data_2R4S
# 
_entry.id   2R4S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2R4S         
RCSB  RCSB044424   
WWPDB D_1000044424 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2R4R 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2R4S 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rasmussen, S.G.F.' 1  
'Choi, H.J.'        2  
'Rosenbaum, D.M.'   3  
'Kobilka, T.S.'     4  
'Thian, F.S.'       5  
'Edwards, P.C.'     6  
'Burghammer, M.'    7  
'Ratnala, V.R.'     8  
'Sanishvili, R.'    9  
'Fischetti, R.F.'   10 
'Schertler, G.F.'   11 
'Weis, W.I.'        12 
'Kobilka, B.K.'     13 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            450 
_citation.page_first                383 
_citation.page_last                 387 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17952055 
_citation.pdbx_database_id_DOI      10.1038/nature06325 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rasmussen, S.G.F.' 1  
primary 'Choi, H.J.'        2  
primary 'Rosenbaum, D.M.'   3  
primary 'Kobilka, T.S.'     4  
primary 'Thian, F.S.'       5  
primary 'Edwards, P.C.'     6  
primary 'Burghammer, M.'    7  
primary 'Ratnala, V.R.'     8  
primary 'Sanishvili, R.'    9  
primary 'Fischetti, R.F.'   10 
primary 'Schertler, G.F.'   11 
primary 'Weis, W.I.'        12 
primary 'Kobilka, B.K.'     13 
# 
_cell.length_a           338.380 
_cell.length_b           48.480 
_cell.length_c           89.350 
_cell.angle_alpha        90.000 
_cell.angle_beta         104.600 
_cell.angle_gamma        90.000 
_cell.entry_id           2R4S 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2R4S 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Beta-2 adrenergic receptor'                   38906.406 1 ? ? ? ? 
2 polymer nat 'antibody for beta2 adrenoceptor, light chain' 23902.539 1 ? ? ? ? 
3 polymer nat 'antibody for beta2 adrenoceptor, heavy chain' 23236.852 1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-2 adrenoceptor, Beta-2 adrenoreceptor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGN
FWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAIN
CYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSK
FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLR
RSSLKAYGNGYSSNGNTGEQSG
;
;VTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGN
FWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAIN
CYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSK
FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLR
RSSLKAYGNGYSSNGNTGEQSG
;
A ? 
2 'polypeptide(L)' no no 
;DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDY
ADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDY
ADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
3 'polypeptide(L)' no no 
;EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAY
MQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
;
;EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAY
MQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   THR n 
1 3   GLN n 
1 4   GLN n 
1 5   ARG n 
1 6   ASP n 
1 7   GLU n 
1 8   VAL n 
1 9   TRP n 
1 10  VAL n 
1 11  VAL n 
1 12  GLY n 
1 13  MET n 
1 14  GLY n 
1 15  ILE n 
1 16  VAL n 
1 17  MET n 
1 18  SER n 
1 19  LEU n 
1 20  ILE n 
1 21  VAL n 
1 22  LEU n 
1 23  ALA n 
1 24  ILE n 
1 25  VAL n 
1 26  PHE n 
1 27  GLY n 
1 28  ASN n 
1 29  VAL n 
1 30  LEU n 
1 31  VAL n 
1 32  ILE n 
1 33  THR n 
1 34  ALA n 
1 35  ILE n 
1 36  ALA n 
1 37  LYS n 
1 38  PHE n 
1 39  GLU n 
1 40  ARG n 
1 41  LEU n 
1 42  GLN n 
1 43  THR n 
1 44  VAL n 
1 45  THR n 
1 46  ASN n 
1 47  TYR n 
1 48  PHE n 
1 49  ILE n 
1 50  THR n 
1 51  SER n 
1 52  LEU n 
1 53  ALA n 
1 54  CYS n 
1 55  ALA n 
1 56  ASP n 
1 57  LEU n 
1 58  VAL n 
1 59  MET n 
1 60  GLY n 
1 61  LEU n 
1 62  ALA n 
1 63  VAL n 
1 64  VAL n 
1 65  PRO n 
1 66  PHE n 
1 67  GLY n 
1 68  ALA n 
1 69  ALA n 
1 70  HIS n 
1 71  ILE n 
1 72  LEU n 
1 73  MET n 
1 74  LYS n 
1 75  MET n 
1 76  TRP n 
1 77  THR n 
1 78  PHE n 
1 79  GLY n 
1 80  ASN n 
1 81  PHE n 
1 82  TRP n 
1 83  CYS n 
1 84  GLU n 
1 85  PHE n 
1 86  TRP n 
1 87  THR n 
1 88  SER n 
1 89  ILE n 
1 90  ASP n 
1 91  VAL n 
1 92  LEU n 
1 93  CYS n 
1 94  VAL n 
1 95  THR n 
1 96  ALA n 
1 97  SER n 
1 98  ILE n 
1 99  GLU n 
1 100 THR n 
1 101 LEU n 
1 102 CYS n 
1 103 VAL n 
1 104 ILE n 
1 105 ALA n 
1 106 VAL n 
1 107 ASP n 
1 108 ARG n 
1 109 TYR n 
1 110 PHE n 
1 111 ALA n 
1 112 ILE n 
1 113 THR n 
1 114 SER n 
1 115 PRO n 
1 116 PHE n 
1 117 LYS n 
1 118 TYR n 
1 119 GLN n 
1 120 SER n 
1 121 LEU n 
1 122 LEU n 
1 123 THR n 
1 124 LYS n 
1 125 ASN n 
1 126 LYS n 
1 127 ALA n 
1 128 ARG n 
1 129 VAL n 
1 130 ILE n 
1 131 ILE n 
1 132 LEU n 
1 133 MET n 
1 134 VAL n 
1 135 TRP n 
1 136 ILE n 
1 137 VAL n 
1 138 SER n 
1 139 GLY n 
1 140 LEU n 
1 141 THR n 
1 142 SER n 
1 143 PHE n 
1 144 LEU n 
1 145 PRO n 
1 146 ILE n 
1 147 GLN n 
1 148 MET n 
1 149 HIS n 
1 150 TRP n 
1 151 TYR n 
1 152 ARG n 
1 153 ALA n 
1 154 THR n 
1 155 HIS n 
1 156 GLN n 
1 157 GLU n 
1 158 ALA n 
1 159 ILE n 
1 160 ASN n 
1 161 CYS n 
1 162 TYR n 
1 163 ALA n 
1 164 ASN n 
1 165 GLU n 
1 166 THR n 
1 167 CYS n 
1 168 CYS n 
1 169 ASP n 
1 170 PHE n 
1 171 PHE n 
1 172 THR n 
1 173 ASN n 
1 174 GLN n 
1 175 ALA n 
1 176 TYR n 
1 177 ALA n 
1 178 ILE n 
1 179 ALA n 
1 180 SER n 
1 181 SER n 
1 182 ILE n 
1 183 VAL n 
1 184 SER n 
1 185 PHE n 
1 186 TYR n 
1 187 VAL n 
1 188 PRO n 
1 189 LEU n 
1 190 VAL n 
1 191 ILE n 
1 192 MET n 
1 193 VAL n 
1 194 PHE n 
1 195 VAL n 
1 196 TYR n 
1 197 SER n 
1 198 ARG n 
1 199 VAL n 
1 200 PHE n 
1 201 GLN n 
1 202 GLU n 
1 203 ALA n 
1 204 LYS n 
1 205 ARG n 
1 206 GLN n 
1 207 LEU n 
1 208 GLN n 
1 209 LYS n 
1 210 ILE n 
1 211 ASP n 
1 212 LYS n 
1 213 SER n 
1 214 GLU n 
1 215 GLY n 
1 216 ARG n 
1 217 PHE n 
1 218 HIS n 
1 219 VAL n 
1 220 GLN n 
1 221 ASN n 
1 222 LEU n 
1 223 SER n 
1 224 GLN n 
1 225 VAL n 
1 226 GLU n 
1 227 GLN n 
1 228 ASP n 
1 229 GLY n 
1 230 ARG n 
1 231 THR n 
1 232 GLY n 
1 233 HIS n 
1 234 GLY n 
1 235 LEU n 
1 236 ARG n 
1 237 ARG n 
1 238 SER n 
1 239 SER n 
1 240 LYS n 
1 241 PHE n 
1 242 CYS n 
1 243 LEU n 
1 244 LYS n 
1 245 GLU n 
1 246 HIS n 
1 247 LYS n 
1 248 ALA n 
1 249 LEU n 
1 250 LYS n 
1 251 THR n 
1 252 LEU n 
1 253 GLY n 
1 254 ILE n 
1 255 ILE n 
1 256 MET n 
1 257 GLY n 
1 258 THR n 
1 259 PHE n 
1 260 THR n 
1 261 LEU n 
1 262 CYS n 
1 263 TRP n 
1 264 LEU n 
1 265 PRO n 
1 266 PHE n 
1 267 PHE n 
1 268 ILE n 
1 269 VAL n 
1 270 ASN n 
1 271 ILE n 
1 272 VAL n 
1 273 HIS n 
1 274 VAL n 
1 275 ILE n 
1 276 GLN n 
1 277 ASP n 
1 278 ASN n 
1 279 LEU n 
1 280 ILE n 
1 281 ARG n 
1 282 LYS n 
1 283 GLU n 
1 284 VAL n 
1 285 TYR n 
1 286 ILE n 
1 287 LEU n 
1 288 LEU n 
1 289 ASN n 
1 290 TRP n 
1 291 ILE n 
1 292 GLY n 
1 293 TYR n 
1 294 VAL n 
1 295 ASN n 
1 296 SER n 
1 297 GLY n 
1 298 PHE n 
1 299 ASN n 
1 300 PRO n 
1 301 LEU n 
1 302 ILE n 
1 303 TYR n 
1 304 CYS n 
1 305 ARG n 
1 306 SER n 
1 307 PRO n 
1 308 ASP n 
1 309 PHE n 
1 310 ARG n 
1 311 ILE n 
1 312 ALA n 
1 313 PHE n 
1 314 GLN n 
1 315 GLU n 
1 316 LEU n 
1 317 LEU n 
1 318 CYS n 
1 319 LEU n 
1 320 ARG n 
1 321 ARG n 
1 322 SER n 
1 323 SER n 
1 324 LEU n 
1 325 LYS n 
1 326 ALA n 
1 327 TYR n 
1 328 GLY n 
1 329 ASN n 
1 330 GLY n 
1 331 TYR n 
1 332 SER n 
1 333 SER n 
1 334 ASN n 
1 335 GLY n 
1 336 ASN n 
1 337 THR n 
1 338 GLY n 
1 339 GLU n 
1 340 GLN n 
1 341 SER n 
1 342 GLY n 
2 1   ASP n 
2 2   ILE n 
2 3   LYS n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   SER n 
2 10  SER n 
2 11  MET n 
2 12  TYR n 
2 13  ALA n 
2 14  SER n 
2 15  LEU n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  LYS n 
2 25  ALA n 
2 26  SER n 
2 27  GLN n 
2 28  ASP n 
2 29  ILE n 
2 30  ASN n 
2 31  SER n 
2 32  TYR n 
2 33  LEU n 
2 34  SER n 
2 35  TRP n 
2 36  PHE n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  LYS n 
2 43  SER n 
2 44  PRO n 
2 45  LYS n 
2 46  THR n 
2 47  LEU n 
2 48  ILE n 
2 49  TYR n 
2 50  ARG n 
2 51  ALA n 
2 52  ASN n 
2 53  ARG n 
2 54  LEU n 
2 55  VAL n 
2 56  ASP n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  SER n 
2 61  ARG n 
2 62  PHE n 
2 63  ILE n 
2 64  GLY n 
2 65  THR n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  GLN n 
2 70  ASP n 
2 71  TYR n 
2 72  SER n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  ASP n 
2 80  TYR n 
2 81  ALA n 
2 82  ASP n 
2 83  MET n 
2 84  GLY n 
2 85  ILE n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  LEU n 
2 90  GLN n 
2 91  TYR n 
2 92  ASP n 
2 93  GLU n 
2 94  PHE n 
2 95  PRO n 
2 96  TYR n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLY n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 LEU n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 ALA n 
2 110 ASP n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 THR n 
2 115 VAL n 
2 116 SER n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 SER n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 THR n 
2 127 SER n 
2 128 GLY n 
2 129 GLY n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 PHE n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 LYS n 
2 143 ASP n 
2 144 ILE n 
2 145 ASN n 
2 146 VAL n 
2 147 LYS n 
2 148 TRP n 
2 149 LYS n 
2 150 ILE n 
2 151 ASP n 
2 152 GLY n 
2 153 SER n 
2 154 GLU n 
2 155 ARG n 
2 156 GLN n 
2 157 ASN n 
2 158 GLY n 
2 159 VAL n 
2 160 LEU n 
2 161 ASN n 
2 162 SER n 
2 163 TRP n 
2 164 THR n 
2 165 ASP n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 MET n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 THR n 
2 183 LYS n 
2 184 ASP n 
2 185 GLU n 
2 186 TYR n 
2 187 GLU n 
2 188 ARG n 
2 189 HIS n 
2 190 ASN n 
2 191 SER n 
2 192 TYR n 
2 193 THR n 
2 194 CYS n 
2 195 GLU n 
2 196 ALA n 
2 197 THR n 
2 198 HIS n 
2 199 LYS n 
2 200 THR n 
2 201 SER n 
2 202 THR n 
2 203 SER n 
2 204 PRO n 
2 205 ILE n 
2 206 VAL n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 ASN n 
2 213 GLU n 
2 214 CYS n 
3 1   GLU n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   ALA n 
3 10  GLU n 
3 11  LEU n 
3 12  ALA n 
3 13  ARG n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  LEU n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  ILE n 
3 29  PHE n 
3 30  THR n 
3 31  ASP n 
3 32  TYR n 
3 33  TYR n 
3 34  ILE n 
3 35  ASN n 
3 36  TRP n 
3 37  VAL n 
3 38  ARG n 
3 39  GLN n 
3 40  ARG n 
3 41  THR n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  PHE n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  GLU n 
3 51  ILE n 
3 52  TYR n 
3 53  PRO n 
3 54  GLY n 
3 55  SER n 
3 56  GLY n 
3 57  ASN n 
3 58  ILE n 
3 59  ASP n 
3 60  TYR n 
3 61  ASN n 
3 62  GLU n 
3 63  ARG n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  LEU n 
3 71  THR n 
3 72  ALA n 
3 73  ASP n 
3 74  LYS n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLN n 
3 83  LEU n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  THR n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  PHE n 
3 96  CYS n 
3 97  VAL n 
3 98  ARG n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 TYR n 
3 103 TRP n 
3 104 GLY n 
3 105 GLN n 
3 106 GLY n 
3 107 THR n 
3 108 THR n 
3 109 LEU n 
3 110 THR n 
3 111 VAL n 
3 112 SER n 
3 113 SER n 
3 114 ALA n 
3 115 LYS n 
3 116 THR n 
3 117 THR n 
3 118 PRO n 
3 119 PRO n 
3 120 SER n 
3 121 VAL n 
3 122 TYR n 
3 123 PRO n 
3 124 LEU n 
3 125 ALA n 
3 126 PRO n 
3 127 GLY n 
3 128 SER n 
3 129 ALA n 
3 130 ALA n 
3 131 GLN n 
3 132 THR n 
3 133 ASN n 
3 134 SER n 
3 135 ALA n 
3 136 VAL n 
3 137 THR n 
3 138 LEU n 
3 139 GLY n 
3 140 CYS n 
3 141 LEU n 
3 142 VAL n 
3 143 LYS n 
3 144 GLY n 
3 145 TYR n 
3 146 PHE n 
3 147 PRO n 
3 148 GLU n 
3 149 PRO n 
3 150 VAL n 
3 151 THR n 
3 152 VAL n 
3 153 THR n 
3 154 TRP n 
3 155 ASN n 
3 156 SER n 
3 157 GLY n 
3 158 SER n 
3 159 LEU n 
3 160 SER n 
3 161 SER n 
3 162 GLY n 
3 163 VAL n 
3 164 HIS n 
3 165 THR n 
3 166 PHE n 
3 167 PRO n 
3 168 ALA n 
3 169 VAL n 
3 170 LEU n 
3 171 GLN n 
3 172 SER n 
3 173 ASP n 
3 174 LEU n 
3 175 TYR n 
3 176 THR n 
3 177 LEU n 
3 178 SER n 
3 179 SER n 
3 180 SER n 
3 181 VAL n 
3 182 THR n 
3 183 VAL n 
3 184 PRO n 
3 185 SER n 
3 186 SER n 
3 187 THR n 
3 188 TRP n 
3 189 PRO n 
3 190 SER n 
3 191 GLU n 
3 192 THR n 
3 193 VAL n 
3 194 THR n 
3 195 CYS n 
3 196 ASN n 
3 197 VAL n 
3 198 ALA n 
3 199 HIS n 
3 200 PRO n 
3 201 ALA n 
3 202 SER n 
3 203 SER n 
3 204 THR n 
3 205 LYS n 
3 206 VAL n 
3 207 ASP n 
3 208 LYS n 
3 209 LYS n 
3 210 ILE n 
3 211 VAL n 
3 212 PRO n 
3 213 ARG n 
3 214 ASP n 
3 215 CYS n 
3 216 GLY n 
3 217 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ADRB2, ADRB2R, B2AR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ADRB2_HUMAN P07550 1 
;VTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGN
FWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAIN
CYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSK
FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLR
RSSLKAYGNGYSSNGNTGEQSG
;
24 ? 
2 PDB 2R4S        2R4S   2 
;DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFIGTGSGQDYSLTISSLDY
ADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
1  ? 
3 PDB 2R4S        2R4S   3 
;EVQLQQSGAELARPGASVKLSCKASGYIFTDYYINWVRQRTGQGFEWIGEIYPGSGNIDYNERFKDKATLTADKSSSTAY
MQLSSLTSEDSAVYFCVRGFGYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSAVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
;
1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2R4S A 1 ? 342 ? P07550 24 ? 365 ? 24 365 
2 2 2R4S L 1 ? 214 ? 2R4S   1  ? 214 ? 1  214 
3 3 2R4S H 1 ? 217 ? 2R4S   1  ? 217 ? 1  217 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2R4S 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.12 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   70.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.pdbx_details    'Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     2R4S 
_reflns.d_resolution_high            3.400 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   19488 
_reflns.pdbx_Rmerge_I_obs            0.120 
_reflns.pdbx_netI_over_sigmaI        7.800 
_reflns.pdbx_chi_squared             1.659 
_reflns.pdbx_redundancy              4.100 
_reflns.percent_possible_obs         99.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.40 
_reflns_shell.d_res_low              3.52 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.456 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.926 
_reflns_shell.pdbx_redundancy        3.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1873 
_reflns_shell.percent_possible_all   98.40 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2R4S 
_refine.ls_d_res_high                            3.400 
_refine.ls_d_res_low                             19.990 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               1751876.875 
_refine.pdbx_data_cutoff_low_absF                0.000 
_refine.ls_percent_reflns_obs                    97.700 
_refine.ls_number_reflns_obs                     19344 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.280 
_refine.ls_percent_reflns_R_free                 9.700 
_refine.ls_number_reflns_R_free                  1886 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.B_iso_mean                               123.300 
_refine.solvent_model_param_bsol                 108.439 
_refine.solvent_model_param_ksol                 0.300 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.aniso_B[1][1]                            -16.530 
_refine.aniso_B[2][2]                            20.330 
_refine.aniso_B[3][3]                            -3.800 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            13.050 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'pdb entry 1gzm and 1igt' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2R4S 
_refine_analyze.Luzzati_coordinate_error_obs    0.370 
_refine_analyze.Luzzati_sigma_a_obs             0.400 
_refine_analyze.Luzzati_d_res_low_obs           6.000 
_refine_analyze.Luzzati_coordinate_error_free   0.450 
_refine_analyze.Luzzati_sigma_a_free            0.410 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4925 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4925 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        19.990 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.008  ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        ? 1.500  ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 24.900 ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 0.970  ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ? ?      ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ? ?      ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ? ?      ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ? ?      ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       3.400 
_refine_ls_shell.d_res_low                        3.610 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.percent_reflns_obs               88.300 
_refine_ls_shell.number_reflns_R_work             2562 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.270 
_refine_ls_shell.R_factor_R_free                  0.322 
_refine_ls_shell.percent_reflns_R_free            10.300 
_refine_ls_shell.number_reflns_R_free             295 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.number_reflns_all                2857 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       protein.top 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2R4S 
_struct.title                     'Crystal structure of the human beta2 adrenoceptor' 
_struct.pdbx_descriptor           
'Beta-2 adrenergic receptor, antibody for beta2 adrenoceptor, light chain, antibody for beta2 adrenoceptor, heavy chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2R4S 
_struct_keywords.text            
;transmembrane helix, G-protein coupled receptor, Glycoprotein, Lipoprotein, Palmitate, Phosphorylation, Receptor, Transducer, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 16  ? VAL A 21  ? VAL A 39  VAL A 44  5 ? 6  
HELX_P HELX_P2  2  LEU A 22  ? GLY A 27  ? LEU A 45  GLY A 50  1 ? 6  
HELX_P HELX_P3  3  ASN A 28  ? ALA A 36  ? ASN A 51  ALA A 59  1 ? 9  
HELX_P HELX_P4  4  PHE A 38  ? GLN A 42  ? PHE A 61  GLN A 65  5 ? 5  
HELX_P HELX_P5  5  VAL A 44  ? ILE A 49  ? VAL A 67  ILE A 72  1 ? 6  
HELX_P HELX_P6  6  ALA A 53  ? VAL A 58  ? ALA A 76  VAL A 81  1 ? 6  
HELX_P HELX_P7  7  ASP A 90  ? THR A 113 ? ASP A 113 THR A 136 1 ? 24 
HELX_P HELX_P8  8  THR A 123 ? LEU A 140 ? THR A 146 LEU A 163 1 ? 18 
HELX_P HELX_P9  9  PHE A 185 ? ILE A 191 ? PHE A 208 ILE A 214 1 ? 7  
HELX_P HELX_P10 10 ILE A 191 ? GLN A 208 ? ILE A 214 GLN A 231 1 ? 18 
HELX_P HELX_P11 11 LYS A 247 ? PHE A 259 ? LYS A 270 PHE A 282 1 ? 13 
HELX_P HELX_P12 12 TRP A 263 ? ILE A 268 ? TRP A 286 ILE A 291 1 ? 6  
HELX_P HELX_P13 13 LEU A 288 ? VAL A 294 ? LEU A 311 VAL A 317 1 ? 7  
HELX_P HELX_P14 14 ASN A 295 ? GLY A 297 ? ASN A 318 GLY A 320 5 ? 3  
HELX_P HELX_P15 15 PHE A 298 ? TYR A 303 ? PHE A 321 TYR A 326 1 ? 6  
HELX_P HELX_P16 16 ASP A 308 ? GLU A 315 ? ASP A 331 GLU A 338 1 ? 8  
HELX_P HELX_P17 17 SER B 121 ? GLY B 128 ? SER L 121 GLY L 128 1 ? 8  
HELX_P HELX_P18 18 LYS B 183 ? ARG B 188 ? LYS L 183 ARG L 188 1 ? 6  
HELX_P HELX_P19 19 GLU C 62  ? LYS C 65  ? GLU H 62  LYS H 65  5 ? 4  
HELX_P HELX_P20 20 THR C 87  ? SER C 91  ? THR H 87  SER H 91  5 ? 5  
HELX_P HELX_P21 21 PRO C 200 ? SER C 203 ? PRO H 200 SER H 203 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf2 disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3 disulf ? ? B CYS 214 SG ? ? ? 1_555 C CYS 217 SG ? ? L CYS 214 H CYS 217 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf4 disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf5 disulf ? ? C CYS 140 SG ? ? ? 1_555 C CYS 195 SG ? ? H CYS 140 H CYS 195 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   B . ? SER 7   L PRO 8   B ? PRO 8   L 1 0.30  
2 PHE 94  B . ? PHE 94  L PRO 95  B ? PRO 95  L 1 0.18  
3 TYR 140 B . ? TYR 140 L PRO 141 B ? PRO 141 L 1 0.02  
4 PHE 146 C . ? PHE 146 H PRO 147 C ? PRO 147 H 1 -0.19 
5 GLU 148 C . ? GLU 148 H PRO 149 C ? PRO 149 H 1 0.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET B 4   ? SER B 7   ? MET L 4   SER L 7   
A 2 VAL B 19  ? ALA B 25  ? VAL L 19  ALA L 25  
A 3 LEU B 73  ? ILE B 75  ? LEU L 73  ILE L 75  
A 4 PHE B 62  ? GLY B 64  ? PHE L 62  GLY L 64  
B 1 TYR B 12  ? ALA B 13  ? TYR L 12  ALA L 13  
B 2 THR B 102 ? ILE B 106 ? THR L 102 ILE L 106 
B 3 GLY B 84  ? GLN B 90  ? GLY L 84  GLN L 90  
B 4 LEU B 33  ? GLN B 38  ? LEU L 33  GLN L 38  
B 5 LYS B 45  ? TYR B 49  ? LYS L 45  TYR L 49  
B 6 ARG B 53  ? LEU B 54  ? ARG L 53  LEU L 54  
C 1 TYR B 12  ? ALA B 13  ? TYR L 12  ALA L 13  
C 2 THR B 102 ? ILE B 106 ? THR L 102 ILE L 106 
C 3 GLY B 84  ? GLN B 90  ? GLY L 84  GLN L 90  
C 4 THR B 97  ? PHE B 98  ? THR L 97  PHE L 98  
D 1 SER B 116 ? PHE B 118 ? SER L 116 PHE L 118 
D 2 GLY B 129 ? PHE B 139 ? GLY L 129 PHE L 139 
D 3 TYR B 173 ? THR B 182 ? TYR L 173 THR L 182 
D 4 VAL B 159 ? TRP B 163 ? VAL L 159 TRP L 163 
E 1 VAL B 146 ? ILE B 150 ? VAL L 146 ILE L 150 
E 2 SER B 191 ? ALA B 196 ? SER L 191 ALA L 196 
E 3 ILE B 205 ? ASN B 210 ? ILE L 205 ASN L 210 
F 1 LEU C 4   ? GLN C 5   ? LEU H 4   GLN H 5   
F 2 SER C 17  ? ALA C 24  ? SER H 17  ALA H 24  
F 3 THR C 78  ? SER C 84  ? THR H 78  SER H 84  
F 4 ALA C 68  ? ASP C 73  ? ALA H 68  ASP H 73  
G 1 ALA C 9   ? ALA C 12  ? ALA H 9   ALA H 12  
G 2 THR C 107 ? VAL C 111 ? THR H 107 VAL H 111 
G 3 ALA C 92  ? CYS C 96  ? ALA H 92  CYS H 96  
G 4 ILE C 34  ? GLN C 39  ? ILE H 34  GLN H 39  
G 5 GLU C 46  ? ILE C 51  ? GLU H 46  ILE H 51  
G 6 ILE C 58  ? TYR C 60  ? ILE H 58  TYR H 60  
H 1 VAL C 121 ? LEU C 124 ? VAL H 121 LEU H 124 
H 2 ALA C 135 ? TYR C 145 ? ALA H 135 TYR H 145 
H 3 TYR C 175 ? PRO C 184 ? TYR H 175 PRO H 184 
H 4 VAL C 163 ? VAL C 169 ? VAL H 163 VAL H 169 
I 1 THR C 194 ? HIS C 199 ? THR H 194 HIS H 199 
I 2 THR C 204 ? LYS C 209 ? THR H 204 LYS H 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER B 7   ? N SER L 7   O THR B 22  ? O THR L 22  
A 2 3 N ILE B 21  ? N ILE L 21  O LEU B 73  ? O LEU L 73  
A 3 4 O THR B 74  ? O THR L 74  N ILE B 63  ? N ILE L 63  
B 1 2 N ALA B 13  ? N ALA L 13  O GLU B 105 ? O GLU L 105 
B 2 3 O LEU B 104 ? O LEU L 104 N GLY B 84  ? N GLY L 84  
B 3 4 O ILE B 85  ? O ILE L 85  N GLN B 38  ? N GLN L 38  
B 4 5 N TRP B 35  ? N TRP L 35  O ILE B 48  ? O ILE L 48  
B 5 6 N TYR B 49  ? N TYR L 49  O ARG B 53  ? O ARG L 53  
C 1 2 N ALA B 13  ? N ALA L 13  O GLU B 105 ? O GLU L 105 
C 2 3 O LEU B 104 ? O LEU L 104 N GLY B 84  ? N GLY L 84  
C 3 4 N GLN B 90  ? N GLN L 90  O THR B 97  ? O THR L 97  
D 1 2 N PHE B 118 ? N PHE L 118 O VAL B 133 ? O VAL L 133 
D 2 3 N PHE B 139 ? N PHE L 139 O TYR B 173 ? O TYR L 173 
D 3 4 O THR B 178 ? O THR L 178 N LEU B 160 ? N LEU L 160 
E 1 2 N LYS B 149 ? N LYS L 149 O THR B 193 ? O THR L 193 
E 2 3 N ALA B 196 ? N ALA L 196 O ILE B 205 ? O ILE L 205 
F 1 2 N GLN C 5   ? N GLN H 5   O LYS C 23  ? O LYS H 23  
F 2 3 N VAL C 18  ? N VAL H 18  O LEU C 83  ? O LEU H 83  
F 3 4 O TYR C 80  ? O TYR H 80  N THR C 71  ? N THR H 71  
G 1 2 N GLU C 10  ? N GLU H 10  O THR C 110 ? O THR H 110 
G 2 3 O THR C 107 ? O THR H 107 N TYR C 94  ? N TYR H 94  
G 3 4 O PHE C 95  ? O PHE H 95  N VAL C 37  ? N VAL H 37  
G 4 5 N ARG C 38  ? N ARG H 38  O GLU C 46  ? O GLU H 46  
G 5 6 N GLU C 50  ? N GLU H 50  O ASP C 59  ? O ASP H 59  
H 1 2 N LEU C 124 ? N LEU H 124 O GLY C 139 ? O GLY H 139 
H 2 3 N LEU C 138 ? N LEU H 138 O VAL C 181 ? O VAL H 181 
H 3 4 O SER C 178 ? O SER H 178 N PHE C 166 ? N PHE H 166 
I 1 2 N HIS C 199 ? N HIS H 199 O THR C 204 ? O THR H 204 
# 
_database_PDB_matrix.entry_id          2R4S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    2R4S 
_atom_sites.fract_transf_matrix[1][1]   0.002955 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000770 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020627 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011565 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLY A 1 14  ? 12.349  38.841 28.886  1.00 232.85 ? 37  GLY A N   1 
ATOM 2    C CA  . GLY A 1 14  ? 11.532  38.159 29.928  1.00 232.85 ? 37  GLY A CA  1 
ATOM 3    C C   . GLY A 1 14  ? 12.237  36.949 30.507  1.00 232.85 ? 37  GLY A C   1 
ATOM 4    O O   . GLY A 1 14  ? 13.162  37.088 31.308  1.00 232.85 ? 37  GLY A O   1 
ATOM 5    N N   . ILE A 1 15  ? 11.800  35.760 30.103  1.00 251.85 ? 38  ILE A N   1 
ATOM 6    C CA  . ILE A 1 15  ? 12.403  34.521 30.582  1.00 251.85 ? 38  ILE A CA  1 
ATOM 7    C C   . ILE A 1 15  ? 13.878  34.471 30.197  1.00 251.85 ? 38  ILE A C   1 
ATOM 8    O O   . ILE A 1 15  ? 14.615  33.582 30.626  1.00 251.85 ? 38  ILE A O   1 
ATOM 9    C CB  . ILE A 1 15  ? 11.677  33.283 29.999  1.00 177.80 ? 38  ILE A CB  1 
ATOM 10   C CG1 . ILE A 1 15  ? 11.570  33.409 28.475  1.00 177.80 ? 38  ILE A CG1 1 
ATOM 11   C CG2 . ILE A 1 15  ? 10.298  33.141 30.633  1.00 177.80 ? 38  ILE A CG2 1 
ATOM 12   C CD1 . ILE A 1 15  ? 10.844  32.255 27.806  1.00 177.80 ? 38  ILE A CD1 1 
ATOM 13   N N   . VAL A 1 16  ? 14.301  35.438 29.387  1.00 294.57 ? 39  VAL A N   1 
ATOM 14   C CA  . VAL A 1 16  ? 15.687  35.531 28.944  1.00 294.57 ? 39  VAL A CA  1 
ATOM 15   C C   . VAL A 1 16  ? 16.469  36.438 29.894  1.00 294.57 ? 39  VAL A C   1 
ATOM 16   O O   . VAL A 1 16  ? 17.654  36.214 30.148  1.00 294.57 ? 39  VAL A O   1 
ATOM 17   C CB  . VAL A 1 16  ? 15.745  36.081 27.518  1.00 164.16 ? 39  VAL A CB  1 
ATOM 18   N N   . MET A 1 17  ? 15.795  37.458 30.420  1.00 274.05 ? 40  MET A N   1 
ATOM 19   C CA  . MET A 1 17  ? 16.416  38.398 31.349  1.00 274.05 ? 40  MET A CA  1 
ATOM 20   C C   . MET A 1 17  ? 16.431  37.820 32.760  1.00 274.05 ? 40  MET A C   1 
ATOM 21   O O   . MET A 1 17  ? 16.939  38.446 33.689  1.00 274.05 ? 40  MET A O   1 
ATOM 22   C CB  . MET A 1 17  ? 15.664  39.730 31.337  1.00 84.90  ? 40  MET A CB  1 
ATOM 23   N N   . SER A 1 18  ? 15.866  36.626 32.914  1.00 217.28 ? 41  SER A N   1 
ATOM 24   C CA  . SER A 1 18  ? 15.819  35.960 34.212  1.00 217.28 ? 41  SER A CA  1 
ATOM 25   C C   . SER A 1 18  ? 17.235  35.721 34.725  1.00 217.28 ? 41  SER A C   1 
ATOM 26   O O   . SER A 1 18  ? 17.455  35.534 35.923  1.00 217.28 ? 41  SER A O   1 
ATOM 27   C CB  . SER A 1 18  ? 15.080  34.622 34.099  1.00 181.46 ? 41  SER A CB  1 
ATOM 28   O OG  . SER A 1 18  ? 13.731  34.809 33.710  1.00 181.46 ? 41  SER A OG  1 
ATOM 29   N N   . LEU A 1 19  ? 18.193  35.728 33.805  1.00 261.41 ? 42  LEU A N   1 
ATOM 30   C CA  . LEU A 1 19  ? 19.591  35.518 34.152  1.00 261.41 ? 42  LEU A CA  1 
ATOM 31   C C   . LEU A 1 19  ? 20.187  36.802 34.720  1.00 261.41 ? 42  LEU A C   1 
ATOM 32   O O   . LEU A 1 19  ? 21.345  36.829 35.136  1.00 261.41 ? 42  LEU A O   1 
ATOM 33   C CB  . LEU A 1 19  ? 20.370  35.079 32.917  1.00 150.14 ? 42  LEU A CB  1 
ATOM 34   N N   . ILE A 1 20  ? 19.385  37.861 34.739  1.00 179.39 ? 43  ILE A N   1 
ATOM 35   C CA  . ILE A 1 20  ? 19.826  39.155 35.246  1.00 179.39 ? 43  ILE A CA  1 
ATOM 36   C C   . ILE A 1 20  ? 19.556  39.315 36.748  1.00 179.39 ? 43  ILE A C   1 
ATOM 37   O O   . ILE A 1 20  ? 19.989  40.289 37.365  1.00 179.39 ? 43  ILE A O   1 
ATOM 38   C CB  . ILE A 1 20  ? 19.150  40.306 34.447  1.00 155.61 ? 43  ILE A CB  1 
ATOM 39   C CG1 . ILE A 1 20  ? 19.576  40.221 32.973  1.00 155.61 ? 43  ILE A CG1 1 
ATOM 40   C CG2 . ILE A 1 20  ? 19.528  41.662 35.034  1.00 155.61 ? 43  ILE A CG2 1 
ATOM 41   C CD1 . ILE A 1 20  ? 19.016  41.321 32.083  1.00 155.61 ? 43  ILE A CD1 1 
ATOM 42   N N   . VAL A 1 21  ? 18.851  38.350 37.335  1.00 189.21 ? 44  VAL A N   1 
ATOM 43   C CA  . VAL A 1 21  ? 18.547  38.388 38.766  1.00 189.21 ? 44  VAL A CA  1 
ATOM 44   C C   . VAL A 1 21  ? 19.622  37.645 39.548  1.00 189.21 ? 44  VAL A C   1 
ATOM 45   O O   . VAL A 1 21  ? 20.077  38.111 40.593  1.00 189.21 ? 44  VAL A O   1 
ATOM 46   C CB  . VAL A 1 21  ? 17.188  37.733 39.081  1.00 182.67 ? 44  VAL A CB  1 
ATOM 47   C CG1 . VAL A 1 21  ? 16.884  37.854 40.572  1.00 182.67 ? 44  VAL A CG1 1 
ATOM 48   C CG2 . VAL A 1 21  ? 16.097  38.387 38.259  1.00 182.67 ? 44  VAL A CG2 1 
ATOM 49   N N   . LEU A 1 22  ? 20.016  36.481 39.041  1.00 186.39 ? 45  LEU A N   1 
ATOM 50   C CA  . LEU A 1 22  ? 21.049  35.679 39.682  1.00 186.39 ? 45  LEU A CA  1 
ATOM 51   C C   . LEU A 1 22  ? 22.325  36.507 39.695  1.00 186.39 ? 45  LEU A C   1 
ATOM 52   O O   . LEU A 1 22  ? 23.252  36.236 40.456  1.00 341.93 ? 45  LEU A O   1 
ATOM 53   C CB  . LEU A 1 22  ? 21.267  34.383 38.908  1.00 191.43 ? 45  LEU A CB  1 
ATOM 54   N N   . ALA A 1 23  ? 22.356  37.521 38.835  1.00 227.43 ? 46  ALA A N   1 
ATOM 55   C CA  . ALA A 1 23  ? 23.496  38.420 38.731  1.00 227.43 ? 46  ALA A CA  1 
ATOM 56   C C   . ALA A 1 23  ? 23.427  39.426 39.877  1.00 227.43 ? 46  ALA A C   1 
ATOM 57   O O   . ALA A 1 23  ? 24.451  39.923 40.347  1.00 227.43 ? 46  ALA A O   1 
ATOM 58   C CB  . ALA A 1 23  ? 23.472  39.145 37.383  1.00 114.17 ? 46  ALA A CB  1 
ATOM 59   N N   . ILE A 1 24  ? 22.207  39.716 40.321  1.00 186.03 ? 47  ILE A N   1 
ATOM 60   C CA  . ILE A 1 24  ? 21.979  40.650 41.419  1.00 186.03 ? 47  ILE A CA  1 
ATOM 61   C C   . ILE A 1 24  ? 21.825  39.865 42.722  1.00 186.03 ? 47  ILE A C   1 
ATOM 62   O O   . ILE A 1 24  ? 21.346  40.390 43.728  1.00 186.03 ? 47  ILE A O   1 
ATOM 63   C CB  . ILE A 1 24  ? 20.724  41.487 41.150  1.00 111.65 ? 47  ILE A CB  1 
ATOM 64   N N   . VAL A 1 25  ? 22.238  38.602 42.686  1.00 170.68 ? 48  VAL A N   1 
ATOM 65   C CA  . VAL A 1 25  ? 22.165  37.723 43.848  1.00 170.68 ? 48  VAL A CA  1 
ATOM 66   C C   . VAL A 1 25  ? 23.488  36.980 44.000  1.00 170.68 ? 48  VAL A C   1 
ATOM 67   O O   . VAL A 1 25  ? 23.711  36.279 44.986  1.00 302.91 ? 48  VAL A O   1 
ATOM 68   C CB  . VAL A 1 25  ? 21.033  36.687 43.696  1.00 158.05 ? 48  VAL A CB  1 
ATOM 69   C CG1 . VAL A 1 25  ? 20.901  35.865 44.971  1.00 158.05 ? 48  VAL A CG1 1 
ATOM 70   C CG2 . VAL A 1 25  ? 19.728  37.392 43.373  1.00 158.05 ? 48  VAL A CG2 1 
ATOM 71   N N   . PHE A 1 26  ? 24.362  37.141 43.011  1.00 246.23 ? 49  PHE A N   1 
ATOM 72   C CA  . PHE A 1 26  ? 25.668  36.493 43.020  1.00 246.23 ? 49  PHE A CA  1 
ATOM 73   C C   . PHE A 1 26  ? 26.780  37.516 43.221  1.00 246.23 ? 49  PHE A C   1 
ATOM 74   O O   . PHE A 1 26  ? 27.468  37.506 44.241  1.00 350.62 ? 49  PHE A O   1 
ATOM 75   C CB  . PHE A 1 26  ? 25.886  35.739 41.713  1.00 159.01 ? 49  PHE A CB  1 
ATOM 76   N N   . GLY A 1 27  ? 26.947  38.397 42.240  1.00 219.55 ? 50  GLY A N   1 
ATOM 77   C CA  . GLY A 1 27  ? 27.980  39.415 42.316  1.00 219.55 ? 50  GLY A CA  1 
ATOM 78   C C   . GLY A 1 27  ? 27.933  40.285 43.560  1.00 219.55 ? 50  GLY A C   1 
ATOM 79   O O   . GLY A 1 27  ? 28.947  40.866 43.947  1.00 219.55 ? 50  GLY A O   1 
ATOM 80   N N   . ASN A 1 28  ? 26.763  40.379 44.186  1.00 166.62 ? 51  ASN A N   1 
ATOM 81   C CA  . ASN A 1 28  ? 26.597  41.187 45.392  1.00 166.62 ? 51  ASN A CA  1 
ATOM 82   C C   . ASN A 1 28  ? 26.826  40.365 46.657  1.00 166.62 ? 51  ASN A C   1 
ATOM 83   O O   . ASN A 1 28  ? 26.896  40.912 47.756  1.00 166.62 ? 51  ASN A O   1 
ATOM 84   C CB  . ASN A 1 28  ? 25.197  41.805 45.423  1.00 230.79 ? 51  ASN A CB  1 
ATOM 85   C CG  . ASN A 1 28  ? 24.940  42.718 44.240  1.00 230.79 ? 51  ASN A CG  1 
ATOM 86   O OD1 . ASN A 1 28  ? 25.634  43.716 44.050  1.00 230.79 ? 51  ASN A OD1 1 
ATOM 87   N ND2 . ASN A 1 28  ? 23.939  42.379 43.438  1.00 230.79 ? 51  ASN A ND2 1 
ATOM 88   N N   . VAL A 1 29  ? 26.936  39.050 46.491  1.00 161.09 ? 52  VAL A N   1 
ATOM 89   C CA  . VAL A 1 29  ? 27.172  38.139 47.610  1.00 161.09 ? 52  VAL A CA  1 
ATOM 90   C C   . VAL A 1 29  ? 28.653  37.776 47.659  1.00 161.09 ? 52  VAL A C   1 
ATOM 91   O O   . VAL A 1 29  ? 29.241  37.654 48.732  1.00 260.48 ? 52  VAL A O   1 
ATOM 92   C CB  . VAL A 1 29  ? 26.356  36.838 47.466  1.00 242.15 ? 52  VAL A CB  1 
ATOM 93   C CG1 . VAL A 1 29  ? 26.654  35.910 48.630  1.00 242.15 ? 52  VAL A CG1 1 
ATOM 94   C CG2 . VAL A 1 29  ? 24.876  37.157 47.412  1.00 242.15 ? 52  VAL A CG2 1 
ATOM 95   N N   . LEU A 1 30  ? 29.246  37.592 46.483  1.00 223.99 ? 53  LEU A N   1 
ATOM 96   C CA  . LEU A 1 30  ? 30.661  37.263 46.386  1.00 223.99 ? 53  LEU A CA  1 
ATOM 97   C C   . LEU A 1 30  ? 31.430  38.453 46.944  1.00 223.99 ? 53  LEU A C   1 
ATOM 98   O O   . LEU A 1 30  ? 32.597  38.339 47.326  1.00 223.99 ? 53  LEU A O   1 
ATOM 99   C CB  . LEU A 1 30  ? 31.043  37.018 44.931  1.00 175.68 ? 53  LEU A CB  1 
ATOM 100  N N   . VAL A 1 31  ? 30.751  39.597 46.985  1.00 212.43 ? 54  VAL A N   1 
ATOM 101  C CA  . VAL A 1 31  ? 31.323  40.834 47.501  1.00 212.43 ? 54  VAL A CA  1 
ATOM 102  C C   . VAL A 1 31  ? 31.127  40.909 49.016  1.00 212.43 ? 54  VAL A C   1 
ATOM 103  O O   . VAL A 1 31  ? 32.075  41.186 49.753  1.00 212.43 ? 54  VAL A O   1 
ATOM 104  C CB  . VAL A 1 31  ? 30.665  42.082 46.842  1.00 140.97 ? 54  VAL A CB  1 
ATOM 105  C CG1 . VAL A 1 31  ? 31.126  43.348 47.547  1.00 140.97 ? 54  VAL A CG1 1 
ATOM 106  C CG2 . VAL A 1 31  ? 31.035  42.155 45.362  1.00 140.97 ? 54  VAL A CG2 1 
ATOM 107  N N   . ILE A 1 32  ? 29.901  40.657 49.474  1.00 146.71 ? 55  ILE A N   1 
ATOM 108  C CA  . ILE A 1 32  ? 29.593  40.699 50.904  1.00 146.71 ? 55  ILE A CA  1 
ATOM 109  C C   . ILE A 1 32  ? 30.467  39.719 51.682  1.00 146.71 ? 55  ILE A C   1 
ATOM 110  O O   . ILE A 1 32  ? 30.882  39.997 52.808  1.00 249.29 ? 55  ILE A O   1 
ATOM 111  C CB  . ILE A 1 32  ? 28.101  40.363 51.186  1.00 195.99 ? 55  ILE A CB  1 
ATOM 112  C CG1 . ILE A 1 32  ? 27.778  38.943 50.721  1.00 195.99 ? 55  ILE A CG1 1 
ATOM 113  C CG2 . ILE A 1 32  ? 27.199  41.374 50.497  1.00 195.99 ? 55  ILE A CG2 1 
ATOM 114  C CD1 . ILE A 1 32  ? 26.349  38.518 50.976  1.00 195.99 ? 55  ILE A CD1 1 
ATOM 115  N N   . THR A 1 33  ? 30.739  38.568 51.077  1.00 173.65 ? 56  THR A N   1 
ATOM 116  C CA  . THR A 1 33  ? 31.573  37.562 51.715  1.00 173.65 ? 56  THR A CA  1 
ATOM 117  C C   . THR A 1 33  ? 33.031  38.002 51.609  1.00 173.65 ? 56  THR A C   1 
ATOM 118  O O   . THR A 1 33  ? 33.800  37.875 52.564  1.00 173.65 ? 56  THR A O   1 
ATOM 119  C CB  . THR A 1 33  ? 31.393  36.180 51.043  1.00 221.60 ? 56  THR A CB  1 
ATOM 120  O OG1 . THR A 1 33  ? 32.220  35.214 51.704  1.00 221.60 ? 56  THR A OG1 1 
ATOM 121  C CG2 . THR A 1 33  ? 31.765  36.244 49.568  1.00 221.60 ? 56  THR A CG2 1 
ATOM 122  N N   . ALA A 1 34  ? 33.394  38.535 50.442  1.00 257.48 ? 57  ALA A N   1 
ATOM 123  C CA  . ALA A 1 34  ? 34.749  39.013 50.187  1.00 257.48 ? 57  ALA A CA  1 
ATOM 124  C C   . ALA A 1 34  ? 35.169  39.972 51.292  1.00 257.48 ? 57  ALA A C   1 
ATOM 125  O O   . ALA A 1 34  ? 36.312  39.950 51.744  1.00 257.48 ? 57  ALA A O   1 
ATOM 126  C CB  . ALA A 1 34  ? 34.813  39.714 48.835  1.00 175.07 ? 57  ALA A CB  1 
ATOM 127  N N   . ILE A 1 35  ? 34.237  40.819 51.715  1.00 170.07 ? 58  ILE A N   1 
ATOM 128  C CA  . ILE A 1 35  ? 34.499  41.774 52.783  1.00 170.07 ? 58  ILE A CA  1 
ATOM 129  C C   . ILE A 1 35  ? 34.294  41.102 54.142  1.00 170.07 ? 58  ILE A C   1 
ATOM 130  O O   . ILE A 1 35  ? 35.228  41.016 54.940  1.00 170.07 ? 58  ILE A O   1 
ATOM 131  C CB  . ILE A 1 35  ? 33.585  43.044 52.656  1.00 159.42 ? 58  ILE A CB  1 
ATOM 132  C CG1 . ILE A 1 35  ? 33.714  43.938 53.899  1.00 159.42 ? 58  ILE A CG1 1 
ATOM 133  C CG2 . ILE A 1 35  ? 32.141  42.636 52.433  1.00 159.42 ? 58  ILE A CG2 1 
ATOM 134  C CD1 . ILE A 1 35  ? 32.888  43.499 55.116  1.00 159.42 ? 58  ILE A CD1 1 
ATOM 135  N N   . ALA A 1 36  ? 33.081  40.615 54.397  1.00 179.00 ? 59  ALA A N   1 
ATOM 136  C CA  . ALA A 1 36  ? 32.769  39.960 55.665  1.00 179.00 ? 59  ALA A CA  1 
ATOM 137  C C   . ALA A 1 36  ? 33.665  38.750 55.914  1.00 179.00 ? 59  ALA A C   1 
ATOM 138  O O   . ALA A 1 36  ? 33.849  38.328 57.057  1.00 179.00 ? 59  ALA A O   1 
ATOM 139  C CB  . ALA A 1 36  ? 31.305  39.540 55.687  1.00 142.53 ? 59  ALA A CB  1 
ATOM 140  N N   . PHE A 1 38  ? 37.541  39.024 53.756  1.00 206.68 ? 61  PHE A N   1 
ATOM 141  C CA  . PHE A 1 38  ? 38.928  38.813 54.151  1.00 207.20 ? 61  PHE A CA  1 
ATOM 142  C C   . PHE A 1 38  ? 39.469  40.026 54.909  1.00 207.75 ? 61  PHE A C   1 
ATOM 143  O O   . PHE A 1 38  ? 39.081  41.165 54.646  1.00 207.81 ? 61  PHE A O   1 
ATOM 144  C CB  . PHE A 1 38  ? 39.795  38.537 52.918  1.00 178.44 ? 61  PHE A CB  1 
ATOM 145  C CG  . PHE A 1 38  ? 39.372  37.321 52.128  1.00 178.39 ? 61  PHE A CG  1 
ATOM 146  C CD1 . PHE A 1 38  ? 38.166  37.307 51.430  1.00 177.91 ? 61  PHE A CD1 1 
ATOM 147  C CD2 . PHE A 1 38  ? 40.195  36.197 52.062  1.00 178.50 ? 61  PHE A CD2 1 
ATOM 148  C CE1 . PHE A 1 38  ? 37.785  36.193 50.675  1.00 177.80 ? 61  PHE A CE1 1 
ATOM 149  C CE2 . PHE A 1 38  ? 39.824  35.078 51.310  1.00 177.57 ? 61  PHE A CE2 1 
ATOM 150  C CZ  . PHE A 1 38  ? 38.618  35.078 50.616  1.00 177.55 ? 61  PHE A CZ  1 
ATOM 151  N N   . GLU A 1 39  ? 40.368  39.760 55.850  1.00 255.11 ? 62  GLU A N   1 
ATOM 152  C CA  . GLU A 1 39  ? 40.983  40.792 56.678  1.00 255.81 ? 62  GLU A CA  1 
ATOM 153  C C   . GLU A 1 39  ? 41.377  42.051 55.901  1.00 255.75 ? 62  GLU A C   1 
ATOM 154  O O   . GLU A 1 39  ? 40.916  43.150 56.212  1.00 255.75 ? 62  GLU A O   1 
ATOM 155  C CB  . GLU A 1 39  ? 42.214  40.208 57.383  1.00 205.52 ? 62  GLU A CB  1 
ATOM 156  C CG  . GLU A 1 39  ? 42.918  41.139 58.370  1.00 206.32 ? 62  GLU A CG  1 
ATOM 157  C CD  . GLU A 1 39  ? 42.083  41.449 59.599  1.00 206.62 ? 62  GLU A CD  1 
ATOM 158  O OE1 . GLU A 1 39  ? 41.537  40.503 60.207  1.00 207.58 ? 62  GLU A OE1 1 
ATOM 159  O OE2 . GLU A 1 39  ? 41.983  42.640 59.964  1.00 208.03 ? 62  GLU A OE2 1 
ATOM 160  N N   . ARG A 1 40  ? 42.221  41.886 54.887  1.00 208.23 ? 63  ARG A N   1 
ATOM 161  C CA  . ARG A 1 40  ? 42.696  43.014 54.089  1.00 208.26 ? 63  ARG A CA  1 
ATOM 162  C C   . ARG A 1 40  ? 41.590  43.808 53.390  1.00 207.60 ? 63  ARG A C   1 
ATOM 163  O O   . ARG A 1 40  ? 41.741  45.010 53.158  1.00 207.64 ? 63  ARG A O   1 
ATOM 164  C CB  . ARG A 1 40  ? 43.710  42.526 53.048  1.00 199.85 ? 63  ARG A CB  1 
ATOM 165  C CG  . ARG A 1 40  ? 44.513  43.639 52.378  1.00 202.13 ? 63  ARG A CG  1 
ATOM 166  C CD  . ARG A 1 40  ? 45.476  44.314 53.356  1.00 205.63 ? 63  ARG A CD  1 
ATOM 167  N NE  . ARG A 1 40  ? 46.318  45.317 52.703  1.00 207.56 ? 63  ARG A NE  1 
ATOM 168  C CZ  . ARG A 1 40  ? 47.288  45.996 53.311  1.00 208.82 ? 63  ARG A CZ  1 
ATOM 169  N NH1 . ARG A 1 40  ? 47.548  45.786 54.594  1.00 209.16 ? 63  ARG A NH1 1 
ATOM 170  N NH2 . ARG A 1 40  ? 48.003  46.887 52.635  1.00 209.08 ? 63  ARG A NH2 1 
ATOM 171  N N   . LEU A 1 41  ? 40.484  43.147 53.057  1.00 134.60 ? 64  LEU A N   1 
ATOM 172  C CA  . LEU A 1 41  ? 39.375  43.817 52.379  1.00 133.68 ? 64  LEU A CA  1 
ATOM 173  C C   . LEU A 1 41  ? 38.458  44.604 53.314  1.00 133.23 ? 64  LEU A C   1 
ATOM 174  O O   . LEU A 1 41  ? 37.443  45.152 52.880  1.00 133.34 ? 64  LEU A O   1 
ATOM 175  C CB  . LEU A 1 41  ? 38.543  42.799 51.593  1.00 153.78 ? 64  LEU A CB  1 
ATOM 176  C CG  . LEU A 1 41  ? 39.146  42.257 50.293  1.00 153.57 ? 64  LEU A CG  1 
ATOM 177  C CD1 . LEU A 1 41  ? 38.198  41.234 49.677  1.00 153.00 ? 64  LEU A CD1 1 
ATOM 178  C CD2 . LEU A 1 41  ? 39.390  43.404 49.321  1.00 153.30 ? 64  LEU A CD2 1 
ATOM 179  N N   . GLN A 1 42  ? 38.824  44.669 54.590  1.00 166.94 ? 65  GLN A N   1 
ATOM 180  C CA  . GLN A 1 42  ? 38.032  45.385 55.589  1.00 166.40 ? 65  GLN A CA  1 
ATOM 181  C C   . GLN A 1 42  ? 38.506  46.822 55.808  1.00 165.44 ? 65  GLN A C   1 
ATOM 182  O O   . GLN A 1 42  ? 39.475  47.063 56.531  1.00 165.63 ? 65  GLN A O   1 
ATOM 183  C CB  . GLN A 1 42  ? 38.073  44.627 56.913  1.00 220.89 ? 65  GLN A CB  1 
ATOM 184  C CG  . GLN A 1 42  ? 37.411  43.265 56.861  1.00 221.21 ? 65  GLN A CG  1 
ATOM 185  C CD  . GLN A 1 42  ? 37.689  42.442 58.099  1.00 221.84 ? 65  GLN A CD  1 
ATOM 186  O OE1 . GLN A 1 42  ? 37.673  42.959 59.218  1.00 223.50 ? 65  GLN A OE1 1 
ATOM 187  N NE2 . GLN A 1 42  ? 37.942  41.149 57.909  1.00 223.00 ? 65  GLN A NE2 1 
ATOM 188  N N   . THR A 1 43  ? 37.806  47.769 55.183  1.00 195.36 ? 66  THR A N   1 
ATOM 189  C CA  . THR A 1 43  ? 38.128  49.194 55.287  1.00 194.01 ? 66  THR A CA  1 
ATOM 190  C C   . THR A 1 43  ? 36.877  50.066 55.120  1.00 193.10 ? 66  THR A C   1 
ATOM 191  O O   . THR A 1 43  ? 35.853  49.601 54.619  1.00 193.07 ? 66  THR A O   1 
ATOM 192  C CB  . THR A 1 43  ? 39.163  49.609 54.216  1.00 199.83 ? 66  THR A CB  1 
ATOM 193  O OG1 . THR A 1 43  ? 38.686  49.234 52.917  1.00 199.96 ? 66  THR A OG1 1 
ATOM 194  C CG2 . THR A 1 43  ? 40.502  48.931 54.472  1.00 199.31 ? 66  THR A CG2 1 
ATOM 195  N N   . VAL A 1 44  ? 36.967  51.328 55.536  1.00 200.16 ? 67  VAL A N   1 
ATOM 196  C CA  . VAL A 1 44  ? 35.841  52.257 55.429  1.00 200.16 ? 67  VAL A CA  1 
ATOM 197  C C   . VAL A 1 44  ? 35.301  52.347 54.004  1.00 200.16 ? 67  VAL A C   1 
ATOM 198  O O   . VAL A 1 44  ? 34.088  52.382 53.799  1.00 200.16 ? 67  VAL A O   1 
ATOM 199  C CB  . VAL A 1 44  ? 36.230  53.684 55.920  1.00 112.19 ? 67  VAL A CB  1 
ATOM 200  C CG1 . VAL A 1 44  ? 35.221  54.717 55.420  1.00 112.19 ? 67  VAL A CG1 1 
ATOM 201  C CG2 . VAL A 1 44  ? 36.275  53.709 57.440  1.00 112.19 ? 67  VAL A CG2 1 
ATOM 202  N N   . THR A 1 45  ? 36.197  52.385 53.022  1.00 188.27 ? 68  THR A N   1 
ATOM 203  C CA  . THR A 1 45  ? 35.788  52.466 51.619  1.00 188.27 ? 68  THR A CA  1 
ATOM 204  C C   . THR A 1 45  ? 35.004  51.225 51.203  1.00 188.27 ? 68  THR A C   1 
ATOM 205  O O   . THR A 1 45  ? 33.898  51.324 50.667  1.00 188.27 ? 68  THR A O   1 
ATOM 206  C CB  . THR A 1 45  ? 37.006  52.594 50.675  1.00 238.00 ? 68  THR A CB  1 
ATOM 207  O OG1 . THR A 1 45  ? 37.740  53.781 50.996  1.00 238.00 ? 68  THR A OG1 1 
ATOM 208  C CG2 . THR A 1 45  ? 36.551  52.663 49.217  1.00 238.00 ? 68  THR A CG2 1 
ATOM 209  N N   . ASN A 1 46  ? 35.587  50.056 51.453  1.00 257.70 ? 69  ASN A N   1 
ATOM 210  C CA  . ASN A 1 46  ? 34.955  48.791 51.101  1.00 257.70 ? 69  ASN A CA  1 
ATOM 211  C C   . ASN A 1 46  ? 33.921  48.378 52.145  1.00 257.70 ? 69  ASN A C   1 
ATOM 212  O O   . ASN A 1 46  ? 33.506  47.220 52.207  1.00 257.70 ? 69  ASN A O   1 
ATOM 213  C CB  . ASN A 1 46  ? 36.024  47.708 50.938  1.00 132.85 ? 69  ASN A CB  1 
ATOM 214  C CG  . ASN A 1 46  ? 37.077  48.080 49.896  1.00 132.85 ? 69  ASN A CG  1 
ATOM 215  O OD1 . ASN A 1 46  ? 36.754  48.341 48.733  1.00 132.85 ? 69  ASN A OD1 1 
ATOM 216  N ND2 . ASN A 1 46  ? 38.343  48.107 50.314  1.00 132.85 ? 69  ASN A ND2 1 
ATOM 217  N N   . TYR A 1 47  ? 33.512  49.346 52.959  1.00 153.33 ? 70  TYR A N   1 
ATOM 218  C CA  . TYR A 1 47  ? 32.516  49.133 54.002  1.00 153.33 ? 70  TYR A CA  1 
ATOM 219  C C   . TYR A 1 47  ? 31.222  49.785 53.532  1.00 153.33 ? 70  TYR A C   1 
ATOM 220  O O   . TYR A 1 47  ? 30.131  49.424 53.972  1.00 153.33 ? 70  TYR A O   1 
ATOM 221  C CB  . TYR A 1 47  ? 32.970  49.786 55.307  1.00 203.45 ? 70  TYR A CB  1 
ATOM 222  C CG  . TYR A 1 47  ? 32.828  48.898 56.516  1.00 203.45 ? 70  TYR A CG  1 
ATOM 223  C CD1 . TYR A 1 47  ? 33.597  47.740 56.647  1.00 203.45 ? 70  TYR A CD1 1 
ATOM 224  C CD2 . TYR A 1 47  ? 31.933  49.214 57.536  1.00 203.45 ? 70  TYR A CD2 1 
ATOM 225  C CE1 . TYR A 1 47  ? 33.480  46.917 57.767  1.00 203.45 ? 70  TYR A CE1 1 
ATOM 226  C CE2 . TYR A 1 47  ? 31.807  48.398 58.663  1.00 203.45 ? 70  TYR A CE2 1 
ATOM 227  C CZ  . TYR A 1 47  ? 32.584  47.253 58.771  1.00 203.45 ? 70  TYR A CZ  1 
ATOM 228  O OH  . TYR A 1 47  ? 32.470  46.447 59.881  1.00 203.45 ? 70  TYR A OH  1 
ATOM 229  N N   . PHE A 1 48  ? 31.367  50.764 52.641  1.00 167.84 ? 71  PHE A N   1 
ATOM 230  C CA  . PHE A 1 48  ? 30.232  51.485 52.073  1.00 167.84 ? 71  PHE A CA  1 
ATOM 231  C C   . PHE A 1 48  ? 29.947  50.906 50.694  1.00 167.84 ? 71  PHE A C   1 
ATOM 232  O O   . PHE A 1 48  ? 28.829  51.006 50.188  1.00 167.84 ? 71  PHE A O   1 
ATOM 233  C CB  . PHE A 1 48  ? 30.541  52.981 51.937  1.00 164.79 ? 71  PHE A CB  1 
ATOM 234  C CG  . PHE A 1 48  ? 30.783  53.685 53.246  1.00 164.79 ? 71  PHE A CG  1 
ATOM 235  C CD1 . PHE A 1 48  ? 31.099  55.041 53.270  1.00 164.79 ? 71  PHE A CD1 1 
ATOM 236  C CD2 . PHE A 1 48  ? 30.711  52.995 54.455  1.00 164.79 ? 71  PHE A CD2 1 
ATOM 237  C CE1 . PHE A 1 48  ? 31.342  55.699 54.475  1.00 164.79 ? 71  PHE A CE1 1 
ATOM 238  C CE2 . PHE A 1 48  ? 30.951  53.645 55.666  1.00 164.79 ? 71  PHE A CE2 1 
ATOM 239  C CZ  . PHE A 1 48  ? 31.268  55.000 55.675  1.00 164.79 ? 71  PHE A CZ  1 
ATOM 240  N N   . ILE A 1 49  ? 30.970  50.316 50.081  1.00 224.38 ? 72  ILE A N   1 
ATOM 241  C CA  . ILE A 1 49  ? 30.805  49.705 48.769  1.00 224.38 ? 72  ILE A CA  1 
ATOM 242  C C   . ILE A 1 49  ? 30.133  48.362 49.027  1.00 224.38 ? 72  ILE A C   1 
ATOM 243  O O   . ILE A 1 49  ? 29.427  47.826 48.170  1.00 224.38 ? 72  ILE A O   1 
ATOM 244  C CB  . ILE A 1 49  ? 32.169  49.483 48.049  1.00 101.59 ? 72  ILE A CB  1 
ATOM 245  C CG1 . ILE A 1 49  ? 31.928  49.142 46.569  1.00 101.59 ? 72  ILE A CG1 1 
ATOM 246  C CG2 . ILE A 1 49  ? 32.936  48.328 48.691  1.00 101.59 ? 72  ILE A CG2 1 
ATOM 247  C CD1 . ILE A 1 49  ? 32.596  50.103 45.586  1.00 101.59 ? 72  ILE A CD1 1 
ATOM 248  N N   . THR A 1 50  ? 30.361  47.836 50.229  1.00 195.80 ? 73  THR A N   1 
ATOM 249  C CA  . THR A 1 50  ? 29.782  46.566 50.655  1.00 195.80 ? 73  THR A CA  1 
ATOM 250  C C   . THR A 1 50  ? 28.357  46.851 51.114  1.00 195.80 ? 73  THR A C   1 
ATOM 251  O O   . THR A 1 50  ? 27.567  45.939 51.357  1.00 348.47 ? 73  THR A O   1 
ATOM 252  C CB  . THR A 1 50  ? 30.604  45.968 51.798  1.00 138.23 ? 73  THR A CB  1 
ATOM 253  N N   . SER A 1 51  ? 28.049  48.137 51.231  1.00 181.99 ? 74  SER A N   1 
ATOM 254  C CA  . SER A 1 51  ? 26.730  48.593 51.636  1.00 181.99 ? 74  SER A CA  1 
ATOM 255  C C   . SER A 1 51  ? 25.806  48.516 50.430  1.00 181.99 ? 74  SER A C   1 
ATOM 256  O O   . SER A 1 51  ? 24.667  48.064 50.532  1.00 181.99 ? 74  SER A O   1 
ATOM 257  C CB  . SER A 1 51  ? 26.807  50.035 52.135  1.00 141.62 ? 74  SER A CB  1 
ATOM 258  O OG  . SER A 1 51  ? 25.516  50.607 52.249  1.00 141.62 ? 74  SER A OG  1 
ATOM 259  N N   . LEU A 1 52  ? 26.312  48.964 49.285  1.00 139.33 ? 75  LEU A N   1 
ATOM 260  C CA  . LEU A 1 52  ? 25.553  48.944 48.042  1.00 139.33 ? 75  LEU A CA  1 
ATOM 261  C C   . LEU A 1 52  ? 25.356  47.511 47.556  1.00 139.33 ? 75  LEU A C   1 
ATOM 262  O O   . LEU A 1 52  ? 24.861  47.282 46.454  1.00 139.33 ? 75  LEU A O   1 
ATOM 263  C CB  . LEU A 1 52  ? 26.281  49.759 46.974  1.00 156.51 ? 75  LEU A CB  1 
ATOM 264  C CG  . LEU A 1 52  ? 26.179  51.282 47.080  1.00 156.51 ? 75  LEU A CG  1 
ATOM 265  C CD1 . LEU A 1 52  ? 26.470  51.745 48.495  1.00 156.51 ? 75  LEU A CD1 1 
ATOM 266  C CD2 . LEU A 1 52  ? 27.149  51.910 46.094  1.00 156.51 ? 75  LEU A CD2 1 
ATOM 267  N N   . ALA A 1 53  ? 25.755  46.552 48.385  1.00 317.57 ? 76  ALA A N   1 
ATOM 268  C CA  . ALA A 1 53  ? 25.609  45.139 48.054  1.00 317.57 ? 76  ALA A CA  1 
ATOM 269  C C   . ALA A 1 53  ? 24.255  44.675 48.570  1.00 317.57 ? 76  ALA A C   1 
ATOM 270  O O   . ALA A 1 53  ? 23.557  43.897 47.918  1.00 317.57 ? 76  ALA A O   1 
ATOM 271  C CB  . ALA A 1 53  ? 26.723  44.330 48.702  1.00 146.74 ? 76  ALA A CB  1 
ATOM 272  N N   . CYS A 1 54  ? 23.896  45.164 49.752  1.00 258.67 ? 77  CYS A N   1 
ATOM 273  C CA  . CYS A 1 54  ? 22.623  44.829 50.375  1.00 258.67 ? 77  CYS A CA  1 
ATOM 274  C C   . CYS A 1 54  ? 21.545  45.685 49.717  1.00 258.67 ? 77  CYS A C   1 
ATOM 275  O O   . CYS A 1 54  ? 20.351  45.421 49.855  1.00 258.67 ? 77  CYS A O   1 
ATOM 276  C CB  . CYS A 1 54  ? 22.685  45.115 51.879  1.00 187.69 ? 77  CYS A CB  1 
ATOM 277  S SG  . CYS A 1 54  ? 24.076  44.314 52.739  1.00 187.69 ? 77  CYS A SG  1 
ATOM 278  N N   . ALA A 1 55  ? 21.989  46.717 49.002  1.00 161.57 ? 78  ALA A N   1 
ATOM 279  C CA  . ALA A 1 55  ? 21.096  47.630 48.293  1.00 161.57 ? 78  ALA A CA  1 
ATOM 280  C C   . ALA A 1 55  ? 21.097  47.254 46.814  1.00 161.57 ? 78  ALA A C   1 
ATOM 281  O O   . ALA A 1 55  ? 20.940  48.104 45.931  1.00 161.57 ? 78  ALA A O   1 
ATOM 282  C CB  . ALA A 1 55  ? 21.566  49.071 48.470  1.00 143.09 ? 78  ALA A CB  1 
ATOM 283  N N   . ASP A 1 56  ? 21.285  45.963 46.563  1.00 185.21 ? 79  ASP A N   1 
ATOM 284  C CA  . ASP A 1 56  ? 21.315  45.425 45.213  1.00 185.21 ? 79  ASP A CA  1 
ATOM 285  C C   . ASP A 1 56  ? 20.889  43.961 45.288  1.00 185.21 ? 79  ASP A C   1 
ATOM 286  O O   . ASP A 1 56  ? 20.270  43.431 44.364  1.00 185.21 ? 79  ASP A O   1 
ATOM 287  C CB  . ASP A 1 56  ? 22.728  45.537 44.642  1.00 208.95 ? 79  ASP A CB  1 
ATOM 288  C CG  . ASP A 1 56  ? 22.735  45.659 43.137  1.00 208.95 ? 79  ASP A CG  1 
ATOM 289  O OD1 . ASP A 1 56  ? 22.179  46.653 42.623  1.00 208.95 ? 79  ASP A OD1 1 
ATOM 290  O OD2 . ASP A 1 56  ? 23.295  44.765 42.470  1.00 208.95 ? 79  ASP A OD2 1 
ATOM 291  N N   . LEU A 1 57  ? 21.232  43.316 46.400  1.00 249.15 ? 80  LEU A N   1 
ATOM 292  C CA  . LEU A 1 57  ? 20.874  41.922 46.633  1.00 249.15 ? 80  LEU A CA  1 
ATOM 293  C C   . LEU A 1 57  ? 19.452  41.881 47.183  1.00 249.15 ? 80  LEU A C   1 
ATOM 294  O O   . LEU A 1 57  ? 18.628  41.075 46.747  1.00 249.15 ? 80  LEU A O   1 
ATOM 295  C CB  . LEU A 1 57  ? 21.846  41.283 47.632  1.00 170.81 ? 80  LEU A CB  1 
ATOM 296  C CG  . LEU A 1 57  ? 21.490  39.908 48.217  1.00 170.81 ? 80  LEU A CG  1 
ATOM 297  C CD1 . LEU A 1 57  ? 22.753  39.229 48.711  1.00 170.81 ? 80  LEU A CD1 1 
ATOM 298  C CD2 . LEU A 1 57  ? 20.483  40.055 49.356  1.00 170.81 ? 80  LEU A CD2 1 
ATOM 299  N N   . VAL A 1 58  ? 19.175  42.754 48.147  1.00 271.35 ? 81  VAL A N   1 
ATOM 300  C CA  . VAL A 1 58  ? 17.849  42.833 48.745  1.00 271.35 ? 81  VAL A CA  1 
ATOM 301  C C   . VAL A 1 58  ? 16.884  43.368 47.692  1.00 271.35 ? 81  VAL A C   1 
ATOM 302  O O   . VAL A 1 58  ? 15.716  42.985 47.657  1.00 271.35 ? 81  VAL A O   1 
ATOM 303  C CB  . VAL A 1 58  ? 17.843  43.766 49.976  1.00 167.78 ? 81  VAL A CB  1 
ATOM 304  C CG1 . VAL A 1 58  ? 16.436  43.874 50.544  1.00 167.78 ? 81  VAL A CG1 1 
ATOM 305  C CG2 . VAL A 1 58  ? 18.798  43.232 51.034  1.00 167.78 ? 81  VAL A CG2 1 
ATOM 306  N N   . MET A 1 59  ? 17.385  44.252 46.833  1.00 139.31 ? 82  MET A N   1 
ATOM 307  C CA  . MET A 1 59  ? 16.577  44.825 45.762  1.00 139.31 ? 82  MET A CA  1 
ATOM 308  C C   . MET A 1 59  ? 16.663  43.907 44.542  1.00 139.31 ? 82  MET A C   1 
ATOM 309  O O   . MET A 1 59  ? 16.590  44.361 43.397  1.00 139.31 ? 82  MET A O   1 
ATOM 310  C CB  . MET A 1 59  ? 17.085  46.221 45.390  1.00 178.95 ? 82  MET A CB  1 
ATOM 311  C CG  . MET A 1 59  ? 16.155  46.973 44.445  1.00 178.95 ? 82  MET A CG  1 
ATOM 312  S SD  . MET A 1 59  ? 16.863  48.470 43.727  1.00 178.95 ? 82  MET A SD  1 
ATOM 313  C CE  . MET A 1 59  ? 17.213  47.900 42.055  1.00 178.95 ? 82  MET A CE  1 
ATOM 314  N N   . GLY A 1 60  ? 16.829  42.613 44.804  1.00 235.91 ? 83  GLY A N   1 
ATOM 315  C CA  . GLY A 1 60  ? 16.927  41.627 43.741  1.00 235.91 ? 83  GLY A CA  1 
ATOM 316  C C   . GLY A 1 60  ? 16.324  40.305 44.175  1.00 235.91 ? 83  GLY A C   1 
ATOM 317  O O   . GLY A 1 60  ? 15.915  39.488 43.348  1.00 235.91 ? 83  GLY A O   1 
ATOM 318  N N   . LEU A 1 61  ? 16.283  40.096 45.488  1.00 200.43 ? 84  LEU A N   1 
ATOM 319  C CA  . LEU A 1 61  ? 15.715  38.888 46.073  1.00 200.43 ? 84  LEU A CA  1 
ATOM 320  C C   . LEU A 1 61  ? 14.497  39.296 46.886  1.00 200.43 ? 84  LEU A C   1 
ATOM 321  O O   . LEU A 1 61  ? 13.994  38.528 47.706  1.00 350.62 ? 84  LEU A O   1 
ATOM 322  C CB  . LEU A 1 61  ? 16.734  38.197 46.983  1.00 205.46 ? 84  LEU A CB  1 
ATOM 323  C CG  . LEU A 1 61  ? 17.893  37.463 46.305  1.00 205.46 ? 84  LEU A CG  1 
ATOM 324  C CD1 . LEU A 1 61  ? 18.867  36.966 47.359  1.00 205.46 ? 84  LEU A CD1 1 
ATOM 325  C CD2 . LEU A 1 61  ? 17.353  36.302 45.481  1.00 205.46 ? 84  LEU A CD2 1 
ATOM 326  N N   . ALA A 1 62  ? 14.032  40.520 46.650  1.00 218.47 ? 85  ALA A N   1 
ATOM 327  C CA  . ALA A 1 62  ? 12.871  41.054 47.349  1.00 218.47 ? 85  ALA A CA  1 
ATOM 328  C C   . ALA A 1 62  ? 12.123  42.084 46.502  1.00 218.47 ? 85  ALA A C   1 
ATOM 329  O O   . ALA A 1 62  ? 10.948  42.356 46.746  1.00 218.47 ? 85  ALA A O   1 
ATOM 330  C CB  . ALA A 1 62  ? 13.302  41.675 48.676  1.00 121.65 ? 85  ALA A CB  1 
ATOM 331  N N   . VAL A 1 63  ? 12.802  42.654 45.508  1.00 192.33 ? 86  VAL A N   1 
ATOM 332  C CA  . VAL A 1 63  ? 12.183  43.652 44.630  1.00 192.33 ? 86  VAL A CA  1 
ATOM 333  C C   . VAL A 1 63  ? 12.084  43.161 43.187  1.00 192.33 ? 86  VAL A C   1 
ATOM 334  O O   . VAL A 1 63  ? 11.040  43.293 42.548  1.00 293.08 ? 86  VAL A O   1 
ATOM 335  C CB  . VAL A 1 63  ? 12.972  44.984 44.640  1.00 208.67 ? 86  VAL A CB  1 
ATOM 336  C CG1 . VAL A 1 63  ? 12.340  45.974 43.667  1.00 208.67 ? 86  VAL A CG1 1 
ATOM 337  C CG2 . VAL A 1 63  ? 12.991  45.565 46.045  1.00 208.67 ? 86  VAL A CG2 1 
ATOM 338  N N   . VAL A 1 64  ? 13.176  42.599 42.680  1.00 224.72 ? 87  VAL A N   1 
ATOM 339  C CA  . VAL A 1 64  ? 13.212  42.082 41.317  1.00 224.72 ? 87  VAL A CA  1 
ATOM 340  C C   . VAL A 1 64  ? 12.308  40.856 41.146  1.00 224.72 ? 87  VAL A C   1 
ATOM 341  O O   . VAL A 1 64  ? 11.624  40.721 40.128  1.00 224.72 ? 87  VAL A O   1 
ATOM 342  C CB  . VAL A 1 64  ? 14.654  41.706 40.901  1.00 204.68 ? 87  VAL A CB  1 
ATOM 343  C CG1 . VAL A 1 64  ? 14.664  41.189 39.473  1.00 204.68 ? 87  VAL A CG1 1 
ATOM 344  C CG2 . VAL A 1 64  ? 15.564  42.919 41.023  1.00 204.68 ? 87  VAL A CG2 1 
ATOM 345  N N   . PRO A 1 65  ? 12.293  39.945 42.137  1.00 304.63 ? 88  PRO A N   1 
ATOM 346  C CA  . PRO A 1 65  ? 11.443  38.755 42.023  1.00 304.63 ? 88  PRO A CA  1 
ATOM 347  C C   . PRO A 1 65  ? 9.968   39.119 41.888  1.00 304.63 ? 88  PRO A C   1 
ATOM 348  O O   . PRO A 1 65  ? 9.347   38.846 40.860  1.00 304.63 ? 88  PRO A O   1 
ATOM 349  C CB  . PRO A 1 65  ? 11.744  37.991 43.312  1.00 182.67 ? 88  PRO A CB  1 
ATOM 350  C CG  . PRO A 1 65  ? 12.078  39.084 44.279  1.00 182.67 ? 88  PRO A CG  1 
ATOM 351  C CD  . PRO A 1 65  ? 12.970  39.971 43.446  1.00 182.67 ? 88  PRO A CD  1 
ATOM 352  N N   . PHE A 1 66  ? 9.415   39.741 42.927  1.00 253.80 ? 89  PHE A N   1 
ATOM 353  C CA  . PHE A 1 66  ? 8.015   40.150 42.918  1.00 253.80 ? 89  PHE A CA  1 
ATOM 354  C C   . PHE A 1 66  ? 7.753   41.126 41.776  1.00 253.80 ? 89  PHE A C   1 
ATOM 355  O O   . PHE A 1 66  ? 6.611   41.509 41.527  1.00 253.80 ? 89  PHE A O   1 
ATOM 356  C CB  . PHE A 1 66  ? 7.635   40.810 44.250  1.00 175.15 ? 89  PHE A CB  1 
ATOM 357  C CG  . PHE A 1 66  ? 7.672   39.873 45.429  1.00 175.15 ? 89  PHE A CG  1 
ATOM 358  C CD1 . PHE A 1 66  ? 6.915   38.703 45.432  1.00 175.15 ? 89  PHE A CD1 1 
ATOM 359  C CD2 . PHE A 1 66  ? 8.459   40.161 46.540  1.00 175.15 ? 89  PHE A CD2 1 
ATOM 360  C CE1 . PHE A 1 66  ? 6.942   37.831 46.526  1.00 175.15 ? 89  PHE A CE1 1 
ATOM 361  C CE2 . PHE A 1 66  ? 8.492   39.296 47.639  1.00 175.15 ? 89  PHE A CE2 1 
ATOM 362  C CZ  . PHE A 1 66  ? 7.732   38.130 47.630  1.00 175.15 ? 89  PHE A CZ  1 
ATOM 363  N N   . GLY A 1 67  ? 8.818   41.523 41.087  1.00 154.20 ? 90  GLY A N   1 
ATOM 364  C CA  . GLY A 1 67  ? 8.682   42.449 39.977  1.00 154.20 ? 90  GLY A CA  1 
ATOM 365  C C   . GLY A 1 67  ? 9.445   41.999 38.745  1.00 154.20 ? 90  GLY A C   1 
ATOM 366  O O   . GLY A 1 67  ? 9.761   42.806 37.871  1.00 154.20 ? 90  GLY A O   1 
ATOM 367  N N   . PHE A 1 85  ? 4.412   46.999 50.292  1.00 244.02 ? 108 PHE A N   1 
ATOM 368  C CA  . PHE A 1 85  ? 5.690   46.653 50.899  1.00 242.67 ? 108 PHE A CA  1 
ATOM 369  C C   . PHE A 1 85  ? 6.730   46.434 49.802  1.00 241.53 ? 108 PHE A C   1 
ATOM 370  O O   . PHE A 1 85  ? 7.932   46.525 50.047  1.00 241.39 ? 108 PHE A O   1 
ATOM 371  C CB  . PHE A 1 85  ? 5.541   45.380 51.745  1.00 177.50 ? 108 PHE A CB  1 
ATOM 372  C CG  . PHE A 1 85  ? 6.525   45.276 52.882  1.00 177.80 ? 108 PHE A CG  1 
ATOM 373  C CD1 . PHE A 1 85  ? 6.532   46.223 53.902  1.00 178.29 ? 108 PHE A CD1 1 
ATOM 374  C CD2 . PHE A 1 85  ? 7.427   44.216 52.947  1.00 177.77 ? 108 PHE A CD2 1 
ATOM 375  C CE1 . PHE A 1 85  ? 7.423   46.115 54.974  1.00 178.17 ? 108 PHE A CE1 1 
ATOM 376  C CE2 . PHE A 1 85  ? 8.322   44.098 54.014  1.00 177.78 ? 108 PHE A CE2 1 
ATOM 377  C CZ  . PHE A 1 85  ? 8.318   45.052 55.030  1.00 178.10 ? 108 PHE A CZ  1 
ATOM 378  N N   . TRP A 1 86  ? 6.257   46.151 48.591  1.00 229.59 ? 109 TRP A N   1 
ATOM 379  C CA  . TRP A 1 86  ? 7.134   45.916 47.446  1.00 228.28 ? 109 TRP A CA  1 
ATOM 380  C C   . TRP A 1 86  ? 7.630   47.224 46.842  1.00 227.59 ? 109 TRP A C   1 
ATOM 381  O O   . TRP A 1 86  ? 8.621   47.239 46.109  1.00 227.44 ? 109 TRP A O   1 
ATOM 382  C CB  . TRP A 1 86  ? 6.403   45.094 46.388  1.00 176.07 ? 109 TRP A CB  1 
ATOM 383  N N   . THR A 1 87  ? 6.925   48.314 47.138  1.00 267.13 ? 110 THR A N   1 
ATOM 384  C CA  . THR A 1 87  ? 7.309   49.637 46.656  1.00 266.33 ? 110 THR A CA  1 
ATOM 385  C C   . THR A 1 87  ? 7.894   50.413 47.839  1.00 265.98 ? 110 THR A C   1 
ATOM 386  O O   . THR A 1 87  ? 8.303   51.558 47.704  1.00 266.32 ? 110 THR A O   1 
ATOM 387  C CB  . THR A 1 87  ? 6.101   50.413 46.071  1.00 165.14 ? 110 THR A CB  1 
ATOM 388  O OG1 . THR A 1 87  ? 5.610   49.729 44.912  1.00 165.03 ? 110 THR A OG1 1 
ATOM 389  C CG2 . THR A 1 87  ? 6.508   51.820 45.669  1.00 164.82 ? 110 THR A CG2 1 
ATOM 390  N N   . SER A 1 88  ? 7.937   49.758 48.995  1.00 224.02 ? 111 SER A N   1 
ATOM 391  C CA  . SER A 1 88  ? 8.484   50.352 50.200  1.00 223.55 ? 111 SER A CA  1 
ATOM 392  C C   . SER A 1 88  ? 10.003  50.189 50.187  1.00 223.11 ? 111 SER A C   1 
ATOM 393  O O   . SER A 1 88  ? 10.750  51.152 50.381  1.00 223.14 ? 111 SER A O   1 
ATOM 394  C CB  . SER A 1 88  ? 7.907   49.660 51.430  1.00 190.59 ? 111 SER A CB  1 
ATOM 395  O OG  . SER A 1 88  ? 6.468   49.690 51.409  1.00 191.07 ? 111 SER A OG  1 
ATOM 396  N N   . ILE A 1 89  ? 10.444  48.957 49.948  1.00 282.27 ? 112 ILE A N   1 
ATOM 397  C CA  . ILE A 1 89  ? 11.857  48.598 49.877  1.00 281.86 ? 112 ILE A CA  1 
ATOM 398  C C   . ILE A 1 89  ? 12.428  49.007 48.518  1.00 281.29 ? 112 ILE A C   1 
ATOM 399  O O   . ILE A 1 89  ? 13.621  48.879 48.277  1.00 281.10 ? 112 ILE A O   1 
ATOM 400  C CB  . ILE A 1 89  ? 12.017  47.094 50.060  1.00 187.38 ? 112 ILE A CB  1 
ATOM 401  N N   . ASP A 1 90  ? 11.581  49.493 47.622  1.00 218.17 ? 113 ASP A N   1 
ATOM 402  C CA  . ASP A 1 90  ? 12.053  49.913 46.314  1.00 217.52 ? 113 ASP A CA  1 
ATOM 403  C C   . ASP A 1 90  ? 12.651  51.310 46.427  1.00 217.03 ? 113 ASP A C   1 
ATOM 404  O O   . ASP A 1 90  ? 13.495  51.709 45.624  1.00 216.84 ? 113 ASP A O   1 
ATOM 405  C CB  . ASP A 1 90  ? 10.900  49.897 45.308  1.00 179.66 ? 113 ASP A CB  1 
ATOM 406  C CG  . ASP A 1 90  ? 11.308  50.427 43.931  1.00 180.08 ? 113 ASP A CG  1 
ATOM 407  O OD1 . ASP A 1 90  ? 11.086  49.729 42.927  1.00 180.41 ? 113 ASP A OD1 1 
ATOM 408  O OD2 . ASP A 1 90  ? 11.835  51.555 43.848  1.00 180.18 ? 113 ASP A OD2 1 
ATOM 409  N N   . VAL A 1 91  ? 12.206  52.051 47.433  1.00 222.75 ? 114 VAL A N   1 
ATOM 410  C CA  . VAL A 1 91  ? 12.702  53.400 47.661  1.00 222.31 ? 114 VAL A CA  1 
ATOM 411  C C   . VAL A 1 91  ? 13.834  53.363 48.688  1.00 222.05 ? 114 VAL A C   1 
ATOM 412  O O   . VAL A 1 91  ? 14.874  53.992 48.507  1.00 221.99 ? 114 VAL A O   1 
ATOM 413  C CB  . VAL A 1 91  ? 11.561  54.312 48.156  1.00 192.38 ? 114 VAL A CB  1 
ATOM 414  C CG1 . VAL A 1 91  ? 12.084  55.703 48.429  1.00 192.24 ? 114 VAL A CG1 1 
ATOM 415  C CG2 . VAL A 1 91  ? 10.448  54.351 47.117  1.00 192.40 ? 114 VAL A CG2 1 
ATOM 416  N N   . LEU A 1 92  ? 13.624  52.604 49.759  1.00 204.60 ? 115 LEU A N   1 
ATOM 417  C CA  . LEU A 1 92  ? 14.625  52.470 50.812  1.00 204.17 ? 115 LEU A CA  1 
ATOM 418  C C   . LEU A 1 92  ? 15.917  51.907 50.226  1.00 203.87 ? 115 LEU A C   1 
ATOM 419  O O   . LEU A 1 92  ? 16.966  51.968 50.863  1.00 203.58 ? 115 LEU A O   1 
ATOM 420  C CB  . LEU A 1 92  ? 14.133  51.528 51.913  1.00 156.15 ? 115 LEU A CB  1 
ATOM 421  C CG  . LEU A 1 92  ? 15.133  51.104 52.999  1.00 156.12 ? 115 LEU A CG  1 
ATOM 422  C CD1 . LEU A 1 92  ? 15.575  52.318 53.808  1.00 156.92 ? 115 LEU A CD1 1 
ATOM 423  C CD2 . LEU A 1 92  ? 14.482  50.068 53.898  1.00 155.96 ? 115 LEU A CD2 1 
ATOM 424  N N   . CYS A 1 93  ? 15.840  51.371 49.010  1.00 189.46 ? 116 CYS A N   1 
ATOM 425  C CA  . CYS A 1 93  ? 17.007  50.804 48.353  1.00 189.46 ? 116 CYS A CA  1 
ATOM 426  C C   . CYS A 1 93  ? 17.720  51.810 47.454  1.00 189.46 ? 116 CYS A C   1 
ATOM 427  O O   . CYS A 1 93  ? 18.943  51.965 47.543  1.00 189.46 ? 116 CYS A O   1 
ATOM 428  C CB  . CYS A 1 93  ? 16.608  49.564 47.540  1.00 197.37 ? 116 CYS A CB  1 
ATOM 429  S SG  . CYS A 1 93  ? 16.198  48.086 48.527  1.00 197.37 ? 116 CYS A SG  1 
ATOM 430  N N   . VAL A 1 94  ? 16.967  52.494 46.597  1.00 165.80 ? 117 VAL A N   1 
ATOM 431  C CA  . VAL A 1 94  ? 17.561  53.470 45.683  1.00 165.80 ? 117 VAL A CA  1 
ATOM 432  C C   . VAL A 1 94  ? 17.778  54.850 46.314  1.00 165.80 ? 117 VAL A C   1 
ATOM 433  O O   . VAL A 1 94  ? 18.432  55.714 45.723  1.00 165.80 ? 117 VAL A O   1 
ATOM 434  C CB  . VAL A 1 94  ? 16.702  53.621 44.402  1.00 105.75 ? 117 VAL A CB  1 
ATOM 435  C CG1 . VAL A 1 94  ? 17.425  54.498 43.383  1.00 105.75 ? 117 VAL A CG1 1 
ATOM 436  C CG2 . VAL A 1 94  ? 16.408  52.251 43.810  1.00 105.75 ? 117 VAL A CG2 1 
ATOM 437  N N   . THR A 1 95  ? 17.236  55.056 47.513  1.00 274.36 ? 118 THR A N   1 
ATOM 438  C CA  . THR A 1 95  ? 17.412  56.329 48.210  1.00 274.36 ? 118 THR A CA  1 
ATOM 439  C C   . THR A 1 95  ? 18.565  56.225 49.206  1.00 274.36 ? 118 THR A C   1 
ATOM 440  O O   . THR A 1 95  ? 18.956  57.214 49.827  1.00 274.36 ? 118 THR A O   1 
ATOM 441  C CB  . THR A 1 95  ? 16.143  56.751 48.971  1.00 222.82 ? 118 THR A CB  1 
ATOM 442  O OG1 . THR A 1 95  ? 15.806  55.760 49.951  1.00 222.82 ? 118 THR A OG1 1 
ATOM 443  C CG2 . THR A 1 95  ? 14.987  56.928 48.006  1.00 222.82 ? 118 THR A CG2 1 
ATOM 444  N N   . ALA A 1 96  ? 19.100  55.015 49.353  1.00 240.64 ? 119 ALA A N   1 
ATOM 445  C CA  . ALA A 1 96  ? 20.226  54.769 50.250  1.00 240.64 ? 119 ALA A CA  1 
ATOM 446  C C   . ALA A 1 96  ? 21.502  54.675 49.411  1.00 240.64 ? 119 ALA A C   1 
ATOM 447  O O   . ALA A 1 96  ? 22.610  54.792 49.934  1.00 240.64 ? 119 ALA A O   1 
ATOM 448  C CB  . ALA A 1 96  ? 20.010  53.468 51.039  1.00 98.00  ? 119 ALA A CB  1 
ATOM 449  N N   . SER A 1 97  ? 21.330  54.467 48.107  1.00 205.39 ? 120 SER A N   1 
ATOM 450  C CA  . SER A 1 97  ? 22.453  54.360 47.179  1.00 205.39 ? 120 SER A CA  1 
ATOM 451  C C   . SER A 1 97  ? 23.091  55.718 46.903  1.00 205.39 ? 120 SER A C   1 
ATOM 452  O O   . SER A 1 97  ? 24.214  55.977 47.335  1.00 205.39 ? 120 SER A O   1 
ATOM 453  C CB  . SER A 1 97  ? 22.000  53.733 45.855  1.00 147.68 ? 120 SER A CB  1 
ATOM 454  O OG  . SER A 1 97  ? 21.741  52.345 45.993  1.00 147.68 ? 120 SER A OG  1 
ATOM 455  N N   . ILE A 1 98  ? 22.375  56.580 46.184  1.00 147.54 ? 121 ILE A N   1 
ATOM 456  C CA  . ILE A 1 98  ? 22.880  57.912 45.856  1.00 147.54 ? 121 ILE A CA  1 
ATOM 457  C C   . ILE A 1 98  ? 23.128  58.702 47.150  1.00 147.54 ? 121 ILE A C   1 
ATOM 458  O O   . ILE A 1 98  ? 23.641  59.822 47.123  1.00 147.54 ? 121 ILE A O   1 
ATOM 459  C CB  . ILE A 1 98  ? 21.877  58.670 44.927  1.00 147.68 ? 121 ILE A CB  1 
ATOM 460  C CG1 . ILE A 1 98  ? 22.626  59.581 43.943  1.00 147.68 ? 121 ILE A CG1 1 
ATOM 461  C CG2 . ILE A 1 98  ? 20.892  59.472 45.764  1.00 147.68 ? 121 ILE A CG2 1 
ATOM 462  C CD1 . ILE A 1 98  ? 23.182  60.855 44.537  1.00 147.68 ? 121 ILE A CD1 1 
ATOM 463  N N   . GLU A 1 99  ? 22.759  58.105 48.283  1.00 206.59 ? 122 GLU A N   1 
ATOM 464  C CA  . GLU A 1 99  ? 22.968  58.723 49.591  1.00 206.59 ? 122 GLU A CA  1 
ATOM 465  C C   . GLU A 1 99  ? 24.341  58.266 50.072  1.00 206.59 ? 122 GLU A C   1 
ATOM 466  O O   . GLU A 1 99  ? 25.131  59.057 50.587  1.00 349.10 ? 122 GLU A O   1 
ATOM 467  C CB  . GLU A 1 99  ? 21.892  58.275 50.570  1.00 155.02 ? 122 GLU A CB  1 
ATOM 468  N N   . THR A 1 100 ? 24.610  56.975 49.895  1.00 180.37 ? 123 THR A N   1 
ATOM 469  C CA  . THR A 1 100 ? 25.892  56.396 50.270  1.00 180.37 ? 123 THR A CA  1 
ATOM 470  C C   . THR A 1 100 ? 26.938  56.968 49.314  1.00 180.37 ? 123 THR A C   1 
ATOM 471  O O   . THR A 1 100 ? 28.069  57.239 49.706  1.00 180.37 ? 123 THR A O   1 
ATOM 472  C CB  . THR A 1 100 ? 25.866  54.858 50.146  1.00 220.19 ? 123 THR A CB  1 
ATOM 473  O OG1 . THR A 1 100 ? 24.846  54.328 51.001  1.00 220.19 ? 123 THR A OG1 1 
ATOM 474  C CG2 . THR A 1 100 ? 27.208  54.267 50.550  1.00 220.19 ? 123 THR A CG2 1 
ATOM 475  N N   . LEU A 1 101 ? 26.544  57.151 48.056  1.00 182.58 ? 124 LEU A N   1 
ATOM 476  C CA  . LEU A 1 101 ? 27.430  57.719 47.044  1.00 182.58 ? 124 LEU A CA  1 
ATOM 477  C C   . LEU A 1 101 ? 27.822  59.120 47.478  1.00 182.58 ? 124 LEU A C   1 
ATOM 478  O O   . LEU A 1 101 ? 28.880  59.626 47.109  1.00 182.58 ? 124 LEU A O   1 
ATOM 479  C CB  . LEU A 1 101 ? 26.722  57.783 45.688  1.00 150.61 ? 124 LEU A CB  1 
ATOM 480  C CG  . LEU A 1 101 ? 26.739  56.533 44.802  1.00 150.61 ? 124 LEU A CG  1 
ATOM 481  C CD1 . LEU A 1 101 ? 27.961  56.564 43.902  1.00 150.61 ? 124 LEU A CD1 1 
ATOM 482  C CD2 . LEU A 1 101 ? 26.713  55.269 45.660  1.00 150.61 ? 124 LEU A CD2 1 
ATOM 483  N N   . CYS A 1 102 ? 26.952  59.747 48.261  1.00 192.19 ? 125 CYS A N   1 
ATOM 484  C CA  . CYS A 1 102 ? 27.212  61.084 48.769  1.00 192.19 ? 125 CYS A CA  1 
ATOM 485  C C   . CYS A 1 102 ? 28.163  60.951 49.953  1.00 192.19 ? 125 CYS A C   1 
ATOM 486  O O   . CYS A 1 102 ? 29.000  61.821 50.194  1.00 192.19 ? 125 CYS A O   1 
ATOM 487  C CB  . CYS A 1 102 ? 25.908  61.743 49.222  1.00 205.12 ? 125 CYS A CB  1 
ATOM 488  S SG  . CYS A 1 102 ? 26.105  63.432 49.843  1.00 205.12 ? 125 CYS A SG  1 
ATOM 489  N N   . VAL A 1 103 ? 28.029  59.845 50.681  1.00 190.72 ? 126 VAL A N   1 
ATOM 490  C CA  . VAL A 1 103 ? 28.866  59.566 51.847  1.00 190.72 ? 126 VAL A CA  1 
ATOM 491  C C   . VAL A 1 103 ? 30.342  59.455 51.473  1.00 190.72 ? 126 VAL A C   1 
ATOM 492  O O   . VAL A 1 103 ? 31.158  60.288 51.871  1.00 190.72 ? 126 VAL A O   1 
ATOM 493  C CB  . VAL A 1 103 ? 28.442  58.249 52.536  1.00 137.03 ? 126 VAL A CB  1 
ATOM 494  C CG1 . VAL A 1 103 ? 29.359  57.958 53.705  1.00 137.03 ? 126 VAL A CG1 1 
ATOM 495  C CG2 . VAL A 1 103 ? 26.996  58.347 53.004  1.00 137.03 ? 126 VAL A CG2 1 
ATOM 496  N N   . ILE A 1 104 ? 30.674  58.416 50.714  1.00 135.17 ? 127 ILE A N   1 
ATOM 497  C CA  . ILE A 1 104 ? 32.043  58.176 50.270  1.00 135.17 ? 127 ILE A CA  1 
ATOM 498  C C   . ILE A 1 104 ? 32.682  59.417 49.634  1.00 135.17 ? 127 ILE A C   1 
ATOM 499  O O   . ILE A 1 104 ? 33.791  59.809 50.008  1.00 135.17 ? 127 ILE A O   1 
ATOM 500  C CB  . ILE A 1 104 ? 32.101  57.006 49.253  1.00 178.69 ? 127 ILE A CB  1 
ATOM 501  C CG1 . ILE A 1 104 ? 31.678  55.697 49.926  1.00 178.69 ? 127 ILE A CG1 1 
ATOM 502  C CG2 . ILE A 1 104 ? 33.504  56.869 48.690  1.00 178.69 ? 127 ILE A CG2 1 
ATOM 503  C CD1 . ILE A 1 104 ? 30.204  55.586 50.173  1.00 178.69 ? 127 ILE A CD1 1 
ATOM 504  N N   . ALA A 1 105 ? 31.987  60.030 48.677  1.00 165.60 ? 128 ALA A N   1 
ATOM 505  C CA  . ALA A 1 105 ? 32.501  61.223 48.006  1.00 165.60 ? 128 ALA A CA  1 
ATOM 506  C C   . ALA A 1 105 ? 33.043  62.221 49.029  1.00 165.60 ? 128 ALA A C   1 
ATOM 507  O O   . ALA A 1 105 ? 34.001  62.945 48.757  1.00 165.60 ? 128 ALA A O   1 
ATOM 508  C CB  . ALA A 1 105 ? 31.405  61.870 47.173  1.00 168.78 ? 128 ALA A CB  1 
ATOM 509  N N   . VAL A 1 106 ? 32.423  62.247 50.205  1.00 151.39 ? 129 VAL A N   1 
ATOM 510  C CA  . VAL A 1 106 ? 32.836  63.132 51.291  1.00 151.39 ? 129 VAL A CA  1 
ATOM 511  C C   . VAL A 1 106 ? 33.917  62.453 52.135  1.00 151.39 ? 129 VAL A C   1 
ATOM 512  O O   . VAL A 1 106 ? 34.925  63.069 52.487  1.00 151.39 ? 129 VAL A O   1 
ATOM 513  C CB  . VAL A 1 106 ? 31.630  63.491 52.195  1.00 150.51 ? 129 VAL A CB  1 
ATOM 514  C CG1 . VAL A 1 106 ? 32.096  64.241 53.442  1.00 150.51 ? 129 VAL A CG1 1 
ATOM 515  C CG2 . VAL A 1 106 ? 30.647  64.338 51.412  1.00 150.51 ? 129 VAL A CG2 1 
ATOM 516  N N   . ASP A 1 107 ? 33.697  61.182 52.461  1.00 131.79 ? 130 ASP A N   1 
ATOM 517  C CA  . ASP A 1 107 ? 34.654  60.418 53.251  1.00 131.79 ? 130 ASP A CA  1 
ATOM 518  C C   . ASP A 1 107 ? 36.008  60.451 52.558  1.00 131.79 ? 130 ASP A C   1 
ATOM 519  O O   . ASP A 1 107 ? 36.994  60.926 53.125  1.00 131.79 ? 130 ASP A O   1 
ATOM 520  C CB  . ASP A 1 107 ? 34.177  58.970 53.399  1.00 174.50 ? 130 ASP A CB  1 
ATOM 521  C CG  . ASP A 1 107 ? 35.250  58.056 53.955  1.00 174.50 ? 130 ASP A CG  1 
ATOM 522  O OD1 . ASP A 1 107 ? 36.197  57.732 53.211  1.00 174.50 ? 130 ASP A OD1 1 
ATOM 523  O OD2 . ASP A 1 107 ? 35.149  57.666 55.137  1.00 174.50 ? 130 ASP A OD2 1 
ATOM 524  N N   . ARG A 1 108 ? 36.042  59.950 51.325  1.00 152.36 ? 131 ARG A N   1 
ATOM 525  C CA  . ARG A 1 108 ? 37.268  59.927 50.543  1.00 152.36 ? 131 ARG A CA  1 
ATOM 526  C C   . ARG A 1 108 ? 37.895  61.318 50.515  1.00 152.36 ? 131 ARG A C   1 
ATOM 527  O O   . ARG A 1 108 ? 39.118  61.456 50.547  1.00 264.61 ? 131 ARG A O   1 
ATOM 528  C CB  . ARG A 1 108 ? 36.988  59.451 49.114  1.00 157.41 ? 131 ARG A CB  1 
ATOM 529  C CG  . ARG A 1 108 ? 36.625  57.968 48.981  1.00 157.41 ? 131 ARG A CG  1 
ATOM 530  C CD  . ARG A 1 108 ? 37.748  57.042 49.437  1.00 157.41 ? 131 ARG A CD  1 
ATOM 531  N NE  . ARG A 1 108 ? 37.828  56.933 50.892  1.00 157.41 ? 131 ARG A NE  1 
ATOM 532  C CZ  . ARG A 1 108 ? 38.791  56.288 51.549  1.00 157.41 ? 131 ARG A CZ  1 
ATOM 533  N NH1 . ARG A 1 108 ? 39.773  55.688 50.885  1.00 157.41 ? 131 ARG A NH1 1 
ATOM 534  N NH2 . ARG A 1 108 ? 38.769  56.232 52.875  1.00 157.41 ? 131 ARG A NH2 1 
ATOM 535  N N   . TYR A 1 109 ? 37.055  62.347 50.451  1.00 153.72 ? 132 TYR A N   1 
ATOM 536  C CA  . TYR A 1 109 ? 37.552  63.720 50.447  1.00 153.72 ? 132 TYR A CA  1 
ATOM 537  C C   . TYR A 1 109 ? 38.290  63.963 51.757  1.00 153.72 ? 132 TYR A C   1 
ATOM 538  O O   . TYR A 1 109 ? 39.487  64.246 51.754  1.00 153.72 ? 132 TYR A O   1 
ATOM 539  C CB  . TYR A 1 109 ? 36.401  64.715 50.339  1.00 139.59 ? 132 TYR A CB  1 
ATOM 540  C CG  . TYR A 1 109 ? 36.836  66.159 50.449  1.00 139.59 ? 132 TYR A CG  1 
ATOM 541  C CD1 . TYR A 1 109 ? 37.242  66.873 49.321  1.00 139.59 ? 132 TYR A CD1 1 
ATOM 542  C CD2 . TYR A 1 109 ? 36.827  66.818 51.682  1.00 139.59 ? 132 TYR A CD2 1 
ATOM 543  C CE1 . TYR A 1 109 ? 37.622  68.213 49.413  1.00 139.59 ? 132 TYR A CE1 1 
ATOM 544  C CE2 . TYR A 1 109 ? 37.208  68.158 51.788  1.00 139.59 ? 132 TYR A CE2 1 
ATOM 545  C CZ  . TYR A 1 109 ? 37.600  68.853 50.648  1.00 139.59 ? 132 TYR A CZ  1 
ATOM 546  O OH  . TYR A 1 109 ? 37.936  70.192 50.733  1.00 139.59 ? 132 TYR A OH  1 
ATOM 547  N N   . PHE A 1 110 ? 37.564  63.853 52.870  1.00 125.66 ? 133 PHE A N   1 
ATOM 548  C CA  . PHE A 1 110 ? 38.141  64.044 54.200  1.00 125.66 ? 133 PHE A CA  1 
ATOM 549  C C   . PHE A 1 110 ? 39.425  63.244 54.348  1.00 125.66 ? 133 PHE A C   1 
ATOM 550  O O   . PHE A 1 110 ? 40.277  63.575 55.170  1.00 125.66 ? 133 PHE A O   1 
ATOM 551  C CB  . PHE A 1 110 ? 37.144  63.617 55.281  1.00 192.83 ? 133 PHE A CB  1 
ATOM 552  C CG  . PHE A 1 110 ? 36.198  64.707 55.700  1.00 192.83 ? 133 PHE A CG  1 
ATOM 553  C CD1 . PHE A 1 110 ? 35.504  65.450 54.751  1.00 192.83 ? 133 PHE A CD1 1 
ATOM 554  C CD2 . PHE A 1 110 ? 35.996  64.987 57.051  1.00 192.83 ? 133 PHE A CD2 1 
ATOM 555  C CE1 . PHE A 1 110 ? 34.621  66.457 55.139  1.00 192.83 ? 133 PHE A CE1 1 
ATOM 556  C CE2 . PHE A 1 110 ? 35.117  65.991 57.451  1.00 192.83 ? 133 PHE A CE2 1 
ATOM 557  C CZ  . PHE A 1 110 ? 34.429  66.727 56.493  1.00 192.83 ? 133 PHE A CZ  1 
ATOM 558  N N   . ALA A 1 111 ? 39.555  62.189 53.549  1.00 157.58 ? 134 ALA A N   1 
ATOM 559  C CA  . ALA A 1 111 ? 40.745  61.348 53.573  1.00 157.58 ? 134 ALA A CA  1 
ATOM 560  C C   . ALA A 1 111 ? 41.895  62.083 52.893  1.00 157.58 ? 134 ALA A C   1 
ATOM 561  O O   . ALA A 1 111 ? 43.000  62.150 53.433  1.00 157.58 ? 134 ALA A O   1 
ATOM 562  C CB  . ALA A 1 111 ? 40.474  60.031 52.863  1.00 163.37 ? 134 ALA A CB  1 
ATOM 563  N N   . ILE A 1 112 ? 41.630  62.634 51.710  1.00 158.86 ? 135 ILE A N   1 
ATOM 564  C CA  . ILE A 1 112 ? 42.643  63.373 50.963  1.00 158.86 ? 135 ILE A CA  1 
ATOM 565  C C   . ILE A 1 112 ? 42.954  64.736 51.575  1.00 158.86 ? 135 ILE A C   1 
ATOM 566  O O   . ILE A 1 112 ? 44.113  65.037 51.867  1.00 125.31 ? 135 ILE A O   1 
ATOM 567  C CB  . ILE A 1 112 ? 42.224  63.577 49.499  1.00 110.47 ? 135 ILE A CB  1 
ATOM 568  C CG1 . ILE A 1 112 ? 42.504  62.291 48.715  1.00 110.47 ? 135 ILE A CG1 1 
ATOM 569  C CG2 . ILE A 1 112 ? 42.950  64.786 48.903  1.00 110.47 ? 135 ILE A CG2 1 
ATOM 570  C CD1 . ILE A 1 112 ? 42.354  62.420 47.197  1.00 110.47 ? 135 ILE A CD1 1 
ATOM 571  N N   . THR A 1 113 ? 41.928  65.564 51.760  1.00 205.32 ? 136 THR A N   1 
ATOM 572  C CA  . THR A 1 113 ? 42.122  66.888 52.351  1.00 205.32 ? 136 THR A CA  1 
ATOM 573  C C   . THR A 1 113 ? 42.835  66.737 53.692  1.00 205.32 ? 136 THR A C   1 
ATOM 574  O O   . THR A 1 113 ? 43.379  67.701 54.234  1.00 324.84 ? 136 THR A O   1 
ATOM 575  C CB  . THR A 1 113 ? 40.777  67.611 52.586  1.00 240.94 ? 136 THR A CB  1 
ATOM 576  O OG1 . THR A 1 113 ? 41.018  68.879 53.207  1.00 240.94 ? 136 THR A OG1 1 
ATOM 577  C CG2 . THR A 1 113 ? 39.873  66.782 53.483  1.00 240.94 ? 136 THR A CG2 1 
ATOM 578  N N   . SER A 1 114 ? 42.822  65.513 54.216  1.00 179.23 ? 137 SER A N   1 
ATOM 579  C CA  . SER A 1 114 ? 43.460  65.190 55.487  1.00 179.23 ? 137 SER A CA  1 
ATOM 580  C C   . SER A 1 114 ? 44.965  65.423 55.427  1.00 179.23 ? 137 SER A C   1 
ATOM 581  O O   . SER A 1 114 ? 45.605  65.174 54.403  1.00 179.23 ? 137 SER A O   1 
ATOM 582  C CB  . SER A 1 114 ? 43.187  63.728 55.855  1.00 219.16 ? 137 SER A CB  1 
ATOM 583  O OG  . SER A 1 114 ? 43.921  63.343 57.004  1.00 219.16 ? 137 SER A OG  1 
ATOM 584  N N   . PRO A 1 115 ? 45.552  65.905 56.535  1.00 142.51 ? 138 PRO A N   1 
ATOM 585  C CA  . PRO A 1 115 ? 46.992  66.171 56.601  1.00 142.51 ? 138 PRO A CA  1 
ATOM 586  C C   . PRO A 1 115 ? 47.826  64.898 56.640  1.00 142.51 ? 138 PRO A C   1 
ATOM 587  O O   . PRO A 1 115 ? 49.010  64.910 56.296  1.00 142.51 ? 138 PRO A O   1 
ATOM 588  C CB  . PRO A 1 115 ? 47.126  66.989 57.880  1.00 211.60 ? 138 PRO A CB  1 
ATOM 589  C CG  . PRO A 1 115 ? 46.063  66.393 58.753  1.00 211.60 ? 138 PRO A CG  1 
ATOM 590  C CD  . PRO A 1 115 ? 44.892  66.280 57.800  1.00 211.60 ? 138 PRO A CD  1 
ATOM 591  N N   . PHE A 1 116 ? 47.207  63.802 57.066  1.00 163.88 ? 139 PHE A N   1 
ATOM 592  C CA  . PHE A 1 116 ? 47.924  62.540 57.141  1.00 163.88 ? 139 PHE A CA  1 
ATOM 593  C C   . PHE A 1 116 ? 47.485  61.539 56.078  1.00 163.88 ? 139 PHE A C   1 
ATOM 594  O O   . PHE A 1 116 ? 46.654  61.847 55.223  1.00 163.88 ? 139 PHE A O   1 
ATOM 595  C CB  . PHE A 1 116 ? 47.783  61.907 58.526  1.00 153.43 ? 139 PHE A CB  1 
ATOM 596  C CG  . PHE A 1 116 ? 49.053  61.260 59.021  1.00 153.43 ? 139 PHE A CG  1 
ATOM 597  C CD1 . PHE A 1 116 ? 49.011  60.253 59.978  1.00 153.43 ? 139 PHE A CD1 1 
ATOM 598  C CD2 . PHE A 1 116 ? 50.301  61.680 58.542  1.00 153.43 ? 139 PHE A CD2 1 
ATOM 599  C CE1 . PHE A 1 116 ? 50.189  59.675 60.453  1.00 153.43 ? 139 PHE A CE1 1 
ATOM 600  C CE2 . PHE A 1 116 ? 51.485  61.109 59.010  1.00 153.43 ? 139 PHE A CE2 1 
ATOM 601  C CZ  . PHE A 1 116 ? 51.430  60.108 59.966  1.00 153.43 ? 139 PHE A CZ  1 
ATOM 602  N N   . LYS A 1 117 ? 48.055  60.339 56.164  1.00 225.15 ? 140 LYS A N   1 
ATOM 603  C CA  . LYS A 1 117 ? 47.814  59.244 55.230  1.00 225.15 ? 140 LYS A CA  1 
ATOM 604  C C   . LYS A 1 117 ? 46.430  59.182 54.594  1.00 225.15 ? 140 LYS A C   1 
ATOM 605  O O   . LYS A 1 117 ? 45.459  59.747 55.103  1.00 225.15 ? 140 LYS A O   1 
ATOM 606  C CB  . LYS A 1 117 ? 48.102  57.893 55.895  1.00 178.91 ? 140 LYS A CB  1 
ATOM 607  C CG  . LYS A 1 117 ? 49.255  57.884 56.895  1.00 178.91 ? 140 LYS A CG  1 
ATOM 608  C CD  . LYS A 1 117 ? 50.546  58.477 56.346  1.00 178.91 ? 140 LYS A CD  1 
ATOM 609  C CE  . LYS A 1 117 ? 51.688  58.271 57.339  1.00 178.91 ? 140 LYS A CE  1 
ATOM 610  N NZ  . LYS A 1 117 ? 52.817  59.222 57.132  1.00 178.91 ? 140 LYS A NZ  1 
ATOM 611  N N   . TYR A 1 118 ? 46.354  58.466 53.474  1.00 180.89 ? 141 TYR A N   1 
ATOM 612  C CA  . TYR A 1 118 ? 45.109  58.311 52.720  1.00 180.89 ? 141 TYR A CA  1 
ATOM 613  C C   . TYR A 1 118 ? 44.226  57.177 53.257  1.00 180.89 ? 141 TYR A C   1 
ATOM 614  O O   . TYR A 1 118 ? 44.485  56.001 53.014  1.00 344.75 ? 141 TYR A O   1 
ATOM 615  C CB  . TYR A 1 118 ? 45.443  58.077 51.239  1.00 158.31 ? 141 TYR A CB  1 
ATOM 616  C CG  . TYR A 1 118 ? 44.245  57.996 50.297  1.00 158.31 ? 141 TYR A CG  1 
ATOM 617  C CD1 . TYR A 1 118 ? 43.272  57.004 50.459  1.00 158.31 ? 141 TYR A CD1 1 
ATOM 618  C CD2 . TYR A 1 118 ? 44.094  58.888 49.233  1.00 158.31 ? 141 TYR A CD2 1 
ATOM 619  C CE1 . TYR A 1 118 ? 42.187  56.895 49.597  1.00 158.31 ? 141 TYR A CE1 1 
ATOM 620  C CE2 . TYR A 1 118 ? 43.002  58.784 48.358  1.00 158.31 ? 141 TYR A CE2 1 
ATOM 621  C CZ  . TYR A 1 118 ? 42.057  57.786 48.550  1.00 158.31 ? 141 TYR A CZ  1 
ATOM 622  O OH  . TYR A 1 118 ? 40.976  57.649 47.708  1.00 158.31 ? 141 TYR A OH  1 
ATOM 623  N N   . GLN A 1 119 ? 43.172  57.566 53.963  1.00 144.53 ? 142 GLN A N   1 
ATOM 624  C CA  . GLN A 1 119 ? 42.191  56.669 54.561  1.00 144.53 ? 142 GLN A CA  1 
ATOM 625  C C   . GLN A 1 119 ? 41.420  57.477 55.590  1.00 144.53 ? 142 GLN A C   1 
ATOM 626  O O   . GLN A 1 119 ? 41.887  57.678 56.716  1.00 144.53 ? 142 GLN A O   1 
ATOM 627  C CB  . GLN A 1 119 ? 42.829  55.470 55.265  1.00 161.75 ? 142 GLN A CB  1 
ATOM 628  C CG  . GLN A 1 119 ? 42.639  54.122 54.548  1.00 161.75 ? 142 GLN A CG  1 
ATOM 629  C CD  . GLN A 1 119 ? 41.164  53.670 54.468  1.00 161.75 ? 142 GLN A CD  1 
ATOM 630  O OE1 . GLN A 1 119 ? 40.347  54.289 53.778  1.00 161.75 ? 142 GLN A OE1 1 
ATOM 631  N NE2 . GLN A 1 119 ? 40.832  52.591 55.165  1.00 161.75 ? 142 GLN A NE2 1 
ATOM 632  N N   . SER A 1 120 ? 40.238  57.931 55.189  1.00 161.71 ? 143 SER A N   1 
ATOM 633  C CA  . SER A 1 120 ? 39.360  58.731 56.029  1.00 161.71 ? 143 SER A CA  1 
ATOM 634  C C   . SER A 1 120 ? 39.434  58.415 57.530  1.00 161.71 ? 143 SER A C   1 
ATOM 635  O O   . SER A 1 120 ? 39.866  57.331 57.933  1.00 161.71 ? 143 SER A O   1 
ATOM 636  C CB  . SER A 1 120 ? 37.934  58.563 55.528  1.00 180.26 ? 143 SER A CB  1 
ATOM 637  O OG  . SER A 1 120 ? 37.082  59.510 56.141  1.00 180.26 ? 143 SER A OG  1 
ATOM 638  N N   . LEU A 1 121 ? 39.004  59.359 58.362  1.00 197.88 ? 144 LEU A N   1 
ATOM 639  C CA  . LEU A 1 121 ? 39.045  59.151 59.811  1.00 197.88 ? 144 LEU A CA  1 
ATOM 640  C C   . LEU A 1 121 ? 37.810  58.419 60.364  1.00 197.88 ? 144 LEU A C   1 
ATOM 641  O O   . LEU A 1 121 ? 37.821  57.969 61.509  1.00 197.88 ? 144 LEU A O   1 
ATOM 642  C CB  . LEU A 1 121 ? 39.216  60.491 60.525  1.00 135.33 ? 144 LEU A CB  1 
ATOM 643  C CG  . LEU A 1 121 ? 40.090  61.536 59.816  1.00 135.33 ? 144 LEU A CG  1 
ATOM 644  C CD1 . LEU A 1 121 ? 40.327  62.689 60.781  1.00 135.33 ? 144 LEU A CD1 1 
ATOM 645  C CD2 . LEU A 1 121 ? 41.429  60.944 59.370  1.00 135.33 ? 144 LEU A CD2 1 
ATOM 646  N N   . LEU A 1 122 ? 36.756  58.302 59.555  1.00 217.47 ? 145 LEU A N   1 
ATOM 647  C CA  . LEU A 1 122 ? 35.539  57.605 59.976  1.00 217.47 ? 145 LEU A CA  1 
ATOM 648  C C   . LEU A 1 122 ? 35.887  56.241 60.574  1.00 217.47 ? 145 LEU A C   1 
ATOM 649  O O   . LEU A 1 122 ? 36.063  55.266 59.845  1.00 217.47 ? 145 LEU A O   1 
ATOM 650  C CB  . LEU A 1 122 ? 34.598  57.408 58.782  1.00 130.55 ? 145 LEU A CB  1 
ATOM 651  C CG  . LEU A 1 122 ? 33.555  58.473 58.401  1.00 130.55 ? 145 LEU A CG  1 
ATOM 652  C CD1 . LEU A 1 122 ? 32.415  58.453 59.413  1.00 130.55 ? 145 LEU A CD1 1 
ATOM 653  C CD2 . LEU A 1 122 ? 34.196  59.855 58.324  1.00 130.55 ? 145 LEU A CD2 1 
ATOM 654  N N   . THR A 1 123 ? 35.979  56.181 61.901  1.00 239.61 ? 146 THR A N   1 
ATOM 655  C CA  . THR A 1 123 ? 36.317  54.947 62.604  1.00 239.61 ? 146 THR A CA  1 
ATOM 656  C C   . THR A 1 123 ? 35.472  53.755 62.141  1.00 239.61 ? 146 THR A C   1 
ATOM 657  O O   . THR A 1 123 ? 34.427  53.932 61.516  1.00 239.61 ? 146 THR A O   1 
ATOM 658  C CB  . THR A 1 123 ? 36.154  55.115 64.130  1.00 215.02 ? 146 THR A CB  1 
ATOM 659  O OG1 . THR A 1 123 ? 34.791  55.418 64.440  1.00 215.02 ? 146 THR A OG1 1 
ATOM 660  C CG2 . THR A 1 123 ? 37.030  56.249 64.637  1.00 215.02 ? 146 THR A CG2 1 
ATOM 661  N N   . LYS A 1 124 ? 35.935  52.545 62.451  1.00 175.15 ? 147 LYS A N   1 
ATOM 662  C CA  . LYS A 1 124 ? 35.241  51.316 62.064  1.00 175.15 ? 147 LYS A CA  1 
ATOM 663  C C   . LYS A 1 124 ? 33.832  51.241 62.641  1.00 175.15 ? 147 LYS A C   1 
ATOM 664  O O   . LYS A 1 124 ? 32.884  50.866 61.947  1.00 300.90 ? 147 LYS A O   1 
ATOM 665  C CB  . LYS A 1 124 ? 36.050  50.094 62.503  1.00 126.00 ? 147 LYS A CB  1 
ATOM 666  N N   . ASN A 1 125 ? 33.699  51.591 63.916  1.00 220.07 ? 148 ASN A N   1 
ATOM 667  C CA  . ASN A 1 125 ? 32.405  51.566 64.584  1.00 220.07 ? 148 ASN A CA  1 
ATOM 668  C C   . ASN A 1 125 ? 31.526  52.745 64.167  1.00 220.07 ? 148 ASN A C   1 
ATOM 669  O O   . ASN A 1 125 ? 30.337  52.572 63.896  1.00 220.07 ? 148 ASN A O   1 
ATOM 670  C CB  . ASN A 1 125 ? 32.594  51.548 66.109  1.00 203.33 ? 148 ASN A CB  1 
ATOM 671  C CG  . ASN A 1 125 ? 33.548  52.627 66.606  1.00 203.33 ? 148 ASN A CG  1 
ATOM 672  O OD1 . ASN A 1 125 ? 33.796  52.738 67.807  1.00 203.33 ? 148 ASN A OD1 1 
ATOM 673  N ND2 . ASN A 1 125 ? 34.087  53.419 65.691  1.00 203.33 ? 148 ASN A ND2 1 
ATOM 674  N N   . LYS A 1 126 ? 32.112  53.938 64.111  1.00 162.85 ? 149 LYS A N   1 
ATOM 675  C CA  . LYS A 1 126 ? 31.376  55.135 63.715  1.00 162.85 ? 149 LYS A CA  1 
ATOM 676  C C   . LYS A 1 126 ? 31.067  55.088 62.217  1.00 162.85 ? 149 LYS A C   1 
ATOM 677  O O   . LYS A 1 126 ? 30.367  55.952 61.685  1.00 162.85 ? 149 LYS A O   1 
ATOM 678  C CB  . LYS A 1 126 ? 32.184  56.394 64.053  1.00 173.59 ? 149 LYS A CB  1 
ATOM 679  C CG  . LYS A 1 126 ? 32.495  56.553 65.537  1.00 173.59 ? 149 LYS A CG  1 
ATOM 680  C CD  . LYS A 1 126 ? 33.394  57.751 65.792  1.00 173.59 ? 149 LYS A CD  1 
ATOM 681  C CE  . LYS A 1 126 ? 33.789  57.841 67.256  1.00 173.59 ? 149 LYS A CE  1 
ATOM 682  N NZ  . LYS A 1 126 ? 34.604  59.056 67.531  1.00 173.59 ? 149 LYS A NZ  1 
ATOM 683  N N   . ALA A 1 127 ? 31.607  54.079 61.539  1.00 213.90 ? 150 ALA A N   1 
ATOM 684  C CA  . ALA A 1 127 ? 31.362  53.898 60.114  1.00 213.90 ? 150 ALA A CA  1 
ATOM 685  C C   . ALA A 1 127 ? 30.060  53.122 60.048  1.00 213.90 ? 150 ALA A C   1 
ATOM 686  O O   . ALA A 1 127 ? 29.233  53.334 59.162  1.00 213.90 ? 150 ALA A O   1 
ATOM 687  C CB  . ALA A 1 127 ? 32.487  53.095 59.475  1.00 186.33 ? 150 ALA A CB  1 
ATOM 688  N N   . ARG A 1 128 ? 29.895  52.219 61.009  1.00 186.72 ? 151 ARG A N   1 
ATOM 689  C CA  . ARG A 1 128 ? 28.692  51.407 61.113  1.00 186.72 ? 151 ARG A CA  1 
ATOM 690  C C   . ARG A 1 128 ? 27.579  52.278 61.692  1.00 186.72 ? 151 ARG A C   1 
ATOM 691  O O   . ARG A 1 128 ? 26.449  52.266 61.203  1.00 186.72 ? 151 ARG A O   1 
ATOM 692  C CB  . ARG A 1 128 ? 28.937  50.203 62.030  1.00 191.62 ? 151 ARG A CB  1 
ATOM 693  C CG  . ARG A 1 128 ? 29.875  49.142 61.464  1.00 191.62 ? 151 ARG A CG  1 
ATOM 694  C CD  . ARG A 1 128 ? 29.922  47.925 62.384  1.00 191.62 ? 151 ARG A CD  1 
ATOM 695  N NE  . ARG A 1 128 ? 30.595  46.778 61.777  1.00 191.62 ? 151 ARG A NE  1 
ATOM 696  C CZ  . ARG A 1 128 ? 30.663  45.570 62.332  1.00 191.62 ? 151 ARG A CZ  1 
ATOM 697  N NH1 . ARG A 1 128 ? 30.099  45.345 63.512  1.00 191.62 ? 151 ARG A NH1 1 
ATOM 698  N NH2 . ARG A 1 128 ? 31.291  44.584 61.704  1.00 191.62 ? 151 ARG A NH2 1 
ATOM 699  N N   . VAL A 1 129 ? 27.913  53.031 62.739  1.00 234.48 ? 152 VAL A N   1 
ATOM 700  C CA  . VAL A 1 129 ? 26.959  53.924 63.393  1.00 234.48 ? 152 VAL A CA  1 
ATOM 701  C C   . VAL A 1 129 ? 26.477  54.959 62.376  1.00 234.48 ? 152 VAL A C   1 
ATOM 702  O O   . VAL A 1 129 ? 25.341  55.433 62.441  1.00 234.48 ? 152 VAL A O   1 
ATOM 703  C CB  . VAL A 1 129 ? 27.622  54.618 64.601  1.00 65.19  ? 152 VAL A CB  1 
ATOM 704  N N   . ILE A 1 130 ? 27.355  55.296 61.435  1.00 188.79 ? 153 ILE A N   1 
ATOM 705  C CA  . ILE A 1 130 ? 27.041  56.252 60.383  1.00 188.79 ? 153 ILE A CA  1 
ATOM 706  C C   . ILE A 1 130 ? 26.311  55.520 59.262  1.00 188.79 ? 153 ILE A C   1 
ATOM 707  O O   . ILE A 1 130 ? 25.485  56.102 58.559  1.00 188.79 ? 153 ILE A O   1 
ATOM 708  C CB  . ILE A 1 130 ? 28.323  56.890 59.845  1.00 169.49 ? 153 ILE A CB  1 
ATOM 709  N N   . ILE A 1 131 ? 26.623  54.238 59.099  1.00 279.13 ? 154 ILE A N   1 
ATOM 710  C CA  . ILE A 1 131 ? 25.992  53.427 58.063  1.00 279.13 ? 154 ILE A CA  1 
ATOM 711  C C   . ILE A 1 131 ? 24.557  53.102 58.459  1.00 279.13 ? 154 ILE A C   1 
ATOM 712  O O   . ILE A 1 131 ? 23.657  53.092 57.620  1.00 279.13 ? 154 ILE A O   1 
ATOM 713  C CB  . ILE A 1 131 ? 26.781  52.139 57.855  1.00 107.97 ? 154 ILE A CB  1 
ATOM 714  N N   . LEU A 1 132 ? 24.356  52.845 59.747  1.00 178.92 ? 155 LEU A N   1 
ATOM 715  C CA  . LEU A 1 132 ? 23.039  52.516 60.271  1.00 178.92 ? 155 LEU A CA  1 
ATOM 716  C C   . LEU A 1 132 ? 22.056  53.670 60.079  1.00 178.92 ? 155 LEU A C   1 
ATOM 717  O O   . LEU A 1 132 ? 20.868  53.451 59.833  1.00 178.92 ? 155 LEU A O   1 
ATOM 718  C CB  . LEU A 1 132 ? 23.149  52.153 61.753  1.00 105.61 ? 155 LEU A CB  1 
ATOM 719  N N   . MET A 1 133 ? 22.562  54.896 60.186  1.00 207.16 ? 156 MET A N   1 
ATOM 720  C CA  . MET A 1 133 ? 21.739  56.095 60.041  1.00 207.16 ? 156 MET A CA  1 
ATOM 721  C C   . MET A 1 133 ? 21.490  56.482 58.586  1.00 207.16 ? 156 MET A C   1 
ATOM 722  O O   . MET A 1 133 ? 20.833  57.487 58.311  1.00 207.16 ? 156 MET A O   1 
ATOM 723  C CB  . MET A 1 133 ? 22.384  57.261 60.784  1.00 131.62 ? 156 MET A CB  1 
ATOM 724  N N   . VAL A 1 134 ? 22.019  55.690 57.658  1.00 229.59 ? 157 VAL A N   1 
ATOM 725  C CA  . VAL A 1 134 ? 21.836  55.957 56.235  1.00 229.59 ? 157 VAL A CA  1 
ATOM 726  C C   . VAL A 1 134 ? 20.618  55.184 55.735  1.00 229.59 ? 157 VAL A C   1 
ATOM 727  O O   . VAL A 1 134 ? 20.054  55.498 54.686  1.00 350.62 ? 157 VAL A O   1 
ATOM 728  C CB  . VAL A 1 134 ? 23.079  55.524 55.412  1.00 180.43 ? 157 VAL A CB  1 
ATOM 729  C CG1 . VAL A 1 134 ? 22.884  55.866 53.940  1.00 180.43 ? 157 VAL A CG1 1 
ATOM 730  C CG2 . VAL A 1 134 ? 24.321  56.211 55.945  1.00 180.43 ? 157 VAL A CG2 1 
ATOM 731  N N   . TRP A 1 135 ? 20.214  54.179 56.506  1.00 293.09 ? 158 TRP A N   1 
ATOM 732  C CA  . TRP A 1 135 ? 19.074  53.342 56.156  1.00 293.09 ? 158 TRP A CA  1 
ATOM 733  C C   . TRP A 1 135 ? 17.748  53.864 56.709  1.00 293.09 ? 158 TRP A C   1 
ATOM 734  O O   . TRP A 1 135 ? 16.790  54.039 55.958  1.00 350.62 ? 158 TRP A O   1 
ATOM 735  C CB  . TRP A 1 135 ? 19.313  51.917 56.638  1.00 219.61 ? 158 TRP A CB  1 
ATOM 736  N N   . ILE A 1 136 ? 17.687  54.108 58.017  1.00 205.93 ? 159 ILE A N   1 
ATOM 737  C CA  . ILE A 1 136 ? 16.458  54.603 58.635  1.00 205.93 ? 159 ILE A CA  1 
ATOM 738  C C   . ILE A 1 136 ? 16.041  55.959 58.065  1.00 205.93 ? 159 ILE A C   1 
ATOM 739  O O   . ILE A 1 136 ? 14.852  56.254 57.965  1.00 205.93 ? 159 ILE A O   1 
ATOM 740  C CB  . ILE A 1 136 ? 16.592  54.711 60.183  1.00 154.08 ? 159 ILE A CB  1 
ATOM 741  C CG1 . ILE A 1 136 ? 17.764  55.627 60.553  1.00 154.08 ? 159 ILE A CG1 1 
ATOM 742  C CG2 . ILE A 1 136 ? 16.756  53.312 60.788  1.00 154.08 ? 159 ILE A CG2 1 
ATOM 743  C CD1 . ILE A 1 136 ? 17.952  55.821 62.053  1.00 154.08 ? 159 ILE A CD1 1 
ATOM 744  N N   . VAL A 1 137 ? 17.021  56.781 57.697  1.00 156.17 ? 160 VAL A N   1 
ATOM 745  C CA  . VAL A 1 137 ? 16.743  58.090 57.107  1.00 156.17 ? 160 VAL A CA  1 
ATOM 746  C C   . VAL A 1 137 ? 16.394  57.860 55.638  1.00 156.17 ? 160 VAL A C   1 
ATOM 747  O O   . VAL A 1 137 ? 15.848  58.737 54.960  1.00 156.17 ? 160 VAL A O   1 
ATOM 748  C CB  . VAL A 1 137 ? 17.967  59.026 57.199  1.00 166.53 ? 160 VAL A CB  1 
ATOM 749  C CG1 . VAL A 1 137 ? 17.685  60.335 56.472  1.00 166.53 ? 160 VAL A CG1 1 
ATOM 750  C CG2 . VAL A 1 137 ? 18.293  59.298 58.656  1.00 166.53 ? 160 VAL A CG2 1 
ATOM 751  N N   . SER A 1 138 ? 16.730  56.665 55.160  1.00 262.44 ? 161 SER A N   1 
ATOM 752  C CA  . SER A 1 138 ? 16.445  56.260 53.792  1.00 262.44 ? 161 SER A CA  1 
ATOM 753  C C   . SER A 1 138 ? 15.074  55.594 53.840  1.00 262.44 ? 161 SER A C   1 
ATOM 754  O O   . SER A 1 138 ? 14.425  55.388 52.815  1.00 262.44 ? 161 SER A O   1 
ATOM 755  C CB  . SER A 1 138 ? 17.500  55.264 53.302  1.00 241.04 ? 161 SER A CB  1 
ATOM 756  O OG  . SER A 1 138 ? 17.274  54.897 51.954  1.00 241.04 ? 161 SER A OG  1 
ATOM 757  N N   . GLY A 1 139 ? 14.649  55.262 55.057  1.00 262.78 ? 162 GLY A N   1 
ATOM 758  C CA  . GLY A 1 139 ? 13.357  54.635 55.264  1.00 262.78 ? 162 GLY A CA  1 
ATOM 759  C C   . GLY A 1 139 ? 12.328  55.686 55.633  1.00 262.78 ? 162 GLY A C   1 
ATOM 760  O O   . GLY A 1 139 ? 11.155  55.576 55.272  1.00 262.78 ? 162 GLY A O   1 
ATOM 761  N N   . LEU A 1 140 ? 12.771  56.706 56.362  1.00 188.29 ? 163 LEU A N   1 
ATOM 762  C CA  . LEU A 1 140 ? 11.895  57.799 56.765  1.00 188.29 ? 163 LEU A CA  1 
ATOM 763  C C   . LEU A 1 140 ? 11.800  58.773 55.594  1.00 188.29 ? 163 LEU A C   1 
ATOM 764  O O   . LEU A 1 140 ? 11.461  59.943 55.774  1.00 188.29 ? 163 LEU A O   1 
ATOM 765  C CB  . LEU A 1 140 ? 12.456  58.526 57.998  1.00 189.02 ? 163 LEU A CB  1 
ATOM 766  C CG  . LEU A 1 140 ? 12.547  57.784 59.340  1.00 189.02 ? 163 LEU A CG  1 
ATOM 767  C CD1 . LEU A 1 140 ? 13.211  58.682 60.379  1.00 189.02 ? 163 LEU A CD1 1 
ATOM 768  C CD2 . LEU A 1 140 ? 11.159  57.375 59.808  1.00 189.02 ? 163 LEU A CD2 1 
ATOM 769  N N   . THR A 1 141 ? 12.115  58.280 54.397  1.00 171.75 ? 164 THR A N   1 
ATOM 770  C CA  . THR A 1 141 ? 12.067  59.089 53.182  1.00 171.75 ? 164 THR A CA  1 
ATOM 771  C C   . THR A 1 141 ? 11.395  58.314 52.051  1.00 171.75 ? 164 THR A C   1 
ATOM 772  O O   . THR A 1 141 ? 11.248  58.822 50.940  1.00 171.75 ? 164 THR A O   1 
ATOM 773  C CB  . THR A 1 141 ? 13.485  59.509 52.718  1.00 205.67 ? 164 THR A CB  1 
ATOM 774  O OG1 . THR A 1 141 ? 13.378  60.423 51.619  1.00 205.67 ? 164 THR A OG1 1 
ATOM 775  C CG2 . THR A 1 141 ? 14.287  58.296 52.271  1.00 205.67 ? 164 THR A CG2 1 
ATOM 776  N N   . SER A 1 180 ? 10.406  64.468 46.346  1.00 217.58 ? 203 SER A N   1 
ATOM 777  C CA  . SER A 1 180 ? 11.534  63.856 47.038  1.00 217.58 ? 203 SER A CA  1 
ATOM 778  C C   . SER A 1 180 ? 12.748  63.783 46.120  1.00 217.58 ? 203 SER A C   1 
ATOM 779  O O   . SER A 1 180 ? 13.863  63.535 46.573  1.00 217.58 ? 203 SER A O   1 
ATOM 780  C CB  . SER A 1 180 ? 11.160  62.450 47.517  1.00 203.46 ? 203 SER A CB  1 
ATOM 781  O OG  . SER A 1 180 ? 12.219  61.855 48.249  1.00 203.46 ? 203 SER A OG  1 
ATOM 782  N N   . SER A 1 181 ? 12.524  64.000 44.827  1.00 273.74 ? 204 SER A N   1 
ATOM 783  C CA  . SER A 1 181 ? 13.607  63.962 43.850  1.00 273.74 ? 204 SER A CA  1 
ATOM 784  C C   . SER A 1 181 ? 14.642  65.028 44.174  1.00 273.74 ? 204 SER A C   1 
ATOM 785  O O   . SER A 1 181 ? 15.761  64.999 43.662  1.00 273.74 ? 204 SER A O   1 
ATOM 786  C CB  . SER A 1 181 ? 13.062  64.191 42.440  1.00 172.82 ? 204 SER A CB  1 
ATOM 787  O OG  . SER A 1 181 ? 12.149  63.171 42.076  1.00 172.82 ? 204 SER A OG  1 
ATOM 788  N N   . ILE A 1 182 ? 14.256  65.975 45.023  1.00 216.41 ? 205 ILE A N   1 
ATOM 789  C CA  . ILE A 1 182 ? 15.148  67.051 45.432  1.00 216.41 ? 205 ILE A CA  1 
ATOM 790  C C   . ILE A 1 182 ? 15.729  66.738 46.807  1.00 216.41 ? 205 ILE A C   1 
ATOM 791  O O   . ILE A 1 182 ? 16.737  67.313 47.213  1.00 216.41 ? 205 ILE A O   1 
ATOM 792  C CB  . ILE A 1 182 ? 14.401  68.409 45.483  1.00 187.82 ? 205 ILE A CB  1 
ATOM 793  C CG1 . ILE A 1 182 ? 13.973  68.821 44.069  1.00 187.82 ? 205 ILE A CG1 1 
ATOM 794  C CG2 . ILE A 1 182 ? 15.288  69.480 46.105  1.00 187.82 ? 205 ILE A CG2 1 
ATOM 795  C CD1 . ILE A 1 182 ? 15.126  69.024 43.096  1.00 187.82 ? 205 ILE A CD1 1 
ATOM 796  N N   . VAL A 1 183 ? 15.094  65.813 47.517  1.00 198.30 ? 206 VAL A N   1 
ATOM 797  C CA  . VAL A 1 183 ? 15.557  65.424 48.842  1.00 198.30 ? 206 VAL A CA  1 
ATOM 798  C C   . VAL A 1 183 ? 16.415  64.164 48.786  1.00 198.30 ? 206 VAL A C   1 
ATOM 799  O O   . VAL A 1 183 ? 17.504  64.119 49.360  1.00 198.30 ? 206 VAL A O   1 
ATOM 800  C CB  . VAL A 1 183 ? 14.370  65.165 49.802  1.00 169.59 ? 206 VAL A CB  1 
ATOM 801  C CG1 . VAL A 1 183 ? 14.885  64.721 51.169  1.00 169.59 ? 206 VAL A CG1 1 
ATOM 802  C CG2 . VAL A 1 183 ? 13.525  66.425 49.937  1.00 169.59 ? 206 VAL A CG2 1 
ATOM 803  N N   . SER A 1 184 ? 15.922  63.147 48.083  1.00 217.62 ? 207 SER A N   1 
ATOM 804  C CA  . SER A 1 184 ? 16.631  61.877 47.973  1.00 217.62 ? 207 SER A CA  1 
ATOM 805  C C   . SER A 1 184 ? 17.376  61.662 46.656  1.00 217.62 ? 207 SER A C   1 
ATOM 806  O O   . SER A 1 184 ? 17.874  60.566 46.396  1.00 217.62 ? 207 SER A O   1 
ATOM 807  C CB  . SER A 1 184 ? 15.656  60.720 48.203  1.00 199.40 ? 207 SER A CB  1 
ATOM 808  O OG  . SER A 1 184 ? 16.337  59.479 48.212  1.00 199.40 ? 207 SER A OG  1 
ATOM 809  N N   . PHE A 1 185 ? 17.452  62.695 45.822  1.00 252.12 ? 208 PHE A N   1 
ATOM 810  C CA  . PHE A 1 185 ? 18.165  62.580 44.553  1.00 252.12 ? 208 PHE A CA  1 
ATOM 811  C C   . PHE A 1 185 ? 19.021  63.803 44.248  1.00 252.12 ? 208 PHE A C   1 
ATOM 812  O O   . PHE A 1 185 ? 20.243  63.697 44.131  1.00 252.12 ? 208 PHE A O   1 
ATOM 813  C CB  . PHE A 1 185 ? 17.191  62.333 43.396  1.00 179.60 ? 208 PHE A CB  1 
ATOM 814  C CG  . PHE A 1 185 ? 17.832  62.436 42.037  1.00 179.60 ? 208 PHE A CG  1 
ATOM 815  C CD1 . PHE A 1 185 ? 17.873  63.654 41.361  1.00 179.60 ? 208 PHE A CD1 1 
ATOM 816  C CD2 . PHE A 1 185 ? 18.421  61.322 41.446  1.00 179.60 ? 208 PHE A CD2 1 
ATOM 817  C CE1 . PHE A 1 185 ? 18.492  63.762 40.117  1.00 179.60 ? 208 PHE A CE1 1 
ATOM 818  C CE2 . PHE A 1 185 ? 19.042  61.419 40.201  1.00 179.60 ? 208 PHE A CE2 1 
ATOM 819  C CZ  . PHE A 1 185 ? 19.078  62.642 39.536  1.00 179.60 ? 208 PHE A CZ  1 
ATOM 820  N N   . TYR A 1 186 ? 18.382  64.960 44.108  1.00 205.31 ? 209 TYR A N   1 
ATOM 821  C CA  . TYR A 1 186 ? 19.107  66.191 43.818  1.00 205.31 ? 209 TYR A CA  1 
ATOM 822  C C   . TYR A 1 186 ? 20.149  66.443 44.902  1.00 205.31 ? 209 TYR A C   1 
ATOM 823  O O   . TYR A 1 186 ? 21.343  66.292 44.661  1.00 350.62 ? 209 TYR A O   1 
ATOM 824  C CB  . TYR A 1 186 ? 18.139  67.365 43.731  1.00 227.65 ? 209 TYR A CB  1 
ATOM 825  N N   . VAL A 1 187 ? 19.690  66.814 46.096  1.00 288.52 ? 210 VAL A N   1 
ATOM 826  C CA  . VAL A 1 187 ? 20.584  67.084 47.222  1.00 288.52 ? 210 VAL A CA  1 
ATOM 827  C C   . VAL A 1 187 ? 21.770  66.115 47.285  1.00 288.52 ? 210 VAL A C   1 
ATOM 828  O O   . VAL A 1 187 ? 22.924  66.543 47.309  1.00 288.52 ? 210 VAL A O   1 
ATOM 829  C CB  . VAL A 1 187 ? 19.811  67.049 48.579  1.00 150.16 ? 210 VAL A CB  1 
ATOM 830  C CG1 . VAL A 1 187 ? 20.782  67.005 49.748  1.00 150.16 ? 210 VAL A CG1 1 
ATOM 831  C CG2 . VAL A 1 187 ? 18.933  68.280 48.703  1.00 150.16 ? 210 VAL A CG2 1 
ATOM 832  N N   . PRO A 1 188 ? 21.504  64.796 47.303  1.00 219.36 ? 211 PRO A N   1 
ATOM 833  C CA  . PRO A 1 188 ? 22.599  63.821 47.365  1.00 219.36 ? 211 PRO A CA  1 
ATOM 834  C C   . PRO A 1 188 ? 23.517  63.771 46.142  1.00 219.36 ? 211 PRO A C   1 
ATOM 835  O O   . PRO A 1 188 ? 24.645  63.297 46.242  1.00 219.36 ? 211 PRO A O   1 
ATOM 836  C CB  . PRO A 1 188 ? 21.872  62.501 47.611  1.00 202.72 ? 211 PRO A CB  1 
ATOM 837  C CG  . PRO A 1 188 ? 20.564  62.709 46.931  1.00 202.72 ? 211 PRO A CG  1 
ATOM 838  C CD  . PRO A 1 188 ? 20.198  64.113 47.345  1.00 202.72 ? 211 PRO A CD  1 
ATOM 839  N N   . LEU A 1 189 ? 23.040  64.243 44.993  1.00 144.32 ? 212 LEU A N   1 
ATOM 840  C CA  . LEU A 1 189 ? 23.866  64.251 43.785  1.00 144.32 ? 212 LEU A CA  1 
ATOM 841  C C   . LEU A 1 189 ? 24.379  65.660 43.488  1.00 144.32 ? 212 LEU A C   1 
ATOM 842  O O   . LEU A 1 189 ? 25.395  65.829 42.815  1.00 144.32 ? 212 LEU A O   1 
ATOM 843  C CB  . LEU A 1 189 ? 23.085  63.717 42.573  1.00 128.97 ? 212 LEU A CB  1 
ATOM 844  C CG  . LEU A 1 189 ? 23.832  63.735 41.224  1.00 128.97 ? 212 LEU A CG  1 
ATOM 845  C CD1 . LEU A 1 189 ? 23.279  62.645 40.319  1.00 128.97 ? 212 LEU A CD1 1 
ATOM 846  C CD2 . LEU A 1 189 ? 23.729  65.115 40.552  1.00 128.97 ? 212 LEU A CD2 1 
ATOM 847  N N   . VAL A 1 190 ? 23.677  66.668 43.993  1.00 220.74 ? 213 VAL A N   1 
ATOM 848  C CA  . VAL A 1 190 ? 24.081  68.052 43.774  1.00 220.74 ? 213 VAL A CA  1 
ATOM 849  C C   . VAL A 1 190 ? 25.471  68.303 44.361  1.00 220.74 ? 213 VAL A C   1 
ATOM 850  O O   . VAL A 1 190 ? 26.320  68.924 43.719  1.00 220.74 ? 213 VAL A O   1 
ATOM 851  C CB  . VAL A 1 190 ? 23.070  69.042 44.405  1.00 269.28 ? 213 VAL A CB  1 
ATOM 852  C CG1 . VAL A 1 190 ? 23.589  70.466 44.285  1.00 269.28 ? 213 VAL A CG1 1 
ATOM 853  C CG2 . VAL A 1 190 ? 21.723  68.926 43.706  1.00 269.28 ? 213 VAL A CG2 1 
ATOM 854  N N   . ILE A 1 191 ? 25.704  67.816 45.577  1.00 215.78 ? 214 ILE A N   1 
ATOM 855  C CA  . ILE A 1 191 ? 26.998  67.995 46.225  1.00 215.78 ? 214 ILE A CA  1 
ATOM 856  C C   . ILE A 1 191 ? 27.948  66.840 45.923  1.00 215.78 ? 214 ILE A C   1 
ATOM 857  O O   . ILE A 1 191 ? 29.136  67.053 45.688  1.00 215.78 ? 214 ILE A O   1 
ATOM 858  C CB  . ILE A 1 191 ? 26.859  68.124 47.764  1.00 152.55 ? 214 ILE A CB  1 
ATOM 859  C CG1 . ILE A 1 191 ? 26.070  66.934 48.323  1.00 152.55 ? 214 ILE A CG1 1 
ATOM 860  C CG2 . ILE A 1 191 ? 26.207  69.453 48.118  1.00 152.55 ? 214 ILE A CG2 1 
ATOM 861  C CD1 . ILE A 1 191 ? 25.981  66.906 49.843  1.00 152.55 ? 214 ILE A CD1 1 
ATOM 862  N N   . MET A 1 192 ? 27.420  65.620 45.922  1.00 141.96 ? 215 MET A N   1 
ATOM 863  C CA  . MET A 1 192 ? 28.220  64.428 45.659  1.00 141.96 ? 215 MET A CA  1 
ATOM 864  C C   . MET A 1 192 ? 29.089  64.528 44.407  1.00 141.96 ? 215 MET A C   1 
ATOM 865  O O   . MET A 1 192 ? 30.163  63.935 44.353  1.00 141.96 ? 215 MET A O   1 
ATOM 866  C CB  . MET A 1 192 ? 27.310  63.195 45.566  1.00 166.85 ? 215 MET A CB  1 
ATOM 867  C CG  . MET A 1 192 ? 28.019  61.889 45.212  1.00 166.85 ? 215 MET A CG  1 
ATOM 868  S SD  . MET A 1 192 ? 28.248  61.613 43.424  1.00 166.85 ? 215 MET A SD  1 
ATOM 869  C CE  . MET A 1 192 ? 27.372  60.048 43.199  1.00 166.85 ? 215 MET A CE  1 
ATOM 870  N N   . VAL A 1 193 ? 28.636  65.276 43.406  1.00 182.73 ? 216 VAL A N   1 
ATOM 871  C CA  . VAL A 1 193 ? 29.400  65.420 42.167  1.00 182.73 ? 216 VAL A CA  1 
ATOM 872  C C   . VAL A 1 193 ? 30.502  66.474 42.262  1.00 182.73 ? 216 VAL A C   1 
ATOM 873  O O   . VAL A 1 193 ? 31.423  66.491 41.444  1.00 182.73 ? 216 VAL A O   1 
ATOM 874  C CB  . VAL A 1 193 ? 28.475  65.768 40.976  1.00 172.20 ? 216 VAL A CB  1 
ATOM 875  C CG1 . VAL A 1 193 ? 29.297  66.000 39.712  1.00 172.20 ? 216 VAL A CG1 1 
ATOM 876  C CG2 . VAL A 1 193 ? 27.489  64.636 40.747  1.00 172.20 ? 216 VAL A CG2 1 
ATOM 877  N N   . PHE A 1 194 ? 30.417  67.347 43.261  1.00 207.66 ? 217 PHE A N   1 
ATOM 878  C CA  . PHE A 1 194 ? 31.423  68.390 43.435  1.00 207.66 ? 217 PHE A CA  1 
ATOM 879  C C   . PHE A 1 194 ? 32.379  68.100 44.592  1.00 207.66 ? 217 PHE A C   1 
ATOM 880  O O   . PHE A 1 194 ? 33.535  68.529 44.568  1.00 207.66 ? 217 PHE A O   1 
ATOM 881  C CB  . PHE A 1 194 ? 30.742  69.747 43.616  1.00 229.71 ? 217 PHE A CB  1 
ATOM 882  C CG  . PHE A 1 194 ? 29.968  70.192 42.408  1.00 229.71 ? 217 PHE A CG  1 
ATOM 883  C CD1 . PHE A 1 194 ? 28.864  69.467 41.970  1.00 229.71 ? 217 PHE A CD1 1 
ATOM 884  C CD2 . PHE A 1 194 ? 30.359  71.316 41.688  1.00 229.71 ? 217 PHE A CD2 1 
ATOM 885  C CE1 . PHE A 1 194 ? 28.162  69.853 40.833  1.00 229.71 ? 217 PHE A CE1 1 
ATOM 886  C CE2 . PHE A 1 194 ? 29.662  71.711 40.547  1.00 229.71 ? 217 PHE A CE2 1 
ATOM 887  C CZ  . PHE A 1 194 ? 28.561  70.977 40.119  1.00 229.71 ? 217 PHE A CZ  1 
ATOM 888  N N   . VAL A 1 195 ? 31.895  67.381 45.604  1.00 209.50 ? 218 VAL A N   1 
ATOM 889  C CA  . VAL A 1 195 ? 32.738  67.005 46.737  1.00 209.50 ? 218 VAL A CA  1 
ATOM 890  C C   . VAL A 1 195 ? 33.756  66.032 46.154  1.00 209.50 ? 218 VAL A C   1 
ATOM 891  O O   . VAL A 1 195 ? 34.892  65.941 46.619  1.00 209.50 ? 218 VAL A O   1 
ATOM 892  C CB  . VAL A 1 195 ? 31.919  66.307 47.867  1.00 147.24 ? 218 VAL A CB  1 
ATOM 893  C CG1 . VAL A 1 195 ? 32.823  65.434 48.722  1.00 147.24 ? 218 VAL A CG1 1 
ATOM 894  C CG2 . VAL A 1 195 ? 31.265  67.361 48.760  1.00 147.24 ? 218 VAL A CG2 1 
ATOM 895  N N   . TYR A 1 196 ? 33.325  65.313 45.122  1.00 149.02 ? 219 TYR A N   1 
ATOM 896  C CA  . TYR A 1 196 ? 34.182  64.361 44.427  1.00 149.02 ? 219 TYR A CA  1 
ATOM 897  C C   . TYR A 1 196 ? 34.993  65.119 43.368  1.00 149.02 ? 219 TYR A C   1 
ATOM 898  O O   . TYR A 1 196 ? 36.189  64.876 43.200  1.00 149.02 ? 219 TYR A O   1 
ATOM 899  C CB  . TYR A 1 196 ? 33.345  63.273 43.750  1.00 188.33 ? 219 TYR A CB  1 
ATOM 900  C CG  . TYR A 1 196 ? 34.166  62.290 42.942  1.00 188.33 ? 219 TYR A CG  1 
ATOM 901  C CD1 . TYR A 1 196 ? 33.656  61.717 41.778  1.00 188.33 ? 219 TYR A CD1 1 
ATOM 902  C CD2 . TYR A 1 196 ? 35.459  61.938 43.338  1.00 188.33 ? 219 TYR A CD2 1 
ATOM 903  C CE1 . TYR A 1 196 ? 34.412  60.820 41.024  1.00 188.33 ? 219 TYR A CE1 1 
ATOM 904  C CE2 . TYR A 1 196 ? 36.223  61.042 42.593  1.00 188.33 ? 219 TYR A CE2 1 
ATOM 905  C CZ  . TYR A 1 196 ? 35.694  60.490 41.438  1.00 188.33 ? 219 TYR A CZ  1 
ATOM 906  O OH  . TYR A 1 196 ? 36.448  59.615 40.693  1.00 188.33 ? 219 TYR A OH  1 
ATOM 907  N N   . SER A 1 197 ? 34.337  66.031 42.652  1.00 176.02 ? 220 SER A N   1 
ATOM 908  C CA  . SER A 1 197 ? 35.022  66.824 41.636  1.00 176.02 ? 220 SER A CA  1 
ATOM 909  C C   . SER A 1 197 ? 36.253  67.434 42.293  1.00 176.02 ? 220 SER A C   1 
ATOM 910  O O   . SER A 1 197 ? 37.373  67.280 41.802  1.00 176.02 ? 220 SER A O   1 
ATOM 911  C CB  . SER A 1 197 ? 34.116  67.940 41.118  1.00 147.98 ? 220 SER A CB  1 
ATOM 912  O OG  . SER A 1 197 ? 34.808  68.757 40.188  1.00 147.98 ? 220 SER A OG  1 
ATOM 913  N N   . ARG A 1 198 ? 36.033  68.128 43.408  1.00 150.79 ? 221 ARG A N   1 
ATOM 914  C CA  . ARG A 1 198 ? 37.126  68.738 44.154  1.00 150.79 ? 221 ARG A CA  1 
ATOM 915  C C   . ARG A 1 198 ? 38.224  67.687 44.266  1.00 150.79 ? 221 ARG A C   1 
ATOM 916  O O   . ARG A 1 198 ? 39.353  67.911 43.832  1.00 143.87 ? 221 ARG A O   1 
ATOM 917  C CB  . ARG A 1 198 ? 36.660  69.141 45.562  1.00 144.86 ? 221 ARG A CB  1 
ATOM 918  C CG  . ARG A 1 198 ? 37.788  69.572 46.504  1.00 144.86 ? 221 ARG A CG  1 
ATOM 919  C CD  . ARG A 1 198 ? 38.102  71.067 46.434  1.00 144.86 ? 221 ARG A CD  1 
ATOM 920  N NE  . ARG A 1 198 ? 37.152  71.869 47.207  1.00 144.86 ? 221 ARG A NE  1 
ATOM 921  C CZ  . ARG A 1 198 ? 37.232  73.189 47.370  1.00 144.86 ? 221 ARG A CZ  1 
ATOM 922  N NH1 . ARG A 1 198 ? 38.224  73.875 46.815  1.00 144.86 ? 221 ARG A NH1 1 
ATOM 923  N NH2 . ARG A 1 198 ? 36.314  73.827 48.087  1.00 144.86 ? 221 ARG A NH2 1 
ATOM 924  N N   . VAL A 1 199 ? 37.863  66.533 44.829  1.00 141.39 ? 222 VAL A N   1 
ATOM 925  C CA  . VAL A 1 199 ? 38.789  65.416 45.027  1.00 141.39 ? 222 VAL A CA  1 
ATOM 926  C C   . VAL A 1 199 ? 39.537  65.008 43.751  1.00 141.39 ? 222 VAL A C   1 
ATOM 927  O O   . VAL A 1 199 ? 40.737  65.253 43.638  1.00 141.39 ? 222 VAL A O   1 
ATOM 928  C CB  . VAL A 1 199 ? 38.064  64.158 45.617  1.00 109.24 ? 222 VAL A CB  1 
ATOM 929  C CG1 . VAL A 1 199 ? 39.035  62.984 45.697  1.00 109.24 ? 222 VAL A CG1 1 
ATOM 930  C CG2 . VAL A 1 199 ? 37.516  64.460 47.011  1.00 109.24 ? 222 VAL A CG2 1 
ATOM 931  N N   . PHE A 1 200 ? 38.843  64.395 42.795  1.00 149.37 ? 223 PHE A N   1 
ATOM 932  C CA  . PHE A 1 200 ? 39.491  63.969 41.555  1.00 149.37 ? 223 PHE A CA  1 
ATOM 933  C C   . PHE A 1 200 ? 40.422  65.045 41.007  1.00 149.37 ? 223 PHE A C   1 
ATOM 934  O O   . PHE A 1 200 ? 41.335  64.751 40.235  1.00 137.75 ? 223 PHE A O   1 
ATOM 935  C CB  . PHE A 1 200 ? 38.453  63.626 40.481  1.00 162.19 ? 223 PHE A CB  1 
ATOM 936  C CG  . PHE A 1 200 ? 39.050  63.021 39.229  1.00 162.19 ? 223 PHE A CG  1 
ATOM 937  C CD1 . PHE A 1 200 ? 39.330  61.656 39.162  1.00 162.19 ? 223 PHE A CD1 1 
ATOM 938  C CD2 . PHE A 1 200 ? 39.360  63.822 38.130  1.00 162.19 ? 223 PHE A CD2 1 
ATOM 939  C CE1 . PHE A 1 200 ? 39.911  61.096 38.023  1.00 162.19 ? 223 PHE A CE1 1 
ATOM 940  C CE2 . PHE A 1 200 ? 39.942  63.272 36.987  1.00 162.19 ? 223 PHE A CE2 1 
ATOM 941  C CZ  . PHE A 1 200 ? 40.217  61.905 36.934  1.00 162.19 ? 223 PHE A CZ  1 
ATOM 942  N N   . GLN A 1 201 ? 40.189  66.294 41.399  1.00 170.85 ? 224 GLN A N   1 
ATOM 943  C CA  . GLN A 1 201 ? 41.022  67.392 40.925  1.00 170.85 ? 224 GLN A CA  1 
ATOM 944  C C   . GLN A 1 201 ? 42.266  67.627 41.790  1.00 170.85 ? 224 GLN A C   1 
ATOM 945  O O   . GLN A 1 201 ? 43.398  67.489 41.316  1.00 170.85 ? 224 GLN A O   1 
ATOM 946  C CB  . GLN A 1 201 ? 40.199  68.683 40.842  1.00 182.28 ? 224 GLN A CB  1 
ATOM 947  C CG  . GLN A 1 201 ? 39.043  68.644 39.845  1.00 182.28 ? 224 GLN A CG  1 
ATOM 948  C CD  . GLN A 1 201 ? 39.475  68.301 38.424  1.00 182.28 ? 224 GLN A CD  1 
ATOM 949  O OE1 . GLN A 1 201 ? 40.659  68.349 38.087  1.00 182.28 ? 224 GLN A OE1 1 
ATOM 950  N NE2 . GLN A 1 201 ? 38.505  67.964 37.581  1.00 182.28 ? 224 GLN A NE2 1 
ATOM 951  N N   . GLU A 1 202 ? 42.054  67.982 43.055  1.00 166.87 ? 225 GLU A N   1 
ATOM 952  C CA  . GLU A 1 202 ? 43.166  68.244 43.960  1.00 166.87 ? 225 GLU A CA  1 
ATOM 953  C C   . GLU A 1 202 ? 43.944  66.966 44.240  1.00 166.87 ? 225 GLU A C   1 
ATOM 954  O O   . GLU A 1 202 ? 44.891  66.963 45.020  1.00 160.29 ? 225 GLU A O   1 
ATOM 955  C CB  . GLU A 1 202 ? 42.660  68.855 45.270  1.00 148.86 ? 225 GLU A CB  1 
ATOM 956  C CG  . GLU A 1 202 ? 43.756  69.500 46.105  1.00 148.86 ? 225 GLU A CG  1 
ATOM 957  C CD  . GLU A 1 202 ? 43.215  70.325 47.258  1.00 148.86 ? 225 GLU A CD  1 
ATOM 958  O OE1 . GLU A 1 202 ? 42.368  71.214 47.013  1.00 148.86 ? 225 GLU A OE1 1 
ATOM 959  O OE2 . GLU A 1 202 ? 43.644  70.089 48.407  1.00 148.86 ? 225 GLU A OE2 1 
ATOM 960  N N   . ALA A 1 203 ? 43.533  65.878 43.601  1.00 133.54 ? 226 ALA A N   1 
ATOM 961  C CA  . ALA A 1 203 ? 44.211  64.600 43.761  1.00 133.54 ? 226 ALA A CA  1 
ATOM 962  C C   . ALA A 1 203 ? 45.204  64.507 42.616  1.00 133.54 ? 226 ALA A C   1 
ATOM 963  O O   . ALA A 1 203 ? 46.015  63.583 42.549  1.00 133.54 ? 226 ALA A O   1 
ATOM 964  C CB  . ALA A 1 203 ? 43.212  63.459 43.685  1.00 186.28 ? 226 ALA A CB  1 
ATOM 965  N N   . LYS A 1 204 ? 45.116  65.483 41.715  1.00 176.00 ? 227 LYS A N   1 
ATOM 966  C CA  . LYS A 1 204 ? 45.992  65.567 40.551  1.00 176.00 ? 227 LYS A CA  1 
ATOM 967  C C   . LYS A 1 204 ? 47.210  66.425 40.853  1.00 176.00 ? 227 LYS A C   1 
ATOM 968  O O   . LYS A 1 204 ? 48.340  66.040 40.550  1.00 334.91 ? 227 LYS A O   1 
ATOM 969  C CB  . LYS A 1 204 ? 45.236  66.157 39.357  1.00 176.51 ? 227 LYS A CB  1 
ATOM 970  C CG  . LYS A 1 204 ? 44.590  65.119 38.451  1.00 176.51 ? 227 LYS A CG  1 
ATOM 971  C CD  . LYS A 1 204 ? 45.646  64.277 37.745  1.00 176.51 ? 227 LYS A CD  1 
ATOM 972  C CE  . LYS A 1 204 ? 45.023  63.267 36.795  1.00 176.51 ? 227 LYS A CE  1 
ATOM 973  N NZ  . LYS A 1 204 ? 46.060  62.447 36.111  1.00 176.51 ? 227 LYS A NZ  1 
ATOM 974  N N   . ARG A 1 205 ? 46.975  67.593 41.442  1.00 130.52 ? 228 ARG A N   1 
ATOM 975  C CA  . ARG A 1 205 ? 48.068  68.487 41.784  1.00 130.52 ? 228 ARG A CA  1 
ATOM 976  C C   . ARG A 1 205 ? 49.106  67.689 42.557  1.00 130.52 ? 228 ARG A C   1 
ATOM 977  O O   . ARG A 1 205 ? 50.305  67.775 42.282  1.00 263.94 ? 228 ARG A O   1 
ATOM 978  C CB  . ARG A 1 205 ? 47.566  69.662 42.637  1.00 179.90 ? 228 ARG A CB  1 
ATOM 979  C CG  . ARG A 1 205 ? 46.712  70.671 41.879  1.00 179.90 ? 228 ARG A CG  1 
ATOM 980  C CD  . ARG A 1 205 ? 46.470  71.949 42.682  1.00 179.90 ? 228 ARG A CD  1 
ATOM 981  N NE  . ARG A 1 205 ? 45.849  72.989 41.860  1.00 179.90 ? 228 ARG A NE  1 
ATOM 982  C CZ  . ARG A 1 205 ? 45.618  74.236 42.259  1.00 179.90 ? 228 ARG A CZ  1 
ATOM 983  N NH1 . ARG A 1 205 ? 45.953  74.622 43.482  1.00 179.90 ? 228 ARG A NH1 1 
ATOM 984  N NH2 . ARG A 1 205 ? 45.056  75.103 41.429  1.00 179.90 ? 228 ARG A NH2 1 
ATOM 985  N N   . GLN A 1 206 ? 48.636  66.902 43.521  1.00 180.50 ? 229 GLN A N   1 
ATOM 986  C CA  . GLN A 1 206 ? 49.528  66.086 44.335  1.00 180.50 ? 229 GLN A CA  1 
ATOM 987  C C   . GLN A 1 206 ? 50.161  64.981 43.504  1.00 180.50 ? 229 GLN A C   1 
ATOM 988  O O   . GLN A 1 206 ? 51.385  64.864 43.445  1.00 180.50 ? 229 GLN A O   1 
ATOM 989  C CB  . GLN A 1 206 ? 48.773  65.456 45.514  1.00 164.79 ? 229 GLN A CB  1 
ATOM 990  C CG  . GLN A 1 206 ? 49.592  64.398 46.256  1.00 164.79 ? 229 GLN A CG  1 
ATOM 991  C CD  . GLN A 1 206 ? 48.841  63.750 47.400  1.00 164.79 ? 229 GLN A CD  1 
ATOM 992  O OE1 . GLN A 1 206 ? 47.621  63.873 47.506  1.00 164.79 ? 229 GLN A OE1 1 
ATOM 993  N NE2 . GLN A 1 206 ? 49.568  63.040 48.259  1.00 164.79 ? 229 GLN A NE2 1 
ATOM 994  N N   . LEU A 1 207 ? 49.312  64.182 42.865  1.00 209.51 ? 230 LEU A N   1 
ATOM 995  C CA  . LEU A 1 207 ? 49.752  63.058 42.050  1.00 209.51 ? 230 LEU A CA  1 
ATOM 996  C C   . LEU A 1 207 ? 51.161  63.228 41.490  1.00 209.51 ? 230 LEU A C   1 
ATOM 997  O O   . LEU A 1 207 ? 51.917  62.259 41.431  1.00 209.51 ? 230 LEU A O   1 
ATOM 998  C CB  . LEU A 1 207 ? 48.765  62.806 40.909  1.00 138.54 ? 230 LEU A CB  1 
ATOM 999  C CG  . LEU A 1 207 ? 48.929  61.448 40.217  1.00 138.54 ? 230 LEU A CG  1 
ATOM 1000 C CD1 . LEU A 1 207 ? 48.523  60.353 41.184  1.00 138.54 ? 230 LEU A CD1 1 
ATOM 1001 C CD2 . LEU A 1 207 ? 48.085  61.385 38.946  1.00 138.54 ? 230 LEU A CD2 1 
ATOM 1002 N N   . GLN A 1 208 ? 51.525  64.440 41.077  1.00 129.05 ? 231 GLN A N   1 
ATOM 1003 C CA  . GLN A 1 208 ? 52.873  64.636 40.562  1.00 129.05 ? 231 GLN A CA  1 
ATOM 1004 C C   . GLN A 1 208 ? 53.661  65.766 41.219  1.00 129.05 ? 231 GLN A C   1 
ATOM 1005 O O   . GLN A 1 208 ? 54.700  66.190 40.707  1.00 129.05 ? 231 GLN A O   1 
ATOM 1006 C CB  . GLN A 1 208 ? 52.867  64.807 39.040  1.00 179.47 ? 231 GLN A CB  1 
ATOM 1007 C CG  . GLN A 1 208 ? 54.225  64.475 38.372  1.00 179.47 ? 231 GLN A CG  1 
ATOM 1008 C CD  . GLN A 1 208 ? 54.703  63.032 38.614  1.00 179.47 ? 231 GLN A CD  1 
ATOM 1009 O OE1 . GLN A 1 208 ? 54.036  62.246 39.289  1.00 179.47 ? 231 GLN A OE1 1 
ATOM 1010 N NE2 . GLN A 1 208 ? 55.863  62.688 38.058  1.00 179.47 ? 231 GLN A NE2 1 
ATOM 1011 N N   . LYS A 1 209 ? 53.173  66.264 42.351  1.00 133.06 ? 232 LYS A N   1 
ATOM 1012 C CA  . LYS A 1 209 ? 53.923  67.278 43.080  1.00 133.06 ? 232 LYS A CA  1 
ATOM 1013 C C   . LYS A 1 209 ? 54.992  66.369 43.691  1.00 133.06 ? 232 LYS A C   1 
ATOM 1014 O O   . LYS A 1 209 ? 55.877  66.795 44.426  1.00 142.96 ? 232 LYS A O   1 
ATOM 1015 C CB  . LYS A 1 209 ? 53.069  67.917 44.177  1.00 183.23 ? 232 LYS A CB  1 
ATOM 1016 C CG  . LYS A 1 209 ? 53.499  69.334 44.549  1.00 183.23 ? 232 LYS A CG  1 
ATOM 1017 C CD  . LYS A 1 209 ? 54.956  69.399 44.980  1.00 183.23 ? 232 LYS A CD  1 
ATOM 1018 C CE  . LYS A 1 209 ? 55.388  70.831 45.249  1.00 183.23 ? 232 LYS A CE  1 
ATOM 1019 N NZ  . LYS A 1 209 ? 56.807  70.909 45.690  1.00 183.23 ? 232 LYS A NZ  1 
ATOM 1020 N N   . ILE A 1 210 ? 54.851  65.088 43.356  1.00 91.25  ? 233 ILE A N   1 
ATOM 1021 C CA  . ILE A 1 210 ? 55.730  64.000 43.751  1.00 91.25  ? 233 ILE A CA  1 
ATOM 1022 C C   . ILE A 1 210 ? 57.057  64.226 43.057  1.00 91.25  ? 233 ILE A C   1 
ATOM 1023 O O   . ILE A 1 210 ? 57.140  64.993 42.100  1.00 91.25  ? 233 ILE A O   1 
ATOM 1024 C CB  . ILE A 1 210 ? 55.165  62.649 43.252  1.00 59.53  ? 233 ILE A CB  1 
ATOM 1025 C CG1 . ILE A 1 210 ? 53.909  62.299 44.049  1.00 59.53  ? 233 ILE A CG1 1 
ATOM 1026 C CG2 . ILE A 1 210 ? 56.224  61.543 43.341  1.00 59.53  ? 233 ILE A CG2 1 
ATOM 1027 C CD1 . ILE A 1 210 ? 53.250  60.998 43.629  1.00 59.53  ? 233 ILE A CD1 1 
ATOM 1028 N N   . ASP A 1 211 ? 58.091  63.545 43.536  1.00 84.79  ? 234 ASP A N   1 
ATOM 1029 C CA  . ASP A 1 211 ? 59.417  63.657 42.947  1.00 84.79  ? 234 ASP A CA  1 
ATOM 1030 C C   . ASP A 1 211 ? 59.469  62.809 41.689  1.00 84.79  ? 234 ASP A C   1 
ATOM 1031 O O   . ASP A 1 211 ? 59.312  61.591 41.754  1.00 84.79  ? 234 ASP A O   1 
ATOM 1032 C CB  . ASP A 1 211 ? 60.476  63.168 43.932  1.00 133.43 ? 234 ASP A CB  1 
ATOM 1033 C CG  . ASP A 1 211 ? 61.877  63.252 43.365  1.00 133.43 ? 234 ASP A CG  1 
ATOM 1034 O OD1 . ASP A 1 211 ? 62.835  62.933 44.098  1.00 133.43 ? 234 ASP A OD1 1 
ATOM 1035 O OD2 . ASP A 1 211 ? 62.023  63.637 42.184  1.00 133.43 ? 234 ASP A OD2 1 
ATOM 1036 N N   . LYS A 1 212 ? 59.687  63.458 40.550  1.00 83.69  ? 235 LYS A N   1 
ATOM 1037 C CA  . LYS A 1 212 ? 59.754  62.753 39.279  1.00 83.69  ? 235 LYS A CA  1 
ATOM 1038 C C   . LYS A 1 212 ? 60.614  61.500 39.469  1.00 83.69  ? 235 LYS A C   1 
ATOM 1039 O O   . LYS A 1 212 ? 60.170  60.388 39.204  1.00 83.69  ? 235 LYS A O   1 
ATOM 1040 C CB  . LYS A 1 212 ? 60.356  63.666 38.205  1.00 97.11  ? 235 LYS A CB  1 
ATOM 1041 C CG  . LYS A 1 212 ? 59.475  63.912 36.967  1.00 97.11  ? 235 LYS A CG  1 
ATOM 1042 C CD  . LYS A 1 212 ? 58.181  64.678 37.271  1.00 97.11  ? 235 LYS A CD  1 
ATOM 1043 C CE  . LYS A 1 212 ? 57.398  65.041 35.978  1.00 97.11  ? 235 LYS A CE  1 
ATOM 1044 N NZ  . LYS A 1 212 ? 56.920  63.909 35.081  1.00 97.11  ? 235 LYS A NZ  1 
ATOM 1045 N N   . SER A 1 213 ? 61.831  61.694 39.969  1.00 61.69  ? 236 SER A N   1 
ATOM 1046 C CA  . SER A 1 213 ? 62.779  60.604 40.215  1.00 61.69  ? 236 SER A CA  1 
ATOM 1047 C C   . SER A 1 213 ? 62.158  59.368 40.853  1.00 61.69  ? 236 SER A C   1 
ATOM 1048 O O   . SER A 1 213 ? 62.546  58.239 40.559  1.00 61.69  ? 236 SER A O   1 
ATOM 1049 C CB  . SER A 1 213 ? 63.927  61.102 41.101  1.00 83.52  ? 236 SER A CB  1 
ATOM 1050 O OG  . SER A 1 213 ? 64.733  62.046 40.419  1.00 83.52  ? 236 SER A OG  1 
ATOM 1051 N N   . GLU A 1 214 ? 61.204  59.587 41.743  1.00 64.72  ? 237 GLU A N   1 
ATOM 1052 C CA  . GLU A 1 214 ? 60.537  58.486 42.407  1.00 64.72  ? 237 GLU A CA  1 
ATOM 1053 C C   . GLU A 1 214 ? 59.967  57.565 41.333  1.00 64.72  ? 237 GLU A C   1 
ATOM 1054 O O   . GLU A 1 214 ? 59.095  57.973 40.565  1.00 64.72  ? 237 GLU A O   1 
ATOM 1055 C CB  . GLU A 1 214 ? 59.400  59.024 43.281  1.00 106.62 ? 237 GLU A CB  1 
ATOM 1056 C CG  . GLU A 1 214 ? 59.610  58.910 44.786  1.00 106.62 ? 237 GLU A CG  1 
ATOM 1057 C CD  . GLU A 1 214 ? 59.323  57.513 45.333  1.00 106.62 ? 237 GLU A CD  1 
ATOM 1058 O OE1 . GLU A 1 214 ? 59.287  57.354 46.573  1.00 106.62 ? 237 GLU A OE1 1 
ATOM 1059 O OE2 . GLU A 1 214 ? 59.131  56.568 44.537  1.00 106.62 ? 237 GLU A OE2 1 
ATOM 1060 N N   . GLY A 1 215 ? 60.467  56.334 41.265  1.00 57.83  ? 238 GLY A N   1 
ATOM 1061 C CA  . GLY A 1 215 ? 59.942  55.394 40.293  1.00 57.83  ? 238 GLY A CA  1 
ATOM 1062 C C   . GLY A 1 215 ? 60.837  55.113 39.108  1.00 57.83  ? 238 GLY A C   1 
ATOM 1063 O O   . GLY A 1 215 ? 60.604  54.164 38.349  1.00 57.83  ? 238 GLY A O   1 
ATOM 1064 N N   . ARG A 1 216 ? 61.868  55.932 38.944  1.00 63.49  ? 239 ARG A N   1 
ATOM 1065 C CA  . ARG A 1 216 ? 62.782  55.735 37.846  1.00 63.49  ? 239 ARG A CA  1 
ATOM 1066 C C   . ARG A 1 216 ? 64.225  55.790 38.311  1.00 63.49  ? 239 ARG A C   1 
ATOM 1067 O O   . ARG A 1 216 ? 65.144  55.618 37.525  1.00 63.49  ? 239 ARG A O   1 
ATOM 1068 C CB  . ARG A 1 216 ? 62.508  56.765 36.753  1.00 59.57  ? 239 ARG A CB  1 
ATOM 1069 C CG  . ARG A 1 216 ? 62.467  58.198 37.209  1.00 59.57  ? 239 ARG A CG  1 
ATOM 1070 C CD  . ARG A 1 216 ? 61.047  58.726 37.361  1.00 59.57  ? 239 ARG A CD  1 
ATOM 1071 N NE  . ARG A 1 216 ? 60.196  58.511 36.190  1.00 59.57  ? 239 ARG A NE  1 
ATOM 1072 C CZ  . ARG A 1 216 ? 59.089  59.206 35.938  1.00 59.57  ? 239 ARG A CZ  1 
ATOM 1073 N NH1 . ARG A 1 216 ? 58.706  60.161 36.770  1.00 59.57  ? 239 ARG A NH1 1 
ATOM 1074 N NH2 . ARG A 1 216 ? 58.351  58.938 34.870  1.00 59.57  ? 239 ARG A NH2 1 
ATOM 1075 N N   . PHE A 1 217 ? 64.432  56.021 39.596  1.00 89.74  ? 240 PHE A N   1 
ATOM 1076 C CA  . PHE A 1 217 ? 65.785  56.059 40.122  1.00 89.74  ? 240 PHE A CA  1 
ATOM 1077 C C   . PHE A 1 217 ? 65.774  55.625 41.578  1.00 89.74  ? 240 PHE A C   1 
ATOM 1078 O O   . PHE A 1 217 ? 66.816  55.295 42.137  1.00 89.74  ? 240 PHE A O   1 
ATOM 1079 C CB  . PHE A 1 217 ? 66.372  57.462 39.984  1.00 48.01  ? 240 PHE A CB  1 
ATOM 1080 C CG  . PHE A 1 217 ? 66.516  57.911 38.568  1.00 48.01  ? 240 PHE A CG  1 
ATOM 1081 C CD1 . PHE A 1 217 ? 67.602  57.516 37.811  1.00 48.01  ? 240 PHE A CD1 1 
ATOM 1082 C CD2 . PHE A 1 217 ? 65.521  58.681 37.968  1.00 48.01  ? 240 PHE A CD2 1 
ATOM 1083 C CE1 . PHE A 1 217 ? 67.697  57.875 36.477  1.00 48.01  ? 240 PHE A CE1 1 
ATOM 1084 C CE2 . PHE A 1 217 ? 65.599  59.049 36.631  1.00 48.01  ? 240 PHE A CE2 1 
ATOM 1085 C CZ  . PHE A 1 217 ? 66.688  58.645 35.884  1.00 48.01  ? 240 PHE A CZ  1 
ATOM 1086 N N   . HIS A 1 218 ? 64.581  55.628 42.171  1.00 160.60 ? 241 HIS A N   1 
ATOM 1087 C CA  . HIS A 1 218 ? 64.352  55.221 43.559  1.00 160.60 ? 241 HIS A CA  1 
ATOM 1088 C C   . HIS A 1 218 ? 65.646  55.018 44.355  1.00 160.60 ? 241 HIS A C   1 
ATOM 1089 O O   . HIS A 1 218 ? 65.990  55.829 45.222  1.00 160.60 ? 241 HIS A O   1 
ATOM 1090 C CB  . HIS A 1 218 ? 63.525  53.931 43.558  1.00 146.16 ? 241 HIS A CB  1 
ATOM 1091 C CG  . HIS A 1 218 ? 62.538  53.831 44.679  1.00 146.16 ? 241 HIS A CG  1 
ATOM 1092 N ND1 . HIS A 1 218 ? 61.353  53.137 44.560  1.00 146.16 ? 241 HIS A ND1 1 
ATOM 1093 C CD2 . HIS A 1 218 ? 62.563  54.319 45.942  1.00 146.16 ? 241 HIS A CD2 1 
ATOM 1094 C CE1 . HIS A 1 218 ? 60.688  53.203 45.700  1.00 146.16 ? 241 HIS A CE1 1 
ATOM 1095 N NE2 . HIS A 1 218 ? 61.400  53.914 46.556  1.00 146.16 ? 241 HIS A NE2 1 
ATOM 1096 N N   . VAL A 1 219 ? 66.354  53.931 44.048  1.00 207.06 ? 242 VAL A N   1 
ATOM 1097 C CA  . VAL A 1 219 ? 67.616  53.598 44.712  1.00 207.06 ? 242 VAL A CA  1 
ATOM 1098 C C   . VAL A 1 219 ? 68.654  54.712 44.540  1.00 207.06 ? 242 VAL A C   1 
ATOM 1099 O O   . VAL A 1 219 ? 69.486  54.684 43.625  1.00 207.06 ? 242 VAL A O   1 
ATOM 1100 C CB  . VAL A 1 219 ? 68.205  52.274 44.154  1.00 149.37 ? 242 VAL A CB  1 
ATOM 1101 C CG1 . VAL A 1 219 ? 69.431  51.856 44.970  1.00 149.37 ? 242 VAL A CG1 1 
ATOM 1102 C CG2 . VAL A 1 219 ? 67.149  51.183 44.182  1.00 149.37 ? 242 VAL A CG2 1 
ATOM 1103 N N   . PHE A 1 241 ? 49.968  59.440 48.804  1.00 99.74  ? 264 PHE A N   1 
ATOM 1104 C CA  . PHE A 1 241 ? 49.202  59.261 47.569  1.00 99.74  ? 264 PHE A CA  1 
ATOM 1105 C C   . PHE A 1 241 ? 50.108  59.095 46.341  1.00 99.74  ? 264 PHE A C   1 
ATOM 1106 O O   . PHE A 1 241 ? 50.984  59.922 46.083  1.00 155.79 ? 264 PHE A O   1 
ATOM 1107 C CB  . PHE A 1 241 ? 48.264  60.455 47.348  1.00 149.50 ? 264 PHE A CB  1 
ATOM 1108 C CG  . PHE A 1 241 ? 47.302  60.279 46.195  1.00 149.50 ? 264 PHE A CG  1 
ATOM 1109 C CD1 . PHE A 1 241 ? 46.183  59.456 46.319  1.00 149.50 ? 264 PHE A CD1 1 
ATOM 1110 C CD2 . PHE A 1 241 ? 47.509  60.944 44.988  1.00 149.50 ? 264 PHE A CD2 1 
ATOM 1111 C CE1 . PHE A 1 241 ? 45.283  59.300 45.259  1.00 149.50 ? 264 PHE A CE1 1 
ATOM 1112 C CE2 . PHE A 1 241 ? 46.614  60.792 43.921  1.00 149.50 ? 264 PHE A CE2 1 
ATOM 1113 C CZ  . PHE A 1 241 ? 45.499  59.968 44.060  1.00 149.50 ? 264 PHE A CZ  1 
ATOM 1114 N N   . CYS A 1 242 ? 49.884  58.018 45.594  1.00 117.42 ? 265 CYS A N   1 
ATOM 1115 C CA  . CYS A 1 242 ? 50.650  57.728 44.387  1.00 117.42 ? 265 CYS A CA  1 
ATOM 1116 C C   . CYS A 1 242 ? 49.678  57.348 43.272  1.00 117.42 ? 265 CYS A C   1 
ATOM 1117 O O   . CYS A 1 242 ? 48.460  57.315 43.482  1.00 117.42 ? 265 CYS A O   1 
ATOM 1118 C CB  . CYS A 1 242 ? 51.647  56.581 44.631  1.00 171.62 ? 265 CYS A CB  1 
ATOM 1119 S SG  . CYS A 1 242 ? 50.924  54.949 44.991  1.00 171.62 ? 265 CYS A SG  1 
ATOM 1120 N N   . LEU A 1 243 ? 50.218  57.056 42.093  1.00 183.72 ? 266 LEU A N   1 
ATOM 1121 C CA  . LEU A 1 243 ? 49.397  56.689 40.947  1.00 183.72 ? 266 LEU A CA  1 
ATOM 1122 C C   . LEU A 1 243 ? 48.469  55.501 41.209  1.00 183.72 ? 266 LEU A C   1 
ATOM 1123 O O   . LEU A 1 243 ? 47.474  55.320 40.506  1.00 183.72 ? 266 LEU A O   1 
ATOM 1124 C CB  . LEU A 1 243 ? 50.287  56.387 39.742  1.00 145.58 ? 266 LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 243 ? 49.521  56.008 38.474  1.00 145.58 ? 266 LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 243 ? 48.577  57.143 38.087  1.00 145.58 ? 266 LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 243 ? 50.499  55.709 37.352  1.00 145.58 ? 266 LEU A CD2 1 
ATOM 1128 N N   . LYS A 1 244 ? 48.790  54.689 42.213  1.00 169.71 ? 267 LYS A N   1 
ATOM 1129 C CA  . LYS A 1 244 ? 47.956  53.537 42.536  1.00 169.71 ? 267 LYS A CA  1 
ATOM 1130 C C   . LYS A 1 244 ? 46.641  54.025 43.139  1.00 169.71 ? 267 LYS A C   1 
ATOM 1131 O O   . LYS A 1 244 ? 45.567  53.770 42.592  1.00 169.71 ? 267 LYS A O   1 
ATOM 1132 C CB  . LYS A 1 244 ? 48.670  52.609 43.528  1.00 158.51 ? 267 LYS A CB  1 
ATOM 1133 C CG  . LYS A 1 244 ? 48.002  51.237 43.704  1.00 158.51 ? 267 LYS A CG  1 
ATOM 1134 C CD  . LYS A 1 244 ? 46.587  51.350 44.272  1.00 158.51 ? 267 LYS A CD  1 
ATOM 1135 C CE  . LYS A 1 244 ? 45.840  50.032 44.203  1.00 158.51 ? 267 LYS A CE  1 
ATOM 1136 N NZ  . LYS A 1 244 ? 44.401  50.209 44.543  1.00 158.51 ? 267 LYS A NZ  1 
ATOM 1137 N N   . GLU A 1 245 ? 46.733  54.724 44.268  1.00 170.74 ? 268 GLU A N   1 
ATOM 1138 C CA  . GLU A 1 245 ? 45.550  55.247 44.944  1.00 170.74 ? 268 GLU A CA  1 
ATOM 1139 C C   . GLU A 1 245 ? 44.868  56.287 44.057  1.00 170.74 ? 268 GLU A C   1 
ATOM 1140 O O   . GLU A 1 245 ? 43.879  56.911 44.444  1.00 170.74 ? 268 GLU A O   1 
ATOM 1141 C CB  . GLU A 1 245 ? 45.941  55.866 46.291  1.00 162.24 ? 268 GLU A CB  1 
ATOM 1142 C CG  . GLU A 1 245 ? 46.638  54.899 47.246  1.00 162.24 ? 268 GLU A CG  1 
ATOM 1143 C CD  . GLU A 1 245 ? 45.743  53.755 47.702  1.00 162.24 ? 268 GLU A CD  1 
ATOM 1144 O OE1 . GLU A 1 245 ? 45.228  53.014 46.840  1.00 162.24 ? 268 GLU A OE1 1 
ATOM 1145 O OE2 . GLU A 1 245 ? 45.561  53.592 48.928  1.00 162.24 ? 268 GLU A OE2 1 
ATOM 1146 N N   . HIS A 1 246 ? 45.413  56.463 42.859  1.00 172.69 ? 269 HIS A N   1 
ATOM 1147 C CA  . HIS A 1 246 ? 44.874  57.403 41.890  1.00 172.69 ? 269 HIS A CA  1 
ATOM 1148 C C   . HIS A 1 246 ? 43.889  56.640 41.008  1.00 172.69 ? 269 HIS A C   1 
ATOM 1149 O O   . HIS A 1 246 ? 43.050  57.232 40.332  1.00 172.69 ? 269 HIS A O   1 
ATOM 1150 C CB  . HIS A 1 246 ? 46.009  57.979 41.041  1.00 163.83 ? 269 HIS A CB  1 
ATOM 1151 C CG  . HIS A 1 246 ? 45.576  59.055 40.097  1.00 163.83 ? 269 HIS A CG  1 
ATOM 1152 N ND1 . HIS A 1 246 ? 44.998  60.231 40.525  1.00 163.83 ? 269 HIS A ND1 1 
ATOM 1153 C CD2 . HIS A 1 246 ? 45.646  59.138 38.748  1.00 163.83 ? 269 HIS A CD2 1 
ATOM 1154 C CE1 . HIS A 1 246 ? 44.731  60.993 39.479  1.00 163.83 ? 269 HIS A CE1 1 
ATOM 1155 N NE2 . HIS A 1 246 ? 45.115  60.354 38.389  1.00 163.83 ? 269 HIS A NE2 1 
ATOM 1156 N N   . LYS A 1 247 ? 44.009  55.316 41.029  1.00 138.93 ? 270 LYS A N   1 
ATOM 1157 C CA  . LYS A 1 247 ? 43.140  54.438 40.256  1.00 138.93 ? 270 LYS A CA  1 
ATOM 1158 C C   . LYS A 1 247 ? 42.017  53.911 41.147  1.00 138.93 ? 270 LYS A C   1 
ATOM 1159 O O   . LYS A 1 247 ? 40.970  53.490 40.659  1.00 333.43 ? 270 LYS A O   1 
ATOM 1160 C CB  . LYS A 1 247 ? 43.945  53.270 39.680  1.00 159.32 ? 270 LYS A CB  1 
ATOM 1161 C CG  . LYS A 1 247 ? 44.992  53.690 38.663  1.00 159.32 ? 270 LYS A CG  1 
ATOM 1162 C CD  . LYS A 1 247 ? 44.347  54.341 37.445  1.00 159.32 ? 270 LYS A CD  1 
ATOM 1163 C CE  . LYS A 1 247 ? 45.389  54.770 36.418  1.00 159.32 ? 270 LYS A CE  1 
ATOM 1164 N NZ  . LYS A 1 247 ? 44.769  55.369 35.201  1.00 159.32 ? 270 LYS A NZ  1 
ATOM 1165 N N   . ALA A 1 248 ? 42.246  53.928 42.457  1.00 159.73 ? 271 ALA A N   1 
ATOM 1166 C CA  . ALA A 1 248 ? 41.241  53.474 43.413  1.00 159.73 ? 271 ALA A CA  1 
ATOM 1167 C C   . ALA A 1 248 ? 40.107  54.494 43.401  1.00 159.73 ? 271 ALA A C   1 
ATOM 1168 O O   . ALA A 1 248 ? 38.993  54.218 43.842  1.00 159.73 ? 271 ALA A O   1 
ATOM 1169 C CB  . ALA A 1 248 ? 41.852  53.372 44.808  1.00 117.66 ? 271 ALA A CB  1 
ATOM 1170 N N   . LEU A 1 249 ? 40.416  55.687 42.902  1.00 172.69 ? 272 LEU A N   1 
ATOM 1171 C CA  . LEU A 1 249 ? 39.435  56.756 42.796  1.00 172.69 ? 272 LEU A CA  1 
ATOM 1172 C C   . LEU A 1 249 ? 38.902  56.709 41.373  1.00 172.69 ? 272 LEU A C   1 
ATOM 1173 O O   . LEU A 1 249 ? 38.032  57.492 40.993  1.00 172.69 ? 272 LEU A O   1 
ATOM 1174 C CB  . LEU A 1 249 ? 40.079  58.115 43.081  1.00 130.55 ? 272 LEU A CB  1 
ATOM 1175 C CG  . LEU A 1 249 ? 40.540  58.363 44.522  1.00 130.55 ? 272 LEU A CG  1 
ATOM 1176 C CD1 . LEU A 1 249 ? 41.245  59.708 44.611  1.00 130.55 ? 272 LEU A CD1 1 
ATOM 1177 C CD2 . LEU A 1 249 ? 39.341  58.330 45.460  1.00 130.55 ? 272 LEU A CD2 1 
ATOM 1178 N N   . LYS A 1 250 ? 39.453  55.786 40.588  1.00 118.51 ? 273 LYS A N   1 
ATOM 1179 C CA  . LYS A 1 250 ? 39.027  55.571 39.208  1.00 118.51 ? 273 LYS A CA  1 
ATOM 1180 C C   . LYS A 1 250 ? 37.913  54.540 39.293  1.00 118.51 ? 273 LYS A C   1 
ATOM 1181 O O   . LYS A 1 250 ? 36.906  54.623 38.588  1.00 235.40 ? 273 LYS A O   1 
ATOM 1182 C CB  . LYS A 1 250 ? 40.178  55.010 38.364  1.00 170.85 ? 273 LYS A CB  1 
ATOM 1183 C CG  . LYS A 1 250 ? 39.742  54.405 37.028  1.00 170.85 ? 273 LYS A CG  1 
ATOM 1184 C CD  . LYS A 1 250 ? 40.887  53.648 36.349  1.00 170.85 ? 273 LYS A CD  1 
ATOM 1185 C CE  . LYS A 1 250 ? 40.425  52.929 35.081  1.00 170.85 ? 273 LYS A CE  1 
ATOM 1186 N NZ  . LYS A 1 250 ? 39.372  51.907 35.348  1.00 170.85 ? 273 LYS A NZ  1 
ATOM 1187 N N   . THR A 1 251 ? 38.118  53.565 40.176  1.00 186.64 ? 274 THR A N   1 
ATOM 1188 C CA  . THR A 1 251 ? 37.153  52.498 40.406  1.00 186.64 ? 274 THR A CA  1 
ATOM 1189 C C   . THR A 1 251 ? 35.923  53.097 41.090  1.00 186.64 ? 274 THR A C   1 
ATOM 1190 O O   . THR A 1 251 ? 34.786  52.759 40.754  1.00 186.64 ? 274 THR A O   1 
ATOM 1191 C CB  . THR A 1 251 ? 37.779  51.367 41.280  1.00 162.19 ? 274 THR A CB  1 
ATOM 1192 O OG1 . THR A 1 251 ? 36.795  50.365 41.552  1.00 162.19 ? 274 THR A OG1 1 
ATOM 1193 C CG2 . THR A 1 251 ? 38.305  51.911 42.590  1.00 162.19 ? 274 THR A CG2 1 
ATOM 1194 N N   . LEU A 1 252 ? 36.163  53.998 42.042  1.00 171.47 ? 275 LEU A N   1 
ATOM 1195 C CA  . LEU A 1 252 ? 35.087  54.680 42.761  1.00 171.47 ? 275 LEU A CA  1 
ATOM 1196 C C   . LEU A 1 252 ? 34.637  55.874 41.918  1.00 171.47 ? 275 LEU A C   1 
ATOM 1197 O O   . LEU A 1 252 ? 33.638  56.520 42.225  1.00 171.47 ? 275 LEU A O   1 
ATOM 1198 C CB  . LEU A 1 252 ? 35.573  55.182 44.130  1.00 159.44 ? 275 LEU A CB  1 
ATOM 1199 C CG  . LEU A 1 252 ? 36.020  54.172 45.195  1.00 159.44 ? 275 LEU A CG  1 
ATOM 1200 C CD1 . LEU A 1 252 ? 36.574  54.923 46.402  1.00 159.44 ? 275 LEU A CD1 1 
ATOM 1201 C CD2 . LEU A 1 252 ? 34.850  53.289 45.608  1.00 159.44 ? 275 LEU A CD2 1 
ATOM 1202 N N   . GLY A 1 253 ? 35.387  56.153 40.854  1.00 180.63 ? 276 GLY A N   1 
ATOM 1203 C CA  . GLY A 1 253 ? 35.072  57.267 39.976  1.00 180.63 ? 276 GLY A CA  1 
ATOM 1204 C C   . GLY A 1 253 ? 34.130  56.904 38.846  1.00 180.63 ? 276 GLY A C   1 
ATOM 1205 O O   . GLY A 1 253 ? 33.599  57.782 38.163  1.00 180.63 ? 276 GLY A O   1 
ATOM 1206 N N   . ILE A 1 254 ? 33.935  55.606 38.636  1.00 194.57 ? 277 ILE A N   1 
ATOM 1207 C CA  . ILE A 1 254 ? 33.029  55.140 37.597  1.00 194.57 ? 277 ILE A CA  1 
ATOM 1208 C C   . ILE A 1 254 ? 31.780  54.566 38.258  1.00 194.57 ? 277 ILE A C   1 
ATOM 1209 O O   . ILE A 1 254 ? 30.707  54.545 37.658  1.00 338.86 ? 277 ILE A O   1 
ATOM 1210 C CB  . ILE A 1 254 ? 33.684  54.065 36.703  1.00 149.66 ? 277 ILE A CB  1 
ATOM 1211 C CG1 . ILE A 1 254 ? 34.142  52.879 37.554  1.00 149.66 ? 277 ILE A CG1 1 
ATOM 1212 C CG2 . ILE A 1 254 ? 34.843  54.680 35.929  1.00 149.66 ? 277 ILE A CG2 1 
ATOM 1213 C CD1 . ILE A 1 254 ? 34.589  51.682 36.742  1.00 149.66 ? 277 ILE A CD1 1 
ATOM 1214 N N   . ILE A 1 255 ? 31.927  54.103 39.498  1.00 143.26 ? 278 ILE A N   1 
ATOM 1215 C CA  . ILE A 1 255 ? 30.798  53.555 40.246  1.00 143.26 ? 278 ILE A CA  1 
ATOM 1216 C C   . ILE A 1 255 ? 29.844  54.704 40.565  1.00 143.26 ? 278 ILE A C   1 
ATOM 1217 O O   . ILE A 1 255 ? 28.637  54.508 40.709  1.00 143.26 ? 278 ILE A O   1 
ATOM 1218 C CB  . ILE A 1 255 ? 31.256  52.893 41.571  1.00 152.62 ? 278 ILE A CB  1 
ATOM 1219 C CG1 . ILE A 1 255 ? 30.040  52.402 42.360  1.00 152.62 ? 278 ILE A CG1 1 
ATOM 1220 C CG2 . ILE A 1 255 ? 32.034  53.884 42.406  1.00 152.62 ? 278 ILE A CG2 1 
ATOM 1221 C CD1 . ILE A 1 255 ? 30.387  51.696 43.651  1.00 152.62 ? 278 ILE A CD1 1 
ATOM 1222 N N   . MET A 1 256 ? 30.407  55.903 40.681  1.00 187.71 ? 279 MET A N   1 
ATOM 1223 C CA  . MET A 1 256 ? 29.628  57.105 40.951  1.00 187.71 ? 279 MET A CA  1 
ATOM 1224 C C   . MET A 1 256 ? 29.309  57.731 39.595  1.00 187.71 ? 279 MET A C   1 
ATOM 1225 O O   . MET A 1 256 ? 28.438  58.594 39.485  1.00 187.71 ? 279 MET A O   1 
ATOM 1226 C CB  . MET A 1 256 ? 30.433  58.100 41.802  1.00 190.39 ? 279 MET A CB  1 
ATOM 1227 C CG  . MET A 1 256 ? 30.927  57.554 43.143  1.00 190.39 ? 279 MET A CG  1 
ATOM 1228 S SD  . MET A 1 256 ? 31.628  58.817 44.259  1.00 190.39 ? 279 MET A SD  1 
ATOM 1229 C CE  . MET A 1 256 ? 33.378  58.424 44.236  1.00 190.39 ? 279 MET A CE  1 
ATOM 1230 N N   . GLY A 1 257 ? 30.024  57.279 38.566  1.00 180.27 ? 280 GLY A N   1 
ATOM 1231 C CA  . GLY A 1 257 ? 29.827  57.793 37.221  1.00 180.27 ? 280 GLY A CA  1 
ATOM 1232 C C   . GLY A 1 257 ? 28.955  56.911 36.344  1.00 180.27 ? 280 GLY A C   1 
ATOM 1233 O O   . GLY A 1 257 ? 28.763  57.197 35.161  1.00 180.27 ? 280 GLY A O   1 
ATOM 1234 N N   . THR A 1 258 ? 28.434  55.831 36.918  1.00 212.83 ? 281 THR A N   1 
ATOM 1235 C CA  . THR A 1 258 ? 27.562  54.915 36.188  1.00 212.83 ? 281 THR A CA  1 
ATOM 1236 C C   . THR A 1 258 ? 26.175  54.968 36.815  1.00 212.83 ? 281 THR A C   1 
ATOM 1237 O O   . THR A 1 258 ? 25.164  54.793 36.138  1.00 212.83 ? 281 THR A O   1 
ATOM 1238 C CB  . THR A 1 258 ? 28.071  53.463 36.260  1.00 157.24 ? 281 THR A CB  1 
ATOM 1239 O OG1 . THR A 1 258 ? 27.193  52.613 35.511  1.00 157.24 ? 281 THR A OG1 1 
ATOM 1240 C CG2 . THR A 1 258 ? 28.120  52.983 37.709  1.00 157.24 ? 281 THR A CG2 1 
ATOM 1241 N N   . PHE A 1 259 ? 26.144  55.216 38.119  1.00 145.61 ? 282 PHE A N   1 
ATOM 1242 C CA  . PHE A 1 259 ? 24.901  55.305 38.869  1.00 145.61 ? 282 PHE A CA  1 
ATOM 1243 C C   . PHE A 1 259 ? 24.231  56.632 38.548  1.00 145.61 ? 282 PHE A C   1 
ATOM 1244 O O   . PHE A 1 259 ? 23.134  56.913 39.022  1.00 145.61 ? 282 PHE A O   1 
ATOM 1245 C CB  . PHE A 1 259 ? 25.192  55.225 40.368  1.00 192.22 ? 282 PHE A CB  1 
ATOM 1246 C CG  . PHE A 1 259 ? 23.979  54.962 41.212  1.00 192.22 ? 282 PHE A CG  1 
ATOM 1247 C CD1 . PHE A 1 259 ? 23.326  53.733 41.149  1.00 192.22 ? 282 PHE A CD1 1 
ATOM 1248 C CD2 . PHE A 1 259 ? 23.493  55.939 42.082  1.00 192.22 ? 282 PHE A CD2 1 
ATOM 1249 C CE1 . PHE A 1 259 ? 22.207  53.478 41.942  1.00 192.22 ? 282 PHE A CE1 1 
ATOM 1250 C CE2 . PHE A 1 259 ? 22.374  55.696 42.880  1.00 192.22 ? 282 PHE A CE2 1 
ATOM 1251 C CZ  . PHE A 1 259 ? 21.730  54.463 42.810  1.00 192.22 ? 282 PHE A CZ  1 
ATOM 1252 N N   . THR A 1 260 ? 24.904  57.452 37.748  1.00 232.48 ? 283 THR A N   1 
ATOM 1253 C CA  . THR A 1 260 ? 24.358  58.744 37.361  1.00 232.48 ? 283 THR A CA  1 
ATOM 1254 C C   . THR A 1 260 ? 23.685  58.614 35.999  1.00 232.48 ? 283 THR A C   1 
ATOM 1255 O O   . THR A 1 260 ? 22.577  59.109 35.801  1.00 232.48 ? 283 THR A O   1 
ATOM 1256 C CB  . THR A 1 260 ? 25.457  59.828 37.294  1.00 165.21 ? 283 THR A CB  1 
ATOM 1257 O OG1 . THR A 1 260 ? 24.886  61.071 36.863  1.00 165.21 ? 283 THR A OG1 1 
ATOM 1258 C CG2 . THR A 1 260 ? 26.550  59.420 36.328  1.00 165.21 ? 283 THR A CG2 1 
ATOM 1259 N N   . LEU A 1 261 ? 24.346  57.937 35.064  1.00 206.78 ? 284 LEU A N   1 
ATOM 1260 C CA  . LEU A 1 261 ? 23.778  57.751 33.733  1.00 206.78 ? 284 LEU A CA  1 
ATOM 1261 C C   . LEU A 1 261 ? 22.782  56.598 33.691  1.00 206.78 ? 284 LEU A C   1 
ATOM 1262 O O   . LEU A 1 261 ? 22.273  56.243 32.625  1.00 206.78 ? 284 LEU A O   1 
ATOM 1263 C CB  . LEU A 1 261 ? 24.880  57.516 32.693  1.00 141.00 ? 284 LEU A CB  1 
ATOM 1264 C CG  . LEU A 1 261 ? 25.495  58.766 32.057  1.00 141.00 ? 284 LEU A CG  1 
ATOM 1265 C CD1 . LEU A 1 261 ? 26.206  59.596 33.114  1.00 141.00 ? 284 LEU A CD1 1 
ATOM 1266 C CD2 . LEU A 1 261 ? 26.466  58.354 30.963  1.00 141.00 ? 284 LEU A CD2 1 
ATOM 1267 N N   . CYS A 1 262 ? 22.500  56.019 34.855  1.00 252.51 ? 285 CYS A N   1 
ATOM 1268 C CA  . CYS A 1 262 ? 21.557  54.911 34.945  1.00 252.51 ? 285 CYS A CA  1 
ATOM 1269 C C   . CYS A 1 262 ? 20.254  55.324 35.634  1.00 252.51 ? 285 CYS A C   1 
ATOM 1270 O O   . CYS A 1 262 ? 19.188  54.780 35.336  1.00 252.51 ? 285 CYS A O   1 
ATOM 1271 C CB  . CYS A 1 262 ? 22.196  53.737 35.697  1.00 219.71 ? 285 CYS A CB  1 
ATOM 1272 S SG  . CYS A 1 262 ? 23.584  52.949 34.835  1.00 219.71 ? 285 CYS A SG  1 
ATOM 1273 N N   . TRP A 1 263 ? 20.343  56.289 36.549  1.00 189.11 ? 286 TRP A N   1 
ATOM 1274 C CA  . TRP A 1 263 ? 19.171  56.766 37.279  1.00 189.08 ? 286 TRP A CA  1 
ATOM 1275 C C   . TRP A 1 263 ? 18.901  58.254 37.066  1.00 189.36 ? 286 TRP A C   1 
ATOM 1276 O O   . TRP A 1 263 ? 18.221  58.892 37.871  1.00 189.47 ? 286 TRP A O   1 
ATOM 1277 C CB  . TRP A 1 263 ? 19.317  56.496 38.777  1.00 213.52 ? 286 TRP A CB  1 
ATOM 1278 C CG  . TRP A 1 263 ? 19.316  55.040 39.131  1.00 213.10 ? 286 TRP A CG  1 
ATOM 1279 C CD1 . TRP A 1 263 ? 20.367  54.176 39.038  1.00 212.58 ? 286 TRP A CD1 1 
ATOM 1280 C CD2 . TRP A 1 263 ? 18.215  54.281 39.647  1.00 212.91 ? 286 TRP A CD2 1 
ATOM 1281 N NE1 . TRP A 1 263 ? 19.993  52.926 39.470  1.00 212.65 ? 286 TRP A NE1 1 
ATOM 1282 C CE2 . TRP A 1 263 ? 18.677  52.961 39.848  1.00 212.62 ? 286 TRP A CE2 1 
ATOM 1283 C CE3 . TRP A 1 263 ? 16.883  54.586 39.960  1.00 213.33 ? 286 TRP A CE3 1 
ATOM 1284 C CZ2 . TRP A 1 263 ? 17.854  51.944 40.348  1.00 213.40 ? 286 TRP A CZ2 1 
ATOM 1285 C CZ3 . TRP A 1 263 ? 16.063  53.572 40.458  1.00 213.09 ? 286 TRP A CZ3 1 
ATOM 1286 C CH2 . TRP A 1 263 ? 16.555  52.268 40.646  1.00 212.95 ? 286 TRP A CH2 1 
ATOM 1287 N N   . LEU A 1 264 ? 19.437  58.817 35.991  1.00 271.00 ? 287 LEU A N   1 
ATOM 1288 C CA  . LEU A 1 264 ? 19.190  60.225 35.713  1.00 271.27 ? 287 LEU A CA  1 
ATOM 1289 C C   . LEU A 1 264 ? 18.041  60.301 34.709  1.00 271.40 ? 287 LEU A C   1 
ATOM 1290 O O   . LEU A 1 264 ? 17.086  61.045 34.926  1.00 271.57 ? 287 LEU A O   1 
ATOM 1291 C CB  . LEU A 1 264 ? 20.433  60.913 35.139  1.00 165.29 ? 287 LEU A CB  1 
ATOM 1292 C CG  . LEU A 1 264 ? 20.748  62.321 35.652  1.00 166.14 ? 287 LEU A CG  1 
ATOM 1293 C CD1 . LEU A 1 264 ? 21.732  62.988 34.697  1.00 166.69 ? 287 LEU A CD1 1 
ATOM 1294 C CD2 . LEU A 1 264 ? 19.480  63.155 35.766  1.00 166.08 ? 287 LEU A CD2 1 
ATOM 1295 N N   . PRO A 1 265 ? 18.120  59.542 33.593  1.00 270.30 ? 288 PRO A N   1 
ATOM 1296 C CA  . PRO A 1 265 ? 17.028  59.589 32.610  1.00 270.41 ? 288 PRO A CA  1 
ATOM 1297 C C   . PRO A 1 265 ? 15.688  59.203 33.232  1.00 270.74 ? 288 PRO A C   1 
ATOM 1298 O O   . PRO A 1 265 ? 14.631  59.335 32.610  1.00 270.66 ? 288 PRO A O   1 
ATOM 1299 C CB  . PRO A 1 265 ? 17.475  58.585 31.563  1.00 196.01 ? 288 PRO A CB  1 
ATOM 1300 C CG  . PRO A 1 265 ? 18.959  58.737 31.574  1.00 195.85 ? 288 PRO A CG  1 
ATOM 1301 C CD  . PRO A 1 265 ? 19.273  58.787 33.058  1.00 195.93 ? 288 PRO A CD  1 
ATOM 1302 N N   . PHE A 1 266 ? 15.748  58.701 34.457  1.00 245.60 ? 289 PHE A N   1 
ATOM 1303 C CA  . PHE A 1 266 ? 14.554  58.278 35.159  1.00 245.92 ? 289 PHE A CA  1 
ATOM 1304 C C   . PHE A 1 266 ? 14.062  59.385 36.078  1.00 246.47 ? 289 PHE A C   1 
ATOM 1305 O O   . PHE A 1 266 ? 12.862  59.628 36.174  1.00 246.45 ? 289 PHE A O   1 
ATOM 1306 C CB  . PHE A 1 266 ? 14.845  56.979 35.933  1.00 189.39 ? 289 PHE A CB  1 
ATOM 1307 C CG  . PHE A 1 266 ? 13.716  56.531 36.830  1.00 189.31 ? 289 PHE A CG  1 
ATOM 1308 C CD1 . PHE A 1 266 ? 13.663  56.951 38.155  1.00 188.98 ? 289 PHE A CD1 1 
ATOM 1309 C CD2 . PHE A 1 266 ? 12.698  55.707 36.352  1.00 188.92 ? 289 PHE A CD2 1 
ATOM 1310 C CE1 . PHE A 1 266 ? 12.623  56.559 38.991  1.00 189.37 ? 289 PHE A CE1 1 
ATOM 1311 C CE2 . PHE A 1 266 ? 11.651  55.310 37.184  1.00 189.42 ? 289 PHE A CE2 1 
ATOM 1312 C CZ  . PHE A 1 266 ? 11.617  55.740 38.507  1.00 189.56 ? 289 PHE A CZ  1 
ATOM 1313 N N   . PHE A 1 267 ? 14.990  60.064 36.743  1.00 228.90 ? 290 PHE A N   1 
ATOM 1314 C CA  . PHE A 1 267 ? 14.623  61.150 37.639  1.00 229.75 ? 290 PHE A CA  1 
ATOM 1315 C C   . PHE A 1 267 ? 14.426  62.457 36.876  1.00 230.34 ? 290 PHE A C   1 
ATOM 1316 O O   . PHE A 1 267 ? 14.048  63.470 37.464  1.00 230.44 ? 290 PHE A O   1 
ATOM 1317 C CB  . PHE A 1 267 ? 15.690  61.337 38.724  1.00 219.91 ? 290 PHE A CB  1 
ATOM 1318 C CG  . PHE A 1 267 ? 15.647  60.299 39.823  1.00 219.80 ? 290 PHE A CG  1 
ATOM 1319 C CD1 . PHE A 1 267 ? 16.058  58.989 39.592  1.00 219.80 ? 290 PHE A CD1 1 
ATOM 1320 C CD2 . PHE A 1 267 ? 15.220  60.645 41.104  1.00 219.62 ? 290 PHE A CD2 1 
ATOM 1321 C CE1 . PHE A 1 267 ? 16.049  58.038 40.622  1.00 220.21 ? 290 PHE A CE1 1 
ATOM 1322 C CE2 . PHE A 1 267 ? 15.207  59.702 42.140  1.00 220.17 ? 290 PHE A CE2 1 
ATOM 1323 C CZ  . PHE A 1 267 ? 15.623  58.399 41.896  1.00 219.92 ? 290 PHE A CZ  1 
ATOM 1324 N N   . ILE A 1 268 ? 14.690  62.424 35.570  1.00 250.94 ? 291 ILE A N   1 
ATOM 1325 C CA  . ILE A 1 268 ? 14.526  63.600 34.717  1.00 252.02 ? 291 ILE A CA  1 
ATOM 1326 C C   . ILE A 1 268 ? 13.087  63.696 34.228  1.00 252.88 ? 291 ILE A C   1 
ATOM 1327 O O   . ILE A 1 268 ? 12.547  64.787 34.070  1.00 253.14 ? 291 ILE A O   1 
ATOM 1328 C CB  . ILE A 1 268 ? 15.466  63.565 33.475  1.00 186.73 ? 291 ILE A CB  1 
ATOM 1329 C CG1 . ILE A 1 268 ? 16.902  63.874 33.891  1.00 186.60 ? 291 ILE A CG1 1 
ATOM 1330 C CG2 . ILE A 1 268 ? 14.996  64.585 32.431  1.00 186.34 ? 291 ILE A CG2 1 
ATOM 1331 C CD1 . ILE A 1 268 ? 17.884  63.996 32.724  1.00 186.84 ? 291 ILE A CD1 1 
ATOM 1332 N N   . LEU A 1 288 ? 12.586  53.129 30.954  1.00 206.97 ? 311 LEU A N   1 
ATOM 1333 C CA  . LEU A 1 288 ? 13.819  53.639 31.546  1.00 205.96 ? 311 LEU A CA  1 
ATOM 1334 C C   . LEU A 1 288 ? 13.952  53.231 33.010  1.00 205.27 ? 311 LEU A C   1 
ATOM 1335 O O   . LEU A 1 288 ? 14.987  53.472 33.634  1.00 205.17 ? 311 LEU A O   1 
ATOM 1336 C CB  . LEU A 1 288 ? 13.871  55.165 31.436  1.00 172.69 ? 311 LEU A CB  1 
ATOM 1337 C CG  . LEU A 1 288 ? 13.763  55.788 30.042  1.00 172.90 ? 311 LEU A CG  1 
ATOM 1338 C CD1 . LEU A 1 288 ? 13.970  57.290 30.164  1.00 173.03 ? 311 LEU A CD1 1 
ATOM 1339 C CD2 . LEU A 1 288 ? 14.798  55.186 29.102  1.00 173.22 ? 311 LEU A CD2 1 
ATOM 1340 N N   . ASN A 1 289 ? 12.903  52.622 33.559  1.00 241.13 ? 312 ASN A N   1 
ATOM 1341 C CA  . ASN A 1 289 ? 12.930  52.178 34.949  1.00 240.41 ? 312 ASN A CA  1 
ATOM 1342 C C   . ASN A 1 289 ? 13.726  50.874 35.012  1.00 240.06 ? 312 ASN A C   1 
ATOM 1343 O O   . ASN A 1 289 ? 14.124  50.422 36.087  1.00 240.22 ? 312 ASN A O   1 
ATOM 1344 C CB  . ASN A 1 289 ? 11.505  51.953 35.469  1.00 185.81 ? 312 ASN A CB  1 
ATOM 1345 C CG  . ASN A 1 289 ? 11.438  51.881 36.991  1.00 185.59 ? 312 ASN A CG  1 
ATOM 1346 O OD1 . ASN A 1 289 ? 10.853  52.747 37.640  1.00 185.26 ? 312 ASN A OD1 1 
ATOM 1347 N ND2 . ASN A 1 289 ? 12.038  50.844 37.563  1.00 185.13 ? 312 ASN A ND2 1 
ATOM 1348 N N   . TRP A 1 290 ? 13.954  50.277 33.844  1.00 222.72 ? 313 TRP A N   1 
ATOM 1349 C CA  . TRP A 1 290 ? 14.710  49.035 33.746  1.00 222.12 ? 313 TRP A CA  1 
ATOM 1350 C C   . TRP A 1 290 ? 16.203  49.341 33.651  1.00 221.63 ? 313 TRP A C   1 
ATOM 1351 O O   . TRP A 1 290 ? 17.038  48.531 34.054  1.00 221.62 ? 313 TRP A O   1 
ATOM 1352 C CB  . TRP A 1 290 ? 14.258  48.242 32.522  1.00 170.59 ? 313 TRP A CB  1 
ATOM 1353 N N   . ILE A 1 291 ? 16.538  50.513 33.117  1.00 262.57 ? 314 ILE A N   1 
ATOM 1354 C CA  . ILE A 1 291 ? 17.937  50.921 32.981  1.00 262.10 ? 314 ILE A CA  1 
ATOM 1355 C C   . ILE A 1 291 ? 18.548  51.131 34.365  1.00 261.87 ? 314 ILE A C   1 
ATOM 1356 O O   . ILE A 1 291 ? 19.734  50.889 34.571  1.00 261.74 ? 314 ILE A O   1 
ATOM 1357 C CB  . ILE A 1 291 ? 18.065  52.234 32.183  1.00 159.15 ? 314 ILE A CB  1 
ATOM 1358 C CG1 . ILE A 1 291 ? 17.437  52.068 30.799  1.00 158.78 ? 314 ILE A CG1 1 
ATOM 1359 C CG2 . ILE A 1 291 ? 19.532  52.624 32.049  1.00 158.79 ? 314 ILE A CG2 1 
ATOM 1360 C CD1 . ILE A 1 291 ? 17.511  53.319 29.950  1.00 158.79 ? 314 ILE A CD1 1 
ATOM 1361 N N   . GLY A 1 292 ? 17.724  51.592 35.301  1.00 218.20 ? 315 GLY A N   1 
ATOM 1362 C CA  . GLY A 1 292 ? 18.193  51.823 36.651  1.00 217.94 ? 315 GLY A CA  1 
ATOM 1363 C C   . GLY A 1 292 ? 18.587  50.526 37.330  1.00 217.77 ? 315 GLY A C   1 
ATOM 1364 O O   . GLY A 1 292 ? 19.528  50.490 38.126  1.00 217.65 ? 315 GLY A O   1 
ATOM 1365 N N   . TYR A 1 293 ? 17.863  49.455 37.015  1.00 203.42 ? 316 TYR A N   1 
ATOM 1366 C CA  . TYR A 1 293 ? 18.130  48.136 37.585  1.00 203.33 ? 316 TYR A CA  1 
ATOM 1367 C C   . TYR A 1 293 ? 19.490  47.630 37.110  1.00 203.25 ? 316 TYR A C   1 
ATOM 1368 O O   . TYR A 1 293 ? 20.121  46.805 37.768  1.00 203.15 ? 316 TYR A O   1 
ATOM 1369 C CB  . TYR A 1 293 ? 17.053  47.132 37.144  1.00 247.23 ? 316 TYR A CB  1 
ATOM 1370 C CG  . TYR A 1 293 ? 15.652  47.411 37.653  1.00 247.56 ? 316 TYR A CG  1 
ATOM 1371 C CD1 . TYR A 1 293 ? 14.575  46.633 37.231  1.00 248.13 ? 316 TYR A CD1 1 
ATOM 1372 C CD2 . TYR A 1 293 ? 15.402  48.447 38.556  1.00 247.44 ? 316 TYR A CD2 1 
ATOM 1373 C CE1 . TYR A 1 293 ? 13.287  46.876 37.688  1.00 247.68 ? 316 TYR A CE1 1 
ATOM 1374 C CE2 . TYR A 1 293 ? 14.111  48.701 39.023  1.00 247.48 ? 316 TYR A CE2 1 
ATOM 1375 C CZ  . TYR A 1 293 ? 13.059  47.910 38.582  1.00 247.88 ? 316 TYR A CZ  1 
ATOM 1376 O OH  . TYR A 1 293 ? 11.780  48.158 39.025  1.00 247.77 ? 316 TYR A OH  1 
ATOM 1377 N N   . VAL A 1 294 ? 19.928  48.142 35.961  1.00 263.52 ? 317 VAL A N   1 
ATOM 1378 C CA  . VAL A 1 294 ? 21.194  47.758 35.343  1.00 263.42 ? 317 VAL A CA  1 
ATOM 1379 C C   . VAL A 1 294 ? 22.437  47.942 36.225  1.00 263.27 ? 317 VAL A C   1 
ATOM 1380 O O   . VAL A 1 294 ? 23.379  47.150 36.142  1.00 263.09 ? 317 VAL A O   1 
ATOM 1381 C CB  . VAL A 1 294 ? 21.399  48.526 34.007  1.00 149.36 ? 317 VAL A CB  1 
ATOM 1382 C CG1 . VAL A 1 294 ? 22.724  48.135 33.371  1.00 149.68 ? 317 VAL A CG1 1 
ATOM 1383 C CG2 . VAL A 1 294 ? 20.237  48.238 33.051  1.00 149.51 ? 317 VAL A CG2 1 
ATOM 1384 N N   . ASN A 1 295 ? 22.449  48.975 37.064  1.00 183.87 ? 318 ASN A N   1 
ATOM 1385 C CA  . ASN A 1 295 ? 23.597  49.220 37.937  1.00 183.87 ? 318 ASN A CA  1 
ATOM 1386 C C   . ASN A 1 295 ? 23.653  48.211 39.082  1.00 183.87 ? 318 ASN A C   1 
ATOM 1387 O O   . ASN A 1 295 ? 24.237  48.477 40.133  1.00 338.06 ? 318 ASN A O   1 
ATOM 1388 C CB  . ASN A 1 295 ? 23.543  50.643 38.495  1.00 120.30 ? 318 ASN A CB  1 
ATOM 1389 N N   . SER A 1 296 ? 23.047  47.050 38.865  1.00 203.92 ? 319 SER A N   1 
ATOM 1390 C CA  . SER A 1 296 ? 23.028  45.989 39.864  1.00 203.92 ? 319 SER A CA  1 
ATOM 1391 C C   . SER A 1 296 ? 24.090  44.950 39.529  1.00 203.92 ? 319 SER A C   1 
ATOM 1392 O O   . SER A 1 296 ? 24.525  44.186 40.390  1.00 350.62 ? 319 SER A O   1 
ATOM 1393 C CB  . SER A 1 296 ? 21.653  45.336 39.907  1.00 196.25 ? 319 SER A CB  1 
ATOM 1394 N N   . GLY A 1 297 ? 24.496  44.928 38.266  1.00 209.75 ? 320 GLY A N   1 
ATOM 1395 C CA  . GLY A 1 297 ? 25.512  43.994 37.829  1.00 209.75 ? 320 GLY A CA  1 
ATOM 1396 C C   . GLY A 1 297 ? 26.628  44.759 37.152  1.00 209.75 ? 320 GLY A C   1 
ATOM 1397 O O   . GLY A 1 297 ? 27.321  44.231 36.283  1.00 209.75 ? 320 GLY A O   1 
ATOM 1398 N N   . PHE A 1 298 ? 26.797  46.014 37.557  1.00 246.94 ? 321 PHE A N   1 
ATOM 1399 C CA  . PHE A 1 298 ? 27.825  46.875 36.988  1.00 246.94 ? 321 PHE A CA  1 
ATOM 1400 C C   . PHE A 1 298 ? 28.956  47.166 37.973  1.00 246.94 ? 321 PHE A C   1 
ATOM 1401 O O   . PHE A 1 298 ? 30.094  47.398 37.565  1.00 246.94 ? 321 PHE A O   1 
ATOM 1402 C CB  . PHE A 1 298 ? 27.197  48.180 36.516  1.00 115.41 ? 321 PHE A CB  1 
ATOM 1403 N N   . ASN A 1 299 ? 28.641  47.156 39.266  1.00 212.55 ? 322 ASN A N   1 
ATOM 1404 C CA  . ASN A 1 299 ? 29.645  47.419 40.296  1.00 212.55 ? 322 ASN A CA  1 
ATOM 1405 C C   . ASN A 1 299 ? 30.580  46.229 40.485  1.00 212.55 ? 322 ASN A C   1 
ATOM 1406 O O   . ASN A 1 299 ? 31.801  46.382 40.441  1.00 212.55 ? 322 ASN A O   1 
ATOM 1407 C CB  . ASN A 1 299 ? 28.972  47.772 41.623  1.00 207.04 ? 322 ASN A CB  1 
ATOM 1408 C CG  . ASN A 1 299 ? 28.190  49.064 41.547  1.00 207.04 ? 322 ASN A CG  1 
ATOM 1409 O OD1 . ASN A 1 299 ? 28.734  50.111 41.200  1.00 207.04 ? 322 ASN A OD1 1 
ATOM 1410 N ND2 . ASN A 1 299 ? 26.905  48.998 41.872  1.00 207.04 ? 322 ASN A ND2 1 
ATOM 1411 N N   . PRO A 1 300 ? 30.023  45.026 40.713  1.00 186.41 ? 323 PRO A N   1 
ATOM 1412 C CA  . PRO A 1 300 ? 30.889  43.858 40.892  1.00 186.41 ? 323 PRO A CA  1 
ATOM 1413 C C   . PRO A 1 300 ? 31.460  43.428 39.540  1.00 186.41 ? 323 PRO A C   1 
ATOM 1414 O O   . PRO A 1 300 ? 32.028  42.344 39.405  1.00 186.41 ? 323 PRO A O   1 
ATOM 1415 C CB  . PRO A 1 300 ? 29.943  42.822 41.486  1.00 184.75 ? 323 PRO A CB  1 
ATOM 1416 C CG  . PRO A 1 300 ? 28.652  43.146 40.806  1.00 184.75 ? 323 PRO A CG  1 
ATOM 1417 C CD  . PRO A 1 300 ? 28.607  44.657 40.896  1.00 184.75 ? 323 PRO A CD  1 
ATOM 1418 N N   . LEU A 1 301 ? 31.292  44.301 38.547  1.00 195.67 ? 324 LEU A N   1 
ATOM 1419 C CA  . LEU A 1 301 ? 31.774  44.074 37.186  1.00 195.67 ? 324 LEU A CA  1 
ATOM 1420 C C   . LEU A 1 301 ? 32.976  44.978 36.904  1.00 195.67 ? 324 LEU A C   1 
ATOM 1421 O O   . LEU A 1 301 ? 33.920  44.583 36.216  1.00 195.67 ? 324 LEU A O   1 
ATOM 1422 C CB  . LEU A 1 301 ? 30.650  44.362 36.179  1.00 195.89 ? 324 LEU A CB  1 
ATOM 1423 C CG  . LEU A 1 301 ? 30.927  44.248 34.673  1.00 195.89 ? 324 LEU A CG  1 
ATOM 1424 C CD1 . LEU A 1 301 ? 29.604  44.164 33.927  1.00 195.89 ? 324 LEU A CD1 1 
ATOM 1425 C CD2 . LEU A 1 301 ? 31.744  45.440 34.183  1.00 195.89 ? 324 LEU A CD2 1 
ATOM 1426 N N   . ILE A 1 302 ? 32.927  46.195 37.436  1.00 184.70 ? 325 ILE A N   1 
ATOM 1427 C CA  . ILE A 1 302 ? 34.008  47.154 37.254  1.00 184.70 ? 325 ILE A CA  1 
ATOM 1428 C C   . ILE A 1 302 ? 35.061  46.949 38.338  1.00 184.70 ? 325 ILE A C   1 
ATOM 1429 O O   . ILE A 1 302 ? 36.148  47.524 38.280  1.00 305.87 ? 325 ILE A O   1 
ATOM 1430 C CB  . ILE A 1 302 ? 33.459  48.576 37.315  1.00 174.97 ? 325 ILE A CB  1 
ATOM 1431 N N   . TYR A 1 303 ? 34.732  46.120 39.325  1.00 132.02 ? 326 TYR A N   1 
ATOM 1432 C CA  . TYR A 1 303 ? 35.643  45.837 40.428  1.00 132.02 ? 326 TYR A CA  1 
ATOM 1433 C C   . TYR A 1 303 ? 36.635  44.733 40.071  1.00 132.02 ? 326 TYR A C   1 
ATOM 1434 O O   . TYR A 1 303 ? 37.560  44.440 40.834  1.00 132.02 ? 326 TYR A O   1 
ATOM 1435 C CB  . TYR A 1 303 ? 34.856  45.455 41.673  1.00 89.45  ? 326 TYR A CB  1 
ATOM 1436 N N   . CYS A 1 304 ? 36.436  44.122 38.907  1.00 209.40 ? 327 CYS A N   1 
ATOM 1437 C CA  . CYS A 1 304 ? 37.324  43.065 38.442  1.00 209.40 ? 327 CYS A CA  1 
ATOM 1438 C C   . CYS A 1 304 ? 38.557  43.683 37.790  1.00 209.40 ? 327 CYS A C   1 
ATOM 1439 O O   . CYS A 1 304 ? 39.667  43.537 38.296  1.00 209.40 ? 327 CYS A O   1 
ATOM 1440 C CB  . CYS A 1 304 ? 36.603  42.156 37.437  1.00 180.39 ? 327 CYS A CB  1 
ATOM 1441 S SG  . CYS A 1 304 ? 35.334  41.068 38.147  1.00 180.39 ? 327 CYS A SG  1 
ATOM 1442 N N   . ARG A 1 305 ? 38.353  44.385 36.676  1.00 222.32 ? 328 ARG A N   1 
ATOM 1443 C CA  . ARG A 1 305 ? 39.453  45.023 35.954  1.00 222.32 ? 328 ARG A CA  1 
ATOM 1444 C C   . ARG A 1 305 ? 39.752  46.456 36.390  1.00 222.32 ? 328 ARG A C   1 
ATOM 1445 O O   . ARG A 1 305 ? 39.946  47.341 35.554  1.00 222.32 ? 328 ARG A O   1 
ATOM 1446 C CB  . ARG A 1 305 ? 39.191  44.999 34.443  1.00 194.28 ? 328 ARG A CB  1 
ATOM 1447 C CG  . ARG A 1 305 ? 39.589  43.698 33.764  1.00 194.28 ? 328 ARG A CG  1 
ATOM 1448 C CD  . ARG A 1 305 ? 39.530  43.837 32.249  1.00 194.28 ? 328 ARG A CD  1 
ATOM 1449 N NE  . ARG A 1 305 ? 40.160  42.708 31.563  1.00 194.28 ? 328 ARG A NE  1 
ATOM 1450 C CZ  . ARG A 1 305 ? 40.322  42.622 30.243  1.00 194.28 ? 328 ARG A CZ  1 
ATOM 1451 N NH1 . ARG A 1 305 ? 39.899  43.601 29.450  1.00 194.28 ? 328 ARG A NH1 1 
ATOM 1452 N NH2 . ARG A 1 305 ? 40.913  41.556 29.713  1.00 194.28 ? 328 ARG A NH2 1 
ATOM 1453 N N   . SER A 1 306 ? 39.789  46.676 37.700  1.00 275.69 ? 329 SER A N   1 
ATOM 1454 C CA  . SER A 1 306 ? 40.093  47.990 38.252  1.00 275.69 ? 329 SER A CA  1 
ATOM 1455 C C   . SER A 1 306 ? 40.669  47.891 39.672  1.00 275.69 ? 329 SER A C   1 
ATOM 1456 O O   . SER A 1 306 ? 41.819  48.269 39.900  1.00 275.69 ? 329 SER A O   1 
ATOM 1457 C CB  . SER A 1 306 ? 38.849  48.893 38.219  1.00 118.63 ? 329 SER A CB  1 
ATOM 1458 O OG  . SER A 1 306 ? 38.635  49.434 36.926  1.00 118.63 ? 329 SER A OG  1 
ATOM 1459 N N   . PRO A 1 307 ? 39.888  47.384 40.645  1.00 159.33 ? 330 PRO A N   1 
ATOM 1460 C CA  . PRO A 1 307 ? 40.437  47.285 41.999  1.00 159.33 ? 330 PRO A CA  1 
ATOM 1461 C C   . PRO A 1 307 ? 40.927  45.879 42.363  1.00 159.33 ? 330 PRO A C   1 
ATOM 1462 O O   . PRO A 1 307 ? 40.755  44.931 41.596  1.00 159.33 ? 330 PRO A O   1 
ATOM 1463 C CB  . PRO A 1 307 ? 39.268  47.727 42.862  1.00 236.51 ? 330 PRO A CB  1 
ATOM 1464 C CG  . PRO A 1 307 ? 38.134  47.065 42.173  1.00 236.51 ? 330 PRO A CG  1 
ATOM 1465 C CD  . PRO A 1 307 ? 38.416  47.307 40.692  1.00 236.51 ? 330 PRO A CD  1 
ATOM 1466 N N   . ASP A 1 308 ? 41.531  45.765 43.544  1.00 275.53 ? 331 ASP A N   1 
ATOM 1467 C CA  . ASP A 1 308 ? 42.066  44.502 44.051  1.00 275.53 ? 331 ASP A CA  1 
ATOM 1468 C C   . ASP A 1 308 ? 41.057  43.361 44.016  1.00 275.53 ? 331 ASP A C   1 
ATOM 1469 O O   . ASP A 1 308 ? 41.432  42.205 43.821  1.00 275.53 ? 331 ASP A O   1 
ATOM 1470 C CB  . ASP A 1 308 ? 42.566  44.688 45.486  1.00 234.76 ? 331 ASP A CB  1 
ATOM 1471 C CG  . ASP A 1 308 ? 43.031  43.389 46.117  1.00 234.76 ? 331 ASP A CG  1 
ATOM 1472 O OD1 . ASP A 1 308 ? 42.203  42.466 46.276  1.00 234.76 ? 331 ASP A OD1 1 
ATOM 1473 O OD2 . ASP A 1 308 ? 44.228  43.291 46.456  1.00 234.76 ? 331 ASP A OD2 1 
ATOM 1474 N N   . PHE A 1 309 ? 39.785  43.691 44.224  1.00 147.91 ? 332 PHE A N   1 
ATOM 1475 C CA  . PHE A 1 309 ? 38.708  42.704 44.213  1.00 147.91 ? 332 PHE A CA  1 
ATOM 1476 C C   . PHE A 1 309 ? 39.004  41.560 43.240  1.00 147.91 ? 332 PHE A C   1 
ATOM 1477 O O   . PHE A 1 309 ? 38.804  40.391 43.570  1.00 278.24 ? 332 PHE A O   1 
ATOM 1478 C CB  . PHE A 1 309 ? 37.390  43.385 43.843  1.00 142.30 ? 332 PHE A CB  1 
ATOM 1479 N N   . ARG A 1 310 ? 39.480  41.918 42.046  1.00 142.18 ? 333 ARG A N   1 
ATOM 1480 C CA  . ARG A 1 310 ? 39.833  40.966 40.989  1.00 142.18 ? 333 ARG A CA  1 
ATOM 1481 C C   . ARG A 1 310 ? 40.140  39.598 41.595  1.00 142.18 ? 333 ARG A C   1 
ATOM 1482 O O   . ARG A 1 310 ? 39.359  38.656 41.466  1.00 142.18 ? 333 ARG A O   1 
ATOM 1483 C CB  . ARG A 1 310 ? 41.066  41.475 40.232  1.00 214.50 ? 333 ARG A CB  1 
ATOM 1484 C CG  . ARG A 1 310 ? 41.111  41.142 38.748  1.00 214.50 ? 333 ARG A CG  1 
ATOM 1485 C CD  . ARG A 1 310 ? 40.953  39.660 38.471  1.00 214.50 ? 333 ARG A CD  1 
ATOM 1486 N NE  . ARG A 1 310 ? 41.131  39.347 37.054  1.00 214.50 ? 333 ARG A NE  1 
ATOM 1487 C CZ  . ARG A 1 310 ? 40.435  39.902 36.064  1.00 214.50 ? 333 ARG A CZ  1 
ATOM 1488 N NH1 . ARG A 1 310 ? 39.504  40.809 36.327  1.00 214.50 ? 333 ARG A NH1 1 
ATOM 1489 N NH2 . ARG A 1 310 ? 40.669  39.547 34.805  1.00 214.50 ? 333 ARG A NH2 1 
ATOM 1490 N N   . ILE A 1 311 ? 41.282  39.505 42.268  1.00 247.76 ? 334 ILE A N   1 
ATOM 1491 C CA  . ILE A 1 311 ? 41.702  38.264 42.906  1.00 247.76 ? 334 ILE A CA  1 
ATOM 1492 C C   . ILE A 1 311 ? 40.842  37.981 44.142  1.00 247.76 ? 334 ILE A C   1 
ATOM 1493 O O   . ILE A 1 311 ? 40.357  36.864 44.330  1.00 247.76 ? 334 ILE A O   1 
ATOM 1494 C CB  . ILE A 1 311 ? 43.202  38.332 43.320  1.00 163.32 ? 334 ILE A CB  1 
ATOM 1495 C CG1 . ILE A 1 311 ? 44.086  38.444 42.069  1.00 163.32 ? 334 ILE A CG1 1 
ATOM 1496 C CG2 . ILE A 1 311 ? 43.578  37.098 44.134  1.00 163.32 ? 334 ILE A CG2 1 
ATOM 1497 C CD1 . ILE A 1 311 ? 45.579  38.517 42.355  1.00 163.32 ? 334 ILE A CD1 1 
ATOM 1498 N N   . ALA A 1 312 ? 40.650  39.005 44.969  1.00 157.99 ? 335 ALA A N   1 
ATOM 1499 C CA  . ALA A 1 312 ? 39.865  38.890 46.196  1.00 157.99 ? 335 ALA A CA  1 
ATOM 1500 C C   . ALA A 1 312 ? 38.652  37.962 46.089  1.00 157.99 ? 335 ALA A C   1 
ATOM 1501 O O   . ALA A 1 312 ? 38.409  37.147 46.982  1.00 157.99 ? 335 ALA A O   1 
ATOM 1502 C CB  . ALA A 1 312 ? 39.418  40.276 46.652  1.00 157.15 ? 335 ALA A CB  1 
ATOM 1503 N N   . PHE A 1 313 ? 37.892  38.080 45.003  1.00 203.47 ? 336 PHE A N   1 
ATOM 1504 C CA  . PHE A 1 313 ? 36.709  37.244 44.839  1.00 203.47 ? 336 PHE A CA  1 
ATOM 1505 C C   . PHE A 1 313 ? 36.694  36.301 43.638  1.00 203.47 ? 336 PHE A C   1 
ATOM 1506 O O   . PHE A 1 313 ? 35.959  35.315 43.640  1.00 203.47 ? 336 PHE A O   1 
ATOM 1507 C CB  . PHE A 1 313 ? 35.432  38.112 44.832  1.00 166.58 ? 336 PHE A CB  1 
ATOM 1508 C CG  . PHE A 1 313 ? 35.311  39.064 43.652  1.00 166.58 ? 336 PHE A CG  1 
ATOM 1509 C CD1 . PHE A 1 313 ? 34.200  39.900 43.544  1.00 166.58 ? 336 PHE A CD1 1 
ATOM 1510 C CD2 . PHE A 1 313 ? 36.287  39.129 42.656  1.00 166.58 ? 336 PHE A CD2 1 
ATOM 1511 C CE1 . PHE A 1 313 ? 34.061  40.782 42.469  1.00 166.58 ? 336 PHE A CE1 1 
ATOM 1512 C CE2 . PHE A 1 313 ? 36.156  40.007 41.577  1.00 166.58 ? 336 PHE A CE2 1 
ATOM 1513 C CZ  . PHE A 1 313 ? 35.041  40.834 41.486  1.00 166.58 ? 336 PHE A CZ  1 
ATOM 1514 N N   . GLN A 1 314 ? 37.497  36.588 42.618  1.00 244.90 ? 337 GLN A N   1 
ATOM 1515 C CA  . GLN A 1 314 ? 37.516  35.729 41.439  1.00 244.90 ? 337 GLN A CA  1 
ATOM 1516 C C   . GLN A 1 314 ? 38.278  34.441 41.724  1.00 244.90 ? 337 GLN A C   1 
ATOM 1517 O O   . GLN A 1 314 ? 37.982  33.395 41.148  1.00 244.90 ? 337 GLN A O   1 
ATOM 1518 C CB  . GLN A 1 314 ? 38.140  36.457 40.243  1.00 180.60 ? 337 GLN A CB  1 
ATOM 1519 C CG  . GLN A 1 314 ? 37.897  35.753 38.909  1.00 180.60 ? 337 GLN A CG  1 
ATOM 1520 C CD  . GLN A 1 314 ? 38.388  36.548 37.713  1.00 180.60 ? 337 GLN A CD  1 
ATOM 1521 O OE1 . GLN A 1 314 ? 38.780  37.707 37.841  1.00 180.60 ? 337 GLN A OE1 1 
ATOM 1522 N NE2 . GLN A 1 314 ? 38.358  35.929 36.537  1.00 180.60 ? 337 GLN A NE2 1 
ATOM 1523 N N   . GLU A 1 315 ? 39.257  34.517 42.619  1.00 230.14 ? 338 GLU A N   1 
ATOM 1524 C CA  . GLU A 1 315 ? 40.036  33.340 42.976  1.00 230.14 ? 338 GLU A CA  1 
ATOM 1525 C C   . GLU A 1 315 ? 39.464  32.675 44.226  1.00 230.14 ? 338 GLU A C   1 
ATOM 1526 O O   . GLU A 1 315 ? 39.913  31.599 44.620  1.00 230.14 ? 338 GLU A O   1 
ATOM 1527 C CB  . GLU A 1 315 ? 41.506  33.712 43.206  1.00 265.53 ? 338 GLU A CB  1 
ATOM 1528 C CG  . GLU A 1 315 ? 42.230  34.209 41.959  1.00 265.53 ? 338 GLU A CG  1 
ATOM 1529 C CD  . GLU A 1 315 ? 43.723  34.395 42.177  1.00 265.53 ? 338 GLU A CD  1 
ATOM 1530 O OE1 . GLU A 1 315 ? 44.411  34.863 41.244  1.00 265.53 ? 338 GLU A OE1 1 
ATOM 1531 O OE2 . GLU A 1 315 ? 44.211  34.070 43.279  1.00 265.53 ? 338 GLU A OE2 1 
ATOM 1532 N N   . LEU A 1 316 ? 38.473  33.313 44.847  1.00 239.72 ? 339 LEU A N   1 
ATOM 1533 C CA  . LEU A 1 316 ? 37.856  32.750 46.044  1.00 239.72 ? 339 LEU A CA  1 
ATOM 1534 C C   . LEU A 1 316 ? 37.082  31.500 45.636  1.00 239.72 ? 339 LEU A C   1 
ATOM 1535 O O   . LEU A 1 316 ? 36.892  30.583 46.438  1.00 239.72 ? 339 LEU A O   1 
ATOM 1536 C CB  . LEU A 1 316 ? 36.920  33.773 46.709  1.00 179.99 ? 339 LEU A CB  1 
ATOM 1537 C CG  . LEU A 1 316 ? 35.516  34.047 46.160  1.00 179.99 ? 339 LEU A CG  1 
ATOM 1538 C CD1 . LEU A 1 316 ? 34.593  32.869 46.453  1.00 179.99 ? 339 LEU A CD1 1 
ATOM 1539 C CD2 . LEU A 1 316 ? 34.960  35.303 46.815  1.00 179.99 ? 339 LEU A CD2 1 
ATOM 1540 N N   . LEU A 1 317 ? 36.635  31.480 44.382  1.00 285.52 ? 340 LEU A N   1 
ATOM 1541 C CA  . LEU A 1 317 ? 35.901  30.343 43.834  1.00 285.52 ? 340 LEU A CA  1 
ATOM 1542 C C   . LEU A 1 317 ? 36.923  29.297 43.394  1.00 285.52 ? 340 LEU A C   1 
ATOM 1543 O O   . LEU A 1 317 ? 37.055  29.003 42.205  1.00 285.52 ? 340 LEU A O   1 
ATOM 1544 C CB  . LEU A 1 317 ? 35.054  30.774 42.626  1.00 176.90 ? 340 LEU A CB  1 
ATOM 1545 C CG  . LEU A 1 317 ? 33.878  31.739 42.823  1.00 176.90 ? 340 LEU A CG  1 
ATOM 1546 C CD1 . LEU A 1 317 ? 33.320  32.148 41.465  1.00 176.90 ? 340 LEU A CD1 1 
ATOM 1547 C CD2 . LEU A 1 317 ? 32.799  31.079 43.668  1.00 176.90 ? 340 LEU A CD2 1 
ATOM 1548 N N   . CYS A 1 318 ? 37.647  28.749 44.366  1.00 276.42 ? 341 CYS A N   1 
ATOM 1549 C CA  . CYS A 1 318 ? 38.674  27.741 44.115  1.00 276.42 ? 341 CYS A CA  1 
ATOM 1550 C C   . CYS A 1 318 ? 39.523  28.074 42.889  1.00 276.42 ? 341 CYS A C   1 
ATOM 1551 O O   . CYS A 1 318 ? 39.544  27.325 41.912  1.00 276.42 ? 341 CYS A O   1 
ATOM 1552 C CB  . CYS A 1 318 ? 38.038  26.357 43.946  1.00 255.19 ? 341 CYS A CB  1 
ATOM 1553 S SG  . CYS A 1 318 ? 37.004  26.159 42.478  1.00 255.19 ? 341 CYS A SG  1 
ATOM 1554 N N   . LEU A 1 319 ? 40.221  29.205 42.955  1.00 273.50 ? 342 LEU A N   1 
ATOM 1555 C CA  . LEU A 1 319 ? 41.083  29.664 41.870  1.00 273.50 ? 342 LEU A CA  1 
ATOM 1556 C C   . LEU A 1 319 ? 40.386  29.640 40.507  1.00 273.50 ? 342 LEU A C   1 
ATOM 1557 O O   . LEU A 1 319 ? 40.234  28.589 39.884  1.00 273.50 ? 342 LEU A O   1 
ATOM 1558 C CB  . LEU A 1 319 ? 42.372  28.829 41.827  1.00 164.86 ? 342 LEU A CB  1 
ATOM 1559 C CG  . LEU A 1 319 ? 43.369  28.984 42.989  1.00 164.86 ? 342 LEU A CG  1 
ATOM 1560 C CD1 . LEU A 1 319 ? 43.695  30.457 43.187  1.00 164.86 ? 342 LEU A CD1 1 
ATOM 1561 C CD2 . LEU A 1 319 ? 42.797  28.400 44.270  1.00 164.86 ? 342 LEU A CD2 1 
ATOM 1562 N N   . ARG A 1 320 ? 39.974  30.822 40.057  1.00 264.55 ? 343 ARG A N   1 
ATOM 1563 C CA  . ARG A 1 320 ? 39.276  31.001 38.786  1.00 264.55 ? 343 ARG A CA  1 
ATOM 1564 C C   . ARG A 1 320 ? 39.983  30.441 37.553  1.00 264.55 ? 343 ARG A C   1 
ATOM 1565 O O   . ARG A 1 320 ? 39.818  29.270 37.211  1.00 264.55 ? 343 ARG A O   1 
ATOM 1566 C CB  . ARG A 1 320 ? 38.986  32.493 38.574  1.00 189.87 ? 343 ARG A CB  1 
ATOM 1567 C CG  . ARG A 1 320 ? 38.501  32.888 37.177  1.00 189.87 ? 343 ARG A CG  1 
ATOM 1568 C CD  . ARG A 1 320 ? 37.093  32.401 36.861  1.00 189.87 ? 343 ARG A CD  1 
ATOM 1569 N NE  . ARG A 1 320 ? 36.644  32.904 35.562  1.00 189.87 ? 343 ARG A NE  1 
ATOM 1570 C CZ  . ARG A 1 320 ? 35.429  32.711 35.056  1.00 189.87 ? 343 ARG A CZ  1 
ATOM 1571 N NH1 . ARG A 1 320 ? 34.525  32.020 35.738  1.00 189.87 ? 343 ARG A NH1 1 
ATOM 1572 N NH2 . ARG A 1 320 ? 35.116  33.211 33.866  1.00 189.87 ? 343 ARG A NH2 1 
ATOM 1573 N N   . ARG A 1 321 ? 40.772  31.285 36.890  1.00 197.88 ? 344 ARG A N   1 
ATOM 1574 C CA  . ARG A 1 321 ? 41.467  30.895 35.668  1.00 197.88 ? 344 ARG A CA  1 
ATOM 1575 C C   . ARG A 1 321 ? 42.970  31.180 35.683  1.00 197.88 ? 344 ARG A C   1 
ATOM 1576 O O   . ARG A 1 321 ? 43.780  30.254 35.715  1.00 350.62 ? 344 ARG A O   1 
ATOM 1577 C CB  . ARG A 1 321 ? 40.815  31.610 34.479  1.00 188.15 ? 344 ARG A CB  1 
ATOM 1578 C CG  . ARG A 1 321 ? 41.355  31.224 33.117  1.00 188.15 ? 344 ARG A CG  1 
ATOM 1579 C CD  . ARG A 1 321 ? 40.632  31.990 32.018  1.00 188.15 ? 344 ARG A CD  1 
ATOM 1580 N NE  . ARG A 1 321 ? 39.188  31.771 32.057  1.00 188.15 ? 344 ARG A NE  1 
ATOM 1581 C CZ  . ARG A 1 321 ? 38.323  32.317 31.207  1.00 188.15 ? 344 ARG A CZ  1 
ATOM 1582 N NH1 . ARG A 1 321 ? 38.756  33.121 30.245  1.00 188.15 ? 344 ARG A NH1 1 
ATOM 1583 N NH2 . ARG A 1 321 ? 37.025  32.061 31.317  1.00 188.15 ? 344 ARG A NH2 1 
ATOM 1584 N N   . SER A 1 322 ? 43.336  32.460 35.657  1.00 249.29 ? 345 SER A N   1 
ATOM 1585 C CA  . SER A 1 322 ? 44.742  32.868 35.652  1.00 249.29 ? 345 SER A CA  1 
ATOM 1586 C C   . SER A 1 322 ? 45.496  32.446 36.910  1.00 249.29 ? 345 SER A C   1 
ATOM 1587 O O   . SER A 1 322 ? 46.570  32.972 37.207  1.00 249.29 ? 345 SER A O   1 
ATOM 1588 C CB  . SER A 1 322 ? 44.857  34.385 35.477  1.00 176.69 ? 345 SER A CB  1 
ATOM 1589 O OG  . SER A 1 322 ? 46.216  34.790 35.449  1.00 176.69 ? 345 SER A OG  1 
ATOM 1590 N N   . SER A 1 323 ? 44.922  31.503 37.649  1.00 305.72 ? 346 SER A N   1 
ATOM 1591 C CA  . SER A 1 323 ? 45.539  30.985 38.863  1.00 305.72 ? 346 SER A CA  1 
ATOM 1592 C C   . SER A 1 323 ? 46.760  30.175 38.445  1.00 305.72 ? 346 SER A C   1 
ATOM 1593 O O   . SER A 1 323 ? 46.933  29.031 38.869  1.00 305.72 ? 346 SER A O   1 
ATOM 1594 C CB  . SER A 1 323 ? 44.543  30.090 39.613  1.00 164.06 ? 346 SER A CB  1 
ATOM 1595 O OG  . SER A 1 323 ? 45.158  29.400 40.690  1.00 164.06 ? 346 SER A OG  1 
ATOM 1596 N N   . LEU A 1 324 ? 47.604  30.776 37.609  1.00 249.53 ? 347 LEU A N   1 
ATOM 1597 C CA  . LEU A 1 324 ? 48.795  30.100 37.113  1.00 249.53 ? 347 LEU A CA  1 
ATOM 1598 C C   . LEU A 1 324 ? 48.301  28.839 36.400  1.00 249.53 ? 347 LEU A C   1 
ATOM 1599 O O   . LEU A 1 324 ? 48.977  27.810 36.371  1.00 249.53 ? 347 LEU A O   1 
ATOM 1600 C CB  . LEU A 1 324 ? 49.726  29.738 38.281  1.00 150.53 ? 347 LEU A CB  1 
ATOM 1601 C CG  . LEU A 1 324 ? 50.367  30.851 39.135  1.00 150.53 ? 347 LEU A CG  1 
ATOM 1602 C CD1 . LEU A 1 324 ? 51.352  31.646 38.293  1.00 150.53 ? 347 LEU A CD1 1 
ATOM 1603 C CD2 . LEU A 1 324 ? 49.298  31.766 39.722  1.00 150.53 ? 347 LEU A CD2 1 
ATOM 1604 N N   . LYS A 1 325 ? 47.104  28.955 35.827  1.00 249.64 ? 348 LYS A N   1 
ATOM 1605 C CA  . LYS A 1 325 ? 46.423  27.879 35.106  1.00 249.64 ? 348 LYS A CA  1 
ATOM 1606 C C   . LYS A 1 325 ? 47.362  26.906 34.394  1.00 249.64 ? 348 LYS A C   1 
ATOM 1607 O O   . LYS A 1 325 ? 47.347  25.710 34.754  1.00 350.62 ? 348 LYS A O   1 
ATOM 1608 C CB  . LYS A 1 325 ? 45.447  28.487 34.093  1.00 199.98 ? 348 LYS A CB  1 
ATOM 1609 C CG  . LYS A 1 325 ? 44.184  27.675 33.861  1.00 199.98 ? 348 LYS A CG  1 
ATOM 1610 C CD  . LYS A 1 325 ? 43.247  28.397 32.903  1.00 199.98 ? 348 LYS A CD  1 
ATOM 1611 C CE  . LYS A 1 325 ? 41.887  27.715 32.808  1.00 199.98 ? 348 LYS A CE  1 
ATOM 1612 N NZ  . LYS A 1 325 ? 41.112  27.807 34.079  1.00 199.98 ? 348 LYS A NZ  1 
ATOM 1613 N N   . ASP B 2 1   ? 59.494  69.954 21.134  1.00 87.19  ? 1   ASP L N   1 
ATOM 1614 C CA  . ASP B 2 1   ? 58.943  69.678 22.487  1.00 87.19  ? 1   ASP L CA  1 
ATOM 1615 C C   . ASP B 2 1   ? 59.712  70.453 23.550  1.00 87.19  ? 1   ASP L C   1 
ATOM 1616 O O   . ASP B 2 1   ? 59.133  71.245 24.295  1.00 87.19  ? 1   ASP L O   1 
ATOM 1617 C CB  . ASP B 2 1   ? 59.016  68.180 22.791  1.00 149.90 ? 1   ASP L CB  1 
ATOM 1618 C CG  . ASP B 2 1   ? 58.264  67.334 21.770  1.00 149.90 ? 1   ASP L CG  1 
ATOM 1619 O OD1 . ASP B 2 1   ? 57.046  67.564 21.578  1.00 149.90 ? 1   ASP L OD1 1 
ATOM 1620 O OD2 . ASP B 2 1   ? 58.892  66.433 21.166  1.00 149.90 ? 1   ASP L OD2 1 
ATOM 1621 N N   . ILE B 2 2   ? 61.019  70.211 23.620  1.00 70.07  ? 2   ILE L N   1 
ATOM 1622 C CA  . ILE B 2 2   ? 61.898  70.889 24.584  1.00 70.07  ? 2   ILE L CA  1 
ATOM 1623 C C   . ILE B 2 2   ? 63.387  70.659 24.299  1.00 70.07  ? 2   ILE L C   1 
ATOM 1624 O O   . ILE B 2 2   ? 64.072  69.907 25.008  1.00 70.07  ? 2   ILE L O   1 
ATOM 1625 C CB  . ILE B 2 2   ? 61.585  70.476 26.068  1.00 76.32  ? 2   ILE L CB  1 
ATOM 1626 C CG1 . ILE B 2 2   ? 62.689  70.993 27.006  1.00 76.32  ? 2   ILE L CG1 1 
ATOM 1627 C CG2 . ILE B 2 2   ? 61.408  68.958 26.166  1.00 76.32  ? 2   ILE L CG2 1 
ATOM 1628 C CD1 . ILE B 2 2   ? 62.398  70.814 28.495  1.00 76.32  ? 2   ILE L CD1 1 
ATOM 1629 N N   . LYS B 2 3   ? 63.867  71.338 23.256  1.00 90.22  ? 3   LYS L N   1 
ATOM 1630 C CA  . LYS B 2 3   ? 65.258  71.266 22.825  1.00 90.22  ? 3   LYS L CA  1 
ATOM 1631 C C   . LYS B 2 3   ? 66.224  71.414 23.993  1.00 90.22  ? 3   LYS L C   1 
ATOM 1632 O O   . LYS B 2 3   ? 66.020  72.244 24.885  1.00 90.22  ? 3   LYS L O   1 
ATOM 1633 C CB  . LYS B 2 3   ? 65.548  72.358 21.784  1.00 124.84 ? 3   LYS L CB  1 
ATOM 1634 C CG  . LYS B 2 3   ? 65.076  72.065 20.349  1.00 124.84 ? 3   LYS L CG  1 
ATOM 1635 C CD  . LYS B 2 3   ? 65.957  71.024 19.651  1.00 124.84 ? 3   LYS L CD  1 
ATOM 1636 C CE  . LYS B 2 3   ? 65.594  70.884 18.178  1.00 124.84 ? 3   LYS L CE  1 
ATOM 1637 N NZ  . LYS B 2 3   ? 66.359  69.799 17.503  1.00 124.84 ? 3   LYS L NZ  1 
ATOM 1638 N N   . MET B 2 4   ? 67.275  70.596 23.964  1.00 102.21 ? 4   MET L N   1 
ATOM 1639 C CA  . MET B 2 4   ? 68.313  70.581 24.991  1.00 102.21 ? 4   MET L CA  1 
ATOM 1640 C C   . MET B 2 4   ? 69.713  70.475 24.393  1.00 102.21 ? 4   MET L C   1 
ATOM 1641 O O   . MET B 2 4   ? 70.253  69.370 24.295  1.00 102.21 ? 4   MET L O   1 
ATOM 1642 C CB  . MET B 2 4   ? 68.108  69.401 25.941  1.00 92.73  ? 4   MET L CB  1 
ATOM 1643 C CG  . MET B 2 4   ? 66.911  69.549 26.856  1.00 92.73  ? 4   MET L CG  1 
ATOM 1644 S SD  . MET B 2 4   ? 67.156  68.601 28.348  1.00 92.73  ? 4   MET L SD  1 
ATOM 1645 C CE  . MET B 2 4   ? 68.712  69.259 28.884  1.00 92.73  ? 4   MET L CE  1 
ATOM 1646 N N   . THR B 2 5   ? 70.306  71.612 24.013  1.00 78.77  ? 5   THR L N   1 
ATOM 1647 C CA  . THR B 2 5   ? 71.648  71.620 23.417  1.00 78.77  ? 5   THR L CA  1 
ATOM 1648 C C   . THR B 2 5   ? 72.672  71.035 24.395  1.00 78.77  ? 5   THR L C   1 
ATOM 1649 O O   . THR B 2 5   ? 72.372  70.866 25.573  1.00 78.77  ? 5   THR L O   1 
ATOM 1650 C CB  . THR B 2 5   ? 72.050  73.045 22.988  1.00 216.32 ? 5   THR L CB  1 
ATOM 1651 O OG1 . THR B 2 5   ? 73.329  73.009 22.346  1.00 216.32 ? 5   THR L OG1 1 
ATOM 1652 C CG2 . THR B 2 5   ? 72.099  73.970 24.186  1.00 216.32 ? 5   THR L CG2 1 
ATOM 1653 N N   . GLN B 2 6   ? 73.880  70.738 23.927  1.00 85.83  ? 6   GLN L N   1 
ATOM 1654 C CA  . GLN B 2 6   ? 74.862  70.109 24.812  1.00 85.83  ? 6   GLN L CA  1 
ATOM 1655 C C   . GLN B 2 6   ? 76.335  70.279 24.407  1.00 85.83  ? 6   GLN L C   1 
ATOM 1656 O O   . GLN B 2 6   ? 76.908  69.374 23.789  1.00 85.83  ? 6   GLN L O   1 
ATOM 1657 C CB  . GLN B 2 6   ? 74.519  68.609 24.890  1.00 93.07  ? 6   GLN L CB  1 
ATOM 1658 C CG  . GLN B 2 6   ? 75.321  67.764 25.872  1.00 93.07  ? 6   GLN L CG  1 
ATOM 1659 C CD  . GLN B 2 6   ? 74.888  66.303 25.851  1.00 93.07  ? 6   GLN L CD  1 
ATOM 1660 O OE1 . GLN B 2 6   ? 73.692  65.993 25.782  1.00 93.07  ? 6   GLN L OE1 1 
ATOM 1661 N NE2 . GLN B 2 6   ? 75.862  65.400 25.917  1.00 93.07  ? 6   GLN L NE2 1 
ATOM 1662 N N   . SER B 2 7   ? 76.959  71.403 24.766  1.00 66.11  ? 7   SER L N   1 
ATOM 1663 C CA  . SER B 2 7   ? 78.358  71.598 24.392  1.00 66.11  ? 7   SER L CA  1 
ATOM 1664 C C   . SER B 2 7   ? 79.303  70.987 25.408  1.00 66.11  ? 7   SER L C   1 
ATOM 1665 O O   . SER B 2 7   ? 79.071  71.071 26.605  1.00 66.11  ? 7   SER L O   1 
ATOM 1666 C CB  . SER B 2 7   ? 78.694  73.075 24.225  1.00 93.32  ? 7   SER L CB  1 
ATOM 1667 O OG  . SER B 2 7   ? 80.039  73.218 23.801  1.00 93.32  ? 7   SER L OG  1 
ATOM 1668 N N   . PRO B 2 8   ? 80.399  70.378 24.933  1.00 145.30 ? 8   PRO L N   1 
ATOM 1669 C CA  . PRO B 2 8   ? 80.761  70.260 23.518  1.00 145.30 ? 8   PRO L CA  1 
ATOM 1670 C C   . PRO B 2 8   ? 80.097  69.101 22.802  1.00 145.30 ? 8   PRO L C   1 
ATOM 1671 O O   . PRO B 2 8   ? 79.072  68.572 23.228  1.00 145.30 ? 8   PRO L O   1 
ATOM 1672 C CB  . PRO B 2 8   ? 82.256  70.038 23.573  1.00 46.60  ? 8   PRO L CB  1 
ATOM 1673 C CG  . PRO B 2 8   ? 82.362  69.098 24.724  1.00 46.60  ? 8   PRO L CG  1 
ATOM 1674 C CD  . PRO B 2 8   ? 81.436  69.753 25.773  1.00 46.60  ? 8   PRO L CD  1 
ATOM 1675 N N   . SER B 2 9   ? 80.732  68.714 21.705  1.00 72.92  ? 9   SER L N   1 
ATOM 1676 C CA  . SER B 2 9   ? 80.285  67.605 20.882  1.00 72.92  ? 9   SER L CA  1 
ATOM 1677 C C   . SER B 2 9   ? 81.472  66.665 20.848  1.00 72.92  ? 9   SER L C   1 
ATOM 1678 O O   . SER B 2 9   ? 81.413  65.552 21.354  1.00 72.92  ? 9   SER L O   1 
ATOM 1679 C CB  . SER B 2 9   ? 79.945  68.096 19.471  1.00 78.34  ? 9   SER L CB  1 
ATOM 1680 O OG  . SER B 2 9   ? 79.703  67.008 18.595  1.00 78.34  ? 9   SER L OG  1 
ATOM 1681 N N   . SER B 2 10  ? 82.558  67.145 20.260  1.00 63.48  ? 10  SER L N   1 
ATOM 1682 C CA  . SER B 2 10  ? 83.801  66.384 20.164  1.00 63.48  ? 10  SER L CA  1 
ATOM 1683 C C   . SER B 2 10  ? 84.631  66.868 21.347  1.00 63.48  ? 10  SER L C   1 
ATOM 1684 O O   . SER B 2 10  ? 84.287  67.892 21.931  1.00 63.48  ? 10  SER L O   1 
ATOM 1685 C CB  . SER B 2 10  ? 84.515  66.731 18.855  1.00 131.00 ? 10  SER L CB  1 
ATOM 1686 O OG  . SER B 2 10  ? 83.630  66.650 17.740  1.00 131.00 ? 10  SER L OG  1 
ATOM 1687 N N   . MET B 2 11  ? 85.699  66.164 21.721  1.00 82.74  ? 11  MET L N   1 
ATOM 1688 C CA  . MET B 2 11  ? 86.521  66.618 22.852  1.00 82.74  ? 11  MET L CA  1 
ATOM 1689 C C   . MET B 2 11  ? 87.605  65.615 23.253  1.00 82.74  ? 11  MET L C   1 
ATOM 1690 O O   . MET B 2 11  ? 87.306  64.478 23.637  1.00 82.74  ? 11  MET L O   1 
ATOM 1691 C CB  . MET B 2 11  ? 85.636  66.904 24.062  1.00 103.26 ? 11  MET L CB  1 
ATOM 1692 C CG  . MET B 2 11  ? 86.198  67.937 24.999  1.00 103.26 ? 11  MET L CG  1 
ATOM 1693 S SD  . MET B 2 11  ? 86.051  67.415 26.709  1.00 103.26 ? 11  MET L SD  1 
ATOM 1694 C CE  . MET B 2 11  ? 87.793  67.030 27.071  1.00 103.26 ? 11  MET L CE  1 
ATOM 1695 N N   . TYR B 2 12  ? 88.861  66.055 23.180  1.00 71.31  ? 12  TYR L N   1 
ATOM 1696 C CA  . TYR B 2 12  ? 90.009  65.212 23.509  1.00 71.31  ? 12  TYR L CA  1 
ATOM 1697 C C   . TYR B 2 12  ? 90.717  65.609 24.794  1.00 71.31  ? 12  TYR L C   1 
ATOM 1698 O O   . TYR B 2 12  ? 91.411  66.612 24.828  1.00 71.31  ? 12  TYR L O   1 
ATOM 1699 C CB  . TYR B 2 12  ? 91.048  65.265 22.390  1.00 108.35 ? 12  TYR L CB  1 
ATOM 1700 C CG  . TYR B 2 12  ? 90.913  64.216 21.315  1.00 108.35 ? 12  TYR L CG  1 
ATOM 1701 C CD1 . TYR B 2 12  ? 90.080  64.417 20.210  1.00 108.35 ? 12  TYR L CD1 1 
ATOM 1702 C CD2 . TYR B 2 12  ? 91.645  63.025 21.390  1.00 108.35 ? 12  TYR L CD2 1 
ATOM 1703 C CE1 . TYR B 2 12  ? 89.982  63.461 19.205  1.00 108.35 ? 12  TYR L CE1 1 
ATOM 1704 C CE2 . TYR B 2 12  ? 91.557  62.058 20.395  1.00 108.35 ? 12  TYR L CE2 1 
ATOM 1705 C CZ  . TYR B 2 12  ? 90.725  62.279 19.304  1.00 108.35 ? 12  TYR L CZ  1 
ATOM 1706 O OH  . TYR B 2 12  ? 90.632  61.313 18.324  1.00 108.35 ? 12  TYR L OH  1 
ATOM 1707 N N   . ALA B 2 13  ? 90.567  64.815 25.843  1.00 81.64  ? 13  ALA L N   1 
ATOM 1708 C CA  . ALA B 2 13  ? 91.242  65.106 27.103  1.00 81.64  ? 13  ALA L CA  1 
ATOM 1709 C C   . ALA B 2 13  ? 92.303  64.036 27.341  1.00 81.64  ? 13  ALA L C   1 
ATOM 1710 O O   . ALA B 2 13  ? 92.173  62.919 26.850  1.00 81.64  ? 13  ALA L O   1 
ATOM 1711 C CB  . ALA B 2 13  ? 90.230  65.110 28.246  1.00 59.96  ? 13  ALA L CB  1 
ATOM 1712 N N   . SER B 2 14  ? 93.360  64.358 28.073  1.00 88.22  ? 14  SER L N   1 
ATOM 1713 C CA  . SER B 2 14  ? 94.376  63.345 28.337  1.00 88.22  ? 14  SER L CA  1 
ATOM 1714 C C   . SER B 2 14  ? 94.132  62.798 29.728  1.00 88.22  ? 14  SER L C   1 
ATOM 1715 O O   . SER B 2 14  ? 93.340  63.359 30.472  1.00 88.22  ? 14  SER L O   1 
ATOM 1716 C CB  . SER B 2 14  ? 95.786  63.928 28.231  1.00 123.40 ? 14  SER L CB  1 
ATOM 1717 O OG  . SER B 2 14  ? 95.929  65.068 29.051  1.00 123.40 ? 14  SER L OG  1 
ATOM 1718 N N   . LEU B 2 15  ? 94.797  61.703 30.074  1.00 103.21 ? 15  LEU L N   1 
ATOM 1719 C CA  . LEU B 2 15  ? 94.619  61.084 31.385  1.00 103.21 ? 15  LEU L CA  1 
ATOM 1720 C C   . LEU B 2 15  ? 94.967  61.977 32.569  1.00 103.21 ? 15  LEU L C   1 
ATOM 1721 O O   . LEU B 2 15  ? 95.987  62.660 32.556  1.00 103.21 ? 15  LEU L O   1 
ATOM 1722 C CB  . LEU B 2 15  ? 95.452  59.809 31.476  1.00 101.33 ? 15  LEU L CB  1 
ATOM 1723 C CG  . LEU B 2 15  ? 94.775  58.545 30.961  1.00 101.33 ? 15  LEU L CG  1 
ATOM 1724 C CD1 . LEU B 2 15  ? 94.332  58.760 29.532  1.00 101.33 ? 15  LEU L CD1 1 
ATOM 1725 C CD2 . LEU B 2 15  ? 95.733  57.366 31.083  1.00 101.33 ? 15  LEU L CD2 1 
ATOM 1726 N N   . GLY B 2 16  ? 94.120  61.967 33.595  1.00 120.95 ? 16  GLY L N   1 
ATOM 1727 C CA  . GLY B 2 16  ? 94.393  62.771 34.771  1.00 120.95 ? 16  GLY L CA  1 
ATOM 1728 C C   . GLY B 2 16  ? 93.700  64.118 34.859  1.00 120.95 ? 16  GLY L C   1 
ATOM 1729 O O   . GLY B 2 16  ? 93.316  64.533 35.951  1.00 120.95 ? 16  GLY L O   1 
ATOM 1730 N N   . GLU B 2 17  ? 93.547  64.809 33.730  1.00 90.37  ? 17  GLU L N   1 
ATOM 1731 C CA  . GLU B 2 17  ? 92.896  66.121 33.720  1.00 90.37  ? 17  GLU L CA  1 
ATOM 1732 C C   . GLU B 2 17  ? 91.398  66.027 33.997  1.00 90.37  ? 17  GLU L C   1 
ATOM 1733 O O   . GLU B 2 17  ? 90.832  64.932 33.985  1.00 90.37  ? 17  GLU L O   1 
ATOM 1734 C CB  . GLU B 2 17  ? 93.140  66.821 32.378  1.00 177.11 ? 17  GLU L CB  1 
ATOM 1735 C CG  . GLU B 2 17  ? 94.477  67.534 32.305  1.00 177.11 ? 17  GLU L CG  1 
ATOM 1736 C CD  . GLU B 2 17  ? 94.566  68.691 33.289  1.00 177.11 ? 17  GLU L CD  1 
ATOM 1737 O OE1 . GLU B 2 17  ? 93.867  69.708 33.083  1.00 177.11 ? 17  GLU L OE1 1 
ATOM 1738 O OE2 . GLU B 2 17  ? 95.326  68.579 34.275  1.00 177.11 ? 17  GLU L OE2 1 
ATOM 1739 N N   . ARG B 2 18  ? 90.767  67.168 34.281  1.00 89.21  ? 18  ARG L N   1 
ATOM 1740 C CA  . ARG B 2 18  ? 89.332  67.184 34.538  1.00 89.21  ? 18  ARG L CA  1 
ATOM 1741 C C   . ARG B 2 18  ? 88.587  67.743 33.336  1.00 89.21  ? 18  ARG L C   1 
ATOM 1742 O O   . ARG B 2 18  ? 88.625  68.942 33.055  1.00 89.21  ? 18  ARG L O   1 
ATOM 1743 C CB  . ARG B 2 18  ? 88.992  67.995 35.788  1.00 97.46  ? 18  ARG L CB  1 
ATOM 1744 C CG  . ARG B 2 18  ? 89.469  69.428 35.763  1.00 97.46  ? 18  ARG L CG  1 
ATOM 1745 C CD  . ARG B 2 18  ? 89.163  70.120 37.084  1.00 97.46  ? 18  ARG L CD  1 
ATOM 1746 N NE  . ARG B 2 18  ? 87.910  70.863 37.058  1.00 97.46  ? 18  ARG L NE  1 
ATOM 1747 C CZ  . ARG B 2 18  ? 87.377  71.468 38.117  1.00 97.46  ? 18  ARG L CZ  1 
ATOM 1748 N NH1 . ARG B 2 18  ? 87.980  71.416 39.299  1.00 97.46  ? 18  ARG L NH1 1 
ATOM 1749 N NH2 . ARG B 2 18  ? 86.248  72.148 37.988  1.00 97.46  ? 18  ARG L NH2 1 
ATOM 1750 N N   . VAL B 2 19  ? 87.931  66.837 32.621  1.00 113.58 ? 19  VAL L N   1 
ATOM 1751 C CA  . VAL B 2 19  ? 87.149  67.148 31.432  1.00 113.58 ? 19  VAL L CA  1 
ATOM 1752 C C   . VAL B 2 19  ? 85.768  67.605 31.890  1.00 113.58 ? 19  VAL L C   1 
ATOM 1753 O O   . VAL B 2 19  ? 85.401  67.409 33.049  1.00 113.58 ? 19  VAL L O   1 
ATOM 1754 C CB  . VAL B 2 19  ? 87.024  65.884 30.545  1.00 107.62 ? 19  VAL L CB  1 
ATOM 1755 C CG1 . VAL B 2 19  ? 86.725  64.688 31.417  1.00 107.62 ? 19  VAL L CG1 1 
ATOM 1756 C CG2 . VAL B 2 19  ? 85.918  66.045 29.516  1.00 107.62 ? 19  VAL L CG2 1 
ATOM 1757 N N   . THR B 2 20  ? 85.002  68.212 30.989  1.00 166.50 ? 20  THR L N   1 
ATOM 1758 C CA  . THR B 2 20  ? 83.670  68.679 31.346  1.00 166.50 ? 20  THR L CA  1 
ATOM 1759 C C   . THR B 2 20  ? 82.741  69.001 30.189  1.00 166.50 ? 20  THR L C   1 
ATOM 1760 O O   . THR B 2 20  ? 83.115  69.713 29.254  1.00 166.50 ? 20  THR L O   1 
ATOM 1761 C CB  . THR B 2 20  ? 83.740  69.943 32.179  1.00 58.07  ? 20  THR L CB  1 
ATOM 1762 O OG1 . THR B 2 20  ? 84.502  69.693 33.358  1.00 58.07  ? 20  THR L OG1 1 
ATOM 1763 C CG2 . THR B 2 20  ? 82.342  70.403 32.547  1.00 58.07  ? 20  THR L CG2 1 
ATOM 1764 N N   . ILE B 2 21  ? 81.517  68.494 30.277  1.00 61.84  ? 21  ILE L N   1 
ATOM 1765 C CA  . ILE B 2 21  ? 80.515  68.773 29.272  1.00 61.84  ? 21  ILE L CA  1 
ATOM 1766 C C   . ILE B 2 21  ? 79.394  69.553 29.991  1.00 61.84  ? 21  ILE L C   1 
ATOM 1767 O O   . ILE B 2 21  ? 79.117  69.340 31.173  1.00 61.84  ? 21  ILE L O   1 
ATOM 1768 C CB  . ILE B 2 21  ? 80.010  67.460 28.628  1.00 89.37  ? 21  ILE L CB  1 
ATOM 1769 C CG1 . ILE B 2 21  ? 79.097  66.694 29.584  1.00 89.37  ? 21  ILE L CG1 1 
ATOM 1770 C CG2 . ILE B 2 21  ? 81.193  66.587 28.288  1.00 89.37  ? 21  ILE L CG2 1 
ATOM 1771 C CD1 . ILE B 2 21  ? 78.620  65.364 29.023  1.00 89.37  ? 21  ILE L CD1 1 
ATOM 1772 N N   . THR B 2 22  ? 78.786  70.483 29.268  1.00 82.89  ? 22  THR L N   1 
ATOM 1773 C CA  . THR B 2 22  ? 77.731  71.319 29.810  1.00 82.89  ? 22  THR L CA  1 
ATOM 1774 C C   . THR B 2 22  ? 76.451  71.195 28.971  1.00 82.89  ? 22  THR L C   1 
ATOM 1775 O O   . THR B 2 22  ? 76.482  71.329 27.738  1.00 82.89  ? 22  THR L O   1 
ATOM 1776 C CB  . THR B 2 22  ? 78.211  72.795 29.858  1.00 102.87 ? 22  THR L CB  1 
ATOM 1777 O OG1 . THR B 2 22  ? 77.184  73.628 30.414  1.00 102.87 ? 22  THR L OG1 1 
ATOM 1778 C CG2 . THR B 2 22  ? 78.575  73.284 28.460  1.00 102.87 ? 22  THR L CG2 1 
ATOM 1779 N N   . CYS B 2 23  ? 75.332  70.952 29.659  1.00 108.87 ? 23  CYS L N   1 
ATOM 1780 C CA  . CYS B 2 23  ? 74.001  70.771 29.050  1.00 108.87 ? 23  CYS L CA  1 
ATOM 1781 C C   . CYS B 2 23  ? 73.067  71.955 29.367  1.00 108.87 ? 23  CYS L C   1 
ATOM 1782 O O   . CYS B 2 23  ? 73.085  72.465 30.484  1.00 108.87 ? 23  CYS L O   1 
ATOM 1783 C CB  . CYS B 2 23  ? 73.409  69.464 29.601  1.00 99.48  ? 23  CYS L CB  1 
ATOM 1784 S SG  . CYS B 2 23  ? 71.793  68.840 29.021  1.00 99.48  ? 23  CYS L SG  1 
ATOM 1785 N N   . LYS B 2 24  ? 72.260  72.394 28.398  1.00 68.96  ? 24  LYS L N   1 
ATOM 1786 C CA  . LYS B 2 24  ? 71.327  73.512 28.617  1.00 68.96  ? 24  LYS L CA  1 
ATOM 1787 C C   . LYS B 2 24  ? 70.010  73.331 27.865  1.00 68.96  ? 24  LYS L C   1 
ATOM 1788 O O   . LYS B 2 24  ? 69.966  73.411 26.638  1.00 68.96  ? 24  LYS L O   1 
ATOM 1789 C CB  . LYS B 2 24  ? 71.955  74.848 28.204  1.00 116.03 ? 24  LYS L CB  1 
ATOM 1790 C CG  . LYS B 2 24  ? 73.178  75.248 29.014  1.00 116.03 ? 24  LYS L CG  1 
ATOM 1791 C CD  . LYS B 2 24  ? 73.580  76.699 28.762  1.00 116.03 ? 24  LYS L CD  1 
ATOM 1792 C CE  . LYS B 2 24  ? 74.793  77.101 29.598  1.00 116.03 ? 24  LYS L CE  1 
ATOM 1793 N NZ  . LYS B 2 24  ? 75.196  78.514 29.346  1.00 116.03 ? 24  LYS L NZ  1 
ATOM 1794 N N   . ALA B 2 25  ? 68.929  73.110 28.602  1.00 81.69  ? 25  ALA L N   1 
ATOM 1795 C CA  . ALA B 2 25  ? 67.625  72.899 27.978  1.00 81.69  ? 25  ALA L CA  1 
ATOM 1796 C C   . ALA B 2 25  ? 66.917  74.178 27.602  1.00 81.69  ? 25  ALA L C   1 
ATOM 1797 O O   . ALA B 2 25  ? 67.339  75.267 27.966  1.00 81.69  ? 25  ALA L O   1 
ATOM 1798 C CB  . ALA B 2 25  ? 66.727  72.088 28.892  1.00 79.85  ? 25  ALA L CB  1 
ATOM 1799 N N   . SER B 2 26  ? 65.814  74.029 26.883  1.00 74.69  ? 26  SER L N   1 
ATOM 1800 C CA  . SER B 2 26  ? 65.021  75.174 26.458  1.00 74.69  ? 26  SER L CA  1 
ATOM 1801 C C   . SER B 2 26  ? 64.210  75.765 27.611  1.00 74.69  ? 26  SER L C   1 
ATOM 1802 O O   . SER B 2 26  ? 64.301  76.951 27.905  1.00 74.69  ? 26  SER L O   1 
ATOM 1803 C CB  . SER B 2 26  ? 64.087  74.759 25.311  1.00 87.62  ? 26  SER L CB  1 
ATOM 1804 O OG  . SER B 2 26  ? 63.516  73.482 25.537  1.00 87.62  ? 26  SER L OG  1 
ATOM 1805 N N   . GLN B 2 27  ? 63.424  74.916 28.260  1.00 70.51  ? 27  GLN L N   1 
ATOM 1806 C CA  . GLN B 2 27  ? 62.574  75.307 29.378  1.00 70.51  ? 27  GLN L CA  1 
ATOM 1807 C C   . GLN B 2 27  ? 63.341  75.489 30.677  1.00 70.51  ? 27  GLN L C   1 
ATOM 1808 O O   . GLN B 2 27  ? 64.424  76.068 30.745  1.00 70.51  ? 27  GLN L O   1 
ATOM 1809 C CB  . GLN B 2 27  ? 61.512  74.230 29.631  1.00 120.46 ? 27  GLN L CB  1 
ATOM 1810 C CG  . GLN B 2 27  ? 60.097  74.688 29.455  1.00 120.46 ? 27  GLN L CG  1 
ATOM 1811 C CD  . GLN B 2 27  ? 59.694  74.729 28.000  1.00 120.46 ? 27  GLN L CD  1 
ATOM 1812 O OE1 . GLN B 2 27  ? 60.541  74.824 27.104  1.00 120.46 ? 27  GLN L OE1 1 
ATOM 1813 N NE2 . GLN B 2 27  ? 58.391  74.665 27.751  1.00 120.46 ? 27  GLN L NE2 1 
ATOM 1814 N N   . ASP B 2 28  ? 62.724  74.951 31.714  1.00 94.84  ? 28  ASP L N   1 
ATOM 1815 C CA  . ASP B 2 28  ? 63.250  74.967 33.053  1.00 94.84  ? 28  ASP L CA  1 
ATOM 1816 C C   . ASP B 2 28  ? 62.816  73.655 33.683  1.00 94.84  ? 28  ASP L C   1 
ATOM 1817 O O   . ASP B 2 28  ? 61.683  73.512 34.149  1.00 94.84  ? 28  ASP L O   1 
ATOM 1818 C CB  . ASP B 2 28  ? 62.670  76.131 33.846  1.00 177.32 ? 28  ASP L CB  1 
ATOM 1819 C CG  . ASP B 2 28  ? 62.860  75.967 35.343  1.00 177.32 ? 28  ASP L CG  1 
ATOM 1820 O OD1 . ASP B 2 28  ? 62.329  76.805 36.099  1.00 177.32 ? 28  ASP L OD1 1 
ATOM 1821 O OD2 . ASP B 2 28  ? 63.536  75.004 35.767  1.00 177.32 ? 28  ASP L OD2 1 
ATOM 1822 N N   . ILE B 2 29  ? 63.719  72.688 33.645  1.00 123.36 ? 29  ILE L N   1 
ATOM 1823 C CA  . ILE B 2 29  ? 63.483  71.392 34.246  1.00 123.36 ? 29  ILE L CA  1 
ATOM 1824 C C   . ILE B 2 29  ? 63.957  71.627 35.664  1.00 123.36 ? 29  ILE L C   1 
ATOM 1825 O O   . ILE B 2 29  ? 65.003  72.232 35.871  1.00 123.36 ? 29  ILE L O   1 
ATOM 1826 C CB  . ILE B 2 29  ? 64.341  70.313 33.569  1.00 80.76  ? 29  ILE L CB  1 
ATOM 1827 C CG1 . ILE B 2 29  ? 65.802  70.784 33.473  1.00 80.76  ? 29  ILE L CG1 1 
ATOM 1828 C CG2 . ILE B 2 29  ? 63.793  70.038 32.174  1.00 80.76  ? 29  ILE L CG2 1 
ATOM 1829 C CD1 . ILE B 2 29  ? 66.776  69.749 32.931  1.00 80.76  ? 29  ILE L CD1 1 
ATOM 1830 N N   . ASN B 2 30  ? 63.189  71.189 36.647  1.00 104.87 ? 30  ASN L N   1 
ATOM 1831 C CA  . ASN B 2 30  ? 63.592  71.410 38.025  1.00 104.87 ? 30  ASN L CA  1 
ATOM 1832 C C   . ASN B 2 30  ? 64.667  70.397 38.426  1.00 104.87 ? 30  ASN L C   1 
ATOM 1833 O O   . ASN B 2 30  ? 64.404  69.444 39.160  1.00 104.87 ? 30  ASN L O   1 
ATOM 1834 C CB  . ASN B 2 30  ? 62.370  71.300 38.938  1.00 131.00 ? 30  ASN L CB  1 
ATOM 1835 C CG  . ASN B 2 30  ? 61.241  72.224 38.516  1.00 131.00 ? 30  ASN L CG  1 
ATOM 1836 O OD1 . ASN B 2 30  ? 60.158  72.198 39.101  1.00 131.00 ? 30  ASN L OD1 1 
ATOM 1837 N ND2 . ASN B 2 30  ? 61.488  73.044 37.499  1.00 131.00 ? 30  ASN L ND2 1 
ATOM 1838 N N   . SER B 2 31  ? 65.887  70.607 37.946  1.00 98.17  ? 31  SER L N   1 
ATOM 1839 C CA  . SER B 2 31  ? 66.980  69.691 38.247  1.00 98.17  ? 31  SER L CA  1 
ATOM 1840 C C   . SER B 2 31  ? 66.575  68.260 37.904  1.00 98.17  ? 31  SER L C   1 
ATOM 1841 O O   . SER B 2 31  ? 67.144  67.294 38.413  1.00 98.17  ? 31  SER L O   1 
ATOM 1842 C CB  . SER B 2 31  ? 67.367  69.788 39.722  1.00 232.30 ? 31  SER L CB  1 
ATOM 1843 O OG  . SER B 2 31  ? 67.963  71.041 39.998  1.00 232.30 ? 31  SER L OG  1 
ATOM 1844 N N   . TYR B 2 32  ? 65.571  68.139 37.039  1.00 106.77 ? 32  TYR L N   1 
ATOM 1845 C CA  . TYR B 2 32  ? 65.082  66.846 36.590  1.00 106.77 ? 32  TYR L CA  1 
ATOM 1846 C C   . TYR B 2 32  ? 65.850  66.439 35.327  1.00 106.77 ? 32  TYR L C   1 
ATOM 1847 O O   . TYR B 2 32  ? 65.275  66.208 34.256  1.00 106.77 ? 32  TYR L O   1 
ATOM 1848 C CB  . TYR B 2 32  ? 63.576  66.926 36.342  1.00 105.24 ? 32  TYR L CB  1 
ATOM 1849 C CG  . TYR B 2 32  ? 62.752  66.722 37.602  1.00 105.24 ? 32  TYR L CG  1 
ATOM 1850 C CD1 . TYR B 2 32  ? 61.420  67.139 37.671  1.00 105.24 ? 32  TYR L CD1 1 
ATOM 1851 C CD2 . TYR B 2 32  ? 63.291  66.072 38.717  1.00 105.24 ? 32  TYR L CD2 1 
ATOM 1852 C CE1 . TYR B 2 32  ? 60.641  66.909 38.823  1.00 105.24 ? 32  TYR L CE1 1 
ATOM 1853 C CE2 . TYR B 2 32  ? 62.522  65.837 39.868  1.00 105.24 ? 32  TYR L CE2 1 
ATOM 1854 C CZ  . TYR B 2 32  ? 61.201  66.257 39.911  1.00 105.24 ? 32  TYR L CZ  1 
ATOM 1855 O OH  . TYR B 2 32  ? 60.438  66.013 41.027  1.00 105.24 ? 32  TYR L OH  1 
ATOM 1856 N N   . LEU B 2 33  ? 67.170  66.366 35.490  1.00 87.23  ? 33  LEU L N   1 
ATOM 1857 C CA  . LEU B 2 33  ? 68.100  66.002 34.426  1.00 87.23  ? 33  LEU L CA  1 
ATOM 1858 C C   . LEU B 2 33  ? 69.006  64.841 34.870  1.00 87.23  ? 33  LEU L C   1 
ATOM 1859 O O   . LEU B 2 33  ? 69.268  64.674 36.062  1.00 87.23  ? 33  LEU L O   1 
ATOM 1860 C CB  . LEU B 2 33  ? 68.931  67.235 34.022  1.00 62.97  ? 33  LEU L CB  1 
ATOM 1861 C CG  . LEU B 2 33  ? 70.207  67.014 33.199  1.00 62.97  ? 33  LEU L CG  1 
ATOM 1862 C CD1 . LEU B 2 33  ? 70.569  68.255 32.392  1.00 62.97  ? 33  LEU L CD1 1 
ATOM 1863 C CD2 . LEU B 2 33  ? 71.336  66.632 34.151  1.00 62.97  ? 33  LEU L CD2 1 
ATOM 1864 N N   . SER B 2 34  ? 69.482  64.056 33.898  1.00 58.32  ? 34  SER L N   1 
ATOM 1865 C CA  . SER B 2 34  ? 70.331  62.886 34.146  1.00 58.32  ? 34  SER L CA  1 
ATOM 1866 C C   . SER B 2 34  ? 71.484  62.760 33.143  1.00 58.32  ? 34  SER L C   1 
ATOM 1867 O O   . SER B 2 34  ? 71.392  63.231 32.022  1.00 58.32  ? 34  SER L O   1 
ATOM 1868 C CB  . SER B 2 34  ? 69.462  61.626 34.110  1.00 68.14  ? 34  SER L CB  1 
ATOM 1869 O OG  . SER B 2 34  ? 70.247  60.463 34.119  1.00 68.14  ? 34  SER L OG  1 
ATOM 1870 N N   . TRP B 2 35  ? 72.573  62.124 33.554  1.00 58.76  ? 35  TRP L N   1 
ATOM 1871 C CA  . TRP B 2 35  ? 73.741  61.958 32.694  1.00 58.76  ? 35  TRP L CA  1 
ATOM 1872 C C   . TRP B 2 35  ? 74.118  60.497 32.586  1.00 58.76  ? 35  TRP L C   1 
ATOM 1873 O O   . TRP B 2 35  ? 74.270  59.832 33.613  1.00 58.76  ? 35  TRP L O   1 
ATOM 1874 C CB  . TRP B 2 35  ? 74.967  62.685 33.267  1.00 97.09  ? 35  TRP L CB  1 
ATOM 1875 C CG  . TRP B 2 35  ? 74.871  64.167 33.337  1.00 97.09  ? 35  TRP L CG  1 
ATOM 1876 C CD1 . TRP B 2 35  ? 74.469  64.917 34.401  1.00 97.09  ? 35  TRP L CD1 1 
ATOM 1877 C CD2 . TRP B 2 35  ? 75.187  65.087 32.294  1.00 97.09  ? 35  TRP L CD2 1 
ATOM 1878 N NE1 . TRP B 2 35  ? 74.516  66.254 34.084  1.00 97.09  ? 35  TRP L NE1 1 
ATOM 1879 C CE2 . TRP B 2 35  ? 74.952  66.383 32.792  1.00 97.09  ? 35  TRP L CE2 1 
ATOM 1880 C CE3 . TRP B 2 35  ? 75.644  64.941 30.982  1.00 97.09  ? 35  TRP L CE3 1 
ATOM 1881 C CZ2 . TRP B 2 35  ? 75.162  67.527 32.024  1.00 97.09  ? 35  TRP L CZ2 1 
ATOM 1882 C CZ3 . TRP B 2 35  ? 75.853  66.075 30.222  1.00 97.09  ? 35  TRP L CZ3 1 
ATOM 1883 C CH2 . TRP B 2 35  ? 75.611  67.351 30.743  1.00 97.09  ? 35  TRP L CH2 1 
ATOM 1884 N N   . PHE B 2 36  ? 74.278  59.999 31.357  1.00 67.78  ? 36  PHE L N   1 
ATOM 1885 C CA  . PHE B 2 36  ? 74.690  58.612 31.139  1.00 67.78  ? 36  PHE L CA  1 
ATOM 1886 C C   . PHE B 2 36  ? 75.782  58.488 30.065  1.00 67.78  ? 36  PHE L C   1 
ATOM 1887 O O   . PHE B 2 36  ? 76.061  59.438 29.334  1.00 67.78  ? 36  PHE L O   1 
ATOM 1888 C CB  . PHE B 2 36  ? 73.476  57.715 30.816  1.00 74.73  ? 36  PHE L CB  1 
ATOM 1889 C CG  . PHE B 2 36  ? 72.758  58.049 29.525  1.00 74.73  ? 36  PHE L CG  1 
ATOM 1890 C CD1 . PHE B 2 36  ? 73.228  57.582 28.298  1.00 74.73  ? 36  PHE L CD1 1 
ATOM 1891 C CD2 . PHE B 2 36  ? 71.579  58.785 29.546  1.00 74.73  ? 36  PHE L CD2 1 
ATOM 1892 C CE1 . PHE B 2 36  ? 72.533  57.841 27.122  1.00 74.73  ? 36  PHE L CE1 1 
ATOM 1893 C CE2 . PHE B 2 36  ? 70.880  59.047 28.372  1.00 74.73  ? 36  PHE L CE2 1 
ATOM 1894 C CZ  . PHE B 2 36  ? 71.357  58.574 27.161  1.00 74.73  ? 36  PHE L CZ  1 
ATOM 1895 N N   . GLN B 2 37  ? 76.410  57.318 29.983  1.00 61.80  ? 37  GLN L N   1 
ATOM 1896 C CA  . GLN B 2 37  ? 77.484  57.077 29.016  1.00 61.80  ? 37  GLN L CA  1 
ATOM 1897 C C   . GLN B 2 37  ? 77.251  55.879 28.086  1.00 61.80  ? 37  GLN L C   1 
ATOM 1898 O O   . GLN B 2 37  ? 76.911  54.789 28.521  1.00 61.80  ? 37  GLN L O   1 
ATOM 1899 C CB  . GLN B 2 37  ? 78.801  56.891 29.765  1.00 102.15 ? 37  GLN L CB  1 
ATOM 1900 C CG  . GLN B 2 37  ? 79.533  55.606 29.451  1.00 102.15 ? 37  GLN L CG  1 
ATOM 1901 C CD  . GLN B 2 37  ? 80.564  55.299 30.498  1.00 102.15 ? 37  GLN L CD  1 
ATOM 1902 O OE1 . GLN B 2 37  ? 80.233  55.138 31.665  1.00 102.15 ? 37  GLN L OE1 1 
ATOM 1903 N NE2 . GLN B 2 37  ? 81.822  55.230 30.096  1.00 102.15 ? 37  GLN L NE2 1 
ATOM 1904 N N   . GLN B 2 38  ? 77.438  56.113 26.795  1.00 56.39  ? 38  GLN L N   1 
ATOM 1905 C CA  . GLN B 2 38  ? 77.284  55.092 25.778  1.00 56.39  ? 38  GLN L CA  1 
ATOM 1906 C C   . GLN B 2 38  ? 78.692  54.734 25.367  1.00 56.39  ? 38  GLN L C   1 
ATOM 1907 O O   . GLN B 2 38  ? 79.489  55.614 25.002  1.00 56.39  ? 38  GLN L O   1 
ATOM 1908 C CB  . GLN B 2 38  ? 76.553  55.640 24.544  1.00 84.58  ? 38  GLN L CB  1 
ATOM 1909 C CG  . GLN B 2 38  ? 75.109  55.177 24.363  1.00 84.58  ? 38  GLN L CG  1 
ATOM 1910 C CD  . GLN B 2 38  ? 74.959  53.873 23.594  1.00 84.58  ? 38  GLN L CD  1 
ATOM 1911 O OE1 . GLN B 2 38  ? 75.670  52.911 23.839  1.00 84.58  ? 38  GLN L OE1 1 
ATOM 1912 N NE2 . GLN B 2 38  ? 74.018  53.838 22.670  1.00 84.58  ? 38  GLN L NE2 1 
ATOM 1913 N N   . LYS B 2 39  ? 79.012  53.452 25.443  1.00 99.48  ? 39  LYS L N   1 
ATOM 1914 C CA  . LYS B 2 39  ? 80.318  52.978 25.042  1.00 99.48  ? 39  LYS L CA  1 
ATOM 1915 C C   . LYS B 2 39  ? 80.050  52.069 23.870  1.00 99.48  ? 39  LYS L C   1 
ATOM 1916 O O   . LYS B 2 39  ? 79.127  51.266 23.902  1.00 99.48  ? 39  LYS L O   1 
ATOM 1917 C CB  . LYS B 2 39  ? 80.963  52.198 26.169  1.00 58.50  ? 39  LYS L CB  1 
ATOM 1918 C CG  . LYS B 2 39  ? 82.112  52.926 26.847  1.00 58.50  ? 39  LYS L CG  1 
ATOM 1919 C CD  . LYS B 2 39  ? 82.472  52.233 28.166  1.00 58.50  ? 39  LYS L CD  1 
ATOM 1920 C CE  . LYS B 2 39  ? 83.740  52.774 28.829  1.00 58.50  ? 39  LYS L CE  1 
ATOM 1921 N NZ  . LYS B 2 39  ? 84.959  52.425 28.054  1.00 58.50  ? 39  LYS L NZ  1 
ATOM 1922 N N   . PRO B 2 40  ? 80.850  52.183 22.812  1.00 80.41  ? 40  PRO L N   1 
ATOM 1923 C CA  . PRO B 2 40  ? 80.641  51.332 21.640  1.00 80.41  ? 40  PRO L CA  1 
ATOM 1924 C C   . PRO B 2 40  ? 80.464  49.880 22.045  1.00 80.41  ? 40  PRO L C   1 
ATOM 1925 O O   . PRO B 2 40  ? 81.221  49.381 22.878  1.00 80.41  ? 40  PRO L O   1 
ATOM 1926 C CB  . PRO B 2 40  ? 81.922  51.535 20.845  1.00 71.07  ? 40  PRO L CB  1 
ATOM 1927 C CG  . PRO B 2 40  ? 82.932  51.751 21.926  1.00 71.07  ? 40  PRO L CG  1 
ATOM 1928 C CD  . PRO B 2 40  ? 82.211  52.734 22.806  1.00 71.07  ? 40  PRO L CD  1 
ATOM 1929 N N   . GLY B 2 41  ? 79.463  49.217 21.470  1.00 179.08 ? 41  GLY L N   1 
ATOM 1930 C CA  . GLY B 2 41  ? 79.217  47.816 21.771  1.00 179.08 ? 41  GLY L CA  1 
ATOM 1931 C C   . GLY B 2 41  ? 78.672  47.487 23.150  1.00 179.08 ? 41  GLY L C   1 
ATOM 1932 O O   . GLY B 2 41  ? 78.886  46.383 23.654  1.00 179.08 ? 41  GLY L O   1 
ATOM 1933 N N   . LYS B 2 42  ? 77.967  48.432 23.764  1.00 155.26 ? 42  LYS L N   1 
ATOM 1934 C CA  . LYS B 2 42  ? 77.393  48.215 25.088  1.00 155.26 ? 42  LYS L CA  1 
ATOM 1935 C C   . LYS B 2 42  ? 76.133  49.048 25.278  1.00 155.26 ? 42  LYS L C   1 
ATOM 1936 O O   . LYS B 2 42  ? 75.882  49.993 24.535  1.00 155.26 ? 42  LYS L O   1 
ATOM 1937 C CB  . LYS B 2 42  ? 78.396  48.589 26.180  1.00 122.85 ? 42  LYS L CB  1 
ATOM 1938 C CG  . LYS B 2 42  ? 79.739  47.889 26.087  1.00 122.85 ? 42  LYS L CG  1 
ATOM 1939 C CD  . LYS B 2 42  ? 80.681  48.393 27.169  1.00 122.85 ? 42  LYS L CD  1 
ATOM 1940 C CE  . LYS B 2 42  ? 82.102  47.895 26.952  1.00 122.85 ? 42  LYS L CE  1 
ATOM 1941 N NZ  . LYS B 2 42  ? 83.059  48.452 27.954  1.00 122.85 ? 42  LYS L NZ  1 
ATOM 1942 N N   . SER B 2 43  ? 75.348  48.686 26.285  1.00 77.92  ? 43  SER L N   1 
ATOM 1943 C CA  . SER B 2 43  ? 74.114  49.392 26.610  1.00 77.92  ? 43  SER L CA  1 
ATOM 1944 C C   . SER B 2 43  ? 74.492  50.514 27.572  1.00 77.92  ? 43  SER L C   1 
ATOM 1945 O O   . SER B 2 43  ? 75.402  50.358 28.393  1.00 77.92  ? 43  SER L O   1 
ATOM 1946 C CB  . SER B 2 43  ? 73.106  48.440 27.264  1.00 211.77 ? 43  SER L CB  1 
ATOM 1947 O OG  . SER B 2 43  ? 73.655  47.823 28.414  1.00 211.77 ? 43  SER L OG  1 
ATOM 1948 N N   . PRO B 2 44  ? 73.807  51.666 27.477  1.00 72.41  ? 44  PRO L N   1 
ATOM 1949 C CA  . PRO B 2 44  ? 74.080  52.825 28.336  1.00 72.41  ? 44  PRO L CA  1 
ATOM 1950 C C   . PRO B 2 44  ? 74.077  52.619 29.845  1.00 72.41  ? 44  PRO L C   1 
ATOM 1951 O O   . PRO B 2 44  ? 73.141  52.079 30.425  1.00 72.41  ? 44  PRO L O   1 
ATOM 1952 C CB  . PRO B 2 44  ? 73.049  53.863 27.875  1.00 58.30  ? 44  PRO L CB  1 
ATOM 1953 C CG  . PRO B 2 44  ? 72.027  53.066 27.122  1.00 58.30  ? 44  PRO L CG  1 
ATOM 1954 C CD  . PRO B 2 44  ? 72.789  51.987 26.464  1.00 58.30  ? 44  PRO L CD  1 
ATOM 1955 N N   . LYS B 2 45  ? 75.157  53.053 30.475  1.00 61.91  ? 45  LYS L N   1 
ATOM 1956 C CA  . LYS B 2 45  ? 75.295  52.955 31.907  1.00 61.91  ? 45  LYS L CA  1 
ATOM 1957 C C   . LYS B 2 45  ? 75.069  54.383 32.439  1.00 61.91  ? 45  LYS L C   1 
ATOM 1958 O O   . LYS B 2 45  ? 75.803  55.302 32.078  1.00 61.91  ? 45  LYS L O   1 
ATOM 1959 C CB  . LYS B 2 45  ? 76.698  52.447 32.239  1.00 127.81 ? 45  LYS L CB  1 
ATOM 1960 C CG  . LYS B 2 45  ? 76.958  52.209 33.711  1.00 127.81 ? 45  LYS L CG  1 
ATOM 1961 C CD  . LYS B 2 45  ? 78.450  52.046 33.979  1.00 127.81 ? 45  LYS L CD  1 
ATOM 1962 C CE  . LYS B 2 45  ? 78.780  52.270 35.455  1.00 127.81 ? 45  LYS L CE  1 
ATOM 1963 N NZ  . LYS B 2 45  ? 80.239  52.521 35.690  1.00 127.81 ? 45  LYS L NZ  1 
ATOM 1964 N N   . THR B 2 46  ? 74.038  54.566 33.270  1.00 64.43  ? 46  THR L N   1 
ATOM 1965 C CA  . THR B 2 46  ? 73.711  55.877 33.848  1.00 64.43  ? 46  THR L CA  1 
ATOM 1966 C C   . THR B 2 46  ? 74.625  56.218 35.015  1.00 64.43  ? 46  THR L C   1 
ATOM 1967 O O   . THR B 2 46  ? 74.979  55.338 35.806  1.00 64.43  ? 46  THR L O   1 
ATOM 1968 C CB  . THR B 2 46  ? 72.285  55.928 34.395  1.00 59.65  ? 46  THR L CB  1 
ATOM 1969 O OG1 . THR B 2 46  ? 71.348  55.659 33.352  1.00 59.65  ? 46  THR L OG1 1 
ATOM 1970 C CG2 . THR B 2 46  ? 72.004  57.291 34.956  1.00 59.65  ? 46  THR L CG2 1 
ATOM 1971 N N   . LEU B 2 47  ? 74.980  57.497 35.138  1.00 61.44  ? 47  LEU L N   1 
ATOM 1972 C CA  . LEU B 2 47  ? 75.867  57.933 36.209  1.00 61.44  ? 47  LEU L CA  1 
ATOM 1973 C C   . LEU B 2 47  ? 75.193  58.856 37.190  1.00 61.44  ? 47  LEU L C   1 
ATOM 1974 O O   . LEU B 2 47  ? 75.326  58.686 38.391  1.00 61.44  ? 47  LEU L O   1 
ATOM 1975 C CB  . LEU B 2 47  ? 77.091  58.686 35.668  1.00 58.79  ? 47  LEU L CB  1 
ATOM 1976 C CG  . LEU B 2 47  ? 77.956  58.272 34.471  1.00 58.79  ? 47  LEU L CG  1 
ATOM 1977 C CD1 . LEU B 2 47  ? 77.751  56.813 34.070  1.00 58.79  ? 47  LEU L CD1 1 
ATOM 1978 C CD2 . LEU B 2 47  ? 77.605  59.219 33.350  1.00 58.79  ? 47  LEU L CD2 1 
ATOM 1979 N N   . ILE B 2 48  ? 74.476  59.846 36.677  1.00 89.11  ? 48  ILE L N   1 
ATOM 1980 C CA  . ILE B 2 48  ? 73.838  60.817 37.547  1.00 89.11  ? 48  ILE L CA  1 
ATOM 1981 C C   . ILE B 2 48  ? 72.429  61.210 37.149  1.00 89.11  ? 48  ILE L C   1 
ATOM 1982 O O   . ILE B 2 48  ? 72.106  61.280 35.969  1.00 89.11  ? 48  ILE L O   1 
ATOM 1983 C CB  . ILE B 2 48  ? 74.675  62.100 37.597  1.00 146.15 ? 48  ILE L CB  1 
ATOM 1984 C CG1 . ILE B 2 48  ? 76.016  61.816 38.269  1.00 146.15 ? 48  ILE L CG1 1 
ATOM 1985 C CG2 . ILE B 2 48  ? 73.926  63.189 38.327  1.00 146.15 ? 48  ILE L CG2 1 
ATOM 1986 C CD1 . ILE B 2 48  ? 76.939  63.026 38.311  1.00 146.15 ? 48  ILE L CD1 1 
ATOM 1987 N N   . TYR B 2 49  ? 71.597  61.467 38.152  1.00 74.01  ? 49  TYR L N   1 
ATOM 1988 C CA  . TYR B 2 49  ? 70.226  61.918 37.939  1.00 74.01  ? 49  TYR L CA  1 
ATOM 1989 C C   . TYR B 2 49  ? 69.966  63.068 38.918  1.00 74.01  ? 49  TYR L C   1 
ATOM 1990 O O   . TYR B 2 49  ? 70.850  63.437 39.693  1.00 74.01  ? 49  TYR L O   1 
ATOM 1991 C CB  . TYR B 2 49  ? 69.230  60.773 38.151  1.00 86.23  ? 49  TYR L CB  1 
ATOM 1992 C CG  . TYR B 2 49  ? 69.045  60.350 39.580  1.00 86.23  ? 49  TYR L CG  1 
ATOM 1993 C CD1 . TYR B 2 49  ? 68.396  61.173 40.488  1.00 86.23  ? 49  TYR L CD1 1 
ATOM 1994 C CD2 . TYR B 2 49  ? 69.534  59.123 40.030  1.00 86.23  ? 49  TYR L CD2 1 
ATOM 1995 C CE1 . TYR B 2 49  ? 68.238  60.790 41.817  1.00 86.23  ? 49  TYR L CE1 1 
ATOM 1996 C CE2 . TYR B 2 49  ? 69.381  58.725 41.358  1.00 86.23  ? 49  TYR L CE2 1 
ATOM 1997 C CZ  . TYR B 2 49  ? 68.730  59.564 42.249  1.00 86.23  ? 49  TYR L CZ  1 
ATOM 1998 O OH  . TYR B 2 49  ? 68.554  59.171 43.560  1.00 86.23  ? 49  TYR L OH  1 
ATOM 1999 N N   . ARG B 2 50  ? 68.766  63.632 38.901  1.00 74.84  ? 50  ARG L N   1 
ATOM 2000 C CA  . ARG B 2 50  ? 68.482  64.760 39.782  1.00 74.84  ? 50  ARG L CA  1 
ATOM 2001 C C   . ARG B 2 50  ? 69.640  65.754 39.671  1.00 74.84  ? 50  ARG L C   1 
ATOM 2002 O O   . ARG B 2 50  ? 70.125  66.272 40.675  1.00 88.70  ? 50  ARG L O   1 
ATOM 2003 C CB  . ARG B 2 50  ? 68.358  64.316 41.243  1.00 143.46 ? 50  ARG L CB  1 
ATOM 2004 C CG  . ARG B 2 50  ? 67.307  65.082 42.067  1.00 143.46 ? 50  ARG L CG  1 
ATOM 2005 C CD  . ARG B 2 50  ? 67.506  66.603 42.110  1.00 143.46 ? 50  ARG L CD  1 
ATOM 2006 N NE  . ARG B 2 50  ? 68.606  67.027 42.978  1.00 143.46 ? 50  ARG L NE  1 
ATOM 2007 C CZ  . ARG B 2 50  ? 68.742  68.260 43.463  1.00 143.46 ? 50  ARG L CZ  1 
ATOM 2008 N NH1 . ARG B 2 50  ? 67.845  69.189 43.167  1.00 143.46 ? 50  ARG L NH1 1 
ATOM 2009 N NH2 . ARG B 2 50  ? 69.769  68.566 44.246  1.00 143.46 ? 50  ARG L NH2 1 
ATOM 2010 N N   . ALA B 2 51  ? 70.104  65.976 38.446  1.00 82.32  ? 51  ALA L N   1 
ATOM 2011 C CA  . ALA B 2 51  ? 71.179  66.923 38.175  1.00 82.32  ? 51  ALA L CA  1 
ATOM 2012 C C   . ALA B 2 51  ? 72.519  66.638 38.830  1.00 82.32  ? 51  ALA L C   1 
ATOM 2013 O O   . ALA B 2 51  ? 73.557  67.035 38.304  1.00 82.32  ? 51  ALA L O   1 
ATOM 2014 C CB  . ALA B 2 51  ? 70.726  68.325 38.558  1.00 94.72  ? 51  ALA L CB  1 
ATOM 2015 N N   . ASN B 2 52  ? 72.514  65.954 39.965  1.00 84.38  ? 52  ASN L N   1 
ATOM 2016 C CA  . ASN B 2 52  ? 73.768  65.707 40.666  1.00 84.38  ? 52  ASN L CA  1 
ATOM 2017 C C   . ASN B 2 52  ? 73.813  64.416 41.464  1.00 84.38  ? 52  ASN L C   1 
ATOM 2018 O O   . ASN B 2 52  ? 74.894  63.965 41.845  1.00 84.38  ? 52  ASN L O   1 
ATOM 2019 C CB  . ASN B 2 52  ? 74.045  66.868 41.624  1.00 66.60  ? 52  ASN L CB  1 
ATOM 2020 C CG  . ASN B 2 52  ? 72.959  67.013 42.685  1.00 66.60  ? 52  ASN L CG  1 
ATOM 2021 O OD1 . ASN B 2 52  ? 72.985  67.929 43.494  1.00 66.60  ? 52  ASN L OD1 1 
ATOM 2022 N ND2 . ASN B 2 52  ? 71.998  66.099 42.679  1.00 66.60  ? 52  ASN L ND2 1 
ATOM 2023 N N   . ARG B 2 53  ? 72.652  63.827 41.735  1.00 59.42  ? 53  ARG L N   1 
ATOM 2024 C CA  . ARG B 2 53  ? 72.635  62.611 42.519  1.00 59.42  ? 53  ARG L CA  1 
ATOM 2025 C C   . ARG B 2 53  ? 73.159  61.360 41.830  1.00 59.42  ? 53  ARG L C   1 
ATOM 2026 O O   . ARG B 2 53  ? 72.423  60.635 41.166  1.00 120.03 ? 53  ARG L O   1 
ATOM 2027 C CB  . ARG B 2 53  ? 71.241  62.384 43.097  1.00 146.72 ? 53  ARG L CB  1 
ATOM 2028 C CG  . ARG B 2 53  ? 71.027  63.243 44.331  1.00 146.72 ? 53  ARG L CG  1 
ATOM 2029 C CD  . ARG B 2 53  ? 69.619  63.214 44.890  1.00 146.72 ? 53  ARG L CD  1 
ATOM 2030 N NE  . ARG B 2 53  ? 69.523  64.012 46.113  1.00 146.72 ? 53  ARG L NE  1 
ATOM 2031 C CZ  . ARG B 2 53  ? 69.935  65.275 46.228  1.00 146.72 ? 53  ARG L CZ  1 
ATOM 2032 N NH1 . ARG B 2 53  ? 70.478  65.902 45.195  1.00 146.72 ? 53  ARG L NH1 1 
ATOM 2033 N NH2 . ARG B 2 53  ? 69.805  65.916 47.381  1.00 146.72 ? 53  ARG L NH2 1 
ATOM 2034 N N   . LEU B 2 54  ? 74.460  61.136 41.998  1.00 74.63  ? 54  LEU L N   1 
ATOM 2035 C CA  . LEU B 2 54  ? 75.150  59.968 41.468  1.00 74.63  ? 54  LEU L CA  1 
ATOM 2036 C C   . LEU B 2 54  ? 74.358  58.682 41.658  1.00 74.63  ? 54  LEU L C   1 
ATOM 2037 O O   . LEU B 2 54  ? 73.718  58.467 42.694  1.00 74.63  ? 54  LEU L O   1 
ATOM 2038 C CB  . LEU B 2 54  ? 76.489  59.766 42.178  1.00 75.46  ? 54  LEU L CB  1 
ATOM 2039 C CG  . LEU B 2 54  ? 77.717  60.252 41.420  1.00 75.46  ? 54  LEU L CG  1 
ATOM 2040 C CD1 . LEU B 2 54  ? 78.964  59.966 42.216  1.00 75.46  ? 54  LEU L CD1 1 
ATOM 2041 C CD2 . LEU B 2 54  ? 77.787  59.551 40.081  1.00 75.46  ? 54  LEU L CD2 1 
ATOM 2042 N N   . VAL B 2 55  ? 74.426  57.813 40.657  1.00 78.78  ? 55  VAL L N   1 
ATOM 2043 C CA  . VAL B 2 55  ? 73.752  56.533 40.721  1.00 78.78  ? 55  VAL L CA  1 
ATOM 2044 C C   . VAL B 2 55  ? 74.643  55.692 41.623  1.00 78.78  ? 55  VAL L C   1 
ATOM 2045 O O   . VAL B 2 55  ? 75.795  56.063 41.880  1.00 78.78  ? 55  VAL L O   1 
ATOM 2046 C CB  . VAL B 2 55  ? 73.656  55.899 39.320  1.00 74.33  ? 55  VAL L CB  1 
ATOM 2047 C CG1 . VAL B 2 55  ? 72.851  54.614 39.379  1.00 74.33  ? 55  VAL L CG1 1 
ATOM 2048 C CG2 . VAL B 2 55  ? 73.027  56.895 38.349  1.00 74.33  ? 55  VAL L CG2 1 
ATOM 2049 N N   . ASP B 2 56  ? 74.102  54.580 42.113  1.00 124.66 ? 56  ASP L N   1 
ATOM 2050 C CA  . ASP B 2 56  ? 74.829  53.666 42.989  1.00 124.66 ? 56  ASP L CA  1 
ATOM 2051 C C   . ASP B 2 56  ? 75.815  52.814 42.187  1.00 124.66 ? 56  ASP L C   1 
ATOM 2052 O O   . ASP B 2 56  ? 75.409  52.026 41.328  1.00 124.66 ? 56  ASP L O   1 
ATOM 2053 C CB  . ASP B 2 56  ? 73.839  52.757 43.716  1.00 229.47 ? 56  ASP L CB  1 
ATOM 2054 C CG  . ASP B 2 56  ? 72.939  52.004 42.760  1.00 229.47 ? 56  ASP L CG  1 
ATOM 2055 O OD1 . ASP B 2 56  ? 72.196  52.665 42.003  1.00 229.47 ? 56  ASP L OD1 1 
ATOM 2056 O OD2 . ASP B 2 56  ? 72.979  50.756 42.761  1.00 229.47 ? 56  ASP L OD2 1 
ATOM 2057 N N   . GLY B 2 57  ? 77.107  52.988 42.469  1.00 91.75  ? 57  GLY L N   1 
ATOM 2058 C CA  . GLY B 2 57  ? 78.140  52.232 41.777  1.00 91.75  ? 57  GLY L CA  1 
ATOM 2059 C C   . GLY B 2 57  ? 79.059  53.096 40.929  1.00 91.75  ? 57  GLY L C   1 
ATOM 2060 O O   . GLY B 2 57  ? 80.222  52.757 40.678  1.00 91.75  ? 57  GLY L O   1 
ATOM 2061 N N   . VAL B 2 58  ? 78.532  54.222 40.474  1.00 78.32  ? 58  VAL L N   1 
ATOM 2062 C CA  . VAL B 2 58  ? 79.314  55.130 39.654  1.00 78.32  ? 58  VAL L CA  1 
ATOM 2063 C C   . VAL B 2 58  ? 80.531  55.632 40.426  1.00 78.32  ? 58  VAL L C   1 
ATOM 2064 O O   . VAL B 2 58  ? 80.431  55.996 41.592  1.00 78.32  ? 58  VAL L O   1 
ATOM 2065 C CB  . VAL B 2 58  ? 78.477  56.380 39.227  1.00 68.86  ? 58  VAL L CB  1 
ATOM 2066 C CG1 . VAL B 2 58  ? 79.355  57.349 38.389  1.00 68.86  ? 58  VAL L CG1 1 
ATOM 2067 C CG2 . VAL B 2 58  ? 77.238  55.943 38.443  1.00 68.86  ? 58  VAL L CG2 1 
ATOM 2068 N N   . PRO B 2 59  ? 81.704  55.653 39.789  1.00 88.29  ? 59  PRO L N   1 
ATOM 2069 C CA  . PRO B 2 59  ? 82.875  56.150 40.519  1.00 88.29  ? 59  PRO L CA  1 
ATOM 2070 C C   . PRO B 2 59  ? 82.715  57.613 40.994  1.00 88.29  ? 59  PRO L C   1 
ATOM 2071 O O   . PRO B 2 59  ? 82.164  58.462 40.283  1.00 88.29  ? 59  PRO L O   1 
ATOM 2072 C CB  . PRO B 2 59  ? 84.020  55.962 39.516  1.00 126.08 ? 59  PRO L CB  1 
ATOM 2073 C CG  . PRO B 2 59  ? 83.322  55.889 38.173  1.00 126.08 ? 59  PRO L CG  1 
ATOM 2074 C CD  . PRO B 2 59  ? 82.085  55.101 38.480  1.00 126.08 ? 59  PRO L CD  1 
ATOM 2075 N N   . SER B 2 60  ? 83.205  57.873 42.205  1.00 109.20 ? 60  SER L N   1 
ATOM 2076 C CA  . SER B 2 60  ? 83.135  59.175 42.860  1.00 109.20 ? 60  SER L CA  1 
ATOM 2077 C C   . SER B 2 60  ? 83.797  60.346 42.147  1.00 109.20 ? 60  SER L C   1 
ATOM 2078 O O   . SER B 2 60  ? 83.809  61.459 42.687  1.00 109.20 ? 60  SER L O   1 
ATOM 2079 C CB  . SER B 2 60  ? 83.745  59.079 44.253  1.00 94.91  ? 60  SER L CB  1 
ATOM 2080 O OG  . SER B 2 60  ? 85.128  58.786 44.153  1.00 94.91  ? 60  SER L OG  1 
ATOM 2081 N N   . ARG B 2 61  ? 84.355  60.119 40.958  1.00 81.43  ? 61  ARG L N   1 
ATOM 2082 C CA  . ARG B 2 61  ? 85.008  61.213 40.241  1.00 81.43  ? 61  ARG L CA  1 
ATOM 2083 C C   . ARG B 2 61  ? 84.109  61.912 39.235  1.00 81.43  ? 61  ARG L C   1 
ATOM 2084 O O   . ARG B 2 61  ? 84.562  62.783 38.501  1.00 81.43  ? 61  ARG L O   1 
ATOM 2085 C CB  . ARG B 2 61  ? 86.291  60.735 39.548  1.00 99.34  ? 61  ARG L CB  1 
ATOM 2086 C CG  . ARG B 2 61  ? 86.104  59.731 38.419  1.00 99.34  ? 61  ARG L CG  1 
ATOM 2087 C CD  . ARG B 2 61  ? 87.462  59.344 37.819  1.00 99.34  ? 61  ARG L CD  1 
ATOM 2088 N NE  . ARG B 2 61  ? 87.353  58.353 36.751  1.00 99.34  ? 61  ARG L NE  1 
ATOM 2089 C CZ  . ARG B 2 61  ? 86.872  57.128 36.917  1.00 99.34  ? 61  ARG L CZ  1 
ATOM 2090 N NH1 . ARG B 2 61  ? 86.446  56.731 38.107  1.00 99.34  ? 61  ARG L NH1 1 
ATOM 2091 N NH2 . ARG B 2 61  ? 86.824  56.298 35.891  1.00 99.34  ? 61  ARG L NH2 1 
ATOM 2092 N N   . PHE B 2 62  ? 82.838  61.530 39.203  1.00 82.96  ? 62  PHE L N   1 
ATOM 2093 C CA  . PHE B 2 62  ? 81.876  62.154 38.304  1.00 82.96  ? 62  PHE L CA  1 
ATOM 2094 C C   . PHE B 2 62  ? 81.084  63.195 39.078  1.00 82.96  ? 62  PHE L C   1 
ATOM 2095 O O   . PHE B 2 62  ? 80.642  62.942 40.198  1.00 82.96  ? 62  PHE L O   1 
ATOM 2096 C CB  . PHE B 2 62  ? 80.911  61.118 37.722  1.00 75.51  ? 62  PHE L CB  1 
ATOM 2097 C CG  . PHE B 2 62  ? 81.520  60.245 36.673  1.00 75.51  ? 62  PHE L CG  1 
ATOM 2098 C CD1 . PHE B 2 62  ? 82.090  59.031 37.004  1.00 75.51  ? 62  PHE L CD1 1 
ATOM 2099 C CD2 . PHE B 2 62  ? 81.552  60.661 35.351  1.00 75.51  ? 62  PHE L CD2 1 
ATOM 2100 C CE1 . PHE B 2 62  ? 82.685  58.249 36.033  1.00 75.51  ? 62  PHE L CE1 1 
ATOM 2101 C CE2 . PHE B 2 62  ? 82.145  59.887 34.374  1.00 75.51  ? 62  PHE L CE2 1 
ATOM 2102 C CZ  . PHE B 2 62  ? 82.714  58.679 34.713  1.00 75.51  ? 62  PHE L CZ  1 
ATOM 2103 N N   . ILE B 2 63  ? 80.886  64.362 38.484  1.00 84.77  ? 63  ILE L N   1 
ATOM 2104 C CA  . ILE B 2 63  ? 80.156  65.413 39.176  1.00 84.77  ? 63  ILE L CA  1 
ATOM 2105 C C   . ILE B 2 63  ? 79.169  66.181 38.298  1.00 84.77  ? 63  ILE L C   1 
ATOM 2106 O O   . ILE B 2 63  ? 79.551  66.829 37.328  1.00 84.77  ? 63  ILE L O   1 
ATOM 2107 C CB  . ILE B 2 63  ? 81.147  66.417 39.831  1.00 60.88  ? 63  ILE L CB  1 
ATOM 2108 C CG1 . ILE B 2 63  ? 81.986  65.705 40.896  1.00 60.88  ? 63  ILE L CG1 1 
ATOM 2109 C CG2 . ILE B 2 63  ? 80.383  67.579 40.462  1.00 60.88  ? 63  ILE L CG2 1 
ATOM 2110 C CD1 . ILE B 2 63  ? 82.922  66.616 41.625  1.00 60.88  ? 63  ILE L CD1 1 
ATOM 2111 N N   . GLY B 2 64  ? 77.893  66.107 38.655  1.00 87.37  ? 64  GLY L N   1 
ATOM 2112 C CA  . GLY B 2 64  ? 76.878  66.811 37.895  1.00 87.37  ? 64  GLY L CA  1 
ATOM 2113 C C   . GLY B 2 64  ? 76.415  68.017 38.682  1.00 87.37  ? 64  GLY L C   1 
ATOM 2114 O O   . GLY B 2 64  ? 76.082  67.894 39.863  1.00 87.37  ? 64  GLY L O   1 
ATOM 2115 N N   . THR B 2 65  ? 76.388  69.183 38.050  1.00 75.05  ? 65  THR L N   1 
ATOM 2116 C CA  . THR B 2 65  ? 75.974  70.366 38.767  1.00 75.05  ? 65  THR L CA  1 
ATOM 2117 C C   . THR B 2 65  ? 75.544  71.522 37.910  1.00 75.05  ? 65  THR L C   1 
ATOM 2118 O O   . THR B 2 65  ? 76.356  72.208 37.291  1.00 75.05  ? 65  THR L O   1 
ATOM 2119 C CB  . THR B 2 65  ? 77.075  70.863 39.687  1.00 142.42 ? 65  THR L CB  1 
ATOM 2120 O OG1 . THR B 2 65  ? 77.473  69.802 40.561  1.00 142.42 ? 65  THR L OG1 1 
ATOM 2121 C CG2 . THR B 2 65  ? 76.569  72.039 40.521  1.00 142.42 ? 65  THR L CG2 1 
ATOM 2122 N N   . GLY B 2 66  ? 74.242  71.736 37.909  1.00 87.48  ? 66  GLY L N   1 
ATOM 2123 C CA  . GLY B 2 66  ? 73.644  72.820 37.170  1.00 87.48  ? 66  GLY L CA  1 
ATOM 2124 C C   . GLY B 2 66  ? 72.379  73.101 37.949  1.00 87.48  ? 66  GLY L C   1 
ATOM 2125 O O   . GLY B 2 66  ? 72.249  72.652 39.090  1.00 87.48  ? 66  GLY L O   1 
ATOM 2126 N N   . SER B 2 67  ? 71.448  73.828 37.345  1.00 88.81  ? 67  SER L N   1 
ATOM 2127 C CA  . SER B 2 67  ? 70.183  74.164 37.984  1.00 88.81  ? 67  SER L CA  1 
ATOM 2128 C C   . SER B 2 67  ? 69.300  74.862 36.966  1.00 88.81  ? 67  SER L C   1 
ATOM 2129 O O   . SER B 2 67  ? 69.782  75.362 35.951  1.00 88.81  ? 67  SER L O   1 
ATOM 2130 C CB  . SER B 2 67  ? 70.398  75.101 39.178  1.00 198.33 ? 67  SER L CB  1 
ATOM 2131 O OG  . SER B 2 67  ? 71.086  74.457 40.235  1.00 198.33 ? 67  SER L OG  1 
ATOM 2132 N N   . GLY B 2 68  ? 68.001  74.880 37.235  1.00 139.82 ? 68  GLY L N   1 
ATOM 2133 C CA  . GLY B 2 68  ? 67.055  75.548 36.355  1.00 139.82 ? 68  GLY L CA  1 
ATOM 2134 C C   . GLY B 2 68  ? 67.071  75.320 34.850  1.00 139.82 ? 68  GLY L C   1 
ATOM 2135 O O   . GLY B 2 68  ? 66.165  74.662 34.334  1.00 139.82 ? 68  GLY L O   1 
ATOM 2136 N N   . GLN B 2 69  ? 68.069  75.858 34.142  1.00 87.22  ? 69  GLN L N   1 
ATOM 2137 C CA  . GLN B 2 69  ? 68.112  75.720 32.680  1.00 87.22  ? 69  GLN L CA  1 
ATOM 2138 C C   . GLN B 2 69  ? 69.467  75.386 32.037  1.00 87.22  ? 69  GLN L C   1 
ATOM 2139 O O   . GLN B 2 69  ? 69.614  75.429 30.809  1.00 87.22  ? 69  GLN L O   1 
ATOM 2140 C CB  . GLN B 2 69  ? 67.563  76.999 32.048  1.00 112.16 ? 69  GLN L CB  1 
ATOM 2141 C CG  . GLN B 2 69  ? 66.968  76.822 30.669  1.00 112.16 ? 69  GLN L CG  1 
ATOM 2142 C CD  . GLN B 2 69  ? 66.445  78.126 30.116  1.00 112.16 ? 69  GLN L CD  1 
ATOM 2143 O OE1 . GLN B 2 69  ? 65.959  78.971 30.864  1.00 112.16 ? 69  GLN L OE1 1 
ATOM 2144 N NE2 . GLN B 2 69  ? 66.537  78.297 28.805  1.00 112.16 ? 69  GLN L NE2 1 
ATOM 2145 N N   . ASP B 2 70  ? 70.446  75.042 32.864  1.00 106.79 ? 70  ASP L N   1 
ATOM 2146 C CA  . ASP B 2 70  ? 71.781  74.707 32.379  1.00 106.79 ? 70  ASP L CA  1 
ATOM 2147 C C   . ASP B 2 70  ? 72.546  73.924 33.441  1.00 106.79 ? 70  ASP L C   1 
ATOM 2148 O O   . ASP B 2 70  ? 72.589  74.319 34.602  1.00 106.79 ? 70  ASP L O   1 
ATOM 2149 C CB  . ASP B 2 70  ? 72.529  75.989 32.010  1.00 133.09 ? 70  ASP L CB  1 
ATOM 2150 C CG  . ASP B 2 70  ? 72.194  77.142 32.929  1.00 133.09 ? 70  ASP L CG  1 
ATOM 2151 O OD1 . ASP B 2 70  ? 70.999  77.496 33.033  1.00 133.09 ? 70  ASP L OD1 1 
ATOM 2152 O OD2 . ASP B 2 70  ? 73.126  77.697 33.546  1.00 133.09 ? 70  ASP L OD2 1 
ATOM 2153 N N   . TYR B 2 71  ? 73.135  72.803 33.043  1.00 116.49 ? 71  TYR L N   1 
ATOM 2154 C CA  . TYR B 2 71  ? 73.869  71.960 33.975  1.00 116.49 ? 71  TYR L CA  1 
ATOM 2155 C C   . TYR B 2 71  ? 75.230  71.616 33.416  1.00 116.49 ? 71  TYR L C   1 
ATOM 2156 O O   . TYR B 2 71  ? 75.738  72.310 32.539  1.00 116.49 ? 71  TYR L O   1 
ATOM 2157 C CB  . TYR B 2 71  ? 73.087  70.675 34.247  1.00 67.91  ? 71  TYR L CB  1 
ATOM 2158 C CG  . TYR B 2 71  ? 71.655  70.939 34.626  1.00 67.91  ? 71  TYR L CG  1 
ATOM 2159 C CD1 . TYR B 2 71  ? 70.809  71.645 33.772  1.00 67.91  ? 71  TYR L CD1 1 
ATOM 2160 C CD2 . TYR B 2 71  ? 71.146  70.515 35.850  1.00 67.91  ? 71  TYR L CD2 1 
ATOM 2161 C CE1 . TYR B 2 71  ? 69.494  71.932 34.126  1.00 67.91  ? 71  TYR L CE1 1 
ATOM 2162 C CE2 . TYR B 2 71  ? 69.820  70.793 36.218  1.00 67.91  ? 71  TYR L CE2 1 
ATOM 2163 C CZ  . TYR B 2 71  ? 69.008  71.501 35.351  1.00 67.91  ? 71  TYR L CZ  1 
ATOM 2164 O OH  . TYR B 2 71  ? 67.712  71.788 35.688  1.00 67.91  ? 71  TYR L OH  1 
ATOM 2165 N N   . SER B 2 72  ? 75.813  70.536 33.922  1.00 71.20  ? 72  SER L N   1 
ATOM 2166 C CA  . SER B 2 72  ? 77.127  70.115 33.472  1.00 71.20  ? 72  SER L CA  1 
ATOM 2167 C C   . SER B 2 72  ? 77.670  68.888 34.202  1.00 71.20  ? 72  SER L C   1 
ATOM 2168 O O   . SER B 2 72  ? 77.775  68.877 35.431  1.00 71.20  ? 72  SER L O   1 
ATOM 2169 C CB  . SER B 2 72  ? 78.117  71.254 33.661  1.00 91.38  ? 72  SER L CB  1 
ATOM 2170 O OG  . SER B 2 72  ? 78.168  71.628 35.027  1.00 91.38  ? 72  SER L OG  1 
ATOM 2171 N N   . LEU B 2 73  ? 78.015  67.858 33.429  1.00 64.90  ? 73  LEU L N   1 
ATOM 2172 C CA  . LEU B 2 73  ? 78.604  66.642 33.969  1.00 64.90  ? 73  LEU L CA  1 
ATOM 2173 C C   . LEU B 2 73  ? 80.106  66.942 33.959  1.00 64.90  ? 73  LEU L C   1 
ATOM 2174 O O   . LEU B 2 73  ? 80.619  67.602 33.035  1.00 64.90  ? 73  LEU L O   1 
ATOM 2175 C CB  . LEU B 2 73  ? 78.285  65.444 33.079  1.00 74.26  ? 73  LEU L CB  1 
ATOM 2176 C CG  . LEU B 2 73  ? 78.973  64.158 33.529  1.00 74.26  ? 73  LEU L CG  1 
ATOM 2177 C CD1 . LEU B 2 73  ? 78.592  63.866 34.974  1.00 74.26  ? 73  LEU L CD1 1 
ATOM 2178 C CD2 . LEU B 2 73  ? 78.583  63.004 32.595  1.00 74.26  ? 73  LEU L CD2 1 
ATOM 2179 N N   . THR B 2 74  ? 80.804  66.477 34.993  1.00 68.71  ? 74  THR L N   1 
ATOM 2180 C CA  . THR B 2 74  ? 82.231  66.742 35.124  1.00 68.71  ? 74  THR L CA  1 
ATOM 2181 C C   . THR B 2 74  ? 82.974  65.701 35.923  1.00 68.71  ? 74  THR L C   1 
ATOM 2182 O O   . THR B 2 74  ? 82.463  65.172 36.909  1.00 68.71  ? 74  THR L O   1 
ATOM 2183 C CB  . THR B 2 74  ? 82.471  68.091 35.821  1.00 131.20 ? 74  THR L CB  1 
ATOM 2184 O OG1 . THR B 2 74  ? 82.078  69.150 34.945  1.00 131.20 ? 74  THR L OG1 1 
ATOM 2185 C CG2 . THR B 2 74  ? 83.933  68.256 36.206  1.00 131.20 ? 74  THR L CG2 1 
ATOM 2186 N N   . ILE B 2 75  ? 84.199  65.437 35.495  1.00 108.45 ? 75  ILE L N   1 
ATOM 2187 C CA  . ILE B 2 75  ? 85.054  64.481 36.166  1.00 108.45 ? 75  ILE L CA  1 
ATOM 2188 C C   . ILE B 2 75  ? 86.439  65.083 36.388  1.00 108.45 ? 75  ILE L C   1 
ATOM 2189 O O   . ILE B 2 75  ? 87.050  65.622 35.467  1.00 108.45 ? 75  ILE L O   1 
ATOM 2190 C CB  . ILE B 2 75  ? 85.177  63.170 35.344  1.00 170.89 ? 75  ILE L CB  1 
ATOM 2191 C CG1 . ILE B 2 75  ? 86.424  62.392 35.777  1.00 170.89 ? 75  ILE L CG1 1 
ATOM 2192 C CG2 . ILE B 2 75  ? 85.180  63.483 33.858  1.00 170.89 ? 75  ILE L CG2 1 
ATOM 2193 C CD1 . ILE B 2 75  ? 86.649  61.107 35.007  1.00 170.89 ? 75  ILE L CD1 1 
ATOM 2194 N N   . SER B 2 76  ? 86.913  65.019 37.626  1.00 113.82 ? 76  SER L N   1 
ATOM 2195 C CA  . SER B 2 76  ? 88.233  65.522 37.957  1.00 113.82 ? 76  SER L CA  1 
ATOM 2196 C C   . SER B 2 76  ? 89.080  64.286 37.796  1.00 113.82 ? 76  SER L C   1 
ATOM 2197 O O   . SER B 2 76  ? 88.584  63.187 38.014  1.00 113.82 ? 76  SER L O   1 
ATOM 2198 C CB  . SER B 2 76  ? 88.282  65.959 39.411  1.00 127.75 ? 76  SER L CB  1 
ATOM 2199 O OG  . SER B 2 76  ? 88.103  64.833 40.252  1.00 127.75 ? 76  SER L OG  1 
ATOM 2200 N N   . SER B 2 77  ? 90.338  64.434 37.412  1.00 87.76  ? 77  SER L N   1 
ATOM 2201 C CA  . SER B 2 77  ? 91.188  63.254 37.267  1.00 87.76  ? 77  SER L CA  1 
ATOM 2202 C C   . SER B 2 77  ? 90.581  62.185 36.352  1.00 87.76  ? 77  SER L C   1 
ATOM 2203 O O   . SER B 2 77  ? 90.163  61.112 36.819  1.00 87.76  ? 77  SER L O   1 
ATOM 2204 C CB  . SER B 2 77  ? 91.466  62.636 38.646  1.00 150.28 ? 77  SER L CB  1 
ATOM 2205 O OG  . SER B 2 77  ? 91.967  61.312 38.534  1.00 150.28 ? 77  SER L OG  1 
ATOM 2206 N N   . LEU B 2 78  ? 90.551  62.489 35.055  1.00 105.02 ? 78  LEU L N   1 
ATOM 2207 C CA  . LEU B 2 78  ? 90.027  61.592 34.026  1.00 105.02 ? 78  LEU L CA  1 
ATOM 2208 C C   . LEU B 2 78  ? 90.794  60.268 33.961  1.00 105.02 ? 78  LEU L C   1 
ATOM 2209 O O   . LEU B 2 78  ? 92.010  60.256 33.764  1.00 105.02 ? 78  LEU L O   1 
ATOM 2210 C CB  . LEU B 2 78  ? 90.098  62.285 32.660  1.00 63.65  ? 78  LEU L CB  1 
ATOM 2211 C CG  . LEU B 2 78  ? 89.952  61.442 31.383  1.00 63.65  ? 78  LEU L CG  1 
ATOM 2212 C CD1 . LEU B 2 78  ? 88.512  60.980 31.229  1.00 63.65  ? 78  LEU L CD1 1 
ATOM 2213 C CD2 . LEU B 2 78  ? 90.379  62.258 30.168  1.00 63.65  ? 78  LEU L CD2 1 
ATOM 2214 N N   . ASP B 2 79  ? 90.070  59.162 34.123  1.00 79.15  ? 79  ASP L N   1 
ATOM 2215 C CA  . ASP B 2 79  ? 90.656  57.827 34.071  1.00 79.15  ? 79  ASP L CA  1 
ATOM 2216 C C   . ASP B 2 79  ? 90.562  57.233 32.670  1.00 79.15  ? 79  ASP L C   1 
ATOM 2217 O O   . ASP B 2 79  ? 89.583  57.468 31.954  1.00 79.15  ? 79  ASP L O   1 
ATOM 2218 C CB  . ASP B 2 79  ? 89.950  56.873 35.025  1.00 97.59  ? 79  ASP L CB  1 
ATOM 2219 C CG  . ASP B 2 79  ? 90.355  55.432 34.787  1.00 97.59  ? 79  ASP L CG  1 
ATOM 2220 O OD1 . ASP B 2 79  ? 91.492  55.086 35.165  1.00 97.59  ? 79  ASP L OD1 1 
ATOM 2221 O OD2 . ASP B 2 79  ? 89.556  54.658 34.209  1.00 97.59  ? 79  ASP L OD2 1 
ATOM 2222 N N   . TYR B 2 80  ? 91.567  56.431 32.306  1.00 86.18  ? 80  TYR L N   1 
ATOM 2223 C CA  . TYR B 2 80  ? 91.627  55.817 30.987  1.00 86.18  ? 80  TYR L CA  1 
ATOM 2224 C C   . TYR B 2 80  ? 90.313  55.172 30.600  1.00 86.18  ? 80  TYR L C   1 
ATOM 2225 O O   . TYR B 2 80  ? 89.837  55.329 29.483  1.00 86.18  ? 80  TYR L O   1 
ATOM 2226 C CB  . TYR B 2 80  ? 92.773  54.790 30.915  1.00 156.86 ? 80  TYR L CB  1 
ATOM 2227 C CG  . TYR B 2 80  ? 92.567  53.535 31.732  1.00 156.86 ? 80  TYR L CG  1 
ATOM 2228 C CD1 . TYR B 2 80  ? 91.635  52.570 31.346  1.00 156.86 ? 80  TYR L CD1 1 
ATOM 2229 C CD2 . TYR B 2 80  ? 93.283  53.323 32.908  1.00 156.86 ? 80  TYR L CD2 1 
ATOM 2230 C CE1 . TYR B 2 80  ? 91.415  51.431 32.112  1.00 156.86 ? 80  TYR L CE1 1 
ATOM 2231 C CE2 . TYR B 2 80  ? 93.073  52.185 33.684  1.00 156.86 ? 80  TYR L CE2 1 
ATOM 2232 C CZ  . TYR B 2 80  ? 92.133  51.246 33.281  1.00 156.86 ? 80  TYR L CZ  1 
ATOM 2233 O OH  . TYR B 2 80  ? 91.883  50.142 34.063  1.00 156.86 ? 80  TYR L OH  1 
ATOM 2234 N N   . ALA B 2 81  ? 89.704  54.471 31.536  1.00 61.78  ? 81  ALA L N   1 
ATOM 2235 C CA  . ALA B 2 81  ? 88.450  53.802 31.239  1.00 61.78  ? 81  ALA L CA  1 
ATOM 2236 C C   . ALA B 2 81  ? 87.317  54.784 30.910  1.00 61.78  ? 81  ALA L C   1 
ATOM 2237 O O   . ALA B 2 81  ? 86.212  54.377 30.546  1.00 61.78  ? 81  ALA L O   1 
ATOM 2238 C CB  . ALA B 2 81  ? 88.052  52.908 32.426  1.00 84.20  ? 81  ALA L CB  1 
ATOM 2239 N N   . ASP B 2 82  ? 87.591  56.077 31.011  1.00 95.07  ? 82  ASP L N   1 
ATOM 2240 C CA  . ASP B 2 82  ? 86.548  57.068 30.773  1.00 95.07  ? 82  ASP L CA  1 
ATOM 2241 C C   . ASP B 2 82  ? 86.344  57.568 29.334  1.00 95.07  ? 82  ASP L C   1 
ATOM 2242 O O   . ASP B 2 82  ? 86.054  58.744 29.111  1.00 95.07  ? 82  ASP L O   1 
ATOM 2243 C CB  . ASP B 2 82  ? 86.779  58.254 31.719  1.00 83.17  ? 82  ASP L CB  1 
ATOM 2244 C CG  . ASP B 2 82  ? 86.831  57.831 33.179  1.00 83.17  ? 82  ASP L CG  1 
ATOM 2245 O OD1 . ASP B 2 82  ? 85.880  57.169 33.638  1.00 83.17  ? 82  ASP L OD1 1 
ATOM 2246 O OD2 . ASP B 2 82  ? 87.817  58.159 33.862  1.00 83.17  ? 82  ASP L OD2 1 
ATOM 2247 N N   . MET B 2 83  ? 86.462  56.678 28.359  1.00 84.52  ? 83  MET L N   1 
ATOM 2248 C CA  . MET B 2 83  ? 86.290  57.064 26.962  1.00 84.52  ? 83  MET L CA  1 
ATOM 2249 C C   . MET B 2 83  ? 84.940  56.619 26.432  1.00 84.52  ? 83  MET L C   1 
ATOM 2250 O O   . MET B 2 83  ? 84.589  55.447 26.555  1.00 84.52  ? 83  MET L O   1 
ATOM 2251 C CB  . MET B 2 83  ? 87.377  56.417 26.127  1.00 133.75 ? 83  MET L CB  1 
ATOM 2252 C CG  . MET B 2 83  ? 87.449  54.922 26.361  1.00 133.75 ? 83  MET L CG  1 
ATOM 2253 S SD  . MET B 2 83  ? 88.732  54.162 25.396  1.00 133.75 ? 83  MET L SD  1 
ATOM 2254 C CE  . MET B 2 83  ? 90.203  54.776 26.236  1.00 133.75 ? 83  MET L CE  1 
ATOM 2255 N N   . GLY B 2 84  ? 84.191  57.537 25.828  1.00 76.62  ? 84  GLY L N   1 
ATOM 2256 C CA  . GLY B 2 84  ? 82.886  57.171 25.287  1.00 76.62  ? 84  GLY L CA  1 
ATOM 2257 C C   . GLY B 2 84  ? 82.024  58.355 24.893  1.00 76.62  ? 84  GLY L C   1 
ATOM 2258 O O   . GLY B 2 84  ? 82.554  59.401 24.501  1.00 76.62  ? 84  GLY L O   1 
ATOM 2259 N N   . ILE B 2 85  ? 80.702  58.201 24.975  1.00 42.95  ? 85  ILE L N   1 
ATOM 2260 C CA  . ILE B 2 85  ? 79.806  59.315 24.636  1.00 42.95  ? 85  ILE L CA  1 
ATOM 2261 C C   . ILE B 2 85  ? 78.751  59.496 25.727  1.00 42.95  ? 85  ILE L C   1 
ATOM 2262 O O   . ILE B 2 85  ? 77.857  58.661 25.879  1.00 42.95  ? 85  ILE L O   1 
ATOM 2263 C CB  . ILE B 2 85  ? 79.050  59.098 23.292  1.00 50.98  ? 85  ILE L CB  1 
ATOM 2264 C CG1 . ILE B 2 85  ? 79.901  58.277 22.330  1.00 50.98  ? 85  ILE L CG1 1 
ATOM 2265 C CG2 . ILE B 2 85  ? 78.719  60.454 22.645  1.00 50.98  ? 85  ILE L CG2 1 
ATOM 2266 C CD1 . ILE B 2 85  ? 79.057  57.633 21.250  1.00 50.98  ? 85  ILE L CD1 1 
ATOM 2267 N N   . TYR B 2 86  ? 78.853  60.596 26.466  1.00 57.84  ? 86  TYR L N   1 
ATOM 2268 C CA  . TYR B 2 86  ? 77.911  60.890 27.531  1.00 57.84  ? 86  TYR L CA  1 
ATOM 2269 C C   . TYR B 2 86  ? 76.804  61.785 26.997  1.00 57.84  ? 86  TYR L C   1 
ATOM 2270 O O   . TYR B 2 86  ? 77.074  62.722 26.244  1.00 57.84  ? 86  TYR L O   1 
ATOM 2271 C CB  . TYR B 2 86  ? 78.614  61.615 28.672  1.00 69.44  ? 86  TYR L CB  1 
ATOM 2272 C CG  . TYR B 2 86  ? 79.942  61.022 29.074  1.00 69.44  ? 86  TYR L CG  1 
ATOM 2273 C CD1 . TYR B 2 86  ? 81.041  61.080 28.218  1.00 69.44  ? 86  TYR L CD1 1 
ATOM 2274 C CD2 . TYR B 2 86  ? 80.095  60.394 30.304  1.00 69.44  ? 86  TYR L CD2 1 
ATOM 2275 C CE1 . TYR B 2 86  ? 82.255  60.527 28.576  1.00 69.44  ? 86  TYR L CE1 1 
ATOM 2276 C CE2 . TYR B 2 86  ? 81.298  59.835 30.674  1.00 69.44  ? 86  TYR L CE2 1 
ATOM 2277 C CZ  . TYR B 2 86  ? 82.378  59.902 29.809  1.00 69.44  ? 86  TYR L CZ  1 
ATOM 2278 O OH  . TYR B 2 86  ? 83.575  59.333 30.185  1.00 69.44  ? 86  TYR L OH  1 
ATOM 2279 N N   . TYR B 2 87  ? 75.564  61.491 27.393  1.00 73.10  ? 87  TYR L N   1 
ATOM 2280 C CA  . TYR B 2 87  ? 74.385  62.264 26.969  1.00 73.10  ? 87  TYR L CA  1 
ATOM 2281 C C   . TYR B 2 87  ? 73.599  62.739 28.198  1.00 73.10  ? 87  TYR L C   1 
ATOM 2282 O O   . TYR B 2 87  ? 73.587  62.048 29.217  1.00 73.10  ? 87  TYR L O   1 
ATOM 2283 C CB  . TYR B 2 87  ? 73.431  61.401 26.132  1.00 104.70 ? 87  TYR L CB  1 
ATOM 2284 C CG  . TYR B 2 87  ? 74.038  60.698 24.940  1.00 104.70 ? 87  TYR L CG  1 
ATOM 2285 C CD1 . TYR B 2 87  ? 75.076  59.785 25.103  1.00 104.70 ? 87  TYR L CD1 1 
ATOM 2286 C CD2 . TYR B 2 87  ? 73.544  60.914 23.650  1.00 104.70 ? 87  TYR L CD2 1 
ATOM 2287 C CE1 . TYR B 2 87  ? 75.608  59.105 24.022  1.00 104.70 ? 87  TYR L CE1 1 
ATOM 2288 C CE2 . TYR B 2 87  ? 74.069  60.235 22.557  1.00 104.70 ? 87  TYR L CE2 1 
ATOM 2289 C CZ  . TYR B 2 87  ? 75.104  59.330 22.756  1.00 104.70 ? 87  TYR L CZ  1 
ATOM 2290 O OH  . TYR B 2 87  ? 75.643  58.630 21.703  1.00 104.70 ? 87  TYR L OH  1 
ATOM 2291 N N   . CYS B 2 88  ? 72.942  63.898 28.102  1.00 59.20  ? 88  CYS L N   1 
ATOM 2292 C CA  . CYS B 2 88  ? 72.136  64.408 29.206  1.00 59.20  ? 88  CYS L CA  1 
ATOM 2293 C C   . CYS B 2 88  ? 70.676  64.201 28.863  1.00 59.20  ? 88  CYS L C   1 
ATOM 2294 O O   . CYS B 2 88  ? 70.261  64.461 27.739  1.00 59.20  ? 88  CYS L O   1 
ATOM 2295 C CB  . CYS B 2 88  ? 72.408  65.896 29.478  1.00 101.42 ? 88  CYS L CB  1 
ATOM 2296 S SG  . CYS B 2 88  ? 72.264  67.085 28.091  1.00 101.42 ? 88  CYS L SG  1 
ATOM 2297 N N   . LEU B 2 89  ? 69.904  63.723 29.834  1.00 94.19  ? 89  LEU L N   1 
ATOM 2298 C CA  . LEU B 2 89  ? 68.484  63.455 29.634  1.00 94.19  ? 89  LEU L CA  1 
ATOM 2299 C C   . LEU B 2 89  ? 67.615  64.253 30.591  1.00 94.19  ? 89  LEU L C   1 
ATOM 2300 O O   . LEU B 2 89  ? 67.968  64.417 31.750  1.00 94.19  ? 89  LEU L O   1 
ATOM 2301 C CB  . LEU B 2 89  ? 68.205  61.959 29.821  1.00 55.20  ? 89  LEU L CB  1 
ATOM 2302 C CG  . LEU B 2 89  ? 66.731  61.530 29.889  1.00 55.20  ? 89  LEU L CG  1 
ATOM 2303 C CD1 . LEU B 2 89  ? 65.928  62.234 28.798  1.00 55.20  ? 89  LEU L CD1 1 
ATOM 2304 C CD2 . LEU B 2 89  ? 66.601  60.025 29.719  1.00 55.20  ? 89  LEU L CD2 1 
ATOM 2305 N N   . GLN B 2 90  ? 66.480  64.755 30.109  1.00 49.64  ? 90  GLN L N   1 
ATOM 2306 C CA  . GLN B 2 90  ? 65.569  65.519 30.963  1.00 49.64  ? 90  GLN L CA  1 
ATOM 2307 C C   . GLN B 2 90  ? 64.273  64.773 31.049  1.00 49.64  ? 90  GLN L C   1 
ATOM 2308 O O   . GLN B 2 90  ? 63.745  64.336 30.029  1.00 49.64  ? 90  GLN L O   1 
ATOM 2309 C CB  . GLN B 2 90  ? 65.298  66.918 30.401  1.00 59.33  ? 90  GLN L CB  1 
ATOM 2310 C CG  . GLN B 2 90  ? 64.365  67.003 29.186  1.00 59.33  ? 90  GLN L CG  1 
ATOM 2311 C CD  . GLN B 2 90  ? 62.884  66.883 29.528  1.00 59.33  ? 90  GLN L CD  1 
ATOM 2312 O OE1 . GLN B 2 90  ? 62.457  67.229 30.629  1.00 59.33  ? 90  GLN L OE1 1 
ATOM 2313 N NE2 . GLN B 2 90  ? 62.091  66.407 28.569  1.00 59.33  ? 90  GLN L NE2 1 
ATOM 2314 N N   . TYR B 2 91  ? 63.768  64.621 32.265  1.00 72.48  ? 91  TYR L N   1 
ATOM 2315 C CA  . TYR B 2 91  ? 62.512  63.921 32.480  1.00 72.48  ? 91  TYR L CA  1 
ATOM 2316 C C   . TYR B 2 91  ? 61.545  64.780 33.259  1.00 72.48  ? 91  TYR L C   1 
ATOM 2317 O O   . TYR B 2 91  ? 60.647  64.259 33.919  1.00 72.48  ? 91  TYR L O   1 
ATOM 2318 C CB  . TYR B 2 91  ? 62.739  62.614 33.233  1.00 62.95  ? 91  TYR L CB  1 
ATOM 2319 C CG  . TYR B 2 91  ? 63.491  62.750 34.534  1.00 62.95  ? 91  TYR L CG  1 
ATOM 2320 C CD1 . TYR B 2 91  ? 64.785  63.246 34.552  1.00 62.95  ? 91  TYR L CD1 1 
ATOM 2321 C CD2 . TYR B 2 91  ? 62.955  62.270 35.728  1.00 62.95  ? 91  TYR L CD2 1 
ATOM 2322 C CE1 . TYR B 2 91  ? 65.543  63.245 35.716  1.00 62.95  ? 91  TYR L CE1 1 
ATOM 2323 C CE2 . TYR B 2 91  ? 63.704  62.262 36.903  1.00 62.95  ? 91  TYR L CE2 1 
ATOM 2324 C CZ  . TYR B 2 91  ? 65.004  62.745 36.888  1.00 62.95  ? 91  TYR L CZ  1 
ATOM 2325 O OH  . TYR B 2 91  ? 65.803  62.674 38.016  1.00 62.95  ? 91  TYR L OH  1 
ATOM 2326 N N   . ASP B 2 92  ? 61.735  66.094 33.168  1.00 82.21  ? 92  ASP L N   1 
ATOM 2327 C CA  . ASP B 2 92  ? 60.885  67.057 33.858  1.00 82.21  ? 92  ASP L CA  1 
ATOM 2328 C C   . ASP B 2 92  ? 59.444  66.977 33.347  1.00 82.21  ? 92  ASP L C   1 
ATOM 2329 O O   . ASP B 2 92  ? 58.497  67.022 34.135  1.00 82.21  ? 92  ASP L O   1 
ATOM 2330 C CB  . ASP B 2 92  ? 61.437  68.478 33.663  1.00 131.01 ? 92  ASP L CB  1 
ATOM 2331 C CG  . ASP B 2 92  ? 60.694  69.523 34.490  1.00 131.01 ? 92  ASP L CG  1 
ATOM 2332 O OD1 . ASP B 2 92  ? 60.683  69.400 35.733  1.00 131.01 ? 92  ASP L OD1 1 
ATOM 2333 O OD2 . ASP B 2 92  ? 60.131  70.473 33.900  1.00 131.01 ? 92  ASP L OD2 1 
ATOM 2334 N N   . GLU B 2 93  ? 59.287  66.862 32.030  1.00 82.65  ? 93  GLU L N   1 
ATOM 2335 C CA  . GLU B 2 93  ? 57.967  66.769 31.411  1.00 82.65  ? 93  GLU L CA  1 
ATOM 2336 C C   . GLU B 2 93  ? 58.011  65.913 30.138  1.00 82.65  ? 93  GLU L C   1 
ATOM 2337 O O   . GLU B 2 93  ? 59.088  65.554 29.644  1.00 82.65  ? 93  GLU L O   1 
ATOM 2338 C CB  . GLU B 2 93  ? 57.433  68.174 31.080  1.00 171.00 ? 93  GLU L CB  1 
ATOM 2339 C CG  . GLU B 2 93  ? 58.463  69.117 30.442  1.00 171.00 ? 93  GLU L CG  1 
ATOM 2340 C CD  . GLU B 2 93  ? 57.860  70.428 29.925  1.00 171.00 ? 93  GLU L CD  1 
ATOM 2341 O OE1 . GLU B 2 93  ? 57.187  70.405 28.866  1.00 171.00 ? 93  GLU L OE1 1 
ATOM 2342 O OE2 . GLU B 2 93  ? 58.059  71.481 30.579  1.00 171.00 ? 93  GLU L OE2 1 
ATOM 2343 N N   . PHE B 2 94  ? 56.836  65.578 29.617  1.00 91.38  ? 94  PHE L N   1 
ATOM 2344 C CA  . PHE B 2 94  ? 56.749  64.781 28.403  1.00 91.38  ? 94  PHE L CA  1 
ATOM 2345 C C   . PHE B 2 94  ? 56.852  65.691 27.191  1.00 91.38  ? 94  PHE L C   1 
ATOM 2346 O O   . PHE B 2 94  ? 56.334  66.803 27.201  1.00 91.38  ? 94  PHE L O   1 
ATOM 2347 C CB  . PHE B 2 94  ? 55.418  64.050 28.338  1.00 71.86  ? 94  PHE L CB  1 
ATOM 2348 C CG  . PHE B 2 94  ? 55.249  62.980 29.380  1.00 71.86  ? 94  PHE L CG  1 
ATOM 2349 C CD1 . PHE B 2 94  ? 56.208  61.984 29.547  1.00 71.86  ? 94  PHE L CD1 1 
ATOM 2350 C CD2 . PHE B 2 94  ? 54.077  62.917 30.132  1.00 71.86  ? 94  PHE L CD2 1 
ATOM 2351 C CE1 . PHE B 2 94  ? 55.999  60.938 30.441  1.00 71.86  ? 94  PHE L CE1 1 
ATOM 2352 C CE2 . PHE B 2 94  ? 53.853  61.879 31.028  1.00 71.86  ? 94  PHE L CE2 1 
ATOM 2353 C CZ  . PHE B 2 94  ? 54.812  60.885 31.183  1.00 71.86  ? 94  PHE L CZ  1 
ATOM 2354 N N   . PRO B 2 95  ? 57.521  65.229 26.126  1.00 95.27  ? 95  PRO L N   1 
ATOM 2355 C CA  . PRO B 2 95  ? 58.164  63.920 26.016  1.00 95.27  ? 95  PRO L CA  1 
ATOM 2356 C C   . PRO B 2 95  ? 59.594  64.013 26.489  1.00 95.27  ? 95  PRO L C   1 
ATOM 2357 O O   . PRO B 2 95  ? 60.280  65.006 26.252  1.00 95.27  ? 95  PRO L O   1 
ATOM 2358 C CB  . PRO B 2 95  ? 58.102  63.639 24.532  1.00 93.34  ? 95  PRO L CB  1 
ATOM 2359 C CG  . PRO B 2 95  ? 58.437  64.988 23.979  1.00 93.34  ? 95  PRO L CG  1 
ATOM 2360 C CD  . PRO B 2 95  ? 57.614  65.946 24.843  1.00 93.34  ? 95  PRO L CD  1 
ATOM 2361 N N   . TYR B 2 96  ? 60.038  62.979 27.175  1.00 67.95  ? 96  TYR L N   1 
ATOM 2362 C CA  . TYR B 2 96  ? 61.396  62.957 27.654  1.00 67.95  ? 96  TYR L CA  1 
ATOM 2363 C C   . TYR B 2 96  ? 62.238  63.214 26.419  1.00 67.95  ? 96  TYR L C   1 
ATOM 2364 O O   . TYR B 2 96  ? 62.024  62.599 25.377  1.00 67.95  ? 96  TYR L O   1 
ATOM 2365 C CB  . TYR B 2 96  ? 61.659  61.598 28.274  1.00 58.25  ? 96  TYR L CB  1 
ATOM 2366 C CG  . TYR B 2 96  ? 60.762  61.347 29.459  1.00 58.25  ? 96  TYR L CG  1 
ATOM 2367 C CD1 . TYR B 2 96  ? 60.283  60.076 29.740  1.00 58.25  ? 96  TYR L CD1 1 
ATOM 2368 C CD2 . TYR B 2 96  ? 60.433  62.378 30.328  1.00 58.25  ? 96  TYR L CD2 1 
ATOM 2369 C CE1 . TYR B 2 96  ? 59.500  59.838 30.860  1.00 58.25  ? 96  TYR L CE1 1 
ATOM 2370 C CE2 . TYR B 2 96  ? 59.658  62.151 31.449  1.00 58.25  ? 96  TYR L CE2 1 
ATOM 2371 C CZ  . TYR B 2 96  ? 59.192  60.879 31.711  1.00 58.25  ? 96  TYR L CZ  1 
ATOM 2372 O OH  . TYR B 2 96  ? 58.421  60.640 32.824  1.00 58.25  ? 96  TYR L OH  1 
ATOM 2373 N N   . THR B 2 97  ? 63.161  64.159 26.531  1.00 48.73  ? 97  THR L N   1 
ATOM 2374 C CA  . THR B 2 97  ? 64.017  64.531 25.414  1.00 48.73  ? 97  THR L CA  1 
ATOM 2375 C C   . THR B 2 97  ? 65.485  64.349 25.771  1.00 48.73  ? 97  THR L C   1 
ATOM 2376 O O   . THR B 2 97  ? 65.916  64.731 26.851  1.00 48.73  ? 97  THR L O   1 
ATOM 2377 C CB  . THR B 2 97  ? 63.758  66.001 24.998  1.00 74.56  ? 97  THR L CB  1 
ATOM 2378 O OG1 . THR B 2 97  ? 64.006  66.882 26.101  1.00 74.56  ? 97  THR L OG1 1 
ATOM 2379 C CG2 . THR B 2 97  ? 62.322  66.174 24.586  1.00 74.56  ? 97  THR L CG2 1 
ATOM 2380 N N   . PHE B 2 98  ? 66.254  63.751 24.872  1.00 83.38  ? 98  PHE L N   1 
ATOM 2381 C CA  . PHE B 2 98  ? 67.663  63.533 25.157  1.00 83.38  ? 98  PHE L CA  1 
ATOM 2382 C C   . PHE B 2 98  ? 68.525  64.653 24.653  1.00 83.38  ? 98  PHE L C   1 
ATOM 2383 O O   . PHE B 2 98  ? 68.115  65.426 23.793  1.00 83.38  ? 98  PHE L O   1 
ATOM 2384 C CB  . PHE B 2 98  ? 68.165  62.247 24.513  1.00 51.44  ? 98  PHE L CB  1 
ATOM 2385 C CG  . PHE B 2 98  ? 67.630  61.012 25.136  1.00 51.44  ? 98  PHE L CG  1 
ATOM 2386 C CD1 . PHE B 2 98  ? 66.290  60.689 25.022  1.00 51.44  ? 98  PHE L CD1 1 
ATOM 2387 C CD2 . PHE B 2 98  ? 68.465  60.177 25.860  1.00 51.44  ? 98  PHE L CD2 1 
ATOM 2388 C CE1 . PHE B 2 98  ? 65.782  59.553 25.624  1.00 51.44  ? 98  PHE L CE1 1 
ATOM 2389 C CE2 . PHE B 2 98  ? 67.976  59.032 26.474  1.00 51.44  ? 98  PHE L CE2 1 
ATOM 2390 C CZ  . PHE B 2 98  ? 66.628  58.717 26.358  1.00 51.44  ? 98  PHE L CZ  1 
ATOM 2391 N N   . GLY B 2 99  ? 69.730  64.735 25.200  1.00 101.78 ? 99  GLY L N   1 
ATOM 2392 C CA  . GLY B 2 99  ? 70.668  65.735 24.742  1.00 101.78 ? 99  GLY L CA  1 
ATOM 2393 C C   . GLY B 2 99  ? 71.105  65.157 23.413  1.00 101.78 ? 99  GLY L C   1 
ATOM 2394 O O   . GLY B 2 99  ? 70.364  64.382 22.808  1.00 101.78 ? 99  GLY L O   1 
ATOM 2395 N N   . GLY B 2 100 ? 72.296  65.500 22.952  1.00 61.31  ? 100 GLY L N   1 
ATOM 2396 C CA  . GLY B 2 100 ? 72.738  64.959 21.685  1.00 61.31  ? 100 GLY L CA  1 
ATOM 2397 C C   . GLY B 2 100 ? 74.034  64.258 21.933  1.00 61.31  ? 100 GLY L C   1 
ATOM 2398 O O   . GLY B 2 100 ? 74.636  63.680 21.023  1.00 61.31  ? 100 GLY L O   1 
ATOM 2399 N N   . GLY B 2 101 ? 74.453  64.322 23.193  1.00 65.66  ? 101 GLY L N   1 
ATOM 2400 C CA  . GLY B 2 101 ? 75.700  63.709 23.613  1.00 65.66  ? 101 GLY L CA  1 
ATOM 2401 C C   . GLY B 2 101 ? 76.998  64.313 23.076  1.00 65.66  ? 101 GLY L C   1 
ATOM 2402 O O   . GLY B 2 101 ? 77.143  64.671 21.900  1.00 65.66  ? 101 GLY L O   1 
ATOM 2403 N N   . THR B 2 102 ? 77.953  64.465 23.971  1.00 64.50  ? 102 THR L N   1 
ATOM 2404 C CA  . THR B 2 102 ? 79.246  64.954 23.568  1.00 64.50  ? 102 THR L CA  1 
ATOM 2405 C C   . THR B 2 102 ? 80.048  63.678 23.728  1.00 64.50  ? 102 THR L C   1 
ATOM 2406 O O   . THR B 2 102 ? 79.797  62.898 24.664  1.00 64.50  ? 102 THR L O   1 
ATOM 2407 C CB  . THR B 2 102 ? 79.796  66.040 24.513  1.00 66.45  ? 102 THR L CB  1 
ATOM 2408 O OG1 . THR B 2 102 ? 81.109  65.666 24.975  1.00 66.45  ? 102 THR L OG1 1 
ATOM 2409 C CG2 . THR B 2 102 ? 78.828  66.275 25.693  1.00 66.45  ? 102 THR L CG2 1 
ATOM 2410 N N   . LYS B 2 103 ? 80.975  63.450 22.801  1.00 52.97  ? 103 LYS L N   1 
ATOM 2411 C CA  . LYS B 2 103 ? 81.809  62.257 22.794  1.00 52.97  ? 103 LYS L CA  1 
ATOM 2412 C C   . LYS B 2 103 ? 83.193  62.693 23.228  1.00 52.97  ? 103 LYS L C   1 
ATOM 2413 O O   . LYS B 2 103 ? 83.700  63.712 22.782  1.00 52.97  ? 103 LYS L O   1 
ATOM 2414 C CB  . LYS B 2 103 ? 81.820  61.678 21.384  1.00 84.49  ? 103 LYS L CB  1 
ATOM 2415 C CG  . LYS B 2 103 ? 82.638  60.430 21.192  1.00 84.49  ? 103 LYS L CG  1 
ATOM 2416 C CD  . LYS B 2 103 ? 82.621  60.073 19.719  1.00 84.49  ? 103 LYS L CD  1 
ATOM 2417 C CE  . LYS B 2 103 ? 83.906  59.400 19.301  1.00 84.49  ? 103 LYS L CE  1 
ATOM 2418 N NZ  . LYS B 2 103 ? 85.076  60.239 19.661  1.00 84.49  ? 103 LYS L NZ  1 
ATOM 2419 N N   . LEU B 2 104 ? 83.812  61.909 24.089  1.00 53.33  ? 104 LEU L N   1 
ATOM 2420 C CA  . LEU B 2 104 ? 85.111  62.263 24.609  1.00 53.33  ? 104 LEU L CA  1 
ATOM 2421 C C   . LEU B 2 104 ? 86.155  61.188 24.323  1.00 53.33  ? 104 LEU L C   1 
ATOM 2422 O O   . LEU B 2 104 ? 85.941  60.001 24.618  1.00 53.33  ? 104 LEU L O   1 
ATOM 2423 C CB  . LEU B 2 104 ? 84.958  62.467 26.112  1.00 60.24  ? 104 LEU L CB  1 
ATOM 2424 C CG  . LEU B 2 104 ? 85.995  62.997 27.100  1.00 60.24  ? 104 LEU L CG  1 
ATOM 2425 C CD1 . LEU B 2 104 ? 85.387  62.778 28.479  1.00 60.24  ? 104 LEU L CD1 1 
ATOM 2426 C CD2 . LEU B 2 104 ? 87.348  62.288 26.992  1.00 60.24  ? 104 LEU L CD2 1 
ATOM 2427 N N   . GLU B 2 105 ? 87.279  61.607 23.739  1.00 65.53  ? 105 GLU L N   1 
ATOM 2428 C CA  . GLU B 2 105 ? 88.390  60.708 23.426  1.00 65.53  ? 105 GLU L CA  1 
ATOM 2429 C C   . GLU B 2 105 ? 89.583  61.124 24.274  1.00 65.53  ? 105 GLU L C   1 
ATOM 2430 O O   . GLU B 2 105 ? 89.637  62.252 24.755  1.00 65.53  ? 105 GLU L O   1 
ATOM 2431 C CB  . GLU B 2 105 ? 88.746  60.791 21.943  1.00 88.96  ? 105 GLU L CB  1 
ATOM 2432 C CG  . GLU B 2 105 ? 87.842  59.955 21.046  1.00 88.96  ? 105 GLU L CG  1 
ATOM 2433 C CD  . GLU B 2 105 ? 88.047  60.235 19.565  1.00 88.96  ? 105 GLU L CD  1 
ATOM 2434 O OE1 . GLU B 2 105 ? 87.799  61.388 19.164  1.00 88.96  ? 105 GLU L OE1 1 
ATOM 2435 O OE2 . GLU B 2 105 ? 88.447  59.319 18.805  1.00 88.96  ? 105 GLU L OE2 1 
ATOM 2436 N N   . ILE B 2 106 ? 90.540  60.220 24.449  1.00 115.16 ? 106 ILE L N   1 
ATOM 2437 C CA  . ILE B 2 106 ? 91.724  60.485 25.265  1.00 115.16 ? 106 ILE L CA  1 
ATOM 2438 C C   . ILE B 2 106 ? 93.022  60.611 24.483  1.00 115.16 ? 106 ILE L C   1 
ATOM 2439 O O   . ILE B 2 106 ? 93.444  59.651 23.836  1.00 115.16 ? 106 ILE L O   1 
ATOM 2440 C CB  . ILE B 2 106 ? 91.923  59.367 26.266  1.00 70.57  ? 106 ILE L CB  1 
ATOM 2441 C CG1 . ILE B 2 106 ? 90.938  59.529 27.413  1.00 70.57  ? 106 ILE L CG1 1 
ATOM 2442 C CG2 . ILE B 2 106 ? 93.357  59.330 26.724  1.00 70.57  ? 106 ILE L CG2 1 
ATOM 2443 C CD1 . ILE B 2 106 ? 91.014  58.403 28.414  1.00 70.57  ? 106 ILE L CD1 1 
ATOM 2444 N N   . LYS B 2 107 ? 93.680  61.768 24.571  1.00 106.16 ? 107 LYS L N   1 
ATOM 2445 C CA  . LYS B 2 107 ? 94.931  61.934 23.838  1.00 106.16 ? 107 LYS L CA  1 
ATOM 2446 C C   . LYS B 2 107 ? 96.037  61.083 24.426  1.00 106.16 ? 107 LYS L C   1 
ATOM 2447 O O   . LYS B 2 107 ? 96.397  61.216 25.593  1.00 106.16 ? 107 LYS L O   1 
ATOM 2448 C CB  . LYS B 2 107 ? 95.359  63.409 23.735  1.00 118.11 ? 107 LYS L CB  1 
ATOM 2449 C CG  . LYS B 2 107 ? 95.049  64.313 24.911  1.00 118.11 ? 107 LYS L CG  1 
ATOM 2450 C CD  . LYS B 2 107 ? 95.331  65.761 24.500  1.00 118.11 ? 107 LYS L CD  1 
ATOM 2451 C CE  . LYS B 2 107 ? 94.977  66.768 25.581  1.00 118.11 ? 107 LYS L CE  1 
ATOM 2452 N NZ  . LYS B 2 107 ? 95.887  66.679 26.751  1.00 118.11 ? 107 LYS L NZ  1 
ATOM 2453 N N   . ARG B 2 108 ? 96.545  60.183 23.589  1.00 96.36  ? 108 ARG L N   1 
ATOM 2454 C CA  . ARG B 2 108 ? 97.597  59.240 23.944  1.00 96.36  ? 108 ARG L CA  1 
ATOM 2455 C C   . ARG B 2 108 ? 98.894  59.687 23.292  1.00 96.36  ? 108 ARG L C   1 
ATOM 2456 O O   . ARG B 2 108 ? 99.016  60.839 22.872  1.00 96.36  ? 108 ARG L O   1 
ATOM 2457 C CB  . ARG B 2 108 ? 97.204  57.848 23.435  1.00 92.63  ? 108 ARG L CB  1 
ATOM 2458 C CG  . ARG B 2 108 ? 98.182  56.748 23.761  1.00 92.63  ? 108 ARG L CG  1 
ATOM 2459 C CD  . ARG B 2 108 ? 97.719  55.403 23.212  1.00 92.63  ? 108 ARG L CD  1 
ATOM 2460 N NE  . ARG B 2 108 ? 98.665  54.356 23.581  1.00 92.63  ? 108 ARG L NE  1 
ATOM 2461 C CZ  . ARG B 2 108 ? 99.952  54.386 23.251  1.00 92.63  ? 108 ARG L CZ  1 
ATOM 2462 N NH1 . ARG B 2 108 ? 100.423 55.404 22.538  1.00 92.63  ? 108 ARG L NH1 1 
ATOM 2463 N NH2 . ARG B 2 108 ? 100.773 53.424 23.661  1.00 92.63  ? 108 ARG L NH2 1 
ATOM 2464 N N   . ALA B 2 109 ? 99.857  58.777 23.210  1.00 88.65  ? 109 ALA L N   1 
ATOM 2465 C CA  . ALA B 2 109 ? 101.141 59.074 22.591  1.00 88.65  ? 109 ALA L CA  1 
ATOM 2466 C C   . ALA B 2 109 ? 101.155 58.491 21.190  1.00 88.65  ? 109 ALA L C   1 
ATOM 2467 O O   . ALA B 2 109 ? 100.613 57.405 20.972  1.00 88.65  ? 109 ALA L O   1 
ATOM 2468 C CB  . ALA B 2 109 ? 102.264 58.473 23.406  1.00 75.27  ? 109 ALA L CB  1 
ATOM 2469 N N   . ASP B 2 110 ? 101.760 59.219 20.248  1.00 89.05  ? 110 ASP L N   1 
ATOM 2470 C CA  . ASP B 2 110 ? 101.863 58.771 18.859  1.00 89.05  ? 110 ASP L CA  1 
ATOM 2471 C C   . ASP B 2 110 ? 102.406 57.345 18.837  1.00 89.05  ? 110 ASP L C   1 
ATOM 2472 O O   . ASP B 2 110 ? 103.437 57.057 19.441  1.00 89.05  ? 110 ASP L O   1 
ATOM 2473 C CB  . ASP B 2 110 ? 102.808 59.688 18.075  1.00 87.05  ? 110 ASP L CB  1 
ATOM 2474 C CG  . ASP B 2 110 ? 102.124 60.950 17.570  1.00 87.05  ? 110 ASP L CG  1 
ATOM 2475 O OD1 . ASP B 2 110 ? 101.246 61.469 18.288  1.00 87.05  ? 110 ASP L OD1 1 
ATOM 2476 O OD2 . ASP B 2 110 ? 102.475 61.433 16.464  1.00 87.05  ? 110 ASP L OD2 1 
ATOM 2477 N N   . ALA B 2 111 ? 101.706 56.449 18.152  1.00 95.11  ? 111 ALA L N   1 
ATOM 2478 C CA  . ALA B 2 111 ? 102.141 55.061 18.066  1.00 95.11  ? 111 ALA L CA  1 
ATOM 2479 C C   . ALA B 2 111 ? 101.732 54.481 16.723  1.00 95.11  ? 111 ALA L C   1 
ATOM 2480 O O   . ALA B 2 111 ? 100.547 54.410 16.398  1.00 95.11  ? 111 ALA L O   1 
ATOM 2481 C CB  . ALA B 2 111 ? 101.537 54.251 19.193  1.00 78.81  ? 111 ALA L CB  1 
ATOM 2482 N N   . ALA B 2 112 ? 102.733 54.083 15.943  1.00 103.22 ? 112 ALA L N   1 
ATOM 2483 C CA  . ALA B 2 112 ? 102.509 53.514 14.624  1.00 103.22 ? 112 ALA L CA  1 
ATOM 2484 C C   . ALA B 2 112 ? 101.802 52.186 14.740  1.00 103.22 ? 112 ALA L C   1 
ATOM 2485 O O   . ALA B 2 112 ? 101.779 51.567 15.804  1.00 103.22 ? 112 ALA L O   1 
ATOM 2486 C CB  . ALA B 2 112 ? 103.813 53.322 13.915  1.00 60.74  ? 112 ALA L CB  1 
ATOM 2487 N N   . PRO B 2 113 ? 101.209 51.731 13.636  1.00 84.00  ? 113 PRO L N   1 
ATOM 2488 C CA  . PRO B 2 113 ? 100.491 50.462 13.608  1.00 84.00  ? 113 PRO L CA  1 
ATOM 2489 C C   . PRO B 2 113 ? 101.369 49.244 13.386  1.00 84.00  ? 113 PRO L C   1 
ATOM 2490 O O   . PRO B 2 113 ? 102.492 49.347 12.881  1.00 84.00  ? 113 PRO L O   1 
ATOM 2491 C CB  . PRO B 2 113 ? 99.495  50.665 12.475  1.00 82.70  ? 113 PRO L CB  1 
ATOM 2492 C CG  . PRO B 2 113 ? 100.258 51.510 11.531  1.00 82.70  ? 113 PRO L CG  1 
ATOM 2493 C CD  . PRO B 2 113 ? 100.906 52.526 12.436  1.00 82.70  ? 113 PRO L CD  1 
ATOM 2494 N N   . THR B 2 114 ? 100.836 48.092 13.786  1.00 77.55  ? 114 THR L N   1 
ATOM 2495 C CA  . THR B 2 114 ? 101.507 46.810 13.622  1.00 77.55  ? 114 THR L CA  1 
ATOM 2496 C C   . THR B 2 114 ? 100.613 46.072 12.620  1.00 77.55  ? 114 THR L C   1 
ATOM 2497 O O   . THR B 2 114 ? 99.631  45.417 12.978  1.00 77.55  ? 114 THR L O   1 
ATOM 2498 C CB  . THR B 2 114 ? 101.581 46.040 14.953  1.00 87.90  ? 114 THR L CB  1 
ATOM 2499 O OG1 . THR B 2 114 ? 101.614 46.970 16.044  1.00 87.90  ? 114 THR L OG1 1 
ATOM 2500 C CG2 . THR B 2 114 ? 102.844 45.202 15.001  1.00 87.90  ? 114 THR L CG2 1 
ATOM 2501 N N   . VAL B 2 115 ? 100.965 46.224 11.351  1.00 95.87  ? 115 VAL L N   1 
ATOM 2502 C CA  . VAL B 2 115 ? 100.230 45.646 10.234  1.00 95.87  ? 115 VAL L CA  1 
ATOM 2503 C C   . VAL B 2 115 ? 100.530 44.164 9.937   1.00 95.87  ? 115 VAL L C   1 
ATOM 2504 O O   . VAL B 2 115 ? 101.635 43.675 10.191  1.00 95.87  ? 115 VAL L O   1 
ATOM 2505 C CB  . VAL B 2 115 ? 100.492 46.514 8.974   1.00 59.93  ? 115 VAL L CB  1 
ATOM 2506 C CG1 . VAL B 2 115 ? 101.980 46.722 8.822   1.00 59.93  ? 115 VAL L CG1 1 
ATOM 2507 C CG2 . VAL B 2 115 ? 99.897  45.870 7.727   1.00 59.93  ? 115 VAL L CG2 1 
ATOM 2508 N N   . SER B 2 116 ? 99.527  43.468 9.399   1.00 80.14  ? 116 SER L N   1 
ATOM 2509 C CA  . SER B 2 116 ? 99.630  42.054 9.039   1.00 80.14  ? 116 SER L CA  1 
ATOM 2510 C C   . SER B 2 116 ? 98.557  41.670 8.022   1.00 80.14  ? 116 SER L C   1 
ATOM 2511 O O   . SER B 2 116 ? 97.379  41.973 8.194   1.00 80.14  ? 116 SER L O   1 
ATOM 2512 C CB  . SER B 2 116 ? 99.497  41.188 10.283  1.00 88.28  ? 116 SER L CB  1 
ATOM 2513 O OG  . SER B 2 116 ? 98.491  41.707 11.124  1.00 88.28  ? 116 SER L OG  1 
ATOM 2514 N N   . ILE B 2 117 ? 98.983  40.995 6.960   1.00 69.64  ? 117 ILE L N   1 
ATOM 2515 C CA  . ILE B 2 117 ? 98.093  40.585 5.877   1.00 69.64  ? 117 ILE L CA  1 
ATOM 2516 C C   . ILE B 2 117 ? 97.987  39.077 5.790   1.00 69.64  ? 117 ILE L C   1 
ATOM 2517 O O   . ILE B 2 117 ? 98.964  38.376 6.002   1.00 69.64  ? 117 ILE L O   1 
ATOM 2518 C CB  . ILE B 2 117 ? 98.609  41.145 4.547   1.00 82.52  ? 117 ILE L CB  1 
ATOM 2519 C CG1 . ILE B 2 117 ? 97.819  40.583 3.379   1.00 82.52  ? 117 ILE L CG1 1 
ATOM 2520 C CG2 . ILE B 2 117 ? 100.076 40.834 4.404   1.00 82.52  ? 117 ILE L CG2 1 
ATOM 2521 C CD1 . ILE B 2 117 ? 98.214  41.238 2.072   1.00 82.52  ? 117 ILE L CD1 1 
ATOM 2522 N N   . PHE B 2 118 ? 96.794  38.588 5.475   1.00 69.68  ? 118 PHE L N   1 
ATOM 2523 C CA  . PHE B 2 118 ? 96.542  37.155 5.386   1.00 69.68  ? 118 PHE L CA  1 
ATOM 2524 C C   . PHE B 2 118 ? 95.931  36.797 4.037   1.00 69.68  ? 118 PHE L C   1 
ATOM 2525 O O   . PHE B 2 118 ? 95.002  37.458 3.576   1.00 69.68  ? 118 PHE L O   1 
ATOM 2526 C CB  . PHE B 2 118 ? 95.573  36.707 6.485   1.00 62.96  ? 118 PHE L CB  1 
ATOM 2527 C CG  . PHE B 2 118 ? 95.927  37.200 7.858   1.00 62.96  ? 118 PHE L CG  1 
ATOM 2528 C CD1 . PHE B 2 118 ? 95.790  38.544 8.188   1.00 62.96  ? 118 PHE L CD1 1 
ATOM 2529 C CD2 . PHE B 2 118 ? 96.421  36.327 8.819   1.00 62.96  ? 118 PHE L CD2 1 
ATOM 2530 C CE1 . PHE B 2 118 ? 96.145  39.016 9.462   1.00 62.96  ? 118 PHE L CE1 1 
ATOM 2531 C CE2 . PHE B 2 118 ? 96.778  36.786 10.097  1.00 62.96  ? 118 PHE L CE2 1 
ATOM 2532 C CZ  . PHE B 2 118 ? 96.640  38.134 10.418  1.00 62.96  ? 118 PHE L CZ  1 
ATOM 2533 N N   . PRO B 2 119 ? 96.444  35.746 3.383   1.00 63.91  ? 119 PRO L N   1 
ATOM 2534 C CA  . PRO B 2 119 ? 95.875  35.377 2.088   1.00 63.91  ? 119 PRO L CA  1 
ATOM 2535 C C   . PRO B 2 119 ? 94.604  34.604 2.361   1.00 63.91  ? 119 PRO L C   1 
ATOM 2536 O O   . PRO B 2 119 ? 94.313  34.254 3.505   1.00 63.91  ? 119 PRO L O   1 
ATOM 2537 C CB  . PRO B 2 119 ? 96.947  34.493 1.477   1.00 56.01  ? 119 PRO L CB  1 
ATOM 2538 C CG  . PRO B 2 119 ? 98.204  34.885 2.220   1.00 56.01  ? 119 PRO L CG  1 
ATOM 2539 C CD  . PRO B 2 119 ? 97.708  35.033 3.615   1.00 56.01  ? 119 PRO L CD  1 
ATOM 2540 N N   . PRO B 2 120 ? 93.833  34.302 1.316   1.00 78.53  ? 120 PRO L N   1 
ATOM 2541 C CA  . PRO B 2 120 ? 92.578  33.556 1.489   1.00 78.53  ? 120 PRO L CA  1 
ATOM 2542 C C   . PRO B 2 120 ? 92.765  32.140 2.046   1.00 78.53  ? 120 PRO L C   1 
ATOM 2543 O O   . PRO B 2 120 ? 93.594  31.370 1.558   1.00 78.53  ? 120 PRO L O   1 
ATOM 2544 C CB  . PRO B 2 120 ? 91.989  33.538 0.081   1.00 45.70  ? 120 PRO L CB  1 
ATOM 2545 C CG  . PRO B 2 120 ? 92.645  34.720 -0.595  1.00 45.70  ? 120 PRO L CG  1 
ATOM 2546 C CD  . PRO B 2 120 ? 94.044  34.665 -0.091  1.00 45.70  ? 120 PRO L CD  1 
ATOM 2547 N N   . SER B 2 121 ? 91.991  31.795 3.067   1.00 89.49  ? 121 SER L N   1 
ATOM 2548 C CA  . SER B 2 121 ? 92.078  30.463 3.665   1.00 89.49  ? 121 SER L CA  1 
ATOM 2549 C C   . SER B 2 121 ? 91.525  29.435 2.693   1.00 89.49  ? 121 SER L C   1 
ATOM 2550 O O   . SER B 2 121 ? 90.403  29.573 2.195   1.00 89.49  ? 121 SER L O   1 
ATOM 2551 C CB  . SER B 2 121 ? 91.275  30.390 4.966   1.00 93.71  ? 121 SER L CB  1 
ATOM 2552 O OG  . SER B 2 121 ? 89.906  30.679 4.731   1.00 93.71  ? 121 SER L OG  1 
ATOM 2553 N N   . SER B 2 122 ? 92.326  28.410 2.425   1.00 92.50  ? 122 SER L N   1 
ATOM 2554 C CA  . SER B 2 122 ? 91.940  27.341 1.522   1.00 92.50  ? 122 SER L CA  1 
ATOM 2555 C C   . SER B 2 122 ? 90.445  27.092 1.636   1.00 92.50  ? 122 SER L C   1 
ATOM 2556 O O   . SER B 2 122 ? 89.757  26.971 0.633   1.00 92.50  ? 122 SER L O   1 
ATOM 2557 C CB  . SER B 2 122 ? 92.715  26.078 1.880   1.00 87.01  ? 122 SER L CB  1 
ATOM 2558 O OG  . SER B 2 122 ? 92.738  25.900 3.284   1.00 87.01  ? 122 SER L OG  1 
ATOM 2559 N N   . GLU B 2 123 ? 89.951  27.059 2.870   1.00 68.41  ? 123 GLU L N   1 
ATOM 2560 C CA  . GLU B 2 123 ? 88.540  26.809 3.158   1.00 68.41  ? 123 GLU L CA  1 
ATOM 2561 C C   . GLU B 2 123 ? 87.555  27.637 2.347   1.00 68.41  ? 123 GLU L C   1 
ATOM 2562 O O   . GLU B 2 123 ? 86.587  27.102 1.812   1.00 68.41  ? 123 GLU L O   1 
ATOM 2563 C CB  . GLU B 2 123 ? 88.266  27.028 4.644   1.00 106.07 ? 123 GLU L CB  1 
ATOM 2564 C CG  . GLU B 2 123 ? 86.844  26.708 5.066   1.00 106.07 ? 123 GLU L CG  1 
ATOM 2565 C CD  . GLU B 2 123 ? 86.552  27.147 6.493   1.00 106.07 ? 123 GLU L CD  1 
ATOM 2566 O OE1 . GLU B 2 123 ? 87.424  26.938 7.370   1.00 106.07 ? 123 GLU L OE1 1 
ATOM 2567 O OE2 . GLU B 2 123 ? 85.446  27.691 6.732   1.00 106.07 ? 123 GLU L OE2 1 
ATOM 2568 N N   . GLN B 2 124 ? 87.789  28.943 2.275   1.00 65.22  ? 124 GLN L N   1 
ATOM 2569 C CA  . GLN B 2 124 ? 86.910  29.837 1.524   1.00 65.22  ? 124 GLN L CA  1 
ATOM 2570 C C   . GLN B 2 124 ? 87.157  29.586 0.060   1.00 65.22  ? 124 GLN L C   1 
ATOM 2571 O O   . GLN B 2 124 ? 86.225  29.385 -0.716  1.00 65.22  ? 124 GLN L O   1 
ATOM 2572 C CB  . GLN B 2 124 ? 87.213  31.307 1.858   1.00 77.56  ? 124 GLN L CB  1 
ATOM 2573 C CG  . GLN B 2 124 ? 86.597  32.324 0.903   1.00 77.56  ? 124 GLN L CG  1 
ATOM 2574 C CD  . GLN B 2 124 ? 86.806  33.766 1.345   1.00 77.56  ? 124 GLN L CD  1 
ATOM 2575 O OE1 . GLN B 2 124 ? 87.904  34.156 1.750   1.00 77.56  ? 124 GLN L OE1 1 
ATOM 2576 N NE2 . GLN B 2 124 ? 85.751  34.567 1.261   1.00 77.56  ? 124 GLN L NE2 1 
ATOM 2577 N N   . LEU B 2 125 ? 88.431  29.586 -0.301  1.00 73.18  ? 125 LEU L N   1 
ATOM 2578 C CA  . LEU B 2 125 ? 88.820  29.362 -1.675  1.00 73.18  ? 125 LEU L CA  1 
ATOM 2579 C C   . LEU B 2 125 ? 88.007  28.237 -2.309  1.00 73.18  ? 125 LEU L C   1 
ATOM 2580 O O   . LEU B 2 125 ? 87.452  28.391 -3.405  1.00 73.18  ? 125 LEU L O   1 
ATOM 2581 C CB  . LEU B 2 125 ? 90.316  29.065 -1.744  1.00 49.59  ? 125 LEU L CB  1 
ATOM 2582 C CG  . LEU B 2 125 ? 91.188  30.322 -1.582  1.00 49.59  ? 125 LEU L CG  1 
ATOM 2583 C CD1 . LEU B 2 125 ? 92.664  29.967 -1.523  1.00 49.59  ? 125 LEU L CD1 1 
ATOM 2584 C CD2 . LEU B 2 125 ? 90.946  31.257 -2.754  1.00 49.59  ? 125 LEU L CD2 1 
ATOM 2585 N N   . THR B 2 126 ? 87.922  27.113 -1.611  1.00 63.58  ? 126 THR L N   1 
ATOM 2586 C CA  . THR B 2 126 ? 87.169  25.979 -2.104  1.00 63.58  ? 126 THR L CA  1 
ATOM 2587 C C   . THR B 2 126 ? 85.719  26.355 -2.246  1.00 63.58  ? 126 THR L C   1 
ATOM 2588 O O   . THR B 2 126 ? 85.082  26.010 -3.237  1.00 63.58  ? 126 THR L O   1 
ATOM 2589 C CB  . THR B 2 126 ? 87.214  24.829 -1.144  1.00 68.18  ? 126 THR L CB  1 
ATOM 2590 O OG1 . THR B 2 126 ? 88.548  24.320 -1.073  1.00 68.18  ? 126 THR L OG1 1 
ATOM 2591 C CG2 . THR B 2 126 ? 86.260  23.752 -1.600  1.00 68.18  ? 126 THR L CG2 1 
ATOM 2592 N N   . SER B 2 127 ? 85.202  27.053 -1.235  1.00 74.07  ? 127 SER L N   1 
ATOM 2593 C CA  . SER B 2 127 ? 83.802  27.481 -1.208  1.00 74.07  ? 127 SER L CA  1 
ATOM 2594 C C   . SER B 2 127 ? 83.431  28.229 -2.482  1.00 74.07  ? 127 SER L C   1 
ATOM 2595 O O   . SER B 2 127 ? 82.383  27.964 -3.064  1.00 74.07  ? 127 SER L O   1 
ATOM 2596 C CB  . SER B 2 127 ? 83.530  28.351 0.031   1.00 124.38 ? 127 SER L CB  1 
ATOM 2597 O OG  . SER B 2 127 ? 82.190  28.209 0.489   1.00 124.38 ? 127 SER L OG  1 
ATOM 2598 N N   . GLY B 2 128 ? 84.290  29.149 -2.918  1.00 74.33  ? 128 GLY L N   1 
ATOM 2599 C CA  . GLY B 2 128 ? 84.006  29.869 -4.145  1.00 74.33  ? 128 GLY L CA  1 
ATOM 2600 C C   . GLY B 2 128 ? 84.684  31.211 -4.368  1.00 74.33  ? 128 GLY L C   1 
ATOM 2601 O O   . GLY B 2 128 ? 84.651  31.774 -5.468  1.00 74.33  ? 128 GLY L O   1 
ATOM 2602 N N   . GLY B 2 129 ? 85.316  31.737 -3.338  1.00 43.63  ? 129 GLY L N   1 
ATOM 2603 C CA  . GLY B 2 129 ? 85.932  33.027 -3.504  1.00 43.63  ? 129 GLY L CA  1 
ATOM 2604 C C   . GLY B 2 129 ? 87.114  33.200 -2.603  1.00 43.63  ? 129 GLY L C   1 
ATOM 2605 O O   . GLY B 2 129 ? 87.621  32.235 -2.052  1.00 43.63  ? 129 GLY L O   1 
ATOM 2606 N N   . ALA B 2 130 ? 87.545  34.442 -2.437  1.00 61.84  ? 130 ALA L N   1 
ATOM 2607 C CA  . ALA B 2 130 ? 88.707  34.708 -1.614  1.00 61.84  ? 130 ALA L CA  1 
ATOM 2608 C C   . ALA B 2 130 ? 88.754  36.152 -1.143  1.00 61.84  ? 130 ALA L C   1 
ATOM 2609 O O   . ALA B 2 130 ? 88.647  37.088 -1.933  1.00 61.84  ? 130 ALA L O   1 
ATOM 2610 C CB  . ALA B 2 130 ? 89.979  34.357 -2.397  1.00 25.31  ? 130 ALA L CB  1 
ATOM 2611 N N   . SER B 2 131 ? 88.913  36.311 0.163   1.00 64.80  ? 131 SER L N   1 
ATOM 2612 C CA  . SER B 2 131 ? 88.978  37.619 0.770   1.00 64.80  ? 131 SER L CA  1 
ATOM 2613 C C   . SER B 2 131 ? 90.338  37.786 1.409   1.00 64.80  ? 131 SER L C   1 
ATOM 2614 O O   . SER B 2 131 ? 90.794  36.913 2.139   1.00 64.80  ? 131 SER L O   1 
ATOM 2615 C CB  . SER B 2 131 ? 87.890  37.768 1.842   1.00 79.84  ? 131 SER L CB  1 
ATOM 2616 O OG  . SER B 2 131 ? 86.594  37.517 1.321   1.00 79.84  ? 131 SER L OG  1 
ATOM 2617 N N   . VAL B 2 132 ? 90.992  38.903 1.123   1.00 76.51  ? 132 VAL L N   1 
ATOM 2618 C CA  . VAL B 2 132 ? 92.282  39.173 1.723   1.00 76.51  ? 132 VAL L CA  1 
ATOM 2619 C C   . VAL B 2 132 ? 92.143  40.218 2.809   1.00 76.51  ? 132 VAL L C   1 
ATOM 2620 O O   . VAL B 2 132 ? 91.657  41.330 2.580   1.00 76.51  ? 132 VAL L O   1 
ATOM 2621 C CB  . VAL B 2 132 ? 93.283  39.714 0.739   1.00 49.50  ? 132 VAL L CB  1 
ATOM 2622 C CG1 . VAL B 2 132 ? 94.624  39.898 1.454   1.00 49.50  ? 132 VAL L CG1 1 
ATOM 2623 C CG2 . VAL B 2 132 ? 93.384  38.798 -0.458  1.00 49.50  ? 132 VAL L CG2 1 
ATOM 2624 N N   . VAL B 2 133 ? 92.587  39.851 3.996   1.00 67.08  ? 133 VAL L N   1 
ATOM 2625 C CA  . VAL B 2 133 ? 92.515  40.739 5.128   1.00 67.08  ? 133 VAL L CA  1 
ATOM 2626 C C   . VAL B 2 133 ? 93.899  41.254 5.517   1.00 67.08  ? 133 VAL L C   1 
ATOM 2627 O O   . VAL B 2 133 ? 94.895  40.542 5.457   1.00 67.08  ? 133 VAL L O   1 
ATOM 2628 C CB  . VAL B 2 133 ? 91.866  40.029 6.319   1.00 61.69  ? 133 VAL L CB  1 
ATOM 2629 C CG1 . VAL B 2 133 ? 91.998  40.865 7.569   1.00 61.69  ? 133 VAL L CG1 1 
ATOM 2630 C CG2 . VAL B 2 133 ? 90.408  39.765 6.009   1.00 61.69  ? 133 VAL L CG2 1 
ATOM 2631 N N   . CYS B 2 134 ? 93.941  42.522 5.893   1.00 72.32  ? 134 CYS L N   1 
ATOM 2632 C CA  . CYS B 2 134 ? 95.155  43.182 6.320   1.00 72.32  ? 134 CYS L CA  1 
ATOM 2633 C C   . CYS B 2 134 ? 94.692  43.921 7.556   1.00 72.32  ? 134 CYS L C   1 
ATOM 2634 O O   . CYS B 2 134 ? 93.603  44.506 7.561   1.00 72.32  ? 134 CYS L O   1 
ATOM 2635 C CB  . CYS B 2 134 ? 95.610  44.161 5.251   1.00 76.59  ? 134 CYS L CB  1 
ATOM 2636 S SG  . CYS B 2 134 ? 96.971  45.244 5.745   1.00 76.59  ? 134 CYS L SG  1 
ATOM 2637 N N   . PHE B 2 135 ? 95.488  43.876 8.617   1.00 61.38  ? 135 PHE L N   1 
ATOM 2638 C CA  . PHE B 2 135 ? 95.106  44.543 9.858   1.00 61.38  ? 135 PHE L CA  1 
ATOM 2639 C C   . PHE B 2 135 ? 96.088  45.624 10.219  1.00 61.38  ? 135 PHE L C   1 
ATOM 2640 O O   . PHE B 2 135 ? 97.234  45.331 10.548  1.00 61.38  ? 135 PHE L O   1 
ATOM 2641 C CB  . PHE B 2 135 ? 95.060  43.555 11.028  1.00 48.79  ? 135 PHE L CB  1 
ATOM 2642 C CG  . PHE B 2 135 ? 93.881  42.634 11.018  1.00 48.79  ? 135 PHE L CG  1 
ATOM 2643 C CD1 . PHE B 2 135 ? 92.601  43.114 11.228  1.00 48.79  ? 135 PHE L CD1 1 
ATOM 2644 C CD2 . PHE B 2 135 ? 94.060  41.272 10.860  1.00 48.79  ? 135 PHE L CD2 1 
ATOM 2645 C CE1 . PHE B 2 135 ? 91.511  42.241 11.287  1.00 48.79  ? 135 PHE L CE1 1 
ATOM 2646 C CE2 . PHE B 2 135 ? 92.984  40.387 10.914  1.00 48.79  ? 135 PHE L CE2 1 
ATOM 2647 C CZ  . PHE B 2 135 ? 91.709  40.867 11.130  1.00 48.79  ? 135 PHE L CZ  1 
ATOM 2648 N N   . LEU B 2 136 ? 95.653  46.874 10.136  1.00 90.57  ? 136 LEU L N   1 
ATOM 2649 C CA  . LEU B 2 136 ? 96.514  47.966 10.549  1.00 90.57  ? 136 LEU L CA  1 
ATOM 2650 C C   . LEU B 2 136 ? 96.069  48.044 11.999  1.00 90.57  ? 136 LEU L C   1 
ATOM 2651 O O   . LEU B 2 136 ? 94.879  48.219 12.266  1.00 90.57  ? 136 LEU L O   1 
ATOM 2652 C CB  . LEU B 2 136 ? 96.201  49.257 9.783   1.00 42.71  ? 136 LEU L CB  1 
ATOM 2653 C CG  . LEU B 2 136 ? 96.588  49.270 8.295   1.00 42.71  ? 136 LEU L CG  1 
ATOM 2654 C CD1 . LEU B 2 136 ? 98.026  48.808 8.087   1.00 42.71  ? 136 LEU L CD1 1 
ATOM 2655 C CD2 . LEU B 2 136 ? 95.639  48.354 7.542   1.00 42.71  ? 136 LEU L CD2 1 
ATOM 2656 N N   . ASN B 2 137 ? 97.003  47.867 12.930  1.00 117.01 ? 137 ASN L N   1 
ATOM 2657 C CA  . ASN B 2 137 ? 96.642  47.844 14.335  1.00 117.01 ? 137 ASN L CA  1 
ATOM 2658 C C   . ASN B 2 137 ? 97.272  48.870 15.241  1.00 117.01 ? 137 ASN L C   1 
ATOM 2659 O O   . ASN B 2 137 ? 98.243  49.527 14.891  1.00 117.01 ? 137 ASN L O   1 
ATOM 2660 C CB  . ASN B 2 137 ? 96.923  46.455 14.913  1.00 78.65  ? 137 ASN L CB  1 
ATOM 2661 C CG  . ASN B 2 137 ? 95.811  45.463 14.621  1.00 78.65  ? 137 ASN L CG  1 
ATOM 2662 O OD1 . ASN B 2 137 ? 96.019  44.244 14.645  1.00 78.65  ? 137 ASN L OD1 1 
ATOM 2663 N ND2 . ASN B 2 137 ? 94.617  45.982 14.345  1.00 78.65  ? 137 ASN L ND2 1 
ATOM 2664 N N   . ASN B 2 138 ? 96.680  48.980 16.424  1.00 78.99  ? 138 ASN L N   1 
ATOM 2665 C CA  . ASN B 2 138 ? 97.113  49.871 17.486  1.00 78.99  ? 138 ASN L CA  1 
ATOM 2666 C C   . ASN B 2 138 ? 97.942  51.045 17.047  1.00 78.99  ? 138 ASN L C   1 
ATOM 2667 O O   . ASN B 2 138 ? 99.165  51.027 17.167  1.00 78.99  ? 138 ASN L O   1 
ATOM 2668 C CB  . ASN B 2 138 ? 97.862  49.048 18.510  1.00 87.21  ? 138 ASN L CB  1 
ATOM 2669 C CG  . ASN B 2 138 ? 97.035  47.895 19.002  1.00 87.21  ? 138 ASN L CG  1 
ATOM 2670 O OD1 . ASN B 2 138 ? 95.971  48.103 19.594  1.00 87.21  ? 138 ASN L OD1 1 
ATOM 2671 N ND2 . ASN B 2 138 ? 97.498  46.667 18.754  1.00 87.21  ? 138 ASN L ND2 1 
ATOM 2672 N N   . PHE B 2 139 ? 97.274  52.074 16.543  1.00 61.58  ? 139 PHE L N   1 
ATOM 2673 C CA  . PHE B 2 139 ? 97.974  53.264 16.112  1.00 61.25  ? 139 PHE L CA  1 
ATOM 2674 C C   . PHE B 2 139 ? 97.259  54.522 16.615  1.00 64.38  ? 139 PHE L C   1 
ATOM 2675 O O   . PHE B 2 139 ? 96.041  54.528 16.770  1.00 63.32  ? 139 PHE L O   1 
ATOM 2676 C CB  . PHE B 2 139 ? 98.073  53.273 14.592  1.00 43.91  ? 139 PHE L CB  1 
ATOM 2677 C CG  . PHE B 2 139 ? 96.744  53.240 13.912  1.00 45.67  ? 139 PHE L CG  1 
ATOM 2678 C CD1 . PHE B 2 139 ? 95.986  54.403 13.786  1.00 47.01  ? 139 PHE L CD1 1 
ATOM 2679 C CD2 . PHE B 2 139 ? 96.217  52.037 13.432  1.00 46.41  ? 139 PHE L CD2 1 
ATOM 2680 C CE1 . PHE B 2 139 ? 94.714  54.376 13.195  1.00 44.97  ? 139 PHE L CE1 1 
ATOM 2681 C CE2 . PHE B 2 139 ? 94.943  51.997 12.834  1.00 42.83  ? 139 PHE L CE2 1 
ATOM 2682 C CZ  . PHE B 2 139 ? 94.196  53.169 12.720  1.00 44.26  ? 139 PHE L CZ  1 
ATOM 2683 N N   . TYR B 2 140 ? 98.036  55.567 16.899  1.00 83.10  ? 140 TYR L N   1 
ATOM 2684 C CA  . TYR B 2 140 ? 97.523  56.866 17.351  1.00 86.49  ? 140 TYR L CA  1 
ATOM 2685 C C   . TYR B 2 140 ? 98.501  57.900 16.793  1.00 87.81  ? 140 TYR L C   1 
ATOM 2686 O O   . TYR B 2 140 ? 99.718  57.740 16.926  1.00 90.44  ? 140 TYR L O   1 
ATOM 2687 C CB  . TYR B 2 140 ? 97.497  56.960 18.884  1.00 89.30  ? 140 TYR L CB  1 
ATOM 2688 C CG  . TYR B 2 140 ? 96.995  58.298 19.418  1.00 94.13  ? 140 TYR L CG  1 
ATOM 2689 C CD1 . TYR B 2 140 ? 97.564  59.499 18.994  1.00 97.47  ? 140 TYR L CD1 1 
ATOM 2690 C CD2 . TYR B 2 140 ? 95.946  58.363 20.331  1.00 92.39  ? 140 TYR L CD2 1 
ATOM 2691 C CE1 . TYR B 2 140 ? 97.104  60.723 19.454  1.00 98.10  ? 140 TYR L CE1 1 
ATOM 2692 C CE2 . TYR B 2 140 ? 95.478  59.591 20.802  1.00 93.19  ? 140 TYR L CE2 1 
ATOM 2693 C CZ  . TYR B 2 140 ? 96.062  60.767 20.357  1.00 95.29  ? 140 TYR L CZ  1 
ATOM 2694 O OH  . TYR B 2 140 ? 95.616  61.990 20.811  1.00 95.00  ? 140 TYR L OH  1 
ATOM 2695 N N   . PRO B 2 141 ? 97.997  58.995 16.187  1.00 58.89  ? 141 PRO L N   1 
ATOM 2696 C CA  . PRO B 2 141 ? 96.648  59.511 15.891  1.00 59.80  ? 141 PRO L CA  1 
ATOM 2697 C C   . PRO B 2 141 ? 95.635  58.596 15.224  1.00 62.41  ? 141 PRO L C   1 
ATOM 2698 O O   . PRO B 2 141 ? 95.993  57.613 14.584  1.00 62.93  ? 141 PRO L O   1 
ATOM 2699 C CB  . PRO B 2 141 ? 96.928  60.721 15.015  1.00 61.17  ? 141 PRO L CB  1 
ATOM 2700 C CG  . PRO B 2 141 ? 98.235  61.200 15.550  1.00 58.93  ? 141 PRO L CG  1 
ATOM 2701 C CD  . PRO B 2 141 ? 99.014  59.929 15.677  1.00 61.63  ? 141 PRO L CD  1 
ATOM 2702 N N   . LYS B 2 142 ? 94.360  58.951 15.354  1.00 67.64  ? 142 LYS L N   1 
ATOM 2703 C CA  . LYS B 2 142 ? 93.307  58.156 14.756  1.00 69.83  ? 142 LYS L CA  1 
ATOM 2704 C C   . LYS B 2 142 ? 93.447  58.126 13.247  1.00 66.71  ? 142 LYS L C   1 
ATOM 2705 O O   . LYS B 2 142 ? 93.213  57.090 12.629  1.00 66.10  ? 142 LYS L O   1 
ATOM 2706 C CB  . LYS B 2 142 ? 91.914  58.686 15.120  1.00 88.40  ? 142 LYS L CB  1 
ATOM 2707 C CG  . LYS B 2 142 ? 90.817  57.693 14.721  1.00 94.62  ? 142 LYS L CG  1 
ATOM 2708 C CD  . LYS B 2 142 ? 89.383  58.085 15.100  1.00 100.23 ? 142 LYS L CD  1 
ATOM 2709 C CE  . LYS B 2 142 ? 88.421  56.934 14.737  1.00 102.93 ? 142 LYS L CE  1 
ATOM 2710 N NZ  . LYS B 2 142 ? 87.004  57.138 15.157  1.00 102.85 ? 142 LYS L NZ  1 
ATOM 2711 N N   . ASP B 2 143 ? 93.834  59.253 12.654  1.00 77.93  ? 143 ASP L N   1 
ATOM 2712 C CA  . ASP B 2 143 ? 93.981  59.324 11.205  1.00 77.93  ? 143 ASP L CA  1 
ATOM 2713 C C   . ASP B 2 143 ? 95.063  58.359 10.713  1.00 77.93  ? 143 ASP L C   1 
ATOM 2714 O O   . ASP B 2 143 ? 96.243  58.489 11.061  1.00 77.93  ? 143 ASP L O   1 
ATOM 2715 C CB  . ASP B 2 143 ? 94.310  60.755 10.776  1.00 193.87 ? 143 ASP L CB  1 
ATOM 2716 C CG  . ASP B 2 143 ? 94.238  60.943 9.270   1.00 193.87 ? 143 ASP L CG  1 
ATOM 2717 O OD1 . ASP B 2 143 ? 95.105  60.395 8.558   1.00 193.87 ? 143 ASP L OD1 1 
ATOM 2718 O OD2 . ASP B 2 143 ? 93.313  61.638 8.796   1.00 193.87 ? 143 ASP L OD2 1 
ATOM 2719 N N   . ILE B 2 144 ? 94.640  57.396 9.894   1.00 79.21  ? 144 ILE L N   1 
ATOM 2720 C CA  . ILE B 2 144 ? 95.521  56.371 9.345   1.00 79.21  ? 144 ILE L CA  1 
ATOM 2721 C C   . ILE B 2 144 ? 95.222  56.287 7.847   1.00 79.21  ? 144 ILE L C   1 
ATOM 2722 O O   . ILE B 2 144 ? 94.371  57.021 7.359   1.00 79.21  ? 144 ILE L O   1 
ATOM 2723 C CB  . ILE B 2 144 ? 95.229  55.027 10.049  1.00 75.24  ? 144 ILE L CB  1 
ATOM 2724 C CG1 . ILE B 2 144 ? 96.526  54.247 10.312  1.00 75.24  ? 144 ILE L CG1 1 
ATOM 2725 C CG2 . ILE B 2 144 ? 94.188  54.264 9.276   1.00 75.24  ? 144 ILE L CG2 1 
ATOM 2726 C CD1 . ILE B 2 144 ? 97.276  53.814 9.098   1.00 75.24  ? 144 ILE L CD1 1 
ATOM 2727 N N   . ASN B 2 145 ? 95.901  55.404 7.115   1.00 88.18  ? 145 ASN L N   1 
ATOM 2728 C CA  . ASN B 2 145 ? 95.668  55.287 5.669   1.00 88.18  ? 145 ASN L CA  1 
ATOM 2729 C C   . ASN B 2 145 ? 96.203  53.982 5.046   1.00 88.18  ? 145 ASN L C   1 
ATOM 2730 O O   . ASN B 2 145 ? 97.296  53.528 5.392   1.00 88.18  ? 145 ASN L O   1 
ATOM 2731 C CB  . ASN B 2 145 ? 96.319  56.483 4.973   1.00 95.52  ? 145 ASN L CB  1 
ATOM 2732 C CG  . ASN B 2 145 ? 95.746  56.747 3.609   1.00 95.52  ? 145 ASN L CG  1 
ATOM 2733 O OD1 . ASN B 2 145 ? 94.696  57.371 3.477   1.00 95.52  ? 145 ASN L OD1 1 
ATOM 2734 N ND2 . ASN B 2 145 ? 96.426  56.264 2.579   1.00 95.52  ? 145 ASN L ND2 1 
ATOM 2735 N N   . VAL B 2 146 ? 95.429  53.386 4.133   1.00 81.99  ? 146 VAL L N   1 
ATOM 2736 C CA  . VAL B 2 146 ? 95.832  52.151 3.431   1.00 81.99  ? 146 VAL L CA  1 
ATOM 2737 C C   . VAL B 2 146 ? 95.596  52.185 1.938   1.00 81.99  ? 146 VAL L C   1 
ATOM 2738 O O   . VAL B 2 146 ? 94.690  52.863 1.469   1.00 81.99  ? 146 VAL L O   1 
ATOM 2739 C CB  . VAL B 2 146 ? 95.090  50.903 3.922   1.00 54.38  ? 146 VAL L CB  1 
ATOM 2740 C CG1 . VAL B 2 146 ? 95.780  50.369 5.149   1.00 54.38  ? 146 VAL L CG1 1 
ATOM 2741 C CG2 . VAL B 2 146 ? 93.632  51.229 4.229   1.00 54.38  ? 146 VAL L CG2 1 
ATOM 2742 N N   . LYS B 2 147 ? 96.419  51.454 1.196   1.00 83.18  ? 147 LYS L N   1 
ATOM 2743 C CA  . LYS B 2 147 ? 96.279  51.371 -0.255  1.00 83.18  ? 147 LYS L CA  1 
ATOM 2744 C C   . LYS B 2 147 ? 96.788  50.010 -0.704  1.00 83.18  ? 147 LYS L C   1 
ATOM 2745 O O   . LYS B 2 147 ? 97.928  49.638 -0.429  1.00 83.18  ? 147 LYS L O   1 
ATOM 2746 C CB  . LYS B 2 147 ? 97.050  52.499 -0.966  1.00 148.17 ? 147 LYS L CB  1 
ATOM 2747 C CG  . LYS B 2 147 ? 98.564  52.410 -0.881  1.00 148.17 ? 147 LYS L CG  1 
ATOM 2748 C CD  . LYS B 2 147 ? 99.246  53.509 -1.701  1.00 148.17 ? 147 LYS L CD  1 
ATOM 2749 C CE  . LYS B 2 147 ? 100.756 53.274 -1.785  1.00 148.17 ? 147 LYS L CE  1 
ATOM 2750 N NZ  . LYS B 2 147 ? 101.499 54.310 -2.562  1.00 148.17 ? 147 LYS L NZ  1 
ATOM 2751 N N   . TRP B 2 148 ? 95.928  49.256 -1.377  1.00 70.37  ? 148 TRP L N   1 
ATOM 2752 C CA  . TRP B 2 148 ? 96.293  47.934 -1.849  1.00 70.37  ? 148 TRP L CA  1 
ATOM 2753 C C   . TRP B 2 148 ? 97.107  47.977 -3.127  1.00 70.37  ? 148 TRP L C   1 
ATOM 2754 O O   . TRP B 2 148 ? 96.836  48.768 -4.023  1.00 70.37  ? 148 TRP L O   1 
ATOM 2755 C CB  . TRP B 2 148 ? 95.044  47.100 -2.100  1.00 67.22  ? 148 TRP L CB  1 
ATOM 2756 C CG  . TRP B 2 148 ? 94.368  46.658 -0.859  1.00 67.22  ? 148 TRP L CG  1 
ATOM 2757 C CD1 . TRP B 2 148 ? 93.317  47.258 -0.234  1.00 67.22  ? 148 TRP L CD1 1 
ATOM 2758 C CD2 . TRP B 2 148 ? 94.740  45.546 -0.046  1.00 67.22  ? 148 TRP L CD2 1 
ATOM 2759 N NE1 . TRP B 2 148 ? 93.014  46.593 0.924   1.00 67.22  ? 148 TRP L NE1 1 
ATOM 2760 C CE2 . TRP B 2 148 ? 93.875  45.536 1.066   1.00 67.22  ? 148 TRP L CE2 1 
ATOM 2761 C CE3 . TRP B 2 148 ? 95.726  44.555 -0.150  1.00 67.22  ? 148 TRP L CE3 1 
ATOM 2762 C CZ2 . TRP B 2 148 ? 93.965  44.569 2.075   1.00 67.22  ? 148 TRP L CZ2 1 
ATOM 2763 C CZ3 . TRP B 2 148 ? 95.815  43.596 0.845   1.00 67.22  ? 148 TRP L CZ3 1 
ATOM 2764 C CH2 . TRP B 2 148 ? 94.940  43.610 1.945   1.00 67.22  ? 148 TRP L CH2 1 
ATOM 2765 N N   . LYS B 2 149 ? 98.116  47.122 -3.202  1.00 106.48 ? 149 LYS L N   1 
ATOM 2766 C CA  . LYS B 2 149 ? 98.951  47.034 -4.389  1.00 106.48 ? 149 LYS L CA  1 
ATOM 2767 C C   . LYS B 2 149 ? 98.946  45.596 -4.861  1.00 106.48 ? 149 LYS L C   1 
ATOM 2768 O O   . LYS B 2 149 ? 99.030  44.662 -4.063  1.00 106.48 ? 149 LYS L O   1 
ATOM 2769 C CB  . LYS B 2 149 ? 100.385 47.461 -4.099  1.00 110.50 ? 149 LYS L CB  1 
ATOM 2770 C CG  . LYS B 2 149 ? 100.680 48.935 -4.317  1.00 110.50 ? 149 LYS L CG  1 
ATOM 2771 C CD  . LYS B 2 149 ? 102.179 49.113 -4.468  1.00 110.50 ? 149 LYS L CD  1 
ATOM 2772 C CE  . LYS B 2 149 ? 102.595 50.558 -4.591  1.00 110.50 ? 149 LYS L CE  1 
ATOM 2773 N NZ  . LYS B 2 149 ? 104.071 50.590 -4.807  1.00 110.50 ? 149 LYS L NZ  1 
ATOM 2774 N N   . ILE B 2 150 ? 98.857  45.419 -6.168  1.00 97.40  ? 150 ILE L N   1 
ATOM 2775 C CA  . ILE B 2 150 ? 98.821  44.089 -6.729  1.00 97.40  ? 150 ILE L CA  1 
ATOM 2776 C C   . ILE B 2 150 ? 99.699  44.005 -7.962  1.00 97.40  ? 150 ILE L C   1 
ATOM 2777 O O   . ILE B 2 150 ? 99.457  44.689 -8.955  1.00 97.40  ? 150 ILE L O   1 
ATOM 2778 C CB  . ILE B 2 150 ? 97.385  43.723 -7.082  1.00 37.96  ? 150 ILE L CB  1 
ATOM 2779 C CG1 . ILE B 2 150 ? 96.524  43.767 -5.812  1.00 37.96  ? 150 ILE L CG1 1 
ATOM 2780 C CG2 . ILE B 2 150 ? 97.348  42.360 -7.729  1.00 37.96  ? 150 ILE L CG2 1 
ATOM 2781 C CD1 . ILE B 2 150 ? 95.069  43.388 -6.021  1.00 37.96  ? 150 ILE L CD1 1 
ATOM 2782 N N   . ASP B 2 151 ? 100.713 43.150 -7.894  1.00 101.53 ? 151 ASP L N   1 
ATOM 2783 C CA  . ASP B 2 151 ? 101.659 42.981 -8.993  1.00 101.53 ? 151 ASP L CA  1 
ATOM 2784 C C   . ASP B 2 151 ? 102.195 44.347 -9.365  1.00 101.53 ? 151 ASP L C   1 
ATOM 2785 O O   . ASP B 2 151 ? 102.156 44.746 -10.525 1.00 101.53 ? 151 ASP L O   1 
ATOM 2786 C CB  . ASP B 2 151 ? 100.991 42.347 -10.218 1.00 102.41 ? 151 ASP L CB  1 
ATOM 2787 C CG  . ASP B 2 151 ? 100.558 40.920 -9.976  1.00 102.41 ? 151 ASP L CG  1 
ATOM 2788 O OD1 . ASP B 2 151 ? 101.391 40.115 -9.502  1.00 102.41 ? 151 ASP L OD1 1 
ATOM 2789 O OD2 . ASP B 2 151 ? 99.388  40.607 -10.271 1.00 102.41 ? 151 ASP L OD2 1 
ATOM 2790 N N   . GLY B 2 152 ? 102.692 45.064 -8.368  1.00 109.46 ? 152 GLY L N   1 
ATOM 2791 C CA  . GLY B 2 152 ? 103.223 46.384 -8.627  1.00 109.46 ? 152 GLY L CA  1 
ATOM 2792 C C   . GLY B 2 152 ? 102.099 47.373 -8.877  1.00 109.46 ? 152 GLY L C   1 
ATOM 2793 O O   . GLY B 2 152 ? 102.166 48.523 -8.436  1.00 109.46 ? 152 GLY L O   1 
ATOM 2794 N N   . SER B 2 153 ? 101.061 46.931 -9.584  1.00 128.82 ? 153 SER L N   1 
ATOM 2795 C CA  . SER B 2 153 ? 99.924  47.795 -9.873  1.00 128.82 ? 153 SER L CA  1 
ATOM 2796 C C   . SER B 2 153 ? 99.352  48.291 -8.552  1.00 128.82 ? 153 SER L C   1 
ATOM 2797 O O   . SER B 2 153 ? 100.005 48.209 -7.514  1.00 128.82 ? 153 SER L O   1 
ATOM 2798 C CB  . SER B 2 153 ? 98.852  47.026 -10.653 1.00 215.91 ? 153 SER L CB  1 
ATOM 2799 O OG  . SER B 2 153 ? 97.774  47.874 -11.013 1.00 215.91 ? 153 SER L OG  1 
ATOM 2800 N N   . GLU B 2 154 ? 98.131  48.802 -8.581  1.00 89.66  ? 154 GLU L N   1 
ATOM 2801 C CA  . GLU B 2 154 ? 97.532  49.292 -7.357  1.00 89.66  ? 154 GLU L CA  1 
ATOM 2802 C C   . GLU B 2 154 ? 96.128  49.786 -7.635  1.00 89.66  ? 154 GLU L C   1 
ATOM 2803 O O   . GLU B 2 154 ? 95.881  50.435 -8.650  1.00 89.66  ? 154 GLU L O   1 
ATOM 2804 C CB  . GLU B 2 154 ? 98.406  50.407 -6.774  1.00 102.97 ? 154 GLU L CB  1 
ATOM 2805 C CG  . GLU B 2 154 ? 97.817  51.794 -6.837  1.00 102.97 ? 154 GLU L CG  1 
ATOM 2806 C CD  . GLU B 2 154 ? 97.024  52.129 -5.597  1.00 102.97 ? 154 GLU L CD  1 
ATOM 2807 O OE1 . GLU B 2 154 ? 96.151  51.321 -5.223  1.00 102.97 ? 154 GLU L OE1 1 
ATOM 2808 O OE2 . GLU B 2 154 ? 97.274  53.201 -5.000  1.00 102.97 ? 154 GLU L OE2 1 
ATOM 2809 N N   . ARG B 2 155 ? 95.211  49.464 -6.729  1.00 106.03 ? 155 ARG L N   1 
ATOM 2810 C CA  . ARG B 2 155 ? 93.821  49.861 -6.881  1.00 106.03 ? 155 ARG L CA  1 
ATOM 2811 C C   . ARG B 2 155 ? 93.017  49.797 -5.585  1.00 106.03 ? 155 ARG L C   1 
ATOM 2812 O O   . ARG B 2 155 ? 93.401  49.154 -4.609  1.00 106.03 ? 155 ARG L O   1 
ATOM 2813 C CB  . ARG B 2 155 ? 93.142  48.989 -7.936  1.00 150.78 ? 155 ARG L CB  1 
ATOM 2814 C CG  . ARG B 2 155 ? 91.776  49.478 -8.357  1.00 150.78 ? 155 ARG L CG  1 
ATOM 2815 C CD  . ARG B 2 155 ? 91.161  48.499 -9.310  1.00 150.78 ? 155 ARG L CD  1 
ATOM 2816 N NE  . ARG B 2 155 ? 89.921  48.996 -9.889  1.00 150.78 ? 155 ARG L NE  1 
ATOM 2817 C CZ  . ARG B 2 155 ? 89.221  48.338 -10.809 1.00 150.78 ? 155 ARG L CZ  1 
ATOM 2818 N NH1 . ARG B 2 155 ? 89.646  47.157 -11.243 1.00 150.78 ? 155 ARG L NH1 1 
ATOM 2819 N NH2 . ARG B 2 155 ? 88.104  48.861 -11.304 1.00 150.78 ? 155 ARG L NH2 1 
ATOM 2820 N N   . GLN B 2 156 ? 91.879  50.473 -5.610  1.00 135.68 ? 156 GLN L N   1 
ATOM 2821 C CA  . GLN B 2 156 ? 90.991  50.549 -4.470  1.00 135.68 ? 156 GLN L CA  1 
ATOM 2822 C C   . GLN B 2 156 ? 89.563  50.264 -4.913  1.00 135.68 ? 156 GLN L C   1 
ATOM 2823 O O   . GLN B 2 156 ? 88.662  51.086 -4.746  1.00 135.68 ? 156 GLN L O   1 
ATOM 2824 C CB  . GLN B 2 156 ? 91.111  51.943 -3.860  1.00 151.30 ? 156 GLN L CB  1 
ATOM 2825 C CG  . GLN B 2 156 ? 91.272  53.047 -4.910  1.00 151.30 ? 156 GLN L CG  1 
ATOM 2826 C CD  . GLN B 2 156 ? 92.028  54.257 -4.384  1.00 151.30 ? 156 GLN L CD  1 
ATOM 2827 O OE1 . GLN B 2 156 ? 92.504  54.264 -3.247  1.00 151.30 ? 156 GLN L OE1 1 
ATOM 2828 N NE2 . GLN B 2 156 ? 92.149  55.285 -5.216  1.00 151.30 ? 156 GLN L NE2 1 
ATOM 2829 N N   . ASN B 2 157 ? 89.370  49.084 -5.488  1.00 87.42  ? 157 ASN L N   1 
ATOM 2830 C CA  . ASN B 2 157 ? 88.062  48.660 -5.967  1.00 87.42  ? 157 ASN L CA  1 
ATOM 2831 C C   . ASN B 2 157 ? 87.557  47.448 -5.176  1.00 87.42  ? 157 ASN L C   1 
ATOM 2832 O O   . ASN B 2 157 ? 88.169  46.379 -5.193  1.00 87.42  ? 157 ASN L O   1 
ATOM 2833 C CB  . ASN B 2 157 ? 88.150  48.323 -7.465  1.00 129.77 ? 157 ASN L CB  1 
ATOM 2834 C CG  . ASN B 2 157 ? 86.809  47.905 -8.066  1.00 129.77 ? 157 ASN L CG  1 
ATOM 2835 O OD1 . ASN B 2 157 ? 86.627  47.954 -9.283  1.00 129.77 ? 157 ASN L OD1 1 
ATOM 2836 N ND2 . ASN B 2 157 ? 85.874  47.479 -7.222  1.00 129.77 ? 157 ASN L ND2 1 
ATOM 2837 N N   . GLY B 2 158 ? 86.442  47.635 -4.475  1.00 102.36 ? 158 GLY L N   1 
ATOM 2838 C CA  . GLY B 2 158 ? 85.852  46.552 -3.713  1.00 102.36 ? 158 GLY L CA  1 
ATOM 2839 C C   . GLY B 2 158 ? 86.566  46.233 -2.419  1.00 102.36 ? 158 GLY L C   1 
ATOM 2840 O O   . GLY B 2 158 ? 86.678  45.069 -2.023  1.00 102.36 ? 158 GLY L O   1 
ATOM 2841 N N   . VAL B 2 159 ? 87.056  47.272 -1.756  1.00 63.25  ? 159 VAL L N   1 
ATOM 2842 C CA  . VAL B 2 159 ? 87.747  47.092 -0.487  1.00 63.25  ? 159 VAL L CA  1 
ATOM 2843 C C   . VAL B 2 159 ? 86.784  47.456 0.640   1.00 63.25  ? 159 VAL L C   1 
ATOM 2844 O O   . VAL B 2 159 ? 86.120  48.494 0.598   1.00 63.25  ? 159 VAL L O   1 
ATOM 2845 C CB  . VAL B 2 159 ? 89.018  47.979 -0.412  1.00 64.75  ? 159 VAL L CB  1 
ATOM 2846 C CG1 . VAL B 2 159 ? 89.791  47.684 0.851   1.00 64.75  ? 159 VAL L CG1 1 
ATOM 2847 C CG2 . VAL B 2 159 ? 89.894  47.735 -1.620  1.00 64.75  ? 159 VAL L CG2 1 
ATOM 2848 N N   . LEU B 2 160 ? 86.687  46.583 1.635   1.00 57.83  ? 160 LEU L N   1 
ATOM 2849 C CA  . LEU B 2 160 ? 85.789  46.814 2.771   1.00 57.83  ? 160 LEU L CA  1 
ATOM 2850 C C   . LEU B 2 160 ? 86.566  47.259 4.016   1.00 57.83  ? 160 LEU L C   1 
ATOM 2851 O O   . LEU B 2 160 ? 87.188  46.454 4.717   1.00 57.83  ? 160 LEU L O   1 
ATOM 2852 C CB  . LEU B 2 160 ? 84.978  45.543 3.066   1.00 71.91  ? 160 LEU L CB  1 
ATOM 2853 C CG  . LEU B 2 160 ? 84.020  45.523 4.262   1.00 71.91  ? 160 LEU L CG  1 
ATOM 2854 C CD1 . LEU B 2 160 ? 83.099  44.318 4.148   1.00 71.91  ? 160 LEU L CD1 1 
ATOM 2855 C CD2 . LEU B 2 160 ? 84.798  45.474 5.567   1.00 71.91  ? 160 LEU L CD2 1 
ATOM 2856 N N   . ASN B 2 161 ? 86.517  48.558 4.279   1.00 52.25  ? 161 ASN L N   1 
ATOM 2857 C CA  . ASN B 2 161 ? 87.223  49.116 5.406   1.00 52.25  ? 161 ASN L CA  1 
ATOM 2858 C C   . ASN B 2 161 ? 86.320  49.358 6.592   1.00 52.25  ? 161 ASN L C   1 
ATOM 2859 O O   . ASN B 2 161 ? 85.099  49.446 6.469   1.00 52.25  ? 161 ASN L O   1 
ATOM 2860 C CB  . ASN B 2 161 ? 87.951  50.414 5.006   1.00 97.81  ? 161 ASN L CB  1 
ATOM 2861 C CG  . ASN B 2 161 ? 89.065  50.178 3.990   1.00 97.81  ? 161 ASN L CG  1 
ATOM 2862 O OD1 . ASN B 2 161 ? 89.878  51.060 3.720   1.00 97.81  ? 161 ASN L OD1 1 
ATOM 2863 N ND2 . ASN B 2 161 ? 89.101  48.982 3.426   1.00 97.81  ? 161 ASN L ND2 1 
ATOM 2864 N N   . SER B 2 162 ? 86.959  49.467 7.748   1.00 44.82  ? 162 SER L N   1 
ATOM 2865 C CA  . SER B 2 162 ? 86.279  49.664 9.010   1.00 44.82  ? 162 SER L CA  1 
ATOM 2866 C C   . SER B 2 162 ? 87.379  49.937 10.046  1.00 44.82  ? 162 SER L C   1 
ATOM 2867 O O   . SER B 2 162 ? 88.430  49.257 10.061  1.00 44.82  ? 162 SER L O   1 
ATOM 2868 C CB  . SER B 2 162 ? 85.509  48.397 9.371   1.00 66.65  ? 162 SER L CB  1 
ATOM 2869 O OG  . SER B 2 162 ? 84.938  48.502 10.651  1.00 66.65  ? 162 SER L OG  1 
ATOM 2870 N N   . TRP B 2 163 ? 87.141  50.946 10.888  1.00 66.61  ? 163 TRP L N   1 
ATOM 2871 C CA  . TRP B 2 163 ? 88.076  51.347 11.935  1.00 66.61  ? 163 TRP L CA  1 
ATOM 2872 C C   . TRP B 2 163 ? 87.362  51.143 13.258  1.00 66.61  ? 163 TRP L C   1 
ATOM 2873 O O   . TRP B 2 163 ? 86.136  51.079 13.298  1.00 66.61  ? 163 TRP L O   1 
ATOM 2874 C CB  . TRP B 2 163 ? 88.416  52.831 11.795  1.00 65.86  ? 163 TRP L CB  1 
ATOM 2875 C CG  . TRP B 2 163 ? 88.760  53.225 10.436  1.00 65.86  ? 163 TRP L CG  1 
ATOM 2876 C CD1 . TRP B 2 163 ? 90.004  53.278 9.897   1.00 65.86  ? 163 TRP L CD1 1 
ATOM 2877 C CD2 . TRP B 2 163 ? 87.849  53.502 9.371   1.00 65.86  ? 163 TRP L CD2 1 
ATOM 2878 N NE1 . TRP B 2 163 ? 89.934  53.559 8.548   1.00 65.86  ? 163 TRP L NE1 1 
ATOM 2879 C CE2 . TRP B 2 163 ? 88.621  53.699 8.199   1.00 65.86  ? 163 TRP L CE2 1 
ATOM 2880 C CE3 . TRP B 2 163 ? 86.459  53.597 9.288   1.00 65.86  ? 163 TRP L CE3 1 
ATOM 2881 C CZ2 . TRP B 2 163 ? 88.051  53.983 6.960   1.00 65.86  ? 163 TRP L CZ2 1 
ATOM 2882 C CZ3 . TRP B 2 163 ? 85.887  53.883 8.046   1.00 65.86  ? 163 TRP L CZ3 1 
ATOM 2883 C CH2 . TRP B 2 163 ? 86.692  54.069 6.899   1.00 65.86  ? 163 TRP L CH2 1 
ATOM 2884 N N   . THR B 2 164 ? 88.112  51.060 14.348  1.00 82.65  ? 164 THR L N   1 
ATOM 2885 C CA  . THR B 2 164 ? 87.462  50.898 15.640  1.00 82.65  ? 164 THR L CA  1 
ATOM 2886 C C   . THR B 2 164 ? 87.558  52.184 16.447  1.00 82.65  ? 164 THR L C   1 
ATOM 2887 O O   . THR B 2 164 ? 88.378  53.063 16.143  1.00 82.65  ? 164 THR L O   1 
ATOM 2888 C CB  . THR B 2 164 ? 88.087  49.752 16.496  1.00 54.68  ? 164 THR L CB  1 
ATOM 2889 O OG1 . THR B 2 164 ? 89.295  50.211 17.127  1.00 54.68  ? 164 THR L OG1 1 
ATOM 2890 C CG2 . THR B 2 164 ? 88.369  48.531 15.630  1.00 54.68  ? 164 THR L CG2 1 
ATOM 2891 N N   . ASP B 2 165 ? 86.702  52.280 17.467  1.00 58.97  ? 165 ASP L N   1 
ATOM 2892 C CA  . ASP B 2 165 ? 86.678  53.420 18.368  1.00 58.97  ? 165 ASP L CA  1 
ATOM 2893 C C   . ASP B 2 165 ? 87.881  53.209 19.265  1.00 58.97  ? 165 ASP L C   1 
ATOM 2894 O O   . ASP B 2 165 ? 88.489  52.149 19.213  1.00 58.97  ? 165 ASP L O   1 
ATOM 2895 C CB  . ASP B 2 165 ? 85.365  53.439 19.154  1.00 131.71 ? 165 ASP L CB  1 
ATOM 2896 C CG  . ASP B 2 165 ? 84.186  53.914 18.303  1.00 131.71 ? 165 ASP L CG  1 
ATOM 2897 O OD1 . ASP B 2 165 ? 84.155  55.110 17.943  1.00 131.71 ? 165 ASP L OD1 1 
ATOM 2898 O OD2 . ASP B 2 165 ? 83.296  53.097 17.984  1.00 131.71 ? 165 ASP L OD2 1 
ATOM 2899 N N   . GLN B 2 166 ? 88.248  54.209 20.057  1.00 83.20  ? 166 GLN L N   1 
ATOM 2900 C CA  . GLN B 2 166 ? 89.414  54.092 20.939  1.00 83.20  ? 166 GLN L CA  1 
ATOM 2901 C C   . GLN B 2 166 ? 89.414  52.819 21.803  1.00 83.20  ? 166 GLN L C   1 
ATOM 2902 O O   . GLN B 2 166 ? 88.455  52.549 22.529  1.00 83.20  ? 166 GLN L O   1 
ATOM 2903 C CB  . GLN B 2 166 ? 89.500  55.339 21.827  1.00 87.78  ? 166 GLN L CB  1 
ATOM 2904 C CG  . GLN B 2 166 ? 90.807  55.505 22.582  1.00 87.78  ? 166 GLN L CG  1 
ATOM 2905 C CD  . GLN B 2 166 ? 91.229  56.949 22.645  1.00 87.78  ? 166 GLN L CD  1 
ATOM 2906 O OE1 . GLN B 2 166 ? 90.392  57.837 22.764  1.00 87.78  ? 166 GLN L OE1 1 
ATOM 2907 N NE2 . GLN B 2 166 ? 92.530  57.195 22.565  1.00 87.78  ? 166 GLN L NE2 1 
ATOM 2908 N N   . ASP B 2 167 ? 90.489  52.037 21.708  1.00 85.08  ? 167 ASP L N   1 
ATOM 2909 C CA  . ASP B 2 167 ? 90.609  50.802 22.472  1.00 85.08  ? 167 ASP L CA  1 
ATOM 2910 C C   . ASP B 2 167 ? 90.618  51.120 23.943  1.00 85.08  ? 167 ASP L C   1 
ATOM 2911 O O   . ASP B 2 167 ? 90.927  52.243 24.330  1.00 85.08  ? 167 ASP L O   1 
ATOM 2912 C CB  . ASP B 2 167 ? 91.897  50.063 22.111  1.00 125.63 ? 167 ASP L CB  1 
ATOM 2913 C CG  . ASP B 2 167 ? 92.309  49.056 23.171  1.00 125.63 ? 167 ASP L CG  1 
ATOM 2914 O OD1 . ASP B 2 167 ? 91.482  48.192 23.528  1.00 125.63 ? 167 ASP L OD1 1 
ATOM 2915 O OD2 . ASP B 2 167 ? 93.462  49.131 23.646  1.00 125.63 ? 167 ASP L OD2 1 
ATOM 2916 N N   . SER B 2 168 ? 90.287  50.130 24.765  1.00 98.72  ? 168 SER L N   1 
ATOM 2917 C CA  . SER B 2 168 ? 90.260  50.324 26.209  1.00 98.72  ? 168 SER L CA  1 
ATOM 2918 C C   . SER B 2 168 ? 91.645  50.482 26.794  1.00 98.72  ? 168 SER L C   1 
ATOM 2919 O O   . SER B 2 168 ? 92.043  51.580 27.176  1.00 98.72  ? 168 SER L O   1 
ATOM 2920 C CB  . SER B 2 168 ? 89.577  49.150 26.900  1.00 84.76  ? 168 SER L CB  1 
ATOM 2921 O OG  . SER B 2 168 ? 88.217  49.073 26.527  1.00 84.76  ? 168 SER L OG  1 
ATOM 2922 N N   . LYS B 2 169 ? 92.384  49.383 26.867  1.00 78.67  ? 169 LYS L N   1 
ATOM 2923 C CA  . LYS B 2 169 ? 93.716  49.447 27.444  1.00 78.67  ? 169 LYS L CA  1 
ATOM 2924 C C   . LYS B 2 169 ? 94.589  50.403 26.647  1.00 78.67  ? 169 LYS L C   1 
ATOM 2925 O O   . LYS B 2 169 ? 94.793  51.552 27.038  1.00 78.67  ? 169 LYS L O   1 
ATOM 2926 C CB  . LYS B 2 169 ? 94.385  48.062 27.481  1.00 126.61 ? 169 LYS L CB  1 
ATOM 2927 C CG  . LYS B 2 169 ? 93.457  46.905 27.801  1.00 126.61 ? 169 LYS L CG  1 
ATOM 2928 C CD  . LYS B 2 169 ? 92.560  46.616 26.602  1.00 126.61 ? 169 LYS L CD  1 
ATOM 2929 C CE  . LYS B 2 169 ? 91.481  45.593 26.927  1.00 126.61 ? 169 LYS L CE  1 
ATOM 2930 N NZ  . LYS B 2 169 ? 90.530  45.418 25.786  1.00 126.61 ? 169 LYS L NZ  1 
ATOM 2931 N N   . ASP B 2 170 ? 95.079  49.928 25.510  1.00 104.55 ? 170 ASP L N   1 
ATOM 2932 C CA  . ASP B 2 170 ? 95.967  50.710 24.669  1.00 104.55 ? 170 ASP L CA  1 
ATOM 2933 C C   . ASP B 2 170 ? 95.474  52.084 24.220  1.00 104.55 ? 170 ASP L C   1 
ATOM 2934 O O   . ASP B 2 170 ? 96.263  52.886 23.719  1.00 104.55 ? 170 ASP L O   1 
ATOM 2935 C CB  . ASP B 2 170 ? 96.366  49.885 23.451  1.00 144.36 ? 170 ASP L CB  1 
ATOM 2936 C CG  . ASP B 2 170 ? 97.681  50.329 22.872  1.00 144.36 ? 170 ASP L CG  1 
ATOM 2937 O OD1 . ASP B 2 170 ? 98.661  50.428 23.643  1.00 144.36 ? 170 ASP L OD1 1 
ATOM 2938 O OD2 . ASP B 2 170 ? 97.741  50.582 21.653  1.00 144.36 ? 170 ASP L OD2 1 
ATOM 2939 N N   . SER B 2 171 ? 94.186  52.359 24.409  1.00 71.17  ? 171 SER L N   1 
ATOM 2940 C CA  . SER B 2 171 ? 93.612  53.640 24.010  1.00 71.17  ? 171 SER L CA  1 
ATOM 2941 C C   . SER B 2 171 ? 94.271  54.111 22.718  1.00 71.17  ? 171 SER L C   1 
ATOM 2942 O O   . SER B 2 171 ? 94.766  55.236 22.606  1.00 71.17  ? 171 SER L O   1 
ATOM 2943 C CB  . SER B 2 171 ? 93.796  54.666 25.126  1.00 64.75  ? 171 SER L CB  1 
ATOM 2944 O OG  . SER B 2 171 ? 95.152  54.736 25.520  1.00 64.75  ? 171 SER L OG  1 
ATOM 2945 N N   . THR B 2 172 ? 94.267  53.205 21.747  1.00 86.28  ? 172 THR L N   1 
ATOM 2946 C CA  . THR B 2 172 ? 94.841  53.435 20.431  1.00 86.28  ? 172 THR L CA  1 
ATOM 2947 C C   . THR B 2 172 ? 93.804  53.082 19.342  1.00 86.28  ? 172 THR L C   1 
ATOM 2948 O O   . THR B 2 172 ? 92.719  52.569 19.637  1.00 86.28  ? 172 THR L O   1 
ATOM 2949 C CB  . THR B 2 172 ? 96.075  52.560 20.241  1.00 58.48  ? 172 THR L CB  1 
ATOM 2950 O OG1 . THR B 2 172 ? 96.744  52.940 19.040  1.00 58.48  ? 172 THR L OG1 1 
ATOM 2951 C CG2 . THR B 2 172 ? 95.675  51.095 20.166  1.00 58.48  ? 172 THR L CG2 1 
ATOM 2952 N N   . TYR B 2 173 ? 94.126  53.356 18.084  1.00 75.17  ? 173 TYR L N   1 
ATOM 2953 C CA  . TYR B 2 173 ? 93.191  53.053 17.015  1.00 75.17  ? 173 TYR L CA  1 
ATOM 2954 C C   . TYR B 2 173 ? 93.705  51.960 16.104  1.00 75.17  ? 173 TYR L C   1 
ATOM 2955 O O   . TYR B 2 173 ? 94.874  51.951 15.729  1.00 75.17  ? 173 TYR L O   1 
ATOM 2956 C CB  . TYR B 2 173 ? 92.888  54.307 16.204  1.00 69.37  ? 173 TYR L CB  1 
ATOM 2957 C CG  . TYR B 2 173 ? 92.261  55.415 17.019  1.00 69.37  ? 173 TYR L CG  1 
ATOM 2958 C CD1 . TYR B 2 173 ? 90.987  55.277 17.568  1.00 69.37  ? 173 TYR L CD1 1 
ATOM 2959 C CD2 . TYR B 2 173 ? 92.964  56.588 17.275  1.00 69.37  ? 173 TYR L CD2 1 
ATOM 2960 C CE1 . TYR B 2 173 ? 90.433  56.284 18.358  1.00 69.37  ? 173 TYR L CE1 1 
ATOM 2961 C CE2 . TYR B 2 173 ? 92.429  57.596 18.056  1.00 69.37  ? 173 TYR L CE2 1 
ATOM 2962 C CZ  . TYR B 2 173 ? 91.166  57.445 18.602  1.00 69.37  ? 173 TYR L CZ  1 
ATOM 2963 O OH  . TYR B 2 173 ? 90.665  58.450 19.410  1.00 69.37  ? 173 TYR L OH  1 
ATOM 2964 N N   . SER B 2 174 ? 92.814  51.031 15.768  1.00 69.60  ? 174 SER L N   1 
ATOM 2965 C CA  . SER B 2 174 ? 93.129  49.907 14.900  1.00 69.60  ? 174 SER L CA  1 
ATOM 2966 C C   . SER B 2 174 ? 92.127  49.885 13.752  1.00 69.60  ? 174 SER L C   1 
ATOM 2967 O O   . SER B 2 174 ? 90.940  50.166 13.943  1.00 69.60  ? 174 SER L O   1 
ATOM 2968 C CB  . SER B 2 174 ? 93.047  48.599 15.686  1.00 135.38 ? 174 SER L CB  1 
ATOM 2969 O OG  . SER B 2 174 ? 93.815  48.672 16.874  1.00 135.38 ? 174 SER L OG  1 
ATOM 2970 N N   . MET B 2 175 ? 92.616  49.556 12.559  1.00 75.51  ? 175 MET L N   1 
ATOM 2971 C CA  . MET B 2 175 ? 91.782  49.494 11.367  1.00 75.51  ? 175 MET L CA  1 
ATOM 2972 C C   . MET B 2 175 ? 91.887  48.170 10.624  1.00 75.51  ? 175 MET L C   1 
ATOM 2973 O O   . MET B 2 175 ? 92.937  47.513 10.631  1.00 75.51  ? 175 MET L O   1 
ATOM 2974 C CB  . MET B 2 175 ? 92.154  50.614 10.400  1.00 66.19  ? 175 MET L CB  1 
ATOM 2975 C CG  . MET B 2 175 ? 91.522  50.448 9.017   1.00 66.19  ? 175 MET L CG  1 
ATOM 2976 S SD  . MET B 2 175 ? 92.060  51.677 7.810   1.00 66.19  ? 175 MET L SD  1 
ATOM 2977 C CE  . MET B 2 175 ? 93.843  51.427 7.895   1.00 66.19  ? 175 MET L CE  1 
ATOM 2978 N N   . SER B 2 176 ? 90.783  47.801 9.974   1.00 63.97  ? 176 SER L N   1 
ATOM 2979 C CA  . SER B 2 176 ? 90.711  46.574 9.190   1.00 63.97  ? 176 SER L CA  1 
ATOM 2980 C C   . SER B 2 176 ? 90.270  46.852 7.761   1.00 63.97  ? 176 SER L C   1 
ATOM 2981 O O   . SER B 2 176 ? 89.187  47.382 7.537   1.00 63.97  ? 176 SER L O   1 
ATOM 2982 C CB  . SER B 2 176 ? 89.733  45.584 9.811   1.00 80.85  ? 176 SER L CB  1 
ATOM 2983 O OG  . SER B 2 176 ? 89.578  44.454 8.965   1.00 80.85  ? 176 SER L OG  1 
ATOM 2984 N N   . SER B 2 177 ? 91.120  46.490 6.804   1.00 96.21  ? 177 SER L N   1 
ATOM 2985 C CA  . SER B 2 177 ? 90.826  46.683 5.389   1.00 96.21  ? 177 SER L CA  1 
ATOM 2986 C C   . SER B 2 177 ? 90.830  45.347 4.683   1.00 96.21  ? 177 SER L C   1 
ATOM 2987 O O   . SER B 2 177 ? 91.809  44.605 4.719   1.00 96.21  ? 177 SER L O   1 
ATOM 2988 C CB  . SER B 2 177 ? 91.860  47.588 4.733   1.00 77.55  ? 177 SER L CB  1 
ATOM 2989 O OG  . SER B 2 177 ? 91.578  47.731 3.354   1.00 77.55  ? 177 SER L OG  1 
ATOM 2990 N N   . THR B 2 178 ? 89.727  45.054 4.018   1.00 69.67  ? 178 THR L N   1 
ATOM 2991 C CA  . THR B 2 178 ? 89.578  43.788 3.324   1.00 69.67  ? 178 THR L CA  1 
ATOM 2992 C C   . THR B 2 178 ? 89.267  44.028 1.860   1.00 69.67  ? 178 THR L C   1 
ATOM 2993 O O   . THR B 2 178 ? 88.399  44.845 1.538   1.00 69.67  ? 178 THR L O   1 
ATOM 2994 C CB  . THR B 2 178 ? 88.397  42.979 3.940   1.00 76.26  ? 178 THR L CB  1 
ATOM 2995 O OG1 . THR B 2 178 ? 88.695  42.648 5.300   1.00 76.26  ? 178 THR L OG1 1 
ATOM 2996 C CG2 . THR B 2 178 ? 88.131  41.705 3.148   1.00 76.26  ? 178 THR L CG2 1 
ATOM 2997 N N   . LEU B 2 179 ? 89.982  43.363 0.958   1.00 52.26  ? 179 LEU L N   1 
ATOM 2998 C CA  . LEU B 2 179 ? 89.606  43.534 -0.440  1.00 52.26  ? 179 LEU L CA  1 
ATOM 2999 C C   . LEU B 2 179 ? 89.041  42.207 -0.874  1.00 52.26  ? 179 LEU L C   1 
ATOM 3000 O O   . LEU B 2 179 ? 89.758  41.232 -0.996  1.00 52.26  ? 179 LEU L O   1 
ATOM 3001 C CB  . LEU B 2 179 ? 90.766  43.971 -1.336  1.00 75.04  ? 179 LEU L CB  1 
ATOM 3002 C CG  . LEU B 2 179 ? 91.965  43.081 -1.519  1.00 75.04  ? 179 LEU L CG  1 
ATOM 3003 C CD1 . LEU B 2 179 ? 92.949  43.776 -2.425  1.00 75.04  ? 179 LEU L CD1 1 
ATOM 3004 C CD2 . LEU B 2 179 ? 92.566  42.793 -0.171  1.00 75.04  ? 179 LEU L CD2 1 
ATOM 3005 N N   . THR B 2 180 ? 87.727  42.192 -1.059  1.00 63.59  ? 180 THR L N   1 
ATOM 3006 C CA  . THR B 2 180 ? 86.987  41.007 -1.434  1.00 63.59  ? 180 THR L CA  1 
ATOM 3007 C C   . THR B 2 180 ? 87.116  40.675 -2.901  1.00 63.59  ? 180 THR L C   1 
ATOM 3008 O O   . THR B 2 180 ? 86.851  41.503 -3.769  1.00 63.59  ? 180 THR L O   1 
ATOM 3009 C CB  . THR B 2 180 ? 85.501  41.179 -1.079  1.00 96.27  ? 180 THR L CB  1 
ATOM 3010 O OG1 . THR B 2 180 ? 84.963  42.307 -1.784  1.00 96.27  ? 180 THR L OG1 1 
ATOM 3011 C CG2 . THR B 2 180 ? 85.352  41.417 0.426   1.00 96.27  ? 180 THR L CG2 1 
ATOM 3012 N N   . LEU B 2 181 ? 87.490  39.435 -3.174  1.00 76.19  ? 181 LEU L N   1 
ATOM 3013 C CA  . LEU B 2 181 ? 87.669  38.999 -4.539  1.00 76.19  ? 181 LEU L CA  1 
ATOM 3014 C C   . LEU B 2 181 ? 87.001  37.671 -4.840  1.00 76.19  ? 181 LEU L C   1 
ATOM 3015 O O   . LEU B 2 181 ? 86.163  37.192 -4.084  1.00 76.19  ? 181 LEU L O   1 
ATOM 3016 C CB  . LEU B 2 181 ? 89.152  38.891 -4.808  1.00 37.48  ? 181 LEU L CB  1 
ATOM 3017 C CG  . LEU B 2 181 ? 89.893  40.223 -4.822  1.00 37.48  ? 181 LEU L CG  1 
ATOM 3018 C CD1 . LEU B 2 181 ? 91.428  40.010 -5.028  1.00 37.48  ? 181 LEU L CD1 1 
ATOM 3019 C CD2 . LEU B 2 181 ? 89.280  41.077 -5.943  1.00 37.48  ? 181 LEU L CD2 1 
ATOM 3020 N N   . THR B 2 182 ? 87.361  37.084 -5.970  1.00 90.75  ? 182 THR L N   1 
ATOM 3021 C CA  . THR B 2 182 ? 86.815  35.793 -6.322  1.00 90.75  ? 182 THR L CA  1 
ATOM 3022 C C   . THR B 2 182 ? 87.972  34.830 -6.362  1.00 90.75  ? 182 THR L C   1 
ATOM 3023 O O   . THR B 2 182 ? 89.134  35.234 -6.301  1.00 90.75  ? 182 THR L O   1 
ATOM 3024 C CB  . THR B 2 182 ? 86.179  35.775 -7.694  1.00 68.42  ? 182 THR L CB  1 
ATOM 3025 O OG1 . THR B 2 182 ? 85.432  36.981 -7.897  1.00 68.42  ? 182 THR L OG1 1 
ATOM 3026 C CG2 . THR B 2 182 ? 85.251  34.556 -7.809  1.00 68.42  ? 182 THR L CG2 1 
ATOM 3027 N N   . LYS B 2 183 ? 87.653  33.549 -6.454  1.00 67.64  ? 183 LYS L N   1 
ATOM 3028 C CA  . LYS B 2 183 ? 88.684  32.541 -6.509  1.00 67.64  ? 183 LYS L CA  1 
ATOM 3029 C C   . LYS B 2 183 ? 89.415  33.005 -7.750  1.00 67.64  ? 183 LYS L C   1 
ATOM 3030 O O   . LYS B 2 183 ? 90.617  33.244 -7.730  1.00 67.64  ? 183 LYS L O   1 
ATOM 3031 C CB  . LYS B 2 183 ? 88.034  31.166 -6.706  1.00 120.11 ? 183 LYS L CB  1 
ATOM 3032 C CG  . LYS B 2 183 ? 88.961  29.957 -6.631  1.00 120.11 ? 183 LYS L CG  1 
ATOM 3033 C CD  . LYS B 2 183 ? 88.154  28.674 -6.820  1.00 120.11 ? 183 LYS L CD  1 
ATOM 3034 C CE  . LYS B 2 183 ? 89.040  27.510 -7.182  1.00 120.11 ? 183 LYS L CE  1 
ATOM 3035 N NZ  . LYS B 2 183 ? 89.703  27.734 -8.490  1.00 120.11 ? 183 LYS L NZ  1 
ATOM 3036 N N   . ASP B 2 184 ? 88.658  33.204 -8.818  1.00 59.25  ? 184 ASP L N   1 
ATOM 3037 C CA  . ASP B 2 184 ? 89.245  33.642 -10.062 1.00 59.25  ? 184 ASP L CA  1 
ATOM 3038 C C   . ASP B 2 184 ? 89.966  34.975 -9.905  1.00 59.25  ? 184 ASP L C   1 
ATOM 3039 O O   . ASP B 2 184 ? 91.197  35.033 -10.033 1.00 59.25  ? 184 ASP L O   1 
ATOM 3040 C CB  . ASP B 2 184 ? 88.157  33.734 -11.103 1.00 150.04 ? 184 ASP L CB  1 
ATOM 3041 C CG  . ASP B 2 184 ? 87.313  32.500 -11.120 1.00 150.04 ? 184 ASP L CG  1 
ATOM 3042 O OD1 . ASP B 2 184 ? 87.924  31.406 -11.175 1.00 150.04 ? 184 ASP L OD1 1 
ATOM 3043 O OD2 . ASP B 2 184 ? 86.065  32.622 -11.061 1.00 150.04 ? 184 ASP L OD2 1 
ATOM 3044 N N   . GLU B 2 185 ? 89.205  36.039 -9.636  1.00 70.16  ? 185 GLU L N   1 
ATOM 3045 C CA  . GLU B 2 185 ? 89.774  37.374 -9.436  1.00 70.16  ? 185 GLU L CA  1 
ATOM 3046 C C   . GLU B 2 185 ? 91.166  37.197 -8.843  1.00 70.16  ? 185 GLU L C   1 
ATOM 3047 O O   . GLU B 2 185 ? 92.170  37.522 -9.459  1.00 70.16  ? 185 GLU L O   1 
ATOM 3048 C CB  . GLU B 2 185 ? 88.911  38.174 -8.454  1.00 186.34 ? 185 GLU L CB  1 
ATOM 3049 C CG  . GLU B 2 185 ? 87.497  38.440 -8.924  1.00 186.34 ? 185 GLU L CG  1 
ATOM 3050 C CD  . GLU B 2 185 ? 87.392  39.616 -9.869  1.00 186.34 ? 185 GLU L CD  1 
ATOM 3051 O OE1 . GLU B 2 185 ? 88.163  39.671 -10.851 1.00 186.34 ? 185 GLU L OE1 1 
ATOM 3052 O OE2 . GLU B 2 185 ? 86.526  40.485 -9.630  1.00 186.34 ? 185 GLU L OE2 1 
ATOM 3053 N N   . TYR B 2 186 ? 91.200  36.637 -7.646  1.00 60.77  ? 186 TYR L N   1 
ATOM 3054 C CA  . TYR B 2 186 ? 92.427  36.390 -6.917  1.00 60.77  ? 186 TYR L CA  1 
ATOM 3055 C C   . TYR B 2 186 ? 93.478  35.547 -7.637  1.00 60.77  ? 186 TYR L C   1 
ATOM 3056 O O   . TYR B 2 186 ? 94.674  35.835 -7.554  1.00 60.77  ? 186 TYR L O   1 
ATOM 3057 C CB  . TYR B 2 186 ? 92.080  35.724 -5.597  1.00 60.64  ? 186 TYR L CB  1 
ATOM 3058 C CG  . TYR B 2 186 ? 93.268  35.316 -4.790  1.00 60.64  ? 186 TYR L CG  1 
ATOM 3059 C CD1 . TYR B 2 186 ? 94.254  36.226 -4.468  1.00 60.64  ? 186 TYR L CD1 1 
ATOM 3060 C CD2 . TYR B 2 186 ? 93.361  34.047 -4.278  1.00 60.64  ? 186 TYR L CD2 1 
ATOM 3061 C CE1 . TYR B 2 186 ? 95.305  35.882 -3.636  1.00 60.64  ? 186 TYR L CE1 1 
ATOM 3062 C CE2 . TYR B 2 186 ? 94.400  33.687 -3.447  1.00 60.64  ? 186 TYR L CE2 1 
ATOM 3063 C CZ  . TYR B 2 186 ? 95.373  34.609 -3.121  1.00 60.64  ? 186 TYR L CZ  1 
ATOM 3064 O OH  . TYR B 2 186 ? 96.391  34.257 -2.255  1.00 60.64  ? 186 TYR L OH  1 
ATOM 3065 N N   . GLU B 2 187 ? 93.047  34.503 -8.334  1.00 102.53 ? 187 GLU L N   1 
ATOM 3066 C CA  . GLU B 2 187 ? 93.993  33.637 -9.026  1.00 102.53 ? 187 GLU L CA  1 
ATOM 3067 C C   . GLU B 2 187 ? 94.751  34.302 -10.167 1.00 102.53 ? 187 GLU L C   1 
ATOM 3068 O O   . GLU B 2 187 ? 95.776  33.780 -10.619 1.00 102.53 ? 187 GLU L O   1 
ATOM 3069 C CB  . GLU B 2 187 ? 93.279  32.400 -9.568  1.00 127.15 ? 187 GLU L CB  1 
ATOM 3070 C CG  . GLU B 2 187 ? 92.889  31.384 -8.513  1.00 127.15 ? 187 GLU L CG  1 
ATOM 3071 C CD  . GLU B 2 187 ? 94.088  30.775 -7.798  1.00 127.15 ? 187 GLU L CD  1 
ATOM 3072 O OE1 . GLU B 2 187 ? 94.947  30.163 -8.471  1.00 127.15 ? 187 GLU L OE1 1 
ATOM 3073 O OE2 . GLU B 2 187 ? 94.171  30.903 -6.557  1.00 127.15 ? 187 GLU L OE2 1 
ATOM 3074 N N   . ARG B 2 188 ? 94.262  35.453 -10.624 1.00 67.36  ? 188 ARG L N   1 
ATOM 3075 C CA  . ARG B 2 188 ? 94.887  36.141 -11.743 1.00 67.36  ? 188 ARG L CA  1 
ATOM 3076 C C   . ARG B 2 188 ? 96.097  37.015 -11.426 1.00 67.36  ? 188 ARG L C   1 
ATOM 3077 O O   . ARG B 2 188 ? 96.677  37.622 -12.332 1.00 67.36  ? 188 ARG L O   1 
ATOM 3078 C CB  . ARG B 2 188 ? 93.835  36.960 -12.486 1.00 122.96 ? 188 ARG L CB  1 
ATOM 3079 C CG  . ARG B 2 188 ? 92.754  36.101 -13.125 1.00 122.96 ? 188 ARG L CG  1 
ATOM 3080 C CD  . ARG B 2 188 ? 91.926  36.891 -14.130 1.00 122.96 ? 188 ARG L CD  1 
ATOM 3081 N NE  . ARG B 2 188 ? 91.272  38.036 -13.504 1.00 122.96 ? 188 ARG L NE  1 
ATOM 3082 C CZ  . ARG B 2 188 ? 90.613  38.985 -14.163 1.00 122.96 ? 188 ARG L CZ  1 
ATOM 3083 N NH1 . ARG B 2 188 ? 90.515  38.935 -15.486 1.00 122.96 ? 188 ARG L NH1 1 
ATOM 3084 N NH2 . ARG B 2 188 ? 90.058  39.990 -13.493 1.00 122.96 ? 188 ARG L NH2 1 
ATOM 3085 N N   . HIS B 2 189 ? 96.495  37.066 -10.156 1.00 74.49  ? 189 HIS L N   1 
ATOM 3086 C CA  . HIS B 2 189 ? 97.633  37.891 -9.748  1.00 74.49  ? 189 HIS L CA  1 
ATOM 3087 C C   . HIS B 2 189 ? 98.490  37.213 -8.707  1.00 74.49  ? 189 HIS L C   1 
ATOM 3088 O O   . HIS B 2 189 ? 97.992  36.460 -7.874  1.00 74.49  ? 189 HIS L O   1 
ATOM 3089 C CB  . HIS B 2 189 ? 97.141  39.232 -9.205  1.00 91.63  ? 189 HIS L CB  1 
ATOM 3090 C CG  . HIS B 2 189 ? 96.453  40.076 -10.232 1.00 91.63  ? 189 HIS L CG  1 
ATOM 3091 N ND1 . HIS B 2 189 ? 97.115  40.608 -11.320 1.00 91.63  ? 189 HIS L ND1 1 
ATOM 3092 C CD2 . HIS B 2 189 ? 95.153  40.424 -10.372 1.00 91.63  ? 189 HIS L CD2 1 
ATOM 3093 C CE1 . HIS B 2 189 ? 96.250  41.244 -12.088 1.00 91.63  ? 189 HIS L CE1 1 
ATOM 3094 N NE2 . HIS B 2 189 ? 95.053  41.146 -11.536 1.00 91.63  ? 189 HIS L NE2 1 
ATOM 3095 N N   . ASN B 2 190 ? 99.782  37.505 -8.734  1.00 68.93  ? 190 ASN L N   1 
ATOM 3096 C CA  . ASN B 2 190 ? 100.706 36.883 -7.800  1.00 68.93  ? 190 ASN L CA  1 
ATOM 3097 C C   . ASN B 2 190 ? 101.049 37.716 -6.574  1.00 68.93  ? 190 ASN L C   1 
ATOM 3098 O O   . ASN B 2 190 ? 100.851 37.266 -5.447  1.00 68.93  ? 190 ASN L O   1 
ATOM 3099 C CB  . ASN B 2 190 ? 101.978 36.485 -8.540  1.00 100.52 ? 190 ASN L CB  1 
ATOM 3100 C CG  . ASN B 2 190 ? 101.696 35.553 -9.701  1.00 100.52 ? 190 ASN L CG  1 
ATOM 3101 O OD1 . ASN B 2 190 ? 102.529 34.717 -10.054 1.00 100.52 ? 190 ASN L OD1 1 
ATOM 3102 N ND2 . ASN B 2 190 ? 100.519 35.695 -10.309 1.00 100.52 ? 190 ASN L ND2 1 
ATOM 3103 N N   . SER B 2 191 ? 101.554 38.926 -6.788  1.00 91.32  ? 191 SER L N   1 
ATOM 3104 C CA  . SER B 2 191 ? 101.923 39.807 -5.684  1.00 91.32  ? 191 SER L CA  1 
ATOM 3105 C C   . SER B 2 191 ? 100.734 40.514 -4.990  1.00 91.32  ? 191 SER L C   1 
ATOM 3106 O O   . SER B 2 191 ? 99.792  40.981 -5.639  1.00 91.32  ? 191 SER L O   1 
ATOM 3107 C CB  . SER B 2 191 ? 102.922 40.842 -6.191  1.00 104.38 ? 191 SER L CB  1 
ATOM 3108 O OG  . SER B 2 191 ? 103.256 41.757 -5.168  1.00 104.38 ? 191 SER L OG  1 
ATOM 3109 N N   . TYR B 2 192 ? 100.779 40.599 -3.665  1.00 74.28  ? 192 TYR L N   1 
ATOM 3110 C CA  . TYR B 2 192 ? 99.711  41.256 -2.921  1.00 74.28  ? 192 TYR L CA  1 
ATOM 3111 C C   . TYR B 2 192 ? 100.262 42.032 -1.739  1.00 74.28  ? 192 TYR L C   1 
ATOM 3112 O O   . TYR B 2 192 ? 100.693 41.446 -0.751  1.00 74.28  ? 192 TYR L O   1 
ATOM 3113 C CB  . TYR B 2 192 ? 98.717  40.215 -2.444  1.00 44.37  ? 192 TYR L CB  1 
ATOM 3114 C CG  . TYR B 2 192 ? 97.711  39.843 -3.488  1.00 44.37  ? 192 TYR L CG  1 
ATOM 3115 C CD1 . TYR B 2 192 ? 96.559  40.590 -3.658  1.00 44.37  ? 192 TYR L CD1 1 
ATOM 3116 C CD2 . TYR B 2 192 ? 97.915  38.757 -4.324  1.00 44.37  ? 192 TYR L CD2 1 
ATOM 3117 C CE1 . TYR B 2 192 ? 95.620  40.271 -4.635  1.00 44.37  ? 192 TYR L CE1 1 
ATOM 3118 C CE2 . TYR B 2 192 ? 96.987  38.422 -5.316  1.00 44.37  ? 192 TYR L CE2 1 
ATOM 3119 C CZ  . TYR B 2 192 ? 95.835  39.185 -5.469  1.00 44.37  ? 192 TYR L CZ  1 
ATOM 3120 O OH  . TYR B 2 192 ? 94.901  38.871 -6.454  1.00 44.37  ? 192 TYR L OH  1 
ATOM 3121 N N   . THR B 2 193 ? 100.238 43.355 -1.828  1.00 78.48  ? 193 THR L N   1 
ATOM 3122 C CA  . THR B 2 193 ? 100.780 44.176 -0.754  1.00 78.48  ? 193 THR L CA  1 
ATOM 3123 C C   . THR B 2 193 ? 99.755  45.053 -0.055  1.00 78.48  ? 193 THR L C   1 
ATOM 3124 O O   . THR B 2 193 ? 98.714  45.401 -0.612  1.00 78.48  ? 193 THR L O   1 
ATOM 3125 C CB  . THR B 2 193 ? 101.906 45.093 -1.275  1.00 82.75  ? 193 THR L CB  1 
ATOM 3126 O OG1 . THR B 2 193 ? 102.376 44.606 -2.536  1.00 82.75  ? 193 THR L OG1 1 
ATOM 3127 C CG2 . THR B 2 193 ? 103.069 45.109 -0.309  1.00 82.75  ? 193 THR L CG2 1 
ATOM 3128 N N   . CYS B 2 194 ? 100.067 45.402 1.185   1.00 86.28  ? 194 CYS L N   1 
ATOM 3129 C CA  . CYS B 2 194 ? 99.211  46.257 1.983   1.00 86.28  ? 194 CYS L CA  1 
ATOM 3130 C C   . CYS B 2 194 ? 100.142 47.325 2.538   1.00 86.28  ? 194 CYS L C   1 
ATOM 3131 O O   . CYS B 2 194 ? 100.999 47.027 3.369   1.00 86.28  ? 194 CYS L O   1 
ATOM 3132 C CB  . CYS B 2 194 ? 98.572  45.453 3.123   1.00 97.68  ? 194 CYS L CB  1 
ATOM 3133 S SG  . CYS B 2 194 ? 97.320  46.367 4.086   1.00 97.68  ? 194 CYS L SG  1 
ATOM 3134 N N   . GLU B 2 195 ? 100.002 48.557 2.053   1.00 114.91 ? 195 GLU L N   1 
ATOM 3135 C CA  . GLU B 2 195 ? 100.841 49.658 2.520   1.00 114.91 ? 195 GLU L CA  1 
ATOM 3136 C C   . GLU B 2 195 ? 100.025 50.626 3.359   1.00 114.91 ? 195 GLU L C   1 
ATOM 3137 O O   . GLU B 2 195 ? 98.980  51.109 2.928   1.00 114.91 ? 195 GLU L O   1 
ATOM 3138 C CB  . GLU B 2 195 ? 101.454 50.414 1.341   1.00 136.77 ? 195 GLU L CB  1 
ATOM 3139 C CG  . GLU B 2 195 ? 102.426 49.604 0.509   1.00 136.77 ? 195 GLU L CG  1 
ATOM 3140 C CD  . GLU B 2 195 ? 103.020 50.414 -0.626  1.00 136.77 ? 195 GLU L CD  1 
ATOM 3141 O OE1 . GLU B 2 195 ? 103.899 49.896 -1.353  1.00 136.77 ? 195 GLU L OE1 1 
ATOM 3142 O OE2 . GLU B 2 195 ? 102.602 51.577 -0.788  1.00 136.77 ? 195 GLU L OE2 1 
ATOM 3143 N N   . ALA B 2 196 ? 100.505 50.906 4.562   1.00 78.37  ? 196 ALA L N   1 
ATOM 3144 C CA  . ALA B 2 196 ? 99.812  51.824 5.455   1.00 78.37  ? 196 ALA L CA  1 
ATOM 3145 C C   . ALA B 2 196 ? 100.686 53.032 5.731   1.00 78.37  ? 196 ALA L C   1 
ATOM 3146 O O   . ALA B 2 196 ? 101.838 52.885 6.144   1.00 78.37  ? 196 ALA L O   1 
ATOM 3147 C CB  . ALA B 2 196 ? 99.480  51.136 6.756   1.00 59.06  ? 196 ALA L CB  1 
ATOM 3148 N N   . THR B 2 197 ? 100.138 54.221 5.492   1.00 95.99  ? 197 THR L N   1 
ATOM 3149 C CA  . THR B 2 197 ? 100.857 55.467 5.729   1.00 95.99  ? 197 THR L CA  1 
ATOM 3150 C C   . THR B 2 197 ? 100.209 56.217 6.891   1.00 95.99  ? 197 THR L C   1 
ATOM 3151 O O   . THR B 2 197 ? 99.072  56.678 6.794   1.00 95.99  ? 197 THR L O   1 
ATOM 3152 C CB  . THR B 2 197 ? 100.861 56.353 4.476   1.00 101.45 ? 197 THR L CB  1 
ATOM 3153 O OG1 . THR B 2 197 ? 99.535  56.436 3.949   1.00 101.45 ? 197 THR L OG1 1 
ATOM 3154 C CG2 . THR B 2 197 ? 101.767 55.774 3.419   1.00 101.45 ? 197 THR L CG2 1 
ATOM 3155 N N   . HIS B 2 198 ? 100.955 56.322 7.988   1.00 105.79 ? 198 HIS L N   1 
ATOM 3156 C CA  . HIS B 2 198 ? 100.505 56.981 9.205   1.00 105.79 ? 198 HIS L CA  1 
ATOM 3157 C C   . HIS B 2 198 ? 101.517 57.989 9.711   1.00 105.79 ? 198 HIS L C   1 
ATOM 3158 O O   . HIS B 2 198 ? 102.702 57.693 9.772   1.00 105.79 ? 198 HIS L O   1 
ATOM 3159 C CB  . HIS B 2 198 ? 100.290 55.946 10.290  1.00 79.32  ? 198 HIS L CB  1 
ATOM 3160 C CG  . HIS B 2 198 ? 99.930  56.529 11.618  1.00 79.32  ? 198 HIS L CG  1 
ATOM 3161 N ND1 . HIS B 2 198 ? 98.781  57.263 11.820  1.00 79.32  ? 198 HIS L ND1 1 
ATOM 3162 C CD2 . HIS B 2 198 ? 100.553 56.466 12.818  1.00 79.32  ? 198 HIS L CD2 1 
ATOM 3163 C CE1 . HIS B 2 198 ? 98.711  57.625 13.088  1.00 79.32  ? 198 HIS L CE1 1 
ATOM 3164 N NE2 . HIS B 2 198 ? 99.774  57.154 13.716  1.00 79.32  ? 198 HIS L NE2 1 
ATOM 3165 N N   . LYS B 2 199 ? 101.035 59.169 10.088  1.00 70.02  ? 199 LYS L N   1 
ATOM 3166 C CA  . LYS B 2 199 ? 101.875 60.245 10.616  1.00 70.02  ? 199 LYS L CA  1 
ATOM 3167 C C   . LYS B 2 199 ? 103.107 59.692 11.340  1.00 70.02  ? 199 LYS L C   1 
ATOM 3168 O O   . LYS B 2 199 ? 104.215 60.186 11.173  1.00 70.02  ? 199 LYS L O   1 
ATOM 3169 C CB  . LYS B 2 199 ? 101.051 61.113 11.573  1.00 83.08  ? 199 LYS L CB  1 
ATOM 3170 C CG  . LYS B 2 199 ? 101.855 62.165 12.297  1.00 83.08  ? 199 LYS L CG  1 
ATOM 3171 C CD  . LYS B 2 199 ? 101.089 62.729 13.477  1.00 83.08  ? 199 LYS L CD  1 
ATOM 3172 C CE  . LYS B 2 199 ? 102.007 63.513 14.404  1.00 83.08  ? 199 LYS L CE  1 
ATOM 3173 N NZ  . LYS B 2 199 ? 101.385 63.751 15.733  1.00 83.08  ? 199 LYS L NZ  1 
ATOM 3174 N N   . THR B 2 200 ? 102.905 58.657 12.139  1.00 86.41  ? 200 THR L N   1 
ATOM 3175 C CA  . THR B 2 200 ? 104.002 58.041 12.860  1.00 86.41  ? 200 THR L CA  1 
ATOM 3176 C C   . THR B 2 200 ? 105.323 58.143 12.073  1.00 86.41  ? 200 THR L C   1 
ATOM 3177 O O   . THR B 2 200 ? 106.336 58.594 12.602  1.00 86.41  ? 200 THR L O   1 
ATOM 3178 C CB  . THR B 2 200 ? 103.671 56.569 13.152  1.00 151.26 ? 200 THR L CB  1 
ATOM 3179 O OG1 . THR B 2 200 ? 104.744 55.973 13.886  1.00 151.26 ? 200 THR L OG1 1 
ATOM 3180 C CG2 . THR B 2 200 ? 103.444 55.804 11.853  1.00 151.26 ? 200 THR L CG2 1 
ATOM 3181 N N   . SER B 2 201 ? 105.306 57.732 10.809  1.00 152.14 ? 201 SER L N   1 
ATOM 3182 C CA  . SER B 2 201 ? 106.498 57.793 9.963   1.00 152.14 ? 201 SER L CA  1 
ATOM 3183 C C   . SER B 2 201 ? 106.149 58.402 8.610   1.00 152.14 ? 201 SER L C   1 
ATOM 3184 O O   . SER B 2 201 ? 105.005 58.781 8.363   1.00 152.14 ? 201 SER L O   1 
ATOM 3185 C CB  . SER B 2 201 ? 107.088 56.391 9.747   1.00 94.50  ? 201 SER L CB  1 
ATOM 3186 O OG  . SER B 2 201 ? 108.222 56.426 8.883   1.00 94.50  ? 201 SER L OG  1 
ATOM 3187 N N   . THR B 2 202 ? 107.144 58.496 7.736   1.00 126.03 ? 202 THR L N   1 
ATOM 3188 C CA  . THR B 2 202 ? 106.938 59.045 6.404   1.00 126.03 ? 202 THR L CA  1 
ATOM 3189 C C   . THR B 2 202 ? 107.063 57.895 5.414   1.00 126.03 ? 202 THR L C   1 
ATOM 3190 O O   . THR B 2 202 ? 106.594 57.975 4.273   1.00 126.03 ? 202 THR L O   1 
ATOM 3191 C CB  . THR B 2 202 ? 107.987 60.117 6.075   1.00 103.04 ? 202 THR L CB  1 
ATOM 3192 O OG1 . THR B 2 202 ? 107.664 60.727 4.820   1.00 103.04 ? 202 THR L OG1 1 
ATOM 3193 C CG2 . THR B 2 202 ? 109.372 59.499 6.003   1.00 103.04 ? 202 THR L CG2 1 
ATOM 3194 N N   . SER B 2 203 ? 107.701 56.823 5.872   1.00 113.40 ? 203 SER L N   1 
ATOM 3195 C CA  . SER B 2 203 ? 107.894 55.626 5.065   1.00 113.40 ? 203 SER L CA  1 
ATOM 3196 C C   . SER B 2 203 ? 106.700 54.701 5.318   1.00 113.40 ? 203 SER L C   1 
ATOM 3197 O O   . SER B 2 203 ? 106.503 54.228 6.443   1.00 113.40 ? 203 SER L O   1 
ATOM 3198 C CB  . SER B 2 203 ? 109.186 54.916 5.487   1.00 129.65 ? 203 SER L CB  1 
ATOM 3199 O OG  . SER B 2 203 ? 110.218 55.843 5.773   1.00 129.65 ? 203 SER L OG  1 
ATOM 3200 N N   . PRO B 2 204 ? 105.886 54.432 4.280   1.00 72.09  ? 204 PRO L N   1 
ATOM 3201 C CA  . PRO B 2 204 ? 104.720 53.549 4.452   1.00 72.09  ? 204 PRO L CA  1 
ATOM 3202 C C   . PRO B 2 204 ? 105.099 52.221 5.123   1.00 72.09  ? 204 PRO L C   1 
ATOM 3203 O O   . PRO B 2 204 ? 106.113 51.626 4.773   1.00 72.09  ? 204 PRO L O   1 
ATOM 3204 C CB  . PRO B 2 204 ? 104.242 53.331 3.015   1.00 69.37  ? 204 PRO L CB  1 
ATOM 3205 C CG  . PRO B 2 204 ? 104.676 54.578 2.309   1.00 69.37  ? 204 PRO L CG  1 
ATOM 3206 C CD  . PRO B 2 204 ? 106.044 54.835 2.871   1.00 69.37  ? 204 PRO L CD  1 
ATOM 3207 N N   . ILE B 2 205 ? 104.330 51.758 6.100   1.00 81.75  ? 205 ILE L N   1 
ATOM 3208 C CA  . ILE B 2 205 ? 104.682 50.465 6.668   1.00 81.75  ? 205 ILE L CA  1 
ATOM 3209 C C   . ILE B 2 205 ? 104.103 49.521 5.634   1.00 81.75  ? 205 ILE L C   1 
ATOM 3210 O O   . ILE B 2 205 ? 102.993 49.748 5.141   1.00 81.75  ? 205 ILE L O   1 
ATOM 3211 C CB  . ILE B 2 205 ? 104.013 50.178 8.002   1.00 86.03  ? 205 ILE L CB  1 
ATOM 3212 C CG1 . ILE B 2 205 ? 104.367 51.251 9.024   1.00 86.03  ? 205 ILE L CG1 1 
ATOM 3213 C CG2 . ILE B 2 205 ? 104.493 48.838 8.508   1.00 86.03  ? 205 ILE L CG2 1 
ATOM 3214 C CD1 . ILE B 2 205 ? 103.815 50.967 10.410  1.00 86.03  ? 205 ILE L CD1 1 
ATOM 3215 N N   . VAL B 2 206 ? 104.836 48.469 5.291   1.00 119.93 ? 206 VAL L N   1 
ATOM 3216 C CA  . VAL B 2 206 ? 104.352 47.563 4.258   1.00 119.93 ? 206 VAL L CA  1 
ATOM 3217 C C   . VAL B 2 206 ? 104.419 46.079 4.560   1.00 119.93 ? 206 VAL L C   1 
ATOM 3218 O O   . VAL B 2 206 ? 105.271 45.626 5.317   1.00 119.93 ? 206 VAL L O   1 
ATOM 3219 C CB  . VAL B 2 206 ? 105.125 47.778 2.952   1.00 70.90  ? 206 VAL L CB  1 
ATOM 3220 C CG1 . VAL B 2 206 ? 104.426 47.081 1.832   1.00 70.90  ? 206 VAL L CG1 1 
ATOM 3221 C CG2 . VAL B 2 206 ? 105.250 49.243 2.651   1.00 70.90  ? 206 VAL L CG2 1 
ATOM 3222 N N   . LYS B 2 207 ? 103.509 45.333 3.940   1.00 68.55  ? 207 LYS L N   1 
ATOM 3223 C CA  . LYS B 2 207 ? 103.443 43.883 4.067   1.00 68.55  ? 207 LYS L CA  1 
ATOM 3224 C C   . LYS B 2 207 ? 102.963 43.314 2.735   1.00 68.55  ? 207 LYS L C   1 
ATOM 3225 O O   . LYS B 2 207 ? 102.035 43.848 2.124   1.00 68.55  ? 207 LYS L O   1 
ATOM 3226 C CB  . LYS B 2 207 ? 102.484 43.456 5.188   1.00 75.94  ? 207 LYS L CB  1 
ATOM 3227 C CG  . LYS B 2 207 ? 102.951 43.833 6.576   1.00 75.94  ? 207 LYS L CG  1 
ATOM 3228 C CD  . LYS B 2 207 ? 104.433 43.542 6.713   1.00 75.94  ? 207 LYS L CD  1 
ATOM 3229 C CE  . LYS B 2 207 ? 104.974 43.949 8.066   1.00 75.94  ? 207 LYS L CE  1 
ATOM 3230 N NZ  . LYS B 2 207 ? 104.443 43.033 9.131   1.00 75.94  ? 207 LYS L NZ  1 
ATOM 3231 N N   . SER B 2 208 ? 103.591 42.230 2.291   1.00 87.16  ? 208 SER L N   1 
ATOM 3232 C CA  . SER B 2 208 ? 103.230 41.604 1.022   1.00 87.16  ? 208 SER L CA  1 
ATOM 3233 C C   . SER B 2 208 ? 103.291 40.077 1.054   1.00 87.16  ? 208 SER L C   1 
ATOM 3234 O O   . SER B 2 208 ? 103.752 39.479 2.023   1.00 87.16  ? 208 SER L O   1 
ATOM 3235 C CB  . SER B 2 208 ? 104.159 42.118 -0.080  1.00 148.79 ? 208 SER L CB  1 
ATOM 3236 O OG  . SER B 2 208 ? 103.952 41.413 -1.289  1.00 148.79 ? 208 SER L OG  1 
ATOM 3237 N N   . PHE B 2 209 ? 102.823 39.447 -0.015  1.00 84.49  ? 209 PHE L N   1 
ATOM 3238 C CA  . PHE B 2 209 ? 102.850 37.993 -0.108  1.00 84.49  ? 209 PHE L CA  1 
ATOM 3239 C C   . PHE B 2 209 ? 102.577 37.534 -1.543  1.00 84.49  ? 209 PHE L C   1 
ATOM 3240 O O   . PHE B 2 209 ? 101.816 38.185 -2.268  1.00 84.49  ? 209 PHE L O   1 
ATOM 3241 C CB  . PHE B 2 209 ? 101.819 37.378 0.857   1.00 61.53  ? 209 PHE L CB  1 
ATOM 3242 C CG  . PHE B 2 209 ? 100.400 37.377 0.340   1.00 61.53  ? 209 PHE L CG  1 
ATOM 3243 C CD1 . PHE B 2 209 ? 100.033 36.604 -0.753  1.00 61.53  ? 209 PHE L CD1 1 
ATOM 3244 C CD2 . PHE B 2 209 ? 99.431  38.161 0.944   1.00 61.53  ? 209 PHE L CD2 1 
ATOM 3245 C CE1 . PHE B 2 209 ? 98.726  36.616 -1.239  1.00 61.53  ? 209 PHE L CE1 1 
ATOM 3246 C CE2 . PHE B 2 209 ? 98.113  38.181 0.463   1.00 61.53  ? 209 PHE L CE2 1 
ATOM 3247 C CZ  . PHE B 2 209 ? 97.763  37.409 -0.630  1.00 61.53  ? 209 PHE L CZ  1 
ATOM 3248 N N   . ASN B 2 210 ? 103.202 36.434 -1.965  1.00 80.34  ? 210 ASN L N   1 
ATOM 3249 C CA  . ASN B 2 210 ? 102.941 35.938 -3.308  1.00 80.34  ? 210 ASN L CA  1 
ATOM 3250 C C   . ASN B 2 210 ? 102.003 34.724 -3.274  1.00 80.34  ? 210 ASN L C   1 
ATOM 3251 O O   . ASN B 2 210 ? 101.958 33.977 -2.295  1.00 80.34  ? 210 ASN L O   1 
ATOM 3252 C CB  . ASN B 2 210 ? 104.229 35.590 -4.042  1.00 85.92  ? 210 ASN L CB  1 
ATOM 3253 C CG  . ASN B 2 210 ? 104.018 35.506 -5.548  1.00 85.92  ? 210 ASN L CG  1 
ATOM 3254 O OD1 . ASN B 2 210 ? 103.235 34.687 -6.035  1.00 85.92  ? 210 ASN L OD1 1 
ATOM 3255 N ND2 . ASN B 2 210 ? 104.707 36.364 -6.289  1.00 85.92  ? 210 ASN L ND2 1 
ATOM 3256 N N   . ARG B 2 211 ? 101.250 34.533 -4.347  1.00 92.78  ? 211 ARG L N   1 
ATOM 3257 C CA  . ARG B 2 211 ? 100.293 33.450 -4.397  1.00 92.78  ? 211 ARG L CA  1 
ATOM 3258 C C   . ARG B 2 211 ? 100.873 32.110 -4.837  1.00 92.78  ? 211 ARG L C   1 
ATOM 3259 O O   . ARG B 2 211 ? 100.149 31.115 -4.917  1.00 92.78  ? 211 ARG L O   1 
ATOM 3260 C CB  . ARG B 2 211 ? 99.135  33.852 -5.316  1.00 84.25  ? 211 ARG L CB  1 
ATOM 3261 C CG  . ARG B 2 211 ? 97.941  32.908 -5.284  1.00 84.25  ? 211 ARG L CG  1 
ATOM 3262 C CD  . ARG B 2 211 ? 96.849  33.366 -6.235  1.00 84.25  ? 211 ARG L CD  1 
ATOM 3263 N NE  . ARG B 2 211 ? 96.723  32.505 -7.407  1.00 84.25  ? 211 ARG L NE  1 
ATOM 3264 C CZ  . ARG B 2 211 ? 97.693  32.275 -8.289  1.00 84.25  ? 211 ARG L CZ  1 
ATOM 3265 N NH1 . ARG B 2 211 ? 98.885  32.842 -8.138  1.00 84.25  ? 211 ARG L NH1 1 
ATOM 3266 N NH2 . ARG B 2 211 ? 97.467  31.480 -9.333  1.00 84.25  ? 211 ARG L NH2 1 
ATOM 3267 N N   . ASN B 2 212 ? 102.172 32.053 -5.100  1.00 187.58 ? 212 ASN L N   1 
ATOM 3268 C CA  . ASN B 2 212 ? 102.751 30.797 -5.554  1.00 187.58 ? 212 ASN L CA  1 
ATOM 3269 C C   . ASN B 2 212 ? 103.441 29.945 -4.499  1.00 187.58 ? 212 ASN L C   1 
ATOM 3270 O O   . ASN B 2 212 ? 102.902 28.913 -4.099  1.00 187.58 ? 212 ASN L O   1 
ATOM 3271 C CB  . ASN B 2 212 ? 103.691 31.066 -6.721  1.00 121.45 ? 212 ASN L CB  1 
ATOM 3272 C CG  . ASN B 2 212 ? 102.973 31.707 -7.897  1.00 121.45 ? 212 ASN L CG  1 
ATOM 3273 O OD1 . ASN B 2 212 ? 102.000 31.158 -8.423  1.00 121.45 ? 212 ASN L OD1 1 
ATOM 3274 N ND2 . ASN B 2 212 ? 103.445 32.880 -8.310  1.00 121.45 ? 212 ASN L ND2 1 
ATOM 3275 N N   . GLU B 2 213 ? 104.624 30.355 -4.050  1.00 117.23 ? 213 GLU L N   1 
ATOM 3276 C CA  . GLU B 2 213 ? 105.331 29.575 -3.041  1.00 117.23 ? 213 GLU L CA  1 
ATOM 3277 C C   . GLU B 2 213 ? 104.337 29.255 -1.940  1.00 117.23 ? 213 GLU L C   1 
ATOM 3278 O O   . GLU B 2 213 ? 104.435 28.228 -1.267  1.00 117.23 ? 213 GLU L O   1 
ATOM 3279 C CB  . GLU B 2 213 ? 106.510 30.364 -2.470  1.00 185.35 ? 213 GLU L CB  1 
ATOM 3280 C CG  . GLU B 2 213 ? 107.432 29.538 -1.571  1.00 185.35 ? 213 GLU L CG  1 
ATOM 3281 C CD  . GLU B 2 213 ? 108.109 28.389 -2.306  1.00 185.35 ? 213 GLU L CD  1 
ATOM 3282 O OE1 . GLU B 2 213 ? 108.826 28.652 -3.294  1.00 185.35 ? 213 GLU L OE1 1 
ATOM 3283 O OE2 . GLU B 2 213 ? 107.929 27.222 -1.893  1.00 185.35 ? 213 GLU L OE2 1 
ATOM 3284 N N   . CYS B 2 214 ? 103.367 30.149 -1.785  1.00 171.61 ? 214 CYS L N   1 
ATOM 3285 C CA  . CYS B 2 214 ? 102.316 30.010 -0.790  1.00 171.61 ? 214 CYS L CA  1 
ATOM 3286 C C   . CYS B 2 214 ? 101.130 29.276 -1.413  1.00 171.61 ? 214 CYS L C   1 
ATOM 3287 O O   . CYS B 2 214 ? 100.002 29.803 -1.344  1.00 171.61 ? 214 CYS L O   1 
ATOM 3288 C CB  . CYS B 2 214 ? 101.887 31.399 -0.312  1.00 212.83 ? 214 CYS L CB  1 
ATOM 3289 S SG  . CYS B 2 214 ? 100.535 31.421 0.905   1.00 212.83 ? 214 CYS L SG  1 
ATOM 3290 O OXT . CYS B 2 214 ? 101.344 28.178 -1.963  1.00 107.44 ? 214 CYS L OXT 1 
ATOM 3291 N N   . GLU C 3 1   ? 73.160  41.150 40.248  1.00 79.57  ? 1   GLU H N   1 
ATOM 3292 C CA  . GLU C 3 1   ? 72.100  40.366 39.559  1.00 79.57  ? 1   GLU H CA  1 
ATOM 3293 C C   . GLU C 3 1   ? 70.797  41.154 39.376  1.00 79.57  ? 1   GLU H C   1 
ATOM 3294 O O   . GLU C 3 1   ? 69.797  40.885 40.054  1.00 79.57  ? 1   GLU H O   1 
ATOM 3295 C CB  . GLU C 3 1   ? 71.786  39.090 40.341  1.00 138.90 ? 1   GLU H CB  1 
ATOM 3296 C CG  . GLU C 3 1   ? 72.975  38.201 40.592  1.00 138.90 ? 1   GLU H CG  1 
ATOM 3297 C CD  . GLU C 3 1   ? 72.577  36.759 40.864  1.00 138.90 ? 1   GLU H CD  1 
ATOM 3298 O OE1 . GLU C 3 1   ? 71.587  36.531 41.603  1.00 138.90 ? 1   GLU H OE1 1 
ATOM 3299 O OE2 . GLU C 3 1   ? 73.266  35.851 40.342  1.00 138.90 ? 1   GLU H OE2 1 
ATOM 3300 N N   . VAL C 3 2   ? 70.812  42.127 38.471  1.00 89.45  ? 2   VAL H N   1 
ATOM 3301 C CA  . VAL C 3 2   ? 69.634  42.937 38.154  1.00 89.45  ? 2   VAL H CA  1 
ATOM 3302 C C   . VAL C 3 2   ? 69.669  42.956 36.654  1.00 89.45  ? 2   VAL H C   1 
ATOM 3303 O O   . VAL C 3 2   ? 70.750  43.081 36.075  1.00 89.45  ? 2   VAL H O   1 
ATOM 3304 C CB  . VAL C 3 2   ? 69.771  44.407 38.600  1.00 42.94  ? 2   VAL H CB  1 
ATOM 3305 C CG1 . VAL C 3 2   ? 68.465  45.170 38.288  1.00 42.94  ? 2   VAL H CG1 1 
ATOM 3306 C CG2 . VAL C 3 2   ? 70.190  44.483 40.091  1.00 42.94  ? 2   VAL H CG2 1 
ATOM 3307 N N   . GLN C 3 3   ? 68.520  42.844 36.003  1.00 71.62  ? 3   GLN H N   1 
ATOM 3308 C CA  . GLN C 3 3   ? 68.573  42.858 34.543  1.00 71.62  ? 3   GLN H CA  1 
ATOM 3309 C C   . GLN C 3 3   ? 67.269  42.722 33.767  1.00 71.62  ? 3   GLN H C   1 
ATOM 3310 O O   . GLN C 3 3   ? 66.337  42.031 34.182  1.00 71.62  ? 3   GLN H O   1 
ATOM 3311 C CB  . GLN C 3 3   ? 69.564  41.780 34.067  1.00 112.45 ? 3   GLN H CB  1 
ATOM 3312 C CG  . GLN C 3 3   ? 69.232  40.363 34.505  1.00 112.45 ? 3   GLN H CG  1 
ATOM 3313 C CD  . GLN C 3 3   ? 70.398  39.408 34.325  1.00 112.45 ? 3   GLN H CD  1 
ATOM 3314 O OE1 . GLN C 3 3   ? 71.240  39.599 33.454  1.00 112.45 ? 3   GLN H OE1 1 
ATOM 3315 N NE2 . GLN C 3 3   ? 70.441  38.364 35.143  1.00 112.45 ? 3   GLN H NE2 1 
ATOM 3316 N N   . LEU C 3 4   ? 67.198  43.405 32.634  1.00 92.32  ? 4   LEU H N   1 
ATOM 3317 C CA  . LEU C 3 4   ? 66.014  43.301 31.803  1.00 92.32  ? 4   LEU H CA  1 
ATOM 3318 C C   . LEU C 3 4   ? 66.473  42.559 30.561  1.00 92.32  ? 4   LEU H C   1 
ATOM 3319 O O   . LEU C 3 4   ? 67.240  43.094 29.771  1.00 92.32  ? 4   LEU H O   1 
ATOM 3320 C CB  . LEU C 3 4   ? 65.471  44.683 31.432  1.00 72.56  ? 4   LEU H CB  1 
ATOM 3321 C CG  . LEU C 3 4   ? 65.172  45.590 32.622  1.00 72.56  ? 4   LEU H CG  1 
ATOM 3322 C CD1 . LEU C 3 4   ? 66.449  46.276 33.019  1.00 72.56  ? 4   LEU H CD1 1 
ATOM 3323 C CD2 . LEU C 3 4   ? 64.133  46.632 32.270  1.00 72.56  ? 4   LEU H CD2 1 
ATOM 3324 N N   . GLN C 3 5   ? 66.037  41.314 30.406  1.00 72.60  ? 5   GLN H N   1 
ATOM 3325 C CA  . GLN C 3 5   ? 66.441  40.544 29.253  1.00 72.60  ? 5   GLN H CA  1 
ATOM 3326 C C   . GLN C 3 5   ? 65.702  41.012 28.019  1.00 72.60  ? 5   GLN H C   1 
ATOM 3327 O O   . GLN C 3 5   ? 64.530  41.412 28.083  1.00 72.60  ? 5   GLN H O   1 
ATOM 3328 C CB  . GLN C 3 5   ? 66.198  39.052 29.471  1.00 137.39 ? 5   GLN H CB  1 
ATOM 3329 C CG  . GLN C 3 5   ? 67.340  38.335 30.172  1.00 137.39 ? 5   GLN H CG  1 
ATOM 3330 C CD  . GLN C 3 5   ? 67.227  36.821 30.070  1.00 137.39 ? 5   GLN H CD  1 
ATOM 3331 O OE1 . GLN C 3 5   ? 66.401  36.293 29.321  1.00 137.39 ? 5   GLN H OE1 1 
ATOM 3332 N NE2 . GLN C 3 5   ? 68.071  36.114 30.812  1.00 137.39 ? 5   GLN H NE2 1 
ATOM 3333 N N   . GLN C 3 6   ? 66.413  40.963 26.893  1.00 90.35  ? 6   GLN H N   1 
ATOM 3334 C CA  . GLN C 3 6   ? 65.886  41.374 25.602  1.00 90.35  ? 6   GLN H CA  1 
ATOM 3335 C C   . GLN C 3 6   ? 66.378  40.459 24.483  1.00 90.35  ? 6   GLN H C   1 
ATOM 3336 O O   . GLN C 3 6   ? 67.436  39.844 24.585  1.00 90.35  ? 6   GLN H O   1 
ATOM 3337 C CB  . GLN C 3 6   ? 66.287  42.822 25.329  1.00 67.24  ? 6   GLN H CB  1 
ATOM 3338 C CG  . GLN C 3 6   ? 65.092  43.722 25.154  1.00 67.24  ? 6   GLN H CG  1 
ATOM 3339 C CD  . GLN C 3 6   ? 65.306  45.101 25.714  1.00 67.24  ? 6   GLN H CD  1 
ATOM 3340 O OE1 . GLN C 3 6   ? 66.338  45.400 26.313  1.00 67.24  ? 6   GLN H OE1 1 
ATOM 3341 N NE2 . GLN C 3 6   ? 64.323  45.955 25.526  1.00 67.24  ? 6   GLN H NE2 1 
ATOM 3342 N N   . SER C 3 7   ? 65.591  40.389 23.418  1.00 106.52 ? 7   SER H N   1 
ATOM 3343 C CA  . SER C 3 7   ? 65.877  39.551 22.266  1.00 106.52 ? 7   SER H CA  1 
ATOM 3344 C C   . SER C 3 7   ? 67.214  39.787 21.567  1.00 106.52 ? 7   SER H C   1 
ATOM 3345 O O   . SER C 3 7   ? 67.847  38.835 21.109  1.00 106.52 ? 7   SER H O   1 
ATOM 3346 C CB  . SER C 3 7   ? 64.741  39.683 21.252  1.00 248.00 ? 7   SER H CB  1 
ATOM 3347 O OG  . SER C 3 7   ? 63.495  39.394 21.864  1.00 248.00 ? 7   SER H OG  1 
ATOM 3348 N N   . GLY C 3 8   ? 67.649  41.036 21.457  1.00 94.51  ? 8   GLY H N   1 
ATOM 3349 C CA  . GLY C 3 8   ? 68.925  41.279 20.799  1.00 94.51  ? 8   GLY H CA  1 
ATOM 3350 C C   . GLY C 3 8   ? 68.920  41.265 19.274  1.00 94.51  ? 8   GLY H C   1 
ATOM 3351 O O   . GLY C 3 8   ? 69.666  42.019 18.657  1.00 94.51  ? 8   GLY H O   1 
ATOM 3352 N N   . ALA C 3 9   ? 68.100  40.409 18.665  1.00 80.88  ? 9   ALA H N   1 
ATOM 3353 C CA  . ALA C 3 9   ? 68.003  40.324 17.206  1.00 80.88  ? 9   ALA H CA  1 
ATOM 3354 C C   . ALA C 3 9   ? 66.562  40.075 16.761  1.00 80.88  ? 9   ALA H C   1 
ATOM 3355 O O   . ALA C 3 9   ? 65.946  39.099 17.175  1.00 80.88  ? 9   ALA H O   1 
ATOM 3356 C CB  . ALA C 3 9   ? 68.903  39.212 16.693  1.00 142.41 ? 9   ALA H CB  1 
ATOM 3357 N N   . GLU C 3 10  ? 66.025  40.949 15.916  1.00 70.08  ? 10  GLU H N   1 
ATOM 3358 C CA  . GLU C 3 10  ? 64.648  40.777 15.445  1.00 70.08  ? 10  GLU H CA  1 
ATOM 3359 C C   . GLU C 3 10  ? 64.399  41.174 13.987  1.00 70.08  ? 10  GLU H C   1 
ATOM 3360 O O   . GLU C 3 10  ? 64.451  42.348 13.637  1.00 70.08  ? 10  GLU H O   1 
ATOM 3361 C CB  . GLU C 3 10  ? 63.694  41.562 16.345  1.00 133.68 ? 10  GLU H CB  1 
ATOM 3362 C CG  . GLU C 3 10  ? 62.230  41.512 15.918  1.00 133.68 ? 10  GLU H CG  1 
ATOM 3363 C CD  . GLU C 3 10  ? 61.626  40.126 16.038  1.00 133.68 ? 10  GLU H CD  1 
ATOM 3364 O OE1 . GLU C 3 10  ? 61.745  39.517 17.126  1.00 133.68 ? 10  GLU H OE1 1 
ATOM 3365 O OE2 . GLU C 3 10  ? 61.024  39.652 15.047  1.00 133.68 ? 10  GLU H OE2 1 
ATOM 3366 N N   . LEU C 3 11  ? 64.095  40.196 13.140  1.00 93.89  ? 11  LEU H N   1 
ATOM 3367 C CA  . LEU C 3 11  ? 63.862  40.474 11.726  1.00 93.89  ? 11  LEU H CA  1 
ATOM 3368 C C   . LEU C 3 11  ? 62.387  40.585 11.432  1.00 93.89  ? 11  LEU H C   1 
ATOM 3369 O O   . LEU C 3 11  ? 61.588  39.789 11.925  1.00 93.89  ? 11  LEU H O   1 
ATOM 3370 C CB  . LEU C 3 11  ? 64.458  39.363 10.861  1.00 99.05  ? 11  LEU H CB  1 
ATOM 3371 C CG  . LEU C 3 11  ? 64.783  39.671 9.395   1.00 99.05  ? 11  LEU H CG  1 
ATOM 3372 C CD1 . LEU C 3 11  ? 63.564  40.198 8.662   1.00 99.05  ? 11  LEU H CD1 1 
ATOM 3373 C CD2 . LEU C 3 11  ? 65.897  40.692 9.339   1.00 99.05  ? 11  LEU H CD2 1 
ATOM 3374 N N   . ALA C 3 12  ? 62.031  41.566 10.614  1.00 59.42  ? 12  ALA H N   1 
ATOM 3375 C CA  . ALA C 3 12  ? 60.637  41.758 10.259  1.00 59.42  ? 12  ALA H CA  1 
ATOM 3376 C C   . ALA C 3 12  ? 60.467  42.327 8.859   1.00 59.42  ? 12  ALA H C   1 
ATOM 3377 O O   . ALA C 3 12  ? 61.211  43.228 8.449   1.00 59.42  ? 12  ALA H O   1 
ATOM 3378 C CB  . ALA C 3 12  ? 59.970  42.664 11.262  1.00 69.48  ? 12  ALA H CB  1 
ATOM 3379 N N   . ARG C 3 13  ? 59.484  41.788 8.130   1.00 75.35  ? 13  ARG H N   1 
ATOM 3380 C CA  . ARG C 3 13  ? 59.194  42.237 6.772   1.00 75.35  ? 13  ARG H CA  1 
ATOM 3381 C C   . ARG C 3 13  ? 58.486  43.573 6.840   1.00 75.35  ? 13  ARG H C   1 
ATOM 3382 O O   . ARG C 3 13  ? 57.691  43.825 7.743   1.00 75.35  ? 13  ARG H O   1 
ATOM 3383 C CB  . ARG C 3 13  ? 58.313  41.230 6.022   1.00 175.73 ? 13  ARG H CB  1 
ATOM 3384 C CG  . ARG C 3 13  ? 59.084  40.191 5.202   1.00 175.73 ? 13  ARG H CG  1 
ATOM 3385 C CD  . ARG C 3 13  ? 58.157  39.321 4.330   1.00 175.73 ? 13  ARG H CD  1 
ATOM 3386 N NE  . ARG C 3 13  ? 57.757  39.953 3.067   1.00 175.73 ? 13  ARG H NE  1 
ATOM 3387 C CZ  . ARG C 3 13  ? 58.540  40.071 1.996   1.00 175.73 ? 13  ARG H CZ  1 
ATOM 3388 N NH1 . ARG C 3 13  ? 59.779  39.600 2.016   1.00 175.73 ? 13  ARG H NH1 1 
ATOM 3389 N NH2 . ARG C 3 13  ? 58.082  40.659 0.898   1.00 175.73 ? 13  ARG H NH2 1 
ATOM 3390 N N   . PRO C 3 14  ? 58.770  44.454 5.875   1.00 82.19  ? 14  PRO H N   1 
ATOM 3391 C CA  . PRO C 3 14  ? 58.145  45.776 5.843   1.00 82.19  ? 14  PRO H CA  1 
ATOM 3392 C C   . PRO C 3 14  ? 56.621  45.692 5.835   1.00 82.19  ? 14  PRO H C   1 
ATOM 3393 O O   . PRO C 3 14  ? 56.036  44.918 5.074   1.00 82.19  ? 14  PRO H O   1 
ATOM 3394 C CB  . PRO C 3 14  ? 58.709  46.384 4.564   1.00 83.56  ? 14  PRO H CB  1 
ATOM 3395 C CG  . PRO C 3 14  ? 58.926  45.184 3.688   1.00 83.56  ? 14  PRO H CG  1 
ATOM 3396 C CD  . PRO C 3 14  ? 59.547  44.207 4.646   1.00 83.56  ? 14  PRO H CD  1 
ATOM 3397 N N   . GLY C 3 15  ? 55.992  46.483 6.698   1.00 71.78  ? 15  GLY H N   1 
ATOM 3398 C CA  . GLY C 3 15  ? 54.547  46.489 6.782   1.00 71.78  ? 15  GLY H CA  1 
ATOM 3399 C C   . GLY C 3 15  ? 54.022  45.561 7.865   1.00 71.78  ? 15  GLY H C   1 
ATOM 3400 O O   . GLY C 3 15  ? 52.871  45.683 8.303   1.00 71.78  ? 15  GLY H O   1 
ATOM 3401 N N   . ALA C 3 16  ? 54.861  44.632 8.304   1.00 92.65  ? 16  ALA H N   1 
ATOM 3402 C CA  . ALA C 3 16  ? 54.471  43.687 9.337   1.00 92.65  ? 16  ALA H CA  1 
ATOM 3403 C C   . ALA C 3 16  ? 54.385  44.318 10.732  1.00 92.65  ? 16  ALA H C   1 
ATOM 3404 O O   . ALA C 3 16  ? 54.073  45.502 10.889  1.00 92.65  ? 16  ALA H O   1 
ATOM 3405 C CB  . ALA C 3 16  ? 55.448  42.527 9.360   1.00 173.43 ? 16  ALA H CB  1 
ATOM 3406 N N   . SER C 3 17  ? 54.654  43.502 11.746  1.00 99.93  ? 17  SER H N   1 
ATOM 3407 C CA  . SER C 3 17  ? 54.596  43.960 13.117  1.00 99.93  ? 17  SER H CA  1 
ATOM 3408 C C   . SER C 3 17  ? 55.294  43.041 14.105  1.00 99.93  ? 17  SER H C   1 
ATOM 3409 O O   . SER C 3 17  ? 54.950  41.867 14.246  1.00 99.93  ? 17  SER H O   1 
ATOM 3410 C CB  . SER C 3 17  ? 53.144  44.138 13.546  1.00 71.16  ? 17  SER H CB  1 
ATOM 3411 O OG  . SER C 3 17  ? 53.043  44.062 14.961  1.00 71.16  ? 17  SER H OG  1 
ATOM 3412 N N   . VAL C 3 18  ? 56.275  43.605 14.795  1.00 62.40  ? 18  VAL H N   1 
ATOM 3413 C CA  . VAL C 3 18  ? 57.031  42.886 15.795  1.00 62.40  ? 18  VAL H CA  1 
ATOM 3414 C C   . VAL C 3 18  ? 56.464  43.261 17.137  1.00 62.40  ? 18  VAL H C   1 
ATOM 3415 O O   . VAL C 3 18  ? 55.726  44.252 17.238  1.00 62.40  ? 18  VAL H O   1 
ATOM 3416 C CB  . VAL C 3 18  ? 58.507  43.284 15.781  1.00 88.23  ? 18  VAL H CB  1 
ATOM 3417 C CG1 . VAL C 3 18  ? 59.152  42.850 14.477  1.00 88.23  ? 18  VAL H CG1 1 
ATOM 3418 C CG2 . VAL C 3 18  ? 58.652  44.790 15.968  1.00 88.23  ? 18  VAL H CG2 1 
ATOM 3419 N N   . LYS C 3 19  ? 56.791  42.459 18.155  1.00 89.00  ? 19  LYS H N   1 
ATOM 3420 C CA  . LYS C 3 19  ? 56.344  42.704 19.529  1.00 89.00  ? 19  LYS H CA  1 
ATOM 3421 C C   . LYS C 3 19  ? 57.463  42.377 20.507  1.00 89.00  ? 19  LYS H C   1 
ATOM 3422 O O   . LYS C 3 19  ? 57.462  41.334 21.157  1.00 89.00  ? 19  LYS H O   1 
ATOM 3423 C CB  . LYS C 3 19  ? 55.119  41.868 19.886  1.00 95.78  ? 19  LYS H CB  1 
ATOM 3424 C CG  . LYS C 3 19  ? 54.581  42.202 21.264  1.00 95.78  ? 19  LYS H CG  1 
ATOM 3425 C CD  . LYS C 3 19  ? 53.361  41.369 21.582  1.00 95.78  ? 19  LYS H CD  1 
ATOM 3426 C CE  . LYS C 3 19  ? 52.685  41.837 22.871  1.00 95.78  ? 19  LYS H CE  1 
ATOM 3427 N NZ  . LYS C 3 19  ? 51.475  41.008 23.204  1.00 95.78  ? 19  LYS H NZ  1 
ATOM 3428 N N   . LEU C 3 20  ? 58.414  43.293 20.603  1.00 78.56  ? 20  LEU H N   1 
ATOM 3429 C CA  . LEU C 3 20  ? 59.551  43.146 21.492  1.00 78.56  ? 20  LEU H CA  1 
ATOM 3430 C C   . LEU C 3 20  ? 59.137  42.955 22.960  1.00 78.56  ? 20  LEU H C   1 
ATOM 3431 O O   . LEU C 3 20  ? 58.134  43.512 23.407  1.00 78.56  ? 20  LEU H O   1 
ATOM 3432 C CB  . LEU C 3 20  ? 60.448  44.382 21.358  1.00 68.21  ? 20  LEU H CB  1 
ATOM 3433 C CG  . LEU C 3 20  ? 61.280  44.660 20.100  1.00 68.21  ? 20  LEU H CG  1 
ATOM 3434 C CD1 . LEU C 3 20  ? 60.823  43.874 18.896  1.00 68.21  ? 20  LEU H CD1 1 
ATOM 3435 C CD2 . LEU C 3 20  ? 61.186  46.137 19.841  1.00 68.21  ? 20  LEU H CD2 1 
ATOM 3436 N N   . SER C 3 21  ? 59.919  42.165 23.695  1.00 88.27  ? 21  SER H N   1 
ATOM 3437 C CA  . SER C 3 21  ? 59.667  41.904 25.115  1.00 88.27  ? 21  SER H CA  1 
ATOM 3438 C C   . SER C 3 21  ? 60.913  42.294 25.909  1.00 88.27  ? 21  SER H C   1 
ATOM 3439 O O   . SER C 3 21  ? 61.939  42.635 25.329  1.00 88.27  ? 21  SER H O   1 
ATOM 3440 C CB  . SER C 3 21  ? 59.366  40.429 25.353  1.00 99.07  ? 21  SER H CB  1 
ATOM 3441 O OG  . SER C 3 21  ? 60.552  39.651 25.309  1.00 99.07  ? 21  SER H OG  1 
ATOM 3442 N N   . CYS C 3 22  ? 60.840  42.210 27.230  1.00 68.35  ? 22  CYS H N   1 
ATOM 3443 C CA  . CYS C 3 22  ? 61.959  42.612 28.069  1.00 68.35  ? 22  CYS H CA  1 
ATOM 3444 C C   . CYS C 3 22  ? 61.728  42.021 29.443  1.00 68.35  ? 22  CYS H C   1 
ATOM 3445 O O   . CYS C 3 22  ? 61.029  42.619 30.267  1.00 68.35  ? 22  CYS H O   1 
ATOM 3446 C CB  . CYS C 3 22  ? 61.955  44.130 28.133  1.00 85.32  ? 22  CYS H CB  1 
ATOM 3447 S SG  . CYS C 3 22  ? 63.116  44.999 29.226  1.00 85.32  ? 22  CYS H SG  1 
ATOM 3448 N N   . LYS C 3 23  ? 62.308  40.845 29.688  1.00 65.50  ? 23  LYS H N   1 
ATOM 3449 C CA  . LYS C 3 23  ? 62.121  40.158 30.959  1.00 65.50  ? 23  LYS H CA  1 
ATOM 3450 C C   . LYS C 3 23  ? 63.010  40.651 32.087  1.00 65.50  ? 23  LYS H C   1 
ATOM 3451 O O   . LYS C 3 23  ? 64.155  40.224 32.243  1.00 65.50  ? 23  LYS H O   1 
ATOM 3452 C CB  . LYS C 3 23  ? 62.297  38.649 30.776  1.00 125.57 ? 23  LYS H CB  1 
ATOM 3453 C CG  . LYS C 3 23  ? 61.849  37.842 31.983  1.00 125.57 ? 23  LYS H CG  1 
ATOM 3454 C CD  . LYS C 3 23  ? 61.607  36.380 31.624  1.00 125.57 ? 23  LYS H CD  1 
ATOM 3455 C CE  . LYS C 3 23  ? 60.997  35.610 32.796  1.00 125.57 ? 23  LYS H CE  1 
ATOM 3456 N NZ  . LYS C 3 23  ? 60.642  34.204 32.441  1.00 125.57 ? 23  LYS H NZ  1 
ATOM 3457 N N   . ALA C 3 24  ? 62.451  41.558 32.879  1.00 77.02  ? 24  ALA H N   1 
ATOM 3458 C CA  . ALA C 3 24  ? 63.146  42.122 34.020  1.00 77.02  ? 24  ALA H CA  1 
ATOM 3459 C C   . ALA C 3 24  ? 63.093  41.121 35.150  1.00 77.02  ? 24  ALA H C   1 
ATOM 3460 O O   . ALA C 3 24  ? 62.040  40.557 35.447  1.00 77.02  ? 24  ALA H O   1 
ATOM 3461 C CB  . ALA C 3 24  ? 62.490  43.405 34.453  1.00 63.14  ? 24  ALA H CB  1 
ATOM 3462 N N   . SER C 3 25  ? 64.241  40.908 35.775  1.00 97.31  ? 25  SER H N   1 
ATOM 3463 C CA  . SER C 3 25  ? 64.356  39.968 36.877  1.00 97.31  ? 25  SER H CA  1 
ATOM 3464 C C   . SER C 3 25  ? 65.558  40.317 37.752  1.00 97.31  ? 25  SER H C   1 
ATOM 3465 O O   . SER C 3 25  ? 66.704  39.990 37.424  1.00 97.31  ? 25  SER H O   1 
ATOM 3466 C CB  . SER C 3 25  ? 64.493  38.545 36.331  1.00 92.83  ? 25  SER H CB  1 
ATOM 3467 O OG  . SER C 3 25  ? 65.500  38.473 35.334  1.00 92.83  ? 25  SER H OG  1 
ATOM 3468 N N   . GLY C 3 26  ? 65.286  40.983 38.869  1.00 85.00  ? 26  GLY H N   1 
ATOM 3469 C CA  . GLY C 3 26  ? 66.344  41.368 39.778  1.00 85.00  ? 26  GLY H CA  1 
ATOM 3470 C C   . GLY C 3 26  ? 65.833  42.439 40.713  1.00 85.00  ? 26  GLY H C   1 
ATOM 3471 O O   . GLY C 3 26  ? 66.572  42.961 41.543  1.00 85.00  ? 26  GLY H O   1 
ATOM 3472 N N   . TYR C 3 27  ? 64.561  42.782 40.570  1.00 102.60 ? 27  TYR H N   1 
ATOM 3473 C CA  . TYR C 3 27  ? 63.953  43.800 41.414  1.00 102.60 ? 27  TYR H CA  1 
ATOM 3474 C C   . TYR C 3 27  ? 62.453  43.604 41.354  1.00 102.60 ? 27  TYR H C   1 
ATOM 3475 O O   . TYR C 3 27  ? 61.967  42.690 40.689  1.00 102.60 ? 27  TYR H O   1 
ATOM 3476 C CB  . TYR C 3 27  ? 64.332  45.218 40.937  1.00 86.78  ? 27  TYR H CB  1 
ATOM 3477 C CG  . TYR C 3 27  ? 63.738  45.644 39.594  1.00 86.78  ? 27  TYR H CG  1 
ATOM 3478 C CD1 . TYR C 3 27  ? 64.047  44.965 38.416  1.00 86.78  ? 27  TYR H CD1 1 
ATOM 3479 C CD2 . TYR C 3 27  ? 62.849  46.714 39.513  1.00 86.78  ? 27  TYR H CD2 1 
ATOM 3480 C CE1 . TYR C 3 27  ? 63.486  45.335 37.203  1.00 86.78  ? 27  TYR H CE1 1 
ATOM 3481 C CE2 . TYR C 3 27  ? 62.284  47.087 38.301  1.00 86.78  ? 27  TYR H CE2 1 
ATOM 3482 C CZ  . TYR C 3 27  ? 62.606  46.391 37.153  1.00 86.78  ? 27  TYR H CZ  1 
ATOM 3483 O OH  . TYR C 3 27  ? 62.018  46.747 35.962  1.00 86.78  ? 27  TYR H OH  1 
ATOM 3484 N N   . ILE C 3 28  ? 61.716  44.454 42.051  1.00 75.74  ? 28  ILE H N   1 
ATOM 3485 C CA  . ILE C 3 28  ? 60.272  44.333 42.049  1.00 75.74  ? 28  ILE H CA  1 
ATOM 3486 C C   . ILE C 3 28  ? 59.675  45.113 40.875  1.00 75.74  ? 28  ILE H C   1 
ATOM 3487 O O   . ILE C 3 28  ? 59.537  46.333 40.939  1.00 75.74  ? 28  ILE H O   1 
ATOM 3488 C CB  . ILE C 3 28  ? 59.687  44.843 43.377  1.00 82.31  ? 28  ILE H CB  1 
ATOM 3489 C CG1 . ILE C 3 28  ? 60.384  44.147 44.548  1.00 82.31  ? 28  ILE H CG1 1 
ATOM 3490 C CG2 . ILE C 3 28  ? 58.186  44.559 43.426  1.00 82.31  ? 28  ILE H CG2 1 
ATOM 3491 C CD1 . ILE C 3 28  ? 59.971  44.676 45.889  1.00 82.31  ? 28  ILE H CD1 1 
ATOM 3492 N N   . PHE C 3 29  ? 59.327  44.386 39.813  1.00 102.21 ? 29  PHE H N   1 
ATOM 3493 C CA  . PHE C 3 29  ? 58.757  44.952 38.593  1.00 102.21 ? 29  PHE H CA  1 
ATOM 3494 C C   . PHE C 3 29  ? 57.952  46.203 38.848  1.00 102.21 ? 29  PHE H C   1 
ATOM 3495 O O   . PHE C 3 29  ? 58.273  47.266 38.317  1.00 102.21 ? 29  PHE H O   1 
ATOM 3496 C CB  . PHE C 3 29  ? 57.857  43.925 37.902  1.00 58.74  ? 29  PHE H CB  1 
ATOM 3497 C CG  . PHE C 3 29  ? 57.647  44.175 36.417  1.00 58.74  ? 29  PHE H CG  1 
ATOM 3498 C CD1 . PHE C 3 29  ? 58.731  44.432 35.568  1.00 58.74  ? 29  PHE H CD1 1 
ATOM 3499 C CD2 . PHE C 3 29  ? 56.372  44.099 35.858  1.00 58.74  ? 29  PHE H CD2 1 
ATOM 3500 C CE1 . PHE C 3 29  ? 58.541  44.604 34.197  1.00 58.74  ? 29  PHE H CE1 1 
ATOM 3501 C CE2 . PHE C 3 29  ? 56.183  44.269 34.489  1.00 58.74  ? 29  PHE H CE2 1 
ATOM 3502 C CZ  . PHE C 3 29  ? 57.268  44.521 33.658  1.00 58.74  ? 29  PHE H CZ  1 
ATOM 3503 N N   . THR C 3 30  ? 56.907  46.074 39.661  1.00 70.40  ? 30  THR H N   1 
ATOM 3504 C CA  . THR C 3 30  ? 56.032  47.207 39.975  1.00 70.40  ? 30  THR H CA  1 
ATOM 3505 C C   . THR C 3 30  ? 56.527  48.154 41.081  1.00 70.40  ? 30  THR H C   1 
ATOM 3506 O O   . THR C 3 30  ? 55.923  48.260 42.144  1.00 70.40  ? 30  THR H O   1 
ATOM 3507 C CB  . THR C 3 30  ? 54.618  46.709 40.335  1.00 111.55 ? 30  THR H CB  1 
ATOM 3508 O OG1 . THR C 3 30  ? 53.842  47.803 40.833  1.00 111.55 ? 30  THR H OG1 1 
ATOM 3509 C CG2 . THR C 3 30  ? 54.685  45.604 41.377  1.00 111.55 ? 30  THR H CG2 1 
ATOM 3510 N N   . ASP C 3 31  ? 57.628  48.841 40.804  1.00 92.89  ? 31  ASP H N   1 
ATOM 3511 C CA  . ASP C 3 31  ? 58.232  49.796 41.725  1.00 92.89  ? 31  ASP H CA  1 
ATOM 3512 C C   . ASP C 3 31  ? 59.000  50.800 40.880  1.00 92.89  ? 31  ASP H C   1 
ATOM 3513 O O   . ASP C 3 31  ? 59.628  51.725 41.396  1.00 92.89  ? 31  ASP H O   1 
ATOM 3514 C CB  . ASP C 3 31  ? 59.198  49.096 42.685  1.00 130.25 ? 31  ASP H CB  1 
ATOM 3515 C CG  . ASP C 3 31  ? 58.487  48.438 43.855  1.00 130.25 ? 31  ASP H CG  1 
ATOM 3516 O OD1 . ASP C 3 31  ? 57.585  47.608 43.616  1.00 130.25 ? 31  ASP H OD1 1 
ATOM 3517 O OD2 . ASP C 3 31  ? 58.829  48.749 45.020  1.00 130.25 ? 31  ASP H OD2 1 
ATOM 3518 N N   . TYR C 3 32  ? 58.931  50.596 39.569  1.00 77.77  ? 32  TYR H N   1 
ATOM 3519 C CA  . TYR C 3 32  ? 59.601  51.436 38.591  1.00 77.77  ? 32  TYR H CA  1 
ATOM 3520 C C   . TYR C 3 32  ? 58.838  51.364 37.298  1.00 77.77  ? 32  TYR H C   1 
ATOM 3521 O O   . TYR C 3 32  ? 58.357  50.295 36.930  1.00 77.77  ? 32  TYR H O   1 
ATOM 3522 C CB  . TYR C 3 32  ? 60.978  50.892 38.272  1.00 77.33  ? 32  TYR H CB  1 
ATOM 3523 C CG  . TYR C 3 32  ? 61.990  51.005 39.363  1.00 77.33  ? 32  TYR H CG  1 
ATOM 3524 C CD1 . TYR C 3 32  ? 62.616  52.213 39.619  1.00 77.33  ? 32  TYR H CD1 1 
ATOM 3525 C CD2 . TYR C 3 32  ? 62.357  49.893 40.117  1.00 77.33  ? 32  TYR H CD2 1 
ATOM 3526 C CE1 . TYR C 3 32  ? 63.587  52.317 40.593  1.00 77.33  ? 32  TYR H CE1 1 
ATOM 3527 C CE2 . TYR C 3 32  ? 63.324  49.987 41.095  1.00 77.33  ? 32  TYR H CE2 1 
ATOM 3528 C CZ  . TYR C 3 32  ? 63.938  51.204 41.330  1.00 77.33  ? 32  TYR H CZ  1 
ATOM 3529 O OH  . TYR C 3 32  ? 64.901  51.325 42.308  1.00 77.33  ? 32  TYR H OH  1 
ATOM 3530 N N   . TYR C 3 33  ? 58.722  52.482 36.593  1.00 69.31  ? 33  TYR H N   1 
ATOM 3531 C CA  . TYR C 3 33  ? 58.077  52.408 35.292  1.00 69.31  ? 33  TYR H CA  1 
ATOM 3532 C C   . TYR C 3 33  ? 59.249  51.932 34.467  1.00 69.31  ? 33  TYR H C   1 
ATOM 3533 O O   . TYR C 3 33  ? 60.378  51.862 34.959  1.00 69.31  ? 33  TYR H O   1 
ATOM 3534 C CB  . TYR C 3 33  ? 57.691  53.767 34.693  1.00 96.78  ? 33  TYR H CB  1 
ATOM 3535 C CG  . TYR C 3 33  ? 57.376  54.899 35.624  1.00 96.78  ? 33  TYR H CG  1 
ATOM 3536 C CD1 . TYR C 3 33  ? 58.362  55.471 36.424  1.00 96.78  ? 33  TYR H CD1 1 
ATOM 3537 C CD2 . TYR C 3 33  ? 56.110  55.479 35.613  1.00 96.78  ? 33  TYR H CD2 1 
ATOM 3538 C CE1 . TYR C 3 33  ? 58.093  56.601 37.178  1.00 96.78  ? 33  TYR H CE1 1 
ATOM 3539 C CE2 . TYR C 3 33  ? 55.830  56.607 36.360  1.00 96.78  ? 33  TYR H CE2 1 
ATOM 3540 C CZ  . TYR C 3 33  ? 56.823  57.169 37.137  1.00 96.78  ? 33  TYR H CZ  1 
ATOM 3541 O OH  . TYR C 3 33  ? 56.541  58.323 37.832  1.00 96.78  ? 33  TYR H OH  1 
ATOM 3542 N N   . ILE C 3 34  ? 58.997  51.616 33.211  1.00 84.72  ? 34  ILE H N   1 
ATOM 3543 C CA  . ILE C 3 34  ? 60.090  51.224 32.356  1.00 84.72  ? 34  ILE H CA  1 
ATOM 3544 C C   . ILE C 3 34  ? 59.772  51.847 31.022  1.00 84.72  ? 34  ILE H C   1 
ATOM 3545 O O   . ILE C 3 34  ? 58.704  51.627 30.475  1.00 84.72  ? 34  ILE H O   1 
ATOM 3546 C CB  . ILE C 3 34  ? 60.241  49.673 32.261  1.00 124.87 ? 34  ILE H CB  1 
ATOM 3547 C CG1 . ILE C 3 34  ? 59.209  49.063 31.320  1.00 124.87 ? 34  ILE H CG1 1 
ATOM 3548 C CG2 . ILE C 3 34  ? 60.084  49.053 33.653  1.00 124.87 ? 34  ILE H CG2 1 
ATOM 3549 C CD1 . ILE C 3 34  ? 59.452  47.586 31.115  1.00 124.87 ? 34  ILE H CD1 1 
ATOM 3550 N N   . ASN C 3 35  ? 60.673  52.674 30.522  1.00 71.26  ? 35  ASN H N   1 
ATOM 3551 C CA  . ASN C 3 35  ? 60.420  53.307 29.250  1.00 71.26  ? 35  ASN H CA  1 
ATOM 3552 C C   . ASN C 3 35  ? 60.974  52.428 28.165  1.00 71.26  ? 35  ASN H C   1 
ATOM 3553 O O   . ASN C 3 35  ? 61.660  51.446 28.442  1.00 71.26  ? 35  ASN H O   1 
ATOM 3554 C CB  . ASN C 3 35  ? 61.119  54.650 29.138  1.00 69.71  ? 35  ASN H CB  1 
ATOM 3555 C CG  . ASN C 3 35  ? 61.029  55.453 30.379  1.00 69.71  ? 35  ASN H CG  1 
ATOM 3556 O OD1 . ASN C 3 35  ? 60.626  56.614 30.346  1.00 69.71  ? 35  ASN H OD1 1 
ATOM 3557 N ND2 . ASN C 3 35  ? 61.420  54.858 31.493  1.00 69.71  ? 35  ASN H ND2 1 
ATOM 3558 N N   . TRP C 3 36  ? 60.677  52.808 26.929  1.00 65.34  ? 36  TRP H N   1 
ATOM 3559 C CA  . TRP C 3 36  ? 61.162  52.110 25.767  1.00 65.34  ? 36  TRP H CA  1 
ATOM 3560 C C   . TRP C 3 36  ? 61.745  53.180 24.876  1.00 65.34  ? 36  TRP H C   1 
ATOM 3561 O O   . TRP C 3 36  ? 61.005  53.878 24.202  1.00 65.34  ? 36  TRP H O   1 
ATOM 3562 C CB  . TRP C 3 36  ? 60.019  51.406 25.051  1.00 76.62  ? 36  TRP H CB  1 
ATOM 3563 C CG  . TRP C 3 36  ? 59.633  50.147 25.715  1.00 76.62  ? 36  TRP H CG  1 
ATOM 3564 C CD1 . TRP C 3 36  ? 58.790  50.001 26.777  1.00 76.62  ? 36  TRP H CD1 1 
ATOM 3565 C CD2 . TRP C 3 36  ? 60.156  48.846 25.432  1.00 76.62  ? 36  TRP H CD2 1 
ATOM 3566 N NE1 . TRP C 3 36  ? 58.762  48.689 27.178  1.00 76.62  ? 36  TRP H NE1 1 
ATOM 3567 C CE2 . TRP C 3 36  ? 59.593  47.959 26.367  1.00 76.62  ? 36  TRP H CE2 1 
ATOM 3568 C CE3 . TRP C 3 36  ? 61.050  48.345 24.477  1.00 76.62  ? 36  TRP H CE3 1 
ATOM 3569 C CZ2 . TRP C 3 36  ? 59.892  46.601 26.376  1.00 76.62  ? 36  TRP H CZ2 1 
ATOM 3570 C CZ3 . TRP C 3 36  ? 61.346  46.993 24.487  1.00 76.62  ? 36  TRP H CZ3 1 
ATOM 3571 C CH2 . TRP C 3 36  ? 60.769  46.138 25.430  1.00 76.62  ? 36  TRP H CH2 1 
ATOM 3572 N N   . VAL C 3 37  ? 63.065  53.329 24.883  1.00 65.05  ? 37  VAL H N   1 
ATOM 3573 C CA  . VAL C 3 37  ? 63.726  54.336 24.051  1.00 65.05  ? 37  VAL H CA  1 
ATOM 3574 C C   . VAL C 3 37  ? 64.271  53.735 22.763  1.00 65.05  ? 37  VAL H C   1 
ATOM 3575 O O   . VAL C 3 37  ? 64.811  52.632 22.768  1.00 65.05  ? 37  VAL H O   1 
ATOM 3576 C CB  . VAL C 3 37  ? 64.901  54.979 24.806  1.00 84.51  ? 37  VAL H CB  1 
ATOM 3577 C CG1 . VAL C 3 37  ? 65.661  55.926 23.895  1.00 84.51  ? 37  VAL H CG1 1 
ATOM 3578 C CG2 . VAL C 3 37  ? 64.379  55.706 26.021  1.00 84.51  ? 37  VAL H CG2 1 
ATOM 3579 N N   . ARG C 3 38  ? 64.130  54.453 21.657  1.00 64.36  ? 38  ARG H N   1 
ATOM 3580 C CA  . ARG C 3 38  ? 64.661  53.962 20.388  1.00 64.36  ? 38  ARG H CA  1 
ATOM 3581 C C   . ARG C 3 38  ? 65.948  54.714 20.078  1.00 64.36  ? 38  ARG H C   1 
ATOM 3582 O O   . ARG C 3 38  ? 66.019  55.931 20.234  1.00 64.36  ? 38  ARG H O   1 
ATOM 3583 C CB  . ARG C 3 38  ? 63.656  54.179 19.252  1.00 89.69  ? 38  ARG H CB  1 
ATOM 3584 C CG  . ARG C 3 38  ? 64.260  54.042 17.869  1.00 89.69  ? 38  ARG H CG  1 
ATOM 3585 C CD  . ARG C 3 38  ? 63.530  54.915 16.861  1.00 89.69  ? 38  ARG H CD  1 
ATOM 3586 N NE  . ARG C 3 38  ? 62.249  54.344 16.458  1.00 89.69  ? 38  ARG H NE  1 
ATOM 3587 C CZ  . ARG C 3 38  ? 61.511  54.799 15.445  1.00 89.69  ? 38  ARG H CZ  1 
ATOM 3588 N NH1 . ARG C 3 38  ? 61.926  55.846 14.733  1.00 89.69  ? 38  ARG H NH1 1 
ATOM 3589 N NH2 . ARG C 3 38  ? 60.373  54.181 15.126  1.00 89.69  ? 38  ARG H NH2 1 
ATOM 3590 N N   . GLN C 3 39  ? 66.974  53.984 19.663  1.00 56.63  ? 39  GLN H N   1 
ATOM 3591 C CA  . GLN C 3 39  ? 68.252  54.595 19.321  1.00 56.63  ? 39  GLN H CA  1 
ATOM 3592 C C   . GLN C 3 39  ? 68.733  54.017 18.000  1.00 56.63  ? 39  GLN H C   1 
ATOM 3593 O O   . GLN C 3 39  ? 69.355  52.943 17.968  1.00 56.63  ? 39  GLN H O   1 
ATOM 3594 C CB  . GLN C 3 39  ? 69.301  54.315 20.380  1.00 76.38  ? 39  GLN H CB  1 
ATOM 3595 C CG  . GLN C 3 39  ? 70.627  54.864 19.967  1.00 76.38  ? 39  GLN H CG  1 
ATOM 3596 C CD  . GLN C 3 39  ? 71.772  54.272 20.729  1.00 76.38  ? 39  GLN H CD  1 
ATOM 3597 O OE1 . GLN C 3 39  ? 71.846  53.057 20.918  1.00 76.38  ? 39  GLN H OE1 1 
ATOM 3598 N NE2 . GLN C 3 39  ? 72.690  55.126 21.167  1.00 76.38  ? 39  GLN H NE2 1 
ATOM 3599 N N   . ARG C 3 40  ? 68.447  54.745 16.918  1.00 75.92  ? 40  ARG H N   1 
ATOM 3600 C CA  . ARG C 3 40  ? 68.801  54.317 15.570  1.00 75.92  ? 40  ARG H CA  1 
ATOM 3601 C C   . ARG C 3 40  ? 70.271  54.021 15.421  1.00 75.92  ? 40  ARG H C   1 
ATOM 3602 O O   . ARG C 3 40  ? 71.048  54.260 16.328  1.00 75.92  ? 40  ARG H O   1 
ATOM 3603 C CB  . ARG C 3 40  ? 68.400  55.375 14.542  1.00 58.68  ? 40  ARG H CB  1 
ATOM 3604 C CG  . ARG C 3 40  ? 68.422  54.855 13.096  1.00 58.68  ? 40  ARG H CG  1 
ATOM 3605 C CD  . ARG C 3 40  ? 68.061  55.921 12.060  1.00 58.68  ? 40  ARG H CD  1 
ATOM 3606 N NE  . ARG C 3 40  ? 66.636  56.001 11.728  1.00 58.68  ? 40  ARG H NE  1 
ATOM 3607 C CZ  . ARG C 3 40  ? 65.689  56.423 12.559  1.00 58.68  ? 40  ARG H CZ  1 
ATOM 3608 N NH1 . ARG C 3 40  ? 66.001  56.808 13.785  1.00 58.68  ? 40  ARG H NH1 1 
ATOM 3609 N NH2 . ARG C 3 40  ? 64.426  56.462 12.164  1.00 58.68  ? 40  ARG H NH2 1 
ATOM 3610 N N   . THR C 3 41  ? 70.653  53.491 14.268  1.00 74.36  ? 41  THR H N   1 
ATOM 3611 C CA  . THR C 3 41  ? 72.048  53.193 14.016  1.00 74.36  ? 41  THR H CA  1 
ATOM 3612 C C   . THR C 3 41  ? 72.740  54.525 14.175  1.00 74.36  ? 41  THR H C   1 
ATOM 3613 O O   . THR C 3 41  ? 72.103  55.488 14.596  1.00 74.36  ? 41  THR H O   1 
ATOM 3614 C CB  . THR C 3 41  ? 72.252  52.665 12.600  1.00 132.62 ? 41  THR H CB  1 
ATOM 3615 O OG1 . THR C 3 41  ? 73.653  52.478 12.365  1.00 132.62 ? 41  THR H OG1 1 
ATOM 3616 C CG2 . THR C 3 41  ? 71.661  53.635 11.581  1.00 132.62 ? 41  THR H CG2 1 
ATOM 3617 N N   . GLY C 3 42  ? 74.019  54.617 13.836  1.00 84.85  ? 42  GLY H N   1 
ATOM 3618 C CA  . GLY C 3 42  ? 74.677  55.896 14.023  1.00 84.85  ? 42  GLY H CA  1 
ATOM 3619 C C   . GLY C 3 42  ? 74.373  56.303 15.457  1.00 84.85  ? 42  GLY H C   1 
ATOM 3620 O O   . GLY C 3 42  ? 74.514  55.485 16.368  1.00 84.85  ? 42  GLY H O   1 
ATOM 3621 N N   . GLN C 3 43  ? 73.919  57.526 15.689  1.00 134.37 ? 43  GLN H N   1 
ATOM 3622 C CA  . GLN C 3 43  ? 73.646  57.917 17.064  1.00 134.37 ? 43  GLN H CA  1 
ATOM 3623 C C   . GLN C 3 43  ? 72.363  58.711 17.256  1.00 134.37 ? 43  GLN H C   1 
ATOM 3624 O O   . GLN C 3 43  ? 71.712  59.102 16.287  1.00 134.37 ? 43  GLN H O   1 
ATOM 3625 C CB  . GLN C 3 43  ? 74.844  58.697 17.612  1.00 147.17 ? 43  GLN H CB  1 
ATOM 3626 C CG  . GLN C 3 43  ? 76.097  57.840 17.789  1.00 147.17 ? 43  GLN H CG  1 
ATOM 3627 C CD  . GLN C 3 43  ? 77.367  58.534 17.321  1.00 147.17 ? 43  GLN H CD  1 
ATOM 3628 O OE1 . GLN C 3 43  ? 77.354  59.715 16.964  1.00 147.17 ? 43  GLN H OE1 1 
ATOM 3629 N NE2 . GLN C 3 43  ? 78.475  57.797 17.320  1.00 147.17 ? 43  GLN H NE2 1 
ATOM 3630 N N   . GLY C 3 44  ? 72.005  58.928 18.520  1.00 87.94  ? 44  GLY H N   1 
ATOM 3631 C CA  . GLY C 3 44  ? 70.806  59.676 18.855  1.00 87.94  ? 44  GLY H CA  1 
ATOM 3632 C C   . GLY C 3 44  ? 69.807  58.827 19.614  1.00 87.94  ? 44  GLY H C   1 
ATOM 3633 O O   . GLY C 3 44  ? 69.697  57.628 19.367  1.00 87.94  ? 44  GLY H O   1 
ATOM 3634 N N   . PHE C 3 45  ? 69.087  59.440 20.548  1.00 79.54  ? 45  PHE H N   1 
ATOM 3635 C CA  . PHE C 3 45  ? 68.075  58.726 21.325  1.00 79.54  ? 45  PHE H CA  1 
ATOM 3636 C C   . PHE C 3 45  ? 66.709  59.389 21.200  1.00 79.54  ? 45  PHE H C   1 
ATOM 3637 O O   . PHE C 3 45  ? 66.598  60.613 21.204  1.00 79.54  ? 45  PHE H O   1 
ATOM 3638 C CB  . PHE C 3 45  ? 68.453  58.691 22.799  1.00 51.03  ? 45  PHE H CB  1 
ATOM 3639 C CG  . PHE C 3 45  ? 69.506  57.693 23.137  1.00 51.03  ? 45  PHE H CG  1 
ATOM 3640 C CD1 . PHE C 3 45  ? 69.169  56.373 23.389  1.00 51.03  ? 45  PHE H CD1 1 
ATOM 3641 C CD2 . PHE C 3 45  ? 70.841  58.077 23.225  1.00 51.03  ? 45  PHE H CD2 1 
ATOM 3642 C CE1 . PHE C 3 45  ? 70.149  55.443 23.731  1.00 51.03  ? 45  PHE H CE1 1 
ATOM 3643 C CE2 . PHE C 3 45  ? 71.833  57.158 23.566  1.00 51.03  ? 45  PHE H CE2 1 
ATOM 3644 C CZ  . PHE C 3 45  ? 71.485  55.837 23.821  1.00 51.03  ? 45  PHE H CZ  1 
ATOM 3645 N N   . GLU C 3 46  ? 65.669  58.579 21.077  1.00 53.35  ? 46  GLU H N   1 
ATOM 3646 C CA  . GLU C 3 46  ? 64.335  59.115 20.983  1.00 53.35  ? 46  GLU H CA  1 
ATOM 3647 C C   . GLU C 3 46  ? 63.407  58.231 21.795  1.00 53.35  ? 46  GLU H C   1 
ATOM 3648 O O   . GLU C 3 46  ? 63.141  57.068 21.444  1.00 53.35  ? 46  GLU H O   1 
ATOM 3649 C CB  . GLU C 3 46  ? 63.879  59.210 19.524  1.00 136.18 ? 46  GLU H CB  1 
ATOM 3650 C CG  . GLU C 3 46  ? 64.046  57.933 18.727  1.00 136.18 ? 46  GLU H CG  1 
ATOM 3651 C CD  . GLU C 3 46  ? 63.581  58.071 17.287  1.00 136.18 ? 46  GLU H CD  1 
ATOM 3652 O OE1 . GLU C 3 46  ? 62.453  58.567 17.072  1.00 136.18 ? 46  GLU H OE1 1 
ATOM 3653 O OE2 . GLU C 3 46  ? 64.337  57.676 16.373  1.00 136.18 ? 46  GLU H OE2 1 
ATOM 3654 N N   . TRP C 3 47  ? 62.955  58.788 22.918  1.00 67.67  ? 47  TRP H N   1 
ATOM 3655 C CA  . TRP C 3 47  ? 62.032  58.120 23.842  1.00 67.67  ? 47  TRP H CA  1 
ATOM 3656 C C   . TRP C 3 47  ? 60.706  57.698 23.142  1.00 67.67  ? 47  TRP H C   1 
ATOM 3657 O O   . TRP C 3 47  ? 60.026  58.503 22.514  1.00 67.67  ? 47  TRP H O   1 
ATOM 3658 C CB  . TRP C 3 47  ? 61.769  59.092 24.978  1.00 65.89  ? 47  TRP H CB  1 
ATOM 3659 C CG  . TRP C 3 47  ? 60.737  58.683 25.927  1.00 65.89  ? 47  TRP H CG  1 
ATOM 3660 C CD1 . TRP C 3 47  ? 60.851  57.762 26.910  1.00 65.89  ? 47  TRP H CD1 1 
ATOM 3661 C CD2 . TRP C 3 47  ? 59.439  59.253 26.052  1.00 65.89  ? 47  TRP H CD2 1 
ATOM 3662 N NE1 . TRP C 3 47  ? 59.705  57.726 27.657  1.00 65.89  ? 47  TRP H NE1 1 
ATOM 3663 C CE2 . TRP C 3 47  ? 58.817  58.634 27.146  1.00 65.89  ? 47  TRP H CE2 1 
ATOM 3664 C CE3 . TRP C 3 47  ? 58.739  60.236 25.342  1.00 65.89  ? 47  TRP H CE3 1 
ATOM 3665 C CZ2 . TRP C 3 47  ? 57.525  58.961 27.552  1.00 65.89  ? 47  TRP H CZ2 1 
ATOM 3666 C CZ3 . TRP C 3 47  ? 57.457  60.561 25.742  1.00 65.89  ? 47  TRP H CZ3 1 
ATOM 3667 C CH2 . TRP C 3 47  ? 56.862  59.925 26.838  1.00 65.89  ? 47  TRP H CH2 1 
ATOM 3668 N N   . ILE C 3 48  ? 60.345  56.431 23.237  1.00 63.45  ? 48  ILE H N   1 
ATOM 3669 C CA  . ILE C 3 48  ? 59.129  55.961 22.595  1.00 63.45  ? 48  ILE H CA  1 
ATOM 3670 C C   . ILE C 3 48  ? 57.954  55.980 23.529  1.00 63.45  ? 48  ILE H C   1 
ATOM 3671 O O   . ILE C 3 48  ? 56.821  55.861 23.097  1.00 63.45  ? 48  ILE H O   1 
ATOM 3672 C CB  . ILE C 3 48  ? 59.263  54.518 22.111  1.00 48.66  ? 48  ILE H CB  1 
ATOM 3673 C CG1 . ILE C 3 48  ? 60.474  54.402 21.195  1.00 48.66  ? 48  ILE H CG1 1 
ATOM 3674 C CG2 . ILE C 3 48  ? 58.002  54.083 21.410  1.00 48.66  ? 48  ILE H CG2 1 
ATOM 3675 C CD1 . ILE C 3 48  ? 60.792  52.975 20.758  1.00 48.66  ? 48  ILE H CD1 1 
ATOM 3676 N N   . GLY C 3 49  ? 58.205  56.113 24.820  1.00 77.44  ? 49  GLY H N   1 
ATOM 3677 C CA  . GLY C 3 49  ? 57.091  56.107 25.744  1.00 77.44  ? 49  GLY H CA  1 
ATOM 3678 C C   . GLY C 3 49  ? 57.470  55.434 27.039  1.00 77.44  ? 49  GLY H C   1 
ATOM 3679 O O   . GLY C 3 49  ? 58.505  54.777 27.129  1.00 77.44  ? 49  GLY H O   1 
ATOM 3680 N N   . GLU C 3 50  ? 56.613  55.587 28.039  1.00 95.57  ? 50  GLU H N   1 
ATOM 3681 C CA  . GLU C 3 50  ? 56.856  55.036 29.362  1.00 95.57  ? 50  GLU H CA  1 
ATOM 3682 C C   . GLU C 3 50  ? 55.572  54.403 29.899  1.00 95.57  ? 50  GLU H C   1 
ATOM 3683 O O   . GLU C 3 50  ? 54.488  54.970 29.784  1.00 95.57  ? 50  GLU H O   1 
ATOM 3684 C CB  . GLU C 3 50  ? 57.331  56.179 30.260  1.00 75.25  ? 50  GLU H CB  1 
ATOM 3685 C CG  . GLU C 3 50  ? 57.810  55.834 31.643  1.00 75.25  ? 50  GLU H CG  1 
ATOM 3686 C CD  . GLU C 3 50  ? 58.140  57.101 32.444  1.00 75.25  ? 50  GLU H CD  1 
ATOM 3687 O OE1 . GLU C 3 50  ? 57.244  57.971 32.601  1.00 75.25  ? 50  GLU H OE1 1 
ATOM 3688 O OE2 . GLU C 3 50  ? 59.295  57.234 32.914  1.00 75.25  ? 50  GLU H OE2 1 
ATOM 3689 N N   . ILE C 3 51  ? 55.687  53.216 30.469  1.00 58.39  ? 51  ILE H N   1 
ATOM 3690 C CA  . ILE C 3 51  ? 54.521  52.544 31.005  1.00 58.39  ? 51  ILE H CA  1 
ATOM 3691 C C   . ILE C 3 51  ? 54.855  52.171 32.428  1.00 58.39  ? 51  ILE H C   1 
ATOM 3692 O O   . ILE C 3 51  ? 55.963  51.713 32.709  1.00 58.39  ? 51  ILE H O   1 
ATOM 3693 C CB  . ILE C 3 51  ? 54.192  51.287 30.171  1.00 50.30  ? 51  ILE H CB  1 
ATOM 3694 C CG1 . ILE C 3 51  ? 52.984  50.539 30.740  1.00 50.30  ? 51  ILE H CG1 1 
ATOM 3695 C CG2 . ILE C 3 51  ? 55.420  50.399 30.093  1.00 50.30  ? 51  ILE H CG2 1 
ATOM 3696 C CD1 . ILE C 3 51  ? 53.315  49.521 31.789  1.00 50.30  ? 51  ILE H CD1 1 
ATOM 3697 N N   . TYR C 3 52  ? 53.904  52.395 33.330  1.00 67.08  ? 52  TYR H N   1 
ATOM 3698 C CA  . TYR C 3 52  ? 54.089  52.086 34.749  1.00 67.08  ? 52  TYR H CA  1 
ATOM 3699 C C   . TYR C 3 52  ? 53.438  50.743 35.072  1.00 67.08  ? 52  TYR H C   1 
ATOM 3700 O O   . TYR C 3 52  ? 52.246  50.674 35.374  1.00 67.08  ? 52  TYR H O   1 
ATOM 3701 C CB  . TYR C 3 52  ? 53.468  53.181 35.614  1.00 108.64 ? 52  TYR H CB  1 
ATOM 3702 C CG  . TYR C 3 52  ? 53.746  53.013 37.083  1.00 108.64 ? 52  TYR H CG  1 
ATOM 3703 C CD1 . TYR C 3 52  ? 55.051  53.077 37.571  1.00 108.64 ? 52  TYR H CD1 1 
ATOM 3704 C CD2 . TYR C 3 52  ? 52.711  52.779 37.990  1.00 108.64 ? 52  TYR H CD2 1 
ATOM 3705 C CE1 . TYR C 3 52  ? 55.326  52.912 38.928  1.00 108.64 ? 52  TYR H CE1 1 
ATOM 3706 C CE2 . TYR C 3 52  ? 52.976  52.611 39.358  1.00 108.64 ? 52  TYR H CE2 1 
ATOM 3707 C CZ  . TYR C 3 52  ? 54.286  52.680 39.813  1.00 108.64 ? 52  TYR H CZ  1 
ATOM 3708 O OH  . TYR C 3 52  ? 54.567  52.514 41.144  1.00 108.64 ? 52  TYR H OH  1 
ATOM 3709 N N   . PRO C 3 53  ? 54.226  49.658 35.024  1.00 79.26  ? 53  PRO H N   1 
ATOM 3710 C CA  . PRO C 3 53  ? 53.737  48.302 35.299  1.00 79.26  ? 53  PRO H CA  1 
ATOM 3711 C C   . PRO C 3 53  ? 52.757  48.225 36.459  1.00 79.26  ? 53  PRO H C   1 
ATOM 3712 O O   . PRO C 3 53  ? 51.700  47.609 36.335  1.00 79.26  ? 53  PRO H O   1 
ATOM 3713 C CB  . PRO C 3 53  ? 55.023  47.507 35.539  1.00 90.04  ? 53  PRO H CB  1 
ATOM 3714 C CG  . PRO C 3 53  ? 55.986  48.550 36.012  1.00 90.04  ? 53  PRO H CG  1 
ATOM 3715 C CD  . PRO C 3 53  ? 55.695  49.692 35.083  1.00 90.04  ? 53  PRO H CD  1 
ATOM 3716 N N   . GLY C 3 54  ? 53.102  48.854 37.578  1.00 95.44  ? 54  GLY H N   1 
ATOM 3717 C CA  . GLY C 3 54  ? 52.211  48.839 38.725  1.00 95.44  ? 54  GLY H CA  1 
ATOM 3718 C C   . GLY C 3 54  ? 50.777  49.248 38.397  1.00 95.44  ? 54  GLY H C   1 
ATOM 3719 O O   . GLY C 3 54  ? 49.844  48.446 38.522  1.00 95.44  ? 54  GLY H O   1 
ATOM 3720 N N   . SER C 3 55  ? 50.602  50.500 37.973  1.00 94.75  ? 55  SER H N   1 
ATOM 3721 C CA  . SER C 3 55  ? 49.287  51.039 37.630  1.00 94.75  ? 55  SER H CA  1 
ATOM 3722 C C   . SER C 3 55  ? 48.763  50.557 36.287  1.00 94.75  ? 55  SER H C   1 
ATOM 3723 O O   . SER C 3 55  ? 48.048  49.562 36.204  1.00 94.75  ? 55  SER H O   1 
ATOM 3724 C CB  . SER C 3 55  ? 49.342  52.564 37.613  1.00 109.53 ? 55  SER H CB  1 
ATOM 3725 O OG  . SER C 3 55  ? 48.201  53.097 36.968  1.00 109.53 ? 55  SER H OG  1 
ATOM 3726 N N   . GLY C 3 56  ? 49.126  51.290 35.242  1.00 106.87 ? 56  GLY H N   1 
ATOM 3727 C CA  . GLY C 3 56  ? 48.698  50.966 33.896  1.00 106.87 ? 56  GLY H CA  1 
ATOM 3728 C C   . GLY C 3 56  ? 48.948  52.167 33.002  1.00 106.87 ? 56  GLY H C   1 
ATOM 3729 O O   . GLY C 3 56  ? 48.923  52.058 31.777  1.00 106.87 ? 56  GLY H O   1 
ATOM 3730 N N   . ASN C 3 57  ? 49.187  53.322 33.621  1.00 102.48 ? 57  ASN H N   1 
ATOM 3731 C CA  . ASN C 3 57  ? 49.451  54.554 32.884  1.00 102.48 ? 57  ASN H CA  1 
ATOM 3732 C C   . ASN C 3 57  ? 50.523  54.320 31.853  1.00 102.48 ? 57  ASN H C   1 
ATOM 3733 O O   . ASN C 3 57  ? 51.613  53.859 32.186  1.00 102.48 ? 57  ASN H O   1 
ATOM 3734 C CB  . ASN C 3 57  ? 49.925  55.668 33.820  1.00 132.97 ? 57  ASN H CB  1 
ATOM 3735 C CG  . ASN C 3 57  ? 48.784  56.406 34.467  1.00 132.97 ? 57  ASN H CG  1 
ATOM 3736 O OD1 . ASN C 3 57  ? 47.939  55.808 35.134  1.00 132.97 ? 57  ASN H OD1 1 
ATOM 3737 N ND2 . ASN C 3 57  ? 48.747  57.719 34.274  1.00 132.97 ? 57  ASN H ND2 1 
ATOM 3738 N N   . ILE C 3 58  ? 50.212  54.627 30.599  1.00 95.64  ? 58  ILE H N   1 
ATOM 3739 C CA  . ILE C 3 58  ? 51.188  54.468 29.531  1.00 95.64  ? 58  ILE H CA  1 
ATOM 3740 C C   . ILE C 3 58  ? 51.225  55.759 28.762  1.00 95.64  ? 58  ILE H C   1 
ATOM 3741 O O   . ILE C 3 58  ? 50.378  55.989 27.911  1.00 95.64  ? 58  ILE H O   1 
ATOM 3742 C CB  . ILE C 3 58  ? 50.804  53.371 28.544  1.00 78.57  ? 58  ILE H CB  1 
ATOM 3743 C CG1 . ILE C 3 58  ? 50.428  52.094 29.301  1.00 78.57  ? 58  ILE H CG1 1 
ATOM 3744 C CG2 . ILE C 3 58  ? 51.964  53.129 27.591  1.00 78.57  ? 58  ILE H CG2 1 
ATOM 3745 C CD1 . ILE C 3 58  ? 49.875  51.006 28.426  1.00 78.57  ? 58  ILE H CD1 1 
ATOM 3746 N N   . ASP C 3 59  ? 52.196  56.611 29.065  1.00 87.77  ? 59  ASP H N   1 
ATOM 3747 C CA  . ASP C 3 59  ? 52.313  57.888 28.370  1.00 87.77  ? 59  ASP H CA  1 
ATOM 3748 C C   . ASP C 3 59  ? 53.175  57.749 27.123  1.00 87.77  ? 59  ASP H C   1 
ATOM 3749 O O   . ASP C 3 59  ? 54.400  57.658 27.196  1.00 87.77  ? 59  ASP H O   1 
ATOM 3750 C CB  . ASP C 3 59  ? 52.900  58.945 29.303  1.00 105.04 ? 59  ASP H CB  1 
ATOM 3751 C CG  . ASP C 3 59  ? 52.082  59.116 30.557  1.00 105.04 ? 59  ASP H CG  1 
ATOM 3752 O OD1 . ASP C 3 59  ? 50.853  59.318 30.441  1.00 105.04 ? 59  ASP H OD1 1 
ATOM 3753 O OD2 . ASP C 3 59  ? 52.666  59.049 31.657  1.00 105.04 ? 59  ASP H OD2 1 
ATOM 3754 N N   . TYR C 3 60  ? 52.526  57.731 25.969  1.00 64.47  ? 60  TYR H N   1 
ATOM 3755 C CA  . TYR C 3 60  ? 53.265  57.597 24.740  1.00 64.47  ? 60  TYR H CA  1 
ATOM 3756 C C   . TYR C 3 60  ? 53.785  58.939 24.300  1.00 64.47  ? 60  TYR H C   1 
ATOM 3757 O O   . TYR C 3 60  ? 53.270  59.975 24.679  1.00 64.47  ? 60  TYR H O   1 
ATOM 3758 C CB  . TYR C 3 60  ? 52.383  57.023 23.626  1.00 68.71  ? 60  TYR H CB  1 
ATOM 3759 C CG  . TYR C 3 60  ? 51.861  55.641 23.899  1.00 68.71  ? 60  TYR H CG  1 
ATOM 3760 C CD1 . TYR C 3 60  ? 50.643  55.461 24.520  1.00 68.71  ? 60  TYR H CD1 1 
ATOM 3761 C CD2 . TYR C 3 60  ? 52.589  54.509 23.537  1.00 68.71  ? 60  TYR H CD2 1 
ATOM 3762 C CE1 . TYR C 3 60  ? 50.150  54.194 24.772  1.00 68.71  ? 60  TYR H CE1 1 
ATOM 3763 C CE2 . TYR C 3 60  ? 52.102  53.235 23.788  1.00 68.71  ? 60  TYR H CE2 1 
ATOM 3764 C CZ  . TYR C 3 60  ? 50.876  53.087 24.403  1.00 68.71  ? 60  TYR H CZ  1 
ATOM 3765 O OH  . TYR C 3 60  ? 50.332  51.843 24.622  1.00 68.71  ? 60  TYR H OH  1 
ATOM 3766 N N   . ASN C 3 61  ? 54.831  58.904 23.504  1.00 86.00  ? 61  ASN H N   1 
ATOM 3767 C CA  . ASN C 3 61  ? 55.384  60.108 22.949  1.00 86.00  ? 61  ASN H CA  1 
ATOM 3768 C C   . ASN C 3 61  ? 54.510  60.301 21.704  1.00 86.00  ? 61  ASN H C   1 
ATOM 3769 O O   . ASN C 3 61  ? 54.236  59.330 21.001  1.00 86.00  ? 61  ASN H O   1 
ATOM 3770 C CB  . ASN C 3 61  ? 56.826  59.841 22.555  1.00 102.50 ? 61  ASN H CB  1 
ATOM 3771 C CG  . ASN C 3 61  ? 57.330  60.808 21.526  1.00 102.50 ? 61  ASN H CG  1 
ATOM 3772 O OD1 . ASN C 3 61  ? 56.749  60.934 20.444  1.00 102.50 ? 61  ASN H OD1 1 
ATOM 3773 N ND2 . ASN C 3 61  ? 58.423  61.501 21.843  1.00 102.50 ? 61  ASN H ND2 1 
ATOM 3774 N N   . GLU C 3 62  ? 54.056  61.526 21.433  1.00 83.16  ? 62  GLU H N   1 
ATOM 3775 C CA  . GLU C 3 62  ? 53.219  61.781 20.255  1.00 83.16  ? 62  GLU H CA  1 
ATOM 3776 C C   . GLU C 3 62  ? 53.654  60.947 19.068  1.00 83.16  ? 62  GLU H C   1 
ATOM 3777 O O   . GLU C 3 62  ? 52.917  60.078 18.610  1.00 83.16  ? 62  GLU H O   1 
ATOM 3778 C CB  . GLU C 3 62  ? 53.267  63.253 19.835  1.00 189.00 ? 62  GLU H CB  1 
ATOM 3779 C CG  . GLU C 3 62  ? 52.338  64.182 20.592  1.00 189.00 ? 62  GLU H CG  1 
ATOM 3780 C CD  . GLU C 3 62  ? 52.195  65.532 19.909  1.00 189.00 ? 62  GLU H CD  1 
ATOM 3781 O OE1 . GLU C 3 62  ? 53.217  66.232 19.727  1.00 189.00 ? 62  GLU H OE1 1 
ATOM 3782 O OE2 . GLU C 3 62  ? 51.054  65.890 19.550  1.00 189.00 ? 62  GLU H OE2 1 
ATOM 3783 N N   . ARG C 3 63  ? 54.860  61.215 18.577  1.00 80.11  ? 63  ARG H N   1 
ATOM 3784 C CA  . ARG C 3 63  ? 55.387  60.510 17.424  1.00 80.11  ? 63  ARG H CA  1 
ATOM 3785 C C   . ARG C 3 63  ? 54.998  59.043 17.360  1.00 80.11  ? 63  ARG H C   1 
ATOM 3786 O O   . ARG C 3 63  ? 54.408  58.611 16.376  1.00 80.11  ? 63  ARG H O   1 
ATOM 3787 C CB  . ARG C 3 63  ? 56.897  60.676 17.364  1.00 132.50 ? 63  ARG H CB  1 
ATOM 3788 C CG  . ARG C 3 63  ? 57.299  62.110 17.090  1.00 132.50 ? 63  ARG H CG  1 
ATOM 3789 C CD  . ARG C 3 63  ? 58.776  62.317 17.289  1.00 132.50 ? 63  ARG H CD  1 
ATOM 3790 N NE  . ARG C 3 63  ? 59.032  63.547 18.029  1.00 132.50 ? 63  ARG H NE  1 
ATOM 3791 C CZ  . ARG C 3 63  ? 60.038  63.701 18.885  1.00 132.50 ? 63  ARG H CZ  1 
ATOM 3792 N NH1 . ARG C 3 63  ? 60.883  62.697 19.105  1.00 132.50 ? 63  ARG H NH1 1 
ATOM 3793 N NH2 . ARG C 3 63  ? 60.189  64.849 19.535  1.00 132.50 ? 63  ARG H NH2 1 
ATOM 3794 N N   . PHE C 3 64  ? 55.288  58.268 18.397  1.00 79.15  ? 64  PHE H N   1 
ATOM 3795 C CA  . PHE C 3 64  ? 54.925  56.853 18.350  1.00 79.15  ? 64  PHE H CA  1 
ATOM 3796 C C   . PHE C 3 64  ? 53.521  56.603 18.864  1.00 79.15  ? 64  PHE H C   1 
ATOM 3797 O O   . PHE C 3 64  ? 53.116  55.458 19.001  1.00 79.15  ? 64  PHE H O   1 
ATOM 3798 C CB  . PHE C 3 64  ? 55.914  55.994 19.156  1.00 64.66  ? 64  PHE H CB  1 
ATOM 3799 C CG  . PHE C 3 64  ? 57.354  56.227 18.797  1.00 64.66  ? 64  PHE H CG  1 
ATOM 3800 C CD1 . PHE C 3 64  ? 57.990  57.417 19.135  1.00 64.66  ? 64  PHE H CD1 1 
ATOM 3801 C CD2 . PHE C 3 64  ? 58.071  55.271 18.094  1.00 64.66  ? 64  PHE H CD2 1 
ATOM 3802 C CE1 . PHE C 3 64  ? 59.316  57.643 18.772  1.00 64.66  ? 64  PHE H CE1 1 
ATOM 3803 C CE2 . PHE C 3 64  ? 59.402  55.500 17.730  1.00 64.66  ? 64  PHE H CE2 1 
ATOM 3804 C CZ  . PHE C 3 64  ? 60.021  56.681 18.068  1.00 64.66  ? 64  PHE H CZ  1 
ATOM 3805 N N   . LYS C 3 65  ? 52.777  57.665 19.145  1.00 116.01 ? 65  LYS H N   1 
ATOM 3806 C CA  . LYS C 3 65  ? 51.421  57.527 19.663  1.00 116.01 ? 65  LYS H CA  1 
ATOM 3807 C C   . LYS C 3 65  ? 50.671  56.326 19.075  1.00 116.01 ? 65  LYS H C   1 
ATOM 3808 O O   . LYS C 3 65  ? 50.365  55.368 19.790  1.00 116.01 ? 65  LYS H O   1 
ATOM 3809 C CB  . LYS C 3 65  ? 50.629  58.809 19.404  1.00 155.53 ? 65  LYS H CB  1 
ATOM 3810 C CG  . LYS C 3 65  ? 49.215  58.802 19.954  1.00 155.53 ? 65  LYS H CG  1 
ATOM 3811 C CD  . LYS C 3 65  ? 48.520  60.111 19.624  1.00 155.53 ? 65  LYS H CD  1 
ATOM 3812 C CE  . LYS C 3 65  ? 47.068  60.104 20.075  1.00 155.53 ? 65  LYS H CE  1 
ATOM 3813 N NZ  . LYS C 3 65  ? 46.367  61.387 19.754  1.00 155.53 ? 65  LYS H NZ  1 
ATOM 3814 N N   . ASP C 3 66  ? 50.378  56.366 17.780  1.00 127.64 ? 66  ASP H N   1 
ATOM 3815 C CA  . ASP C 3 66  ? 49.657  55.267 17.161  1.00 127.64 ? 66  ASP H CA  1 
ATOM 3816 C C   . ASP C 3 66  ? 50.571  54.133 16.690  1.00 127.64 ? 66  ASP H C   1 
ATOM 3817 O O   . ASP C 3 66  ? 50.107  53.012 16.457  1.00 127.64 ? 66  ASP H O   1 
ATOM 3818 C CB  . ASP C 3 66  ? 48.798  55.785 16.001  1.00 149.40 ? 66  ASP H CB  1 
ATOM 3819 C CG  . ASP C 3 66  ? 49.608  56.494 14.941  1.00 149.40 ? 66  ASP H CG  1 
ATOM 3820 O OD1 . ASP C 3 66  ? 48.989  57.046 14.003  1.00 149.40 ? 66  ASP H OD1 1 
ATOM 3821 O OD2 . ASP C 3 66  ? 50.854  56.498 15.042  1.00 149.40 ? 66  ASP H OD2 1 
ATOM 3822 N N   . LYS C 3 67  ? 51.869  54.410 16.573  1.00 94.41  ? 67  LYS H N   1 
ATOM 3823 C CA  . LYS C 3 67  ? 52.840  53.399 16.135  1.00 94.41  ? 67  LYS H CA  1 
ATOM 3824 C C   . LYS C 3 67  ? 53.064  52.257 17.136  1.00 94.41  ? 67  LYS H C   1 
ATOM 3825 O O   . LYS C 3 67  ? 52.907  51.080 16.808  1.00 94.41  ? 67  LYS H O   1 
ATOM 3826 C CB  . LYS C 3 67  ? 54.189  54.057 15.849  1.00 100.57 ? 67  LYS H CB  1 
ATOM 3827 C CG  . LYS C 3 67  ? 55.248  53.081 15.342  1.00 100.57 ? 67  LYS H CG  1 
ATOM 3828 C CD  . LYS C 3 67  ? 54.838  52.481 14.010  1.00 100.57 ? 67  LYS H CD  1 
ATOM 3829 C CE  . LYS C 3 67  ? 56.034  51.944 13.251  1.00 100.57 ? 67  LYS H CE  1 
ATOM 3830 N NZ  . LYS C 3 67  ? 55.694  51.757 11.815  1.00 100.57 ? 67  LYS H NZ  1 
ATOM 3831 N N   . ALA C 3 68  ? 53.442  52.616 18.356  1.00 91.82  ? 68  ALA H N   1 
ATOM 3832 C CA  . ALA C 3 68  ? 53.706  51.625 19.378  1.00 91.82  ? 68  ALA H CA  1 
ATOM 3833 C C   . ALA C 3 68  ? 52.673  51.636 20.495  1.00 91.82  ? 68  ALA H C   1 
ATOM 3834 O O   . ALA C 3 68  ? 52.021  52.650 20.741  1.00 91.82  ? 68  ALA H O   1 
ATOM 3835 C CB  . ALA C 3 68  ? 55.087  51.850 19.946  1.00 58.27  ? 68  ALA H CB  1 
ATOM 3836 N N   . THR C 3 69  ? 52.528  50.489 21.159  1.00 62.56  ? 69  THR H N   1 
ATOM 3837 C CA  . THR C 3 69  ? 51.603  50.323 22.276  1.00 62.56  ? 69  THR H CA  1 
ATOM 3838 C C   . THR C 3 69  ? 52.235  49.460 23.373  1.00 62.56  ? 69  THR H C   1 
ATOM 3839 O O   . THR C 3 69  ? 52.414  48.253 23.229  1.00 62.56  ? 69  THR H O   1 
ATOM 3840 C CB  . THR C 3 69  ? 50.272  49.713 21.814  1.00 71.28  ? 69  THR H CB  1 
ATOM 3841 O OG1 . THR C 3 69  ? 50.503  48.775 20.760  1.00 71.28  ? 69  THR H OG1 1 
ATOM 3842 C CG2 . THR C 3 69  ? 49.363  50.798 21.298  1.00 71.28  ? 69  THR H CG2 1 
ATOM 3843 N N   . LEU C 3 70  ? 52.593  50.119 24.469  1.00 78.77  ? 70  LEU H N   1 
ATOM 3844 C CA  . LEU C 3 70  ? 53.221  49.460 25.597  1.00 78.77  ? 70  LEU H CA  1 
ATOM 3845 C C   . LEU C 3 70  ? 52.233  48.610 26.364  1.00 78.77  ? 70  LEU H C   1 
ATOM 3846 O O   . LEU C 3 70  ? 51.020  48.824 26.296  1.00 78.77  ? 70  LEU H O   1 
ATOM 3847 C CB  . LEU C 3 70  ? 53.826  50.490 26.536  1.00 63.99  ? 70  LEU H CB  1 
ATOM 3848 C CG  . LEU C 3 70  ? 54.733  51.534 25.895  1.00 63.99  ? 70  LEU H CG  1 
ATOM 3849 C CD1 . LEU C 3 70  ? 55.599  52.159 26.981  1.00 63.99  ? 70  LEU H CD1 1 
ATOM 3850 C CD2 . LEU C 3 70  ? 55.616  50.895 24.845  1.00 63.99  ? 70  LEU H CD2 1 
ATOM 3851 N N   . THR C 3 71  ? 52.768  47.654 27.110  1.00 90.94  ? 71  THR H N   1 
ATOM 3852 C CA  . THR C 3 71  ? 51.960  46.737 27.889  1.00 90.94  ? 71  THR H CA  1 
ATOM 3853 C C   . THR C 3 71  ? 52.903  45.990 28.822  1.00 90.94  ? 71  THR H C   1 
ATOM 3854 O O   . THR C 3 71  ? 54.042  45.691 28.452  1.00 90.94  ? 71  THR H O   1 
ATOM 3855 C CB  . THR C 3 71  ? 51.228  45.755 26.953  1.00 79.16  ? 71  THR H CB  1 
ATOM 3856 O OG1 . THR C 3 71  ? 50.718  44.658 27.710  1.00 79.16  ? 71  THR H OG1 1 
ATOM 3857 C CG2 . THR C 3 71  ? 52.164  45.231 25.885  1.00 79.16  ? 71  THR H CG2 1 
ATOM 3858 N N   . ALA C 3 72  ? 52.428  45.710 30.035  1.00 96.01  ? 72  ALA H N   1 
ATOM 3859 C CA  . ALA C 3 72  ? 53.219  45.012 31.049  1.00 96.01  ? 72  ALA H CA  1 
ATOM 3860 C C   . ALA C 3 72  ? 52.533  43.751 31.542  1.00 96.01  ? 72  ALA H C   1 
ATOM 3861 O O   . ALA C 3 72  ? 51.308  43.633 31.459  1.00 96.01  ? 72  ALA H O   1 
ATOM 3862 C CB  . ALA C 3 72  ? 53.466  45.928 32.224  1.00 80.16  ? 72  ALA H CB  1 
ATOM 3863 N N   . ASP C 3 73  ? 53.324  42.817 32.072  1.00 97.81  ? 73  ASP H N   1 
ATOM 3864 C CA  . ASP C 3 73  ? 52.793  41.556 32.595  1.00 97.81  ? 73  ASP H CA  1 
ATOM 3865 C C   . ASP C 3 73  ? 53.250  41.346 34.036  1.00 97.81  ? 73  ASP H C   1 
ATOM 3866 O O   . ASP C 3 73  ? 54.338  40.827 34.287  1.00 97.81  ? 73  ASP H O   1 
ATOM 3867 C CB  . ASP C 3 73  ? 53.259  40.384 31.732  1.00 131.56 ? 73  ASP H CB  1 
ATOM 3868 C CG  . ASP C 3 73  ? 52.297  39.219 31.775  1.00 131.56 ? 73  ASP H CG  1 
ATOM 3869 O OD1 . ASP C 3 73  ? 51.148  39.381 31.310  1.00 131.56 ? 73  ASP H OD1 1 
ATOM 3870 O OD2 . ASP C 3 73  ? 52.687  38.146 32.276  1.00 131.56 ? 73  ASP H OD2 1 
ATOM 3871 N N   . LYS C 3 74  ? 52.398  41.755 34.972  1.00 140.04 ? 74  LYS H N   1 
ATOM 3872 C CA  . LYS C 3 74  ? 52.662  41.671 36.407  1.00 140.04 ? 74  LYS H CA  1 
ATOM 3873 C C   . LYS C 3 74  ? 53.227  40.328 36.869  1.00 140.04 ? 74  LYS H C   1 
ATOM 3874 O O   . LYS C 3 74  ? 54.149  40.279 37.682  1.00 140.04 ? 74  LYS H O   1 
ATOM 3875 C CB  . LYS C 3 74  ? 51.374  42.010 37.169  1.00 187.84 ? 74  LYS H CB  1 
ATOM 3876 C CG  . LYS C 3 74  ? 50.787  43.369 36.769  1.00 187.84 ? 74  LYS H CG  1 
ATOM 3877 C CD  . LYS C 3 74  ? 49.435  43.658 37.415  1.00 187.84 ? 74  LYS H CD  1 
ATOM 3878 C CE  . LYS C 3 74  ? 48.855  44.976 36.901  1.00 187.84 ? 74  LYS H CE  1 
ATOM 3879 N NZ  . LYS C 3 74  ? 47.506  45.283 37.459  1.00 187.84 ? 74  LYS H NZ  1 
ATOM 3880 N N   . SER C 3 75  ? 52.672  39.242 36.351  1.00 102.44 ? 75  SER H N   1 
ATOM 3881 C CA  . SER C 3 75  ? 53.135  37.908 36.704  1.00 102.44 ? 75  SER H CA  1 
ATOM 3882 C C   . SER C 3 75  ? 54.537  37.646 36.151  1.00 102.44 ? 75  SER H C   1 
ATOM 3883 O O   . SER C 3 75  ? 55.520  37.643 36.905  1.00 102.44 ? 75  SER H O   1 
ATOM 3884 C CB  . SER C 3 75  ? 52.169  36.862 36.147  1.00 138.66 ? 75  SER H CB  1 
ATOM 3885 O OG  . SER C 3 75  ? 52.755  35.571 36.159  1.00 138.66 ? 75  SER H OG  1 
ATOM 3886 N N   . SER C 3 76  ? 54.601  37.430 34.831  1.00 102.91 ? 76  SER H N   1 
ATOM 3887 C CA  . SER C 3 76  ? 55.836  37.145 34.089  1.00 102.91 ? 76  SER H CA  1 
ATOM 3888 C C   . SER C 3 76  ? 56.947  38.112 34.422  1.00 102.91 ? 76  SER H C   1 
ATOM 3889 O O   . SER C 3 76  ? 58.122  37.797 34.265  1.00 102.91 ? 76  SER H O   1 
ATOM 3890 C CB  . SER C 3 76  ? 55.583  37.202 32.581  1.00 136.08 ? 76  SER H CB  1 
ATOM 3891 O OG  . SER C 3 76  ? 54.604  36.262 32.185  1.00 136.08 ? 76  SER H OG  1 
ATOM 3892 N N   . SER C 3 77  ? 56.560  39.300 34.866  1.00 82.10  ? 77  SER H N   1 
ATOM 3893 C CA  . SER C 3 77  ? 57.512  40.334 35.240  1.00 82.10  ? 77  SER H CA  1 
ATOM 3894 C C   . SER C 3 77  ? 58.357  40.654 34.017  1.00 82.10  ? 77  SER H C   1 
ATOM 3895 O O   . SER C 3 77  ? 59.592  40.715 34.065  1.00 82.10  ? 77  SER H O   1 
ATOM 3896 C CB  . SER C 3 77  ? 58.384  39.848 36.404  1.00 124.42 ? 77  SER H CB  1 
ATOM 3897 O OG  . SER C 3 77  ? 58.456  40.815 37.446  1.00 124.42 ? 77  SER H OG  1 
ATOM 3898 N N   . THR C 3 78  ? 57.645  40.827 32.909  1.00 99.33  ? 78  THR H N   1 
ATOM 3899 C CA  . THR C 3 78  ? 58.222  41.169 31.618  1.00 99.33  ? 78  THR H CA  1 
ATOM 3900 C C   . THR C 3 78  ? 57.256  42.197 31.030  1.00 99.33  ? 78  THR H C   1 
ATOM 3901 O O   . THR C 3 78  ? 56.069  42.214 31.376  1.00 99.33  ? 78  THR H O   1 
ATOM 3902 C CB  . THR C 3 78  ? 58.285  39.947 30.680  1.00 104.59 ? 78  THR H CB  1 
ATOM 3903 O OG1 . THR C 3 78  ? 57.039  39.806 29.986  1.00 104.59 ? 78  THR H OG1 1 
ATOM 3904 C CG2 . THR C 3 78  ? 58.546  38.686 31.483  1.00 104.59 ? 78  THR H CG2 1 
ATOM 3905 N N   . ALA C 3 79  ? 57.763  43.065 30.164  1.00 94.92  ? 79  ALA H N   1 
ATOM 3906 C CA  . ALA C 3 79  ? 56.920  44.076 29.551  1.00 94.92  ? 79  ALA H CA  1 
ATOM 3907 C C   . ALA C 3 79  ? 57.109  44.030 28.050  1.00 94.92  ? 79  ALA H C   1 
ATOM 3908 O O   . ALA C 3 79  ? 58.129  43.539 27.574  1.00 94.92  ? 79  ALA H O   1 
ATOM 3909 C CB  . ALA C 3 79  ? 57.270  45.420 30.092  1.00 36.39  ? 79  ALA H CB  1 
ATOM 3910 N N   . TYR C 3 80  ? 56.130  44.538 27.308  1.00 110.45 ? 80  TYR H N   1 
ATOM 3911 C CA  . TYR C 3 80  ? 56.193  44.495 25.853  1.00 110.45 ? 80  TYR H CA  1 
ATOM 3912 C C   . TYR C 3 80  ? 55.949  45.826 25.155  1.00 110.45 ? 80  TYR H C   1 
ATOM 3913 O O   . TYR C 3 80  ? 55.553  46.811 25.780  1.00 110.45 ? 80  TYR H O   1 
ATOM 3914 C CB  . TYR C 3 80  ? 55.171  43.491 25.323  1.00 95.65  ? 80  TYR H CB  1 
ATOM 3915 C CG  . TYR C 3 80  ? 55.191  42.137 25.989  1.00 95.65  ? 80  TYR H CG  1 
ATOM 3916 C CD1 . TYR C 3 80  ? 54.772  41.980 27.303  1.00 95.65  ? 80  TYR H CD1 1 
ATOM 3917 C CD2 . TYR C 3 80  ? 55.617  41.011 25.296  1.00 95.65  ? 80  TYR H CD2 1 
ATOM 3918 C CE1 . TYR C 3 80  ? 54.779  40.735 27.912  1.00 95.65  ? 80  TYR H CE1 1 
ATOM 3919 C CE2 . TYR C 3 80  ? 55.627  39.763 25.893  1.00 95.65  ? 80  TYR H CE2 1 
ATOM 3920 C CZ  . TYR C 3 80  ? 55.210  39.627 27.203  1.00 95.65  ? 80  TYR H CZ  1 
ATOM 3921 O OH  . TYR C 3 80  ? 55.253  38.388 27.813  1.00 95.65  ? 80  TYR H OH  1 
ATOM 3922 N N   . MET C 3 81  ? 56.176  45.822 23.843  1.00 99.62  ? 81  MET H N   1 
ATOM 3923 C CA  . MET C 3 81  ? 55.977  46.988 22.993  1.00 99.62  ? 81  MET H CA  1 
ATOM 3924 C C   . MET C 3 81  ? 55.480  46.596 21.597  1.00 99.62  ? 81  MET H C   1 
ATOM 3925 O O   . MET C 3 81  ? 56.228  46.034 20.801  1.00 99.62  ? 81  MET H O   1 
ATOM 3926 C CB  . MET C 3 81  ? 57.275  47.770 22.849  1.00 120.69 ? 81  MET H CB  1 
ATOM 3927 C CG  . MET C 3 81  ? 57.175  48.851 21.797  1.00 120.69 ? 81  MET H CG  1 
ATOM 3928 S SD  . MET C 3 81  ? 58.640  49.835 21.699  1.00 120.69 ? 81  MET H SD  1 
ATOM 3929 C CE  . MET C 3 81  ? 59.779  48.658 21.035  1.00 120.69 ? 81  MET H CE  1 
ATOM 3930 N N   . GLN C 3 82  ? 54.224  46.911 21.300  1.00 124.72 ? 82  GLN H N   1 
ATOM 3931 C CA  . GLN C 3 82  ? 53.632  46.581 20.006  1.00 124.72 ? 82  GLN H CA  1 
ATOM 3932 C C   . GLN C 3 82  ? 54.009  47.587 18.924  1.00 124.72 ? 82  GLN H C   1 
ATOM 3933 O O   . GLN C 3 82  ? 53.553  48.732 18.946  1.00 124.72 ? 82  GLN H O   1 
ATOM 3934 C CB  . GLN C 3 82  ? 52.107  46.533 20.131  1.00 147.14 ? 82  GLN H CB  1 
ATOM 3935 C CG  . GLN C 3 82  ? 51.392  45.970 18.919  1.00 147.14 ? 82  GLN H CG  1 
ATOM 3936 C CD  . GLN C 3 82  ? 51.660  44.495 18.736  1.00 147.14 ? 82  GLN H CD  1 
ATOM 3937 O OE1 . GLN C 3 82  ? 52.281  43.856 19.585  1.00 147.14 ? 82  GLN H OE1 1 
ATOM 3938 N NE2 . GLN C 3 82  ? 51.184  43.941 17.631  1.00 147.14 ? 82  GLN H NE2 1 
ATOM 3939 N N   . LEU C 3 83  ? 54.836  47.159 17.973  1.00 81.14  ? 83  LEU H N   1 
ATOM 3940 C CA  . LEU C 3 83  ? 55.242  48.038 16.877  1.00 81.14  ? 83  LEU H CA  1 
ATOM 3941 C C   . LEU C 3 83  ? 54.539  47.647 15.579  1.00 81.14  ? 83  LEU H C   1 
ATOM 3942 O O   . LEU C 3 83  ? 54.960  46.711 14.903  1.00 81.14  ? 83  LEU H O   1 
ATOM 3943 C CB  . LEU C 3 83  ? 56.749  47.971 16.691  1.00 83.74  ? 83  LEU H CB  1 
ATOM 3944 C CG  . LEU C 3 83  ? 57.393  49.348 16.539  1.00 83.74  ? 83  LEU H CG  1 
ATOM 3945 C CD1 . LEU C 3 83  ? 56.397  50.455 16.910  1.00 83.74  ? 83  LEU H CD1 1 
ATOM 3946 C CD2 . LEU C 3 83  ? 58.638  49.407 17.422  1.00 83.74  ? 83  LEU H CD2 1 
ATOM 3947 N N   . SER C 3 84  ? 53.474  48.374 15.236  1.00 78.38  ? 84  SER H N   1 
ATOM 3948 C CA  . SER C 3 84  ? 52.663  48.085 14.047  1.00 78.38  ? 84  SER H CA  1 
ATOM 3949 C C   . SER C 3 84  ? 53.127  48.733 12.746  1.00 78.38  ? 84  SER H C   1 
ATOM 3950 O O   . SER C 3 84  ? 53.749  49.788 12.758  1.00 78.38  ? 84  SER H O   1 
ATOM 3951 C CB  . SER C 3 84  ? 51.203  48.483 14.304  1.00 140.39 ? 84  SER H CB  1 
ATOM 3952 O OG  . SER C 3 84  ? 50.631  47.725 15.359  1.00 140.39 ? 84  SER H OG  1 
ATOM 3953 N N   . SER C 3 85  ? 52.804  48.095 11.623  1.00 72.69  ? 85  SER H N   1 
ATOM 3954 C CA  . SER C 3 85  ? 53.179  48.590 10.293  1.00 72.69  ? 85  SER H CA  1 
ATOM 3955 C C   . SER C 3 85  ? 54.611  49.103 10.236  1.00 72.69  ? 85  SER H C   1 
ATOM 3956 O O   . SER C 3 85  ? 54.852  50.255 9.892   1.00 72.69  ? 85  SER H O   1 
ATOM 3957 C CB  . SER C 3 85  ? 52.224  49.698 9.841   1.00 112.15 ? 85  SER H CB  1 
ATOM 3958 O OG  . SER C 3 85  ? 52.282  50.811 10.713  1.00 112.15 ? 85  SER H OG  1 
ATOM 3959 N N   . LEU C 3 86  ? 55.546  48.220 10.571  1.00 73.98  ? 86  LEU H N   1 
ATOM 3960 C CA  . LEU C 3 86  ? 56.968  48.526 10.581  1.00 73.98  ? 86  LEU H CA  1 
ATOM 3961 C C   . LEU C 3 86  ? 57.468  48.950 9.218   1.00 73.98  ? 86  LEU H C   1 
ATOM 3962 O O   . LEU C 3 86  ? 57.114  48.353 8.206   1.00 73.98  ? 86  LEU H O   1 
ATOM 3963 C CB  . LEU C 3 86  ? 57.754  47.304 11.024  1.00 63.16  ? 86  LEU H CB  1 
ATOM 3964 C CG  . LEU C 3 86  ? 57.295  46.690 12.335  1.00 63.16  ? 86  LEU H CG  1 
ATOM 3965 C CD1 . LEU C 3 86  ? 58.202  45.529 12.702  1.00 63.16  ? 86  LEU H CD1 1 
ATOM 3966 C CD2 . LEU C 3 86  ? 57.319  47.755 13.403  1.00 63.16  ? 86  LEU H CD2 1 
ATOM 3967 N N   . THR C 3 87  ? 58.315  49.970 9.197   1.00 88.59  ? 87  THR H N   1 
ATOM 3968 C CA  . THR C 3 87  ? 58.852  50.458 7.946   1.00 88.59  ? 87  THR H CA  1 
ATOM 3969 C C   . THR C 3 87  ? 60.371  50.490 8.017   1.00 88.59  ? 87  THR H C   1 
ATOM 3970 O O   . THR C 3 87  ? 60.950  50.351 9.094   1.00 88.59  ? 87  THR H O   1 
ATOM 3971 C CB  . THR C 3 87  ? 58.317  51.860 7.629   1.00 86.05  ? 87  THR H CB  1 
ATOM 3972 O OG1 . THR C 3 87  ? 58.735  52.237 6.319   1.00 86.05  ? 87  THR H OG1 1 
ATOM 3973 C CG2 . THR C 3 87  ? 58.845  52.867 8.602   1.00 86.05  ? 87  THR H CG2 1 
ATOM 3974 N N   . SER C 3 88  ? 61.004  50.671 6.858   1.00 83.12  ? 88  SER H N   1 
ATOM 3975 C CA  . SER C 3 88  ? 62.464  50.714 6.735   1.00 83.12  ? 88  SER H CA  1 
ATOM 3976 C C   . SER C 3 88  ? 63.115  51.634 7.759   1.00 83.12  ? 88  SER H C   1 
ATOM 3977 O O   . SER C 3 88  ? 64.212  51.352 8.245   1.00 83.12  ? 88  SER H O   1 
ATOM 3978 C CB  . SER C 3 88  ? 62.865  51.170 5.327   1.00 134.66 ? 88  SER H CB  1 
ATOM 3979 O OG  . SER C 3 88  ? 62.264  50.366 4.327   1.00 134.66 ? 88  SER H OG  1 
ATOM 3980 N N   . GLU C 3 89  ? 62.440  52.735 8.081   1.00 85.49  ? 89  GLU H N   1 
ATOM 3981 C CA  . GLU C 3 89  ? 62.971  53.683 9.046   1.00 85.49  ? 89  GLU H CA  1 
ATOM 3982 C C   . GLU C 3 89  ? 62.663  53.314 10.494  1.00 85.49  ? 89  GLU H C   1 
ATOM 3983 O O   . GLU C 3 89  ? 63.077  54.008 11.418  1.00 85.49  ? 89  GLU H O   1 
ATOM 3984 C CB  . GLU C 3 89  ? 62.478  55.097 8.721   1.00 154.72 ? 89  GLU H CB  1 
ATOM 3985 C CG  . GLU C 3 89  ? 61.078  55.164 8.147   1.00 154.72 ? 89  GLU H CG  1 
ATOM 3986 C CD  . GLU C 3 89  ? 60.713  56.556 7.665   1.00 154.72 ? 89  GLU H CD  1 
ATOM 3987 O OE1 . GLU C 3 89  ? 60.779  57.506 8.472   1.00 154.72 ? 89  GLU H OE1 1 
ATOM 3988 O OE2 . GLU C 3 89  ? 60.358  56.703 6.477   1.00 154.72 ? 89  GLU H OE2 1 
ATOM 3989 N N   . ASP C 3 90  ? 61.938  52.221 10.692  1.00 61.78  ? 90  ASP H N   1 
ATOM 3990 C CA  . ASP C 3 90  ? 61.622  51.760 12.035  1.00 61.78  ? 90  ASP H CA  1 
ATOM 3991 C C   . ASP C 3 90  ? 62.750  50.863 12.552  1.00 61.78  ? 90  ASP H C   1 
ATOM 3992 O O   . ASP C 3 90  ? 62.737  50.425 13.697  1.00 61.78  ? 90  ASP H O   1 
ATOM 3993 C CB  . ASP C 3 90  ? 60.310  50.983 12.030  1.00 114.27 ? 90  ASP H CB  1 
ATOM 3994 C CG  . ASP C 3 90  ? 59.106  51.881 12.176  1.00 114.27 ? 90  ASP H CG  1 
ATOM 3995 O OD1 . ASP C 3 90  ? 58.944  52.488 13.257  1.00 114.27 ? 90  ASP H OD1 1 
ATOM 3996 O OD2 . ASP C 3 90  ? 58.322  51.986 11.213  1.00 114.27 ? 90  ASP H OD2 1 
ATOM 3997 N N   . SER C 3 91  ? 63.732  50.600 11.700  1.00 68.18  ? 91  SER H N   1 
ATOM 3998 C CA  . SER C 3 91  ? 64.841  49.747 12.081  1.00 68.18  ? 91  SER H CA  1 
ATOM 3999 C C   . SER C 3 91  ? 65.816  50.530 12.932  1.00 68.18  ? 91  SER H C   1 
ATOM 4000 O O   . SER C 3 91  ? 66.244  51.612 12.553  1.00 68.18  ? 91  SER H O   1 
ATOM 4001 C CB  . SER C 3 91  ? 65.544  49.212 10.833  1.00 105.19 ? 91  SER H CB  1 
ATOM 4002 O OG  . SER C 3 91  ? 64.609  48.684 9.905   1.00 105.19 ? 91  SER H OG  1 
ATOM 4003 N N   . ALA C 3 92  ? 66.165  49.974 14.087  1.00 75.56  ? 92  ALA H N   1 
ATOM 4004 C CA  . ALA C 3 92  ? 67.094  50.615 15.012  1.00 75.56  ? 92  ALA H CA  1 
ATOM 4005 C C   . ALA C 3 92  ? 67.188  49.775 16.259  1.00 75.56  ? 92  ALA H C   1 
ATOM 4006 O O   . ALA C 3 92  ? 66.597  48.706 16.340  1.00 75.56  ? 92  ALA H O   1 
ATOM 4007 C CB  . ALA C 3 92  ? 66.590  51.970 15.376  1.00 36.54  ? 92  ALA H CB  1 
ATOM 4008 N N   . VAL C 3 93  ? 67.924  50.251 17.247  1.00 58.88  ? 93  VAL H N   1 
ATOM 4009 C CA  . VAL C 3 93  ? 68.006  49.482 18.466  1.00 58.88  ? 93  VAL H CA  1 
ATOM 4010 C C   . VAL C 3 93  ? 66.992  50.030 19.436  1.00 58.88  ? 93  VAL H C   1 
ATOM 4011 O O   . VAL C 3 93  ? 66.961  51.226 19.733  1.00 58.88  ? 93  VAL H O   1 
ATOM 4012 C CB  . VAL C 3 93  ? 69.373  49.540 19.116  1.00 57.01  ? 93  VAL H CB  1 
ATOM 4013 C CG1 . VAL C 3 93  ? 69.259  49.042 20.544  1.00 57.01  ? 93  VAL H CG1 1 
ATOM 4014 C CG2 . VAL C 3 93  ? 70.360  48.661 18.342  1.00 57.01  ? 93  VAL H CG2 1 
ATOM 4015 N N   . TYR C 3 94  ? 66.152  49.130 19.922  1.00 80.05  ? 94  TYR H N   1 
ATOM 4016 C CA  . TYR C 3 94  ? 65.107  49.489 20.847  1.00 80.05  ? 94  TYR H CA  1 
ATOM 4017 C C   . TYR C 3 94  ? 65.469  49.064 22.260  1.00 80.05  ? 94  TYR H C   1 
ATOM 4018 O O   . TYR C 3 94  ? 65.613  47.881 22.555  1.00 80.05  ? 94  TYR H O   1 
ATOM 4019 C CB  . TYR C 3 94  ? 63.795  48.858 20.388  1.00 90.09  ? 94  TYR H CB  1 
ATOM 4020 C CG  . TYR C 3 94  ? 63.219  49.523 19.147  1.00 90.09  ? 94  TYR H CG  1 
ATOM 4021 C CD1 . TYR C 3 94  ? 63.756  49.289 17.881  1.00 90.09  ? 94  TYR H CD1 1 
ATOM 4022 C CD2 . TYR C 3 94  ? 62.161  50.430 19.254  1.00 90.09  ? 94  TYR H CD2 1 
ATOM 4023 C CE1 . TYR C 3 94  ? 63.255  49.946 16.757  1.00 90.09  ? 94  TYR H CE1 1 
ATOM 4024 C CE2 . TYR C 3 94  ? 61.653  51.094 18.140  1.00 90.09  ? 94  TYR H CE2 1 
ATOM 4025 C CZ  . TYR C 3 94  ? 62.200  50.851 16.898  1.00 90.09  ? 94  TYR H CZ  1 
ATOM 4026 O OH  . TYR C 3 94  ? 61.681  51.531 15.815  1.00 90.09  ? 94  TYR H OH  1 
ATOM 4027 N N   . PHE C 3 95  ? 65.618  50.063 23.125  1.00 64.01  ? 95  PHE H N   1 
ATOM 4028 C CA  . PHE C 3 95  ? 65.995  49.858 24.512  1.00 64.01  ? 95  PHE H CA  1 
ATOM 4029 C C   . PHE C 3 95  ? 64.835  49.868 25.479  1.00 64.01  ? 95  PHE H C   1 
ATOM 4030 O O   . PHE C 3 95  ? 63.861  50.599 25.315  1.00 64.01  ? 95  PHE H O   1 
ATOM 4031 C CB  . PHE C 3 95  ? 67.014  50.918 24.950  1.00 66.57  ? 95  PHE H CB  1 
ATOM 4032 C CG  . PHE C 3 95  ? 68.380  50.736 24.342  1.00 66.57  ? 95  PHE H CG  1 
ATOM 4033 C CD1 . PHE C 3 95  ? 68.816  51.564 23.308  1.00 66.57  ? 95  PHE H CD1 1 
ATOM 4034 C CD2 . PHE C 3 95  ? 69.221  49.714 24.783  1.00 66.57  ? 95  PHE H CD2 1 
ATOM 4035 C CE1 . PHE C 3 95  ? 70.070  51.375 22.716  1.00 66.57  ? 95  PHE H CE1 1 
ATOM 4036 C CE2 . PHE C 3 95  ? 70.467  49.521 24.199  1.00 66.57  ? 95  PHE H CE2 1 
ATOM 4037 C CZ  . PHE C 3 95  ? 70.895  50.355 23.159  1.00 66.57  ? 95  PHE H CZ  1 
ATOM 4038 N N   . CYS C 3 96  ? 64.974  49.053 26.512  1.00 53.71  ? 96  CYS H N   1 
ATOM 4039 C CA  . CYS C 3 96  ? 63.966  48.915 27.541  1.00 53.71  ? 96  CYS H CA  1 
ATOM 4040 C C   . CYS C 3 96  ? 64.652  49.269 28.829  1.00 53.71  ? 96  CYS H C   1 
ATOM 4041 O O   . CYS C 3 96  ? 65.415  48.477 29.366  1.00 53.71  ? 96  CYS H O   1 
ATOM 4042 C CB  . CYS C 3 96  ? 63.481  47.478 27.555  1.00 89.69  ? 96  CYS H CB  1 
ATOM 4043 S SG  . CYS C 3 96  ? 62.534  46.943 28.994  1.00 89.69  ? 96  CYS H SG  1 
ATOM 4044 N N   . VAL C 3 97  ? 64.407  50.479 29.309  1.00 64.11  ? 97  VAL H N   1 
ATOM 4045 C CA  . VAL C 3 97  ? 65.032  50.925 30.546  1.00 64.11  ? 97  VAL H CA  1 
ATOM 4046 C C   . VAL C 3 97  ? 64.134  50.799 31.741  1.00 64.11  ? 97  VAL H C   1 
ATOM 4047 O O   . VAL C 3 97  ? 62.960  50.467 31.628  1.00 64.11  ? 97  VAL H O   1 
ATOM 4048 C CB  . VAL C 3 97  ? 65.470  52.423 30.509  1.00 72.07  ? 97  VAL H CB  1 
ATOM 4049 C CG1 . VAL C 3 97  ? 66.915  52.538 30.094  1.00 72.07  ? 97  VAL H CG1 1 
ATOM 4050 C CG2 . VAL C 3 97  ? 64.574  53.225 29.559  1.00 72.07  ? 97  VAL H CG2 1 
ATOM 4051 N N   . ARG C 3 98  ? 64.727  51.077 32.894  1.00 95.46  ? 98  ARG H N   1 
ATOM 4052 C CA  . ARG C 3 98  ? 64.013  51.067 34.147  1.00 95.46  ? 98  ARG H CA  1 
ATOM 4053 C C   . ARG C 3 98  ? 63.999  52.537 34.527  1.00 95.46  ? 98  ARG H C   1 
ATOM 4054 O O   . ARG C 3 98  ? 64.724  52.967 35.424  1.00 95.46  ? 98  ARG H O   1 
ATOM 4055 C CB  . ARG C 3 98  ? 64.751  50.244 35.207  1.00 79.63  ? 98  ARG H CB  1 
ATOM 4056 C CG  . ARG C 3 98  ? 63.928  50.066 36.453  1.00 79.63  ? 98  ARG H CG  1 
ATOM 4057 C CD  . ARG C 3 98  ? 64.547  49.085 37.424  1.00 79.63  ? 98  ARG H CD  1 
ATOM 4058 N NE  . ARG C 3 98  ? 65.592  49.663 38.270  1.00 79.63  ? 98  ARG H NE  1 
ATOM 4059 C CZ  . ARG C 3 98  ? 66.119  49.040 39.325  1.00 79.63  ? 98  ARG H CZ  1 
ATOM 4060 N NH1 . ARG C 3 98  ? 65.694  47.827 39.658  1.00 79.63  ? 98  ARG H NH1 1 
ATOM 4061 N NH2 . ARG C 3 98  ? 67.079  49.613 40.045  1.00 79.63  ? 98  ARG H NH2 1 
ATOM 4062 N N   . GLY C 3 99  ? 63.208  53.309 33.787  1.00 69.32  ? 99  GLY H N   1 
ATOM 4063 C CA  . GLY C 3 99  ? 63.091  54.729 34.046  1.00 69.32  ? 99  GLY H CA  1 
ATOM 4064 C C   . GLY C 3 99  ? 64.374  55.517 33.907  1.00 69.32  ? 99  GLY H C   1 
ATOM 4065 O O   . GLY C 3 99  ? 64.600  56.505 34.601  1.00 69.32  ? 99  GLY H O   1 
ATOM 4066 N N   . PHE C 3 100 ? 65.228  55.070 33.006  1.00 80.73  ? 100 PHE H N   1 
ATOM 4067 C CA  . PHE C 3 100 ? 66.492  55.748 32.759  1.00 80.73  ? 100 PHE H CA  1 
ATOM 4068 C C   . PHE C 3 100 ? 67.574  55.454 33.787  1.00 80.73  ? 100 PHE H C   1 
ATOM 4069 O O   . PHE C 3 100 ? 68.612  56.110 33.811  1.00 80.73  ? 100 PHE H O   1 
ATOM 4070 C CB  . PHE C 3 100 ? 66.265  57.257 32.662  1.00 77.52  ? 100 PHE H CB  1 
ATOM 4071 C CG  . PHE C 3 100 ? 65.175  57.644 31.695  1.00 77.52  ? 100 PHE H CG  1 
ATOM 4072 C CD1 . PHE C 3 100 ? 64.913  56.861 30.574  1.00 77.52  ? 100 PHE H CD1 1 
ATOM 4073 C CD2 . PHE C 3 100 ? 64.422  58.796 31.894  1.00 77.52  ? 100 PHE H CD2 1 
ATOM 4074 C CE1 . PHE C 3 100 ? 63.933  57.212 29.683  1.00 77.52  ? 100 PHE H CE1 1 
ATOM 4075 C CE2 . PHE C 3 100 ? 63.437  59.150 30.999  1.00 77.52  ? 100 PHE H CE2 1 
ATOM 4076 C CZ  . PHE C 3 100 ? 63.192  58.355 29.890  1.00 77.52  ? 100 PHE H CZ  1 
ATOM 4077 N N   . GLY C 3 101 ? 67.342  54.466 34.634  1.00 87.26  ? 101 GLY H N   1 
ATOM 4078 C CA  . GLY C 3 101 ? 68.357  54.131 35.609  1.00 87.26  ? 101 GLY H CA  1 
ATOM 4079 C C   . GLY C 3 101 ? 69.245  53.054 35.027  1.00 87.26  ? 101 GLY H C   1 
ATOM 4080 O O   . GLY C 3 101 ? 70.388  53.304 34.645  1.00 87.26  ? 101 GLY H O   1 
ATOM 4081 N N   . TYR C 3 102 ? 68.687  51.849 34.972  1.00 59.73  ? 102 TYR H N   1 
ATOM 4082 C CA  . TYR C 3 102 ? 69.341  50.666 34.432  1.00 59.73  ? 102 TYR H CA  1 
ATOM 4083 C C   . TYR C 3 102 ? 68.716  50.414 33.055  1.00 59.73  ? 102 TYR H C   1 
ATOM 4084 O O   . TYR C 3 102 ? 67.479  50.343 32.927  1.00 59.73  ? 102 TYR H O   1 
ATOM 4085 C CB  . TYR C 3 102 ? 69.060  49.468 35.326  1.00 68.49  ? 102 TYR H CB  1 
ATOM 4086 C CG  . TYR C 3 102 ? 69.758  48.211 34.885  1.00 68.49  ? 102 TYR H CG  1 
ATOM 4087 C CD1 . TYR C 3 102 ? 71.102  48.004 35.182  1.00 68.49  ? 102 TYR H CD1 1 
ATOM 4088 C CD2 . TYR C 3 102 ? 69.080  47.222 34.163  1.00 68.49  ? 102 TYR H CD2 1 
ATOM 4089 C CE1 . TYR C 3 102 ? 71.760  46.836 34.774  1.00 68.49  ? 102 TYR H CE1 1 
ATOM 4090 C CE2 . TYR C 3 102 ? 69.729  46.044 33.744  1.00 68.49  ? 102 TYR H CE2 1 
ATOM 4091 C CZ  . TYR C 3 102 ? 71.072  45.865 34.060  1.00 68.49  ? 102 TYR H CZ  1 
ATOM 4092 O OH  . TYR C 3 102 ? 71.743  44.725 33.687  1.00 68.49  ? 102 TYR H OH  1 
ATOM 4093 N N   . TRP C 3 103 ? 69.556  50.291 32.026  1.00 75.66  ? 103 TRP H N   1 
ATOM 4094 C CA  . TRP C 3 103 ? 69.054  50.060 30.670  1.00 75.66  ? 103 TRP H CA  1 
ATOM 4095 C C   . TRP C 3 103 ? 69.012  48.574 30.436  1.00 75.66  ? 103 TRP H C   1 
ATOM 4096 O O   . TRP C 3 103 ? 69.622  47.821 31.179  1.00 75.66  ? 103 TRP H O   1 
ATOM 4097 C CB  . TRP C 3 103 ? 69.966  50.698 29.607  1.00 79.21  ? 103 TRP H CB  1 
ATOM 4098 C CG  . TRP C 3 103 ? 70.011  52.208 29.605  1.00 79.21  ? 103 TRP H CG  1 
ATOM 4099 C CD1 . TRP C 3 103 ? 70.574  53.015 30.552  1.00 79.21  ? 103 TRP H CD1 1 
ATOM 4100 C CD2 . TRP C 3 103 ? 69.492  53.083 28.598  1.00 79.21  ? 103 TRP H CD2 1 
ATOM 4101 N NE1 . TRP C 3 103 ? 70.443  54.333 30.199  1.00 79.21  ? 103 TRP H NE1 1 
ATOM 4102 C CE2 . TRP C 3 103 ? 69.782  54.406 29.005  1.00 79.21  ? 103 TRP H CE2 1 
ATOM 4103 C CE3 . TRP C 3 103 ? 68.814  52.879 27.392  1.00 79.21  ? 103 TRP H CE3 1 
ATOM 4104 C CZ2 . TRP C 3 103 ? 69.419  55.523 28.251  1.00 79.21  ? 103 TRP H CZ2 1 
ATOM 4105 C CZ3 . TRP C 3 103 ? 68.449  53.994 26.635  1.00 79.21  ? 103 TRP H CZ3 1 
ATOM 4106 C CH2 . TRP C 3 103 ? 68.756  55.303 27.074  1.00 79.21  ? 103 TRP H CH2 1 
ATOM 4107 N N   . GLY C 3 104 ? 68.281  48.158 29.409  1.00 56.47  ? 104 GLY H N   1 
ATOM 4108 C CA  . GLY C 3 104 ? 68.199  46.752 29.064  1.00 56.47  ? 104 GLY H CA  1 
ATOM 4109 C C   . GLY C 3 104 ? 69.411  46.314 28.249  1.00 56.47  ? 104 GLY H C   1 
ATOM 4110 O O   . GLY C 3 104 ? 70.453  46.977 28.258  1.00 56.47  ? 104 GLY H O   1 
ATOM 4111 N N   . GLN C 3 105 ? 69.275  45.190 27.550  1.00 69.38  ? 105 GLN H N   1 
ATOM 4112 C CA  . GLN C 3 105 ? 70.347  44.658 26.719  1.00 69.38  ? 105 GLN H CA  1 
ATOM 4113 C C   . GLN C 3 105 ? 70.246  45.352 25.377  1.00 69.38  ? 105 GLN H C   1 
ATOM 4114 O O   . GLN C 3 105 ? 71.216  45.934 24.899  1.00 121.35 ? 105 GLN H O   1 
ATOM 4115 C CB  . GLN C 3 105 ? 70.186  43.144 26.546  1.00 134.28 ? 105 GLN H CB  1 
ATOM 4116 C CG  . GLN C 3 105 ? 70.252  42.349 27.847  1.00 134.28 ? 105 GLN H CG  1 
ATOM 4117 C CD  . GLN C 3 105 ? 69.946  40.878 27.656  1.00 134.28 ? 105 GLN H CD  1 
ATOM 4118 O OE1 . GLN C 3 105 ? 68.928  40.519 27.066  1.00 134.28 ? 105 GLN H OE1 1 
ATOM 4119 N NE2 . GLN C 3 105 ? 70.825  40.018 28.159  1.00 134.28 ? 105 GLN H NE2 1 
ATOM 4120 N N   . GLY C 3 106 ? 69.053  45.305 24.788  1.00 89.95  ? 106 GLY H N   1 
ATOM 4121 C CA  . GLY C 3 106 ? 68.819  45.935 23.502  1.00 89.95  ? 106 GLY H CA  1 
ATOM 4122 C C   . GLY C 3 106 ? 68.315  44.920 22.502  1.00 89.95  ? 106 GLY H C   1 
ATOM 4123 O O   . GLY C 3 106 ? 68.662  43.744 22.584  1.00 89.95  ? 106 GLY H O   1 
ATOM 4124 N N   . THR C 3 107 ? 67.477  45.358 21.569  1.00 60.16  ? 107 THR H N   1 
ATOM 4125 C CA  . THR C 3 107 ? 66.951  44.452 20.545  1.00 60.16  ? 107 THR H CA  1 
ATOM 4126 C C   . THR C 3 107 ? 67.156  45.092 19.167  1.00 60.16  ? 107 THR H C   1 
ATOM 4127 O O   . THR C 3 107 ? 66.489  46.072 18.813  1.00 60.16  ? 107 THR H O   1 
ATOM 4128 C CB  . THR C 3 107 ? 65.467  44.152 20.771  1.00 61.39  ? 107 THR H CB  1 
ATOM 4129 O OG1 . THR C 3 107 ? 65.229  43.969 22.170  1.00 61.39  ? 107 THR H OG1 1 
ATOM 4130 C CG2 . THR C 3 107 ? 65.081  42.875 20.066  1.00 61.39  ? 107 THR H CG2 1 
ATOM 4131 N N   . THR C 3 108 ? 68.094  44.516 18.411  1.00 57.19  ? 108 THR H N   1 
ATOM 4132 C CA  . THR C 3 108 ? 68.480  44.996 17.087  1.00 57.19  ? 108 THR H CA  1 
ATOM 4133 C C   . THR C 3 108 ? 67.428  44.715 16.014  1.00 57.19  ? 108 THR H C   1 
ATOM 4134 O O   . THR C 3 108 ? 67.683  44.012 15.037  1.00 57.19  ? 108 THR H O   1 
ATOM 4135 C CB  . THR C 3 108 ? 69.846  44.371 16.672  1.00 55.90  ? 108 THR H CB  1 
ATOM 4136 O OG1 . THR C 3 108 ? 70.567  43.992 17.854  1.00 55.90  ? 108 THR H OG1 1 
ATOM 4137 C CG2 . THR C 3 108 ? 70.692  45.372 15.904  1.00 55.90  ? 108 THR H CG2 1 
ATOM 4138 N N   . LEU C 3 109 ? 66.244  45.286 16.216  1.00 47.80  ? 109 LEU H N   1 
ATOM 4139 C CA  . LEU C 3 109 ? 65.138  45.153 15.278  1.00 47.80  ? 109 LEU H CA  1 
ATOM 4140 C C   . LEU C 3 109 ? 65.547  45.651 13.926  1.00 47.80  ? 109 LEU H C   1 
ATOM 4141 O O   . LEU C 3 109 ? 66.254  46.641 13.800  1.00 47.80  ? 109 LEU H O   1 
ATOM 4142 C CB  . LEU C 3 109 ? 63.945  45.977 15.723  1.00 40.97  ? 109 LEU H CB  1 
ATOM 4143 C CG  . LEU C 3 109 ? 62.852  46.257 14.697  1.00 40.97  ? 109 LEU H CG  1 
ATOM 4144 C CD1 . LEU C 3 109 ? 62.452  44.999 13.973  1.00 40.97  ? 109 LEU H CD1 1 
ATOM 4145 C CD2 . LEU C 3 109 ? 61.642  46.839 15.443  1.00 40.97  ? 109 LEU H CD2 1 
ATOM 4146 N N   . THR C 3 110 ? 65.097  44.955 12.901  1.00 70.96  ? 110 THR H N   1 
ATOM 4147 C CA  . THR C 3 110 ? 65.416  45.357 11.555  1.00 70.96  ? 110 THR H CA  1 
ATOM 4148 C C   . THR C 3 110 ? 64.297  44.940 10.624  1.00 70.96  ? 110 THR H C   1 
ATOM 4149 O O   . THR C 3 110 ? 63.959  43.761 10.513  1.00 70.96  ? 110 THR H O   1 
ATOM 4150 C CB  . THR C 3 110 ? 66.777  44.778 11.100  1.00 92.89  ? 110 THR H CB  1 
ATOM 4151 O OG1 . THR C 3 110 ? 66.723  44.485 9.701   1.00 92.89  ? 110 THR H OG1 1 
ATOM 4152 C CG2 . THR C 3 110 ? 67.141  43.534 11.894  1.00 92.89  ? 110 THR H CG2 1 
ATOM 4153 N N   . VAL C 3 111 ? 63.695  45.943 9.998   1.00 59.93  ? 111 VAL H N   1 
ATOM 4154 C CA  . VAL C 3 111 ? 62.603  45.740 9.072   1.00 59.93  ? 111 VAL H CA  1 
ATOM 4155 C C   . VAL C 3 111 ? 63.235  45.598 7.698   1.00 59.93  ? 111 VAL H C   1 
ATOM 4156 O O   . VAL C 3 111 ? 63.905  46.508 7.222   1.00 59.93  ? 111 VAL H O   1 
ATOM 4157 C CB  . VAL C 3 111 ? 61.654  46.954 9.088   1.00 76.85  ? 111 VAL H CB  1 
ATOM 4158 C CG1 . VAL C 3 111 ? 60.462  46.701 8.190   1.00 76.85  ? 111 VAL H CG1 1 
ATOM 4159 C CG2 . VAL C 3 111 ? 61.195  47.230 10.505  1.00 76.85  ? 111 VAL H CG2 1 
ATOM 4160 N N   . SER C 3 112 ? 63.052  44.454 7.055   1.00 79.27  ? 112 SER H N   1 
ATOM 4161 C CA  . SER C 3 112 ? 63.651  44.282 5.741   1.00 79.27  ? 112 SER H CA  1 
ATOM 4162 C C   . SER C 3 112 ? 62.967  43.181 4.955   1.00 79.27  ? 112 SER H C   1 
ATOM 4163 O O   . SER C 3 112 ? 62.418  42.247 5.538   1.00 79.27  ? 112 SER H O   1 
ATOM 4164 C CB  . SER C 3 112 ? 65.149  43.973 5.875   1.00 69.83  ? 112 SER H CB  1 
ATOM 4165 O OG  . SER C 3 112 ? 65.778  43.900 4.597   1.00 69.83  ? 112 SER H OG  1 
ATOM 4166 N N   . SER C 3 113 ? 63.004  43.318 3.629   1.00 78.06  ? 113 SER H N   1 
ATOM 4167 C CA  . SER C 3 113 ? 62.408  42.363 2.715   1.00 78.06  ? 113 SER H CA  1 
ATOM 4168 C C   . SER C 3 113 ? 63.369  41.188 2.640   1.00 78.06  ? 113 SER H C   1 
ATOM 4169 O O   . SER C 3 113 ? 63.011  40.093 2.189   1.00 78.06  ? 113 SER H O   1 
ATOM 4170 C CB  . SER C 3 113 ? 62.259  42.987 1.326   1.00 125.53 ? 113 SER H CB  1 
ATOM 4171 O OG  . SER C 3 113 ? 61.479  44.168 1.363   1.00 125.53 ? 113 SER H OG  1 
ATOM 4172 N N   . ALA C 3 114 ? 64.594  41.424 3.103   1.00 77.65  ? 114 ALA H N   1 
ATOM 4173 C CA  . ALA C 3 114 ? 65.643  40.408 3.086   1.00 77.65  ? 114 ALA H CA  1 
ATOM 4174 C C   . ALA C 3 114 ? 65.321  39.120 3.810   1.00 77.65  ? 114 ALA H C   1 
ATOM 4175 O O   . ALA C 3 114 ? 64.459  39.053 4.697   1.00 77.65  ? 114 ALA H O   1 
ATOM 4176 C CB  . ALA C 3 114 ? 66.943  40.972 3.641   1.00 46.89  ? 114 ALA H CB  1 
ATOM 4177 N N   . LYS C 3 115 ? 66.051  38.097 3.393   1.00 82.27  ? 115 LYS H N   1 
ATOM 4178 C CA  . LYS C 3 115 ? 65.958  36.752 3.934   1.00 82.27  ? 115 LYS H CA  1 
ATOM 4179 C C   . LYS C 3 115 ? 67.229  36.593 4.765   1.00 82.27  ? 115 LYS H C   1 
ATOM 4180 O O   . LYS C 3 115 ? 68.278  37.133 4.407   1.00 112.85 ? 115 LYS H O   1 
ATOM 4181 C CB  . LYS C 3 115 ? 65.943  35.752 2.774   1.00 147.80 ? 115 LYS H CB  1 
ATOM 4182 C CG  . LYS C 3 115 ? 66.929  36.119 1.659   1.00 147.80 ? 115 LYS H CG  1 
ATOM 4183 C CD  . LYS C 3 115 ? 66.938  35.093 0.535   1.00 147.80 ? 115 LYS H CD  1 
ATOM 4184 C CE  . LYS C 3 115 ? 67.916  35.480 -0.568  1.00 147.80 ? 115 LYS H CE  1 
ATOM 4185 N NZ  . LYS C 3 115 ? 67.950  34.450 -1.645  1.00 147.80 ? 115 LYS H NZ  1 
ATOM 4186 N N   . THR C 3 116 ? 67.148  35.879 5.877   1.00 116.88 ? 116 THR H N   1 
ATOM 4187 C CA  . THR C 3 116 ? 68.332  35.697 6.697   1.00 116.88 ? 116 THR H CA  1 
ATOM 4188 C C   . THR C 3 116 ? 69.317  34.720 6.079   1.00 116.88 ? 116 THR H C   1 
ATOM 4189 O O   . THR C 3 116 ? 68.944  33.851 5.293   1.00 116.88 ? 116 THR H O   1 
ATOM 4190 C CB  . THR C 3 116 ? 67.979  35.167 8.070   1.00 73.55  ? 116 THR H CB  1 
ATOM 4191 O OG1 . THR C 3 116 ? 67.179  36.131 8.762   1.00 73.55  ? 116 THR H OG1 1 
ATOM 4192 C CG2 . THR C 3 116 ? 69.245  34.877 8.865   1.00 73.55  ? 116 THR H CG2 1 
ATOM 4193 N N   . THR C 3 117 ? 70.582  34.872 6.444   1.00 65.02  ? 117 THR H N   1 
ATOM 4194 C CA  . THR C 3 117 ? 71.637  33.999 5.962   1.00 65.02  ? 117 THR H CA  1 
ATOM 4195 C C   . THR C 3 117 ? 72.761  34.114 6.977   1.00 65.02  ? 117 THR H C   1 
ATOM 4196 O O   . THR C 3 117 ? 73.310  35.194 7.157   1.00 65.02  ? 117 THR H O   1 
ATOM 4197 C CB  . THR C 3 117 ? 72.157  34.434 4.582   1.00 134.60 ? 117 THR H CB  1 
ATOM 4198 O OG1 . THR C 3 117 ? 72.468  35.828 4.610   1.00 134.60 ? 117 THR H OG1 1 
ATOM 4199 C CG2 . THR C 3 117 ? 71.117  34.168 3.498   1.00 134.60 ? 117 THR H CG2 1 
ATOM 4200 N N   . PRO C 3 118 ? 73.099  33.010 7.679   1.00 76.66  ? 118 PRO H N   1 
ATOM 4201 C CA  . PRO C 3 118 ? 74.169  32.985 8.698   1.00 76.66  ? 118 PRO H CA  1 
ATOM 4202 C C   . PRO C 3 118 ? 75.574  33.293 8.159   1.00 76.66  ? 118 PRO H C   1 
ATOM 4203 O O   . PRO C 3 118 ? 75.830  33.157 6.957   1.00 76.66  ? 118 PRO H O   1 
ATOM 4204 C CB  . PRO C 3 118 ? 74.046  31.584 9.292   1.00 101.31 ? 118 PRO H CB  1 
ATOM 4205 C CG  . PRO C 3 118 ? 73.479  30.786 8.173   1.00 101.31 ? 118 PRO H CG  1 
ATOM 4206 C CD  . PRO C 3 118 ? 72.437  31.698 7.585   1.00 101.31 ? 118 PRO H CD  1 
ATOM 4207 N N   . PRO C 3 119 ? 76.502  33.710 9.041   1.00 61.05  ? 119 PRO H N   1 
ATOM 4208 C CA  . PRO C 3 119 ? 77.880  34.045 8.639   1.00 61.05  ? 119 PRO H CA  1 
ATOM 4209 C C   . PRO C 3 119 ? 78.713  32.916 8.010   1.00 61.05  ? 119 PRO H C   1 
ATOM 4210 O O   . PRO C 3 119 ? 78.191  31.855 7.659   1.00 61.05  ? 119 PRO H O   1 
ATOM 4211 C CB  . PRO C 3 119 ? 78.504  34.545 9.940   1.00 81.77  ? 119 PRO H CB  1 
ATOM 4212 C CG  . PRO C 3 119 ? 77.799  33.726 10.964  1.00 81.77  ? 119 PRO H CG  1 
ATOM 4213 C CD  . PRO C 3 119 ? 76.361  33.769 10.506  1.00 81.77  ? 119 PRO H CD  1 
ATOM 4214 N N   . SER C 3 120 ? 80.013  33.164 7.857   1.00 41.01  ? 120 SER H N   1 
ATOM 4215 C CA  . SER C 3 120 ? 80.941  32.168 7.310   1.00 41.01  ? 120 SER H CA  1 
ATOM 4216 C C   . SER C 3 120 ? 82.298  32.415 7.944   1.00 41.01  ? 120 SER H C   1 
ATOM 4217 O O   . SER C 3 120 ? 83.175  33.030 7.357   1.00 41.01  ? 120 SER H O   1 
ATOM 4218 C CB  . SER C 3 120 ? 81.069  32.299 5.788   1.00 50.73  ? 120 SER H CB  1 
ATOM 4219 O OG  . SER C 3 120 ? 79.926  31.803 5.123   1.00 50.73  ? 120 SER H OG  1 
ATOM 4220 N N   . VAL C 3 121 ? 82.481  31.938 9.155   1.00 60.43  ? 121 VAL H N   1 
ATOM 4221 C CA  . VAL C 3 121 ? 83.748  32.173 9.808   1.00 60.43  ? 121 VAL H CA  1 
ATOM 4222 C C   . VAL C 3 121 ? 84.881  31.483 9.059   1.00 60.43  ? 121 VAL H C   1 
ATOM 4223 O O   . VAL C 3 121 ? 84.866  30.273 8.837   1.00 60.43  ? 121 VAL H O   1 
ATOM 4224 C CB  . VAL C 3 121 ? 83.698  31.690 11.275  1.00 51.36  ? 121 VAL H CB  1 
ATOM 4225 C CG1 . VAL C 3 121 ? 84.890  32.229 12.053  1.00 51.36  ? 121 VAL H CG1 1 
ATOM 4226 C CG2 . VAL C 3 121 ? 82.380  32.122 11.907  1.00 51.36  ? 121 VAL H CG2 1 
ATOM 4227 N N   . TYR C 3 122 ? 85.839  32.282 8.618   1.00 69.30  ? 122 TYR H N   1 
ATOM 4228 C CA  . TYR C 3 122 ? 87.005  31.758 7.933   1.00 69.30  ? 122 TYR H CA  1 
ATOM 4229 C C   . TYR C 3 122 ? 88.125  32.279 8.818   1.00 69.30  ? 122 TYR H C   1 
ATOM 4230 O O   . TYR C 3 122 ? 88.055  33.408 9.312   1.00 69.30  ? 122 TYR H O   1 
ATOM 4231 C CB  . TYR C 3 122 ? 87.166  32.333 6.512   1.00 69.29  ? 122 TYR H CB  1 
ATOM 4232 C CG  . TYR C 3 122 ? 86.031  32.064 5.549   1.00 69.29  ? 122 TYR H CG  1 
ATOM 4233 C CD1 . TYR C 3 122 ? 85.670  30.767 5.185   1.00 69.29  ? 122 TYR H CD1 1 
ATOM 4234 C CD2 . TYR C 3 122 ? 85.310  33.116 5.007   1.00 69.29  ? 122 TYR H CD2 1 
ATOM 4235 C CE1 . TYR C 3 122 ? 84.603  30.534 4.299   1.00 69.29  ? 122 TYR H CE1 1 
ATOM 4236 C CE2 . TYR C 3 122 ? 84.248  32.898 4.130   1.00 69.29  ? 122 TYR H CE2 1 
ATOM 4237 C CZ  . TYR C 3 122 ? 83.894  31.614 3.784   1.00 69.29  ? 122 TYR H CZ  1 
ATOM 4238 O OH  . TYR C 3 122 ? 82.789  31.445 2.981   1.00 69.29  ? 122 TYR H OH  1 
ATOM 4239 N N   . PRO C 3 123 ? 89.154  31.451 9.054   1.00 65.83  ? 123 PRO H N   1 
ATOM 4240 C CA  . PRO C 3 123 ? 90.314  31.784 9.883   1.00 65.83  ? 123 PRO H CA  1 
ATOM 4241 C C   . PRO C 3 123 ? 91.486  32.343 9.105   1.00 65.83  ? 123 PRO H C   1 
ATOM 4242 O O   . PRO C 3 123 ? 91.837  31.834 8.038   1.00 65.83  ? 123 PRO H O   1 
ATOM 4243 C CB  . PRO C 3 123 ? 90.658  30.457 10.515  1.00 67.16  ? 123 PRO H CB  1 
ATOM 4244 C CG  . PRO C 3 123 ? 90.418  29.540 9.374   1.00 67.16  ? 123 PRO H CG  1 
ATOM 4245 C CD  . PRO C 3 123 ? 89.081  29.996 8.846   1.00 67.16  ? 123 PRO H CD  1 
ATOM 4246 N N   . LEU C 3 124 ? 92.091  33.388 9.665   1.00 72.31  ? 124 LEU H N   1 
ATOM 4247 C CA  . LEU C 3 124 ? 93.240  34.048 9.060   1.00 72.31  ? 124 LEU H CA  1 
ATOM 4248 C C   . LEU C 3 124 ? 94.484  33.800 9.891   1.00 72.31  ? 124 LEU H C   1 
ATOM 4249 O O   . LEU C 3 124 ? 94.626  34.373 10.962  1.00 72.31  ? 124 LEU H O   1 
ATOM 4250 C CB  . LEU C 3 124 ? 93.008  35.554 8.964   1.00 78.20  ? 124 LEU H CB  1 
ATOM 4251 C CG  . LEU C 3 124 ? 91.697  36.028 8.339   1.00 78.20  ? 124 LEU H CG  1 
ATOM 4252 C CD1 . LEU C 3 124 ? 91.285  35.124 7.197   1.00 78.20  ? 124 LEU H CD1 1 
ATOM 4253 C CD2 . LEU C 3 124 ? 90.624  36.041 9.388   1.00 78.20  ? 124 LEU H CD2 1 
ATOM 4254 N N   . ALA C 3 125 ? 95.377  32.951 9.384   1.00 54.26  ? 125 ALA H N   1 
ATOM 4255 C CA  . ALA C 3 125 ? 96.635  32.611 10.055  1.00 54.26  ? 125 ALA H CA  1 
ATOM 4256 C C   . ALA C 3 125 ? 97.817  33.276 9.342   1.00 54.26  ? 125 ALA H C   1 
ATOM 4257 O O   . ALA C 3 125 ? 97.725  33.612 8.155   1.00 54.26  ? 125 ALA H O   1 
ATOM 4258 C CB  . ALA C 3 125 ? 96.822  31.114 10.066  1.00 80.25  ? 125 ALA H CB  1 
ATOM 4259 N N   . PRO C 3 126 ? 98.951  33.464 10.048  1.00 90.49  ? 126 PRO H N   1 
ATOM 4260 C CA  . PRO C 3 126 ? 100.136 34.102 9.439   1.00 90.49  ? 126 PRO H CA  1 
ATOM 4261 C C   . PRO C 3 126 ? 100.608 33.477 8.120   1.00 90.49  ? 126 PRO H C   1 
ATOM 4262 O O   . PRO C 3 126 ? 100.735 32.252 7.999   1.00 90.49  ? 126 PRO H O   1 
ATOM 4263 C CB  . PRO C 3 126 ? 101.195 34.017 10.547  1.00 95.06  ? 126 PRO H CB  1 
ATOM 4264 C CG  . PRO C 3 126 ? 100.750 32.810 11.373  1.00 95.06  ? 126 PRO H CG  1 
ATOM 4265 C CD  . PRO C 3 126 ? 99.242  32.975 11.410  1.00 95.06  ? 126 PRO H CD  1 
ATOM 4266 N N   . GLY C 3 127 ? 100.872 34.346 7.147   1.00 136.19 ? 127 GLY H N   1 
ATOM 4267 C CA  . GLY C 3 127 ? 101.306 33.930 5.822   1.00 136.19 ? 127 GLY H CA  1 
ATOM 4268 C C   . GLY C 3 127 ? 102.492 32.983 5.667   1.00 136.19 ? 127 GLY H C   1 
ATOM 4269 O O   . GLY C 3 127 ? 102.314 31.760 5.642   1.00 136.19 ? 127 GLY H O   1 
ATOM 4270 N N   . SER C 3 128 ? 103.701 33.537 5.555   1.00 159.89 ? 128 SER H N   1 
ATOM 4271 C CA  . SER C 3 128 ? 104.913 32.733 5.363   1.00 159.89 ? 128 SER H CA  1 
ATOM 4272 C C   . SER C 3 128 ? 105.806 32.571 6.592   1.00 159.89 ? 128 SER H C   1 
ATOM 4273 O O   . SER C 3 128 ? 106.882 33.162 6.654   1.00 159.89 ? 128 SER H O   1 
ATOM 4274 C CB  . SER C 3 128 ? 105.747 33.325 4.223   1.00 137.19 ? 128 SER H CB  1 
ATOM 4275 O OG  . SER C 3 128 ? 106.178 34.640 4.533   1.00 137.19 ? 128 SER H OG  1 
ATOM 4276 N N   . ALA C 3 129 ? 105.368 31.753 7.548   1.00 245.46 ? 129 ALA H N   1 
ATOM 4277 C CA  . ALA C 3 129 ? 106.110 31.494 8.788   1.00 245.46 ? 129 ALA H CA  1 
ATOM 4278 C C   . ALA C 3 129 ? 107.013 32.645 9.222   1.00 245.46 ? 129 ALA H C   1 
ATOM 4279 O O   . ALA C 3 129 ? 108.116 32.420 9.725   1.00 245.46 ? 129 ALA H O   1 
ATOM 4280 C CB  . ALA C 3 129 ? 106.942 30.213 8.653   1.00 111.06 ? 129 ALA H CB  1 
ATOM 4281 N N   . ALA C 3 130 ? 106.543 33.876 9.034   1.00 197.33 ? 130 ALA H N   1 
ATOM 4282 C CA  . ALA C 3 130 ? 107.321 35.048 9.410   1.00 197.33 ? 130 ALA H CA  1 
ATOM 4283 C C   . ALA C 3 130 ? 107.347 35.226 10.921  1.00 197.33 ? 130 ALA H C   1 
ATOM 4284 O O   . ALA C 3 130 ? 106.474 35.876 11.494  1.00 197.33 ? 130 ALA H O   1 
ATOM 4285 C CB  . ALA C 3 130 ? 106.751 36.298 8.748   1.00 88.85  ? 130 ALA H CB  1 
ATOM 4286 N N   . GLN C 3 131 ? 108.344 34.628 11.563  1.00 200.51 ? 131 GLN H N   1 
ATOM 4287 C CA  . GLN C 3 131 ? 108.505 34.742 13.006  1.00 200.51 ? 131 GLN H CA  1 
ATOM 4288 C C   . GLN C 3 131 ? 109.121 36.116 13.240  1.00 200.51 ? 131 GLN H C   1 
ATOM 4289 O O   . GLN C 3 131 ? 110.284 36.236 13.622  1.00 200.51 ? 131 GLN H O   1 
ATOM 4290 C CB  . GLN C 3 131 ? 109.436 33.639 13.516  1.00 212.53 ? 131 GLN H CB  1 
ATOM 4291 C CG  . GLN C 3 131 ? 109.783 33.720 14.996  1.00 212.53 ? 131 GLN H CG  1 
ATOM 4292 C CD  . GLN C 3 131 ? 111.257 34.004 15.231  1.00 212.53 ? 131 GLN H CD  1 
ATOM 4293 O OE1 . GLN C 3 131 ? 112.051 34.042 14.292  1.00 212.53 ? 131 GLN H OE1 1 
ATOM 4294 N NE2 . GLN C 3 131 ? 111.630 34.197 16.490  1.00 212.53 ? 131 GLN H NE2 1 
ATOM 4295 N N   . THR C 3 132 ? 108.328 37.155 12.998  1.00 261.63 ? 132 THR H N   1 
ATOM 4296 C CA  . THR C 3 132 ? 108.795 38.527 13.145  1.00 261.63 ? 132 THR H CA  1 
ATOM 4297 C C   . THR C 3 132 ? 108.195 39.262 14.338  1.00 261.63 ? 132 THR H C   1 
ATOM 4298 O O   . THR C 3 132 ? 107.725 40.391 14.192  1.00 261.63 ? 132 THR H O   1 
ATOM 4299 C CB  . THR C 3 132 ? 108.479 39.352 11.877  1.00 192.47 ? 132 THR H CB  1 
ATOM 4300 O OG1 . THR C 3 132 ? 107.062 39.552 11.777  1.00 192.47 ? 132 THR H OG1 1 
ATOM 4301 C CG2 . THR C 3 132 ? 108.968 38.624 10.629  1.00 192.47 ? 132 THR H CG2 1 
ATOM 4302 N N   . ASN C 3 133 ? 108.209 38.641 15.514  1.00 147.90 ? 133 ASN H N   1 
ATOM 4303 C CA  . ASN C 3 133 ? 107.657 39.307 16.688  1.00 147.90 ? 133 ASN H CA  1 
ATOM 4304 C C   . ASN C 3 133 ? 107.681 38.461 17.952  1.00 147.90 ? 133 ASN H C   1 
ATOM 4305 O O   . ASN C 3 133 ? 107.795 37.232 17.906  1.00 147.90 ? 133 ASN H O   1 
ATOM 4306 C CB  . ASN C 3 133 ? 106.210 39.746 16.416  1.00 158.20 ? 133 ASN H CB  1 
ATOM 4307 C CG  . ASN C 3 133 ? 105.748 40.860 17.343  1.00 158.20 ? 133 ASN H CG  1 
ATOM 4308 O OD1 . ASN C 3 133 ? 104.560 41.174 17.412  1.00 158.20 ? 133 ASN H OD1 1 
ATOM 4309 N ND2 . ASN C 3 133 ? 106.690 41.471 18.050  1.00 158.20 ? 133 ASN H ND2 1 
ATOM 4310 N N   . SER C 3 134 ? 107.582 39.154 19.083  1.00 113.42 ? 134 SER H N   1 
ATOM 4311 C CA  . SER C 3 134 ? 107.542 38.530 20.396  1.00 113.42 ? 134 SER H CA  1 
ATOM 4312 C C   . SER C 3 134 ? 106.113 38.022 20.512  1.00 113.42 ? 134 SER H C   1 
ATOM 4313 O O   . SER C 3 134 ? 105.796 37.177 21.350  1.00 113.42 ? 134 SER H O   1 
ATOM 4314 C CB  . SER C 3 134 ? 107.826 39.582 21.479  1.00 126.76 ? 134 SER H CB  1 
ATOM 4315 O OG  . SER C 3 134 ? 107.693 39.051 22.786  1.00 126.76 ? 134 SER H OG  1 
ATOM 4316 N N   . ALA C 3 135 ? 105.262 38.544 19.631  1.00 112.01 ? 135 ALA H N   1 
ATOM 4317 C CA  . ALA C 3 135 ? 103.850 38.197 19.591  1.00 112.01 ? 135 ALA H CA  1 
ATOM 4318 C C   . ALA C 3 135 ? 103.411 37.747 18.188  1.00 112.01 ? 135 ALA H C   1 
ATOM 4319 O O   . ALA C 3 135 ? 104.234 37.605 17.280  1.00 112.01 ? 135 ALA H O   1 
ATOM 4320 C CB  . ALA C 3 135 ? 103.017 39.407 20.057  1.00 52.33  ? 135 ALA H CB  1 
ATOM 4321 N N   . VAL C 3 136 ? 102.109 37.500 18.041  1.00 102.42 ? 136 VAL H N   1 
ATOM 4322 C CA  . VAL C 3 136 ? 101.496 37.081 16.778  1.00 102.42 ? 136 VAL H CA  1 
ATOM 4323 C C   . VAL C 3 136 ? 100.075 37.598 16.721  1.00 102.42 ? 136 VAL H C   1 
ATOM 4324 O O   . VAL C 3 136 ? 99.422  37.753 17.749  1.00 102.42 ? 136 VAL H O   1 
ATOM 4325 C CB  . VAL C 3 136 ? 101.391 35.552 16.630  1.00 71.25  ? 136 VAL H CB  1 
ATOM 4326 C CG1 . VAL C 3 136 ? 100.651 35.223 15.357  1.00 71.25  ? 136 VAL H CG1 1 
ATOM 4327 C CG2 . VAL C 3 136 ? 102.763 34.933 16.578  1.00 71.25  ? 136 VAL H CG2 1 
ATOM 4328 N N   . THR C 3 137 ? 99.586  37.857 15.519  1.00 82.96  ? 137 THR H N   1 
ATOM 4329 C CA  . THR C 3 137 ? 98.226  38.334 15.398  1.00 82.96  ? 137 THR H CA  1 
ATOM 4330 C C   . THR C 3 137 ? 97.465  37.561 14.337  1.00 82.96  ? 137 THR H C   1 
ATOM 4331 O O   . THR C 3 137 ? 97.696  37.719 13.139  1.00 82.96  ? 137 THR H O   1 
ATOM 4332 C CB  . THR C 3 137 ? 98.161  39.862 15.086  1.00 111.32 ? 137 THR H CB  1 
ATOM 4333 O OG1 . THR C 3 137 ? 98.641  40.122 13.762  1.00 111.32 ? 137 THR H OG1 1 
ATOM 4334 C CG2 . THR C 3 137 ? 99.005  40.637 16.080  1.00 111.32 ? 137 THR H CG2 1 
ATOM 4335 N N   . LEU C 3 138 ? 96.577  36.691 14.795  1.00 75.95  ? 138 LEU H N   1 
ATOM 4336 C CA  . LEU C 3 138 ? 95.747  35.918 13.893  1.00 75.95  ? 138 LEU H CA  1 
ATOM 4337 C C   . LEU C 3 138 ? 94.400  36.608 13.945  1.00 75.95  ? 138 LEU H C   1 
ATOM 4338 O O   . LEU C 3 138 ? 94.257  37.636 14.602  1.00 75.95  ? 138 LEU H O   1 
ATOM 4339 C CB  . LEU C 3 138 ? 95.603  34.473 14.377  1.00 68.16  ? 138 LEU H CB  1 
ATOM 4340 C CG  . LEU C 3 138 ? 96.170  34.154 15.758  1.00 68.16  ? 138 LEU H CG  1 
ATOM 4341 C CD1 . LEU C 3 138 ? 95.658  32.803 16.251  1.00 68.16  ? 138 LEU H CD1 1 
ATOM 4342 C CD2 . LEU C 3 138 ? 97.681  34.179 15.674  1.00 68.16  ? 138 LEU H CD2 1 
ATOM 4343 N N   . GLY C 3 139 ? 93.412  36.048 13.262  1.00 48.59  ? 139 GLY H N   1 
ATOM 4344 C CA  . GLY C 3 139 ? 92.087  36.649 13.267  1.00 48.59  ? 139 GLY H CA  1 
ATOM 4345 C C   . GLY C 3 139 ? 91.083  35.804 12.512  1.00 48.59  ? 139 GLY H C   1 
ATOM 4346 O O   . GLY C 3 139 ? 91.467  34.890 11.782  1.00 48.59  ? 139 GLY H O   1 
ATOM 4347 N N   . CYS C 3 140 ? 89.799  36.079 12.696  1.00 61.05  ? 140 CYS H N   1 
ATOM 4348 C CA  . CYS C 3 140 ? 88.798  35.323 11.977  1.00 61.05  ? 140 CYS H CA  1 
ATOM 4349 C C   . CYS C 3 140 ? 87.708  36.216 11.433  1.00 61.05  ? 140 CYS H C   1 
ATOM 4350 O O   . CYS C 3 140 ? 86.913  36.805 12.159  1.00 61.05  ? 140 CYS H O   1 
ATOM 4351 C CB  . CYS C 3 140 ? 88.216  34.184 12.833  1.00 90.89  ? 140 CYS H CB  1 
ATOM 4352 S SG  . CYS C 3 140 ? 86.865  34.522 14.022  1.00 90.89  ? 140 CYS H SG  1 
ATOM 4353 N N   . LEU C 3 141 ? 87.711  36.316 10.115  1.00 40.26  ? 141 LEU H N   1 
ATOM 4354 C CA  . LEU C 3 141 ? 86.763  37.130 9.385   1.00 40.26  ? 141 LEU H CA  1 
ATOM 4355 C C   . LEU C 3 141 ? 85.420  36.401 9.204   1.00 40.26  ? 141 LEU H C   1 
ATOM 4356 O O   . LEU C 3 141 ? 85.345  35.321 8.618   1.00 40.26  ? 141 LEU H O   1 
ATOM 4357 C CB  . LEU C 3 141 ? 87.418  37.543 8.039   1.00 49.92  ? 141 LEU H CB  1 
ATOM 4358 C CG  . LEU C 3 141 ? 86.742  37.577 6.661   1.00 49.92  ? 141 LEU H CG  1 
ATOM 4359 C CD1 . LEU C 3 141 ? 86.432  36.154 6.242   1.00 49.92  ? 141 LEU H CD1 1 
ATOM 4360 C CD2 . LEU C 3 141 ? 85.479  38.459 6.674   1.00 49.92  ? 141 LEU H CD2 1 
ATOM 4361 N N   . VAL C 3 142 ? 84.371  36.973 9.771   1.00 57.93  ? 142 VAL H N   1 
ATOM 4362 C CA  . VAL C 3 142 ? 83.061  36.389 9.622   1.00 57.93  ? 142 VAL H CA  1 
ATOM 4363 C C   . VAL C 3 142 ? 82.522  37.092 8.393   1.00 57.93  ? 142 VAL H C   1 
ATOM 4364 O O   . VAL C 3 142 ? 82.356  38.307 8.406   1.00 57.93  ? 142 VAL H O   1 
ATOM 4365 C CB  . VAL C 3 142 ? 82.158  36.688 10.849  1.00 45.18  ? 142 VAL H CB  1 
ATOM 4366 C CG1 . VAL C 3 142 ? 82.950  37.397 11.927  1.00 45.18  ? 142 VAL H CG1 1 
ATOM 4367 C CG2 . VAL C 3 142 ? 80.909  37.481 10.428  1.00 45.18  ? 142 VAL H CG2 1 
ATOM 4368 N N   . LYS C 3 143 ? 82.267  36.359 7.319   1.00 73.64  ? 143 LYS H N   1 
ATOM 4369 C CA  . LYS C 3 143 ? 81.776  37.018 6.120   1.00 73.64  ? 143 LYS H CA  1 
ATOM 4370 C C   . LYS C 3 143 ? 80.353  36.676 5.784   1.00 73.64  ? 143 LYS H C   1 
ATOM 4371 O O   . LYS C 3 143 ? 79.887  35.574 6.063   1.00 73.64  ? 143 LYS H O   1 
ATOM 4372 C CB  . LYS C 3 143 ? 82.656  36.709 4.910   1.00 80.65  ? 143 LYS H CB  1 
ATOM 4373 C CG  . LYS C 3 143 ? 81.988  37.095 3.619   1.00 80.65  ? 143 LYS H CG  1 
ATOM 4374 C CD  . LYS C 3 143 ? 82.875  36.956 2.407   1.00 80.65  ? 143 LYS H CD  1 
ATOM 4375 C CE  . LYS C 3 143 ? 82.087  37.307 1.143   1.00 80.65  ? 143 LYS H CE  1 
ATOM 4376 N NZ  . LYS C 3 143 ? 82.882  37.113 -0.103  1.00 80.65  ? 143 LYS H NZ  1 
ATOM 4377 N N   . GLY C 3 144 ? 79.676  37.658 5.197   1.00 59.55  ? 144 GLY H N   1 
ATOM 4378 C CA  . GLY C 3 144 ? 78.295  37.528 4.764   1.00 59.55  ? 144 GLY H CA  1 
ATOM 4379 C C   . GLY C 3 144 ? 77.222  36.927 5.645   1.00 59.55  ? 144 GLY H C   1 
ATOM 4380 O O   . GLY C 3 144 ? 77.052  35.703 5.661   1.00 59.55  ? 144 GLY H O   1 
ATOM 4381 N N   . TYR C 3 145 ? 76.488  37.784 6.351   1.00 66.64  ? 145 TYR H N   1 
ATOM 4382 C CA  . TYR C 3 145 ? 75.393  37.337 7.197   1.00 66.64  ? 145 TYR H CA  1 
ATOM 4383 C C   . TYR C 3 145 ? 74.338  38.424 7.329   1.00 66.64  ? 145 TYR H C   1 
ATOM 4384 O O   . TYR C 3 145 ? 74.503  39.510 6.785   1.00 66.64  ? 145 TYR H O   1 
ATOM 4385 C CB  . TYR C 3 145 ? 75.908  36.943 8.558   1.00 45.05  ? 145 TYR H CB  1 
ATOM 4386 C CG  . TYR C 3 145 ? 76.431  38.107 9.334   1.00 45.05  ? 145 TYR H CG  1 
ATOM 4387 C CD1 . TYR C 3 145 ? 75.556  38.977 9.968   1.00 45.05  ? 145 TYR H CD1 1 
ATOM 4388 C CD2 . TYR C 3 145 ? 77.808  38.327 9.472   1.00 45.05  ? 145 TYR H CD2 1 
ATOM 4389 C CE1 . TYR C 3 145 ? 76.028  40.031 10.725  1.00 45.05  ? 145 TYR H CE1 1 
ATOM 4390 C CE2 . TYR C 3 145 ? 78.294  39.383 10.232  1.00 45.05  ? 145 TYR H CE2 1 
ATOM 4391 C CZ  . TYR C 3 145 ? 77.397  40.233 10.862  1.00 45.05  ? 145 TYR H CZ  1 
ATOM 4392 O OH  . TYR C 3 145 ? 77.835  41.281 11.658  1.00 45.05  ? 145 TYR H OH  1 
ATOM 4393 N N   . PHE C 3 146 ? 73.265  38.145 8.061   1.00 54.37  ? 146 PHE H N   1 
ATOM 4394 C CA  . PHE C 3 146 ? 72.186  39.116 8.189   1.00 54.37  ? 146 PHE H CA  1 
ATOM 4395 C C   . PHE C 3 146 ? 70.969  38.539 8.918   1.00 54.37  ? 146 PHE H C   1 
ATOM 4396 O O   . PHE C 3 146 ? 70.654  37.351 8.809   1.00 54.37  ? 146 PHE H O   1 
ATOM 4397 C CB  . PHE C 3 146 ? 71.794  39.582 6.779   1.00 48.46  ? 146 PHE H CB  1 
ATOM 4398 C CG  . PHE C 3 146 ? 70.565  40.462 6.707   1.00 48.46  ? 146 PHE H CG  1 
ATOM 4399 C CD1 . PHE C 3 146 ? 69.311  39.998 7.107   1.00 48.46  ? 146 PHE H CD1 1 
ATOM 4400 C CD2 . PHE C 3 146 ? 70.656  41.731 6.144   1.00 48.46  ? 146 PHE H CD2 1 
ATOM 4401 C CE1 . PHE C 3 146 ? 68.175  40.780 6.942   1.00 48.46  ? 146 PHE H CE1 1 
ATOM 4402 C CE2 . PHE C 3 146 ? 69.526  42.525 5.969   1.00 48.46  ? 146 PHE H CE2 1 
ATOM 4403 C CZ  . PHE C 3 146 ? 68.283  42.047 6.368   1.00 48.46  ? 146 PHE H CZ  1 
ATOM 4404 N N   . PRO C 3 147 ? 70.271  39.387 9.680   1.00 48.37  ? 147 PRO H N   1 
ATOM 4405 C CA  . PRO C 3 147 ? 70.611  40.805 9.848   1.00 48.37  ? 147 PRO H CA  1 
ATOM 4406 C C   . PRO C 3 147 ? 71.680  40.988 10.919  1.00 48.37  ? 147 PRO H C   1 
ATOM 4407 O O   . PRO C 3 147 ? 72.409  40.060 11.255  1.00 48.37  ? 147 PRO H O   1 
ATOM 4408 C CB  . PRO C 3 147 ? 69.283  41.420 10.251  1.00 45.94  ? 147 PRO H CB  1 
ATOM 4409 C CG  . PRO C 3 147 ? 68.695  40.339 11.089  1.00 45.94  ? 147 PRO H CG  1 
ATOM 4410 C CD  . PRO C 3 147 ? 68.971  39.081 10.295  1.00 45.94  ? 147 PRO H CD  1 
ATOM 4411 N N   . GLU C 3 148 ? 71.793  42.200 11.436  1.00 70.93  ? 148 GLU H N   1 
ATOM 4412 C CA  . GLU C 3 148 ? 72.748  42.457 12.496  1.00 70.93  ? 148 GLU H CA  1 
ATOM 4413 C C   . GLU C 3 148 ? 72.050  41.938 13.749  1.00 70.93  ? 148 GLU H C   1 
ATOM 4414 O O   . GLU C 3 148 ? 70.831  41.788 13.764  1.00 70.93  ? 148 GLU H O   1 
ATOM 4415 C CB  . GLU C 3 148 ? 73.027  43.962 12.623  1.00 100.86 ? 148 GLU H CB  1 
ATOM 4416 C CG  . GLU C 3 148 ? 74.270  44.423 11.892  1.00 100.86 ? 148 GLU H CG  1 
ATOM 4417 C CD  . GLU C 3 148 ? 75.554  43.790 12.442  1.00 100.86 ? 148 GLU H CD  1 
ATOM 4418 O OE1 . GLU C 3 148 ? 75.652  42.545 12.486  1.00 100.86 ? 148 GLU H OE1 1 
ATOM 4419 O OE2 . GLU C 3 148 ? 76.475  44.540 12.836  1.00 100.86 ? 148 GLU H OE2 1 
ATOM 4420 N N   . PRO C 3 149 ? 72.802  41.666 14.818  1.00 62.13  ? 149 PRO H N   1 
ATOM 4421 C CA  . PRO C 3 149 ? 74.248  41.781 15.022  1.00 62.13  ? 149 PRO H CA  1 
ATOM 4422 C C   . PRO C 3 149 ? 74.867  40.415 15.097  1.00 62.13  ? 149 PRO H C   1 
ATOM 4423 O O   . PRO C 3 149 ? 74.212  39.445 14.753  1.00 62.13  ? 149 PRO H O   1 
ATOM 4424 C CB  . PRO C 3 149 ? 74.324  42.468 16.357  1.00 72.75  ? 149 PRO H CB  1 
ATOM 4425 C CG  . PRO C 3 149 ? 73.245  41.761 17.108  1.00 72.75  ? 149 PRO H CG  1 
ATOM 4426 C CD  . PRO C 3 149 ? 72.103  41.686 16.113  1.00 72.75  ? 149 PRO H CD  1 
ATOM 4427 N N   . VAL C 3 150 ? 76.120  40.340 15.540  1.00 46.40  ? 150 VAL H N   1 
ATOM 4428 C CA  . VAL C 3 150 ? 76.799  39.051 15.718  1.00 46.40  ? 150 VAL H CA  1 
ATOM 4429 C C   . VAL C 3 150 ? 77.859  39.108 16.805  1.00 46.40  ? 150 VAL H C   1 
ATOM 4430 O O   . VAL C 3 150 ? 78.851  39.830 16.696  1.00 46.40  ? 150 VAL H O   1 
ATOM 4431 C CB  . VAL C 3 150 ? 77.482  38.483 14.408  1.00 59.44  ? 150 VAL H CB  1 
ATOM 4432 C CG1 . VAL C 3 150 ? 76.477  38.397 13.286  1.00 59.44  ? 150 VAL H CG1 1 
ATOM 4433 C CG2 . VAL C 3 150 ? 78.677  39.309 14.003  1.00 59.44  ? 150 VAL H CG2 1 
ATOM 4434 N N   . THR C 3 151 ? 77.627  38.355 17.872  1.00 77.00  ? 151 THR H N   1 
ATOM 4435 C CA  . THR C 3 151 ? 78.568  38.290 18.979  1.00 77.00  ? 151 THR H CA  1 
ATOM 4436 C C   . THR C 3 151 ? 79.798  37.565 18.435  1.00 77.00  ? 151 THR H C   1 
ATOM 4437 O O   . THR C 3 151 ? 79.683  36.591 17.685  1.00 77.00  ? 151 THR H O   1 
ATOM 4438 C CB  . THR C 3 151 ? 77.991  37.475 20.166  1.00 106.58 ? 151 THR H CB  1 
ATOM 4439 O OG1 . THR C 3 151 ? 76.700  37.983 20.535  1.00 106.58 ? 151 THR H OG1 1 
ATOM 4440 C CG2 . THR C 3 151 ? 78.921  37.557 21.366  1.00 106.58 ? 151 THR H CG2 1 
ATOM 4441 N N   . VAL C 3 152 ? 80.975  38.052 18.792  1.00 56.48  ? 152 VAL H N   1 
ATOM 4442 C CA  . VAL C 3 152 ? 82.206  37.427 18.329  1.00 56.48  ? 152 VAL H CA  1 
ATOM 4443 C C   . VAL C 3 152 ? 83.252  37.450 19.419  1.00 56.48  ? 152 VAL H C   1 
ATOM 4444 O O   . VAL C 3 152 ? 83.917  38.461 19.642  1.00 56.48  ? 152 VAL H O   1 
ATOM 4445 C CB  . VAL C 3 152 ? 82.779  38.141 17.084  1.00 86.62  ? 152 VAL H CB  1 
ATOM 4446 C CG1 . VAL C 3 152 ? 84.190  37.612 16.770  1.00 86.62  ? 152 VAL H CG1 1 
ATOM 4447 C CG2 . VAL C 3 152 ? 81.835  37.938 15.897  1.00 86.62  ? 152 VAL H CG2 1 
ATOM 4448 N N   . THR C 3 153 ? 83.380  36.324 20.103  1.00 98.62  ? 153 THR H N   1 
ATOM 4449 C CA  . THR C 3 153 ? 84.350  36.188 21.169  1.00 98.62  ? 153 THR H CA  1 
ATOM 4450 C C   . THR C 3 153 ? 85.527  35.323 20.717  1.00 98.62  ? 153 THR H C   1 
ATOM 4451 O O   . THR C 3 153 ? 85.533  34.803 19.601  1.00 98.62  ? 153 THR H O   1 
ATOM 4452 C CB  . THR C 3 153 ? 83.698  35.568 22.413  1.00 88.27  ? 153 THR H CB  1 
ATOM 4453 O OG1 . THR C 3 153 ? 84.715  34.990 23.237  1.00 88.27  ? 153 THR H OG1 1 
ATOM 4454 C CG2 . THR C 3 153 ? 82.672  34.512 22.019  1.00 88.27  ? 153 THR H CG2 1 
ATOM 4455 N N   . TRP C 3 154 ? 86.536  35.194 21.570  1.00 103.13 ? 154 TRP H N   1 
ATOM 4456 C CA  . TRP C 3 154 ? 87.694  34.373 21.241  1.00 103.13 ? 154 TRP H CA  1 
ATOM 4457 C C   . TRP C 3 154 ? 88.037  33.441 22.399  1.00 103.13 ? 154 TRP H C   1 
ATOM 4458 O O   . TRP C 3 154 ? 88.082  33.870 23.555  1.00 103.13 ? 154 TRP H O   1 
ATOM 4459 C CB  . TRP C 3 154 ? 88.906  35.251 20.901  1.00 104.77 ? 154 TRP H CB  1 
ATOM 4460 C CG  . TRP C 3 154 ? 88.913  35.730 19.486  1.00 104.77 ? 154 TRP H CG  1 
ATOM 4461 C CD1 . TRP C 3 154 ? 88.057  36.623 18.926  1.00 104.77 ? 154 TRP H CD1 1 
ATOM 4462 C CD2 . TRP C 3 154 ? 89.791  35.302 18.433  1.00 104.77 ? 154 TRP H CD2 1 
ATOM 4463 N NE1 . TRP C 3 154 ? 88.339  36.782 17.591  1.00 104.77 ? 154 TRP H NE1 1 
ATOM 4464 C CE2 . TRP C 3 154 ? 89.399  35.982 17.260  1.00 104.77 ? 154 TRP H CE2 1 
ATOM 4465 C CE3 . TRP C 3 154 ? 90.868  34.410 18.364  1.00 104.77 ? 154 TRP H CE3 1 
ATOM 4466 C CZ2 . TRP C 3 154 ? 90.047  35.797 16.029  1.00 104.77 ? 154 TRP H CZ2 1 
ATOM 4467 C CZ3 . TRP C 3 154 ? 91.511  34.227 17.136  1.00 104.77 ? 154 TRP H CZ3 1 
ATOM 4468 C CH2 . TRP C 3 154 ? 91.096  34.918 15.990  1.00 104.77 ? 154 TRP H CH2 1 
ATOM 4469 N N   . ASN C 3 155 ? 88.273  32.170 22.077  1.00 86.01  ? 155 ASN H N   1 
ATOM 4470 C CA  . ASN C 3 155 ? 88.612  31.162 23.073  1.00 86.01  ? 155 ASN H CA  1 
ATOM 4471 C C   . ASN C 3 155 ? 87.425  30.937 24.013  1.00 86.01  ? 155 ASN H C   1 
ATOM 4472 O O   . ASN C 3 155 ? 87.599  30.703 25.205  1.00 86.01  ? 155 ASN H O   1 
ATOM 4473 C CB  . ASN C 3 155 ? 89.841  31.617 23.866  1.00 138.16 ? 155 ASN H CB  1 
ATOM 4474 C CG  . ASN C 3 155 ? 91.001  30.651 23.751  1.00 138.16 ? 155 ASN H CG  1 
ATOM 4475 O OD1 . ASN C 3 155 ? 91.274  30.118 22.674  1.00 138.16 ? 155 ASN H OD1 1 
ATOM 4476 N ND2 . ASN C 3 155 ? 91.701  30.428 24.859  1.00 138.16 ? 155 ASN H ND2 1 
ATOM 4477 N N   . SER C 3 156 ? 86.217  30.991 23.463  1.00 97.10  ? 156 SER H N   1 
ATOM 4478 C CA  . SER C 3 156 ? 85.005  30.837 24.260  1.00 97.10  ? 156 SER H CA  1 
ATOM 4479 C C   . SER C 3 156 ? 85.004  31.896 25.371  1.00 97.10  ? 156 SER H C   1 
ATOM 4480 O O   . SER C 3 156 ? 84.769  31.605 26.540  1.00 97.10  ? 156 SER H O   1 
ATOM 4481 C CB  . SER C 3 156 ? 84.918  29.426 24.855  1.00 78.83  ? 156 SER H CB  1 
ATOM 4482 O OG  . SER C 3 156 ? 84.311  28.515 23.957  1.00 78.83  ? 156 SER H OG  1 
ATOM 4483 N N   . GLY C 3 157 ? 85.273  33.137 24.987  1.00 128.75 ? 157 GLY H N   1 
ATOM 4484 C CA  . GLY C 3 157 ? 85.296  34.210 25.957  1.00 128.75 ? 157 GLY H CA  1 
ATOM 4485 C C   . GLY C 3 157 ? 86.575  34.215 26.762  1.00 128.75 ? 157 GLY H C   1 
ATOM 4486 O O   . GLY C 3 157 ? 86.927  35.230 27.363  1.00 128.75 ? 157 GLY H O   1 
ATOM 4487 N N   . SER C 3 158 ? 87.278  33.087 26.775  1.00 115.22 ? 158 SER H N   1 
ATOM 4488 C CA  . SER C 3 158 ? 88.529  32.986 27.527  1.00 115.22 ? 158 SER H CA  1 
ATOM 4489 C C   . SER C 3 158 ? 89.501  34.138 27.263  1.00 115.22 ? 158 SER H C   1 
ATOM 4490 O O   . SER C 3 158 ? 89.827  34.886 28.179  1.00 115.22 ? 158 SER H O   1 
ATOM 4491 C CB  . SER C 3 158 ? 89.231  31.654 27.241  1.00 98.24  ? 158 SER H CB  1 
ATOM 4492 O OG  . SER C 3 158 ? 88.519  30.572 27.808  1.00 98.24  ? 158 SER H OG  1 
ATOM 4493 N N   . LEU C 3 159 ? 89.968  34.283 26.026  1.00 123.27 ? 159 LEU H N   1 
ATOM 4494 C CA  . LEU C 3 159 ? 90.902  35.357 25.706  1.00 123.27 ? 159 LEU H CA  1 
ATOM 4495 C C   . LEU C 3 159 ? 90.255  36.740 25.679  1.00 123.27 ? 159 LEU H C   1 
ATOM 4496 O O   . LEU C 3 159 ? 89.094  36.882 25.299  1.00 123.27 ? 159 LEU H O   1 
ATOM 4497 C CB  . LEU C 3 159 ? 91.580  35.086 24.364  1.00 133.76 ? 159 LEU H CB  1 
ATOM 4498 C CG  . LEU C 3 159 ? 93.013  34.576 24.507  1.00 133.76 ? 159 LEU H CG  1 
ATOM 4499 C CD1 . LEU C 3 159 ? 92.996  33.205 25.178  1.00 133.76 ? 159 LEU H CD1 1 
ATOM 4500 C CD2 . LEU C 3 159 ? 93.689  34.528 23.142  1.00 133.76 ? 159 LEU H CD2 1 
ATOM 4501 N N   . SER C 3 160 ? 91.010  37.760 26.084  1.00 132.22 ? 160 SER H N   1 
ATOM 4502 C CA  . SER C 3 160 ? 90.491  39.125 26.094  1.00 132.22 ? 160 SER H CA  1 
ATOM 4503 C C   . SER C 3 160 ? 91.545  40.193 25.793  1.00 132.22 ? 160 SER H C   1 
ATOM 4504 O O   . SER C 3 160 ? 91.407  40.959 24.841  1.00 132.22 ? 160 SER H O   1 
ATOM 4505 C CB  . SER C 3 160 ? 89.819  39.434 27.443  1.00 98.87  ? 160 SER H CB  1 
ATOM 4506 O OG  . SER C 3 160 ? 90.725  39.365 28.536  1.00 98.87  ? 160 SER H OG  1 
ATOM 4507 N N   . SER C 3 161 ? 92.600  40.241 26.597  1.00 148.37 ? 161 SER H N   1 
ATOM 4508 C CA  . SER C 3 161 ? 93.643  41.241 26.412  1.00 148.37 ? 161 SER H CA  1 
ATOM 4509 C C   . SER C 3 161 ? 94.306  41.201 25.035  1.00 148.37 ? 161 SER H C   1 
ATOM 4510 O O   . SER C 3 161 ? 95.137  40.333 24.766  1.00 148.37 ? 161 SER H O   1 
ATOM 4511 C CB  . SER C 3 161 ? 94.710  41.082 27.496  1.00 259.98 ? 161 SER H CB  1 
ATOM 4512 O OG  . SER C 3 161 ? 95.650  42.141 27.436  1.00 259.98 ? 161 SER H OG  1 
ATOM 4513 N N   . GLY C 3 162 ? 93.935  42.136 24.164  1.00 117.73 ? 162 GLY H N   1 
ATOM 4514 C CA  . GLY C 3 162 ? 94.541  42.189 22.843  1.00 117.73 ? 162 GLY H CA  1 
ATOM 4515 C C   . GLY C 3 162 ? 93.716  41.704 21.664  1.00 117.73 ? 162 GLY H C   1 
ATOM 4516 O O   . GLY C 3 162 ? 94.264  41.385 20.605  1.00 117.73 ? 162 GLY H O   1 
ATOM 4517 N N   . VAL C 3 163 ? 92.400  41.644 21.824  1.00 79.37  ? 163 VAL H N   1 
ATOM 4518 C CA  . VAL C 3 163 ? 91.551  41.192 20.726  1.00 79.37  ? 163 VAL H CA  1 
ATOM 4519 C C   . VAL C 3 163 ? 90.638  42.298 20.222  1.00 79.37  ? 163 VAL H C   1 
ATOM 4520 O O   . VAL C 3 163 ? 89.842  42.844 20.983  1.00 79.37  ? 163 VAL H O   1 
ATOM 4521 C CB  . VAL C 3 163 ? 90.657  39.991 21.134  1.00 103.50 ? 163 VAL H CB  1 
ATOM 4522 C CG1 . VAL C 3 163 ? 89.722  40.376 22.281  1.00 103.50 ? 163 VAL H CG1 1 
ATOM 4523 C CG2 . VAL C 3 163 ? 89.842  39.525 19.924  1.00 103.50 ? 163 VAL H CG2 1 
ATOM 4524 N N   . HIS C 3 164 ? 90.756  42.634 18.943  1.00 83.89  ? 164 HIS H N   1 
ATOM 4525 C CA  . HIS C 3 164 ? 89.904  43.665 18.377  1.00 83.89  ? 164 HIS H CA  1 
ATOM 4526 C C   . HIS C 3 164 ? 88.893  43.021 17.444  1.00 83.89  ? 164 HIS H C   1 
ATOM 4527 O O   . HIS C 3 164 ? 89.177  41.998 16.822  1.00 83.89  ? 164 HIS H O   1 
ATOM 4528 C CB  . HIS C 3 164 ? 90.702  44.685 17.562  1.00 100.89 ? 164 HIS H CB  1 
ATOM 4529 C CG  . HIS C 3 164 ? 91.900  45.241 18.263  1.00 100.89 ? 164 HIS H CG  1 
ATOM 4530 N ND1 . HIS C 3 164 ? 93.119  44.599 18.274  1.00 100.89 ? 164 HIS H ND1 1 
ATOM 4531 C CD2 . HIS C 3 164 ? 92.086  46.411 18.918  1.00 100.89 ? 164 HIS H CD2 1 
ATOM 4532 C CE1 . HIS C 3 164 ? 94.006  45.351 18.898  1.00 100.89 ? 164 HIS H CE1 1 
ATOM 4533 N NE2 . HIS C 3 164 ? 93.405  46.457 19.298  1.00 100.89 ? 164 HIS H NE2 1 
ATOM 4534 N N   . THR C 3 165 ? 87.709  43.620 17.362  1.00 63.01  ? 165 THR H N   1 
ATOM 4535 C CA  . THR C 3 165 ? 86.651  43.148 16.470  1.00 63.01  ? 165 THR H CA  1 
ATOM 4536 C C   . THR C 3 165 ? 86.120  44.418 15.835  1.00 63.01  ? 165 THR H C   1 
ATOM 4537 O O   . THR C 3 165 ? 85.778  45.384 16.533  1.00 63.01  ? 165 THR H O   1 
ATOM 4538 C CB  . THR C 3 165 ? 85.472  42.451 17.211  1.00 70.88  ? 165 THR H CB  1 
ATOM 4539 O OG1 . THR C 3 165 ? 85.952  41.305 17.927  1.00 70.88  ? 165 THR H OG1 1 
ATOM 4540 C CG2 . THR C 3 165 ? 84.407  41.996 16.212  1.00 70.88  ? 165 THR H CG2 1 
ATOM 4541 N N   . PHE C 3 166 ? 86.042  44.419 14.512  1.00 53.02  ? 166 PHE H N   1 
ATOM 4542 C CA  . PHE C 3 166 ? 85.564  45.588 13.803  1.00 53.02  ? 166 PHE H CA  1 
ATOM 4543 C C   . PHE C 3 166 ? 84.092  45.550 13.447  1.00 53.02  ? 166 PHE H C   1 
ATOM 4544 O O   . PHE C 3 166 ? 83.529  44.492 13.191  1.00 53.02  ? 166 PHE H O   1 
ATOM 4545 C CB  . PHE C 3 166 ? 86.411  45.790 12.569  1.00 67.62  ? 166 PHE H CB  1 
ATOM 4546 C CG  . PHE C 3 166 ? 87.861  45.807 12.867  1.00 67.62  ? 166 PHE H CG  1 
ATOM 4547 C CD1 . PHE C 3 166 ? 88.486  44.667 13.365  1.00 67.62  ? 166 PHE H CD1 1 
ATOM 4548 C CD2 . PHE C 3 166 ? 88.597  46.967 12.694  1.00 67.62  ? 166 PHE H CD2 1 
ATOM 4549 C CE1 . PHE C 3 166 ? 89.823  44.680 13.694  1.00 67.62  ? 166 PHE H CE1 1 
ATOM 4550 C CE2 . PHE C 3 166 ? 89.938  46.996 13.019  1.00 67.62  ? 166 PHE H CE2 1 
ATOM 4551 C CZ  . PHE C 3 166 ? 90.558  45.843 13.524  1.00 67.62  ? 166 PHE H CZ  1 
ATOM 4552 N N   . PRO C 3 167 ? 83.451  46.723 13.434  1.00 47.38  ? 167 PRO H N   1 
ATOM 4553 C CA  . PRO C 3 167 ? 82.032  46.854 13.117  1.00 47.38  ? 167 PRO H CA  1 
ATOM 4554 C C   . PRO C 3 167 ? 81.628  46.327 11.747  1.00 47.38  ? 167 PRO H C   1 
ATOM 4555 O O   . PRO C 3 167 ? 82.206  46.669 10.712  1.00 47.38  ? 167 PRO H O   1 
ATOM 4556 C CB  . PRO C 3 167 ? 81.766  48.351 13.321  1.00 54.90  ? 167 PRO H CB  1 
ATOM 4557 C CG  . PRO C 3 167 ? 83.086  48.970 13.066  1.00 54.90  ? 167 PRO H CG  1 
ATOM 4558 C CD  . PRO C 3 167 ? 84.032  48.034 13.757  1.00 54.90  ? 167 PRO H CD  1 
ATOM 4559 N N   . ALA C 3 168 ? 80.623  45.465 11.769  1.00 69.22  ? 168 ALA H N   1 
ATOM 4560 C CA  . ALA C 3 168 ? 80.126  44.862 10.563  1.00 69.22  ? 168 ALA H CA  1 
ATOM 4561 C C   . ALA C 3 168 ? 79.813  45.944 9.558   1.00 69.22  ? 168 ALA H C   1 
ATOM 4562 O O   . ALA C 3 168 ? 78.946  46.778 9.779   1.00 69.22  ? 168 ALA H O   1 
ATOM 4563 C CB  . ALA C 3 168 ? 78.877  44.040 10.862  1.00 220.63 ? 168 ALA H CB  1 
ATOM 4564 N N   . VAL C 3 169 ? 80.563  45.946 8.466   1.00 77.76  ? 169 VAL H N   1 
ATOM 4565 C CA  . VAL C 3 169 ? 80.335  46.889 7.386   1.00 77.76  ? 169 VAL H CA  1 
ATOM 4566 C C   . VAL C 3 169 ? 79.432  46.133 6.456   1.00 77.76  ? 169 VAL H C   1 
ATOM 4567 O O   . VAL C 3 169 ? 79.547  44.917 6.322   1.00 77.76  ? 169 VAL H O   1 
ATOM 4568 C CB  . VAL C 3 169 ? 81.606  47.208 6.603   1.00 51.56  ? 169 VAL H CB  1 
ATOM 4569 C CG1 . VAL C 3 169 ? 81.247  47.904 5.306   1.00 51.56  ? 169 VAL H CG1 1 
ATOM 4570 C CG2 . VAL C 3 169 ? 82.528  48.053 7.451   1.00 51.56  ? 169 VAL H CG2 1 
ATOM 4571 N N   . LEU C 3 170 ? 78.515  46.833 5.824   1.00 75.33  ? 170 LEU H N   1 
ATOM 4572 C CA  . LEU C 3 170 ? 77.652  46.134 4.913   1.00 75.33  ? 170 LEU H CA  1 
ATOM 4573 C C   . LEU C 3 170 ? 78.472  45.939 3.625   1.00 75.33  ? 170 LEU H C   1 
ATOM 4574 O O   . LEU C 3 170 ? 79.617  46.394 3.558   1.00 75.33  ? 170 LEU H O   1 
ATOM 4575 C CB  . LEU C 3 170 ? 76.389  46.957 4.701   1.00 61.40  ? 170 LEU H CB  1 
ATOM 4576 C CG  . LEU C 3 170 ? 75.195  46.195 4.147   1.00 61.40  ? 170 LEU H CG  1 
ATOM 4577 C CD1 . LEU C 3 170 ? 75.303  44.740 4.506   1.00 61.40  ? 170 LEU H CD1 1 
ATOM 4578 C CD2 . LEU C 3 170 ? 73.921  46.792 4.703   1.00 61.40  ? 170 LEU H CD2 1 
ATOM 4579 N N   . GLN C 3 171 ? 77.927  45.242 2.630   1.00 77.86  ? 171 GLN H N   1 
ATOM 4580 C CA  . GLN C 3 171 ? 78.647  45.012 1.371   1.00 77.86  ? 171 GLN H CA  1 
ATOM 4581 C C   . GLN C 3 171 ? 77.794  44.101 0.514   1.00 77.86  ? 171 GLN H C   1 
ATOM 4582 O O   . GLN C 3 171 ? 77.756  42.897 0.744   1.00 77.86  ? 171 GLN H O   1 
ATOM 4583 C CB  . GLN C 3 171 ? 80.014  44.355 1.631   1.00 73.05  ? 171 GLN H CB  1 
ATOM 4584 C CG  . GLN C 3 171 ? 80.878  44.118 0.381   1.00 73.05  ? 171 GLN H CG  1 
ATOM 4585 C CD  . GLN C 3 171 ? 82.351  43.754 0.690   1.00 73.05  ? 171 GLN H CD  1 
ATOM 4586 O OE1 . GLN C 3 171 ? 82.637  42.763 1.376   1.00 73.05  ? 171 GLN H OE1 1 
ATOM 4587 N NE2 . GLN C 3 171 ? 83.286  44.559 0.176   1.00 73.05  ? 171 GLN H NE2 1 
ATOM 4588 N N   . SER C 3 172 ? 77.096  44.680 -0.461  1.00 86.33  ? 172 SER H N   1 
ATOM 4589 C CA  . SER C 3 172 ? 76.233  43.912 -1.358  1.00 86.33  ? 172 SER H CA  1 
ATOM 4590 C C   . SER C 3 172 ? 75.089  43.210 -0.603  1.00 86.33  ? 172 SER H C   1 
ATOM 4591 O O   . SER C 3 172 ? 74.944  41.989 -0.625  1.00 86.33  ? 172 SER H O   1 
ATOM 4592 C CB  . SER C 3 172 ? 77.080  42.897 -2.132  1.00 107.61 ? 172 SER H CB  1 
ATOM 4593 O OG  . SER C 3 172 ? 78.101  43.551 -2.872  1.00 107.61 ? 172 SER H OG  1 
ATOM 4594 N N   . ASP C 3 173 ? 74.276  44.027 0.052   1.00 90.82  ? 173 ASP H N   1 
ATOM 4595 C CA  . ASP C 3 173 ? 73.141  43.581 0.842   1.00 90.82  ? 173 ASP H CA  1 
ATOM 4596 C C   . ASP C 3 173 ? 73.463  42.448 1.812   1.00 90.82  ? 173 ASP H C   1 
ATOM 4597 O O   . ASP C 3 173 ? 72.606  41.615 2.094   1.00 90.82  ? 173 ASP H O   1 
ATOM 4598 C CB  . ASP C 3 173 ? 71.979  43.168 -0.066  1.00 291.04 ? 173 ASP H CB  1 
ATOM 4599 C CG  . ASP C 3 173 ? 70.650  43.114 0.678   1.00 291.04 ? 173 ASP H CG  1 
ATOM 4600 O OD1 . ASP C 3 173 ? 69.635  42.730 0.063   1.00 291.04 ? 173 ASP H OD1 1 
ATOM 4601 O OD2 . ASP C 3 173 ? 70.620  43.463 1.879   1.00 291.04 ? 173 ASP H OD2 1 
ATOM 4602 N N   . LEU C 3 174 ? 74.683  42.432 2.344   1.00 44.88  ? 174 LEU H N   1 
ATOM 4603 C CA  . LEU C 3 174 ? 75.091  41.386 3.289   1.00 44.88  ? 174 LEU H CA  1 
ATOM 4604 C C   . LEU C 3 174 ? 76.207  41.872 4.221   1.00 44.88  ? 174 LEU H C   1 
ATOM 4605 O O   . LEU C 3 174 ? 77.186  42.455 3.755   1.00 44.88  ? 174 LEU H O   1 
ATOM 4606 C CB  . LEU C 3 174 ? 75.562  40.162 2.501   1.00 50.00  ? 174 LEU H CB  1 
ATOM 4607 C CG  . LEU C 3 174 ? 74.781  38.868 2.691   1.00 50.00  ? 174 LEU H CG  1 
ATOM 4608 C CD1 . LEU C 3 174 ? 75.125  38.347 4.031   1.00 50.00  ? 174 LEU H CD1 1 
ATOM 4609 C CD2 . LEU C 3 174 ? 73.276  39.087 2.577   1.00 50.00  ? 174 LEU H CD2 1 
ATOM 4610 N N   . TYR C 3 175 ? 76.068  41.647 5.527   1.00 55.76  ? 175 TYR H N   1 
ATOM 4611 C CA  . TYR C 3 175 ? 77.092  42.100 6.474   1.00 55.76  ? 175 TYR H CA  1 
ATOM 4612 C C   . TYR C 3 175 ? 78.345  41.259 6.478   1.00 55.76  ? 175 TYR H C   1 
ATOM 4613 O O   . TYR C 3 175 ? 78.299  40.062 6.214   1.00 55.76  ? 175 TYR H O   1 
ATOM 4614 C CB  . TYR C 3 175 ? 76.531  42.176 7.883   1.00 62.19  ? 175 TYR H CB  1 
ATOM 4615 C CG  . TYR C 3 175 ? 75.660  43.375 8.043   1.00 62.19  ? 175 TYR H CG  1 
ATOM 4616 C CD1 . TYR C 3 175 ? 76.209  44.646 8.131   1.00 62.19  ? 175 TYR H CD1 1 
ATOM 4617 C CD2 . TYR C 3 175 ? 74.284  43.257 8.016   1.00 62.19  ? 175 TYR H CD2 1 
ATOM 4618 C CE1 . TYR C 3 175 ? 75.402  45.779 8.183   1.00 62.19  ? 175 TYR H CE1 1 
ATOM 4619 C CE2 . TYR C 3 175 ? 73.469  44.370 8.068   1.00 62.19  ? 175 TYR H CE2 1 
ATOM 4620 C CZ  . TYR C 3 175 ? 74.030  45.631 8.148   1.00 62.19  ? 175 TYR H CZ  1 
ATOM 4621 O OH  . TYR C 3 175 ? 73.214  46.738 8.166   1.00 62.19  ? 175 TYR H OH  1 
ATOM 4622 N N   . THR C 3 176 ? 79.469  41.898 6.779   1.00 60.26  ? 176 THR H N   1 
ATOM 4623 C CA  . THR C 3 176 ? 80.764  41.224 6.798   1.00 60.26  ? 176 THR H CA  1 
ATOM 4624 C C   . THR C 3 176 ? 81.579  41.882 7.891   1.00 60.26  ? 176 THR H C   1 
ATOM 4625 O O   . THR C 3 176 ? 81.588  43.104 8.014   1.00 60.26  ? 176 THR H O   1 
ATOM 4626 C CB  . THR C 3 176 ? 81.550  41.413 5.438   1.00 60.59  ? 176 THR H CB  1 
ATOM 4627 O OG1 . THR C 3 176 ? 80.811  40.839 4.352   1.00 60.59  ? 176 THR H OG1 1 
ATOM 4628 C CG2 . THR C 3 176 ? 82.933  40.766 5.504   1.00 60.59  ? 176 THR H CG2 1 
ATOM 4629 N N   . LEU C 3 177 ? 82.258  41.086 8.698   1.00 61.05  ? 177 LEU H N   1 
ATOM 4630 C CA  . LEU C 3 177 ? 83.087  41.672 9.731   1.00 61.05  ? 177 LEU H CA  1 
ATOM 4631 C C   . LEU C 3 177 ? 84.229  40.743 10.094  1.00 61.05  ? 177 LEU H C   1 
ATOM 4632 O O   . LEU C 3 177 ? 84.335  39.646 9.548   1.00 61.05  ? 177 LEU H O   1 
ATOM 4633 C CB  . LEU C 3 177 ? 82.242  42.031 10.953  1.00 57.56  ? 177 LEU H CB  1 
ATOM 4634 C CG  . LEU C 3 177 ? 81.881  41.033 12.035  1.00 57.56  ? 177 LEU H CG  1 
ATOM 4635 C CD1 . LEU C 3 177 ? 83.089  40.736 12.903  1.00 57.56  ? 177 LEU H CD1 1 
ATOM 4636 C CD2 . LEU C 3 177 ? 80.788  41.653 12.876  1.00 57.56  ? 177 LEU H CD2 1 
ATOM 4637 N N   . SER C 3 178 ? 85.087  41.176 11.008  1.00 60.88  ? 178 SER H N   1 
ATOM 4638 C CA  . SER C 3 178 ? 86.229  40.355 11.370  1.00 60.88  ? 178 SER H CA  1 
ATOM 4639 C C   . SER C 3 178 ? 86.867  40.735 12.687  1.00 60.88  ? 178 SER H C   1 
ATOM 4640 O O   . SER C 3 178 ? 86.795  41.881 13.111  1.00 60.88  ? 178 SER H O   1 
ATOM 4641 C CB  . SER C 3 178 ? 87.276  40.459 10.268  1.00 76.11  ? 178 SER H CB  1 
ATOM 4642 O OG  . SER C 3 178 ? 87.543  41.823 9.975   1.00 76.11  ? 178 SER H OG  1 
ATOM 4643 N N   . SER C 3 179 ? 87.513  39.774 13.324  1.00 68.42  ? 179 SER H N   1 
ATOM 4644 C CA  . SER C 3 179 ? 88.175  40.053 14.576  1.00 68.42  ? 179 SER H CA  1 
ATOM 4645 C C   . SER C 3 179 ? 89.603  39.523 14.550  1.00 68.42  ? 179 SER H C   1 
ATOM 4646 O O   . SER C 3 179 ? 89.832  38.346 14.280  1.00 68.42  ? 179 SER H O   1 
ATOM 4647 C CB  . SER C 3 179 ? 87.404  39.422 15.723  1.00 89.75  ? 179 SER H CB  1 
ATOM 4648 O OG  . SER C 3 179 ? 88.135  39.559 16.934  1.00 89.75  ? 179 SER H OG  1 
ATOM 4649 N N   . SER C 3 180 ? 90.563  40.401 14.816  1.00 71.62  ? 180 SER H N   1 
ATOM 4650 C CA  . SER C 3 180 ? 91.969  40.023 14.825  1.00 71.62  ? 180 SER H CA  1 
ATOM 4651 C C   . SER C 3 180 ? 92.378  39.800 16.263  1.00 71.62  ? 180 SER H C   1 
ATOM 4652 O O   . SER C 3 180 ? 91.677  40.230 17.178  1.00 71.62  ? 180 SER H O   1 
ATOM 4653 C CB  . SER C 3 180 ? 92.830  41.134 14.220  1.00 75.47  ? 180 SER H CB  1 
ATOM 4654 O OG  . SER C 3 180 ? 92.776  42.314 14.999  1.00 75.47  ? 180 SER H OG  1 
ATOM 4655 N N   . VAL C 3 181 ? 93.513  39.140 16.469  1.00 96.24  ? 181 VAL H N   1 
ATOM 4656 C CA  . VAL C 3 181 ? 93.986  38.874 17.823  1.00 96.24  ? 181 VAL H CA  1 
ATOM 4657 C C   . VAL C 3 181 ? 95.496  38.733 17.937  1.00 96.24  ? 181 VAL H C   1 
ATOM 4658 O O   . VAL C 3 181 ? 96.146  38.099 17.112  1.00 96.24  ? 181 VAL H O   1 
ATOM 4659 C CB  . VAL C 3 181 ? 93.363  37.587 18.389  1.00 67.47  ? 181 VAL H CB  1 
ATOM 4660 C CG1 . VAL C 3 181 ? 93.853  36.383 17.593  1.00 67.47  ? 181 VAL H CG1 1 
ATOM 4661 C CG2 . VAL C 3 181 ? 93.724  37.446 19.866  1.00 67.47  ? 181 VAL H CG2 1 
ATOM 4662 N N   . THR C 3 182 ? 96.040  39.326 18.986  1.00 107.41 ? 182 THR H N   1 
ATOM 4663 C CA  . THR C 3 182 ? 97.463  39.257 19.253  1.00 107.41 ? 182 THR H CA  1 
ATOM 4664 C C   . THR C 3 182 ? 97.623  38.383 20.503  1.00 107.41 ? 182 THR H C   1 
ATOM 4665 O O   . THR C 3 182 ? 96.783  38.414 21.412  1.00 107.41 ? 182 THR H O   1 
ATOM 4666 C CB  . THR C 3 182 ? 98.036  40.667 19.518  1.00 104.77 ? 182 THR H CB  1 
ATOM 4667 O OG1 . THR C 3 182 ? 97.642  41.545 18.458  1.00 104.77 ? 182 THR H OG1 1 
ATOM 4668 C CG2 . THR C 3 182 ? 99.550  40.631 19.587  1.00 104.77 ? 182 THR H CG2 1 
ATOM 4669 N N   . VAL C 3 183 ? 98.684  37.582 20.530  1.00 80.57  ? 183 VAL H N   1 
ATOM 4670 C CA  . VAL C 3 183 ? 98.984  36.707 21.664  1.00 80.57  ? 183 VAL H CA  1 
ATOM 4671 C C   . VAL C 3 183 ? 100.496 36.548 21.654  1.00 80.57  ? 183 VAL H C   1 
ATOM 4672 O O   . VAL C 3 183 ? 101.162 37.096 20.791  1.00 80.57  ? 183 VAL H O   1 
ATOM 4673 C CB  . VAL C 3 183 ? 98.324  35.299 21.510  1.00 65.49  ? 183 VAL H CB  1 
ATOM 4674 C CG1 . VAL C 3 183 ? 96.800  35.429 21.457  1.00 65.49  ? 183 VAL H CG1 1 
ATOM 4675 C CG2 . VAL C 3 183 ? 98.864  34.603 20.269  1.00 65.49  ? 183 VAL H CG2 1 
ATOM 4676 N N   . PRO C 3 184 ? 101.067 35.831 22.628  1.00 101.97 ? 184 PRO H N   1 
ATOM 4677 C CA  . PRO C 3 184 ? 102.524 35.739 22.505  1.00 101.97 ? 184 PRO H CA  1 
ATOM 4678 C C   . PRO C 3 184 ? 102.836 34.695 21.442  1.00 101.97 ? 184 PRO H C   1 
ATOM 4679 O O   . PRO C 3 184 ? 102.178 33.656 21.381  1.00 101.97 ? 184 PRO H O   1 
ATOM 4680 C CB  . PRO C 3 184 ? 102.968 35.284 23.894  1.00 111.33 ? 184 PRO H CB  1 
ATOM 4681 C CG  . PRO C 3 184 ? 101.884 35.797 24.787  1.00 111.33 ? 184 PRO H CG  1 
ATOM 4682 C CD  . PRO C 3 184 ? 100.635 35.492 23.993  1.00 111.33 ? 184 PRO H CD  1 
ATOM 4683 N N   . SER C 3 185 ? 103.814 34.968 20.589  1.00 91.22  ? 185 SER H N   1 
ATOM 4684 C CA  . SER C 3 185 ? 104.162 33.993 19.572  1.00 91.22  ? 185 SER H CA  1 
ATOM 4685 C C   . SER C 3 185 ? 104.512 32.722 20.333  1.00 91.22  ? 185 SER H C   1 
ATOM 4686 O O   . SER C 3 185 ? 104.388 31.604 19.820  1.00 91.22  ? 185 SER H O   1 
ATOM 4687 C CB  . SER C 3 185 ? 105.358 34.483 18.760  1.00 91.18  ? 185 SER H CB  1 
ATOM 4688 O OG  . SER C 3 185 ? 105.932 35.637 19.347  1.00 91.18  ? 185 SER H OG  1 
ATOM 4689 N N   . SER C 3 186 ? 104.916 32.931 21.585  1.00 94.88  ? 186 SER H N   1 
ATOM 4690 C CA  . SER C 3 186 ? 105.311 31.876 22.512  1.00 94.88  ? 186 SER H CA  1 
ATOM 4691 C C   . SER C 3 186 ? 104.117 31.040 22.929  1.00 94.88  ? 186 SER H C   1 
ATOM 4692 O O   . SER C 3 186 ? 104.219 30.224 23.840  1.00 94.88  ? 186 SER H O   1 
ATOM 4693 C CB  . SER C 3 186 ? 105.922 32.494 23.775  1.00 182.91 ? 186 SER H CB  1 
ATOM 4694 O OG  . SER C 3 186 ? 106.697 33.642 23.478  1.00 182.91 ? 186 SER H OG  1 
ATOM 4695 N N   . THR C 3 187 ? 102.983 31.226 22.269  1.00 165.44 ? 187 THR H N   1 
ATOM 4696 C CA  . THR C 3 187 ? 101.814 30.482 22.683  1.00 165.44 ? 187 THR H CA  1 
ATOM 4697 C C   . THR C 3 187 ? 100.939 29.815 21.634  1.00 165.44 ? 187 THR H C   1 
ATOM 4698 O O   . THR C 3 187 ? 100.811 28.596 21.626  1.00 165.44 ? 187 THR H O   1 
ATOM 4699 C CB  . THR C 3 187 ? 100.922 31.371 23.575  1.00 97.52  ? 187 THR H CB  1 
ATOM 4700 O OG1 . THR C 3 187 ? 100.724 32.646 22.945  1.00 97.52  ? 187 THR H OG1 1 
ATOM 4701 C CG2 . THR C 3 187 ? 101.571 31.569 24.938  1.00 97.52  ? 187 THR H CG2 1 
ATOM 4702 N N   . TRP C 3 188 ? 100.343 30.600 20.745  1.00 196.34 ? 188 TRP H N   1 
ATOM 4703 C CA  . TRP C 3 188 ? 99.429  30.050 19.747  1.00 196.34 ? 188 TRP H CA  1 
ATOM 4704 C C   . TRP C 3 188 ? 99.667  28.674 19.127  1.00 196.34 ? 188 TRP H C   1 
ATOM 4705 O O   . TRP C 3 188 ? 99.089  27.688 19.574  1.00 196.34 ? 188 TRP H O   1 
ATOM 4706 C CB  . TRP C 3 188 ? 99.199  31.045 18.614  1.00 87.28  ? 188 TRP H CB  1 
ATOM 4707 C CG  . TRP C 3 188 ? 98.477  30.423 17.462  1.00 87.28  ? 188 TRP H CG  1 
ATOM 4708 C CD1 . TRP C 3 188 ? 97.290  29.729 17.501  1.00 87.28  ? 188 TRP H CD1 1 
ATOM 4709 C CD2 . TRP C 3 188 ? 98.898  30.421 16.106  1.00 87.28  ? 188 TRP H CD2 1 
ATOM 4710 N NE1 . TRP C 3 188 ? 96.954  29.294 16.240  1.00 87.28  ? 188 TRP H NE1 1 
ATOM 4711 C CE2 . TRP C 3 188 ? 97.924  29.707 15.365  1.00 87.28  ? 188 TRP H CE2 1 
ATOM 4712 C CE3 . TRP C 3 188 ? 100.004 30.954 15.440  1.00 87.28  ? 188 TRP H CE3 1 
ATOM 4713 C CZ2 . TRP C 3 188 ? 98.023  29.520 13.997  1.00 87.28  ? 188 TRP H CZ2 1 
ATOM 4714 C CZ3 . TRP C 3 188 ? 100.105 30.771 14.082  1.00 87.28  ? 188 TRP H CZ3 1 
ATOM 4715 C CH2 . TRP C 3 188 ? 99.119  30.058 13.369  1.00 87.28  ? 188 TRP H CH2 1 
ATOM 4716 N N   . PRO C 3 189 ? 100.512 28.584 18.089  1.00 127.64 ? 189 PRO H N   1 
ATOM 4717 C CA  . PRO C 3 189 ? 100.716 27.257 17.494  1.00 127.64 ? 189 PRO H CA  1 
ATOM 4718 C C   . PRO C 3 189 ? 100.917 26.147 18.526  1.00 127.64 ? 189 PRO H C   1 
ATOM 4719 O O   . PRO C 3 189 ? 100.638 24.973 18.257  1.00 127.64 ? 189 PRO H O   1 
ATOM 4720 C CB  . PRO C 3 189 ? 101.930 27.470 16.604  1.00 72.61  ? 189 PRO H CB  1 
ATOM 4721 C CG  . PRO C 3 189 ? 102.716 28.483 17.384  1.00 72.61  ? 189 PRO H CG  1 
ATOM 4722 C CD  . PRO C 3 189 ? 101.653 29.467 17.790  1.00 72.61  ? 189 PRO H CD  1 
ATOM 4723 N N   . SER C 3 190 ? 101.392 26.538 19.709  1.00 113.97 ? 190 SER H N   1 
ATOM 4724 C CA  . SER C 3 190 ? 101.633 25.611 20.810  1.00 113.97 ? 190 SER H CA  1 
ATOM 4725 C C   . SER C 3 190 ? 100.294 25.236 21.437  1.00 113.97 ? 190 SER H C   1 
ATOM 4726 O O   . SER C 3 190 ? 99.874  24.079 21.374  1.00 113.97 ? 190 SER H O   1 
ATOM 4727 C CB  . SER C 3 190 ? 102.519 26.271 21.869  1.00 87.41  ? 190 SER H CB  1 
ATOM 4728 O OG  . SER C 3 190 ? 103.492 27.117 21.274  1.00 87.41  ? 190 SER H OG  1 
ATOM 4729 N N   . GLU C 3 191 ? 99.632  26.229 22.035  1.00 75.73  ? 191 GLU H N   1 
ATOM 4730 C CA  . GLU C 3 191 ? 98.328  26.050 22.685  1.00 75.73  ? 191 GLU H CA  1 
ATOM 4731 C C   . GLU C 3 191 ? 97.165  26.422 21.749  1.00 75.73  ? 191 GLU H C   1 
ATOM 4732 O O   . GLU C 3 191 ? 97.249  27.359 20.958  1.00 75.73  ? 191 GLU H O   1 
ATOM 4733 C CB  . GLU C 3 191 ? 98.258  26.890 23.972  1.00 200.92 ? 191 GLU H CB  1 
ATOM 4734 C CG  . GLU C 3 191 ? 97.028  26.630 24.847  1.00 200.92 ? 191 GLU H CG  1 
ATOM 4735 C CD  . GLU C 3 191 ? 97.131  27.295 26.214  1.00 200.92 ? 191 GLU H CD  1 
ATOM 4736 O OE1 . GLU C 3 191 ? 98.051  26.940 26.981  1.00 200.92 ? 191 GLU H OE1 1 
ATOM 4737 O OE2 . GLU C 3 191 ? 96.295  28.171 26.524  1.00 200.92 ? 191 GLU H OE2 1 
ATOM 4738 N N   . THR C 3 192 ? 96.074  25.679 21.852  1.00 111.43 ? 192 THR H N   1 
ATOM 4739 C CA  . THR C 3 192 ? 94.917  25.919 21.010  1.00 111.43 ? 192 THR H CA  1 
ATOM 4740 C C   . THR C 3 192 ? 94.373  27.348 21.090  1.00 111.43 ? 192 THR H C   1 
ATOM 4741 O O   . THR C 3 192 ? 94.445  28.002 22.134  1.00 111.43 ? 192 THR H O   1 
ATOM 4742 C CB  . THR C 3 192 ? 93.794  24.927 21.357  1.00 188.09 ? 192 THR H CB  1 
ATOM 4743 O OG1 . THR C 3 192 ? 92.639  25.215 20.563  1.00 188.09 ? 192 THR H OG1 1 
ATOM 4744 C CG2 . THR C 3 192 ? 93.437  25.021 22.832  1.00 188.09 ? 192 THR H CG2 1 
ATOM 4745 N N   . VAL C 3 193 ? 93.844  27.825 19.962  1.00 89.71  ? 193 VAL H N   1 
ATOM 4746 C CA  . VAL C 3 193 ? 93.248  29.165 19.850  1.00 89.71  ? 193 VAL H CA  1 
ATOM 4747 C C   . VAL C 3 193 ? 92.057  29.135 18.875  1.00 89.71  ? 193 VAL H C   1 
ATOM 4748 O O   . VAL C 3 193 ? 92.227  29.013 17.656  1.00 89.71  ? 193 VAL H O   1 
ATOM 4749 C CB  . VAL C 3 193 ? 94.279  30.208 19.351  1.00 92.99  ? 193 VAL H CB  1 
ATOM 4750 C CG1 . VAL C 3 193 ? 93.632  31.583 19.257  1.00 92.99  ? 193 VAL H CG1 1 
ATOM 4751 C CG2 . VAL C 3 193 ? 95.471  30.246 20.297  1.00 92.99  ? 193 VAL H CG2 1 
ATOM 4752 N N   . THR C 3 194 ? 90.851  29.226 19.421  1.00 111.92 ? 194 THR H N   1 
ATOM 4753 C CA  . THR C 3 194 ? 89.652  29.210 18.596  1.00 111.92 ? 194 THR H CA  1 
ATOM 4754 C C   . THR C 3 194 ? 89.002  30.594 18.576  1.00 111.92 ? 194 THR H C   1 
ATOM 4755 O O   . THR C 3 194 ? 89.358  31.473 19.366  1.00 111.92 ? 194 THR H O   1 
ATOM 4756 C CB  . THR C 3 194 ? 88.625  28.156 19.110  1.00 104.18 ? 194 THR H CB  1 
ATOM 4757 O OG1 . THR C 3 194 ? 87.421  28.232 18.335  1.00 104.18 ? 194 THR H OG1 1 
ATOM 4758 C CG2 . THR C 3 194 ? 88.302  28.391 20.581  1.00 104.18 ? 194 THR H CG2 1 
ATOM 4759 N N   . CYS C 3 195 ? 88.064  30.789 17.654  1.00 70.31  ? 195 CYS H N   1 
ATOM 4760 C CA  . CYS C 3 195 ? 87.363  32.052 17.539  1.00 70.31  ? 195 CYS H CA  1 
ATOM 4761 C C   . CYS C 3 195 ? 85.903  31.660 17.446  1.00 70.31  ? 195 CYS H C   1 
ATOM 4762 O O   . CYS C 3 195 ? 85.514  30.837 16.607  1.00 70.31  ? 195 CYS H O   1 
ATOM 4763 C CB  . CYS C 3 195 ? 87.808  32.793 16.288  1.00 97.11  ? 195 CYS H CB  1 
ATOM 4764 S SG  . CYS C 3 195 ? 86.633  32.707 14.908  1.00 97.11  ? 195 CYS H SG  1 
ATOM 4765 N N   . ASN C 3 196 ? 85.111  32.239 18.341  1.00 102.99 ? 196 ASN H N   1 
ATOM 4766 C CA  . ASN C 3 196 ? 83.687  31.959 18.426  1.00 102.99 ? 196 ASN H CA  1 
ATOM 4767 C C   . ASN C 3 196 ? 82.879  32.994 17.672  1.00 102.99 ? 196 ASN H C   1 
ATOM 4768 O O   . ASN C 3 196 ? 83.331  34.115 17.463  1.00 102.99 ? 196 ASN H O   1 
ATOM 4769 C CB  . ASN C 3 196 ? 83.259  31.944 19.892  1.00 100.00 ? 196 ASN H CB  1 
ATOM 4770 C CG  . ASN C 3 196 ? 84.253  31.222 20.779  1.00 100.00 ? 196 ASN H CG  1 
ATOM 4771 O OD1 . ASN C 3 196 ? 85.379  31.680 20.972  1.00 100.00 ? 196 ASN H OD1 1 
ATOM 4772 N ND2 . ASN C 3 196 ? 83.842  30.083 21.319  1.00 100.00 ? 196 ASN H ND2 1 
ATOM 4773 N N   . VAL C 3 197 ? 81.674  32.612 17.273  1.00 69.80  ? 197 VAL H N   1 
ATOM 4774 C CA  . VAL C 3 197 ? 80.798  33.504 16.529  1.00 69.80  ? 197 VAL H CA  1 
ATOM 4775 C C   . VAL C 3 197 ? 79.335  33.185 16.778  1.00 69.80  ? 197 VAL H C   1 
ATOM 4776 O O   . VAL C 3 197 ? 78.938  32.026 16.812  1.00 69.80  ? 197 VAL H O   1 
ATOM 4777 C CB  . VAL C 3 197 ? 81.061  33.393 15.037  1.00 48.19  ? 197 VAL H CB  1 
ATOM 4778 C CG1 . VAL C 3 197 ? 80.226  34.428 14.302  1.00 48.19  ? 197 VAL H CG1 1 
ATOM 4779 C CG2 . VAL C 3 197 ? 82.565  33.546 14.761  1.00 48.19  ? 197 VAL H CG2 1 
ATOM 4780 N N   . ALA C 3 198 ? 78.523  34.219 16.921  1.00 71.51  ? 198 ALA H N   1 
ATOM 4781 C CA  . ALA C 3 198 ? 77.118  33.994 17.205  1.00 71.51  ? 198 ALA H CA  1 
ATOM 4782 C C   . ALA C 3 198 ? 76.145  34.847 16.394  1.00 71.51  ? 198 ALA H C   1 
ATOM 4783 O O   . ALA C 3 198 ? 76.226  36.071 16.386  1.00 71.51  ? 198 ALA H O   1 
ATOM 4784 C CB  . ALA C 3 198 ? 76.883  34.210 18.681  1.00 29.99  ? 198 ALA H CB  1 
ATOM 4785 N N   . HIS C 3 199 ? 75.212  34.196 15.717  1.00 72.30  ? 199 HIS H N   1 
ATOM 4786 C CA  . HIS C 3 199 ? 74.239  34.928 14.935  1.00 72.30  ? 199 HIS H CA  1 
ATOM 4787 C C   . HIS C 3 199 ? 72.834  34.561 15.412  1.00 72.30  ? 199 HIS H C   1 
ATOM 4788 O O   . HIS C 3 199 ? 72.204  33.609 14.911  1.00 72.30  ? 199 HIS H O   1 
ATOM 4789 C CB  . HIS C 3 199 ? 74.386  34.626 13.447  1.00 100.22 ? 199 HIS H CB  1 
ATOM 4790 C CG  . HIS C 3 199 ? 73.530  35.494 12.579  1.00 100.22 ? 199 HIS H CG  1 
ATOM 4791 N ND1 . HIS C 3 199 ? 73.283  35.212 11.253  1.00 100.22 ? 199 HIS H ND1 1 
ATOM 4792 C CD2 . HIS C 3 199 ? 72.859  36.638 12.853  1.00 100.22 ? 199 HIS H CD2 1 
ATOM 4793 C CE1 . HIS C 3 199 ? 72.494  36.143 10.746  1.00 100.22 ? 199 HIS H CE1 1 
ATOM 4794 N NE2 . HIS C 3 199 ? 72.222  37.020 11.697  1.00 100.22 ? 199 HIS H NE2 1 
ATOM 4795 N N   . PRO C 3 200 ? 72.322  35.319 16.395  1.00 76.25  ? 200 PRO H N   1 
ATOM 4796 C CA  . PRO C 3 200 ? 71.000  35.111 16.975  1.00 76.25  ? 200 PRO H CA  1 
ATOM 4797 C C   . PRO C 3 200 ? 69.931  35.266 15.926  1.00 76.25  ? 200 PRO H C   1 
ATOM 4798 O O   . PRO C 3 200 ? 68.993  34.479 15.855  1.00 76.25  ? 200 PRO H O   1 
ATOM 4799 C CB  . PRO C 3 200 ? 70.916  36.197 18.027  1.00 66.73  ? 200 PRO H CB  1 
ATOM 4800 C CG  . PRO C 3 200 ? 72.348  36.465 18.360  1.00 66.73  ? 200 PRO H CG  1 
ATOM 4801 C CD  . PRO C 3 200 ? 72.978  36.473 17.023  1.00 66.73  ? 200 PRO H CD  1 
ATOM 4802 N N   . ALA C 3 201 ? 70.066  36.294 15.105  1.00 88.43  ? 201 ALA H N   1 
ATOM 4803 C CA  . ALA C 3 201 ? 69.072  36.509 14.072  1.00 88.43  ? 201 ALA H CA  1 
ATOM 4804 C C   . ALA C 3 201 ? 68.734  35.169 13.434  1.00 88.43  ? 201 ALA H C   1 
ATOM 4805 O O   . ALA C 3 201 ? 67.624  34.980 12.933  1.00 88.43  ? 201 ALA H O   1 
ATOM 4806 C CB  . ALA C 3 201 ? 69.601  37.482 13.018  1.00 94.75  ? 201 ALA H CB  1 
ATOM 4807 N N   . SER C 3 202 ? 69.689  34.237 13.483  1.00 64.06  ? 202 SER H N   1 
ATOM 4808 C CA  . SER C 3 202 ? 69.521  32.911 12.890  1.00 64.06  ? 202 SER H CA  1 
ATOM 4809 C C   . SER C 3 202 ? 69.672  31.814 13.925  1.00 64.06  ? 202 SER H C   1 
ATOM 4810 O O   . SER C 3 202 ? 69.480  30.635 13.618  1.00 64.06  ? 202 SER H O   1 
ATOM 4811 C CB  . SER C 3 202 ? 70.562  32.704 11.796  1.00 66.07  ? 202 SER H CB  1 
ATOM 4812 O OG  . SER C 3 202 ? 71.860  32.657 12.360  1.00 66.07  ? 202 SER H OG  1 
ATOM 4813 N N   . SER C 3 203 ? 69.993  32.218 15.151  1.00 115.73 ? 203 SER H N   1 
ATOM 4814 C CA  . SER C 3 203 ? 70.203  31.278 16.237  1.00 115.73 ? 203 SER H CA  1 
ATOM 4815 C C   . SER C 3 203 ? 71.248  30.339 15.683  1.00 115.73 ? 203 SER H C   1 
ATOM 4816 O O   . SER C 3 203 ? 70.992  29.167 15.412  1.00 115.73 ? 203 SER H O   1 
ATOM 4817 C CB  . SER C 3 203 ? 68.918  30.526 16.554  1.00 95.45  ? 203 SER H CB  1 
ATOM 4818 O OG  . SER C 3 203 ? 67.904  31.421 16.970  1.00 95.45  ? 203 SER H OG  1 
ATOM 4819 N N   . THR C 3 204 ? 72.436  30.891 15.502  1.00 91.55  ? 204 THR H N   1 
ATOM 4820 C CA  . THR C 3 204 ? 73.558  30.159 14.941  1.00 91.55  ? 204 THR H CA  1 
ATOM 4821 C C   . THR C 3 204 ? 74.863  30.450 15.679  1.00 91.55  ? 204 THR H C   1 
ATOM 4822 O O   . THR C 3 204 ? 75.414  31.539 15.530  1.00 91.55  ? 204 THR H O   1 
ATOM 4823 C CB  . THR C 3 204 ? 73.738  30.559 13.465  1.00 76.81  ? 204 THR H CB  1 
ATOM 4824 O OG1 . THR C 3 204 ? 72.724  29.927 12.681  1.00 76.81  ? 204 THR H OG1 1 
ATOM 4825 C CG2 . THR C 3 204 ? 75.128  30.189 12.961  1.00 76.81  ? 204 THR H CG2 1 
ATOM 4826 N N   . LYS C 3 205 ? 75.361  29.502 16.468  1.00 108.84 ? 205 LYS H N   1 
ATOM 4827 C CA  . LYS C 3 205 ? 76.624  29.726 17.167  1.00 108.84 ? 205 LYS H CA  1 
ATOM 4828 C C   . LYS C 3 205 ? 77.707  28.940 16.433  1.00 108.84 ? 205 LYS H C   1 
ATOM 4829 O O   . LYS C 3 205 ? 77.427  27.881 15.868  1.00 108.84 ? 205 LYS H O   1 
ATOM 4830 C CB  . LYS C 3 205 ? 76.528  29.289 18.629  1.00 103.30 ? 205 LYS H CB  1 
ATOM 4831 C CG  . LYS C 3 205 ? 77.739  29.687 19.457  1.00 103.30 ? 205 LYS H CG  1 
ATOM 4832 C CD  . LYS C 3 205 ? 77.501  29.458 20.941  1.00 103.30 ? 205 LYS H CD  1 
ATOM 4833 C CE  . LYS C 3 205 ? 78.727  29.838 21.767  1.00 103.30 ? 205 LYS H CE  1 
ATOM 4834 N NZ  . LYS C 3 205 ? 78.484  29.671 23.233  1.00 103.30 ? 205 LYS H NZ  1 
ATOM 4835 N N   . VAL C 3 206 ? 78.937  29.453 16.432  1.00 88.88  ? 206 VAL H N   1 
ATOM 4836 C CA  . VAL C 3 206 ? 80.019  28.786 15.708  1.00 88.88  ? 206 VAL H CA  1 
ATOM 4837 C C   . VAL C 3 206 ? 81.426  28.950 16.252  1.00 88.88  ? 206 VAL H C   1 
ATOM 4838 O O   . VAL C 3 206 ? 81.811  30.015 16.726  1.00 88.88  ? 206 VAL H O   1 
ATOM 4839 C CB  . VAL C 3 206 ? 80.066  29.251 14.259  1.00 50.14  ? 206 VAL H CB  1 
ATOM 4840 C CG1 . VAL C 3 206 ? 79.863  28.059 13.338  1.00 50.14  ? 206 VAL H CG1 1 
ATOM 4841 C CG2 . VAL C 3 206 ? 79.011  30.343 14.024  1.00 50.14  ? 206 VAL H CG2 1 
ATOM 4842 N N   . ASP C 3 207 ? 82.204  27.885 16.129  1.00 124.73 ? 207 ASP H N   1 
ATOM 4843 C CA  . ASP C 3 207 ? 83.575  27.876 16.603  1.00 124.73 ? 207 ASP H CA  1 
ATOM 4844 C C   . ASP C 3 207 ? 84.492  27.558 15.429  1.00 124.73 ? 207 ASP H C   1 
ATOM 4845 O O   . ASP C 3 207 ? 84.125  26.770 14.557  1.00 124.73 ? 207 ASP H O   1 
ATOM 4846 C CB  . ASP C 3 207 ? 83.711  26.811 17.687  1.00 121.43 ? 207 ASP H CB  1 
ATOM 4847 C CG  . ASP C 3 207 ? 82.628  26.925 18.747  1.00 121.43 ? 207 ASP H CG  1 
ATOM 4848 O OD1 . ASP C 3 207 ? 82.786  27.739 19.687  1.00 121.43 ? 207 ASP H OD1 1 
ATOM 4849 O OD2 . ASP C 3 207 ? 81.603  26.213 18.624  1.00 121.43 ? 207 ASP H OD2 1 
ATOM 4850 N N   . LYS C 3 208 ? 85.670  28.178 15.390  1.00 65.79  ? 208 LYS H N   1 
ATOM 4851 C CA  . LYS C 3 208 ? 86.619  27.913 14.306  1.00 65.79  ? 208 LYS H CA  1 
ATOM 4852 C C   . LYS C 3 208 ? 88.045  27.966 14.827  1.00 65.79  ? 208 LYS H C   1 
ATOM 4853 O O   . LYS C 3 208 ? 88.588  29.033 15.076  1.00 65.79  ? 208 LYS H O   1 
ATOM 4854 C CB  . LYS C 3 208 ? 86.453  28.931 13.174  1.00 103.21 ? 208 LYS H CB  1 
ATOM 4855 C CG  . LYS C 3 208 ? 86.601  28.352 11.760  1.00 103.21 ? 208 LYS H CG  1 
ATOM 4856 C CD  . LYS C 3 208 ? 85.308  27.648 11.324  1.00 103.21 ? 208 LYS H CD  1 
ATOM 4857 C CE  . LYS C 3 208 ? 85.391  27.092 9.903   1.00 103.21 ? 208 LYS H CE  1 
ATOM 4858 N NZ  . LYS C 3 208 ? 84.091  26.505 9.485   1.00 103.21 ? 208 LYS H NZ  1 
ATOM 4859 N N   . LYS C 3 209 ? 88.641  26.796 14.993  1.00 79.88  ? 209 LYS H N   1 
ATOM 4860 C CA  . LYS C 3 209 ? 90.004  26.663 15.493  1.00 79.88  ? 209 LYS H CA  1 
ATOM 4861 C C   . LYS C 3 209 ? 90.918  27.248 14.422  1.00 79.88  ? 209 LYS H C   1 
ATOM 4862 O O   . LYS C 3 209 ? 90.508  27.375 13.261  1.00 79.88  ? 209 LYS H O   1 
ATOM 4863 C CB  . LYS C 3 209 ? 90.303  25.176 15.692  1.00 168.49 ? 209 LYS H CB  1 
ATOM 4864 C CG  . LYS C 3 209 ? 91.306  24.812 16.775  1.00 168.49 ? 209 LYS H CG  1 
ATOM 4865 C CD  . LYS C 3 209 ? 91.319  23.290 16.946  1.00 168.49 ? 209 LYS H CD  1 
ATOM 4866 C CE  . LYS C 3 209 ? 92.203  22.824 18.090  1.00 168.49 ? 209 LYS H CE  1 
ATOM 4867 N NZ  . LYS C 3 209 ? 92.137  21.343 18.242  1.00 168.49 ? 209 LYS H NZ  1 
ATOM 4868 N N   . ILE C 3 210 ? 92.145  27.594 14.803  1.00 109.89 ? 210 ILE H N   1 
ATOM 4869 C CA  . ILE C 3 210 ? 93.107  28.168 13.865  1.00 109.89 ? 210 ILE H CA  1 
ATOM 4870 C C   . ILE C 3 210 ? 94.343  27.305 13.665  1.00 109.89 ? 210 ILE H C   1 
ATOM 4871 O O   . ILE C 3 210 ? 95.387  27.547 14.285  1.00 109.89 ? 210 ILE H O   1 
ATOM 4872 C CB  . ILE C 3 210 ? 93.603  29.553 14.328  1.00 69.44  ? 210 ILE H CB  1 
ATOM 4873 C CG1 . ILE C 3 210 ? 92.423  30.481 14.540  1.00 69.44  ? 210 ILE H CG1 1 
ATOM 4874 C CG2 . ILE C 3 210 ? 94.572  30.144 13.301  1.00 69.44  ? 210 ILE H CG2 1 
ATOM 4875 C CD1 . ILE C 3 210 ? 92.831  31.816 15.125  1.00 69.44  ? 210 ILE H CD1 1 
ATOM 4876 N N   . VAL C 3 211 ? 94.229  26.301 12.805  1.00 95.10  ? 211 VAL H N   1 
ATOM 4877 C CA  . VAL C 3 211 ? 95.365  25.439 12.505  1.00 95.10  ? 211 VAL H CA  1 
ATOM 4878 C C   . VAL C 3 211 ? 96.464  26.334 11.912  1.00 95.10  ? 211 VAL H C   1 
ATOM 4879 O O   . VAL C 3 211 ? 96.197  27.118 10.999  1.00 95.10  ? 211 VAL H O   1 
ATOM 4880 C CB  . VAL C 3 211 ? 94.976  24.374 11.475  1.00 121.42 ? 211 VAL H CB  1 
ATOM 4881 C CG1 . VAL C 3 211 ? 96.180  23.525 11.128  1.00 121.42 ? 211 VAL H CG1 1 
ATOM 4882 C CG2 . VAL C 3 211 ? 93.845  23.518 12.017  1.00 121.42 ? 211 VAL H CG2 1 
ATOM 4883 N N   . PRO C 3 212 ? 97.711  26.211 12.407  1.00 94.81  ? 212 PRO H N   1 
ATOM 4884 C CA  . PRO C 3 212 ? 98.834  27.022 11.922  1.00 94.81  ? 212 PRO H CA  1 
ATOM 4885 C C   . PRO C 3 212 ? 98.718  27.452 10.468  1.00 94.81  ? 212 PRO H C   1 
ATOM 4886 O O   . PRO C 3 212 ? 98.114  28.478 10.182  1.00 94.81  ? 212 PRO H O   1 
ATOM 4887 C CB  . PRO C 3 212 ? 100.056 26.145 12.204  1.00 114.37 ? 212 PRO H CB  1 
ATOM 4888 C CG  . PRO C 3 212 ? 99.485  24.762 12.371  1.00 114.37 ? 212 PRO H CG  1 
ATOM 4889 C CD  . PRO C 3 212 ? 98.218  25.028 13.116  1.00 114.37 ? 212 PRO H CD  1 
ATOM 4890 N N   . ARG C 3 213 ? 99.293  26.695 9.544   1.00 144.96 ? 213 ARG H N   1 
ATOM 4891 C CA  . ARG C 3 213 ? 99.192  27.054 8.134   1.00 144.96 ? 213 ARG H CA  1 
ATOM 4892 C C   . ARG C 3 213 ? 99.472  25.834 7.282   1.00 144.96 ? 213 ARG H C   1 
ATOM 4893 O O   . ARG C 3 213 ? 99.685  24.749 7.814   1.00 144.96 ? 213 ARG H O   1 
ATOM 4894 C CB  . ARG C 3 213 ? 100.159 28.200 7.791   1.00 127.17 ? 213 ARG H CB  1 
ATOM 4895 C CG  . ARG C 3 213 ? 99.441  29.529 7.473   1.00 127.17 ? 213 ARG H CG  1 
ATOM 4896 C CD  . ARG C 3 213 ? 98.577  29.397 6.202   1.00 127.17 ? 213 ARG H CD  1 
ATOM 4897 N NE  . ARG C 3 213 ? 97.535  30.422 6.055   1.00 127.17 ? 213 ARG H NE  1 
ATOM 4898 C CZ  . ARG C 3 213 ? 97.752  31.726 5.869   1.00 127.17 ? 213 ARG H CZ  1 
ATOM 4899 N NH1 . ARG C 3 213 ? 98.989  32.197 5.804   1.00 127.17 ? 213 ARG H NH1 1 
ATOM 4900 N NH2 . ARG C 3 213 ? 96.726  32.568 5.740   1.00 127.17 ? 213 ARG H NH2 1 
ATOM 4901 N N   . ASP C 3 214 ? 99.454  26.003 5.964   1.00 251.23 ? 214 ASP H N   1 
ATOM 4902 C CA  . ASP C 3 214 ? 99.706  24.892 5.050   1.00 251.23 ? 214 ASP H CA  1 
ATOM 4903 C C   . ASP C 3 214 ? 101.158 24.433 5.094   1.00 251.23 ? 214 ASP H C   1 
ATOM 4904 O O   . ASP C 3 214 ? 101.611 23.708 4.207   1.00 251.23 ? 214 ASP H O   1 
ATOM 4905 C CB  . ASP C 3 214 ? 99.343  25.287 3.616   1.00 134.38 ? 214 ASP H CB  1 
ATOM 4906 C CG  . ASP C 3 214 ? 97.850  25.479 3.423   1.00 134.38 ? 214 ASP H CG  1 
ATOM 4907 O OD1 . ASP C 3 214 ? 97.260  26.337 4.117   1.00 134.38 ? 214 ASP H OD1 1 
ATOM 4908 O OD2 . ASP C 3 214 ? 97.264  24.774 2.573   1.00 134.38 ? 214 ASP H OD2 1 
ATOM 4909 N N   . CYS C 3 215 ? 101.880 24.855 6.129   1.00 216.15 ? 215 CYS H N   1 
ATOM 4910 C CA  . CYS C 3 215 ? 103.287 24.500 6.298   1.00 216.15 ? 215 CYS H CA  1 
ATOM 4911 C C   . CYS C 3 215 ? 104.120 24.961 5.108   1.00 216.15 ? 215 CYS H C   1 
ATOM 4912 O O   . CYS C 3 215 ? 105.338 25.103 5.213   1.00 216.15 ? 215 CYS H O   1 
ATOM 4913 C CB  . CYS C 3 215 ? 103.450 22.983 6.483   1.00 188.11 ? 215 CYS H CB  1 
ATOM 4914 S SG  . CYS C 3 215 ? 102.971 22.325 8.113   1.00 188.11 ? 215 CYS H SG  1 
ATOM 4915 N N   . GLY C 3 216 ? 103.456 25.196 3.980   1.00 225.46 ? 216 GLY H N   1 
ATOM 4916 C CA  . GLY C 3 216 ? 104.148 25.633 2.784   1.00 225.46 ? 216 GLY H CA  1 
ATOM 4917 C C   . GLY C 3 216 ? 104.257 27.141 2.697   1.00 225.46 ? 216 GLY H C   1 
ATOM 4918 O O   . GLY C 3 216 ? 105.321 27.674 2.383   1.00 225.46 ? 216 GLY H O   1 
ATOM 4919 N N   . CYS C 3 217 ? 103.160 27.834 2.981   1.00 173.42 ? 217 CYS H N   1 
ATOM 4920 C CA  . CYS C 3 217 ? 103.153 29.290 2.920   1.00 173.42 ? 217 CYS H CA  1 
ATOM 4921 C C   . CYS C 3 217 ? 104.124 29.877 3.940   1.00 173.42 ? 217 CYS H C   1 
ATOM 4922 O O   . CYS C 3 217 ? 105.083 30.552 3.512   1.00 173.42 ? 217 CYS H O   1 
ATOM 4923 C CB  . CYS C 3 217 ? 101.743 29.822 3.179   1.00 178.72 ? 217 CYS H CB  1 
ATOM 4924 S SG  . CYS C 3 217 ? 101.490 31.559 2.689   1.00 178.72 ? 217 CYS H SG  1 
ATOM 4925 O OXT . CYS C 3 217 ? 103.919 29.652 5.151   1.00 178.72 ? 217 CYS H OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   24  ?   ?   ?   A . n 
A 1 2   THR 2   25  ?   ?   ?   A . n 
A 1 3   GLN 3   26  ?   ?   ?   A . n 
A 1 4   GLN 4   27  ?   ?   ?   A . n 
A 1 5   ARG 5   28  ?   ?   ?   A . n 
A 1 6   ASP 6   29  ?   ?   ?   A . n 
A 1 7   GLU 7   30  ?   ?   ?   A . n 
A 1 8   VAL 8   31  ?   ?   ?   A . n 
A 1 9   TRP 9   32  ?   ?   ?   A . n 
A 1 10  VAL 10  33  ?   ?   ?   A . n 
A 1 11  VAL 11  34  ?   ?   ?   A . n 
A 1 12  GLY 12  35  ?   ?   ?   A . n 
A 1 13  MET 13  36  ?   ?   ?   A . n 
A 1 14  GLY 14  37  37  GLY GLY A . n 
A 1 15  ILE 15  38  38  ILE ILE A . n 
A 1 16  VAL 16  39  39  VAL ALA A . n 
A 1 17  MET 17  40  40  MET ALA A . n 
A 1 18  SER 18  41  41  SER SER A . n 
A 1 19  LEU 19  42  42  LEU ALA A . n 
A 1 20  ILE 20  43  43  ILE ILE A . n 
A 1 21  VAL 21  44  44  VAL VAL A . n 
A 1 22  LEU 22  45  45  LEU ALA A . n 
A 1 23  ALA 23  46  46  ALA ALA A . n 
A 1 24  ILE 24  47  47  ILE ALA A . n 
A 1 25  VAL 25  48  48  VAL VAL A . n 
A 1 26  PHE 26  49  49  PHE ALA A . n 
A 1 27  GLY 27  50  50  GLY GLY A . n 
A 1 28  ASN 28  51  51  ASN ASN A . n 
A 1 29  VAL 29  52  52  VAL VAL A . n 
A 1 30  LEU 30  53  53  LEU ALA A . n 
A 1 31  VAL 31  54  54  VAL VAL A . n 
A 1 32  ILE 32  55  55  ILE ILE A . n 
A 1 33  THR 33  56  56  THR THR A . n 
A 1 34  ALA 34  57  57  ALA ALA A . n 
A 1 35  ILE 35  58  58  ILE ILE A . n 
A 1 36  ALA 36  59  59  ALA ALA A . n 
A 1 37  LYS 37  60  ?   ?   ?   A . n 
A 1 38  PHE 38  61  61  PHE PHE A . n 
A 1 39  GLU 39  62  62  GLU GLU A . n 
A 1 40  ARG 40  63  63  ARG ARG A . n 
A 1 41  LEU 41  64  64  LEU LEU A . n 
A 1 42  GLN 42  65  65  GLN GLN A . n 
A 1 43  THR 43  66  66  THR THR A . n 
A 1 44  VAL 44  67  67  VAL VAL A . n 
A 1 45  THR 45  68  68  THR THR A . n 
A 1 46  ASN 46  69  69  ASN ASN A . n 
A 1 47  TYR 47  70  70  TYR TYR A . n 
A 1 48  PHE 48  71  71  PHE PHE A . n 
A 1 49  ILE 49  72  72  ILE ILE A . n 
A 1 50  THR 50  73  73  THR ALA A . n 
A 1 51  SER 51  74  74  SER SER A . n 
A 1 52  LEU 52  75  75  LEU LEU A . n 
A 1 53  ALA 53  76  76  ALA ALA A . n 
A 1 54  CYS 54  77  77  CYS CYS A . n 
A 1 55  ALA 55  78  78  ALA ALA A . n 
A 1 56  ASP 56  79  79  ASP ASP A . n 
A 1 57  LEU 57  80  80  LEU LEU A . n 
A 1 58  VAL 58  81  81  VAL VAL A . n 
A 1 59  MET 59  82  82  MET MET A . n 
A 1 60  GLY 60  83  83  GLY GLY A . n 
A 1 61  LEU 61  84  84  LEU LEU A . n 
A 1 62  ALA 62  85  85  ALA ALA A . n 
A 1 63  VAL 63  86  86  VAL VAL A . n 
A 1 64  VAL 64  87  87  VAL VAL A . n 
A 1 65  PRO 65  88  88  PRO PRO A . n 
A 1 66  PHE 66  89  89  PHE PHE A . n 
A 1 67  GLY 67  90  90  GLY GLY A . n 
A 1 68  ALA 68  91  ?   ?   ?   A . n 
A 1 69  ALA 69  92  ?   ?   ?   A . n 
A 1 70  HIS 70  93  ?   ?   ?   A . n 
A 1 71  ILE 71  94  ?   ?   ?   A . n 
A 1 72  LEU 72  95  ?   ?   ?   A . n 
A 1 73  MET 73  96  ?   ?   ?   A . n 
A 1 74  LYS 74  97  ?   ?   ?   A . n 
A 1 75  MET 75  98  ?   ?   ?   A . n 
A 1 76  TRP 76  99  ?   ?   ?   A . n 
A 1 77  THR 77  100 ?   ?   ?   A . n 
A 1 78  PHE 78  101 ?   ?   ?   A . n 
A 1 79  GLY 79  102 ?   ?   ?   A . n 
A 1 80  ASN 80  103 ?   ?   ?   A . n 
A 1 81  PHE 81  104 ?   ?   ?   A . n 
A 1 82  TRP 82  105 ?   ?   ?   A . n 
A 1 83  CYS 83  106 ?   ?   ?   A . n 
A 1 84  GLU 84  107 ?   ?   ?   A . n 
A 1 85  PHE 85  108 108 PHE PHE A . n 
A 1 86  TRP 86  109 109 TRP ALA A . n 
A 1 87  THR 87  110 110 THR THR A . n 
A 1 88  SER 88  111 111 SER SER A . n 
A 1 89  ILE 89  112 112 ILE ALA A . n 
A 1 90  ASP 90  113 113 ASP ASP A . n 
A 1 91  VAL 91  114 114 VAL VAL A . n 
A 1 92  LEU 92  115 115 LEU LEU A . n 
A 1 93  CYS 93  116 116 CYS CYS A . n 
A 1 94  VAL 94  117 117 VAL VAL A . n 
A 1 95  THR 95  118 118 THR THR A . n 
A 1 96  ALA 96  119 119 ALA ALA A . n 
A 1 97  SER 97  120 120 SER SER A . n 
A 1 98  ILE 98  121 121 ILE ILE A . n 
A 1 99  GLU 99  122 122 GLU ALA A . n 
A 1 100 THR 100 123 123 THR THR A . n 
A 1 101 LEU 101 124 124 LEU LEU A . n 
A 1 102 CYS 102 125 125 CYS CYS A . n 
A 1 103 VAL 103 126 126 VAL VAL A . n 
A 1 104 ILE 104 127 127 ILE ILE A . n 
A 1 105 ALA 105 128 128 ALA ALA A . n 
A 1 106 VAL 106 129 129 VAL VAL A . n 
A 1 107 ASP 107 130 130 ASP ASP A . n 
A 1 108 ARG 108 131 131 ARG ARG A . n 
A 1 109 TYR 109 132 132 TYR TYR A . n 
A 1 110 PHE 110 133 133 PHE PHE A . n 
A 1 111 ALA 111 134 134 ALA ALA A . n 
A 1 112 ILE 112 135 135 ILE ILE A . n 
A 1 113 THR 113 136 136 THR THR A . n 
A 1 114 SER 114 137 137 SER SER A . n 
A 1 115 PRO 115 138 138 PRO PRO A . n 
A 1 116 PHE 116 139 139 PHE PHE A . n 
A 1 117 LYS 117 140 140 LYS LYS A . n 
A 1 118 TYR 118 141 141 TYR TYR A . n 
A 1 119 GLN 119 142 142 GLN GLN A . n 
A 1 120 SER 120 143 143 SER SER A . n 
A 1 121 LEU 121 144 144 LEU LEU A . n 
A 1 122 LEU 122 145 145 LEU LEU A . n 
A 1 123 THR 123 146 146 THR THR A . n 
A 1 124 LYS 124 147 147 LYS ALA A . n 
A 1 125 ASN 125 148 148 ASN ASN A . n 
A 1 126 LYS 126 149 149 LYS LYS A . n 
A 1 127 ALA 127 150 150 ALA ALA A . n 
A 1 128 ARG 128 151 151 ARG ARG A . n 
A 1 129 VAL 129 152 152 VAL ALA A . n 
A 1 130 ILE 130 153 153 ILE ALA A . n 
A 1 131 ILE 131 154 154 ILE ALA A . n 
A 1 132 LEU 132 155 155 LEU ALA A . n 
A 1 133 MET 133 156 156 MET ALA A . n 
A 1 134 VAL 134 157 157 VAL VAL A . n 
A 1 135 TRP 135 158 158 TRP ALA A . n 
A 1 136 ILE 136 159 159 ILE ILE A . n 
A 1 137 VAL 137 160 160 VAL VAL A . n 
A 1 138 SER 138 161 161 SER SER A . n 
A 1 139 GLY 139 162 162 GLY GLY A . n 
A 1 140 LEU 140 163 163 LEU LEU A . n 
A 1 141 THR 141 164 164 THR THR A . n 
A 1 142 SER 142 165 ?   ?   ?   A . n 
A 1 143 PHE 143 166 ?   ?   ?   A . n 
A 1 144 LEU 144 167 ?   ?   ?   A . n 
A 1 145 PRO 145 168 ?   ?   ?   A . n 
A 1 146 ILE 146 169 ?   ?   ?   A . n 
A 1 147 GLN 147 170 ?   ?   ?   A . n 
A 1 148 MET 148 171 ?   ?   ?   A . n 
A 1 149 HIS 149 172 ?   ?   ?   A . n 
A 1 150 TRP 150 173 ?   ?   ?   A . n 
A 1 151 TYR 151 174 ?   ?   ?   A . n 
A 1 152 ARG 152 175 ?   ?   ?   A . n 
A 1 153 ALA 153 176 ?   ?   ?   A . n 
A 1 154 THR 154 177 ?   ?   ?   A . n 
A 1 155 HIS 155 178 ?   ?   ?   A . n 
A 1 156 GLN 156 179 ?   ?   ?   A . n 
A 1 157 GLU 157 180 ?   ?   ?   A . n 
A 1 158 ALA 158 181 ?   ?   ?   A . n 
A 1 159 ILE 159 182 ?   ?   ?   A . n 
A 1 160 ASN 160 183 ?   ?   ?   A . n 
A 1 161 CYS 161 184 ?   ?   ?   A . n 
A 1 162 TYR 162 185 ?   ?   ?   A . n 
A 1 163 ALA 163 186 ?   ?   ?   A . n 
A 1 164 ASN 164 187 ?   ?   ?   A . n 
A 1 165 GLU 165 188 ?   ?   ?   A . n 
A 1 166 THR 166 189 ?   ?   ?   A . n 
A 1 167 CYS 167 190 ?   ?   ?   A . n 
A 1 168 CYS 168 191 ?   ?   ?   A . n 
A 1 169 ASP 169 192 ?   ?   ?   A . n 
A 1 170 PHE 170 193 ?   ?   ?   A . n 
A 1 171 PHE 171 194 ?   ?   ?   A . n 
A 1 172 THR 172 195 ?   ?   ?   A . n 
A 1 173 ASN 173 196 ?   ?   ?   A . n 
A 1 174 GLN 174 197 ?   ?   ?   A . n 
A 1 175 ALA 175 198 ?   ?   ?   A . n 
A 1 176 TYR 176 199 ?   ?   ?   A . n 
A 1 177 ALA 177 200 ?   ?   ?   A . n 
A 1 178 ILE 178 201 ?   ?   ?   A . n 
A 1 179 ALA 179 202 ?   ?   ?   A . n 
A 1 180 SER 180 203 203 SER SER A . n 
A 1 181 SER 181 204 204 SER SER A . n 
A 1 182 ILE 182 205 205 ILE ILE A . n 
A 1 183 VAL 183 206 206 VAL VAL A . n 
A 1 184 SER 184 207 207 SER SER A . n 
A 1 185 PHE 185 208 208 PHE PHE A . n 
A 1 186 TYR 186 209 209 TYR ALA A . n 
A 1 187 VAL 187 210 210 VAL VAL A . n 
A 1 188 PRO 188 211 211 PRO PRO A . n 
A 1 189 LEU 189 212 212 LEU LEU A . n 
A 1 190 VAL 190 213 213 VAL VAL A . n 
A 1 191 ILE 191 214 214 ILE ILE A . n 
A 1 192 MET 192 215 215 MET MET A . n 
A 1 193 VAL 193 216 216 VAL VAL A . n 
A 1 194 PHE 194 217 217 PHE PHE A . n 
A 1 195 VAL 195 218 218 VAL VAL A . n 
A 1 196 TYR 196 219 219 TYR TYR A . n 
A 1 197 SER 197 220 220 SER SER A . n 
A 1 198 ARG 198 221 221 ARG ARG A . n 
A 1 199 VAL 199 222 222 VAL VAL A . n 
A 1 200 PHE 200 223 223 PHE PHE A . n 
A 1 201 GLN 201 224 224 GLN GLN A . n 
A 1 202 GLU 202 225 225 GLU GLU A . n 
A 1 203 ALA 203 226 226 ALA ALA A . n 
A 1 204 LYS 204 227 227 LYS LYS A . n 
A 1 205 ARG 205 228 228 ARG ARG A . n 
A 1 206 GLN 206 229 229 GLN GLN A . n 
A 1 207 LEU 207 230 230 LEU LEU A . n 
A 1 208 GLN 208 231 231 GLN GLN A . n 
A 1 209 LYS 209 232 232 LYS LYS A . n 
A 1 210 ILE 210 233 233 ILE ILE A . n 
A 1 211 ASP 211 234 234 ASP ASP A . n 
A 1 212 LYS 212 235 235 LYS LYS A . n 
A 1 213 SER 213 236 236 SER SER A . n 
A 1 214 GLU 214 237 237 GLU GLU A . n 
A 1 215 GLY 215 238 238 GLY GLY A . n 
A 1 216 ARG 216 239 239 ARG ARG A . n 
A 1 217 PHE 217 240 240 PHE PHE A . n 
A 1 218 HIS 218 241 241 HIS HIS A . n 
A 1 219 VAL 219 242 242 VAL VAL A . n 
A 1 220 GLN 220 243 ?   ?   ?   A . n 
A 1 221 ASN 221 244 ?   ?   ?   A . n 
A 1 222 LEU 222 245 ?   ?   ?   A . n 
A 1 223 SER 223 246 ?   ?   ?   A . n 
A 1 224 GLN 224 247 ?   ?   ?   A . n 
A 1 225 VAL 225 248 ?   ?   ?   A . n 
A 1 226 GLU 226 249 ?   ?   ?   A . n 
A 1 227 GLN 227 250 ?   ?   ?   A . n 
A 1 228 ASP 228 251 ?   ?   ?   A . n 
A 1 229 GLY 229 252 ?   ?   ?   A . n 
A 1 230 ARG 230 253 ?   ?   ?   A . n 
A 1 231 THR 231 254 ?   ?   ?   A . n 
A 1 232 GLY 232 255 ?   ?   ?   A . n 
A 1 233 HIS 233 256 ?   ?   ?   A . n 
A 1 234 GLY 234 257 ?   ?   ?   A . n 
A 1 235 LEU 235 258 ?   ?   ?   A . n 
A 1 236 ARG 236 259 ?   ?   ?   A . n 
A 1 237 ARG 237 260 ?   ?   ?   A . n 
A 1 238 SER 238 261 ?   ?   ?   A . n 
A 1 239 SER 239 262 ?   ?   ?   A . n 
A 1 240 LYS 240 263 ?   ?   ?   A . n 
A 1 241 PHE 241 264 264 PHE PHE A . n 
A 1 242 CYS 242 265 265 CYS CYS A . n 
A 1 243 LEU 243 266 266 LEU LEU A . n 
A 1 244 LYS 244 267 267 LYS LYS A . n 
A 1 245 GLU 245 268 268 GLU GLU A . n 
A 1 246 HIS 246 269 269 HIS HIS A . n 
A 1 247 LYS 247 270 270 LYS LYS A . n 
A 1 248 ALA 248 271 271 ALA ALA A . n 
A 1 249 LEU 249 272 272 LEU LEU A . n 
A 1 250 LYS 250 273 273 LYS LYS A . n 
A 1 251 THR 251 274 274 THR THR A . n 
A 1 252 LEU 252 275 275 LEU LEU A . n 
A 1 253 GLY 253 276 276 GLY GLY A . n 
A 1 254 ILE 254 277 277 ILE ILE A . n 
A 1 255 ILE 255 278 278 ILE ILE A . n 
A 1 256 MET 256 279 279 MET MET A . n 
A 1 257 GLY 257 280 280 GLY GLY A . n 
A 1 258 THR 258 281 281 THR THR A . n 
A 1 259 PHE 259 282 282 PHE PHE A . n 
A 1 260 THR 260 283 283 THR THR A . n 
A 1 261 LEU 261 284 284 LEU LEU A . n 
A 1 262 CYS 262 285 285 CYS CYS A . n 
A 1 263 TRP 263 286 286 TRP TRP A . n 
A 1 264 LEU 264 287 287 LEU LEU A . n 
A 1 265 PRO 265 288 288 PRO PRO A . n 
A 1 266 PHE 266 289 289 PHE PHE A . n 
A 1 267 PHE 267 290 290 PHE PHE A . n 
A 1 268 ILE 268 291 291 ILE ILE A . n 
A 1 269 VAL 269 292 ?   ?   ?   A . n 
A 1 270 ASN 270 293 ?   ?   ?   A . n 
A 1 271 ILE 271 294 ?   ?   ?   A . n 
A 1 272 VAL 272 295 ?   ?   ?   A . n 
A 1 273 HIS 273 296 ?   ?   ?   A . n 
A 1 274 VAL 274 297 ?   ?   ?   A . n 
A 1 275 ILE 275 298 ?   ?   ?   A . n 
A 1 276 GLN 276 299 ?   ?   ?   A . n 
A 1 277 ASP 277 300 ?   ?   ?   A . n 
A 1 278 ASN 278 301 ?   ?   ?   A . n 
A 1 279 LEU 279 302 ?   ?   ?   A . n 
A 1 280 ILE 280 303 ?   ?   ?   A . n 
A 1 281 ARG 281 304 ?   ?   ?   A . n 
A 1 282 LYS 282 305 ?   ?   ?   A . n 
A 1 283 GLU 283 306 ?   ?   ?   A . n 
A 1 284 VAL 284 307 ?   ?   ?   A . n 
A 1 285 TYR 285 308 ?   ?   ?   A . n 
A 1 286 ILE 286 309 ?   ?   ?   A . n 
A 1 287 LEU 287 310 ?   ?   ?   A . n 
A 1 288 LEU 288 311 311 LEU LEU A . n 
A 1 289 ASN 289 312 312 ASN ASN A . n 
A 1 290 TRP 290 313 313 TRP ALA A . n 
A 1 291 ILE 291 314 314 ILE ILE A . n 
A 1 292 GLY 292 315 315 GLY GLY A . n 
A 1 293 TYR 293 316 316 TYR TYR A . n 
A 1 294 VAL 294 317 317 VAL VAL A . n 
A 1 295 ASN 295 318 318 ASN ALA A . n 
A 1 296 SER 296 319 319 SER ALA A . n 
A 1 297 GLY 297 320 320 GLY GLY A . n 
A 1 298 PHE 298 321 321 PHE ALA A . n 
A 1 299 ASN 299 322 322 ASN ASN A . n 
A 1 300 PRO 300 323 323 PRO PRO A . n 
A 1 301 LEU 301 324 324 LEU LEU A . n 
A 1 302 ILE 302 325 325 ILE ALA A . n 
A 1 303 TYR 303 326 326 TYR ALA A . n 
A 1 304 CYS 304 327 327 CYS CYS A . n 
A 1 305 ARG 305 328 328 ARG ARG A . n 
A 1 306 SER 306 329 329 SER SER A . n 
A 1 307 PRO 307 330 330 PRO PRO A . n 
A 1 308 ASP 308 331 331 ASP ASP A . n 
A 1 309 PHE 309 332 332 PHE ALA A . n 
A 1 310 ARG 310 333 333 ARG ARG A . n 
A 1 311 ILE 311 334 334 ILE ILE A . n 
A 1 312 ALA 312 335 335 ALA ALA A . n 
A 1 313 PHE 313 336 336 PHE PHE A . n 
A 1 314 GLN 314 337 337 GLN GLN A . n 
A 1 315 GLU 315 338 338 GLU GLU A . n 
A 1 316 LEU 316 339 339 LEU LEU A . n 
A 1 317 LEU 317 340 340 LEU LEU A . n 
A 1 318 CYS 318 341 341 CYS CYS A . n 
A 1 319 LEU 319 342 342 LEU LEU A . n 
A 1 320 ARG 320 343 343 ARG ARG A . n 
A 1 321 ARG 321 344 344 ARG ARG A . n 
A 1 322 SER 322 345 345 SER SER A . n 
A 1 323 SER 323 346 346 SER SER A . n 
A 1 324 LEU 324 347 347 LEU LEU A . n 
A 1 325 LYS 325 348 348 LYS LYS A . n 
A 1 326 ALA 326 349 ?   ?   ?   A . n 
A 1 327 TYR 327 350 ?   ?   ?   A . n 
A 1 328 GLY 328 351 ?   ?   ?   A . n 
A 1 329 ASN 329 352 ?   ?   ?   A . n 
A 1 330 GLY 330 353 ?   ?   ?   A . n 
A 1 331 TYR 331 354 ?   ?   ?   A . n 
A 1 332 SER 332 355 ?   ?   ?   A . n 
A 1 333 SER 333 356 ?   ?   ?   A . n 
A 1 334 ASN 334 357 ?   ?   ?   A . n 
A 1 335 GLY 335 358 ?   ?   ?   A . n 
A 1 336 ASN 336 359 ?   ?   ?   A . n 
A 1 337 THR 337 360 ?   ?   ?   A . n 
A 1 338 GLY 338 361 ?   ?   ?   A . n 
A 1 339 GLU 339 362 ?   ?   ?   A . n 
A 1 340 GLN 340 363 ?   ?   ?   A . n 
A 1 341 SER 341 364 ?   ?   ?   A . n 
A 1 342 GLY 342 365 ?   ?   ?   A . n 
B 2 1   ASP 1   1   1   ASP ASP L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   LYS 3   3   3   LYS LYS L . n 
B 2 4   MET 4   4   4   MET MET L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   SER 7   7   7   SER SER L . n 
B 2 8   PRO 8   8   8   PRO PRO L . n 
B 2 9   SER 9   9   9   SER SER L . n 
B 2 10  SER 10  10  10  SER SER L . n 
B 2 11  MET 11  11  11  MET MET L . n 
B 2 12  TYR 12  12  12  TYR TYR L . n 
B 2 13  ALA 13  13  13  ALA ALA L . n 
B 2 14  SER 14  14  14  SER SER L . n 
B 2 15  LEU 15  15  15  LEU LEU L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  GLU 17  17  17  GLU GLU L . n 
B 2 18  ARG 18  18  18  ARG ARG L . n 
B 2 19  VAL 19  19  19  VAL VAL L . n 
B 2 20  THR 20  20  20  THR THR L . n 
B 2 21  ILE 21  21  21  ILE ILE L . n 
B 2 22  THR 22  22  22  THR THR L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  LYS 24  24  24  LYS LYS L . n 
B 2 25  ALA 25  25  25  ALA ALA L . n 
B 2 26  SER 26  26  26  SER SER L . n 
B 2 27  GLN 27  27  27  GLN GLN L . n 
B 2 28  ASP 28  28  28  ASP ASP L . n 
B 2 29  ILE 29  29  29  ILE ILE L . n 
B 2 30  ASN 30  30  30  ASN ASN L . n 
B 2 31  SER 31  31  31  SER SER L . n 
B 2 32  TYR 32  32  32  TYR TYR L . n 
B 2 33  LEU 33  33  33  LEU LEU L . n 
B 2 34  SER 34  34  34  SER SER L . n 
B 2 35  TRP 35  35  35  TRP TRP L . n 
B 2 36  PHE 36  36  36  PHE PHE L . n 
B 2 37  GLN 37  37  37  GLN GLN L . n 
B 2 38  GLN 38  38  38  GLN GLN L . n 
B 2 39  LYS 39  39  39  LYS LYS L . n 
B 2 40  PRO 40  40  40  PRO PRO L . n 
B 2 41  GLY 41  41  41  GLY GLY L . n 
B 2 42  LYS 42  42  42  LYS LYS L . n 
B 2 43  SER 43  43  43  SER SER L . n 
B 2 44  PRO 44  44  44  PRO PRO L . n 
B 2 45  LYS 45  45  45  LYS LYS L . n 
B 2 46  THR 46  46  46  THR THR L . n 
B 2 47  LEU 47  47  47  LEU LEU L . n 
B 2 48  ILE 48  48  48  ILE ILE L . n 
B 2 49  TYR 49  49  49  TYR TYR L . n 
B 2 50  ARG 50  50  50  ARG ARG L . n 
B 2 51  ALA 51  51  51  ALA ALA L . n 
B 2 52  ASN 52  52  52  ASN ASN L . n 
B 2 53  ARG 53  53  53  ARG ARG L . n 
B 2 54  LEU 54  54  54  LEU LEU L . n 
B 2 55  VAL 55  55  55  VAL VAL L . n 
B 2 56  ASP 56  56  56  ASP ASP L . n 
B 2 57  GLY 57  57  57  GLY GLY L . n 
B 2 58  VAL 58  58  58  VAL VAL L . n 
B 2 59  PRO 59  59  59  PRO PRO L . n 
B 2 60  SER 60  60  60  SER SER L . n 
B 2 61  ARG 61  61  61  ARG ARG L . n 
B 2 62  PHE 62  62  62  PHE PHE L . n 
B 2 63  ILE 63  63  63  ILE ILE L . n 
B 2 64  GLY 64  64  64  GLY GLY L . n 
B 2 65  THR 65  65  65  THR THR L . n 
B 2 66  GLY 66  66  66  GLY GLY L . n 
B 2 67  SER 67  67  67  SER SER L . n 
B 2 68  GLY 68  68  68  GLY GLY L . n 
B 2 69  GLN 69  69  69  GLN GLN L . n 
B 2 70  ASP 70  70  70  ASP ASP L . n 
B 2 71  TYR 71  71  71  TYR TYR L . n 
B 2 72  SER 72  72  72  SER SER L . n 
B 2 73  LEU 73  73  73  LEU LEU L . n 
B 2 74  THR 74  74  74  THR THR L . n 
B 2 75  ILE 75  75  75  ILE ILE L . n 
B 2 76  SER 76  76  76  SER SER L . n 
B 2 77  SER 77  77  77  SER SER L . n 
B 2 78  LEU 78  78  78  LEU LEU L . n 
B 2 79  ASP 79  79  79  ASP ASP L . n 
B 2 80  TYR 80  80  80  TYR TYR L . n 
B 2 81  ALA 81  81  81  ALA ALA L . n 
B 2 82  ASP 82  82  82  ASP ASP L . n 
B 2 83  MET 83  83  83  MET MET L . n 
B 2 84  GLY 84  84  84  GLY GLY L . n 
B 2 85  ILE 85  85  85  ILE ILE L . n 
B 2 86  TYR 86  86  86  TYR TYR L . n 
B 2 87  TYR 87  87  87  TYR TYR L . n 
B 2 88  CYS 88  88  88  CYS CYS L . n 
B 2 89  LEU 89  89  89  LEU LEU L . n 
B 2 90  GLN 90  90  90  GLN GLN L . n 
B 2 91  TYR 91  91  91  TYR TYR L . n 
B 2 92  ASP 92  92  92  ASP ASP L . n 
B 2 93  GLU 93  93  93  GLU GLU L . n 
B 2 94  PHE 94  94  94  PHE PHE L . n 
B 2 95  PRO 95  95  95  PRO PRO L . n 
B 2 96  TYR 96  96  96  TYR TYR L . n 
B 2 97  THR 97  97  97  THR THR L . n 
B 2 98  PHE 98  98  98  PHE PHE L . n 
B 2 99  GLY 99  99  99  GLY GLY L . n 
B 2 100 GLY 100 100 100 GLY GLY L . n 
B 2 101 GLY 101 101 101 GLY GLY L . n 
B 2 102 THR 102 102 102 THR THR L . n 
B 2 103 LYS 103 103 103 LYS LYS L . n 
B 2 104 LEU 104 104 104 LEU LEU L . n 
B 2 105 GLU 105 105 105 GLU GLU L . n 
B 2 106 ILE 106 106 106 ILE ILE L . n 
B 2 107 LYS 107 107 107 LYS LYS L . n 
B 2 108 ARG 108 108 108 ARG ARG L . n 
B 2 109 ALA 109 109 109 ALA ALA L . n 
B 2 110 ASP 110 110 110 ASP ASP L . n 
B 2 111 ALA 111 111 111 ALA ALA L . n 
B 2 112 ALA 112 112 112 ALA ALA L . n 
B 2 113 PRO 113 113 113 PRO PRO L . n 
B 2 114 THR 114 114 114 THR THR L . n 
B 2 115 VAL 115 115 115 VAL VAL L . n 
B 2 116 SER 116 116 116 SER SER L . n 
B 2 117 ILE 117 117 117 ILE ILE L . n 
B 2 118 PHE 118 118 118 PHE PHE L . n 
B 2 119 PRO 119 119 119 PRO PRO L . n 
B 2 120 PRO 120 120 120 PRO PRO L . n 
B 2 121 SER 121 121 121 SER SER L . n 
B 2 122 SER 122 122 122 SER SER L . n 
B 2 123 GLU 123 123 123 GLU GLU L . n 
B 2 124 GLN 124 124 124 GLN GLN L . n 
B 2 125 LEU 125 125 125 LEU LEU L . n 
B 2 126 THR 126 126 126 THR THR L . n 
B 2 127 SER 127 127 127 SER SER L . n 
B 2 128 GLY 128 128 128 GLY GLY L . n 
B 2 129 GLY 129 129 129 GLY GLY L . n 
B 2 130 ALA 130 130 130 ALA ALA L . n 
B 2 131 SER 131 131 131 SER SER L . n 
B 2 132 VAL 132 132 132 VAL VAL L . n 
B 2 133 VAL 133 133 133 VAL VAL L . n 
B 2 134 CYS 134 134 134 CYS CYS L . n 
B 2 135 PHE 135 135 135 PHE PHE L . n 
B 2 136 LEU 136 136 136 LEU LEU L . n 
B 2 137 ASN 137 137 137 ASN ASN L . n 
B 2 138 ASN 138 138 138 ASN ASN L . n 
B 2 139 PHE 139 139 139 PHE PHE L . n 
B 2 140 TYR 140 140 140 TYR TYR L . n 
B 2 141 PRO 141 141 141 PRO PRO L . n 
B 2 142 LYS 142 142 142 LYS LYS L . n 
B 2 143 ASP 143 143 143 ASP ASP L . n 
B 2 144 ILE 144 144 144 ILE ILE L . n 
B 2 145 ASN 145 145 145 ASN ASN L . n 
B 2 146 VAL 146 146 146 VAL VAL L . n 
B 2 147 LYS 147 147 147 LYS LYS L . n 
B 2 148 TRP 148 148 148 TRP TRP L . n 
B 2 149 LYS 149 149 149 LYS LYS L . n 
B 2 150 ILE 150 150 150 ILE ILE L . n 
B 2 151 ASP 151 151 151 ASP ASP L . n 
B 2 152 GLY 152 152 152 GLY GLY L . n 
B 2 153 SER 153 153 153 SER SER L . n 
B 2 154 GLU 154 154 154 GLU GLU L . n 
B 2 155 ARG 155 155 155 ARG ARG L . n 
B 2 156 GLN 156 156 156 GLN GLN L . n 
B 2 157 ASN 157 157 157 ASN ASN L . n 
B 2 158 GLY 158 158 158 GLY GLY L . n 
B 2 159 VAL 159 159 159 VAL VAL L . n 
B 2 160 LEU 160 160 160 LEU LEU L . n 
B 2 161 ASN 161 161 161 ASN ASN L . n 
B 2 162 SER 162 162 162 SER SER L . n 
B 2 163 TRP 163 163 163 TRP TRP L . n 
B 2 164 THR 164 164 164 THR THR L . n 
B 2 165 ASP 165 165 165 ASP ASP L . n 
B 2 166 GLN 166 166 166 GLN GLN L . n 
B 2 167 ASP 167 167 167 ASP ASP L . n 
B 2 168 SER 168 168 168 SER SER L . n 
B 2 169 LYS 169 169 169 LYS LYS L . n 
B 2 170 ASP 170 170 170 ASP ASP L . n 
B 2 171 SER 171 171 171 SER SER L . n 
B 2 172 THR 172 172 172 THR THR L . n 
B 2 173 TYR 173 173 173 TYR TYR L . n 
B 2 174 SER 174 174 174 SER SER L . n 
B 2 175 MET 175 175 175 MET MET L . n 
B 2 176 SER 176 176 176 SER SER L . n 
B 2 177 SER 177 177 177 SER SER L . n 
B 2 178 THR 178 178 178 THR THR L . n 
B 2 179 LEU 179 179 179 LEU LEU L . n 
B 2 180 THR 180 180 180 THR THR L . n 
B 2 181 LEU 181 181 181 LEU LEU L . n 
B 2 182 THR 182 182 182 THR THR L . n 
B 2 183 LYS 183 183 183 LYS LYS L . n 
B 2 184 ASP 184 184 184 ASP ASP L . n 
B 2 185 GLU 185 185 185 GLU GLU L . n 
B 2 186 TYR 186 186 186 TYR TYR L . n 
B 2 187 GLU 187 187 187 GLU GLU L . n 
B 2 188 ARG 188 188 188 ARG ARG L . n 
B 2 189 HIS 189 189 189 HIS HIS L . n 
B 2 190 ASN 190 190 190 ASN ASN L . n 
B 2 191 SER 191 191 191 SER SER L . n 
B 2 192 TYR 192 192 192 TYR TYR L . n 
B 2 193 THR 193 193 193 THR THR L . n 
B 2 194 CYS 194 194 194 CYS CYS L . n 
B 2 195 GLU 195 195 195 GLU GLU L . n 
B 2 196 ALA 196 196 196 ALA ALA L . n 
B 2 197 THR 197 197 197 THR THR L . n 
B 2 198 HIS 198 198 198 HIS HIS L . n 
B 2 199 LYS 199 199 199 LYS LYS L . n 
B 2 200 THR 200 200 200 THR THR L . n 
B 2 201 SER 201 201 201 SER SER L . n 
B 2 202 THR 202 202 202 THR THR L . n 
B 2 203 SER 203 203 203 SER SER L . n 
B 2 204 PRO 204 204 204 PRO PRO L . n 
B 2 205 ILE 205 205 205 ILE ILE L . n 
B 2 206 VAL 206 206 206 VAL VAL L . n 
B 2 207 LYS 207 207 207 LYS LYS L . n 
B 2 208 SER 208 208 208 SER SER L . n 
B 2 209 PHE 209 209 209 PHE PHE L . n 
B 2 210 ASN 210 210 210 ASN ASN L . n 
B 2 211 ARG 211 211 211 ARG ARG L . n 
B 2 212 ASN 212 212 212 ASN ASN L . n 
B 2 213 GLU 213 213 213 GLU GLU L . n 
B 2 214 CYS 214 214 214 CYS CYS L . n 
C 3 1   GLU 1   1   1   GLU GLU H . n 
C 3 2   VAL 2   2   2   VAL VAL H . n 
C 3 3   GLN 3   3   3   GLN GLN H . n 
C 3 4   LEU 4   4   4   LEU LEU H . n 
C 3 5   GLN 5   5   5   GLN GLN H . n 
C 3 6   GLN 6   6   6   GLN GLN H . n 
C 3 7   SER 7   7   7   SER SER H . n 
C 3 8   GLY 8   8   8   GLY GLY H . n 
C 3 9   ALA 9   9   9   ALA ALA H . n 
C 3 10  GLU 10  10  10  GLU GLU H . n 
C 3 11  LEU 11  11  11  LEU LEU H . n 
C 3 12  ALA 12  12  12  ALA ALA H . n 
C 3 13  ARG 13  13  13  ARG ARG H . n 
C 3 14  PRO 14  14  14  PRO PRO H . n 
C 3 15  GLY 15  15  15  GLY GLY H . n 
C 3 16  ALA 16  16  16  ALA ALA H . n 
C 3 17  SER 17  17  17  SER SER H . n 
C 3 18  VAL 18  18  18  VAL VAL H . n 
C 3 19  LYS 19  19  19  LYS LYS H . n 
C 3 20  LEU 20  20  20  LEU LEU H . n 
C 3 21  SER 21  21  21  SER SER H . n 
C 3 22  CYS 22  22  22  CYS CYS H . n 
C 3 23  LYS 23  23  23  LYS LYS H . n 
C 3 24  ALA 24  24  24  ALA ALA H . n 
C 3 25  SER 25  25  25  SER SER H . n 
C 3 26  GLY 26  26  26  GLY GLY H . n 
C 3 27  TYR 27  27  27  TYR TYR H . n 
C 3 28  ILE 28  28  28  ILE ILE H . n 
C 3 29  PHE 29  29  29  PHE PHE H . n 
C 3 30  THR 30  30  30  THR THR H . n 
C 3 31  ASP 31  31  31  ASP ASP H . n 
C 3 32  TYR 32  32  32  TYR TYR H . n 
C 3 33  TYR 33  33  33  TYR TYR H . n 
C 3 34  ILE 34  34  34  ILE ILE H . n 
C 3 35  ASN 35  35  35  ASN ASN H . n 
C 3 36  TRP 36  36  36  TRP TRP H . n 
C 3 37  VAL 37  37  37  VAL VAL H . n 
C 3 38  ARG 38  38  38  ARG ARG H . n 
C 3 39  GLN 39  39  39  GLN GLN H . n 
C 3 40  ARG 40  40  40  ARG ARG H . n 
C 3 41  THR 41  41  41  THR THR H . n 
C 3 42  GLY 42  42  42  GLY GLY H . n 
C 3 43  GLN 43  43  43  GLN GLN H . n 
C 3 44  GLY 44  44  44  GLY GLY H . n 
C 3 45  PHE 45  45  45  PHE PHE H . n 
C 3 46  GLU 46  46  46  GLU GLU H . n 
C 3 47  TRP 47  47  47  TRP TRP H . n 
C 3 48  ILE 48  48  48  ILE ILE H . n 
C 3 49  GLY 49  49  49  GLY GLY H . n 
C 3 50  GLU 50  50  50  GLU GLU H . n 
C 3 51  ILE 51  51  51  ILE ILE H . n 
C 3 52  TYR 52  52  52  TYR TYR H . n 
C 3 53  PRO 53  53  53  PRO PRO H . n 
C 3 54  GLY 54  54  54  GLY GLY H . n 
C 3 55  SER 55  55  55  SER SER H . n 
C 3 56  GLY 56  56  56  GLY GLY H . n 
C 3 57  ASN 57  57  57  ASN ASN H . n 
C 3 58  ILE 58  58  58  ILE ILE H . n 
C 3 59  ASP 59  59  59  ASP ASP H . n 
C 3 60  TYR 60  60  60  TYR TYR H . n 
C 3 61  ASN 61  61  61  ASN ASN H . n 
C 3 62  GLU 62  62  62  GLU GLU H . n 
C 3 63  ARG 63  63  63  ARG ARG H . n 
C 3 64  PHE 64  64  64  PHE PHE H . n 
C 3 65  LYS 65  65  65  LYS LYS H . n 
C 3 66  ASP 66  66  66  ASP ASP H . n 
C 3 67  LYS 67  67  67  LYS LYS H . n 
C 3 68  ALA 68  68  68  ALA ALA H . n 
C 3 69  THR 69  69  69  THR THR H . n 
C 3 70  LEU 70  70  70  LEU LEU H . n 
C 3 71  THR 71  71  71  THR THR H . n 
C 3 72  ALA 72  72  72  ALA ALA H . n 
C 3 73  ASP 73  73  73  ASP ASP H . n 
C 3 74  LYS 74  74  74  LYS LYS H . n 
C 3 75  SER 75  75  75  SER SER H . n 
C 3 76  SER 76  76  76  SER SER H . n 
C 3 77  SER 77  77  77  SER SER H . n 
C 3 78  THR 78  78  78  THR THR H . n 
C 3 79  ALA 79  79  79  ALA ALA H . n 
C 3 80  TYR 80  80  80  TYR TYR H . n 
C 3 81  MET 81  81  81  MET MET H . n 
C 3 82  GLN 82  82  82  GLN GLN H . n 
C 3 83  LEU 83  83  83  LEU LEU H . n 
C 3 84  SER 84  84  84  SER SER H . n 
C 3 85  SER 85  85  85  SER SER H . n 
C 3 86  LEU 86  86  86  LEU LEU H . n 
C 3 87  THR 87  87  87  THR THR H . n 
C 3 88  SER 88  88  88  SER SER H . n 
C 3 89  GLU 89  89  89  GLU GLU H . n 
C 3 90  ASP 90  90  90  ASP ASP H . n 
C 3 91  SER 91  91  91  SER SER H . n 
C 3 92  ALA 92  92  92  ALA ALA H . n 
C 3 93  VAL 93  93  93  VAL VAL H . n 
C 3 94  TYR 94  94  94  TYR TYR H . n 
C 3 95  PHE 95  95  95  PHE PHE H . n 
C 3 96  CYS 96  96  96  CYS CYS H . n 
C 3 97  VAL 97  97  97  VAL VAL H . n 
C 3 98  ARG 98  98  98  ARG ARG H . n 
C 3 99  GLY 99  99  99  GLY GLY H . n 
C 3 100 PHE 100 100 100 PHE PHE H . n 
C 3 101 GLY 101 101 101 GLY GLY H . n 
C 3 102 TYR 102 102 102 TYR TYR H . n 
C 3 103 TRP 103 103 103 TRP TRP H . n 
C 3 104 GLY 104 104 104 GLY GLY H . n 
C 3 105 GLN 105 105 105 GLN GLN H . n 
C 3 106 GLY 106 106 106 GLY GLY H . n 
C 3 107 THR 107 107 107 THR THR H . n 
C 3 108 THR 108 108 108 THR THR H . n 
C 3 109 LEU 109 109 109 LEU LEU H . n 
C 3 110 THR 110 110 110 THR THR H . n 
C 3 111 VAL 111 111 111 VAL VAL H . n 
C 3 112 SER 112 112 112 SER SER H . n 
C 3 113 SER 113 113 113 SER SER H . n 
C 3 114 ALA 114 114 114 ALA ALA H . n 
C 3 115 LYS 115 115 115 LYS LYS H . n 
C 3 116 THR 116 116 116 THR THR H . n 
C 3 117 THR 117 117 117 THR THR H . n 
C 3 118 PRO 118 118 118 PRO PRO H . n 
C 3 119 PRO 119 119 119 PRO PRO H . n 
C 3 120 SER 120 120 120 SER SER H . n 
C 3 121 VAL 121 121 121 VAL VAL H . n 
C 3 122 TYR 122 122 122 TYR TYR H . n 
C 3 123 PRO 123 123 123 PRO PRO H . n 
C 3 124 LEU 124 124 124 LEU LEU H . n 
C 3 125 ALA 125 125 125 ALA ALA H . n 
C 3 126 PRO 126 126 126 PRO PRO H . n 
C 3 127 GLY 127 127 127 GLY GLY H . n 
C 3 128 SER 128 128 128 SER SER H . n 
C 3 129 ALA 129 129 129 ALA ALA H . n 
C 3 130 ALA 130 130 130 ALA ALA H . n 
C 3 131 GLN 131 131 131 GLN GLN H . n 
C 3 132 THR 132 132 132 THR THR H . n 
C 3 133 ASN 133 133 133 ASN ASN H . n 
C 3 134 SER 134 134 134 SER SER H . n 
C 3 135 ALA 135 135 135 ALA ALA H . n 
C 3 136 VAL 136 136 136 VAL VAL H . n 
C 3 137 THR 137 137 137 THR THR H . n 
C 3 138 LEU 138 138 138 LEU LEU H . n 
C 3 139 GLY 139 139 139 GLY GLY H . n 
C 3 140 CYS 140 140 140 CYS CYS H . n 
C 3 141 LEU 141 141 141 LEU LEU H . n 
C 3 142 VAL 142 142 142 VAL VAL H . n 
C 3 143 LYS 143 143 143 LYS LYS H . n 
C 3 144 GLY 144 144 144 GLY GLY H . n 
C 3 145 TYR 145 145 145 TYR TYR H . n 
C 3 146 PHE 146 146 146 PHE PHE H . n 
C 3 147 PRO 147 147 147 PRO PRO H . n 
C 3 148 GLU 148 148 148 GLU GLU H . n 
C 3 149 PRO 149 149 149 PRO PRO H . n 
C 3 150 VAL 150 150 150 VAL VAL H . n 
C 3 151 THR 151 151 151 THR THR H . n 
C 3 152 VAL 152 152 152 VAL VAL H . n 
C 3 153 THR 153 153 153 THR THR H . n 
C 3 154 TRP 154 154 154 TRP TRP H . n 
C 3 155 ASN 155 155 155 ASN ASN H . n 
C 3 156 SER 156 156 156 SER SER H . n 
C 3 157 GLY 157 157 157 GLY GLY H . n 
C 3 158 SER 158 158 158 SER SER H . n 
C 3 159 LEU 159 159 159 LEU LEU H . n 
C 3 160 SER 160 160 160 SER SER H . n 
C 3 161 SER 161 161 161 SER SER H . n 
C 3 162 GLY 162 162 162 GLY GLY H . n 
C 3 163 VAL 163 163 163 VAL VAL H . n 
C 3 164 HIS 164 164 164 HIS HIS H . n 
C 3 165 THR 165 165 165 THR THR H . n 
C 3 166 PHE 166 166 166 PHE PHE H . n 
C 3 167 PRO 167 167 167 PRO PRO H . n 
C 3 168 ALA 168 168 168 ALA ALA H . n 
C 3 169 VAL 169 169 169 VAL VAL H . n 
C 3 170 LEU 170 170 170 LEU LEU H . n 
C 3 171 GLN 171 171 171 GLN GLN H . n 
C 3 172 SER 172 172 172 SER SER H . n 
C 3 173 ASP 173 173 173 ASP ASP H . n 
C 3 174 LEU 174 174 174 LEU LEU H . n 
C 3 175 TYR 175 175 175 TYR TYR H . n 
C 3 176 THR 176 176 176 THR THR H . n 
C 3 177 LEU 177 177 177 LEU LEU H . n 
C 3 178 SER 178 178 178 SER SER H . n 
C 3 179 SER 179 179 179 SER SER H . n 
C 3 180 SER 180 180 180 SER SER H . n 
C 3 181 VAL 181 181 181 VAL VAL H . n 
C 3 182 THR 182 182 182 THR THR H . n 
C 3 183 VAL 183 183 183 VAL VAL H . n 
C 3 184 PRO 184 184 184 PRO PRO H . n 
C 3 185 SER 185 185 185 SER SER H . n 
C 3 186 SER 186 186 186 SER SER H . n 
C 3 187 THR 187 187 187 THR THR H . n 
C 3 188 TRP 188 188 188 TRP TRP H . n 
C 3 189 PRO 189 189 189 PRO PRO H . n 
C 3 190 SER 190 190 190 SER SER H . n 
C 3 191 GLU 191 191 191 GLU GLU H . n 
C 3 192 THR 192 192 192 THR THR H . n 
C 3 193 VAL 193 193 193 VAL VAL H . n 
C 3 194 THR 194 194 194 THR THR H . n 
C 3 195 CYS 195 195 195 CYS CYS H . n 
C 3 196 ASN 196 196 196 ASN ASN H . n 
C 3 197 VAL 197 197 197 VAL VAL H . n 
C 3 198 ALA 198 198 198 ALA ALA H . n 
C 3 199 HIS 199 199 199 HIS HIS H . n 
C 3 200 PRO 200 200 200 PRO PRO H . n 
C 3 201 ALA 201 201 201 ALA ALA H . n 
C 3 202 SER 202 202 202 SER SER H . n 
C 3 203 SER 203 203 203 SER SER H . n 
C 3 204 THR 204 204 204 THR THR H . n 
C 3 205 LYS 205 205 205 LYS LYS H . n 
C 3 206 VAL 206 206 206 VAL VAL H . n 
C 3 207 ASP 207 207 207 ASP ASP H . n 
C 3 208 LYS 208 208 208 LYS LYS H . n 
C 3 209 LYS 209 209 209 LYS LYS H . n 
C 3 210 ILE 210 210 210 ILE ILE H . n 
C 3 211 VAL 211 211 211 VAL VAL H . n 
C 3 212 PRO 212 212 212 PRO PRO H . n 
C 3 213 ARG 213 213 213 ARG ARG H . n 
C 3 214 ASP 214 214 214 ASP ASP H . n 
C 3 215 CYS 215 215 215 CYS CYS H . n 
C 3 216 GLY 216 216 216 GLY GLY H . n 
C 3 217 CYS 217 217 217 CYS CYS H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-06 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
_pdbx_phasing_MR.entry_id                     2R4S 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          4.500 
_pdbx_phasing_MR.d_res_low_rotation           11.990 
_pdbx_phasing_MR.d_res_high_translation       4.500 
_pdbx_phasing_MR.d_res_low_translation        11.990 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?              other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
CNS         1.2   ?              package 'Axel T. Brunger'    axel.brunger@yale.edu       refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 4 
PDB_EXTRACT 3.000 'July 2, 2007' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
HKL-2000    .     ?              ?       ?                    ?                           'data collection' ? ?          ? 6 
HKL-2000    .     ?              ?       ?                    ?                           'data reduction'  ? ?          ? 7 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             L 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             L 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             L 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              23 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                121.16 
_pdbx_validate_rmsd_angle.angle_target_value         114.20 
_pdbx_validate_rmsd_angle.angle_deviation            6.96 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 75  ? ? -69.43  7.18    
2  1 ASP A 79  ? ? -153.67 -32.59  
3  1 MET A 82  ? ? -87.84  30.77   
4  1 ALA A 85  ? ? -151.56 -20.56  
5  1 LYS A 140 ? ? -31.19  160.10  
6  1 GLN A 142 ? ? 163.67  99.28   
7  1 SER A 143 ? ? -32.13  159.21  
8  1 LEU A 145 ? ? -49.27  96.54   
9  1 THR A 146 ? ? -49.27  162.68  
10 1 PHE A 208 ? ? -137.45 -62.16  
11 1 TYR A 209 ? ? -57.37  -71.58  
12 1 VAL A 222 ? ? -52.24  -71.23  
13 1 GLU A 225 ? ? -67.00  2.45    
14 1 LEU A 230 ? ? -25.76  -38.68  
15 1 PHE A 240 ? ? -151.03 -16.08  
16 1 HIS A 241 ? ? 10.04   -72.51  
17 1 GLU A 268 ? ? -64.68  3.30    
18 1 PRO A 288 ? ? -58.07  -9.94   
19 1 ASN A 318 ? ? -73.46  24.27   
20 1 ARG A 328 ? ? -90.48  44.95   
21 1 SER A 329 ? ? -155.17 -63.67  
22 1 ARG A 333 ? ? -23.48  -71.87  
23 1 LEU A 342 ? ? 49.30   102.61  
24 1 ARG A 343 ? ? -54.47  -92.43  
25 1 ARG A 344 ? ? -128.15 -68.87  
26 1 SER A 345 ? ? -62.77  16.92   
27 1 SER A 346 ? ? -69.61  50.29   
28 1 ILE L 2   ? ? -168.73 74.34   
29 1 GLN L 6   ? ? -157.64 83.44   
30 1 PRO L 8   ? ? -83.72  -158.36 
31 1 SER L 9   ? ? -122.90 -64.12  
32 1 MET L 11  ? ? 173.19  120.08  
33 1 GLN L 27  ? ? -76.95  -136.29 
34 1 TYR L 32  ? ? -90.66  58.23   
35 1 ALA L 51  ? ? 61.30   -27.15  
36 1 ASN L 52  ? ? -149.68 -16.83  
37 1 SER L 60  ? ? -59.52  2.20    
38 1 THR L 65  ? ? -160.87 106.94  
39 1 TYR L 71  ? ? -130.64 -158.54 
40 1 SER L 72  ? ? 177.55  124.10  
41 1 SER L 77  ? ? 53.74   71.04   
42 1 ASP L 82  ? ? -88.72  38.44   
43 1 ARG L 108 ? ? -106.06 -162.66 
44 1 ASN L 138 ? ? 22.28   79.99   
45 1 SER L 153 ? ? -57.35  -163.29 
46 1 GLU L 154 ? ? -178.31 138.29  
47 1 SER L 162 ? ? -172.08 135.40  
48 1 SER L 168 ? ? -70.50  -73.48  
49 1 LYS L 169 ? ? -60.47  -78.49  
50 1 SER L 171 ? ? 36.13   51.73   
51 1 LYS L 199 ? ? -29.44  -43.14  
52 1 ASN L 212 ? ? -98.27  -73.46  
53 1 GLN H 3   ? ? 179.61  145.22  
54 1 ALA H 16  ? ? -73.12  -149.88 
55 1 CYS H 22  ? ? -163.42 94.30   
56 1 ASP H 31  ? ? -153.85 0.84    
57 1 ARG H 40  ? ? -55.27  173.08  
58 1 THR H 41  ? ? -58.48  -171.46 
59 1 SER H 55  ? ? -75.96  -88.04  
60 1 SER H 75  ? ? -68.53  -74.14  
61 1 ALA H 92  ? ? 175.71  -175.78 
62 1 ARG H 98  ? ? -111.42 71.15   
63 1 PRO H 119 ? ? -61.12  -169.26 
64 1 SER H 128 ? ? -104.14 73.73   
65 1 ALA H 129 ? ? 27.75   38.05   
66 1 THR H 132 ? ? -109.17 48.60   
67 1 ASN H 133 ? ? 177.42  160.15  
68 1 PHE H 146 ? ? 172.57  146.46  
69 1 PRO H 149 ? ? -109.20 -167.07 
70 1 SER H 160 ? ? -146.85 -58.24  
71 1 SER H 161 ? ? -58.18  102.94  
72 1 GLN H 171 ? ? 175.54  101.29  
73 1 SER H 186 ? ? -69.39  10.27   
74 1 THR H 187 ? ? -134.87 -62.15  
75 1 TRP H 188 ? ? -35.20  -83.49  
76 1 PRO H 212 ? ? -29.35  -93.67  
77 1 ASP H 214 ? ? -69.59  15.26   
78 1 CYS H 215 ? ? 58.69   -20.53  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A VAL 39  ? CG1 ? A VAL 16  CG1 
2   1 Y 1 A VAL 39  ? CG2 ? A VAL 16  CG2 
3   1 Y 1 A MET 40  ? CG  ? A MET 17  CG  
4   1 Y 1 A MET 40  ? SD  ? A MET 17  SD  
5   1 Y 1 A MET 40  ? CE  ? A MET 17  CE  
6   1 Y 1 A LEU 42  ? CG  ? A LEU 19  CG  
7   1 Y 1 A LEU 42  ? CD1 ? A LEU 19  CD1 
8   1 Y 1 A LEU 42  ? CD2 ? A LEU 19  CD2 
9   1 Y 1 A LEU 45  ? CG  ? A LEU 22  CG  
10  1 Y 1 A LEU 45  ? CD1 ? A LEU 22  CD1 
11  1 Y 1 A LEU 45  ? CD2 ? A LEU 22  CD2 
12  1 Y 1 A ILE 47  ? CG1 ? A ILE 24  CG1 
13  1 Y 1 A ILE 47  ? CG2 ? A ILE 24  CG2 
14  1 Y 1 A ILE 47  ? CD1 ? A ILE 24  CD1 
15  1 Y 1 A PHE 49  ? CG  ? A PHE 26  CG  
16  1 Y 1 A PHE 49  ? CD1 ? A PHE 26  CD1 
17  1 Y 1 A PHE 49  ? CD2 ? A PHE 26  CD2 
18  1 Y 1 A PHE 49  ? CE1 ? A PHE 26  CE1 
19  1 Y 1 A PHE 49  ? CE2 ? A PHE 26  CE2 
20  1 Y 1 A PHE 49  ? CZ  ? A PHE 26  CZ  
21  1 Y 1 A LEU 53  ? CG  ? A LEU 30  CG  
22  1 Y 1 A LEU 53  ? CD1 ? A LEU 30  CD1 
23  1 Y 1 A LEU 53  ? CD2 ? A LEU 30  CD2 
24  1 Y 1 A THR 73  ? OG1 ? A THR 50  OG1 
25  1 Y 1 A THR 73  ? CG2 ? A THR 50  CG2 
26  1 Y 1 A TRP 109 ? CG  ? A TRP 86  CG  
27  1 Y 1 A TRP 109 ? CD1 ? A TRP 86  CD1 
28  1 Y 1 A TRP 109 ? CD2 ? A TRP 86  CD2 
29  1 Y 1 A TRP 109 ? NE1 ? A TRP 86  NE1 
30  1 Y 1 A TRP 109 ? CE2 ? A TRP 86  CE2 
31  1 Y 1 A TRP 109 ? CE3 ? A TRP 86  CE3 
32  1 Y 1 A TRP 109 ? CZ2 ? A TRP 86  CZ2 
33  1 Y 1 A TRP 109 ? CZ3 ? A TRP 86  CZ3 
34  1 Y 1 A TRP 109 ? CH2 ? A TRP 86  CH2 
35  1 Y 1 A ILE 112 ? CG1 ? A ILE 89  CG1 
36  1 Y 1 A ILE 112 ? CG2 ? A ILE 89  CG2 
37  1 Y 1 A ILE 112 ? CD1 ? A ILE 89  CD1 
38  1 Y 1 A GLU 122 ? CG  ? A GLU 99  CG  
39  1 Y 1 A GLU 122 ? CD  ? A GLU 99  CD  
40  1 Y 1 A GLU 122 ? OE1 ? A GLU 99  OE1 
41  1 Y 1 A GLU 122 ? OE2 ? A GLU 99  OE2 
42  1 Y 1 A LYS 147 ? CG  ? A LYS 124 CG  
43  1 Y 1 A LYS 147 ? CD  ? A LYS 124 CD  
44  1 Y 1 A LYS 147 ? CE  ? A LYS 124 CE  
45  1 Y 1 A LYS 147 ? NZ  ? A LYS 124 NZ  
46  1 Y 1 A VAL 152 ? CG1 ? A VAL 129 CG1 
47  1 Y 1 A VAL 152 ? CG2 ? A VAL 129 CG2 
48  1 Y 1 A ILE 153 ? CG1 ? A ILE 130 CG1 
49  1 Y 1 A ILE 153 ? CG2 ? A ILE 130 CG2 
50  1 Y 1 A ILE 153 ? CD1 ? A ILE 130 CD1 
51  1 Y 1 A ILE 154 ? CG1 ? A ILE 131 CG1 
52  1 Y 1 A ILE 154 ? CG2 ? A ILE 131 CG2 
53  1 Y 1 A ILE 154 ? CD1 ? A ILE 131 CD1 
54  1 Y 1 A LEU 155 ? CG  ? A LEU 132 CG  
55  1 Y 1 A LEU 155 ? CD1 ? A LEU 132 CD1 
56  1 Y 1 A LEU 155 ? CD2 ? A LEU 132 CD2 
57  1 Y 1 A MET 156 ? CG  ? A MET 133 CG  
58  1 Y 1 A MET 156 ? SD  ? A MET 133 SD  
59  1 Y 1 A MET 156 ? CE  ? A MET 133 CE  
60  1 Y 1 A TRP 158 ? CG  ? A TRP 135 CG  
61  1 Y 1 A TRP 158 ? CD1 ? A TRP 135 CD1 
62  1 Y 1 A TRP 158 ? CD2 ? A TRP 135 CD2 
63  1 Y 1 A TRP 158 ? NE1 ? A TRP 135 NE1 
64  1 Y 1 A TRP 158 ? CE2 ? A TRP 135 CE2 
65  1 Y 1 A TRP 158 ? CE3 ? A TRP 135 CE3 
66  1 Y 1 A TRP 158 ? CZ2 ? A TRP 135 CZ2 
67  1 Y 1 A TRP 158 ? CZ3 ? A TRP 135 CZ3 
68  1 Y 1 A TRP 158 ? CH2 ? A TRP 135 CH2 
69  1 Y 1 A TYR 209 ? CG  ? A TYR 186 CG  
70  1 Y 1 A TYR 209 ? CD1 ? A TYR 186 CD1 
71  1 Y 1 A TYR 209 ? CD2 ? A TYR 186 CD2 
72  1 Y 1 A TYR 209 ? CE1 ? A TYR 186 CE1 
73  1 Y 1 A TYR 209 ? CE2 ? A TYR 186 CE2 
74  1 Y 1 A TYR 209 ? CZ  ? A TYR 186 CZ  
75  1 Y 1 A TYR 209 ? OH  ? A TYR 186 OH  
76  1 Y 1 A TRP 313 ? CG  ? A TRP 290 CG  
77  1 Y 1 A TRP 313 ? CD1 ? A TRP 290 CD1 
78  1 Y 1 A TRP 313 ? CD2 ? A TRP 290 CD2 
79  1 Y 1 A TRP 313 ? NE1 ? A TRP 290 NE1 
80  1 Y 1 A TRP 313 ? CE2 ? A TRP 290 CE2 
81  1 Y 1 A TRP 313 ? CE3 ? A TRP 290 CE3 
82  1 Y 1 A TRP 313 ? CZ2 ? A TRP 290 CZ2 
83  1 Y 1 A TRP 313 ? CZ3 ? A TRP 290 CZ3 
84  1 Y 1 A TRP 313 ? CH2 ? A TRP 290 CH2 
85  1 Y 1 A ASN 318 ? CG  ? A ASN 295 CG  
86  1 Y 1 A ASN 318 ? OD1 ? A ASN 295 OD1 
87  1 Y 1 A ASN 318 ? ND2 ? A ASN 295 ND2 
88  1 Y 1 A SER 319 ? OG  ? A SER 296 OG  
89  1 Y 1 A PHE 321 ? CG  ? A PHE 298 CG  
90  1 Y 1 A PHE 321 ? CD1 ? A PHE 298 CD1 
91  1 Y 1 A PHE 321 ? CD2 ? A PHE 298 CD2 
92  1 Y 1 A PHE 321 ? CE1 ? A PHE 298 CE1 
93  1 Y 1 A PHE 321 ? CE2 ? A PHE 298 CE2 
94  1 Y 1 A PHE 321 ? CZ  ? A PHE 298 CZ  
95  1 Y 1 A ILE 325 ? CG1 ? A ILE 302 CG1 
96  1 Y 1 A ILE 325 ? CG2 ? A ILE 302 CG2 
97  1 Y 1 A ILE 325 ? CD1 ? A ILE 302 CD1 
98  1 Y 1 A TYR 326 ? CG  ? A TYR 303 CG  
99  1 Y 1 A TYR 326 ? CD1 ? A TYR 303 CD1 
100 1 Y 1 A TYR 326 ? CD2 ? A TYR 303 CD2 
101 1 Y 1 A TYR 326 ? CE1 ? A TYR 303 CE1 
102 1 Y 1 A TYR 326 ? CE2 ? A TYR 303 CE2 
103 1 Y 1 A TYR 326 ? CZ  ? A TYR 303 CZ  
104 1 Y 1 A TYR 326 ? OH  ? A TYR 303 OH  
105 1 Y 1 A PHE 332 ? CG  ? A PHE 309 CG  
106 1 Y 1 A PHE 332 ? CD1 ? A PHE 309 CD1 
107 1 Y 1 A PHE 332 ? CD2 ? A PHE 309 CD2 
108 1 Y 1 A PHE 332 ? CE1 ? A PHE 309 CE1 
109 1 Y 1 A PHE 332 ? CE2 ? A PHE 309 CE2 
110 1 Y 1 A PHE 332 ? CZ  ? A PHE 309 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A VAL 24  ? A VAL 1   
2   1 Y 1 A THR 25  ? A THR 2   
3   1 Y 1 A GLN 26  ? A GLN 3   
4   1 Y 1 A GLN 27  ? A GLN 4   
5   1 Y 1 A ARG 28  ? A ARG 5   
6   1 Y 1 A ASP 29  ? A ASP 6   
7   1 Y 1 A GLU 30  ? A GLU 7   
8   1 Y 1 A VAL 31  ? A VAL 8   
9   1 Y 1 A TRP 32  ? A TRP 9   
10  1 Y 1 A VAL 33  ? A VAL 10  
11  1 Y 1 A VAL 34  ? A VAL 11  
12  1 Y 1 A GLY 35  ? A GLY 12  
13  1 Y 1 A MET 36  ? A MET 13  
14  1 Y 1 A LYS 60  ? A LYS 37  
15  1 Y 1 A ALA 91  ? A ALA 68  
16  1 Y 1 A ALA 92  ? A ALA 69  
17  1 Y 1 A HIS 93  ? A HIS 70  
18  1 Y 1 A ILE 94  ? A ILE 71  
19  1 Y 1 A LEU 95  ? A LEU 72  
20  1 Y 1 A MET 96  ? A MET 73  
21  1 Y 1 A LYS 97  ? A LYS 74  
22  1 Y 1 A MET 98  ? A MET 75  
23  1 Y 1 A TRP 99  ? A TRP 76  
24  1 Y 1 A THR 100 ? A THR 77  
25  1 Y 1 A PHE 101 ? A PHE 78  
26  1 Y 1 A GLY 102 ? A GLY 79  
27  1 Y 1 A ASN 103 ? A ASN 80  
28  1 Y 1 A PHE 104 ? A PHE 81  
29  1 Y 1 A TRP 105 ? A TRP 82  
30  1 Y 1 A CYS 106 ? A CYS 83  
31  1 Y 1 A GLU 107 ? A GLU 84  
32  1 Y 1 A SER 165 ? A SER 142 
33  1 Y 1 A PHE 166 ? A PHE 143 
34  1 Y 1 A LEU 167 ? A LEU 144 
35  1 Y 1 A PRO 168 ? A PRO 145 
36  1 Y 1 A ILE 169 ? A ILE 146 
37  1 Y 1 A GLN 170 ? A GLN 147 
38  1 Y 1 A MET 171 ? A MET 148 
39  1 Y 1 A HIS 172 ? A HIS 149 
40  1 Y 1 A TRP 173 ? A TRP 150 
41  1 Y 1 A TYR 174 ? A TYR 151 
42  1 Y 1 A ARG 175 ? A ARG 152 
43  1 Y 1 A ALA 176 ? A ALA 153 
44  1 Y 1 A THR 177 ? A THR 154 
45  1 Y 1 A HIS 178 ? A HIS 155 
46  1 Y 1 A GLN 179 ? A GLN 156 
47  1 Y 1 A GLU 180 ? A GLU 157 
48  1 Y 1 A ALA 181 ? A ALA 158 
49  1 Y 1 A ILE 182 ? A ILE 159 
50  1 Y 1 A ASN 183 ? A ASN 160 
51  1 Y 1 A CYS 184 ? A CYS 161 
52  1 Y 1 A TYR 185 ? A TYR 162 
53  1 Y 1 A ALA 186 ? A ALA 163 
54  1 Y 1 A ASN 187 ? A ASN 164 
55  1 Y 1 A GLU 188 ? A GLU 165 
56  1 Y 1 A THR 189 ? A THR 166 
57  1 Y 1 A CYS 190 ? A CYS 167 
58  1 Y 1 A CYS 191 ? A CYS 168 
59  1 Y 1 A ASP 192 ? A ASP 169 
60  1 Y 1 A PHE 193 ? A PHE 170 
61  1 Y 1 A PHE 194 ? A PHE 171 
62  1 Y 1 A THR 195 ? A THR 172 
63  1 Y 1 A ASN 196 ? A ASN 173 
64  1 Y 1 A GLN 197 ? A GLN 174 
65  1 Y 1 A ALA 198 ? A ALA 175 
66  1 Y 1 A TYR 199 ? A TYR 176 
67  1 Y 1 A ALA 200 ? A ALA 177 
68  1 Y 1 A ILE 201 ? A ILE 178 
69  1 Y 1 A ALA 202 ? A ALA 179 
70  1 Y 1 A GLN 243 ? A GLN 220 
71  1 Y 1 A ASN 244 ? A ASN 221 
72  1 Y 1 A LEU 245 ? A LEU 222 
73  1 Y 1 A SER 246 ? A SER 223 
74  1 Y 1 A GLN 247 ? A GLN 224 
75  1 Y 1 A VAL 248 ? A VAL 225 
76  1 Y 1 A GLU 249 ? A GLU 226 
77  1 Y 1 A GLN 250 ? A GLN 227 
78  1 Y 1 A ASP 251 ? A ASP 228 
79  1 Y 1 A GLY 252 ? A GLY 229 
80  1 Y 1 A ARG 253 ? A ARG 230 
81  1 Y 1 A THR 254 ? A THR 231 
82  1 Y 1 A GLY 255 ? A GLY 232 
83  1 Y 1 A HIS 256 ? A HIS 233 
84  1 Y 1 A GLY 257 ? A GLY 234 
85  1 Y 1 A LEU 258 ? A LEU 235 
86  1 Y 1 A ARG 259 ? A ARG 236 
87  1 Y 1 A ARG 260 ? A ARG 237 
88  1 Y 1 A SER 261 ? A SER 238 
89  1 Y 1 A SER 262 ? A SER 239 
90  1 Y 1 A LYS 263 ? A LYS 240 
91  1 Y 1 A VAL 292 ? A VAL 269 
92  1 Y 1 A ASN 293 ? A ASN 270 
93  1 Y 1 A ILE 294 ? A ILE 271 
94  1 Y 1 A VAL 295 ? A VAL 272 
95  1 Y 1 A HIS 296 ? A HIS 273 
96  1 Y 1 A VAL 297 ? A VAL 274 
97  1 Y 1 A ILE 298 ? A ILE 275 
98  1 Y 1 A GLN 299 ? A GLN 276 
99  1 Y 1 A ASP 300 ? A ASP 277 
100 1 Y 1 A ASN 301 ? A ASN 278 
101 1 Y 1 A LEU 302 ? A LEU 279 
102 1 Y 1 A ILE 303 ? A ILE 280 
103 1 Y 1 A ARG 304 ? A ARG 281 
104 1 Y 1 A LYS 305 ? A LYS 282 
105 1 Y 1 A GLU 306 ? A GLU 283 
106 1 Y 1 A VAL 307 ? A VAL 284 
107 1 Y 1 A TYR 308 ? A TYR 285 
108 1 Y 1 A ILE 309 ? A ILE 286 
109 1 Y 1 A LEU 310 ? A LEU 287 
110 1 Y 1 A ALA 349 ? A ALA 326 
111 1 Y 1 A TYR 350 ? A TYR 327 
112 1 Y 1 A GLY 351 ? A GLY 328 
113 1 Y 1 A ASN 352 ? A ASN 329 
114 1 Y 1 A GLY 353 ? A GLY 330 
115 1 Y 1 A TYR 354 ? A TYR 331 
116 1 Y 1 A SER 355 ? A SER 332 
117 1 Y 1 A SER 356 ? A SER 333 
118 1 Y 1 A ASN 357 ? A ASN 334 
119 1 Y 1 A GLY 358 ? A GLY 335 
120 1 Y 1 A ASN 359 ? A ASN 336 
121 1 Y 1 A THR 360 ? A THR 337 
122 1 Y 1 A GLY 361 ? A GLY 338 
123 1 Y 1 A GLU 362 ? A GLU 339 
124 1 Y 1 A GLN 363 ? A GLN 340 
125 1 Y 1 A SER 364 ? A SER 341 
126 1 Y 1 A GLY 365 ? A GLY 342 
#