ? 42  ASN D N   1 
ATOM   10300 C CA  . ASN D 1 42  ? -2.241  27.527  124.075 1.00 20.45 ? 42  ASN D CA  1 
ATOM   10301 C C   . ASN D 1 42  ? -1.862  26.227  124.752 1.00 19.13 ? 42  ASN D C   1 
ATOM   10302 O O   . ASN D 1 42  ? -2.687  25.319  124.807 1.00 18.14 ? 42  ASN D O   1 
ATOM   10303 C CB  . ASN D 1 42  ? -3.424  28.157  124.806 1.00 20.33 ? 42  ASN D CB  1 
ATOM   10304 C CG  . ASN D 1 42  ? -2.994  28.877  126.067 1.00 23.73 ? 42  ASN D CG  1 
ATOM   10305 O OD1 . ASN D 1 42  ? -2.210  28.355  126.868 1.00 23.75 ? 42  ASN D OD1 1 
ATOM   10306 N ND2 . ASN D 1 42  ? -3.463  30.095  126.228 1.00 20.67 ? 42  ASN D ND2 1 
ATOM   10307 N N   . PRO D 1 43  ? -0.601  26.131  125.240 1.00 19.51 ? 43  PRO D N   1 
ATOM   10308 C CA  . PRO D 1 43  ? -0.104  24.876  125.845 1.00 20.53 ? 43  PRO D CA  1 
ATOM   10309 C C   . PRO D 1 43  ? -0.665  24.659  127.269 1.00 20.76 ? 43  PRO D C   1 
ATOM   10310 O O   . PRO D 1 43  ? -0.622  23.552  127.798 1.00 20.25 ? 43  PRO D O   1 
ATOM   10311 C CB  . PRO D 1 43  ? 1.425   25.066  125.806 1.00 19.70 ? 43  PRO D CB  1 
ATOM   10312 C CG  . PRO D 1 43  ? 1.603   26.543  126.014 1.00 21.87 ? 43  PRO D CG  1 
ATOM   10313 C CD  . PRO D 1 43  ? 0.443   27.178  125.235 1.00 20.91 ? 43  PRO D CD  1 
ATOM   10314 N N   . ASN D 1 44  ? -1.215  25.712  127.883 1.00 21.36 ? 44  ASN D N   1 
ATOM   10315 C CA  . ASN D 1 44  ? -1.853  25.588  129.182 1.00 22.08 ? 44  ASN D CA  1 
ATOM   10316 C C   . ASN D 1 44  ? -3.062  24.697  129.206 1.00 21.97 ? 44  ASN D C   1 
ATOM   10317 O O   . ASN D 1 44  ? -3.496  24.249  130.281 1.00 21.79 ? 44  ASN D O   1 
ATOM   10318 C CB  . ASN D 1 44  ? -2.269  26.971  129.685 1.00 23.36 ? 44  ASN D CB  1 
ATOM   10319 C CG  . ASN D 1 44  ? -1.127  27.746  130.220 1.00 26.35 ? 44  ASN D CG  1 
ATOM   10320 O OD1 . ASN D 1 44  ? -0.301  27.225  130.961 1.00 30.89 ? 44  ASN D OD1 1 
ATOM   10321 N ND2 . ASN D 1 44  ? -1.065  29.004  129.859 1.00 30.65 ? 44  ASN D ND2 1 
ATOM   10322 N N   . MET D 1 45  ? -3.618  24.435  128.016 1.00 21.52 ? 45  MET D N   1 
ATOM   10323 C CA  . MET D 1 45  ? -4.784  23.590  127.862 1.00 20.56 ? 45  MET D CA  1 
ATOM   10324 C C   . MET D 1 45  ? -4.387  22.112  127.857 1.00 20.21 ? 45  MET D C   1 
ATOM   10325 O O   . MET D 1 45  ? -5.227  21.239  128.060 1.00 19.85 ? 45  MET D O   1 
ATOM   10326 C CB  . MET D 1 45  ? -5.484  23.897  126.536 1.00 20.20 ? 45  MET D CB  1 
ATOM   10327 C CG  . MET D 1 45  ? -6.068  25.309  126.418 1.00 22.15 ? 45  MET D CG  1 
ATOM   10328 S SD  . MET D 1 45  ? -7.425  25.491  127.533 1.00 25.87 ? 45  MET D SD  1 
ATOM   10329 C CE  . MET D 1 45  ? -6.698  26.423  128.872 1.00 22.57 ? 45  MET D CE  1 
ATOM   10330 N N   . PHE D 1 46  ? -3.106  21.853  127.618 1.00 19.78 ? 46  PHE D N   1 
ATOM   10331 C CA  . PHE D 1 46  ? -2.599  20.476  127.549 1.00 19.01 ? 46  PHE D CA  1 
ATOM   10332 C C   . PHE D 1 46  ? -2.626  19.805  128.917 1.00 18.70 ? 46  PHE D C   1 
ATOM   10333 O O   . PHE D 1 46  ? -2.197  20.424  129.901 1.00 18.69 ? 46  PHE D O   1 
ATOM   10334 C CB  . PHE D 1 46  ? -1.177  20.465  126.939 1.00 18.49 ? 46  PHE D CB  1 
ATOM   10335 C CG  . PHE D 1 46  ? -1.097  21.005  125.529 1.00 19.57 ? 46  PHE D CG  1 
ATOM   10336 C CD1 . PHE D 1 46  ? -2.215  20.973  124.660 1.00 21.90 ? 46  PHE D CD1 1 
ATOM   10337 C CD2 . PHE D 1 46  ? 0.125   21.466  125.023 1.00 17.29 ? 46  PHE D CD2 1 
ATOM   10338 C CE1 . PHE D 1 46  ? -2.139  21.465  123.323 1.00 18.65 ? 46  PHE D CE1 1 
ATOM   10339 C CE2 . PHE D 1 46  ? 0.222   21.941  123.709 1.00 19.36 ? 46  PHE D CE2 1 
ATOM   10340 C CZ  . PHE D 1 46  ? -0.948  21.927  122.834 1.00 19.57 ? 46  PHE D CZ  1 
ATOM   10341 N N   . PRO D 1 47  ? -3.106  18.532  128.997 1.00 17.90 ? 47  PRO D N   1 
ATOM   10342 C CA  . PRO D 1 47  ? -3.347  17.928  130.326 1.00 17.90 ? 47  PRO D CA  1 
ATOM   10343 C C   . PRO D 1 47  ? -2.155  17.423  131.163 1.00 17.48 ? 47  PRO D C   1 
ATOM   10344 O O   . PRO D 1 47  ? -2.298  17.321  132.344 1.00 16.62 ? 47  PRO D O   1 
ATOM   10345 C CB  . PRO D 1 47  ? -4.371  16.827  130.032 1.00 18.55 ? 47  PRO D CB  1 
ATOM   10346 C CG  . PRO D 1 47  ? -4.051  16.413  128.596 1.00 19.25 ? 47  PRO D CG  1 
ATOM   10347 C CD  . PRO D 1 47  ? -3.584  17.673  127.896 1.00 17.50 ? 47  PRO D CD  1 
ATOM   10348 N N   . PHE D 1 48  ? -1.028  17.101  130.544 1.00 17.99 ? 48  PHE D N   1 
ATOM   10349 C CA  . PHE D 1 48  ? 0.197   16.676  131.240 1.00 17.28 ? 48  PHE D CA  1 
ATOM   10350 C C   . PHE D 1 48  ? 0.918   17.918  131.783 1.00 16.85 ? 48  PHE D C   1 
ATOM   10351 O O   . PHE D 1 48  ? 1.148   18.845  131.052 1.00 17.71 ? 48  PHE D O   1 
ATOM   10352 C CB  . PHE D 1 48  ? 1.137   15.974  130.241 1.00 17.28 ? 48  PHE D CB  1 
ATOM   10353 C CG  . PHE D 1 48  ? 0.440   14.976  129.341 1.00 18.34 ? 48  PHE D CG  1 
ATOM   10354 C CD1 . PHE D 1 48  ? 0.059   13.731  129.842 1.00 17.76 ? 48  PHE D CD1 1 
ATOM   10355 C CD2 . PHE D 1 48  ? 0.158   15.291  127.989 1.00 19.41 ? 48  PHE D CD2 1 
ATOM   10356 C CE1 . PHE D 1 48  ? -0.582  12.764  128.997 1.00 20.29 ? 48  PHE D CE1 1 
ATOM   10357 C CE2 . PHE D 1 48  ? -0.494  14.355  127.148 1.00 20.10 ? 48  PHE D CE2 1 
ATOM   10358 C CZ  . PHE D 1 48  ? -0.866  13.103  127.649 1.00 21.60 ? 48  PHE D CZ  1 
ATOM   10359 N N   . LYS D 1 49  ? 1.293   17.911  133.055 1.00 18.09 ? 49  LYS D N   1 
ATOM   10360 C CA  . LYS D 1 49  ? 1.769   19.138  133.707 1.00 17.19 ? 49  LYS D CA  1 
ATOM   10361 C C   . LYS D 1 49  ? 3.222   19.077  134.170 1.00 18.09 ? 49  LYS D C   1 
ATOM   10362 O O   . LYS D 1 49  ? 3.888   20.091  134.198 1.00 17.07 ? 49  LYS D O   1 
ATOM   10363 C CB  . LYS D 1 49  ? 0.875   19.484  134.890 1.00 18.94 ? 49  LYS D CB  1 
ATOM   10364 C CG  . LYS D 1 49  ? -0.505  19.768  134.527 1.00 17.84 ? 49  LYS D CG  1 
ATOM   10365 C CD  . LYS D 1 49  ? -0.547  20.948  133.563 1.00 23.24 ? 49  LYS D CD  1 
ATOM   10366 C CE  . LYS D 1 49  ? -1.972  21.176  133.123 1.00 23.34 ? 49  LYS D CE  1 
ATOM   10367 N NZ  . LYS D 1 49  ? -2.163  22.387  132.256 1.00 24.87 ? 49  LYS D NZ  1 
ATOM   10368 N N   . THR D 1 50  ? 3.721   17.885  134.498 1.00 17.70 ? 50  THR D N   1 
ATOM   10369 C CA  . THR D 1 50  ? 5.113   17.729  134.969 1.00 19.75 ? 50  THR D CA  1 
ATOM   10370 C C   . THR D 1 50  ? 5.533   16.312  134.632 1.00 18.54 ? 50  THR D C   1 
ATOM   10371 O O   . THR D 1 50  ? 4.691   15.451  134.436 1.00 19.48 ? 50  THR D O   1 
ATOM   10372 C CB  . THR D 1 50  ? 5.303   17.936  136.513 1.00 20.03 ? 50  THR D CB  1 
ATOM   10373 O OG1 . THR D 1 50  ? 4.693   16.854  137.237 1.00 22.06 ? 50  THR D OG1 1 
ATOM   10374 C CG2 . THR D 1 50  ? 4.735   19.296  137.038 1.00 22.73 ? 50  THR D CG2 1 
ATOM   10375 N N   . ALA D 1 51  ? 6.825   16.088  134.544 1.00 19.81 ? 51  ALA D N   1 
ATOM   10376 C CA  . ALA D 1 51  ? 7.355   14.718  134.294 1.00 19.30 ? 51  ALA D CA  1 
ATOM   10377 C C   . ALA D 1 51  ? 8.608   14.520  135.158 1.00 19.74 ? 51  ALA D C   1 
ATOM   10378 O O   . ALA D 1 51  ? 9.411   15.464  135.316 1.00 18.70 ? 51  ALA D O   1 
ATOM   10379 C CB  . ALA D 1 51  ? 7.710   14.568  132.818 1.00 17.69 ? 51  ALA D CB  1 
ATOM   10380 N N   . VAL D 1 52  ? 8.747   13.303  135.709 1.00 19.56 ? 52  VAL D N   1 
ATOM   10381 C CA  . VAL D 1 52  ? 9.958   12.833  136.386 1.00 17.78 ? 52  VAL D CA  1 
ATOM   10382 C C   . VAL D 1 52  ? 10.362  11.500  135.767 1.00 18.51 ? 52  VAL D C   1 
ATOM   10383 O O   . VAL D 1 52  ? 9.605   10.488  135.800 1.00 17.21 ? 52  VAL D O   1 
ATOM   10384 C CB  . VAL D 1 52  ? 9.788   12.643  137.947 1.00 18.91 ? 52  VAL D CB  1 
ATOM   10385 C CG1 . VAL D 1 52  ? 11.111  12.137  138.591 1.00 17.62 ? 52  VAL D CG1 1 
ATOM   10386 C CG2 . VAL D 1 52  ? 9.347   13.964  138.687 1.00 18.21 ? 52  VAL D CG2 1 
ATOM   10387 N N   . ILE D 1 53  ? 11.556  11.495  135.201 1.00 18.20 ? 53  ILE D N   1 
ATOM   10388 C CA  . ILE D 1 53  ? 12.063  10.302  134.497 1.00 19.62 ? 53  ILE D CA  1 
ATOM   10389 C C   . ILE D 1 53  ? 13.394  9.889   135.155 1.00 18.31 ? 53  ILE D C   1 
ATOM   10390 O O   . ILE D 1 53  ? 14.302  10.682  135.216 1.00 19.22 ? 53  ILE D O   1 
ATOM   10391 C CB  . ILE D 1 53  ? 12.199  10.602  133.003 1.00 18.79 ? 53  ILE D CB  1 
ATOM   10392 C CG1 . ILE D 1 53  ? 10.775  10.939  132.446 1.00 19.41 ? 53  ILE D CG1 1 
ATOM   10393 C CG2 . ILE D 1 53  ? 12.889  9.389   132.223 1.00 20.39 ? 53  ILE D CG2 1 
ATOM   10394 C CD1 . ILE D 1 53  ? 10.791  11.671  131.103 1.00 17.32 ? 53  ILE D CD1 1 
ATOM   10395 N N   . THR D 1 54  ? 13.472  8.672   135.687 1.00 18.72 ? 54  THR D N   1 
ATOM   10396 C CA  . THR D 1 54  ? 14.700  8.209   136.312 1.00 17.88 ? 54  THR D CA  1 
ATOM   10397 C C   . THR D 1 54  ? 15.665  7.686   135.279 1.00 17.42 ? 54  THR D C   1 
ATOM   10398 O O   . THR D 1 54  ? 15.251  7.124   134.266 1.00 19.91 ? 54  THR D O   1 
ATOM   10399 C CB  . THR D 1 54  ? 14.471  7.099   137.439 1.00 17.81 ? 54  THR D CB  1 
ATOM   10400 O OG1 . THR D 1 54  ? 13.800  5.961   136.869 1.00 20.88 ? 54  THR D OG1 1 
ATOM   10401 C CG2 . THR D 1 54  ? 13.669  7.655   138.594 1.00 16.97 ? 54  THR D CG2 1 
ATOM   10402 N N   . VAL D 1 55  ? 16.960  7.812   135.569 1.00 19.13 ? 55  VAL D N   1 
ATOM   10403 C CA  . VAL D 1 55  ? 18.021  7.391   134.665 1.00 21.00 ? 55  VAL D CA  1 
ATOM   10404 C C   . VAL D 1 55  ? 19.046  6.499   135.400 1.00 22.56 ? 55  VAL D C   1 
ATOM   10405 O O   . VAL D 1 55  ? 19.525  6.827   136.524 1.00 23.31 ? 55  VAL D O   1 
ATOM   10406 C CB  . VAL D 1 55  ? 18.711  8.627   134.009 1.00 19.73 ? 55  VAL D CB  1 
ATOM   10407 C CG1 . VAL D 1 55  ? 19.772  8.234   133.041 1.00 21.11 ? 55  VAL D CG1 1 
ATOM   10408 C CG2 . VAL D 1 55  ? 17.666  9.567   133.323 1.00 20.40 ? 55  VAL D CG2 1 
ATOM   10409 N N   . GLU D 1 56  ? 19.359  5.360   134.797 1.00 22.75 ? 56  GLU D N   1 
ATOM   10410 C CA  . GLU D 1 56  ? 20.454  4.539   135.300 1.00 24.21 ? 56  GLU D CA  1 
ATOM   10411 C C   . GLU D 1 56  ? 21.790  5.220   135.019 1.00 24.94 ? 56  GLU D C   1 
ATOM   10412 O O   . GLU D 1 56  ? 22.050  5.626   133.876 1.00 24.10 ? 56  GLU D O   1 
ATOM   10413 C CB  . GLU D 1 56  ? 20.425  3.125   134.671 1.00 24.97 ? 56  GLU D CB  1 
ATOM   10414 C CG  . GLU D 1 56  ? 21.385  2.121   135.397 1.00 27.90 ? 56  GLU D CG  1 
ATOM   10415 C CD  . GLU D 1 56  ? 21.112  0.632   135.129 1.00 28.95 ? 56  GLU D CD  1 
ATOM   10416 O OE1 . GLU D 1 56  ? 19.991  0.141   135.384 1.00 39.64 ? 56  GLU D OE1 1 
ATOM   10417 O OE2 . GLU D 1 56  ? 22.039  -0.070  134.705 1.00 34.51 ? 56  GLU D OE2 1 
ATOM   10418 N N   . ASN D 1 57  ? 22.636  5.319   136.058 1.00 24.98 ? 57  ASN D N   1 
ATOM   10419 C CA  . ASN D 1 57  ? 23.946  6.006   135.991 1.00 26.40 ? 57  ASN D CA  1 
ATOM   10420 C C   . ASN D 1 57  ? 23.829  7.470   135.552 1.00 26.60 ? 57  ASN D C   1 
ATOM   10421 O O   . ASN D 1 57  ? 24.689  7.964   134.821 1.00 27.73 ? 57  ASN D O   1 
ATOM   10422 C CB  . ASN D 1 57  ? 24.979  5.290   135.053 1.00 27.18 ? 57  ASN D CB  1 
ATOM   10423 C CG  . ASN D 1 57  ? 25.112  3.779   135.307 1.00 28.27 ? 57  ASN D CG  1 
ATOM   10424 O OD1 . ASN D 1 57  ? 24.817  2.965   134.432 1.00 29.16 ? 57  ASN D OD1 1 
ATOM   10425 N ND2 . ASN D 1 57  ? 25.604  3.412   136.474 1.00 28.65 ? 57  ASN D ND2 1 
ATOM   10426 N N   . GLY D 1 58  ? 22.787  8.172   135.995 1.00 26.71 ? 58  GLY D N   1 
ATOM   10427 C CA  . GLY D 1 58  ? 22.594  9.579   135.596 1.00 26.48 ? 58  GLY D CA  1 
ATOM   10428 C C   . GLY D 1 58  ? 21.586  10.250  136.500 1.00 26.84 ? 58  GLY D C   1 
ATOM   10429 O O   . GLY D 1 58  ? 20.915  9.575   137.292 1.00 25.95 ? 58  GLY D O   1 
ATOM   10430 N N   . LYS D 1 59  ? 21.511  11.580  136.402 1.00 26.33 ? 59  LYS D N   1 
ATOM   10431 C CA  . LYS D 1 59  ? 20.645  12.385  137.256 1.00 25.96 ? 59  LYS D CA  1 
ATOM   10432 C C   . LYS D 1 59  ? 19.221  12.201  136.773 1.00 24.69 ? 59  LYS D C   1 
ATOM   10433 O O   . LYS D 1 59  ? 18.999  12.108  135.583 1.00 23.07 ? 59  LYS D O   1 
ATOM   10434 C CB  . LYS D 1 59  ? 21.042  13.858  137.095 1.00 25.67 ? 59  LYS D CB  1 
ATOM   10435 C CG  . LYS D 1 59  ? 20.588  14.809  138.195 1.00 30.09 ? 59  LYS D CG  1 
ATOM   10436 C CD  . LYS D 1 59  ? 21.198  16.203  137.938 1.00 32.51 ? 59  LYS D CD  1 
ATOM   10437 C CE  . LYS D 1 59  ? 22.709  16.198  138.346 1.00 38.83 ? 59  LYS D CE  1 
ATOM   10438 N NZ  . LYS D 1 59  ? 22.886  16.158  139.874 1.00 38.48 ? 59  LYS D NZ  1 
ATOM   10439 N N   . THR D 1 60  ? 18.244  12.193  137.685 1.00 23.81 ? 60  THR D N   1 
ATOM   10440 C CA  . THR D 1 60  ? 16.882  12.069  137.237 1.00 23.92 ? 60  THR D CA  1 
ATOM   10441 C C   . THR D 1 60  ? 16.429  13.268  136.427 1.00 23.35 ? 60  THR D C   1 
ATOM   10442 O O   . THR D 1 60  ? 16.854  14.387  136.625 1.00 22.85 ? 60  THR D O   1 
ATOM   10443 C CB  . THR D 1 60  ? 15.834  11.537  138.298 1.00 24.98 ? 60  THR D CB  1 
ATOM   10444 O OG1 . THR D 1 60  ? 14.715  12.435  138.501 1.00 29.42 ? 60  THR D OG1 1 
ATOM   10445 C CG2 . THR D 1 60  ? 16.476  10.981  139.492 1.00 18.18 ? 60  THR D CG2 1 
ATOM   10446 N N   . ILE D 1 61  ? 15.625  13.004  135.441 1.00 23.74 ? 61  ILE D N   1 
ATOM   10447 C CA  . ILE D 1 61  ? 15.213  14.099  134.578 1.00 23.42 ? 61  ILE D CA  1 
ATOM   10448 C C   . ILE D 1 61  ? 13.880  14.587  135.059 1.00 23.84 ? 61  ILE D C   1 
ATOM   10449 O O   . ILE D 1 61  ? 12.949  13.797  135.283 1.00 23.66 ? 61  ILE D O   1 
ATOM   10450 C CB  . ILE D 1 61  ? 15.175  13.669  133.105 1.00 23.51 ? 61  ILE D CB  1 
ATOM   10451 C CG1 . ILE D 1 61  ? 16.621  13.320  132.741 1.00 22.75 ? 61  ILE D CG1 1 
ATOM   10452 C CG2 . ILE D 1 61  ? 14.517  14.822  132.224 1.00 21.20 ? 61  ILE D CG2 1 
ATOM   10453 C CD1 . ILE D 1 61  ? 16.845  12.733  131.373 1.00 22.67 ? 61  ILE D CD1 1 
ATOM   10454 N N   . GLN D 1 62  ? 13.788  15.896  135.200 1.00 22.31 ? 62  GLN D N   1 
ATOM   10455 C CA  . GLN D 1 62  ? 12.561  16.504  135.659 1.00 23.38 ? 62  GLN D CA  1 
ATOM   10456 C C   . GLN D 1 62  ? 12.126  17.595  134.735 1.00 22.01 ? 62  GLN D C   1 
ATOM   10457 O O   . GLN D 1 62  ? 12.887  18.503  134.453 1.00 22.71 ? 62  GLN D O   1 
ATOM   10458 C CB  . GLN D 1 62  ? 12.704  17.097  137.057 1.00 23.36 ? 62  GLN D CB  1 
ATOM   10459 C CG  . GLN D 1 62  ? 12.822  16.038  138.125 1.00 28.30 ? 62  GLN D CG  1 
ATOM   10460 C CD  . GLN D 1 62  ? 12.743  16.616  139.491 1.00 37.80 ? 62  GLN D CD  1 
ATOM   10461 O OE1 . GLN D 1 62  ? 11.665  17.035  139.951 1.00 40.67 ? 62  GLN D OE1 1 
ATOM   10462 N NE2 . GLN D 1 62  ? 13.885  16.653  140.171 1.00 41.31 ? 62  GLN D NE2 1 
ATOM   10463 N N   . PHE D 1 63  ? 10.881  17.515  134.294 1.00 21.28 ? 63  PHE D N   1 
ATOM   10464 C CA  . PHE D 1 63  ? 10.292  18.638  133.595 1.00 21.21 ? 63  PHE D CA  1 
ATOM   10465 C C   . PHE D 1 63  ? 9.351   19.331  134.587 1.00 21.55 ? 63  PHE D C   1 
ATOM   10466 O O   . PHE D 1 63  ? 8.291   18.806  134.870 1.00 20.87 ? 63  PHE D O   1 
ATOM   10467 C CB  . PHE D 1 63  ? 9.474   18.206  132.368 1.00 20.48 ? 63  PHE D CB  1 
ATOM   10468 C CG  . PHE D 1 63  ? 10.254  17.552  131.245 1.00 19.91 ? 63  PHE D CG  1 
ATOM   10469 C CD1 . PHE D 1 63  ? 11.659  17.513  131.202 1.00 21.65 ? 63  PHE D CD1 1 
ATOM   10470 C CD2 . PHE D 1 63  ? 9.538   16.973  130.195 1.00 19.89 ? 63  PHE D CD2 1 
ATOM   10471 C CE1 . PHE D 1 63  ? 12.336  16.855  130.112 1.00 21.96 ? 63  PHE D CE1 1 
ATOM   10472 C CE2 . PHE D 1 63  ? 10.181  16.364  129.111 1.00 21.75 ? 63  PHE D CE2 1 
ATOM   10473 C CZ  . PHE D 1 63  ? 11.584  16.275  129.076 1.00 18.49 ? 63  PHE D CZ  1 
ATOM   10474 N N   . GLY D 1 64  ? 9.746   20.497  135.123 1.00 22.14 ? 64  GLY D N   1 
ATOM   10475 C CA  . GLY D 1 64  ? 8.806   21.354  135.902 1.00 22.28 ? 64  GLY D CA  1 
ATOM   10476 C C   . GLY D 1 64  ? 7.735   21.961  134.988 1.00 23.07 ? 64  GLY D C   1 
ATOM   10477 O O   . GLY D 1 64  ? 7.673   21.651  133.783 1.00 22.30 ? 64  GLY D O   1 
ATOM   10478 N N   . GLU D 1 65  ? 6.867   22.822  135.514 1.00 22.77 ? 65  GLU D N   1 
ATOM   10479 C CA  . GLU D 1 65  ? 5.713   23.188  134.704 1.00 24.32 ? 65  GLU D CA  1 
ATOM   10480 C C   . GLU D 1 65  ? 6.001   23.943  133.432 1.00 23.41 ? 65  GLU D C   1 
ATOM   10481 O O   . GLU D 1 65  ? 5.323   23.684  132.442 1.00 21.81 ? 65  GLU D O   1 
ATOM   10482 C CB  . GLU D 1 65  ? 4.519   23.735  135.489 1.00 27.02 ? 65  GLU D CB  1 
ATOM   10483 C CG  . GLU D 1 65  ? 4.799   24.177  136.871 1.00 33.77 ? 65  GLU D CG  1 
ATOM   10484 C CD  . GLU D 1 65  ? 5.085   23.048  137.849 1.00 40.42 ? 65  GLU D CD  1 
ATOM   10485 O OE1 . GLU D 1 65  ? 4.130   22.339  138.275 1.00 43.54 ? 65  GLU D OE1 1 
ATOM   10486 O OE2 . GLU D 1 65  ? 6.277   22.925  138.247 1.00 43.34 ? 65  GLU D OE2 1 
ATOM   10487 N N   . GLU D 1 66  ? 7.014   24.821  133.442 1.00 21.95 ? 66  GLU D N   1 
ATOM   10488 C CA  . GLU D 1 66  ? 7.358   25.604  132.241 1.00 22.89 ? 66  GLU D CA  1 
ATOM   10489 C C   . GLU D 1 66  ? 8.048   24.754  131.152 1.00 21.37 ? 66  GLU D C   1 
ATOM   10490 O O   . GLU D 1 66  ? 7.686   24.843  129.981 1.00 20.52 ? 66  GLU D O   1 
ATOM   10491 C CB  . GLU D 1 66  ? 8.192   26.863  132.599 1.00 23.28 ? 66  GLU D CB  1 
ATOM   10492 C CG  . GLU D 1 66  ? 7.336   27.918  133.354 1.00 27.22 ? 66  GLU D CG  1 
ATOM   10493 C CD  . GLU D 1 66  ? 6.080   28.358  132.560 1.00 32.61 ? 66  GLU D CD  1 
ATOM   10494 O OE1 . GLU D 1 66  ? 6.229   28.764  131.378 1.00 36.77 ? 66  GLU D OE1 1 
ATOM   10495 O OE2 . GLU D 1 66  ? 4.957   28.268  133.107 1.00 31.92 ? 66  GLU D OE2 1 
ATOM   10496 N N   . MET D 1 67  ? 9.013   23.935  131.567 1.00 20.79 ? 67  MET D N   1 
ATOM   10497 C CA  . MET D 1 67  ? 9.677   22.977  130.675 1.00 20.30 ? 67  MET D CA  1 
ATOM   10498 C C   . MET D 1 67  ? 8.700   21.973  130.059 1.00 19.57 ? 67  MET D C   1 
ATOM   10499 O O   . MET D 1 67  ? 8.835   21.625  128.880 1.00 20.75 ? 67  MET D O   1 
ATOM   10500 C CB  . MET D 1 67  ? 10.764  22.232  131.423 1.00 20.77 ? 67  MET D CB  1 
ATOM   10501 C CG  . MET D 1 67  ? 11.531  21.189  130.557 1.00 21.03 ? 67  MET D CG  1 
ATOM   10502 S SD  . MET D 1 67  ? 12.551  21.907  129.290 1.00 28.82 ? 67  MET D SD  1 
ATOM   10503 C CE  . MET D 1 67  ? 13.853  22.626  130.328 1.00 26.86 ? 67  MET D CE  1 
ATOM   10504 N N   . MET D 1 68  ? 7.748   21.483  130.855 1.00 19.82 ? 68  MET D N   1 
ATOM   10505 C CA  . MET D 1 68  ? 6.680   20.611  130.330 1.00 19.58 ? 68  MET D CA  1 
ATOM   10506 C C   . MET D 1 68  ? 5.872   21.301  129.233 1.00 19.40 ? 68  MET D C   1 
ATOM   10507 O O   . MET D 1 68  ? 5.607   20.720  128.183 1.00 17.79 ? 68  MET D O   1 
ATOM   10508 C CB  . MET D 1 68  ? 5.763   20.154  131.465 1.00 19.50 ? 68  MET D CB  1 
ATOM   10509 C CG  . MET D 1 68  ? 4.848   19.037  131.066 1.00 21.73 ? 68  MET D CG  1 
ATOM   10510 S SD  . MET D 1 68  ? 5.723   17.499  130.723 1.00 26.48 ? 68  MET D SD  1 
ATOM   10511 C CE  . MET D 1 68  ? 4.469   16.254  130.861 1.00 28.69 ? 68  MET D CE  1 
ATOM   10512 N N   . LYS D 1 69  ? 5.497   22.561  129.449 1.00 17.24 ? 69  LYS D N   1 
ATOM   10513 C CA  . LYS D 1 69  ? 4.756   23.245  128.406 1.00 17.03 ? 69  LYS D CA  1 
ATOM   10514 C C   . LYS D 1 69  ? 5.571   23.290  127.091 1.00 17.30 ? 69  LYS D C   1 
ATOM   10515 O O   . LYS D 1 69  ? 4.988   23.207  126.016 1.00 17.28 ? 69  LYS D O   1 
ATOM   10516 C CB  . LYS D 1 69  ? 4.332   24.674  128.785 1.00 17.68 ? 69  LYS D CB  1 
ATOM   10517 C CG  . LYS D 1 69  ? 3.211   24.693  129.781 1.00 19.60 ? 69  LYS D CG  1 
ATOM   10518 C CD  . LYS D 1 69  ? 2.793   26.114  129.953 1.00 25.70 ? 69  LYS D CD  1 
ATOM   10519 C CE  . LYS D 1 69  ? 3.290   26.688  131.214 1.00 29.98 ? 69  LYS D CE  1 
ATOM   10520 N NZ  . LYS D 1 69  ? 2.267   26.491  132.316 1.00 35.06 ? 69  LYS D NZ  1 
ATOM   10521 N N   . ARG D 1 70  ? 6.878   23.541  127.191 1.00 16.13 ? 70  ARG D N   1 
ATOM   10522 C CA  . ARG D 1 70  ? 7.738   23.532  126.030 1.00 15.85 ? 70  ARG D CA  1 
ATOM   10523 C C   . ARG D 1 70  ? 7.801   22.144  125.396 1.00 15.49 ? 70  ARG D C   1 
ATOM   10524 O O   . ARG D 1 70  ? 7.823   22.024  124.154 1.00 16.60 ? 70  ARG D O   1 
ATOM   10525 C CB  . ARG D 1 70  ? 9.168   23.980  126.409 1.00 15.98 ? 70  ARG D CB  1 
ATOM   10526 C CG  . ARG D 1 70  ? 10.158  23.952  125.235 1.00 14.86 ? 70  ARG D CG  1 
ATOM   10527 C CD  . ARG D 1 70  ? 11.570  24.318  125.623 1.00 19.86 ? 70  ARG D CD  1 
ATOM   10528 N NE  . ARG D 1 70  ? 12.472  24.230  124.451 1.00 16.29 ? 70  ARG D NE  1 
ATOM   10529 C CZ  . ARG D 1 70  ? 13.797  24.117  124.514 1.00 16.99 ? 70  ARG D CZ  1 
ATOM   10530 N NH1 . ARG D 1 70  ? 14.394  24.051  125.688 1.00 15.00 ? 70  ARG D NH1 1 
ATOM   10531 N NH2 . ARG D 1 70  ? 14.535  24.021  123.402 1.00 16.01 ? 70  ARG D NH2 1 
ATOM   10532 N N   . ALA D 1 71  ? 7.900   21.098  126.247 1.00 14.94 ? 71  ALA D N   1 
ATOM   10533 C CA  . ALA D 1 71  ? 7.950   19.671  125.799 1.00 14.08 ? 71  ALA D CA  1 
ATOM   10534 C C   . ALA D 1 71  ? 6.717   19.273  124.998 1.00 14.96 ? 71  ALA D C   1 
ATOM   10535 O O   . ALA D 1 71  ? 6.765   18.435  124.045 1.00 14.17 ? 71  ALA D O   1 
ATOM   10536 C CB  . ALA D 1 71  ? 8.139   18.750  127.057 1.00 14.06 ? 71  ALA D CB  1 
ATOM   10537 N N   . LEU D 1 72  ? 5.594   19.883  125.366 1.00 13.07 ? 72  LEU D N   1 
ATOM   10538 C CA  . LEU D 1 72  ? 4.328   19.574  124.702 1.00 13.58 ? 72  LEU D CA  1 
ATOM   10539 C C   . LEU D 1 72  ? 3.963   20.498  123.527 1.00 13.34 ? 72  LEU D C   1 
ATOM   10540 O O   . LEU D 1 72  ? 2.887   20.321  122.948 1.00 14.88 ? 72  LEU D O   1 
ATOM   10541 C CB  . LEU D 1 72  ? 3.165   19.590  125.735 1.00 11.70 ? 72  LEU D CB  1 
ATOM   10542 C CG  . LEU D 1 72  ? 3.320   18.667  126.962 1.00 15.12 ? 72  LEU D CG  1 
ATOM   10543 C CD1 . LEU D 1 72  ? 2.142   18.865  127.875 1.00 17.63 ? 72  LEU D CD1 1 
ATOM   10544 C CD2 . LEU D 1 72  ? 3.447   17.216  126.476 1.00 10.74 ? 72  LEU D CD2 1 
ATOM   10545 N N   . GLN D 1 73  ? 4.849   21.435  123.164 1.00 14.47 ? 73  GLN D N   1 
ATOM   10546 C CA  . GLN D 1 73  ? 4.543   22.460  122.141 1.00 13.25 ? 73  GLN D CA  1 
ATOM   10547 C C   . GLN D 1 73  ? 5.385   22.245  120.881 1.00 13.69 ? 73  GLN D C   1 
ATOM   10548 O O   . GLN D 1 73  ? 6.439   21.636  120.939 1.00 14.80 ? 73  GLN D O   1 
ATOM   10549 C CB  . GLN D 1 73  ? 4.827   23.856  122.750 1.00 12.81 ? 73  GLN D CB  1 
ATOM   10550 C CG  . GLN D 1 73  ? 4.657   25.037  121.796 1.00 14.85 ? 73  GLN D CG  1 
ATOM   10551 C CD  . GLN D 1 73  ? 3.234   25.101  121.347 1.00 16.30 ? 73  GLN D CD  1 
ATOM   10552 O OE1 . GLN D 1 73  ? 2.815   24.312  120.510 1.00 17.81 ? 73  GLN D OE1 1 
ATOM   10553 N NE2 . GLN D 1 73  ? 2.444   25.948  122.008 1.00 15.93 ? 73  GLN D NE2 1 
ATOM   10554 N N   . TYR D 1 74  ? 4.940   22.761  119.742 1.00 13.62 ? 74  TYR D N   1 
ATOM   10555 C CA  . TYR D 1 74  ? 5.738   22.715  118.528 1.00 16.01 ? 74  TYR D CA  1 
ATOM   10556 C C   . TYR D 1 74  ? 7.142   23.271  118.760 1.00 17.01 ? 74  TYR D C   1 
ATOM   10557 O O   . TYR D 1 74  ? 7.361   24.132  119.666 1.00 17.82 ? 74  TYR D O   1 
ATOM   10558 C CB  . TYR D 1 74  ? 5.099   23.581  117.470 1.00 15.64 ? 74  TYR D CB  1 
ATOM   10559 C CG  . TYR D 1 74  ? 3.806   23.084  116.923 1.00 15.66 ? 74  TYR D CG  1 
ATOM   10560 C CD1 . TYR D 1 74  ? 3.726   21.884  116.226 1.00 18.70 ? 74  TYR D CD1 1 
ATOM   10561 C CD2 . TYR D 1 74  ? 2.659   23.896  116.984 1.00 15.87 ? 74  TYR D CD2 1 
ATOM   10562 C CE1 . TYR D 1 74  ? 2.515   21.503  115.592 1.00 19.08 ? 74  TYR D CE1 1 
ATOM   10563 C CE2 . TYR D 1 74  ? 1.463   23.480  116.452 1.00 16.59 ? 74  TYR D CE2 1 
ATOM   10564 C CZ  . TYR D 1 74  ? 1.397   22.280  115.763 1.00 19.88 ? 74  TYR D CZ  1 
ATOM   10565 O OH  . TYR D 1 74  ? 0.169   21.909  115.218 1.00 18.36 ? 74  TYR D OH  1 
ATOM   10566 N N   . SER D 1 75  ? 8.086   22.821  117.935 1.00 16.07 ? 75  SER D N   1 
ATOM   10567 C CA  . SER D 1 75  ? 9.439   23.295  118.019 1.00 15.75 ? 75  SER D CA  1 
ATOM   10568 C C   . SER D 1 75  ? 10.058  23.278  116.620 1.00 15.90 ? 75  SER D C   1 
ATOM   10569 O O   . SER D 1 75  ? 9.389   22.855  115.660 1.00 17.47 ? 75  SER D O   1 
ATOM   10570 C CB  . SER D 1 75  ? 10.197  22.420  119.032 1.00 13.86 ? 75  SER D CB  1 
ATOM   10571 O OG  . SER D 1 75  ? 10.264  21.049  118.590 1.00 16.24 ? 75  SER D OG  1 
ATOM   10572 N N   . PRO D 1 76  ? 11.316  23.720  116.478 1.00 16.09 ? 76  PRO D N   1 
ATOM   10573 C CA  . PRO D 1 76  ? 11.891  23.880  115.130 1.00 17.05 ? 76  PRO D CA  1 
ATOM   10574 C C   . PRO D 1 76  ? 12.082  22.619  114.325 1.00 17.71 ? 76  PRO D C   1 
ATOM   10575 O O   . PRO D 1 76  ? 12.430  21.563  114.858 1.00 16.82 ? 76  PRO D O   1 
ATOM   10576 C CB  . PRO D 1 76  ? 13.254  24.569  115.403 1.00 17.29 ? 76  PRO D CB  1 
ATOM   10577 C CG  . PRO D 1 76  ? 13.066  25.209  116.708 1.00 16.61 ? 76  PRO D CG  1 
ATOM   10578 C CD  . PRO D 1 76  ? 12.274  24.182  117.492 1.00 15.85 ? 76  PRO D CD  1 
ATOM   10579 N N   . SER D 1 77  ? 11.843  22.757  113.023 1.00 17.33 ? 77  SER D N   1 
ATOM   10580 C CA  . SER D 1 77  ? 11.911  21.627  112.106 1.00 19.51 ? 77  SER D CA  1 
ATOM   10581 C C   . SER D 1 77  ? 13.173  20.770  112.169 1.00 19.55 ? 77  SER D C   1 
ATOM   10582 O O   . SER D 1 77  ? 13.089  19.557  112.028 1.00 17.30 ? 77  SER D O   1 
ATOM   10583 C CB  . SER D 1 77  ? 11.671  22.123  110.676 1.00 19.44 ? 77  SER D CB  1 
ATOM   10584 O OG  . SER D 1 77  ? 10.267  22.364  110.546 1.00 24.38 ? 77  SER D OG  1 
ATOM   10585 N N   . ALA D 1 78  ? 14.332  21.409  112.375 1.00 18.82 ? 78  ALA D N   1 
ATOM   10586 C CA  . ALA D 1 78  ? 15.608  20.694  112.349 1.00 18.36 ? 78  ALA D CA  1 
ATOM   10587 C C   . ALA D 1 78  ? 15.996  20.144  113.734 1.00 18.64 ? 78  ALA D C   1 
ATOM   10588 O O   . ALA D 1 78  ? 16.976  19.414  113.867 1.00 19.80 ? 78  ALA D O   1 
ATOM   10589 C CB  . ALA D 1 78  ? 16.677  21.609  111.822 1.00 20.36 ? 78  ALA D CB  1 
ATOM   10590 N N   . GLY D 1 79  ? 15.214  20.464  114.751 1.00 17.26 ? 79  GLY D N   1 
ATOM   10591 C CA  . GLY D 1 79  ? 15.500  19.984  116.114 1.00 16.99 ? 79  GLY D CA  1 
ATOM   10592 C C   . GLY D 1 79  ? 15.548  21.130  117.095 1.00 17.06 ? 79  GLY D C   1 
ATOM   10593 O O   . GLY D 1 79  ? 15.664  22.324  116.710 1.00 16.69 ? 79  GLY D O   1 
ATOM   10594 N N   . ILE D 1 80  ? 15.396  20.832  118.376 1.00 17.26 ? 80  ILE D N   1 
ATOM   10595 C CA  . ILE D 1 80  ? 15.635  21.887  119.381 1.00 17.10 ? 80  ILE D CA  1 
ATOM   10596 C C   . ILE D 1 80  ? 17.156  22.318  119.460 1.00 17.45 ? 80  ILE D C   1 
ATOM   10597 O O   . ILE D 1 80  ? 18.050  21.521  119.242 1.00 17.06 ? 80  ILE D O   1 
ATOM   10598 C CB  . ILE D 1 80  ? 15.172  21.441  120.787 1.00 16.31 ? 80  ILE D CB  1 
ATOM   10599 C CG1 . ILE D 1 80  ? 16.115  20.326  121.289 1.00 16.42 ? 80  ILE D CG1 1 
ATOM   10600 C CG2 . ILE D 1 80  ? 13.647  21.028  120.724 1.00 14.10 ? 80  ILE D CG2 1 
ATOM   10601 C CD1 . ILE D 1 80  ? 15.847  19.858  122.747 1.00 18.59 ? 80  ILE D CD1 1 
ATOM   10602 N N   . PRO D 1 81  ? 17.429  23.619  119.738 1.00 17.42 ? 81  PRO D N   1 
ATOM   10603 C CA  . PRO D 1 81  ? 18.794  24.153  119.616 1.00 17.27 ? 81  PRO D CA  1 
ATOM   10604 C C   . PRO D 1 81  ? 19.820  23.441  120.467 1.00 17.32 ? 81  PRO D C   1 
ATOM   10605 O O   . PRO D 1 81  ? 20.913  23.183  119.990 1.00 17.73 ? 81  PRO D O   1 
ATOM   10606 C CB  . PRO D 1 81  ? 18.674  25.630  120.055 1.00 17.98 ? 81  PRO D CB  1 
ATOM   10607 C CG  . PRO D 1 81  ? 17.281  25.814  120.544 1.00 20.62 ? 81  PRO D CG  1 
ATOM   10608 C CD  . PRO D 1 81  ? 16.429  24.654  120.043 1.00 17.28 ? 81  PRO D CD  1 
ATOM   10609 N N   . GLU D 1 82  ? 19.463  23.075  121.688 1.00 17.70 ? 82  GLU D N   1 
ATOM   10610 C CA  . GLU D 1 82  ? 20.445  22.429  122.572 1.00 18.50 ? 82  GLU D CA  1 
ATOM   10611 C C   . GLU D 1 82  ? 20.873  21.042  122.088 1.00 16.75 ? 82  GLU D C   1 
ATOM   10612 O O   . GLU D 1 82  ? 22.006  20.691  122.250 1.00 15.53 ? 82  GLU D O   1 
ATOM   10613 C CB  . GLU D 1 82  ? 20.020  22.405  124.065 1.00 18.95 ? 82  GLU D CB  1 
ATOM   10614 C CG  . GLU D 1 82  ? 18.674  21.882  124.451 1.00 23.31 ? 82  GLU D CG  1 
ATOM   10615 C CD  . GLU D 1 82  ? 17.608  22.959  124.384 1.00 23.77 ? 82  GLU D CD  1 
ATOM   10616 O OE1 . GLU D 1 82  ? 17.290  23.384  123.266 1.00 20.82 ? 82  GLU D OE1 1 
ATOM   10617 O OE2 . GLU D 1 82  ? 17.055  23.336  125.444 1.00 27.73 ? 82  GLU D OE2 1 
ATOM   10618 N N   . LEU D 1 83  ? 19.983  20.298  121.461 1.00 16.29 ? 83  LEU D N   1 
ATOM   10619 C CA  . LEU D 1 83  ? 20.357  18.974  120.914 1.00 16.79 ? 83  LEU D CA  1 
ATOM   10620 C C   . LEU D 1 83  ? 21.120  19.131  119.632 1.00 16.30 ? 83  LEU D C   1 
ATOM   10621 O O   . LEU D 1 83  ? 22.101  18.413  119.393 1.00 17.62 ? 83  LEU D O   1 
ATOM   10622 C CB  . LEU D 1 83  ? 19.113  18.166  120.620 1.00 15.63 ? 83  LEU D CB  1 
ATOM   10623 C CG  . LEU D 1 83  ? 19.096  16.661  120.871 1.00 21.78 ? 83  LEU D CG  1 
ATOM   10624 C CD1 . LEU D 1 83  ? 18.170  15.933  119.903 1.00 16.47 ? 83  LEU D CD1 1 
ATOM   10625 C CD2 . LEU D 1 83  ? 20.419  15.940  121.134 1.00 16.08 ? 83  LEU D CD2 1 
ATOM   10626 N N   . LEU D 1 84  ? 20.719  20.088  118.806 1.00 16.88 ? 84  LEU D N   1 
ATOM   10627 C CA  . LEU D 1 84  ? 21.491  20.317  117.579 1.00 17.30 ? 84  LEU D CA  1 
ATOM   10628 C C   . LEU D 1 84  ? 22.917  20.686  117.891 1.00 17.72 ? 84  LEU D C   1 
ATOM   10629 O O   . LEU D 1 84  ? 23.823  20.179  117.215 1.00 17.52 ? 84  LEU D O   1 
ATOM   10630 C CB  . LEU D 1 84  ? 20.877  21.394  116.696 1.00 18.96 ? 84  LEU D CB  1 
ATOM   10631 C CG  . LEU D 1 84  ? 19.637  20.976  115.947 1.00 19.56 ? 84  LEU D CG  1 
ATOM   10632 C CD1 . LEU D 1 84  ? 18.945  22.261  115.568 1.00 18.76 ? 84  LEU D CD1 1 
ATOM   10633 C CD2 . LEU D 1 84  ? 20.024  20.166  114.706 1.00 20.40 ? 84  LEU D CD2 1 
ATOM   10634 N N   . SER D 1 85  ? 23.123  21.563  118.887 1.00 17.91 ? 85  SER D N   1 
ATOM   10635 C CA  . SER D 1 85  ? 24.460  22.036  119.163 1.00 19.20 ? 85  SER D CA  1 
ATOM   10636 C C   . SER D 1 85  ? 25.252  20.897  119.806 1.00 18.64 ? 85  SER D C   1 
ATOM   10637 O O   . SER D 1 85  ? 26.374  20.703  119.436 1.00 19.88 ? 85  SER D O   1 
ATOM   10638 C CB  . SER D 1 85  ? 24.518  23.290  120.022 1.00 20.44 ? 85  SER D CB  1 
ATOM   10639 O OG  . SER D 1 85  ? 23.787  23.161  121.224 1.00 25.35 ? 85  SER D OG  1 
ATOM   10640 N N   . TRP D 1 86  ? 24.650  20.145  120.736 1.00 18.02 ? 86  TRP D N   1 
ATOM   10641 C CA  . TRP D 1 86  ? 25.305  18.956  121.344 1.00 17.47 ? 86  TRP D CA  1 
ATOM   10642 C C   . TRP D 1 86  ? 25.786  17.939  120.276 1.00 16.32 ? 86  TRP D C   1 
ATOM   10643 O O   . TRP D 1 86  ? 26.932  17.474  120.276 1.00 15.06 ? 86  TRP D O   1 
ATOM   10644 C CB  . TRP D 1 86  ? 24.370  18.280  122.361 1.00 16.66 ? 86  TRP D CB  1 
ATOM   10645 C CG  . TRP D 1 86  ? 25.187  17.461  123.394 1.00 19.42 ? 86  TRP D CG  1 
ATOM   10646 C CD1 . TRP D 1 86  ? 25.658  17.907  124.591 1.00 18.57 ? 86  TRP D CD1 1 
ATOM   10647 C CD2 . TRP D 1 86  ? 25.669  16.118  123.246 1.00 18.25 ? 86  TRP D CD2 1 
ATOM   10648 N NE1 . TRP D 1 86  ? 26.335  16.906  125.232 1.00 21.59 ? 86  TRP D NE1 1 
ATOM   10649 C CE2 . TRP D 1 86  ? 26.389  15.807  124.418 1.00 21.73 ? 86  TRP D CE2 1 
ATOM   10650 C CE3 . TRP D 1 86  ? 25.556  15.145  122.236 1.00 21.61 ? 86  TRP D CE3 1 
ATOM   10651 C CZ2 . TRP D 1 86  ? 26.999  14.557  124.630 1.00 20.00 ? 86  TRP D CZ2 1 
ATOM   10652 C CZ3 . TRP D 1 86  ? 26.173  13.870  122.449 1.00 19.54 ? 86  TRP D CZ3 1 
ATOM   10653 C CH2 . TRP D 1 86  ? 26.885  13.609  123.643 1.00 21.41 ? 86  TRP D CH2 1 
ATOM   10654 N N   . LEU D 1 87  ? 24.907  17.621  119.351 1.00 16.24 ? 87  LEU D N   1 
ATOM   10655 C CA  . LEU D 1 87  ? 25.212  16.683  118.228 1.00 17.25 ? 87  LEU D CA  1 
ATOM   10656 C C   . LEU D 1 87  ? 26.220  17.217  117.189 1.00 17.74 ? 87  LEU D C   1 
ATOM   10657 O O   . LEU D 1 87  ? 27.059  16.462  116.655 1.00 16.12 ? 87  LEU D O   1 
ATOM   10658 C CB  . LEU D 1 87  ? 23.896  16.341  117.518 1.00 16.96 ? 87  LEU D CB  1 
ATOM   10659 C CG  . LEU D 1 87  ? 23.035  15.113  117.882 1.00 20.25 ? 87  LEU D CG  1 
ATOM   10660 C CD1 . LEU D 1 87  ? 23.475  14.272  119.072 1.00 15.95 ? 87  LEU D CD1 1 
ATOM   10661 C CD2 . LEU D 1 87  ? 21.500  15.321  117.782 1.00 16.61 ? 87  LEU D CD2 1 
ATOM   10662 N N   . LYS D 1 88  ? 26.115  18.510  116.825 1.00 17.16 ? 88  LYS D N   1 
ATOM   10663 C CA  . LYS D 1 88  ? 27.141  19.067  115.941 1.00 17.79 ? 88  LYS D CA  1 
ATOM   10664 C C   . LYS D 1 88  ? 28.510  19.019  116.668 1.00 18.38 ? 88  LYS D C   1 
ATOM   10665 O O   . LYS D 1 88  ? 29.548  18.730  116.063 1.00 19.44 ? 88  LYS D O   1 
ATOM   10666 C CB  . LYS D 1 88  ? 26.775  20.503  115.537 1.00 18.40 ? 88  LYS D CB  1 
ATOM   10667 C CG  . LYS D 1 88  ? 25.597  20.566  114.594 1.00 17.43 ? 88  LYS D CG  1 
ATOM   10668 C CD  . LYS D 1 88  ? 25.291  21.989  114.198 1.00 16.84 ? 88  LYS D CD  1 
ATOM   10669 C CE  . LYS D 1 88  ? 24.258  21.985  113.057 1.00 22.65 ? 88  LYS D CE  1 
ATOM   10670 N NZ  . LYS D 1 88  ? 23.882  23.420  112.695 1.00 22.98 ? 88  LYS D NZ  1 
ATOM   10671 N N   . GLN D 1 89  ? 28.520  19.276  117.973 1.00 18.35 ? 89  GLN D N   1 
ATOM   10672 C CA  . GLN D 1 89  ? 29.807  19.219  118.702 1.00 18.75 ? 89  GLN D CA  1 
ATOM   10673 C C   . GLN D 1 89  ? 30.336  17.782  118.876 1.00 18.33 ? 89  GLN D C   1 
ATOM   10674 O O   . GLN D 1 89  ? 31.535  17.521  118.774 1.00 18.02 ? 89  GLN D O   1 
ATOM   10675 C CB  . GLN D 1 89  ? 29.729  19.857  120.072 1.00 19.20 ? 89  GLN D CB  1 
ATOM   10676 C CG  . GLN D 1 89  ? 31.113  19.853  120.723 1.00 24.90 ? 89  GLN D CG  1 
ATOM   10677 C CD  . GLN D 1 89  ? 32.151  20.592  119.858 1.00 30.72 ? 89  GLN D CD  1 
ATOM   10678 O OE1 . GLN D 1 89  ? 33.180  20.039  119.499 1.00 31.30 ? 89  GLN D OE1 1 
ATOM   10679 N NE2 . GLN D 1 89  ? 31.842  21.844  119.505 1.00 33.20 ? 89  GLN D NE2 1 
ATOM   10680 N N   . LEU D 1 90  ? 29.438  16.865  119.142 1.00 17.31 ? 90  LEU D N   1 
ATOM   10681 C CA  . LEU D 1 90  ? 29.743  15.442  119.020 1.00 18.10 ? 90  LEU D CA  1 
ATOM   10682 C C   . LEU D 1 90  ? 30.366  15.043  117.666 1.00 18.30 ? 90  LEU D C   1 
ATOM   10683 O O   . LEU D 1 90  ? 31.390  14.349  117.630 1.00 18.69 ? 90  LEU D O   1 
ATOM   10684 C CB  . LEU D 1 90  ? 28.481  14.579  119.288 1.00 18.30 ? 90  LEU D CB  1 
ATOM   10685 C CG  . LEU D 1 90  ? 28.830  13.063  119.286 1.00 21.13 ? 90  LEU D CG  1 
ATOM   10686 C CD1 . LEU D 1 90  ? 29.441  12.676  120.612 1.00 18.36 ? 90  LEU D CD1 1 
ATOM   10687 C CD2 . LEU D 1 90  ? 27.607  12.226  119.024 1.00 20.30 ? 90  LEU D CD2 1 
ATOM   10688 N N   . GLN D 1 91  ? 29.781  15.472  116.552 1.00 18.68 ? 91  GLN D N   1 
ATOM   10689 C CA  . GLN D 1 91  ? 30.389  15.166  115.263 1.00 18.81 ? 91  GLN D CA  1 
ATOM   10690 C C   . GLN D 1 91  ? 31.798  15.793  115.071 1.00 20.88 ? 91  GLN D C   1 
ATOM   10691 O O   . GLN D 1 91  ? 32.705  15.191  114.499 1.00 20.04 ? 91  GLN D O   1 
ATOM   10692 C CB  . GLN D 1 91  ? 29.472  15.580  114.127 1.00 19.01 ? 91  GLN D CB  1 
ATOM   10693 C CG  . GLN D 1 91  ? 28.055  14.999  114.170 1.00 18.95 ? 91  GLN D CG  1 
ATOM   10694 C CD  . GLN D 1 91  ? 28.002  13.474  114.085 1.00 19.24 ? 91  GLN D CD  1 
ATOM   10695 O OE1 . GLN D 1 91  ? 28.465  12.760  114.977 1.00 20.86 ? 91  GLN D OE1 1 
ATOM   10696 N NE2 . GLN D 1 91  ? 27.372  12.980  113.040 1.00 18.42 ? 91  GLN D NE2 1 
ATOM   10697 N N   . ILE D 1 92  ? 31.952  17.023  115.506 1.00 22.32 ? 92  ILE D N   1 
ATOM   10698 C CA  . ILE D 1 92  ? 33.240  17.663  115.466 1.00 25.49 ? 92  ILE D CA  1 
ATOM   10699 C C   . ILE D 1 92  ? 34.206  16.821  116.275 1.00 26.32 ? 92  ILE D C   1 
ATOM   10700 O O   . ILE D 1 92  ? 35.233  16.444  115.750 1.00 27.79 ? 92  ILE D O   1 
ATOM   10701 C CB  . ILE D 1 92  ? 33.173  19.161  115.878 1.00 25.94 ? 92  ILE D CB  1 
ATOM   10702 C CG1 . ILE D 1 92  ? 32.364  19.907  114.825 1.00 25.46 ? 92  ILE D CG1 1 
ATOM   10703 C CG2 . ILE D 1 92  ? 34.583  19.763  115.996 1.00 25.44 ? 92  ILE D CG2 1 
ATOM   10704 C CD1 . ILE D 1 92  ? 31.874  21.290  115.276 1.00 26.82 ? 92  ILE D CD1 1 
ATOM   10705 N N   . LYS D 1 93  ? 33.842  16.426  117.494 1.00 26.91 ? 93  LYS D N   1 
ATOM   10706 C CA  . LYS D 1 93  ? 34.756  15.621  118.301 1.00 27.77 ? 93  LYS D CA  1 
ATOM   10707 C C   . LYS D 1 93  ? 35.169  14.291  117.704 1.00 26.36 ? 93  LYS D C   1 
ATOM   10708 O O   . LYS D 1 93  ? 36.329  13.948  117.765 1.00 26.68 ? 93  LYS D O   1 
ATOM   10709 C CB  . LYS D 1 93  ? 34.197  15.312  119.702 1.00 29.00 ? 93  LYS D CB  1 
ATOM   10710 C CG  . LYS D 1 93  ? 34.246  16.497  120.643 1.00 34.54 ? 93  LYS D CG  1 
ATOM   10711 C CD  . LYS D 1 93  ? 35.683  16.915  121.023 1.00 38.78 ? 93  LYS D CD  1 
ATOM   10712 C CE  . LYS D 1 93  ? 35.672  17.478  122.427 1.00 42.47 ? 93  LYS D CE  1 
ATOM   10713 N NZ  . LYS D 1 93  ? 34.362  18.123  122.717 1.00 44.56 ? 93  LYS D NZ  1 
ATOM   10714 N N   . LEU D 1 94  ? 34.201  13.532  117.210 1.00 24.19 ? 94  LEU D N   1 
ATOM   10715 C CA  . LEU D 1 94  ? 34.398  12.150  116.822 1.00 23.83 ? 94  LEU D CA  1 
ATOM   10716 C C   . LEU D 1 94  ? 34.938  11.979  115.427 1.00 23.12 ? 94  LEU D C   1 
ATOM   10717 O O   . LEU D 1 94  ? 35.583  10.963  115.160 1.00 23.33 ? 94  LEU D O   1 
ATOM   10718 C CB  . LEU D 1 94  ? 33.086  11.362  116.925 1.00 21.49 ? 94  LEU D CB  1 
ATOM   10719 C CG  . LEU D 1 94  ? 32.393  11.285  118.285 1.00 24.10 ? 94  LEU D CG  1 
ATOM   10720 C CD1 . LEU D 1 94  ? 31.298  10.306  118.185 1.00 23.83 ? 94  LEU D CD1 1 
ATOM   10721 C CD2 . LEU D 1 94  ? 33.355  10.828  119.370 1.00 25.60 ? 94  LEU D CD2 1 
ATOM   10722 N N   . HIS D 1 95  ? 34.607  12.931  114.550 1.00 22.03 ? 95  HIS D N   1 
ATOM   10723 C CA  . HIS D 1 95  ? 34.888  12.807  113.106 1.00 23.32 ? 95  HIS D CA  1 
ATOM   10724 C C   . HIS D 1 95  ? 35.657  13.976  112.530 1.00 22.11 ? 95  HIS D C   1 
ATOM   10725 O O   . HIS D 1 95  ? 36.087  13.904  111.371 1.00 23.18 ? 95  HIS D O   1 
ATOM   10726 C CB  . HIS D 1 95  ? 33.590  12.642  112.265 1.00 21.67 ? 95  HIS D CB  1 
ATOM   10727 C CG  . HIS D 1 95  ? 32.616  11.654  112.837 1.00 23.18 ? 95  HIS D CG  1 
ATOM   10728 N ND1 . HIS D 1 95  ? 32.902  10.306  112.965 1.00 21.71 ? 95  HIS D ND1 1 
ATOM   10729 C CD2 . HIS D 1 95  ? 31.367  11.825  113.349 1.00 21.21 ? 95  HIS D CD2 1 
ATOM   10730 C CE1 . HIS D 1 95  ? 31.873  9.693   113.536 1.00 20.47 ? 95  HIS D CE1 1 
ATOM   10731 N NE2 . HIS D 1 95  ? 30.940  10.596  113.790 1.00 19.71 ? 95  HIS D NE2 1 
ATOM   10732 N N   . ASN D 1 96  ? 35.785  15.059  113.297 1.00 22.01 ? 96  ASN D N   1 
ATOM   10733 C CA  . ASN D 1 96  ? 36.366  16.322  112.815 1.00 21.53 ? 96  ASN D CA  1 
ATOM   10734 C C   . ASN D 1 96  ? 36.155  16.530  111.327 1.00 21.46 ? 96  ASN D C   1 
ATOM   10735 O O   . ASN D 1 96  ? 37.128  16.591  110.568 1.00 20.69 ? 96  ASN D O   1 
ATOM   10736 C CB  . ASN D 1 96  ? 37.886  16.371  113.128 1.00 24.11 ? 96  ASN D CB  1 
ATOM   10737 C CG  . ASN D 1 96  ? 38.483  17.768  112.961 1.00 25.64 ? 96  ASN D CG  1 
ATOM   10738 O OD1 . ASN D 1 96  ? 37.767  18.745  112.881 1.00 29.94 ? 96  ASN D OD1 1 
ATOM   10739 N ND2 . ASN D 1 96  ? 39.812  17.853  112.922 1.00 33.29 ? 96  ASN D ND2 1 
ATOM   10740 N N   . PRO D 1 97  ? 34.879  16.690  110.873 1.00 20.72 ? 97  PRO D N   1 
ATOM   10741 C CA  . PRO D 1 97  ? 34.709  16.737  109.392 1.00 19.65 ? 97  PRO D CA  1 
ATOM   10742 C C   . PRO D 1 97  ? 35.460  17.878  108.701 1.00 20.83 ? 97  PRO D C   1 
ATOM   10743 O O   . PRO D 1 97  ? 35.358  19.026  109.159 1.00 21.29 ? 97  PRO D O   1 
ATOM   10744 C CB  . PRO D 1 97  ? 33.186  16.932  109.224 1.00 18.54 ? 97  PRO D CB  1 
ATOM   10745 C CG  . PRO D 1 97  ? 32.618  16.323  110.542 1.00 19.18 ? 97  PRO D CG  1 
ATOM   10746 C CD  . PRO D 1 97  ? 33.588  16.828  111.582 1.00 19.18 ? 97  PRO D CD  1 
ATOM   10747 N N   . PRO D 1 98  ? 36.214  17.577  107.598 1.00 21.86 ? 98  PRO D N   1 
ATOM   10748 C CA  . PRO D 1 98  ? 36.985  18.604  106.863 1.00 22.11 ? 98  PRO D CA  1 
ATOM   10749 C C   . PRO D 1 98  ? 36.135  19.812  106.414 1.00 23.00 ? 98  PRO D C   1 
ATOM   10750 O O   . PRO D 1 98  ? 36.646  20.875  106.091 1.00 22.80 ? 98  PRO D O   1 
ATOM   10751 C CB  . PRO D 1 98  ? 37.453  17.849  105.608 1.00 22.42 ? 98  PRO D CB  1 
ATOM   10752 C CG  . PRO D 1 98  ? 37.474  16.427  105.985 1.00 22.66 ? 98  PRO D CG  1 
ATOM   10753 C CD  . PRO D 1 98  ? 36.383  16.231  107.003 1.00 20.22 ? 98  PRO D CD  1 
ATOM   10754 N N   . THR D 1 99  ? 34.824  19.618  106.420 1.00 22.95 ? 99  THR D N   1 
ATOM   10755 C CA  . THR D 1 99  ? 33.831  20.509  105.828 1.00 22.98 ? 99  THR D CA  1 
ATOM   10756 C C   . THR D 1 99  ? 33.230  21.612  106.805 1.00 21.81 ? 99  THR D C   1 
ATOM   10757 O O   . THR D 1 99  ? 32.453  22.509  106.424 1.00 19.48 ? 99  THR D O   1 
ATOM   10758 C CB  . THR D 1 99  ? 32.783  19.513  105.329 1.00 24.06 ? 99  THR D CB  1 
ATOM   10759 O OG1 . THR D 1 99  ? 32.249  19.880  104.053 1.00 31.82 ? 99  THR D OG1 1 
ATOM   10760 C CG2 . THR D 1 99  ? 31.767  19.259  106.328 1.00 19.51 ? 99  THR D CG2 1 
ATOM   10761 N N   . ILE D 1 100 ? 33.581  21.532  108.082 1.00 21.20 ? 100 ILE D N   1 
ATOM   10762 C CA  . ILE D 1 100 ? 32.861  22.311  109.094 1.00 21.63 ? 100 ILE D CA  1 
ATOM   10763 C C   . ILE D 1 100 ? 32.879  23.837  108.862 1.00 22.62 ? 100 ILE D C   1 
ATOM   10764 O O   . ILE D 1 100 ? 31.923  24.530  109.208 1.00 22.07 ? 100 ILE D O   1 
ATOM   10765 C CB  . ILE D 1 100 ? 33.349  21.987  110.539 1.00 22.39 ? 100 ILE D CB  1 
ATOM   10766 C CG1 . ILE D 1 100 ? 34.875  22.194  110.677 1.00 23.20 ? 100 ILE D CG1 1 
ATOM   10767 C CG2 . ILE D 1 100 ? 32.919  20.546  110.955 1.00 23.94 ? 100 ILE D CG2 1 
ATOM   10768 C CD1 . ILE D 1 100 ? 35.402  22.069  112.145 1.00 23.30 ? 100 ILE D CD1 1 
ATOM   10769 N N   . HIS D 1 101 ? 33.975  24.361  108.284 1.00 23.44 ? 101 HIS D N   1 
ATOM   10770 C CA  . HIS D 1 101 ? 34.144  25.821  108.100 1.00 23.44 ? 101 HIS D CA  1 
ATOM   10771 C C   . HIS D 1 101 ? 34.077  26.226  106.631 1.00 23.94 ? 101 HIS D C   1 
ATOM   10772 O O   . HIS D 1 101 ? 34.448  27.341  106.295 1.00 21.58 ? 101 HIS D O   1 
ATOM   10773 C CB  . HIS D 1 101 ? 35.458  26.319  108.752 1.00 23.95 ? 101 HIS D CB  1 
ATOM   10774 C CG  . HIS D 1 101 ? 35.467  26.169  110.246 1.00 24.99 ? 101 HIS D CG  1 
ATOM   10775 N ND1 . HIS D 1 101 ? 36.570  25.746  110.958 1.00 30.56 ? 101 HIS D ND1 1 
ATOM   10776 C CD2 . HIS D 1 101 ? 34.463  26.279  111.150 1.00 23.78 ? 101 HIS D CD2 1 
ATOM   10777 C CE1 . HIS D 1 101 ? 36.267  25.669  112.245 1.00 26.48 ? 101 HIS D CE1 1 
ATOM   10778 N NE2 . HIS D 1 101 ? 34.985  25.963  112.382 1.00 28.50 ? 101 HIS D NE2 1 
ATOM   10779 N N   . TYR D 1 102 ? 33.679  25.306  105.746 1.00 22.74 ? 102 TYR D N   1 
ATOM   10780 C CA  . TYR D 1 102 ? 33.491  25.709  104.342 1.00 24.90 ? 102 TYR D CA  1 
ATOM   10781 C C   . TYR D 1 102 ? 32.308  26.661  104.328 1.00 25.97 ? 102 TYR D C   1 
ATOM   10782 O O   . TYR D 1 102 ? 31.526  26.698  105.282 1.00 26.65 ? 102 TYR D O   1 
ATOM   10783 C CB  . TYR D 1 102 ? 33.137  24.521  103.416 1.00 23.84 ? 102 TYR D CB  1 
ATOM   10784 C CG  . TYR D 1 102 ? 34.207  23.482  103.166 1.00 23.60 ? 102 TYR D CG  1 
ATOM   10785 C CD1 . TYR D 1 102 ? 33.959  22.386  102.307 1.00 21.53 ? 102 TYR D CD1 1 
ATOM   10786 C CD2 . TYR D 1 102 ? 35.468  23.571  103.768 1.00 24.87 ? 102 TYR D CD2 1 
ATOM   10787 C CE1 . TYR D 1 102 ? 34.942  21.431  102.066 1.00 22.87 ? 102 TYR D CE1 1 
ATOM   10788 C CE2 . TYR D 1 102 ? 36.462  22.620  103.516 1.00 22.79 ? 102 TYR D CE2 1 
ATOM   10789 C CZ  . TYR D 1 102 ? 36.196  21.560  102.684 1.00 22.90 ? 102 TYR D CZ  1 
ATOM   10790 O OH  . TYR D 1 102 ? 37.196  20.623  102.477 1.00 24.81 ? 102 TYR D OH  1 
ATOM   10791 N N   . PRO D 1 103 ? 32.204  27.489  103.272 1.00 27.27 ? 103 PRO D N   1 
ATOM   10792 C CA  . PRO D 1 103 ? 30.974  28.197  102.953 1.00 27.41 ? 103 PRO D CA  1 
ATOM   10793 C C   . PRO D 1 103 ? 29.778  27.255  102.848 1.00 27.13 ? 103 PRO D C   1 
ATOM   10794 O O   . PRO D 1 103 ? 29.936  26.116  102.415 1.00 26.58 ? 103 PRO D O   1 
ATOM   10795 C CB  . PRO D 1 103 ? 31.294  28.825  101.579 1.00 27.58 ? 103 PRO D CB  1 
ATOM   10796 C CG  . PRO D 1 103 ? 32.821  29.081  101.691 1.00 28.01 ? 103 PRO D CG  1 
ATOM   10797 C CD  . PRO D 1 103 ? 33.310  27.831  102.340 1.00 27.28 ? 103 PRO D CD  1 
ATOM   10798 N N   . PRO D 1 104 ? 28.585  27.716  103.267 1.00 27.63 ? 104 PRO D N   1 
ATOM   10799 C CA  . PRO D 1 104 ? 27.364  26.910  103.106 1.00 27.97 ? 104 PRO D CA  1 
ATOM   10800 C C   . PRO D 1 104 ? 27.250  26.345  101.695 1.00 28.14 ? 104 PRO D C   1 
ATOM   10801 O O   . PRO D 1 104 ? 27.103  25.136  101.535 1.00 27.95 ? 104 PRO D O   1 
ATOM   10802 C CB  . PRO D 1 104 ? 26.242  27.928  103.408 1.00 28.50 ? 104 PRO D CB  1 
ATOM   10803 C CG  . PRO D 1 104 ? 26.872  28.819  104.444 1.00 28.53 ? 104 PRO D CG  1 
ATOM   10804 C CD  . PRO D 1 104 ? 28.296  29.005  103.925 1.00 28.12 ? 104 PRO D CD  1 
ATOM   10805 N N   . SER D 1 105 ? 27.375  27.209  100.679 1.00 28.07 ? 105 SER D N   1 
ATOM   10806 C CA  . SER D 1 105 ? 27.185  26.859  99.266  1.00 28.22 ? 105 SER D CA  1 
ATOM   10807 C C   . SER D 1 105 ? 28.190  25.811  98.754  1.00 28.44 ? 105 SER D C   1 
ATOM   10808 O O   . SER D 1 105 ? 27.953  25.110  97.767  1.00 28.61 ? 105 SER D O   1 
ATOM   10809 C CB  . SER D 1 105 ? 27.267  28.143  98.423  1.00 29.03 ? 105 SER D CB  1 
ATOM   10810 O OG  . SER D 1 105 ? 28.639  28.433  98.136  1.00 31.39 ? 105 SER D OG  1 
ATOM   10811 N N   . GLN D 1 106 ? 29.282  25.669  99.493  1.00 28.70 ? 106 GLN D N   1 
ATOM   10812 C CA  . GLN D 1 106 ? 30.275  24.631  99.270  1.00 29.40 ? 106 GLN D CA  1 
ATOM   10813 C C   . GLN D 1 106 ? 30.174  23.423  100.203 1.00 29.66 ? 106 GLN D C   1 
ATOM   10814 O O   . GLN D 1 106 ? 31.133  22.695  100.340 1.00 30.11 ? 106 GLN D O   1 
ATOM   10815 C CB  . GLN D 1 106 ? 31.681  25.193  99.451  1.00 29.03 ? 106 GLN D CB  1 
ATOM   10816 C CG  . GLN D 1 106 ? 32.161  26.156  98.418  1.00 32.12 ? 106 GLN D CG  1 
ATOM   10817 C CD  . GLN D 1 106 ? 33.560  26.627  98.733  1.00 35.87 ? 106 GLN D CD  1 
ATOM   10818 O OE1 . GLN D 1 106 ? 33.911  27.752  98.458  1.00 33.93 ? 106 GLN D OE1 1 
ATOM   10819 N NE2 . GLN D 1 106 ? 34.352  25.755  99.327  1.00 37.63 ? 106 GLN D NE2 1 
ATOM   10820 N N   . GLY D 1 107 ? 29.044  23.200  100.846 1.00 29.54 ? 107 GLY D N   1 
ATOM   10821 C CA  . GLY D 1 107 ? 28.866  21.950  101.555 1.00 27.59 ? 107 GLY D CA  1 
ATOM   10822 C C   . GLY D 1 107 ? 29.312  21.922  102.999 1.00 25.28 ? 107 GLY D C   1 
ATOM   10823 O O   . GLY D 1 107 ? 29.600  20.866  103.533 1.00 24.03 ? 107 GLY D O   1 
ATOM   10824 N N   . GLN D 1 108 ? 29.350  23.089  103.623 1.00 23.96 ? 108 GLN D N   1 
ATOM   10825 C CA  . GLN D 1 108 ? 29.524  23.207  105.065 1.00 22.76 ? 108 GLN D CA  1 
ATOM   10826 C C   . GLN D 1 108 ? 28.701  22.162  105.809 1.00 22.66 ? 108 GLN D C   1 
ATOM   10827 O O   . GLN D 1 108 ? 27.541  21.940  105.488 1.00 23.68 ? 108 GLN D O   1 
ATOM   10828 C CB  . GLN D 1 108 ? 29.142  24.608  105.530 1.00 22.18 ? 108 GLN D CB  1 
ATOM   10829 C CG  . GLN D 1 108 ? 29.390  24.856  106.997 1.00 23.01 ? 108 GLN D CG  1 
ATOM   10830 C CD  . GLN D 1 108 ? 29.199  26.293  107.405 1.00 27.16 ? 108 GLN D CD  1 
ATOM   10831 O OE1 . GLN D 1 108 ? 29.862  26.768  108.301 1.00 33.07 ? 108 GLN D OE1 1 
ATOM   10832 N NE2 . GLN D 1 108 ? 28.291  26.967  106.769 1.00 26.03 ? 108 GLN D NE2 1 
ATOM   10833 N N   . MET D 1 109 ? 29.324  21.497  106.771 1.00 21.31 ? 109 MET D N   1 
ATOM   10834 C CA  . MET D 1 109 ? 28.633  20.480  107.587 1.00 20.48 ? 109 MET D CA  1 
ATOM   10835 C C   . MET D 1 109 ? 27.418  21.125  108.219 1.00 21.15 ? 109 MET D C   1 
ATOM   10836 O O   . MET D 1 109 ? 27.563  22.149  108.880 1.00 20.15 ? 109 MET D O   1 
ATOM   10837 C CB  . MET D 1 109 ? 29.522  19.980  108.728 1.00 20.26 ? 109 MET D CB  1 
ATOM   10838 C CG  . MET D 1 109 ? 28.904  18.735  109.469 1.00 20.88 ? 109 MET D CG  1 
ATOM   10839 S SD  . MET D 1 109 ? 29.786  18.328  110.990 1.00 25.53 ? 109 MET D SD  1 
ATOM   10840 C CE  . MET D 1 109 ? 29.058  19.588  112.051 1.00 31.72 ? 109 MET D CE  1 
ATOM   10841 N N   . ASP D 1 110 ? 26.247  20.520  107.998 1.00 20.75 ? 110 ASP D N   1 
ATOM   10842 C CA  . ASP D 1 110 ? 25.018  20.870  108.682 1.00 20.13 ? 110 ASP D CA  1 
ATOM   10843 C C   . ASP D 1 110 ? 24.436  19.571  109.227 1.00 18.87 ? 110 ASP D C   1 
ATOM   10844 O O   . ASP D 1 110 ? 24.866  18.492  108.827 1.00 19.34 ? 110 ASP D O   1 
ATOM   10845 C CB  . ASP D 1 110 ? 24.038  21.597  107.752 1.00 18.34 ? 110 ASP D CB  1 
ATOM   10846 C CG  . ASP D 1 110 ? 22.971  22.394  108.522 1.00 23.42 ? 110 ASP D CG  1 
ATOM   10847 O OD1 . ASP D 1 110 ? 22.972  22.396  109.798 1.00 22.97 ? 110 ASP D OD1 1 
ATOM   10848 O OD2 . ASP D 1 110 ? 22.098  23.011  107.846 1.00 24.41 ? 110 ASP D OD2 1 
ATOM   10849 N N   . LEU D 1 111 ? 23.493  19.686  110.157 1.00 18.20 ? 111 LEU D N   1 
ATOM   10850 C CA  . LEU D 1 111 ? 22.936  18.506  110.845 1.00 18.02 ? 111 LEU D CA  1 
ATOM   10851 C C   . LEU D 1 111 ? 21.477  18.788  111.159 1.00 18.39 ? 111 LEU D C   1 
ATOM   10852 O O   . LEU D 1 111 ? 21.104  19.936  111.508 1.00 15.89 ? 111 LEU D O   1 
ATOM   10853 C CB  . LEU D 1 111 ? 23.728  18.297  112.160 1.00 17.70 ? 111 LEU D CB  1 
ATOM   10854 C CG  . LEU D 1 111 ? 23.468  17.039  112.995 1.00 18.93 ? 111 LEU D CG  1 
ATOM   10855 C CD1 . LEU D 1 111 ? 24.747  16.528  113.668 1.00 18.29 ? 111 LEU D CD1 1 
ATOM   10856 C CD2 . LEU D 1 111 ? 22.292  17.184  114.002 1.00 15.56 ? 111 LEU D CD2 1 
ATOM   10857 N N   . CYS D 1 112 ? 20.646  17.758  111.032 1.00 18.47 ? 112 CYS D N   1 
ATOM   10858 C CA  . CYS D 1 112 ? 19.263  17.860  111.495 1.00 19.95 ? 112 CYS D CA  1 
ATOM   10859 C C   . CYS D 1 112 ? 18.857  16.616  112.259 1.00 18.03 ? 112 CYS D C   1 
ATOM   10860 O O   . CYS D 1 112 ? 19.215  15.512  111.891 1.00 17.53 ? 112 CYS D O   1 
ATOM   10861 C CB  . CYS D 1 112 ? 18.255  18.115  110.366 1.00 19.84 ? 112 CYS D CB  1 
ATOM   10862 S SG  . CYS D 1 112 ? 18.290  16.974  109.042 1.00 27.02 ? 112 CYS D SG  1 
ATOM   10863 N N   . VAL D 1 113 ? 18.110  16.832  113.322 1.00 18.12 ? 113 VAL D N   1 
ATOM   10864 C CA  . VAL D 1 113 ? 17.496  15.745  114.068 1.00 18.03 ? 113 VAL D CA  1 
ATOM   10865 C C   . VAL D 1 113 ? 16.318  15.253  113.224 1.00 17.69 ? 113 VAL D C   1 
ATOM   10866 O O   . VAL D 1 113 ? 15.589  16.057  112.644 1.00 17.80 ? 113 VAL D O   1 
ATOM   10867 C CB  . VAL D 1 113 ? 16.976  16.261  115.435 1.00 16.85 ? 113 VAL D CB  1 
ATOM   10868 C CG1 . VAL D 1 113 ? 16.361  15.145  116.289 1.00 15.48 ? 113 VAL D CG1 1 
ATOM   10869 C CG2 . VAL D 1 113 ? 18.106  17.039  116.181 1.00 17.58 ? 113 VAL D CG2 1 
ATOM   10870 N N   . THR D 1 114 ? 16.194  13.932  113.136 1.00 17.01 ? 114 THR D N   1 
ATOM   10871 C CA  . THR D 1 114 ? 15.174  13.277  112.365 1.00 18.17 ? 114 THR D CA  1 
ATOM   10872 C C   . THR D 1 114 ? 14.368  12.347  113.302 1.00 18.56 ? 114 THR D C   1 
ATOM   10873 O O   . THR D 1 114 ? 14.817  12.030  114.419 1.00 18.21 ? 114 THR D O   1 
ATOM   10874 C CB  . THR D 1 114 ? 15.805  12.489  111.156 1.00 18.10 ? 114 THR D CB  1 
ATOM   10875 O OG1 . THR D 1 114 ? 16.659  11.461  111.640 1.00 19.66 ? 114 THR D OG1 1 
ATOM   10876 C CG2 . THR D 1 114 ? 16.608  13.427  110.273 1.00 17.66 ? 114 THR D CG2 1 
ATOM   10877 N N   . SER D 1 115 ? 13.184  11.943  112.852 1.00 18.75 ? 115 SER D N   1 
ATOM   10878 C CA  . SER D 1 115 ? 12.287  11.120  113.629 1.00 19.75 ? 115 SER D CA  1 
ATOM   10879 C C   . SER D 1 115 ? 12.713  9.685   113.384 1.00 20.03 ? 115 SER D C   1 
ATOM   10880 O O   . SER D 1 115 ? 12.055  8.954   112.648 1.00 20.72 ? 115 SER D O   1 
ATOM   10881 C CB  . SER D 1 115 ? 10.819  11.420  113.251 1.00 19.77 ? 115 SER D CB  1 
ATOM   10882 O OG  . SER D 1 115 ? 10.491  12.765  113.640 1.00 20.22 ? 115 SER D OG  1 
ATOM   10883 N N   . GLY D 1 116 ? 13.857  9.319   113.969 1.00 19.20 ? 116 GLY D N   1 
ATOM   10884 C CA  . GLY D 1 116 ? 14.591  8.092   113.639 1.00 19.49 ? 116 GLY D CA  1 
ATOM   10885 C C   . GLY D 1 116 ? 15.584  8.319   112.504 1.00 20.12 ? 116 GLY D C   1 
ATOM   10886 O O   . GLY D 1 116 ? 15.390  9.238   111.679 1.00 20.19 ? 116 GLY D O   1 
ATOM   10887 N N   . SER D 1 117 ? 16.646  7.514   112.429 1.00 18.54 ? 117 SER D N   1 
ATOM   10888 C CA  . SER D 1 117 ? 17.583  7.679   111.320 1.00 18.97 ? 117 SER D CA  1 
ATOM   10889 C C   . SER D 1 117 ? 16.948  7.320   109.972 1.00 19.37 ? 117 SER D C   1 
ATOM   10890 O O   . SER D 1 117 ? 17.251  7.955   108.952 1.00 18.20 ? 117 SER D O   1 
ATOM   10891 C CB  . SER D 1 117 ? 18.922  6.952   111.508 1.00 19.57 ? 117 SER D CB  1 
ATOM   10892 O OG  . SER D 1 117 ? 18.808  5.544   111.336 1.00 20.30 ? 117 SER D OG  1 
ATOM   10893 N N   . GLN D 1 118 ? 16.083  6.305   109.951 1.00 18.56 ? 118 GLN D N   1 
ATOM   10894 C CA  . GLN D 1 118 ? 15.459  5.902   108.708 1.00 19.05 ? 118 GLN D CA  1 
ATOM   10895 C C   . GLN D 1 118 ? 14.711  7.089   108.020 1.00 17.90 ? 118 GLN D C   1 
ATOM   10896 O O   . GLN D 1 118 ? 14.617  7.161   106.785 1.00 16.70 ? 118 GLN D O   1 
ATOM   10897 C CB  . GLN D 1 118 ? 14.491  4.762   108.995 1.00 19.82 ? 118 GLN D CB  1 
ATOM   10898 C CG  . GLN D 1 118 ? 13.716  4.331   107.771 1.00 27.02 ? 118 GLN D CG  1 
ATOM   10899 C CD  . GLN D 1 118 ? 14.301  3.075   107.200 1.00 34.53 ? 118 GLN D CD  1 
ATOM   10900 O OE1 . GLN D 1 118 ? 15.519  2.914   107.175 1.00 38.48 ? 118 GLN D OE1 1 
ATOM   10901 N NE2 . GLN D 1 118 ? 13.434  2.140   106.803 1.00 37.97 ? 118 GLN D NE2 1 
ATOM   10902 N N   . GLN D 1 119 ? 14.172  8.015   108.798 1.00 17.34 ? 119 GLN D N   1 
ATOM   10903 C CA  . GLN D 1 119 ? 13.461  9.155   108.182 1.00 18.72 ? 119 GLN D CA  1 
ATOM   10904 C C   . GLN D 1 119 ? 14.408  9.995   107.349 1.00 18.73 ? 119 GLN D C   1 
ATOM   10905 O O   . GLN D 1 119 ? 14.075  10.340  106.221 1.00 18.82 ? 119 GLN D O   1 
ATOM   10906 C CB  . GLN D 1 119 ? 12.713  10.069  109.195 1.00 18.13 ? 119 GLN D CB  1 
ATOM   10907 C CG  . GLN D 1 119 ? 12.035  11.276  108.477 1.00 18.62 ? 119 GLN D CG  1 
ATOM   10908 C CD  . GLN D 1 119 ? 11.544  12.343  109.425 1.00 18.23 ? 119 GLN D CD  1 
ATOM   10909 O OE1 . GLN D 1 119 ? 12.240  12.726  110.354 1.00 22.57 ? 119 GLN D OE1 1 
ATOM   10910 N NE2 . GLN D 1 119 ? 10.332  12.826  109.184 1.00 21.38 ? 119 GLN D NE2 1 
ATOM   10911 N N   . GLY D 1 120 ? 15.561  10.333  107.931 1.00 18.88 ? 120 GLY D N   1 
ATOM   10912 C CA  . GLY D 1 120 ? 16.648  11.036  107.232 1.00 19.63 ? 120 GLY D CA  1 
ATOM   10913 C C   . GLY D 1 120 ? 17.050  10.279  105.971 1.00 20.53 ? 120 GLY D C   1 
ATOM   10914 O O   . GLY D 1 120 ? 17.160  10.896  104.909 1.00 19.63 ? 120 GLY D O   1 
ATOM   10915 N N   . LEU D 1 121 ? 17.269  8.957   106.068 1.00 18.86 ? 121 LEU D N   1 
ATOM   10916 C CA  . LEU D 1 121 ? 17.641  8.184   104.877 1.00 20.46 ? 121 LEU D CA  1 
ATOM   10917 C C   . LEU D 1 121 ? 16.551  8.216   103.830 1.00 19.42 ? 121 LEU D C   1 
ATOM   10918 O O   . LEU D 1 121 ? 16.800  8.385   102.614 1.00 19.64 ? 121 LEU D O   1 
ATOM   10919 C CB  . LEU D 1 121 ? 17.924  6.698   105.220 1.00 20.54 ? 121 LEU D CB  1 
ATOM   10920 C CG  . LEU D 1 121 ? 19.125  6.444   106.138 1.00 24.44 ? 121 LEU D CG  1 
ATOM   10921 C CD1 . LEU D 1 121 ? 19.002  5.100   106.787 1.00 28.59 ? 121 LEU D CD1 1 
ATOM   10922 C CD2 . LEU D 1 121 ? 20.376  6.484   105.307 1.00 29.55 ? 121 LEU D CD2 1 
ATOM   10923 N N   . CYS D 1 122 ? 15.335  7.993   104.278 1.00 18.49 ? 122 CYS D N   1 
ATOM   10924 C CA  . CYS D 1 122 ? 14.211  8.041   103.346 1.00 18.61 ? 122 CYS D CA  1 
ATOM   10925 C C   . CYS D 1 122 ? 14.118  9.406   102.632 1.00 18.62 ? 122 CYS D C   1 
ATOM   10926 O O   . CYS D 1 122 ? 13.981  9.435   101.415 1.00 18.95 ? 122 CYS D O   1 
ATOM   10927 C CB  . CYS D 1 122 ? 12.909  7.720   104.044 1.00 19.14 ? 122 CYS D CB  1 
ATOM   10928 S SG  . CYS D 1 122 ? 11.481  7.499   102.863 1.00 24.71 ? 122 CYS D SG  1 
ATOM   10929 N N   . LYS D 1 123 ? 14.236  10.528  103.350 1.00 18.27 ? 123 LYS D N   1 
ATOM   10930 C CA  . LYS D 1 123 ? 14.133  11.837  102.631 1.00 18.81 ? 123 LYS D CA  1 
ATOM   10931 C C   . LYS D 1 123 ? 15.329  12.060  101.678 1.00 17.80 ? 123 LYS D C   1 
ATOM   10932 O O   . LYS D 1 123 ? 15.208  12.741  100.671 1.00 16.29 ? 123 LYS D O   1 
ATOM   10933 C CB  . LYS D 1 123 ? 14.070  13.002  103.565 1.00 19.12 ? 123 LYS D CB  1 
ATOM   10934 C CG  . LYS D 1 123 ? 12.992  12.909  104.633 1.00 22.70 ? 123 LYS D CG  1 
ATOM   10935 C CD  . LYS D 1 123 ? 11.600  12.764  104.116 1.00 27.03 ? 123 LYS D CD  1 
ATOM   10936 C CE  . LYS D 1 123 ? 10.625  13.186  105.224 1.00 29.93 ? 123 LYS D CE  1 
ATOM   10937 N NZ  . LYS D 1 123 ? 9.197   12.981  104.820 1.00 33.24 ? 123 LYS D NZ  1 
ATOM   10938 N N   . VAL D 1 124 ? 16.499  11.534  102.059 1.00 17.23 ? 124 VAL D N   1 
ATOM   10939 C CA  . VAL D 1 124 ? 17.643  11.618  101.174 1.00 17.27 ? 124 VAL D CA  1 
ATOM   10940 C C   . VAL D 1 124 ? 17.384  10.861  99.860  1.00 16.17 ? 124 VAL D C   1 
ATOM   10941 O O   . VAL D 1 124 ? 17.656  11.390  98.773  1.00 16.15 ? 124 VAL D O   1 
ATOM   10942 C CB  . VAL D 1 124 ? 18.933  11.124  101.874 1.00 17.13 ? 124 VAL D CB  1 
ATOM   10943 C CG1 . VAL D 1 124 ? 20.001  10.813  100.861 1.00 15.81 ? 124 VAL D CG1 1 
ATOM   10944 C CG2 . VAL D 1 124 ? 19.419  12.171  102.888 1.00 16.02 ? 124 VAL D CG2 1 
ATOM   10945 N N   . PHE D 1 125 ? 16.917  9.619   99.967  1.00 16.67 ? 125 PHE D N   1 
ATOM   10946 C CA  . PHE D 1 125 ? 16.592  8.841   98.757  1.00 17.83 ? 125 PHE D CA  1 
ATOM   10947 C C   . PHE D 1 125 ? 15.613  9.614   97.891  1.00 18.07 ? 125 PHE D C   1 
ATOM   10948 O O   . PHE D 1 125 ? 15.813  9.677   96.674  1.00 20.20 ? 125 PHE D O   1 
ATOM   10949 C CB  . PHE D 1 125 ? 16.016  7.464   99.049  1.00 17.10 ? 125 PHE D CB  1 
ATOM   10950 C CG  . PHE D 1 125 ? 16.971  6.523   99.776  1.00 18.57 ? 125 PHE D CG  1 
ATOM   10951 C CD1 . PHE D 1 125 ? 16.456  5.553   100.640 1.00 19.60 ? 125 PHE D CD1 1 
ATOM   10952 C CD2 . PHE D 1 125 ? 18.360  6.634   99.648  1.00 20.04 ? 125 PHE D CD2 1 
ATOM   10953 C CE1 . PHE D 1 125 ? 17.295  4.720   101.374 1.00 19.37 ? 125 PHE D CE1 1 
ATOM   10954 C CE2 . PHE D 1 125 ? 19.220  5.765   100.381 1.00 19.29 ? 125 PHE D CE2 1 
ATOM   10955 C CZ  . PHE D 1 125 ? 18.670  4.806   101.227 1.00 20.11 ? 125 PHE D CZ  1 
ATOM   10956 N N   . GLU D 1 126 ? 14.571  10.197  98.500  1.00 17.86 ? 126 GLU D N   1 
ATOM   10957 C CA  . GLU D 1 126 ? 13.495  10.869  97.728  1.00 19.05 ? 126 GLU D CA  1 
ATOM   10958 C C   . GLU D 1 126 ? 14.011  12.132  97.081  1.00 18.31 ? 126 GLU D C   1 
ATOM   10959 O O   . GLU D 1 126 ? 13.551  12.512  95.998  1.00 19.34 ? 126 GLU D O   1 
ATOM   10960 C CB  . GLU D 1 126 ? 12.296  11.197  98.637  1.00 18.63 ? 126 GLU D CB  1 
ATOM   10961 C CG  . GLU D 1 126 ? 11.601  9.938   99.094  1.00 22.80 ? 126 GLU D CG  1 
ATOM   10962 C CD  . GLU D 1 126 ? 10.671  10.131  100.286 1.00 27.40 ? 126 GLU D CD  1 
ATOM   10963 O OE1 . GLU D 1 126 ? 9.747   9.284   100.441 1.00 28.18 ? 126 GLU D OE1 1 
ATOM   10964 O OE2 . GLU D 1 126 ? 10.877  11.100  101.074 1.00 28.45 ? 126 GLU D OE2 1 
ATOM   10965 N N   . MET D 1 127 ? 14.961  12.770  97.750  1.00 18.54 ? 127 MET D N   1 
ATOM   10966 C CA  . MET D 1 127 ? 15.603  13.999  97.266  1.00 19.89 ? 127 MET D CA  1 
ATOM   10967 C C   . MET D 1 127 ? 16.444  13.767  95.991  1.00 19.87 ? 127 MET D C   1 
ATOM   10968 O O   . MET D 1 127 ? 16.524  14.625  95.111  1.00 20.73 ? 127 MET D O   1 
ATOM   10969 C CB  . MET D 1 127 ? 16.529  14.535  98.366  1.00 18.74 ? 127 MET D CB  1 
ATOM   10970 C CG  . MET D 1 127 ? 17.345  15.789  98.000  1.00 18.50 ? 127 MET D CG  1 
ATOM   10971 S SD  . MET D 1 127 ? 18.648  16.219  99.211  1.00 20.38 ? 127 MET D SD  1 
ATOM   10972 C CE  . MET D 1 127 ? 19.724  14.762  99.042  1.00 19.16 ? 127 MET D CE  1 
ATOM   10973 N N   . ILE D 1 128 ? 17.041  12.590  95.898  1.00 20.18 ? 128 ILE D N   1 
ATOM   10974 C CA  . ILE D 1 128 ? 18.097  12.306  94.905  1.00 19.89 ? 128 ILE D CA  1 
ATOM   10975 C C   . ILE D 1 128 ? 17.531  11.606  93.682  1.00 20.59 ? 128 ILE D C   1 
ATOM   10976 O O   . ILE D 1 128 ? 17.875  11.963  92.538  1.00 20.00 ? 128 ILE D O   1 
ATOM   10977 C CB  . ILE D 1 128 ? 19.238  11.469  95.517  1.00 20.60 ? 128 ILE D CB  1 
ATOM   10978 C CG1 . ILE D 1 128 ? 19.945  12.291  96.604  1.00 18.46 ? 128 ILE D CG1 1 
ATOM   10979 C CG2 . ILE D 1 128 ? 20.286  11.028  94.413  1.00 22.73 ? 128 ILE D CG2 1 
ATOM   10980 C CD1 . ILE D 1 128 ? 21.000  11.492  97.454  1.00 18.19 ? 128 ILE D CD1 1 
ATOM   10981 N N   . ILE D 1 129 ? 16.690  10.607  93.926  1.00 21.46 ? 129 ILE D N   1 
ATOM   10982 C CA  . ILE D 1 129 ? 16.341  9.585   92.899  1.00 22.20 ? 129 ILE D CA  1 
ATOM   10983 C C   . ILE D 1 129 ? 15.191  9.921   91.900  1.00 22.86 ? 129 ILE D C   1 
ATOM   10984 O O   . ILE D 1 129 ? 14.053  10.125  92.311  1.00 24.58 ? 129 ILE D O   1 
ATOM   10985 C CB  . ILE D 1 129 ? 16.112  8.200   93.543  1.00 21.29 ? 129 ILE D CB  1 
ATOM   10986 C CG1 . ILE D 1 129 ? 17.403  7.699   94.193  1.00 21.39 ? 129 ILE D CG1 1 
ATOM   10987 C CG2 . ILE D 1 129 ? 15.650  7.158   92.485  1.00 21.57 ? 129 ILE D CG2 1 
ATOM   10988 C CD1 . ILE D 1 129 ? 17.181  6.517   95.186  1.00 23.31 ? 129 ILE D CD1 1 
ATOM   10989 N N   . ASN D 1 130 ? 15.528  9.974   90.600  1.00 22.92 ? 130 ASN D N   1 
ATOM   10990 C CA  . ASN D 1 130 ? 14.578  9.937   89.479  1.00 23.15 ? 130 ASN D CA  1 
ATOM   10991 C C   . ASN D 1 130 ? 14.476  8.506   88.989  1.00 23.37 ? 130 ASN D C   1 
ATOM   10992 O O   . ASN D 1 130 ? 15.448  7.776   89.079  1.00 23.47 ? 130 ASN D O   1 
ATOM   10993 C CB  . ASN D 1 130 ? 15.079  10.817  88.321  1.00 22.64 ? 130 ASN D CB  1 
ATOM   10994 C CG  . ASN D 1 130 ? 15.168  12.279  88.705  1.00 25.38 ? 130 ASN D CG  1 
ATOM   10995 O OD1 . ASN D 1 130 ? 14.242  12.816  89.322  1.00 25.67 ? 130 ASN D OD1 1 
ATOM   10996 N ND2 . ASN D 1 130 ? 16.290  12.922  88.386  1.00 25.39 ? 130 ASN D ND2 1 
ATOM   10997 N N   . PRO D 1 131 ? 13.304  8.078   88.489  1.00 24.56 ? 131 PRO D N   1 
ATOM   10998 C CA  . PRO D 1 131 ? 13.217  6.717   87.962  1.00 24.76 ? 131 PRO D CA  1 
ATOM   10999 C C   . PRO D 1 131 ? 14.319  6.416   86.904  1.00 25.39 ? 131 PRO D C   1 
ATOM   11000 O O   . PRO D 1 131 ? 14.578  7.245   86.006  1.00 25.32 ? 131 PRO D O   1 
ATOM   11001 C CB  . PRO D 1 131 ? 11.816  6.693   87.303  1.00 25.51 ? 131 PRO D CB  1 
ATOM   11002 C CG  . PRO D 1 131 ? 11.033  7.737   88.046  1.00 25.01 ? 131 PRO D CG  1 
ATOM   11003 C CD  . PRO D 1 131 ? 12.012  8.804   88.383  1.00 25.53 ? 131 PRO D CD  1 
ATOM   11004 N N   . GLY D 1 132 ? 14.979  5.261   87.014  1.00 26.09 ? 132 GLY D N   1 
ATOM   11005 C CA  . GLY D 1 132 ? 16.008  4.865   86.017  1.00 25.31 ? 132 GLY D CA  1 
ATOM   11006 C C   . GLY D 1 132 ? 17.407  5.289   86.414  1.00 24.44 ? 132 GLY D C   1 
ATOM   11007 O O   . GLY D 1 132 ? 18.373  4.872   85.789  1.00 25.07 ? 132 GLY D O   1 
ATOM   11008 N N   . ASP D 1 133 ? 17.535  6.121   87.454  1.00 23.53 ? 133 ASP D N   1 
ATOM   11009 C CA  . ASP D 1 133 ? 18.849  6.491   88.002  1.00 22.47 ? 133 ASP D CA  1 
ATOM   11010 C C   . ASP D 1 133 ? 19.581  5.245   88.530  1.00 22.69 ? 133 ASP D C   1 
ATOM   11011 O O   . ASP D 1 133 ? 18.953  4.363   89.067  1.00 23.98 ? 133 ASP D O   1 
ATOM   11012 C CB  . ASP D 1 133 ? 18.722  7.475   89.164  1.00 22.64 ? 133 ASP D CB  1 
ATOM   11013 C CG  . ASP D 1 133 ? 18.508  8.920   88.726  1.00 23.71 ? 133 ASP D CG  1 
ATOM   11014 O OD1 . ASP D 1 133 ? 18.549  9.216   87.484  1.00 22.34 ? 133 ASP D OD1 1 
ATOM   11015 O OD2 . ASP D 1 133 ? 18.308  9.752   89.660  1.00 21.92 ? 133 ASP D OD2 1 
ATOM   11016 N N   . ASN D 1 134 ? 20.896  5.207   88.358  1.00 22.43 ? 134 ASN D N   1 
ATOM   11017 C CA  . ASN D 1 134 ? 21.786  4.153   88.852  1.00 23.36 ? 134 ASN D CA  1 
ATOM   11018 C C   . ASN D 1 134 ? 22.325  4.467   90.245  1.00 22.59 ? 134 ASN D C   1 
ATOM   11019 O O   . ASN D 1 134 ? 22.760  5.587   90.512  1.00 23.38 ? 134 ASN D O   1 
ATOM   11020 C CB  . ASN D 1 134 ? 22.961  3.977   87.857  1.00 23.41 ? 134 ASN D CB  1 
ATOM   11021 C CG  . ASN D 1 134 ? 22.533  3.311   86.582  1.00 24.46 ? 134 ASN D CG  1 
ATOM   11022 O OD1 . ASN D 1 134 ? 21.844  2.280   86.609  1.00 21.27 ? 134 ASN D OD1 1 
ATOM   11023 N ND2 . ASN D 1 134 ? 22.941  3.878   85.451  1.00 24.14 ? 134 ASN D ND2 1 
ATOM   11024 N N   . VAL D 1 135 ? 22.250  3.487   91.148  1.00 23.83 ? 135 VAL D N   1 
ATOM   11025 C CA  . VAL D 1 135 ? 22.762  3.627   92.506  1.00 22.57 ? 135 VAL D CA  1 
ATOM   11026 C C   . VAL D 1 135 ? 23.504  2.333   92.859  1.00 22.47 ? 135 VAL D C   1 
ATOM   11027 O O   . VAL D 1 135 ? 23.203  1.252   92.325  1.00 22.18 ? 135 VAL D O   1 
ATOM   11028 C CB  . VAL D 1 135 ? 21.627  3.941   93.585  1.00 24.26 ? 135 VAL D CB  1 
ATOM   11029 C CG1 . VAL D 1 135 ? 20.752  5.160   93.182  1.00 22.42 ? 135 VAL D CG1 1 
ATOM   11030 C CG2 . VAL D 1 135 ? 20.757  2.755   93.867  1.00 23.61 ? 135 VAL D CG2 1 
ATOM   11031 N N   . LEU D 1 136 ? 24.480  2.483   93.736  1.00 21.29 ? 136 LEU D N   1 
ATOM   11032 C CA  . LEU D 1 136 ? 25.371  1.453   94.140  1.00 21.08 ? 136 LEU D CA  1 
ATOM   11033 C C   . LEU D 1 136 ? 25.127  1.070   95.613  1.00 21.52 ? 136 LEU D C   1 
ATOM   11034 O O   . LEU D 1 136 ? 24.964  1.929   96.459  1.00 19.26 ? 136 LEU D O   1 
ATOM   11035 C CB  . LEU D 1 136 ? 26.790  1.981   93.972  1.00 20.31 ? 136 LEU D CB  1 
ATOM   11036 C CG  . LEU D 1 136 ? 27.210  2.399   92.545  1.00 21.42 ? 136 LEU D CG  1 
ATOM   11037 C CD1 . LEU D 1 136 ? 28.309  3.387   92.695  1.00 17.94 ? 136 LEU D CD1 1 
ATOM   11038 C CD2 . LEU D 1 136 ? 27.682  1.156   91.783  1.00 19.45 ? 136 LEU D CD2 1 
ATOM   11039 N N   . LEU D 1 137 ? 25.083  -0.227  95.872  1.00 20.39 ? 137 LEU D N   1 
ATOM   11040 C CA  . LEU D 1 137 ? 25.273  -0.742  97.205  1.00 22.63 ? 137 LEU D CA  1 
ATOM   11041 C C   . LEU D 1 137 ? 25.713  -2.207  97.234  1.00 22.59 ? 137 LEU D C   1 
ATOM   11042 O O   . LEU D 1 137 ? 25.667  -2.884  96.226  1.00 23.00 ? 137 LEU D O   1 
ATOM   11043 C CB  . LEU D 1 137 ? 24.037  -0.490  98.071  1.00 22.62 ? 137 LEU D CB  1 
ATOM   11044 C CG  . LEU D 1 137 ? 22.761  -1.330  98.060  1.00 26.94 ? 137 LEU D CG  1 
ATOM   11045 C CD1 . LEU D 1 137 ? 21.536  -0.538  97.815  1.00 30.20 ? 137 LEU D CD1 1 
ATOM   11046 C CD2 . LEU D 1 137 ? 22.800  -2.542  97.210  1.00 29.19 ? 137 LEU D CD2 1 
ATOM   11047 N N   . ASP D 1 138 ? 26.165  -2.665  98.397  1.00 22.87 ? 138 ASP D N   1 
ATOM   11048 C CA  . ASP D 1 138 ? 26.550  -4.073  98.578  1.00 23.21 ? 138 ASP D CA  1 
ATOM   11049 C C   . ASP D 1 138 ? 25.375  -4.871  99.146  1.00 23.87 ? 138 ASP D C   1 
ATOM   11050 O O   . ASP D 1 138 ? 24.847  -4.510  100.201 1.00 22.88 ? 138 ASP D O   1 
ATOM   11051 C CB  . ASP D 1 138 ? 27.780  -4.178  99.538  1.00 22.13 ? 138 ASP D CB  1 
ATOM   11052 C CG  . ASP D 1 138 ? 27.563  -3.452  100.875 1.00 24.86 ? 138 ASP D CG  1 
ATOM   11053 O OD1 . ASP D 1 138 ? 27.219  -2.245  100.895 1.00 25.73 ? 138 ASP D OD1 1 
ATOM   11054 O OD2 . ASP D 1 138 ? 27.721  -4.089  101.935 1.00 25.31 ? 138 ASP D OD2 1 
ATOM   11055 N N   . GLU D 1 139 ? 24.958  -5.941  98.458  1.00 23.62 ? 139 GLU D N   1 
ATOM   11056 C CA  . GLU D 1 139 ? 23.989  -6.909  99.019  1.00 24.92 ? 139 GLU D CA  1 
ATOM   11057 C C   . GLU D 1 139 ? 24.786  -8.062  99.695  1.00 24.90 ? 139 GLU D C   1 
ATOM   11058 O O   . GLU D 1 139 ? 25.863  -8.404  99.216  1.00 25.16 ? 139 GLU D O   1 
ATOM   11059 C CB  . GLU D 1 139 ? 23.085  -7.513  97.929  1.00 25.38 ? 139 GLU D CB  1 
ATOM   11060 C CG  . GLU D 1 139 ? 22.145  -6.540  97.199  1.00 27.56 ? 139 GLU D CG  1 
ATOM   11061 C CD  . GLU D 1 139 ? 21.542  -7.146  95.926  1.00 28.93 ? 139 GLU D CD  1 
ATOM   11062 O OE1 . GLU D 1 139 ? 20.709  -8.072  95.989  1.00 26.10 ? 139 GLU D OE1 1 
ATOM   11063 O OE2 . GLU D 1 139 ? 21.897  -6.678  94.817  1.00 39.71 ? 139 GLU D OE2 1 
ATOM   11064 N N   . PRO D 1 140 ? 24.243  -8.693  100.760 1.00 24.81 ? 140 PRO D N   1 
ATOM   11065 C CA  . PRO D 1 140 ? 22.921  -8.431  101.382 1.00 24.01 ? 140 PRO D CA  1 
ATOM   11066 C C   . PRO D 1 140 ? 22.889  -7.052  102.075 1.00 23.69 ? 140 PRO D C   1 
ATOM   11067 O O   . PRO D 1 140 ? 23.905  -6.617  102.669 1.00 22.49 ? 140 PRO D O   1 
ATOM   11068 C CB  . PRO D 1 140 ? 22.748  -9.576  102.381 1.00 24.80 ? 140 PRO D CB  1 
ATOM   11069 C CG  . PRO D 1 140 ? 24.112  -10.096 102.621 1.00 25.27 ? 140 PRO D CG  1 
ATOM   11070 C CD  . PRO D 1 140 ? 24.962  -9.810  101.418 1.00 24.53 ? 140 PRO D CD  1 
ATOM   11071 N N   . ALA D 1 141 ? 21.742  -6.375  101.956 1.00 22.97 ? 141 ALA D N   1 
ATOM   11072 C CA  . ALA D 1 141 ? 21.584  -4.995  102.459 1.00 22.64 ? 141 ALA D CA  1 
ATOM   11073 C C   . ALA D 1 141 ? 20.400  -4.958  103.409 1.00 22.86 ? 141 ALA D C   1 
ATOM   11074 O O   . ALA D 1 141 ? 19.577  -5.869  103.398 1.00 22.71 ? 141 ALA D O   1 
ATOM   11075 C CB  . ALA D 1 141 ? 21.383  -4.015  101.306 1.00 21.77 ? 141 ALA D CB  1 
ATOM   11076 N N   . TYR D 1 142 ? 20.325  -3.922  104.248 1.00 22.33 ? 142 TYR D N   1 
ATOM   11077 C CA  . TYR D 1 142 ? 19.193  -3.748  105.152 1.00 24.00 ? 142 TYR D CA  1 
ATOM   11078 C C   . TYR D 1 142 ? 17.843  -3.789  104.388 1.00 24.17 ? 142 TYR D C   1 
ATOM   11079 O O   . TYR D 1 142 ? 17.671  -3.083  103.417 1.00 22.34 ? 142 TYR D O   1 
ATOM   11080 C CB  . TYR D 1 142 ? 19.387  -2.443  105.955 1.00 25.63 ? 142 TYR D CB  1 
ATOM   11081 C CG  . TYR D 1 142 ? 18.187  -1.947  106.752 1.00 26.44 ? 142 TYR D CG  1 
ATOM   11082 C CD1 . TYR D 1 142 ? 17.459  -2.786  107.575 1.00 29.93 ? 142 TYR D CD1 1 
ATOM   11083 C CD2 . TYR D 1 142 ? 17.803  -0.603  106.676 1.00 30.22 ? 142 TYR D CD2 1 
ATOM   11084 C CE1 . TYR D 1 142 ? 16.357  -2.303  108.289 1.00 30.42 ? 142 TYR D CE1 1 
ATOM   11085 C CE2 . TYR D 1 142 ? 16.713  -0.121  107.379 1.00 30.22 ? 142 TYR D CE2 1 
ATOM   11086 C CZ  . TYR D 1 142 ? 16.006  -0.974  108.179 1.00 28.85 ? 142 TYR D CZ  1 
ATOM   11087 O OH  . TYR D 1 142 ? 14.935  -0.477  108.888 1.00 35.16 ? 142 TYR D OH  1 
ATOM   11088 N N   . SER D 1 143 ? 16.904  -4.636  104.811 1.00 24.65 ? 143 SER D N   1 
ATOM   11089 C CA  . SER D 1 143 ? 15.668  -4.796  104.069 1.00 25.14 ? 143 SER D CA  1 
ATOM   11090 C C   . SER D 1 143 ? 14.861  -3.492  103.951 1.00 25.13 ? 143 SER D C   1 
ATOM   11091 O O   . SER D 1 143 ? 14.212  -3.256  102.920 1.00 24.19 ? 143 SER D O   1 
ATOM   11092 C CB  . SER D 1 143 ? 14.798  -5.891  104.676 1.00 26.05 ? 143 SER D CB  1 
ATOM   11093 O OG  . SER D 1 143 ? 14.555  -5.615  106.051 1.00 32.26 ? 143 SER D OG  1 
ATOM   11094 N N   . GLY D 1 144 ? 14.865  -2.685  105.004 1.00 22.99 ? 144 GLY D N   1 
ATOM   11095 C CA  . GLY D 1 144 ? 14.237  -1.353  104.979 1.00 23.25 ? 144 GLY D CA  1 
ATOM   11096 C C   . GLY D 1 144 ? 14.734  -0.405  103.891 1.00 22.28 ? 144 GLY D C   1 
ATOM   11097 O O   . GLY D 1 144 ? 13.927  0.300   103.259 1.00 23.07 ? 144 GLY D O   1 
ATOM   11098 N N   . THR D 1 145 ? 16.047  -0.364  103.637 1.00 22.97 ? 145 THR D N   1 
ATOM   11099 C CA  . THR D 1 145 ? 16.519  0.427   102.496 1.00 23.45 ? 145 THR D CA  1 
ATOM   11100 C C   . THR D 1 145 ? 16.062  -0.135  101.139 1.00 22.29 ? 145 THR D C   1 
ATOM   11101 O O   . THR D 1 145 ? 15.635  0.629   100.293 1.00 20.42 ? 145 THR D O   1 
ATOM   11102 C CB  . THR D 1 145 ? 18.037  0.773   102.504 1.00 25.00 ? 145 THR D CB  1 
ATOM   11103 O OG1 . THR D 1 145 ? 18.774  -0.305  101.955 1.00 35.07 ? 145 THR D OG1 1 
ATOM   11104 C CG2 . THR D 1 145 ? 18.553  1.095   103.917 1.00 22.00 ? 145 THR D CG2 1 
ATOM   11105 N N   . LEU D 1 146 ? 16.140  -1.475  100.962 1.00 20.89 ? 146 LEU D N   1 
ATOM   11106 C CA  . LEU D 1 146 ? 15.651  -2.129  99.765  1.00 20.44 ? 146 LEU D CA  1 
ATOM   11107 C C   . LEU D 1 146 ? 14.183  -1.829  99.535  1.00 21.17 ? 146 LEU D C   1 
ATOM   11108 O O   . LEU D 1 146 ? 13.787  -1.580  98.393  1.00 19.93 ? 146 LEU D O   1 
ATOM   11109 C CB  . LEU D 1 146 ? 15.881  -3.671  99.798  1.00 19.90 ? 146 LEU D CB  1 
ATOM   11110 C CG  . LEU D 1 146 ? 17.337  -4.195  99.973  1.00 20.05 ? 146 LEU D CG  1 
ATOM   11111 C CD1 . LEU D 1 146 ? 17.406  -5.712  99.819  1.00 19.78 ? 146 LEU D CD1 1 
ATOM   11112 C CD2 . LEU D 1 146 ? 18.310  -3.625  99.001  1.00 19.88 ? 146 LEU D CD2 1 
ATOM   11113 N N   . GLN D 1 147 ? 13.373  -1.905  100.597 1.00 20.30 ? 147 GLN D N   1 
ATOM   11114 C CA  . GLN D 1 147 ? 11.938  -1.549  100.441 1.00 22.94 ? 147 GLN D CA  1 
ATOM   11115 C C   . GLN D 1 147 ? 11.710  -0.049  100.171 1.00 20.92 ? 147 GLN D C   1 
ATOM   11116 O O   . GLN D 1 147 ? 10.705  0.329   99.540  1.00 20.21 ? 147 GLN D O   1 
ATOM   11117 C CB  . GLN D 1 147 ? 11.080  -2.020  101.636 1.00 23.38 ? 147 GLN D CB  1 
ATOM   11118 C CG  . GLN D 1 147 ? 10.678  -3.521  101.644 1.00 30.73 ? 147 GLN D CG  1 
ATOM   11119 C CD  . GLN D 1 147 ? 10.722  -4.188  100.254 1.00 40.19 ? 147 GLN D CD  1 
ATOM   11120 O OE1 . GLN D 1 147 ? 9.859   -3.950  99.380  1.00 41.57 ? 147 GLN D OE1 1 
ATOM   11121 N NE2 . GLN D 1 147 ? 11.744  -5.038  100.046 1.00 42.93 ? 147 GLN D NE2 1 
ATOM   11122 N N   . SER D 1 148 ? 12.628  0.792   100.640 1.00 20.63 ? 148 SER D N   1 
ATOM   11123 C CA  . SER D 1 148 ? 12.565  2.238   100.363 1.00 21.58 ? 148 SER D CA  1 
ATOM   11124 C C   . SER D 1 148 ? 12.983  2.580   98.911  1.00 21.51 ? 148 SER D C   1 
ATOM   11125 O O   . SER D 1 148 ? 12.369  3.460   98.246  1.00 22.06 ? 148 SER D O   1 
ATOM   11126 C CB  . SER D 1 148 ? 13.426  2.990   101.358 1.00 20.06 ? 148 SER D CB  1 
ATOM   11127 O OG  . SER D 1 148 ? 13.316  4.375   101.141 1.00 28.61 ? 148 SER D OG  1 
ATOM   11128 N N   . LEU D 1 149 ? 13.979  1.870   98.400  1.00 21.86 ? 149 LEU D N   1 
ATOM   11129 C CA  . LEU D 1 149 ? 14.514  2.152   97.054  1.00 21.74 ? 149 LEU D CA  1 
ATOM   11130 C C   . LEU D 1 149 ? 13.680  1.618   95.927  1.00 22.50 ? 149 LEU D C   1 
ATOM   11131 O O   . LEU D 1 149 ? 13.703  2.143   94.840  1.00 24.10 ? 149 LEU D O   1 
ATOM   11132 C CB  . LEU D 1 149 ? 15.934  1.630   96.904  1.00 21.08 ? 149 LEU D CB  1 
ATOM   11133 C CG  . LEU D 1 149 ? 17.013  2.325   97.787  1.00 21.63 ? 149 LEU D CG  1 
ATOM   11134 C CD1 . LEU D 1 149 ? 18.263  1.498   97.710  1.00 18.87 ? 149 LEU D CD1 1 
ATOM   11135 C CD2 . LEU D 1 149 ? 17.307  3.819   97.395  1.00 19.65 ? 149 LEU D CD2 1 
ATOM   11136 N N   . HIS D 1 150 ? 12.941  0.552   96.194  1.00 23.35 ? 150 HIS D N   1 
ATOM   11137 C CA  . HIS D 1 150 ? 12.216  -0.160  95.163  1.00 23.69 ? 150 HIS D CA  1 
ATOM   11138 C C   . HIS D 1 150 ? 11.143  0.719   94.464  1.00 23.25 ? 150 HIS D C   1 
ATOM   11139 O O   . HIS D 1 150 ? 11.100  0.763   93.248  1.00 23.35 ? 150 HIS D O   1 
ATOM   1114