data_2R32
# 
_entry.id   2R32 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2R32         
RCSB  RCSB044362   
WWPDB D_1000044362 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2q1m . unspecified 
PDB 2R30 . unspecified 
# 
_pdbx_database_status.entry_id                        2R32 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chattopadhyay, K.' 1 
'Ramagopal, U.A.'   2 
'Nathenson, S.G.'   3 
'Almo, S.C.'        4 
# 
_citation.id                        primary 
_citation.title                     
'Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            104 
_citation.page_first                19452 
_citation.page_last                 19457 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18040044 
_citation.pdbx_database_id_DOI      10.1073/pnas.0709264104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chattopadhyay, K.'  1 
primary 'Ramagopal, U.A.'    2 
primary 'Mukhopadhaya, A.'   3 
primary 'Malashkevich, V.N.' 4 
primary 'Dilorenzo, T.P.'    5 
primary 'Brenowitz, M.'      6 
primary 'Nathenson, S.G.'    7 
primary 'Almo, S.C.'         8 
# 
_cell.length_a           61.219 
_cell.length_b           61.219 
_cell.length_c           113.948 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           2R32 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              9 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.entry_id                         2R32 
_symmetry.Int_Tables_number                146 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein' 18917.713 1  ? ? 
'TNF homology domain' ? 
2 non-polymer syn 'SULFATE ION'                                                                96.063    1  ? ? ? ? 
3 water       nat water                                                                        18.015    48 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glucocorticoid-induced TNF-related ligand, hGITRL, Activation-inducible TNF-related ligand, AITRL' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMGGSRMKQIEDKIEEILSKIYHIENEIARIKKLIGERETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQ
NGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLA
NPQFIS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMGGSRMKQIEDKIEEILSKIYHIENEIARIKKLIGERETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQ
NGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLA
NPQFIS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLY n 
1 6   GLY n 
1 7   SER n 
1 8   ARG n 
1 9   MET n 
1 10  LYS n 
1 11  GLN n 
1 12  ILE n 
1 13  GLU n 
1 14  ASP n 
1 15  LYS n 
1 16  ILE n 
1 17  GLU n 
1 18  GLU n 
1 19  ILE n 
1 20  LEU n 
1 21  SER n 
1 22  LYS n 
1 23  ILE n 
1 24  TYR n 
1 25  HIS n 
1 26  ILE n 
1 27  GLU n 
1 28  ASN n 
1 29  GLU n 
1 30  ILE n 
1 31  ALA n 
1 32  ARG n 
1 33  ILE n 
1 34  LYS n 
1 35  LYS n 
1 36  LEU n 
1 37  ILE n 
1 38  GLY n 
1 39  GLU n 
1 40  ARG n 
1 41  GLU n 
1 42  THR n 
1 43  ALA n 
1 44  LYS n 
1 45  GLU n 
1 46  PRO n 
1 47  CYS n 
1 48  MET n 
1 49  ALA n 
1 50  LYS n 
1 51  PHE n 
1 52  GLY n 
1 53  PRO n 
1 54  LEU n 
1 55  PRO n 
1 56  SER n 
1 57  LYS n 
1 58  TRP n 
1 59  GLN n 
1 60  MET n 
1 61  ALA n 
1 62  SER n 
1 63  SER n 
1 64  GLU n 
1 65  PRO n 
1 66  PRO n 
1 67  CYS n 
1 68  VAL n 
1 69  ASN n 
1 70  LYS n 
1 71  VAL n 
1 72  SER n 
1 73  ASP n 
1 74  TRP n 
1 75  LYS n 
1 76  LEU n 
1 77  GLU n 
1 78  ILE n 
1 79  LEU n 
1 80  GLN n 
1 81  ASN n 
1 82  GLY n 
1 83  LEU n 
1 84  TYR n 
1 85  LEU n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLN n 
1 90  VAL n 
1 91  ALA n 
1 92  PRO n 
1 93  ASN n 
1 94  ALA n 
1 95  ASN n 
1 96  TYR n 
1 97  ASN n 
1 98  ASP n 
1 99  VAL n 
1 100 ALA n 
1 101 PRO n 
1 102 PHE n 
1 103 GLU n 
1 104 VAL n 
1 105 ARG n 
1 106 LEU n 
1 107 TYR n 
1 108 LYS n 
1 109 ASN n 
1 110 LYS n 
1 111 ASP n 
1 112 MET n 
1 113 ILE n 
1 114 GLN n 
1 115 THR n 
1 116 LEU n 
1 117 THR n 
1 118 ASN n 
1 119 LYS n 
1 120 SER n 
1 121 LYS n 
1 122 ILE n 
1 123 GLN n 
1 124 ASN n 
1 125 VAL n 
1 126 GLY n 
1 127 GLY n 
1 128 THR n 
1 129 TYR n 
1 130 GLU n 
1 131 LEU n 
1 132 HIS n 
1 133 VAL n 
1 134 GLY n 
1 135 ASP n 
1 136 THR n 
1 137 ILE n 
1 138 ASP n 
1 139 LEU n 
1 140 ILE n 
1 141 PHE n 
1 142 ASN n 
1 143 SER n 
1 144 GLU n 
1 145 HIS n 
1 146 GLN n 
1 147 VAL n 
1 148 LEU n 
1 149 LYS n 
1 150 ASN n 
1 151 ASN n 
1 152 THR n 
1 153 TYR n 
1 154 TRP n 
1 155 GLY n 
1 156 ILE n 
1 157 ILE n 
1 158 LEU n 
1 159 LEU n 
1 160 ALA n 
1 161 ASN n 
1 162 PRO n 
1 163 GLN n 
1 164 PHE n 
1 165 ILE n 
1 166 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast, human
;
_entity_src_gen.gene_src_genus                     'Saccharomyces, Homo' 
_entity_src_gen.pdbx_gene_src_gene                 'TNFSF18, AITRL, GITRL, TL6' 
_entity_src_gen.gene_src_species                   , 
_entity_src_gen.gene_src_strain                    , 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae, Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932,9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-14b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNF18_HUMAN 
_struct_ref.pdbx_db_accession          Q9UNG2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKS
KIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
;
_struct_ref.pdbx_align_begin           52 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2R32 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 41 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 166 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UNG2 
_struct_ref_seq.db_align_beg                  52 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  177 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       52 
_struct_ref_seq.pdbx_auth_seq_align_end       177 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2R32 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    '2.0 M Ammonium Sulphate, Vapor diffusion, Sitting drop, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-04-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.072 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        1.072 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     2R32 
_reflns.d_resolution_high            1.950 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   11656 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_netI_over_sigmaI        13.400 
_reflns.pdbx_chi_squared             1.142 
_reflns.pdbx_redundancy              5.900 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   11656 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.95 2.02  ? ? ? 0.491 ? ? 0.708 5.70 ? 1165 99.60  ? 1  
2.02 2.10  ? ? ? 0.346 ? ? 0.807 6.00 ? 1152 100.00 ? 2  
2.10 2.20  ? ? ? 0.264 ? ? 0.909 6.00 ? 1181 100.00 ? 3  
2.20 2.31  ? ? ? 0.196 ? ? 1.083 6.00 ? 1144 100.00 ? 4  
2.31 2.46  ? ? ? 0.155 ? ? 1.186 6.10 ? 1199 100.00 ? 5  
2.46 2.65  ? ? ? 0.118 ? ? 1.279 6.10 ? 1166 100.00 ? 6  
2.65 2.91  ? ? ? 0.084 ? ? 1.283 6.00 ? 1154 100.00 ? 7  
2.91 3.33  ? ? ? 0.064 ? ? 1.239 6.00 ? 1162 100.00 ? 8  
3.33 4.20  ? ? ? 0.059 ? ? 1.386 5.80 ? 1170 100.00 ? 9  
4.20 50.00 ? ? ? 0.074 ? ? 1.550 5.60 ? 1163 98.90  ? 10 
# 
_refine.entry_id                                 2R32 
_refine.ls_d_res_high                            1.950 
_refine.ls_d_res_low                             48.060 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.850 
_refine.ls_number_reflns_obs                     11656 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_percent_reflns_R_free                 4.800 
_refine.ls_number_reflns_R_free                  554 
_refine.B_iso_mean                               47.232 
_refine.aniso_B[1][1]                            -1.190 
_refine.aniso_B[2][2]                            -1.190 
_refine.aniso_B[3][3]                            1.790 
_refine.aniso_B[1][2]                            -0.600 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.pdbx_overall_ESU_R                       0.169 
_refine.pdbx_overall_ESU_R_Free                  0.158 
_refine.overall_SU_ML                            0.109 
_refine.overall_SU_B                             3.693 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     11656 
_refine.ls_R_factor_all                          0.201 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      2q1m 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1125 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               1178 
_refine_hist.d_res_high                       1.950 
_refine_hist.d_res_low                        48.060 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1153 0.013  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1558 1.534  1.960  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   136  6.531  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   50   33.435 25.600 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   211  18.103 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   3    22.244 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           175  0.103  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     831  0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            454  0.220  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          779  0.326  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    94   0.139  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   56   0.203  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 17   0.225  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              722  4.537  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1130 5.946  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              499  4.736  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             428  6.254  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.947 
_refine_ls_shell.d_res_low                        1.997 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.540 
_refine_ls_shell.number_reflns_R_work             813 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.218 
_refine_ls_shell.R_factor_R_free                  0.324 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                860 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2R32 
_struct.title                     'Crystal Structure of human GITRL variant' 
_struct.pdbx_descriptor           'GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2R32 
_struct_keywords.text            
'GITRL, Glucocorticoid-Induced TNF Receptor Ligand, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The biological unit is a trimer' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 8   ? LEU A 36  ? ARG A 19  LEU A 47  1 ? 29 
HELX_P HELX_P2 2 SER A 143 ? VAL A 147 ? SER A 154 VAL A 158 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            47 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            67 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             58 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             78 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.020 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 52 A . ? GLY 63 A PRO 53 A ? PRO 64 A 1 -0.93 
2 LEU 54 A . ? LEU 65 A PRO 55 A ? PRO 66 A 1 15.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 58  ? ALA A 61  ? TRP A 69  ALA A 72  
A 2 MET A 48  ? PHE A 51  ? MET A 59  PHE A 62  
A 3 TYR A 153 ? ALA A 160 ? TYR A 164 ALA A 171 
A 4 GLY A 82  ? VAL A 90  ? GLY A 93  VAL A 101 
A 5 GLN A 123 ? ASN A 124 ? GLN A 134 ASN A 135 
B 1 TRP A 58  ? ALA A 61  ? TRP A 69  ALA A 72  
B 2 MET A 48  ? PHE A 51  ? MET A 59  PHE A 62  
B 3 TYR A 153 ? ALA A 160 ? TYR A 164 ALA A 171 
B 4 GLY A 82  ? VAL A 90  ? GLY A 93  VAL A 101 
B 5 GLY A 127 ? LEU A 131 ? GLY A 138 LEU A 142 
C 1 VAL A 68  ? SER A 72  ? VAL A 79  SER A 83  
C 2 LYS A 75  ? ILE A 78  ? LYS A 86  ILE A 89  
C 3 THR A 136 ? PHE A 141 ? THR A 147 PHE A 152 
C 4 VAL A 104 ? LYS A 108 ? VAL A 115 LYS A 119 
C 5 ASP A 111 ? LEU A 116 ? ASP A 122 LEU A 127 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 59  ? O GLN A 70  N LYS A 50  ? N LYS A 61  
A 2 3 N PHE A 51  ? N PHE A 62  O TRP A 154 ? O TRP A 165 
A 3 4 O ALA A 160 ? O ALA A 171 N LEU A 83  ? N LEU A 94  
A 4 5 N VAL A 90  ? N VAL A 101 O GLN A 123 ? O GLN A 134 
B 1 2 O GLN A 59  ? O GLN A 70  N LYS A 50  ? N LYS A 61  
B 2 3 N PHE A 51  ? N PHE A 62  O TRP A 154 ? O TRP A 165 
B 3 4 O ALA A 160 ? O ALA A 171 N LEU A 83  ? N LEU A 94  
B 4 5 N TYR A 84  ? N TYR A 95  O TYR A 129 ? O TYR A 140 
C 1 2 N ASN A 69  ? N ASN A 80  O GLU A 77  ? O GLU A 88  
C 2 3 N LEU A 76  ? N LEU A 87  O ILE A 137 ? O ILE A 148 
C 3 4 O ASP A 138 ? O ASP A 149 N TYR A 107 ? N TYR A 118 
C 4 5 N LEU A 106 ? N LEU A 117 O ILE A 113 ? O ILE A 124 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 25 ? HIS A 36  . ? 1_555 ? 
2 AC1 4 ASN A 28 ? ASN A 39  . ? 1_555 ? 
3 AC1 4 ARG A 32 ? ARG A 43  . ? 1_555 ? 
4 AC1 4 HOH C .  ? HOH A 183 . ? 6_445 ? 
# 
_atom_sites.entry_id                    2R32 
_atom_sites.fract_transf_matrix[1][1]   0.016335 
_atom_sites.fract_transf_matrix[1][2]   0.009431 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018862 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008776 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 8   ? 6.081   -30.471 67.350  1.00 86.76 ? 19  ARG A N   1 
ATOM   2    C CA  . ARG A 1 8   ? 6.074   -31.670 66.460  1.00 85.25 ? 19  ARG A CA  1 
ATOM   3    C C   . ARG A 1 8   ? 4.774   -31.742 65.667  1.00 83.10 ? 19  ARG A C   1 
ATOM   4    O O   . ARG A 1 8   ? 4.768   -32.168 64.514  1.00 78.54 ? 19  ARG A O   1 
ATOM   5    C CB  . ARG A 1 8   ? 6.267   -32.952 67.276  1.00 86.58 ? 19  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 8   ? 6.723   -34.147 66.453  1.00 86.33 ? 19  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 8   ? 7.003   -35.358 67.333  1.00 86.41 ? 19  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 8   ? 7.251   -36.557 66.537  1.00 85.97 ? 19  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 8   ? 7.220   -37.795 67.018  1.00 84.55 ? 19  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 8   ? 6.953   -38.002 68.300  1.00 85.42 ? 19  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 8   ? 7.454   -38.826 66.219  1.00 83.57 ? 19  ARG A NH2 1 
ATOM   12   N N   . MET A 1 9   ? 3.676   -31.332 66.299  1.00 82.36 ? 20  MET A N   1 
ATOM   13   C CA  . MET A 1 9   ? 2.401   -31.158 65.609  1.00 82.76 ? 20  MET A CA  1 
ATOM   14   C C   . MET A 1 9   ? 2.505   -30.085 64.541  1.00 81.61 ? 20  MET A C   1 
ATOM   15   O O   . MET A 1 9   ? 2.022   -30.263 63.423  1.00 84.36 ? 20  MET A O   1 
ATOM   16   C CB  . MET A 1 9   ? 1.290   -30.783 66.592  1.00 86.42 ? 20  MET A CB  1 
ATOM   17   C CG  . MET A 1 9   ? 0.175   -31.800 66.668  1.00 90.91 ? 20  MET A CG  1 
ATOM   18   S SD  . MET A 1 9   ? 0.827   -33.462 66.896  1.00 98.92 ? 20  MET A SD  1 
ATOM   19   C CE  . MET A 1 9   ? 1.636   -33.318 68.497  1.00 97.37 ? 20  MET A CE  1 
ATOM   20   N N   . LYS A 1 10  ? 3.135   -28.969 64.891  1.00 78.89 ? 21  LYS A N   1 
ATOM   21   C CA  . LYS A 1 10  ? 3.288   -27.855 63.960  1.00 79.98 ? 21  LYS A CA  1 
ATOM   22   C C   . LYS A 1 10  ? 4.048   -28.257 62.692  1.00 74.34 ? 21  LYS A C   1 
ATOM   23   O O   . LYS A 1 10  ? 3.713   -27.805 61.602  1.00 72.71 ? 21  LYS A O   1 
ATOM   24   C CB  . LYS A 1 10  ? 3.955   -26.658 64.646  1.00 81.61 ? 21  LYS A CB  1 
ATOM   25   C CG  . LYS A 1 10  ? 3.078   -25.972 65.701  1.00 85.04 ? 21  LYS A CG  1 
ATOM   26   C CD  . LYS A 1 10  ? 3.821   -24.846 66.435  1.00 86.89 ? 21  LYS A CD  1 
ATOM   27   C CE  . LYS A 1 10  ? 4.192   -23.699 65.491  1.00 89.49 ? 21  LYS A CE  1 
ATOM   28   N NZ  . LYS A 1 10  ? 5.086   -22.689 66.138  1.00 89.77 ? 21  LYS A NZ  1 
ATOM   29   N N   . GLN A 1 11  ? 5.057   -29.113 62.833  1.00 70.47 ? 22  GLN A N   1 
ATOM   30   C CA  . GLN A 1 11  ? 5.841   -29.546 61.678  1.00 72.31 ? 22  GLN A CA  1 
ATOM   31   C C   . GLN A 1 11  ? 4.968   -30.318 60.703  1.00 67.76 ? 22  GLN A C   1 
ATOM   32   O O   . GLN A 1 11  ? 4.921   -30.013 59.519  1.00 68.40 ? 22  GLN A O   1 
ATOM   33   C CB  . GLN A 1 11  ? 7.018   -30.419 62.109  1.00 78.81 ? 22  GLN A CB  1 
ATOM   34   C CG  . GLN A 1 11  ? 8.126   -29.673 62.835  1.00 85.54 ? 22  GLN A CG  1 
ATOM   35   C CD  . GLN A 1 11  ? 9.438   -30.444 62.839  1.00 90.70 ? 22  GLN A CD  1 
ATOM   36   O OE1 . GLN A 1 11  ? 10.511  -29.864 62.650  1.00 92.30 ? 22  GLN A OE1 1 
ATOM   37   N NE2 . GLN A 1 11  ? 9.358   -31.761 63.048  1.00 90.88 ? 22  GLN A NE2 1 
ATOM   38   N N   . ILE A 1 12  ? 4.295   -31.332 61.228  1.00 62.42 ? 23  ILE A N   1 
ATOM   39   C CA  . ILE A 1 12  ? 3.342   -32.144 60.489  1.00 52.93 ? 23  ILE A CA  1 
ATOM   40   C C   . ILE A 1 12  ? 2.317   -31.268 59.757  1.00 51.84 ? 23  ILE A C   1 
ATOM   41   O O   . ILE A 1 12  ? 2.099   -31.430 58.553  1.00 47.19 ? 23  ILE A O   1 
ATOM   42   C CB  . ILE A 1 12  ? 2.628   -33.098 61.461  1.00 52.23 ? 23  ILE A CB  1 
ATOM   43   C CG1 . ILE A 1 12  ? 3.535   -34.291 61.780  1.00 54.08 ? 23  ILE A CG1 1 
ATOM   44   C CG2 . ILE A 1 12  ? 1.299   -33.546 60.902  1.00 52.25 ? 23  ILE A CG2 1 
ATOM   45   C CD1 . ILE A 1 12  ? 2.900   -35.306 62.695  1.00 58.64 ? 23  ILE A CD1 1 
ATOM   46   N N   . GLU A 1 13  ? 1.712   -30.334 60.486  1.00 53.02 ? 24  GLU A N   1 
ATOM   47   C CA  . GLU A 1 13  ? 0.756   -29.372 59.910  1.00 55.21 ? 24  GLU A CA  1 
ATOM   48   C C   . GLU A 1 13  ? 1.374   -28.474 58.828  1.00 55.71 ? 24  GLU A C   1 
ATOM   49   O O   . GLU A 1 13  ? 0.723   -28.130 57.836  1.00 50.72 ? 24  GLU A O   1 
ATOM   50   C CB  . GLU A 1 13  ? 0.139   -28.513 61.010  1.00 56.18 ? 24  GLU A CB  1 
ATOM   51   C CG  . GLU A 1 13  ? -0.651  -29.299 62.024  1.00 59.53 ? 24  GLU A CG  1 
ATOM   52   C CD  . GLU A 1 13  ? -1.129  -28.457 63.211  1.00 64.54 ? 24  GLU A CD  1 
ATOM   53   O OE1 . GLU A 1 13  ? -2.261  -28.704 63.678  1.00 66.45 ? 24  GLU A OE1 1 
ATOM   54   O OE2 . GLU A 1 13  ? -0.386  -27.560 63.682  1.00 63.49 ? 24  GLU A OE2 1 
ATOM   55   N N   . ASP A 1 14  ? 2.637   -28.108 59.006  1.00 54.95 ? 25  ASP A N   1 
ATOM   56   C CA  . ASP A 1 14  ? 3.312   -27.309 57.998  1.00 55.18 ? 25  ASP A CA  1 
ATOM   57   C C   . ASP A 1 14  ? 3.654   -28.144 56.750  1.00 51.64 ? 25  ASP A C   1 
ATOM   58   O O   . ASP A 1 14  ? 3.625   -27.633 55.629  1.00 52.22 ? 25  ASP A O   1 
ATOM   59   C CB  . ASP A 1 14  ? 4.548   -26.614 58.595  1.00 64.31 ? 25  ASP A CB  1 
ATOM   60   C CG  . ASP A 1 14  ? 4.184   -25.374 59.438  1.00 70.03 ? 25  ASP A CG  1 
ATOM   61   O OD1 . ASP A 1 14  ? 3.089   -24.800 59.248  1.00 71.84 ? 25  ASP A OD1 1 
ATOM   62   O OD2 . ASP A 1 14  ? 4.998   -24.966 60.295  1.00 71.19 ? 25  ASP A OD2 1 
ATOM   63   N N   . LYS A 1 15  ? 3.965   -29.426 56.940  1.00 46.33 ? 26  LYS A N   1 
ATOM   64   C CA  . LYS A 1 15  ? 4.196   -30.320 55.810  1.00 51.89 ? 26  LYS A CA  1 
ATOM   65   C C   . LYS A 1 15  ? 2.890   -30.565 55.030  1.00 42.82 ? 26  LYS A C   1 
ATOM   66   O O   . LYS A 1 15  ? 2.877   -30.598 53.817  1.00 43.47 ? 26  LYS A O   1 
ATOM   67   C CB  . LYS A 1 15  ? 4.818   -31.650 56.264  1.00 51.31 ? 26  LYS A CB  1 
ATOM   68   C CG  . LYS A 1 15  ? 6.338   -31.697 56.083  1.00 62.31 ? 26  LYS A CG  1 
ATOM   69   C CD  . LYS A 1 15  ? 6.988   -32.887 56.795  1.00 65.14 ? 26  LYS A CD  1 
ATOM   70   C CE  . LYS A 1 15  ? 7.019   -32.688 58.326  1.00 72.63 ? 26  LYS A CE  1 
ATOM   71   N NZ  . LYS A 1 15  ? 7.392   -33.925 59.103  1.00 71.58 ? 26  LYS A NZ  1 
ATOM   72   N N   . ILE A 1 16  ? 1.799   -30.733 55.751  1.00 44.62 ? 27  ILE A N   1 
ATOM   73   C CA  . ILE A 1 16  ? 0.493   -30.939 55.129  1.00 44.95 ? 27  ILE A CA  1 
ATOM   74   C C   . ILE A 1 16  ? 0.089   -29.741 54.275  1.00 48.67 ? 27  ILE A C   1 
ATOM   75   O O   . ILE A 1 16  ? -0.414  -29.905 53.160  1.00 50.49 ? 27  ILE A O   1 
ATOM   76   C CB  . ILE A 1 16  ? -0.552  -31.255 56.191  1.00 47.88 ? 27  ILE A CB  1 
ATOM   77   C CG1 . ILE A 1 16  ? -0.294  -32.671 56.709  1.00 46.67 ? 27  ILE A CG1 1 
ATOM   78   C CG2 . ILE A 1 16  ? -1.981  -31.097 55.628  1.00 49.49 ? 27  ILE A CG2 1 
ATOM   79   C CD1 . ILE A 1 16  ? -1.056  -33.022 57.931  1.00 51.55 ? 27  ILE A CD1 1 
ATOM   80   N N   . GLU A 1 17  ? 0.352   -28.536 54.779  1.00 48.25 ? 28  GLU A N   1 
ATOM   81   C CA  . GLU A 1 17  ? 0.133   -27.323 53.999  1.00 48.91 ? 28  GLU A CA  1 
ATOM   82   C C   . GLU A 1 17  ? 0.990   -27.299 52.736  1.00 46.81 ? 28  GLU A C   1 
ATOM   83   O O   . GLU A 1 17  ? 0.501   -26.934 51.668  1.00 40.59 ? 28  GLU A O   1 
ATOM   84   C CB  . GLU A 1 17  ? 0.388   -26.070 54.854  1.00 57.17 ? 28  GLU A CB  1 
ATOM   85   C CG  . GLU A 1 17  ? -0.074  -24.755 54.213  1.00 62.33 ? 28  GLU A CG  1 
ATOM   86   C CD  . GLU A 1 17  ? 0.953   -24.164 53.259  1.00 63.12 ? 28  GLU A CD  1 
ATOM   87   N N   . GLU A 1 18  ? 2.264   -27.690 52.847  1.00 42.44 ? 29  GLU A N   1 
ATOM   88   C CA  . GLU A 1 18  ? 3.149   -27.747 51.689  1.00 43.85 ? 29  GLU A CA  1 
ATOM   89   C C   . GLU A 1 18  ? 2.684   -28.765 50.644  1.00 38.00 ? 29  GLU A C   1 
ATOM   90   O O   . GLU A 1 18  ? 2.755   -28.515 49.439  1.00 40.74 ? 29  GLU A O   1 
ATOM   91   C CB  . GLU A 1 18  ? 4.582   -28.090 52.125  1.00 47.48 ? 29  GLU A CB  1 
ATOM   92   N N   . ILE A 1 19  ? 2.244   -29.929 51.116  1.00 37.50 ? 30  ILE A N   1 
ATOM   93   C CA  . ILE A 1 19  ? 1.712   -30.980 50.240  1.00 39.18 ? 30  ILE A CA  1 
ATOM   94   C C   . ILE A 1 19  ? 0.475   -30.532 49.410  1.00 37.98 ? 30  ILE A C   1 
ATOM   95   O O   . ILE A 1 19  ? 0.420   -30.728 48.194  1.00 35.64 ? 30  ILE A O   1 
ATOM   96   C CB  . ILE A 1 19  ? 1.381   -32.255 51.074  1.00 38.27 ? 30  ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 19  ? 2.669   -33.032 51.380  1.00 41.98 ? 30  ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 19  ? 0.415   -33.168 50.326  1.00 40.41 ? 30  ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 19  ? 2.577   -33.935 52.611  1.00 42.12 ? 30  ILE A CD1 1 
ATOM   100  N N   . LEU A 1 20  ? -0.509  -29.943 50.086  1.00 39.73 ? 31  LEU A N   1 
ATOM   101  C CA  . LEU A 1 20  ? -1.693  -29.362 49.410  1.00 41.67 ? 31  LEU A CA  1 
ATOM   102  C C   . LEU A 1 20  ? -1.310  -28.409 48.276  1.00 38.66 ? 31  LEU A C   1 
ATOM   103  O O   . LEU A 1 20  ? -1.873  -28.406 47.176  1.00 37.92 ? 31  LEU A O   1 
ATOM   104  C CB  . LEU A 1 20  ? -2.523  -28.603 50.445  1.00 42.90 ? 31  LEU A CB  1 
ATOM   105  C CG  . LEU A 1 20  ? -3.730  -29.298 51.073  1.00 49.58 ? 31  LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 20  ? -3.914  -30.704 50.554  1.00 46.81 ? 31  LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 20  ? -3.666  -29.227 52.585  1.00 47.12 ? 31  LEU A CD2 1 
ATOM   108  N N   . SER A 1 21  ? -0.326  -27.570 48.552  1.00 41.91 ? 32  SER A N   1 
ATOM   109  C CA  . SER A 1 21  ? 0.140   -26.618 47.564  1.00 37.92 ? 32  SER A CA  1 
ATOM   110  C C   . SER A 1 21  ? 0.790   -27.289 46.383  1.00 33.28 ? 32  SER A C   1 
ATOM   111  O O   . SER A 1 21  ? 0.629   -26.854 45.228  1.00 29.56 ? 32  SER A O   1 
ATOM   112  C CB  . SER A 1 21  ? 1.094   -25.625 48.242  1.00 47.07 ? 32  SER A CB  1 
ATOM   113  O OG  . SER A 1 21  ? 1.678   -24.760 47.292  1.00 54.42 ? 32  SER A OG  1 
ATOM   114  N N   . LYS A 1 22  ? 1.541   -28.359 46.627  1.00 35.73 ? 33  LYS A N   1 
ATOM   115  C CA  . LYS A 1 22  ? 2.138   -29.099 45.515  1.00 33.05 ? 33  LYS A CA  1 
ATOM   116  C C   . LYS A 1 22  ? 1.091   -29.823 44.657  1.00 24.44 ? 33  LYS A C   1 
ATOM   117  O O   . LYS A 1 22  ? 1.228   -29.940 43.432  1.00 32.21 ? 33  LYS A O   1 
ATOM   118  C CB  . LYS A 1 22  ? 3.081   -30.159 46.055  1.00 35.92 ? 33  LYS A CB  1 
ATOM   119  C CG  . LYS A 1 22  ? 4.295   -29.619 46.768  1.00 38.99 ? 33  LYS A CG  1 
ATOM   120  C CD  . LYS A 1 22  ? 5.149   -30.763 47.308  1.00 44.55 ? 33  LYS A CD  1 
ATOM   121  C CE  . LYS A 1 22  ? 6.478   -30.212 47.858  1.00 53.53 ? 33  LYS A CE  1 
ATOM   122  N NZ  . LYS A 1 22  ? 6.973   -30.987 49.028  1.00 55.10 ? 33  LYS A NZ  1 
ATOM   123  N N   . ILE A 1 23  ? 0.098   -30.363 45.334  1.00 32.01 ? 34  ILE A N   1 
ATOM   124  C CA  . ILE A 1 23  ? -1.013  -31.032 44.632  1.00 30.21 ? 34  ILE A CA  1 
ATOM   125  C C   . ILE A 1 23  ? -1.783  -30.049 43.743  1.00 30.42 ? 34  ILE A C   1 
ATOM   126  O O   . ILE A 1 23  ? -2.109  -30.326 42.580  1.00 28.63 ? 34  ILE A O   1 
ATOM   127  C CB  . ILE A 1 23  ? -1.885  -31.723 45.669  1.00 35.51 ? 34  ILE A CB  1 
ATOM   128  C CG1 . ILE A 1 23  ? -1.111  -32.946 46.198  1.00 36.28 ? 34  ILE A CG1 1 
ATOM   129  C CG2 . ILE A 1 23  ? -3.224  -32.195 45.077  1.00 34.54 ? 34  ILE A CG2 1 
ATOM   130  C CD1 . ILE A 1 23  ? -1.847  -33.679 47.275  1.00 40.49 ? 34  ILE A CD1 1 
ATOM   131  N N   . TYR A 1 24  ? -1.993  -28.845 44.272  1.00 33.11 ? 35  TYR A N   1 
ATOM   132  C CA  . TYR A 1 24  ? -2.673  -27.802 43.480  1.00 30.57 ? 35  TYR A CA  1 
ATOM   133  C C   . TYR A 1 24  ? -1.852  -27.460 42.265  1.00 28.52 ? 35  TYR A C   1 
ATOM   134  O O   . TYR A 1 24  ? -2.342  -27.370 41.142  1.00 31.47 ? 35  TYR A O   1 
ATOM   135  C CB  . TYR A 1 24  ? -2.905  -26.597 44.378  1.00 31.38 ? 35  TYR A CB  1 
ATOM   136  C CG  . TYR A 1 24  ? -3.685  -25.489 43.701  1.00 36.93 ? 35  TYR A CG  1 
ATOM   137  C CD1 . TYR A 1 24  ? -5.066  -25.344 43.914  1.00 34.33 ? 35  TYR A CD1 1 
ATOM   138  C CD2 . TYR A 1 24  ? -3.047  -24.614 42.845  1.00 39.16 ? 35  TYR A CD2 1 
ATOM   139  C CE1 . TYR A 1 24  ? -5.783  -24.321 43.286  1.00 35.99 ? 35  TYR A CE1 1 
ATOM   140  C CE2 . TYR A 1 24  ? -3.740  -23.597 42.193  1.00 43.08 ? 35  TYR A CE2 1 
ATOM   141  C CZ  . TYR A 1 24  ? -5.112  -23.458 42.414  1.00 39.84 ? 35  TYR A CZ  1 
ATOM   142  O OH  . TYR A 1 24  ? -5.742  -22.444 41.746  1.00 38.03 ? 35  TYR A OH  1 
ATOM   143  N N   . HIS A 1 25  ? -0.530  -27.295 42.470  1.00 35.01 ? 36  HIS A N   1 
ATOM   144  C CA  . HIS A 1 25  ? 0.355   -27.091 41.344  1.00 32.36 ? 36  HIS A CA  1 
ATOM   145  C C   . HIS A 1 25  ? 0.270   -28.228 40.344  1.00 24.93 ? 36  HIS A C   1 
ATOM   146  O O   . HIS A 1 25  ? 0.224   -28.026 39.128  1.00 33.22 ? 36  HIS A O   1 
ATOM   147  C CB  . HIS A 1 25  ? 1.832   -26.917 41.802  1.00 37.89 ? 36  HIS A CB  1 
ATOM   148  C CG  . HIS A 1 25  ? 2.781   -26.786 40.660  1.00 41.95 ? 36  HIS A CG  1 
ATOM   149  N ND1 . HIS A 1 25  ? 2.703   -25.750 39.757  1.00 45.73 ? 36  HIS A ND1 1 
ATOM   150  C CD2 . HIS A 1 25  ? 3.805   -27.570 40.246  1.00 46.09 ? 36  HIS A CD2 1 
ATOM   151  C CE1 . HIS A 1 25  ? 3.637   -25.897 38.834  1.00 47.57 ? 36  HIS A CE1 1 
ATOM   152  N NE2 . HIS A 1 25  ? 4.323   -26.991 39.110  1.00 43.80 ? 36  HIS A NE2 1 
ATOM   153  N N   . ILE A 1 26  ? 0.287   -29.458 40.843  1.00 32.00 ? 37  ILE A N   1 
ATOM   154  C CA  . ILE A 1 26  ? 0.209   -30.580 39.916  1.00 31.08 ? 37  ILE A CA  1 
ATOM   155  C C   . ILE A 1 26  ? -1.084  -30.562 39.096  1.00 26.75 ? 37  ILE A C   1 
ATOM   156  O O   . ILE A 1 26  ? -1.097  -30.815 37.893  1.00 29.58 ? 37  ILE A O   1 
ATOM   157  C CB  . ILE A 1 26  ? 0.353   -31.942 40.700  1.00 28.91 ? 37  ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 26  ? 1.829   -32.209 41.036  1.00 33.83 ? 37  ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 26  ? -0.195  -33.112 39.872  1.00 32.62 ? 37  ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 26  ? 2.012   -33.221 42.165  1.00 34.28 ? 37  ILE A CD1 1 
ATOM   161  N N   . GLU A 1 27  ? -2.194  -30.247 39.765  1.00 31.57 ? 38  GLU A N   1 
ATOM   162  C CA  . GLU A 1 27  ? -3.463  -30.234 39.042  1.00 30.93 ? 38  GLU A CA  1 
ATOM   163  C C   . GLU A 1 27  ? -3.464  -29.119 37.981  1.00 30.27 ? 38  GLU A C   1 
ATOM   164  O O   . GLU A 1 27  ? -4.031  -29.264 36.907  1.00 31.15 ? 38  GLU A O   1 
ATOM   165  C CB  . GLU A 1 27  ? -4.608  -30.096 40.050  1.00 31.88 ? 38  GLU A CB  1 
ATOM   166  C CG  . GLU A 1 27  ? -4.872  -31.352 40.910  1.00 39.46 ? 38  GLU A CG  1 
ATOM   167  C CD  . GLU A 1 27  ? -5.604  -32.487 40.159  1.00 42.15 ? 38  GLU A CD  1 
ATOM   168  O OE1 . GLU A 1 27  ? -5.360  -32.749 38.948  1.00 42.48 ? 38  GLU A OE1 1 
ATOM   169  O OE2 . GLU A 1 27  ? -6.424  -33.141 40.813  1.00 44.86 ? 38  GLU A OE2 1 
ATOM   170  N N   . ASN A 1 28  ? -2.799  -27.993 38.279  1.00 31.36 ? 39  ASN A N   1 
ATOM   171  C CA  . ASN A 1 28  ? -2.540  -26.977 37.269  1.00 26.01 ? 39  ASN A CA  1 
ATOM   172  C C   . ASN A 1 28  ? -1.779  -27.499 36.078  1.00 34.55 ? 39  ASN A C   1 
ATOM   173  O O   . ASN A 1 28  ? -2.147  -27.237 34.949  1.00 34.43 ? 39  ASN A O   1 
ATOM   174  C CB  . ASN A 1 28  ? -1.732  -25.808 37.888  1.00 35.67 ? 39  ASN A CB  1 
ATOM   175  C CG  . ASN A 1 28  ? -2.618  -24.697 38.418  1.00 37.37 ? 39  ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 28  ? -3.768  -24.606 38.032  1.00 35.68 ? 39  ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 28  ? -2.076  -23.835 39.299  1.00 35.77 ? 39  ASN A ND2 1 
ATOM   178  N N   . GLU A 1 29  ? -0.685  -28.231 36.330  1.00 35.21 ? 40  GLU A N   1 
ATOM   179  C CA  . GLU A 1 29  ? 0.091   -28.809 35.218  1.00 37.13 ? 40  GLU A CA  1 
ATOM   180  C C   . GLU A 1 29  ? -0.743  -29.770 34.400  1.00 30.68 ? 40  GLU A C   1 
ATOM   181  O O   . GLU A 1 29  ? -0.667  -29.781 33.183  1.00 37.68 ? 40  GLU A O   1 
ATOM   182  C CB  . GLU A 1 29  ? 1.323   -29.561 35.758  1.00 41.02 ? 40  GLU A CB  1 
ATOM   183  C CG  . GLU A 1 29  ? 2.345   -28.662 36.436  1.00 39.31 ? 40  GLU A CG  1 
ATOM   184  C CD  . GLU A 1 29  ? 3.486   -29.479 37.029  1.00 49.07 ? 40  GLU A CD  1 
ATOM   185  O OE1 . GLU A 1 29  ? 4.651   -29.268 36.604  1.00 46.82 ? 40  GLU A OE1 1 
ATOM   186  O OE2 . GLU A 1 29  ? 3.202   -30.361 37.884  1.00 44.97 ? 40  GLU A OE2 1 
ATOM   187  N N   . ILE A 1 30  ? -1.554  -30.573 35.087  1.00 34.62 ? 41  ILE A N   1 
ATOM   188  C CA  . ILE A 1 30  ? -2.431  -31.533 34.400  1.00 34.82 ? 41  ILE A CA  1 
ATOM   189  C C   . ILE A 1 30  ? -3.483  -30.803 33.532  1.00 31.84 ? 41  ILE A C   1 
ATOM   190  O O   . ILE A 1 30  ? -3.651  -31.102 32.343  1.00 36.07 ? 41  ILE A O   1 
ATOM   191  C CB  . ILE A 1 30  ? -3.081  -32.478 35.440  1.00 36.71 ? 41  ILE A CB  1 
ATOM   192  C CG1 . ILE A 1 30  ? -2.033  -33.495 35.926  1.00 37.65 ? 41  ILE A CG1 1 
ATOM   193  C CG2 . ILE A 1 30  ? -4.349  -33.212 34.878  1.00 39.22 ? 41  ILE A CG2 1 
ATOM   194  C CD1 . ILE A 1 30  ? -2.397  -34.105 37.238  1.00 46.33 ? 41  ILE A CD1 1 
ATOM   195  N N   . ALA A 1 31  ? -4.155  -29.825 34.119  1.00 37.33 ? 42  ALA A N   1 
ATOM   196  C CA  . ALA A 1 31  ? -5.066  -28.974 33.339  1.00 32.54 ? 42  ALA A CA  1 
ATOM   197  C C   . ALA A 1 31  ? -4.418  -28.477 32.061  1.00 38.45 ? 42  ALA A C   1 
ATOM   198  O O   . ALA A 1 31  ? -4.993  -28.595 30.965  1.00 37.83 ? 42  ALA A O   1 
ATOM   199  C CB  . ALA A 1 31  ? -5.549  -27.800 34.205  1.00 37.81 ? 42  ALA A CB  1 
ATOM   200  N N   . ARG A 1 32  ? -3.195  -27.936 32.167  1.00 39.27 ? 43  ARG A N   1 
ATOM   201  C CA  . ARG A 1 32  ? -2.517  -27.472 30.961  1.00 35.84 ? 43  ARG A CA  1 
ATOM   202  C C   . ARG A 1 32  ? -2.221  -28.611 30.005  1.00 42.13 ? 43  ARG A C   1 
ATOM   203  O O   . ARG A 1 32  ? -2.384  -28.467 28.789  1.00 38.21 ? 43  ARG A O   1 
ATOM   204  C CB  . ARG A 1 32  ? -1.246  -26.685 31.292  1.00 41.09 ? 43  ARG A CB  1 
ATOM   205  C CG  . ARG A 1 32  ? -1.486  -25.401 32.136  1.00 45.05 ? 43  ARG A CG  1 
ATOM   206  C CD  . ARG A 1 32  ? -0.159  -24.794 32.639  1.00 50.68 ? 43  ARG A CD  1 
ATOM   207  N NE  . ARG A 1 32  ? -0.382  -23.867 33.756  1.00 52.02 ? 43  ARG A NE  1 
ATOM   208  C CZ  . ARG A 1 32  ? 0.177   -23.960 34.960  1.00 53.59 ? 43  ARG A CZ  1 
ATOM   209  N NH1 . ARG A 1 32  ? 1.048   -24.927 35.238  1.00 57.93 ? 43  ARG A NH1 1 
ATOM   210  N NH2 . ARG A 1 32  ? -0.125  -23.061 35.887  1.00 51.57 ? 43  ARG A NH2 1 
ATOM   211  N N   . ILE A 1 33  ? -1.818  -29.770 30.528  1.00 36.89 ? 44  ILE A N   1 
ATOM   212  C CA  . ILE A 1 33  ? -1.560  -30.901 29.616  1.00 37.51 ? 44  ILE A CA  1 
ATOM   213  C C   . ILE A 1 33  ? -2.811  -31.337 28.852  1.00 42.60 ? 44  ILE A C   1 
ATOM   214  O O   . ILE A 1 33  ? -2.761  -31.549 27.645  1.00 40.33 ? 44  ILE A O   1 
ATOM   215  C CB  . ILE A 1 33  ? -0.918  -32.093 30.353  1.00 42.00 ? 44  ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 33  ? 0.560   -31.780 30.659  1.00 44.32 ? 44  ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 33  ? -1.052  -33.366 29.524  1.00 45.15 ? 44  ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 33  ? 1.127   -32.608 31.793  1.00 41.74 ? 44  ILE A CD1 1 
ATOM   219  N N   . LYS A 1 34  ? -3.938  -31.449 29.558  1.00 44.22 ? 45  LYS A N   1 
ATOM   220  C CA  . LYS A 1 34  ? -5.216  -31.794 28.938  1.00 43.57 ? 45  LYS A CA  1 
ATOM   221  C C   . LYS A 1 34  ? -5.614  -30.865 27.801  1.00 45.55 ? 45  LYS A C   1 
ATOM   222  O O   . LYS A 1 34  ? -6.165  -31.307 26.794  1.00 51.95 ? 45  LYS A O   1 
ATOM   223  C CB  . LYS A 1 34  ? -6.324  -31.788 29.995  1.00 42.92 ? 45  LYS A CB  1 
ATOM   224  C CG  . LYS A 1 34  ? -6.249  -32.949 30.919  1.00 43.90 ? 45  LYS A CG  1 
ATOM   225  C CD  . LYS A 1 34  ? -6.937  -32.703 32.251  1.00 48.59 ? 45  LYS A CD  1 
ATOM   226  C CE  . LYS A 1 34  ? -8.420  -32.941 32.187  1.00 55.89 ? 45  LYS A CE  1 
ATOM   227  N NZ  . LYS A 1 34  ? -8.937  -33.165 33.583  1.00 53.53 ? 45  LYS A NZ  1 
ATOM   228  N N   . LYS A 1 35  ? -5.350  -29.578 27.966  1.00 49.23 ? 46  LYS A N   1 
ATOM   229  C CA  . LYS A 1 35  ? -5.710  -28.604 26.954  1.00 55.60 ? 46  LYS A CA  1 
ATOM   230  C C   . LYS A 1 35  ? -4.891  -28.838 25.676  1.00 62.24 ? 46  LYS A C   1 
ATOM   231  O O   . LYS A 1 35  ? -5.446  -28.934 24.579  1.00 64.21 ? 46  LYS A O   1 
ATOM   232  C CB  . LYS A 1 35  ? -5.506  -27.204 27.502  1.00 62.44 ? 46  LYS A CB  1 
ATOM   233  C CG  . LYS A 1 35  ? -6.477  -26.167 26.968  1.00 67.69 ? 46  LYS A CG  1 
ATOM   234  C CD  . LYS A 1 35  ? -6.338  -24.886 27.765  1.00 69.81 ? 46  LYS A CD  1 
ATOM   235  C CE  . LYS A 1 35  ? -4.865  -24.492 27.897  1.00 74.00 ? 46  LYS A CE  1 
ATOM   236  N NZ  . LYS A 1 35  ? -4.560  -23.782 29.187  1.00 76.64 ? 46  LYS A NZ  1 
ATOM   237  N N   . LEU A 1 36  ? -3.574  -28.941 25.827  1.00 64.42 ? 47  LEU A N   1 
ATOM   238  C CA  . LEU A 1 36  ? -2.690  -29.315 24.721  1.00 66.22 ? 47  LEU A CA  1 
ATOM   239  C C   . LEU A 1 36  ? -2.987  -30.745 24.295  1.00 65.10 ? 47  LEU A C   1 
ATOM   240  O O   . LEU A 1 36  ? -3.626  -30.968 23.277  1.00 69.05 ? 47  LEU A O   1 
ATOM   241  C CB  . LEU A 1 36  ? -1.219  -29.217 25.143  1.00 66.35 ? 47  LEU A CB  1 
ATOM   242  C CG  . LEU A 1 36  ? -0.608  -27.857 25.475  1.00 67.09 ? 47  LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 36  ? -1.583  -26.935 26.191  1.00 70.56 ? 47  LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 36  ? 0.639   -28.054 26.313  1.00 68.10 ? 47  LEU A CD2 1 
ATOM   245  N N   . PRO A 1 46  ? -3.537  -28.925 16.161  1.00 68.67 ? 57  PRO A N   1 
ATOM   246  C CA  . PRO A 1 46  ? -2.415  -28.310 15.466  1.00 64.48 ? 57  PRO A CA  1 
ATOM   247  C C   . PRO A 1 46  ? -2.799  -26.959 14.865  1.00 61.71 ? 57  PRO A C   1 
ATOM   248  O O   . PRO A 1 46  ? -3.990  -26.677 14.679  1.00 61.68 ? 57  PRO A O   1 
ATOM   249  C CB  . PRO A 1 46  ? -2.109  -29.315 14.356  1.00 67.12 ? 57  PRO A CB  1 
ATOM   250  C CG  . PRO A 1 46  ? -3.418  -29.961 14.061  1.00 69.25 ? 57  PRO A CG  1 
ATOM   251  C CD  . PRO A 1 46  ? -4.316  -29.808 15.273  1.00 69.58 ? 57  PRO A CD  1 
ATOM   252  N N   . CYS A 1 47  ? -1.789  -26.131 14.594  1.00 52.86 ? 58  CYS A N   1 
ATOM   253  C CA  . CYS A 1 47  ? -1.966  -24.833 13.964  1.00 48.97 ? 58  CYS A CA  1 
ATOM   254  C C   . CYS A 1 47  ? -2.437  -24.977 12.507  1.00 47.42 ? 58  CYS A C   1 
ATOM   255  O O   . CYS A 1 47  ? -1.812  -25.680 11.714  1.00 38.61 ? 58  CYS A O   1 
ATOM   256  C CB  . CYS A 1 47  ? -0.642  -24.073 14.031  1.00 53.43 ? 58  CYS A CB  1 
ATOM   257  S SG  . CYS A 1 47  ? -0.681  -22.379 13.377  1.00 56.08 ? 58  CYS A SG  1 
ATOM   258  N N   . MET A 1 48  ? -3.554  -24.330 12.168  1.00 38.85 ? 59  MET A N   1 
ATOM   259  C CA  . MET A 1 48  ? -4.148  -24.431 10.854  1.00 37.49 ? 59  MET A CA  1 
ATOM   260  C C   . MET A 1 48  ? -4.835  -23.149 10.490  1.00 34.95 ? 59  MET A C   1 
ATOM   261  O O   . MET A 1 48  ? -5.202  -22.340 11.357  1.00 38.80 ? 59  MET A O   1 
ATOM   262  C CB  . MET A 1 48  ? -5.244  -25.493 10.798  1.00 40.30 ? 59  MET A CB  1 
ATOM   263  C CG  . MET A 1 48  ? -4.891  -26.821 11.288  1.00 49.59 ? 59  MET A CG  1 
ATOM   264  S SD  . MET A 1 48  ? -6.338  -27.840 11.015  1.00 51.07 ? 59  MET A SD  1 
ATOM   265  C CE  . MET A 1 48  ? -6.469  -27.827 9.267   1.00 36.72 ? 59  MET A CE  1 
ATOM   266  N N   . ALA A 1 49  ? -5.060  -22.986 9.203   1.00 30.89 ? 60  ALA A N   1 
ATOM   267  C CA  . ALA A 1 49  ? -5.749  -21.783 8.738   1.00 32.92 ? 60  ALA A CA  1 
ATOM   268  C C   . ALA A 1 49  ? -6.413  -22.141 7.448   1.00 35.57 ? 60  ALA A C   1 
ATOM   269  O O   . ALA A 1 49  ? -5.917  -23.000 6.720   1.00 33.07 ? 60  ALA A O   1 
ATOM   270  C CB  . ALA A 1 49  ? -4.759  -20.662 8.546   1.00 32.26 ? 60  ALA A CB  1 
ATOM   271  N N   . LYS A 1 50  ? -7.549  -21.521 7.145   1.00 30.51 ? 61  LYS A N   1 
ATOM   272  C CA  . LYS A 1 50  ? -8.229  -21.809 5.901   1.00 28.08 ? 61  LYS A CA  1 
ATOM   273  C C   . LYS A 1 50  ? -8.801  -20.501 5.366   1.00 26.88 ? 61  LYS A C   1 
ATOM   274  O O   . LYS A 1 50  ? -9.321  -19.701 6.139   1.00 29.71 ? 61  LYS A O   1 
ATOM   275  C CB  . LYS A 1 50  ? -9.391  -22.804 6.176   1.00 29.09 ? 61  LYS A CB  1 
ATOM   276  C CG  . LYS A 1 50  ? -10.314 -22.984 4.978   1.00 32.30 ? 61  LYS A CG  1 
ATOM   277  C CD  . LYS A 1 50  ? -11.532 -23.872 5.307   1.00 37.22 ? 61  LYS A CD  1 
ATOM   278  C CE  . LYS A 1 50  ? -12.299 -24.259 4.036   1.00 40.83 ? 61  LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 50  ? -13.543 -25.038 4.337   1.00 40.16 ? 61  LYS A NZ  1 
ATOM   280  N N   . PHE A 1 51  ? -8.715  -20.281 4.064   1.00 25.45 ? 62  PHE A N   1 
ATOM   281  C CA  . PHE A 1 51  ? -9.413  -19.166 3.430   1.00 34.76 ? 62  PHE A CA  1 
ATOM   282  C C   . PHE A 1 51  ? -10.579 -19.654 2.561   1.00 33.24 ? 62  PHE A C   1 
ATOM   283  O O   . PHE A 1 51  ? -10.388 -20.432 1.606   1.00 32.05 ? 62  PHE A O   1 
ATOM   284  C CB  . PHE A 1 51  ? -8.495  -18.325 2.528   1.00 29.26 ? 62  PHE A CB  1 
ATOM   285  C CG  . PHE A 1 51  ? -9.130  -17.017 2.116   1.00 32.02 ? 62  PHE A CG  1 
ATOM   286  C CD1 . PHE A 1 51  ? -9.094  -15.921 2.972   1.00 27.82 ? 62  PHE A CD1 1 
ATOM   287  C CD2 . PHE A 1 51  ? -9.855  -16.919 0.960   1.00 30.27 ? 62  PHE A CD2 1 
ATOM   288  C CE1 . PHE A 1 51  ? -9.722  -14.689 2.609   1.00 26.29 ? 62  PHE A CE1 1 
ATOM   289  C CE2 . PHE A 1 51  ? -10.496 -15.699 0.592   1.00 33.13 ? 62  PHE A CE2 1 
ATOM   290  C CZ  . PHE A 1 51  ? -10.418 -14.614 1.428   1.00 26.39 ? 62  PHE A CZ  1 
ATOM   291  N N   . GLY A 1 52  ? -11.786 -19.139 2.841   1.00 33.30 ? 63  GLY A N   1 
ATOM   292  C CA  . GLY A 1 52  ? -12.920 -19.456 1.997   1.00 34.09 ? 63  GLY A CA  1 
ATOM   293  C C   . GLY A 1 52  ? -13.615 -20.733 2.474   1.00 28.33 ? 63  GLY A C   1 
ATOM   294  O O   . GLY A 1 52  ? -13.333 -21.229 3.577   1.00 35.73 ? 63  GLY A O   1 
ATOM   295  N N   . PRO A 1 53  ? -14.613 -21.198 1.734   1.00 33.16 ? 64  PRO A N   1 
ATOM   296  C CA  . PRO A 1 53  ? -15.113 -20.591 0.525   1.00 35.72 ? 64  PRO A CA  1 
ATOM   297  C C   . PRO A 1 53  ? -15.815 -19.274 0.924   1.00 39.69 ? 64  PRO A C   1 
ATOM   298  O O   . PRO A 1 53  ? -16.312 -19.148 2.042   1.00 40.50 ? 64  PRO A O   1 
ATOM   299  C CB  . PRO A 1 53  ? -16.120 -21.619 -0.016  1.00 39.20 ? 64  PRO A CB  1 
ATOM   300  C CG  . PRO A 1 53  ? -16.420 -22.544 1.036   1.00 35.57 ? 64  PRO A CG  1 
ATOM   301  C CD  . PRO A 1 53  ? -15.435 -22.346 2.181   1.00 39.83 ? 64  PRO A CD  1 
ATOM   302  N N   . LEU A 1 54  ? -15.776 -18.287 0.058   1.00 42.91 ? 65  LEU A N   1 
ATOM   303  C CA  . LEU A 1 54  ? -16.455 -17.021 0.352   1.00 49.09 ? 65  LEU A CA  1 
ATOM   304  C C   . LEU A 1 54  ? -17.953 -17.335 0.537   1.00 50.24 ? 65  LEU A C   1 
ATOM   305  O O   . LEU A 1 54  ? -18.497 -18.177 -0.176  1.00 45.07 ? 65  LEU A O   1 
ATOM   306  C CB  . LEU A 1 54  ? -16.256 -16.058 -0.813  1.00 47.73 ? 65  LEU A CB  1 
ATOM   307  C CG  . LEU A 1 54  ? -15.112 -15.038 -0.935  1.00 50.09 ? 65  LEU A CG  1 
ATOM   308  C CD1 . LEU A 1 54  ? -14.122 -14.965 0.238   1.00 50.22 ? 65  LEU A CD1 1 
ATOM   309  C CD2 . LEU A 1 54  ? -14.408 -15.279 -2.241  1.00 49.87 ? 65  LEU A CD2 1 
ATOM   310  N N   . PRO A 1 55  ? -18.634 -16.634 1.452   1.00 53.82 ? 66  PRO A N   1 
ATOM   311  C CA  . PRO A 1 55  ? -18.224 -15.392 2.099   1.00 55.80 ? 66  PRO A CA  1 
ATOM   312  C C   . PRO A 1 55  ? -17.210 -15.524 3.230   1.00 53.12 ? 66  PRO A C   1 
ATOM   313  O O   . PRO A 1 55  ? -16.716 -14.503 3.707   1.00 52.85 ? 66  PRO A O   1 
ATOM   314  C CB  . PRO A 1 55  ? -19.547 -14.870 2.669   1.00 57.58 ? 66  PRO A CB  1 
ATOM   315  C CG  . PRO A 1 55  ? -20.271 -16.112 3.044   1.00 56.38 ? 66  PRO A CG  1 
ATOM   316  C CD  . PRO A 1 55  ? -19.963 -17.070 1.917   1.00 57.40 ? 66  PRO A CD  1 
ATOM   317  N N   . SER A 1 56  ? -16.906 -16.743 3.676   1.00 48.01 ? 67  SER A N   1 
ATOM   318  C CA  . SER A 1 56  ? -15.877 -16.900 4.707   1.00 44.83 ? 67  SER A CA  1 
ATOM   319  C C   . SER A 1 56  ? -14.543 -16.378 4.169   1.00 42.37 ? 67  SER A C   1 
ATOM   320  O O   . SER A 1 56  ? -14.216 -16.568 2.993   1.00 42.53 ? 67  SER A O   1 
ATOM   321  C CB  . SER A 1 56  ? -15.729 -18.356 5.139   1.00 50.53 ? 67  SER A CB  1 
ATOM   322  O OG  . SER A 1 56  ? -16.983 -18.928 5.452   1.00 54.68 ? 67  SER A OG  1 
ATOM   323  N N   . LYS A 1 57  ? -13.786 -15.721 5.036   1.00 39.13 ? 68  LYS A N   1 
ATOM   324  C CA  . LYS A 1 57  ? -12.471 -15.198 4.669   1.00 41.14 ? 68  LYS A CA  1 
ATOM   325  C C   . LYS A 1 57  ? -11.420 -16.034 5.407   1.00 30.47 ? 68  LYS A C   1 
ATOM   326  O O   . LYS A 1 57  ? -11.483 -17.247 5.240   1.00 34.76 ? 68  LYS A O   1 
ATOM   327  C CB  . LYS A 1 57  ? -12.415 -13.676 4.852   1.00 39.81 ? 68  LYS A CB  1 
ATOM   328  C CG  . LYS A 1 57  ? -12.989 -13.016 3.599   1.00 44.37 ? 68  LYS A CG  1 
ATOM   329  C CD  . LYS A 1 57  ? -13.680 -11.716 3.851   1.00 57.08 ? 68  LYS A CD  1 
ATOM   330  C CE  . LYS A 1 57  ? -14.406 -11.284 2.584   1.00 55.93 ? 68  LYS A CE  1 
ATOM   331  N NZ  . LYS A 1 57  ? -14.527 -9.826  2.587   1.00 58.56 ? 68  LYS A NZ  1 
ATOM   332  N N   . TRP A 1 58  ? -10.525 -15.462 6.231   1.00 36.50 ? 69  TRP A N   1 
ATOM   333  C CA  . TRP A 1 58  ? -9.493  -16.280 6.916   1.00 38.15 ? 69  TRP A CA  1 
ATOM   334  C C   . TRP A 1 58  ? -10.059 -16.853 8.184   1.00 41.04 ? 69  TRP A C   1 
ATOM   335  O O   . TRP A 1 58  ? -10.680 -16.146 8.979   1.00 41.28 ? 69  TRP A O   1 
ATOM   336  C CB  . TRP A 1 58  ? -8.150  -15.520 7.193   1.00 31.83 ? 69  TRP A CB  1 
ATOM   337  C CG  . TRP A 1 58  ? -7.212  -15.540 5.997   1.00 35.11 ? 69  TRP A CG  1 
ATOM   338  C CD1 . TRP A 1 58  ? -6.902  -14.502 5.190   1.00 33.01 ? 69  TRP A CD1 1 
ATOM   339  C CD2 . TRP A 1 58  ? -6.509  -16.682 5.472   1.00 31.37 ? 69  TRP A CD2 1 
ATOM   340  N NE1 . TRP A 1 58  ? -6.065  -14.920 4.189   1.00 31.84 ? 69  TRP A NE1 1 
ATOM   341  C CE2 . TRP A 1 58  ? -5.826  -16.257 4.328   1.00 31.42 ? 69  TRP A CE2 1 
ATOM   342  C CE3 . TRP A 1 58  ? -6.467  -18.034 5.818   1.00 31.87 ? 69  TRP A CE3 1 
ATOM   343  C CZ2 . TRP A 1 58  ? -5.025  -17.113 3.564   1.00 33.58 ? 69  TRP A CZ2 1 
ATOM   344  C CZ3 . TRP A 1 58  ? -5.663  -18.908 5.052   1.00 30.51 ? 69  TRP A CZ3 1 
ATOM   345  C CH2 . TRP A 1 58  ? -4.975  -18.447 3.934   1.00 35.06 ? 69  TRP A CH2 1 
ATOM   346  N N   . GLN A 1 59  ? -9.850  -18.149 8.389   1.00 34.01 ? 70  GLN A N   1 
ATOM   347  C CA  . GLN A 1 59  ? -10.242 -18.799 9.609   1.00 36.32 ? 70  GLN A CA  1 
ATOM   348  C C   . GLN A 1 59  ? -9.041  -19.498 10.164  1.00 40.12 ? 70  GLN A C   1 
ATOM   349  O O   . GLN A 1 59  ? -8.354  -20.185 9.420   1.00 34.27 ? 70  GLN A O   1 
ATOM   350  C CB  . GLN A 1 59  ? -11.350 -19.818 9.287   1.00 37.92 ? 70  GLN A CB  1 
ATOM   351  C CG  . GLN A 1 59  ? -12.457 -19.201 8.388   1.00 40.95 ? 70  GLN A CG  1 
ATOM   352  C CD  . GLN A 1 59  ? -12.973 -20.163 7.341   1.00 43.82 ? 70  GLN A CD  1 
ATOM   353  O OE1 . GLN A 1 59  ? -13.746 -21.087 7.654   1.00 45.43 ? 70  GLN A OE1 1 
ATOM   354  N NE2 . GLN A 1 59  ? -12.548 -19.963 6.079   1.00 34.27 ? 70  GLN A NE2 1 
ATOM   355  N N   . MET A 1 60  ? -8.781  -19.358 11.457  1.00 35.59 ? 71  MET A N   1 
ATOM   356  C CA  . MET A 1 60  ? -7.618  -19.997 12.052  1.00 44.92 ? 71  MET A CA  1 
ATOM   357  C C   . MET A 1 60  ? -8.030  -20.862 13.210  1.00 49.62 ? 71  MET A C   1 
ATOM   358  O O   . MET A 1 60  ? -9.042  -20.596 13.853  1.00 50.53 ? 71  MET A O   1 
ATOM   359  C CB  . MET A 1 60  ? -6.630  -18.957 12.582  1.00 50.81 ? 71  MET A CB  1 
ATOM   360  C CG  . MET A 1 60  ? -6.722  -17.626 11.890  1.00 61.96 ? 71  MET A CG  1 
ATOM   361  S SD  . MET A 1 60  ? -5.628  -17.643 10.490  1.00 69.36 ? 71  MET A SD  1 
ATOM   362  C CE  . MET A 1 60  ? -4.113  -17.978 11.378  1.00 63.65 ? 71  MET A CE  1 
ATOM   363  N N   . ALA A 1 61  ? -7.214  -21.869 13.499  1.00 46.61 ? 72  ALA A N   1 
ATOM   364  C CA  . ALA A 1 61  ? -7.409  -22.734 14.650  1.00 54.14 ? 72  ALA A CA  1 
ATOM   365  C C   . ALA A 1 61  ? -6.140  -22.723 15.494  1.00 65.12 ? 72  ALA A C   1 
ATOM   366  O O   . ALA A 1 61  ? -5.084  -23.194 15.049  1.00 71.07 ? 72  ALA A O   1 
ATOM   367  C CB  . ALA A 1 61  ? -7.744  -24.160 14.203  1.00 56.37 ? 72  ALA A CB  1 
ATOM   368  N N   . PRO A 1 65  ? 1.680   -19.266 20.392  1.00 77.00 ? 76  PRO A N   1 
ATOM   369  C CA  . PRO A 1 65  ? 2.029   -18.402 19.272  1.00 76.18 ? 76  PRO A CA  1 
ATOM   370  C C   . PRO A 1 65  ? 1.557   -18.978 17.926  1.00 72.87 ? 76  PRO A C   1 
ATOM   371  O O   . PRO A 1 65  ? 1.664   -20.191 17.691  1.00 71.49 ? 76  PRO A O   1 
ATOM   372  C CB  . PRO A 1 65  ? 3.562   -18.344 19.338  1.00 77.00 ? 76  PRO A CB  1 
ATOM   373  C CG  . PRO A 1 65  ? 3.979   -19.593 20.078  1.00 77.85 ? 76  PRO A CG  1 
ATOM   374  C CD  . PRO A 1 65  ? 2.739   -20.250 20.667  1.00 79.61 ? 76  PRO A CD  1 
ATOM   375  N N   . PRO A 1 66  ? 1.017   -18.111 17.052  1.00 67.01 ? 77  PRO A N   1 
ATOM   376  C CA  . PRO A 1 66  ? 0.493   -18.545 15.756  1.00 60.03 ? 77  PRO A CA  1 
ATOM   377  C C   . PRO A 1 66  ? 1.635   -18.960 14.835  1.00 56.78 ? 77  PRO A C   1 
ATOM   378  O O   . PRO A 1 66  ? 2.716   -18.379 14.915  1.00 48.16 ? 77  PRO A O   1 
ATOM   379  C CB  . PRO A 1 66  ? -0.175  -17.275 15.210  1.00 63.27 ? 77  PRO A CB  1 
ATOM   380  C CG  . PRO A 1 66  ? 0.564   -16.147 15.868  1.00 66.42 ? 77  PRO A CG  1 
ATOM   381  C CD  . PRO A 1 66  ? 0.892   -16.655 17.249  1.00 66.02 ? 77  PRO A CD  1 
ATOM   382  N N   . CYS A 1 67  ? 1.390   -19.943 13.967  1.00 43.66 ? 78  CYS A N   1 
ATOM   383  C CA  . CYS A 1 67  ? 2.386   -20.354 12.985  1.00 43.98 ? 78  CYS A CA  1 
ATOM   384  C C   . CYS A 1 67  ? 2.213   -19.545 11.692  1.00 37.85 ? 78  CYS A C   1 
ATOM   385  O O   . CYS A 1 67  ? 3.092   -19.515 10.855  1.00 37.21 ? 78  CYS A O   1 
ATOM   386  C CB  . CYS A 1 67  ? 2.271   -21.869 12.734  1.00 45.14 ? 78  CYS A CB  1 
ATOM   387  S SG  . CYS A 1 67  ? 0.703   -22.391 11.905  1.00 50.85 ? 78  CYS A SG  1 
ATOM   388  N N   . VAL A 1 68  ? 1.059   -18.884 11.529  1.00 35.38 ? 79  VAL A N   1 
ATOM   389  C CA  . VAL A 1 68  ? 0.783   -18.107 10.321  1.00 34.05 ? 79  VAL A CA  1 
ATOM   390  C C   . VAL A 1 68  ? 0.028   -16.781 10.585  1.00 34.30 ? 79  VAL A C   1 
ATOM   391  O O   . VAL A 1 68  ? -0.598  -16.612 11.614  1.00 41.23 ? 79  VAL A O   1 
ATOM   392  C CB  . VAL A 1 68  ? -0.072  -18.905 9.299   1.00 37.44 ? 79  VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 68  ? 0.686   -20.092 8.780   1.00 41.23 ? 79  VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 68  ? -1.369  -19.349 9.943   1.00 39.09 ? 79  VAL A CG2 1 
ATOM   395  N N   . ASN A 1 69  ? 0.130   -15.861 9.641   1.00 33.79 ? 80  ASN A N   1 
ATOM   396  C CA  . ASN A 1 69  ? -0.491  -14.535 9.757   1.00 40.21 ? 80  ASN A CA  1 
ATOM   397  C C   . ASN A 1 69  ? -1.166  -14.247 8.456   1.00 32.61 ? 80  ASN A C   1 
ATOM   398  O O   . ASN A 1 69  ? -0.527  -14.335 7.415   1.00 33.47 ? 80  ASN A O   1 
ATOM   399  C CB  . ASN A 1 69  ? 0.619   -13.502 9.990   1.00 51.47 ? 80  ASN A CB  1 
ATOM   400  C CG  . ASN A 1 69  ? 0.112   -12.101 10.054  1.00 59.77 ? 80  ASN A CG  1 
ATOM   401  O OD1 . ASN A 1 69  ? 0.340   -11.299 9.140   1.00 66.01 ? 80  ASN A OD1 1 
ATOM   402  N ND2 . ASN A 1 69  ? -0.587  -11.785 11.134  1.00 60.75 ? 80  ASN A ND2 1 
ATOM   403  N N   . LYS A 1 70  ? -2.463  -13.897 8.468   1.00 33.06 ? 81  LYS A N   1 
ATOM   404  C CA  . LYS A 1 70  ? -3.103  -13.543 7.200   1.00 31.82 ? 81  LYS A CA  1 
ATOM   405  C C   . LYS A 1 70  ? -2.512  -12.261 6.641   1.00 35.11 ? 81  LYS A C   1 
ATOM   406  O O   . LYS A 1 70  ? -2.144  -11.369 7.386   1.00 38.97 ? 81  LYS A O   1 
ATOM   407  C CB  . LYS A 1 70  ? -4.619  -13.379 7.393   1.00 38.75 ? 81  LYS A CB  1 
ATOM   408  C CG  . LYS A 1 70  ? -4.980  -12.226 8.339   1.00 38.84 ? 81  LYS A CG  1 
ATOM   409  C CD  . LYS A 1 70  ? -6.465  -11.877 8.236   1.00 49.19 ? 81  LYS A CD  1 
ATOM   410  C CE  . LYS A 1 70  ? -7.243  -12.512 9.334   1.00 57.76 ? 81  LYS A CE  1 
ATOM   411  N NZ  . LYS A 1 70  ? -8.541  -11.783 9.478   1.00 65.24 ? 81  LYS A NZ  1 
ATOM   412  N N   . VAL A 1 71  ? -2.420  -12.185 5.329   1.00 29.71 ? 82  VAL A N   1 
ATOM   413  C CA  . VAL A 1 71  ? -1.850  -11.032 4.648   1.00 34.38 ? 82  VAL A CA  1 
ATOM   414  C C   . VAL A 1 71  ? -2.950  -10.268 3.983   1.00 38.62 ? 82  VAL A C   1 
ATOM   415  O O   . VAL A 1 71  ? -3.086  -9.079  4.216   1.00 34.27 ? 82  VAL A O   1 
ATOM   416  C CB  . VAL A 1 71  ? -0.808  -11.456 3.598   1.00 33.91 ? 82  VAL A CB  1 
ATOM   417  C CG1 . VAL A 1 71  ? -0.387  -10.277 2.693   1.00 35.54 ? 82  VAL A CG1 1 
ATOM   418  C CG2 . VAL A 1 71  ? 0.418   -12.066 4.330   1.00 33.45 ? 82  VAL A CG2 1 
ATOM   419  N N   . SER A 1 72  ? -3.705  -10.965 3.134   1.00 31.34 ? 83  SER A N   1 
ATOM   420  C CA  . SER A 1 72  ? -4.758  -10.381 2.320   1.00 32.65 ? 83  SER A CA  1 
ATOM   421  C C   . SER A 1 72  ? -5.653  -11.562 1.959   1.00 34.30 ? 83  SER A C   1 
ATOM   422  O O   . SER A 1 72  ? -5.376  -12.690 2.376   1.00 34.63 ? 83  SER A O   1 
ATOM   423  C CB  . SER A 1 72  ? -4.234  -9.590  1.093   1.00 30.23 ? 83  SER A CB  1 
ATOM   424  O OG  . SER A 1 72  ? -3.473  -10.369 0.162   1.00 35.29 ? 83  SER A OG  1 
ATOM   425  N N   . ASP A 1 73  ? -6.729  -11.329 1.242   1.00 35.78 ? 84  ASP A N   1 
ATOM   426  C CA  . ASP A 1 73  ? -7.599  -12.454 0.853   1.00 32.27 ? 84  ASP A CA  1 
ATOM   427  C C   . ASP A 1 73  ? -6.789  -13.499 0.038   1.00 26.69 ? 84  ASP A C   1 
ATOM   428  O O   . ASP A 1 73  ? -6.216  -13.189 -1.018  1.00 34.16 ? 84  ASP A O   1 
ATOM   429  C CB  . ASP A 1 73  ? -8.719  -11.955 -0.067  1.00 28.37 ? 84  ASP A CB  1 
ATOM   430  C CG  . ASP A 1 73  ? -9.714  -11.011 0.624   1.00 29.87 ? 84  ASP A CG  1 
ATOM   431  O OD1 . ASP A 1 73  ? -9.778  -10.909 1.877   1.00 33.09 ? 84  ASP A OD1 1 
ATOM   432  O OD2 . ASP A 1 73  ? -10.494 -10.438 -0.156  1.00 37.74 ? 84  ASP A OD2 1 
ATOM   433  N N   . TRP A 1 74  ? -6.809  -14.752 0.474   1.00 30.90 ? 85  TRP A N   1 
ATOM   434  C CA  . TRP A 1 74  ? -6.250  -15.855 -0.323  1.00 27.14 ? 85  TRP A CA  1 
ATOM   435  C C   . TRP A 1 74  ? -4.768  -15.932 -0.104  1.00 31.34 ? 85  TRP A C   1 
ATOM   436  O O   . TRP A 1 74  ? -4.127  -16.808 -0.687  1.00 30.13 ? 85  TRP A O   1 
ATOM   437  C CB  . TRP A 1 74  ? -6.483  -15.758 -1.840  1.00 31.00 ? 85  TRP A CB  1 
ATOM   438  C CG  . TRP A 1 74  ? -7.936  -15.782 -2.244  1.00 38.87 ? 85  TRP A CG  1 
ATOM   439  C CD1 . TRP A 1 74  ? -8.714  -14.707 -2.631  1.00 37.76 ? 85  TRP A CD1 1 
ATOM   440  C CD2 . TRP A 1 74  ? -8.801  -16.921 -2.231  1.00 36.03 ? 85  TRP A CD2 1 
ATOM   441  N NE1 . TRP A 1 74  ? -10.024 -15.130 -2.880  1.00 36.88 ? 85  TRP A NE1 1 
ATOM   442  C CE2 . TRP A 1 74  ? -10.095 -16.481 -2.634  1.00 38.57 ? 85  TRP A CE2 1 
ATOM   443  C CE3 . TRP A 1 74  ? -8.609  -18.275 -1.928  1.00 39.84 ? 85  TRP A CE3 1 
ATOM   444  C CZ2 . TRP A 1 74  ? -11.183 -17.355 -2.738  1.00 37.92 ? 85  TRP A CZ2 1 
ATOM   445  C CZ3 . TRP A 1 74  ? -9.692  -19.141 -2.034  1.00 40.03 ? 85  TRP A CZ3 1 
ATOM   446  C CH2 . TRP A 1 74  ? -10.955 -18.684 -2.437  1.00 36.91 ? 85  TRP A CH2 1 
ATOM   447  N N   . LYS A 1 75  ? -4.235  -15.027 0.728   1.00 24.99 ? 86  LYS A N   1 
ATOM   448  C CA  . LYS A 1 75  ? -2.775  -14.908 0.953   1.00 28.74 ? 86  LYS A CA  1 
ATOM   449  C C   . LYS A 1 75  ? -2.365  -14.861 2.426   1.00 31.71 ? 86  LYS A C   1 
ATOM   450  O O   . LYS A 1 75  ? -2.965  -14.161 3.234   1.00 34.29 ? 86  LYS A O   1 
ATOM   451  C CB  . LYS A 1 75  ? -2.219  -13.674 0.235   1.00 33.61 ? 86  LYS A CB  1 
ATOM   452  C CG  . LYS A 1 75  ? -0.656  -13.595 0.350   1.00 31.54 ? 86  LYS A CG  1 
ATOM   453  C CD  . LYS A 1 75  ? -0.114  -12.504 -0.562  1.00 33.53 ? 86  LYS A CD  1 
ATOM   454  C CE  . LYS A 1 75  ? 1.377   -12.294 -0.249  1.00 38.61 ? 86  LYS A CE  1 
ATOM   455  N NZ  . LYS A 1 75  ? 1.897   -11.298 -1.194  1.00 40.63 ? 86  LYS A NZ  1 
ATOM   456  N N   . LEU A 1 76  ? -1.303  -15.608 2.765   1.00 28.15 ? 87  LEU A N   1 
ATOM   457  C CA  . LEU A 1 76  ? -0.935  -15.920 4.133   1.00 33.41 ? 87  LEU A CA  1 
ATOM   458  C C   . LEU A 1 76  ? 0.576   -15.772 4.272   1.00 29.82 ? 87  LEU A C   1 
ATOM   459  O O   . LEU A 1 76  ? 1.266   -15.932 3.296   1.00 29.62 ? 87  LEU A O   1 
ATOM   460  C CB  . LEU A 1 76  ? -1.278  -17.398 4.374   1.00 41.02 ? 87  LEU A CB  1 
ATOM   461  C CG  . LEU A 1 76  ? -1.398  -17.957 5.776   1.00 50.53 ? 87  LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 76  ? -2.508  -17.262 6.511   1.00 51.99 ? 87  LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 76  ? -1.699  -19.446 5.689   1.00 42.28 ? 87  LEU A CD2 1 
ATOM   464  N N   . GLU A 1 77  ? 1.056   -15.491 5.474   1.00 33.01 ? 88  GLU A N   1 
ATOM   465  C CA  . GLU A 1 77  ? 2.500   -15.418 5.762   1.00 36.70 ? 88  GLU A CA  1 
ATOM   466  C C   . GLU A 1 77  ? 2.886   -16.389 6.864   1.00 30.85 ? 88  GLU A C   1 
ATOM   467  O O   . GLU A 1 77  ? 2.199   -16.540 7.879   1.00 34.12 ? 88  GLU A O   1 
ATOM   468  C CB  . GLU A 1 77  ? 2.891   -14.003 6.224   1.00 43.14 ? 88  GLU A CB  1 
ATOM   469  C CG  . GLU A 1 77  ? 4.374   -13.815 6.549   1.00 45.09 ? 88  GLU A CG  1 
ATOM   470  C CD  . GLU A 1 77  ? 4.632   -12.535 7.369   1.00 50.85 ? 88  GLU A CD  1 
ATOM   471  O OE1 . GLU A 1 77  ? 3.662   -11.919 7.859   1.00 58.22 ? 88  GLU A OE1 1 
ATOM   472  O OE2 . GLU A 1 77  ? 5.804   -12.146 7.521   1.00 55.78 ? 88  GLU A OE2 1 
ATOM   473  N N   . ILE A 1 78  ? 4.031   -17.040 6.681   1.00 33.25 ? 89  ILE A N   1 
ATOM   474  C CA  . ILE A 1 78  ? 4.460   -18.050 7.624   1.00 28.79 ? 89  ILE A CA  1 
ATOM   475  C C   . ILE A 1 78  ? 5.286   -17.402 8.723   1.00 31.46 ? 89  ILE A C   1 
ATOM   476  O O   . ILE A 1 78  ? 6.182   -16.611 8.423   1.00 36.15 ? 89  ILE A O   1 
ATOM   477  C CB  . ILE A 1 78  ? 5.356   -19.089 6.905   1.00 29.76 ? 89  ILE A CB  1 
ATOM   478  C CG1 . ILE A 1 78  ? 4.582   -19.698 5.729   1.00 32.33 ? 89  ILE A CG1 1 
ATOM   479  C CG2 . ILE A 1 78  ? 5.825   -20.082 7.937   1.00 33.33 ? 89  ILE A CG2 1 
ATOM   480  C CD1 . ILE A 1 78  ? 3.308   -20.490 6.212   1.00 29.31 ? 89  ILE A CD1 1 
ATOM   481  N N   . LEU A 1 79  ? 4.986   -17.726 9.974   1.00 37.84 ? 90  LEU A N   1 
ATOM   482  C CA  . LEU A 1 79  ? 5.689   -17.095 11.102  1.00 43.89 ? 90  LEU A CA  1 
ATOM   483  C C   . LEU A 1 79  ? 6.515   -18.093 11.896  1.00 45.89 ? 90  LEU A C   1 
ATOM   484  O O   . LEU A 1 79  ? 7.244   -17.711 12.817  1.00 43.81 ? 90  LEU A O   1 
ATOM   485  C CB  . LEU A 1 79  ? 4.689   -16.448 12.059  1.00 40.23 ? 90  LEU A CB  1 
ATOM   486  C CG  . LEU A 1 79  ? 3.644   -15.536 11.425  1.00 39.22 ? 90  LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 79  ? 2.732   -15.051 12.518  1.00 41.72 ? 90  LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 79  ? 4.309   -14.376 10.654  1.00 42.76 ? 90  LEU A CD2 1 
ATOM   489  N N   . GLN A 1 80  ? 6.356   -19.374 11.577  1.00 40.85 ? 91  GLN A N   1 
ATOM   490  C CA  . GLN A 1 80  ? 7.138   -20.433 12.225  1.00 42.45 ? 91  GLN A CA  1 
ATOM   491  C C   . GLN A 1 80  ? 7.768   -21.345 11.181  1.00 46.49 ? 91  GLN A C   1 
ATOM   492  O O   . GLN A 1 80  ? 7.088   -21.833 10.282  1.00 34.57 ? 91  GLN A O   1 
ATOM   493  C CB  . GLN A 1 80  ? 6.249   -21.272 13.127  1.00 49.13 ? 91  GLN A CB  1 
ATOM   494  C CG  . GLN A 1 80  ? 5.907   -20.621 14.451  1.00 63.95 ? 91  GLN A CG  1 
ATOM   495  C CD  . GLN A 1 80  ? 5.282   -21.604 15.429  1.00 71.69 ? 91  GLN A CD  1 
ATOM   496  O OE1 . GLN A 1 80  ? 5.359   -22.825 15.236  1.00 73.89 ? 91  GLN A OE1 1 
ATOM   497  N NE2 . GLN A 1 80  ? 4.657   -21.077 16.482  1.00 73.60 ? 91  GLN A NE2 1 
ATOM   498  N N   . ASN A 1 81  ? 9.070   -21.567 11.292  1.00 41.72 ? 92  ASN A N   1 
ATOM   499  C CA  . ASN A 1 81  ? 9.760   -22.531 10.441  1.00 40.00 ? 92  ASN A CA  1 
ATOM   500  C C   . ASN A 1 81  ? 9.116   -23.873 10.616  1.00 33.60 ? 92  ASN A C   1 
ATOM   501  O O   . ASN A 1 81  ? 8.769   -24.241 11.730  1.00 37.86 ? 92  ASN A O   1 
ATOM   502  C CB  . ASN A 1 81  ? 11.206  -22.688 10.917  1.00 45.27 ? 92  ASN A CB  1 
ATOM   503  C CG  . ASN A 1 81  ? 12.006  -21.459 10.678  1.00 48.62 ? 92  ASN A CG  1 
ATOM   504  O OD1 . ASN A 1 81  ? 11.846  -20.827 9.659   1.00 41.55 ? 92  ASN A OD1 1 
ATOM   505  N ND2 . ASN A 1 81  ? 12.856  -21.089 11.630  1.00 45.12 ? 92  ASN A ND2 1 
ATOM   506  N N   . GLY A 1 82  ? 8.961   -24.621 9.527   1.00 35.57 ? 93  GLY A N   1 
ATOM   507  C CA  . GLY A 1 82  ? 8.403   -25.951 9.697   1.00 36.45 ? 93  GLY A CA  1 
ATOM   508  C C   . GLY A 1 82  ? 7.942   -26.628 8.448   1.00 27.24 ? 93  GLY A C   1 
ATOM   509  O O   . GLY A 1 82  ? 8.085   -26.097 7.334   1.00 30.14 ? 93  GLY A O   1 
ATOM   510  N N   . LEU A 1 83  ? 7.402   -27.828 8.663   1.00 32.84 ? 94  LEU A N   1 
ATOM   511  C CA  . LEU A 1 83  ? 6.879   -28.680 7.597   1.00 34.89 ? 94  LEU A CA  1 
ATOM   512  C C   . LEU A 1 83  ? 5.357   -28.540 7.590   1.00 32.60 ? 94  LEU A C   1 
ATOM   513  O O   . LEU A 1 83  ? 4.684   -28.847 8.570   1.00 31.53 ? 94  LEU A O   1 
ATOM   514  C CB  . LEU A 1 83  ? 7.244   -30.162 7.825   1.00 33.58 ? 94  LEU A CB  1 
ATOM   515  C CG  . LEU A 1 83  ? 6.883   -31.137 6.691   1.00 34.23 ? 94  LEU A CG  1 
ATOM   516  C CD1 . LEU A 1 83  ? 7.690   -30.839 5.433   1.00 35.43 ? 94  LEU A CD1 1 
ATOM   517  C CD2 . LEU A 1 83  ? 7.035   -32.628 7.102   1.00 40.75 ? 94  LEU A CD2 1 
ATOM   518  N N   . TYR A 1 84  ? 4.844   -28.057 6.477   1.00 31.55 ? 95  TYR A N   1 
ATOM   519  C CA  . TYR A 1 84  ? 3.415   -27.747 6.374   1.00 32.05 ? 95  TYR A CA  1 
ATOM   520  C C   . TYR A 1 84  ? 2.769   -28.562 5.271   1.00 31.40 ? 95  TYR A C   1 
ATOM   521  O O   . TYR A 1 84  ? 3.362   -28.820 4.230   1.00 33.67 ? 95  TYR A O   1 
ATOM   522  C CB  . TYR A 1 84  ? 3.213   -26.253 6.022   1.00 31.31 ? 95  TYR A CB  1 
ATOM   523  C CG  . TYR A 1 84  ? 3.605   -25.308 7.109   1.00 28.08 ? 95  TYR A CG  1 
ATOM   524  C CD1 . TYR A 1 84  ? 4.944   -24.921 7.285   1.00 34.89 ? 95  TYR A CD1 1 
ATOM   525  C CD2 . TYR A 1 84  ? 2.638   -24.774 7.965   1.00 32.76 ? 95  TYR A CD2 1 
ATOM   526  C CE1 . TYR A 1 84  ? 5.296   -24.029 8.309   1.00 32.54 ? 95  TYR A CE1 1 
ATOM   527  C CE2 . TYR A 1 84  ? 2.984   -23.879 8.984   1.00 33.63 ? 95  TYR A CE2 1 
ATOM   528  C CZ  . TYR A 1 84  ? 4.305   -23.505 9.129   1.00 36.38 ? 95  TYR A CZ  1 
ATOM   529  O OH  . TYR A 1 84  ? 4.604   -22.639 10.145  1.00 37.48 ? 95  TYR A OH  1 
ATOM   530  N N   . LEU A 1 85  ? 1.517   -28.920 5.487   1.00 30.35 ? 96  LEU A N   1 
ATOM   531  C CA  . LEU A 1 85  ? 0.741   -29.462 4.401   1.00 26.54 ? 96  LEU A CA  1 
ATOM   532  C C   . LEU A 1 85  ? -0.272  -28.425 3.903   1.00 27.92 ? 96  LEU A C   1 
ATOM   533  O O   . LEU A 1 85  ? -1.071  -27.917 4.672   1.00 24.46 ? 96  LEU A O   1 
ATOM   534  C CB  . LEU A 1 85  ? 0.037   -30.694 4.929   1.00 34.15 ? 96  LEU A CB  1 
ATOM   535  C CG  . LEU A 1 85  ? -0.912  -31.450 4.051   1.00 35.68 ? 96  LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 85  ? -0.157  -31.828 2.817   1.00 45.84 ? 96  LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 85  ? -1.224  -32.727 4.839   1.00 40.26 ? 96  LEU A CD2 1 
ATOM   538  N N   . ILE A 1 86  ? -0.267  -28.147 2.613   1.00 29.79 ? 97  ILE A N   1 
ATOM   539  C CA  . ILE A 1 86  ? -1.222  -27.187 2.052   1.00 33.15 ? 97  ILE A CA  1 
ATOM   540  C C   . ILE A 1 86  ? -2.287  -27.982 1.318   1.00 32.54 ? 97  ILE A C   1 
ATOM   541  O O   . ILE A 1 86  ? -1.962  -28.963 0.598   1.00 27.77 ? 97  ILE A O   1 
ATOM   542  C CB  . ILE A 1 86  ? -0.485  -26.205 1.086   1.00 33.27 ? 97  ILE A CB  1 
ATOM   543  C CG1 . ILE A 1 86  ? 0.443   -25.285 1.871   1.00 29.56 ? 97  ILE A CG1 1 
ATOM   544  C CG2 . ILE A 1 86  ? -1.450  -25.379 0.220   1.00 29.64 ? 97  ILE A CG2 1 
ATOM   545  C CD1 . ILE A 1 86  ? 1.418   -24.537 0.968   1.00 33.18 ? 97  ILE A CD1 1 
ATOM   546  N N   . TYR A 1 87  ? -3.556  -27.589 1.474   1.00 27.74 ? 98  TYR A N   1 
ATOM   547  C CA  . TYR A 1 87  ? -4.671  -28.351 0.818   1.00 31.07 ? 98  TYR A CA  1 
ATOM   548  C C   . TYR A 1 87  ? -5.702  -27.375 0.258   1.00 37.71 ? 98  TYR A C   1 
ATOM   549  O O   . TYR A 1 87  ? -5.691  -26.205 0.603   1.00 29.93 ? 98  TYR A O   1 
ATOM   550  C CB  . TYR A 1 87  ? -5.357  -29.307 1.844   1.00 31.63 ? 98  TYR A CB  1 
ATOM   551  C CG  . TYR A 1 87  ? -6.203  -28.612 2.878   1.00 32.06 ? 98  TYR A CG  1 
ATOM   552  C CD1 . TYR A 1 87  ? -7.560  -28.411 2.664   1.00 34.03 ? 98  TYR A CD1 1 
ATOM   553  C CD2 . TYR A 1 87  ? -5.638  -28.102 4.037   1.00 31.48 ? 98  TYR A CD2 1 
ATOM   554  C CE1 . TYR A 1 87  ? -8.327  -27.740 3.590   1.00 37.19 ? 98  TYR A CE1 1 
ATOM   555  C CE2 . TYR A 1 87  ? -6.398  -27.444 4.973   1.00 37.52 ? 98  TYR A CE2 1 
ATOM   556  C CZ  . TYR A 1 87  ? -7.742  -27.274 4.755   1.00 32.88 ? 98  TYR A CZ  1 
ATOM   557  O OH  . TYR A 1 87  ? -8.512  -26.610 5.692   1.00 39.43 ? 98  TYR A OH  1 
ATOM   558  N N   . GLY A 1 88  ? -6.587  -27.838 -0.613  1.00 33.21 ? 99  GLY A N   1 
ATOM   559  C CA  . GLY A 1 88  ? -7.775  -27.042 -0.925  1.00 33.62 ? 99  GLY A CA  1 
ATOM   560  C C   . GLY A 1 88  ? -8.415  -27.580 -2.176  1.00 34.69 ? 99  GLY A C   1 
ATOM   561  O O   . GLY A 1 88  ? -8.080  -28.669 -2.622  1.00 27.73 ? 99  GLY A O   1 
ATOM   562  N N   . GLN A 1 89  ? -9.332  -26.826 -2.756  1.00 30.83 ? 100 GLN A N   1 
ATOM   563  C CA  . GLN A 1 89  ? -9.904  -27.205 -4.040  1.00 38.09 ? 100 GLN A CA  1 
ATOM   564  C C   . GLN A 1 89  ? -10.297 -25.943 -4.784  1.00 36.36 ? 100 GLN A C   1 
ATOM   565  O O   . GLN A 1 89  ? -10.654 -24.943 -4.163  1.00 33.27 ? 100 GLN A O   1 
ATOM   566  C CB  . GLN A 1 89  ? -11.124 -28.122 -3.851  1.00 44.38 ? 100 GLN A CB  1 
ATOM   567  C CG  . GLN A 1 89  ? -12.393 -27.380 -3.583  1.00 42.04 ? 100 GLN A CG  1 
ATOM   568  C CD  . GLN A 1 89  ? -13.623 -28.278 -3.360  1.00 46.90 ? 100 GLN A CD  1 
ATOM   569  O OE1 . GLN A 1 89  ? -14.743 -27.778 -3.256  1.00 51.41 ? 100 GLN A OE1 1 
ATOM   570  N NE2 . GLN A 1 89  ? -13.407 -29.575 -3.233  1.00 42.88 ? 100 GLN A NE2 1 
ATOM   571  N N   . VAL A 1 90  ? -10.199 -26.000 -6.109  1.00 35.41 ? 101 VAL A N   1 
ATOM   572  C CA  . VAL A 1 90  ? -10.617 -24.907 -6.959  1.00 41.62 ? 101 VAL A CA  1 
ATOM   573  C C   . VAL A 1 90  ? -11.775 -25.463 -7.776  1.00 43.79 ? 101 VAL A C   1 
ATOM   574  O O   . VAL A 1 90  ? -11.638 -26.518 -8.404  1.00 42.92 ? 101 VAL A O   1 
ATOM   575  C CB  . VAL A 1 90  ? -9.468  -24.420 -7.881  1.00 40.06 ? 101 VAL A CB  1 
ATOM   576  C CG1 . VAL A 1 90  ? -9.979  -23.392 -8.903  1.00 42.35 ? 101 VAL A CG1 1 
ATOM   577  C CG2 . VAL A 1 90  ? -8.332  -23.821 -7.060  1.00 40.40 ? 101 VAL A CG2 1 
ATOM   578  N N   . ALA A 1 91  ? -12.921 -24.780 -7.709  1.00 42.54 ? 102 ALA A N   1 
ATOM   579  C CA  . ALA A 1 91  ? -14.117 -25.195 -8.430  1.00 43.77 ? 102 ALA A CA  1 
ATOM   580  C C   . ALA A 1 91  ? -14.301 -24.258 -9.617  1.00 48.61 ? 102 ALA A C   1 
ATOM   581  O O   . ALA A 1 91  ? -14.602 -23.064 -9.447  1.00 47.23 ? 102 ALA A O   1 
ATOM   582  C CB  . ALA A 1 91  ? -15.335 -25.152 -7.513  1.00 43.30 ? 102 ALA A CB  1 
ATOM   583  N N   . PRO A 1 92  ? -14.046 -24.775 -10.818 1.00 53.41 ? 103 PRO A N   1 
ATOM   584  C CA  . PRO A 1 92  ? -14.120 -23.945 -12.003 1.00 57.05 ? 103 PRO A CA  1 
ATOM   585  C C   . PRO A 1 92  ? -15.549 -23.520 -12.300 1.00 58.64 ? 103 PRO A C   1 
ATOM   586  O O   . PRO A 1 92  ? -16.495 -24.249 -11.977 1.00 52.03 ? 103 PRO A O   1 
ATOM   587  C CB  . PRO A 1 92  ? -13.587 -24.864 -13.113 1.00 57.24 ? 103 PRO A CB  1 
ATOM   588  C CG  . PRO A 1 92  ? -12.833 -25.945 -12.401 1.00 59.90 ? 103 PRO A CG  1 
ATOM   589  C CD  . PRO A 1 92  ? -13.628 -26.148 -11.138 1.00 57.76 ? 103 PRO A CD  1 
ATOM   590  N N   . ASN A 1 93  ? -15.681 -22.333 -12.885 1.00 64.82 ? 104 ASN A N   1 
ATOM   591  C CA  . ASN A 1 93  ? -16.960 -21.796 -13.332 1.00 68.60 ? 104 ASN A CA  1 
ATOM   592  C C   . ASN A 1 93  ? -17.008 -21.630 -14.848 1.00 68.94 ? 104 ASN A C   1 
ATOM   593  O O   . ASN A 1 93  ? -16.812 -22.590 -15.591 1.00 69.14 ? 104 ASN A O   1 
ATOM   594  C CB  . ASN A 1 93  ? -17.220 -20.450 -12.676 1.00 71.61 ? 104 ASN A CB  1 
ATOM   595  C CG  . ASN A 1 93  ? -18.412 -19.750 -13.260 1.00 73.72 ? 104 ASN A CG  1 
ATOM   596  O OD1 . ASN A 1 93  ? -19.396 -20.388 -13.642 1.00 75.44 ? 104 ASN A OD1 1 
ATOM   597  N ND2 . ASN A 1 93  ? -18.339 -18.429 -13.335 1.00 76.09 ? 104 ASN A ND2 1 
ATOM   598  N N   . ALA A 1 100 ? -11.062 -16.534 -22.264 1.00 82.50 ? 111 ALA A N   1 
ATOM   599  C CA  . ALA A 1 100 ? -9.831  -16.479 -21.480 1.00 84.41 ? 111 ALA A CA  1 
ATOM   600  C C   . ALA A 1 100 ? -9.454  -17.863 -20.939 1.00 85.06 ? 111 ALA A C   1 
ATOM   601  O O   . ALA A 1 100 ? -10.249 -18.497 -20.241 1.00 85.97 ? 111 ALA A O   1 
ATOM   602  C CB  . ALA A 1 100 ? -9.971  -15.472 -20.342 1.00 81.92 ? 111 ALA A CB  1 
ATOM   603  N N   . PRO A 1 101 ? -8.235  -18.334 -21.258 1.00 83.28 ? 112 PRO A N   1 
ATOM   604  C CA  . PRO A 1 101 ? -7.799  -19.659 -20.812 1.00 79.64 ? 112 PRO A CA  1 
ATOM   605  C C   . PRO A 1 101 ? -7.814  -19.785 -19.277 1.00 74.20 ? 112 PRO A C   1 
ATOM   606  O O   . PRO A 1 101 ? -7.457  -18.840 -18.564 1.00 71.25 ? 112 PRO A O   1 
ATOM   607  C CB  . PRO A 1 101 ? -6.372  -19.772 -21.377 1.00 80.33 ? 112 PRO A CB  1 
ATOM   608  C CG  . PRO A 1 101 ? -5.940  -18.365 -21.650 1.00 81.32 ? 112 PRO A CG  1 
ATOM   609  C CD  . PRO A 1 101 ? -7.194  -17.642 -22.041 1.00 83.75 ? 112 PRO A CD  1 
ATOM   610  N N   . PHE A 1 102 ? -8.256  -20.933 -18.776 1.00 69.99 ? 113 PHE A N   1 
ATOM   611  C CA  . PHE A 1 102 ? -8.402  -21.116 -17.328 1.00 63.34 ? 113 PHE A CA  1 
ATOM   612  C C   . PHE A 1 102 ? -7.033  -21.266 -16.695 1.00 57.36 ? 113 PHE A C   1 
ATOM   613  O O   . PHE A 1 102 ? -6.201  -22.040 -17.173 1.00 54.44 ? 113 PHE A O   1 
ATOM   614  C CB  . PHE A 1 102 ? -9.281  -22.327 -17.013 1.00 65.10 ? 113 PHE A CB  1 
ATOM   615  C CG  . PHE A 1 102 ? -9.549  -22.508 -15.550 1.00 66.62 ? 113 PHE A CG  1 
ATOM   616  C CD1 . PHE A 1 102 ? -10.564 -21.804 -14.927 1.00 67.42 ? 113 PHE A CD1 1 
ATOM   617  C CD2 . PHE A 1 102 ? -8.777  -23.374 -14.790 1.00 67.60 ? 113 PHE A CD2 1 
ATOM   618  C CE1 . PHE A 1 102 ? -10.804 -21.957 -13.570 1.00 65.41 ? 113 PHE A CE1 1 
ATOM   619  C CE2 . PHE A 1 102 ? -9.014  -23.532 -13.445 1.00 63.38 ? 113 PHE A CE2 1 
ATOM   620  C CZ  . PHE A 1 102 ? -10.030 -22.820 -12.834 1.00 64.88 ? 113 PHE A CZ  1 
ATOM   621  N N   . GLU A 1 103 ? -6.775  -20.489 -15.653 1.00 55.51 ? 114 GLU A N   1 
ATOM   622  C CA  . GLU A 1 103 ? -5.517  -20.620 -14.947 1.00 57.60 ? 114 GLU A CA  1 
ATOM   623  C C   . GLU A 1 103 ? -5.589  -20.079 -13.540 1.00 53.36 ? 114 GLU A C   1 
ATOM   624  O O   . GLU A 1 103 ? -5.887  -18.889 -13.311 1.00 45.72 ? 114 GLU A O   1 
ATOM   625  C CB  . GLU A 1 103 ? -4.354  -19.969 -15.699 1.00 62.35 ? 114 GLU A CB  1 
ATOM   626  C CG  . GLU A 1 103 ? -2.997  -20.556 -15.304 1.00 68.14 ? 114 GLU A CG  1 
ATOM   627  C CD  . GLU A 1 103 ? -1.817  -19.802 -15.890 1.00 70.96 ? 114 GLU A CD  1 
ATOM   628  O OE1 . GLU A 1 103 ? -1.834  -18.546 -15.883 1.00 75.08 ? 114 GLU A OE1 1 
ATOM   629  O OE2 . GLU A 1 103 ? -0.861  -20.472 -16.344 1.00 76.76 ? 114 GLU A OE2 1 
ATOM   630  N N   . VAL A 1 104 ? -5.324  -20.988 -12.602 1.00 45.98 ? 115 VAL A N   1 
ATOM   631  C CA  . VAL A 1 104 ? -5.168  -20.661 -11.205 1.00 43.70 ? 115 VAL A CA  1 
ATOM   632  C C   . VAL A 1 104 ? -3.765  -21.136 -10.786 1.00 44.86 ? 115 VAL A C   1 
ATOM   633  O O   . VAL A 1 104 ? -3.292  -22.205 -11.210 1.00 43.04 ? 115 VAL A O   1 
ATOM   634  C CB  . VAL A 1 104 ? -6.297  -21.287 -10.349 1.00 39.13 ? 115 VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 104 ? -6.157  -20.866 -8.892  1.00 39.83 ? 115 VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 104 ? -7.664  -20.857 -10.899 1.00 37.86 ? 115 VAL A CG2 1 
ATOM   637  N N   . ARG A 1 105 ? -3.078  -20.299 -10.023 1.00 39.13 ? 116 ARG A N   1 
ATOM   638  C CA  . ARG A 1 105 ? -1.697  -20.565 -9.643  1.00 40.39 ? 116 ARG A CA  1 
ATOM   639  C C   . ARG A 1 105 ? -1.527  -20.405 -8.156  1.00 40.97 ? 116 ARG A C   1 
ATOM   640  O O   . ARG A 1 105 ? -1.984  -19.415 -7.551  1.00 38.55 ? 116 ARG A O   1 
ATOM   641  C CB  . ARG A 1 105 ? -0.710  -19.614 -10.370 1.00 41.31 ? 116 ARG A CB  1 
ATOM   642  C CG  . ARG A 1 105 ? -0.561  -19.857 -11.886 1.00 48.53 ? 116 ARG A CG  1 
ATOM   643  C CD  . ARG A 1 105 ? 0.221   -18.716 -12.612 1.00 54.03 ? 116 ARG A CD  1 
ATOM   644  N NE  . ARG A 1 105 ? -0.649  -17.574 -12.923 1.00 65.89 ? 116 ARG A NE  1 
ATOM   645  C CZ  . ARG A 1 105 ? -0.234  -16.382 -13.351 1.00 70.97 ? 116 ARG A CZ  1 
ATOM   646  N NH1 . ARG A 1 105 ? -1.124  -15.423 -13.593 1.00 72.12 ? 116 ARG A NH1 1 
ATOM   647  N NH2 . ARG A 1 105 ? 1.061   -16.137 -13.530 1.00 72.04 ? 116 ARG A NH2 1 
ATOM   648  N N   . LEU A 1 106 ? -0.833  -21.366 -7.561  1.00 34.88 ? 117 LEU A N   1 
ATOM   649  C CA  . LEU A 1 106 ? -0.411  -21.255 -6.178  1.00 37.46 ? 117 LEU A CA  1 
ATOM   650  C C   . LEU A 1 106 ? 1.054   -20.802 -6.157  1.00 34.57 ? 117 LEU A C   1 
ATOM   651  O O   . LEU A 1 106 ? 1.921   -21.389 -6.849  1.00 36.84 ? 117 LEU A O   1 
ATOM   652  C CB  . LEU A 1 106 ? -0.543  -22.624 -5.480  1.00 35.63 ? 117 LEU A CB  1 
ATOM   653  C CG  . LEU A 1 106 ? -0.188  -22.739 -4.003  1.00 34.04 ? 117 LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 106 ? -1.189  -22.045 -3.119  1.00 29.89 ? 117 LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 106 ? -0.117  -24.259 -3.636  1.00 37.63 ? 117 LEU A CD2 1 
ATOM   656  N N   . TYR A 1 107 ? 1.336   -19.809 -5.335  1.00 34.69 ? 118 TYR A N   1 
ATOM   657  C CA  . TYR A 1 107 ? 2.672   -19.238 -5.215  1.00 35.88 ? 118 TYR A CA  1 
ATOM   658  C C   . TYR A 1 107 ? 3.224   -19.456 -3.842  1.00 35.21 ? 118 TYR A C   1 
ATOM   659  O O   . TYR A 1 107 ? 2.508   -19.330 -2.839  1.00 32.21 ? 118 TYR A O   1 
ATOM   660  C CB  . TYR A 1 107 ? 2.655   -17.704 -5.501  1.00 34.22 ? 118 TYR A CB  1 
ATOM   661  C CG  . TYR A 1 107 ? 2.492   -17.404 -6.970  1.00 39.31 ? 118 TYR A CG  1 
ATOM   662  C CD1 . TYR A 1 107 ? 1.224   -17.348 -7.569  1.00 44.39 ? 118 TYR A CD1 1 
ATOM   663  C CD2 . TYR A 1 107 ? 3.608   -17.219 -7.772  1.00 39.02 ? 118 TYR A CD2 1 
ATOM   664  C CE1 . TYR A 1 107 ? 1.092   -17.098 -8.939  1.00 42.35 ? 118 TYR A CE1 1 
ATOM   665  C CE2 . TYR A 1 107 ? 3.488   -16.955 -9.104  1.00 44.17 ? 118 TYR A CE2 1 
ATOM   666  C CZ  . TYR A 1 107 ? 2.244   -16.893 -9.691  1.00 46.35 ? 118 TYR A CZ  1 
ATOM   667  O OH  . TYR A 1 107 ? 2.195   -16.642 -11.054 1.00 47.35 ? 118 TYR A OH  1 
ATOM   668  N N   . LYS A 1 108 ? 4.532   -19.707 -3.788  1.00 31.66 ? 119 LYS A N   1 
ATOM   669  C CA  . LYS A 1 108 ? 5.306   -19.593 -2.569  1.00 32.72 ? 119 LYS A CA  1 
ATOM   670  C C   . LYS A 1 108 ? 6.258   -18.405 -2.850  1.00 39.01 ? 119 LYS A C   1 
ATOM   671  O O   . LYS A 1 108 ? 7.066   -18.469 -3.768  1.00 38.95 ? 119 LYS A O   1 
ATOM   672  C CB  . LYS A 1 108 ? 6.151   -20.856 -2.289  1.00 34.88 ? 119 LYS A CB  1 
ATOM   673  C CG  . LYS A 1 108 ? 6.979   -20.682 -1.019  1.00 38.39 ? 119 LYS A CG  1 
ATOM   674  C CD  . LYS A 1 108 ? 7.912   -21.841 -0.633  1.00 41.77 ? 119 LYS A CD  1 
ATOM   675  C CE  . LYS A 1 108 ? 9.092   -21.987 -1.566  1.00 48.48 ? 119 LYS A CE  1 
ATOM   676  N NZ  . LYS A 1 108 ? 10.156  -22.720 -0.824  1.00 49.30 ? 119 LYS A NZ  1 
ATOM   677  N N   . ASN A 1 109 ? 6.141   -17.331 -2.095  1.00 38.59 ? 120 ASN A N   1 
ATOM   678  C CA  . ASN A 1 109 ? 6.849   -16.092 -2.434  1.00 42.47 ? 120 ASN A CA  1 
ATOM   679  C C   . ASN A 1 109 ? 6.588   -15.728 -3.859  1.00 46.90 ? 120 ASN A C   1 
ATOM   680  O O   . ASN A 1 109 ? 5.426   -15.607 -4.261  1.00 43.83 ? 120 ASN A O   1 
ATOM   681  C CB  . ASN A 1 109 ? 8.341   -16.235 -2.155  1.00 38.13 ? 120 ASN A CB  1 
ATOM   682  C CG  . ASN A 1 109 ? 8.585   -16.542 -0.743  1.00 37.50 ? 120 ASN A CG  1 
ATOM   683  O OD1 . ASN A 1 109 ? 7.920   -15.985 0.113   1.00 39.58 ? 120 ASN A OD1 1 
ATOM   684  N ND2 . ASN A 1 109 ? 9.518   -17.447 -0.460  1.00 40.53 ? 120 ASN A ND2 1 
ATOM   685  N N   . LYS A 1 110 ? 7.646   -15.590 -4.648  1.00 45.72 ? 121 LYS A N   1 
ATOM   686  C CA  . LYS A 1 110 ? 7.458   -15.311 -6.073  1.00 51.65 ? 121 LYS A CA  1 
ATOM   687  C C   . LYS A 1 110 ? 7.384   -16.559 -6.944  1.00 53.02 ? 121 LYS A C   1 
ATOM   688  O O   . LYS A 1 110 ? 7.006   -16.476 -8.101  1.00 56.00 ? 121 LYS A O   1 
ATOM   689  C CB  . LYS A 1 110 ? 8.537   -14.363 -6.604  1.00 59.42 ? 121 LYS A CB  1 
ATOM   690  C CG  . LYS A 1 110 ? 8.130   -12.896 -6.541  1.00 65.83 ? 121 LYS A CG  1 
ATOM   691  C CD  . LYS A 1 110 ? 8.297   -12.318 -5.138  1.00 70.30 ? 121 LYS A CD  1 
ATOM   692  C CE  . LYS A 1 110 ? 9.527   -11.418 -5.047  1.00 74.62 ? 121 LYS A CE  1 
ATOM   693  N NZ  . LYS A 1 110 ? 10.683  -11.933 -5.859  1.00 75.47 ? 121 LYS A NZ  1 
ATOM   694  N N   . ASP A 1 111 ? 7.754   -17.711 -6.401  1.00 53.39 ? 122 ASP A N   1 
ATOM   695  C CA  . ASP A 1 111 ? 7.789   -18.932 -7.206  1.00 54.11 ? 122 ASP A CA  1 
ATOM   696  C C   . ASP A 1 111 ? 6.389   -19.494 -7.361  1.00 50.68 ? 122 ASP A C   1 
ATOM   697  O O   . ASP A 1 111 ? 5.713   -19.765 -6.361  1.00 40.64 ? 122 ASP A O   1 
ATOM   698  C CB  . ASP A 1 111 ? 8.618   -20.028 -6.522  1.00 60.74 ? 122 ASP A CB  1 
ATOM   699  C CG  . ASP A 1 111 ? 9.823   -19.488 -5.777  1.00 69.49 ? 122 ASP A CG  1 
ATOM   700  O OD1 . ASP A 1 111 ? 10.661  -18.832 -6.429  1.00 66.97 ? 122 ASP A OD1 1 
ATOM   701  O OD2 . ASP A 1 111 ? 9.931   -19.740 -4.544  1.00 71.18 ? 122 ASP A OD2 1 
ATOM   702  N N   . MET A 1 112 ? 5.962   -19.705 -8.595  1.00 49.61 ? 123 MET A N   1 
ATOM   703  C CA  . MET A 1 112 ? 4.769   -20.475 -8.821  1.00 52.69 ? 123 MET A CA  1 
ATOM   704  C C   . MET A 1 112 ? 5.047   -21.908 -8.367  1.00 52.50 ? 123 MET A C   1 
ATOM   705  O O   . MET A 1 112 ? 6.030   -22.509 -8.797  1.00 52.01 ? 123 MET A O   1 
ATOM   706  C CB  . MET A 1 112 ? 4.420   -20.474 -10.291 1.00 55.37 ? 123 MET A CB  1 
ATOM   707  C CG  . MET A 1 112 ? 2.946   -20.639 -10.530 1.00 57.78 ? 123 MET A CG  1 
ATOM   708  S SD  . MET A 1 112 ? 2.630   -21.857 -11.778 1.00 70.59 ? 123 MET A SD  1 
ATOM   709  C CE  . MET A 1 112 ? 3.582   -23.206 -11.093 1.00 35.76 ? 123 MET A CE  1 
ATOM   710  N N   . ILE A 1 113 ? 4.200   -22.468 -7.503  1.00 42.92 ? 124 ILE A N   1 
ATOM   711  C CA  . ILE A 1 113 ? 4.442   -23.848 -7.046  1.00 37.32 ? 124 ILE A CA  1 
ATOM   712  C C   . ILE A 1 113 ? 3.421   -24.849 -7.591  1.00 43.48 ? 124 ILE A C   1 
ATOM   713  O O   . ILE A 1 113 ? 3.656   -26.061 -7.576  1.00 42.41 ? 124 ILE A O   1 
ATOM   714  C CB  . ILE A 1 113 ? 4.628   -23.963 -5.514  1.00 40.72 ? 124 ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 113 ? 3.458   -23.332 -4.759  1.00 36.17 ? 124 ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 113 ? 5.977   -23.376 -5.082  1.00 41.46 ? 124 ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 113 ? 3.498   -23.617 -3.261  1.00 35.19 ? 124 ILE A CD1 1 
ATOM   718  N N   . GLN A 1 114 ? 2.297   -24.352 -8.116  1.00 39.20 ? 125 GLN A N   1 
ATOM   719  C CA  . GLN A 1 114 ? 1.349   -25.215 -8.770  1.00 35.98 ? 125 GLN A CA  1 
ATOM   720  C C   . GLN A 1 114 ? 0.532   -24.408 -9.720  1.00 45.31 ? 125 GLN A C   1 
ATOM   721  O O   . GLN A 1 114 ? 0.221   -23.261 -9.448  1.00 43.54 ? 125 GLN A O   1 
ATOM   722  C CB  . GLN A 1 114 ? 0.426   -25.891 -7.757  1.00 43.76 ? 125 GLN A CB  1 
ATOM   723  C CG  . GLN A 1 114 ? -0.497  -26.975 -8.356  1.00 42.10 ? 125 GLN A CG  1 
ATOM   724  C CD  . GLN A 1 114 ? -1.395  -27.618 -7.310  1.00 46.50 ? 125 GLN A CD  1 
ATOM   725  O OE1 . GLN A 1 114 ? -1.466  -27.155 -6.168  1.00 49.60 ? 125 GLN A OE1 1 
ATOM   726  N NE2 . GLN A 1 114 ? -2.102  -28.674 -7.700  1.00 48.77 ? 125 GLN A NE2 1 
ATOM   727  N N   . THR A 1 115 ? 0.177   -24.999 -10.848 1.00 42.67 ? 126 THR A N   1 
ATOM   728  C CA  . THR A 1 115 ? -0.725  -24.316 -11.766 1.00 49.33 ? 126 THR A CA  1 
ATOM   729  C C   . THR A 1 115 ? -1.872  -25.228 -12.106 1.00 47.40 ? 126 THR A C   1 
ATOM   730  O O   . THR A 1 115 ? -1.681  -26.428 -12.305 1.00 48.64 ? 126 THR A O   1 
ATOM   731  C CB  . THR A 1 115 ? 0.008   -23.773 -13.034 1.00 54.68 ? 126 THR A CB  1 
ATOM   732  O OG1 . THR A 1 115 ? -0.929  -23.623 -14.109 1.00 58.93 ? 126 THR A OG1 1 
ATOM   733  C CG2 . THR A 1 115 ? 1.114   -24.717 -13.462 1.00 61.24 ? 126 THR A CG2 1 
ATOM   734  N N   . LEU A 1 116 ? -3.074  -24.660 -12.090 1.00 46.09 ? 127 LEU A N   1 
ATOM   735  C CA  . LEU A 1 116 ? -4.309  -25.373 -12.388 1.00 44.73 ? 127 LEU A CA  1 
ATOM   736  C C   . LEU A 1 116 ? -4.909  -24.782 -13.656 1.00 54.28 ? 127 LEU A C   1 
ATOM   737  O O   . LEU A 1 116 ? -5.039  -23.560 -13.796 1.00 57.11 ? 127 LEU A O   1 
ATOM   738  C CB  . LEU A 1 116 ? -5.285  -25.293 -11.218 1.00 50.26 ? 127 LEU A CB  1 
ATOM   739  C CG  . LEU A 1 116 ? -4.822  -26.031 -9.949  1.00 51.64 ? 127 LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 116 ? -5.803  -25.843 -8.816  1.00 54.99 ? 127 LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 116 ? -4.619  -27.512 -10.240 1.00 53.01 ? 127 LEU A CD2 1 
ATOM   742  N N   . THR A 1 117 ? -5.294  -25.669 -14.562 1.00 57.00 ? 128 THR A N   1 
ATOM   743  C CA  . THR A 1 117 ? -5.444  -25.343 -15.968 1.00 64.31 ? 128 THR A CA  1 
ATOM   744  C C   . THR A 1 117 ? -6.741  -25.939 -16.546 1.00 65.24 ? 128 THR A C   1 
ATOM   745  O O   . THR A 1 117 ? -7.166  -25.592 -17.661 1.00 62.19 ? 128 THR A O   1 
ATOM   746  C CB  . THR A 1 117 ? -4.232  -25.922 -16.722 1.00 67.50 ? 128 THR A CB  1 
ATOM   747  O OG1 . THR A 1 117 ? -4.087  -25.288 -17.996 1.00 74.54 ? 128 THR A OG1 1 
ATOM   748  C CG2 . THR A 1 117 ? -4.379  -27.431 -16.895 1.00 65.88 ? 128 THR A CG2 1 
ATOM   749  N N   . ASN A 1 118 ? -7.371  -26.814 -15.766 1.00 63.22 ? 129 ASN A N   1 
ATOM   750  C CA  . ASN A 1 118 ? -8.497  -27.615 -16.229 1.00 67.56 ? 129 ASN A CA  1 
ATOM   751  C C   . ASN A 1 118 ? -9.820  -26.984 -15.820 1.00 70.29 ? 129 ASN A C   1 
ATOM   752  O O   . ASN A 1 118 ? -10.103 -26.815 -14.631 1.00 72.54 ? 129 ASN A O   1 
ATOM   753  C CB  . ASN A 1 118 ? -8.373  -29.038 -15.670 1.00 71.88 ? 129 ASN A CB  1 
ATOM   754  C CG  . ASN A 1 118 ? -9.397  -30.009 -16.259 1.00 74.37 ? 129 ASN A CG  1 
ATOM   755  O OD1 . ASN A 1 118 ? -10.507 -29.625 -16.625 1.00 75.62 ? 129 ASN A OD1 1 
ATOM   756  N ND2 . ASN A 1 118 ? -9.024  -31.280 -16.333 1.00 69.67 ? 129 ASN A ND2 1 
ATOM   757  N N   . LYS A 1 119 ? -10.635 -26.641 -16.811 1.00 70.99 ? 130 LYS A N   1 
ATOM   758  C CA  . LYS A 1 119 ? -11.875 -25.909 -16.564 1.00 74.68 ? 130 LYS A CA  1 
ATOM   759  C C   . LYS A 1 119 ? -13.097 -26.798 -16.315 1.00 75.83 ? 130 LYS A C   1 
ATOM   760  O O   . LYS A 1 119 ? -14.187 -26.294 -16.059 1.00 74.99 ? 130 LYS A O   1 
ATOM   761  C CB  . LYS A 1 119 ? -12.157 -24.928 -17.712 1.00 76.88 ? 130 LYS A CB  1 
ATOM   762  C CG  . LYS A 1 119 ? -11.858 -25.482 -19.105 1.00 76.91 ? 130 LYS A CG  1 
ATOM   763  N N   . SER A 1 120 ? -12.911 -28.113 -16.373 1.00 78.11 ? 131 SER A N   1 
ATOM   764  C CA  . SER A 1 120 ? -14.030 -29.058 -16.285 1.00 81.55 ? 131 SER A CA  1 
ATOM   765  C C   . SER A 1 120 ? -14.232 -29.614 -14.866 1.00 80.39 ? 131 SER A C   1 
ATOM   766  O O   . SER A 1 120 ? -15.344 -29.571 -14.324 1.00 81.86 ? 131 SER A O   1 
ATOM   767  C CB  . SER A 1 120 ? -13.825 -30.207 -17.290 1.00 83.90 ? 131 SER A CB  1 
ATOM   768  O OG  . SER A 1 120 ? -15.019 -30.944 -17.509 1.00 86.91 ? 131 SER A OG  1 
ATOM   769  N N   . LYS A 1 121 ? -13.151 -30.122 -14.271 1.00 74.60 ? 132 LYS A N   1 
ATOM   770  C CA  . LYS A 1 121 ? -13.203 -30.774 -12.957 1.00 67.13 ? 132 LYS A CA  1 
ATOM   771  C C   . LYS A 1 121 ? -12.806 -29.853 -11.801 1.00 62.88 ? 132 LYS A C   1 
ATOM   772  O O   . LYS A 1 121 ? -12.066 -28.866 -11.980 1.00 60.14 ? 132 LYS A O   1 
ATOM   773  C CB  . LYS A 1 121 ? -12.297 -32.010 -12.946 1.00 69.95 ? 132 LYS A CB  1 
ATOM   774  C CG  . LYS A 1 121 ? -12.910 -33.266 -13.559 1.00 73.16 ? 132 LYS A CG  1 
ATOM   775  N N   . ILE A 1 122 ? -13.311 -30.190 -10.620 1.00 56.92 ? 133 ILE A N   1 
ATOM   776  C CA  . ILE A 1 122 ? -12.873 -29.601 -9.363  1.00 50.38 ? 133 ILE A CA  1 
ATOM   777  C C   . ILE A 1 122 ? -11.498 -30.185 -9.082  1.00 54.50 ? 133 ILE A C   1 
ATOM   778  O O   . ILE A 1 122 ? -11.310 -31.400 -9.166  1.00 53.34 ? 133 ILE A O   1 
ATOM   779  C CB  . ILE A 1 122 ? -13.876 -29.914 -8.235  1.00 53.85 ? 133 ILE A CB  1 
ATOM   780  C CG1 . ILE A 1 122 ? -15.207 -29.208 -8.508  1.00 50.83 ? 133 ILE A CG1 1 
ATOM   781  C CG2 . ILE A 1 122 ? -13.327 -29.520 -6.879  1.00 55.42 ? 133 ILE A CG2 1 
ATOM   782  C CD1 . ILE A 1 122 ? -16.086 -29.100 -7.287  1.00 55.24 ? 133 ILE A CD1 1 
ATOM   783  N N   . GLN A 1 123 ? -10.525 -29.316 -8.816  1.00 53.47 ? 134 GLN A N   1 
ATOM   784  C CA  . GLN A 1 123 ? -9.128  -29.735 -8.698  1.00 51.69 ? 134 GLN A CA  1 
ATOM   785  C C   . GLN A 1 123 ? -8.530  -29.446 -7.321  1.00 49.66 ? 134 GLN A C   1 
ATOM   786  O O   . GLN A 1 123 ? -8.727  -28.372 -6.767  1.00 41.77 ? 134 GLN A O   1 
ATOM   787  C CB  . GLN A 1 123 ? -8.282  -29.028 -9.755  1.00 56.60 ? 134 GLN A CB  1 
ATOM   788  C CG  . GLN A 1 123 ? -8.905  -28.982 -11.133 1.00 63.44 ? 134 GLN A CG  1 
ATOM   789  C CD  . GLN A 1 123 ? -7.880  -28.666 -12.195 1.00 64.59 ? 134 GLN A CD  1 
ATOM   790  O OE1 . GLN A 1 123 ? -7.781  -27.530 -12.659 1.00 63.07 ? 134 GLN A OE1 1 
ATOM   791  N NE2 . GLN A 1 123 ? -7.080  -29.667 -12.559 1.00 67.45 ? 134 GLN A NE2 1 
ATOM   792  N N   . ASN A 1 124 ? -7.785  -30.406 -6.787  1.00 40.08 ? 135 ASN A N   1 
ATOM   793  C CA  . ASN A 1 124 ? -7.022  -30.211 -5.547  1.00 42.58 ? 135 ASN A CA  1 
ATOM   794  C C   . ASN A 1 124 ? -5.833  -29.249 -5.655  1.00 40.80 ? 135 ASN A C   1 
ATOM   795  O O   . ASN A 1 124 ? -5.199  -29.141 -6.696  1.00 40.75 ? 135 ASN A O   1 
ATOM   796  C CB  . ASN A 1 124 ? -6.517  -31.559 -5.033  1.00 51.98 ? 135 ASN A CB  1 
ATOM   797  C CG  . ASN A 1 124 ? -7.476  -32.204 -4.065  1.00 59.49 ? 135 ASN A CG  1 
ATOM   798  O OD1 . ASN A 1 124 ? -8.611  -31.749 -3.897  1.00 62.70 ? 135 ASN A OD1 1 
ATOM   799  N ND2 . ASN A 1 124 ? -7.016  -33.259 -3.396  1.00 62.16 ? 135 ASN A ND2 1 
ATOM   800  N N   . VAL A 1 125 ? -5.519  -28.557 -4.564  1.00 34.85 ? 136 VAL A N   1 
ATOM   801  C CA  . VAL A 1 125 ? -4.370  -27.660 -4.565  1.00 40.18 ? 136 VAL A CA  1 
ATOM   802  C C   . VAL A 1 125 ? -3.467  -28.035 -3.424  1.00 36.51 ? 136 VAL A C   1 
ATOM   803  O O   . VAL A 1 125 ? -3.950  -28.493 -2.378  1.00 35.61 ? 136 VAL A O   1 
ATOM   804  C CB  . VAL A 1 125 ? -4.798  -26.142 -4.434  1.00 44.06 ? 136 VAL A CB  1 
ATOM   805  C CG1 . VAL A 1 125 ? -6.268  -25.956 -4.706  1.00 43.94 ? 136 VAL A CG1 1 
ATOM   806  C CG2 . VAL A 1 125 ? -4.428  -25.550 -3.077  1.00 46.41 ? 136 VAL A CG2 1 
ATOM   807  N N   . GLY A 1 126 ? -2.157  -27.855 -3.611  1.00 31.50 ? 137 GLY A N   1 
ATOM   808  C CA  . GLY A 1 126 ? -1.219  -27.960 -2.495  1.00 32.77 ? 137 GLY A CA  1 
ATOM   809  C C   . GLY A 1 126 ? -0.280  -29.163 -2.578  1.00 33.81 ? 137 GLY A C   1 
ATOM   810  O O   . GLY A 1 126 ? -0.012  -29.663 -3.656  1.00 36.35 ? 137 GLY A O   1 
ATOM   811  N N   . GLY A 1 127 ? 0.142   -29.665 -1.434  1.00 34.34 ? 138 GLY A N   1 
ATOM   812  C CA  . GLY A 1 127 ? 1.282   -30.609 -1.339  1.00 35.31 ? 138 GLY A CA  1 
ATOM   813  C C   . GLY A 1 127 ? 1.951   -30.334 -0.006  1.00 39.87 ? 138 GLY A C   1 
ATOM   814  O O   . GLY A 1 127 ? 1.457   -29.522 0.768   1.00 33.62 ? 138 GLY A O   1 
ATOM   815  N N   . THR A 1 128 ? 3.077   -30.988 0.267   1.00 28.83 ? 139 THR A N   1 
ATOM   816  C CA  . THR A 1 128 ? 3.807   -30.813 1.523   1.00 33.28 ? 139 THR A CA  1 
ATOM   817  C C   . THR A 1 128 ? 5.016   -29.946 1.238   1.00 37.36 ? 139 THR A C   1 
ATOM   818  O O   . THR A 1 128 ? 5.752   -30.213 0.302   1.00 35.54 ? 139 THR A O   1 
ATOM   819  C CB  . THR A 1 128 ? 4.371   -32.177 2.023   1.00 37.55 ? 139 THR A CB  1 
ATOM   820  O OG1 . THR A 1 128 ? 3.329   -33.150 2.007   1.00 39.62 ? 139 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 128 ? 4.922   -32.077 3.445   1.00 35.08 ? 139 THR A CG2 1 
ATOM   822  N N   . TYR A 1 129 ? 5.256   -28.951 2.073   1.00 33.13 ? 140 TYR A N   1 
ATOM   823  C CA  . TYR A 1 129 ? 6.291   -27.965 1.810   1.00 37.67 ? 140 TYR A CA  1 
ATOM   824  C C   . TYR A 1 129 ? 6.998   -27.625 3.110   1.00 36.51 ? 140 TYR A C   1 
ATOM   825  O O   . TYR A 1 129 ? 6.336   -27.454 4.143   1.00 34.90 ? 140 TYR A O   1 
ATOM   826  C CB  . TYR A 1 129 ? 5.661   -26.692 1.177   1.00 34.74 ? 140 TYR A CB  1 
ATOM   827  C CG  . TYR A 1 129 ? 5.092   -26.923 -0.207  1.00 35.88 ? 140 TYR A CG  1 
ATOM   828  C CD1 . TYR A 1 129 ? 5.896   -26.835 -1.328  1.00 37.67 ? 140 TYR A CD1 1 
ATOM   829  C CD2 . TYR A 1 129 ? 3.754   -27.249 -0.387  1.00 36.35 ? 140 TYR A CD2 1 
ATOM   830  C CE1 . TYR A 1 129 ? 5.374   -27.055 -2.608  1.00 39.43 ? 140 TYR A CE1 1 
ATOM   831  C CE2 . TYR A 1 129 ? 3.227   -27.482 -1.657  1.00 33.53 ? 140 TYR A CE2 1 
ATOM   832  C CZ  . TYR A 1 129 ? 4.046   -27.387 -2.753  1.00 40.31 ? 140 TYR A CZ  1 
ATOM   833  O OH  . TYR A 1 129 ? 3.534   -27.605 -4.007  1.00 44.12 ? 140 TYR A OH  1 
ATOM   834  N N   . GLU A 1 130 ? 8.336   -27.561 3.080   1.00 29.96 ? 141 GLU A N   1 
ATOM   835  C CA  . GLU A 1 130 ? 9.065   -26.891 4.141   1.00 37.41 ? 141 GLU A CA  1 
ATOM   836  C C   . GLU A 1 130 ? 8.981   -25.406 3.902   1.00 29.62 ? 141 GLU A C   1 
ATOM   837  O O   . GLU A 1 130 ? 9.288   -24.951 2.808   1.00 33.91 ? 141 GLU A O   1 
ATOM   838  C CB  . GLU A 1 130 ? 10.570  -27.206 4.116   1.00 39.58 ? 141 GLU A CB  1 
ATOM   839  C CG  . GLU A 1 130 ? 10.916  -28.616 4.466   1.00 46.72 ? 141 GLU A CG  1 
ATOM   840  C CD  . GLU A 1 130 ? 12.414  -28.791 4.749   1.00 48.85 ? 141 GLU A CD  1 
ATOM   841  O OE1 . GLU A 1 130 ? 12.795  -29.928 5.094   1.00 48.04 ? 141 GLU A OE1 1 
ATOM   842  O OE2 . GLU A 1 130 ? 13.189  -27.797 4.650   1.00 42.93 ? 141 GLU A OE2 1 
ATOM   843  N N   . LEU A 1 131 ? 8.635   -24.671 4.950   1.00 35.16 ? 142 LEU A N   1 
ATOM   844  C CA  . LEU A 1 131 ? 8.445   -23.234 4.857   1.00 36.80 ? 142 LEU A CA  1 
ATOM   845  C C   . LEU A 1 131 ? 9.169   -22.549 5.987   1.00 32.21 ? 142 LEU A C   1 
ATOM   846  O O   . LEU A 1 131 ? 9.282   -23.081 7.093   1.00 38.70 ? 142 LEU A O   1 
ATOM   847  C CB  . LEU A 1 131 ? 6.939   -22.831 4.863   1.00 27.68 ? 142 LEU A CB  1 
ATOM   848  C CG  . LEU A 1 131 ? 6.081   -23.510 3.788   1.00 31.15 ? 142 LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 131 ? 4.576   -23.206 3.884   1.00 36.74 ? 142 LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 131 ? 6.541   -23.209 2.399   1.00 27.57 ? 142 LEU A CD2 1 
ATOM   851  N N   . HIS A 1 132 ? 9.631   -21.338 5.715   1.00 39.21 ? 143 HIS A N   1 
ATOM   852  C CA  . HIS A 1 132 ? 10.430  -20.614 6.690   1.00 38.76 ? 143 HIS A CA  1 
ATOM   853  C C   . HIS A 1 132 ? 9.760   -19.321 7.095   1.00 42.98 ? 143 HIS A C   1 
ATOM   854  O O   . HIS A 1 132 ? 8.948   -18.792 6.349   1.00 33.93 ? 143 HIS A O   1 
ATOM   855  C CB  . HIS A 1 132 ? 11.797  -20.307 6.076   1.00 42.58 ? 143 HIS A CB  1 
ATOM   856  C CG  . HIS A 1 132 ? 12.509  -21.513 5.571   1.00 47.50 ? 143 HIS A CG  1 
ATOM   857  N ND1 . HIS A 1 132 ? 13.027  -21.594 4.297   1.00 55.41 ? 143 HIS A ND1 1 
ATOM   858  C CD2 . HIS A 1 132 ? 12.791  -22.695 6.168   1.00 52.00 ? 143 HIS A CD2 1 
ATOM   859  C CE1 . HIS A 1 132 ? 13.590  -22.777 4.129   1.00 53.07 ? 143 HIS A CE1 1 
ATOM   860  N NE2 . HIS A 1 132 ? 13.471  -23.459 5.252   1.00 53.22 ? 143 HIS A NE2 1 
ATOM   861  N N   . VAL A 1 133 ? 10.075  -18.847 8.294   1.00 41.82 ? 144 VAL A N   1 
ATOM   862  C CA  . VAL A 1 133 ? 9.620   -17.535 8.749   1.00 42.79 ? 144 VAL A CA  1 
ATOM   863  C C   . VAL A 1 133 ? 9.733   -16.546 7.613   1.00 40.98 ? 144 VAL A C   1 
ATOM   864  O O   . VAL A 1 133 ? 10.736  -16.510 6.908   1.00 43.34 ? 144 VAL A O   1 
ATOM   865  C CB  . VAL A 1 133 ? 10.436  -17.053 9.934   1.00 43.28 ? 144 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 133 ? 9.905   -15.700 10.438  1.00 52.08 ? 144 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 133 ? 10.372  -18.053 11.027  1.00 44.55 ? 144 VAL A CG2 1 
ATOM   868  N N   . GLY A 1 134 ? 8.665   -15.781 7.388   1.00 39.75 ? 145 GLY A N   1 
ATOM   869  C CA  . GLY A 1 134 ? 8.632   -14.816 6.320   1.00 37.94 ? 145 GLY A CA  1 
ATOM   870  C C   . GLY A 1 134 ? 8.124   -15.274 4.973   1.00 40.42 ? 145 GLY A C   1 
ATOM   871  O O   . GLY A 1 134 ? 7.851   -14.443 4.121   1.00 36.42 ? 145 GLY A O   1 
ATOM   872  N N   . ASP A 1 135 ? 8.003   -16.580 4.732   1.00 32.17 ? 146 ASP A N   1 
ATOM   873  C CA  . ASP A 1 135 ? 7.507   -16.997 3.426   1.00 33.12 ? 146 ASP A CA  1 
ATOM   874  C C   . ASP A 1 135 ? 6.019   -16.624 3.334   1.00 29.62 ? 146 ASP A C   1 
ATOM   875  O O   . ASP A 1 135 ? 5.351   -16.529 4.353   1.00 37.63 ? 146 ASP A O   1 
ATOM   876  C CB  . ASP A 1 135 ? 7.602   -18.531 3.219   1.00 30.71 ? 146 ASP A CB  1 
ATOM   877  C CG  . ASP A 1 135 ? 9.044   -19.020 2.884   1.00 46.92 ? 146 ASP A CG  1 
ATOM   878  O OD1 . ASP A 1 135 ? 9.903   -18.207 2.491   1.00 44.99 ? 146 ASP A OD1 1 
ATOM   879  O OD2 . ASP A 1 135 ? 9.316   -20.231 2.994   1.00 44.74 ? 146 ASP A OD2 1 
ATOM   880  N N   . THR A 1 136 ? 5.546   -16.422 2.114   1.00 31.33 ? 147 THR A N   1 
ATOM   881  C CA  . THR A 1 136 ? 4.103   -16.208 1.865   1.00 36.62 ? 147 THR A CA  1 
ATOM   882  C C   . THR A 1 136 ? 3.571   -17.260 0.917   1.00 33.30 ? 147 THR A C   1 
ATOM   883  O O   . THR A 1 136 ? 4.305   -17.794 0.092   1.00 34.44 ? 147 THR A O   1 
ATOM   884  C CB  . THR A 1 136 ? 3.823   -14.810 1.267   1.00 26.00 ? 147 THR A CB  1 
ATOM   885  O OG1 . THR A 1 136 ? 4.375   -14.699 -0.044  1.00 38.93 ? 147 THR A OG1 1 
ATOM   886  C CG2 . THR A 1 136 ? 4.359   -13.711 2.198   1.00 34.66 ? 147 THR A CG2 1 
ATOM   887  N N   . ILE A 1 137 ? 2.294   -17.586 1.054   1.00 33.43 ? 148 ILE A N   1 
ATOM   888  C CA  . ILE A 1 137 ? 1.644   -18.502 0.142   1.00 28.72 ? 148 ILE A CA  1 
ATOM   889  C C   . ILE A 1 137 ? 0.404   -17.778 -0.451  1.00 25.36 ? 148 ILE A C   1 
ATOM   890  O O   . ILE A 1 137 ? -0.340  -17.191 0.296   1.00 31.08 ? 148 ILE A O   1 
ATOM   891  C CB  . ILE A 1 137 ? 1.231   -19.812 0.931   1.00 32.31 ? 148 ILE A CB  1 
ATOM   892  C CG1 . ILE A 1 137 ? 2.454   -20.507 1.543   1.00 32.42 ? 148 ILE A CG1 1 
ATOM   893  C CG2 . ILE A 1 137 ? 0.427   -20.767 0.058   1.00 31.68 ? 148 ILE A CG2 1 
ATOM   894  C CD1 . ILE A 1 137 ? 3.413   -21.072 0.475   1.00 31.28 ? 148 ILE A CD1 1 
ATOM   895  N N   . ASP A 1 138 ? 0.175   -17.858 -1.744  1.00 28.75 ? 149 ASP A N   1 
ATOM   896  C CA  . ASP A 1 138 ? -0.905  -17.075 -2.348  1.00 36.71 ? 149 ASP A CA  1 
ATOM   897  C C   . ASP A 1 138 ? -1.545  -17.913 -3.419  1.00 32.19 ? 149 ASP A C   1 
ATOM   898  O O   . ASP A 1 138 ? -0.866  -18.599 -4.199  1.00 34.56 ? 149 ASP A O   1 
ATOM   899  C CB  . ASP A 1 138 ? -0.276  -15.821 -2.980  1.00 37.21 ? 149 ASP A CB  1 
ATOM   900  C CG  . ASP A 1 138 ? -1.282  -14.736 -3.342  1.00 47.03 ? 149 ASP A CG  1 
ATOM   901  O OD1 . ASP A 1 138 ? -2.504  -14.869 -3.074  1.00 41.50 ? 149 ASP A OD1 1 
ATOM   902  O OD2 . ASP A 1 138 ? -0.806  -13.723 -3.916  1.00 46.17 ? 149 ASP A OD2 1 
ATOM   903  N N   . LEU A 1 139 ? -2.856  -17.839 -3.498  1.00 30.96 ? 150 LEU A N   1 
ATOM   904  C CA  . LEU A 1 139 ? -3.557  -18.486 -4.570  1.00 32.96 ? 150 LEU A CA  1 
ATOM   905  C C   . LEU A 1 139 ? -4.172  -17.360 -5.417  1.00 31.86 ? 150 LEU A C   1 
ATOM   906  O O   . LEU A 1 139 ? -4.972  -16.544 -4.922  1.00 32.82 ? 150 LEU A O   1 
ATOM   907  C CB  . LEU A 1 139 ? -4.641  -19.406 -4.004  1.00 31.84 ? 150 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 139 ? -5.389  -20.236 -5.033  1.00 35.69 ? 150 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 139 ? -4.459  -21.309 -5.657  1.00 37.39 ? 150 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 139 ? -6.656  -20.866 -4.418  1.00 36.46 ? 150 LEU A CD2 1 
ATOM   911  N N   . ILE A 1 140 ? -3.790  -17.331 -6.673  1.00 33.46 ? 151 ILE A N   1 
ATOM   912  C CA  . ILE A 1 140 ? -4.053  -16.210 -7.572  1.00 42.92 ? 151 ILE A CA  1 
ATOM   913  C C   . ILE A 1 140 ? -4.860  -16.718 -8.739  1.00 39.91 ? 151 ILE A C   1 
ATOM   914  O O   . ILE A 1 140 ? -4.478  -17.679 -9.378  1.00 39.23 ? 151 ILE A O   1 
ATOM   915  C CB  . ILE A 1 140 ? -2.743  -15.639 -8.146  1.00 45.15 ? 151 ILE A CB  1 
ATOM   916  C CG1 . ILE A 1 140 ? -1.881  -15.092 -7.033  1.00 43.65 ? 151 ILE A CG1 1 
ATOM   917  C CG2 . ILE A 1 140 ? -3.029  -14.549 -9.174  1.00 52.04 ? 151 ILE A CG2 1 
ATOM   918  C CD1 . ILE A 1 140 ? -2.597  -14.073 -6.223  1.00 59.24 ? 151 ILE A CD1 1 
ATOM   919  N N   . PHE A 1 141 ? -5.979  -16.062 -9.011  1.00 40.34 ? 152 PHE A N   1 
ATOM   920  C CA  . PHE A 1 141 ? -6.856  -16.465 -10.100 1.00 39.35 ? 152 PHE A CA  1 
ATOM   921  C C   . PHE A 1 141 ? -6.606  -15.599 -11.328 1.00 46.46 ? 152 PHE A C   1 
ATOM   922  O O   . PHE A 1 141 ? -6.503  -14.391 -11.211 1.00 49.76 ? 152 PHE A O   1 
ATOM   923  C CB  . PHE A 1 141 ? -8.313  -16.330 -9.636  1.00 40.16 ? 152 PHE A CB  1 
ATOM   924  C CG  . PHE A 1 141 ? -8.611  -17.082 -8.376  1.00 42.50 ? 152 PHE A CG  1 
ATOM   925  C CD1 . PHE A 1 141 ? -8.789  -18.451 -8.411  1.00 46.71 ? 152 PHE A CD1 1 
ATOM   926  C CD2 . PHE A 1 141 ? -8.707  -16.440 -7.158  1.00 40.56 ? 152 PHE A CD2 1 
ATOM   927  C CE1 . PHE A 1 141 ? -9.040  -19.147 -7.259  1.00 43.10 ? 152 PHE A CE1 1 
ATOM   928  C CE2 . PHE A 1 141 ? -8.956  -17.153 -5.992  1.00 38.06 ? 152 PHE A CE2 1 
ATOM   929  C CZ  . PHE A 1 141 ? -9.126  -18.494 -6.048  1.00 33.61 ? 152 PHE A CZ  1 
ATOM   930  N N   . ASN A 1 142 ? -6.515  -16.218 -12.500 1.00 50.74 ? 153 ASN A N   1 
ATOM   931  C CA  . ASN A 1 142 ? -6.358  -15.478 -13.744 1.00 59.33 ? 153 ASN A CA  1 
ATOM   932  C C   . ASN A 1 142 ? -7.522  -14.518 -13.879 1.00 62.09 ? 153 ASN A C   1 
ATOM   933  O O   . ASN A 1 142 ? -7.337  -13.299 -13.908 1.00 64.87 ? 153 ASN A O   1 
ATOM   934  C CB  . ASN A 1 142 ? -6.315  -16.428 -14.943 1.00 63.36 ? 153 ASN A CB  1 
ATOM   935  C CG  . ASN A 1 142 ? -5.243  -16.051 -15.938 1.00 69.93 ? 153 ASN A CG  1 
ATOM   936  O OD1 . ASN A 1 142 ? -4.755  -16.898 -16.694 1.00 74.72 ? 153 ASN A OD1 1 
ATOM   937  N ND2 . ASN A 1 142 ? -4.852  -14.775 -15.938 1.00 66.15 ? 153 ASN A ND2 1 
ATOM   938  N N   . SER A 1 143 ? -8.728  -15.070 -13.949 1.00 60.29 ? 154 SER A N   1 
ATOM   939  C CA  . SER A 1 143 ? -9.925  -14.257 -13.833 1.00 66.34 ? 154 SER A CA  1 
ATOM   940  C C   . SER A 1 143 ? -10.660 -14.666 -12.582 1.00 66.04 ? 154 SER A C   1 
ATOM   941  O O   . SER A 1 143 ? -10.884 -15.850 -12.347 1.00 64.19 ? 154 SER A O   1 
ATOM   942  C CB  . SER A 1 143 ? -10.835 -14.407 -15.063 1.00 71.45 ? 154 SER A CB  1 
ATOM   943  O OG  . SER A 1 143 ? -12.130 -13.867 -14.828 1.00 74.98 ? 154 SER A OG  1 
ATOM   944  N N   . GLU A 1 144 ? -11.035 -13.676 -11.783 1.00 68.07 ? 155 GLU A N   1 
ATOM   945  C CA  . GLU A 1 144 ? -11.777 -13.906 -10.556 1.00 71.10 ? 155 GLU A CA  1 
ATOM   946  C C   . GLU A 1 144 ? -13.061 -14.689 -10.811 1.00 74.52 ? 155 GLU A C   1 
ATOM   947  O O   . GLU A 1 144 ? -13.432 -15.563 -10.026 1.00 74.79 ? 155 GLU A O   1 
ATOM   948  C CB  . GLU A 1 144 ? -12.108 -12.567 -9.894  1.00 72.72 ? 155 GLU A CB  1 
ATOM   949  C CG  . GLU A 1 144 ? -10.888 -11.691 -9.641  1.00 76.14 ? 155 GLU A CG  1 
ATOM   950  C CD  . GLU A 1 144 ? -9.937  -12.302 -8.617  1.00 75.94 ? 155 GLU A CD  1 
ATOM   951  O OE1 . GLU A 1 144 ? -8.710  -12.336 -8.872  1.00 73.91 ? 155 GLU A OE1 1 
ATOM   952  O OE2 . GLU A 1 144 ? -10.425 -12.758 -7.560  1.00 73.53 ? 155 GLU A OE2 1 
ATOM   953  N N   . HIS A 1 145 ? -13.738 -14.374 -11.911 1.00 75.20 ? 156 HIS A N   1 
ATOM   954  C CA  . HIS A 1 145 ? -15.043 -14.964 -12.184 1.00 77.83 ? 156 HIS A CA  1 
ATOM   955  C C   . HIS A 1 145 ? -14.967 -16.316 -12.912 1.00 74.97 ? 156 HIS A C   1 
ATOM   956  O O   . HIS A 1 145 ? -15.994 -16.924 -13.185 1.00 76.02 ? 156 HIS A O   1 
ATOM   957  C CB  . HIS A 1 145 ? -15.941 -13.964 -12.927 1.00 85.71 ? 156 HIS A CB  1 
ATOM   958  C CG  . HIS A 1 145 ? -16.149 -12.676 -12.184 1.00 92.05 ? 156 HIS A CG  1 
ATOM   959  N ND1 . HIS A 1 145 ? -15.297 -11.598 -12.306 1.00 94.03 ? 156 HIS A ND1 1 
ATOM   960  C CD2 . HIS A 1 145 ? -17.103 -12.302 -11.297 1.00 93.56 ? 156 HIS A CD2 1 
ATOM   961  C CE1 . HIS A 1 145 ? -15.722 -10.613 -11.534 1.00 95.30 ? 156 HIS A CE1 1 
ATOM   962  N NE2 . HIS A 1 145 ? -16.816 -11.014 -10.911 1.00 95.73 ? 156 HIS A NE2 1 
ATOM   963  N N   . GLN A 1 146 ? -13.750 -16.781 -13.207 1.00 72.28 ? 157 GLN A N   1 
ATOM   964  C CA  . GLN A 1 146 ? -13.530 -18.121 -13.764 1.00 70.64 ? 157 GLN A CA  1 
ATOM   965  C C   . GLN A 1 146 ? -13.806 -19.198 -12.711 1.00 65.83 ? 157 GLN A C   1 
ATOM   966  O O   . GLN A 1 146 ? -13.927 -20.385 -13.025 1.00 58.47 ? 157 GLN A O   1 
ATOM   967  C CB  . GLN A 1 146 ? -12.074 -18.289 -14.201 1.00 75.49 ? 157 GLN A CB  1 
ATOM   968  C CG  . GLN A 1 146 ? -11.644 -17.617 -15.497 1.00 78.69 ? 157 GLN A CG  1 
ATOM   969  C CD  . GLN A 1 146 ? -10.126 -17.686 -15.691 1.00 79.09 ? 157 GLN A CD  1 
ATOM   970  O OE1 . GLN A 1 146 ? -9.472  -18.654 -15.280 1.00 82.18 ? 157 GLN A OE1 1 
ATOM   971  N NE2 . GLN A 1 146 ? -9.562  -16.654 -16.304 1.00 81.90 ? 157 GLN A NE2 1 
ATOM   972  N N   . VAL A 1 147 ? -13.866 -18.773 -11.455 1.00 62.52 ? 158 VAL A N   1 
ATOM   973  C CA  . VAL A 1 147 ? -13.946 -19.690 -10.338 1.00 61.77 ? 158 VAL A CA  1 
ATOM   974  C C   . VAL A 1 147 ? -15.246 -19.477 -9.586  1.00 63.35 ? 158 VAL A C   1 
ATOM   975  O O   . VAL A 1 147 ? -15.725 -18.343 -9.470  1.00 65.49 ? 158 VAL A O   1 
ATOM   976  C CB  . VAL A 1 147 ? -12.748 -19.483 -9.374  1.00 61.56 ? 158 VAL A CB  1 
ATOM   977  C CG1 . VAL A 1 147 ? -12.912 -18.208 -8.584  1.00 53.84 ? 158 VAL A CG1 1 
ATOM   978  C CG2 . VAL A 1 147 ? -12.613 -20.632 -8.433  1.00 57.42 ? 158 VAL A CG2 1 
ATOM   979  N N   . LEU A 1 148 ? -15.814 -20.580 -9.106  1.00 62.24 ? 159 LEU A N   1 
ATOM   980  C CA  . LEU A 1 148 ? -16.950 -20.578 -8.192  1.00 62.15 ? 159 LEU A CA  1 
ATOM   981  C C   . LEU A 1 148 ? -16.455 -20.394 -6.769  1.00 65.69 ? 159 LEU A C   1 
ATOM   982  O O   . LEU A 1 148 ? -16.020 -21.359 -6.121  1.00 61.52 ? 159 LEU A O   1 
ATOM   983  C CB  . LEU A 1 148 ? -17.694 -21.900 -8.302  1.00 62.84 ? 159 LEU A CB  1 
ATOM   984  C CG  . LEU A 1 148 ? -18.537 -22.062 -9.565  1.00 66.44 ? 159 LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 148 ? -19.197 -23.419 -9.569  1.00 62.84 ? 159 LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 148 ? -19.578 -20.957 -9.622  1.00 63.92 ? 159 LEU A CD2 1 
ATOM   987  N N   . LYS A 1 149 ? -16.511 -19.156 -6.290  1.00 62.37 ? 160 LYS A N   1 
ATOM   988  C CA  . LYS A 1 149 ? -15.839 -18.783 -5.050  1.00 70.24 ? 160 LYS A CA  1 
ATOM   989  C C   . LYS A 1 149 ? -16.488 -19.380 -3.804  1.00 69.00 ? 160 LYS A C   1 
ATOM   990  O O   . LYS A 1 149 ? -15.948 -19.260 -2.697  1.00 68.26 ? 160 LYS A O   1 
ATOM   991  C CB  . LYS A 1 149 ? -15.727 -17.256 -4.932  1.00 73.05 ? 160 LYS A CB  1 
ATOM   992  C CG  . LYS A 1 149 ? -14.524 -16.668 -5.665  1.00 75.51 ? 160 LYS A CG  1 
ATOM   993  N N   . ASN A 1 150 ? -17.621 -20.049 -4.009  1.00 66.71 ? 161 ASN A N   1 
ATOM   994  C CA  . ASN A 1 150 ? -18.387 -20.640 -2.922  1.00 68.43 ? 161 ASN A CA  1 
ATOM   995  C C   . ASN A 1 150 ? -18.140 -22.141 -2.795  1.00 62.71 ? 161 ASN A C   1 
ATOM   996  O O   . ASN A 1 150 ? -18.713 -22.812 -1.928  1.00 63.41 ? 161 ASN A O   1 
ATOM   997  C CB  . ASN A 1 150 ? -19.880 -20.333 -3.081  1.00 75.69 ? 161 ASN A CB  1 
ATOM   998  C CG  . ASN A 1 150 ? -20.518 -19.858 -1.779  1.00 81.97 ? 161 ASN A CG  1 
ATOM   999  O OD1 . ASN A 1 150 ? -20.260 -20.409 -0.699  1.00 82.60 ? 161 ASN A OD1 1 
ATOM   1000 N ND2 . ASN A 1 150 ? -21.348 -18.821 -1.873  1.00 86.01 ? 161 ASN A ND2 1 
ATOM   1001 N N   . ASN A 1 151 ? -17.270 -22.655 -3.664  1.00 52.65 ? 162 ASN A N   1 
ATOM   1002 C CA  . ASN A 1 151 ? -16.754 -24.010 -3.552  1.00 52.16 ? 162 ASN A CA  1 
ATOM   1003 C C   . ASN A 1 151 ? -15.231 -24.096 -3.796  1.00 42.55 ? 162 ASN A C   1 
ATOM   1004 O O   . ASN A 1 151 ? -14.708 -25.140 -4.165  1.00 48.31 ? 162 ASN A O   1 
ATOM   1005 C CB  . ASN A 1 151 ? -17.485 -24.947 -4.509  1.00 56.18 ? 162 ASN A CB  1 
ATOM   1006 C CG  . ASN A 1 151 ? -17.649 -26.329 -3.930  1.00 61.77 ? 162 ASN A CG  1 
ATOM   1007 O OD1 . ASN A 1 151 ? -17.849 -27.305 -4.656  1.00 66.86 ? 162 ASN A OD1 1 
ATOM   1008 N ND2 . ASN A 1 151 ? -17.548 -26.425 -2.602  1.00 60.29 ? 162 ASN A ND2 1 
ATOM   1009 N N   . THR A 1 152 ? -14.546 -22.984 -3.585  1.00 40.10 ? 163 THR A N   1 
ATOM   1010 C CA  . THR A 1 152 ? -13.090 -22.865 -3.792  1.00 36.96 ? 163 THR A CA  1 
ATOM   1011 C C   . THR A 1 152 ? -12.503 -22.346 -2.498  1.00 37.78 ? 163 THR A C   1 
ATOM   1012 O O   . THR A 1 152 ? -13.008 -21.368 -1.921  1.00 37.43 ? 163 THR A O   1 
ATOM   1013 C CB  . THR A 1 152 ? -12.840 -21.876 -4.940  1.00 39.24 ? 163 THR A CB  1 
ATOM   1014 O OG1 . THR A 1 152 ? -13.404 -22.433 -6.109  1.00 39.88 ? 163 THR A OG1 1 
ATOM   1015 C CG2 . THR A 1 152 ? -11.342 -21.572 -5.210  1.00 35.88 ? 163 THR A CG2 1 
ATOM   1016 N N   . TYR A 1 153 ? -11.432 -22.986 -2.023  1.00 32.51 ? 164 TYR A N   1 
ATOM   1017 C CA  . TYR A 1 153 ? -10.850 -22.632 -0.754  1.00 28.30 ? 164 TYR A CA  1 
ATOM   1018 C C   . TYR A 1 153 ? -9.467  -23.250 -0.672  1.00 31.19 ? 164 TYR A C   1 
ATOM   1019 O O   . TYR A 1 153 ? -9.144  -24.112 -1.476  1.00 30.82 ? 164 TYR A O   1 
ATOM   1020 C CB  . TYR A 1 153 ? -11.683 -23.125 0.419   1.00 29.92 ? 164 TYR A CB  1 
ATOM   1021 C CG  . TYR A 1 153 ? -11.969 -24.639 0.396   1.00 32.95 ? 164 TYR A CG  1 
ATOM   1022 C CD1 . TYR A 1 153 ? -10.999 -25.559 0.825   1.00 36.35 ? 164 TYR A CD1 1 
ATOM   1023 C CD2 . TYR A 1 153 ? -13.229 -25.125 0.038   1.00 36.49 ? 164 TYR A CD2 1 
ATOM   1024 C CE1 . TYR A 1 153 ? -11.257 -26.930 0.817   1.00 34.90 ? 164 TYR A CE1 1 
ATOM   1025 C CE2 . TYR A 1 153 ? -13.499 -26.518 0.046   1.00 37.08 ? 164 TYR A CE2 1 
ATOM   1026 C CZ  . TYR A 1 153 ? -12.512 -27.388 0.433   1.00 35.94 ? 164 TYR A CZ  1 
ATOM   1027 O OH  . TYR A 1 153 ? -12.762 -28.733 0.462   1.00 34.30 ? 164 TYR A OH  1 
ATOM   1028 N N   . TRP A 1 154 ? -8.654  -22.781 0.260   1.00 32.54 ? 165 TRP A N   1 
ATOM   1029 C CA  . TRP A 1 154 ? -7.357  -23.454 0.506   1.00 31.76 ? 165 TRP A CA  1 
ATOM   1030 C C   . TRP A 1 154 ? -6.990  -23.258 1.942   1.00 32.15 ? 165 TRP A C   1 
ATOM   1031 O O   . TRP A 1 154 ? -7.473  -22.336 2.595   1.00 31.18 ? 165 TRP A O   1 
ATOM   1032 C CB  . TRP A 1 154 ? -6.265  -23.059 -0.537  1.00 29.37 ? 165 TRP A CB  1 
ATOM   1033 C CG  . TRP A 1 154 ? -5.565  -21.730 -0.267  1.00 31.93 ? 165 TRP A CG  1 
ATOM   1034 C CD1 . TRP A 1 154 ? -5.886  -20.491 -0.798  1.00 31.17 ? 165 TRP A CD1 1 
ATOM   1035 C CD2 . TRP A 1 154 ? -4.431  -21.519 0.601   1.00 28.35 ? 165 TRP A CD2 1 
ATOM   1036 N NE1 . TRP A 1 154 ? -5.002  -19.517 -0.290  1.00 28.03 ? 165 TRP A NE1 1 
ATOM   1037 C CE2 . TRP A 1 154 ? -4.094  -20.133 0.538   1.00 25.87 ? 165 TRP A CE2 1 
ATOM   1038 C CE3 . TRP A 1 154 ? -3.634  -22.375 1.384   1.00 29.33 ? 165 TRP A CE3 1 
ATOM   1039 C CZ2 . TRP A 1 154 ? -3.033  -19.593 1.267   1.00 32.42 ? 165 TRP A CZ2 1 
ATOM   1040 C CZ3 . TRP A 1 154 ? -2.569  -21.840 2.101   1.00 30.44 ? 165 TRP A CZ3 1 
ATOM   1041 C CH2 . TRP A 1 154 ? -2.285  -20.443 2.039   1.00 31.76 ? 165 TRP A CH2 1 
ATOM   1042 N N   . GLY A 1 155 ? -6.202  -24.181 2.491   1.00 28.13 ? 166 GLY A N   1 
ATOM   1043 C CA  . GLY A 1 155 ? -5.844  -24.130 3.874   1.00 28.65 ? 166 GLY A CA  1 
ATOM   1044 C C   . GLY A 1 155 ? -4.482  -24.766 4.050   1.00 28.00 ? 166 GLY A C   1 
ATOM   1045 O O   . GLY A 1 155 ? -3.856  -25.191 3.063   1.00 27.48 ? 166 GLY A O   1 
ATOM   1046 N N   . ILE A 1 156 ? -4.026  -24.772 5.286   1.00 30.40 ? 167 ILE A N   1 
ATOM   1047 C CA  . ILE A 1 156 ? -2.652  -25.155 5.623   1.00 27.27 ? 167 ILE A CA  1 
ATOM   1048 C C   . ILE A 1 156 ? -2.661  -25.709 7.002   1.00 31.89 ? 167 ILE A C   1 
ATOM   1049 O O   . ILE A 1 156 ? -3.452  -25.286 7.816   1.00 32.31 ? 167 ILE A O   1 
ATOM   1050 C CB  . ILE A 1 156 ? -1.648  -23.960 5.471   1.00 28.88 ? 167 ILE A CB  1 
ATOM   1051 C CG1 . ILE A 1 156 ? -0.191  -24.444 5.621   1.00 29.61 ? 167 ILE A CG1 1 
ATOM   1052 C CG2 . ILE A 1 156 ? -1.974  -22.782 6.492   1.00 31.27 ? 167 ILE A CG2 1 
ATOM   1053 C CD1 . ILE A 1 156 ? 0.814   -23.398 5.056   1.00 31.07 ? 167 ILE A CD1 1 
ATOM   1054 N N   . ILE A 1 157 ? -1.823  -26.715 7.253   1.00 29.34 ? 168 ILE A N   1 
ATOM   1055 C CA  . ILE A 1 157 ? -1.662  -27.255 8.576   1.00 27.75 ? 168 ILE A CA  1 
ATOM   1056 C C   . ILE A 1 157 ? -0.175  -27.478 8.859   1.00 27.72 ? 168 ILE A C   1 
ATOM   1057 O O   . ILE A 1 157 ? 0.556   -27.872 7.970   1.00 27.81 ? 168 ILE A O   1 
ATOM   1058 C CB  . ILE A 1 157 ? -2.422  -28.571 8.759   1.00 29.82 ? 168 ILE A CB  1 
ATOM   1059 C CG1 . ILE A 1 157 ? -2.192  -29.141 10.169  1.00 31.14 ? 168 ILE A CG1 1 
ATOM   1060 C CG2 . ILE A 1 157 ? -2.045  -29.550 7.675   1.00 29.50 ? 168 ILE A CG2 1 
ATOM   1061 C CD1 . ILE A 1 157 ? -3.190  -30.261 10.511  1.00 38.87 ? 168 ILE A CD1 1 
ATOM   1062 N N   . LEU A 1 158 ? 0.246   -27.164 10.081  1.00 27.24 ? 169 LEU A N   1 
ATOM   1063 C CA  . LEU A 1 158 ? 1.629   -27.394 10.486  1.00 31.64 ? 169 LEU A CA  1 
ATOM   1064 C C   . LEU A 1 158 ? 1.735   -28.826 10.968  1.00 33.93 ? 169 LEU A C   1 
ATOM   1065 O O   . LEU A 1 158 ? 1.033   -29.228 11.893  1.00 38.37 ? 169 LEU A O   1 
ATOM   1066 C CB  . LEU A 1 158 ? 2.069   -26.413 11.584  1.00 34.26 ? 169 LEU A CB  1 
ATOM   1067 C CG  . LEU A 1 158 ? 3.442   -26.696 12.235  1.00 37.81 ? 169 LEU A CG  1 
ATOM   1068 C CD1 . LEU A 1 158 ? 4.593   -26.371 11.328  1.00 33.36 ? 169 LEU A CD1 1 
ATOM   1069 C CD2 . LEU A 1 158 ? 3.555   -25.945 13.546  1.00 40.46 ? 169 LEU A CD2 1 
ATOM   1070 N N   . LEU A 1 159 ? 2.597   -29.600 10.303  1.00 33.64 ? 170 LEU A N   1 
ATOM   1071 C CA  . LEU A 1 159 ? 2.843   -31.006 10.673  1.00 32.16 ? 170 LEU A CA  1 
ATOM   1072 C C   . LEU A 1 159 ? 3.929   -31.179 11.730  1.00 34.23 ? 170 LEU A C   1 
ATOM   1073 O O   . LEU A 1 159 ? 3.814   -32.045 12.592  1.00 39.40 ? 170 LEU A O   1 
ATOM   1074 C CB  . LEU A 1 159 ? 3.262   -31.803 9.423   1.00 38.31 ? 170 LEU A CB  1 
ATOM   1075 C CG  . LEU A 1 159 ? 2.262   -31.845 8.276   1.00 37.54 ? 170 LEU A CG  1 
ATOM   1076 C CD1 . LEU A 1 159 ? 2.808   -32.739 7.157   1.00 43.73 ? 170 LEU A CD1 1 
ATOM   1077 C CD2 . LEU A 1 159 ? 0.883   -32.331 8.732   1.00 36.74 ? 170 LEU A CD2 1 
ATOM   1078 N N   . ALA A 1 160 ? 4.990   -30.385 11.639  1.00 37.40 ? 171 ALA A N   1 
ATOM   1079 C CA  . ALA A 1 160 ? 6.164   -30.557 12.503  1.00 40.86 ? 171 ALA A CA  1 
ATOM   1080 C C   . ALA A 1 160 ? 7.095   -29.378 12.393  1.00 39.07 ? 171 ALA A C   1 
ATOM   1081 O O   . ALA A 1 160 ? 7.147   -28.718 11.359  1.00 36.99 ? 171 ALA A O   1 
ATOM   1082 C CB  . ALA A 1 160 ? 6.920   -31.825 12.129  1.00 41.65 ? 171 ALA A CB  1 
ATOM   1083 N N   . ASN A 1 161 ? 7.844   -29.127 13.460  1.00 40.87 ? 172 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 161 ? 8.869   -28.090 13.437  1.00 43.04 ? 172 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 161 ? 10.205  -28.593 13.946  1.00 48.27 ? 172 ASN A C   1 
ATOM   1086 O O   . ASN A 1 161 ? 10.698  -28.118 14.971  1.00 46.15 ? 172 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 161 ? 8.435   -26.899 14.270  1.00 53.51 ? 172 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 161 ? 7.582   -27.304 15.434  1.00 60.09 ? 172 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 161 ? 6.396   -26.975 15.496  1.00 69.53 ? 172 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 161 ? 8.164   -28.054 16.354  1.00 65.17 ? 172 ASN A ND2 1 
ATOM   1091 N N   . PRO A 1 162 ? 10.832  -29.523 13.216  1.00 44.02 ? 173 PRO A N   1 
ATOM   1092 C CA  . PRO A 1 162 ? 12.148  -29.961 13.703  1.00 49.60 ? 173 PRO A CA  1 
ATOM   1093 C C   . PRO A 1 162 ? 13.218  -28.856 13.601  1.00 49.22 ? 173 PRO A C   1 
ATOM   1094 O O   . PRO A 1 162 ? 13.105  -27.972 12.769  1.00 43.47 ? 173 PRO A O   1 
ATOM   1095 C CB  . PRO A 1 162 ? 12.499  -31.097 12.746  1.00 45.39 ? 173 PRO A CB  1 
ATOM   1096 C CG  . PRO A 1 162 ? 11.779  -30.714 11.459  1.00 45.96 ? 173 PRO A CG  1 
ATOM   1097 C CD  . PRO A 1 162 ? 10.456  -30.183 11.954  1.00 46.44 ? 173 PRO A CD  1 
ATOM   1098 N N   . GLN A 1 163 ? 14.270  -28.942 14.418  1.00 54.95 ? 174 GLN A N   1 
ATOM   1099 C CA  . GLN A 1 163 ? 15.388  -27.991 14.367  1.00 52.98 ? 174 GLN A CA  1 
ATOM   1100 C C   . GLN A 1 163 ? 16.002  -27.833 12.975  1.00 50.73 ? 174 GLN A C   1 
ATOM   1101 O O   . GLN A 1 163 ? 16.385  -26.729 12.576  1.00 47.85 ? 174 GLN A O   1 
ATOM   1102 C CB  . GLN A 1 163 ? 16.476  -28.403 15.368  1.00 66.33 ? 174 GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 163 ? 16.542  -27.570 16.653  1.00 76.17 ? 174 GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 163 ? 15.201  -27.439 17.362  1.00 81.09 ? 174 GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 163 ? 14.290  -26.762 16.879  1.00 79.55 ? 174 GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 163 ? 15.085  -28.072 18.529  1.00 84.51 ? 174 GLN A NE2 1 
ATOM   1107 N N   . PHE A 1 164 ? 16.075  -28.920 12.212  1.00 48.96 ? 175 PHE A N   1 
ATOM   1108 C CA  . PHE A 1 164 ? 16.687  -28.854 10.885  1.00 43.52 ? 175 PHE A CA  1 
ATOM   1109 C C   . PHE A 1 164 ? 15.970  -27.998 9.812   1.00 47.22 ? 175 PHE A C   1 
ATOM   1110 O O   . PHE A 1 164 ? 16.499  -27.784 8.702   1.00 46.05 ? 175 PHE A O   1 
ATOM   1111 C CB  . PHE A 1 164 ? 17.062  -30.256 10.375  1.00 43.94 ? 175 PHE A CB  1 
ATOM   1112 C CG  . PHE A 1 164 ? 15.896  -31.180 10.107  1.00 42.51 ? 175 PHE A CG  1 
ATOM   1113 C CD1 . PHE A 1 164 ? 15.689  -32.297 10.904  1.00 41.16 ? 175 PHE A CD1 1 
ATOM   1114 C CD2 . PHE A 1 164 ? 15.059  -30.969 9.015   1.00 43.53 ? 175 PHE A CD2 1 
ATOM   1115 C CE1 . PHE A 1 164 ? 14.652  -33.181 10.635  1.00 41.27 ? 175 PHE A CE1 1 
ATOM   1116 C CE2 . PHE A 1 164 ? 13.998  -31.844 8.746   1.00 42.13 ? 175 PHE A CE2 1 
ATOM   1117 C CZ  . PHE A 1 164 ? 13.802  -32.943 9.543   1.00 39.43 ? 175 PHE A CZ  1 
ATOM   1118 N N   . ILE A 1 165 ? 14.756  -27.538 10.109  1.00 44.78 ? 176 ILE A N   1 
ATOM   1119 C CA  . ILE A 1 165 ? 14.112  -26.597 9.208   1.00 43.35 ? 176 ILE A CA  1 
ATOM   1120 C C   . ILE A 1 165 ? 14.263  -25.180 9.802   1.00 52.55 ? 176 ILE A C   1 
ATOM   1121 O O   . ILE A 1 165 ? 15.126  -24.408 9.363   1.00 59.75 ? 176 ILE A O   1 
ATOM   1122 C CB  . ILE A 1 165 ? 12.607  -26.896 8.938   1.00 43.39 ? 176 ILE A CB  1 
ATOM   1123 C CG1 . ILE A 1 165 ? 12.400  -28.293 8.327   1.00 45.12 ? 176 ILE A CG1 1 
ATOM   1124 C CG2 . ILE A 1 165 ? 12.055  -25.875 7.961   1.00 42.41 ? 176 ILE A CG2 1 
ATOM   1125 C CD1 . ILE A 1 165 ? 10.932  -28.754 8.344   1.00 42.97 ? 176 ILE A CD1 1 
HETATM 1126 S S   . SO4 B 2 .   ? 0.807   -22.926 40.568  1.00 67.35 ? 1   SO4 A S   1 
HETATM 1127 O O1  . SO4 B 2 .   ? 1.818   -21.930 40.217  1.00 68.67 ? 1   SO4 A O1  1 
HETATM 1128 O O2  . SO4 B 2 .   ? 0.695   -23.749 39.366  1.00 53.82 ? 1   SO4 A O2  1 
HETATM 1129 O O3  . SO4 B 2 .   ? 1.174   -23.680 41.752  1.00 62.45 ? 1   SO4 A O3  1 
HETATM 1130 O O4  . SO4 B 2 .   ? -0.441  -22.246 40.925  1.00 70.79 ? 1   SO4 A O4  1 
HETATM 1131 O O   . HOH C 3 .   ? -4.445  -28.953 46.855  1.00 42.66 ? 178 HOH A O   1 
HETATM 1132 O O   . HOH C 3 .   ? -6.823  -29.775 37.008  1.00 37.20 ? 179 HOH A O   1 
HETATM 1133 O O   . HOH C 3 .   ? 5.704   -11.930 -0.767  1.00 56.00 ? 180 HOH A O   1 
HETATM 1134 O O   . HOH C 3 .   ? 6.859   -29.825 37.838  1.00 41.44 ? 181 HOH A O   1 
HETATM 1135 O O   . HOH C 3 .   ? -9.906  -12.576 6.443   1.00 44.79 ? 182 HOH A O   1 
HETATM 1136 O O   . HOH C 3 .   ? -11.913 -9.257  2.703   1.00 56.79 ? 183 HOH A O   1 
HETATM 1137 O O   . HOH C 3 .   ? -5.161  -10.902 -2.158  1.00 39.13 ? 184 HOH A O   1 
HETATM 1138 O O   . HOH C 3 .   ? 4.297   -35.276 0.351   1.00 36.53 ? 185 HOH A O   1 
HETATM 1139 O O   . HOH C 3 .   ? -6.475  -13.563 -7.688  1.00 43.87 ? 186 HOH A O   1 
HETATM 1140 O O   . HOH C 3 .   ? -15.838 -25.550 2.810   1.00 46.73 ? 187 HOH A O   1 
HETATM 1141 O O   . HOH C 3 .   ? 3.321   -15.333 -2.483  1.00 42.06 ? 188 HOH A O   1 
HETATM 1142 O O   . HOH C 3 .   ? -6.355  -14.328 -5.253  1.00 36.82 ? 189 HOH A O   1 
HETATM 1143 O O   . HOH C 3 .   ? -5.823  -30.695 -1.362  1.00 43.12 ? 190 HOH A O   1 
HETATM 1144 O O   . HOH C 3 .   ? -3.513  -13.630 11.272  1.00 41.04 ? 191 HOH A O   1 
HETATM 1145 O O   . HOH C 3 .   ? -2.147  -7.870  6.141   1.00 42.21 ? 192 HOH A O   1 
HETATM 1146 O O   . HOH C 3 .   ? 8.955   -25.362 0.017   1.00 46.07 ? 193 HOH A O   1 
HETATM 1147 O O   . HOH C 3 .   ? -3.867  -12.746 -3.550  1.00 46.52 ? 194 HOH A O   1 
HETATM 1148 O O   . HOH C 3 .   ? -4.488  -24.841 34.763  1.00 48.34 ? 195 HOH A O   1 
HETATM 1149 O O   . HOH C 3 .   ? -5.199  -24.750 32.094  1.00 48.61 ? 196 HOH A O   1 
HETATM 1150 O O   . HOH C 3 .   ? -10.984 -30.585 0.571   1.00 40.37 ? 197 HOH A O   1 
HETATM 1151 O O   . HOH C 3 .   ? 7.933   -31.245 15.514  1.00 52.86 ? 198 HOH A O   1 
HETATM 1152 O O   . HOH C 3 .   ? -4.749  -11.624 -6.632  1.00 49.33 ? 199 HOH A O   1 
HETATM 1153 O O   . HOH C 3 .   ? -8.681  -30.788 -1.009  1.00 54.48 ? 200 HOH A O   1 
HETATM 1154 O O   . HOH C 3 .   ? -4.666  -30.922 -8.522  1.00 46.72 ? 201 HOH A O   1 
HETATM 1155 O O   . HOH C 3 .   ? -7.811  -27.941 30.891  1.00 39.91 ? 202 HOH A O   1 
HETATM 1156 O O   . HOH C 3 .   ? -8.342  -30.440 35.086  1.00 40.80 ? 203 HOH A O   1 
HETATM 1157 O O   . HOH C 3 .   ? 0.432   -33.377 0.638   1.00 51.16 ? 204 HOH A O   1 
HETATM 1158 O O   . HOH C 3 .   ? -1.354  -11.137 -4.707  1.00 49.15 ? 205 HOH A O   1 
HETATM 1159 O O   . HOH C 3 .   ? 1.747   -13.507 -3.754  1.00 46.93 ? 206 HOH A O   1 
HETATM 1160 O O   . HOH C 3 .   ? 4.441   -16.053 15.814  1.00 68.74 ? 207 HOH A O   1 
HETATM 1161 O O   . HOH C 3 .   ? -2.177  -30.983 -5.173  1.00 50.05 ? 208 HOH A O   1 
HETATM 1162 O O   . HOH C 3 .   ? 11.305  -15.958 3.567   1.00 57.06 ? 209 HOH A O   1 
HETATM 1163 O O   . HOH C 3 .   ? 14.317  -31.196 16.390  1.00 74.10 ? 210 HOH A O   1 
HETATM 1164 O O   . HOH C 3 .   ? -14.913 -20.742 10.587  1.00 66.62 ? 211 HOH A O   1 
HETATM 1165 O O   . HOH C 3 .   ? 1.672   -27.356 -11.624 1.00 49.74 ? 212 HOH A O   1 
HETATM 1166 O O   . HOH C 3 .   ? -6.000  -22.542 -20.027 1.00 73.54 ? 213 HOH A O   1 
HETATM 1167 O O   . HOH C 3 .   ? -0.224  -31.489 12.829  1.00 62.48 ? 214 HOH A O   1 
HETATM 1168 O O   . HOH C 3 .   ? 10.215  -20.609 13.767  1.00 46.96 ? 215 HOH A O   1 
HETATM 1169 O O   . HOH C 3 .   ? 2.528   -34.804 12.234  1.00 62.01 ? 216 HOH A O   1 
HETATM 1170 O O   . HOH C 3 .   ? 3.012   -26.409 33.483  1.00 54.67 ? 217 HOH A O   1 
HETATM 1171 O O   . HOH C 3 .   ? -18.450 -29.583 -2.695  1.00 69.97 ? 218 HOH A O   1 
HETATM 1172 O O   . HOH C 3 .   ? 8.480   -18.344 15.260  1.00 68.75 ? 219 HOH A O   1 
HETATM 1173 O O   . HOH C 3 .   ? -23.176 -18.471 0.322   1.00 63.23 ? 220 HOH A O   1 
HETATM 1174 O O   . HOH C 3 .   ? 7.033   -36.606 58.042  1.00 65.51 ? 221 HOH A O   1 
HETATM 1175 O O   . HOH C 3 .   ? -2.041  -14.867 13.067  1.00 52.28 ? 222 HOH A O   1 
HETATM 1176 O O   . HOH C 3 .   ? 11.209  -19.079 -2.144  1.00 57.17 ? 223 HOH A O   1 
HETATM 1177 O O   . HOH C 3 .   ? 2.221   -28.956 -7.995  1.00 55.11 ? 224 HOH A O   1 
HETATM 1178 O O   . HOH C 3 .   ? 0.115   -8.649  7.057   1.00 56.94 ? 225 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   12  ?   ?   ?   A . n 
A 1 2   SER 2   13  ?   ?   ?   A . n 
A 1 3   HIS 3   14  ?   ?   ?   A . n 
A 1 4   MET 4   15  ?   ?   ?   A . n 
A 1 5   GLY 5   16  ?   ?   ?   A . n 
A 1 6   GLY 6   17  ?   ?   ?   A . n 
A 1 7   SER 7   18  ?   ?   ?   A . n 
A 1 8   ARG 8   19  19  ARG ARG A . n 
A 1 9   MET 9   20  20  MET MET A . n 
A 1 10  LYS 10  21  21  LYS LYS A . n 
A 1 11  GLN 11  22  22  GLN GLN A . n 
A 1 12  ILE 12  23  23  ILE ILE A . n 
A 1 13  GLU 13  24  24  GLU GLU A . n 
A 1 14  ASP 14  25  25  ASP ASP A . n 
A 1 15  LYS 15  26  26  LYS LYS A . n 
A 1 16  ILE 16  27  27  ILE ILE A . n 
A 1 17  GLU 17  28  28  GLU GLU A . n 
A 1 18  GLU 18  29  29  GLU GLU A . n 
A 1 19  ILE 19  30  30  ILE ILE A . n 
A 1 20  LEU 20  31  31  LEU LEU A . n 
A 1 21  SER 21  32  32  SER SER A . n 
A 1 22  LYS 22  33  33  LYS LYS A . n 
A 1 23  ILE 23  34  34  ILE ILE A . n 
A 1 24  TYR 24  35  35  TYR TYR A . n 
A 1 25  HIS 25  36  36  HIS HIS A . n 
A 1 26  ILE 26  37  37  ILE ILE A . n 
A 1 27  GLU 27  38  38  GLU GLU A . n 
A 1 28  ASN 28  39  39  ASN ASN A . n 
A 1 29  GLU 29  40  40  GLU GLU A . n 
A 1 30  ILE 30  41  41  ILE ILE A . n 
A 1 31  ALA 31  42  42  ALA ALA A . n 
A 1 32  ARG 32  43  43  ARG ARG A . n 
A 1 33  ILE 33  44  44  ILE ILE A . n 
A 1 34  LYS 34  45  45  LYS LYS A . n 
A 1 35  LYS 35  46  46  LYS LYS A . n 
A 1 36  LEU 36  47  47  LEU LEU A . n 
A 1 37  ILE 37  48  ?   ?   ?   A . n 
A 1 38  GLY 38  49  ?   ?   ?   A . n 
A 1 39  GLU 39  50  ?   ?   ?   A . n 
A 1 40  ARG 40  51  ?   ?   ?   A . n 
A 1 41  GLU 41  52  ?   ?   ?   A . n 
A 1 42  THR 42  53  ?   ?   ?   A . n 
A 1 43  ALA 43  54  ?   ?   ?   A . n 
A 1 44  LYS 44  55  ?   ?   ?   A . n 
A 1 45  GLU 45  56  ?   ?   ?   A . n 
A 1 46  PRO 46  57  57  PRO PRO A . n 
A 1 47  CYS 47  58  58  CYS CYS A . n 
A 1 48  MET 48  59  59  MET MET A . n 
A 1 49  ALA 49  60  60  ALA ALA A . n 
A 1 50  LYS 50  61  61  LYS LYS A . n 
A 1 51  PHE 51  62  62  PHE PHE A . n 
A 1 52  GLY 52  63  63  GLY GLY A . n 
A 1 53  PRO 53  64  64  PRO PRO A . n 
A 1 54  LEU 54  65  65  LEU LEU A . n 
A 1 55  PRO 55  66  66  PRO PRO A . n 
A 1 56  SER 56  67  67  SER SER A . n 
A 1 57  LYS 57  68  68  LYS LYS A . n 
A 1 58  TRP 58  69  69  TRP TRP A . n 
A 1 59  GLN 59  70  70  GLN GLN A . n 
A 1 60  MET 60  71  71  MET MET A . n 
A 1 61  ALA 61  72  72  ALA ALA A . n 
A 1 62  SER 62  73  ?   ?   ?   A . n 
A 1 63  SER 63  74  ?   ?   ?   A . n 
A 1 64  GLU 64  75  ?   ?   ?   A . n 
A 1 65  PRO 65  76  76  PRO PRO A . n 
A 1 66  PRO 66  77  77  PRO PRO A . n 
A 1 67  CYS 67  78  78  CYS CYS A . n 
A 1 68  VAL 68  79  79  VAL VAL A . n 
A 1 69  ASN 69  80  80  ASN ASN A . n 
A 1 70  LYS 70  81  81  LYS LYS A . n 
A 1 71  VAL 71  82  82  VAL VAL A . n 
A 1 72  SER 72  83  83  SER SER A . n 
A 1 73  ASP 73  84  84  ASP ASP A . n 
A 1 74  TRP 74  85  85  TRP TRP A . n 
A 1 75  LYS 75  86  86  LYS LYS A . n 
A 1 76  LEU 76  87  87  LEU LEU A . n 
A 1 77  GLU 77  88  88  GLU GLU A . n 
A 1 78  ILE 78  89  89  ILE ILE A . n 
A 1 79  LEU 79  90  90  LEU LEU A . n 
A 1 80  GLN 80  91  91  GLN GLN A . n 
A 1 81  ASN 81  92  92  ASN ASN A . n 
A 1 82  GLY 82  93  93  GLY GLY A . n 
A 1 83  LEU 83  94  94  LEU LEU A . n 
A 1 84  TYR 84  95  95  TYR TYR A . n 
A 1 85  LEU 85  96  96  LEU LEU A . n 
A 1 86  ILE 86  97  97  ILE ILE A . n 
A 1 87  TYR 87  98  98  TYR TYR A . n 
A 1 88  GLY 88  99  99  GLY GLY A . n 
A 1 89  GLN 89  100 100 GLN GLN A . n 
A 1 90  VAL 90  101 101 VAL VAL A . n 
A 1 91  ALA 91  102 102 ALA ALA A . n 
A 1 92  PRO 92  103 103 PRO PRO A . n 
A 1 93  ASN 93  104 104 ASN ASN A . n 
A 1 94  ALA 94  105 ?   ?   ?   A . n 
A 1 95  ASN 95  106 ?   ?   ?   A . n 
A 1 96  TYR 96  107 ?   ?   ?   A . n 
A 1 97  ASN 97  108 ?   ?   ?   A . n 
A 1 98  ASP 98  109 ?   ?   ?   A . n 
A 1 99  VAL 99  110 ?   ?   ?   A . n 
A 1 100 ALA 100 111 111 ALA ALA A . n 
A 1 101 PRO 101 112 112 PRO PRO A . n 
A 1 102 PHE 102 113 113 PHE PHE A . n 
A 1 103 GLU 103 114 114 GLU GLU A . n 
A 1 104 VAL 104 115 115 VAL VAL A . n 
A 1 105 ARG 105 116 116 ARG ARG A . n 
A 1 106 LEU 106 117 117 LEU LEU A . n 
A 1 107 TYR 107 118 118 TYR TYR A . n 
A 1 108 LYS 108 119 119 LYS LYS A . n 
A 1 109 ASN 109 120 120 ASN ASN A . n 
A 1 110 LYS 110 121 121 LYS LYS A . n 
A 1 111 ASP 111 122 122 ASP ASP A . n 
A 1 112 MET 112 123 123 MET MET A . n 
A 1 113 ILE 113 124 124 ILE ILE A . n 
A 1 114 GLN 114 125 125 GLN GLN A . n 
A 1 115 THR 115 126 126 THR THR A . n 
A 1 116 LEU 116 127 127 LEU LEU A . n 
A 1 117 THR 117 128 128 THR THR A . n 
A 1 118 ASN 118 129 129 ASN ASN A . n 
A 1 119 LYS 119 130 130 LYS LYS A . n 
A 1 120 SER 120 131 131 SER SER A . n 
A 1 121 LYS 121 132 132 LYS LYS A . n 
A 1 122 ILE 122 133 133 ILE ILE A . n 
A 1 123 GLN 123 134 134 GLN GLN A . n 
A 1 124 ASN 124 135 135 ASN ASN A . n 
A 1 125 VAL 125 136 136 VAL VAL A . n 
A 1 126 GLY 126 137 137 GLY GLY A . n 
A 1 127 GLY 127 138 138 GLY GLY A . n 
A 1 128 THR 128 139 139 THR THR A . n 
A 1 129 TYR 129 140 140 TYR TYR A . n 
A 1 130 GLU 130 141 141 GLU GLU A . n 
A 1 131 LEU 131 142 142 LEU LEU A . n 
A 1 132 HIS 132 143 143 HIS HIS A . n 
A 1 133 VAL 133 144 144 VAL VAL A . n 
A 1 134 GLY 134 145 145 GLY GLY A . n 
A 1 135 ASP 135 146 146 ASP ASP A . n 
A 1 136 THR 136 147 147 THR THR A . n 
A 1 137 ILE 137 148 148 ILE ILE A . n 
A 1 138 ASP 138 149 149 ASP ASP A . n 
A 1 139 LEU 139 150 150 LEU LEU A . n 
A 1 140 ILE 140 151 151 ILE ILE A . n 
A 1 141 PHE 141 152 152 PHE PHE A . n 
A 1 142 ASN 142 153 153 ASN ASN A . n 
A 1 143 SER 143 154 154 SER SER A . n 
A 1 144 GLU 144 155 155 GLU GLU A . n 
A 1 145 HIS 145 156 156 HIS HIS A . n 
A 1 146 GLN 146 157 157 GLN GLN A . n 
A 1 147 VAL 147 158 158 VAL VAL A . n 
A 1 148 LEU 148 159 159 LEU LEU A . n 
A 1 149 LYS 149 160 160 LYS LYS A . n 
A 1 150 ASN 150 161 161 ASN ASN A . n 
A 1 151 ASN 151 162 162 ASN ASN A . n 
A 1 152 THR 152 163 163 THR THR A . n 
A 1 153 TYR 153 164 164 TYR TYR A . n 
A 1 154 TRP 154 165 165 TRP TRP A . n 
A 1 155 GLY 155 166 166 GLY GLY A . n 
A 1 156 ILE 156 167 167 ILE ILE A . n 
A 1 157 ILE 157 168 168 ILE ILE A . n 
A 1 158 LEU 158 169 169 LEU LEU A . n 
A 1 159 LEU 159 170 170 LEU LEU A . n 
A 1 160 ALA 160 171 171 ALA ALA A . n 
A 1 161 ASN 161 172 172 ASN ASN A . n 
A 1 162 PRO 162 173 173 PRO PRO A . n 
A 1 163 GLN 163 174 174 GLN GLN A . n 
A 1 164 PHE 164 175 175 PHE PHE A . n 
A 1 165 ILE 165 176 176 ILE ILE A . n 
A 1 166 SER 166 177 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1  1   1  SO4 SO4 A . 
C 3 HOH 1  178 2  HOH HOH A . 
C 3 HOH 2  179 3  HOH HOH A . 
C 3 HOH 3  180 4  HOH HOH A . 
C 3 HOH 4  181 5  HOH HOH A . 
C 3 HOH 5  182 6  HOH HOH A . 
C 3 HOH 6  183 7  HOH HOH A . 
C 3 HOH 7  184 9  HOH HOH A . 
C 3 HOH 8  185 10 HOH HOH A . 
C 3 HOH 9  186 11 HOH HOH A . 
C 3 HOH 10 187 12 HOH HOH A . 
C 3 HOH 11 188 13 HOH HOH A . 
C 3 HOH 12 189 14 HOH HOH A . 
C 3 HOH 13 190 15 HOH HOH A . 
C 3 HOH 14 191 16 HOH HOH A . 
C 3 HOH 15 192 17 HOH HOH A . 
C 3 HOH 16 193 18 HOH HOH A . 
C 3 HOH 17 194 19 HOH HOH A . 
C 3 HOH 18 195 21 HOH HOH A . 
C 3 HOH 19 196 22 HOH HOH A . 
C 3 HOH 20 197 23 HOH HOH A . 
C 3 HOH 21 198 24 HOH HOH A . 
C 3 HOH 22 199 25 HOH HOH A . 
C 3 HOH 23 200 27 HOH HOH A . 
C 3 HOH 24 201 28 HOH HOH A . 
C 3 HOH 25 202 29 HOH HOH A . 
C 3 HOH 26 203 30 HOH HOH A . 
C 3 HOH 27 204 31 HOH HOH A . 
C 3 HOH 28 205 33 HOH HOH A . 
C 3 HOH 29 206 34 HOH HOH A . 
C 3 HOH 30 207 35 HOH HOH A . 
C 3 HOH 31 208 36 HOH HOH A . 
C 3 HOH 32 209 38 HOH HOH A . 
C 3 HOH 33 210 39 HOH HOH A . 
C 3 HOH 34 211 40 HOH HOH A . 
C 3 HOH 35 212 41 HOH HOH A . 
C 3 HOH 36 213 43 HOH HOH A . 
C 3 HOH 37 214 44 HOH HOH A . 
C 3 HOH 38 215 45 HOH HOH A . 
C 3 HOH 39 216 46 HOH HOH A . 
C 3 HOH 40 217 47 HOH HOH A . 
C 3 HOH 41 218 51 HOH HOH A . 
C 3 HOH 42 219 52 HOH HOH A . 
C 3 HOH 43 220 53 HOH HOH A . 
C 3 HOH 44 221 54 HOH HOH A . 
C 3 HOH 45 222 56 HOH HOH A . 
C 3 HOH 46 223 57 HOH HOH A . 
C 3 HOH 47 224 60 HOH HOH A . 
C 3 HOH 48 225 61 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_assembly_prop.biol_id   1 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     6800 
_pdbx_struct_assembly_prop.details   ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_445 -y-1,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 -30.6095000000 0.8660254038  
-0.5000000000 0.0000000000 -53.0172091943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_545 -x+y,-x-1,z  -0.5000000000 0.8660254038  0.0000000000 30.6095000000  -0.8660254038 
-0.5000000000 0.0000000000 -53.0172091943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC      .     ?              program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT 3.000 'July 2, 2007' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CBASS       .     ?              ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .     ?              ?       ?                    ?                        'data reduction'  ? ?          ? 6 
MOLREP      .     ?              ?       ?                    ?                        phasing           ? ?          ? 7 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The sequence RMKQIEDKIEEILSKIYHIENEIARIKKLIGER 
corresponds to the coiled-coil protein structural motif 
of GCN4-pII, and is fused at the N-terminus of TNF18_HUMAN.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 68  ? ? -110.05 -122.75 
2 1 TRP A 85  ? ? 83.27   -0.39   
3 1 ASN A 120 ? ? 50.98   -122.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 28  ? OE1 ? A GLU 17  OE1 
2  1 Y 1 A GLU 28  ? OE2 ? A GLU 17  OE2 
3  1 Y 1 A GLU 29  ? CG  ? A GLU 18  CG  
4  1 Y 1 A GLU 29  ? CD  ? A GLU 18  CD  
5  1 Y 1 A GLU 29  ? OE1 ? A GLU 18  OE1 
6  1 Y 1 A GLU 29  ? OE2 ? A GLU 18  OE2 
7  1 Y 1 A LYS 130 ? CD  ? A LYS 119 CD  
8  1 Y 1 A LYS 130 ? CE  ? A LYS 119 CE  
9  1 Y 1 A LYS 130 ? NZ  ? A LYS 119 NZ  
10 1 Y 1 A LYS 132 ? CD  ? A LYS 121 CD  
11 1 Y 1 A LYS 132 ? CE  ? A LYS 121 CE  
12 1 Y 1 A LYS 132 ? NZ  ? A LYS 121 NZ  
13 1 Y 1 A LYS 160 ? CD  ? A LYS 149 CD  
14 1 Y 1 A LYS 160 ? CE  ? A LYS 149 CE  
15 1 Y 1 A LYS 160 ? NZ  ? A LYS 149 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 12  ? A GLY 1   
2  1 Y 1 A SER 13  ? A SER 2   
3  1 Y 1 A HIS 14  ? A HIS 3   
4  1 Y 1 A MET 15  ? A MET 4   
5  1 Y 1 A GLY 16  ? A GLY 5   
6  1 Y 1 A GLY 17  ? A GLY 6   
7  1 Y 1 A SER 18  ? A SER 7   
8  1 Y 1 A ILE 48  ? A ILE 37  
9  1 Y 1 A GLY 49  ? A GLY 38  
10 1 Y 1 A GLU 50  ? A GLU 39  
11 1 Y 1 A ARG 51  ? A ARG 40  
12 1 Y 1 A GLU 52  ? A GLU 41  
13 1 Y 1 A THR 53  ? A THR 42  
14 1 Y 1 A ALA 54  ? A ALA 43  
15 1 Y 1 A LYS 55  ? A LYS 44  
16 1 Y 1 A GLU 56  ? A GLU 45  
17 1 Y 1 A SER 73  ? A SER 62  
18 1 Y 1 A SER 74  ? A SER 63  
19 1 Y 1 A GLU 75  ? A GLU 64  
20 1 Y 1 A ALA 105 ? A ALA 94  
21 1 Y 1 A ASN 106 ? A ASN 95  
22 1 Y 1 A TYR 107 ? A TYR 96  
23 1 Y 1 A ASN 108 ? A ASN 97  
24 1 Y 1 A ASP 109 ? A ASP 98  
25 1 Y 1 A VAL 110 ? A VAL 99  
26 1 Y 1 A SER 177 ? A SER 166 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#