data_2R5G
# 
_entry.id   2R5G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2R5G         
RCSB  RCSB044448   
WWPDB D_1000044448 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2R4V 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2R5G 
_pdbx_database_status.recvd_initial_deposition_date   2007-09-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gorman, M.A.' 1 
'Hansen, G.'   2 
'Cromer, B.A.' 3 
'Parker, M.W.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Janus Protein Human CLIC2' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            374 
_citation.page_first                719 
_citation.page_last                 731 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17945253 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.09.041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cromer, B.A.'   1  
primary 'Gorman, M.A.'   2  
primary 'Hansen, G.'     3  
primary 'Adams, J.J.'    4  
primary 'Coggan, M.'     5  
primary 'Littler, D.R.'  6  
primary 'Brown, L.J.'    7  
primary 'Mazzanti, M.'   8  
primary 'Breit, S.N.'    9  
primary 'Curmi, P.M.G.'  10 
primary 'Dulhunty, A.F.' 11 
primary 'Board, P.G.'    12 
primary 'Parker, M.W.'   13 
# 
_cell.entry_id           2R5G 
_cell.length_a           35.973 
_cell.length_b           66.940 
_cell.length_c           44.071 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2R5G 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Chloride intracellular channel protein 2' 28393.395 1   ? ? ? ? 
2 water   nat water                                      18.015    139 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        XAP121 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK
TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDP
DSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK
TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDP
DSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   LEU n 
1 5   ARG n 
1 6   PRO n 
1 7   GLY n 
1 8   THR n 
1 9   GLN n 
1 10  VAL n 
1 11  ASP n 
1 12  PRO n 
1 13  GLU n 
1 14  ILE n 
1 15  GLU n 
1 16  LEU n 
1 17  PHE n 
1 18  VAL n 
1 19  LYS n 
1 20  ALA n 
1 21  GLY n 
1 22  SER n 
1 23  ASP n 
1 24  GLY n 
1 25  GLU n 
1 26  SER n 
1 27  ILE n 
1 28  GLY n 
1 29  ASN n 
1 30  CYS n 
1 31  PRO n 
1 32  PHE n 
1 33  CYS n 
1 34  GLN n 
1 35  ARG n 
1 36  LEU n 
1 37  PHE n 
1 38  MET n 
1 39  ILE n 
1 40  LEU n 
1 41  TRP n 
1 42  LEU n 
1 43  LYS n 
1 44  GLY n 
1 45  VAL n 
1 46  LYS n 
1 47  PHE n 
1 48  ASN n 
1 49  VAL n 
1 50  THR n 
1 51  THR n 
1 52  VAL n 
1 53  ASP n 
1 54  MET n 
1 55  THR n 
1 56  ARG n 
1 57  LYS n 
1 58  PRO n 
1 59  GLU n 
1 60  GLU n 
1 61  LEU n 
1 62  LYS n 
1 63  ASP n 
1 64  LEU n 
1 65  ALA n 
1 66  PRO n 
1 67  GLY n 
1 68  THR n 
1 69  ASN n 
1 70  PRO n 
1 71  PRO n 
1 72  PHE n 
1 73  LEU n 
1 74  VAL n 
1 75  TYR n 
1 76  ASN n 
1 77  LYS n 
1 78  GLU n 
1 79  LEU n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  PHE n 
1 84  ILE n 
1 85  LYS n 
1 86  ILE n 
1 87  GLU n 
1 88  GLU n 
1 89  PHE n 
1 90  LEU n 
1 91  GLU n 
1 92  GLN n 
1 93  THR n 
1 94  LEU n 
1 95  ALA n 
1 96  PRO n 
1 97  PRO n 
1 98  ARG n 
1 99  TYR n 
1 100 PRO n 
1 101 HIS n 
1 102 LEU n 
1 103 SER n 
1 104 PRO n 
1 105 LYS n 
1 106 TYR n 
1 107 LYS n 
1 108 GLU n 
1 109 SER n 
1 110 PHE n 
1 111 ASP n 
1 112 VAL n 
1 113 GLY n 
1 114 CYS n 
1 115 ASN n 
1 116 LEU n 
1 117 PHE n 
1 118 ALA n 
1 119 LYS n 
1 120 PHE n 
1 121 SER n 
1 122 ALA n 
1 123 TYR n 
1 124 ILE n 
1 125 LYS n 
1 126 ASN n 
1 127 THR n 
1 128 GLN n 
1 129 LYS n 
1 130 GLU n 
1 131 ALA n 
1 132 ASN n 
1 133 LYS n 
1 134 ASN n 
1 135 PHE n 
1 136 GLU n 
1 137 LYS n 
1 138 SER n 
1 139 LEU n 
1 140 LEU n 
1 141 LYS n 
1 142 GLU n 
1 143 PHE n 
1 144 LYS n 
1 145 ARG n 
1 146 LEU n 
1 147 ASP n 
1 148 ASP n 
1 149 TYR n 
1 150 LEU n 
1 151 ASN n 
1 152 THR n 
1 153 PRO n 
1 154 LEU n 
1 155 LEU n 
1 156 ASP n 
1 157 GLU n 
1 158 ILE n 
1 159 ASP n 
1 160 PRO n 
1 161 ASP n 
1 162 SER n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 PRO n 
1 167 PRO n 
1 168 VAL n 
1 169 SER n 
1 170 ARG n 
1 171 ARG n 
1 172 LEU n 
1 173 PHE n 
1 174 LEU n 
1 175 ASP n 
1 176 GLY n 
1 177 ASP n 
1 178 GLN n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 ALA n 
1 183 ASP n 
1 184 CYS n 
1 185 SER n 
1 186 LEU n 
1 187 LEU n 
1 188 PRO n 
1 189 LYS n 
1 190 LEU n 
1 191 ASN n 
1 192 ILE n 
1 193 ILE n 
1 194 LYS n 
1 195 VAL n 
1 196 ALA n 
1 197 ALA n 
1 198 LYS n 
1 199 LYS n 
1 200 TYR n 
1 201 ARG n 
1 202 ASP n 
1 203 PHE n 
1 204 ASP n 
1 205 ILE n 
1 206 PRO n 
1 207 ALA n 
1 208 GLU n 
1 209 PHE n 
1 210 SER n 
1 211 GLY n 
1 212 VAL n 
1 213 TRP n 
1 214 ARG n 
1 215 TYR n 
1 216 LEU n 
1 217 HIS n 
1 218 ASN n 
1 219 ALA n 
1 220 TYR n 
1 221 ALA n 
1 222 ARG n 
1 223 GLU n 
1 224 GLU n 
1 225 PHE n 
1 226 THR n 
1 227 HIS n 
1 228 THR n 
1 229 CYS n 
1 230 PRO n 
1 231 GLU n 
1 232 ASP n 
1 233 LYS n 
1 234 GLU n 
1 235 ILE n 
1 236 GLU n 
1 237 ASN n 
1 238 THR n 
1 239 TYR n 
1 240 ALA n 
1 241 ASN n 
1 242 VAL n 
1 243 ALA n 
1 244 LYS n 
1 245 GLN n 
1 246 LYS n 
1 247 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CLIC2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'inhouse vector' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CLIC2_HUMAN 
_struct_ref.pdbx_db_accession          O15247 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK
TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDP
DSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2R5G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 247 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O15247 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  247 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       247 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2R5G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.84 
_exptl_crystal.density_percent_sol   33.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'30%-32% PEG 400, 100mM Tris-HCl, pH7.5, 5mM GSH, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2007-04-10 
_diffrn_detector.details                Xenocs 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Xenocs mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2R5G 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.86 
_reflns.d_resolution_low             20.7 
_reflns.number_all                   17172 
_reflns.number_obs                   17172 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        33.7 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   84.3 
_reflns_shell.Rmerge_I_obs           0.315 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2053 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2R5G 
_refine.ls_number_reflns_obs                     17172 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.65 
_refine.ls_d_res_high                            1.86 
_refine.ls_percent_reflns_obs                    99.49 
_refine.ls_R_factor_obs                          0.18617 
_refine.ls_R_factor_all                          0.201 
_refine.ls_R_factor_R_work                       0.18396 
_refine.ls_R_factor_R_free                       0.22764 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  869 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               18.992 
_refine.aniso_B[1][1]                            1.07 
_refine.aniso_B[2][2]                            -0.13 
_refine.aniso_B[3][3]                            -0.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.32 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1K0M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.180 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.105 
_refine.overall_SU_B                             3.429 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1961 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               2100 
_refine_hist.d_res_high                       1.86 
_refine_hist.d_res_low                        20.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.007  0.022  ? 2016 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 1418 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.065  1.982  ? 2738 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.848  3.001  ? 3476 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.800  5.000  ? 249  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.415 25.052 ? 97   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.159 15.000 ? 361  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   12.147 15.000 ? 9    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.057  0.200  ? 294  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 2238 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 397  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.207  0.200  ? 451  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.180  0.200  ? 1494 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.176  0.200  ? 984  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.083  0.200  ? 972  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.123  0.200  ? 130  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.192  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.178  0.200  ? 51   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.119  0.200  ? 17   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.630  1.500  ? 1592 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.081  1.500  ? 475  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.721  2.000  ? 1994 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.177  3.000  ? 941  'X-RAY DIFFRACTION' ? 
r_scangle_it             1.713  4.500  ? 741  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.863 
_refine_ls_shell.d_res_low                        1.911 
_refine_ls_shell.number_reflns_R_work             1119 
_refine_ls_shell.R_factor_R_work                  0.299 
_refine_ls_shell.percent_reflns_obs               84.3 
_refine_ls_shell.R_factor_R_free                  0.466 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2R5G 
_struct.title                     'Structure of human CLIC2, crystal form B' 
_struct.pdbx_descriptor           'Chloride intracellular channel protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2R5G 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
;Chloride Intracellular Channel, CLIC2, pore-forming protein, Ryanodine receptor, Chloride channel, Ion transport, Ionic channel, Transport, Voltage-gated channel, TRANSPORT PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 30  ? GLY A 44  ? CYS A 30  GLY A 44  1 ? 15 
HELX_P HELX_P2  2  ARG A 56  ? LEU A 61  ? ARG A 56  LEU A 61  1 ? 6  
HELX_P HELX_P3  3  PHE A 83  ? LEU A 94  ? PHE A 83  LEU A 94  1 ? 12 
HELX_P HELX_P4  4  LYS A 107 ? ASN A 126 ? LYS A 107 ASN A 126 1 ? 20 
HELX_P HELX_P5  5  GLN A 128 ? GLU A 130 ? GLN A 128 GLU A 130 5 ? 3  
HELX_P HELX_P6  6  ALA A 131 ? THR A 152 ? ALA A 131 THR A 152 1 ? 22 
HELX_P HELX_P7  7  THR A 180 ? ASP A 202 ? THR A 180 ASP A 202 1 ? 23 
HELX_P HELX_P8  8  PHE A 209 ? ALA A 221 ? PHE A 209 ALA A 221 1 ? 13 
HELX_P HELX_P9  9  ARG A 222 ? HIS A 227 ? ARG A 222 HIS A 227 1 ? 6  
HELX_P HELX_P10 10 GLU A 231 ? ALA A 240 ? GLU A 231 ALA A 240 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            30 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            33 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             30 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             33 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.088 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 63 A . ? ASP 63 A LEU 64 A ? LEU 64 A 1 -2.69 
2 PRO 70 A . ? PRO 70 A PRO 71 A ? PRO 71 A 1 0.07  
3 PRO 96 A . ? PRO 96 A PRO 97 A ? PRO 97 A 1 5.64  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 48  ? VAL A 52  ? ASN A 48  VAL A 52  
A 2 ILE A 14  ? LYS A 19  ? ILE A 14  LYS A 19  
A 3 PHE A 72  ? TYR A 75  ? PHE A 72  TYR A 75  
A 4 GLU A 78  ? LYS A 80  ? GLU A 78  LYS A 80  
B 1 ILE A 158 ? ASP A 159 ? ILE A 158 ASP A 159 
B 2 ALA A 163 ? GLU A 164 ? ALA A 163 GLU A 164 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASN A 48  ? O ASN A 48  N LEU A 16  ? N LEU A 16  
A 2 3 N PHE A 17  ? N PHE A 17  O PHE A 72  ? O PHE A 72  
A 3 4 N LEU A 73  ? N LEU A 73  O LYS A 80  ? O LYS A 80  
B 1 2 N ASP A 159 ? N ASP A 159 O ALA A 163 ? O ALA A 163 
# 
_database_PDB_matrix.entry_id          2R5G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2R5G 
_atom_sites.fract_transf_matrix[1][1]   0.027798 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004831 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014939 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023031 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 11  ? 25.410 2.857   27.515  1.00 31.39 ? 11  ASP A N   1 
ATOM   2    C CA  . ASP A 1 11  ? 25.118 4.011   26.616  1.00 31.30 ? 11  ASP A CA  1 
ATOM   3    C C   . ASP A 1 11  ? 25.294 5.343   27.346  1.00 31.04 ? 11  ASP A C   1 
ATOM   4    O O   . ASP A 1 11  ? 25.227 5.397   28.577  1.00 31.27 ? 11  ASP A O   1 
ATOM   5    C CB  . ASP A 1 11  ? 23.675 3.932   26.092  1.00 31.57 ? 11  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 11  ? 23.497 2.921   24.968  1.00 31.98 ? 11  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 11  ? 24.499 2.433   24.399  1.00 32.96 ? 11  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 11  ? 22.328 2.623   24.646  1.00 33.14 ? 11  ASP A OD2 1 
ATOM   9    N N   . PRO A 1 12  ? 25.503 6.431   26.586  1.00 30.73 ? 12  PRO A N   1 
ATOM   10   C CA  . PRO A 1 12  ? 25.424 7.770   27.160  1.00 30.18 ? 12  PRO A CA  1 
ATOM   11   C C   . PRO A 1 12  ? 23.981 8.172   27.486  1.00 29.68 ? 12  PRO A C   1 
ATOM   12   O O   . PRO A 1 12  ? 23.033 7.513   27.043  1.00 29.79 ? 12  PRO A O   1 
ATOM   13   C CB  . PRO A 1 12  ? 25.977 8.654   26.044  1.00 30.45 ? 12  PRO A CB  1 
ATOM   14   C CG  . PRO A 1 12  ? 25.653 7.913   24.799  1.00 30.63 ? 12  PRO A CG  1 
ATOM   15   C CD  . PRO A 1 12  ? 25.828 6.474   25.147  1.00 30.65 ? 12  PRO A CD  1 
ATOM   16   N N   . GLU A 1 13  ? 23.831 9.237   28.268  1.00 28.98 ? 13  GLU A N   1 
ATOM   17   C CA  . GLU A 1 13  ? 22.525 9.836   28.541  1.00 28.51 ? 13  GLU A CA  1 
ATOM   18   C C   . GLU A 1 13  ? 22.199 10.803  27.419  1.00 27.42 ? 13  GLU A C   1 
ATOM   19   O O   . GLU A 1 13  ? 22.871 11.825  27.279  1.00 27.25 ? 13  GLU A O   1 
ATOM   20   C CB  . GLU A 1 13  ? 22.545 10.618  29.856  1.00 28.80 ? 13  GLU A CB  1 
ATOM   21   C CG  . GLU A 1 13  ? 22.729 9.784   31.100  1.00 30.05 ? 13  GLU A CG  1 
ATOM   22   C CD  . GLU A 1 13  ? 22.918 10.642  32.343  1.00 30.72 ? 13  GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 13  ? 22.445 11.805  32.354  1.00 34.16 ? 13  GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 13  ? 23.547 10.152  33.307  1.00 34.16 ? 13  GLU A OE2 1 
ATOM   25   N N   . ILE A 1 14  ? 21.186 10.487  26.614  1.00 26.17 ? 14  ILE A N   1 
ATOM   26   C CA  . ILE A 1 14  ? 20.800 11.368  25.511  1.00 25.47 ? 14  ILE A CA  1 
ATOM   27   C C   . ILE A 1 14  ? 19.338 11.799  25.605  1.00 24.47 ? 14  ILE A C   1 
ATOM   28   O O   . ILE A 1 14  ? 18.432 10.971  25.716  1.00 24.05 ? 14  ILE A O   1 
ATOM   29   C CB  . ILE A 1 14  ? 21.054 10.722  24.129  1.00 25.25 ? 14  ILE A CB  1 
ATOM   30   C CG1 . ILE A 1 14  ? 22.502 10.238  24.018  1.00 25.66 ? 14  ILE A CG1 1 
ATOM   31   C CG2 . ILE A 1 14  ? 20.745 11.733  23.015  1.00 25.48 ? 14  ILE A CG2 1 
ATOM   32   C CD1 . ILE A 1 14  ? 22.797 9.425   22.756  1.00 25.60 ? 14  ILE A CD1 1 
ATOM   33   N N   . GLU A 1 15  ? 19.118 13.107  25.567  1.00 23.72 ? 15  GLU A N   1 
ATOM   34   C CA  . GLU A 1 15  ? 17.778 13.642  25.415  1.00 23.47 ? 15  GLU A CA  1 
ATOM   35   C C   . GLU A 1 15  ? 17.749 14.605  24.238  1.00 22.63 ? 15  GLU A C   1 
ATOM   36   O O   . GLU A 1 15  ? 18.486 15.586  24.215  1.00 22.67 ? 15  GLU A O   1 
ATOM   37   C CB  . GLU A 1 15  ? 17.310 14.353  26.682  1.00 23.49 ? 15  GLU A CB  1 
ATOM   38   C CG  . GLU A 1 15  ? 15.837 14.735  26.636  1.00 23.98 ? 15  GLU A CG  1 
ATOM   39   C CD  . GLU A 1 15  ? 15.304 15.235  27.961  1.00 24.58 ? 15  GLU A CD  1 
ATOM   40   O OE1 . GLU A 1 15  ? 16.083 15.336  28.933  1.00 26.03 ? 15  GLU A OE1 1 
ATOM   41   O OE2 . GLU A 1 15  ? 14.092 15.531  28.030  1.00 26.56 ? 15  GLU A OE2 1 
ATOM   42   N N   . LEU A 1 16  ? 16.896 14.296  23.268  1.00 21.84 ? 16  LEU A N   1 
ATOM   43   C CA  . LEU A 1 16  ? 16.672 15.143  22.108  1.00 21.63 ? 16  LEU A CA  1 
ATOM   44   C C   . LEU A 1 16  ? 15.452 16.019  22.356  1.00 21.30 ? 16  LEU A C   1 
ATOM   45   O O   . LEU A 1 16  ? 14.370 15.508  22.662  1.00 21.13 ? 16  LEU A O   1 
ATOM   46   C CB  . LEU A 1 16  ? 16.441 14.278  20.864  1.00 21.31 ? 16  LEU A CB  1 
ATOM   47   C CG  . LEU A 1 16  ? 16.109 15.019  19.567  1.00 21.28 ? 16  LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 16  ? 17.293 15.876  19.139  1.00 19.21 ? 16  LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 16  ? 15.725 14.031  18.475  1.00 20.88 ? 16  LEU A CD2 1 
ATOM   50   N N   . PHE A 1 17  ? 15.625 17.332  22.216  1.00 21.18 ? 17  PHE A N   1 
ATOM   51   C CA  . PHE A 1 17  ? 14.518 18.277  22.337  1.00 21.19 ? 17  PHE A CA  1 
ATOM   52   C C   . PHE A 1 17  ? 14.069 18.705  20.941  1.00 21.11 ? 17  PHE A C   1 
ATOM   53   O O   . PHE A 1 17  ? 14.844 19.317  20.197  1.00 20.78 ? 17  PHE A O   1 
ATOM   54   C CB  . PHE A 1 17  ? 14.927 19.492  23.166  1.00 21.24 ? 17  PHE A CB  1 
ATOM   55   C CG  . PHE A 1 17  ? 15.195 19.169  24.612  1.00 21.76 ? 17  PHE A CG  1 
ATOM   56   C CD1 . PHE A 1 17  ? 16.388 18.563  24.990  1.00 21.81 ? 17  PHE A CD1 1 
ATOM   57   C CD2 . PHE A 1 17  ? 14.256 19.464  25.591  1.00 21.86 ? 17  PHE A CD2 1 
ATOM   58   C CE1 . PHE A 1 17  ? 16.648 18.256  26.334  1.00 21.97 ? 17  PHE A CE1 1 
ATOM   59   C CE2 . PHE A 1 17  ? 14.507 19.163  26.936  1.00 22.06 ? 17  PHE A CE2 1 
ATOM   60   C CZ  . PHE A 1 17  ? 15.704 18.558  27.302  1.00 22.05 ? 17  PHE A CZ  1 
ATOM   61   N N   . VAL A 1 18  ? 12.833 18.353  20.590  1.00 20.94 ? 18  VAL A N   1 
ATOM   62   C CA  . VAL A 1 18  ? 12.277 18.633  19.268  1.00 21.27 ? 18  VAL A CA  1 
ATOM   63   C C   . VAL A 1 18  ? 11.111 19.607  19.383  1.00 21.56 ? 18  VAL A C   1 
ATOM   64   O O   . VAL A 1 18  ? 10.605 19.855  20.481  1.00 21.09 ? 18  VAL A O   1 
ATOM   65   C CB  . VAL A 1 18  ? 11.806 17.335  18.565  1.00 21.17 ? 18  VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 18  ? 12.973 16.353  18.419  1.00 20.85 ? 18  VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 18  ? 10.658 16.680  19.319  1.00 20.34 ? 18  VAL A CG2 1 
ATOM   68   N N   . LYS A 1 19  ? 10.689 20.158  18.247  1.00 21.94 ? 19  LYS A N   1 
ATOM   69   C CA  . LYS A 1 19  ? 9.538  21.066  18.207  1.00 22.56 ? 19  LYS A CA  1 
ATOM   70   C C   . LYS A 1 19  ? 8.244  20.324  18.481  1.00 22.55 ? 19  LYS A C   1 
ATOM   71   O O   . LYS A 1 19  ? 7.989  19.278  17.879  1.00 22.47 ? 19  LYS A O   1 
ATOM   72   C CB  . LYS A 1 19  ? 9.404  21.733  16.836  1.00 22.52 ? 19  LYS A CB  1 
ATOM   73   C CG  . LYS A 1 19  ? 10.257 22.946  16.625  1.00 23.60 ? 19  LYS A CG  1 
ATOM   74   C CD  . LYS A 1 19  ? 9.847  23.691  15.341  1.00 23.70 ? 19  LYS A CD  1 
ATOM   75   C CE  . LYS A 1 19  ? 8.639  24.578  15.542  1.00 24.28 ? 19  LYS A CE  1 
ATOM   76   N NZ  . LYS A 1 19  ? 8.345  25.386  14.319  1.00 24.34 ? 19  LYS A NZ  1 
ATOM   77   N N   . ALA A 1 20  ? 7.420  20.880  19.366  1.00 23.07 ? 20  ALA A N   1 
ATOM   78   C CA  . ALA A 1 20  ? 6.083  20.343  19.613  1.00 23.60 ? 20  ALA A CA  1 
ATOM   79   C C   . ALA A 1 20  ? 5.132  20.801  18.522  1.00 24.13 ? 20  ALA A C   1 
ATOM   80   O O   . ALA A 1 20  ? 5.325  21.861  17.921  1.00 24.39 ? 20  ALA A O   1 
ATOM   81   C CB  . ALA A 1 20  ? 5.558  20.784  20.978  1.00 23.56 ? 20  ALA A CB  1 
ATOM   82   N N   . GLY A 1 21  ? 4.112  19.987  18.273  1.00 24.61 ? 21  GLY A N   1 
ATOM   83   C CA  . GLY A 1 21  ? 3.046  20.328  17.346  1.00 25.22 ? 21  GLY A CA  1 
ATOM   84   C C   . GLY A 1 21  ? 2.044  21.298  17.950  1.00 25.77 ? 21  GLY A C   1 
ATOM   85   O O   . GLY A 1 21  ? 2.328  21.968  18.953  1.00 25.61 ? 21  GLY A O   1 
ATOM   86   N N   . SER A 1 22  ? 0.865  21.359  17.336  1.00 26.47 ? 22  SER A N   1 
ATOM   87   C CA  . SER A 1 22  ? -0.146 22.364  17.667  1.00 26.90 ? 22  SER A CA  1 
ATOM   88   C C   . SER A 1 22  ? -0.675 22.233  19.091  1.00 27.13 ? 22  SER A C   1 
ATOM   89   O O   . SER A 1 22  ? -0.934 23.246  19.748  1.00 27.61 ? 22  SER A O   1 
ATOM   90   C CB  . SER A 1 22  ? -1.304 22.304  16.667  1.00 27.05 ? 22  SER A CB  1 
ATOM   91   O OG  . SER A 1 22  ? -1.786 20.978  16.541  1.00 29.14 ? 22  SER A OG  1 
ATOM   92   N N   . ASP A 1 23  ? -0.822 20.997  19.568  1.00 27.08 ? 23  ASP A N   1 
ATOM   93   C CA  . ASP A 1 23  ? -1.272 20.740  20.946  1.00 26.88 ? 23  ASP A CA  1 
ATOM   94   C C   . ASP A 1 23  ? -0.184 20.989  22.013  1.00 26.78 ? 23  ASP A C   1 
ATOM   95   O O   . ASP A 1 23  ? -0.436 20.832  23.212  1.00 27.05 ? 23  ASP A O   1 
ATOM   96   C CB  . ASP A 1 23  ? -1.840 19.315  21.073  1.00 27.33 ? 23  ASP A CB  1 
ATOM   97   C CG  . ASP A 1 23  ? -0.794 18.223  20.824  1.00 27.78 ? 23  ASP A CG  1 
ATOM   98   O OD1 . ASP A 1 23  ? 0.420  18.497  20.916  1.00 27.84 ? 23  ASP A OD1 1 
ATOM   99   O OD2 . ASP A 1 23  ? -1.196 17.076  20.537  1.00 29.78 ? 23  ASP A OD2 1 
ATOM   100  N N   . GLY A 1 24  ? 1.022  21.357  21.580  1.00 26.17 ? 24  GLY A N   1 
ATOM   101  C CA  . GLY A 1 24  ? 2.131  21.640  22.492  1.00 25.72 ? 24  GLY A CA  1 
ATOM   102  C C   . GLY A 1 24  ? 2.807  20.414  23.087  1.00 25.28 ? 24  GLY A C   1 
ATOM   103  O O   . GLY A 1 24  ? 3.698  20.544  23.934  1.00 24.99 ? 24  GLY A O   1 
ATOM   104  N N   . GLU A 1 25  ? 2.407  19.229  22.630  1.00 24.83 ? 25  GLU A N   1 
ATOM   105  C CA  . GLU A 1 25  ? 2.898  17.965  23.191  1.00 24.71 ? 25  GLU A CA  1 
ATOM   106  C C   . GLU A 1 25  ? 3.360  16.975  22.121  1.00 23.85 ? 25  GLU A C   1 
ATOM   107  O O   . GLU A 1 25  ? 4.416  16.347  22.264  1.00 23.61 ? 25  GLU A O   1 
ATOM   108  C CB  . GLU A 1 25  ? 1.802  17.321  24.039  1.00 25.15 ? 25  GLU A CB  1 
ATOM   109  C CG  . GLU A 1 25  ? 1.295  18.229  25.150  1.00 26.55 ? 25  GLU A CG  1 
ATOM   110  C CD  . GLU A 1 25  ? 0.402  17.514  26.147  1.00 27.15 ? 25  GLU A CD  1 
ATOM   111  O OE1 . GLU A 1 25  ? -0.617 16.917  25.729  1.00 30.21 ? 25  GLU A OE1 1 
ATOM   112  O OE2 . GLU A 1 25  ? 0.716  17.566  27.358  1.00 31.68 ? 25  GLU A OE2 1 
ATOM   113  N N   . SER A 1 26  ? 2.557  16.829  21.069  1.00 23.15 ? 26  SER A N   1 
ATOM   114  C CA  A SER A 1 26  ? 2.873  15.920  19.970  0.50 22.91 ? 26  SER A CA  1 
ATOM   115  C CA  B SER A 1 26  ? 2.872  15.922  19.967  0.50 22.90 ? 26  SER A CA  1 
ATOM   116  C C   . SER A 1 26  ? 4.125  16.377  19.233  1.00 22.53 ? 26  SER A C   1 
ATOM   117  O O   . SER A 1 26  ? 4.555  17.522  19.373  1.00 22.41 ? 26  SER A O   1 
ATOM   118  C CB  A SER A 1 26  ? 1.701  15.835  18.988  0.50 22.93 ? 26  SER A CB  1 
ATOM   119  C CB  B SER A 1 26  ? 1.706  15.856  18.977  0.50 22.91 ? 26  SER A CB  1 
ATOM   120  O OG  A SER A 1 26  ? 1.508  17.063  18.303  0.50 22.66 ? 26  SER A OG  1 
ATOM   121  O OG  B SER A 1 26  ? 0.533  15.352  19.591  0.50 22.58 ? 26  SER A OG  1 
ATOM   122  N N   . ILE A 1 27  ? 4.707  15.474  18.452  1.00 22.04 ? 27  ILE A N   1 
ATOM   123  C CA  . ILE A 1 27  ? 5.842  15.815  17.612  1.00 21.61 ? 27  ILE A CA  1 
ATOM   124  C C   . ILE A 1 27  ? 5.363  16.785  16.538  1.00 20.69 ? 27  ILE A C   1 
ATOM   125  O O   . ILE A 1 27  ? 4.384  16.514  15.849  1.00 20.01 ? 27  ILE A O   1 
ATOM   126  C CB  . ILE A 1 27  ? 6.446  14.573  16.924  1.00 21.76 ? 27  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 27  ? 7.039  13.607  17.961  1.00 22.80 ? 27  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 27  ? 7.513  14.989  15.912  1.00 22.37 ? 27  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 27  ? 8.073  14.218  18.876  1.00 23.78 ? 27  ILE A CD1 1 
ATOM   130  N N   . GLY A 1 28  ? 6.052  17.915  16.412  1.00 19.94 ? 28  GLY A N   1 
ATOM   131  C CA  . GLY A 1 28  ? 5.681  18.950  15.451  1.00 19.42 ? 28  GLY A CA  1 
ATOM   132  C C   . GLY A 1 28  ? 6.378  18.778  14.112  1.00 18.74 ? 28  GLY A C   1 
ATOM   133  O O   . GLY A 1 28  ? 7.264  17.937  13.960  1.00 18.46 ? 28  GLY A O   1 
ATOM   134  N N   . ASN A 1 29  ? 5.977  19.579  13.132  1.00 17.87 ? 29  ASN A N   1 
ATOM   135  C CA  . ASN A 1 29  ? 6.679  19.597  11.858  1.00 17.83 ? 29  ASN A CA  1 
ATOM   136  C C   . ASN A 1 29  ? 8.018  20.332  11.999  1.00 17.46 ? 29  ASN A C   1 
ATOM   137  O O   . ASN A 1 29  ? 8.058  21.552  12.130  1.00 17.27 ? 29  ASN A O   1 
ATOM   138  C CB  . ASN A 1 29  ? 5.833  20.237  10.757  1.00 17.37 ? 29  ASN A CB  1 
ATOM   139  C CG  . ASN A 1 29  ? 6.585  20.332  9.440   1.00 17.29 ? 29  ASN A CG  1 
ATOM   140  O OD1 . ASN A 1 29  ? 7.401  19.470  9.127   1.00 14.85 ? 29  ASN A OD1 1 
ATOM   141  N ND2 . ASN A 1 29  ? 6.319  21.382  8.669   1.00 15.15 ? 29  ASN A ND2 1 
ATOM   142  N N   . CYS A 1 30  ? 9.100  19.564  11.975  1.00 17.82 ? 30  CYS A N   1 
ATOM   143  C CA  . CYS A 1 30  ? 10.462 20.093  12.082  1.00 17.95 ? 30  CYS A CA  1 
ATOM   144  C C   . CYS A 1 30  ? 11.369 19.051  11.444  1.00 17.69 ? 30  CYS A C   1 
ATOM   145  O O   . CYS A 1 30  ? 11.739 18.068  12.094  1.00 17.62 ? 30  CYS A O   1 
ATOM   146  C CB  . CYS A 1 30  ? 10.835 20.324  13.555  1.00 18.25 ? 30  CYS A CB  1 
ATOM   147  S SG  . CYS A 1 30  ? 12.584 20.720  13.892  1.00 19.89 ? 30  CYS A SG  1 
ATOM   148  N N   . PRO A 1 31  ? 11.676 19.213  10.147  1.00 17.63 ? 31  PRO A N   1 
ATOM   149  C CA  . PRO A 1 31  ? 12.400 18.126  9.468   1.00 17.45 ? 31  PRO A CA  1 
ATOM   150  C C   . PRO A 1 31  ? 13.811 17.855  10.014  1.00 17.40 ? 31  PRO A C   1 
ATOM   151  O O   . PRO A 1 31  ? 14.264 16.712  9.965   1.00 16.88 ? 31  PRO A O   1 
ATOM   152  C CB  . PRO A 1 31  ? 12.437 18.579  8.003   1.00 17.38 ? 31  PRO A CB  1 
ATOM   153  C CG  . PRO A 1 31  ? 12.234 20.046  8.038   1.00 17.46 ? 31  PRO A CG  1 
ATOM   154  C CD  . PRO A 1 31  ? 11.367 20.326  9.233   1.00 17.59 ? 31  PRO A CD  1 
ATOM   155  N N   . PHE A 1 32  ? 14.491 18.871  10.547  1.00 17.58 ? 32  PHE A N   1 
ATOM   156  C CA  . PHE A 1 32  ? 15.794 18.614  11.166  1.00 17.44 ? 32  PHE A CA  1 
ATOM   157  C C   . PHE A 1 32  ? 15.644 17.900  12.508  1.00 17.10 ? 32  PHE A C   1 
ATOM   158  O O   . PHE A 1 32  ? 16.506 17.105  12.883  1.00 15.73 ? 32  PHE A O   1 
ATOM   159  C CB  . PHE A 1 32  ? 16.638 19.877  11.327  1.00 18.36 ? 32  PHE A CB  1 
ATOM   160  C CG  . PHE A 1 32  ? 18.113 19.596  11.289  1.00 17.92 ? 32  PHE A CG  1 
ATOM   161  C CD1 . PHE A 1 32  ? 18.845 19.829  10.135  1.00 19.34 ? 32  PHE A CD1 1 
ATOM   162  C CD2 . PHE A 1 32  ? 18.754 19.027  12.380  1.00 18.99 ? 32  PHE A CD2 1 
ATOM   163  C CE1 . PHE A 1 32  ? 20.195 19.540  10.087  1.00 19.49 ? 32  PHE A CE1 1 
ATOM   164  C CE2 . PHE A 1 32  ? 20.104 18.742  12.342  1.00 19.50 ? 32  PHE A CE2 1 
ATOM   165  C CZ  . PHE A 1 32  ? 20.823 18.992  11.193  1.00 19.42 ? 32  PHE A CZ  1 
ATOM   166  N N   . CYS A 1 33  ? 14.556 18.176  13.227  1.00 16.75 ? 33  CYS A N   1 
ATOM   167  C CA  . CYS A 1 33  ? 14.241 17.413  14.436  1.00 16.96 ? 33  CYS A CA  1 
ATOM   168  C C   . CYS A 1 33  ? 14.073 15.945  14.073  1.00 16.39 ? 33  CYS A C   1 
ATOM   169  O O   . CYS A 1 33  ? 14.648 15.073  14.723  1.00 16.54 ? 33  CYS A O   1 
ATOM   170  C CB  . CYS A 1 33  ? 12.964 17.923  15.118  1.00 17.13 ? 33  CYS A CB  1 
ATOM   171  S SG  . CYS A 1 33  ? 13.023 19.655  15.633  1.00 19.34 ? 33  CYS A SG  1 
ATOM   172  N N   . GLN A 1 34  ? 13.305 15.676  13.019  1.00 16.07 ? 34  GLN A N   1 
ATOM   173  C CA  . GLN A 1 34  ? 13.102 14.310  12.565  1.00 15.73 ? 34  GLN A CA  1 
ATOM   174  C C   . GLN A 1 34  ? 14.422 13.659  12.118  1.00 15.39 ? 34  GLN A C   1 
ATOM   175  O O   . GLN A 1 34  ? 14.672 12.496  12.417  1.00 14.70 ? 34  GLN A O   1 
ATOM   176  C CB  . GLN A 1 34  ? 12.075 14.253  11.436  1.00 15.70 ? 34  GLN A CB  1 
ATOM   177  C CG  . GLN A 1 34  ? 11.633 12.836  11.130  1.00 16.22 ? 34  GLN A CG  1 
ATOM   178  C CD  . GLN A 1 34  ? 10.548 12.755  10.089  1.00 15.75 ? 34  GLN A CD  1 
ATOM   179  O OE1 . GLN A 1 34  ? 10.043 13.774  9.608   1.00 17.48 ? 34  GLN A OE1 1 
ATOM   180  N NE2 . GLN A 1 34  ? 10.179 11.532  9.731   1.00 16.74 ? 34  GLN A NE2 1 
ATOM   181  N N   . ARG A 1 35  ? 15.249 14.420  11.399  1.00 15.35 ? 35  ARG A N   1 
ATOM   182  C CA  . ARG A 1 35  ? 16.594 13.980  11.001  1.00 15.41 ? 35  ARG A CA  1 
ATOM   183  C C   . ARG A 1 35  ? 17.357 13.399  12.193  1.00 15.05 ? 35  ARG A C   1 
ATOM   184  O O   . ARG A 1 35  ? 17.847 12.275  12.134  1.00 13.91 ? 35  ARG A O   1 
ATOM   185  C CB  . ARG A 1 35  ? 17.349 15.169  10.414  1.00 15.98 ? 35  ARG A CB  1 
ATOM   186  C CG  . ARG A 1 35  ? 18.720 14.896  9.846   1.00 16.26 ? 35  ARG A CG  1 
ATOM   187  C CD  . ARG A 1 35  ? 19.217 16.163  9.149   1.00 17.10 ? 35  ARG A CD  1 
ATOM   188  N NE  . ARG A 1 35  ? 20.522 15.978  8.539   1.00 19.39 ? 35  ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 35  ? 21.072 16.816  7.662   1.00 20.46 ? 35  ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 35  ? 20.427 17.904  7.248   1.00 20.97 ? 35  ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 35  ? 22.270 16.543  7.170   1.00 21.21 ? 35  ARG A NH2 1 
ATOM   192  N N   . LEU A 1 36  ? 17.430 14.169  13.279  1.00 14.51 ? 36  LEU A N   1 
ATOM   193  C CA  . LEU A 1 36  ? 18.166 13.759  14.482  1.00 14.91 ? 36  LEU A CA  1 
ATOM   194  C C   . LEU A 1 36  ? 17.501 12.589  15.215  1.00 14.89 ? 36  LEU A C   1 
ATOM   195  O O   . LEU A 1 36  ? 18.185 11.723  15.757  1.00 14.35 ? 36  LEU A O   1 
ATOM   196  C CB  . LEU A 1 36  ? 18.325 14.949  15.429  1.00 14.68 ? 36  LEU A CB  1 
ATOM   197  C CG  . LEU A 1 36  ? 19.231 16.063  14.913  1.00 15.28 ? 36  LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 36  ? 19.204 17.237  15.869  1.00 16.09 ? 36  LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 36  ? 20.669 15.560  14.708  1.00 15.22 ? 36  LEU A CD2 1 
ATOM   200  N N   . PHE A 1 37  ? 16.168 12.590  15.241  1.00 15.21 ? 37  PHE A N   1 
ATOM   201  C CA  . PHE A 1 37  ? 15.389 11.482  15.792  1.00 15.37 ? 37  PHE A CA  1 
ATOM   202  C C   . PHE A 1 37  ? 15.783 10.186  15.059  1.00 15.40 ? 37  PHE A C   1 
ATOM   203  O O   . PHE A 1 37  ? 16.104 9.182   15.696  1.00 15.01 ? 37  PHE A O   1 
ATOM   204  C CB  . PHE A 1 37  ? 13.890 11.783  15.624  1.00 15.62 ? 37  PHE A CB  1 
ATOM   205  C CG  . PHE A 1 37  ? 12.956 10.957  16.492  1.00 15.63 ? 37  PHE A CG  1 
ATOM   206  C CD1 . PHE A 1 37  ? 11.671 11.431  16.742  1.00 16.24 ? 37  PHE A CD1 1 
ATOM   207  C CD2 . PHE A 1 37  ? 13.325 9.728   17.037  1.00 16.59 ? 37  PHE A CD2 1 
ATOM   208  C CE1 . PHE A 1 37  ? 10.771 10.703  17.518  1.00 16.72 ? 37  PHE A CE1 1 
ATOM   209  C CE2 . PHE A 1 37  ? 12.432 8.992   17.808  1.00 16.43 ? 37  PHE A CE2 1 
ATOM   210  C CZ  . PHE A 1 37  ? 11.152 9.485   18.053  1.00 16.45 ? 37  PHE A CZ  1 
ATOM   211  N N   . MET A 1 38  ? 15.783 10.228  13.725  1.00 15.50 ? 38  MET A N   1 
ATOM   212  C CA  . MET A 1 38  ? 16.162 9.066   12.910  1.00 15.57 ? 38  MET A CA  1 
ATOM   213  C C   . MET A 1 38  ? 17.603 8.619   13.156  1.00 15.40 ? 38  MET A C   1 
ATOM   214  O O   . MET A 1 38  ? 17.874 7.425   13.240  1.00 15.46 ? 38  MET A O   1 
ATOM   215  C CB  . MET A 1 38  ? 15.980 9.353   11.421  1.00 15.50 ? 38  MET A CB  1 
ATOM   216  C CG  . MET A 1 38  ? 14.536 9.404   10.975  1.00 15.51 ? 38  MET A CG  1 
ATOM   217  S SD  . MET A 1 38  ? 14.369 9.785   9.223   1.00 16.53 ? 38  MET A SD  1 
ATOM   218  C CE  . MET A 1 38  ? 14.931 8.260   8.476   1.00 16.04 ? 38  MET A CE  1 
ATOM   219  N N   . ILE A 1 39  ? 18.526 9.570   13.252  1.00 15.51 ? 39  ILE A N   1 
ATOM   220  C CA  . ILE A 1 39  ? 19.931 9.243   13.496  1.00 15.69 ? 39  ILE A CA  1 
ATOM   221  C C   . ILE A 1 39  ? 20.087 8.453   14.801  1.00 15.70 ? 39  ILE A C   1 
ATOM   222  O O   . ILE A 1 39  ? 20.743 7.413   14.838  1.00 15.67 ? 39  ILE A O   1 
ATOM   223  C CB  . ILE A 1 39  ? 20.813 10.512  13.543  1.00 15.62 ? 39  ILE A CB  1 
ATOM   224  C CG1 . ILE A 1 39  ? 20.949 11.121  12.143  1.00 15.73 ? 39  ILE A CG1 1 
ATOM   225  C CG2 . ILE A 1 39  ? 22.205 10.190  14.085  1.00 15.68 ? 39  ILE A CG2 1 
ATOM   226  C CD1 . ILE A 1 39  ? 21.587 12.486  12.146  1.00 15.49 ? 39  ILE A CD1 1 
ATOM   227  N N   . LEU A 1 40  ? 19.474 8.952   15.864  1.00 15.92 ? 40  LEU A N   1 
ATOM   228  C CA  . LEU A 1 40  ? 19.557 8.300   17.167  1.00 16.37 ? 40  LEU A CA  1 
ATOM   229  C C   . LEU A 1 40  ? 18.959 6.893   17.125  1.00 16.53 ? 40  LEU A C   1 
ATOM   230  O O   . LEU A 1 40  ? 19.554 5.956   17.646  1.00 16.20 ? 40  LEU A O   1 
ATOM   231  C CB  . LEU A 1 40  ? 18.872 9.154   18.231  1.00 16.30 ? 40  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 40  ? 19.605 10.466  18.534  1.00 16.15 ? 40  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 40  ? 18.711 11.396  19.325  1.00 16.94 ? 40  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 40  ? 20.922 10.213  19.268  1.00 15.55 ? 40  LEU A CD2 1 
ATOM   235  N N   . TRP A 1 41  ? 17.803 6.753   16.474  1.00 17.27 ? 41  TRP A N   1 
ATOM   236  C CA  . TRP A 1 41  ? 17.162 5.446   16.271  1.00 17.55 ? 41  TRP A CA  1 
ATOM   237  C C   . TRP A 1 41  ? 18.084 4.481   15.509  1.00 17.76 ? 41  TRP A C   1 
ATOM   238  O O   . TRP A 1 41  ? 18.272 3.339   15.919  1.00 17.90 ? 41  TRP A O   1 
ATOM   239  C CB  . TRP A 1 41  ? 15.842 5.619   15.512  1.00 17.95 ? 41  TRP A CB  1 
ATOM   240  C CG  . TRP A 1 41  ? 14.858 4.472   15.640  1.00 18.15 ? 41  TRP A CG  1 
ATOM   241  C CD1 . TRP A 1 41  ? 15.132 3.131   15.636  1.00 18.87 ? 41  TRP A CD1 1 
ATOM   242  C CD2 . TRP A 1 41  ? 13.434 4.585   15.733  1.00 18.68 ? 41  TRP A CD2 1 
ATOM   243  N NE1 . TRP A 1 41  ? 13.963 2.405   15.749  1.00 19.17 ? 41  TRP A NE1 1 
ATOM   244  C CE2 . TRP A 1 41  ? 12.908 3.273   15.807  1.00 18.74 ? 41  TRP A CE2 1 
ATOM   245  C CE3 . TRP A 1 41  ? 12.549 5.669   15.769  1.00 18.76 ? 41  TRP A CE3 1 
ATOM   246  C CZ2 . TRP A 1 41  ? 11.541 3.019   15.918  1.00 18.78 ? 41  TRP A CZ2 1 
ATOM   247  C CZ3 . TRP A 1 41  ? 11.184 5.410   15.891  1.00 18.89 ? 41  TRP A CZ3 1 
ATOM   248  C CH2 . TRP A 1 41  ? 10.699 4.100   15.958  1.00 19.09 ? 41  TRP A CH2 1 
ATOM   249  N N   . LEU A 1 42  ? 18.670 4.951   14.412  1.00 17.93 ? 42  LEU A N   1 
ATOM   250  C CA  . LEU A 1 42  ? 19.542 4.119   13.582  1.00 18.28 ? 42  LEU A CA  1 
ATOM   251  C C   . LEU A 1 42  ? 20.865 3.737   14.261  1.00 18.50 ? 42  LEU A C   1 
ATOM   252  O O   . LEU A 1 42  ? 21.446 2.703   13.929  1.00 18.36 ? 42  LEU A O   1 
ATOM   253  C CB  . LEU A 1 42  ? 19.811 4.805   12.230  1.00 18.43 ? 42  LEU A CB  1 
ATOM   254  C CG  . LEU A 1 42  ? 18.588 4.899   11.311  1.00 18.20 ? 42  LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 42  ? 18.833 5.883   10.179  1.00 19.19 ? 42  LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 42  ? 18.202 3.528   10.760  1.00 19.07 ? 42  LEU A CD2 1 
ATOM   257  N N   . LYS A 1 43  ? 21.329 4.553   15.208  1.00 18.72 ? 43  LYS A N   1 
ATOM   258  C CA  . LYS A 1 43  ? 22.532 4.228   15.983  1.00 19.39 ? 43  LYS A CA  1 
ATOM   259  C C   . LYS A 1 43  ? 22.309 3.080   16.971  1.00 20.01 ? 43  LYS A C   1 
ATOM   260  O O   . LYS A 1 43  ? 23.261 2.411   17.360  1.00 20.48 ? 43  LYS A O   1 
ATOM   261  C CB  . LYS A 1 43  ? 23.050 5.453   16.752  1.00 18.82 ? 43  LYS A CB  1 
ATOM   262  C CG  . LYS A 1 43  ? 23.718 6.527   15.886  1.00 18.20 ? 43  LYS A CG  1 
ATOM   263  C CD  . LYS A 1 43  ? 25.009 6.039   15.243  1.00 17.22 ? 43  LYS A CD  1 
ATOM   264  C CE  . LYS A 1 43  ? 25.697 7.157   14.476  1.00 17.18 ? 43  LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 43  ? 27.001 6.729   13.884  1.00 16.72 ? 43  LYS A NZ  1 
ATOM   266  N N   . GLY A 1 44  ? 21.064 2.872   17.388  1.00 20.80 ? 44  GLY A N   1 
ATOM   267  C CA  . GLY A 1 44  ? 20.727 1.815   18.351  1.00 21.55 ? 44  GLY A CA  1 
ATOM   268  C C   . GLY A 1 44  ? 20.995 2.198   19.794  1.00 22.06 ? 44  GLY A C   1 
ATOM   269  O O   . GLY A 1 44  ? 20.993 1.342   20.684  1.00 22.89 ? 44  GLY A O   1 
ATOM   270  N N   . VAL A 1 45  ? 21.218 3.486   20.030  1.00 22.51 ? 45  VAL A N   1 
ATOM   271  C CA  . VAL A 1 45  ? 21.511 3.991   21.367  1.00 22.70 ? 45  VAL A CA  1 
ATOM   272  C C   . VAL A 1 45  ? 20.208 4.254   22.120  1.00 23.09 ? 45  VAL A C   1 
ATOM   273  O O   . VAL A 1 45  ? 19.176 4.544   21.512  1.00 23.29 ? 45  VAL A O   1 
ATOM   274  C CB  . VAL A 1 45  ? 22.356 5.288   21.305  1.00 22.68 ? 45  VAL A CB  1 
ATOM   275  C CG1 . VAL A 1 45  ? 21.513 6.467   20.818  1.00 21.53 ? 45  VAL A CG1 1 
ATOM   276  C CG2 . VAL A 1 45  ? 22.971 5.590   22.661  1.00 22.54 ? 45  VAL A CG2 1 
ATOM   277  N N   . LYS A 1 46  ? 20.253 4.126   23.442  1.00 23.62 ? 46  LYS A N   1 
ATOM   278  C CA  . LYS A 1 46  ? 19.130 4.523   24.286  1.00 23.93 ? 46  LYS A CA  1 
ATOM   279  C C   . LYS A 1 46  ? 19.021 6.046   24.271  1.00 23.72 ? 46  LYS A C   1 
ATOM   280  O O   . LYS A 1 46  ? 20.031 6.742   24.363  1.00 23.65 ? 46  LYS A O   1 
ATOM   281  C CB  . LYS A 1 46  ? 19.327 4.045   25.726  1.00 24.54 ? 46  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 46  ? 19.012 2.569   25.966  1.00 25.30 ? 46  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 46  ? 19.514 2.148   27.351  1.00 25.75 ? 46  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 46  ? 18.626 1.105   28.007  1.00 26.56 ? 46  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 46  ? 19.088 0.793   29.404  1.00 27.15 ? 46  LYS A NZ  1 
ATOM   286  N N   . PHE A 1 47  ? 17.803 6.561   24.144  1.00 23.54 ? 47  PHE A N   1 
ATOM   287  C CA  . PHE A 1 47  ? 17.594 8.010   24.174  1.00 23.28 ? 47  PHE A CA  1 
ATOM   288  C C   . PHE A 1 47  ? 16.141 8.378   24.427  1.00 23.18 ? 47  PHE A C   1 
ATOM   289  O O   . PHE A 1 47  ? 15.231 7.583   24.176  1.00 23.34 ? 47  PHE A O   1 
ATOM   290  C CB  . PHE A 1 47  ? 18.079 8.668   22.869  1.00 22.83 ? 47  PHE A CB  1 
ATOM   291  C CG  . PHE A 1 47  ? 17.217 8.364   21.669  1.00 22.48 ? 47  PHE A CG  1 
ATOM   292  C CD1 . PHE A 1 47  ? 16.324 9.308   21.176  1.00 21.77 ? 47  PHE A CD1 1 
ATOM   293  C CD2 . PHE A 1 47  ? 17.305 7.137   21.033  1.00 21.88 ? 47  PHE A CD2 1 
ATOM   294  C CE1 . PHE A 1 47  ? 15.537 9.029   20.062  1.00 22.24 ? 47  PHE A CE1 1 
ATOM   295  C CE2 . PHE A 1 47  ? 16.524 6.846   19.920  1.00 22.34 ? 47  PHE A CE2 1 
ATOM   296  C CZ  . PHE A 1 47  ? 15.637 7.796   19.433  1.00 22.52 ? 47  PHE A CZ  1 
ATOM   297  N N   . ASN A 1 48  ? 15.944 9.597   24.923  1.00 23.06 ? 48  ASN A N   1 
ATOM   298  C CA  . ASN A 1 48  ? 14.618 10.176  25.102  1.00 23.21 ? 48  ASN A CA  1 
ATOM   299  C C   . ASN A 1 48  ? 14.364 11.298  24.107  1.00 22.98 ? 48  ASN A C   1 
ATOM   300  O O   . ASN A 1 48  ? 15.292 11.952  23.635  1.00 23.01 ? 48  ASN A O   1 
ATOM   301  C CB  . ASN A 1 48  ? 14.459 10.732  26.518  1.00 23.49 ? 48  ASN A CB  1 
ATOM   302  C CG  . ASN A 1 48  ? 13.792 9.754   27.451  1.00 24.40 ? 48  ASN A CG  1 
ATOM   303  O OD1 . ASN A 1 48  ? 14.403 9.274   28.407  1.00 24.90 ? 48  ASN A OD1 1 
ATOM   304  N ND2 . ASN A 1 48  ? 12.529 9.451   27.179  1.00 25.96 ? 48  ASN A ND2 1 
ATOM   305  N N   . VAL A 1 49  ? 13.091 11.507  23.800  1.00 22.95 ? 49  VAL A N   1 
ATOM   306  C CA  . VAL A 1 49  ? 12.668 12.620  22.969  1.00 22.71 ? 49  VAL A CA  1 
ATOM   307  C C   . VAL A 1 49  ? 11.642 13.433  23.744  1.00 22.59 ? 49  VAL A C   1 
ATOM   308  O O   . VAL A 1 49  ? 10.630 12.892  24.192  1.00 22.44 ? 49  VAL A O   1 
ATOM   309  C CB  . VAL A 1 49  ? 12.064 12.138  21.633  1.00 22.84 ? 49  VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 49  ? 11.409 13.303  20.888  1.00 22.38 ? 49  VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 49  ? 13.136 11.491  20.778  1.00 22.08 ? 49  VAL A CG2 1 
ATOM   312  N N   . THR A 1 50  ? 11.926 14.722  23.908  1.00 22.40 ? 50  THR A N   1 
ATOM   313  C CA  . THR A 1 50  ? 11.034 15.652  24.592  1.00 22.62 ? 50  THR A CA  1 
ATOM   314  C C   . THR A 1 50  ? 10.607 16.725  23.602  1.00 22.69 ? 50  THR A C   1 
ATOM   315  O O   . THR A 1 50  ? 11.427 17.219  22.828  1.00 22.43 ? 50  THR A O   1 
ATOM   316  C CB  . THR A 1 50  ? 11.748 16.316  25.784  1.00 22.40 ? 50  THR A CB  1 
ATOM   317  O OG1 . THR A 1 50  ? 12.019 15.330  26.785  1.00 22.21 ? 50  THR A OG1 1 
ATOM   318  C CG2 . THR A 1 50  ? 10.898 17.439  26.386  1.00 22.28 ? 50  THR A CG2 1 
ATOM   319  N N   . THR A 1 51  ? 9.329  17.084  23.623  1.00 23.09 ? 51  THR A N   1 
ATOM   320  C CA  . THR A 1 51  ? 8.816  18.112  22.725  1.00 23.82 ? 51  THR A CA  1 
ATOM   321  C C   . THR A 1 51  ? 8.788  19.460  23.436  1.00 24.60 ? 51  THR A C   1 
ATOM   322  O O   . THR A 1 51  ? 8.520  19.539  24.641  1.00 24.64 ? 51  THR A O   1 
ATOM   323  C CB  . THR A 1 51  ? 7.420  17.763  22.196  1.00 23.74 ? 51  THR A CB  1 
ATOM   324  O OG1 . THR A 1 51  ? 6.514  17.581  23.291  1.00 23.40 ? 51  THR A OG1 1 
ATOM   325  C CG2 . THR A 1 51  ? 7.479  16.495  21.367  1.00 23.48 ? 51  THR A CG2 1 
ATOM   326  N N   . VAL A 1 52  ? 9.083  20.512  22.680  1.00 25.20 ? 52  VAL A N   1 
ATOM   327  C CA  . VAL A 1 52  ? 9.168  21.861  23.214  1.00 25.89 ? 52  VAL A CA  1 
ATOM   328  C C   . VAL A 1 52  ? 8.079  22.720  22.583  1.00 26.51 ? 52  VAL A C   1 
ATOM   329  O O   . VAL A 1 52  ? 8.035  22.888  21.366  1.00 26.33 ? 52  VAL A O   1 
ATOM   330  C CB  . VAL A 1 52  ? 10.551 22.489  22.938  1.00 25.93 ? 52  VAL A CB  1 
ATOM   331  C CG1 . VAL A 1 52  ? 10.627 23.886  23.532  1.00 26.11 ? 52  VAL A CG1 1 
ATOM   332  C CG2 . VAL A 1 52  ? 11.662 21.618  23.502  1.00 25.79 ? 52  VAL A CG2 1 
ATOM   333  N N   . ASP A 1 53  ? 7.204  23.259  23.427  1.00 27.30 ? 53  ASP A N   1 
ATOM   334  C CA  . ASP A 1 53  ? 6.086  24.081  22.988  1.00 27.94 ? 53  ASP A CA  1 
ATOM   335  C C   . ASP A 1 53  ? 6.583  25.508  22.741  1.00 28.69 ? 53  ASP A C   1 
ATOM   336  O O   . ASP A 1 53  ? 6.806  26.276  23.681  1.00 28.09 ? 53  ASP A O   1 
ATOM   337  C CB  . ASP A 1 53  ? 4.985  24.043  24.056  1.00 28.05 ? 53  ASP A CB  1 
ATOM   338  C CG  . ASP A 1 53  ? 3.728  24.787  23.649  1.00 27.73 ? 53  ASP A CG  1 
ATOM   339  O OD1 . ASP A 1 53  ? 3.755  25.568  22.675  1.00 28.11 ? 53  ASP A OD1 1 
ATOM   340  O OD2 . ASP A 1 53  ? 2.702  24.592  24.331  1.00 28.13 ? 53  ASP A OD2 1 
ATOM   341  N N   . MET A 1 54  ? 6.750  25.864  21.471  1.00 29.61 ? 54  MET A N   1 
ATOM   342  C CA  . MET A 1 54  ? 7.311  27.169  21.131  1.00 30.55 ? 54  MET A CA  1 
ATOM   343  C C   . MET A 1 54  ? 6.309  28.326  21.272  1.00 31.21 ? 54  MET A C   1 
ATOM   344  O O   . MET A 1 54  ? 6.663  29.479  21.024  1.00 31.42 ? 54  MET A O   1 
ATOM   345  C CB  . MET A 1 54  ? 7.946  27.139  19.734  1.00 31.00 ? 54  MET A CB  1 
ATOM   346  C CG  . MET A 1 54  ? 9.179  26.221  19.632  1.00 31.77 ? 54  MET A CG  1 
ATOM   347  S SD  . MET A 1 54  ? 10.649 26.836  20.509  1.00 34.38 ? 54  MET A SD  1 
ATOM   348  C CE  . MET A 1 54  ? 10.214 26.611  22.232  1.00 35.86 ? 54  MET A CE  1 
ATOM   349  N N   . THR A 1 55  ? 5.078  28.025  21.684  1.00 31.87 ? 55  THR A N   1 
ATOM   350  C CA  . THR A 1 55  ? 4.122  29.068  22.079  1.00 32.43 ? 55  THR A CA  1 
ATOM   351  C C   . THR A 1 55  ? 4.223  29.401  23.583  1.00 32.87 ? 55  THR A C   1 
ATOM   352  O O   . THR A 1 55  ? 3.488  30.259  24.080  1.00 32.84 ? 55  THR A O   1 
ATOM   353  C CB  . THR A 1 55  ? 2.661  28.681  21.728  1.00 32.46 ? 55  THR A CB  1 
ATOM   354  O OG1 . THR A 1 55  ? 2.160  27.732  22.677  1.00 32.97 ? 55  THR A OG1 1 
ATOM   355  C CG2 . THR A 1 55  ? 2.574  28.098  20.318  1.00 32.52 ? 55  THR A CG2 1 
ATOM   356  N N   . ARG A 1 56  ? 5.130  28.726  24.293  1.00 33.32 ? 56  ARG A N   1 
ATOM   357  C CA  . ARG A 1 56  ? 5.354  28.963  25.721  1.00 33.83 ? 56  ARG A CA  1 
ATOM   358  C C   . ARG A 1 56  ? 6.856  29.064  26.007  1.00 34.39 ? 56  ARG A C   1 
ATOM   359  O O   . ARG A 1 56  ? 7.375  28.407  26.910  1.00 34.24 ? 56  ARG A O   1 
ATOM   360  C CB  . ARG A 1 56  ? 4.704  27.848  26.551  1.00 33.71 ? 56  ARG A CB  1 
ATOM   361  C CG  . ARG A 1 56  ? 3.204  27.677  26.278  1.00 33.54 ? 56  ARG A CG  1 
ATOM   362  C CD  . ARG A 1 56  ? 2.528  26.688  27.223  1.00 33.29 ? 56  ARG A CD  1 
ATOM   363  N NE  . ARG A 1 56  ? 3.134  25.355  27.176  1.00 32.98 ? 56  ARG A NE  1 
ATOM   364  C CZ  . ARG A 1 56  ? 4.062  24.903  28.019  1.00 32.44 ? 56  ARG A CZ  1 
ATOM   365  N NH1 . ARG A 1 56  ? 4.508  25.653  29.020  1.00 32.26 ? 56  ARG A NH1 1 
ATOM   366  N NH2 . ARG A 1 56  ? 4.537  23.675  27.866  1.00 32.04 ? 56  ARG A NH2 1 
ATOM   367  N N   . LYS A 1 57  ? 7.534  29.922  25.243  1.00 35.14 ? 57  LYS A N   1 
ATOM   368  C CA  . LYS A 1 57  ? 8.999  30.046  25.279  1.00 35.94 ? 57  LYS A CA  1 
ATOM   369  C C   . LYS A 1 57  ? 9.566  30.405  26.663  1.00 36.53 ? 57  LYS A C   1 
ATOM   370  O O   . LYS A 1 57  ? 10.560 29.815  27.086  1.00 36.47 ? 57  LYS A O   1 
ATOM   371  C CB  . LYS A 1 57  ? 9.490  31.085  24.254  1.00 36.11 ? 57  LYS A CB  1 
ATOM   372  C CG  . LYS A 1 57  ? 9.154  30.781  22.792  1.00 36.36 ? 57  LYS A CG  1 
ATOM   373  C CD  . LYS A 1 57  ? 9.487  31.980  21.894  1.00 36.38 ? 57  LYS A CD  1 
ATOM   374  C CE  . LYS A 1 57  ? 8.872  31.848  20.500  1.00 36.88 ? 57  LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 57  ? 8.907  33.133  19.738  1.00 37.19 ? 57  LYS A NZ  1 
ATOM   376  N N   . PRO A 1 58  ? 8.944  31.371  27.371  1.00 37.25 ? 58  PRO A N   1 
ATOM   377  C CA  . PRO A 1 58  ? 9.496  31.758  28.676  1.00 37.81 ? 58  PRO A CA  1 
ATOM   378  C C   . PRO A 1 58  ? 9.674  30.572  29.628  1.00 38.40 ? 58  PRO A C   1 
ATOM   379  O O   . PRO A 1 58  ? 10.686 30.480  30.327  1.00 38.25 ? 58  PRO A O   1 
ATOM   380  C CB  . PRO A 1 58  ? 8.450  32.739  29.223  1.00 37.70 ? 58  PRO A CB  1 
ATOM   381  C CG  . PRO A 1 58  ? 7.779  33.284  28.020  1.00 37.52 ? 58  PRO A CG  1 
ATOM   382  C CD  . PRO A 1 58  ? 7.730  32.145  27.046  1.00 37.33 ? 58  PRO A CD  1 
ATOM   383  N N   . GLU A 1 59  ? 8.693  29.674  29.634  1.00 39.27 ? 59  GLU A N   1 
ATOM   384  C CA  . GLU A 1 59  ? 8.734  28.480  30.470  1.00 39.75 ? 59  GLU A CA  1 
ATOM   385  C C   . GLU A 1 59  ? 9.518  27.346  29.807  1.00 40.25 ? 59  GLU A C   1 
ATOM   386  O O   . GLU A 1 59  ? 10.393 26.738  30.430  1.00 40.10 ? 59  GLU A O   1 
ATOM   387  C CB  . GLU A 1 59  ? 7.307  28.010  30.779  1.00 39.88 ? 59  GLU A CB  1 
ATOM   388  C CG  . GLU A 1 59  ? 7.230  26.787  31.679  1.00 40.23 ? 59  GLU A CG  1 
ATOM   389  C CD  . GLU A 1 59  ? 7.959  26.994  32.988  1.00 41.74 ? 59  GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 59  ? 7.435  27.744  33.843  1.00 42.23 ? 59  GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 59  ? 9.059  26.416  33.152  1.00 42.82 ? 59  GLU A OE2 1 
ATOM   392  N N   . GLU A 1 60  ? 9.188  27.060  28.549  1.00 40.74 ? 60  GLU A N   1 
ATOM   393  C CA  . GLU A 1 60  ? 9.761  25.919  27.832  1.00 41.26 ? 60  GLU A CA  1 
ATOM   394  C C   . GLU A 1 60  ? 11.236 26.083  27.524  1.00 41.95 ? 60  GLU A C   1 
ATOM   395  O O   . GLU A 1 60  ? 11.996 25.113  27.557  1.00 41.90 ? 60  GLU A O   1 
ATOM   396  C CB  . GLU A 1 60  ? 8.999  25.665  26.532  1.00 41.07 ? 60  GLU A CB  1 
ATOM   397  C CG  . GLU A 1 60  ? 7.658  25.015  26.752  1.00 40.34 ? 60  GLU A CG  1 
ATOM   398  C CD  . GLU A 1 60  ? 7.788  23.537  27.043  1.00 39.41 ? 60  GLU A CD  1 
ATOM   399  O OE1 . GLU A 1 60  ? 7.562  22.732  26.118  1.00 37.60 ? 60  GLU A OE1 1 
ATOM   400  O OE2 . GLU A 1 60  ? 8.144  23.183  28.186  1.00 38.64 ? 60  GLU A OE2 1 
ATOM   401  N N   . LEU A 1 61  ? 11.647 27.311  27.229  1.00 42.68 ? 61  LEU A N   1 
ATOM   402  C CA  . LEU A 1 61  ? 13.052 27.587  27.003  1.00 43.38 ? 61  LEU A CA  1 
ATOM   403  C C   . LEU A 1 61  ? 13.806 27.714  28.330  1.00 44.06 ? 61  LEU A C   1 
ATOM   404  O O   . LEU A 1 61  ? 14.731 28.509  28.414  1.00 44.08 ? 61  LEU A O   1 
ATOM   405  C CB  . LEU A 1 61  ? 13.224 28.854  26.157  1.00 43.38 ? 61  LEU A CB  1 
ATOM   406  N N   . LYS A 1 62  ? 13.397 26.947  29.353  1.00 44.94 ? 62  LYS A N   1 
ATOM   407  C CA  . LYS A 1 62  ? 14.154 26.790  30.610  1.00 45.30 ? 62  LYS A CA  1 
ATOM   408  C C   . LYS A 1 62  ? 15.109 28.000  30.682  1.00 46.06 ? 62  LYS A C   1 
ATOM   409  O O   . LYS A 1 62  ? 14.627 29.077  31.038  1.00 46.30 ? 62  LYS A O   1 
ATOM   410  C CB  . LYS A 1 62  ? 14.799 25.400  30.629  1.00 45.61 ? 62  LYS A CB  1 
ATOM   411  C CG  . LYS A 1 62  ? 14.411 24.534  31.813  1.00 45.88 ? 62  LYS A CG  1 
ATOM   412  C CD  . LYS A 1 62  ? 15.078 24.993  33.094  1.00 46.34 ? 62  LYS A CD  1 
ATOM   413  C CE  . LYS A 1 62  ? 14.461 24.313  34.300  1.00 46.53 ? 62  LYS A CE  1 
ATOM   414  N NZ  . LYS A 1 62  ? 13.037 24.716  34.492  1.00 46.60 ? 62  LYS A NZ  1 
ATOM   415  N N   . ASP A 1 63  ? 16.418 27.915  30.406  1.00 46.61 ? 63  ASP A N   1 
ATOM   416  C CA  . ASP A 1 63  ? 17.444 27.060  31.040  1.00 47.06 ? 63  ASP A CA  1 
ATOM   417  C C   . ASP A 1 63  ? 18.640 27.970  31.444  1.00 46.99 ? 63  ASP A C   1 
ATOM   418  O O   . ASP A 1 63  ? 19.002 27.975  32.621  1.00 47.29 ? 63  ASP A O   1 
ATOM   419  C CB  . ASP A 1 63  ? 17.946 25.824  30.229  1.00 47.27 ? 63  ASP A CB  1 
ATOM   420  C CG  . ASP A 1 63  ? 17.660 25.897  28.726  1.00 48.07 ? 63  ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 63  ? 16.579 26.367  28.314  1.00 49.22 ? 63  ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 63  ? 18.531 25.446  27.949  1.00 49.22 ? 63  ASP A OD2 1 
ATOM   423  N N   . LEU A 1 64  ? 19.262 28.736  30.527  1.00 46.86 ? 64  LEU A N   1 
ATOM   424  C CA  . LEU A 1 64  ? 18.963 28.783  29.081  1.00 46.51 ? 64  LEU A CA  1 
ATOM   425  C C   . LEU A 1 64  ? 20.210 28.832  28.187  1.00 46.34 ? 64  LEU A C   1 
ATOM   426  O O   . LEU A 1 64  ? 20.656 27.803  27.678  1.00 46.39 ? 64  LEU A O   1 
ATOM   427  C CB  . LEU A 1 64  ? 18.057 29.984  28.726  1.00 46.69 ? 64  LEU A CB  1 
ATOM   428  C CG  . LEU A 1 64  ? 17.133 29.836  27.499  1.00 46.83 ? 64  LEU A CG  1 
ATOM   429  C CD1 . LEU A 1 64  ? 16.895 31.164  26.809  1.00 46.68 ? 64  LEU A CD1 1 
ATOM   430  C CD2 . LEU A 1 64  ? 17.630 28.808  26.482  1.00 47.42 ? 64  LEU A CD2 1 
ATOM   431  N N   . ALA A 1 65  ? 20.774 30.029  28.026  1.00 46.02 ? 65  ALA A N   1 
ATOM   432  C CA  . ALA A 1 65  ? 21.551 30.391  26.839  1.00 45.63 ? 65  ALA A CA  1 
ATOM   433  C C   . ALA A 1 65  ? 20.543 30.701  25.723  1.00 45.35 ? 65  ALA A C   1 
ATOM   434  O O   . ALA A 1 65  ? 20.066 29.782  25.058  1.00 45.44 ? 65  ALA A O   1 
ATOM   435  C CB  . ALA A 1 65  ? 22.502 29.269  26.428  1.00 45.68 ? 65  ALA A CB  1 
ATOM   436  N N   . PRO A 1 66  ? 20.201 31.997  25.527  1.00 44.84 ? 66  PRO A N   1 
ATOM   437  C CA  . PRO A 1 66  ? 19.118 32.436  24.619  1.00 44.20 ? 66  PRO A CA  1 
ATOM   438  C C   . PRO A 1 66  ? 19.154 31.878  23.193  1.00 43.65 ? 66  PRO A C   1 
ATOM   439  O O   . PRO A 1 66  ? 18.104 31.779  22.553  1.00 43.67 ? 66  PRO A O   1 
ATOM   440  C CB  . PRO A 1 66  ? 19.280 33.962  24.587  1.00 44.41 ? 66  PRO A CB  1 
ATOM   441  C CG  . PRO A 1 66  ? 19.929 34.301  25.865  1.00 44.66 ? 66  PRO A CG  1 
ATOM   442  C CD  . PRO A 1 66  ? 20.853 33.153  26.174  1.00 44.89 ? 66  PRO A CD  1 
ATOM   443  N N   . GLY A 1 67  ? 20.341 31.529  22.699  1.00 42.79 ? 67  GLY A N   1 
ATOM   444  C CA  . GLY A 1 67  ? 20.477 30.899  21.384  1.00 42.06 ? 67  GLY A CA  1 
ATOM   445  C C   . GLY A 1 67  ? 20.043 29.440  21.324  1.00 41.41 ? 67  GLY A C   1 
ATOM   446  O O   . GLY A 1 67  ? 20.144 28.809  20.269  1.00 41.62 ? 67  GLY A O   1 
ATOM   447  N N   . THR A 1 68  ? 19.574 28.895  22.448  1.00 40.40 ? 68  THR A N   1 
ATOM   448  C CA  . THR A 1 68  ? 19.080 27.521  22.502  1.00 39.42 ? 68  THR A CA  1 
ATOM   449  C C   . THR A 1 68  ? 17.644 27.449  21.982  1.00 38.57 ? 68  THR A C   1 
ATOM   450  O O   . THR A 1 68  ? 16.725 27.995  22.599  1.00 38.57 ? 68  THR A O   1 
ATOM   451  C CB  . THR A 1 68  ? 19.153 26.989  23.929  1.00 39.58 ? 68  THR A CB  1 
ATOM   452  N N   . ASN A 1 69  ? 17.465 26.782  20.841  1.00 37.38 ? 69  ASN A N   1 
ATOM   453  C CA  . ASN A 1 69  ? 16.149 26.574  20.233  1.00 36.30 ? 69  ASN A CA  1 
ATOM   454  C C   . ASN A 1 69  ? 16.092 25.209  19.547  1.00 35.10 ? 69  ASN A C   1 
ATOM   455  O O   . ASN A 1 69  ? 17.106 24.744  19.032  1.00 34.75 ? 69  ASN A O   1 
ATOM   456  C CB  . ASN A 1 69  ? 15.860 27.671  19.209  1.00 36.33 ? 69  ASN A CB  1 
ATOM   457  C CG  . ASN A 1 69  ? 15.638 29.020  19.851  1.00 36.79 ? 69  ASN A CG  1 
ATOM   458  O OD1 . ASN A 1 69  ? 16.542 29.859  19.889  1.00 38.25 ? 69  ASN A OD1 1 
ATOM   459  N ND2 . ASN A 1 69  ? 14.437 29.235  20.374  1.00 36.38 ? 69  ASN A ND2 1 
ATOM   460  N N   . PRO A 1 70  ? 14.906 24.566  19.528  1.00 33.73 ? 70  PRO A N   1 
ATOM   461  C CA  . PRO A 1 70  ? 14.817 23.221  18.954  1.00 33.14 ? 70  PRO A CA  1 
ATOM   462  C C   . PRO A 1 70  ? 15.134 23.191  17.453  1.00 31.41 ? 70  PRO A C   1 
ATOM   463  O O   . PRO A 1 70  ? 14.774 24.128  16.735  1.00 31.28 ? 70  PRO A O   1 
ATOM   464  C CB  . PRO A 1 70  ? 13.361 22.811  19.220  1.00 33.03 ? 70  PRO A CB  1 
ATOM   465  C CG  . PRO A 1 70  ? 12.627 24.084  19.421  1.00 33.49 ? 70  PRO A CG  1 
ATOM   466  C CD  . PRO A 1 70  ? 13.603 25.042  20.022  1.00 33.80 ? 70  PRO A CD  1 
ATOM   467  N N   . PRO A 1 71  ? 15.812 22.129  16.979  1.00 29.74 ? 71  PRO A N   1 
ATOM   468  C CA  . PRO A 1 71  ? 16.281 20.985  17.765  1.00 28.57 ? 71  PRO A CA  1 
ATOM   469  C C   . PRO A 1 71  ? 17.523 21.305  18.592  1.00 27.91 ? 71  PRO A C   1 
ATOM   470  O O   . PRO A 1 71  ? 18.422 21.995  18.116  1.00 27.18 ? 71  PRO A O   1 
ATOM   471  C CB  . PRO A 1 71  ? 16.624 19.938  16.699  1.00 28.78 ? 71  PRO A CB  1 
ATOM   472  C CG  . PRO A 1 71  ? 16.979 20.738  15.491  1.00 29.06 ? 71  PRO A CG  1 
ATOM   473  C CD  . PRO A 1 71  ? 16.165 22.001  15.553  1.00 29.57 ? 71  PRO A CD  1 
ATOM   474  N N   . PHE A 1 72  ? 17.550 20.829  19.832  1.00 27.09 ? 72  PHE A N   1 
ATOM   475  C CA  . PHE A 1 72  ? 18.793 20.764  20.594  1.00 27.03 ? 72  PHE A CA  1 
ATOM   476  C C   . PHE A 1 72  ? 18.851 19.447  21.348  1.00 26.78 ? 72  PHE A C   1 
ATOM   477  O O   . PHE A 1 72  ? 17.869 18.718  21.421  1.00 26.16 ? 72  PHE A O   1 
ATOM   478  C CB  . PHE A 1 72  ? 18.982 21.970  21.526  1.00 26.78 ? 72  PHE A CB  1 
ATOM   479  C CG  . PHE A 1 72  ? 17.900 22.143  22.549  1.00 26.40 ? 72  PHE A CG  1 
ATOM   480  C CD1 . PHE A 1 72  ? 18.054 21.639  23.831  1.00 26.43 ? 72  PHE A CD1 1 
ATOM   481  C CD2 . PHE A 1 72  ? 16.744 22.843  22.241  1.00 26.29 ? 72  PHE A CD2 1 
ATOM   482  C CE1 . PHE A 1 72  ? 17.068 21.810  24.783  1.00 26.25 ? 72  PHE A CE1 1 
ATOM   483  C CE2 . PHE A 1 72  ? 15.748 23.018  23.185  1.00 26.99 ? 72  PHE A CE2 1 
ATOM   484  C CZ  . PHE A 1 72  ? 15.910 22.499  24.462  1.00 27.00 ? 72  PHE A CZ  1 
ATOM   485  N N   . LEU A 1 73  ? 20.021 19.138  21.885  1.00 26.89 ? 73  LEU A N   1 
ATOM   486  C CA  . LEU A 1 73  ? 20.256 17.830  22.461  1.00 27.10 ? 73  LEU A CA  1 
ATOM   487  C C   . LEU A 1 73  ? 21.170 17.950  23.665  1.00 27.26 ? 73  LEU A C   1 
ATOM   488  O O   . LEU A 1 73  ? 22.111 18.747  23.658  1.00 27.07 ? 73  LEU A O   1 
ATOM   489  C CB  . LEU A 1 73  ? 20.862 16.917  21.396  1.00 27.02 ? 73  LEU A CB  1 
ATOM   490  C CG  . LEU A 1 73  ? 21.414 15.552  21.804  1.00 27.19 ? 73  LEU A CG  1 
ATOM   491  C CD1 . LEU A 1 73  ? 20.952 14.476  20.825  1.00 27.82 ? 73  LEU A CD1 1 
ATOM   492  C CD2 . LEU A 1 73  ? 22.935 15.598  21.887  1.00 27.02 ? 73  LEU A CD2 1 
ATOM   493  N N   . VAL A 1 74  ? 20.867 17.172  24.702  1.00 27.52 ? 74  VAL A N   1 
ATOM   494  C CA  . VAL A 1 74  ? 21.729 17.066  25.870  1.00 27.91 ? 74  VAL A CA  1 
ATOM   495  C C   . VAL A 1 74  ? 22.345 15.671  25.885  1.00 28.24 ? 74  VAL A C   1 
ATOM   496  O O   . VAL A 1 74  ? 21.632 14.667  25.893  1.00 27.80 ? 74  VAL A O   1 
ATOM   497  C CB  . VAL A 1 74  ? 20.966 17.348  27.183  1.00 27.87 ? 74  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 74  ? 21.902 17.248  28.386  1.00 27.68 ? 74  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 74  ? 20.323 18.731  27.137  1.00 27.46 ? 74  VAL A CG2 1 
ATOM   500  N N   . TYR A 1 75  ? 23.674 15.633  25.863  1.00 29.05 ? 75  TYR A N   1 
ATOM   501  C CA  . TYR A 1 75  ? 24.448 14.399  25.840  1.00 29.52 ? 75  TYR A CA  1 
ATOM   502  C C   . TYR A 1 75  ? 25.329 14.360  27.087  1.00 29.87 ? 75  TYR A C   1 
ATOM   503  O O   . TYR A 1 75  ? 26.275 15.138  27.199  1.00 29.51 ? 75  TYR A O   1 
ATOM   504  C CB  . TYR A 1 75  ? 25.319 14.364  24.581  1.00 29.83 ? 75  TYR A CB  1 
ATOM   505  C CG  . TYR A 1 75  ? 26.145 13.108  24.422  1.00 29.81 ? 75  TYR A CG  1 
ATOM   506  C CD1 . TYR A 1 75  ? 25.715 12.068  23.600  1.00 30.57 ? 75  TYR A CD1 1 
ATOM   507  C CD2 . TYR A 1 75  ? 27.363 12.961  25.083  1.00 30.18 ? 75  TYR A CD2 1 
ATOM   508  C CE1 . TYR A 1 75  ? 26.473 10.917  23.447  1.00 30.48 ? 75  TYR A CE1 1 
ATOM   509  C CE2 . TYR A 1 75  ? 28.127 11.814  24.937  1.00 30.35 ? 75  TYR A CE2 1 
ATOM   510  C CZ  . TYR A 1 75  ? 27.679 10.797  24.120  1.00 30.73 ? 75  TYR A CZ  1 
ATOM   511  O OH  . TYR A 1 75  ? 28.440 9.658   23.980  1.00 31.15 ? 75  TYR A OH  1 
ATOM   512  N N   . ASN A 1 76  ? 25.029 13.450  28.011  1.00 30.44 ? 76  ASN A N   1 
ATOM   513  C CA  . ASN A 1 76  ? 25.704 13.421  29.309  1.00 31.24 ? 76  ASN A CA  1 
ATOM   514  C C   . ASN A 1 76  ? 25.816 14.841  29.902  1.00 31.89 ? 76  ASN A C   1 
ATOM   515  O O   . ASN A 1 76  ? 26.909 15.321  30.208  1.00 31.93 ? 76  ASN A O   1 
ATOM   516  C CB  . ASN A 1 76  ? 27.086 12.756  29.191  1.00 30.93 ? 76  ASN A CB  1 
ATOM   517  C CG  . ASN A 1 76  ? 27.006 11.259  28.922  1.00 30.75 ? 76  ASN A CG  1 
ATOM   518  O OD1 . ASN A 1 76  ? 26.009 10.605  29.229  1.00 29.72 ? 76  ASN A OD1 1 
ATOM   519  N ND2 . ASN A 1 76  ? 28.072 10.707  28.351  1.00 31.24 ? 76  ASN A ND2 1 
ATOM   520  N N   . LYS A 1 77  ? 24.667 15.508  30.016  1.00 32.89 ? 77  LYS A N   1 
ATOM   521  C CA  . LYS A 1 77  ? 24.544 16.864  30.592  1.00 33.49 ? 77  LYS A CA  1 
ATOM   522  C C   . LYS A 1 77  ? 25.063 18.024  29.714  1.00 34.08 ? 77  LYS A C   1 
ATOM   523  O O   . LYS A 1 77  ? 24.788 19.184  30.024  1.00 34.36 ? 77  LYS A O   1 
ATOM   524  C CB  . LYS A 1 77  ? 25.202 16.949  31.984  1.00 33.93 ? 77  LYS A CB  1 
ATOM   525  C CG  . LYS A 1 77  ? 24.847 15.827  32.958  1.00 34.18 ? 77  LYS A CG  1 
ATOM   526  C CD  . LYS A 1 77  ? 23.367 15.755  33.224  1.00 35.03 ? 77  LYS A CD  1 
ATOM   527  C CE  . LYS A 1 77  ? 23.070 14.993  34.504  1.00 35.33 ? 77  LYS A CE  1 
ATOM   528  N NZ  . LYS A 1 77  ? 23.537 13.577  34.460  1.00 36.82 ? 77  LYS A NZ  1 
ATOM   529  N N   . GLU A 1 78  ? 25.804 17.733  28.642  1.00 34.48 ? 78  GLU A N   1 
ATOM   530  C CA  . GLU A 1 78  ? 26.314 18.781  27.748  1.00 34.93 ? 78  GLU A CA  1 
ATOM   531  C C   . GLU A 1 78  ? 25.240 19.192  26.744  1.00 34.94 ? 78  GLU A C   1 
ATOM   532  O O   . GLU A 1 78  ? 24.652 18.336  26.081  1.00 34.91 ? 78  GLU A O   1 
ATOM   533  C CB  . GLU A 1 78  ? 27.548 18.305  26.970  1.00 35.12 ? 78  GLU A CB  1 
ATOM   534  C CG  . GLU A 1 78  ? 28.813 18.097  27.795  1.00 36.00 ? 78  GLU A CG  1 
ATOM   535  C CD  . GLU A 1 78  ? 30.010 17.670  26.942  1.00 36.31 ? 78  GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 78  ? 29.798 17.084  25.857  1.00 38.05 ? 78  GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 78  ? 31.166 17.914  27.359  1.00 38.47 ? 78  GLU A OE2 1 
ATOM   538  N N   . LEU A 1 79  ? 25.007 20.497  26.621  1.00 35.01 ? 79  LEU A N   1 
ATOM   539  C CA  . LEU A 1 79  ? 24.051 21.028  25.651  1.00 35.00 ? 79  LEU A CA  1 
ATOM   540  C C   . LEU A 1 79  ? 24.711 21.152  24.282  1.00 35.05 ? 79  LEU A C   1 
ATOM   541  O O   . LEU A 1 79  ? 25.806 21.710  24.157  1.00 34.94 ? 79  LEU A O   1 
ATOM   542  C CB  . LEU A 1 79  ? 23.530 22.397  26.099  1.00 35.09 ? 79  LEU A CB  1 
ATOM   543  C CG  . LEU A 1 79  ? 22.569 23.129  25.150  1.00 35.21 ? 79  LEU A CG  1 
ATOM   544  C CD1 . LEU A 1 79  ? 21.264 22.352  24.969  1.00 34.73 ? 79  LEU A CD1 1 
ATOM   545  C CD2 . LEU A 1 79  ? 22.296 24.537  25.662  1.00 35.15 ? 79  LEU A CD2 1 
ATOM   546  N N   . LYS A 1 80  ? 24.037 20.635  23.259  1.00 34.83 ? 80  LYS A N   1 
ATOM   547  C CA  . LYS A 1 80  ? 24.533 20.707  21.891  1.00 34.94 ? 80  LYS A CA  1 
ATOM   548  C C   . LYS A 1 80  ? 23.480 21.315  20.971  1.00 34.87 ? 80  LYS A C   1 
ATOM   549  O O   . LYS A 1 80  ? 22.299 20.964  21.039  1.00 34.26 ? 80  LYS A O   1 
ATOM   550  C CB  . LYS A 1 80  ? 24.981 19.323  21.429  1.00 35.22 ? 80  LYS A CB  1 
ATOM   551  C CG  . LYS A 1 80  ? 26.386 19.005  21.911  1.00 35.66 ? 80  LYS A CG  1 
ATOM   552  C CD  . LYS A 1 80  ? 26.531 17.619  22.483  1.00 36.26 ? 80  LYS A CD  1 
ATOM   553  C CE  . LYS A 1 80  ? 27.757 17.555  23.382  1.00 36.75 ? 80  LYS A CE  1 
ATOM   554  N NZ  . LYS A 1 80  ? 28.985 18.079  22.714  1.00 37.14 ? 80  LYS A NZ  1 
ATOM   555  N N   . THR A 1 81  ? 23.925 22.236  20.119  1.00 34.78 ? 81  THR A N   1 
ATOM   556  C CA  . THR A 1 81  ? 23.023 23.137  19.413  1.00 34.65 ? 81  THR A CA  1 
ATOM   557  C C   . THR A 1 81  ? 23.422 23.285  17.943  1.00 34.44 ? 81  THR A C   1 
ATOM   558  O O   . THR A 1 81  ? 24.485 22.818  17.525  1.00 34.31 ? 81  THR A O   1 
ATOM   559  C CB  . THR A 1 81  ? 22.995 24.514  20.142  1.00 34.83 ? 81  THR A CB  1 
ATOM   560  O OG1 . THR A 1 81  ? 22.381 24.354  21.428  1.00 35.39 ? 81  THR A OG1 1 
ATOM   561  C CG2 . THR A 1 81  ? 22.227 25.569  19.367  1.00 35.07 ? 81  THR A CG2 1 
ATOM   562  N N   . ASP A 1 82  ? 22.519 23.876  17.165  1.00 34.31 ? 82  ASP A N   1 
ATOM   563  C CA  . ASP A 1 82  ? 22.776 24.331  15.797  1.00 34.05 ? 82  ASP A CA  1 
ATOM   564  C C   . ASP A 1 82  ? 22.829 23.202  14.767  1.00 33.74 ? 82  ASP A C   1 
ATOM   565  O O   . ASP A 1 82  ? 23.863 22.945  14.146  1.00 33.83 ? 82  ASP A O   1 
ATOM   566  C CB  . ASP A 1 82  ? 24.033 25.214  15.710  1.00 34.40 ? 82  ASP A CB  1 
ATOM   567  C CG  . ASP A 1 82  ? 24.159 25.925  14.359  1.00 35.09 ? 82  ASP A CG  1 
ATOM   568  O OD1 . ASP A 1 82  ? 23.124 26.374  13.816  1.00 37.28 ? 82  ASP A OD1 1 
ATOM   569  O OD2 . ASP A 1 82  ? 25.290 26.024  13.834  1.00 37.70 ? 82  ASP A OD2 1 
ATOM   570  N N   . PHE A 1 83  ? 21.693 22.535  14.602  1.00 33.06 ? 83  PHE A N   1 
ATOM   571  C CA  . PHE A 1 83  ? 21.444 21.676  13.449  1.00 32.50 ? 83  PHE A CA  1 
ATOM   572  C C   . PHE A 1 83  ? 22.615 20.733  13.127  1.00 31.82 ? 83  PHE A C   1 
ATOM   573  O O   . PHE A 1 83  ? 22.817 19.746  13.836  1.00 31.05 ? 83  PHE A O   1 
ATOM   574  C CB  . PHE A 1 83  ? 21.070 22.538  12.235  1.00 32.80 ? 83  PHE A CB  1 
ATOM   575  C CG  . PHE A 1 83  ? 19.936 23.481  12.496  1.00 32.97 ? 83  PHE A CG  1 
ATOM   576  C CD1 . PHE A 1 83  ? 18.628 23.025  12.498  1.00 33.10 ? 83  PHE A CD1 1 
ATOM   577  C CD2 . PHE A 1 83  ? 20.177 24.823  12.750  1.00 33.46 ? 83  PHE A CD2 1 
ATOM   578  C CE1 . PHE A 1 83  ? 17.576 23.889  12.746  1.00 33.47 ? 83  PHE A CE1 1 
ATOM   579  C CE2 . PHE A 1 83  ? 19.129 25.695  13.001  1.00 33.61 ? 83  PHE A CE2 1 
ATOM   580  C CZ  . PHE A 1 83  ? 17.824 25.222  12.999  1.00 33.44 ? 83  PHE A CZ  1 
ATOM   581  N N   . ILE A 1 84  ? 23.385 21.050  12.078  1.00 31.13 ? 84  ILE A N   1 
ATOM   582  C CA  . ILE A 1 84  ? 24.382 20.126  11.536  1.00 30.70 ? 84  ILE A CA  1 
ATOM   583  C C   . ILE A 1 84  ? 25.478 19.791  12.542  1.00 29.81 ? 84  ILE A C   1 
ATOM   584  O O   . ILE A 1 84  ? 26.019 18.689  12.518  1.00 29.76 ? 84  ILE A O   1 
ATOM   585  C CB  . ILE A 1 84  ? 25.013 20.659  10.210  1.00 30.90 ? 84  ILE A CB  1 
ATOM   586  C CG1 . ILE A 1 84  ? 25.854 19.575  9.524   1.00 31.64 ? 84  ILE A CG1 1 
ATOM   587  C CG2 . ILE A 1 84  ? 25.865 21.907  10.467  1.00 31.02 ? 84  ILE A CG2 1 
ATOM   588  C CD1 . ILE A 1 84  ? 25.140 18.244  9.357   1.00 31.79 ? 84  ILE A CD1 1 
ATOM   589  N N   . LYS A 1 85  ? 25.795 20.728  13.430  1.00 29.02 ? 85  LYS A N   1 
ATOM   590  C CA  . LYS A 1 85  ? 26.770 20.465  14.488  1.00 28.44 ? 85  LYS A CA  1 
ATOM   591  C C   . LYS A 1 85  ? 26.334 19.296  15.378  1.00 27.49 ? 85  LYS A C   1 
ATOM   592  O O   . LYS A 1 85  ? 27.167 18.519  15.845  1.00 27.01 ? 85  LYS A O   1 
ATOM   593  C CB  . LYS A 1 85  ? 27.009 21.728  15.318  1.00 28.52 ? 85  LYS A CB  1 
ATOM   594  C CG  . LYS A 1 85  ? 27.790 22.789  14.562  1.00 28.91 ? 85  LYS A CG  1 
ATOM   595  C CD  . LYS A 1 85  ? 27.797 24.122  15.287  1.00 28.93 ? 85  LYS A CD  1 
ATOM   596  C CE  . LYS A 1 85  ? 28.675 25.137  14.573  0.01 28.82 ? 85  LYS A CE  1 
ATOM   597  N NZ  . LYS A 1 85  ? 28.695 26.451  15.274  0.01 28.87 ? 85  LYS A NZ  1 
ATOM   598  N N   . ILE A 1 86  ? 25.026 19.156  15.582  1.00 26.68 ? 86  ILE A N   1 
ATOM   599  C CA  . ILE A 1 86  ? 24.495 18.061  16.389  1.00 26.27 ? 86  ILE A CA  1 
ATOM   600  C C   . ILE A 1 86  ? 24.684 16.738  15.644  1.00 25.51 ? 86  ILE A C   1 
ATOM   601  O O   . ILE A 1 86  ? 25.119 15.752  16.232  1.00 25.04 ? 86  ILE A O   1 
ATOM   602  C CB  . ILE A 1 86  ? 22.997 18.243  16.740  1.00 26.11 ? 86  ILE A CB  1 
ATOM   603  C CG1 . ILE A 1 86  ? 22.723 19.625  17.340  1.00 26.84 ? 86  ILE A CG1 1 
ATOM   604  C CG2 . ILE A 1 86  ? 22.556 17.178  17.731  1.00 26.34 ? 86  ILE A CG2 1 
ATOM   605  C CD1 . ILE A 1 86  ? 21.249 19.897  17.578  1.00 26.74 ? 86  ILE A CD1 1 
ATOM   606  N N   . GLU A 1 87  ? 24.365 16.731  14.351  1.00 25.02 ? 87  GLU A N   1 
ATOM   607  C CA  . GLU A 1 87  ? 24.526 15.535  13.526  1.00 24.78 ? 87  GLU A CA  1 
ATOM   608  C C   . GLU A 1 87  ? 25.981 15.075  13.504  1.00 24.22 ? 87  GLU A C   1 
ATOM   609  O O   . GLU A 1 87  ? 26.259 13.893  13.665  1.00 23.56 ? 87  GLU A O   1 
ATOM   610  C CB  . GLU A 1 87  ? 24.036 15.777  12.092  1.00 24.70 ? 87  GLU A CB  1 
ATOM   611  C CG  . GLU A 1 87  ? 24.543 14.742  11.093  1.00 25.14 ? 87  GLU A CG  1 
ATOM   612  C CD  . GLU A 1 87  ? 23.779 14.746  9.790   1.00 25.40 ? 87  GLU A CD  1 
ATOM   613  O OE1 . GLU A 1 87  ? 22.564 14.478  9.820   1.00 27.41 ? 87  GLU A OE1 1 
ATOM   614  O OE2 . GLU A 1 87  ? 24.395 14.992  8.735   1.00 26.67 ? 87  GLU A OE2 1 
ATOM   615  N N   . GLU A 1 88  ? 26.894 16.022  13.296  1.00 24.12 ? 88  GLU A N   1 
ATOM   616  C CA  . GLU A 1 88  ? 28.331 15.735  13.254  1.00 24.22 ? 88  GLU A CA  1 
ATOM   617  C C   . GLU A 1 88  ? 28.810 15.126  14.569  1.00 23.62 ? 88  GLU A C   1 
ATOM   618  O O   . GLU A 1 88  ? 29.542 14.133  14.576  1.00 23.29 ? 88  GLU A O   1 
ATOM   619  C CB  . GLU A 1 88  ? 29.114 17.018  12.939  1.00 24.52 ? 88  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 88  ? 28.908 17.527  11.508  1.00 25.47 ? 88  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 88  ? 29.492 18.918  11.266  1.00 26.03 ? 88  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 88  ? 29.889 19.604  12.240  1.00 28.20 ? 88  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 88  ? 29.552 19.326  10.084  1.00 29.58 ? 88  GLU A OE2 1 
ATOM   624  N N   . PHE A 1 89  ? 28.374 15.711  15.679  1.00 23.06 ? 89  PHE A N   1 
ATOM   625  C CA  . PHE A 1 89  ? 28.731 15.209  16.996  1.00 22.86 ? 89  PHE A CA  1 
ATOM   626  C C   . PHE A 1 89  ? 28.253 13.770  17.201  1.00 22.39 ? 89  PHE A C   1 
ATOM   627  O O   . PHE A 1 89  ? 29.014 12.932  17.675  1.00 22.04 ? 89  PHE A O   1 
ATOM   628  C CB  . PHE A 1 89  ? 28.161 16.107  18.094  1.00 23.34 ? 89  PHE A CB  1 
ATOM   629  C CG  . PHE A 1 89  ? 28.339 15.549  19.470  1.00 23.24 ? 89  PHE A CG  1 
ATOM   630  C CD1 . PHE A 1 89  ? 29.520 15.758  20.167  1.00 23.96 ? 89  PHE A CD1 1 
ATOM   631  C CD2 . PHE A 1 89  ? 27.331 14.813  20.066  1.00 23.68 ? 89  PHE A CD2 1 
ATOM   632  C CE1 . PHE A 1 89  ? 29.689 15.242  21.438  1.00 24.10 ? 89  PHE A CE1 1 
ATOM   633  C CE2 . PHE A 1 89  ? 27.495 14.289  21.334  1.00 24.50 ? 89  PHE A CE2 1 
ATOM   634  C CZ  . PHE A 1 89  ? 28.676 14.501  22.022  1.00 24.08 ? 89  PHE A CZ  1 
ATOM   635  N N   . LEU A 1 90  ? 27.000 13.496  16.841  1.00 21.92 ? 90  LEU A N   1 
ATOM   636  C CA  . LEU A 1 90  ? 26.419 12.155  16.994  1.00 21.70 ? 90  LEU A CA  1 
ATOM   637  C C   . LEU A 1 90  ? 27.117 11.104  16.125  1.00 21.50 ? 90  LEU A C   1 
ATOM   638  O O   . LEU A 1 90  ? 27.405 10.002  16.594  1.00 21.20 ? 90  LEU A O   1 
ATOM   639  C CB  . LEU A 1 90  ? 24.917 12.174  16.669  1.00 21.18 ? 90  LEU A CB  1 
ATOM   640  C CG  . LEU A 1 90  ? 24.005 12.949  17.622  1.00 20.60 ? 90  LEU A CG  1 
ATOM   641  C CD1 . LEU A 1 90  ? 22.566 12.908  17.132  1.00 19.49 ? 90  LEU A CD1 1 
ATOM   642  C CD2 . LEU A 1 90  ? 24.111 12.396  19.044  1.00 19.74 ? 90  LEU A CD2 1 
ATOM   643  N N   . GLU A 1 91  ? 27.378 11.442  14.865  1.00 21.68 ? 91  GLU A N   1 
ATOM   644  C CA  . GLU A 1 91  ? 28.075 10.522  13.955  1.00 22.17 ? 91  GLU A CA  1 
ATOM   645  C C   . GLU A 1 91  ? 29.492 10.218  14.463  1.00 22.51 ? 91  GLU A C   1 
ATOM   646  O O   . GLU A 1 91  ? 29.951 9.085   14.363  1.00 22.73 ? 91  GLU A O   1 
ATOM   647  C CB  . GLU A 1 91  ? 28.088 11.081  12.519  1.00 21.86 ? 91  GLU A CB  1 
ATOM   648  C CG  . GLU A 1 91  ? 28.942 10.313  11.496  1.00 21.43 ? 91  GLU A CG  1 
ATOM   649  C CD  . GLU A 1 91  ? 28.408 8.925   11.146  1.00 19.53 ? 91  GLU A CD  1 
ATOM   650  O OE1 . GLU A 1 91  ? 27.384 8.492   11.707  1.00 18.17 ? 91  GLU A OE1 1 
ATOM   651  O OE2 . GLU A 1 91  ? 29.024 8.258   10.294  1.00 19.66 ? 91  GLU A OE2 1 
ATOM   652  N N   . GLN A 1 92  ? 30.162 11.222  15.032  1.00 22.99 ? 92  GLN A N   1 
ATOM   653  C CA  . GLN A 1 92  ? 31.514 11.055  15.577  1.00 23.18 ? 92  GLN A CA  1 
ATOM   654  C C   . GLN A 1 92  ? 31.537 10.233  16.857  1.00 23.04 ? 92  GLN A C   1 
ATOM   655  O O   . GLN A 1 92  ? 32.325 9.292   16.988  1.00 22.91 ? 92  GLN A O   1 
ATOM   656  C CB  . GLN A 1 92  ? 32.159 12.418  15.880  1.00 23.44 ? 92  GLN A CB  1 
ATOM   657  C CG  . GLN A 1 92  ? 33.474 12.300  16.675  1.00 24.10 ? 92  GLN A CG  1 
ATOM   658  C CD  . GLN A 1 92  ? 34.000 13.619  17.192  1.00 24.86 ? 92  GLN A CD  1 
ATOM   659  O OE1 . GLN A 1 92  ? 34.937 13.644  17.990  1.00 28.90 ? 92  GLN A OE1 1 
ATOM   660  N NE2 . GLN A 1 92  ? 33.404 14.722  16.752  1.00 27.15 ? 92  GLN A NE2 1 
ATOM   661  N N   . THR A 1 93  ? 30.686 10.620  17.801  1.00 22.85 ? 93  THR A N   1 
ATOM   662  C CA  . THR A 1 93  ? 30.721 10.092  19.161  1.00 22.89 ? 93  THR A CA  1 
ATOM   663  C C   . THR A 1 93  ? 30.139 8.681   19.248  1.00 22.80 ? 93  THR A C   1 
ATOM   664  O O   . THR A 1 93  ? 30.677 7.828   19.961  1.00 22.87 ? 93  THR A O   1 
ATOM   665  C CB  . THR A 1 93  ? 29.976 11.047  20.131  1.00 23.04 ? 93  THR A CB  1 
ATOM   666  O OG1 . THR A 1 93  ? 30.436 12.389  19.923  1.00 23.57 ? 93  THR A OG1 1 
ATOM   667  C CG2 . THR A 1 93  ? 30.223 10.662  21.572  1.00 23.21 ? 93  THR A CG2 1 
ATOM   668  N N   . LEU A 1 94  ? 29.043 8.443   18.527  1.00 22.30 ? 94  LEU A N   1 
ATOM   669  C CA  . LEU A 1 94  ? 28.430 7.124   18.459  1.00 22.34 ? 94  LEU A CA  1 
ATOM   670  C C   . LEU A 1 94  ? 28.995 6.410   17.235  1.00 22.20 ? 94  LEU A C   1 
ATOM   671  O O   . LEU A 1 94  ? 28.363 6.355   16.181  1.00 22.05 ? 94  LEU A O   1 
ATOM   672  C CB  . LEU A 1 94  ? 26.904 7.239   18.385  1.00 22.02 ? 94  LEU A CB  1 
ATOM   673  C CG  . LEU A 1 94  ? 26.239 8.063   19.491  1.00 22.13 ? 94  LEU A CG  1 
ATOM   674  C CD1 . LEU A 1 94  ? 24.753 8.260   19.208  1.00 23.07 ? 94  LEU A CD1 1 
ATOM   675  C CD2 . LEU A 1 94  ? 26.456 7.408   20.852  1.00 22.01 ? 94  LEU A CD2 1 
ATOM   676  N N   . ALA A 1 95  ? 30.200 5.870   17.389  1.00 22.27 ? 95  ALA A N   1 
ATOM   677  C CA  . ALA A 1 95  ? 30.968 5.333   16.268  1.00 22.76 ? 95  ALA A CA  1 
ATOM   678  C C   . ALA A 1 95  ? 31.291 3.851   16.471  1.00 22.84 ? 95  ALA A C   1 
ATOM   679  O O   . ALA A 1 95  ? 31.136 3.332   17.576  1.00 22.42 ? 95  ALA A O   1 
ATOM   680  C CB  . ALA A 1 95  ? 32.255 6.134   16.091  1.00 22.67 ? 95  ALA A CB  1 
ATOM   681  N N   . PRO A 1 96  ? 31.719 3.162   15.397  1.00 23.24 ? 96  PRO A N   1 
ATOM   682  C CA  . PRO A 1 96  ? 32.205 1.783   15.547  1.00 23.79 ? 96  PRO A CA  1 
ATOM   683  C C   . PRO A 1 96  ? 33.414 1.678   16.496  1.00 24.50 ? 96  PRO A C   1 
ATOM   684  O O   . PRO A 1 96  ? 34.141 2.657   16.670  1.00 25.24 ? 96  PRO A O   1 
ATOM   685  C CB  . PRO A 1 96  ? 32.604 1.388   14.120  1.00 23.75 ? 96  PRO A CB  1 
ATOM   686  C CG  . PRO A 1 96  ? 31.843 2.319   13.226  1.00 23.67 ? 96  PRO A CG  1 
ATOM   687  C CD  . PRO A 1 96  ? 31.734 3.603   13.989  1.00 23.18 ? 96  PRO A CD  1 
ATOM   688  N N   . PRO A 1 97  ? 33.649 0.494   17.084  1.00 25.56 ? 97  PRO A N   1 
ATOM   689  C CA  . PRO A 1 97  ? 32.956 -0.781  16.855  1.00 25.96 ? 97  PRO A CA  1 
ATOM   690  C C   . PRO A 1 97  ? 31.544 -0.891  17.442  1.00 26.10 ? 97  PRO A C   1 
ATOM   691  O O   . PRO A 1 97  ? 30.758 -1.707  16.968  1.00 26.07 ? 97  PRO A O   1 
ATOM   692  C CB  . PRO A 1 97  ? 33.884 -1.799  17.531  1.00 25.89 ? 97  PRO A CB  1 
ATOM   693  C CG  . PRO A 1 97  ? 34.515 -1.031  18.634  1.00 26.09 ? 97  PRO A CG  1 
ATOM   694  C CD  . PRO A 1 97  ? 34.718 0.356   18.093  1.00 25.65 ? 97  PRO A CD  1 
ATOM   695  N N   . ARG A 1 98  ? 31.219 -0.069  18.437  1.00 26.45 ? 98  ARG A N   1 
ATOM   696  C CA  . ARG A 1 98  ? 29.961 -0.209  19.177  1.00 26.75 ? 98  ARG A CA  1 
ATOM   697  C C   . ARG A 1 98  ? 28.708 0.217   18.397  1.00 26.25 ? 98  ARG A C   1 
ATOM   698  O O   . ARG A 1 98  ? 27.693 -0.471  18.441  1.00 26.15 ? 98  ARG A O   1 
ATOM   699  C CB  . ARG A 1 98  ? 30.046 0.552   20.508  1.00 27.41 ? 98  ARG A CB  1 
ATOM   700  C CG  . ARG A 1 98  ? 31.106 -0.027  21.449  1.00 28.91 ? 98  ARG A CG  1 
ATOM   701  C CD  . ARG A 1 98  ? 31.184 0.684   22.796  1.00 29.49 ? 98  ARG A CD  1 
ATOM   702  N NE  . ARG A 1 98  ? 32.030 -0.059  23.736  1.00 31.13 ? 98  ARG A NE  1 
ATOM   703  C CZ  . ARG A 1 98  ? 32.253 0.292   25.002  1.00 32.74 ? 98  ARG A CZ  1 
ATOM   704  N NH1 . ARG A 1 98  ? 31.699 1.392   25.513  1.00 34.18 ? 98  ARG A NH1 1 
ATOM   705  N NH2 . ARG A 1 98  ? 33.037 -0.464  25.768  1.00 33.64 ? 98  ARG A NH2 1 
ATOM   706  N N   . TYR A 1 99  ? 28.779 1.341   17.688  1.00 25.42 ? 99  TYR A N   1 
ATOM   707  C CA  . TYR A 1 99  ? 27.619 1.867   16.964  1.00 25.01 ? 99  TYR A CA  1 
ATOM   708  C C   . TYR A 1 99  ? 27.873 1.885   15.454  1.00 24.27 ? 99  TYR A C   1 
ATOM   709  O O   . TYR A 1 99  ? 29.022 1.975   15.020  1.00 24.19 ? 99  TYR A O   1 
ATOM   710  C CB  . TYR A 1 99  ? 27.293 3.274   17.463  1.00 25.03 ? 99  TYR A CB  1 
ATOM   711  C CG  . TYR A 1 99  ? 27.093 3.362   18.961  1.00 25.28 ? 99  TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 99  ? 25.839 3.165   19.523  1.00 24.62 ? 99  TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 99  ? 28.161 3.638   19.820  1.00 25.18 ? 99  TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 99  ? 25.640 3.241   20.896  1.00 25.52 ? 99  TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 99  ? 27.974 3.717   21.196  1.00 25.11 ? 99  TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 99  ? 26.707 3.515   21.729  1.00 25.54 ? 99  TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 99  ? 26.489 3.585   23.091  1.00 26.30 ? 99  TYR A OH  1 
ATOM   718  N N   . PRO A 1 100 ? 26.800 1.793   14.647  1.00 23.69 ? 100 PRO A N   1 
ATOM   719  C CA  . PRO A 1 100 ? 26.974 1.802   13.192  1.00 23.49 ? 100 PRO A CA  1 
ATOM   720  C C   . PRO A 1 100 ? 27.344 3.179   12.636  1.00 23.11 ? 100 PRO A C   1 
ATOM   721  O O   . PRO A 1 100 ? 26.833 4.198   13.091  1.00 22.58 ? 100 PRO A O   1 
ATOM   722  C CB  . PRO A 1 100 ? 25.603 1.360   12.668  1.00 23.46 ? 100 PRO A CB  1 
ATOM   723  C CG  . PRO A 1 100 ? 24.647 1.771   13.712  1.00 23.82 ? 100 PRO A CG  1 
ATOM   724  C CD  . PRO A 1 100 ? 25.382 1.672   15.029  1.00 23.76 ? 100 PRO A CD  1 
ATOM   725  N N   . HIS A 1 101 ? 28.246 3.172   11.663  1.00 23.10 ? 101 HIS A N   1 
ATOM   726  C CA  . HIS A 1 101 ? 28.626 4.341   10.884  1.00 22.74 ? 101 HIS A CA  1 
ATOM   727  C C   . HIS A 1 101 ? 27.475 4.644   9.921   1.00 22.35 ? 101 HIS A C   1 
ATOM   728  O O   . HIS A 1 101 ? 27.035 3.757   9.186   1.00 21.87 ? 101 HIS A O   1 
ATOM   729  C CB  . HIS A 1 101 ? 29.932 3.998   10.144  1.00 23.33 ? 101 HIS A CB  1 
ATOM   730  C CG  . HIS A 1 101 ? 30.326 4.961   9.070   1.00 23.97 ? 101 HIS A CG  1 
ATOM   731  N ND1 . HIS A 1 101 ? 31.241 5.971   9.276   1.00 25.94 ? 101 HIS A ND1 1 
ATOM   732  C CD2 . HIS A 1 101 ? 29.979 5.028   7.762   1.00 25.26 ? 101 HIS A CD2 1 
ATOM   733  C CE1 . HIS A 1 101 ? 31.420 6.635   8.148   1.00 25.92 ? 101 HIS A CE1 1 
ATOM   734  N NE2 . HIS A 1 101 ? 30.661 6.087   7.216   1.00 26.23 ? 101 HIS A NE2 1 
ATOM   735  N N   . LEU A 1 102 ? 26.977 5.882   9.942   1.00 21.78 ? 102 LEU A N   1 
ATOM   736  C CA  . LEU A 1 102 ? 25.845 6.278   9.091   1.00 21.31 ? 102 LEU A CA  1 
ATOM   737  C C   . LEU A 1 102 ? 26.182 7.241   7.941   1.00 21.16 ? 102 LEU A C   1 
ATOM   738  O O   . LEU A 1 102 ? 25.339 7.467   7.078   1.00 20.47 ? 102 LEU A O   1 
ATOM   739  C CB  . LEU A 1 102 ? 24.736 6.902   9.945   1.00 20.94 ? 102 LEU A CB  1 
ATOM   740  C CG  . LEU A 1 102 ? 24.127 6.026   11.036  1.00 20.41 ? 102 LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 102 ? 23.045 6.809   11.791  1.00 19.37 ? 102 LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 102 ? 23.576 4.724   10.450  1.00 19.69 ? 102 LEU A CD2 1 
ATOM   743  N N   . SER A 1 103 ? 27.383 7.819   7.920   1.00 21.11 ? 103 SER A N   1 
ATOM   744  C CA  A SER A 1 103 ? 27.749 8.775   6.869   0.50 21.19 ? 103 SER A CA  1 
ATOM   745  C CA  B SER A 1 103 ? 27.733 8.781   6.877   0.50 21.25 ? 103 SER A CA  1 
ATOM   746  C C   . SER A 1 103 ? 27.700 8.121   5.492   1.00 21.11 ? 103 SER A C   1 
ATOM   747  O O   . SER A 1 103 ? 28.199 7.005   5.319   1.00 20.80 ? 103 SER A O   1 
ATOM   748  C CB  A SER A 1 103 ? 29.152 9.346   7.106   0.50 21.23 ? 103 SER A CB  1 
ATOM   749  C CB  B SER A 1 103 ? 29.111 9.400   7.148   0.50 21.32 ? 103 SER A CB  1 
ATOM   750  O OG  A SER A 1 103 ? 29.167 10.237  8.201   0.50 20.82 ? 103 SER A OG  1 
ATOM   751  O OG  B SER A 1 103 ? 29.289 10.593  6.404   0.50 21.44 ? 103 SER A OG  1 
ATOM   752  N N   . PRO A 1 104 ? 27.103 8.809   4.493   1.00 21.33 ? 104 PRO A N   1 
ATOM   753  C CA  . PRO A 1 104 ? 27.107 8.225   3.158   1.00 21.81 ? 104 PRO A CA  1 
ATOM   754  C C   . PRO A 1 104 ? 28.496 8.312   2.514   1.00 22.27 ? 104 PRO A C   1 
ATOM   755  O O   . PRO A 1 104 ? 29.307 9.151   2.897   1.00 21.91 ? 104 PRO A O   1 
ATOM   756  C CB  . PRO A 1 104 ? 26.107 9.090   2.391   1.00 21.80 ? 104 PRO A CB  1 
ATOM   757  C CG  . PRO A 1 104 ? 26.139 10.394  3.062   1.00 21.49 ? 104 PRO A CG  1 
ATOM   758  C CD  . PRO A 1 104 ? 26.444 10.129  4.506   1.00 21.26 ? 104 PRO A CD  1 
ATOM   759  N N   . LYS A 1 105 ? 28.756 7.434   1.554   1.00 23.00 ? 105 LYS A N   1 
ATOM   760  C CA  . LYS A 1 105 ? 30.006 7.457   0.804   1.00 23.95 ? 105 LYS A CA  1 
ATOM   761  C C   . LYS A 1 105 ? 30.050 8.631   -0.170  1.00 24.11 ? 105 LYS A C   1 
ATOM   762  O O   . LYS A 1 105 ? 31.116 9.196   -0.416  1.00 24.02 ? 105 LYS A O   1 
ATOM   763  C CB  . LYS A 1 105 ? 30.171 6.161   0.020   1.00 24.20 ? 105 LYS A CB  1 
ATOM   764  C CG  . LYS A 1 105 ? 30.151 4.902   0.873   1.00 25.16 ? 105 LYS A CG  1 
ATOM   765  C CD  . LYS A 1 105 ? 29.760 3.689   0.051   1.00 25.61 ? 105 LYS A CD  1 
ATOM   766  C CE  . LYS A 1 105 ? 28.272 3.675   -0.265  1.00 26.57 ? 105 LYS A CE  1 
ATOM   767  N NZ  . LYS A 1 105 ? 27.776 2.338   -0.680  1.00 27.61 ? 105 LYS A NZ  1 
ATOM   768  N N   . TYR A 1 106 ? 28.888 8.989   -0.718  1.00 24.38 ? 106 TYR A N   1 
ATOM   769  C CA  . TYR A 1 106 ? 28.796 9.965   -1.805  1.00 24.63 ? 106 TYR A CA  1 
ATOM   770  C C   . TYR A 1 106 ? 28.072 11.234  -1.366  1.00 24.79 ? 106 TYR A C   1 
ATOM   771  O O   . TYR A 1 106 ? 26.913 11.186  -0.950  1.00 24.70 ? 106 TYR A O   1 
ATOM   772  C CB  . TYR A 1 106 ? 28.082 9.337   -3.005  1.00 24.98 ? 106 TYR A CB  1 
ATOM   773  C CG  . TYR A 1 106 ? 28.739 8.065   -3.496  1.00 24.98 ? 106 TYR A CG  1 
ATOM   774  C CD1 . TYR A 1 106 ? 28.102 6.832   -3.382  1.00 25.05 ? 106 TYR A CD1 1 
ATOM   775  C CD2 . TYR A 1 106 ? 30.010 8.095   -4.058  1.00 25.41 ? 106 TYR A CD2 1 
ATOM   776  C CE1 . TYR A 1 106 ? 28.712 5.663   -3.824  1.00 24.89 ? 106 TYR A CE1 1 
ATOM   777  C CE2 . TYR A 1 106 ? 30.625 6.936   -4.506  1.00 25.44 ? 106 TYR A CE2 1 
ATOM   778  C CZ  . TYR A 1 106 ? 29.975 5.724   -4.386  1.00 25.54 ? 106 TYR A CZ  1 
ATOM   779  O OH  . TYR A 1 106 ? 30.599 4.582   -4.835  1.00 25.91 ? 106 TYR A OH  1 
ATOM   780  N N   . LYS A 1 107 ? 28.775 12.363  -1.457  1.00 25.02 ? 107 LYS A N   1 
ATOM   781  C CA  . LYS A 1 107 ? 28.223 13.687  -1.155  1.00 25.02 ? 107 LYS A CA  1 
ATOM   782  C C   . LYS A 1 107 ? 26.971 13.988  -1.987  1.00 24.74 ? 107 LYS A C   1 
ATOM   783  O O   . LYS A 1 107 ? 26.059 14.667  -1.526  1.00 24.15 ? 107 LYS A O   1 
ATOM   784  C CB  . LYS A 1 107 ? 29.291 14.749  -1.417  1.00 25.37 ? 107 LYS A CB  1 
ATOM   785  C CG  . LYS A 1 107 ? 28.854 16.199  -1.231  1.00 25.91 ? 107 LYS A CG  1 
ATOM   786  C CD  . LYS A 1 107 ? 29.967 17.143  -1.683  1.00 26.04 ? 107 LYS A CD  1 
ATOM   787  C CE  . LYS A 1 107 ? 29.460 18.539  -1.942  1.00 26.98 ? 107 LYS A CE  1 
ATOM   788  N NZ  . LYS A 1 107 ? 30.396 19.285  -2.837  1.00 28.90 ? 107 LYS A NZ  1 
ATOM   789  N N   . GLU A 1 108 ? 26.944 13.472  -3.213  1.00 24.81 ? 108 GLU A N   1 
ATOM   790  C CA  . GLU A 1 108 ? 25.815 13.660  -4.116  1.00 25.05 ? 108 GLU A CA  1 
ATOM   791  C C   . GLU A 1 108 ? 24.502 13.159  -3.483  1.00 25.09 ? 108 GLU A C   1 
ATOM   792  O O   . GLU A 1 108 ? 23.434 13.701  -3.757  1.00 25.44 ? 108 GLU A O   1 
ATOM   793  C CB  . GLU A 1 108 ? 26.082 12.958  -5.454  1.00 25.12 ? 108 GLU A CB  1 
ATOM   794  C CG  . GLU A 1 108 ? 27.219 13.574  -6.297  1.00 25.54 ? 108 GLU A CG  1 
ATOM   795  C CD  . GLU A 1 108 ? 28.631 13.152  -5.870  1.00 26.56 ? 108 GLU A CD  1 
ATOM   796  O OE1 . GLU A 1 108 ? 28.785 12.382  -4.898  1.00 26.75 ? 108 GLU A OE1 1 
ATOM   797  O OE2 . GLU A 1 108 ? 29.601 13.599  -6.518  1.00 27.74 ? 108 GLU A OE2 1 
ATOM   798  N N   . SER A 1 109 ? 24.596 12.145  -2.620  1.00 25.04 ? 109 SER A N   1 
ATOM   799  C CA  . SER A 1 109 ? 23.426 11.616  -1.909  1.00 25.05 ? 109 SER A CA  1 
ATOM   800  C C   . SER A 1 109 ? 22.747 12.685  -1.042  1.00 24.89 ? 109 SER A C   1 
ATOM   801  O O   . SER A 1 109 ? 21.534 12.634  -0.844  1.00 24.55 ? 109 SER A O   1 
ATOM   802  C CB  . SER A 1 109 ? 23.809 10.398  -1.059  1.00 24.94 ? 109 SER A CB  1 
ATOM   803  O OG  . SER A 1 109 ? 24.272 9.322   -1.872  1.00 25.19 ? 109 SER A OG  1 
ATOM   804  N N   . PHE A 1 110 ? 23.529 13.649  -0.542  1.00 24.99 ? 110 PHE A N   1 
ATOM   805  C CA  . PHE A 1 110 ? 22.987 14.843  0.125   1.00 25.19 ? 110 PHE A CA  1 
ATOM   806  C C   . PHE A 1 110 ? 22.442 15.881  -0.848  1.00 25.53 ? 110 PHE A C   1 
ATOM   807  O O   . PHE A 1 110 ? 21.334 16.396  -0.667  1.00 25.69 ? 110 PHE A O   1 
ATOM   808  C CB  . PHE A 1 110 ? 24.060 15.543  0.967   1.00 24.72 ? 110 PHE A CB  1 
ATOM   809  C CG  . PHE A 1 110 ? 24.366 14.854  2.259   1.00 24.47 ? 110 PHE A CG  1 
ATOM   810  C CD1 . PHE A 1 110 ? 23.445 14.862  3.294   1.00 23.80 ? 110 PHE A CD1 1 
ATOM   811  C CD2 . PHE A 1 110 ? 25.586 14.221  2.451   1.00 24.09 ? 110 PHE A CD2 1 
ATOM   812  C CE1 . PHE A 1 110 ? 23.734 14.236  4.498   1.00 24.18 ? 110 PHE A CE1 1 
ATOM   813  C CE2 . PHE A 1 110 ? 25.879 13.600  3.654   1.00 24.40 ? 110 PHE A CE2 1 
ATOM   814  C CZ  . PHE A 1 110 ? 24.954 13.607  4.673   1.00 23.90 ? 110 PHE A CZ  1 
ATOM   815  N N   . ASP A 1 111 ? 23.251 16.213  -1.851  1.00 25.92 ? 111 ASP A N   1 
ATOM   816  C CA  . ASP A 1 111 ? 22.981 17.350  -2.741  1.00 26.03 ? 111 ASP A CA  1 
ATOM   817  C C   . ASP A 1 111 ? 21.651 17.229  -3.496  1.00 25.89 ? 111 ASP A C   1 
ATOM   818  O O   . ASP A 1 111 ? 20.956 18.224  -3.689  1.00 25.83 ? 111 ASP A O   1 
ATOM   819  C CB  . ASP A 1 111 ? 24.120 17.519  -3.753  1.00 26.40 ? 111 ASP A CB  1 
ATOM   820  C CG  . ASP A 1 111 ? 25.462 17.825  -3.095  1.00 27.39 ? 111 ASP A CG  1 
ATOM   821  O OD1 . ASP A 1 111 ? 25.484 18.281  -1.933  1.00 28.62 ? 111 ASP A OD1 1 
ATOM   822  O OD2 . ASP A 1 111 ? 26.499 17.607  -3.755  1.00 29.68 ? 111 ASP A OD2 1 
ATOM   823  N N   . VAL A 1 112 ? 21.306 16.014  -3.917  1.00 26.07 ? 112 VAL A N   1 
ATOM   824  C CA  . VAL A 1 112 ? 20.042 15.771  -4.627  1.00 26.07 ? 112 VAL A CA  1 
ATOM   825  C C   . VAL A 1 112 ? 18.817 16.151  -3.770  1.00 26.09 ? 112 VAL A C   1 
ATOM   826  O O   . VAL A 1 112 ? 17.813 16.642  -4.293  1.00 26.41 ? 112 VAL A O   1 
ATOM   827  C CB  . VAL A 1 112 ? 19.945 14.303  -5.144  1.00 26.18 ? 112 VAL A CB  1 
ATOM   828  C CG1 . VAL A 1 112 ? 19.857 13.305  -3.994  1.00 25.94 ? 112 VAL A CG1 1 
ATOM   829  C CG2 . VAL A 1 112 ? 18.758 14.143  -6.085  1.00 26.16 ? 112 VAL A CG2 1 
ATOM   830  N N   . GLY A 1 113 ? 18.916 15.959  -2.457  1.00 25.99 ? 113 GLY A N   1 
ATOM   831  C CA  . GLY A 1 113 ? 17.801 16.234  -1.542  1.00 25.76 ? 113 GLY A CA  1 
ATOM   832  C C   . GLY A 1 113 ? 17.593 17.702  -1.191  1.00 25.73 ? 113 GLY A C   1 
ATOM   833  O O   . GLY A 1 113 ? 16.455 18.151  -1.022  1.00 25.71 ? 113 GLY A O   1 
ATOM   834  N N   . CYS A 1 114 ? 18.687 18.453  -1.081  1.00 25.66 ? 114 CYS A N   1 
ATOM   835  C CA  A CYS A 1 114 ? 18.606 19.866  -0.711  0.50 25.40 ? 114 CYS A CA  1 
ATOM   836  C CA  B CYS A 1 114 ? 18.640 19.872  -0.726  0.50 25.40 ? 114 CYS A CA  1 
ATOM   837  C C   . CYS A 1 114 ? 18.011 20.726  -1.832  1.00 25.31 ? 114 CYS A C   1 
ATOM   838  O O   . CYS A 1 114 ? 17.183 21.605  -1.569  1.00 24.93 ? 114 CYS A O   1 
ATOM   839  C CB  A CYS A 1 114 ? 19.975 20.397  -0.272  0.50 25.65 ? 114 CYS A CB  1 
ATOM   840  C CB  B CYS A 1 114 ? 20.054 20.379  -0.419  0.50 25.65 ? 114 CYS A CB  1 
ATOM   841  S SG  A CYS A 1 114 ? 20.465 19.817  1.373   0.50 26.48 ? 114 CYS A SG  1 
ATOM   842  S SG  B CYS A 1 114 ? 20.168 22.154  -0.154  0.50 26.48 ? 114 CYS A SG  1 
ATOM   843  N N   . ASN A 1 115 ? 18.410 20.468  -3.075  1.00 24.71 ? 115 ASN A N   1 
ATOM   844  C CA  . ASN A 1 115 ? 17.850 21.189  -4.214  1.00 24.44 ? 115 ASN A CA  1 
ATOM   845  C C   . ASN A 1 115 ? 16.350 20.913  -4.388  1.00 23.73 ? 115 ASN A C   1 
ATOM   846  O O   . ASN A 1 115 ? 15.578 21.826  -4.677  1.00 23.61 ? 115 ASN A O   1 
ATOM   847  C CB  . ASN A 1 115 ? 18.615 20.850  -5.498  1.00 24.94 ? 115 ASN A CB  1 
ATOM   848  C CG  . ASN A 1 115 ? 20.006 21.465  -5.529  1.00 25.91 ? 115 ASN A CG  1 
ATOM   849  O OD1 . ASN A 1 115 ? 20.179 22.643  -5.222  1.00 29.17 ? 115 ASN A OD1 1 
ATOM   850  N ND2 . ASN A 1 115 ? 21.002 20.669  -5.906  1.00 28.03 ? 115 ASN A ND2 1 
ATOM   851  N N   . LEU A 1 116 ? 15.944 19.662  -4.188  1.00 23.04 ? 116 LEU A N   1 
ATOM   852  C CA  . LEU A 1 116 ? 14.532 19.282  -4.315  1.00 22.32 ? 116 LEU A CA  1 
ATOM   853  C C   . LEU A 1 116 ? 13.658 20.054  -3.332  1.00 21.57 ? 116 LEU A C   1 
ATOM   854  O O   . LEU A 1 116 ? 12.617 20.598  -3.719  1.00 20.54 ? 116 LEU A O   1 
ATOM   855  C CB  . LEU A 1 116 ? 14.355 17.772  -4.126  1.00 22.31 ? 116 LEU A CB  1 
ATOM   856  C CG  . LEU A 1 116 ? 12.923 17.235  -4.232  1.00 22.76 ? 116 LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 116 ? 12.409 17.383  -5.653  1.00 22.34 ? 116 LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 116 ? 12.847 15.778  -3.769  1.00 22.09 ? 116 LEU A CD2 1 
ATOM   859  N N   . PHE A 1 117 ? 14.080 20.127  -2.070  1.00 21.02 ? 117 PHE A N   1 
ATOM   860  C CA  . PHE A 1 117 ? 13.267 20.809  -1.067  1.00 21.04 ? 117 PHE A CA  1 
ATOM   861  C C   . PHE A 1 117 ? 13.196 22.316  -1.315  1.00 20.70 ? 117 PHE A C   1 
ATOM   862  O O   . PHE A 1 117 ? 12.189 22.942  -1.011  1.00 20.45 ? 117 PHE A O   1 
ATOM   863  C CB  . PHE A 1 117 ? 13.744 20.517  0.360   1.00 21.02 ? 117 PHE A CB  1 
ATOM   864  C CG  . PHE A 1 117 ? 12.767 20.961  1.413   1.00 21.47 ? 117 PHE A CG  1 
ATOM   865  C CD1 . PHE A 1 117 ? 11.600 20.235  1.645   1.00 21.14 ? 117 PHE A CD1 1 
ATOM   866  C CD2 . PHE A 1 117 ? 12.993 22.120  2.151   1.00 21.97 ? 117 PHE A CD2 1 
ATOM   867  C CE1 . PHE A 1 117 ? 10.686 20.646  2.610   1.00 21.40 ? 117 PHE A CE1 1 
ATOM   868  C CE2 . PHE A 1 117 ? 12.084 22.542  3.121   1.00 21.52 ? 117 PHE A CE2 1 
ATOM   869  C CZ  . PHE A 1 117 ? 10.929 21.802  3.355   1.00 21.27 ? 117 PHE A CZ  1 
ATOM   870  N N   . ALA A 1 118 ? 14.257 22.884  -1.882  1.00 20.70 ? 118 ALA A N   1 
ATOM   871  C CA  . ALA A 1 118 ? 14.293 24.305  -2.239  1.00 20.64 ? 118 ALA A CA  1 
ATOM   872  C C   . ALA A 1 118 ? 13.272 24.647  -3.334  1.00 20.46 ? 118 ALA A C   1 
ATOM   873  O O   . ALA A 1 118 ? 12.562 25.644  -3.229  1.00 20.31 ? 118 ALA A O   1 
ATOM   874  C CB  . ALA A 1 118 ? 15.699 24.702  -2.680  1.00 20.84 ? 118 ALA A CB  1 
ATOM   875  N N   . LYS A 1 119 ? 13.207 23.821  -4.375  1.00 20.52 ? 119 LYS A N   1 
ATOM   876  C CA  . LYS A 1 119 ? 12.228 24.012  -5.449  1.00 20.54 ? 119 LYS A CA  1 
ATOM   877  C C   . LYS A 1 119 ? 10.802 23.852  -4.936  1.00 20.15 ? 119 LYS A C   1 
ATOM   878  O O   . LYS A 1 119 ? 9.912  24.597  -5.341  1.00 19.93 ? 119 LYS A O   1 
ATOM   879  C CB  . LYS A 1 119 ? 12.454 23.032  -6.605  1.00 21.31 ? 119 LYS A CB  1 
ATOM   880  C CG  . LYS A 1 119 ? 13.824 23.075  -7.284  1.00 22.78 ? 119 LYS A CG  1 
ATOM   881  C CD  . LYS A 1 119 ? 14.378 24.467  -7.458  1.00 24.61 ? 119 LYS A CD  1 
ATOM   882  C CE  . LYS A 1 119 ? 15.742 24.406  -8.114  1.00 25.29 ? 119 LYS A CE  1 
ATOM   883  N NZ  . LYS A 1 119 ? 15.647 23.978  -9.533  1.00 26.41 ? 119 LYS A NZ  1 
ATOM   884  N N   . PHE A 1 120 ? 10.576 22.876  -4.057  1.00 19.70 ? 120 PHE A N   1 
ATOM   885  C CA  . PHE A 1 120 ? 9.264  22.729  -3.420  1.00 19.71 ? 120 PHE A CA  1 
ATOM   886  C C   . PHE A 1 120 ? 8.896  23.980  -2.629  1.00 19.44 ? 120 PHE A C   1 
ATOM   887  O O   . PHE A 1 120 ? 7.762  24.450  -2.694  1.00 18.96 ? 120 PHE A O   1 
ATOM   888  C CB  . PHE A 1 120 ? 9.211  21.520  -2.480  1.00 19.54 ? 120 PHE A CB  1 
ATOM   889  C CG  . PHE A 1 120 ? 8.157  21.651  -1.404  1.00 19.51 ? 120 PHE A CG  1 
ATOM   890  C CD1 . PHE A 1 120 ? 6.818  21.429  -1.691  1.00 19.61 ? 120 PHE A CD1 1 
ATOM   891  C CD2 . PHE A 1 120 ? 8.507  22.035  -0.117  1.00 19.16 ? 120 PHE A CD2 1 
ATOM   892  C CE1 . PHE A 1 120 ? 5.853  21.567  -0.706  1.00 19.43 ? 120 PHE A CE1 1 
ATOM   893  C CE2 . PHE A 1 120 ? 7.548  22.178  0.869   1.00 19.40 ? 120 PHE A CE2 1 
ATOM   894  C CZ  . PHE A 1 120 ? 6.220  21.942  0.577   1.00 19.14 ? 120 PHE A CZ  1 
ATOM   895  N N   . SER A 1 121 ? 9.861  24.503  -1.874  1.00 19.90 ? 121 SER A N   1 
ATOM   896  C CA  . SER A 1 121 ? 9.635  25.682  -1.035  1.00 20.17 ? 121 SER A CA  1 
ATOM   897  C C   . SER A 1 121 ? 9.248  26.904  -1.866  1.00 20.28 ? 121 SER A C   1 
ATOM   898  O O   . SER A 1 121 ? 8.320  27.623  -1.510  1.00 20.45 ? 121 SER A O   1 
ATOM   899  C CB  . SER A 1 121 ? 10.868 25.975  -0.178  1.00 20.10 ? 121 SER A CB  1 
ATOM   900  O OG  . SER A 1 121 ? 11.147 24.888  0.692   1.00 20.55 ? 121 SER A OG  1 
ATOM   901  N N   . ALA A 1 122 ? 9.941  27.121  -2.983  1.00 20.57 ? 122 ALA A N   1 
ATOM   902  C CA  . ALA A 1 122 ? 9.601  28.209  -3.909  1.00 20.63 ? 122 ALA A CA  1 
ATOM   903  C C   . ALA A 1 122 ? 8.183  28.043  -4.457  1.00 20.70 ? 122 ALA A C   1 
ATOM   904  O O   . ALA A 1 122 ? 7.411  28.992  -4.554  1.00 20.33 ? 122 ALA A O   1 
ATOM   905  C CB  . ALA A 1 122 ? 10.601 28.249  -5.052  1.00 20.66 ? 122 ALA A CB  1 
ATOM   906  N N   . TYR A 1 123 ? 7.865  26.801  -4.798  1.00 21.19 ? 123 TYR A N   1 
ATOM   907  C CA  . TYR A 1 123 ? 6.586  26.403  -5.362  1.00 21.15 ? 123 TYR A CA  1 
ATOM   908  C C   . TYR A 1 123 ? 5.423  26.622  -4.386  1.00 21.16 ? 123 TYR A C   1 
ATOM   909  O O   . TYR A 1 123 ? 4.398  27.214  -4.746  1.00 20.54 ? 123 TYR A O   1 
ATOM   910  C CB  . TYR A 1 123 ? 6.760  24.939  -5.790  1.00 21.91 ? 123 TYR A CB  1 
ATOM   911  C CG  . TYR A 1 123 ? 5.563  24.075  -6.038  1.00 22.26 ? 123 TYR A CG  1 
ATOM   912  C CD1 . TYR A 1 123 ? 4.936  24.065  -7.270  1.00 23.49 ? 123 TYR A CD1 1 
ATOM   913  C CD2 . TYR A 1 123 ? 5.141  23.161  -5.079  1.00 24.00 ? 123 TYR A CD2 1 
ATOM   914  C CE1 . TYR A 1 123 ? 3.879  23.218  -7.522  1.00 23.18 ? 123 TYR A CE1 1 
ATOM   915  C CE2 . TYR A 1 123 ? 4.082  22.321  -5.317  1.00 23.80 ? 123 TYR A CE2 1 
ATOM   916  C CZ  . TYR A 1 123 ? 3.455  22.358  -6.541  1.00 23.23 ? 123 TYR A CZ  1 
ATOM   917  O OH  . TYR A 1 123 ? 2.408  21.515  -6.787  1.00 24.20 ? 123 TYR A OH  1 
ATOM   918  N N   . ILE A 1 124 ? 5.603  26.182  -3.143  1.00 21.07 ? 124 ILE A N   1 
ATOM   919  C CA  . ILE A 1 124 ? 4.539  26.250  -2.138  1.00 21.58 ? 124 ILE A CA  1 
ATOM   920  C C   . ILE A 1 124 ? 4.338  27.686  -1.615  1.00 21.69 ? 124 ILE A C   1 
ATOM   921  O O   . ILE A 1 124 ? 3.252  28.034  -1.152  1.00 22.20 ? 124 ILE A O   1 
ATOM   922  C CB  . ILE A 1 124 ? 4.814  25.258  -0.967  1.00 21.14 ? 124 ILE A CB  1 
ATOM   923  C CG1 . ILE A 1 124 ? 3.506  24.811  -0.306  1.00 22.30 ? 124 ILE A CG1 1 
ATOM   924  C CG2 . ILE A 1 124 ? 5.780  25.858  0.043   1.00 20.52 ? 124 ILE A CG2 1 
ATOM   925  C CD1 . ILE A 1 124 ? 2.771  23.725  -1.078  1.00 22.93 ? 124 ILE A CD1 1 
ATOM   926  N N   . LYS A 1 125 ? 5.375  28.515  -1.715  1.00 22.19 ? 125 LYS A N   1 
ATOM   927  C CA  . LYS A 1 125 ? 5.308  29.918  -1.288  1.00 22.58 ? 125 LYS A CA  1 
ATOM   928  C C   . LYS A 1 125 ? 4.942  30.895  -2.421  1.00 22.82 ? 125 LYS A C   1 
ATOM   929  O O   . LYS A 1 125 ? 4.675  32.070  -2.156  1.00 23.09 ? 125 LYS A O   1 
ATOM   930  C CB  . LYS A 1 125 ? 6.637  30.345  -0.651  1.00 22.79 ? 125 LYS A CB  1 
ATOM   931  C CG  . LYS A 1 125 ? 7.015  29.554  0.599   1.00 23.19 ? 125 LYS A CG  1 
ATOM   932  C CD  . LYS A 1 125 ? 8.453  29.835  1.031   1.00 23.30 ? 125 LYS A CD  1 
ATOM   933  C CE  . LYS A 1 125 ? 8.964  28.814  2.057   1.00 23.72 ? 125 LYS A CE  1 
ATOM   934  N NZ  . LYS A 1 125 ? 10.455 28.900  2.271   1.00 23.08 ? 125 LYS A NZ  1 
ATOM   935  N N   . ASN A 1 126 ? 4.924  30.421  -3.666  1.00 22.69 ? 126 ASN A N   1 
ATOM   936  C CA  . ASN A 1 126 ? 4.522  31.256  -4.806  1.00 22.98 ? 126 ASN A CA  1 
ATOM   937  C C   . ASN A 1 126 ? 3.083  31.753  -4.667  1.00 23.08 ? 126 ASN A C   1 
ATOM   938  O O   . ASN A 1 126 ? 2.143  30.956  -4.681  1.00 22.98 ? 126 ASN A O   1 
ATOM   939  C CB  . ASN A 1 126 ? 4.666  30.487  -6.125  1.00 22.62 ? 126 ASN A CB  1 
ATOM   940  C CG  . ASN A 1 126 ? 3.926  31.157  -7.281  1.00 22.54 ? 126 ASN A CG  1 
ATOM   941  O OD1 . ASN A 1 126 ? 3.142  30.517  -7.979  1.00 22.70 ? 126 ASN A OD1 1 
ATOM   942  N ND2 . ASN A 1 126 ? 4.170  32.452  -7.478  1.00 19.47 ? 126 ASN A ND2 1 
ATOM   943  N N   . THR A 1 127 ? 2.925  33.072  -4.556  1.00 23.71 ? 127 THR A N   1 
ATOM   944  C CA  . THR A 1 127 ? 1.613  33.693  -4.343  1.00 23.99 ? 127 THR A CA  1 
ATOM   945  C C   . THR A 1 127 ? 0.821  33.944  -5.628  1.00 24.05 ? 127 THR A C   1 
ATOM   946  O O   . THR A 1 127 ? -0.353 34.300  -5.561  1.00 23.76 ? 127 THR A O   1 
ATOM   947  C CB  . THR A 1 127 ? 1.746  35.049  -3.601  1.00 24.05 ? 127 THR A CB  1 
ATOM   948  O OG1 . THR A 1 127 ? 2.670  35.893  -4.300  1.00 24.92 ? 127 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 127 ? 2.235  34.842  -2.177  1.00 24.62 ? 127 THR A CG2 1 
ATOM   950  N N   . GLN A 1 128 ? 1.454  33.768  -6.788  1.00 24.12 ? 128 GLN A N   1 
ATOM   951  C CA  . GLN A 1 128 ? 0.822  34.077  -8.076  1.00 24.33 ? 128 GLN A CA  1 
ATOM   952  C C   . GLN A 1 128 ? 0.386  32.797  -8.778  1.00 24.24 ? 128 GLN A C   1 
ATOM   953  O O   . GLN A 1 128 ? 1.221  32.086  -9.340  1.00 23.55 ? 128 GLN A O   1 
ATOM   954  C CB  . GLN A 1 128 ? 1.793  34.843  -8.990  1.00 24.55 ? 128 GLN A CB  1 
ATOM   955  C CG  . GLN A 1 128 ? 2.557  35.976  -8.320  1.00 26.55 ? 128 GLN A CG  1 
ATOM   956  C CD  . GLN A 1 128 ? 1.669  37.125  -7.914  1.00 28.38 ? 128 GLN A CD  1 
ATOM   957  O OE1 . GLN A 1 128 ? 1.632  37.514  -6.744  1.00 31.94 ? 128 GLN A OE1 1 
ATOM   958  N NE2 . GLN A 1 128 ? 0.949  37.683  -8.878  1.00 30.27 ? 128 GLN A NE2 1 
ATOM   959  N N   . LYS A 1 129 ? -0.915 32.506  -8.771  1.00 24.30 ? 129 LYS A N   1 
ATOM   960  C CA  . LYS A 1 129 ? -1.417 31.300  -9.443  1.00 24.33 ? 129 LYS A CA  1 
ATOM   961  C C   . LYS A 1 129 ? -0.977 31.223  -10.907 1.00 24.00 ? 129 LYS A C   1 
ATOM   962  O O   . LYS A 1 129 ? -0.782 30.131  -11.438 1.00 23.64 ? 129 LYS A O   1 
ATOM   963  C CB  . LYS A 1 129 ? -2.944 31.204  -9.371  1.00 24.61 ? 129 LYS A CB  1 
ATOM   964  C CG  . LYS A 1 129 ? -3.500 29.818  -9.679  1.00 24.96 ? 129 LYS A CG  1 
ATOM   965  C CD  . LYS A 1 129 ? -5.032 29.801  -9.688  1.00 25.80 ? 129 LYS A CD  1 
ATOM   966  C CE  . LYS A 1 129 ? -5.589 28.502  -10.268 1.00 27.19 ? 129 LYS A CE  1 
ATOM   967  N NZ  . LYS A 1 129 ? -5.327 27.316  -9.389  1.00 28.70 ? 129 LYS A NZ  1 
ATOM   968  N N   . GLU A 1 130 ? -0.822 32.371  -11.562 1.00 23.97 ? 130 GLU A N   1 
ATOM   969  C CA  . GLU A 1 130 ? -0.385 32.387  -12.963 1.00 24.16 ? 130 GLU A CA  1 
ATOM   970  C C   . GLU A 1 130 ? 1.046  31.871  -13.171 1.00 23.54 ? 130 GLU A C   1 
ATOM   971  O O   . GLU A 1 130 ? 1.389  31.457  -14.275 1.00 23.38 ? 130 GLU A O   1 
ATOM   972  C CB  . GLU A 1 130 ? -0.528 33.786  -13.558 1.00 24.38 ? 130 GLU A CB  1 
ATOM   973  C CG  . GLU A 1 130 ? -1.973 34.189  -13.763 1.00 25.49 ? 130 GLU A CG  1 
ATOM   974  C CD  . GLU A 1 130 ? -2.106 35.512  -14.474 1.00 26.27 ? 130 GLU A CD  1 
ATOM   975  O OE1 . GLU A 1 130 ? -1.899 36.560  -13.820 1.00 28.98 ? 130 GLU A OE1 1 
ATOM   976  O OE2 . GLU A 1 130 ? -2.422 35.498  -15.682 1.00 29.65 ? 130 GLU A OE2 1 
ATOM   977  N N   . ALA A 1 131 ? 1.869  31.904  -12.121 1.00 23.20 ? 131 ALA A N   1 
ATOM   978  C CA  . ALA A 1 131 ? 3.229  31.352  -12.169 1.00 23.13 ? 131 ALA A CA  1 
ATOM   979  C C   . ALA A 1 131 ? 3.296  29.861  -11.795 1.00 22.97 ? 131 ALA A C   1 
ATOM   980  O O   . ALA A 1 131 ? 4.374  29.264  -11.843 1.00 22.74 ? 131 ALA A O   1 
ATOM   981  C CB  . ALA A 1 131 ? 4.155  32.159  -11.257 1.00 23.15 ? 131 ALA A CB  1 
ATOM   982  N N   . ASN A 1 132 ? 2.161  29.255  -11.441 1.00 22.64 ? 132 ASN A N   1 
ATOM   983  C CA  . ASN A 1 132 ? 2.151  27.857  -10.986 1.00 22.79 ? 132 ASN A CA  1 
ATOM   984  C C   . ASN A 1 132 ? 2.798  26.873  -11.961 1.00 22.81 ? 132 ASN A C   1 
ATOM   985  O O   . ASN A 1 132 ? 3.529  25.981  -11.538 1.00 22.43 ? 132 ASN A O   1 
ATOM   986  C CB  . ASN A 1 132 ? 0.726  27.386  -10.660 1.00 22.85 ? 132 ASN A CB  1 
ATOM   987  C CG  . ASN A 1 132 ? 0.249  27.859  -9.301  1.00 22.77 ? 132 ASN A CG  1 
ATOM   988  O OD1 . ASN A 1 132 ? -0.893 27.599  -8.905  1.00 24.68 ? 132 ASN A OD1 1 
ATOM   989  N ND2 . ASN A 1 132 ? 1.122  28.533  -8.570  1.00 21.18 ? 132 ASN A ND2 1 
ATOM   990  N N   . LYS A 1 133 ? 2.529  27.029  -13.255 1.00 23.06 ? 133 LYS A N   1 
ATOM   991  C CA  . LYS A 1 133 ? 3.070  26.100  -14.244 1.00 22.99 ? 133 LYS A CA  1 
ATOM   992  C C   . LYS A 1 133 ? 4.592  26.013  -14.171 1.00 22.66 ? 133 LYS A C   1 
ATOM   993  O O   . LYS A 1 133 ? 5.150  24.914  -14.188 1.00 22.89 ? 133 LYS A O   1 
ATOM   994  C CB  . LYS A 1 133 ? 2.643  26.488  -15.657 1.00 23.48 ? 133 LYS A CB  1 
ATOM   995  C CG  . LYS A 1 133 ? 2.976  25.446  -16.715 1.00 24.90 ? 133 LYS A CG  1 
ATOM   996  C CD  . LYS A 1 133 ? 1.938  24.317  -16.791 1.00 27.49 ? 133 LYS A CD  1 
ATOM   997  C CE  . LYS A 1 133 ? 2.201  23.186  -15.795 1.00 28.40 ? 133 LYS A CE  1 
ATOM   998  N NZ  . LYS A 1 133 ? 1.678  21.883  -16.319 1.00 29.09 ? 133 LYS A NZ  1 
ATOM   999  N N   . ASN A 1 134 ? 5.258  27.164  -14.086 1.00 22.26 ? 134 ASN A N   1 
ATOM   1000 C CA  . ASN A 1 134 ? 6.717  27.200  -14.057 1.00 22.10 ? 134 ASN A CA  1 
ATOM   1001 C C   . ASN A 1 134 ? 7.287  26.605  -12.775 1.00 21.61 ? 134 ASN A C   1 
ATOM   1002 O O   . ASN A 1 134 ? 8.243  25.832  -12.816 1.00 20.67 ? 134 ASN A O   1 
ATOM   1003 C CB  . ASN A 1 134 ? 7.236  28.630  -14.248 1.00 22.27 ? 134 ASN A CB  1 
ATOM   1004 C CG  . ASN A 1 134 ? 7.087  29.126  -15.685 1.00 23.54 ? 134 ASN A CG  1 
ATOM   1005 O OD1 . ASN A 1 134 ? 6.759  28.362  -16.603 1.00 25.61 ? 134 ASN A OD1 1 
ATOM   1006 N ND2 . ASN A 1 134 ? 7.342  30.412  -15.885 1.00 24.92 ? 134 ASN A ND2 1 
ATOM   1007 N N   . PHE A 1 135 ? 6.703  26.973  -11.637 1.00 21.21 ? 135 PHE A N   1 
ATOM   1008 C CA  . PHE A 1 135 ? 7.136  26.413  -10.352 1.00 21.38 ? 135 PHE A CA  1 
ATOM   1009 C C   . PHE A 1 135 ? 6.915  24.900  -10.292 1.00 21.14 ? 135 PHE A C   1 
ATOM   1010 O O   . PHE A 1 135 ? 7.752  24.174  -9.756  1.00 20.81 ? 135 PHE A O   1 
ATOM   1011 C CB  . PHE A 1 135 ? 6.429  27.114  -9.186  1.00 21.66 ? 135 PHE A CB  1 
ATOM   1012 C CG  . PHE A 1 135 ? 6.987  28.473  -8.884  1.00 21.58 ? 135 PHE A CG  1 
ATOM   1013 C CD1 . PHE A 1 135 ? 6.309  29.620  -9.258  1.00 22.48 ? 135 PHE A CD1 1 
ATOM   1014 C CD2 . PHE A 1 135 ? 8.219  28.604  -8.250  1.00 22.78 ? 135 PHE A CD2 1 
ATOM   1015 C CE1 . PHE A 1 135 ? 6.835  30.874  -8.992  1.00 22.31 ? 135 PHE A CE1 1 
ATOM   1016 C CE2 . PHE A 1 135 ? 8.751  29.859  -7.981  1.00 22.83 ? 135 PHE A CE2 1 
ATOM   1017 C CZ  . PHE A 1 135 ? 8.059  30.992  -8.350  1.00 22.21 ? 135 PHE A CZ  1 
ATOM   1018 N N   . GLU A 1 136 ? 5.802  24.433  -10.850 1.00 21.27 ? 136 GLU A N   1 
ATOM   1019 C CA  . GLU A 1 136 ? 5.504  23.000  -10.904 1.00 21.50 ? 136 GLU A CA  1 
ATOM   1020 C C   . GLU A 1 136 ? 6.501  22.261  -11.792 1.00 21.20 ? 136 GLU A C   1 
ATOM   1021 O O   . GLU A 1 136 ? 6.996  21.190  -11.436 1.00 20.78 ? 136 GLU A O   1 
ATOM   1022 C CB  . GLU A 1 136 ? 4.091  22.757  -11.436 1.00 21.71 ? 136 GLU A CB  1 
ATOM   1023 C CG  . GLU A 1 136 ? 3.719  21.274  -11.509 1.00 22.41 ? 136 GLU A CG  1 
ATOM   1024 C CD  . GLU A 1 136 ? 2.266  21.049  -11.882 1.00 23.47 ? 136 GLU A CD  1 
ATOM   1025 O OE1 . GLU A 1 136 ? 1.823  21.571  -12.929 1.00 27.12 ? 136 GLU A OE1 1 
ATOM   1026 O OE2 . GLU A 1 136 ? 1.571  20.340  -11.128 1.00 27.59 ? 136 GLU A OE2 1 
ATOM   1027 N N   . LYS A 1 137 ? 6.766  22.826  -12.967 1.00 20.82 ? 137 LYS A N   1 
ATOM   1028 C CA  . LYS A 1 137 ? 7.768  22.272  -13.868 1.00 20.84 ? 137 LYS A CA  1 
ATOM   1029 C C   . LYS A 1 137 ? 9.130  22.209  -13.189 1.00 20.21 ? 137 LYS A C   1 
ATOM   1030 O O   . LYS A 1 137 ? 9.844  21.218  -13.318 1.00 19.91 ? 137 LYS A O   1 
ATOM   1031 C CB  . LYS A 1 137 ? 7.847  23.088  -15.156 1.00 20.85 ? 137 LYS A CB  1 
ATOM   1032 C CG  . LYS A 1 137 ? 6.748  22.754  -16.133 1.00 21.29 ? 137 LYS A CG  1 
ATOM   1033 C CD  . LYS A 1 137 ? 6.885  23.579  -17.407 1.00 22.04 ? 137 LYS A CD  1 
ATOM   1034 C CE  . LYS A 1 137 ? 5.709  23.340  -18.337 1.00 22.55 ? 137 LYS A CE  1 
ATOM   1035 N NZ  . LYS A 1 137 ? 5.794  24.154  -19.580 0.01 22.03 ? 137 LYS A NZ  1 
ATOM   1036 N N   . SER A 1 138 ? 9.471  23.263  -12.453 1.00 19.63 ? 138 SER A N   1 
ATOM   1037 C CA  . SER A 1 138 ? 10.724 23.311  -11.710 1.00 19.52 ? 138 SER A CA  1 
ATOM   1038 C C   . SER A 1 138 ? 10.802 22.159  -10.698 1.00 18.95 ? 138 SER A C   1 
ATOM   1039 O O   . SER A 1 138 ? 11.811 21.465  -10.623 1.00 18.59 ? 138 SER A O   1 
ATOM   1040 C CB  . SER A 1 138 ? 10.874 24.659  -11.004 1.00 19.38 ? 138 SER A CB  1 
ATOM   1041 O OG  . SER A 1 138 ? 12.071 24.711  -10.247 1.00 21.46 ? 138 SER A OG  1 
ATOM   1042 N N   . LEU A 1 139 ? 9.728  21.964  -9.935  1.00 18.45 ? 139 LEU A N   1 
ATOM   1043 C CA  . LEU A 1 139 ? 9.667  20.888  -8.943  1.00 18.18 ? 139 LEU A CA  1 
ATOM   1044 C C   . LEU A 1 139 ? 9.788  19.513  -9.602  1.00 17.94 ? 139 LEU A C   1 
ATOM   1045 O O   . LEU A 1 139 ? 10.552 18.661  -9.137  1.00 17.32 ? 139 LEU A O   1 
ATOM   1046 C CB  . LEU A 1 139 ? 8.359  20.965  -8.149  1.00 17.95 ? 139 LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 139 ? 8.155  19.910  -7.057  1.00 17.62 ? 139 LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 139 ? 9.417  19.724  -6.219  1.00 16.62 ? 139 LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 139 ? 6.968  20.278  -6.166  1.00 17.71 ? 139 LEU A CD2 1 
ATOM   1050 N N   . LEU A 1 140 ? 9.023  19.313  -10.675 1.00 17.98 ? 140 LEU A N   1 
ATOM   1051 C CA  . LEU A 1 140 ? 9.058  18.078  -11.457 1.00 18.28 ? 140 LEU A CA  1 
ATOM   1052 C C   . LEU A 1 140 ? 10.454 17.780  -12.004 1.00 18.54 ? 140 LEU A C   1 
ATOM   1053 O O   . LEU A 1 140 ? 10.880 16.627  -12.010 1.00 18.42 ? 140 LEU A O   1 
ATOM   1054 C CB  . LEU A 1 140 ? 8.065  18.148  -12.626 1.00 18.43 ? 140 LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 140 ? 6.586  17.918  -12.311 1.00 19.30 ? 140 LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 140 ? 5.740  18.233  -13.543 1.00 20.52 ? 140 LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 140 ? 6.341  16.493  -11.832 1.00 20.64 ? 140 LEU A CD2 1 
ATOM   1058 N N   . LYS A 1 141 ? 11.151 18.821  -12.464 1.00 18.81 ? 141 LYS A N   1 
ATOM   1059 C CA  . LYS A 1 141 ? 12.496 18.665  -13.015 1.00 18.69 ? 141 LYS A CA  1 
ATOM   1060 C C   . LYS A 1 141 ? 13.460 18.161  -11.933 1.00 18.57 ? 141 LYS A C   1 
ATOM   1061 O O   . LYS A 1 141 ? 14.282 17.274  -12.181 1.00 18.02 ? 141 LYS A O   1 
ATOM   1062 C CB  . LYS A 1 141 ? 12.982 19.982  -13.636 1.00 19.09 ? 141 LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 141 ? 14.278 19.861  -14.451 1.00 20.09 ? 141 LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 141 ? 14.091 19.074  -15.754 1.00 21.16 ? 141 LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 141 ? 13.411 19.907  -16.831 1.00 21.98 ? 141 LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 141 ? 13.085 19.124  -18.048 1.00 22.59 ? 141 LYS A NZ  1 
ATOM   1067 N N   . GLU A 1 142 ? 13.340 18.708  -10.727 1.00 18.33 ? 142 GLU A N   1 
ATOM   1068 C CA  . GLU A 1 142 ? 14.172 18.255  -9.615  1.00 18.35 ? 142 GLU A CA  1 
ATOM   1069 C C   . GLU A 1 142 ? 13.801 16.837  -9.158  1.00 17.83 ? 142 GLU A C   1 
ATOM   1070 O O   . GLU A 1 142 ? 14.687 16.057  -8.799  1.00 17.22 ? 142 GLU A O   1 
ATOM   1071 C CB  . GLU A 1 142 ? 14.114 19.240  -8.444  1.00 18.96 ? 142 GLU A CB  1 
ATOM   1072 C CG  . GLU A 1 142 ? 15.418 19.341  -7.669  1.00 21.21 ? 142 GLU A CG  1 
ATOM   1073 C CD  . GLU A 1 142 ? 16.570 19.871  -8.502  1.00 23.62 ? 142 GLU A CD  1 
ATOM   1074 O OE1 . GLU A 1 142 ? 17.694 19.363  -8.338  1.00 26.52 ? 142 GLU A OE1 1 
ATOM   1075 O OE2 . GLU A 1 142 ? 16.353 20.789  -9.316  1.00 25.59 ? 142 GLU A OE2 1 
ATOM   1076 N N   . PHE A 1 143 ? 12.510 16.496  -9.176  1.00 17.24 ? 143 PHE A N   1 
ATOM   1077 C CA  . PHE A 1 143 ? 12.096 15.104  -8.934  1.00 17.31 ? 143 PHE A CA  1 
ATOM   1078 C C   . PHE A 1 143 ? 12.690 14.157  -9.976  1.00 17.19 ? 143 PHE A C   1 
ATOM   1079 O O   . PHE A 1 143 ? 13.097 13.043  -9.640  1.00 17.08 ? 143 PHE A O   1 
ATOM   1080 C CB  . PHE A 1 143 ? 10.566 14.945  -8.888  1.00 16.98 ? 143 PHE A CB  1 
ATOM   1081 C CG  . PHE A 1 143 ? 9.988  15.047  -7.494  1.00 17.40 ? 143 PHE A CG  1 
ATOM   1082 C CD1 . PHE A 1 143 ? 9.188  16.119  -7.129  1.00 16.67 ? 143 PHE A CD1 1 
ATOM   1083 C CD2 . PHE A 1 143 ? 10.260 14.067  -6.547  1.00 16.99 ? 143 PHE A CD2 1 
ATOM   1084 C CE1 . PHE A 1 143 ? 8.662  16.209  -5.841  1.00 16.33 ? 143 PHE A CE1 1 
ATOM   1085 C CE2 . PHE A 1 143 ? 9.744  14.153  -5.261  1.00 17.35 ? 143 PHE A CE2 1 
ATOM   1086 C CZ  . PHE A 1 143 ? 8.938  15.223  -4.912  1.00 16.93 ? 143 PHE A CZ  1 
ATOM   1087 N N   . LYS A 1 144 ? 12.752 14.599  -11.230 1.00 17.29 ? 144 LYS A N   1 
ATOM   1088 C CA  . LYS A 1 144 ? 13.405 13.801  -12.276 1.00 17.20 ? 144 LYS A CA  1 
ATOM   1089 C C   . LYS A 1 144 ? 14.895 13.607  -11.986 1.00 16.94 ? 144 LYS A C   1 
ATOM   1090 O O   . LYS A 1 144 ? 15.437 12.524  -12.225 1.00 16.39 ? 144 LYS A O   1 
ATOM   1091 C CB  . LYS A 1 144 ? 13.204 14.421  -13.664 1.00 17.76 ? 144 LYS A CB  1 
ATOM   1092 C CG  . LYS A 1 144 ? 13.775 13.582  -14.823 1.00 18.42 ? 144 LYS A CG  1 
ATOM   1093 C CD  . LYS A 1 144 ? 13.054 12.250  -14.995 1.00 20.28 ? 144 LYS A CD  1 
ATOM   1094 C CE  . LYS A 1 144 ? 13.662 11.424  -16.119 1.00 21.52 ? 144 LYS A CE  1 
ATOM   1095 N NZ  . LYS A 1 144 ? 13.416 12.034  -17.445 1.00 24.69 ? 144 LYS A NZ  1 
ATOM   1096 N N   . ARG A 1 145 ? 15.555 14.646  -11.475 1.00 16.55 ? 145 ARG A N   1 
ATOM   1097 C CA  . ARG A 1 145 ? 16.951 14.522  -11.055 1.00 16.99 ? 145 ARG A CA  1 
ATOM   1098 C C   . ARG A 1 145 ? 17.094 13.446  -9.982  1.00 16.32 ? 145 ARG A C   1 
ATOM   1099 O O   . ARG A 1 145 ? 17.989 12.605  -10.057 1.00 15.25 ? 145 ARG A O   1 
ATOM   1100 C CB  . ARG A 1 145 ? 17.507 15.853  -10.545 1.00 17.24 ? 145 ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 145 ? 17.742 16.872  -11.641 1.00 18.50 ? 145 ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 145 ? 18.769 17.923  -11.225 1.00 20.15 ? 145 ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 145 ? 20.126 17.379  -11.162 1.00 22.46 ? 145 ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 145 ? 20.905 17.143  -12.216 1.00 23.99 ? 145 ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 145 ? 20.484 17.398  -13.451 1.00 26.06 ? 145 ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 145 ? 22.120 16.646  -12.034 1.00 24.32 ? 145 ARG A NH2 1 
ATOM   1107 N N   . LEU A 1 146 ? 16.192 13.460  -9.001  1.00 15.58 ? 146 LEU A N   1 
ATOM   1108 C CA  . LEU A 1 146 ? 16.219 12.457  -7.942  1.00 15.60 ? 146 LEU A CA  1 
ATOM   1109 C C   . LEU A 1 146 ? 15.934 11.071  -8.512  1.00 15.51 ? 146 LEU A C   1 
ATOM   1110 O O   . LEU A 1 146 ? 16.623 10.113  -8.177  1.00 15.60 ? 146 LEU A O   1 
ATOM   1111 C CB  . LEU A 1 146 ? 15.209 12.803  -6.841  1.00 15.18 ? 146 LEU A CB  1 
ATOM   1112 C CG  . LEU A 1 146 ? 15.082 11.822  -5.678  1.00 14.91 ? 146 LEU A CG  1 
ATOM   1113 C CD1 . LEU A 1 146 ? 16.432 11.595  -4.984  1.00 13.93 ? 146 LEU A CD1 1 
ATOM   1114 C CD2 . LEU A 1 146 ? 14.035 12.336  -4.686  1.00 14.59 ? 146 LEU A CD2 1 
ATOM   1115 N N   . ASP A 1 147 ? 14.913 10.979  -9.364  1.00 15.74 ? 147 ASP A N   1 
ATOM   1116 C CA  . ASP A 1 147 ? 14.582 9.736   -10.065 1.00 15.86 ? 147 ASP A CA  1 
ATOM   1117 C C   . ASP A 1 147 ? 15.808 9.176   -10.782 1.00 15.83 ? 147 ASP A C   1 
ATOM   1118 O O   . ASP A 1 147 ? 16.127 7.991   -10.640 1.00 15.64 ? 147 ASP A O   1 
ATOM   1119 C CB  . ASP A 1 147 ? 13.445 9.970   -11.073 1.00 15.88 ? 147 ASP A CB  1 
ATOM   1120 C CG  . ASP A 1 147 ? 12.749 8.679   -11.490 1.00 16.28 ? 147 ASP A CG  1 
ATOM   1121 O OD1 . ASP A 1 147 ? 12.634 8.413   -12.712 1.00 17.71 ? 147 ASP A OD1 1 
ATOM   1122 O OD2 . ASP A 1 147 ? 12.305 7.932   -10.599 1.00 15.60 ? 147 ASP A OD2 1 
ATOM   1123 N N   . ASP A 1 148 ? 16.491 10.029  -11.547 1.00 15.93 ? 148 ASP A N   1 
ATOM   1124 C CA  . ASP A 1 148 ? 17.706 9.625   -12.261 1.00 16.20 ? 148 ASP A CA  1 
ATOM   1125 C C   . ASP A 1 148 ? 18.782 9.136   -11.296 1.00 16.21 ? 148 ASP A C   1 
ATOM   1126 O O   . ASP A 1 148 ? 19.398 8.094   -11.526 1.00 15.84 ? 148 ASP A O   1 
ATOM   1127 C CB  . ASP A 1 148 ? 18.259 10.773  -13.108 1.00 16.41 ? 148 ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 148 ? 17.408 11.071  -14.326 1.00 16.74 ? 148 ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 148 ? 16.460 10.309  -14.617 1.00 18.54 ? 148 ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 148 ? 17.691 12.084  -14.996 1.00 19.39 ? 148 ASP A OD2 1 
ATOM   1131 N N   . TYR A 1 149 ? 19.009 9.891   -10.220 1.00 16.62 ? 149 TYR A N   1 
ATOM   1132 C CA  . TYR A 1 149 ? 19.982 9.491   -9.205  1.00 16.70 ? 149 TYR A CA  1 
ATOM   1133 C C   . TYR A 1 149 ? 19.685 8.108   -8.633  1.00 16.78 ? 149 TYR A C   1 
ATOM   1134 O O   . TYR A 1 149 ? 20.591 7.291   -8.490  1.00 16.89 ? 149 TYR A O   1 
ATOM   1135 C CB  . TYR A 1 149 ? 20.036 10.496  -8.059  1.00 17.22 ? 149 TYR A CB  1 
ATOM   1136 C CG  . TYR A 1 149 ? 21.189 10.245  -7.110  1.00 16.74 ? 149 TYR A CG  1 
ATOM   1137 C CD1 . TYR A 1 149 ? 22.498 10.549  -7.484  1.00 18.05 ? 149 TYR A CD1 1 
ATOM   1138 C CD2 . TYR A 1 149 ? 20.979 9.709   -5.849  1.00 17.78 ? 149 TYR A CD2 1 
ATOM   1139 C CE1 . TYR A 1 149 ? 23.565 10.326  -6.624  1.00 17.89 ? 149 TYR A CE1 1 
ATOM   1140 C CE2 . TYR A 1 149 ? 22.040 9.480   -4.973  1.00 17.17 ? 149 TYR A CE2 1 
ATOM   1141 C CZ  . TYR A 1 149 ? 23.336 9.790   -5.374  1.00 18.17 ? 149 TYR A CZ  1 
ATOM   1142 O OH  . TYR A 1 149 ? 24.398 9.581   -4.531  1.00 17.37 ? 149 TYR A OH  1 
ATOM   1143 N N   . LEU A 1 150 ? 18.422 7.858   -8.305  1.00 16.57 ? 150 LEU A N   1 
ATOM   1144 C CA  . LEU A 1 150 ? 18.001 6.572   -7.736  1.00 17.02 ? 150 LEU A CA  1 
ATOM   1145 C C   . LEU A 1 150 ? 17.996 5.408   -8.734  1.00 17.39 ? 150 LEU A C   1 
ATOM   1146 O O   . LEU A 1 150 ? 18.107 4.258   -8.332  1.00 18.05 ? 150 LEU A O   1 
ATOM   1147 C CB  . LEU A 1 150 ? 16.614 6.706   -7.108  1.00 16.66 ? 150 LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 150 ? 16.588 7.473   -5.784  1.00 16.09 ? 150 LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 150 ? 15.160 7.884   -5.425  1.00 15.11 ? 150 LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 150 ? 17.223 6.636   -4.663  1.00 15.26 ? 150 LEU A CD2 1 
ATOM   1151 N N   . ASN A 1 151 ? 17.830 5.702   -10.020 1.00 17.96 ? 151 ASN A N   1 
ATOM   1152 C CA  . ASN A 1 151 ? 17.855 4.669   -11.066 1.00 18.21 ? 151 ASN A CA  1 
ATOM   1153 C C   . ASN A 1 151 ? 19.239 4.411   -11.660 1.00 18.51 ? 151 ASN A C   1 
ATOM   1154 O O   . ASN A 1 151 ? 19.436 3.411   -12.364 1.00 18.67 ? 151 ASN A O   1 
ATOM   1155 C CB  . ASN A 1 151 ? 16.875 5.035   -12.189 1.00 18.25 ? 151 ASN A CB  1 
ATOM   1156 C CG  . ASN A 1 151 ? 15.436 4.756   -11.817 1.00 18.26 ? 151 ASN A CG  1 
ATOM   1157 O OD1 . ASN A 1 151 ? 15.157 3.964   -10.923 1.00 19.34 ? 151 ASN A OD1 1 
ATOM   1158 N ND2 . ASN A 1 151 ? 14.510 5.404   -12.510 1.00 20.03 ? 151 ASN A ND2 1 
ATOM   1159 N N   . THR A 1 152 ? 20.186 5.303   -11.386 1.00 18.60 ? 152 THR A N   1 
ATOM   1160 C CA  . THR A 1 152 ? 21.547 5.183   -11.901 1.00 19.11 ? 152 THR A CA  1 
ATOM   1161 C C   . THR A 1 152 ? 22.415 4.470   -10.871 1.00 19.31 ? 152 THR A C   1 
ATOM   1162 O O   . THR A 1 152 ? 22.515 4.917   -9.733  1.00 19.03 ? 152 THR A O   1 
ATOM   1163 C CB  . THR A 1 152 ? 22.139 6.563   -12.228 1.00 19.19 ? 152 THR A CB  1 
ATOM   1164 O OG1 . THR A 1 152 ? 21.359 7.168   -13.267 1.00 19.22 ? 152 THR A OG1 1 
ATOM   1165 C CG2 . THR A 1 152 ? 23.585 6.438   -12.692 1.00 19.02 ? 152 THR A CG2 1 
ATOM   1166 N N   . PRO A 1 153 ? 23.033 3.341   -11.256 1.00 19.98 ? 153 PRO A N   1 
ATOM   1167 C CA  . PRO A 1 153 ? 23.838 2.635   -10.266 1.00 20.28 ? 153 PRO A CA  1 
ATOM   1168 C C   . PRO A 1 153 ? 24.997 3.479   -9.763  1.00 20.53 ? 153 PRO A C   1 
ATOM   1169 O O   . PRO A 1 153 ? 25.618 4.213   -10.532 1.00 20.38 ? 153 PRO A O   1 
ATOM   1170 C CB  . PRO A 1 153 ? 24.350 1.407   -11.029 1.00 20.56 ? 153 PRO A CB  1 
ATOM   1171 C CG  . PRO A 1 153 ? 23.451 1.274   -12.193 1.00 20.20 ? 153 PRO A CG  1 
ATOM   1172 C CD  . PRO A 1 153 ? 23.047 2.654   -12.558 1.00 20.24 ? 153 PRO A CD  1 
ATOM   1173 N N   . LEU A 1 154 ? 25.263 3.384   -8.468  1.00 20.84 ? 154 LEU A N   1 
ATOM   1174 C CA  . LEU A 1 154 ? 26.420 4.025   -7.874  1.00 21.38 ? 154 LEU A CA  1 
ATOM   1175 C C   . LEU A 1 154 ? 27.696 3.302   -8.313  1.00 21.88 ? 154 LEU A C   1 
ATOM   1176 O O   . LEU A 1 154 ? 27.645 2.179   -8.821  1.00 20.96 ? 154 LEU A O   1 
ATOM   1177 C CB  . LEU A 1 154 ? 26.289 4.057   -6.352  1.00 21.44 ? 154 LEU A CB  1 
ATOM   1178 C CG  . LEU A 1 154 ? 25.085 4.858   -5.827  1.00 21.63 ? 154 LEU A CG  1 
ATOM   1179 C CD1 . LEU A 1 154 ? 24.930 4.698   -4.316  1.00 22.26 ? 154 LEU A CD1 1 
ATOM   1180 C CD2 . LEU A 1 154 ? 25.205 6.331   -6.193  1.00 23.52 ? 154 LEU A CD2 1 
ATOM   1181 N N   . LEU A 1 155 ? 28.830 3.966   -8.120  1.00 22.42 ? 155 LEU A N   1 
ATOM   1182 C CA  . LEU A 1 155 ? 30.125 3.466   -8.590  1.00 22.92 ? 155 LEU A CA  1 
ATOM   1183 C C   . LEU A 1 155 ? 30.522 2.161   -7.898  1.00 23.26 ? 155 LEU A C   1 
ATOM   1184 O O   . LEU A 1 155 ? 31.194 1.316   -8.497  1.00 24.18 ? 155 LEU A O   1 
ATOM   1185 C CB  . LEU A 1 155 ? 31.205 4.537   -8.374  1.00 23.17 ? 155 LEU A CB  1 
ATOM   1186 C CG  . LEU A 1 155 ? 32.564 4.373   -9.062  1.00 23.61 ? 155 LEU A CG  1 
ATOM   1187 C CD1 . LEU A 1 155 ? 32.405 4.241   -10.571 1.00 25.93 ? 155 LEU A CD1 1 
ATOM   1188 C CD2 . LEU A 1 155 ? 33.468 5.554   -8.728  1.00 25.58 ? 155 LEU A CD2 1 
ATOM   1189 N N   . ASP A 1 156 ? 30.082 1.990   -6.653  1.00 23.48 ? 156 ASP A N   1 
ATOM   1190 C CA  . ASP A 1 156 ? 30.408 0.803   -5.850  1.00 23.55 ? 156 ASP A CA  1 
ATOM   1191 C C   . ASP A 1 156 ? 29.275 -0.225  -5.796  1.00 23.35 ? 156 ASP A C   1 
ATOM   1192 O O   . ASP A 1 156 ? 29.254 -1.079  -4.906  1.00 23.79 ? 156 ASP A O   1 
ATOM   1193 C CB  . ASP A 1 156 ? 30.750 1.236   -4.419  1.00 23.94 ? 156 ASP A CB  1 
ATOM   1194 C CG  . ASP A 1 156 ? 29.546 1.808   -3.666  1.00 25.63 ? 156 ASP A CG  1 
ATOM   1195 O OD1 . ASP A 1 156 ? 28.586 2.276   -4.315  1.00 27.21 ? 156 ASP A OD1 1 
ATOM   1196 O OD2 . ASP A 1 156 ? 29.567 1.788   -2.416  1.00 28.19 ? 156 ASP A OD2 1 
ATOM   1197 N N   . GLU A 1 157 ? 28.334 -0.143  -6.730  1.00 22.63 ? 157 GLU A N   1 
ATOM   1198 C CA  . GLU A 1 157 ? 27.083 -0.886  -6.610  1.00 22.16 ? 157 GLU A CA  1 
ATOM   1199 C C   . GLU A 1 157 ? 27.189 -2.306  -7.158  1.00 21.67 ? 157 GLU A C   1 
ATOM   1200 O O   . GLU A 1 157 ? 27.591 -2.501  -8.303  1.00 21.79 ? 157 GLU A O   1 
ATOM   1201 C CB  . GLU A 1 157 ? 25.973 -0.141  -7.337  1.00 21.81 ? 157 GLU A CB  1 
ATOM   1202 C CG  . GLU A 1 157 ? 24.599 -0.775  -7.219  1.00 22.20 ? 157 GLU A CG  1 
ATOM   1203 C CD  . GLU A 1 157 ? 23.486 0.193   -7.582  1.00 21.88 ? 157 GLU A CD  1 
ATOM   1204 O OE1 . GLU A 1 157 ? 23.566 1.365   -7.162  1.00 20.68 ? 157 GLU A OE1 1 
ATOM   1205 O OE2 . GLU A 1 157 ? 22.535 -0.217  -8.275  1.00 21.78 ? 157 GLU A OE2 1 
ATOM   1206 N N   . ILE A 1 158 ? 26.812 -3.277  -6.330  1.00 21.34 ? 158 ILE A N   1 
ATOM   1207 C CA  . ILE A 1 158 ? 26.698 -4.678  -6.738  1.00 21.25 ? 158 ILE A CA  1 
ATOM   1208 C C   . ILE A 1 158 ? 25.220 -5.065  -6.644  1.00 20.98 ? 158 ILE A C   1 
ATOM   1209 O O   . ILE A 1 158 ? 24.664 -5.154  -5.550  1.00 20.61 ? 158 ILE A O   1 
ATOM   1210 C CB  . ILE A 1 158 ? 27.538 -5.627  -5.829  1.00 21.03 ? 158 ILE A CB  1 
ATOM   1211 C CG1 . ILE A 1 158 ? 28.980 -5.123  -5.658  1.00 21.10 ? 158 ILE A CG1 1 
ATOM   1212 C CG2 . ILE A 1 158 ? 27.528 -7.056  -6.374  1.00 21.03 ? 158 ILE A CG2 1 
ATOM   1213 C CD1 . ILE A 1 158 ? 29.730 -4.876  -6.957  1.00 20.66 ? 158 ILE A CD1 1 
ATOM   1214 N N   . ASP A 1 159 ? 24.581 -5.264  -7.792  1.00 20.83 ? 159 ASP A N   1 
ATOM   1215 C CA  . ASP A 1 159 ? 23.192 -5.703  -7.833  1.00 20.96 ? 159 ASP A CA  1 
ATOM   1216 C C   . ASP A 1 159 ? 23.096 -7.118  -7.250  1.00 20.96 ? 159 ASP A C   1 
ATOM   1217 O O   . ASP A 1 159 ? 23.966 -7.949  -7.516  1.00 20.56 ? 159 ASP A O   1 
ATOM   1218 C CB  . ASP A 1 159 ? 22.673 -5.664  -9.269  1.00 20.84 ? 159 ASP A CB  1 
ATOM   1219 C CG  . ASP A 1 159 ? 21.190 -5.941  -9.365  1.00 21.04 ? 159 ASP A CG  1 
ATOM   1220 O OD1 . ASP A 1 159 ? 20.804 -7.131  -9.368  1.00 21.45 ? 159 ASP A OD1 1 
ATOM   1221 O OD2 . ASP A 1 159 ? 20.405 -4.968  -9.431  1.00 20.46 ? 159 ASP A OD2 1 
ATOM   1222 N N   . PRO A 1 160 ? 22.054 -7.394  -6.441  1.00 21.36 ? 160 PRO A N   1 
ATOM   1223 C CA  . PRO A 1 160 ? 21.975 -8.706  -5.792  1.00 21.49 ? 160 PRO A CA  1 
ATOM   1224 C C   . PRO A 1 160 ? 21.753 -9.850  -6.775  1.00 21.50 ? 160 PRO A C   1 
ATOM   1225 O O   . PRO A 1 160 ? 22.118 -10.996 -6.492  1.00 21.89 ? 160 PRO A O   1 
ATOM   1226 C CB  . PRO A 1 160 ? 20.765 -8.561  -4.861  1.00 21.64 ? 160 PRO A CB  1 
ATOM   1227 C CG  . PRO A 1 160 ? 19.942 -7.518  -5.486  1.00 22.27 ? 160 PRO A CG  1 
ATOM   1228 C CD  . PRO A 1 160 ? 20.906 -6.546  -6.075  1.00 21.52 ? 160 PRO A CD  1 
ATOM   1229 N N   . ASP A 1 161 ? 21.161 -9.540  -7.922  1.00 21.46 ? 161 ASP A N   1 
ATOM   1230 C CA  . ASP A 1 161 ? 20.852 -10.557 -8.911  1.00 21.69 ? 161 ASP A CA  1 
ATOM   1231 C C   . ASP A 1 161 ? 21.820 -10.586 -10.099 1.00 21.59 ? 161 ASP A C   1 
ATOM   1232 O O   . ASP A 1 161 ? 22.095 -11.661 -10.634 1.00 21.33 ? 161 ASP A O   1 
ATOM   1233 C CB  . ASP A 1 161 ? 19.400 -10.398 -9.355  1.00 22.15 ? 161 ASP A CB  1 
ATOM   1234 C CG  . ASP A 1 161 ? 18.419 -10.766 -8.247  1.00 23.23 ? 161 ASP A CG  1 
ATOM   1235 O OD1 . ASP A 1 161 ? 18.685 -11.720 -7.478  1.00 25.94 ? 161 ASP A OD1 1 
ATOM   1236 O OD2 . ASP A 1 161 ? 17.382 -10.099 -8.133  1.00 25.80 ? 161 ASP A OD2 1 
ATOM   1237 N N   . SER A 1 162 ? 22.350 -9.424  -10.497 1.00 21.46 ? 162 SER A N   1 
ATOM   1238 C CA  . SER A 1 162 ? 23.236 -9.339  -11.666 1.00 21.41 ? 162 SER A CA  1 
ATOM   1239 C C   . SER A 1 162 ? 24.661 -8.867  -11.360 1.00 21.43 ? 162 SER A C   1 
ATOM   1240 O O   . SER A 1 162 ? 25.451 -8.653  -12.285 1.00 21.80 ? 162 SER A O   1 
ATOM   1241 C CB  . SER A 1 162 ? 22.604 -8.449  -12.747 1.00 21.55 ? 162 SER A CB  1 
ATOM   1242 O OG  . SER A 1 162 ? 22.647 -7.080  -12.395 1.00 20.70 ? 162 SER A OG  1 
ATOM   1243 N N   . ALA A 1 163 ? 24.991 -8.717  -10.077 1.00 21.44 ? 163 ALA A N   1 
ATOM   1244 C CA  . ALA A 1 163 ? 26.346 -8.369  -9.634  1.00 21.73 ? 163 ALA A CA  1 
ATOM   1245 C C   . ALA A 1 163 ? 26.775 -6.962  -10.088 1.00 22.11 ? 163 ALA A C   1 
ATOM   1246 O O   . ALA A 1 163 ? 25.950 -6.045  -10.109 1.00 21.72 ? 163 ALA A O   1 
ATOM   1247 C CB  . ALA A 1 163 ? 27.351 -9.433  -10.075 1.00 21.18 ? 163 ALA A CB  1 
ATOM   1248 N N   . GLU A 1 164 ? 28.053 -6.780  -10.431 1.00 22.64 ? 164 GLU A N   1 
ATOM   1249 C CA  . GLU A 1 164 ? 28.583 -5.434  -10.661 1.00 23.30 ? 164 GLU A CA  1 
ATOM   1250 C C   . GLU A 1 164 ? 28.111 -4.816  -11.971 1.00 23.91 ? 164 GLU A C   1 
ATOM   1251 O O   . GLU A 1 164 ? 27.612 -5.504  -12.865 1.00 23.93 ? 164 GLU A O   1 
ATOM   1252 C CB  . GLU A 1 164 ? 30.115 -5.383  -10.578 1.00 23.34 ? 164 GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 164 ? 30.880 -5.918  -11.801 1.00 23.11 ? 164 GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 164 ? 31.195 -7.392  -11.697 1.00 23.38 ? 164 GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 164 ? 32.280 -7.794  -12.166 1.00 24.04 ? 164 GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 164 ? 30.368 -8.145  -11.133 1.00 21.91 ? 164 GLU A OE2 1 
ATOM   1257 N N   . GLU A 1 165 ? 28.275 -3.497  -12.043 1.00 24.89 ? 165 GLU A N   1 
ATOM   1258 C CA  . GLU A 1 165 ? 27.959 -2.704  -13.227 1.00 25.74 ? 165 GLU A CA  1 
ATOM   1259 C C   . GLU A 1 165 ? 26.586 -3.019  -13.817 1.00 25.86 ? 165 GLU A C   1 
ATOM   1260 O O   . GLU A 1 165 ? 26.477 -3.332  -15.000 1.00 26.00 ? 165 GLU A O   1 
ATOM   1261 C CB  . GLU A 1 165 ? 29.068 -2.877  -14.272 1.00 26.07 ? 165 GLU A CB  1 
ATOM   1262 C CG  . GLU A 1 165 ? 30.459 -2.551  -13.733 1.00 27.24 ? 165 GLU A CG  1 
ATOM   1263 C CD  . GLU A 1 165 ? 31.546 -2.649  -14.789 1.00 27.80 ? 165 GLU A CD  1 
ATOM   1264 O OE1 . GLU A 1 165 ? 31.398 -2.017  -15.858 1.00 31.15 ? 165 GLU A OE1 1 
ATOM   1265 O OE2 . GLU A 1 165 ? 32.555 -3.347  -14.543 1.00 32.70 ? 165 GLU A OE2 1 
ATOM   1266 N N   . PRO A 1 166 ? 25.524 -2.936  -12.990 1.00 26.02 ? 166 PRO A N   1 
ATOM   1267 C CA  . PRO A 1 166 ? 24.180 -3.182  -13.515 1.00 26.27 ? 166 PRO A CA  1 
ATOM   1268 C C   . PRO A 1 166 ? 23.730 -2.059  -14.446 1.00 26.37 ? 166 PRO A C   1 
ATOM   1269 O O   . PRO A 1 166 ? 24.236 -0.948  -14.339 1.00 26.90 ? 166 PRO A O   1 
ATOM   1270 C CB  . PRO A 1 166 ? 23.313 -3.216  -12.253 1.00 26.25 ? 166 PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 166 ? 24.039 -2.363  -11.284 1.00 26.21 ? 166 PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 166 ? 25.495 -2.605  -11.553 1.00 26.10 ? 166 PRO A CD  1 
ATOM   1273 N N   . PRO A 1 167 ? 22.788 -2.346  -15.357 1.00 26.49 ? 167 PRO A N   1 
ATOM   1274 C CA  . PRO A 1 167 ? 22.307 -1.326  -16.300 1.00 26.13 ? 167 PRO A CA  1 
ATOM   1275 C C   . PRO A 1 167 ? 21.439 -0.258  -15.619 1.00 25.90 ? 167 PRO A C   1 
ATOM   1276 O O   . PRO A 1 167 ? 21.534 0.926   -15.960 1.00 26.02 ? 167 PRO A O   1 
ATOM   1277 C CB  . PRO A 1 167 ? 21.482 -2.140  -17.301 1.00 26.40 ? 167 PRO A CB  1 
ATOM   1278 C CG  . PRO A 1 167 ? 21.017 -3.326  -16.527 1.00 26.79 ? 167 PRO A CG  1 
ATOM   1279 C CD  . PRO A 1 167 ? 22.110 -3.641  -15.550 1.00 26.70 ? 167 PRO A CD  1 
ATOM   1280 N N   . VAL A 1 168 ? 20.617 -0.693  -14.666 1.00 25.08 ? 168 VAL A N   1 
ATOM   1281 C CA  . VAL A 1 168 ? 19.753 0.182   -13.888 1.00 24.73 ? 168 VAL A CA  1 
ATOM   1282 C C   . VAL A 1 168 ? 19.887 -0.184  -12.404 1.00 24.15 ? 168 VAL A C   1 
ATOM   1283 O O   . VAL A 1 168 ? 20.215 -1.326  -12.064 1.00 23.97 ? 168 VAL A O   1 
ATOM   1284 C CB  . VAL A 1 168 ? 18.280 0.056   -14.346 1.00 24.85 ? 168 VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 168 ? 17.729 -1.331  -14.033 1.00 25.58 ? 168 VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 168 ? 17.421 1.136   -13.702 1.00 25.32 ? 168 VAL A CG2 1 
ATOM   1287 N N   . SER A 1 169 ? 19.655 0.786   -11.524 1.00 23.10 ? 169 SER A N   1 
ATOM   1288 C CA  . SER A 1 169 ? 19.781 0.550   -10.088 1.00 22.27 ? 169 SER A CA  1 
ATOM   1289 C C   . SER A 1 169 ? 18.470 0.074   -9.482  1.00 21.82 ? 169 SER A C   1 
ATOM   1290 O O   . SER A 1 169 ? 17.392 0.578   -9.822  1.00 21.28 ? 169 SER A O   1 
ATOM   1291 C CB  . SER A 1 169 ? 20.244 1.819   -9.368  1.00 22.16 ? 169 SER A CB  1 
ATOM   1292 O OG  . SER A 1 169 ? 20.492 1.555   -7.996  1.00 21.09 ? 169 SER A OG  1 
ATOM   1293 N N   . ARG A 1 170 ? 18.575 -0.901  -8.585  1.00 20.98 ? 170 ARG A N   1 
ATOM   1294 C CA  . ARG A 1 170 ? 17.461 -1.322  -7.745  1.00 21.23 ? 170 ARG A CA  1 
ATOM   1295 C C   . ARG A 1 170 ? 17.844 -1.290  -6.258  1.00 20.35 ? 170 ARG A C   1 
ATOM   1296 O O   . ARG A 1 170 ? 17.245 -1.991  -5.438  1.00 20.15 ? 170 ARG A O   1 
ATOM   1297 C CB  . ARG A 1 170 ? 17.004 -2.722  -8.139  1.00 21.22 ? 170 ARG A CB  1 
ATOM   1298 C CG  . ARG A 1 170 ? 16.523 -2.834  -9.573  1.00 22.53 ? 170 ARG A CG  1 
ATOM   1299 C CD  . ARG A 1 170 ? 16.003 -4.219  -9.836  1.00 23.81 ? 170 ARG A CD  1 
ATOM   1300 N NE  . ARG A 1 170 ? 17.003 -5.216  -9.468  1.00 26.14 ? 170 ARG A NE  1 
ATOM   1301 C CZ  . ARG A 1 170 ? 16.751 -6.500  -9.236  1.00 27.48 ? 170 ARG A CZ  1 
ATOM   1302 N NH1 . ARG A 1 170 ? 15.517 -6.987  -9.330  1.00 28.24 ? 170 ARG A NH1 1 
ATOM   1303 N NH2 . ARG A 1 170 ? 17.748 -7.306  -8.900  1.00 26.51 ? 170 ARG A NH2 1 
ATOM   1304 N N   . ARG A 1 171 ? 18.831 -0.465  -5.912  1.00 19.58 ? 171 ARG A N   1 
ATOM   1305 C CA  . ARG A 1 171 ? 19.239 -0.294  -4.517  1.00 19.15 ? 171 ARG A CA  1 
ATOM   1306 C C   . ARG A 1 171 ? 18.090 0.255   -3.683  1.00 18.52 ? 171 ARG A C   1 
ATOM   1307 O O   . ARG A 1 171 ? 17.157 0.856   -4.219  1.00 18.41 ? 171 ARG A O   1 
ATOM   1308 C CB  . ARG A 1 171 ? 20.452 0.636   -4.409  1.00 19.10 ? 171 ARG A CB  1 
ATOM   1309 C CG  . ARG A 1 171 ? 20.182 2.105   -4.716  1.00 18.86 ? 171 ARG A CG  1 
ATOM   1310 C CD  . ARG A 1 171 ? 21.507 2.853   -4.750  1.00 19.08 ? 171 ARG A CD  1 
ATOM   1311 N NE  . ARG A 1 171 ? 21.389 4.308   -4.811  1.00 17.87 ? 171 ARG A NE  1 
ATOM   1312 C CZ  . ARG A 1 171 ? 21.339 5.035   -5.927  1.00 18.38 ? 171 ARG A CZ  1 
ATOM   1313 N NH1 . ARG A 1 171 ? 21.357 4.461   -7.125  1.00 17.31 ? 171 ARG A NH1 1 
ATOM   1314 N NH2 . ARG A 1 171 ? 21.262 6.361   -5.841  1.00 18.11 ? 171 ARG A NH2 1 
ATOM   1315 N N   . LEU A 1 172 ? 18.156 0.050   -2.373  1.00 17.75 ? 172 LEU A N   1 
ATOM   1316 C CA  . LEU A 1 172 ? 17.057 0.430   -1.502  1.00 17.84 ? 172 LEU A CA  1 
ATOM   1317 C C   . LEU A 1 172 ? 16.995 1.940   -1.288  1.00 17.06 ? 172 LEU A C   1 
ATOM   1318 O O   . LEU A 1 172 ? 15.928 2.530   -1.390  1.00 16.58 ? 172 LEU A O   1 
ATOM   1319 C CB  . LEU A 1 172 ? 17.151 -0.268  -0.148  1.00 17.82 ? 172 LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 172 ? 16.949 -1.786  -0.098  1.00 18.59 ? 172 LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 172 ? 17.103 -2.260  1.339   1.00 19.78 ? 172 LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 172 ? 15.597 -2.187  -0.653  1.00 20.24 ? 172 LEU A CD2 1 
ATOM   1323 N N   . PHE A 1 173 ? 18.141 2.549   -1.000  1.00 16.86 ? 173 PHE A N   1 
ATOM   1324 C CA  . PHE A 1 173 ? 18.186 3.928   -0.507  1.00 17.06 ? 173 PHE A CA  1 
ATOM   1325 C C   . PHE A 1 173 ? 19.189 4.782   -1.291  1.00 16.86 ? 173 PHE A C   1 
ATOM   1326 O O   . PHE A 1 173 ? 19.778 4.314   -2.261  1.00 17.19 ? 173 PHE A O   1 
ATOM   1327 C CB  . PHE A 1 173 ? 18.489 3.909   0.996   1.00 16.90 ? 173 PHE A CB  1 
ATOM   1328 C CG  . PHE A 1 173 ? 17.535 3.045   1.791   1.00 17.55 ? 173 PHE A CG  1 
ATOM   1329 C CD1 . PHE A 1 173 ? 16.171 3.331   1.811   1.00 18.07 ? 173 PHE A CD1 1 
ATOM   1330 C CD2 . PHE A 1 173 ? 17.993 1.934   2.499   1.00 18.09 ? 173 PHE A CD2 1 
ATOM   1331 C CE1 . PHE A 1 173 ? 15.281 2.534   2.540   1.00 17.62 ? 173 PHE A CE1 1 
ATOM   1332 C CE2 . PHE A 1 173 ? 17.114 1.137   3.226   1.00 17.92 ? 173 PHE A CE2 1 
ATOM   1333 C CZ  . PHE A 1 173 ? 15.755 1.439   3.247   1.00 17.46 ? 173 PHE A CZ  1 
ATOM   1334 N N   . LEU A 1 174 ? 19.370 6.036   -0.881  1.00 16.55 ? 174 LEU A N   1 
ATOM   1335 C CA  . LEU A 1 174 ? 20.159 6.998   -1.660  1.00 16.71 ? 174 LEU A CA  1 
ATOM   1336 C C   . LEU A 1 174 ? 21.595 6.561   -1.939  1.00 16.51 ? 174 LEU A C   1 
ATOM   1337 O O   . LEU A 1 174 ? 22.096 6.735   -3.045  1.00 16.31 ? 174 LEU A O   1 
ATOM   1338 C CB  . LEU A 1 174 ? 20.194 8.356   -0.951  1.00 15.97 ? 174 LEU A CB  1 
ATOM   1339 C CG  . LEU A 1 174 ? 18.907 9.163   -0.992  1.00 15.56 ? 174 LEU A CG  1 
ATOM   1340 C CD1 . LEU A 1 174 ? 18.988 10.271  0.055   1.00 14.60 ? 174 LEU A CD1 1 
ATOM   1341 C CD2 . LEU A 1 174 ? 18.660 9.732   -2.403  1.00 15.06 ? 174 LEU A CD2 1 
ATOM   1342 N N   . ASP A 1 175 ? 22.255 6.015   -0.929  1.00 17.20 ? 175 ASP A N   1 
ATOM   1343 C CA  . ASP A 1 175 ? 23.692 5.760   -0.997  1.00 17.98 ? 175 ASP A CA  1 
ATOM   1344 C C   . ASP A 1 175 ? 24.041 4.279   -1.126  1.00 18.37 ? 175 ASP A C   1 
ATOM   1345 O O   . ASP A 1 175 ? 25.223 3.917   -1.231  1.00 18.66 ? 175 ASP A O   1 
ATOM   1346 C CB  . ASP A 1 175 ? 24.344 6.327   0.259   1.00 18.08 ? 175 ASP A CB  1 
ATOM   1347 C CG  . ASP A 1 175 ? 25.797 6.633   0.067   1.00 18.93 ? 175 ASP A CG  1 
ATOM   1348 O OD1 . ASP A 1 175 ? 26.125 7.489   -0.786  1.00 21.49 ? 175 ASP A OD1 1 
ATOM   1349 O OD2 . ASP A 1 175 ? 26.607 6.016   0.777   1.00 19.41 ? 175 ASP A OD2 1 
ATOM   1350 N N   . GLY A 1 176 ? 23.014 3.435   -1.126  1.00 18.58 ? 176 GLY A N   1 
ATOM   1351 C CA  . GLY A 1 176 ? 23.172 1.988   -1.096  1.00 18.70 ? 176 GLY A CA  1 
ATOM   1352 C C   . GLY A 1 176 ? 21.963 1.345   -0.447  1.00 18.92 ? 176 GLY A C   1 
ATOM   1353 O O   . GLY A 1 176 ? 20.859 1.892   -0.508  1.00 18.56 ? 176 GLY A O   1 
ATOM   1354 N N   . ASP A 1 177 ? 22.173 0.193   0.190   1.00 18.94 ? 177 ASP A N   1 
ATOM   1355 C CA  . ASP A 1 177 ? 21.076 -0.596  0.759   1.00 19.52 ? 177 ASP A CA  1 
ATOM   1356 C C   . ASP A 1 177 ? 20.894 -0.419  2.265   1.00 19.60 ? 177 ASP A C   1 
ATOM   1357 O O   . ASP A 1 177 ? 20.054 -1.084  2.865   1.00 19.96 ? 177 ASP A O   1 
ATOM   1358 C CB  . ASP A 1 177 ? 21.267 -2.077  0.416   1.00 19.94 ? 177 ASP A CB  1 
ATOM   1359 C CG  . ASP A 1 177 ? 21.182 -2.344  -1.081  1.00 20.61 ? 177 ASP A CG  1 
ATOM   1360 O OD1 . ASP A 1 177 ? 20.412 -1.654  -1.781  1.00 20.44 ? 177 ASP A OD1 1 
ATOM   1361 O OD2 . ASP A 1 177 ? 21.888 -3.251  -1.559  1.00 23.85 ? 177 ASP A OD2 1 
ATOM   1362 N N   . GLN A 1 178 ? 21.671 0.478   2.866   1.00 19.71 ? 178 GLN A N   1 
ATOM   1363 C CA  . GLN A 1 178 ? 21.497 0.854   4.268   1.00 19.90 ? 178 GLN A CA  1 
ATOM   1364 C C   . GLN A 1 178 ? 21.090 2.322   4.374   1.00 19.37 ? 178 GLN A C   1 
ATOM   1365 O O   . GLN A 1 178 ? 21.519 3.153   3.571   1.00 19.03 ? 178 GLN A O   1 
ATOM   1366 C CB  . GLN A 1 178 ? 22.786 0.623   5.067   1.00 20.73 ? 178 GLN A CB  1 
ATOM   1367 C CG  . GLN A 1 178 ? 22.905 -0.773  5.679   1.00 23.57 ? 178 GLN A CG  1 
ATOM   1368 C CD  . GLN A 1 178 ? 23.734 -1.713  4.842   1.00 26.84 ? 178 GLN A CD  1 
ATOM   1369 O OE1 . GLN A 1 178 ? 23.205 -2.446  4.005   1.00 30.24 ? 178 GLN A OE1 1 
ATOM   1370 N NE2 . GLN A 1 178 ? 25.053 -1.689  5.052   1.00 29.37 ? 178 GLN A NE2 1 
ATOM   1371 N N   . LEU A 1 179 ? 20.263 2.625   5.369   1.00 18.65 ? 179 LEU A N   1 
ATOM   1372 C CA  . LEU A 1 179 ? 19.879 4.002   5.658   1.00 18.33 ? 179 LEU A CA  1 
ATOM   1373 C C   . LEU A 1 179 ? 21.103 4.777   6.142   1.00 17.86 ? 179 LEU A C   1 
ATOM   1374 O O   . LEU A 1 179 ? 21.837 4.307   7.012   1.00 17.98 ? 179 LEU A O   1 
ATOM   1375 C CB  . LEU A 1 179 ? 18.753 4.050   6.698   1.00 18.34 ? 179 LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 179 ? 17.351 3.691   6.183   1.00 18.05 ? 179 LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 179 ? 16.345 3.669   7.328   1.00 17.75 ? 179 LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 179 ? 16.881 4.662   5.093   1.00 17.28 ? 179 LEU A CD2 1 
ATOM   1379 N N   . THR A 1 180 ? 21.337 5.944   5.544   1.00 17.23 ? 180 THR A N   1 
ATOM   1380 C CA  . THR A 1 180 ? 22.461 6.797   5.910   1.00 16.80 ? 180 THR A CA  1 
ATOM   1381 C C   . THR A 1 180 ? 21.971 8.183   6.316   1.00 16.41 ? 180 THR A C   1 
ATOM   1382 O O   . THR A 1 180 ? 20.768 8.468   6.263   1.00 16.19 ? 180 THR A O   1 
ATOM   1383 C CB  . THR A 1 180 ? 23.455 6.943   4.732   1.00 16.47 ? 180 THR A CB  1 
ATOM   1384 O OG1 . THR A 1 180 ? 22.823 7.620   3.642   1.00 16.06 ? 180 THR A OG1 1 
ATOM   1385 C CG2 . THR A 1 180 ? 23.969 5.584   4.282   1.00 16.95 ? 180 THR A CG2 1 
ATOM   1386 N N   . LEU A 1 181 ? 22.909 9.044   6.709   1.00 15.76 ? 181 LEU A N   1 
ATOM   1387 C CA  . LEU A 1 181 ? 22.604 10.443  7.027   1.00 15.76 ? 181 LEU A CA  1 
ATOM   1388 C C   . LEU A 1 181 ? 21.913 11.160  5.868   1.00 15.55 ? 181 LEU A C   1 
ATOM   1389 O O   . LEU A 1 181 ? 21.089 12.039  6.089   1.00 15.93 ? 181 LEU A O   1 
ATOM   1390 C CB  . LEU A 1 181 ? 23.871 11.209  7.406   1.00 15.84 ? 181 LEU A CB  1 
ATOM   1391 C CG  . LEU A 1 181 ? 24.637 10.718  8.634   1.00 15.55 ? 181 LEU A CG  1 
ATOM   1392 C CD1 . LEU A 1 181 ? 25.868 11.593  8.861   1.00 15.86 ? 181 LEU A CD1 1 
ATOM   1393 C CD2 . LEU A 1 181 ? 23.731 10.703  9.854   1.00 15.52 ? 181 LEU A CD2 1 
ATOM   1394 N N   . ALA A 1 182 ? 22.251 10.779  4.640   1.00 15.29 ? 182 ALA A N   1 
ATOM   1395 C CA  . ALA A 1 182 ? 21.597 11.324  3.447   1.00 15.15 ? 182 ALA A CA  1 
ATOM   1396 C C   . ALA A 1 182 ? 20.086 11.061  3.443   1.00 14.93 ? 182 ALA A C   1 
ATOM   1397 O O   . ALA A 1 182 ? 19.300 11.935  3.066   1.00 15.10 ? 182 ALA A O   1 
ATOM   1398 C CB  . ALA A 1 182 ? 22.241 10.758  2.191   1.00 15.10 ? 182 ALA A CB  1 
ATOM   1399 N N   . ASP A 1 183 ? 19.686 9.866   3.875   1.00 14.68 ? 183 ASP A N   1 
ATOM   1400 C CA  . ASP A 1 183 ? 18.264 9.512   3.998   1.00 14.75 ? 183 ASP A CA  1 
ATOM   1401 C C   . ASP A 1 183 ? 17.613 10.209  5.185   1.00 14.58 ? 183 ASP A C   1 
ATOM   1402 O O   . ASP A 1 183 ? 16.449 10.606  5.118   1.00 14.61 ? 183 ASP A O   1 
ATOM   1403 C CB  . ASP A 1 183 ? 18.091 8.000   4.140   1.00 14.76 ? 183 ASP A CB  1 
ATOM   1404 C CG  . ASP A 1 183 ? 18.738 7.236   3.012   1.00 14.14 ? 183 ASP A CG  1 
ATOM   1405 O OD1 . ASP A 1 183 ? 18.228 7.312   1.874   1.00 14.19 ? 183 ASP A OD1 1 
ATOM   1406 O OD2 . ASP A 1 183 ? 19.764 6.570   3.260   1.00 15.27 ? 183 ASP A OD2 1 
ATOM   1407 N N   . CYS A 1 184 ? 18.357 10.345  6.280   1.00 14.48 ? 184 CYS A N   1 
ATOM   1408 C CA  . CYS A 1 184 ? 17.871 11.077  7.446   1.00 14.98 ? 184 CYS A CA  1 
ATOM   1409 C C   . CYS A 1 184 ? 17.578 12.540  7.105   1.00 14.97 ? 184 CYS A C   1 
ATOM   1410 O O   . CYS A 1 184 ? 16.686 13.154  7.687   1.00 14.95 ? 184 CYS A O   1 
ATOM   1411 C CB  . CYS A 1 184 ? 18.878 10.966  8.602   1.00 14.71 ? 184 CYS A CB  1 
ATOM   1412 S SG  . CYS A 1 184 ? 19.080 9.269   9.222   1.00 15.19 ? 184 CYS A SG  1 
ATOM   1413 N N   . SER A 1 185 ? 18.331 13.094  6.162   1.00 15.47 ? 185 SER A N   1 
ATOM   1414 C CA  . SER A 1 185 ? 18.082 14.457  5.693   1.00 15.81 ? 185 SER A CA  1 
ATOM   1415 C C   . SER A 1 185 ? 16.890 14.516  4.748   1.00 15.67 ? 185 SER A C   1 
ATOM   1416 O O   . SER A 1 185 ? 15.971 15.320  4.937   1.00 15.42 ? 185 SER A O   1 
ATOM   1417 C CB  . SER A 1 185 ? 19.315 15.020  4.982   1.00 16.06 ? 185 SER A CB  1 
ATOM   1418 O OG  . SER A 1 185 ? 19.010 16.285  4.413   1.00 17.74 ? 185 SER A OG  1 
ATOM   1419 N N   . LEU A 1 186 ? 16.909 13.669  3.723   1.00 15.88 ? 186 LEU A N   1 
ATOM   1420 C CA  . LEU A 1 186 ? 15.937 13.779  2.637   1.00 15.74 ? 186 LEU A CA  1 
ATOM   1421 C C   . LEU A 1 186 ? 14.549 13.266  3.016   1.00 15.59 ? 186 LEU A C   1 
ATOM   1422 O O   . LEU A 1 186 ? 13.549 13.900  2.681   1.00 15.71 ? 186 LEU A O   1 
ATOM   1423 C CB  . LEU A 1 186 ? 16.441 13.056  1.382   1.00 15.85 ? 186 LEU A CB  1 
ATOM   1424 C CG  . LEU A 1 186 ? 15.533 13.102  0.142   1.00 16.57 ? 186 LEU A CG  1 
ATOM   1425 C CD1 . LEU A 1 186 ? 15.167 14.524  -0.234  1.00 17.51 ? 186 LEU A CD1 1 
ATOM   1426 C CD2 . LEU A 1 186 ? 16.197 12.395  -1.029  1.00 16.33 ? 186 LEU A CD2 1 
ATOM   1427 N N   . LEU A 1 187 ? 14.473 12.134  3.708   1.00 15.13 ? 187 LEU A N   1 
ATOM   1428 C CA  . LEU A 1 187 ? 13.170 11.501  3.935   1.00 15.40 ? 187 LEU A CA  1 
ATOM   1429 C C   . LEU A 1 187 ? 12.150 12.407  4.651   1.00 15.20 ? 187 LEU A C   1 
ATOM   1430 O O   . LEU A 1 187 ? 11.019 12.510  4.192   1.00 15.60 ? 187 LEU A O   1 
ATOM   1431 C CB  . LEU A 1 187 ? 13.306 10.135  4.626   1.00 15.32 ? 187 LEU A CB  1 
ATOM   1432 C CG  . LEU A 1 187 ? 13.870 9.025   3.724   1.00 15.14 ? 187 LEU A CG  1 
ATOM   1433 C CD1 . LEU A 1 187 ? 14.046 7.713   4.505   1.00 13.61 ? 187 LEU A CD1 1 
ATOM   1434 C CD2 . LEU A 1 187 ? 12.985 8.808   2.485   1.00 14.86 ? 187 LEU A CD2 1 
ATOM   1435 N N   . PRO A 1 188 ? 12.540 13.075  5.757   1.00 15.22 ? 188 PRO A N   1 
ATOM   1436 C CA  . PRO A 1 188 ? 11.594 14.036  6.357   1.00 15.30 ? 188 PRO A CA  1 
ATOM   1437 C C   . PRO A 1 188 ? 11.133 15.126  5.372   1.00 15.48 ? 188 PRO A C   1 
ATOM   1438 O O   . PRO A 1 188 ? 9.964  15.518  5.377   1.00 15.22 ? 188 PRO A O   1 
ATOM   1439 C CB  . PRO A 1 188 ? 12.398 14.647  7.510   1.00 15.11 ? 188 PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 188 ? 13.432 13.611  7.839   1.00 15.30 ? 188 PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 188 ? 13.790 12.985  6.526   1.00 15.18 ? 188 PRO A CD  1 
ATOM   1442 N N   . LYS A 1 189 ? 12.055 15.609  4.546   1.00 15.55 ? 189 LYS A N   1 
ATOM   1443 C CA  . LYS A 1 189 ? 11.729 16.625  3.539   1.00 15.77 ? 189 LYS A CA  1 
ATOM   1444 C C   . LYS A 1 189 ? 10.780 16.091  2.448   1.00 15.46 ? 189 LYS A C   1 
ATOM   1445 O O   . LYS A 1 189 ? 9.858  16.792  2.025   1.00 15.50 ? 189 LYS A O   1 
ATOM   1446 C CB  . LYS A 1 189 ? 13.007 17.175  2.908   1.00 16.02 ? 189 LYS A CB  1 
ATOM   1447 C CG  . LYS A 1 189 ? 13.925 17.920  3.881   1.00 17.36 ? 189 LYS A CG  1 
ATOM   1448 C CD  . LYS A 1 189 ? 15.249 18.266  3.217   1.00 17.34 ? 189 LYS A CD  1 
ATOM   1449 C CE  . LYS A 1 189 ? 16.315 18.647  4.237   1.00 18.61 ? 189 LYS A CE  1 
ATOM   1450 N NZ  . LYS A 1 189 ? 17.617 18.991  3.587   1.00 20.10 ? 189 LYS A NZ  1 
ATOM   1451 N N   A LEU A 1 190 ? 11.021 14.863  1.986   0.50 15.34 ? 190 LEU A N   1 
ATOM   1452 N N   B LEU A 1 190 ? 11.013 14.854  2.021   0.50 15.45 ? 190 LEU A N   1 
ATOM   1453 C CA  A LEU A 1 190 ? 10.136 14.215  1.005   0.50 15.28 ? 190 LEU A CA  1 
ATOM   1454 C CA  B LEU A 1 190 ? 10.173 14.194  1.022   0.50 15.42 ? 190 LEU A CA  1 
ATOM   1455 C C   A LEU A 1 190 ? 8.728  14.013  1.559   0.50 15.25 ? 190 LEU A C   1 
ATOM   1456 C C   B LEU A 1 190 ? 8.750  13.964  1.546   0.50 15.33 ? 190 LEU A C   1 
ATOM   1457 O O   A LEU A 1 190 ? 7.741  14.224  0.853   0.50 15.06 ? 190 LEU A O   1 
ATOM   1458 O O   B LEU A 1 190 ? 7.776  14.109  0.806   0.50 15.17 ? 190 LEU A O   1 
ATOM   1459 C CB  A LEU A 1 190 ? 10.704 12.866  0.543   0.50 15.17 ? 190 LEU A CB  1 
ATOM   1460 C CB  B LEU A 1 190 ? 10.821 12.867  0.608   0.50 15.42 ? 190 LEU A CB  1 
ATOM   1461 C CG  A LEU A 1 190 ? 11.748 12.918  -0.574  0.50 14.77 ? 190 LEU A CG  1 
ATOM   1462 C CG  B LEU A 1 190 ? 10.321 12.142  -0.642  0.50 15.56 ? 190 LEU A CG  1 
ATOM   1463 C CD1 A LEU A 1 190 ? 12.364 11.544  -0.764  0.50 14.34 ? 190 LEU A CD1 1 
ATOM   1464 C CD1 B LEU A 1 190 ? 9.925  13.105  -1.760  0.50 16.06 ? 190 LEU A CD1 1 
ATOM   1465 C CD2 A LEU A 1 190 ? 11.137 13.422  -1.880  0.50 15.17 ? 190 LEU A CD2 1 
ATOM   1466 C CD2 B LEU A 1 190 ? 11.402 11.174  -1.122  0.50 15.34 ? 190 LEU A CD2 1 
ATOM   1467 N N   . ASN A 1 191 ? 8.642  13.610  2.825   1.00 15.18 ? 191 ASN A N   1 
ATOM   1468 C CA  . ASN A 1 191 ? 7.347  13.484  3.501   1.00 15.13 ? 191 ASN A CA  1 
ATOM   1469 C C   . ASN A 1 191 ? 6.599  14.821  3.515   1.00 14.76 ? 191 ASN A C   1 
ATOM   1470 O O   . ASN A 1 191 ? 5.407  14.868  3.223   1.00 14.63 ? 191 ASN A O   1 
ATOM   1471 C CB  . ASN A 1 191 ? 7.534  12.991  4.936   1.00 15.09 ? 191 ASN A CB  1 
ATOM   1472 C CG  . ASN A 1 191 ? 6.215  12.749  5.651   1.00 15.81 ? 191 ASN A CG  1 
ATOM   1473 O OD1 . ASN A 1 191 ? 5.924  13.387  6.678   1.00 18.57 ? 191 ASN A OD1 1 
ATOM   1474 N ND2 . ASN A 1 191 ? 5.400  11.845  5.110   1.00 15.21 ? 191 ASN A ND2 1 
ATOM   1475 N N   . ILE A 1 192 ? 7.313  15.896  3.844   1.00 15.07 ? 192 ILE A N   1 
ATOM   1476 C CA  . ILE A 1 192 ? 6.740  17.247  3.816   1.00 15.21 ? 192 ILE A CA  1 
ATOM   1477 C C   . ILE A 1 192 ? 6.232  17.610  2.414   1.00 15.32 ? 192 ILE A C   1 
ATOM   1478 O O   . ILE A 1 192 ? 5.095  18.067  2.257   1.00 14.86 ? 192 ILE A O   1 
ATOM   1479 C CB  . ILE A 1 192 ? 7.750  18.325  4.294   1.00 15.33 ? 192 ILE A CB  1 
ATOM   1480 C CG1 . ILE A 1 192 ? 8.041  18.177  5.790   1.00 15.34 ? 192 ILE A CG1 1 
ATOM   1481 C CG2 . ILE A 1 192 ? 7.207  19.728  4.005   1.00 15.35 ? 192 ILE A CG2 1 
ATOM   1482 C CD1 . ILE A 1 192 ? 9.222  18.992  6.280   1.00 15.06 ? 192 ILE A CD1 1 
ATOM   1483 N N   . ILE A 1 193 ? 7.073  17.406  1.401   1.00 15.59 ? 193 ILE A N   1 
ATOM   1484 C CA  . ILE A 1 193 ? 6.692  17.720  0.016   1.00 15.67 ? 193 ILE A CA  1 
ATOM   1485 C C   . ILE A 1 193 ? 5.431  16.959  -0.384  1.00 15.75 ? 193 ILE A C   1 
ATOM   1486 O O   . ILE A 1 193 ? 4.506  17.535  -0.953  1.00 16.08 ? 193 ILE A O   1 
ATOM   1487 C CB  . ILE A 1 193 ? 7.813  17.372  -0.992  1.00 15.66 ? 193 ILE A CB  1 
ATOM   1488 C CG1 . ILE A 1 193 ? 9.049  18.255  -0.786  1.00 15.74 ? 193 ILE A CG1 1 
ATOM   1489 C CG2 . ILE A 1 193 ? 7.310  17.539  -2.427  1.00 15.89 ? 193 ILE A CG2 1 
ATOM   1490 C CD1 . ILE A 1 193 ? 10.279 17.782  -1.548  1.00 15.40 ? 193 ILE A CD1 1 
ATOM   1491 N N   . LYS A 1 194 ? 5.397  15.666  -0.067  1.00 15.94 ? 194 LYS A N   1 
ATOM   1492 C CA  . LYS A 1 194 ? 4.285  14.803  -0.441  1.00 16.11 ? 194 LYS A CA  1 
ATOM   1493 C C   . LYS A 1 194 ? 2.971  15.257  0.198   1.00 15.96 ? 194 LYS A C   1 
ATOM   1494 O O   . LYS A 1 194 ? 1.941  15.341  -0.471  1.00 15.90 ? 194 LYS A O   1 
ATOM   1495 C CB  . LYS A 1 194 ? 4.590  13.352  -0.057  1.00 16.26 ? 194 LYS A CB  1 
ATOM   1496 C CG  . LYS A 1 194 ? 3.726  12.330  -0.755  1.00 16.71 ? 194 LYS A CG  1 
ATOM   1497 C CD  . LYS A 1 194 ? 4.187  10.908  -0.417  1.00 17.70 ? 194 LYS A CD  1 
ATOM   1498 C CE  . LYS A 1 194 ? 3.402  9.858   -1.184  1.00 18.85 ? 194 LYS A CE  1 
ATOM   1499 N NZ  . LYS A 1 194 ? 2.059  9.615   -0.588  1.00 21.71 ? 194 LYS A NZ  1 
ATOM   1500 N N   . VAL A 1 195 ? 3.016  15.561  1.492   1.00 15.70 ? 195 VAL A N   1 
ATOM   1501 C CA  . VAL A 1 195 ? 1.829  15.995  2.227   1.00 15.58 ? 195 VAL A CA  1 
ATOM   1502 C C   . VAL A 1 195 ? 1.372  17.404  1.807   1.00 15.51 ? 195 VAL A C   1 
ATOM   1503 O O   . VAL A 1 195 ? 0.206  17.602  1.428   1.00 14.78 ? 195 VAL A O   1 
ATOM   1504 C CB  . VAL A 1 195 ? 2.083  15.966  3.754   1.00 15.64 ? 195 VAL A CB  1 
ATOM   1505 C CG1 . VAL A 1 195 ? 0.920  16.607  4.519   1.00 15.74 ? 195 VAL A CG1 1 
ATOM   1506 C CG2 . VAL A 1 195 ? 2.320  14.524  4.229   1.00 15.82 ? 195 VAL A CG2 1 
ATOM   1507 N N   . ALA A 1 196 ? 2.296  18.362  1.861   1.00 15.35 ? 196 ALA A N   1 
ATOM   1508 C CA  . ALA A 1 196 ? 1.973  19.775  1.620   1.00 15.68 ? 196 ALA A CA  1 
ATOM   1509 C C   . ALA A 1 196 ? 1.623  20.089  0.170   1.00 15.81 ? 196 ALA A C   1 
ATOM   1510 O O   . ALA A 1 196 ? 0.686  20.845  -0.092  1.00 15.79 ? 196 ALA A O   1 
ATOM   1511 C CB  . ALA A 1 196 ? 3.121  20.676  2.089   1.00 15.61 ? 196 ALA A CB  1 
ATOM   1512 N N   . ALA A 1 197 ? 2.375  19.521  -0.770  1.00 16.19 ? 197 ALA A N   1 
ATOM   1513 C CA  . ALA A 1 197 ? 2.122  19.754  -2.188  1.00 16.46 ? 197 ALA A CA  1 
ATOM   1514 C C   . ALA A 1 197 ? 0.781  19.170  -2.615  1.00 16.84 ? 197 ALA A C   1 
ATOM   1515 O O   . ALA A 1 197 ? 0.076  19.772  -3.428  1.00 16.54 ? 197 ALA A O   1 
ATOM   1516 C CB  . ALA A 1 197 ? 3.245  19.200  -3.040  1.00 16.55 ? 197 ALA A CB  1 
ATOM   1517 N N   . LYS A 1 198 ? 0.412  18.017  -2.055  1.00 17.11 ? 198 LYS A N   1 
ATOM   1518 C CA  . LYS A 1 198 ? -0.898 17.434  -2.350  1.00 17.42 ? 198 LYS A CA  1 
ATOM   1519 C C   . LYS A 1 198 ? -2.032 18.308  -1.795  1.00 17.51 ? 198 LYS A C   1 
ATOM   1520 O O   . LYS A 1 198 ? -2.991 18.611  -2.507  1.00 17.43 ? 198 LYS A O   1 
ATOM   1521 C CB  . LYS A 1 198 ? -1.015 16.006  -1.805  1.00 17.58 ? 198 LYS A CB  1 
ATOM   1522 C CG  . LYS A 1 198 ? -2.308 15.298  -2.201  1.00 18.03 ? 198 LYS A CG  1 
ATOM   1523 C CD  . LYS A 1 198 ? -2.535 15.301  -3.715  1.00 18.96 ? 198 LYS A CD  1 
ATOM   1524 C CE  . LYS A 1 198 ? -3.655 14.360  -4.117  1.00 19.98 ? 198 LYS A CE  1 
ATOM   1525 N NZ  . LYS A 1 198 ? -4.037 14.545  -5.554  1.00 20.49 ? 198 LYS A NZ  1 
ATOM   1526 N N   . LYS A 1 199 ? -1.904 18.721  -0.538  1.00 17.80 ? 199 LYS A N   1 
ATOM   1527 C CA  . LYS A 1 199 ? -2.920 19.542  0.127   1.00 18.24 ? 199 LYS A CA  1 
ATOM   1528 C C   . LYS A 1 199 ? -3.158 20.879  -0.562  1.00 18.39 ? 199 LYS A C   1 
ATOM   1529 O O   . LYS A 1 199 ? -4.307 21.253  -0.801  1.00 18.46 ? 199 LYS A O   1 
ATOM   1530 C CB  . LYS A 1 199 ? -2.534 19.792  1.593   1.00 18.71 ? 199 LYS A CB  1 
ATOM   1531 C CG  . LYS A 1 199 ? -3.496 20.692  2.384   1.00 19.08 ? 199 LYS A CG  1 
ATOM   1532 C CD  . LYS A 1 199 ? -4.886 20.095  2.487   1.00 20.94 ? 199 LYS A CD  1 
ATOM   1533 C CE  . LYS A 1 199 ? -5.749 20.868  3.488   1.00 22.21 ? 199 LYS A CE  1 
ATOM   1534 N NZ  . LYS A 1 199 ? -7.077 20.204  3.673   1.00 23.12 ? 199 LYS A NZ  1 
ATOM   1535 N N   . TYR A 1 200 ? -2.082 21.598  -0.874  1.00 18.42 ? 200 TYR A N   1 
ATOM   1536 C CA  . TYR A 1 200 ? -2.197 22.989  -1.329  1.00 18.95 ? 200 TYR A CA  1 
ATOM   1537 C C   . TYR A 1 200 ? -2.004 23.213  -2.832  1.00 19.33 ? 200 TYR A C   1 
ATOM   1538 O O   . TYR A 1 200 ? -2.304 24.294  -3.334  1.00 19.65 ? 200 TYR A O   1 
ATOM   1539 C CB  . TYR A 1 200 ? -1.245 23.871  -0.517  1.00 18.70 ? 200 TYR A CB  1 
ATOM   1540 C CG  . TYR A 1 200 ? -1.617 23.878  0.954   1.00 18.69 ? 200 TYR A CG  1 
ATOM   1541 C CD1 . TYR A 1 200 ? -2.762 24.539  1.388   1.00 18.70 ? 200 TYR A CD1 1 
ATOM   1542 C CD2 . TYR A 1 200 ? -0.849 23.207  1.903   1.00 18.13 ? 200 TYR A CD2 1 
ATOM   1543 C CE1 . TYR A 1 200 ? -3.131 24.546  2.725   1.00 18.92 ? 200 TYR A CE1 1 
ATOM   1544 C CE2 . TYR A 1 200 ? -1.217 23.204  3.260   1.00 18.09 ? 200 TYR A CE2 1 
ATOM   1545 C CZ  . TYR A 1 200 ? -2.360 23.883  3.657   1.00 18.68 ? 200 TYR A CZ  1 
ATOM   1546 O OH  . TYR A 1 200 ? -2.757 23.904  4.970   1.00 18.40 ? 200 TYR A OH  1 
ATOM   1547 N N   . ARG A 1 201 ? -1.502 22.211  -3.549  1.00 19.85 ? 201 ARG A N   1 
ATOM   1548 C CA  . ARG A 1 201 ? -1.331 22.334  -4.998  1.00 20.02 ? 201 ARG A CA  1 
ATOM   1549 C C   . ARG A 1 201 ? -1.863 21.134  -5.790  1.00 20.55 ? 201 ARG A C   1 
ATOM   1550 O O   . ARG A 1 201 ? -1.666 21.067  -7.006  1.00 20.78 ? 201 ARG A O   1 
ATOM   1551 C CB  . ARG A 1 201 ? 0.145  22.559  -5.322  1.00 20.20 ? 201 ARG A CB  1 
ATOM   1552 C CG  . ARG A 1 201 ? 0.757  23.821  -4.716  1.00 20.01 ? 201 ARG A CG  1 
ATOM   1553 C CD  . ARG A 1 201 ? 0.281  25.068  -5.439  1.00 20.31 ? 201 ARG A CD  1 
ATOM   1554 N NE  . ARG A 1 201 ? 0.994  26.258  -4.980  1.00 20.25 ? 201 ARG A NE  1 
ATOM   1555 C CZ  . ARG A 1 201 ? 0.581  27.065  -4.005  1.00 20.48 ? 201 ARG A CZ  1 
ATOM   1556 N NH1 . ARG A 1 201 ? -0.553 26.827  -3.351  1.00 20.04 ? 201 ARG A NH1 1 
ATOM   1557 N NH2 . ARG A 1 201 ? 1.312  28.119  -3.673  1.00 20.58 ? 201 ARG A NH2 1 
ATOM   1558 N N   . ASP A 1 202 ? -2.544 20.205  -5.114  1.00 20.83 ? 202 ASP A N   1 
ATOM   1559 C CA  . ASP A 1 202 ? -3.056 18.985  -5.736  1.00 21.22 ? 202 ASP A CA  1 
ATOM   1560 C C   . ASP A 1 202 ? -1.958 18.257  -6.521  1.00 21.21 ? 202 ASP A C   1 
ATOM   1561 O O   . ASP A 1 202 ? -2.219 17.649  -7.557  1.00 22.15 ? 202 ASP A O   1 
ATOM   1562 C CB  . ASP A 1 202 ? -4.258 19.304  -6.637  1.00 21.68 ? 202 ASP A CB  1 
ATOM   1563 C CG  . ASP A 1 202 ? -5.182 18.109  -6.840  1.00 22.26 ? 202 ASP A CG  1 
ATOM   1564 O OD1 . ASP A 1 202 ? -5.082 17.110  -6.094  1.00 24.73 ? 202 ASP A OD1 1 
ATOM   1565 O OD2 . ASP A 1 202 ? -6.023 18.173  -7.765  1.00 26.58 ? 202 ASP A OD2 1 
ATOM   1566 N N   . PHE A 1 203 ? -0.733 18.326  -6.004  1.00 21.00 ? 203 PHE A N   1 
ATOM   1567 C CA  . PHE A 1 203 ? 0.430  17.740  -6.649  1.00 20.90 ? 203 PHE A CA  1 
ATOM   1568 C C   . PHE A 1 203 ? 0.592  16.301  -6.183  1.00 20.86 ? 203 PHE A C   1 
ATOM   1569 O O   . PHE A 1 203 ? 0.567  16.032  -4.987  1.00 20.35 ? 203 PHE A O   1 
ATOM   1570 C CB  . PHE A 1 203 ? 1.681  18.556  -6.295  1.00 21.08 ? 203 PHE A CB  1 
ATOM   1571 C CG  . PHE A 1 203 ? 2.952  18.042  -6.918  1.00 20.77 ? 203 PHE A CG  1 
ATOM   1572 C CD1 . PHE A 1 203 ? 3.343  18.458  -8.185  1.00 20.80 ? 203 PHE A CD1 1 
ATOM   1573 C CD2 . PHE A 1 203 ? 3.768  17.152  -6.228  1.00 21.13 ? 203 PHE A CD2 1 
ATOM   1574 C CE1 . PHE A 1 203 ? 4.520  17.971  -8.763  1.00 21.58 ? 203 PHE A CE1 1 
ATOM   1575 C CE2 . PHE A 1 203 ? 4.941  16.671  -6.793  1.00 20.79 ? 203 PHE A CE2 1 
ATOM   1576 C CZ  . PHE A 1 203 ? 5.318  17.085  -8.061  1.00 20.78 ? 203 PHE A CZ  1 
ATOM   1577 N N   . ASP A 1 204 ? 0.759  15.385  -7.131  1.00 20.95 ? 204 ASP A N   1 
ATOM   1578 C CA  . ASP A 1 204 ? 1.179  14.022  -6.831  1.00 21.26 ? 204 ASP A CA  1 
ATOM   1579 C C   . ASP A 1 204 ? 2.541  13.795  -7.459  1.00 21.25 ? 204 ASP A C   1 
ATOM   1580 O O   . ASP A 1 204 ? 2.814  14.291  -8.549  1.00 21.55 ? 204 ASP A O   1 
ATOM   1581 C CB  . ASP A 1 204 ? 0.201  13.005  -7.413  1.00 21.89 ? 204 ASP A CB  1 
ATOM   1582 C CG  . ASP A 1 204 ? -1.187 13.133  -6.835  1.00 22.85 ? 204 ASP A CG  1 
ATOM   1583 O OD1 . ASP A 1 204 ? -1.400 12.679  -5.693  1.00 25.07 ? 204 ASP A OD1 1 
ATOM   1584 O OD2 . ASP A 1 204 ? -2.066 13.672  -7.530  1.00 25.88 ? 204 ASP A OD2 1 
ATOM   1585 N N   . ILE A 1 205 ? 3.395  13.045  -6.775  1.00 21.11 ? 205 ILE A N   1 
ATOM   1586 C CA  . ILE A 1 205 ? 4.678  12.661  -7.339  1.00 21.09 ? 205 ILE A CA  1 
ATOM   1587 C C   . ILE A 1 205 ? 4.359  11.667  -8.456  1.00 21.16 ? 205 ILE A C   1 
ATOM   1588 O O   . ILE A 1 205 ? 3.775  10.622  -8.182  1.00 20.80 ? 205 ILE A O   1 
ATOM   1589 C CB  . ILE A 1 205 ? 5.591  12.003  -6.279  1.00 20.82 ? 205 ILE A CB  1 
ATOM   1590 C CG1 . ILE A 1 205 ? 5.926  13.010  -5.173  1.00 20.89 ? 205 ILE A CG1 1 
ATOM   1591 C CG2 . ILE A 1 205 ? 6.869  11.478  -6.924  1.00 20.98 ? 205 ILE A CG2 1 
ATOM   1592 C CD1 . ILE A 1 205 ? 6.493  12.391  -3.912  1.00 21.15 ? 205 ILE A CD1 1 
ATOM   1593 N N   . PRO A 1 206 ? 4.693  12.010  -9.717  1.00 21.43 ? 206 PRO A N   1 
ATOM   1594 C CA  . PRO A 1 206 ? 4.341  11.152  -10.857 1.00 21.73 ? 206 PRO A CA  1 
ATOM   1595 C C   . PRO A 1 206 ? 4.703  9.677   -10.689 1.00 21.76 ? 206 PRO A C   1 
ATOM   1596 O O   . PRO A 1 206 ? 5.817  9.353   -10.270 1.00 20.96 ? 206 PRO A O   1 
ATOM   1597 C CB  . PRO A 1 206 ? 5.143  11.763  -12.008 1.00 21.87 ? 206 PRO A CB  1 
ATOM   1598 C CG  . PRO A 1 206 ? 5.248  13.202  -11.651 1.00 22.16 ? 206 PRO A CG  1 
ATOM   1599 C CD  . PRO A 1 206 ? 5.392  13.231  -10.161 1.00 21.47 ? 206 PRO A CD  1 
ATOM   1600 N N   . ALA A 1 207 ? 3.757  8.800   -11.022 1.00 22.10 ? 207 ALA A N   1 
ATOM   1601 C CA  . ALA A 1 207 ? 3.995  7.355   -11.016 1.00 22.47 ? 207 ALA A CA  1 
ATOM   1602 C C   . ALA A 1 207 ? 5.145  6.955   -11.943 1.00 22.64 ? 207 ALA A C   1 
ATOM   1603 O O   . ALA A 1 207 ? 5.796  5.939   -11.711 1.00 23.10 ? 207 ALA A O   1 
ATOM   1604 C CB  . ALA A 1 207 ? 2.722  6.604   -11.392 1.00 22.64 ? 207 ALA A CB  1 
ATOM   1605 N N   . GLU A 1 208 ? 5.409  7.771   -12.966 1.00 22.79 ? 208 GLU A N   1 
ATOM   1606 C CA  . GLU A 1 208 ? 6.477  7.507   -13.940 1.00 22.96 ? 208 GLU A CA  1 
ATOM   1607 C C   . GLU A 1 208 ? 7.867  7.585   -13.326 1.00 22.39 ? 208 GLU A C   1 
ATOM   1608 O O   . GLU A 1 208 ? 8.812  7.035   -13.884 1.00 22.85 ? 208 GLU A O   1 
ATOM   1609 C CB  . GLU A 1 208 ? 6.432  8.489   -15.123 1.00 23.72 ? 208 GLU A CB  1 
ATOM   1610 C CG  . GLU A 1 208 ? 5.079  8.621   -15.801 1.00 26.58 ? 208 GLU A CG  1 
ATOM   1611 C CD  . GLU A 1 208 ? 4.223  9.694   -15.157 1.00 29.48 ? 208 GLU A CD  1 
ATOM   1612 O OE1 . GLU A 1 208 ? 4.431  10.887  -15.481 1.00 33.08 ? 208 GLU A OE1 1 
ATOM   1613 O OE2 . GLU A 1 208 ? 3.364  9.344   -14.319 1.00 31.14 ? 208 GLU A OE2 1 
ATOM   1614 N N   . PHE A 1 209 ? 8.001  8.289   -12.201 1.00 21.62 ? 209 PHE A N   1 
ATOM   1615 C CA  . PHE A 1 209 ? 9.271  8.338   -11.478 1.00 20.75 ? 209 PHE A CA  1 
ATOM   1616 C C   . PHE A 1 209 ? 9.397  7.061   -10.634 1.00 20.04 ? 209 PHE A C   1 
ATOM   1617 O O   . PHE A 1 209 ? 9.224  7.084   -9.407  1.00 19.59 ? 209 PHE A O   1 
ATOM   1618 C CB  . PHE A 1 209 ? 9.378  9.607   -10.609 1.00 21.39 ? 209 PHE A CB  1 
ATOM   1619 C CG  . PHE A 1 209 ? 9.365  10.912  -11.393 1.00 21.63 ? 209 PHE A CG  1 
ATOM   1620 C CD1 . PHE A 1 209 ? 9.955  11.016  -12.648 1.00 22.84 ? 209 PHE A CD1 1 
ATOM   1621 C CD2 . PHE A 1 209 ? 8.797  12.051  -10.844 1.00 22.53 ? 209 PHE A CD2 1 
ATOM   1622 C CE1 . PHE A 1 209 ? 9.940  12.224  -13.348 1.00 23.24 ? 209 PHE A CE1 1 
ATOM   1623 C CE2 . PHE A 1 209 ? 8.785  13.259  -11.537 1.00 22.54 ? 209 PHE A CE2 1 
ATOM   1624 C CZ  . PHE A 1 209 ? 9.356  13.344  -12.789 1.00 22.75 ? 209 PHE A CZ  1 
ATOM   1625 N N   A SER A 1 210 ? 9.705  5.952   -11.301 0.50 19.42 ? 210 SER A N   1 
ATOM   1626 N N   B SER A 1 210 ? 9.713  5.960   -11.315 0.50 19.56 ? 210 SER A N   1 
ATOM   1627 C CA  A SER A 1 210 ? 9.755  4.644   -10.653 0.50 19.08 ? 210 SER A CA  1 
ATOM   1628 C CA  B SER A 1 210 ? 9.793  4.634   -10.703 0.50 19.34 ? 210 SER A CA  1 
ATOM   1629 C C   A SER A 1 210 ? 10.873 4.540   -9.612  0.50 18.61 ? 210 SER A C   1 
ATOM   1630 C C   B SER A 1 210 ? 10.860 4.560   -9.613  0.50 18.75 ? 210 SER A C   1 
ATOM   1631 O O   A SER A 1 210 ? 10.755 3.772   -8.659  0.50 18.53 ? 210 SER A O   1 
ATOM   1632 O O   B SER A 1 210 ? 10.696 3.839   -8.631  0.50 18.69 ? 210 SER A O   1 
ATOM   1633 C CB  A SER A 1 210 ? 9.915  3.533   -11.695 0.50 19.03 ? 210 SER A CB  1 
ATOM   1634 C CB  B SER A 1 210 ? 10.092 3.571   -11.768 0.50 19.41 ? 210 SER A CB  1 
ATOM   1635 O OG  A SER A 1 210 ? 11.128 3.681   -12.411 0.50 18.33 ? 210 SER A OG  1 
ATOM   1636 O OG  B SER A 1 210 ? 9.248  3.716   -12.896 0.50 20.14 ? 210 SER A OG  1 
ATOM   1637 N N   . GLY A 1 211 ? 11.954 5.296   -9.801  1.00 18.28 ? 211 GLY A N   1 
ATOM   1638 C CA  . GLY A 1 211 ? 13.056 5.330   -8.828  1.00 17.94 ? 211 GLY A CA  1 
ATOM   1639 C C   . GLY A 1 211 ? 12.664 6.009   -7.527  1.00 17.29 ? 211 GLY A C   1 
ATOM   1640 O O   . GLY A 1 211 ? 12.926 5.486   -6.430  1.00 17.00 ? 211 GLY A O   1 
ATOM   1641 N N   . VAL A 1 212 ? 12.029 7.173   -7.648  1.00 16.79 ? 212 VAL A N   1 
ATOM   1642 C CA  . VAL A 1 212 ? 11.508 7.884   -6.481  1.00 16.59 ? 212 VAL A CA  1 
ATOM   1643 C C   . VAL A 1 212 ? 10.496 7.010   -5.731  1.00 16.48 ? 212 VAL A C   1 
ATOM   1644 O O   . VAL A 1 212 ? 10.562 6.893   -4.510  1.00 15.71 ? 212 VAL A O   1 
ATOM   1645 C CB  . VAL A 1 212 ? 10.874 9.249   -6.855  1.00 16.81 ? 212 VAL A CB  1 
ATOM   1646 C CG1 . VAL A 1 212 ? 10.258 9.918   -5.614  1.00 15.78 ? 212 VAL A CG1 1 
ATOM   1647 C CG2 . VAL A 1 212 ? 11.920 10.170  -7.508  1.00 15.90 ? 212 VAL A CG2 1 
ATOM   1648 N N   . TRP A 1 213 ? 9.579  6.379   -6.464  1.00 16.44 ? 213 TRP A N   1 
ATOM   1649 C CA  . TRP A 1 213 ? 8.555  5.546   -5.831  1.00 16.88 ? 213 TRP A CA  1 
ATOM   1650 C C   . TRP A 1 213 ? 9.103  4.262   -5.209  1.00 16.53 ? 213 TRP A C   1 
ATOM   1651 O O   . TRP A 1 213 ? 8.627  3.831   -4.158  1.00 16.95 ? 213 TRP A O   1 
ATOM   1652 C CB  . TRP A 1 213 ? 7.409  5.260   -6.806  1.00 17.40 ? 213 TRP A CB  1 
ATOM   1653 C CG  . TRP A 1 213 ? 6.431  6.378   -6.793  1.00 17.90 ? 213 TRP A CG  1 
ATOM   1654 C CD1 . TRP A 1 213 ? 6.219  7.302   -7.775  1.00 18.64 ? 213 TRP A CD1 1 
ATOM   1655 C CD2 . TRP A 1 213 ? 5.572  6.733   -5.710  1.00 18.22 ? 213 TRP A CD2 1 
ATOM   1656 N NE1 . TRP A 1 213 ? 5.256  8.197   -7.377  1.00 18.28 ? 213 TRP A NE1 1 
ATOM   1657 C CE2 . TRP A 1 213 ? 4.839  7.867   -6.114  1.00 18.95 ? 213 TRP A CE2 1 
ATOM   1658 C CE3 . TRP A 1 213 ? 5.333  6.186   -4.443  1.00 18.79 ? 213 TRP A CE3 1 
ATOM   1659 C CZ2 . TRP A 1 213 ? 3.880  8.468   -5.294  1.00 18.98 ? 213 TRP A CZ2 1 
ATOM   1660 C CZ3 . TRP A 1 213 ? 4.383  6.789   -3.625  1.00 19.00 ? 213 TRP A CZ3 1 
ATOM   1661 C CH2 . TRP A 1 213 ? 3.669  7.917   -4.058  1.00 18.75 ? 213 TRP A CH2 1 
ATOM   1662 N N   . ARG A 1 214 ? 10.115 3.672   -5.840  1.00 16.37 ? 214 ARG A N   1 
ATOM   1663 C CA  . ARG A 1 214 ? 10.823 2.528   -5.259  1.00 16.21 ? 214 ARG A CA  1 
ATOM   1664 C C   . ARG A 1 214 ? 11.414 2.932   -3.907  1.00 15.76 ? 214 ARG A C   1 
ATOM   1665 O O   . ARG A 1 214 ? 11.233 2.249   -2.900  1.00 14.97 ? 214 ARG A O   1 
ATOM   1666 C CB  . ARG A 1 214 ? 11.935 2.057   -6.202  1.00 15.92 ? 214 ARG A CB  1 
ATOM   1667 C CG  . ARG A 1 214 ? 12.618 0.773   -5.774  1.00 16.68 ? 214 ARG A CG  1 
ATOM   1668 C CD  . ARG A 1 214 ? 13.759 0.411   -6.715  1.00 17.46 ? 214 ARG A CD  1 
ATOM   1669 N NE  . ARG A 1 214 ? 15.014 1.049   -6.308  1.00 17.59 ? 214 ARG A NE  1 
ATOM   1670 C CZ  . ARG A 1 214 ? 15.670 1.992   -6.986  1.00 17.20 ? 214 ARG A CZ  1 
ATOM   1671 N NH1 . ARG A 1 214 ? 16.808 2.469   -6.494  1.00 16.32 ? 214 ARG A NH1 1 
ATOM   1672 N NH2 . ARG A 1 214 ? 15.224 2.452   -8.151  1.00 17.96 ? 214 ARG A NH2 1 
ATOM   1673 N N   . TYR A 1 215 ? 12.108 4.064   -3.906  1.00 15.44 ? 215 TYR A N   1 
ATOM   1674 C CA  . TYR A 1 215 ? 12.707 4.639   -2.700  1.00 15.72 ? 215 TYR A CA  1 
ATOM   1675 C C   . TYR A 1 215 ? 11.676 4.902   -1.602  1.00 15.82 ? 215 TYR A C   1 
ATOM   1676 O O   . TYR A 1 215 ? 11.877 4.517   -0.443  1.00 15.55 ? 215 TYR A O   1 
ATOM   1677 C CB  . TYR A 1 215 ? 13.420 5.940   -3.081  1.00 15.13 ? 215 TYR A CB  1 
ATOM   1678 C CG  . TYR A 1 215 ? 14.117 6.663   -1.957  1.00 14.80 ? 215 TYR A CG  1 
ATOM   1679 C CD1 . TYR A 1 215 ? 14.999 5.997   -1.111  1.00 14.78 ? 215 TYR A CD1 1 
ATOM   1680 C CD2 . TYR A 1 215 ? 13.932 8.035   -1.771  1.00 14.93 ? 215 TYR A CD2 1 
ATOM   1681 C CE1 . TYR A 1 215 ? 15.649 6.662   -0.091  1.00 13.91 ? 215 TYR A CE1 1 
ATOM   1682 C CE2 . TYR A 1 215 ? 14.581 8.711   -0.752  1.00 14.20 ? 215 TYR A CE2 1 
ATOM   1683 C CZ  . TYR A 1 215 ? 15.435 8.018   0.083   1.00 14.40 ? 215 TYR A CZ  1 
ATOM   1684 O OH  . TYR A 1 215 ? 16.086 8.679   1.082   1.00 14.14 ? 215 TYR A OH  1 
ATOM   1685 N N   . LEU A 1 216 ? 10.574 5.554   -1.970  1.00 16.29 ? 216 LEU A N   1 
ATOM   1686 C CA  . LEU A 1 216 ? 9.503  5.861   -1.020  1.00 16.74 ? 216 LEU A CA  1 
ATOM   1687 C C   . LEU A 1 216 ? 8.899  4.598   -0.413  1.00 16.90 ? 216 LEU A C   1 
ATOM   1688 O O   . LEU A 1 216 ? 8.666  4.540   0.795   1.00 16.60 ? 216 LEU A O   1 
ATOM   1689 C CB  . LEU A 1 216 ? 8.399  6.699   -1.680  1.00 17.12 ? 216 LEU A CB  1 
ATOM   1690 C CG  . LEU A 1 216 ? 8.740  8.159   -2.002  1.00 17.96 ? 216 LEU A CG  1 
ATOM   1691 C CD1 . LEU A 1 216 ? 7.555  8.849   -2.676  1.00 19.67 ? 216 LEU A CD1 1 
ATOM   1692 C CD2 . LEU A 1 216 ? 9.150  8.918   -0.754  1.00 20.49 ? 216 LEU A CD2 1 
ATOM   1693 N N   . HIS A 1 217 ? 8.660  3.590   -1.245  1.00 17.20 ? 217 HIS A N   1 
ATOM   1694 C CA  . HIS A 1 217 ? 8.125  2.319   -0.766  1.00 17.73 ? 217 HIS A CA  1 
ATOM   1695 C C   . HIS A 1 217 ? 9.086  1.638   0.207   1.00 17.68 ? 217 HIS A C   1 
ATOM   1696 O O   . HIS A 1 217 ? 8.670  1.190   1.281   1.00 18.03 ? 217 HIS A O   1 
ATOM   1697 C CB  . HIS A 1 217 ? 7.788  1.389   -1.937  1.00 18.31 ? 217 HIS A CB  1 
ATOM   1698 C CG  . HIS A 1 217 ? 6.585  1.821   -2.718  1.00 19.87 ? 217 HIS A CG  1 
ATOM   1699 N ND1 . HIS A 1 217 ? 5.494  2.427   -2.132  1.00 22.14 ? 217 HIS A ND1 1 
ATOM   1700 C CD2 . HIS A 1 217 ? 6.302  1.732   -4.039  1.00 21.29 ? 217 HIS A CD2 1 
ATOM   1701 C CE1 . HIS A 1 217 ? 4.592  2.698   -3.060  1.00 22.03 ? 217 HIS A CE1 1 
ATOM   1702 N NE2 . HIS A 1 217 ? 5.060  2.289   -4.226  1.00 22.44 ? 217 HIS A NE2 1 
ATOM   1703 N N   . ASN A 1 218 ? 10.363 1.567   -0.166  1.00 17.51 ? 218 ASN A N   1 
ATOM   1704 C CA  . ASN A 1 218 ? 11.401 1.052   0.732   1.00 17.75 ? 218 ASN A CA  1 
ATOM   1705 C C   . ASN A 1 218 ? 11.478 1.844   2.037   1.00 17.65 ? 218 ASN A C   1 
ATOM   1706 O O   . ASN A 1 218 ? 11.617 1.258   3.115   1.00 17.47 ? 218 ASN A O   1 
ATOM   1707 C CB  . ASN A 1 218 ? 12.773 1.076   0.053   1.00 17.59 ? 218 ASN A CB  1 
ATOM   1708 C CG  . ASN A 1 218 ? 12.885 0.087   -1.091  1.00 18.39 ? 218 ASN A CG  1 
ATOM   1709 O OD1 . ASN A 1 218 ? 12.157 -0.901  -1.150  1.00 20.41 ? 218 ASN A OD1 1 
ATOM   1710 N ND2 . ASN A 1 218 ? 13.802 0.350   -2.004  1.00 18.30 ? 218 ASN A ND2 1 
ATOM   1711 N N   . ALA A 1 219 ? 11.393 3.170   1.924   1.00 17.72 ? 219 ALA A N   1 
ATOM   1712 C CA  . ALA A 1 219 ? 11.545 4.073   3.069   1.00 18.20 ? 219 ALA A CA  1 
ATOM   1713 C C   . ALA A 1 219 ? 10.356 4.025   4.022   1.00 18.51 ? 219 ALA A C   1 
ATOM   1714 O O   . ALA A 1 219 ? 10.536 3.977   5.247   1.00 18.41 ? 219 ALA A O   1 
ATOM   1715 C CB  . ALA A 1 219 ? 11.775 5.513   2.581   1.00 17.61 ? 219 ALA A CB  1 
ATOM   1716 N N   . TYR A 1 220 ? 9.143  4.035   3.469   1.00 19.03 ? 220 TYR A N   1 
ATOM   1717 C CA  . TYR A 1 220 ? 7.932  3.987   4.294   1.00 19.65 ? 220 TYR A CA  1 
ATOM   1718 C C   . TYR A 1 220 ? 7.726  2.601   4.935   1.00 20.16 ? 220 TYR A C   1 
ATOM   1719 O O   . TYR A 1 220 ? 6.909  2.449   5.839   1.00 20.50 ? 220 TYR A O   1 
ATOM   1720 C CB  . TYR A 1 220 ? 6.690  4.479   3.514   1.00 19.95 ? 220 TYR A CB  1 
ATOM   1721 C CG  . TYR A 1 220 ? 6.590  6.007   3.433   1.00 19.84 ? 220 TYR A CG  1 
ATOM   1722 C CD1 . TYR A 1 220 ? 6.162  6.760   4.528   1.00 20.23 ? 220 TYR A CD1 1 
ATOM   1723 C CD2 . TYR A 1 220 ? 6.936  6.694   2.269   1.00 20.82 ? 220 TYR A CD2 1 
ATOM   1724 C CE1 . TYR A 1 220 ? 6.081  8.153   4.462   1.00 19.77 ? 220 TYR A CE1 1 
ATOM   1725 C CE2 . TYR A 1 220 ? 6.863  8.076   2.193   1.00 20.27 ? 220 TYR A CE2 1 
ATOM   1726 C CZ  . TYR A 1 220 ? 6.426  8.802   3.287   1.00 20.07 ? 220 TYR A CZ  1 
ATOM   1727 O OH  . TYR A 1 220 ? 6.360  10.174  3.200   1.00 19.88 ? 220 TYR A OH  1 
ATOM   1728 N N   . ALA A 1 221 ? 8.496  1.609   4.488   1.00 20.41 ? 221 ALA A N   1 
ATOM   1729 C CA  . ALA A 1 221 ? 8.555  0.295   5.136   1.00 20.55 ? 221 ALA A CA  1 
ATOM   1730 C C   . ALA A 1 221 ? 9.490  0.258   6.357   1.00 20.92 ? 221 ALA A C   1 
ATOM   1731 O O   . ALA A 1 221 ? 9.572  -0.766  7.042   1.00 21.80 ? 221 ALA A O   1 
ATOM   1732 C CB  . ALA A 1 221 ? 8.984  -0.760  4.118   1.00 20.99 ? 221 ALA A CB  1 
ATOM   1733 N N   . ARG A 1 222 ? 10.205 1.348   6.633   1.00 20.53 ? 222 ARG A N   1 
ATOM   1734 C CA  . ARG A 1 222 ? 11.120 1.396   7.772   1.00 20.36 ? 222 ARG A CA  1 
ATOM   1735 C C   . ARG A 1 222 ? 10.556 2.269   8.897   1.00 20.34 ? 222 ARG A C   1 
ATOM   1736 O O   . ARG A 1 222 ? 10.334 3.464   8.709   1.00 19.89 ? 222 ARG A O   1 
ATOM   1737 C CB  . ARG A 1 222 ? 12.496 1.899   7.329   1.00 20.57 ? 222 ARG A CB  1 
ATOM   1738 C CG  . ARG A 1 222 ? 13.257 0.907   6.449   1.00 21.16 ? 222 ARG A CG  1 
ATOM   1739 C CD  . ARG A 1 222 ? 13.694 -0.322  7.243   1.00 21.88 ? 222 ARG A CD  1 
ATOM   1740 N NE  . ARG A 1 222 ? 14.684 0.012   8.269   1.00 21.87 ? 222 ARG A NE  1 
ATOM   1741 C CZ  . ARG A 1 222 ? 15.998 0.111   8.054   1.00 23.25 ? 222 ARG A CZ  1 
ATOM   1742 N NH1 . ARG A 1 222 ? 16.520 -0.111  6.850   1.00 23.39 ? 222 ARG A NH1 1 
ATOM   1743 N NH2 . ARG A 1 222 ? 16.806 0.426   9.058   1.00 23.18 ? 222 ARG A NH2 1 
ATOM   1744 N N   A GLU A 1 223 ? 10.334 1.654   10.060  0.50 20.22 ? 223 GLU A N   1 
ATOM   1745 N N   B GLU A 1 223 ? 10.333 1.665   10.063  0.50 20.19 ? 223 GLU A N   1 
ATOM   1746 C CA  A GLU A 1 223 ? 9.775  2.346   11.227  0.50 20.35 ? 223 GLU A CA  1 
ATOM   1747 C CA  B GLU A 1 223 ? 9.748  2.378   11.201  0.50 20.30 ? 223 GLU A CA  1 
ATOM   1748 C C   A GLU A 1 223 ? 10.579 3.580   11.637  0.50 19.97 ? 223 GLU A C   1 
ATOM   1749 C C   B GLU A 1 223 ? 10.584 3.573   11.671  0.50 19.95 ? 223 GLU A C   1 
ATOM   1750 O O   A GLU A 1 223 ? 10.002 4.568   12.089  0.50 19.62 ? 223 GLU A O   1 
ATOM   1751 O O   B GLU A 1 223 ? 10.028 4.539   12.191  0.50 19.63 ? 223 GLU A O   1 
ATOM   1752 C CB  A GLU A 1 223 ? 9.661  1.395   12.424  0.50 20.49 ? 223 GLU A CB  1 
ATOM   1753 C CB  B GLU A 1 223 ? 9.482  1.423   12.369  0.50 20.39 ? 223 GLU A CB  1 
ATOM   1754 C CG  A GLU A 1 223 ? 11.005 0.957   13.002  0.50 21.04 ? 223 GLU A CG  1 
ATOM   1755 C CG  B GLU A 1 223 ? 8.353  0.435   12.102  0.50 20.95 ? 223 GLU A CG  1 
ATOM   1756 C CD  A GLU A 1 223 ? 10.878 -0.008  14.162  0.50 21.40 ? 223 GLU A CD  1 
ATOM   1757 C CD  B GLU A 1 223 ? 8.246  -0.646  13.159  0.50 21.17 ? 223 GLU A CD  1 
ATOM   1758 O OE1 A GLU A 1 223 ? 9.792  -0.101  14.769  0.50 23.30 ? 223 GLU A OE1 1 
ATOM   1759 O OE1 B GLU A 1 223 ? 8.719  -0.433  14.294  0.50 23.50 ? 223 GLU A OE1 1 
ATOM   1760 O OE2 A GLU A 1 223 ? 11.887 -0.670  14.472  0.50 23.56 ? 223 GLU A OE2 1 
ATOM   1761 O OE2 B GLU A 1 223 ? 7.683  -1.719  12.858  0.50 22.27 ? 223 GLU A OE2 1 
ATOM   1762 N N   . GLU A 1 224 ? 11.901 3.521   11.475  1.00 19.77 ? 224 GLU A N   1 
ATOM   1763 C CA  . GLU A 1 224 ? 12.784 4.643   11.868  1.00 19.76 ? 224 GLU A CA  1 
ATOM   1764 C C   . GLU A 1 224 ? 12.382 5.940   11.178  1.00 19.38 ? 224 GLU A C   1 
ATOM   1765 O O   . GLU A 1 224 ? 12.459 7.013   11.772  1.00 19.19 ? 224 GLU A O   1 
ATOM   1766 C CB  . GLU A 1 224 ? 14.254 4.348   11.569  1.00 19.78 ? 224 GLU A CB  1 
ATOM   1767 C CG  . GLU A 1 224 ? 14.811 3.147   12.312  1.00 20.14 ? 224 GLU A CG  1 
ATOM   1768 C CD  . GLU A 1 224 ? 14.731 1.864   11.525  1.00 20.39 ? 224 GLU A CD  1 
ATOM   1769 O OE1 . GLU A 1 224 ? 13.895 1.757   10.607  1.00 21.10 ? 224 GLU A OE1 1 
ATOM   1770 O OE2 . GLU A 1 224 ? 15.515 0.947   11.829  1.00 22.72 ? 224 GLU A OE2 1 
ATOM   1771 N N   . PHE A 1 225 ? 11.925 5.822   9.936   1.00 18.97 ? 225 PHE A N   1 
ATOM   1772 C CA  . PHE A 1 225 ? 11.379 6.950   9.196   1.00 19.08 ? 225 PHE A CA  1 
ATOM   1773 C C   . PHE A 1 225 ? 9.920  7.222   9.574   1.00 19.01 ? 225 PHE A C   1 
ATOM   1774 O O   . PHE A 1 225 ? 9.592  8.302   10.070  1.00 18.90 ? 225 PHE A O   1 
ATOM   1775 C CB  . PHE A 1 225 ? 11.506 6.702   7.686   1.00 18.69 ? 225 PHE A CB  1 
ATOM   1776 C CG  . PHE A 1 225 ? 10.779 7.710   6.832   1.00 18.74 ? 225 PHE A CG  1 
ATOM   1777 C CD1 . PHE A 1 225 ? 10.786 9.070   7.153   1.00 18.72 ? 225 PHE A CD1 1 
ATOM   1778 C CD2 . PHE A 1 225 ? 10.099 7.300   5.694   1.00 18.81 ? 225 PHE A CD2 1 
ATOM   1779 C CE1 . PHE A 1 225 ? 10.113 9.987   6.356   1.00 17.74 ? 225 PHE A CE1 1 
ATOM   1780 C CE2 . PHE A 1 225 ? 9.431  8.215   4.888   1.00 19.00 ? 225 PHE A CE2 1 
ATOM   1781 C CZ  . PHE A 1 225 ? 9.440  9.559   5.222   1.00 18.30 ? 225 PHE A CZ  1 
ATOM   1782 N N   . THR A 1 226 ? 9.050  6.243   9.352   1.00 19.42 ? 226 THR A N   1 
ATOM   1783 C CA  . THR A 1 226 ? 7.610  6.472   9.476   1.00 19.51 ? 226 THR A CA  1 
ATOM   1784 C C   . THR A 1 226 ? 7.156  6.843   10.892  1.00 19.41 ? 226 THR A C   1 
ATOM   1785 O O   . THR A 1 226 ? 6.247  7.653   11.045  1.00 19.12 ? 226 THR A O   1 
ATOM   1786 C CB  . THR A 1 226 ? 6.798  5.263   9.005   1.00 19.77 ? 226 THR A CB  1 
ATOM   1787 O OG1 . THR A 1 226 ? 7.197  4.109   9.745   1.00 21.13 ? 226 THR A OG1 1 
ATOM   1788 C CG2 . THR A 1 226 ? 7.012  5.017   7.528   1.00 18.95 ? 226 THR A CG2 1 
ATOM   1789 N N   . HIS A 1 227 ? 7.778  6.256   11.916  1.00 19.37 ? 227 HIS A N   1 
ATOM   1790 C CA  . HIS A 1 227 ? 7.382  6.525   13.303  1.00 19.49 ? 227 HIS A CA  1 
ATOM   1791 C C   . HIS A 1 227 ? 8.008  7.803   13.876  1.00 19.11 ? 227 HIS A C   1 
ATOM   1792 O O   . HIS A 1 227 ? 7.705  8.184   15.007  1.00 19.18 ? 227 HIS A O   1 
ATOM   1793 C CB  . HIS A 1 227 ? 7.694  5.326   14.211  1.00 19.73 ? 227 HIS A CB  1 
ATOM   1794 C CG  . HIS A 1 227 ? 6.855  4.118   13.928  1.00 20.26 ? 227 HIS A CG  1 
ATOM   1795 N ND1 . HIS A 1 227 ? 6.586  3.162   14.884  1.00 21.14 ? 227 HIS A ND1 1 
ATOM   1796 C CD2 . HIS A 1 227 ? 6.208  3.720   12.807  1.00 21.07 ? 227 HIS A CD2 1 
ATOM   1797 C CE1 . HIS A 1 227 ? 5.822  2.220   14.359  1.00 21.60 ? 227 HIS A CE1 1 
ATOM   1798 N NE2 . HIS A 1 227 ? 5.572  2.538   13.102  1.00 21.12 ? 227 HIS A NE2 1 
ATOM   1799 N N   . THR A 1 228 ? 8.873  8.464   13.108  1.00 18.29 ? 228 THR A N   1 
ATOM   1800 C CA  . THR A 1 228 ? 9.394  9.771   13.498  1.00 18.29 ? 228 THR A CA  1 
ATOM   1801 C C   . THR A 1 228 ? 8.706  10.915  12.743  1.00 18.23 ? 228 THR A C   1 
ATOM   1802 O O   . THR A 1 228 ? 8.967  12.080  13.016  1.00 17.97 ? 228 THR A O   1 
ATOM   1803 C CB  . THR A 1 228 ? 10.937 9.852   13.312  1.00 18.22 ? 228 THR A CB  1 
ATOM   1804 O OG1 . THR A 1 228 ? 11.283 9.629   11.941  1.00 16.87 ? 228 THR A OG1 1 
ATOM   1805 C CG2 . THR A 1 228 ? 11.628 8.811   14.176  1.00 17.92 ? 228 THR A CG2 1 
ATOM   1806 N N   . CYS A 1 229 ? 7.820  10.580  11.806  1.00 18.29 ? 229 CYS A N   1 
ATOM   1807 C CA  . CYS A 1 229 ? 7.055  11.587  11.075  1.00 18.46 ? 229 CYS A CA  1 
ATOM   1808 C C   . CYS A 1 229 ? 6.027  12.231  11.983  1.00 18.80 ? 229 CYS A C   1 
ATOM   1809 O O   . CYS A 1 229 ? 5.419  11.543  12.812  1.00 18.75 ? 229 CYS A O   1 
ATOM   1810 C CB  . CYS A 1 229 ? 6.305  10.964  9.893   1.00 18.55 ? 229 CYS A CB  1 
ATOM   1811 S SG  . CYS A 1 229 ? 7.331  10.434  8.521   1.00 17.98 ? 229 CYS A SG  1 
ATOM   1812 N N   . PRO A 1 230 ? 5.784  13.538  11.800  1.00 18.97 ? 230 PRO A N   1 
ATOM   1813 C CA  . PRO A 1 230 ? 4.671  14.138  12.522  1.00 19.35 ? 230 PRO A CA  1 
ATOM   1814 C C   . PRO A 1 230 ? 3.377  13.721  11.841  1.00 19.51 ? 230 PRO A C   1 
ATOM   1815 O O   . PRO A 1 230 ? 3.417  13.177  10.738  1.00 19.26 ? 230 PRO A O   1 
ATOM   1816 C CB  . PRO A 1 230 ? 4.916  15.633  12.345  1.00 19.47 ? 230 PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 230 ? 5.538  15.728  10.996  1.00 19.37 ? 230 PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 230 ? 6.438  14.511  10.903  1.00 18.96 ? 230 PRO A CD  1 
ATOM   1819 N N   . GLU A 1 231 ? 2.240  13.948  12.488  1.00 19.77 ? 231 GLU A N   1 
ATOM   1820 C CA  . GLU A 1 231 ? 0.956  13.734  11.826  1.00 20.00 ? 231 GLU A CA  1 
ATOM   1821 C C   . GLU A 1 231 ? 0.876  14.660  10.616  1.00 19.93 ? 231 GLU A C   1 
ATOM   1822 O O   . GLU A 1 231 ? 1.403  15.781  10.652  1.00 19.45 ? 231 GLU A O   1 
ATOM   1823 C CB  . GLU A 1 231 ? -0.201 14.006  12.785  1.00 20.33 ? 231 GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 231 ? -0.311 12.991  13.904  1.00 22.25 ? 231 GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 231 ? -0.744 11.617  13.420  1.00 25.06 ? 231 GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 231 ? -1.517 11.534  12.442  1.00 27.03 ? 231 GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 231 ? -0.308 10.615  14.023  1.00 28.31 ? 231 GLU A OE2 1 
ATOM   1828 N N   . ASP A 1 232 ? 0.242  14.189  9.544   1.00 19.78 ? 232 ASP A N   1 
ATOM   1829 C CA  . ASP A 1 232 ? 0.118  14.972  8.305   1.00 19.94 ? 232 ASP A CA  1 
ATOM   1830 C C   . ASP A 1 232 ? -0.400 16.392  8.538   1.00 19.65 ? 232 ASP A C   1 
ATOM   1831 O O   . ASP A 1 232 ? 0.072  17.349  7.918   1.00 18.85 ? 232 ASP A O   1 
ATOM   1832 C CB  . ASP A 1 232 ? -0.807 14.259  7.305   1.00 20.29 ? 232 ASP A CB  1 
ATOM   1833 C CG  . ASP A 1 232 ? -0.154 13.058  6.638   1.00 21.25 ? 232 ASP A CG  1 
ATOM   1834 O OD1 . ASP A 1 232 ? 0.997  12.700  6.977   1.00 22.20 ? 232 ASP A OD1 1 
ATOM   1835 O OD2 . ASP A 1 232 ? -0.799 12.472  5.744   1.00 23.40 ? 232 ASP A OD2 1 
ATOM   1836 N N   . LYS A 1 233 ? -1.379 16.526  9.426   1.00 19.79 ? 233 LYS A N   1 
ATOM   1837 C CA  . LYS A 1 233 ? -1.976 17.834  9.721   1.00 19.73 ? 233 LYS A CA  1 
ATOM   1838 C C   . LYS A 1 233 ? -0.997 18.874  10.298  1.00 19.00 ? 233 LYS A C   1 
ATOM   1839 O O   . LYS A 1 233 ? -1.211 20.069  10.132  1.00 18.82 ? 233 LYS A O   1 
ATOM   1840 C CB  . LYS A 1 233 ? -3.207 17.676  10.623  1.00 20.48 ? 233 LYS A CB  1 
ATOM   1841 C CG  . LYS A 1 233 ? -2.959 16.952  11.944  1.00 22.01 ? 233 LYS A CG  1 
ATOM   1842 C CD  . LYS A 1 233 ? -2.660 17.903  13.085  1.00 23.94 ? 233 LYS A CD  1 
ATOM   1843 C CE  . LYS A 1 233 ? -2.981 17.261  14.428  1.00 23.82 ? 233 LYS A CE  1 
ATOM   1844 N NZ  . LYS A 1 233 ? -3.145 18.289  15.491  1.00 25.43 ? 233 LYS A NZ  1 
ATOM   1845 N N   . GLU A 1 234 ? 0.073  18.426  10.957  1.00 18.54 ? 234 GLU A N   1 
ATOM   1846 C CA  . GLU A 1 234 ? 1.111  19.341  11.446  1.00 18.50 ? 234 GLU A CA  1 
ATOM   1847 C C   . GLU A 1 234 ? 1.833  19.986  10.265  1.00 17.97 ? 234 GLU A C   1 
ATOM   1848 O O   . GLU A 1 234 ? 2.058  21.195  10.246  1.00 17.06 ? 234 GLU A O   1 
ATOM   1849 C CB  . GLU A 1 234 ? 2.124  18.617  12.332  1.00 18.38 ? 234 GLU A CB  1 
ATOM   1850 C CG  . GLU A 1 234 ? 1.564  18.077  13.626  1.00 19.19 ? 234 GLU A CG  1 
ATOM   1851 C CD  . GLU A 1 234 ? 0.969  19.149  14.520  1.00 21.38 ? 234 GLU A CD  1 
ATOM   1852 O OE1 . GLU A 1 234 ? 1.536  20.264  14.601  1.00 20.82 ? 234 GLU A OE1 1 
ATOM   1853 O OE2 . GLU A 1 234 ? -0.069 18.867  15.154  1.00 23.99 ? 234 GLU A OE2 1 
ATOM   1854 N N   . ILE A 1 235 ? 2.184  19.158  9.282   1.00 17.73 ? 235 ILE A N   1 
ATOM   1855 C CA  . ILE A 1 235 ? 2.774  19.639  8.036   1.00 17.83 ? 235 ILE A CA  1 
ATOM   1856 C C   . ILE A 1 235 ? 1.797  20.580  7.317   1.00 17.93 ? 235 ILE A C   1 
ATOM   1857 O O   . ILE A 1 235 ? 2.172  21.677  6.901   1.00 17.91 ? 235 ILE A O   1 
ATOM   1858 C CB  . ILE A 1 235 ? 3.194  18.450  7.128   1.00 17.61 ? 235 ILE A CB  1 
ATOM   1859 C CG1 . ILE A 1 235 ? 4.388  17.726  7.759   1.00 17.85 ? 235 ILE A CG1 1 
ATOM   1860 C CG2 . ILE A 1 235 ? 3.532  18.928  5.704   1.00 17.14 ? 235 ILE A CG2 1 
ATOM   1861 C CD1 . ILE A 1 235 ? 4.695  16.370  7.153   1.00 17.67 ? 235 ILE A CD1 1 
ATOM   1862 N N   . GLU A 1 236 ? 0.539  20.164  7.194   1.00 18.29 ? 236 GLU A N   1 
ATOM   1863 C CA  . GLU A 1 236 ? -0.469 21.006  6.545   1.00 18.40 ? 236 GLU A CA  1 
ATOM   1864 C C   . GLU A 1 236 ? -0.616 22.359  7.250   1.00 18.25 ? 236 GLU A C   1 
ATOM   1865 O O   . GLU A 1 236 ? -0.720 23.396  6.589   1.00 17.60 ? 236 GLU A O   1 
ATOM   1866 C CB  . GLU A 1 236 ? -1.813 20.277  6.458   1.00 18.41 ? 236 GLU A CB  1 
ATOM   1867 C CG  . GLU A 1 236 ? -1.771 19.084  5.515   1.00 18.84 ? 236 GLU A CG  1 
ATOM   1868 C CD  . GLU A 1 236 ? -3.062 18.293  5.480   1.00 19.94 ? 236 GLU A CD  1 
ATOM   1869 O OE1 . GLU A 1 236 ? -4.038 18.706  6.141   1.00 22.89 ? 236 GLU A OE1 1 
ATOM   1870 O OE2 . GLU A 1 236 ? -3.088 17.255  4.787   1.00 21.75 ? 236 GLU A OE2 1 
ATOM   1871 N N   . ASN A 1 237 ? -0.580 22.350  8.583   1.00 18.09 ? 237 ASN A N   1 
ATOM   1872 C CA  . ASN A 1 237 ? -0.665 23.591  9.365   1.00 18.50 ? 237 ASN A CA  1 
ATOM   1873 C C   . ASN A 1 237 ? 0.464  24.570  9.062   1.00 18.25 ? 237 ASN A C   1 
ATOM   1874 O O   . ASN A 1 237 ? 0.238  25.775  9.000   1.00 18.30 ? 237 ASN A O   1 
ATOM   1875 C CB  . ASN A 1 237 ? -0.677 23.296  10.874  1.00 18.81 ? 237 ASN A CB  1 
ATOM   1876 C CG  . ASN A 1 237 ? -2.012 22.776  11.361  1.00 20.29 ? 237 ASN A CG  1 
ATOM   1877 O OD1 . ASN A 1 237 ? -3.002 22.755  10.622  1.00 22.97 ? 237 ASN A OD1 1 
ATOM   1878 N ND2 . ASN A 1 237 ? -2.044 22.338  12.619  1.00 22.79 ? 237 ASN A ND2 1 
ATOM   1879 N N   . THR A 1 238 ? 1.675  24.048  8.881   1.00 18.02 ? 238 THR A N   1 
ATOM   1880 C CA  . THR A 1 238 ? 2.838  24.881  8.579   1.00 18.15 ? 238 THR A CA  1 
ATOM   1881 C C   . THR A 1 238 ? 2.600  25.786  7.360   1.00 18.29 ? 238 THR A C   1 
ATOM   1882 O O   . THR A 1 238 ? 2.984  26.961  7.366   1.00 17.94 ? 238 THR A O   1 
ATOM   1883 C CB  . THR A 1 238 ? 4.104  24.018  8.352   1.00 17.86 ? 238 THR A CB  1 
ATOM   1884 O OG1 . THR A 1 238 ? 4.447  23.331  9.567   1.00 16.88 ? 238 THR A OG1 1 
ATOM   1885 C CG2 . THR A 1 238 ? 5.283  24.886  7.887   1.00 17.62 ? 238 THR A CG2 1 
ATOM   1886 N N   . TYR A 1 239 ? 1.953  25.244  6.329   1.00 18.65 ? 239 TYR A N   1 
ATOM   1887 C CA  . TYR A 1 239 ? 1.793  25.956  5.057   1.00 19.22 ? 239 TYR A CA  1 
ATOM   1888 C C   . TYR A 1 239 ? 0.414  26.596  4.845   1.00 19.82 ? 239 TYR A C   1 
ATOM   1889 O O   . TYR A 1 239 ? 0.148  27.153  3.771   1.00 19.89 ? 239 TYR A O   1 
ATOM   1890 C CB  . TYR A 1 239 ? 2.129  25.008  3.901   1.00 18.66 ? 239 TYR A CB  1 
ATOM   1891 C CG  . TYR A 1 239 ? 3.570  24.577  3.929   1.00 18.75 ? 239 TYR A CG  1 
ATOM   1892 C CD1 . TYR A 1 239 ? 4.570  25.413  3.438   1.00 17.74 ? 239 TYR A CD1 1 
ATOM   1893 C CD2 . TYR A 1 239 ? 3.946  23.352  4.484   1.00 17.86 ? 239 TYR A CD2 1 
ATOM   1894 C CE1 . TYR A 1 239 ? 5.901  25.036  3.479   1.00 18.30 ? 239 TYR A CE1 1 
ATOM   1895 C CE2 . TYR A 1 239 ? 5.272  22.970  4.534   1.00 18.12 ? 239 TYR A CE2 1 
ATOM   1896 C CZ  . TYR A 1 239 ? 6.249  23.816  4.027   1.00 18.27 ? 239 TYR A CZ  1 
ATOM   1897 O OH  . TYR A 1 239 ? 7.564  23.440  4.068   1.00 18.16 ? 239 TYR A OH  1 
ATOM   1898 N N   . ALA A 1 240 ? -0.434 26.557  5.870   1.00 20.38 ? 240 ALA A N   1 
ATOM   1899 C CA  . ALA A 1 240 ? -1.832 26.979  5.736   1.00 21.24 ? 240 ALA A CA  1 
ATOM   1900 C C   . ALA A 1 240 ? -1.988 28.430  5.257   1.00 21.85 ? 240 ALA A C   1 
ATOM   1901 O O   . ALA A 1 240 ? -2.855 28.722  4.434   1.00 22.10 ? 240 ALA A O   1 
ATOM   1902 C CB  . ALA A 1 240 ? -2.590 26.762  7.054   1.00 21.14 ? 240 ALA A CB  1 
ATOM   1903 N N   . ASN A 1 241 ? -1.143 29.324  5.758   1.00 22.67 ? 241 ASN A N   1 
ATOM   1904 C CA  . ASN A 1 241 ? -1.177 30.725  5.340   1.00 23.20 ? 241 ASN A CA  1 
ATOM   1905 C C   . ASN A 1 241 ? -0.336 30.999  4.093   1.00 23.62 ? 241 ASN A C   1 
ATOM   1906 O O   . ASN A 1 241 ? -0.823 31.622  3.146   1.00 23.87 ? 241 ASN A O   1 
ATOM   1907 C CB  . ASN A 1 241 ? -0.724 31.631  6.481   1.00 23.66 ? 241 ASN A CB  1 
ATOM   1908 C CG  . ASN A 1 241 ? -1.620 31.524  7.698   1.00 25.37 ? 241 ASN A CG  1 
ATOM   1909 O OD1 . ASN A 1 241 ? -2.849 31.520  7.583   1.00 28.32 ? 241 ASN A OD1 1 
ATOM   1910 N ND2 . ASN A 1 241 ? -1.010 31.439  8.876   1.00 27.10 ? 241 ASN A ND2 1 
ATOM   1911 N N   . VAL A 1 242 ? 0.914  30.529  4.088   1.00 23.63 ? 242 VAL A N   1 
ATOM   1912 C CA  . VAL A 1 242 ? 1.860  30.873  3.017   1.00 23.78 ? 242 VAL A CA  1 
ATOM   1913 C C   . VAL A 1 242 ? 1.484  30.279  1.657   1.00 23.87 ? 242 VAL A C   1 
ATOM   1914 O O   . VAL A 1 242 ? 1.880  30.812  0.626   1.00 23.64 ? 242 VAL A O   1 
ATOM   1915 C CB  . VAL A 1 242 ? 3.315  30.481  3.359   1.00 23.80 ? 242 VAL A CB  1 
ATOM   1916 C CG1 . VAL A 1 242 ? 3.748  31.135  4.673   1.00 24.16 ? 242 VAL A CG1 1 
ATOM   1917 C CG2 . VAL A 1 242 ? 3.479  28.964  3.410   1.00 23.67 ? 242 VAL A CG2 1 
ATOM   1918 N N   . ALA A 1 243 ? 0.710  29.193  1.664   1.00 24.25 ? 243 ALA A N   1 
ATOM   1919 C CA  . ALA A 1 243 ? 0.256  28.542  0.433   1.00 24.51 ? 243 ALA A CA  1 
ATOM   1920 C C   . ALA A 1 243 ? -0.954 29.211  -0.241  1.00 24.71 ? 243 ALA A C   1 
ATOM   1921 O O   . ALA A 1 243 ? -1.359 28.786  -1.321  1.00 24.58 ? 243 ALA A O   1 
ATOM   1922 C CB  . ALA A 1 243 ? -0.038 27.058  0.693   1.00 24.60 ? 243 ALA A CB  1 
ATOM   1923 N N   . LYS A 1 244 ? -1.525 30.243  0.377   1.00 25.09 ? 244 LYS A N   1 
ATOM   1924 C CA  . LYS A 1 244 ? -2.632 30.997  -0.239  1.00 25.40 ? 244 LYS A CA  1 
ATOM   1925 C C   . LYS A 1 244 ? -2.151 31.826  -1.429  1.00 25.66 ? 244 LYS A C   1 
ATOM   1926 O O   . LYS A 1 244 ? -1.106 32.471  -1.357  1.00 25.98 ? 244 LYS A O   1 
ATOM   1927 C CB  . LYS A 1 244 ? -3.294 31.917  0.785   1.00 25.70 ? 244 LYS A CB  1 
ATOM   1928 C CG  . LYS A 1 244 ? -3.984 31.179  1.909   1.00 25.59 ? 244 LYS A CG  1 
ATOM   1929 C CD  . LYS A 1 244 ? -4.826 32.126  2.755   1.00 25.96 ? 244 LYS A CD  1 
ATOM   1930 C CE  . LYS A 1 244 ? -5.424 31.415  3.956   1.00 26.30 ? 244 LYS A CE  1 
ATOM   1931 N NZ  . LYS A 1 244 ? -6.354 30.321  3.559   1.00 26.68 ? 244 LYS A NZ  1 
ATOM   1932 N N   . GLN A 1 245 ? -2.925 31.821  -2.512  1.00 25.67 ? 245 GLN A N   1 
ATOM   1933 C CA  . GLN A 1 245 ? -2.509 32.444  -3.765  1.00 25.80 ? 245 GLN A CA  1 
ATOM   1934 C C   . GLN A 1 245 ? -3.446 33.528  -4.290  1.00 26.01 ? 245 GLN A C   1 
ATOM   1935 O O   . GLN A 1 245 ? -4.658 33.478  -4.088  1.00 26.01 ? 245 GLN A O   1 
ATOM   1936 C CB  . GLN A 1 245 ? -2.395 31.385  -4.850  1.00 25.71 ? 245 GLN A CB  1 
ATOM   1937 C CG  . GLN A 1 245 ? -1.320 30.371  -4.614  1.00 25.38 ? 245 GLN A CG  1 
ATOM   1938 C CD  . GLN A 1 245 ? -0.977 29.634  -5.884  1.00 25.44 ? 245 GLN A CD  1 
ATOM   1939 O OE1 . GLN A 1 245 ? -1.810 28.923  -6.443  1.00 24.21 ? 245 GLN A OE1 1 
ATOM   1940 N NE2 . GLN A 1 245 ? 0.252  29.817  -6.360  1.00 24.06 ? 245 GLN A NE2 1 
ATOM   1941 N N   . LYS A 1 246 ? -2.851 34.480  -5.003  1.00 26.31 ? 246 LYS A N   1 
ATOM   1942 C CA  . LYS A 1 246 ? -3.591 35.460  -5.788  1.00 26.35 ? 246 LYS A CA  1 
ATOM   1943 C C   . LYS A 1 246 ? -3.848 34.921  -7.200  1.00 26.50 ? 246 LYS A C   1 
ATOM   1944 O O   . LYS A 1 246 ? -2.912 34.457  -7.865  1.00 26.26 ? 246 LYS A O   1 
ATOM   1945 C CB  . LYS A 1 246 ? -2.806 36.772  -5.866  1.00 26.29 ? 246 LYS A CB  1 
ATOM   1946 C CG  . LYS A 1 246 ? -3.403 37.821  -6.788  1.00 26.69 ? 246 LYS A CG  1 
ATOM   1947 C CD  . LYS A 1 246 ? -2.723 39.169  -6.607  0.01 26.46 ? 246 LYS A CD  1 
ATOM   1948 C CE  . LYS A 1 246 ? -3.317 40.220  -7.530  0.01 26.48 ? 246 LYS A CE  1 
ATOM   1949 N NZ  . LYS A 1 246 ? -2.659 41.545  -7.365  0.01 26.54 ? 246 LYS A NZ  1 
ATOM   1950 N N   A SER A 1 247 ? -5.115 34.981  -7.616  0.50 26.39 ? 247 SER A N   1 
ATOM   1951 N N   B SER A 1 247 ? -5.111 34.970  -7.626  0.50 26.42 ? 247 SER A N   1 
ATOM   1952 C CA  A SER A 1 247 ? -5.607 34.471  -8.905  0.50 26.44 ? 247 SER A CA  1 
ATOM   1953 C CA  B SER A 1 247 ? -5.523 34.909  -9.044  0.50 26.51 ? 247 SER A CA  1 
ATOM   1954 C C   A SER A 1 247 ? -5.811 32.964  -8.867  0.50 26.56 ? 247 SER A C   1 
ATOM   1955 C C   B SER A 1 247 ? -7.000 34.547  -9.153  0.50 26.54 ? 247 SER A C   1 
ATOM   1956 O O   A SER A 1 247 ? -6.851 32.484  -8.407  0.50 26.65 ? 247 SER A O   1 
ATOM   1957 O O   B SER A 1 247 ? -7.396 33.430  -8.825  0.50 26.71 ? 247 SER A O   1 
ATOM   1958 C CB  A SER A 1 247 ? -4.697 34.869  -10.072 0.50 26.42 ? 247 SER A CB  1 
ATOM   1959 C CB  B SER A 1 247 ? -4.709 33.919  -9.874  0.50 26.54 ? 247 SER A CB  1 
ATOM   1960 O OG  A SER A 1 247 ? -4.424 36.258  -10.041 0.50 26.32 ? 247 SER A OG  1 
ATOM   1961 O OG  B SER A 1 247 ? -4.974 34.089  -11.253 0.50 26.04 ? 247 SER A OG  1 
HETATM 1962 O O   . HOH B 2 .   ? 21.665 5.656   1.822   1.00 16.03 ? 248 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? 8.203  22.447  6.574   1.00 14.36 ? 249 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? 25.097 -10.451 -6.992  1.00 17.78 ? 250 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? 2.506  14.834  15.257  1.00 16.74 ? 251 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? 8.336  14.891  7.810   1.00 17.49 ? 252 HOH A O   1 
HETATM 1967 O O   . HOH B 2 .   ? 19.576 0.377   7.304   1.00 14.45 ? 253 HOH A O   1 
HETATM 1968 O O   . HOH B 2 .   ? 3.932  21.373  13.874  1.00 15.00 ? 254 HOH A O   1 
HETATM 1969 O O   . HOH B 2 .   ? 2.800  12.037  -4.256  1.00 20.57 ? 255 HOH A O   1 
HETATM 1970 O O   . HOH B 2 .   ? 24.138 0.833   -4.475  1.00 20.08 ? 256 HOH A O   1 
HETATM 1971 O O   . HOH B 2 .   ? 30.110 6.767   13.042  1.00 23.62 ? 257 HOH A O   1 
HETATM 1972 O O   . HOH B 2 .   ? 6.419  23.485  12.922  1.00 16.71 ? 258 HOH A O   1 
HETATM 1973 O O   . HOH B 2 .   ? 10.099 31.015  3.795   1.00 23.45 ? 259 HOH A O   1 
HETATM 1974 O O   . HOH B 2 .   ? 32.985 -10.206 -12.287 1.00 18.78 ? 260 HOH A O   1 
HETATM 1975 O O   . HOH B 2 .   ? 16.260 13.071  -17.109 1.00 31.52 ? 261 HOH A O   1 
HETATM 1976 O O   . HOH B 2 .   ? 8.769  17.143  9.812   1.00 25.00 ? 262 HOH A O   1 
HETATM 1977 O O   . HOH B 2 .   ? -1.822 16.096  2.466   1.00 19.54 ? 263 HOH A O   1 
HETATM 1978 O O   . HOH B 2 .   ? 28.295 6.915   -7.436  1.00 29.92 ? 264 HOH A O   1 
HETATM 1979 O O   . HOH B 2 .   ? 9.653  20.742  27.086  1.00 23.98 ? 265 HOH A O   1 
HETATM 1980 O O   . HOH B 2 .   ? 17.184 18.489  7.726   1.00 32.45 ? 266 HOH A O   1 
HETATM 1981 O O   . HOH B 2 .   ? 2.132  14.552  -3.201  1.00 21.79 ? 267 HOH A O   1 
HETATM 1982 O O   . HOH B 2 .   ? 21.534 2.184   8.712   1.00 23.20 ? 268 HOH A O   1 
HETATM 1983 O O   . HOH B 2 .   ? 10.167 14.073  14.047  1.00 28.40 ? 269 HOH A O   1 
HETATM 1984 O O   . HOH B 2 .   ? 19.834 13.808  1.068   1.00 21.30 ? 270 HOH A O   1 
HETATM 1985 O O   . HOH B 2 .   ? 32.739 2.305   20.018  1.00 33.36 ? 271 HOH A O   1 
HETATM 1986 O O   . HOH B 2 .   ? 15.420 16.854  7.225   1.00 22.70 ? 272 HOH A O   1 
HETATM 1987 O O   . HOH B 2 .   ? 21.004 -2.358  -8.138  1.00 20.81 ? 273 HOH A O   1 
HETATM 1988 O O   . HOH B 2 .   ? 9.213  25.222  2.894   1.00 20.63 ? 274 HOH A O   1 
HETATM 1989 O O   . HOH B 2 .   ? 3.730  12.659  18.819  1.00 29.67 ? 275 HOH A O   1 
HETATM 1990 O O   . HOH B 2 .   ? 6.603  23.827  30.205  1.00 24.16 ? 276 HOH A O   1 
HETATM 1991 O O   . HOH B 2 .   ? 14.197 22.421  -11.208 1.00 22.06 ? 277 HOH A O   1 
HETATM 1992 O O   . HOH B 2 .   ? 28.726 0.458   10.669  1.00 23.93 ? 278 HOH A O   1 
HETATM 1993 O O   . HOH B 2 .   ? 8.640  2.117   -8.549  1.00 31.03 ? 279 HOH A O   1 
HETATM 1994 O O   . HOH B 2 .   ? 14.872 -1.231  -4.125  1.00 25.82 ? 280 HOH A O   1 
HETATM 1995 O O   . HOH B 2 .   ? 21.402 -3.155  -5.633  1.00 29.91 ? 281 HOH A O   1 
HETATM 1996 O O   . HOH B 2 .   ? 23.089 -1.571  -3.817  1.00 24.65 ? 282 HOH A O   1 
HETATM 1997 O O   . HOH B 2 .   ? 23.555 2.806   1.862   1.00 25.75 ? 283 HOH A O   1 
HETATM 1998 O O   . HOH B 2 .   ? 20.295 7.928   26.750  1.00 29.50 ? 284 HOH A O   1 
HETATM 1999 O O   . HOH B 2 .   ? 0.087  16.003  15.969  1.00 23.83 ? 285 HOH A O   1 
HETATM 2000 O O   . HOH B 2 .   ? 1.704  29.244  6.734   1.00 23.58 ? 286 HOH A O   1 
HETATM 2001 O O   . HOH B 2 .   ? 5.159  23.411  15.764  1.00 29.39 ? 287 HOH A O   1 
HETATM 2002 O O   . HOH B 2 .   ? -1.268 35.111  -10.597 1.00 27.68 ? 288 HOH A O   1 
HETATM 2003 O O   . HOH B 2 .   ? 0.740  22.750  13.759  1.00 31.04 ? 289 HOH A O   1 
HETATM 2004 O O   . HOH B 2 .   ? 19.307 16.287  1.745   1.00 39.18 ? 290 HOH A O   1 
HETATM 2005 O O   . HOH B 2 .   ? 26.289 2.015   -2.849  1.00 28.08 ? 291 HOH A O   1 
HETATM 2006 O O   . HOH B 2 .   ? 9.482  17.879  15.988  1.00 22.50 ? 292 HOH A O   1 
HETATM 2007 O O   . HOH B 2 .   ? -0.691 18.811  17.771  1.00 36.57 ? 293 HOH A O   1 
HETATM 2008 O O   . HOH B 2 .   ? 18.252 3.827   19.144  1.00 34.52 ? 294 HOH A O   1 
HETATM 2009 O O   . HOH B 2 .   ? 6.035  32.614  -14.054 1.00 31.70 ? 295 HOH A O   1 
HETATM 2010 O O   . HOH B 2 .   ? 21.514 1.409   11.464  1.00 22.46 ? 296 HOH A O   1 
HETATM 2011 O O   . HOH B 2 .   ? 8.277  31.486  -4.200  1.00 33.38 ? 297 HOH A O   1 
HETATM 2012 O O   . HOH B 2 .   ? 9.003  32.891  1.948   1.00 32.42 ? 298 HOH A O   1 
HETATM 2013 O O   . HOH B 2 .   ? 2.033  19.841  27.806  1.00 24.81 ? 299 HOH A O   1 
HETATM 2014 O O   . HOH B 2 .   ? 15.913 16.798  -14.520 1.00 24.69 ? 300 HOH A O   1 
HETATM 2015 O O   . HOH B 2 .   ? 14.868 7.822   -14.133 1.00 28.04 ? 301 HOH A O   1 
HETATM 2016 O O   . HOH B 2 .   ? 11.663 5.993   -13.598 1.00 24.04 ? 302 HOH A O   1 
HETATM 2017 O O   . HOH B 2 .   ? 13.040 1.942   -10.410 1.00 28.35 ? 303 HOH A O   1 
HETATM 2018 O O   . HOH B 2 .   ? 23.264 7.609   -8.972  1.00 25.88 ? 304 HOH A O   1 
HETATM 2019 O O   . HOH B 2 .   ? 24.377 -7.251  -3.877  1.00 30.00 ? 305 HOH A O   1 
HETATM 2020 O O   . HOH B 2 .   ? 25.134 -6.251  -13.542 1.00 35.17 ? 306 HOH A O   1 
HETATM 2021 O O   . HOH B 2 .   ? 20.611 -5.921  -13.499 1.00 32.16 ? 307 HOH A O   1 
HETATM 2022 O O   . HOH B 2 .   ? 26.138 3.666   2.271   1.00 30.18 ? 308 HOH A O   1 
HETATM 2023 O O   . HOH B 2 .   ? 11.913 29.210  -0.095  1.00 30.58 ? 309 HOH A O   1 
HETATM 2024 O O   . HOH B 2 .   ? 25.067 -2.644  2.192   1.00 33.18 ? 310 HOH A O   1 
HETATM 2025 O O   . HOH B 2 .   ? 24.921 -0.712  0.523   1.00 27.01 ? 311 HOH A O   1 
HETATM 2026 O O   . HOH B 2 .   ? 3.377  13.101  8.080   1.00 20.47 ? 312 HOH A O   1 
HETATM 2027 O O   . HOH B 2 .   ? 1.149  7.182   -1.658  1.00 37.66 ? 313 HOH A O   1 
HETATM 2028 O O   . HOH B 2 .   ? 0.631  10.337  -4.642  1.00 33.30 ? 314 HOH A O   1 
HETATM 2029 O O   . HOH B 2 .   ? 0.986  9.202   -8.221  1.00 41.48 ? 315 HOH A O   1 
HETATM 2030 O O   . HOH B 2 .   ? -4.910 27.646  3.127   1.00 31.79 ? 316 HOH A O   1 
HETATM 2031 O O   . HOH B 2 .   ? 1.284  9.643   -12.200 1.00 31.75 ? 317 HOH A O   1 
HETATM 2032 O O   . HOH B 2 .   ? 15.368 -1.848  4.735   1.00 26.38 ? 318 HOH A O   1 
HETATM 2033 O O   . HOH B 2 .   ? 12.942 -1.168  3.320   1.00 26.58 ? 319 HOH A O   1 
HETATM 2034 O O   . HOH B 2 .   ? -1.070 11.675  9.733   1.00 26.00 ? 320 HOH A O   1 
HETATM 2035 O O   . HOH B 2 .   ? -3.135 14.326  10.287  1.00 30.90 ? 321 HOH A O   1 
HETATM 2036 O O   . HOH B 2 .   ? 1.089  23.767  -8.981  1.00 32.13 ? 322 HOH A O   1 
HETATM 2037 O O   . HOH B 2 .   ? 29.406 -1.614  -10.040 1.00 24.46 ? 323 HOH A O   1 
HETATM 2038 O O   . HOH B 2 .   ? 14.267 -0.886  15.442  1.00 50.09 ? 324 HOH A O   1 
HETATM 2039 O O   . HOH B 2 .   ? 12.422 7.040   22.200  1.00 38.43 ? 325 HOH A O   1 
HETATM 2040 O O   . HOH B 2 .   ? 35.377 4.269   14.589  1.00 33.21 ? 326 HOH A O   1 
HETATM 2041 O O   . HOH B 2 .   ? 17.747 14.676  -14.540 1.00 24.48 ? 327 HOH A O   1 
HETATM 2042 O O   . HOH B 2 .   ? 20.024 23.964  18.706  1.00 30.98 ? 328 HOH A O   1 
HETATM 2043 O O   . HOH B 2 .   ? 28.190 0.862   -11.145 1.00 30.45 ? 329 HOH A O   1 
HETATM 2044 O O   . HOH B 2 .   ? 19.499 -3.953  -12.014 1.00 35.85 ? 330 HOH A O   1 
HETATM 2045 O O   . HOH B 2 .   ? -5.283 32.206  -12.707 1.00 27.96 ? 331 HOH A O   1 
HETATM 2046 O O   . HOH B 2 .   ? 6.179  -0.055  1.617   1.00 30.40 ? 332 HOH A O   1 
HETATM 2047 O O   . HOH B 2 .   ? 3.012  21.820  26.209  1.00 23.12 ? 333 HOH A O   1 
HETATM 2048 O O   . HOH B 2 .   ? 21.779 18.184  4.284   1.00 47.68 ? 334 HOH A O   1 
HETATM 2049 O O   . HOH B 2 .   ? 1.213  30.724  -1.903  1.00 26.32 ? 335 HOH A O   1 
HETATM 2050 O O   . HOH B 2 .   ? 9.740  25.487  -7.860  1.00 25.24 ? 336 HOH A O   1 
HETATM 2051 O O   . HOH B 2 .   ? 12.508 16.312  -17.697 1.00 30.20 ? 337 HOH A O   1 
HETATM 2052 O O   . HOH B 2 .   ? 3.979  32.769  0.285   1.00 28.33 ? 338 HOH A O   1 
HETATM 2053 O O   . HOH B 2 .   ? -8.323 31.125  1.844   1.00 39.01 ? 339 HOH A O   1 
HETATM 2054 O O   . HOH B 2 .   ? 9.114  16.525  12.432  1.00 32.83 ? 340 HOH A O   1 
HETATM 2055 O O   . HOH B 2 .   ? 13.431 26.483  16.824  1.00 36.00 ? 341 HOH A O   1 
HETATM 2056 O O   . HOH B 2 .   ? 5.694  34.550  -4.326  1.00 31.22 ? 342 HOH A O   1 
HETATM 2057 O O   . HOH B 2 .   ? 0.281  28.920  -14.362 1.00 35.31 ? 343 HOH A O   1 
HETATM 2058 O O   . HOH B 2 .   ? 6.100  24.601  19.031  1.00 28.44 ? 344 HOH A O   1 
HETATM 2059 O O   . HOH B 2 .   ? 2.861  12.411  16.370  1.00 32.11 ? 345 HOH A O   1 
HETATM 2060 O O   . HOH B 2 .   ? 23.943 11.126  35.652  1.00 47.67 ? 346 HOH A O   1 
HETATM 2061 O O   . HOH B 2 .   ? 32.666 6.521   12.168  1.00 38.99 ? 347 HOH A O   1 
HETATM 2062 O O   . HOH B 2 .   ? 1.285  21.269  -8.720  1.00 27.40 ? 348 HOH A O   1 
HETATM 2063 O O   . HOH B 2 .   ? 2.961  27.496  -7.064  1.00 31.69 ? 349 HOH A O   1 
HETATM 2064 O O   . HOH B 2 .   ? 11.441 27.277  -8.952  1.00 41.58 ? 350 HOH A O   1 
HETATM 2065 O O   . HOH B 2 .   ? 17.533 19.099  -14.094 1.00 25.97 ? 351 HOH A O   1 
HETATM 2066 O O   . HOH B 2 .   ? 26.622 22.236  28.169  1.00 41.69 ? 352 HOH A O   1 
HETATM 2067 O O   . HOH B 2 .   ? 3.347  22.338  -20.134 1.00 50.37 ? 353 HOH A O   1 
HETATM 2068 O O   . HOH B 2 .   ? -5.707 31.727  -5.957  1.00 32.15 ? 354 HOH A O   1 
HETATM 2069 O O   . HOH B 2 .   ? -4.379 21.283  14.371  1.00 37.10 ? 355 HOH A O   1 
HETATM 2070 O O   . HOH B 2 .   ? 10.369 8.547   26.142  1.00 40.14 ? 356 HOH A O   1 
HETATM 2071 O O   . HOH B 2 .   ? 3.810  28.385  30.024  1.00 30.58 ? 357 HOH A O   1 
HETATM 2072 O O   . HOH B 2 .   ? 19.483 -4.185  -3.663  1.00 38.37 ? 358 HOH A O   1 
HETATM 2073 O O   . HOH B 2 .   ? 4.010  2.644   1.169   1.00 36.01 ? 359 HOH A O   1 
HETATM 2074 O O   . HOH B 2 .   ? -5.826 18.926  15.625  1.00 43.98 ? 360 HOH A O   1 
HETATM 2075 O O   . HOH B 2 .   ? 31.979 1.947   -1.202  1.00 37.38 ? 361 HOH A O   1 
HETATM 2076 O O   . HOH B 2 .   ? 2.340  24.483  16.023  1.00 37.47 ? 362 HOH A O   1 
HETATM 2077 O O   . HOH B 2 .   ? 22.422 14.084  29.839  1.00 40.83 ? 363 HOH A O   1 
HETATM 2078 O O   . HOH B 2 .   ? 23.908 -0.034  18.140  1.00 33.11 ? 364 HOH A O   1 
HETATM 2079 O O   . HOH B 2 .   ? 11.271 8.702   23.660  1.00 39.28 ? 365 HOH A O   1 
HETATM 2080 O O   . HOH B 2 .   ? 10.998 26.956  16.499  1.00 43.86 ? 366 HOH A O   1 
HETATM 2081 O O   . HOH B 2 .   ? 3.157  16.782  27.886  1.00 35.20 ? 367 HOH A O   1 
HETATM 2082 O O   . HOH B 2 .   ? 24.531 2.919   7.111   1.00 35.09 ? 368 HOH A O   1 
HETATM 2083 O O   . HOH B 2 .   ? 12.861 -1.835  12.507  1.00 44.60 ? 369 HOH A O   1 
HETATM 2084 O O   . HOH B 2 .   ? 28.058 4.617   4.254   1.00 31.26 ? 370 HOH A O   1 
HETATM 2085 O O   . HOH B 2 .   ? 31.142 11.467  -4.471  1.00 44.05 ? 371 HOH A O   1 
HETATM 2086 O O   . HOH B 2 .   ? 16.722 22.806  0.741   1.00 37.41 ? 372 HOH A O   1 
HETATM 2087 O O   . HOH B 2 .   ? 14.944 25.117  1.004   1.00 40.97 ? 373 HOH A O   1 
HETATM 2088 O O   . HOH B 2 .   ? 17.045 0.934   13.826  1.00 40.63 ? 374 HOH A O   1 
HETATM 2089 O O   . HOH B 2 .   ? 2.076  11.210  2.200   1.00 33.63 ? 375 HOH A O   1 
HETATM 2090 O O   . HOH B 2 .   ? 2.711  8.812   2.925   1.00 42.21 ? 376 HOH A O   1 
HETATM 2091 O O   . HOH B 2 .   ? 0.030  12.180  0.720   1.00 37.81 ? 377 HOH A O   1 
HETATM 2092 O O   . HOH B 2 .   ? 22.994 19.480  0.517   1.00 43.61 ? 378 HOH A O   1 
HETATM 2093 O O   . HOH B 2 .   ? 31.657 8.971   10.088  1.00 39.02 ? 379 HOH A O   1 
HETATM 2094 O O   . HOH B 2 .   ? -0.364 12.022  -1.855  1.00 43.06 ? 380 HOH A O   1 
HETATM 2095 O O   . HOH B 2 .   ? 3.199  6.943   1.138   1.00 52.45 ? 381 HOH A O   1 
HETATM 2096 O O   . HOH B 2 .   ? 7.965  25.754  -19.328 1.00 58.63 ? 382 HOH A O   1 
HETATM 2097 O O   . HOH B 2 .   ? 0.902  12.542  -11.220 1.00 32.99 ? 383 HOH A O   1 
HETATM 2098 O O   . HOH B 2 .   ? 14.710 10.673  31.778  1.00 38.58 ? 384 HOH A O   1 
HETATM 2099 O O   . HOH B 2 .   ? 5.303  30.423  29.080  1.00 37.38 ? 385 HOH A O   1 
HETATM 2100 O O   . HOH B 2 .   ? 22.793 28.486  19.917  1.00 42.34 ? 386 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   ARG 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   GLN 9   9   ?   ?   ?   A . n 
A 1 10  VAL 10  10  ?   ?   ?   A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  CYS 33  33  33  CYS CYS A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  MET 54  54  54  MET MET A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LEU 61  61  61  LEU ALA A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  THR 68  68  68  THR ALA A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 CYS 114 114 114 CYS CYS A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 CYS 184 184 184 CYS CYS A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 PHE 209 209 209 PHE PHE A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 HIS 217 217 217 HIS HIS A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 HIS 227 227 227 HIS HIS A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 CYS 229 229 229 CYS CYS A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ILE 235 235 235 ILE ILE A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 SER 247 247 247 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   248 1   HOH HOH A . 
B 2 HOH 2   249 2   HOH HOH A . 
B 2 HOH 3   250 3   HOH HOH A . 
B 2 HOH 4   251 4   HOH HOH A . 
B 2 HOH 5   252 5   HOH HOH A . 
B 2 HOH 6   253 6   HOH HOH A . 
B 2 HOH 7   254 7   HOH HOH A . 
B 2 HOH 8   255 8   HOH HOH A . 
B 2 HOH 9   256 9   HOH HOH A . 
B 2 HOH 10  257 10  HOH HOH A . 
B 2 HOH 11  258 11  HOH HOH A . 
B 2 HOH 12  259 12  HOH HOH A . 
B 2 HOH 13  260 13  HOH HOH A . 
B 2 HOH 14  261 14  HOH HOH A . 
B 2 HOH 15  262 15  HOH HOH A . 
B 2 HOH 16  263 16  HOH HOH A . 
B 2 HOH 17  264 17  HOH HOH A . 
B 2 HOH 18  265 18  HOH HOH A . 
B 2 HOH 19  266 19  HOH HOH A . 
B 2 HOH 20  267 20  HOH HOH A . 
B 2 HOH 21  268 21  HOH HOH A . 
B 2 HOH 22  269 22  HOH HOH A . 
B 2 HOH 23  270 23  HOH HOH A . 
B 2 HOH 24  271 24  HOH HOH A . 
B 2 HOH 25  272 25  HOH HOH A . 
B 2 HOH 26  273 26  HOH HOH A . 
B 2 HOH 27  274 27  HOH HOH A . 
B 2 HOH 28  275 28  HOH HOH A . 
B 2 HOH 29  276 29  HOH HOH A . 
B 2 HOH 30  277 30  HOH HOH A . 
B 2 HOH 31  278 31  HOH HOH A . 
B 2 HOH 32  279 32  HOH HOH A . 
B 2 HOH 33  280 33  HOH HOH A . 
B 2 HOH 34  281 34  HOH HOH A . 
B 2 HOH 35  282 35  HOH HOH A . 
B 2 HOH 36  283 36  HOH HOH A . 
B 2 HOH 37  284 37  HOH HOH A . 
B 2 HOH 38  285 38  HOH HOH A . 
B 2 HOH 39  286 39  HOH HOH A . 
B 2 HOH 40  287 40  HOH HOH A . 
B 2 HOH 41  288 41  HOH HOH A . 
B 2 HOH 42  289 42  HOH HOH A . 
B 2 HOH 43  290 43  HOH HOH A . 
B 2 HOH 44  291 44  HOH HOH A . 
B 2 HOH 45  292 45  HOH HOH A . 
B 2 HOH 46  293 46  HOH HOH A . 
B 2 HOH 47  294 47  HOH HOH A . 
B 2 HOH 48  295 48  HOH HOH A . 
B 2 HOH 49  296 49  HOH HOH A . 
B 2 HOH 50  297 50  HOH HOH A . 
B 2 HOH 51  298 51  HOH HOH A . 
B 2 HOH 52  299 52  HOH HOH A . 
B 2 HOH 53  300 53  HOH HOH A . 
B 2 HOH 54  301 54  HOH HOH A . 
B 2 HOH 55  302 55  HOH HOH A . 
B 2 HOH 56  303 56  HOH HOH A . 
B 2 HOH 57  304 57  HOH HOH A . 
B 2 HOH 58  305 58  HOH HOH A . 
B 2 HOH 59  306 59  HOH HOH A . 
B 2 HOH 60  307 60  HOH HOH A . 
B 2 HOH 61  308 61  HOH HOH A . 
B 2 HOH 62  309 62  HOH HOH A . 
B 2 HOH 63  310 63  HOH HOH A . 
B 2 HOH 64  311 64  HOH HOH A . 
B 2 HOH 65  312 65  HOH HOH A . 
B 2 HOH 66  313 66  HOH HOH A . 
B 2 HOH 67  314 67  HOH HOH A . 
B 2 HOH 68  315 68  HOH HOH A . 
B 2 HOH 69  316 69  HOH HOH A . 
B 2 HOH 70  317 70  HOH HOH A . 
B 2 HOH 71  318 71  HOH HOH A . 
B 2 HOH 72  319 72  HOH HOH A . 
B 2 HOH 73  320 73  HOH HOH A . 
B 2 HOH 74  321 74  HOH HOH A . 
B 2 HOH 75  322 75  HOH HOH A . 
B 2 HOH 76  323 76  HOH HOH A . 
B 2 HOH 77  324 77  HOH HOH A . 
B 2 HOH 78  325 78  HOH HOH A . 
B 2 HOH 79  326 79  HOH HOH A . 
B 2 HOH 80  327 80  HOH HOH A . 
B 2 HOH 81  328 81  HOH HOH A . 
B 2 HOH 82  329 82  HOH HOH A . 
B 2 HOH 83  330 83  HOH HOH A . 
B 2 HOH 84  331 84  HOH HOH A . 
B 2 HOH 85  332 85  HOH HOH A . 
B 2 HOH 86  333 86  HOH HOH A . 
B 2 HOH 87  334 87  HOH HOH A . 
B 2 HOH 88  335 88  HOH HOH A . 
B 2 HOH 89  336 89  HOH HOH A . 
B 2 HOH 90  337 90  HOH HOH A . 
B 2 HOH 91  338 91  HOH HOH A . 
B 2 HOH 92  339 92  HOH HOH A . 
B 2 HOH 93  340 93  HOH HOH A . 
B 2 HOH 94  341 94  HOH HOH A . 
B 2 HOH 95  342 95  HOH HOH A . 
B 2 HOH 96  343 96  HOH HOH A . 
B 2 HOH 97  344 97  HOH HOH A . 
B 2 HOH 98  345 98  HOH HOH A . 
B 2 HOH 99  346 99  HOH HOH A . 
B 2 HOH 100 347 100 HOH HOH A . 
B 2 HOH 101 348 101 HOH HOH A . 
B 2 HOH 102 349 102 HOH HOH A . 
B 2 HOH 103 350 103 HOH HOH A . 
B 2 HOH 104 351 104 HOH HOH A . 
B 2 HOH 105 352 105 HOH HOH A . 
B 2 HOH 106 353 106 HOH HOH A . 
B 2 HOH 107 354 107 HOH HOH A . 
B 2 HOH 108 355 108 HOH HOH A . 
B 2 HOH 109 356 109 HOH HOH A . 
B 2 HOH 110 357 110 HOH HOH A . 
B 2 HOH 111 358 111 HOH HOH A . 
B 2 HOH 112 359 112 HOH HOH A . 
B 2 HOH 113 360 113 HOH HOH A . 
B 2 HOH 114 361 114 HOH HOH A . 
B 2 HOH 115 362 115 HOH HOH A . 
B 2 HOH 116 363 116 HOH HOH A . 
B 2 HOH 117 364 117 HOH HOH A . 
B 2 HOH 118 365 118 HOH HOH A . 
B 2 HOH 119 366 119 HOH HOH A . 
B 2 HOH 120 367 120 HOH HOH A . 
B 2 HOH 121 368 121 HOH HOH A . 
B 2 HOH 122 369 123 HOH HOH A . 
B 2 HOH 123 370 124 HOH HOH A . 
B 2 HOH 124 371 125 HOH HOH A . 
B 2 HOH 125 372 126 HOH HOH A . 
B 2 HOH 126 373 127 HOH HOH A . 
B 2 HOH 127 374 128 HOH HOH A . 
B 2 HOH 128 375 129 HOH HOH A . 
B 2 HOH 129 376 130 HOH HOH A . 
B 2 HOH 130 377 131 HOH HOH A . 
B 2 HOH 131 378 132 HOH HOH A . 
B 2 HOH 132 379 133 HOH HOH A . 
B 2 HOH 133 380 134 HOH HOH A . 
B 2 HOH 134 381 135 HOH HOH A . 
B 2 HOH 135 382 137 HOH HOH A . 
B 2 HOH 136 383 138 HOH HOH A . 
B 2 HOH 137 384 139 HOH HOH A . 
B 2 HOH 138 385 140 HOH HOH A . 
B 2 HOH 139 386 141 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-13 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
MAR345 'data collection' .        ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
PHASER phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 25  ? ? -131.60 -45.17  
2  1 LEU A 61  ? ? -79.51  33.70   
3  1 LYS A 62  ? ? 20.02   -103.12 
4  1 ASP A 63  ? ? -129.10 -56.06  
5  1 LEU A 64  ? ? -138.20 -81.66  
6  1 ALA A 65  ? ? 77.99   95.75   
7  1 LYS A 77  ? ? 73.54   -12.63  
8  1 ASP A 82  ? ? 75.64   64.00   
9  1 PHE A 83  ? ? 46.53   -104.20 
10 1 ALA A 163 ? ? 65.38   -143.79 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    62 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    63 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -58.13 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LEU 61 ? CG  ? A LEU 61 CG  
2 1 Y 1 A LEU 61 ? CD1 ? A LEU 61 CD1 
3 1 Y 1 A LEU 61 ? CD2 ? A LEU 61 CD2 
4 1 Y 1 A THR 68 ? OG1 ? A THR 68 OG1 
5 1 Y 1 A THR 68 ? CG2 ? A THR 68 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A SER 2  ? A SER 2  
3  1 Y 1 A GLY 3  ? A GLY 3  
4  1 Y 1 A LEU 4  ? A LEU 4  
5  1 Y 1 A ARG 5  ? A ARG 5  
6  1 Y 1 A PRO 6  ? A PRO 6  
7  1 Y 1 A GLY 7  ? A GLY 7  
8  1 Y 1 A THR 8  ? A THR 8  
9  1 Y 1 A GLN 9  ? A GLN 9  
10 1 Y 1 A VAL 10 ? A VAL 10 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#