data_2R8J
# 
_entry.id   2R8J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2R8J         
NDB   PD1043       
RCSB  RCSB044558   
WWPDB D_1000044558 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JIH 'apoenzyme structure'                                     unspecified 
PDB 2R8K 'DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin' unspecified 
# 
_pdbx_database_status.entry_id                        2R8J 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-09-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Carell, T.'  1 
'Alt, A.'     2 
'Lammens, K.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Bypass of DNA lesions generated during anticancer treatment with cisplatin by DNA polymerase eta' 
_citation.journal_abbrev            Science 
_citation.journal_volume            318 
_citation.page_first                967 
_citation.page_last                 970 
_citation.year                      2007 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17991862 
_citation.pdbx_database_id_DOI      10.1126/science.1148242 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Alt, A.'        1 
primary 'Lammens, K.'    2 
primary 'Chiocchini, C.' 3 
primary 'Lammens, A.'    4 
primary 'Pieck, J.C.'    5 
primary 'Kuch, D.'       6 
primary 'Hopfner, K.P.'  7 
primary 'Carell, T.'     8 
# 
_cell.entry_id           2R8J 
_cell.length_a           104.090 
_cell.length_b           104.090 
_cell.length_c           293.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2R8J 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                92 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DGP*DTP*DGP*DGP*DAP*DTP*DGP*DAP*DG)-3')
;
2835.871  2   ?       ? ?                  SYN 
2 polymer     syn 
;DNA (5'-D(P*DGP*DGP*DCP*DTP*DCP*DAP*DTP*DCP*DCP*DAP*DC)-3')
;
3294.162  2   ?       ? ?                  SYN 
3 polymer     man 'DNA polymerase eta'                                          62617.781 2   2.7.7.7 ? 'Catalytic domain' MAN 
4 non-polymer syn Cisplatin                                                     300.045   2   ?       ? ?                  ?   
5 non-polymer syn 'CALCIUM ION'                                                 40.078    4   ?       ? ?                  ?   
6 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                            467.157   2   ?       ? ?                  ?   
7 water       nat water                                                         18.015    121 ?       ? ?                  ?   
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Radiation sensitive protein 30' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DT)(DG)(DG)(DA)(DT)(DG)(DA)(DG)' GTGGATGAG Q,P ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DT)(DC)(DA)(DT)(DC)(DC)(DA)(DC)' GGCTCATCCAC U,T ? 
3 'polypeptide(L)'        no no 
;MASWSHPQFEKGASTSLYKKAGRMSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWN
SIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRK
ALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKF
EGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDC
GKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKL
SRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRK
SGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAG
;
;MASWSHPQFEKGASTSLYKKAGRMSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWN
SIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRK
ALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKF
EGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDC
GKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKL
SRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRK
SGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAG
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DT  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DG  n 
1 8   DA  n 
1 9   DG  n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DC  n 
2 6   DA  n 
2 7   DT  n 
2 8   DC  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
3 1   MET n 
3 2   ALA n 
3 3   SER n 
3 4   TRP n 
3 5   SER n 
3 6   HIS n 
3 7   PRO n 
3 8   GLN n 
3 9   PHE n 
3 10  GLU n 
3 11  LYS n 
3 12  GLY n 
3 13  ALA n 
3 14  SER n 
3 15  THR n 
3 16  SER n 
3 17  LEU n 
3 18  TYR n 
3 19  LYS n 
3 20  LYS n 
3 21  ALA n 
3 22  GLY n 
3 23  ARG n 
3 24  MET n 
3 25  SER n 
3 26  LYS n 
3 27  PHE n 
3 28  THR n 
3 29  TRP n 
3 30  LYS n 
3 31  GLU n 
3 32  LEU n 
3 33  ILE n 
3 34  GLN n 
3 35  LEU n 
3 36  GLY n 
3 37  SER n 
3 38  PRO n 
3 39  SER n 
3 40  LYS n 
3 41  ALA n 
3 42  TYR n 
3 43  GLU n 
3 44  SER n 
3 45  SER n 
3 46  LEU n 
3 47  ALA n 
3 48  CYS n 
3 49  ILE n 
3 50  ALA n 
3 51  HIS n 
3 52  ILE n 
3 53  ASP n 
3 54  MET n 
3 55  ASN n 
3 56  ALA n 
3 57  PHE n 
3 58  PHE n 
3 59  ALA n 
3 60  GLN n 
3 61  VAL n 
3 62  GLU n 
3 63  GLN n 
3 64  MET n 
3 65  ARG n 
3 66  CYS n 
3 67  GLY n 
3 68  LEU n 
3 69  SER n 
3 70  LYS n 
3 71  GLU n 
3 72  ASP n 
3 73  PRO n 
3 74  VAL n 
3 75  VAL n 
3 76  CYS n 
3 77  VAL n 
3 78  GLN n 
3 79  TRP n 
3 80  ASN n 
3 81  SER n 
3 82  ILE n 
3 83  ILE n 
3 84  ALA n 
3 85  VAL n 
3 86  SER n 
3 87  TYR n 
3 88  ALA n 
3 89  ALA n 
3 90  ARG n 
3 91  LYS n 
3 92  TYR n 
3 93  GLY n 
3 94  ILE n 
3 95  SER n 
3 96  ARG n 
3 97  MET n 
3 98  ASP n 
3 99  THR n 
3 100 ILE n 
3 101 GLN n 
3 102 GLU n 
3 103 ALA n 
3 104 LEU n 
3 105 LYS n 
3 106 LYS n 
3 107 CYS n 
3 108 SER n 
3 109 ASN n 
3 110 LEU n 
3 111 ILE n 
3 112 PRO n 
3 113 ILE n 
3 114 HIS n 
3 115 THR n 
3 116 ALA n 
3 117 VAL n 
3 118 PHE n 
3 119 LYS n 
3 120 LYS n 
3 121 GLY n 
3 122 GLU n 
3 123 ASP n 
3 124 PHE n 
3 125 TRP n 
3 126 GLN n 
3 127 TYR n 
3 128 HIS n 
3 129 ASP n 
3 130 GLY n 
3 131 CYS n 
3 132 GLY n 
3 133 SER n 
3 134 TRP n 
3 135 VAL n 
3 136 GLN n 
3 137 ASP n 
3 138 PRO n 
3 139 ALA n 
3 140 LYS n 
3 141 GLN n 
3 142 ILE n 
3 143 SER n 
3 144 VAL n 
3 145 GLU n 
3 146 ASP n 
3 147 HIS n 
3 148 LYS n 
3 149 VAL n 
3 150 SER n 
3 151 LEU n 
3 152 GLU n 
3 153 PRO n 
3 154 TYR n 
3 155 ARG n 
3 156 ARG n 
3 157 GLU n 
3 158 SER n 
3 159 ARG n 
3 160 LYS n 
3 161 ALA n 
3 162 LEU n 
3 163 LYS n 
3 164 ILE n 
3 165 PHE n 
3 166 LYS n 
3 167 SER n 
3 168 ALA n 
3 169 CYS n 
3 170 ASP n 
3 171 LEU n 
3 172 VAL n 
3 173 GLU n 
3 174 ARG n 
3 175 ALA n 
3 176 SER n 
3 177 ILE n 
3 178 ASP n 
3 179 GLU n 
3 180 VAL n 
3 181 PHE n 
3 182 LEU n 
3 183 ASP n 
3 184 LEU n 
3 185 GLY n 
3 186 ARG n 
3 187 ILE n 
3 188 CYS n 
3 189 PHE n 
3 190 ASN n 
3 191 MET n 
3 192 LEU n 
3 193 MET n 
3 194 PHE n 
3 195 ASP n 
3 196 ASN n 
3 197 GLU n 
3 198 TYR n 
3 199 GLU n 
3 200 LEU n 
3 201 THR n 
3 202 GLY n 
3 203 ASP n 
3 204 LEU n 
3 205 LYS n 
3 206 LEU n 
3 207 LYS n 
3 208 ASP n 
3 209 ALA n 
3 210 LEU n 
3 211 SER n 
3 212 ASN n 
3 213 ILE n 
3 214 ARG n 
3 215 GLU n 
3 216 ALA n 
3 217 PHE n 
3 218 ILE n 
3 219 GLY n 
3 220 GLY n 
3 221 ASN n 
3 222 TYR n 
3 223 ASP n 
3 224 ILE n 
3 225 ASN n 
3 226 SER n 
3 227 HIS n 
3 228 LEU n 
3 229 PRO n 
3 230 LEU n 
3 231 ILE n 
3 232 PRO n 
3 233 GLU n 
3 234 LYS n 
3 235 ILE n 
3 236 LYS n 
3 237 SER n 
3 238 LEU n 
3 239 LYS n 
3 240 PHE n 
3 241 GLU n 
3 242 GLY n 
3 243 ASP n 
3 244 VAL n 
3 245 PHE n 
3 246 ASN n 
3 247 PRO n 
3 248 GLU n 
3 249 GLY n 
3 250 ARG n 
3 251 ASP n 
3 252 LEU n 
3 253 ILE n 
3 254 THR n 
3 255 ASP n 
3 256 TRP n 
3 257 ASP n 
3 258 ASP n 
3 259 VAL n 
3 260 ILE n 
3 261 LEU n 
3 262 ALA n 
3 263 LEU n 
3 264 GLY n 
3 265 SER n 
3 266 GLN n 
3 267 VAL n 
3 268 CYS n 
3 269 LYS n 
3 270 GLY n 
3 271 ILE n 
3 272 ARG n 
3 273 ASP n 
3 274 SER n 
3 275 ILE n 
3 276 LYS n 
3 277 ASP n 
3 278 ILE n 
3 279 LEU n 
3 280 GLY n 
3 281 TYR n 
3 282 THR n 
3 283 THR n 
3 284 SER n 
3 285 CYS n 
3 286 GLY n 
3 287 LEU n 
3 288 SER n 
3 289 SER n 
3 290 THR n 
3 291 LYS n 
3 292 ASN n 
3 293 VAL n 
3 294 CYS n 
3 295 LYS n 
3 296 LEU n 
3 297 ALA n 
3 298 SER n 
3 299 ASN n 
3 300 TYR n 
3 301 LYS n 
3 302 LYS n 
3 303 PRO n 
3 304 ASP n 
3 305 ALA n 
3 306 GLN n 
3 307 THR n 
3 308 ILE n 
3 309 VAL n 
3 310 LYS n 
3 311 ASN n 
3 312 ASP n 
3 313 CYS n 
3 314 LEU n 
3 315 LEU n 
3 316 ASP n 
3 317 PHE n 
3 318 LEU n 
3 319 ASP n 
3 320 CYS n 
3 321 GLY n 
3 322 LYS n 
3 323 PHE n 
3 324 GLU n 
3 325 ILE n 
3 326 THR n 
3 327 SER n 
3 328 PHE n 
3 329 TRP n 
3 330 THR n 
3 331 LEU n 
3 332 GLY n 
3 333 GLY n 
3 334 VAL n 
3 335 LEU n 
3 336 GLY n 
3 337 LYS n 
3 338 GLU n 
3 339 LEU n 
3 340 ILE n 
3 341 ASP n 
3 342 VAL n 
3 343 LEU n 
3 344 ASP n 
3 345 LEU n 
3 346 PRO n 
3 347 HIS n 
3 348 GLU n 
3 349 ASN n 
3 350 SER n 
3 351 ILE n 
3 352 LYS n 
3 353 HIS n 
3 354 ILE n 
3 355 ARG n 
3 356 GLU n 
3 357 THR n 
3 358 TRP n 
3 359 PRO n 
3 360 ASP n 
3 361 ASN n 
3 362 ALA n 
3 363 GLY n 
3 364 GLN n 
3 365 LEU n 
3 366 LYS n 
3 367 GLU n 
3 368 PHE n 
3 369 LEU n 
3 370 ASP n 
3 371 ALA n 
3 372 LYS n 
3 373 VAL n 
3 374 LYS n 
3 375 GLN n 
3 376 SER n 
3 377 ASP n 
3 378 TYR n 
3 379 ASP n 
3 380 ARG n 
3 381 SER n 
3 382 THR n 
3 383 SER n 
3 384 ASN n 
3 385 ILE n 
3 386 ASP n 
3 387 PRO n 
3 388 LEU n 
3 389 LYS n 
3 390 THR n 
3 391 ALA n 
3 392 ASP n 
3 393 LEU n 
3 394 ALA n 
3 395 GLU n 
3 396 LYS n 
3 397 LEU n 
3 398 PHE n 
3 399 LYS n 
3 400 LEU n 
3 401 SER n 
3 402 ARG n 
3 403 GLY n 
3 404 ARG n 
3 405 TYR n 
3 406 GLY n 
3 407 LEU n 
3 408 PRO n 
3 409 LEU n 
3 410 SER n 
3 411 SER n 
3 412 ARG n 
3 413 PRO n 
3 414 VAL n 
3 415 VAL n 
3 416 LYS n 
3 417 SER n 
3 418 MET n 
3 419 MET n 
3 420 SER n 
3 421 ASN n 
3 422 LYS n 
3 423 ASN n 
3 424 LEU n 
3 425 ARG n 
3 426 GLY n 
3 427 LYS n 
3 428 SER n 
3 429 CYS n 
3 430 ASN n 
3 431 SER n 
3 432 ILE n 
3 433 VAL n 
3 434 ASP n 
3 435 CYS n 
3 436 ILE n 
3 437 SER n 
3 438 TRP n 
3 439 LEU n 
3 440 GLU n 
3 441 VAL n 
3 442 PHE n 
3 443 CYS n 
3 444 ALA n 
3 445 GLU n 
3 446 LEU n 
3 447 THR n 
3 448 SER n 
3 449 ARG n 
3 450 ILE n 
3 451 GLN n 
3 452 ASP n 
3 453 LEU n 
3 454 GLU n 
3 455 GLN n 
3 456 GLU n 
3 457 TYR n 
3 458 ASN n 
3 459 LYS n 
3 460 ILE n 
3 461 VAL n 
3 462 ILE n 
3 463 PRO n 
3 464 ARG n 
3 465 THR n 
3 466 VAL n 
3 467 SER n 
3 468 ILE n 
3 469 SER n 
3 470 LEU n 
3 471 LYS n 
3 472 THR n 
3 473 LYS n 
3 474 SER n 
3 475 TYR n 
3 476 GLU n 
3 477 VAL n 
3 478 TYR n 
3 479 ARG n 
3 480 LYS n 
3 481 SER n 
3 482 GLY n 
3 483 PRO n 
3 484 VAL n 
3 485 ALA n 
3 486 TYR n 
3 487 LYS n 
3 488 GLY n 
3 489 ILE n 
3 490 ASN n 
3 491 PHE n 
3 492 GLN n 
3 493 SER n 
3 494 HIS n 
3 495 GLU n 
3 496 LEU n 
3 497 LEU n 
3 498 LYS n 
3 499 VAL n 
3 500 GLY n 
3 501 ILE n 
3 502 LYS n 
3 503 PHE n 
3 504 VAL n 
3 505 THR n 
3 506 ASP n 
3 507 LEU n 
3 508 ASP n 
3 509 ILE n 
3 510 LYS n 
3 511 GLY n 
3 512 LYS n 
3 513 ASN n 
3 514 LYS n 
3 515 SER n 
3 516 TYR n 
3 517 TYR n 
3 518 PRO n 
3 519 LEU n 
3 520 THR n 
3 521 LYS n 
3 522 LEU n 
3 523 SER n 
3 524 MET n 
3 525 THR n 
3 526 ILE n 
3 527 THR n 
3 528 ASN n 
3 529 PHE n 
3 530 ASP n 
3 531 ILE n 
3 532 ILE n 
3 533 ASP n 
3 534 LEU n 
3 535 GLN n 
3 536 LYS n 
3 537 THR n 
3 538 VAL n 
3 539 VAL n 
3 540 ASP n 
3 541 MET n 
3 542 PHE n 
3 543 GLY n 
3 544 ASN n 
3 545 GLN n 
3 546 VAL n 
3 547 HIS n 
3 548 THR n 
3 549 PHE n 
3 550 LYS n 
3 551 SER n 
3 552 SER n 
3 553 ALA n 
3 554 GLY n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 'RAD30, DBH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'YPH499 (ATCC 76625)' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21 DE3 Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pExp007 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP POLH_YEAST Q04049 1 
;MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTIQEA
LKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLD
LGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILAL
GSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVL
DLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKN
LRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRKSGPVAYKGINFQSHELLKVGIKF
VTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAG
;
? 
2 1 PDB 2R8J       2R8J   5 ? ? 
3 2 PDB 2R8J       2R8J   4 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2R8J A 24 ? 554 ? Q04049 1 ? 531 ? 1 531 
2 1 2R8J B 24 ? 554 ? Q04049 1 ? 531 ? 1 531 
3 2 2R8J P 1  ? 9   ? 2R8J   5 ? 13  ? 5 13  
4 2 2R8J Q 1  ? 9   ? 2R8J   5 ? 13  ? 5 13  
5 3 2R8J U 1  ? 11  ? 2R8J   4 ? 14  ? 4 14  
6 3 2R8J T 1  ? 11  ? 2R8J   4 ? 14  ? 4 14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2R8J MET A 1  ? UNP Q04049 ? ? 'EXPRESSION TAG' -22 1  
1 2R8J ALA A 2  ? UNP Q04049 ? ? 'EXPRESSION TAG' -21 2  
1 2R8J SER A 3  ? UNP Q04049 ? ? 'EXPRESSION TAG' -20 3  
1 2R8J TRP A 4  ? UNP Q04049 ? ? 'EXPRESSION TAG' -19 4  
1 2R8J SER A 5  ? UNP Q04049 ? ? 'EXPRESSION TAG' -18 5  
1 2R8J HIS A 6  ? UNP Q04049 ? ? 'EXPRESSION TAG' -17 6  
1 2R8J PRO A 7  ? UNP Q04049 ? ? 'EXPRESSION TAG' -16 7  
1 2R8J GLN A 8  ? UNP Q04049 ? ? 'EXPRESSION TAG' -15 8  
1 2R8J PHE A 9  ? UNP Q04049 ? ? 'EXPRESSION TAG' -14 9  
1 2R8J GLU A 10 ? UNP Q04049 ? ? 'EXPRESSION TAG' -13 10 
1 2R8J LYS A 11 ? UNP Q04049 ? ? 'EXPRESSION TAG' -12 11 
1 2R8J GLY A 12 ? UNP Q04049 ? ? 'EXPRESSION TAG' -11 12 
1 2R8J ALA A 13 ? UNP Q04049 ? ? 'EXPRESSION TAG' -10 13 
1 2R8J SER A 14 ? UNP Q04049 ? ? 'EXPRESSION TAG' -9  14 
1 2R8J THR A 15 ? UNP Q04049 ? ? 'EXPRESSION TAG' -8  15 
1 2R8J SER A 16 ? UNP Q04049 ? ? 'EXPRESSION TAG' -7  16 
1 2R8J LEU A 17 ? UNP Q04049 ? ? 'EXPRESSION TAG' -6  17 
1 2R8J TYR A 18 ? UNP Q04049 ? ? 'EXPRESSION TAG' -5  18 
1 2R8J LYS A 19 ? UNP Q04049 ? ? 'EXPRESSION TAG' -4  19 
1 2R8J LYS A 20 ? UNP Q04049 ? ? 'EXPRESSION TAG' -3  20 
1 2R8J ALA A 21 ? UNP Q04049 ? ? 'EXPRESSION TAG' -2  21 
1 2R8J GLY A 22 ? UNP Q04049 ? ? 'EXPRESSION TAG' -1  22 
1 2R8J ARG A 23 ? UNP Q04049 ? ? 'EXPRESSION TAG' 0   23 
2 2R8J MET B 1  ? UNP Q04049 ? ? 'EXPRESSION TAG' -22 24 
2 2R8J ALA B 2  ? UNP Q04049 ? ? 'EXPRESSION TAG' -21 25 
2 2R8J SER B 3  ? UNP Q04049 ? ? 'EXPRESSION TAG' -20 26 
2 2R8J TRP B 4  ? UNP Q04049 ? ? 'EXPRESSION TAG' -19 27 
2 2R8J SER B 5  ? UNP Q04049 ? ? 'EXPRESSION TAG' -18 28 
2 2R8J HIS B 6  ? UNP Q04049 ? ? 'EXPRESSION TAG' -17 29 
2 2R8J PRO B 7  ? UNP Q04049 ? ? 'EXPRESSION TAG' -16 30 
2 2R8J GLN B 8  ? UNP Q04049 ? ? 'EXPRESSION TAG' -15 31 
2 2R8J PHE B 9  ? UNP Q04049 ? ? 'EXPRESSION TAG' -14 32 
2 2R8J GLU B 10 ? UNP Q04049 ? ? 'EXPRESSION TAG' -13 33 
2 2R8J LYS B 11 ? UNP Q04049 ? ? 'EXPRESSION TAG' -12 34 
2 2R8J GLY B 12 ? UNP Q04049 ? ? 'EXPRESSION TAG' -11 35 
2 2R8J ALA B 13 ? UNP Q04049 ? ? 'EXPRESSION TAG' -10 36 
2 2R8J SER B 14 ? UNP Q04049 ? ? 'EXPRESSION TAG' -9  37 
2 2R8J THR B 15 ? UNP Q04049 ? ? 'EXPRESSION TAG' -8  38 
2 2R8J SER B 16 ? UNP Q04049 ? ? 'EXPRESSION TAG' -7  39 
2 2R8J LEU B 17 ? UNP Q04049 ? ? 'EXPRESSION TAG' -6  40 
2 2R8J TYR B 18 ? UNP Q04049 ? ? 'EXPRESSION TAG' -5  41 
2 2R8J LYS B 19 ? UNP Q04049 ? ? 'EXPRESSION TAG' -4  42 
2 2R8J LYS B 20 ? UNP Q04049 ? ? 'EXPRESSION TAG' -3  43 
2 2R8J ALA B 21 ? UNP Q04049 ? ? 'EXPRESSION TAG' -2  44 
2 2R8J GLY B 22 ? UNP Q04049 ? ? 'EXPRESSION TAG' -1  45 
2 2R8J ARG B 23 ? UNP Q04049 ? ? 'EXPRESSION TAG' 0   46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                            'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ?                            'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                            'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                            'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                            'Ca 2'             40.078  
CPT non-polymer         . Cisplatin                            'diammine(dichloro)platinum' 'Cl2 H6 N2 Pt'     300.045 
CYS 'L-peptide linking' y CYSTEINE                             ?                            'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                            'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                            'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ?                            'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                            'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                            'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                            'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                            'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ?                            'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                            'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ?                            'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                            'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                            'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ?                            'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ?                            'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                            'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ?                            'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ?                            'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ?                            'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                            'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                            'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ?                            'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2R8J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_percent_sol   57.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    '170 mM Calcium chloride, 16% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 291.0K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 CaCl2      ? ? ? 
1 2 1 'PEG 3350' ? ? ? 
1 3 2 CaCl2      ? ? ? 
1 4 2 'PEG 3350' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-11-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
# 
_reflns.entry_id                     2R8J 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.10 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   30191 
_reflns.number_obs                   30191 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.154 
_reflns.pdbx_netI_over_sigmaI        16.98 
_reflns.B_iso_Wilson_estimate        40.053 
_reflns.pdbx_redundancy              14.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.443 
_reflns_shell.meanI_over_sigI_obs    5.71 
_reflns_shell.pdbx_redundancy        13.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2R8J 
_refine.ls_d_res_high                            3.10 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     30031 
_refine.ls_number_reflns_obs                     30031 
_refine.ls_number_reflns_R_free                  2412 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2082 
_refine.ls_R_factor_R_free                       0.2574 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 12.4 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1JIH 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.B_iso_mean                               33.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8103 
_refine_hist.pdbx_number_atoms_nucleic_acid   818 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             121 
_refine_hist.number_atoms_total               9108 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg  1.20265 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d     0.00415 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  1.344   1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 2.372   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  1.920   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it 3.150   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2R8J 
_struct.title                     
'Structure of the Eukaryotic DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin containing DNA' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2R8J 
_struct_keywords.pdbx_keywords   'REPLICATION, TRANSFERASE/DNA' 
_struct_keywords.text            'protein-cisplatin-DNA-dNTP complex, REPLICATION, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 5 ? 
M N N 5 ? 
N N N 6 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR E 28  ? GLN E 34  ? THR A 5   GLN A 11  1 ? 7  
HELX_P HELX_P2  2  LEU E 35  ? SER E 37  ? LEU A 12  SER A 14  5 ? 3  
HELX_P HELX_P3  3  ALA E 56  ? CYS E 66  ? ALA A 33  CYS A 43  1 ? 11 
HELX_P HELX_P4  4  ALA E 88  ? GLY E 93  ? ALA A 65  GLY A 70  5 ? 6  
HELX_P HELX_P5  5  THR E 99  ? LYS E 105 ? THR A 76  LYS A 82  1 ? 7  
HELX_P HELX_P6  6  SER E 143 ? GLU E 145 ? SER A 120 GLU A 122 5 ? 3  
HELX_P HELX_P7  7  LEU E 151 ? CYS E 169 ? LEU A 128 CYS A 146 1 ? 19 
HELX_P HELX_P8  8  LEU E 184 ? ASP E 195 ? LEU A 161 ASP A 172 1 ? 12 
HELX_P HELX_P9  9  LYS E 205 ? LEU E 210 ? LYS A 182 LEU A 187 1 ? 6  
HELX_P HELX_P10 10 LEU E 210 ? GLY E 220 ? LEU A 187 GLY A 197 1 ? 11 
HELX_P HELX_P11 11 PRO E 232 ? LEU E 238 ? PRO A 209 LEU A 215 5 ? 7  
HELX_P HELX_P12 12 ASP E 255 ? LEU E 279 ? ASP A 232 LEU A 256 1 ? 25 
HELX_P HELX_P13 13 THR E 290 ? LYS E 301 ? THR A 267 LYS A 278 1 ? 12 
HELX_P HELX_P14 14 LYS E 310 ? ASP E 312 ? LYS A 287 ASP A 289 5 ? 3  
HELX_P HELX_P15 15 CYS E 313 ? ASP E 319 ? CYS A 290 ASP A 296 1 ? 7  
HELX_P HELX_P16 16 GLU E 324 ? PHE E 328 ? GLU A 301 PHE A 305 5 ? 5  
HELX_P HELX_P17 17 GLY E 333 ? ASP E 344 ? GLY A 310 ASP A 321 1 ? 12 
HELX_P HELX_P18 18 ASN E 349 ? THR E 357 ? ASN A 326 THR A 334 1 ? 9  
HELX_P HELX_P19 19 ASN E 361 ? VAL E 373 ? ASN A 338 VAL A 350 1 ? 13 
HELX_P HELX_P20 20 ASP E 386 ? LEU E 388 ? ASP A 363 LEU A 365 5 ? 3  
HELX_P HELX_P21 21 LYS E 389 ? SER E 401 ? LYS A 366 SER A 378 1 ? 13 
HELX_P HELX_P22 22 SER E 431 ? ASN E 458 ? SER A 408 ASN A 435 1 ? 28 
HELX_P HELX_P23 23 HIS E 494 ? GLY E 511 ? HIS A 471 GLY A 488 1 ? 18 
HELX_P HELX_P24 24 THR F 28  ? LEU F 35  ? THR B 5   LEU B 12  1 ? 8  
HELX_P HELX_P25 25 ALA F 56  ? CYS F 66  ? ALA B 33  CYS B 43  1 ? 11 
HELX_P HELX_P26 26 SER F 86  ? LYS F 91  ? SER B 63  LYS B 68  1 ? 6  
HELX_P HELX_P27 27 THR F 99  ? CYS F 107 ? THR B 76  CYS B 84  1 ? 9  
HELX_P HELX_P28 28 SER F 143 ? GLU F 145 ? SER B 120 GLU B 122 5 ? 3  
HELX_P HELX_P29 29 LEU F 151 ? CYS F 169 ? LEU B 128 CYS B 146 1 ? 19 
HELX_P HELX_P30 30 LEU F 184 ? ASP F 195 ? LEU B 161 ASP B 172 1 ? 12 
HELX_P HELX_P31 31 LYS F 205 ? LEU F 210 ? LYS B 182 LEU B 187 1 ? 6  
HELX_P HELX_P32 32 LEU F 210 ? GLY F 220 ? LEU B 187 GLY B 197 1 ? 11 
HELX_P HELX_P33 33 PRO F 232 ? LEU F 238 ? PRO B 209 LEU B 215 5 ? 7  
HELX_P HELX_P34 34 ASP F 255 ? LEU F 279 ? ASP B 232 LEU B 256 1 ? 25 
HELX_P HELX_P35 35 THR F 290 ? TYR F 300 ? THR B 267 TYR B 277 1 ? 11 
HELX_P HELX_P36 36 LYS F 310 ? ASP F 312 ? LYS B 287 ASP B 289 5 ? 3  
HELX_P HELX_P37 37 CYS F 313 ? ASP F 319 ? CYS B 290 ASP B 296 1 ? 7  
HELX_P HELX_P38 38 GLU F 324 ? PHE F 328 ? GLU B 301 PHE B 305 5 ? 5  
HELX_P HELX_P39 39 GLY F 333 ? LEU F 343 ? GLY B 310 LEU B 320 1 ? 11 
HELX_P HELX_P40 40 ASN F 349 ? TRP F 358 ? ASN B 326 TRP B 335 1 ? 10 
HELX_P HELX_P41 41 ASN F 361 ? LYS F 374 ? ASN B 338 LYS B 351 1 ? 14 
HELX_P HELX_P42 42 ASP F 379 ? SER F 383 ? ASP B 356 SER B 360 5 ? 5  
HELX_P HELX_P43 43 LYS F 389 ? ARG F 402 ? LYS B 366 ARG B 379 1 ? 14 
HELX_P HELX_P44 44 SER F 431 ? TYR F 457 ? SER B 408 TYR B 434 1 ? 27 
HELX_P HELX_P45 45 SER F 493 ? GLY F 511 ? SER B 470 GLY B 488 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B DG  1   N7  ? ? ? 1_555 G CPT .  PT1 ? ? U DG  4    U CPT 45   1_555 ? ? ? ? ? ? ?            1.964 ? 
metalc2  metalc ? ? B DG  2   N7  ? ? ? 1_555 G CPT .  PT1 ? ? U DG  5    U CPT 45   1_555 ? ? ? ? ? ? ?            2.008 ? 
metalc3  metalc ? ? D DG  1   N7  ? ? ? 1_555 H CPT .  PT1 ? ? T DG  4    T CPT 45   1_555 ? ? ? ? ? ? ?            1.962 ? 
metalc4  metalc ? ? D DG  2   N7  ? ? ? 1_555 H CPT .  PT1 ? ? T DG  5    T CPT 45   1_555 ? ? ? ? ? ? ?            1.986 ? 
metalc5  metalc ? ? E ASP 53  OD1 ? ? ? 1_555 J CA  .  CA  ? ? A ASP 30   A CA  1502 1_555 ? ? ? ? ? ? ?            2.088 ? 
metalc6  metalc ? ? E ASP 53  OD2 ? ? ? 1_555 I CA  .  CA  ? ? A ASP 30   A CA  1501 1_555 ? ? ? ? ? ? ?            2.699 ? 
metalc7  metalc ? ? E MET 54  O   ? ? ? 1_555 J CA  .  CA  ? ? A MET 31   A CA  1502 1_555 ? ? ? ? ? ? ?            2.464 ? 
metalc8  metalc ? ? E ASP 178 OD1 ? ? ? 1_555 J CA  .  CA  ? ? A ASP 155  A CA  1502 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc9  metalc ? ? E GLU 179 OE1 ? ? ? 1_555 I CA  .  CA  ? ? A GLU 156  A CA  1501 1_555 ? ? ? ? ? ? ?            2.644 ? 
metalc10 metalc ? ? F ASP 53  OD1 ? ? ? 1_555 M CA  .  CA  ? ? B ASP 30   B CA  1702 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc11 metalc ? ? F ASP 53  OD2 ? ? ? 1_555 M CA  .  CA  ? ? B ASP 30   B CA  1702 1_555 ? ? ? ? ? ? ?            2.880 ? 
metalc12 metalc ? ? F ASP 53  OD2 ? ? ? 1_555 L CA  .  CA  ? ? B ASP 30   B CA  1701 1_555 ? ? ? ? ? ? ?            2.762 ? 
metalc13 metalc ? ? F MET 54  O   ? ? ? 1_555 M CA  .  CA  ? ? B MET 31   B CA  1702 1_555 ? ? ? ? ? ? ?            2.599 ? 
metalc14 metalc ? ? F ASP 178 OD1 ? ? ? 1_555 M CA  .  CA  ? ? B ASP 155  B CA  1702 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc15 metalc ? ? F ASP 178 OD1 ? ? ? 1_555 L CA  .  CA  ? ? B ASP 155  B CA  1701 1_555 ? ? ? ? ? ? ?            2.785 ? 
metalc16 metalc ? ? F ASP 178 OD2 ? ? ? 1_555 L CA  .  CA  ? ? B ASP 155  B CA  1701 1_555 ? ? ? ? ? ? ?            2.746 ? 
metalc17 metalc ? ? F GLU 179 OE1 ? ? ? 1_555 L CA  .  CA  ? ? B GLU 156  B CA  1701 1_555 ? ? ? ? ? ? ?            2.473 ? 
metalc18 metalc ? ? J CA  .   CA  ? ? ? 1_555 K DCP .  O2B ? ? A CA  1502 A DCP 2001 1_555 ? ? ? ? ? ? ?            2.677 ? 
metalc19 metalc ? ? J CA  .   CA  ? ? ? 1_555 K DCP .  O3G ? ? A CA  1502 A DCP 2001 1_555 ? ? ? ? ? ? ?            2.742 ? 
metalc20 metalc ? ? J CA  .   CA  ? ? ? 1_555 K DCP .  O1A ? ? A CA  1502 A DCP 2001 1_555 ? ? ? ? ? ? ?            2.302 ? 
metalc21 metalc ? ? L CA  .   CA  ? ? ? 1_555 N DCP .  O1A ? ? B CA  1701 B DCP 3001 1_555 ? ? ? ? ? ? ?            2.561 ? 
metalc22 metalc ? ? M CA  .   CA  ? ? ? 1_555 N DCP .  O1G ? ? B CA  1702 B DCP 3001 1_555 ? ? ? ? ? ? ?            2.538 ? 
metalc23 metalc ? ? M CA  .   CA  ? ? ? 1_555 N DCP .  O1A ? ? B CA  1702 B DCP 3001 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc24 metalc ? ? M CA  .   CA  ? ? ? 1_555 N DCP .  O2B ? ? B CA  1702 B DCP 3001 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc25 metalc ? ? I CA  .   CA  ? ? ? 1_555 S HOH .  O   ? ? A CA  1501 A HOH 2004 1_555 ? ? ? ? ? ? ?            2.680 ? 
metalc26 metalc ? ? I CA  .   CA  ? ? ? 1_555 K DCP .  O1A ? ? A CA  1501 A DCP 2001 1_555 ? ? ? ? ? ? ?            3.141 ? 
hydrog1  hydrog ? ? A DG  1   N1  ? ? ? 1_555 B DC  11 N3  ? ? Q DG  5    U DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1   N2  ? ? ? 1_555 B DC  11 O2  ? ? Q DG  5    U DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1   O6  ? ? ? 1_555 B DC  11 N4  ? ? Q DG  5    U DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT  2   N3  ? ? ? 1_555 B DA  10 N1  ? ? Q DT  6    U DA  13   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog5  hydrog ? ? A DG  3   N1  ? ? ? 1_555 B DC  9  N3  ? ? Q DG  7    U DC  12   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog6  hydrog ? ? A DG  4   N2  ? ? ? 1_555 B DC  8  O2  ? ? Q DG  8    U DC  11   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog7  hydrog ? ? A DA  5   N1  ? ? ? 1_555 B DT  7  N3  ? ? Q DA  9    U DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  5   N6  ? ? ? 1_555 B DT  7  O4  ? ? Q DA  9    U DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  6   N3  ? ? ? 1_555 B DA  6  N1  ? ? Q DT  10   U DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  6   O4  ? ? ? 1_555 B DA  6  N6  ? ? Q DT  10   U DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  7   N1  ? ? ? 1_555 B DC  5  N3  ? ? Q DG  11   U DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  7   N2  ? ? ? 1_555 B DC  5  O2  ? ? Q DG  11   U DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  7   O6  ? ? ? 1_555 B DC  5  N4  ? ? Q DG  11   U DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA  8   N1  ? ? ? 1_555 B DT  4  N3  ? ? Q DA  12   U DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA  8   N6  ? ? ? 1_555 B DT  4  O4  ? ? Q DA  12   U DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  9   N1  ? ? ? 1_555 B DC  3  O2  ? ? Q DG  13   U DC  6    1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog17 hydrog ? ? C DG  1   N1  ? ? ? 1_555 D DC  11 N3  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  1   N2  ? ? ? 1_555 D DC  11 O2  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  1   O6  ? ? ? 1_555 D DC  11 N4  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DT  2   N3  ? ? ? 1_555 D DA  10 N1  ? ? P DT  6    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT  2   O4  ? ? ? 1_555 D DA  10 N6  ? ? P DT  6    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DG  3   N1  ? ? ? 1_555 D DC  9  N3  ? ? P DG  7    T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DG  3   N2  ? ? ? 1_555 D DC  9  O2  ? ? P DG  7    T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG  3   O6  ? ? ? 1_555 D DC  9  N4  ? ? P DG  7    T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  8  N3  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  8  O2  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  8  N4  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DA  5   N1  ? ? ? 1_555 D DT  7  N3  ? ? P DA  9    T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DA  5   N6  ? ? ? 1_555 D DT  7  O4  ? ? P DA  9    T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT  6   N3  ? ? ? 1_555 D DA  6  N1  ? ? P DT  10   T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DT  6   O4  ? ? ? 1_555 D DA  6  N6  ? ? P DT  10   T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  7   N1  ? ? ? 1_555 D DC  5  N3  ? ? P DG  11   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  7   N2  ? ? ? 1_555 D DC  5  O2  ? ? P DG  11   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  7   O6  ? ? ? 1_555 D DC  5  N4  ? ? P DG  11   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DA  8   N1  ? ? ? 1_555 D DT  4  N3  ? ? P DA  12   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DA  8   N6  ? ? ? 1_555 D DT  4  O4  ? ? P DA  12   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  3  N3  ? ? P DG  13   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  3  O2  ? ? P DG  13   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  3  N4  ? ? P DG  13   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 302 E . ? LYS 279 A PRO 303 E ? PRO 280 A 1 -0.23 
2 TYR 517 E . ? TYR 494 A PRO 518 E ? PRO 495 A 1 -0.31 
3 LYS 302 F . ? LYS 279 B PRO 303 F ? PRO 280 B 1 0.12  
4 TYR 517 F . ? TYR 494 B PRO 518 F ? PRO 495 B 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
E ? 6 ? 
F ? 3 ? 
G ? 2 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? parallel      
E 5 6 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 172 ? SER E 176 ? VAL A 149 SER A 153 
A 2 GLU E 179 ? ASP E 183 ? GLU A 156 ASP A 160 
A 3 ILE E 49  ? MET E 54  ? ILE A 26  MET A 31  
A 4 THR E 283 ? SER E 288 ? THR A 260 SER A 265 
A 5 GLN E 306 ? ILE E 308 ? GLN A 283 ILE A 285 
A 6 ASP E 243 ? VAL E 244 ? ASP A 220 VAL A 221 
B 1 SER E 81  ? VAL E 85  ? SER A 58  VAL A 62  
B 2 VAL E 74  ? GLN E 78  ? VAL A 51  GLN A 55  
B 3 ILE E 111 ? HIS E 114 ? ILE A 88  HIS A 91  
C 1 TRP E 125 ? GLN E 126 ? TRP A 102 GLN A 103 
C 2 VAL E 117 ? LYS E 119 ? VAL A 94  LYS A 96  
C 3 HIS E 147 ? VAL E 149 ? HIS A 124 VAL A 126 
D 1 MET E 418 ? LYS E 422 ? MET A 395 LYS A 399 
D 2 LYS E 521 ? PHE E 529 ? LYS A 498 PHE A 506 
D 3 PRO E 463 ? LYS E 471 ? PRO A 440 LYS A 448 
D 4 VAL E 477 ? PRO E 483 ? VAL A 454 PRO A 460 
E 1 VAL F 172 ? ARG F 174 ? VAL B 149 ARG B 151 
E 2 GLU F 179 ? ASP F 183 ? GLU B 156 ASP B 160 
E 3 ILE F 49  ? MET F 54  ? ILE B 26  MET B 31  
E 4 THR F 283 ? SER F 288 ? THR B 260 SER B 265 
E 5 GLN F 306 ? ILE F 308 ? GLN B 283 ILE B 285 
E 6 ASP F 243 ? VAL F 244 ? ASP B 220 VAL B 221 
F 1 SER F 81  ? VAL F 85  ? SER B 58  VAL B 62  
F 2 VAL F 74  ? GLN F 78  ? VAL B 51  GLN B 55  
F 3 ILE F 111 ? HIS F 114 ? ILE B 88  HIS B 91  
G 1 VAL F 117 ? LYS F 119 ? VAL B 94  LYS B 96  
G 2 HIS F 147 ? VAL F 149 ? HIS B 124 VAL B 126 
H 1 SER F 417 ? ASN F 423 ? SER B 394 ASN B 400 
H 2 LYS F 521 ? ILE F 532 ? LYS B 498 ILE B 509 
H 3 ILE F 460 ? LYS F 471 ? ILE B 437 LYS B 448 
H 4 VAL F 477 ? LYS F 480 ? VAL B 454 LYS B 457 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU E 173 ? N GLU A 150 O PHE E 181 ? O PHE A 158 
A 2 3 O LEU E 182 ? O LEU A 159 N ALA E 50  ? N ALA A 27  
A 3 4 N ASP E 53  ? N ASP A 30  O SER E 284 ? O SER A 261 
A 4 5 N LEU E 287 ? N LEU A 264 O THR E 307 ? O THR A 284 
A 5 6 O ILE E 308 ? O ILE A 285 N ASP E 243 ? N ASP A 220 
B 1 2 O SER E 81  ? O SER A 58  N GLN E 78  ? N GLN A 55  
B 2 3 N VAL E 77  ? N VAL A 54  O ILE E 113 ? O ILE A 90  
C 1 2 O GLN E 126 ? O GLN A 103 N VAL E 117 ? N VAL A 94  
C 2 3 N PHE E 118 ? N PHE A 95  O LYS E 148 ? O LYS A 125 
D 1 2 N SER E 420 ? N SER A 397 O MET E 524 ? O MET A 501 
D 2 3 O SER E 523 ? O SER A 500 N SER E 469 ? N SER A 446 
D 3 4 N ILE E 468 ? N ILE A 445 O LYS E 480 ? O LYS A 457 
E 1 2 N GLU F 173 ? N GLU B 150 O PHE F 181 ? O PHE B 158 
E 2 3 O LEU F 182 ? O LEU B 159 N ALA F 50  ? N ALA B 27  
E 3 4 N ILE F 49  ? N ILE B 26  O SER F 288 ? O SER B 265 
E 4 5 N CYS F 285 ? N CYS B 262 O THR F 307 ? O THR B 284 
E 5 6 O ILE F 308 ? O ILE B 285 N ASP F 243 ? N ASP B 220 
F 1 2 O ILE F 83  ? O ILE B 60  N CYS F 76  ? N CYS B 53  
F 2 3 N VAL F 75  ? N VAL B 52  O ILE F 113 ? O ILE B 90  
G 1 2 N PHE F 118 ? N PHE B 95  O LYS F 148 ? O LYS B 125 
H 1 2 N SER F 420 ? N SER B 397 O MET F 524 ? O MET B 501 
H 2 3 O ILE F 532 ? O ILE B 509 N ILE F 460 ? N ILE B 437 
H 3 4 N LEU F 470 ? N LEU B 447 O TYR F 478 ? O TYR B 455 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CPT U 45'   
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CPT T 45'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1501'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1502'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 1701'  
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 1702'  
AC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE DCP A 2001' 
AC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DCP B 3001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  DG  A 9   ? DG  Q 13   . ? 1_555 ? 
2  AC1 4  DG  B 1   ? DG  U 4    . ? 1_555 ? 
3  AC1 4  DG  B 2   ? DG  U 5    . ? 1_555 ? 
4  AC1 4  DC  B 3   ? DC  U 6    . ? 1_555 ? 
5  AC2 4  DG  C 9   ? DG  P 13   . ? 1_555 ? 
6  AC2 4  DG  D 1   ? DG  T 4    . ? 1_555 ? 
7  AC2 4  DG  D 2   ? DG  T 5    . ? 1_555 ? 
8  AC2 4  DC  D 3   ? DC  T 6    . ? 1_555 ? 
9  AC3 5  ASP E 53  ? ASP A 30   . ? 1_555 ? 
10 AC3 5  GLU E 179 ? GLU A 156  . ? 1_555 ? 
11 AC3 5  DCP K .   ? DCP A 2001 . ? 1_555 ? 
12 AC3 5  HOH S .   ? HOH A 2004 . ? 1_555 ? 
13 AC3 5  DG  A 9   ? DG  Q 13   . ? 1_555 ? 
14 AC4 4  ASP E 53  ? ASP A 30   . ? 1_555 ? 
15 AC4 4  MET E 54  ? MET A 31   . ? 1_555 ? 
16 AC4 4  ASP E 178 ? ASP A 155  . ? 1_555 ? 
17 AC4 4  DCP K .   ? DCP A 2001 . ? 1_555 ? 
18 AC5 5  ASP F 53  ? ASP B 30   . ? 1_555 ? 
19 AC5 5  ASP F 178 ? ASP B 155  . ? 1_555 ? 
20 AC5 5  GLU F 179 ? GLU B 156  . ? 1_555 ? 
21 AC5 5  CA  M .   ? CA  B 1702 . ? 1_555 ? 
22 AC5 5  DCP N .   ? DCP B 3001 . ? 1_555 ? 
23 AC6 5  ASP F 53  ? ASP B 30   . ? 1_555 ? 
24 AC6 5  MET F 54  ? MET B 31   . ? 1_555 ? 
25 AC6 5  ASP F 178 ? ASP B 155  . ? 1_555 ? 
26 AC6 5  CA  L .   ? CA  B 1701 . ? 1_555 ? 
27 AC6 5  DCP N .   ? DCP B 3001 . ? 1_555 ? 
28 AC7 16 ASP E 53  ? ASP A 30   . ? 1_555 ? 
29 AC7 16 MET E 54  ? MET A 31   . ? 1_555 ? 
30 AC7 16 ASN E 55  ? ASN A 32   . ? 1_555 ? 
31 AC7 16 ALA E 56  ? ALA A 33   . ? 1_555 ? 
32 AC7 16 PHE E 57  ? PHE A 34   . ? 1_555 ? 
33 AC7 16 PHE E 58  ? PHE A 35   . ? 1_555 ? 
34 AC7 16 ILE E 83  ? ILE A 60   . ? 1_555 ? 
35 AC7 16 TYR E 87  ? TYR A 64   . ? 1_555 ? 
36 AC7 16 ARG E 90  ? ARG A 67   . ? 1_555 ? 
37 AC7 16 ARG E 96  ? ARG A 73   . ? 1_555 ? 
38 AC7 16 ASP E 178 ? ASP A 155  . ? 1_555 ? 
39 AC7 16 LYS E 302 ? LYS A 279  . ? 1_555 ? 
40 AC7 16 CA  I .   ? CA  A 1501 . ? 1_555 ? 
41 AC7 16 CA  J .   ? CA  A 1502 . ? 1_555 ? 
42 AC7 16 DG  A 9   ? DG  Q 13   . ? 1_555 ? 
43 AC7 16 DG  B 2   ? DG  U 5    . ? 1_555 ? 
44 AC8 17 ASP F 53  ? ASP B 30   . ? 1_555 ? 
45 AC8 17 MET F 54  ? MET B 31   . ? 1_555 ? 
46 AC8 17 ASN F 55  ? ASN B 32   . ? 1_555 ? 
47 AC8 17 ALA F 56  ? ALA B 33   . ? 1_555 ? 
48 AC8 17 PHE F 57  ? PHE B 34   . ? 1_555 ? 
49 AC8 17 PHE F 58  ? PHE B 35   . ? 1_555 ? 
50 AC8 17 ILE F 83  ? ILE B 60   . ? 1_555 ? 
51 AC8 17 TYR F 87  ? TYR B 64   . ? 1_555 ? 
52 AC8 17 ARG F 90  ? ARG B 67   . ? 1_555 ? 
53 AC8 17 ARG F 96  ? ARG B 73   . ? 1_555 ? 
54 AC8 17 ASP F 178 ? ASP B 155  . ? 1_555 ? 
55 AC8 17 LYS F 302 ? LYS B 279  . ? 1_555 ? 
56 AC8 17 CA  L .   ? CA  B 1701 . ? 1_555 ? 
57 AC8 17 CA  M .   ? CA  B 1702 . ? 1_555 ? 
58 AC8 17 HOH T .   ? HOH B 3056 . ? 1_555 ? 
59 AC8 17 DG  C 9   ? DG  P 13   . ? 1_555 ? 
60 AC8 17 DG  D 2   ? DG  T 5    . ? 1_555 ? 
# 
_atom_sites.entry_id                    2R8J 
_atom_sites.fract_transf_matrix[1][1]   0.009607 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009607 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003412 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 31.980  -44.771 12.540  1.00 67.50  ? 5    DG  Q "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 32.705  -43.592 12.883  1.00 64.87  ? 5    DG  Q "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 31.790  -42.497 13.380  1.00 64.02  ? 5    DG  Q "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 32.583  -41.361 13.785  1.00 63.38  ? 5    DG  Q "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 30.805  -41.962 12.346  1.00 62.91  ? 5    DG  Q "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 29.606  -41.554 13.012  1.00 63.56  ? 5    DG  Q "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 31.543  -40.773 11.754  1.00 61.92  ? 5    DG  Q "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 32.335  -40.245 12.940  1.00 60.06  ? 5    DG  Q "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 33.635  -39.677 12.605  1.00 56.98  ? 5    DG  Q N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 34.628  -40.275 11.869  1.00 56.13  ? 5    DG  Q C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 35.717  -39.559 11.803  1.00 56.42  ? 5    DG  Q N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 35.418  -38.411 12.525  1.00 55.59  ? 5    DG  Q C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 36.217  -37.274 12.819  1.00 54.86  ? 5    DG  Q C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 37.392  -37.053 12.501  1.00 55.62  ? 5    DG  Q O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 35.519  -36.339 13.576  1.00 53.63  ? 5    DG  Q N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 34.224  -36.479 14.003  1.00 54.37  ? 5    DG  Q C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 33.728  -35.461 14.723  1.00 53.35  ? 5    DG  Q N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 33.470  -37.538 13.744  1.00 55.35  ? 5    DG  Q N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 34.128  -38.458 13.006  1.00 55.86  ? 5    DG  Q C4    1 
ATOM   20   P  P     . DT  A 1 2   ? 28.317  -41.133 12.152  1.00 64.74  ? 6    DT  Q P     1 
ATOM   21   O  OP1   . DT  A 1 2   ? 27.152  -41.924 12.627  1.00 65.31  ? 6    DT  Q OP1   1 
ATOM   22   O  OP2   . DT  A 1 2   ? 28.683  -41.154 10.713  1.00 64.68  ? 6    DT  Q OP2   1 
ATOM   23   O  "O5'" . DT  A 1 2   ? 28.066  -39.624 12.575  1.00 61.94  ? 6    DT  Q "O5'" 1 
ATOM   24   C  "C5'" . DT  A 1 2   ? 27.517  -38.699 11.652  1.00 57.80  ? 6    DT  Q "C5'" 1 
ATOM   25   C  "C4'" . DT  A 1 2   ? 27.882  -37.291 12.051  1.00 54.12  ? 6    DT  Q "C4'" 1 
ATOM   26   O  "O4'" . DT  A 1 2   ? 29.321  -37.160 12.161  1.00 51.75  ? 6    DT  Q "O4'" 1 
ATOM   27   C  "C3'" . DT  A 1 2   ? 27.440  -36.244 11.034  1.00 52.83  ? 6    DT  Q "C3'" 1 
ATOM   28   O  "O3'" . DT  A 1 2   ? 27.020  -35.070 11.719  1.00 54.18  ? 6    DT  Q "O3'" 1 
ATOM   29   C  "C2'" . DT  A 1 2   ? 28.707  -35.965 10.253  1.00 51.51  ? 6    DT  Q "C2'" 1 
ATOM   30   C  "C1'" . DT  A 1 2   ? 29.761  -36.097 11.332  1.00 49.24  ? 6    DT  Q "C1'" 1 
ATOM   31   N  N1    . DT  A 1 2   ? 31.106  -36.426 10.827  1.00 45.91  ? 6    DT  Q N1    1 
ATOM   32   C  C2    . DT  A 1 2   ? 32.124  -35.546 11.107  1.00 43.96  ? 6    DT  Q C2    1 
ATOM   33   O  O2    . DT  A 1 2   ? 31.964  -34.537 11.771  1.00 42.63  ? 6    DT  Q O2    1 
ATOM   34   N  N3    . DT  A 1 2   ? 33.342  -35.894 10.582  1.00 42.81  ? 6    DT  Q N3    1 
ATOM   35   C  C4    . DT  A 1 2   ? 33.637  -37.012 9.827   1.00 43.67  ? 6    DT  Q C4    1 
ATOM   36   O  O4    . DT  A 1 2   ? 34.779  -37.188 9.414   1.00 44.11  ? 6    DT  Q O4    1 
ATOM   37   C  C5    . DT  A 1 2   ? 32.525  -37.902 9.584   1.00 43.17  ? 6    DT  Q C5    1 
ATOM   38   C  C7    . DT  A 1 2   ? 32.755  -39.146 8.785   1.00 40.42  ? 6    DT  Q C7    1 
ATOM   39   C  C6    . DT  A 1 2   ? 31.330  -37.568 10.090  1.00 44.53  ? 6    DT  Q C6    1 
ATOM   40   P  P     . DG  A 1 3   ? 25.460  -34.726 11.807  1.00 55.82  ? 7    DG  Q P     1 
ATOM   41   O  OP1   . DG  A 1 3   ? 24.884  -35.566 12.888  1.00 55.55  ? 7    DG  Q OP1   1 
ATOM   42   O  OP2   . DG  A 1 3   ? 24.904  -34.811 10.433  1.00 56.64  ? 7    DG  Q OP2   1 
ATOM   43   O  "O5'" . DG  A 1 3   ? 25.437  -33.210 12.287  1.00 56.69  ? 7    DG  Q "O5'" 1 
ATOM   44   C  "C5'" . DG  A 1 3   ? 25.958  -32.845 13.561  1.00 58.86  ? 7    DG  Q "C5'" 1 
ATOM   45   C  "C4'" . DG  A 1 3   ? 26.877  -31.654 13.425  1.00 60.68  ? 7    DG  Q "C4'" 1 
ATOM   46   O  "O4'" . DG  A 1 3   ? 28.026  -32.026 12.628  1.00 60.73  ? 7    DG  Q "O4'" 1 
ATOM   47   C  "C3'" . DG  A 1 3   ? 26.252  -30.450 12.722  1.00 62.49  ? 7    DG  Q "C3'" 1 
ATOM   48   O  "O3'" . DG  A 1 3   ? 26.763  -29.246 13.302  1.00 66.08  ? 7    DG  Q "O3'" 1 
ATOM   49   C  "C2'" . DG  A 1 3   ? 26.728  -30.604 11.289  1.00 61.69  ? 7    DG  Q "C2'" 1 
ATOM   50   C  "C1'" . DG  A 1 3   ? 28.114  -31.194 11.479  1.00 60.60  ? 7    DG  Q "C1'" 1 
ATOM   51   N  N9    . DG  A 1 3   ? 28.596  -32.017 10.373  1.00 58.88  ? 7    DG  Q N9    1 
ATOM   52   C  C8    . DG  A 1 3   ? 27.853  -32.849 9.571   1.00 58.59  ? 7    DG  Q C8    1 
ATOM   53   N  N7    . DG  A 1 3   ? 28.574  -33.488 8.690   1.00 57.85  ? 7    DG  Q N7    1 
ATOM   54   C  C5    . DG  A 1 3   ? 29.870  -33.047 8.920   1.00 57.00  ? 7    DG  Q C5    1 
ATOM   55   C  C6    . DG  A 1 3   ? 31.089  -33.398 8.280   1.00 56.70  ? 7    DG  Q C6    1 
ATOM   56   O  O6    . DG  A 1 3   ? 31.276  -34.209 7.366   1.00 56.91  ? 7    DG  Q O6    1 
ATOM   57   N  N1    . DG  A 1 3   ? 32.166  -32.700 8.814   1.00 56.48  ? 7    DG  Q N1    1 
ATOM   58   C  C2    . DG  A 1 3   ? 32.086  -31.788 9.836   1.00 57.45  ? 7    DG  Q C2    1 
ATOM   59   N  N2    . DG  A 1 3   ? 33.240  -31.210 10.204  1.00 58.40  ? 7    DG  Q N2    1 
ATOM   60   N  N3    . DG  A 1 3   ? 30.958  -31.463 10.451  1.00 57.44  ? 7    DG  Q N3    1 
ATOM   61   C  C4    . DG  A 1 3   ? 29.898  -32.126 9.944   1.00 57.54  ? 7    DG  Q C4    1 
ATOM   62   P  P     . DG  A 1 4   ? 25.849  -27.926 13.335  1.00 69.53  ? 8    DG  Q P     1 
ATOM   63   O  OP1   . DG  A 1 4   ? 25.929  -27.375 14.713  1.00 70.27  ? 8    DG  Q OP1   1 
ATOM   64   O  OP2   . DG  A 1 4   ? 24.523  -28.255 12.750  1.00 68.65  ? 8    DG  Q OP2   1 
ATOM   65   O  "O5'" . DG  A 1 4   ? 26.606  -26.933 12.347  1.00 69.10  ? 8    DG  Q "O5'" 1 
ATOM   66   C  "C5'" . DG  A 1 4   ? 27.299  -27.452 11.220  1.00 69.19  ? 8    DG  Q "C5'" 1 
ATOM   67   C  "C4'" . DG  A 1 4   ? 28.632  -26.763 11.046  1.00 69.17  ? 8    DG  Q "C4'" 1 
ATOM   68   O  "O4'" . DG  A 1 4   ? 29.525  -27.670 10.369  1.00 68.25  ? 8    DG  Q "O4'" 1 
ATOM   69   C  "C3'" . DG  A 1 4   ? 28.597  -25.507 10.183  1.00 69.28  ? 8    DG  Q "C3'" 1 
ATOM   70   O  "O3'" . DG  A 1 4   ? 29.662  -24.627 10.571  1.00 70.16  ? 8    DG  Q "O3'" 1 
ATOM   71   C  "C2'" . DG  A 1 4   ? 28.796  -26.063 8.783   1.00 68.20  ? 8    DG  Q "C2'" 1 
ATOM   72   C  "C1'" . DG  A 1 4   ? 29.661  -27.306 9.004   1.00 66.70  ? 8    DG  Q "C1'" 1 
ATOM   73   N  N9    . DG  A 1 4   ? 29.244  -28.464 8.220   1.00 64.89  ? 8    DG  Q N9    1 
ATOM   74   C  C8    . DG  A 1 4   ? 27.965  -28.952 8.087   1.00 63.57  ? 8    DG  Q C8    1 
ATOM   75   N  N7    . DG  A 1 4   ? 27.898  -30.021 7.341   1.00 62.65  ? 8    DG  Q N7    1 
ATOM   76   C  C5    . DG  A 1 4   ? 29.211  -30.251 6.952   1.00 62.78  ? 8    DG  Q C5    1 
ATOM   77   C  C6    . DG  A 1 4   ? 29.760  -31.272 6.135   1.00 62.05  ? 8    DG  Q C6    1 
ATOM   78   O  O6    . DG  A 1 4   ? 29.177  -32.210 5.577   1.00 61.80  ? 8    DG  Q O6    1 
ATOM   79   N  N1    . DG  A 1 4   ? 31.139  -31.130 5.997   1.00 61.54  ? 8    DG  Q N1    1 
ATOM   80   C  C2    . DG  A 1 4   ? 31.893  -30.134 6.571   1.00 61.99  ? 8    DG  Q C2    1 
ATOM   81   N  N2    . DG  A 1 4   ? 33.211  -30.166 6.316   1.00 60.72  ? 8    DG  Q N2    1 
ATOM   82   N  N3    . DG  A 1 4   ? 31.393  -29.177 7.338   1.00 62.29  ? 8    DG  Q N3    1 
ATOM   83   C  C4    . DG  A 1 4   ? 30.054  -29.296 7.484   1.00 63.53  ? 8    DG  Q C4    1 
ATOM   84   P  P     . DA  A 1 5   ? 29.769  -23.158 9.926   1.00 69.85  ? 9    DA  Q P     1 
ATOM   85   O  OP1   . DA  A 1 5   ? 29.909  -22.175 11.031  1.00 69.83  ? 9    DA  Q OP1   1 
ATOM   86   O  OP2   . DA  A 1 5   ? 28.669  -23.006 8.939   1.00 69.89  ? 9    DA  Q OP2   1 
ATOM   87   O  "O5'" . DA  A 1 5   ? 31.153  -23.205 9.145   1.00 67.57  ? 9    DA  Q "O5'" 1 
ATOM   88   C  "C5'" . DA  A 1 5   ? 31.526  -24.373 8.429   1.00 64.77  ? 9    DA  Q "C5'" 1 
ATOM   89   C  "C4'" . DA  A 1 5   ? 32.794  -24.130 7.647   1.00 63.24  ? 9    DA  Q "C4'" 1 
ATOM   90   O  "O4'" . DA  A 1 5   ? 33.008  -25.291 6.816   1.00 61.98  ? 9    DA  Q "O4'" 1 
ATOM   91   C  "C3'" . DA  A 1 5   ? 32.700  -22.956 6.682   1.00 63.40  ? 9    DA  Q "C3'" 1 
ATOM   92   O  "O3'" . DA  A 1 5   ? 34.001  -22.391 6.473   1.00 64.15  ? 9    DA  Q "O3'" 1 
ATOM   93   C  "C2'" . DA  A 1 5   ? 32.124  -23.584 5.426   1.00 61.61  ? 9    DA  Q "C2'" 1 
ATOM   94   C  "C1'" . DA  A 1 5   ? 32.618  -25.026 5.475   1.00 59.62  ? 9    DA  Q "C1'" 1 
ATOM   95   N  N9    . DA  A 1 5   ? 31.577  -25.993 5.129   1.00 56.46  ? 9    DA  Q N9    1 
ATOM   96   C  C8    . DA  A 1 5   ? 30.256  -25.967 5.506   1.00 54.20  ? 9    DA  Q C8    1 
ATOM   97   N  N7    . DA  A 1 5   ? 29.555  -26.974 5.048   1.00 52.36  ? 9    DA  Q N7    1 
ATOM   98   C  C5    . DA  A 1 5   ? 30.475  -27.715 4.319   1.00 52.95  ? 9    DA  Q C5    1 
ATOM   99   C  C6    . DA  A 1 5   ? 30.359  -28.908 3.584   1.00 52.66  ? 9    DA  Q C6    1 
ATOM   100  N  N6    . DA  A 1 5   ? 29.220  -29.591 3.457   1.00 52.33  ? 9    DA  Q N6    1 
ATOM   101  N  N1    . DA  A 1 5   ? 31.467  -29.380 2.975   1.00 53.48  ? 9    DA  Q N1    1 
ATOM   102  C  C2    . DA  A 1 5   ? 32.611  -28.693 3.103   1.00 55.37  ? 9    DA  Q C2    1 
ATOM   103  N  N3    . DA  A 1 5   ? 32.846  -27.561 3.767   1.00 55.06  ? 9    DA  Q N3    1 
ATOM   104  C  C4    . DA  A 1 5   ? 31.724  -27.120 4.359   1.00 54.73  ? 9    DA  Q C4    1 
ATOM   105  P  P     . DT  A 1 6   ? 34.225  -21.315 5.301   1.00 64.07  ? 10   DT  Q P     1 
ATOM   106  O  OP1   . DT  A 1 6   ? 35.623  -20.819 5.406   1.00 62.41  ? 10   DT  Q OP1   1 
ATOM   107  O  OP2   . DT  A 1 6   ? 33.095  -20.347 5.319   1.00 63.74  ? 10   DT  Q OP2   1 
ATOM   108  O  "O5'" . DT  A 1 6   ? 34.117  -22.193 3.978   1.00 62.49  ? 10   DT  Q "O5'" 1 
ATOM   109  C  "C5'" . DT  A 1 6   ? 35.155  -23.104 3.627   1.00 59.86  ? 10   DT  Q "C5'" 1 
ATOM   110  C  "C4'" . DT  A 1 6   ? 35.068  -23.452 2.161   1.00 56.54  ? 10   DT  Q "C4'" 1 
ATOM   111  O  "O4'" . DT  A 1 6   ? 34.138  -24.542 1.942   1.00 54.03  ? 10   DT  Q "O4'" 1 
ATOM   112  C  "C3'" . DT  A 1 6   ? 34.591  -22.295 1.281   1.00 55.46  ? 10   DT  Q "C3'" 1 
ATOM   113  O  "O3'" . DT  A 1 6   ? 35.402  -22.186 0.111   1.00 54.26  ? 10   DT  Q "O3'" 1 
ATOM   114  C  "C2'" . DT  A 1 6   ? 33.166  -22.686 0.917   1.00 52.77  ? 10   DT  Q "C2'" 1 
ATOM   115  C  "C1'" . DT  A 1 6   ? 33.261  -24.199 0.883   1.00 50.47  ? 10   DT  Q "C1'" 1 
ATOM   116  N  N1    . DT  A 1 6   ? 31.992  -24.934 1.074   1.00 45.61  ? 10   DT  Q N1    1 
ATOM   117  C  C2    . DT  A 1 6   ? 31.863  -26.161 0.455   1.00 43.80  ? 10   DT  Q C2    1 
ATOM   118  O  O2    . DT  A 1 6   ? 32.745  -26.667 -0.219  1.00 44.82  ? 10   DT  Q O2    1 
ATOM   119  N  N3    . DT  A 1 6   ? 30.656  -26.778 0.654   1.00 39.34  ? 10   DT  Q N3    1 
ATOM   120  C  C4    . DT  A 1 6   ? 29.592  -26.309 1.394   1.00 38.27  ? 10   DT  Q C4    1 
ATOM   121  O  O4    . DT  A 1 6   ? 28.568  -26.976 1.475   1.00 36.83  ? 10   DT  Q O4    1 
ATOM   122  C  C5    . DT  A 1 6   ? 29.797  -25.024 2.027   1.00 39.03  ? 10   DT  Q C5    1 
ATOM   123  C  C7    . DT  A 1 6   ? 28.700  -24.441 2.861   1.00 35.67  ? 10   DT  Q C7    1 
ATOM   124  C  C6    . DT  A 1 6   ? 30.972  -24.408 1.837   1.00 42.20  ? 10   DT  Q C6    1 
ATOM   125  P  P     . DG  A 1 7   ? 35.038  -21.089 -0.997  1.00 53.95  ? 11   DG  Q P     1 
ATOM   126  O  OP1   . DG  A 1 7   ? 36.292  -20.675 -1.679  1.00 53.77  ? 11   DG  Q OP1   1 
ATOM   127  O  OP2   . DG  A 1 7   ? 34.172  -20.062 -0.363  1.00 53.28  ? 11   DG  Q OP2   1 
ATOM   128  O  "O5'" . DG  A 1 7   ? 34.155  -21.913 -2.028  1.00 53.64  ? 11   DG  Q "O5'" 1 
ATOM   129  C  "C5'" . DG  A 1 7   ? 34.745  -22.914 -2.847  1.00 52.78  ? 11   DG  Q "C5'" 1 
ATOM   130  C  "C4'" . DG  A 1 7   ? 33.851  -23.202 -4.028  1.00 52.92  ? 11   DG  Q "C4'" 1 
ATOM   131  O  "O4'" . DG  A 1 7   ? 32.742  -24.041 -3.617  1.00 52.98  ? 11   DG  Q "O4'" 1 
ATOM   132  C  "C3'" . DG  A 1 7   ? 33.232  -21.943 -4.638  1.00 52.45  ? 11   DG  Q "C3'" 1 
ATOM   133  O  "O3'" . DG  A 1 7   ? 33.253  -22.021 -6.063  1.00 51.88  ? 11   DG  Q "O3'" 1 
ATOM   134  C  "C2'" . DG  A 1 7   ? 31.807  -21.955 -4.113  1.00 51.03  ? 11   DG  Q "C2'" 1 
ATOM   135  C  "C1'" . DG  A 1 7   ? 31.520  -23.440 -4.013  1.00 51.16  ? 11   DG  Q "C1'" 1 
ATOM   136  N  N9    . DG  A 1 7   ? 30.491  -23.800 -3.040  1.00 50.24  ? 11   DG  Q N9    1 
ATOM   137  C  C8    . DG  A 1 7   ? 30.052  -23.052 -1.972  1.00 49.71  ? 11   DG  Q C8    1 
ATOM   138  N  N7    . DG  A 1 7   ? 29.081  -23.623 -1.311  1.00 47.44  ? 11   DG  Q N7    1 
ATOM   139  C  C5    . DG  A 1 7   ? 28.873  -24.824 -1.976  1.00 46.83  ? 11   DG  Q C5    1 
ATOM   140  C  C6    . DG  A 1 7   ? 27.939  -25.860 -1.728  1.00 45.97  ? 11   DG  Q C6    1 
ATOM   141  O  O6    . DG  A 1 7   ? 27.075  -25.923 -0.846  1.00 46.12  ? 11   DG  Q O6    1 
ATOM   142  N  N1    . DG  A 1 7   ? 28.074  -26.900 -2.643  1.00 45.83  ? 11   DG  Q N1    1 
ATOM   143  C  C2    . DG  A 1 7   ? 28.989  -26.941 -3.667  1.00 46.41  ? 11   DG  Q C2    1 
ATOM   144  N  N2    . DG  A 1 7   ? 28.971  -28.038 -4.441  1.00 43.42  ? 11   DG  Q N2    1 
ATOM   145  N  N3    . DG  A 1 7   ? 29.860  -25.977 -3.912  1.00 48.80  ? 11   DG  Q N3    1 
ATOM   146  C  C4    . DG  A 1 7   ? 29.745  -24.956 -3.035  1.00 48.70  ? 11   DG  Q C4    1 
ATOM   147  P  P     . DA  A 1 8   ? 32.563  -20.862 -6.935  1.00 52.03  ? 12   DA  Q P     1 
ATOM   148  O  OP1   . DA  A 1 8   ? 33.523  -20.517 -8.015  1.00 52.24  ? 12   DA  Q OP1   1 
ATOM   149  O  OP2   . DA  A 1 8   ? 32.047  -19.793 -6.039  1.00 50.72  ? 12   DA  Q OP2   1 
ATOM   150  O  "O5'" . DA  A 1 8   ? 31.328  -21.615 -7.595  1.00 52.25  ? 12   DA  Q "O5'" 1 
ATOM   151  C  "C5'" . DA  A 1 8   ? 31.531  -22.871 -8.237  1.00 53.44  ? 12   DA  Q "C5'" 1 
ATOM   152  C  "C4'" . DA  A 1 8   ? 30.211  -23.494 -8.623  1.00 53.00  ? 12   DA  Q "C4'" 1 
ATOM   153  O  "O4'" . DA  A 1 8   ? 29.548  -24.066 -7.465  1.00 52.13  ? 12   DA  Q "O4'" 1 
ATOM   154  C  "C3'" . DA  A 1 8   ? 29.211  -22.532 -9.268  1.00 52.02  ? 12   DA  Q "C3'" 1 
ATOM   155  O  "O3'" . DA  A 1 8   ? 28.618  -23.139 -10.415 1.00 51.23  ? 12   DA  Q "O3'" 1 
ATOM   156  C  "C2'" . DA  A 1 8   ? 28.166  -22.341 -8.187  1.00 53.25  ? 12   DA  Q "C2'" 1 
ATOM   157  C  "C1'" . DA  A 1 8   ? 28.186  -23.688 -7.493  1.00 53.32  ? 12   DA  Q "C1'" 1 
ATOM   158  N  N9    . DA  A 1 8   ? 27.678  -23.636 -6.123  1.00 54.23  ? 12   DA  Q N9    1 
ATOM   159  C  C8    . DA  A 1 8   ? 27.964  -22.713 -5.146  1.00 54.37  ? 12   DA  Q C8    1 
ATOM   160  N  N7    . DA  A 1 8   ? 27.263  -22.871 -4.049  1.00 54.30  ? 12   DA  Q N7    1 
ATOM   161  C  C5    . DA  A 1 8   ? 26.481  -23.987 -4.312  1.00 53.34  ? 12   DA  Q C5    1 
ATOM   162  C  C6    . DA  A 1 8   ? 25.509  -24.660 -3.554  1.00 53.49  ? 12   DA  Q C6    1 
ATOM   163  N  N6    . DA  A 1 8   ? 25.136  -24.283 -2.329  1.00 55.17  ? 12   DA  Q N6    1 
ATOM   164  N  N1    . DA  A 1 8   ? 24.922  -25.744 -4.103  1.00 52.78  ? 12   DA  Q N1    1 
ATOM   165  C  C2    . DA  A 1 8   ? 25.291  -26.116 -5.333  1.00 53.34  ? 12   DA  Q C2    1 
ATOM   166  N  N3    . DA  A 1 8   ? 26.185  -25.562 -6.149  1.00 53.51  ? 12   DA  Q N3    1 
ATOM   167  C  C4    . DA  A 1 8   ? 26.748  -24.486 -5.573  1.00 53.44  ? 12   DA  Q C4    1 
ATOM   168  P  P     . DG  A 1 9   ? 27.272  -22.522 -11.040 1.00 51.52  ? 13   DG  Q P     1 
ATOM   169  O  OP1   . DG  A 1 9   ? 27.409  -22.585 -12.518 1.00 53.62  ? 13   DG  Q OP1   1 
ATOM   170  O  OP2   . DG  A 1 9   ? 26.959  -21.224 -10.387 1.00 48.39  ? 13   DG  Q OP2   1 
ATOM   171  O  "O5'" . DG  A 1 9   ? 26.168  -23.587 -10.617 1.00 49.72  ? 13   DG  Q "O5'" 1 
ATOM   172  C  "C5'" . DG  A 1 9   ? 26.392  -24.977 -10.841 1.00 45.62  ? 13   DG  Q "C5'" 1 
ATOM   173  C  "C4'" . DG  A 1 9   ? 25.104  -25.749 -10.685 1.00 42.99  ? 13   DG  Q "C4'" 1 
ATOM   174  O  "O4'" . DG  A 1 9   ? 24.681  -25.716 -9.299  1.00 40.55  ? 13   DG  Q "O4'" 1 
ATOM   175  C  "C3'" . DG  A 1 9   ? 23.934  -25.191 -11.493 1.00 42.64  ? 13   DG  Q "C3'" 1 
ATOM   176  C  "C2'" . DG  A 1 9   ? 23.212  -24.329 -10.477 1.00 40.25  ? 13   DG  Q "C2'" 1 
ATOM   177  C  "C1'" . DG  A 1 9   ? 23.385  -25.150 -9.211  1.00 36.46  ? 13   DG  Q "C1'" 1 
ATOM   178  N  N9    . DG  A 1 9   ? 23.305  -24.380 -7.975  1.00 30.93  ? 13   DG  Q N9    1 
ATOM   179  C  C8    . DG  A 1 9   ? 24.111  -23.339 -7.586  1.00 28.39  ? 13   DG  Q C8    1 
ATOM   180  N  N7    . DG  A 1 9   ? 23.763  -22.825 -6.438  1.00 27.78  ? 13   DG  Q N7    1 
ATOM   181  C  C5    . DG  A 1 9   ? 22.666  -23.578 -6.043  1.00 27.94  ? 13   DG  Q C5    1 
ATOM   182  C  C6    . DG  A 1 9   ? 21.847  -23.481 -4.882  1.00 27.92  ? 13   DG  Q C6    1 
ATOM   183  O  O6    . DG  A 1 9   ? 21.925  -22.677 -3.945  1.00 26.56  ? 13   DG  Q O6    1 
ATOM   184  N  N1    . DG  A 1 9   ? 20.848  -24.447 -4.882  1.00 27.70  ? 13   DG  Q N1    1 
ATOM   185  C  C2    . DG  A 1 9   ? 20.653  -25.382 -5.868  1.00 30.18  ? 13   DG  Q C2    1 
ATOM   186  N  N2    . DG  A 1 9   ? 19.632  -26.234 -5.683  1.00 30.29  ? 13   DG  Q N2    1 
ATOM   187  N  N3    . DG  A 1 9   ? 21.401  -25.477 -6.956  1.00 30.77  ? 13   DG  Q N3    1 
ATOM   188  C  C4    . DG  A 1 9   ? 22.381  -24.550 -6.977  1.00 29.01  ? 13   DG  Q C4    1 
ATOM   189  P  P     . DG  B 2 1   ? 18.709  -16.438 3.508   1.00 68.67  ? 4    DG  U P     1 
ATOM   190  O  OP1   . DG  B 2 1   ? 19.241  -16.209 4.873   1.00 66.94  ? 4    DG  U OP1   1 
ATOM   191  O  OP2   . DG  B 2 1   ? 19.637  -16.605 2.367   1.00 67.83  ? 4    DG  U OP2   1 
ATOM   192  O  "O5'" . DG  B 2 1   ? 17.675  -15.232 3.151   1.00 66.93  ? 4    DG  U "O5'" 1 
ATOM   193  C  "C5'" . DG  B 2 1   ? 16.268  -15.256 3.520   1.00 63.49  ? 4    DG  U "C5'" 1 
ATOM   194  C  "C4'" . DG  B 2 1   ? 15.368  -15.661 2.341   1.00 59.40  ? 4    DG  U "C4'" 1 
ATOM   195  O  "O4'" . DG  B 2 1   ? 15.796  -14.956 1.137   1.00 57.75  ? 4    DG  U "O4'" 1 
ATOM   196  C  "C3'" . DG  B 2 1   ? 15.464  -17.120 1.934   1.00 58.14  ? 4    DG  U "C3'" 1 
ATOM   197  O  "O3'" . DG  B 2 1   ? 15.142  -18.182 2.899   1.00 59.09  ? 4    DG  U "O3'" 1 
ATOM   198  C  "C2'" . DG  B 2 1   ? 14.706  -16.948 0.603   1.00 55.44  ? 4    DG  U "C2'" 1 
ATOM   199  C  "C1'" . DG  B 2 1   ? 15.440  -15.741 -0.027  1.00 53.43  ? 4    DG  U "C1'" 1 
ATOM   200  N  N9    . DG  B 2 1   ? 16.637  -16.250 -0.787  1.00 50.91  ? 4    DG  U N9    1 
ATOM   201  C  C8    . DG  B 2 1   ? 17.249  -17.477 -0.704  1.00 46.74  ? 4    DG  U C8    1 
ATOM   202  N  N7    . DG  B 2 1   ? 18.242  -17.661 -1.434  1.00 44.39  ? 4    DG  U N7    1 
ATOM   203  C  C5    . DG  B 2 1   ? 18.390  -16.473 -2.138  1.00 50.27  ? 4    DG  U C5    1 
ATOM   204  C  C6    . DG  B 2 1   ? 19.358  -16.088 -3.123  1.00 52.49  ? 4    DG  U C6    1 
ATOM   205  O  O6    . DG  B 2 1   ? 20.295  -16.757 -3.576  1.00 55.06  ? 4    DG  U O6    1 
ATOM   206  N  N1    . DG  B 2 1   ? 19.146  -14.783 -3.580  1.00 54.39  ? 4    DG  U N1    1 
ATOM   207  C  C2    . DG  B 2 1   ? 18.133  -13.904 -3.165  1.00 54.24  ? 4    DG  U C2    1 
ATOM   208  N  N2    . DG  B 2 1   ? 18.124  -12.696 -3.744  1.00 57.89  ? 4    DG  U N2    1 
ATOM   209  N  N3    . DG  B 2 1   ? 17.209  -14.268 -2.222  1.00 51.76  ? 4    DG  U N3    1 
ATOM   210  C  C4    . DG  B 2 1   ? 17.398  -15.566 -1.751  1.00 50.44  ? 4    DG  U C4    1 
ATOM   211  P  P     . DG  B 2 2   ? 13.644  -18.669 3.302   1.00 60.31  ? 5    DG  U P     1 
ATOM   212  O  OP1   . DG  B 2 2   ? 12.678  -17.679 2.798   1.00 62.26  ? 5    DG  U OP1   1 
ATOM   213  O  OP2   . DG  B 2 2   ? 13.637  -18.935 4.765   1.00 60.98  ? 5    DG  U OP2   1 
ATOM   214  O  "O5'" . DG  B 2 2   ? 13.406  -20.020 2.467   1.00 57.93  ? 5    DG  U "O5'" 1 
ATOM   215  C  "C5'" . DG  B 2 2   ? 13.353  -19.957 1.013   1.00 53.51  ? 5    DG  U "C5'" 1 
ATOM   216  C  "C4'" . DG  B 2 2   ? 13.086  -21.275 0.298   1.00 49.77  ? 5    DG  U "C4'" 1 
ATOM   217  O  "O4'" . DG  B 2 2   ? 13.804  -21.226 -0.942  1.00 49.09  ? 5    DG  U "O4'" 1 
ATOM   218  C  "C3'" . DG  B 2 2   ? 13.599  -22.470 1.088   1.00 47.62  ? 5    DG  U "C3'" 1 
ATOM   219  O  "O3'" . DG  B 2 2   ? 12.689  -23.637 0.881   1.00 49.84  ? 5    DG  U "O3'" 1 
ATOM   220  C  "C2'" . DG  B 2 2   ? 14.981  -22.610 0.520   1.00 46.17  ? 5    DG  U "C2'" 1 
ATOM   221  C  "C1'" . DG  B 2 2   ? 14.790  -22.280 -0.993  1.00 45.65  ? 5    DG  U "C1'" 1 
ATOM   222  N  N9    . DG  B 2 2   ? 15.974  -21.716 -1.613  1.00 42.71  ? 5    DG  U N9    1 
ATOM   223  C  C8    . DG  B 2 2   ? 16.854  -20.835 -1.040  1.00 40.76  ? 5    DG  U C8    1 
ATOM   224  N  N7    . DG  B 2 2   ? 17.817  -20.461 -1.787  1.00 39.89  ? 5    DG  U N7    1 
ATOM   225  C  C5    . DG  B 2 2   ? 17.572  -21.154 -2.968  1.00 38.99  ? 5    DG  U C5    1 
ATOM   226  C  C6    . DG  B 2 2   ? 18.295  -21.141 -4.163  1.00 36.84  ? 5    DG  U C6    1 
ATOM   227  O  O6    . DG  B 2 2   ? 19.303  -20.520 -4.395  1.00 35.50  ? 5    DG  U O6    1 
ATOM   228  N  N1    . DG  B 2 2   ? 17.748  -21.963 -5.145  1.00 35.70  ? 5    DG  U N1    1 
ATOM   229  C  C2    . DG  B 2 2   ? 16.589  -22.735 -5.003  1.00 35.91  ? 5    DG  U C2    1 
ATOM   230  N  N2    . DG  B 2 2   ? 16.282  -23.424 -6.087  1.00 34.84  ? 5    DG  U N2    1 
ATOM   231  N  N3    . DG  B 2 2   ? 15.869  -22.756 -3.844  1.00 37.62  ? 5    DG  U N3    1 
ATOM   232  C  C4    . DG  B 2 2   ? 16.434  -21.935 -2.877  1.00 39.76  ? 5    DG  U C4    1 
ATOM   233  P  P     . DC  B 2 3   ? 13.065  -25.163 1.418   1.00 47.79  ? 6    DC  U P     1 
ATOM   234  O  OP1   . DC  B 2 3   ? 11.886  -26.088 1.321   1.00 45.55  ? 6    DC  U OP1   1 
ATOM   235  O  OP2   . DC  B 2 3   ? 13.927  -25.261 2.655   1.00 47.34  ? 6    DC  U OP2   1 
ATOM   236  O  "O5'" . DC  B 2 3   ? 14.025  -25.636 0.258   1.00 48.14  ? 6    DC  U "O5'" 1 
ATOM   237  C  "C5'" . DC  B 2 3   ? 13.551  -25.789 -1.067  1.00 46.55  ? 6    DC  U "C5'" 1 
ATOM   238  C  "C4'" . DC  B 2 3   ? 14.576  -26.575 -1.851  1.00 45.91  ? 6    DC  U "C4'" 1 
ATOM   239  O  "O4'" . DC  B 2 3   ? 15.721  -25.736 -2.159  1.00 45.64  ? 6    DC  U "O4'" 1 
ATOM   240  C  "C3'" . DC  B 2 3   ? 15.144  -27.817 -1.143  1.00 45.24  ? 6    DC  U "C3'" 1 
ATOM   241  O  "O3'" . DC  B 2 3   ? 15.302  -28.915 -2.064  1.00 43.73  ? 6    DC  U "O3'" 1 
ATOM   242  C  "C2'" . DC  B 2 3   ? 16.504  -27.354 -0.649  1.00 47.23  ? 6    DC  U "C2'" 1 
ATOM   243  C  "C1'" . DC  B 2 3   ? 16.925  -26.352 -1.719  1.00 46.23  ? 6    DC  U "C1'" 1 
ATOM   244  N  N1    . DC  B 2 3   ? 17.801  -25.300 -1.177  1.00 48.67  ? 6    DC  U N1    1 
ATOM   245  C  C2    . DC  B 2 3   ? 18.682  -24.599 -2.027  1.00 49.08  ? 6    DC  U C2    1 
ATOM   246  O  O2    . DC  B 2 3   ? 18.688  -24.851 -3.249  1.00 49.99  ? 6    DC  U O2    1 
ATOM   247  N  N3    . DC  B 2 3   ? 19.503  -23.663 -1.483  1.00 48.72  ? 6    DC  U N3    1 
ATOM   248  C  C4    . DC  B 2 3   ? 19.462  -23.421 -0.165  1.00 48.65  ? 6    DC  U C4    1 
ATOM   249  N  N4    . DC  B 2 3   ? 20.291  -22.509 0.339   1.00 49.68  ? 6    DC  U N4    1 
ATOM   250  C  C5    . DC  B 2 3   ? 18.570  -24.105 0.700   1.00 49.22  ? 6    DC  U C5    1 
ATOM   251  C  C6    . DC  B 2 3   ? 17.766  -25.019 0.160   1.00 49.68  ? 6    DC  U C6    1 
ATOM   252  P  P     . DT  B 2 4   ? 15.776  -30.370 -1.530  1.00 43.20  ? 7    DT  U P     1 
ATOM   253  O  OP1   . DT  B 2 4   ? 14.648  -31.331 -1.703  1.00 43.56  ? 7    DT  U OP1   1 
ATOM   254  O  OP2   . DT  B 2 4   ? 16.401  -30.222 -0.189  1.00 41.34  ? 7    DT  U OP2   1 
ATOM   255  O  "O5'" . DT  B 2 4   ? 16.937  -30.783 -2.545  1.00 41.81  ? 7    DT  U "O5'" 1 
ATOM   256  C  "C5'" . DT  B 2 4   ? 16.760  -30.680 -3.957  1.00 37.39  ? 7    DT  U "C5'" 1 
ATOM   257  C  "C4'" . DT  B 2 4   ? 18.088  -30.835 -4.663  1.00 35.29  ? 7    DT  U "C4'" 1 
ATOM   258  O  "O4'" . DT  B 2 4   ? 18.913  -29.654 -4.516  1.00 32.48  ? 7    DT  U "O4'" 1 
ATOM   259  C  "C3'" . DT  B 2 4   ? 18.947  -32.009 -4.196  1.00 36.04  ? 7    DT  U "C3'" 1 
ATOM   260  O  "O3'" . DT  B 2 4   ? 19.514  -32.629 -5.345  1.00 38.43  ? 7    DT  U "O3'" 1 
ATOM   261  C  "C2'" . DT  B 2 4   ? 20.043  -31.345 -3.378  1.00 34.15  ? 7    DT  U "C2'" 1 
ATOM   262  C  "C1'" . DT  B 2 4   ? 20.222  -30.043 -4.131  1.00 32.59  ? 7    DT  U "C1'" 1 
ATOM   263  N  N1    . DT  B 2 4   ? 20.823  -28.934 -3.366  1.00 31.72  ? 7    DT  U N1    1 
ATOM   264  C  C2    . DT  B 2 4   ? 21.807  -28.190 -3.981  1.00 31.25  ? 7    DT  U C2    1 
ATOM   265  O  O2    . DT  B 2 4   ? 22.222  -28.429 -5.102  1.00 31.62  ? 7    DT  U O2    1 
ATOM   266  N  N3    . DT  B 2 4   ? 22.294  -27.152 -3.227  1.00 30.73  ? 7    DT  U N3    1 
ATOM   267  C  C4    . DT  B 2 4   ? 21.912  -26.799 -1.947  1.00 31.21  ? 7    DT  U C4    1 
ATOM   268  O  O4    . DT  B 2 4   ? 22.428  -25.830 -1.398  1.00 32.98  ? 7    DT  U O4    1 
ATOM   269  C  C5    . DT  B 2 4   ? 20.895  -27.634 -1.353  1.00 30.67  ? 7    DT  U C5    1 
ATOM   270  C  C7    . DT  B 2 4   ? 20.439  -27.338 0.039   1.00 27.75  ? 7    DT  U C7    1 
ATOM   271  C  C6    . DT  B 2 4   ? 20.405  -28.646 -2.084  1.00 31.59  ? 7    DT  U C6    1 
ATOM   272  P  P     . DC  B 2 5   ? 20.040  -34.137 -5.260  1.00 40.56  ? 8    DC  U P     1 
ATOM   273  O  OP1   . DC  B 2 5   ? 19.286  -34.910 -6.277  1.00 42.65  ? 8    DC  U OP1   1 
ATOM   274  O  OP2   . DC  B 2 5   ? 20.031  -34.572 -3.839  1.00 39.66  ? 8    DC  U OP2   1 
ATOM   275  O  "O5'" . DC  B 2 5   ? 21.542  -33.995 -5.745  1.00 40.04  ? 8    DC  U "O5'" 1 
ATOM   276  C  "C5'" . DC  B 2 5   ? 22.224  -32.770 -5.533  1.00 43.42  ? 8    DC  U "C5'" 1 
ATOM   277  C  "C4'" . DC  B 2 5   ? 23.632  -32.857 -6.061  1.00 45.21  ? 8    DC  U "C4'" 1 
ATOM   278  O  "O4'" . DC  B 2 5   ? 24.307  -31.626 -5.717  1.00 45.14  ? 8    DC  U "O4'" 1 
ATOM   279  C  "C3'" . DC  B 2 5   ? 24.447  -33.974 -5.421  1.00 46.61  ? 8    DC  U "C3'" 1 
ATOM   280  O  "O3'" . DC  B 2 5   ? 25.385  -34.475 -6.375  1.00 50.04  ? 8    DC  U "O3'" 1 
ATOM   281  C  "C2'" . DC  B 2 5   ? 25.112  -33.292 -4.238  1.00 44.07  ? 8    DC  U "C2'" 1 
ATOM   282  C  "C1'" . DC  B 2 5   ? 25.274  -31.848 -4.699  1.00 43.13  ? 8    DC  U "C1'" 1 
ATOM   283  N  N1    . DC  B 2 5   ? 25.030  -30.854 -3.642  1.00 40.63  ? 8    DC  U N1    1 
ATOM   284  C  C2    . DC  B 2 5   ? 25.904  -29.770 -3.519  1.00 40.17  ? 8    DC  U C2    1 
ATOM   285  O  O2    . DC  B 2 5   ? 26.858  -29.678 -4.307  1.00 40.45  ? 8    DC  U O2    1 
ATOM   286  N  N3    . DC  B 2 5   ? 25.689  -28.852 -2.549  1.00 38.17  ? 8    DC  U N3    1 
ATOM   287  C  C4    . DC  B 2 5   ? 24.652  -28.988 -1.723  1.00 38.15  ? 8    DC  U C4    1 
ATOM   288  N  N4    . DC  B 2 5   ? 24.486  -28.064 -0.776  1.00 37.40  ? 8    DC  U N4    1 
ATOM   289  C  C5    . DC  B 2 5   ? 23.741  -30.080 -1.829  1.00 38.88  ? 8    DC  U C5    1 
ATOM   290  C  C6    . DC  B 2 5   ? 23.966  -30.981 -2.792  1.00 38.82  ? 8    DC  U C6    1 
ATOM   291  P  P     . DA  B 2 6   ? 26.197  -35.825 -6.069  1.00 52.67  ? 9    DA  U P     1 
ATOM   292  O  OP1   . DA  B 2 6   ? 26.308  -36.541 -7.366  1.00 51.98  ? 9    DA  U OP1   1 
ATOM   293  O  OP2   . DA  B 2 6   ? 25.612  -36.521 -4.892  1.00 52.19  ? 9    DA  U OP2   1 
ATOM   294  O  "O5'" . DA  B 2 6   ? 27.642  -35.287 -5.680  1.00 50.75  ? 9    DA  U "O5'" 1 
ATOM   295  C  "C5'" . DA  B 2 6   ? 28.427  -34.600 -6.645  1.00 52.15  ? 9    DA  U "C5'" 1 
ATOM   296  C  "C4'" . DA  B 2 6   ? 29.698  -34.082 -6.018  1.00 53.28  ? 9    DA  U "C4'" 1 
ATOM   297  O  "O4'" . DA  B 2 6   ? 29.410  -32.928 -5.192  1.00 50.69  ? 9    DA  U "O4'" 1 
ATOM   298  C  "C3'" . DA  B 2 6   ? 30.415  -35.090 -5.122  1.00 54.51  ? 9    DA  U "C3'" 1 
ATOM   299  O  "O3'" . DA  B 2 6   ? 31.822  -35.057 -5.370  1.00 60.55  ? 9    DA  U "O3'" 1 
ATOM   300  C  "C2'" . DA  B 2 6   ? 30.100  -34.606 -3.718  1.00 51.53  ? 9    DA  U "C2'" 1 
ATOM   301  C  "C1'" . DA  B 2 6   ? 29.982  -33.105 -3.910  1.00 47.86  ? 9    DA  U "C1'" 1 
ATOM   302  N  N9    . DA  B 2 6   ? 29.117  -32.438 -2.938  1.00 43.71  ? 9    DA  U N9    1 
ATOM   303  C  C8    . DA  B 2 6   ? 27.870  -32.823 -2.515  1.00 42.75  ? 9    DA  U C8    1 
ATOM   304  N  N7    . DA  B 2 6   ? 27.349  -32.030 -1.611  1.00 41.99  ? 9    DA  U N7    1 
ATOM   305  C  C5    . DA  B 2 6   ? 28.317  -31.052 -1.429  1.00 40.67  ? 9    DA  U C5    1 
ATOM   306  C  C6    . DA  B 2 6   ? 28.376  -29.923 -0.593  1.00 39.55  ? 9    DA  U C6    1 
ATOM   307  N  N6    . DA  B 2 6   ? 27.403  -29.579 0.254   1.00 38.95  ? 9    DA  U N6    1 
ATOM   308  N  N1    . DA  B 2 6   ? 29.483  -29.151 -0.656  1.00 38.51  ? 9    DA  U N1    1 
ATOM   309  C  C2    . DA  B 2 6   ? 30.460  -29.502 -1.503  1.00 39.72  ? 9    DA  U C2    1 
ATOM   310  N  N3    . DA  B 2 6   ? 30.523  -30.542 -2.335  1.00 40.38  ? 9    DA  U N3    1 
ATOM   311  C  C4    . DA  B 2 6   ? 29.407  -31.287 -2.247  1.00 41.49  ? 9    DA  U C4    1 
ATOM   312  P  P     . DT  B 2 7   ? 32.744  -36.270 -4.864  1.00 65.28  ? 10   DT  U P     1 
ATOM   313  O  OP1   . DT  B 2 7   ? 34.089  -36.098 -5.474  1.00 65.06  ? 10   DT  U OP1   1 
ATOM   314  O  OP2   . DT  B 2 7   ? 32.005  -37.545 -5.065  1.00 65.85  ? 10   DT  U OP2   1 
ATOM   315  O  "O5'" . DT  B 2 7   ? 32.855  -36.005 -3.298  1.00 64.74  ? 10   DT  U "O5'" 1 
ATOM   316  C  "C5'" . DT  B 2 7   ? 34.104  -36.113 -2.621  1.00 63.57  ? 10   DT  U "C5'" 1 
ATOM   317  C  "C4'" . DT  B 2 7   ? 34.920  -34.856 -2.822  1.00 62.24  ? 10   DT  U "C4'" 1 
ATOM   318  O  "O4'" . DT  B 2 7   ? 34.083  -33.691 -2.631  1.00 58.91  ? 10   DT  U "O4'" 1 
ATOM   319  C  "C3'" . DT  B 2 7   ? 36.071  -34.719 -1.831  1.00 63.31  ? 10   DT  U "C3'" 1 
ATOM   320  O  "O3'" . DT  B 2 7   ? 37.234  -34.162 -2.447  1.00 66.33  ? 10   DT  U "O3'" 1 
ATOM   321  C  "C2'" . DT  B 2 7   ? 35.516  -33.805 -0.754  1.00 59.78  ? 10   DT  U "C2'" 1 
ATOM   322  C  "C1'" . DT  B 2 7   ? 34.486  -32.955 -1.482  1.00 55.16  ? 10   DT  U "C1'" 1 
ATOM   323  N  N1    . DT  B 2 7   ? 33.275  -32.702 -0.676  1.00 50.45  ? 10   DT  U N1    1 
ATOM   324  C  C2    . DT  B 2 7   ? 33.221  -31.565 0.095   1.00 47.55  ? 10   DT  U C2    1 
ATOM   325  O  O2    . DT  B 2 7   ? 34.134  -30.760 0.157   1.00 47.15  ? 10   DT  U O2    1 
ATOM   326  N  N3    . DT  B 2 7   ? 32.049  -31.406 0.798   1.00 44.34  ? 10   DT  U N3    1 
ATOM   327  C  C4    . DT  B 2 7   ? 30.957  -32.256 0.808   1.00 42.63  ? 10   DT  U C4    1 
ATOM   328  O  O4    . DT  B 2 7   ? 29.968  -31.979 1.482   1.00 38.41  ? 10   DT  U O4    1 
ATOM   329  C  C5    . DT  B 2 7   ? 31.089  -33.434 -0.014  1.00 43.19  ? 10   DT  U C5    1 
ATOM   330  C  C7    . DT  B 2 7   ? 29.964  -34.417 -0.056  1.00 43.04  ? 10   DT  U C7    1 
ATOM   331  C  C6    . DT  B 2 7   ? 32.224  -33.596 -0.706  1.00 46.86  ? 10   DT  U C6    1 
ATOM   332  P  P     . DC  B 2 8   ? 38.664  -34.358 -1.742  1.00 67.85  ? 11   DC  U P     1 
ATOM   333  O  OP1   . DC  B 2 8   ? 39.686  -33.699 -2.598  1.00 68.09  ? 11   DC  U OP1   1 
ATOM   334  O  OP2   . DC  B 2 8   ? 38.821  -35.790 -1.379  1.00 67.06  ? 11   DC  U OP2   1 
ATOM   335  O  "O5'" . DC  B 2 8   ? 38.519  -33.522 -0.397  1.00 67.30  ? 11   DC  U "O5'" 1 
ATOM   336  C  "C5'" . DC  B 2 8   ? 38.608  -32.102 -0.416  1.00 68.54  ? 11   DC  U "C5'" 1 
ATOM   337  C  "C4'" . DC  B 2 8   ? 38.661  -31.569 0.995   1.00 69.26  ? 11   DC  U "C4'" 1 
ATOM   338  O  "O4'" . DC  B 2 8   ? 37.329  -31.472 1.557   1.00 69.02  ? 11   DC  U "O4'" 1 
ATOM   339  C  "C3'" . DC  B 2 8   ? 39.472  -32.437 1.958   1.00 69.82  ? 11   DC  U "C3'" 1 
ATOM   340  O  "O3'" . DC  B 2 8   ? 40.259  -31.606 2.812   1.00 70.57  ? 11   DC  U "O3'" 1 
ATOM   341  C  "C2'" . DC  B 2 8   ? 38.405  -33.163 2.760   1.00 68.25  ? 11   DC  U "C2'" 1 
ATOM   342  C  "C1'" . DC  B 2 8   ? 37.297  -32.125 2.816   1.00 67.30  ? 11   DC  U "C1'" 1 
ATOM   343  N  N1    . DC  B 2 8   ? 35.938  -32.660 3.016   1.00 64.95  ? 11   DC  U N1    1 
ATOM   344  C  C2    . DC  B 2 8   ? 35.042  -31.941 3.818   1.00 63.82  ? 11   DC  U C2    1 
ATOM   345  O  O2    . DC  B 2 8   ? 35.420  -30.878 4.340   1.00 62.96  ? 11   DC  U O2    1 
ATOM   346  N  N3    . DC  B 2 8   ? 33.789  -32.420 4.004   1.00 62.33  ? 11   DC  U N3    1 
ATOM   347  C  C4    . DC  B 2 8   ? 33.421  -33.566 3.425   1.00 61.80  ? 11   DC  U C4    1 
ATOM   348  N  N4    . DC  B 2 8   ? 32.173  -34.001 3.631   1.00 60.24  ? 11   DC  U N4    1 
ATOM   349  C  C5    . DC  B 2 8   ? 34.314  -34.318 2.607   1.00 62.02  ? 11   DC  U C5    1 
ATOM   350  C  C6    . DC  B 2 8   ? 35.551  -33.834 2.432   1.00 63.49  ? 11   DC  U C6    1 
ATOM   351  P  P     . DC  B 2 9   ? 41.415  -32.259 3.715   1.00 70.64  ? 12   DC  U P     1 
ATOM   352  O  OP1   . DC  B 2 9   ? 42.685  -31.581 3.348   1.00 69.82  ? 12   DC  U OP1   1 
ATOM   353  O  OP2   . DC  B 2 9   ? 41.321  -33.741 3.626   1.00 69.28  ? 12   DC  U OP2   1 
ATOM   354  O  "O5'" . DC  B 2 9   ? 41.009  -31.803 5.186   1.00 70.53  ? 12   DC  U "O5'" 1 
ATOM   355  C  "C5'" . DC  B 2 9   ? 40.712  -30.431 5.464   1.00 68.53  ? 12   DC  U "C5'" 1 
ATOM   356  C  "C4'" . DC  B 2 9   ? 40.131  -30.283 6.852   1.00 67.51  ? 12   DC  U "C4'" 1 
ATOM   357  O  "O4'" . DC  B 2 9   ? 38.755  -30.737 6.887   1.00 65.50  ? 12   DC  U "O4'" 1 
ATOM   358  C  "C3'" . DC  B 2 9   ? 40.867  -31.065 7.941   1.00 68.03  ? 12   DC  U "C3'" 1 
ATOM   359  O  "O3'" . DC  B 2 9   ? 40.951  -30.278 9.129   1.00 70.24  ? 12   DC  U "O3'" 1 
ATOM   360  C  "C2'" . DC  B 2 9   ? 39.966  -32.263 8.180   1.00 65.73  ? 12   DC  U "C2'" 1 
ATOM   361  C  "C1'" . DC  B 2 9   ? 38.591  -31.662 7.951   1.00 62.29  ? 12   DC  U "C1'" 1 
ATOM   362  N  N1    . DC  B 2 9   ? 37.544  -32.624 7.568   1.00 58.10  ? 12   DC  U N1    1 
ATOM   363  C  C2    . DC  B 2 9   ? 36.224  -32.367 7.956   1.00 56.19  ? 12   DC  U C2    1 
ATOM   364  O  O2    . DC  B 2 9   ? 35.977  -31.332 8.597   1.00 53.73  ? 12   DC  U O2    1 
ATOM   365  N  N3    . DC  B 2 9   ? 35.252  -33.251 7.624   1.00 54.48  ? 12   DC  U N3    1 
ATOM   366  C  C4    . DC  B 2 9   ? 35.559  -34.350 6.930   1.00 52.71  ? 12   DC  U C4    1 
ATOM   367  N  N4    . DC  B 2 9   ? 34.570  -35.194 6.626   1.00 48.97  ? 12   DC  U N4    1 
ATOM   368  C  C5    . DC  B 2 9   ? 36.893  -34.633 6.517   1.00 53.88  ? 12   DC  U C5    1 
ATOM   369  C  C6    . DC  B 2 9   ? 37.845  -33.750 6.853   1.00 56.10  ? 12   DC  U C6    1 
ATOM   370  P  P     . DA  B 2 10  ? 42.388  -29.960 9.768   1.00 73.06  ? 13   DA  U P     1 
ATOM   371  O  OP1   . DA  B 2 10  ? 43.326  -29.670 8.650   1.00 73.59  ? 13   DA  U OP1   1 
ATOM   372  O  OP2   . DA  B 2 10  ? 42.717  -31.036 10.739  1.00 72.46  ? 13   DA  U OP2   1 
ATOM   373  O  "O5'" . DA  B 2 10  ? 42.139  -28.609 10.574  1.00 71.86  ? 13   DA  U "O5'" 1 
ATOM   374  C  "C5'" . DA  B 2 10  ? 42.022  -28.620 11.990  1.00 69.15  ? 13   DA  U "C5'" 1 
ATOM   375  C  "C4'" . DA  B 2 10  ? 40.635  -28.187 12.403  1.00 66.34  ? 13   DA  U "C4'" 1 
ATOM   376  O  "O4'" . DA  B 2 10  ? 39.656  -29.019 11.740  1.00 63.55  ? 13   DA  U "O4'" 1 
ATOM   377  C  "C3'" . DA  B 2 10  ? 40.379  -28.348 13.897  1.00 66.34  ? 13   DA  U "C3'" 1 
ATOM   378  O  "O3'" . DA  B 2 10  ? 39.551  -27.293 14.379  1.00 66.49  ? 13   DA  U "O3'" 1 
ATOM   379  C  "C2'" . DA  B 2 10  ? 39.689  -29.696 14.001  1.00 64.60  ? 13   DA  U "C2'" 1 
ATOM   380  C  "C1'" . DA  B 2 10  ? 38.943  -29.814 12.682  1.00 62.36  ? 13   DA  U "C1'" 1 
ATOM   381  N  N9    . DA  B 2 10  ? 38.896  -31.177 12.152  1.00 59.85  ? 13   DA  U N9    1 
ATOM   382  C  C8    . DA  B 2 10  ? 39.965  -31.944 11.756  1.00 58.65  ? 13   DA  U C8    1 
ATOM   383  N  N7    . DA  B 2 10  ? 39.626  -33.112 11.265  1.00 57.45  ? 13   DA  U N7    1 
ATOM   384  C  C5    . DA  B 2 10  ? 38.241  -33.121 11.353  1.00 56.89  ? 13   DA  U C5    1 
ATOM   385  C  C6    . DA  B 2 10  ? 37.277  -34.074 10.980  1.00 55.98  ? 13   DA  U C6    1 
ATOM   386  N  N6    . DA  B 2 10  ? 37.574  -35.241 10.404  1.00 55.81  ? 13   DA  U N6    1 
ATOM   387  N  N1    . DA  B 2 10  ? 35.981  -33.781 11.215  1.00 55.38  ? 13   DA  U N1    1 
ATOM   388  C  C2    . DA  B 2 10  ? 35.683  -32.602 11.776  1.00 56.77  ? 13   DA  U C2    1 
ATOM   389  N  N3    . DA  B 2 10  ? 36.497  -31.619 12.158  1.00 57.23  ? 13   DA  U N3    1 
ATOM   390  C  C4    . DA  B 2 10  ? 37.778  -31.944 11.916  1.00 57.97  ? 13   DA  U C4    1 
ATOM   391  P  P     . DC  B 2 11  ? 39.625  -26.882 15.925  1.00 66.46  ? 14   DC  U P     1 
ATOM   392  O  OP1   . DC  B 2 11  ? 39.166  -25.474 16.050  1.00 65.07  ? 14   DC  U OP1   1 
ATOM   393  O  OP2   . DC  B 2 11  ? 40.974  -27.263 16.417  1.00 65.64  ? 14   DC  U OP2   1 
ATOM   394  O  "O5'" . DC  B 2 11  ? 38.546  -27.828 16.614  1.00 65.18  ? 14   DC  U "O5'" 1 
ATOM   395  C  "C5'" . DC  B 2 11  ? 37.160  -27.502 16.564  1.00 61.63  ? 14   DC  U "C5'" 1 
ATOM   396  C  "C4'" . DC  B 2 11  ? 36.341  -28.569 17.253  1.00 59.76  ? 14   DC  U "C4'" 1 
ATOM   397  O  "O4'" . DC  B 2 11  ? 36.265  -29.765 16.435  1.00 57.96  ? 14   DC  U "O4'" 1 
ATOM   398  C  "C3'" . DC  B 2 11  ? 36.877  -29.018 18.614  1.00 58.02  ? 14   DC  U "C3'" 1 
ATOM   399  O  "O3'" . DC  B 2 11  ? 35.780  -29.324 19.475  1.00 58.86  ? 14   DC  U "O3'" 1 
ATOM   400  C  "C2'" . DC  B 2 11  ? 37.549  -30.342 18.293  1.00 56.94  ? 14   DC  U "C2'" 1 
ATOM   401  C  "C1'" . DC  B 2 11  ? 36.623  -30.887 17.221  1.00 54.98  ? 14   DC  U "C1'" 1 
ATOM   402  N  N1    . DC  B 2 11  ? 37.203  -31.909 16.334  1.00 52.39  ? 14   DC  U N1    1 
ATOM   403  C  C2    . DC  B 2 11  ? 36.355  -32.873 15.771  1.00 51.90  ? 14   DC  U C2    1 
ATOM   404  O  O2    . DC  B 2 11  ? 35.141  -32.820 16.015  1.00 53.22  ? 14   DC  U O2    1 
ATOM   405  N  N3    . DC  B 2 11  ? 36.880  -33.836 14.978  1.00 49.34  ? 14   DC  U N3    1 
ATOM   406  C  C4    . DC  B 2 11  ? 38.192  -33.859 14.740  1.00 48.26  ? 14   DC  U C4    1 
ATOM   407  N  N4    . DC  B 2 11  ? 38.670  -34.835 13.968  1.00 45.09  ? 14   DC  U N4    1 
ATOM   408  C  C5    . DC  B 2 11  ? 39.075  -32.883 15.286  1.00 50.45  ? 14   DC  U C5    1 
ATOM   409  C  C6    . DC  B 2 11  ? 38.543  -31.934 16.069  1.00 51.97  ? 14   DC  U C6    1 
ATOM   410  O  "O5'" . DG  C 1 1   ? 72.110  -60.004 -17.555 1.00 65.44  ? 5    DG  P "O5'" 1 
ATOM   411  C  "C5'" . DG  C 1 1   ? 73.469  -60.459 -17.561 1.00 66.54  ? 5    DG  P "C5'" 1 
ATOM   412  C  "C4'" . DG  C 1 1   ? 73.655  -61.784 -18.266 1.00 66.61  ? 5    DG  P "C4'" 1 
ATOM   413  O  "O4'" . DG  C 1 1   ? 72.701  -62.739 -17.746 1.00 66.78  ? 5    DG  P "O4'" 1 
ATOM   414  C  "C3'" . DG  C 1 1   ? 73.432  -61.758 -19.779 1.00 65.39  ? 5    DG  P "C3'" 1 
ATOM   415  O  "O3'" . DG  C 1 1   ? 74.308  -62.698 -20.410 1.00 65.02  ? 5    DG  P "O3'" 1 
ATOM   416  C  "C2'" . DG  C 1 1   ? 71.985  -62.188 -19.924 1.00 64.95  ? 5    DG  P "C2'" 1 
ATOM   417  C  "C1'" . DG  C 1 1   ? 71.814  -63.168 -18.773 1.00 64.17  ? 5    DG  P "C1'" 1 
ATOM   418  N  N9    . DG  C 1 1   ? 70.471  -63.205 -18.201 1.00 61.29  ? 5    DG  P N9    1 
ATOM   419  C  C8    . DG  C 1 1   ? 69.796  -62.170 -17.599 1.00 59.40  ? 5    DG  P C8    1 
ATOM   420  N  N7    . DG  C 1 1   ? 68.624  -62.519 -17.142 1.00 58.21  ? 5    DG  P N7    1 
ATOM   421  C  C5    . DG  C 1 1   ? 68.515  -63.865 -17.470 1.00 56.09  ? 5    DG  P C5    1 
ATOM   422  C  C6    . DG  C 1 1   ? 67.472  -64.788 -17.219 1.00 53.18  ? 5    DG  P C6    1 
ATOM   423  O  O6    . DG  C 1 1   ? 66.403  -64.599 -16.627 1.00 51.91  ? 5    DG  P O6    1 
ATOM   424  N  N1    . DG  C 1 1   ? 67.770  -66.046 -17.730 1.00 51.00  ? 5    DG  P N1    1 
ATOM   425  C  C2    . DG  C 1 1   ? 68.926  -66.376 -18.391 1.00 52.04  ? 5    DG  P C2    1 
ATOM   426  N  N2    . DG  C 1 1   ? 69.030  -67.643 -18.814 1.00 51.63  ? 5    DG  P N2    1 
ATOM   427  N  N3    . DG  C 1 1   ? 69.910  -65.528 -18.623 1.00 54.82  ? 5    DG  P N3    1 
ATOM   428  C  C4    . DG  C 1 1   ? 69.640  -64.299 -18.137 1.00 57.79  ? 5    DG  P C4    1 
ATOM   429  P  P     . DT  C 1 2   ? 74.543  -62.630 -21.998 1.00 65.82  ? 6    DT  P P     1 
ATOM   430  O  OP1   . DT  C 1 2   ? 75.940  -63.062 -22.264 1.00 65.21  ? 6    DT  P OP1   1 
ATOM   431  O  OP2   . DT  C 1 2   ? 74.073  -61.310 -22.491 1.00 65.08  ? 6    DT  P OP2   1 
ATOM   432  O  "O5'" . DT  C 1 2   ? 73.571  -63.751 -22.573 1.00 64.08  ? 6    DT  P "O5'" 1 
ATOM   433  C  "C5'" . DT  C 1 2   ? 73.899  -65.131 -22.436 1.00 60.30  ? 6    DT  P "C5'" 1 
ATOM   434  C  "C4'" . DT  C 1 2   ? 72.837  -65.989 -23.082 1.00 56.79  ? 6    DT  P "C4'" 1 
ATOM   435  O  "O4'" . DT  C 1 2   ? 71.614  -65.963 -22.306 1.00 55.18  ? 6    DT  P "O4'" 1 
ATOM   436  C  "C3'" . DT  C 1 2   ? 72.445  -65.567 -24.499 1.00 55.46  ? 6    DT  P "C3'" 1 
ATOM   437  O  "O3'" . DT  C 1 2   ? 72.183  -66.736 -25.268 1.00 57.29  ? 6    DT  P "O3'" 1 
ATOM   438  C  "C2'" . DT  C 1 2   ? 71.130  -64.843 -24.284 1.00 53.45  ? 6    DT  P "C2'" 1 
ATOM   439  C  "C1'" . DT  C 1 2   ? 70.536  -65.692 -23.182 1.00 51.69  ? 6    DT  P "C1'" 1 
ATOM   440  N  N1    . DT  C 1 2   ? 69.444  -65.086 -22.404 1.00 47.77  ? 6    DT  P N1    1 
ATOM   441  C  C2    . DT  C 1 2   ? 68.492  -65.935 -21.893 1.00 45.88  ? 6    DT  P C2    1 
ATOM   442  O  O2    . DT  C 1 2   ? 68.534  -67.146 -22.042 1.00 44.03  ? 6    DT  P O2    1 
ATOM   443  N  N3    . DT  C 1 2   ? 67.488  -65.317 -21.196 1.00 44.27  ? 6    DT  P N3    1 
ATOM   444  C  C4    . DT  C 1 2   ? 67.347  -63.965 -20.961 1.00 44.64  ? 6    DT  P C4    1 
ATOM   445  O  O4    . DT  C 1 2   ? 66.383  -63.555 -20.320 1.00 43.33  ? 6    DT  P O4    1 
ATOM   446  C  C5    . DT  C 1 2   ? 68.390  -63.131 -21.520 1.00 45.07  ? 6    DT  P C5    1 
ATOM   447  C  C7    . DT  C 1 2   ? 68.327  -61.651 -21.313 1.00 46.04  ? 6    DT  P C7    1 
ATOM   448  C  C6    . DT  C 1 2   ? 69.374  -63.726 -22.203 1.00 45.72  ? 6    DT  P C6    1 
ATOM   449  P  P     . DG  C 1 3   ? 73.326  -67.340 -26.213 1.00 59.99  ? 7    DG  P P     1 
ATOM   450  O  OP1   . DG  C 1 3   ? 74.583  -67.339 -25.425 1.00 61.81  ? 7    DG  P OP1   1 
ATOM   451  O  OP2   . DG  C 1 3   ? 73.281  -66.646 -27.527 1.00 60.57  ? 7    DG  P OP2   1 
ATOM   452  O  "O5'" . DG  C 1 3   ? 72.870  -68.852 -26.407 1.00 59.31  ? 7    DG  P "O5'" 1 
ATOM   453  C  "C5'" . DG  C 1 3   ? 72.862  -69.754 -25.302 1.00 57.82  ? 7    DG  P "C5'" 1 
ATOM   454  C  "C4'" . DG  C 1 3   ? 71.559  -70.518 -25.252 1.00 56.82  ? 7    DG  P "C4'" 1 
ATOM   455  O  "O4'" . DG  C 1 3   ? 70.477  -69.630 -24.882 1.00 55.64  ? 7    DG  P "O4'" 1 
ATOM   456  C  "C3'" . DG  C 1 3   ? 71.134  -71.180 -26.562 1.00 57.11  ? 7    DG  P "C3'" 1 
ATOM   457  O  "O3'" . DG  C 1 3   ? 70.560  -72.459 -26.279 1.00 58.76  ? 7    DG  P "O3'" 1 
ATOM   458  C  "C2'" . DG  C 1 3   ? 70.094  -70.223 -27.123 1.00 54.57  ? 7    DG  P "C2'" 1 
ATOM   459  C  "C1'" . DG  C 1 3   ? 69.452  -69.651 -25.869 1.00 53.19  ? 7    DG  P "C1'" 1 
ATOM   460  N  N9    . DG  C 1 3   ? 68.948  -68.286 -26.000 1.00 50.33  ? 7    DG  P N9    1 
ATOM   461  C  C8    . DG  C 1 3   ? 69.518  -67.257 -26.709 1.00 49.13  ? 7    DG  P C8    1 
ATOM   462  N  N7    . DG  C 1 3   ? 68.869  -66.130 -26.590 1.00 48.18  ? 7    DG  P N7    1 
ATOM   463  C  C5    . DG  C 1 3   ? 67.798  -66.434 -25.761 1.00 47.94  ? 7    DG  P C5    1 
ATOM   464  C  C6    . DG  C 1 3   ? 66.752  -65.607 -25.265 1.00 48.04  ? 7    DG  P C6    1 
ATOM   465  O  O6    . DG  C 1 3   ? 66.566  -64.399 -25.456 1.00 49.11  ? 7    DG  P O6    1 
ATOM   466  N  N1    . DG  C 1 3   ? 65.869  -66.324 -24.465 1.00 46.92  ? 7    DG  P N1    1 
ATOM   467  C  C2    . DG  C 1 3   ? 65.976  -67.660 -24.174 1.00 46.87  ? 7    DG  P C2    1 
ATOM   468  N  N2    . DG  C 1 3   ? 65.017  -68.168 -23.390 1.00 44.81  ? 7    DG  P N2    1 
ATOM   469  N  N3    . DG  C 1 3   ? 66.950  -68.440 -24.620 1.00 48.52  ? 7    DG  P N3    1 
ATOM   470  C  C4    . DG  C 1 3   ? 67.820  -67.765 -25.403 1.00 49.08  ? 7    DG  P C4    1 
ATOM   471  P  P     . DG  C 1 4   ? 70.385  -73.536 -27.457 1.00 59.90  ? 8    DG  P P     1 
ATOM   472  O  OP1   . DG  C 1 4   ? 70.803  -74.857 -26.919 1.00 59.03  ? 8    DG  P OP1   1 
ATOM   473  O  OP2   . DG  C 1 4   ? 71.019  -73.011 -28.692 1.00 60.19  ? 8    DG  P OP2   1 
ATOM   474  O  "O5'" . DG  C 1 4   ? 68.811  -73.571 -27.677 1.00 60.02  ? 8    DG  P "O5'" 1 
ATOM   475  C  "C5'" . DG  C 1 4   ? 67.940  -73.828 -26.580 1.00 60.44  ? 8    DG  P "C5'" 1 
ATOM   476  C  "C4'" . DG  C 1 4   ? 66.529  -73.411 -26.922 1.00 59.42  ? 8    DG  P "C4'" 1 
ATOM   477  O  "O4'" . DG  C 1 4   ? 66.426  -71.966 -26.985 1.00 59.36  ? 8    DG  P "O4'" 1 
ATOM   478  C  "C3'" . DG  C 1 4   ? 66.013  -73.931 -28.265 1.00 58.40  ? 8    DG  P "C3'" 1 
ATOM   479  O  "O3'" . DG  C 1 4   ? 64.625  -74.229 -28.124 1.00 57.58  ? 8    DG  P "O3'" 1 
ATOM   480  C  "C2'" . DG  C 1 4   ? 66.169  -72.726 -29.175 1.00 57.65  ? 8    DG  P "C2'" 1 
ATOM   481  C  "C1'" . DG  C 1 4   ? 65.812  -71.610 -28.213 1.00 57.38  ? 8    DG  P "C1'" 1 
ATOM   482  N  N9    . DG  C 1 4   ? 66.254  -70.269 -28.582 1.00 55.05  ? 8    DG  P N9    1 
ATOM   483  C  C8    . DG  C 1 4   ? 67.336  -69.924 -29.356 1.00 55.32  ? 8    DG  P C8    1 
ATOM   484  N  N7    . DG  C 1 4   ? 67.458  -68.634 -29.520 1.00 53.81  ? 8    DG  P N7    1 
ATOM   485  C  C5    . DG  C 1 4   ? 66.395  -68.096 -28.809 1.00 52.67  ? 8    DG  P C5    1 
ATOM   486  C  C6    . DG  C 1 4   ? 66.003  -66.746 -28.621 1.00 52.12  ? 8    DG  P C6    1 
ATOM   487  O  O6    . DG  C 1 4   ? 66.538  -65.719 -29.057 1.00 52.13  ? 8    DG  P O6    1 
ATOM   488  N  N1    . DG  C 1 4   ? 64.860  -66.652 -27.832 1.00 51.29  ? 8    DG  P N1    1 
ATOM   489  C  C2    . DG  C 1 4   ? 64.182  -67.716 -27.291 1.00 50.00  ? 8    DG  P C2    1 
ATOM   490  N  N2    . DG  C 1 4   ? 63.101  -67.420 -26.561 1.00 49.09  ? 8    DG  P N2    1 
ATOM   491  N  N3    . DG  C 1 4   ? 64.537  -68.977 -27.457 1.00 50.76  ? 8    DG  P N3    1 
ATOM   492  C  C4    . DG  C 1 4   ? 65.644  -69.092 -28.222 1.00 53.24  ? 8    DG  P C4    1 
ATOM   493  P  P     . DA  C 1 5   ? 63.970  -75.438 -28.949 1.00 57.43  ? 9    DA  P P     1 
ATOM   494  O  OP1   . DA  C 1 5   ? 64.511  -76.702 -28.390 1.00 57.51  ? 9    DA  P OP1   1 
ATOM   495  O  OP2   . DA  C 1 5   ? 64.103  -75.161 -30.404 1.00 57.31  ? 9    DA  P OP2   1 
ATOM   496  O  "O5'" . DA  C 1 5   ? 62.434  -75.321 -28.546 1.00 55.26  ? 9    DA  P "O5'" 1 
ATOM   497  C  "C5'" . DA  C 1 5   ? 62.062  -74.998 -27.206 1.00 50.89  ? 9    DA  P "C5'" 1 
ATOM   498  C  "C4'" . DA  C 1 5   ? 61.112  -73.822 -27.189 1.00 49.05  ? 9    DA  P "C4'" 1 
ATOM   499  O  "O4'" . DA  C 1 5   ? 61.781  -72.619 -27.650 1.00 48.57  ? 9    DA  P "O4'" 1 
ATOM   500  C  "C3'" . DA  C 1 5   ? 59.881  -73.978 -28.082 1.00 48.53  ? 9    DA  P "C3'" 1 
ATOM   501  O  "O3'" . DA  C 1 5   ? 58.758  -73.357 -27.445 1.00 47.37  ? 9    DA  P "O3'" 1 
ATOM   502  C  "C2'" . DA  C 1 5   ? 60.272  -73.206 -29.329 1.00 48.00  ? 9    DA  P "C2'" 1 
ATOM   503  C  "C1'" . DA  C 1 5   ? 61.037  -72.049 -28.719 1.00 46.96  ? 9    DA  P "C1'" 1 
ATOM   504  N  N9    . DA  C 1 5   ? 61.967  -71.361 -29.619 1.00 44.20  ? 9    DA  P N9    1 
ATOM   505  C  C8    . DA  C 1 5   ? 62.940  -71.906 -30.422 1.00 42.85  ? 9    DA  P C8    1 
ATOM   506  N  N7    . DA  C 1 5   ? 63.626  -71.017 -31.103 1.00 39.96  ? 9    DA  P N7    1 
ATOM   507  C  C5    . DA  C 1 5   ? 63.065  -69.804 -30.727 1.00 38.09  ? 9    DA  P C5    1 
ATOM   508  C  C6    . DA  C 1 5   ? 63.348  -68.475 -31.094 1.00 35.70  ? 9    DA  P C6    1 
ATOM   509  N  N6    . DA  C 1 5   ? 64.314  -68.129 -31.946 1.00 31.91  ? 9    DA  P N6    1 
ATOM   510  N  N1    . DA  C 1 5   ? 62.595  -67.500 -30.544 1.00 36.49  ? 9    DA  P N1    1 
ATOM   511  C  C2    . DA  C 1 5   ? 61.631  -67.843 -29.681 1.00 38.52  ? 9    DA  P C2    1 
ATOM   512  N  N3    . DA  C 1 5   ? 61.273  -69.052 -29.252 1.00 39.67  ? 9    DA  P N3    1 
ATOM   513  C  C4    . DA  C 1 5   ? 62.037  -70.001 -29.820 1.00 40.80  ? 9    DA  P C4    1 
ATOM   514  P  P     . DT  C 1 6   ? 57.273  -73.900 -27.733 1.00 49.23  ? 10   DT  P P     1 
ATOM   515  O  OP1   . DT  C 1 6   ? 56.506  -73.762 -26.465 1.00 47.27  ? 10   DT  P OP1   1 
ATOM   516  O  OP2   . DT  C 1 6   ? 57.373  -75.230 -28.396 1.00 46.86  ? 10   DT  P OP2   1 
ATOM   517  O  "O5'" . DT  C 1 6   ? 56.684  -72.853 -28.779 1.00 48.34  ? 10   DT  P "O5'" 1 
ATOM   518  C  "C5'" . DT  C 1 6   ? 57.552  -71.959 -29.462 1.00 47.60  ? 10   DT  P "C5'" 1 
ATOM   519  C  "C4'" . DT  C 1 6   ? 56.871  -70.635 -29.703 1.00 46.14  ? 10   DT  P "C4'" 1 
ATOM   520  O  "O4'" . DT  C 1 6   ? 57.883  -69.696 -30.134 1.00 45.09  ? 10   DT  P "O4'" 1 
ATOM   521  C  "C3'" . DT  C 1 6   ? 55.814  -70.664 -30.804 1.00 47.20  ? 10   DT  P "C3'" 1 
ATOM   522  O  "O3'" . DT  C 1 6   ? 54.716  -69.803 -30.477 1.00 49.58  ? 10   DT  P "O3'" 1 
ATOM   523  C  "C2'" . DT  C 1 6   ? 56.566  -70.185 -32.033 1.00 45.06  ? 10   DT  P "C2'" 1 
ATOM   524  C  "C1'" . DT  C 1 6   ? 57.668  -69.292 -31.475 1.00 42.12  ? 10   DT  P "C1'" 1 
ATOM   525  N  N1    . DT  C 1 6   ? 58.950  -69.440 -32.194 1.00 39.24  ? 10   DT  P N1    1 
ATOM   526  C  C2    . DT  C 1 6   ? 59.685  -68.312 -32.491 1.00 38.57  ? 10   DT  P C2    1 
ATOM   527  O  O2    . DT  C 1 6   ? 59.363  -67.190 -32.137 1.00 39.65  ? 10   DT  P O2    1 
ATOM   528  N  N3    . DT  C 1 6   ? 60.826  -68.550 -33.218 1.00 37.00  ? 10   DT  P N3    1 
ATOM   529  C  C4    . DT  C 1 6   ? 61.301  -69.773 -33.652 1.00 36.53  ? 10   DT  P C4    1 
ATOM   530  O  O4    . DT  C 1 6   ? 62.331  -69.829 -34.317 1.00 33.94  ? 10   DT  P O4    1 
ATOM   531  C  C5    . DT  C 1 6   ? 60.503  -70.913 -33.271 1.00 37.39  ? 10   DT  P C5    1 
ATOM   532  C  C7    . DT  C 1 6   ? 60.958  -72.282 -33.668 1.00 38.92  ? 10   DT  P C7    1 
ATOM   533  C  C6    . DT  C 1 6   ? 59.383  -70.693 -32.572 1.00 37.99  ? 10   DT  P C6    1 
ATOM   534  P  P     . DG  C 1 7   ? 53.399  -69.797 -31.403 1.00 49.37  ? 11   DG  P P     1 
ATOM   535  O  OP1   . DG  C 1 7   ? 52.278  -69.292 -30.568 1.00 47.18  ? 11   DG  P OP1   1 
ATOM   536  O  OP2   . DG  C 1 7   ? 53.274  -71.110 -32.092 1.00 45.88  ? 11   DG  P OP2   1 
ATOM   537  O  "O5'" . DG  C 1 7   ? 53.727  -68.686 -32.496 1.00 51.29  ? 11   DG  P "O5'" 1 
ATOM   538  C  "C5'" . DG  C 1 7   ? 53.941  -67.328 -32.112 1.00 51.11  ? 11   DG  P "C5'" 1 
ATOM   539  C  "C4'" . DG  C 1 7   ? 54.300  -66.494 -33.319 1.00 51.20  ? 11   DG  P "C4'" 1 
ATOM   540  O  "O4'" . DG  C 1 7   ? 55.662  -66.758 -33.740 1.00 50.42  ? 11   DG  P "O4'" 1 
ATOM   541  C  "C3'" . DG  C 1 7   ? 53.419  -66.751 -34.544 1.00 51.39  ? 11   DG  P "C3'" 1 
ATOM   542  O  "O3'" . DG  C 1 7   ? 53.193  -65.521 -35.228 1.00 53.29  ? 11   DG  P "O3'" 1 
ATOM   543  C  "C2'" . DG  C 1 7   ? 54.292  -67.639 -35.409 1.00 50.51  ? 11   DG  P "C2'" 1 
ATOM   544  C  "C1'" . DG  C 1 7   ? 55.654  -67.038 -35.128 1.00 50.47  ? 11   DG  P "C1'" 1 
ATOM   545  N  N9    . DG  C 1 7   ? 56.797  -67.887 -35.440 1.00 49.51  ? 11   DG  P N9    1 
ATOM   546  C  C8    . DG  C 1 7   ? 56.862  -69.259 -35.399 1.00 49.63  ? 11   DG  P C8    1 
ATOM   547  N  N7    . DG  C 1 7   ? 58.020  -69.728 -35.780 1.00 49.81  ? 11   DG  P N7    1 
ATOM   548  C  C5    . DG  C 1 7   ? 58.766  -68.596 -36.081 1.00 49.93  ? 11   DG  P C5    1 
ATOM   549  C  C6    . DG  C 1 7   ? 60.099  -68.468 -36.552 1.00 50.39  ? 11   DG  P C6    1 
ATOM   550  O  O6    . DG  C 1 7   ? 60.916  -69.361 -36.813 1.00 51.99  ? 11   DG  P O6    1 
ATOM   551  N  N1    . DG  C 1 7   ? 60.455  -67.135 -36.719 1.00 49.28  ? 11   DG  P N1    1 
ATOM   552  C  C2    . DG  C 1 7   ? 59.637  -66.062 -36.469 1.00 48.80  ? 11   DG  P C2    1 
ATOM   553  N  N2    . DG  C 1 7   ? 60.166  -64.853 -36.691 1.00 49.48  ? 11   DG  P N2    1 
ATOM   554  N  N3    . DG  C 1 7   ? 58.394  -66.167 -36.035 1.00 47.94  ? 11   DG  P N3    1 
ATOM   555  C  C4    . DG  C 1 7   ? 58.027  -67.453 -35.865 1.00 49.04  ? 11   DG  P C4    1 
ATOM   556  P  P     . DA  C 1 8   ? 51.715  -64.906 -35.291 1.00 55.38  ? 12   DA  P P     1 
ATOM   557  O  OP1   . DA  C 1 8   ? 51.037  -65.216 -34.006 1.00 56.39  ? 12   DA  P OP1   1 
ATOM   558  O  OP2   . DA  C 1 8   ? 51.086  -65.316 -36.575 1.00 54.69  ? 12   DA  P OP2   1 
ATOM   559  O  "O5'" . DA  C 1 8   ? 51.974  -63.340 -35.343 1.00 55.93  ? 12   DA  P "O5'" 1 
ATOM   560  C  "C5'" . DA  C 1 8   ? 51.966  -62.650 -36.584 1.00 56.34  ? 12   DA  P "C5'" 1 
ATOM   561  C  "C4'" . DA  C 1 8   ? 53.260  -61.894 -36.769 1.00 55.01  ? 12   DA  P "C4'" 1 
ATOM   562  O  "O4'" . DA  C 1 8   ? 54.379  -62.813 -36.692 1.00 52.86  ? 12   DA  P "O4'" 1 
ATOM   563  C  "C3'" . DA  C 1 8   ? 53.360  -61.221 -38.135 1.00 54.82  ? 12   DA  P "C3'" 1 
ATOM   564  O  "O3'" . DA  C 1 8   ? 54.010  -59.954 -38.020 1.00 54.05  ? 12   DA  P "O3'" 1 
ATOM   565  C  "C2'" . DA  C 1 8   ? 54.185  -62.200 -38.948 1.00 53.78  ? 12   DA  P "C2'" 1 
ATOM   566  C  "C1'" . DA  C 1 8   ? 55.114  -62.798 -37.907 1.00 52.02  ? 12   DA  P "C1'" 1 
ATOM   567  N  N9    . DA  C 1 8   ? 55.511  -64.173 -38.210 1.00 51.07  ? 12   DA  P N9    1 
ATOM   568  C  C8    . DA  C 1 8   ? 54.792  -65.321 -37.986 1.00 51.76  ? 12   DA  P C8    1 
ATOM   569  N  N7    . DA  C 1 8   ? 55.402  -66.413 -38.378 1.00 51.15  ? 12   DA  P N7    1 
ATOM   570  C  C5    . DA  C 1 8   ? 56.607  -65.954 -38.891 1.00 50.01  ? 12   DA  P C5    1 
ATOM   571  C  C6    . DA  C 1 8   ? 57.701  -66.620 -39.468 1.00 49.66  ? 12   DA  P C6    1 
ATOM   572  N  N6    . DA  C 1 8   ? 57.761  -67.943 -39.630 1.00 49.18  ? 12   DA  P N6    1 
ATOM   573  N  N1    . DA  C 1 8   ? 58.745  -65.869 -39.880 1.00 49.95  ? 12   DA  P N1    1 
ATOM   574  C  C2    . DA  C 1 8   ? 58.683  -64.541 -39.718 1.00 50.59  ? 12   DA  P C2    1 
ATOM   575  N  N3    . DA  C 1 8   ? 57.710  -63.800 -39.190 1.00 50.13  ? 12   DA  P N3    1 
ATOM   576  C  C4    . DA  C 1 8   ? 56.688  -64.576 -38.792 1.00 50.54  ? 12   DA  P C4    1 
ATOM   577  P  P     . DG  C 1 9   ? 53.744  -58.826 -39.129 1.00 52.83  ? 13   DG  P P     1 
ATOM   578  O  OP1   . DG  C 1 9   ? 53.489  -57.545 -38.420 1.00 51.79  ? 13   DG  P OP1   1 
ATOM   579  O  OP2   . DG  C 1 9   ? 52.730  -59.365 -40.074 1.00 49.84  ? 13   DG  P OP2   1 
ATOM   580  O  "O5'" . DG  C 1 9   ? 55.142  -58.721 -39.885 1.00 52.97  ? 13   DG  P "O5'" 1 
ATOM   581  C  "C5'" . DG  C 1 9   ? 55.924  -59.891 -40.110 1.00 52.57  ? 13   DG  P "C5'" 1 
ATOM   582  C  "C4'" . DG  C 1 9   ? 56.724  -59.756 -41.381 1.00 51.89  ? 13   DG  P "C4'" 1 
ATOM   583  O  "O4'" . DG  C 1 9   ? 57.260  -61.063 -41.692 1.00 51.65  ? 13   DG  P "O4'" 1 
ATOM   584  C  "C3'" . DG  C 1 9   ? 55.888  -59.370 -42.597 1.00 52.89  ? 13   DG  P "C3'" 1 
ATOM   585  C  "C2'" . DG  C 1 9   ? 55.400  -60.714 -43.100 1.00 51.91  ? 13   DG  P "C2'" 1 
ATOM   586  C  "C1'" . DG  C 1 9   ? 56.602  -61.607 -42.831 1.00 51.07  ? 13   DG  P "C1'" 1 
ATOM   587  N  N9    . DG  C 1 9   ? 56.244  -62.988 -42.525 1.00 50.41  ? 13   DG  P N9    1 
ATOM   588  C  C8    . DG  C 1 9   ? 55.142  -63.421 -41.827 1.00 49.27  ? 13   DG  P C8    1 
ATOM   589  N  N7    . DG  C 1 9   ? 55.078  -64.719 -41.723 1.00 47.61  ? 13   DG  P N7    1 
ATOM   590  C  C5    . DG  C 1 9   ? 56.207  -65.172 -42.389 1.00 48.23  ? 13   DG  P C5    1 
ATOM   591  C  C6    . DG  C 1 9   ? 56.669  -66.489 -42.610 1.00 48.88  ? 13   DG  P C6    1 
ATOM   592  O  O6    . DG  C 1 9   ? 56.158  -67.554 -42.248 1.00 49.47  ? 13   DG  P O6    1 
ATOM   593  N  N1    . DG  C 1 9   ? 57.855  -66.499 -43.339 1.00 48.85  ? 13   DG  P N1    1 
ATOM   594  C  C2    . DG  C 1 9   ? 58.509  -65.383 -43.799 1.00 48.62  ? 13   DG  P C2    1 
ATOM   595  N  N2    . DG  C 1 9   ? 59.632  -65.602 -44.502 1.00 48.20  ? 13   DG  P N2    1 
ATOM   596  N  N3    . DG  C 1 9   ? 58.090  -64.145 -43.592 1.00 48.81  ? 13   DG  P N3    1 
ATOM   597  C  C4    . DG  C 1 9   ? 56.939  -64.115 -42.887 1.00 49.00  ? 13   DG  P C4    1 
ATOM   598  P  P     . DG  D 2 1   ? 51.628  -75.935 -43.505 1.00 94.05  ? 4    DG  T P     1 
ATOM   599  O  OP1   . DG  D 2 1   ? 52.368  -74.726 -43.065 1.00 93.48  ? 4    DG  T OP1   1 
ATOM   600  O  OP2   . DG  D 2 1   ? 50.487  -76.439 -42.708 1.00 93.67  ? 4    DG  T OP2   1 
ATOM   601  O  "O5'" . DG  D 2 1   ? 52.704  -77.143 -43.692 1.00 92.50  ? 4    DG  T "O5'" 1 
ATOM   602  C  "C5'" . DG  D 2 1   ? 52.445  -78.296 -44.526 1.00 88.95  ? 4    DG  T "C5'" 1 
ATOM   603  C  "C4'" . DG  D 2 1   ? 52.656  -77.977 -46.015 1.00 86.09  ? 4    DG  T "C4'" 1 
ATOM   604  O  "O4'" . DG  D 2 1   ? 51.788  -76.854 -46.377 1.00 83.28  ? 4    DG  T "O4'" 1 
ATOM   605  C  "C3'" . DG  D 2 1   ? 54.047  -77.474 -46.414 1.00 85.46  ? 4    DG  T "C3'" 1 
ATOM   606  O  "O3'" . DG  D 2 1   ? 55.222  -78.325 -46.376 1.00 87.90  ? 4    DG  T "O3'" 1 
ATOM   607  C  "C2'" . DG  D 2 1   ? 53.679  -76.885 -47.771 1.00 82.97  ? 4    DG  T "C2'" 1 
ATOM   608  C  "C1'" . DG  D 2 1   ? 52.390  -76.112 -47.472 1.00 79.83  ? 4    DG  T "C1'" 1 
ATOM   609  N  N9    . DG  D 2 1   ? 52.711  -74.670 -47.182 1.00 76.23  ? 4    DG  T N9    1 
ATOM   610  C  C8    . DG  D 2 1   ? 53.430  -74.072 -46.160 1.00 70.55  ? 4    DG  T C8    1 
ATOM   611  N  N7    . DG  D 2 1   ? 53.496  -72.790 -46.237 1.00 65.03  ? 4    DG  T N7    1 
ATOM   612  C  C5    . DG  D 2 1   ? 52.794  -72.456 -47.368 1.00 71.75  ? 4    DG  T C5    1 
ATOM   613  C  C6    . DG  D 2 1   ? 52.520  -71.178 -47.932 1.00 75.31  ? 4    DG  T C6    1 
ATOM   614  O  O6    . DG  D 2 1   ? 52.882  -70.071 -47.528 1.00 78.07  ? 4    DG  T O6    1 
ATOM   615  N  N1    . DG  D 2 1   ? 51.758  -71.278 -49.099 1.00 78.27  ? 4    DG  T N1    1 
ATOM   616  C  C2    . DG  D 2 1   ? 51.274  -72.462 -49.680 1.00 79.58  ? 4    DG  T C2    1 
ATOM   617  N  N2    . DG  D 2 1   ? 50.556  -72.331 -50.803 1.00 81.99  ? 4    DG  T N2    1 
ATOM   618  N  N3    . DG  D 2 1   ? 51.534  -73.678 -49.128 1.00 77.93  ? 4    DG  T N3    1 
ATOM   619  C  C4    . DG  D 2 1   ? 52.286  -73.598 -47.968 1.00 74.89  ? 4    DG  T C4    1 
ATOM   620  P  P     . DG  D 2 2   ? 55.750  -79.129 -45.030 1.00 89.55  ? 5    DG  T P     1 
ATOM   621  O  OP1   . DG  D 2 2   ? 56.491  -80.393 -45.224 1.00 90.76  ? 5    DG  T OP1   1 
ATOM   622  O  OP2   . DG  D 2 2   ? 55.894  -78.289 -43.792 1.00 89.48  ? 5    DG  T OP2   1 
ATOM   623  O  "O5'" . DG  D 2 2   ? 57.156  -78.472 -45.537 1.00 87.31  ? 5    DG  T "O5'" 1 
ATOM   624  C  "C5'" . DG  D 2 2   ? 57.377  -77.052 -45.681 1.00 84.13  ? 5    DG  T "C5'" 1 
ATOM   625  C  "C4'" . DG  D 2 2   ? 58.738  -76.644 -46.180 1.00 81.97  ? 5    DG  T "C4'" 1 
ATOM   626  O  "O4'" . DG  D 2 2   ? 58.453  -75.478 -46.979 1.00 80.92  ? 5    DG  T "O4'" 1 
ATOM   627  C  "C3'" . DG  D 2 2   ? 59.645  -76.201 -45.046 1.00 80.95  ? 5    DG  T "C3'" 1 
ATOM   628  O  "O3'" . DG  D 2 2   ? 61.081  -76.421 -45.471 1.00 81.43  ? 5    DG  T "O3'" 1 
ATOM   629  C  "C2'" . DG  D 2 2   ? 59.273  -74.770 -44.926 1.00 79.81  ? 5    DG  T "C2'" 1 
ATOM   630  C  "C1'" . DG  D 2 2   ? 59.005  -74.291 -46.383 1.00 77.81  ? 5    DG  T "C1'" 1 
ATOM   631  N  N9    . DG  D 2 2   ? 58.015  -73.214 -46.411 1.00 73.61  ? 5    DG  T N9    1 
ATOM   632  C  C8    . DG  D 2 2   ? 56.891  -73.122 -45.632 1.00 68.30  ? 5    DG  T C8    1 
ATOM   633  N  N7    . DG  D 2 2   ? 56.165  -72.073 -45.849 1.00 64.75  ? 5    DG  T N7    1 
ATOM   634  C  C5    . DG  D 2 2   ? 56.844  -71.403 -46.844 1.00 70.44  ? 5    DG  T C5    1 
ATOM   635  C  C6    . DG  D 2 2   ? 56.530  -70.180 -47.485 1.00 73.31  ? 5    DG  T C6    1 
ATOM   636  O  O6    . DG  D 2 2   ? 55.570  -69.454 -47.285 1.00 74.19  ? 5    DG  T O6    1 
ATOM   637  N  N1    . DG  D 2 2   ? 57.465  -69.816 -48.461 1.00 75.39  ? 5    DG  T N1    1 
ATOM   638  C  C2    . DG  D 2 2   ? 58.617  -70.542 -48.810 1.00 75.32  ? 5    DG  T C2    1 
ATOM   639  N  N2    . DG  D 2 2   ? 59.335  -69.969 -49.774 1.00 75.99  ? 5    DG  T N2    1 
ATOM   640  N  N3    . DG  D 2 2   ? 58.931  -71.722 -48.192 1.00 74.20  ? 5    DG  T N3    1 
ATOM   641  C  C4    . DG  D 2 2   ? 57.999  -72.086 -47.214 1.00 72.58  ? 5    DG  T C4    1 
ATOM   642  P  P     . DC  D 2 3   ? 62.355  -75.649 -44.760 1.00 80.97  ? 6    DC  T P     1 
ATOM   643  O  OP1   . DC  D 2 3   ? 63.589  -76.286 -45.335 1.00 79.70  ? 6    DC  T OP1   1 
ATOM   644  O  OP2   . DC  D 2 3   ? 62.162  -75.600 -43.303 1.00 79.24  ? 6    DC  T OP2   1 
ATOM   645  O  "O5'" . DC  D 2 3   ? 62.240  -74.160 -45.289 1.00 80.31  ? 6    DC  T "O5'" 1 
ATOM   646  C  "C5'" . DC  D 2 3   ? 62.465  -73.845 -46.655 1.00 78.06  ? 6    DC  T "C5'" 1 
ATOM   647  C  "C4'" . DC  D 2 3   ? 62.748  -72.366 -46.778 1.00 76.39  ? 6    DC  T "C4'" 1 
ATOM   648  O  "O4'" . DC  D 2 3   ? 61.566  -71.568 -46.496 1.00 74.17  ? 6    DC  T "O4'" 1 
ATOM   649  C  "C3'" . DC  D 2 3   ? 63.830  -71.860 -45.823 1.00 75.98  ? 6    DC  T "C3'" 1 
ATOM   650  O  "O3'" . DC  D 2 3   ? 64.713  -70.934 -46.453 1.00 76.53  ? 6    DC  T "O3'" 1 
ATOM   651  C  "C2'" . DC  D 2 3   ? 63.040  -71.174 -44.730 1.00 74.75  ? 6    DC  T "C2'" 1 
ATOM   652  C  "C1'" . DC  D 2 3   ? 61.859  -70.606 -45.493 1.00 73.04  ? 6    DC  T "C1'" 1 
ATOM   653  N  N1    . DC  D 2 3   ? 60.655  -70.423 -44.659 1.00 70.50  ? 6    DC  T N1    1 
ATOM   654  C  C2    . DC  D 2 3   ? 59.893  -69.258 -44.803 1.00 70.01  ? 6    DC  T C2    1 
ATOM   655  O  O2    . DC  D 2 3   ? 60.223  -68.428 -45.659 1.00 70.94  ? 6    DC  T O2    1 
ATOM   656  N  N3    . DC  D 2 3   ? 58.816  -69.072 -44.004 1.00 69.42  ? 6    DC  T N3    1 
ATOM   657  C  C4    . DC  D 2 3   ? 58.493  -69.997 -43.095 1.00 69.09  ? 6    DC  T C4    1 
ATOM   658  N  N4    . DC  D 2 3   ? 57.439  -69.763 -42.310 1.00 68.04  ? 6    DC  T N4    1 
ATOM   659  C  C5    . DC  D 2 3   ? 59.239  -71.201 -42.947 1.00 69.02  ? 6    DC  T C5    1 
ATOM   660  C  C6    . DC  D 2 3   ? 60.297  -71.371 -43.742 1.00 69.45  ? 6    DC  T C6    1 
ATOM   661  P  P     . DT  D 2 4   ? 65.971  -70.348 -45.631 1.00 77.10  ? 7    DT  T P     1 
ATOM   662  O  OP1   . DT  D 2 4   ? 67.150  -70.443 -46.536 1.00 76.34  ? 7    DT  T OP1   1 
ATOM   663  O  OP2   . DT  D 2 4   ? 66.044  -70.946 -44.270 1.00 76.35  ? 7    DT  T OP2   1 
ATOM   664  O  "O5'" . DT  D 2 4   ? 65.608  -68.808 -45.459 1.00 75.59  ? 7    DT  T "O5'" 1 
ATOM   665  C  "C5'" . DT  D 2 4   ? 65.173  -68.046 -46.577 1.00 72.55  ? 7    DT  T "C5'" 1 
ATOM   666  C  "C4'" . DT  D 2 4   ? 64.790  -66.652 -46.139 1.00 69.18  ? 7    DT  T "C4'" 1 
ATOM   667  O  "O4'" . DT  D 2 4   ? 63.582  -66.696 -45.340 1.00 68.97  ? 7    DT  T "O4'" 1 
ATOM   668  C  "C3'" . DT  D 2 4   ? 65.841  -65.952 -45.278 1.00 67.09  ? 7    DT  T "C3'" 1 
ATOM   669  O  "O3'" . DT  D 2 4   ? 65.928  -64.571 -45.639 1.00 63.79  ? 7    DT  T "O3'" 1 
ATOM   670  C  "C2'" . DT  D 2 4   ? 65.309  -66.122 -43.865 1.00 67.38  ? 7    DT  T "C2'" 1 
ATOM   671  C  "C1'" . DT  D 2 4   ? 63.807  -66.080 -44.080 1.00 67.53  ? 7    DT  T "C1'" 1 
ATOM   672  N  N1    . DT  D 2 4   ? 63.000  -66.801 -43.072 1.00 66.55  ? 7    DT  T N1    1 
ATOM   673  C  C2    . DT  D 2 4   ? 61.942  -66.131 -42.497 1.00 66.43  ? 7    DT  T C2    1 
ATOM   674  O  O2    . DT  D 2 4   ? 61.666  -64.972 -42.759 1.00 67.29  ? 7    DT  T O2    1 
ATOM   675  N  N3    . DT  D 2 4   ? 61.216  -66.871 -41.595 1.00 65.45  ? 7    DT  T N3    1 
ATOM   676  C  C4    . DT  D 2 4   ? 61.443  -68.180 -41.214 1.00 65.49  ? 7    DT  T C4    1 
ATOM   677  O  O4    . DT  D 2 4   ? 60.697  -68.719 -40.399 1.00 65.15  ? 7    DT  T O4    1 
ATOM   678  C  C5    . DT  D 2 4   ? 62.582  -68.814 -41.839 1.00 65.13  ? 7    DT  T C5    1 
ATOM   679  C  C7    . DT  D 2 4   ? 62.915  -70.224 -41.470 1.00 65.35  ? 7    DT  T C7    1 
ATOM   680  C  C6    . DT  D 2 4   ? 63.293  -68.104 -42.727 1.00 65.40  ? 7    DT  T C6    1 
ATOM   681  P  P     . DC  D 2 5   ? 67.055  -63.650 -44.970 1.00 61.04  ? 8    DC  T P     1 
ATOM   682  O  OP1   . DC  D 2 5   ? 67.476  -62.637 -45.967 1.00 60.55  ? 8    DC  T OP1   1 
ATOM   683  O  OP2   . DC  D 2 5   ? 68.074  -64.530 -44.341 1.00 60.90  ? 8    DC  T OP2   1 
ATOM   684  O  "O5'" . DC  D 2 5   ? 66.260  -62.910 -43.813 1.00 58.63  ? 8    DC  T "O5'" 1 
ATOM   685  C  "C5'" . DC  D 2 5   ? 66.895  -62.606 -42.588 1.00 55.70  ? 8    DC  T "C5'" 1 
ATOM   686  C  "C4'" . DC  D 2 5   ? 65.952  -61.838 -41.697 1.00 54.53  ? 8    DC  T "C4'" 1 
ATOM   687  O  "O4'" . DC  D 2 5   ? 64.780  -62.649 -41.425 1.00 53.53  ? 8    DC  T "O4'" 1 
ATOM   688  C  "C3'" . DC  D 2 5   ? 66.569  -61.506 -40.341 1.00 54.28  ? 8    DC  T "C3'" 1 
ATOM   689  O  "O3'" . DC  D 2 5   ? 66.253  -60.180 -39.944 1.00 52.69  ? 8    DC  T "O3'" 1 
ATOM   690  C  "C2'" . DC  D 2 5   ? 65.943  -62.506 -39.392 1.00 54.05  ? 8    DC  T "C2'" 1 
ATOM   691  C  "C1'" . DC  D 2 5   ? 64.592  -62.779 -40.024 1.00 54.18  ? 8    DC  T "C1'" 1 
ATOM   692  N  N1    . DC  D 2 5   ? 64.126  -64.144 -39.741 1.00 54.18  ? 8    DC  T N1    1 
ATOM   693  C  C2    . DC  D 2 5   ? 62.922  -64.315 -39.053 1.00 54.03  ? 8    DC  T C2    1 
ATOM   694  O  O2    . DC  D 2 5   ? 62.244  -63.315 -38.774 1.00 54.32  ? 8    DC  T O2    1 
ATOM   695  N  N3    . DC  D 2 5   ? 62.527  -65.562 -38.711 1.00 53.89  ? 8    DC  T N3    1 
ATOM   696  C  C4    . DC  D 2 5   ? 63.281  -66.613 -39.040 1.00 54.41  ? 8    DC  T C4    1 
ATOM   697  N  N4    . DC  D 2 5   ? 62.873  -67.823 -38.649 1.00 53.90  ? 8    DC  T N4    1 
ATOM   698  C  C5    . DC  D 2 5   ? 64.493  -66.471 -39.779 1.00 54.20  ? 8    DC  T C5    1 
ATOM   699  C  C6    . DC  D 2 5   ? 64.871  -65.230 -40.109 1.00 53.95  ? 8    DC  T C6    1 
ATOM   700  P  P     . DA  D 2 6   ? 66.908  -59.588 -38.609 1.00 53.24  ? 9    DA  T P     1 
ATOM   701  O  OP1   . DA  D 2 6   ? 67.350  -58.198 -38.905 1.00 51.58  ? 9    DA  T OP1   1 
ATOM   702  O  OP2   . DA  D 2 6   ? 67.883  -60.579 -38.078 1.00 51.74  ? 9    DA  T OP2   1 
ATOM   703  O  "O5'" . DA  D 2 6   ? 65.675  -59.546 -37.610 1.00 51.11  ? 9    DA  T "O5'" 1 
ATOM   704  C  "C5'" . DA  D 2 6   ? 64.406  -59.091 -38.059 1.00 47.10  ? 9    DA  T "C5'" 1 
ATOM   705  C  "C4'" . DA  D 2 6   ? 63.378  -59.291 -36.973 1.00 44.40  ? 9    DA  T "C4'" 1 
ATOM   706  O  "O4'" . DA  D 2 6   ? 63.044  -60.697 -36.863 1.00 43.42  ? 9    DA  T "O4'" 1 
ATOM   707  C  "C3'" . DA  D 2 6   ? 63.862  -58.856 -35.591 1.00 42.27  ? 9    DA  T "C3'" 1 
ATOM   708  O  "O3'" . DA  D 2 6   ? 62.809  -58.190 -34.896 1.00 40.24  ? 9    DA  T "O3'" 1 
ATOM   709  C  "C2'" . DA  D 2 6   ? 64.224  -60.168 -34.914 1.00 41.74  ? 9    DA  T "C2'" 1 
ATOM   710  C  "C1'" . DA  D 2 6   ? 63.214  -61.124 -35.521 1.00 41.81  ? 9    DA  T "C1'" 1 
ATOM   711  N  N9    . DA  D 2 6   ? 63.617  -62.531 -35.542 1.00 39.76  ? 9    DA  T N9    1 
ATOM   712  C  C8    . DA  D 2 6   ? 64.685  -63.104 -36.186 1.00 38.85  ? 9    DA  T C8    1 
ATOM   713  N  N7    . DA  D 2 6   ? 64.769  -64.402 -36.021 1.00 37.77  ? 9    DA  T N7    1 
ATOM   714  C  C5    . DA  D 2 6   ? 63.684  -64.706 -35.211 1.00 38.95  ? 9    DA  T C5    1 
ATOM   715  C  C6    . DA  D 2 6   ? 63.209  -65.919 -34.674 1.00 39.54  ? 9    DA  T C6    1 
ATOM   716  N  N6    . DA  D 2 6   ? 63.791  -67.102 -34.884 1.00 38.78  ? 9    DA  T N6    1 
ATOM   717  N  N1    . DA  D 2 6   ? 62.098  -65.873 -33.904 1.00 39.79  ? 9    DA  T N1    1 
ATOM   718  C  C2    . DA  D 2 6   ? 61.513  -64.688 -33.693 1.00 38.26  ? 9    DA  T C2    1 
ATOM   719  N  N3    . DA  D 2 6   ? 61.862  -63.484 -34.142 1.00 38.62  ? 9    DA  T N3    1 
ATOM   720  C  C4    . DA  D 2 6   ? 62.968  -63.563 -34.904 1.00 38.89  ? 9    DA  T C4    1 
ATOM   721  P  P     . DT  D 2 7   ? 63.071  -57.615 -33.425 1.00 39.07  ? 10   DT  T P     1 
ATOM   722  O  OP1   . DT  D 2 7   ? 62.415  -56.292 -33.345 1.00 40.32  ? 10   DT  T OP1   1 
ATOM   723  O  OP2   . DT  D 2 7   ? 64.513  -57.736 -33.107 1.00 42.18  ? 10   DT  T OP2   1 
ATOM   724  O  "O5'" . DT  D 2 7   ? 62.271  -58.628 -32.500 1.00 42.71  ? 10   DT  T "O5'" 1 
ATOM   725  C  "C5'" . DT  D 2 7   ? 60.874  -58.814 -32.682 1.00 47.72  ? 10   DT  T "C5'" 1 
ATOM   726  C  "C4'" . DT  D 2 7   ? 60.281  -59.513 -31.482 1.00 51.00  ? 10   DT  T "C4'" 1 
ATOM   727  O  "O4'" . DT  D 2 7   ? 60.640  -60.916 -31.493 1.00 51.17  ? 10   DT  T "O4'" 1 
ATOM   728  C  "C3'" . DT  D 2 7   ? 60.751  -58.961 -30.138 1.00 52.52  ? 10   DT  T "C3'" 1 
ATOM   729  O  "O3'" . DT  D 2 7   ? 59.650  -58.927 -29.228 1.00 55.32  ? 10   DT  T "O3'" 1 
ATOM   730  C  "C2'" . DT  D 2 7   ? 61.808  -59.962 -29.698 1.00 51.99  ? 10   DT  T "C2'" 1 
ATOM   731  C  "C1'" . DT  D 2 7   ? 61.279  -61.264 -30.276 1.00 52.46  ? 10   DT  T "C1'" 1 
ATOM   732  N  N1    . DT  D 2 7   ? 62.298  -62.289 -30.581 1.00 54.06  ? 10   DT  T N1    1 
ATOM   733  C  C2    . DT  D 2 7   ? 62.020  -63.595 -30.241 1.00 55.23  ? 10   DT  T C2    1 
ATOM   734  O  O2    . DT  D 2 7   ? 60.998  -63.932 -29.668 1.00 57.47  ? 10   DT  T O2    1 
ATOM   735  N  N3    . DT  D 2 7   ? 62.991  -64.499 -30.595 1.00 55.18  ? 10   DT  T N3    1 
ATOM   736  C  C4    . DT  D 2 7   ? 64.189  -64.234 -31.229 1.00 55.81  ? 10   DT  T C4    1 
ATOM   737  O  O4    . DT  D 2 7   ? 64.957  -65.156 -31.498 1.00 55.67  ? 10   DT  T O4    1 
ATOM   738  C  C5    . DT  D 2 7   ? 64.430  -62.840 -31.531 1.00 56.08  ? 10   DT  T C5    1 
ATOM   739  C  C7    . DT  D 2 7   ? 65.715  -62.454 -32.193 1.00 56.49  ? 10   DT  T C7    1 
ATOM   740  C  C6    . DT  D 2 7   ? 63.483  -61.949 -31.199 1.00 55.31  ? 10   DT  T C6    1 
ATOM   741  P  P     . DC  D 2 8   ? 59.826  -58.243 -27.787 1.00 57.25  ? 11   DC  T P     1 
ATOM   742  O  OP1   . DC  D 2 8   ? 58.587  -57.475 -27.503 1.00 57.35  ? 11   DC  T OP1   1 
ATOM   743  O  OP2   . DC  D 2 8   ? 61.144  -57.558 -27.740 1.00 56.97  ? 11   DC  T OP2   1 
ATOM   744  O  "O5'" . DC  D 2 8   ? 59.876  -59.490 -26.800 1.00 57.54  ? 11   DC  T "O5'" 1 
ATOM   745  C  "C5'" . DC  D 2 8   ? 58.897  -60.521 -26.885 1.00 57.13  ? 11   DC  T "C5'" 1 
ATOM   746  C  "C4'" . DC  D 2 8   ? 59.273  -61.674 -25.984 1.00 57.38  ? 11   DC  T "C4'" 1 
ATOM   747  O  "O4'" . DC  D 2 8   ? 60.412  -62.389 -26.522 1.00 56.98  ? 11   DC  T "O4'" 1 
ATOM   748  C  "C3'" . DC  D 2 8   ? 59.668  -61.263 -24.566 1.00 57.46  ? 11   DC  T "C3'" 1 
ATOM   749  O  "O3'" . DC  D 2 8   ? 59.189  -62.239 -23.645 1.00 58.98  ? 11   DC  T "O3'" 1 
ATOM   750  C  "C2'" . DC  D 2 8   ? 61.185  -61.309 -24.603 1.00 56.00  ? 11   DC  T "C2'" 1 
ATOM   751  C  "C1'" . DC  D 2 8   ? 61.423  -62.484 -25.532 1.00 54.55  ? 11   DC  T "C1'" 1 
ATOM   752  N  N1    . DC  D 2 8   ? 62.723  -62.500 -26.216 1.00 53.00  ? 11   DC  T N1    1 
ATOM   753  C  C2    . DC  D 2 8   ? 63.307  -63.736 -26.509 1.00 51.75  ? 11   DC  T C2    1 
ATOM   754  O  O2    . DC  D 2 8   ? 62.720  -64.769 -26.161 1.00 51.11  ? 11   DC  T O2    1 
ATOM   755  N  N3    . DC  D 2 8   ? 64.492  -63.773 -27.162 1.00 50.30  ? 11   DC  T N3    1 
ATOM   756  C  C4    . DC  D 2 8   ? 65.092  -62.636 -27.514 1.00 50.71  ? 11   DC  T C4    1 
ATOM   757  N  N4    . DC  D 2 8   ? 66.249  -62.720 -28.169 1.00 49.96  ? 11   DC  T N4    1 
ATOM   758  C  C5    . DC  D 2 8   ? 64.528  -61.360 -27.214 1.00 52.48  ? 11   DC  T C5    1 
ATOM   759  C  C6    . DC  D 2 8   ? 63.352  -61.339 -26.570 1.00 53.13  ? 11   DC  T C6    1 
ATOM   760  P  P     . DC  D 2 9   ? 58.142  -61.814 -22.508 1.00 61.29  ? 12   DC  T P     1 
ATOM   761  O  OP1   . DC  D 2 9   ? 56.794  -61.781 -23.137 1.00 59.70  ? 12   DC  T OP1   1 
ATOM   762  O  OP2   . DC  D 2 9   ? 58.658  -60.608 -21.806 1.00 59.82  ? 12   DC  T OP2   1 
ATOM   763  O  "O5'" . DC  D 2 9   ? 58.187  -63.049 -21.508 1.00 59.92  ? 12   DC  T "O5'" 1 
ATOM   764  C  "C5'" . DC  D 2 9   ? 57.816  -64.348 -21.953 1.00 59.01  ? 12   DC  T "C5'" 1 
ATOM   765  C  "C4'" . DC  D 2 9   ? 58.788  -65.377 -21.429 1.00 58.69  ? 12   DC  T "C4'" 1 
ATOM   766  O  "O4'" . DC  D 2 9   ? 60.048  -65.303 -22.140 1.00 58.21  ? 12   DC  T "O4'" 1 
ATOM   767  C  "C3'" . DC  D 2 9   ? 59.126  -65.235 -19.944 1.00 57.87  ? 12   DC  T "C3'" 1 
ATOM   768  O  "O3'" . DC  D 2 9   ? 59.215  -66.534 -19.362 1.00 58.64  ? 12   DC  T "O3'" 1 
ATOM   769  C  "C2'" . DC  D 2 9   ? 60.502  -64.595 -19.965 1.00 57.43  ? 12   DC  T "C2'" 1 
ATOM   770  C  "C1'" . DC  D 2 9   ? 61.108  -65.235 -21.200 1.00 56.74  ? 12   DC  T "C1'" 1 
ATOM   771  N  N1    . DC  D 2 9   ? 62.227  -64.504 -21.821 1.00 55.37  ? 12   DC  T N1    1 
ATOM   772  C  C2    . DC  D 2 9   ? 63.207  -65.233 -22.502 1.00 54.01  ? 12   DC  T C2    1 
ATOM   773  O  O2    . DC  D 2 9   ? 63.110  -66.466 -22.551 1.00 53.29  ? 12   DC  T O2    1 
ATOM   774  N  N3    . DC  D 2 9   ? 64.234  -64.578 -23.088 1.00 53.53  ? 12   DC  T N3    1 
ATOM   775  C  C4    . DC  D 2 9   ? 64.306  -63.248 -23.011 1.00 53.82  ? 12   DC  T C4    1 
ATOM   776  N  N4    . DC  D 2 9   ? 65.334  -62.641 -23.611 1.00 53.30  ? 12   DC  T N4    1 
ATOM   777  C  C5    . DC  D 2 9   ? 63.328  -62.480 -22.316 1.00 54.47  ? 12   DC  T C5    1 
ATOM   778  C  C6    . DC  D 2 9   ? 62.313  -63.142 -21.742 1.00 55.26  ? 12   DC  T C6    1 
ATOM   779  P  P     . DA  D 2 10  ? 57.988  -67.106 -18.503 1.00 58.99  ? 13   DA  T P     1 
ATOM   780  O  OP1   . DA  D 2 10  ? 56.775  -67.017 -19.357 1.00 59.12  ? 13   DA  T OP1   1 
ATOM   781  O  OP2   . DA  D 2 10  ? 58.005  -66.427 -17.182 1.00 59.44  ? 13   DA  T OP2   1 
ATOM   782  O  "O5'" . DA  D 2 10  ? 58.347  -68.649 -18.310 1.00 56.51  ? 13   DA  T "O5'" 1 
ATOM   783  C  "C5'" . DA  D 2 10  ? 58.170  -69.580 -19.381 1.00 52.94  ? 13   DA  T "C5'" 1 
ATOM   784  C  "C4'" . DA  D 2 10  ? 59.374  -70.487 -19.503 1.00 50.93  ? 13   DA  T "C4'" 1 
ATOM   785  O  "O4'" . DA  D 2 10  ? 60.547  -69.684 -19.769 1.00 50.83  ? 13   DA  T "O4'" 1 
ATOM   786  C  "C3'" . DA  D 2 10  ? 59.710  -71.314 -18.264 1.00 50.79  ? 13   DA  T "C3'" 1 
ATOM   787  O  "O3'" . DA  D 2 10  ? 60.251  -72.580 -18.671 1.00 51.09  ? 13   DA  T "O3'" 1 
ATOM   788  C  "C2'" . DA  D 2 10  ? 60.755  -70.470 -17.555 1.00 49.60  ? 13   DA  T "C2'" 1 
ATOM   789  C  "C1'" . DA  D 2 10  ? 61.488  -69.790 -18.704 1.00 48.51  ? 13   DA  T "C1'" 1 
ATOM   790  N  N9    . DA  D 2 10  ? 61.954  -68.434 -18.401 1.00 45.96  ? 13   DA  T N9    1 
ATOM   791  C  C8    . DA  D 2 10  ? 61.364  -67.518 -17.562 1.00 44.28  ? 13   DA  T C8    1 
ATOM   792  N  N7    . DA  D 2 10  ? 61.980  -66.361 -17.524 1.00 42.29  ? 13   DA  T N7    1 
ATOM   793  C  C5    . DA  D 2 10  ? 63.053  -66.526 -18.387 1.00 42.25  ? 13   DA  T C5    1 
ATOM   794  C  C6    . DA  D 2 10  ? 64.081  -65.656 -18.793 1.00 41.39  ? 13   DA  T C6    1 
ATOM   795  N  N6    . DA  D 2 10  ? 64.189  -64.393 -18.374 1.00 40.09  ? 13   DA  T N6    1 
ATOM   796  N  N1    . DA  D 2 10  ? 65.001  -66.131 -19.661 1.00 41.07  ? 13   DA  T N1    1 
ATOM   797  C  C2    . DA  D 2 10  ? 64.885  -67.395 -20.088 1.00 41.78  ? 13   DA  T C2    1 
ATOM   798  N  N3    . DA  D 2 10  ? 63.962  -68.308 -19.785 1.00 43.15  ? 13   DA  T N3    1 
ATOM   799  C  C4    . DA  D 2 10  ? 63.062  -67.804 -18.922 1.00 43.81  ? 13   DA  T C4    1 
ATOM   800  P  P     . DC  D 2 11  ? 60.366  -73.787 -17.611 1.00 50.60  ? 14   DC  T P     1 
ATOM   801  O  OP1   . DC  D 2 11  ? 59.693  -74.981 -18.183 1.00 50.53  ? 14   DC  T OP1   1 
ATOM   802  O  OP2   . DC  D 2 11  ? 59.946  -73.271 -16.280 1.00 49.80  ? 14   DC  T OP2   1 
ATOM   803  O  "O5'" . DC  D 2 11  ? 61.927  -74.091 -17.565 1.00 49.58  ? 14   DC  T "O5'" 1 
ATOM   804  C  "C5'" . DC  D 2 11  ? 62.866  -73.045 -17.790 1.00 47.85  ? 14   DC  T "C5'" 1 
ATOM   805  C  "C4'" . DC  D 2 11  ? 64.261  -73.602 -17.948 1.00 45.87  ? 14   DC  T "C4'" 1 
ATOM   806  O  "O4'" . DC  D 2 11  ? 65.124  -72.484 -18.242 1.00 45.14  ? 14   DC  T "O4'" 1 
ATOM   807  C  "C3'" . DC  D 2 11  ? 64.842  -74.232 -16.686 1.00 44.92  ? 14   DC  T "C3'" 1 
ATOM   808  O  "O3'" . DC  D 2 11  ? 65.978  -75.040 -17.006 1.00 44.29  ? 14   DC  T "O3'" 1 
ATOM   809  C  "C2'" . DC  D 2 11  ? 65.385  -73.024 -15.948 1.00 43.64  ? 14   DC  T "C2'" 1 
ATOM   810  C  "C1'" . DC  D 2 11  ? 65.845  -72.105 -17.080 1.00 41.68  ? 14   DC  T "C1'" 1 
ATOM   811  N  N1    . DC  D 2 11  ? 65.560  -70.685 -16.828 1.00 39.04  ? 14   DC  T N1    1 
ATOM   812  C  C2    . DC  D 2 11  ? 66.424  -69.719 -17.344 1.00 38.71  ? 14   DC  T C2    1 
ATOM   813  O  O2    . DC  D 2 11  ? 67.370  -70.082 -18.063 1.00 38.98  ? 14   DC  T O2    1 
ATOM   814  N  N3    . DC  D 2 11  ? 66.203  -68.413 -17.055 1.00 36.75  ? 14   DC  T N3    1 
ATOM   815  C  C4    . DC  D 2 11  ? 65.158  -68.065 -16.299 1.00 35.03  ? 14   DC  T C4    1 
ATOM   816  N  N4    . DC  D 2 11  ? 64.992  -66.774 -16.012 1.00 33.04  ? 14   DC  T N4    1 
ATOM   817  C  C5    . DC  D 2 11  ? 64.239  -69.028 -15.797 1.00 35.76  ? 14   DC  T C5    1 
ATOM   818  C  C6    . DC  D 2 11  ? 64.475  -70.314 -16.082 1.00 36.96  ? 14   DC  T C6    1 
ATOM   819  N  N     . GLY E 3 22  ? 58.346  -17.491 -39.204 1.00 42.64  ? -1   GLY A N     1 
ATOM   820  C  CA    . GLY E 3 22  ? 57.574  -17.564 -40.477 1.00 45.19  ? -1   GLY A CA    1 
ATOM   821  C  C     . GLY E 3 22  ? 58.021  -18.698 -41.380 1.00 46.74  ? -1   GLY A C     1 
ATOM   822  O  O     . GLY E 3 22  ? 58.809  -19.553 -40.968 1.00 46.91  ? -1   GLY A O     1 
ATOM   823  N  N     . ARG E 3 23  ? 57.515  -18.720 -42.606 1.00 20.00  ? 0    ARG A N     1 
ATOM   824  C  CA    . ARG E 3 23  ? 57.853  -19.734 -43.598 1.00 20.00  ? 0    ARG A CA    1 
ATOM   825  C  C     . ARG E 3 23  ? 57.653  -21.139 -43.040 1.00 20.00  ? 0    ARG A C     1 
ATOM   826  O  O     . ARG E 3 23  ? 58.275  -22.096 -43.547 1.00 51.92  ? 0    ARG A O     1 
ATOM   827  C  CB    . ARG E 3 23  ? 59.297  -19.558 -44.074 0.00 20.00  ? 0    ARG A CB    1 
ATOM   828  C  CG    . ARG E 3 23  ? 59.534  -18.292 -44.881 0.00 20.00  ? 0    ARG A CG    1 
ATOM   829  C  CD    . ARG E 3 23  ? 60.972  -18.105 -45.335 0.00 20.00  ? 0    ARG A CD    1 
ATOM   830  N  NE    . ARG E 3 23  ? 61.153  -16.866 -46.086 0.00 20.00  ? 0    ARG A NE    1 
ATOM   831  C  CZ    . ARG E 3 23  ? 62.322  -16.430 -46.534 0.00 20.00  ? 0    ARG A CZ    1 
ATOM   832  N  NH1   . ARG E 3 23  ? 63.424  -17.134 -46.311 0.00 20.00  ? 0    ARG A NH1   1 
ATOM   833  N  NH2   . ARG E 3 23  ? 62.393  -15.290 -47.208 0.00 20.00  ? 0    ARG A NH2   1 
ATOM   834  N  N     . MET E 3 24  ? 56.795  -21.285 -42.047 1.00 52.97  ? 1    MET A N     1 
ATOM   835  C  CA    . MET E 3 24  ? 56.511  -22.575 -41.414 1.00 52.30  ? 1    MET A CA    1 
ATOM   836  C  C     . MET E 3 24  ? 55.479  -22.358 -40.301 1.00 50.87  ? 1    MET A C     1 
ATOM   837  O  O     . MET E 3 24  ? 55.560  -21.371 -39.571 1.00 51.90  ? 1    MET A O     1 
ATOM   838  C  CB    . MET E 3 24  ? 57.794  -23.145 -40.805 1.00 54.83  ? 1    MET A CB    1 
ATOM   839  C  CG    . MET E 3 24  ? 57.767  -24.640 -40.552 1.00 58.23  ? 1    MET A CG    1 
ATOM   840  S  SD    . MET E 3 24  ? 58.056  -25.583 -42.059 1.00 62.89  ? 1    MET A SD    1 
ATOM   841  C  CE    . MET E 3 24  ? 56.385  -25.708 -42.722 1.00 62.05  ? 1    MET A CE    1 
ATOM   842  N  N     . SER E 3 25  ? 54.517  -23.269 -40.166 1.00 47.52  ? 2    SER A N     1 
ATOM   843  C  CA    . SER E 3 25  ? 53.494  -23.137 -39.127 1.00 44.56  ? 2    SER A CA    1 
ATOM   844  C  C     . SER E 3 25  ? 54.069  -23.335 -37.728 1.00 43.12  ? 2    SER A C     1 
ATOM   845  O  O     . SER E 3 25  ? 54.938  -24.178 -37.521 1.00 43.38  ? 2    SER A O     1 
ATOM   846  C  CB    . SER E 3 25  ? 52.368  -24.147 -39.348 1.00 44.46  ? 2    SER A CB    1 
ATOM   847  O  OG    . SER E 3 25  ? 51.448  -24.119 -38.267 1.00 43.33  ? 2    SER A OG    1 
ATOM   848  N  N     . LYS E 3 26  ? 53.574  -22.562 -36.767 1.00 41.89  ? 3    LYS A N     1 
ATOM   849  C  CA    . LYS E 3 26  ? 54.046  -22.662 -35.392 1.00 41.14  ? 3    LYS A CA    1 
ATOM   850  C  C     . LYS E 3 26  ? 53.834  -24.048 -34.791 1.00 40.14  ? 3    LYS A C     1 
ATOM   851  O  O     . LYS E 3 26  ? 54.676  -24.537 -34.036 1.00 39.46  ? 3    LYS A O     1 
ATOM   852  C  CB    . LYS E 3 26  ? 53.353  -21.617 -34.508 1.00 42.20  ? 3    LYS A CB    1 
ATOM   853  C  CG    . LYS E 3 26  ? 53.501  -21.889 -33.007 1.00 44.63  ? 3    LYS A CG    1 
ATOM   854  C  CD    . LYS E 3 26  ? 53.130  -20.692 -32.126 1.00 46.59  ? 3    LYS A CD    1 
ATOM   855  C  CE    . LYS E 3 26  ? 51.698  -20.196 -32.340 1.00 48.61  ? 3    LYS A CE    1 
ATOM   856  N  NZ    . LYS E 3 26  ? 51.512  -19.434 -33.614 1.00 48.26  ? 3    LYS A NZ    1 
ATOM   857  N  N     . PHE E 3 27  ? 52.712  -24.679 -35.129 1.00 38.65  ? 4    PHE A N     1 
ATOM   858  C  CA    . PHE E 3 27  ? 52.393  -25.999 -34.597 1.00 37.56  ? 4    PHE A CA    1 
ATOM   859  C  C     . PHE E 3 27  ? 53.048  -27.165 -35.324 1.00 36.73  ? 4    PHE A C     1 
ATOM   860  O  O     . PHE E 3 27  ? 53.537  -27.025 -36.445 1.00 36.92  ? 4    PHE A O     1 
ATOM   861  C  CB    . PHE E 3 27  ? 50.884  -26.212 -34.590 1.00 37.46  ? 4    PHE A CB    1 
ATOM   862  C  CG    . PHE E 3 27  ? 50.134  -25.164 -33.836 1.00 38.17  ? 4    PHE A CG    1 
ATOM   863  C  CD1   . PHE E 3 27  ? 49.717  -24.000 -34.469 1.00 38.40  ? 4    PHE A CD1   1 
ATOM   864  C  CD2   . PHE E 3 27  ? 49.849  -25.334 -32.486 1.00 38.91  ? 4    PHE A CD2   1 
ATOM   865  C  CE1   . PHE E 3 27  ? 49.023  -23.019 -33.769 1.00 38.27  ? 4    PHE A CE1   1 
ATOM   866  C  CE2   . PHE E 3 27  ? 49.156  -24.359 -31.777 1.00 38.05  ? 4    PHE A CE2   1 
ATOM   867  C  CZ    . PHE E 3 27  ? 48.741  -23.199 -32.421 1.00 37.95  ? 4    PHE A CZ    1 
ATOM   868  N  N     . THR E 3 28  ? 53.029  -28.324 -34.670 1.00 35.18  ? 5    THR A N     1 
ATOM   869  C  CA    . THR E 3 28  ? 53.613  -29.545 -35.213 1.00 34.83  ? 5    THR A CA    1 
ATOM   870  C  C     . THR E 3 28  ? 52.567  -30.629 -35.457 1.00 34.11  ? 5    THR A C     1 
ATOM   871  O  O     . THR E 3 28  ? 51.430  -30.518 -35.005 1.00 33.60  ? 5    THR A O     1 
ATOM   872  C  CB    . THR E 3 28  ? 54.659  -30.122 -34.258 1.00 35.41  ? 5    THR A CB    1 
ATOM   873  O  OG1   . THR E 3 28  ? 54.050  -30.361 -32.983 1.00 35.43  ? 5    THR A OG1   1 
ATOM   874  C  CG2   . THR E 3 28  ? 55.826  -29.162 -34.102 1.00 35.16  ? 5    THR A CG2   1 
ATOM   875  N  N     . TRP E 3 29  ? 52.967  -31.682 -36.167 1.00 34.13  ? 6    TRP A N     1 
ATOM   876  C  CA    . TRP E 3 29  ? 52.070  -32.793 -36.460 1.00 33.48  ? 6    TRP A CA    1 
ATOM   877  C  C     . TRP E 3 29  ? 51.662  -33.509 -35.184 1.00 34.01  ? 6    TRP A C     1 
ATOM   878  O  O     . TRP E 3 29  ? 50.508  -33.899 -35.025 1.00 34.57  ? 6    TRP A O     1 
ATOM   879  C  CB    . TRP E 3 29  ? 52.732  -33.804 -37.398 1.00 31.87  ? 6    TRP A CB    1 
ATOM   880  C  CG    . TRP E 3 29  ? 52.885  -33.323 -38.792 1.00 28.96  ? 6    TRP A CG    1 
ATOM   881  C  CD1   . TRP E 3 29  ? 53.946  -32.650 -39.315 1.00 28.94  ? 6    TRP A CD1   1 
ATOM   882  C  CD2   . TRP E 3 29  ? 51.929  -33.452 -39.847 1.00 27.56  ? 6    TRP A CD2   1 
ATOM   883  N  NE1   . TRP E 3 29  ? 53.712  -32.349 -40.635 1.00 28.25  ? 6    TRP A NE1   1 
ATOM   884  C  CE2   . TRP E 3 29  ? 52.480  -32.830 -40.987 1.00 26.44  ? 6    TRP A CE2   1 
ATOM   885  C  CE3   . TRP E 3 29  ? 50.659  -34.031 -39.940 1.00 26.37  ? 6    TRP A CE3   1 
ATOM   886  C  CZ2   . TRP E 3 29  ? 51.805  -32.769 -42.206 1.00 24.80  ? 6    TRP A CZ2   1 
ATOM   887  C  CZ3   . TRP E 3 29  ? 49.987  -33.970 -41.153 1.00 25.32  ? 6    TRP A CZ3   1 
ATOM   888  C  CH2   . TRP E 3 29  ? 50.564  -33.343 -42.270 1.00 25.04  ? 6    TRP A CH2   1 
ATOM   889  N  N     . LYS E 3 30  ? 52.616  -33.691 -34.280 1.00 33.76  ? 7    LYS A N     1 
ATOM   890  C  CA    . LYS E 3 30  ? 52.327  -34.364 -33.027 1.00 34.32  ? 7    LYS A CA    1 
ATOM   891  C  C     . LYS E 3 30  ? 51.109  -33.731 -32.369 1.00 34.51  ? 7    LYS A C     1 
ATOM   892  O  O     . LYS E 3 30  ? 50.215  -34.432 -31.897 1.00 34.56  ? 7    LYS A O     1 
ATOM   893  C  CB    . LYS E 3 30  ? 53.519  -34.270 -32.077 1.00 35.25  ? 7    LYS A CB    1 
ATOM   894  C  CG    . LYS E 3 30  ? 53.289  -34.999 -30.766 1.00 38.38  ? 7    LYS A CG    1 
ATOM   895  C  CD    . LYS E 3 30  ? 54.432  -34.800 -29.785 1.00 41.63  ? 7    LYS A CD    1 
ATOM   896  C  CE    . LYS E 3 30  ? 54.223  -35.643 -28.530 1.00 43.82  ? 7    LYS A CE    1 
ATOM   897  N  NZ    . LYS E 3 30  ? 52.919  -35.356 -27.862 1.00 44.21  ? 7    LYS A NZ    1 
ATOM   898  N  N     . GLU E 3 31  ? 51.076  -32.402 -32.356 1.00 35.02  ? 8    GLU A N     1 
ATOM   899  C  CA    . GLU E 3 31  ? 49.977  -31.662 -31.740 1.00 35.52  ? 8    GLU A CA    1 
ATOM   900  C  C     . GLU E 3 31  ? 48.658  -31.781 -32.483 1.00 34.01  ? 8    GLU A C     1 
ATOM   901  O  O     . GLU E 3 31  ? 47.597  -31.821 -31.863 1.00 34.11  ? 8    GLU A O     1 
ATOM   902  C  CB    . GLU E 3 31  ? 50.351  -30.187 -31.594 1.00 37.72  ? 8    GLU A CB    1 
ATOM   903  C  CG    . GLU E 3 31  ? 51.499  -29.957 -30.635 1.00 41.81  ? 8    GLU A CG    1 
ATOM   904  C  CD    . GLU E 3 31  ? 51.754  -28.492 -30.380 1.00 45.19  ? 8    GLU A CD    1 
ATOM   905  O  OE1   . GLU E 3 31  ? 52.126  -27.776 -31.337 1.00 46.42  ? 8    GLU A OE1   1 
ATOM   906  O  OE2   . GLU E 3 31  ? 51.577  -28.060 -29.221 1.00 46.99  ? 8    GLU A OE2   1 
ATOM   907  N  N     . LEU E 3 32  ? 48.724  -31.833 -33.808 1.00 32.94  ? 9    LEU A N     1 
ATOM   908  C  CA    . LEU E 3 32  ? 47.521  -31.959 -34.622 1.00 31.70  ? 9    LEU A CA    1 
ATOM   909  C  C     . LEU E 3 32  ? 46.952  -33.378 -34.526 1.00 31.51  ? 9    LEU A C     1 
ATOM   910  O  O     . LEU E 3 32  ? 45.741  -33.561 -34.413 1.00 32.24  ? 9    LEU A O     1 
ATOM   911  C  CB    . LEU E 3 32  ? 47.834  -31.616 -36.080 1.00 29.43  ? 9    LEU A CB    1 
ATOM   912  C  CG    . LEU E 3 32  ? 46.682  -31.758 -37.074 1.00 28.46  ? 9    LEU A CG    1 
ATOM   913  C  CD1   . LEU E 3 32  ? 45.523  -30.875 -36.650 1.00 26.85  ? 9    LEU A CD1   1 
ATOM   914  C  CD2   . LEU E 3 32  ? 47.167  -31.383 -38.463 1.00 27.90  ? 9    LEU A CD2   1 
ATOM   915  N  N     . ILE E 3 33  ? 47.830  -34.377 -34.561 1.00 29.63  ? 10   ILE A N     1 
ATOM   916  C  CA    . ILE E 3 33  ? 47.404  -35.768 -34.477 1.00 27.89  ? 10   ILE A CA    1 
ATOM   917  C  C     . ILE E 3 33  ? 46.735  -36.063 -33.139 1.00 27.84  ? 10   ILE A C     1 
ATOM   918  O  O     . ILE E 3 33  ? 45.803  -36.860 -33.080 1.00 29.10  ? 10   ILE A O     1 
ATOM   919  C  CB    . ILE E 3 33  ? 48.591  -36.753 -34.623 1.00 27.61  ? 10   ILE A CB    1 
ATOM   920  C  CG1   . ILE E 3 33  ? 49.342  -36.517 -35.940 1.00 26.25  ? 10   ILE A CG1   1 
ATOM   921  C  CG2   . ILE E 3 33  ? 48.074  -38.185 -34.564 1.00 26.56  ? 10   ILE A CG2   1 
ATOM   922  C  CD1   . ILE E 3 33  ? 48.665  -37.072 -37.167 1.00 22.67  ? 10   ILE A CD1   1 
ATOM   923  N  N     . GLN E 3 34  ? 47.209  -35.432 -32.068 1.00 27.99  ? 11   GLN A N     1 
ATOM   924  C  CA    . GLN E 3 34  ? 46.640  -35.665 -30.740 1.00 29.86  ? 11   GLN A CA    1 
ATOM   925  C  C     . GLN E 3 34  ? 45.129  -35.481 -30.683 1.00 30.71  ? 11   GLN A C     1 
ATOM   926  O  O     . GLN E 3 34  ? 44.462  -36.053 -29.819 1.00 30.69  ? 11   GLN A O     1 
ATOM   927  C  CB    . GLN E 3 34  ? 47.284  -34.751 -29.695 1.00 30.62  ? 11   GLN A CB    1 
ATOM   928  C  CG    . GLN E 3 34  ? 48.677  -35.161 -29.264 1.00 36.42  ? 11   GLN A CG    1 
ATOM   929  C  CD    . GLN E 3 34  ? 49.183  -34.350 -28.078 1.00 40.74  ? 11   GLN A CD    1 
ATOM   930  O  OE1   . GLN E 3 34  ? 48.576  -34.352 -27.006 1.00 41.59  ? 11   GLN A OE1   1 
ATOM   931  N  NE2   . GLN E 3 34  ? 50.302  -33.654 -28.266 1.00 43.23  ? 11   GLN A NE2   1 
ATOM   932  N  N     . LEU E 3 35  ? 44.587  -34.683 -31.595 1.00 31.49  ? 12   LEU A N     1 
ATOM   933  C  CA    . LEU E 3 35  ? 43.150  -34.443 -31.615 1.00 33.00  ? 12   LEU A CA    1 
ATOM   934  C  C     . LEU E 3 35  ? 42.395  -35.750 -31.830 1.00 34.46  ? 12   LEU A C     1 
ATOM   935  O  O     . LEU E 3 35  ? 41.211  -35.853 -31.510 1.00 34.09  ? 12   LEU A O     1 
ATOM   936  C  CB    . LEU E 3 35  ? 42.795  -33.439 -32.717 1.00 32.45  ? 12   LEU A CB    1 
ATOM   937  C  CG    . LEU E 3 35  ? 43.471  -32.069 -32.611 1.00 31.45  ? 12   LEU A CG    1 
ATOM   938  C  CD1   . LEU E 3 35  ? 42.933  -31.148 -33.688 1.00 29.98  ? 12   LEU A CD1   1 
ATOM   939  C  CD2   . LEU E 3 35  ? 43.218  -31.475 -31.236 1.00 31.61  ? 12   LEU A CD2   1 
ATOM   940  N  N     . GLY E 3 36  ? 43.092  -36.747 -32.366 1.00 36.19  ? 13   GLY A N     1 
ATOM   941  C  CA    . GLY E 3 36  ? 42.482  -38.042 -32.610 1.00 40.00  ? 13   GLY A CA    1 
ATOM   942  C  C     . GLY E 3 36  ? 42.453  -38.933 -31.379 1.00 42.71  ? 13   GLY A C     1 
ATOM   943  O  O     . GLY E 3 36  ? 41.638  -39.852 -31.291 1.00 42.83  ? 13   GLY A O     1 
ATOM   944  N  N     . SER E 3 37  ? 43.347  -38.668 -30.432 1.00 45.06  ? 14   SER A N     1 
ATOM   945  C  CA    . SER E 3 37  ? 43.416  -39.445 -29.199 1.00 48.36  ? 14   SER A CA    1 
ATOM   946  C  C     . SER E 3 37  ? 42.454  -38.868 -28.179 1.00 50.24  ? 14   SER A C     1 
ATOM   947  O  O     . SER E 3 37  ? 42.558  -37.700 -27.813 1.00 51.85  ? 14   SER A O     1 
ATOM   948  C  CB    . SER E 3 37  ? 44.830  -39.419 -28.620 1.00 50.17  ? 14   SER A CB    1 
ATOM   949  O  OG    . SER E 3 37  ? 44.847  -39.976 -27.314 1.00 52.65  ? 14   SER A OG    1 
ATOM   950  N  N     . PRO E 3 38  ? 41.510  -39.686 -27.698 1.00 51.63  ? 15   PRO A N     1 
ATOM   951  C  CA    . PRO E 3 38  ? 40.507  -39.272 -26.710 1.00 52.96  ? 15   PRO A CA    1 
ATOM   952  C  C     . PRO E 3 38  ? 41.058  -38.931 -25.330 1.00 53.63  ? 15   PRO A C     1 
ATOM   953  O  O     . PRO E 3 38  ? 40.429  -38.194 -24.576 1.00 53.75  ? 15   PRO A O     1 
ATOM   954  C  CB    . PRO E 3 38  ? 39.562  -40.472 -26.653 1.00 53.48  ? 15   PRO A CB    1 
ATOM   955  C  CG    . PRO E 3 38  ? 39.726  -41.109 -28.005 1.00 53.79  ? 15   PRO A CG    1 
ATOM   956  C  CD    . PRO E 3 38  ? 41.210  -41.034 -28.205 1.00 51.79  ? 15   PRO A CD    1 
ATOM   957  N  N     . SER E 3 39  ? 42.233  -39.457 -25.005 1.00 55.31  ? 16   SER A N     1 
ATOM   958  C  CA    . SER E 3 39  ? 42.831  -39.231 -23.691 1.00 56.98  ? 16   SER A CA    1 
ATOM   959  C  C     . SER E 3 39  ? 43.948  -38.194 -23.628 1.00 57.58  ? 16   SER A C     1 
ATOM   960  O  O     . SER E 3 39  ? 44.393  -37.828 -22.540 1.00 57.05  ? 16   SER A O     1 
ATOM   961  C  CB    . SER E 3 39  ? 43.359  -40.557 -23.144 1.00 57.05  ? 16   SER A CB    1 
ATOM   962  O  OG    . SER E 3 39  ? 44.294  -41.128 -24.046 1.00 57.83  ? 16   SER A OG    1 
ATOM   963  N  N     . LYS E 3 40  ? 44.402  -37.717 -24.782 1.00 58.40  ? 17   LYS A N     1 
ATOM   964  C  CA    . LYS E 3 40  ? 45.488  -36.745 -24.803 1.00 58.41  ? 17   LYS A CA    1 
ATOM   965  C  C     . LYS E 3 40  ? 45.205  -35.603 -25.780 1.00 57.64  ? 17   LYS A C     1 
ATOM   966  O  O     . LYS E 3 40  ? 46.129  -34.975 -26.298 1.00 58.82  ? 17   LYS A O     1 
ATOM   967  C  CB    . LYS E 3 40  ? 46.794  -37.456 -25.184 1.00 58.62  ? 17   LYS A CB    1 
ATOM   968  C  CG    . LYS E 3 40  ? 48.057  -36.846 -24.593 1.00 60.67  ? 17   LYS A CG    1 
ATOM   969  C  CD    . LYS E 3 40  ? 48.073  -36.964 -23.072 1.00 61.77  ? 17   LYS A CD    1 
ATOM   970  C  CE    . LYS E 3 40  ? 49.377  -36.440 -22.484 1.00 62.08  ? 17   LYS A CE    1 
ATOM   971  N  NZ    . LYS E 3 40  ? 49.397  -36.505 -20.995 1.00 61.97  ? 17   LYS A NZ    1 
ATOM   972  N  N     . ALA E 3 41  ? 43.926  -35.329 -26.019 1.00 55.38  ? 18   ALA A N     1 
ATOM   973  C  CA    . ALA E 3 41  ? 43.532  -34.275 -26.944 1.00 53.02  ? 18   ALA A CA    1 
ATOM   974  C  C     . ALA E 3 41  ? 43.374  -32.913 -26.280 1.00 52.47  ? 18   ALA A C     1 
ATOM   975  O  O     . ALA E 3 41  ? 43.451  -31.884 -26.947 1.00 52.09  ? 18   ALA A O     1 
ATOM   976  C  CB    . ALA E 3 41  ? 42.237  -34.660 -27.639 1.00 53.20  ? 18   ALA A CB    1 
ATOM   977  N  N     . TYR E 3 42  ? 43.154  -32.903 -24.969 1.00 52.15  ? 19   TYR A N     1 
ATOM   978  C  CA    . TYR E 3 42  ? 42.973  -31.650 -24.244 1.00 51.73  ? 19   TYR A CA    1 
ATOM   979  C  C     . TYR E 3 42  ? 44.293  -30.926 -23.966 1.00 51.75  ? 19   TYR A C     1 
ATOM   980  O  O     . TYR E 3 42  ? 44.305  -29.714 -23.758 1.00 52.01  ? 19   TYR A O     1 
ATOM   981  C  CB    . TYR E 3 42  ? 42.243  -31.899 -22.918 1.00 52.06  ? 19   TYR A CB    1 
ATOM   982  C  CG    . TYR E 3 42  ? 43.114  -32.536 -21.864 1.00 54.30  ? 19   TYR A CG    1 
ATOM   983  C  CD1   . TYR E 3 42  ? 43.462  -33.883 -21.938 1.00 55.92  ? 19   TYR A CD1   1 
ATOM   984  C  CD2   . TYR E 3 42  ? 43.653  -31.774 -20.830 1.00 55.73  ? 19   TYR A CD2   1 
ATOM   985  C  CE1   . TYR E 3 42  ? 44.336  -34.454 -21.010 1.00 57.65  ? 19   TYR A CE1   1 
ATOM   986  C  CE2   . TYR E 3 42  ? 44.528  -32.333 -19.899 1.00 57.35  ? 19   TYR A CE2   1 
ATOM   987  C  CZ    . TYR E 3 42  ? 44.868  -33.672 -19.996 1.00 57.82  ? 19   TYR A CZ    1 
ATOM   988  O  OH    . TYR E 3 42  ? 45.757  -34.217 -19.094 1.00 58.67  ? 19   TYR A OH    1 
ATOM   989  N  N     . GLU E 3 43  ? 45.401  -31.665 -23.957 1.00 51.60  ? 20   GLU A N     1 
ATOM   990  C  CA    . GLU E 3 43  ? 46.707  -31.064 -23.692 1.00 51.07  ? 20   GLU A CA    1 
ATOM   991  C  C     . GLU E 3 43  ? 47.249  -30.383 -24.938 1.00 50.72  ? 20   GLU A C     1 
ATOM   992  O  O     . GLU E 3 43  ? 48.048  -29.451 -24.853 1.00 52.58  ? 20   GLU A O     1 
ATOM   993  C  CB    . GLU E 3 43  ? 47.714  -32.119 -23.225 1.00 52.14  ? 20   GLU A CB    1 
ATOM   994  C  CG    . GLU E 3 43  ? 48.189  -33.055 -24.323 0.00 52.45  ? 20   GLU A CG    1 
ATOM   995  C  CD    . GLU E 3 43  ? 49.503  -33.731 -23.986 0.00 52.73  ? 20   GLU A CD    1 
ATOM   996  O  OE1   . GLU E 3 43  ? 49.997  -34.522 -24.817 0.00 52.84  ? 20   GLU A OE1   1 
ATOM   997  O  OE2   . GLU E 3 43  ? 50.047  -33.471 -22.891 0.00 52.84  ? 20   GLU A OE2   1 
ATOM   998  N  N     . SER E 3 44  ? 46.821  -30.866 -26.098 1.00 49.35  ? 21   SER A N     1 
ATOM   999  C  CA    . SER E 3 44  ? 47.258  -30.303 -27.367 1.00 47.86  ? 21   SER A CA    1 
ATOM   1000 C  C     . SER E 3 44  ? 47.013  -28.799 -27.399 1.00 47.13  ? 21   SER A C     1 
ATOM   1001 O  O     . SER E 3 44  ? 46.143  -28.289 -26.697 1.00 48.10  ? 21   SER A O     1 
ATOM   1002 C  CB    . SER E 3 44  ? 46.499  -30.972 -28.517 1.00 47.04  ? 21   SER A CB    1 
ATOM   1003 O  OG    . SER E 3 44  ? 46.788  -30.351 -29.757 1.00 46.14  ? 21   SER A OG    1 
ATOM   1004 N  N     . SER E 3 45  ? 47.790  -28.087 -28.206 1.00 45.94  ? 22   SER A N     1 
ATOM   1005 C  CA    . SER E 3 45  ? 47.615  -26.646 -28.329 1.00 44.93  ? 22   SER A CA    1 
ATOM   1006 C  C     . SER E 3 45  ? 46.460  -26.404 -29.305 1.00 43.15  ? 22   SER A C     1 
ATOM   1007 O  O     . SER E 3 45  ? 45.773  -25.380 -29.242 1.00 42.86  ? 22   SER A O     1 
ATOM   1008 C  CB    . SER E 3 45  ? 48.890  -26.002 -28.876 1.00 46.53  ? 22   SER A CB    1 
ATOM   1009 O  OG    . SER E 3 45  ? 50.020  -26.375 -28.111 1.00 49.74  ? 22   SER A OG    1 
ATOM   1010 N  N     . LEU E 3 46  ? 46.254  -27.364 -30.203 1.00 39.00  ? 23   LEU A N     1 
ATOM   1011 C  CA    . LEU E 3 46  ? 45.202  -27.278 -31.205 1.00 35.42  ? 23   LEU A CA    1 
ATOM   1012 C  C     . LEU E 3 46  ? 43.877  -27.816 -30.682 1.00 33.95  ? 23   LEU A C     1 
ATOM   1013 O  O     . LEU E 3 46  ? 42.943  -28.036 -31.453 1.00 34.75  ? 23   LEU A O     1 
ATOM   1014 C  CB    . LEU E 3 46  ? 45.607  -28.062 -32.456 1.00 34.37  ? 23   LEU A CB    1 
ATOM   1015 C  CG    . LEU E 3 46  ? 46.850  -27.594 -33.215 1.00 32.56  ? 23   LEU A CG    1 
ATOM   1016 C  CD1   . LEU E 3 46  ? 47.180  -28.581 -34.319 1.00 33.60  ? 23   LEU A CD1   1 
ATOM   1017 C  CD2   . LEU E 3 46  ? 46.608  -26.216 -33.795 1.00 32.96  ? 23   LEU A CD2   1 
ATOM   1018 N  N     . ALA E 3 47  ? 43.795  -28.018 -29.372 1.00 30.79  ? 24   ALA A N     1 
ATOM   1019 C  CA    . ALA E 3 47  ? 42.579  -28.542 -28.760 1.00 28.54  ? 24   ALA A CA    1 
ATOM   1020 C  C     . ALA E 3 47  ? 41.371  -27.644 -29.001 1.00 27.37  ? 24   ALA A C     1 
ATOM   1021 O  O     . ALA E 3 47  ? 41.490  -26.417 -29.012 1.00 27.18  ? 24   ALA A O     1 
ATOM   1022 C  CB    . ALA E 3 47  ? 42.792  -28.729 -27.268 1.00 28.42  ? 24   ALA A CB    1 
ATOM   1023 N  N     . CYS E 3 48  ? 40.209  -28.266 -29.191 1.00 25.15  ? 25   CYS A N     1 
ATOM   1024 C  CA    . CYS E 3 48  ? 38.965  -27.538 -29.420 1.00 23.44  ? 25   CYS A CA    1 
ATOM   1025 C  C     . CYS E 3 48  ? 37.882  -28.047 -28.470 1.00 21.12  ? 25   CYS A C     1 
ATOM   1026 O  O     . CYS E 3 48  ? 37.185  -29.018 -28.770 1.00 21.88  ? 25   CYS A O     1 
ATOM   1027 C  CB    . CYS E 3 48  ? 38.512  -27.717 -30.868 1.00 24.61  ? 25   CYS A CB    1 
ATOM   1028 S  SG    . CYS E 3 48  ? 37.086  -26.710 -31.327 1.00 34.30  ? 25   CYS A SG    1 
ATOM   1029 N  N     . ILE E 3 49  ? 37.751  -27.382 -27.325 1.00 18.67  ? 26   ILE A N     1 
ATOM   1030 C  CA    . ILE E 3 49  ? 36.772  -27.746 -26.303 1.00 17.57  ? 26   ILE A CA    1 
ATOM   1031 C  C     . ILE E 3 49  ? 35.510  -26.894 -26.476 1.00 18.85  ? 26   ILE A C     1 
ATOM   1032 O  O     . ILE E 3 49  ? 35.541  -25.879 -27.169 1.00 19.75  ? 26   ILE A O     1 
ATOM   1033 C  CB    . ILE E 3 49  ? 37.351  -27.499 -24.882 1.00 16.78  ? 26   ILE A CB    1 
ATOM   1034 C  CG1   . ILE E 3 49  ? 38.781  -28.046 -24.790 1.00 15.71  ? 26   ILE A CG1   1 
ATOM   1035 C  CG2   . ILE E 3 49  ? 36.456  -28.128 -23.827 1.00 15.16  ? 26   ILE A CG2   1 
ATOM   1036 C  CD1   . ILE E 3 49  ? 38.925  -29.521 -25.120 1.00 17.51  ? 26   ILE A CD1   1 
ATOM   1037 N  N     . ALA E 3 50  ? 34.407  -27.305 -25.849 1.00 19.00  ? 27   ALA A N     1 
ATOM   1038 C  CA    . ALA E 3 50  ? 33.142  -26.568 -25.931 1.00 19.27  ? 27   ALA A CA    1 
ATOM   1039 C  C     . ALA E 3 50  ? 32.280  -26.772 -24.685 1.00 20.62  ? 27   ALA A C     1 
ATOM   1040 O  O     . ALA E 3 50  ? 32.177  -27.884 -24.166 1.00 20.66  ? 27   ALA A O     1 
ATOM   1041 C  CB    . ALA E 3 50  ? 32.361  -26.993 -27.173 1.00 17.79  ? 27   ALA A CB    1 
ATOM   1042 N  N     . HIS E 3 51  ? 31.665  -25.692 -24.210 1.00 20.97  ? 28   HIS A N     1 
ATOM   1043 C  CA    . HIS E 3 51  ? 30.804  -25.739 -23.031 1.00 20.65  ? 28   HIS A CA    1 
ATOM   1044 C  C     . HIS E 3 51  ? 29.427  -25.250 -23.457 1.00 19.72  ? 28   HIS A C     1 
ATOM   1045 O  O     . HIS E 3 51  ? 29.304  -24.199 -24.074 1.00 20.61  ? 28   HIS A O     1 
ATOM   1046 C  CB    . HIS E 3 51  ? 31.376  -24.845 -21.918 1.00 22.77  ? 28   HIS A CB    1 
ATOM   1047 C  CG    . HIS E 3 51  ? 30.621  -24.918 -20.625 1.00 24.46  ? 28   HIS A CG    1 
ATOM   1048 N  ND1   . HIS E 3 51  ? 29.444  -24.236 -20.406 1.00 25.42  ? 28   HIS A ND1   1 
ATOM   1049 C  CD2   . HIS E 3 51  ? 30.872  -25.605 -19.484 1.00 24.03  ? 28   HIS A CD2   1 
ATOM   1050 C  CE1   . HIS E 3 51  ? 29.003  -24.498 -19.188 1.00 24.59  ? 28   HIS A CE1   1 
ATOM   1051 N  NE2   . HIS E 3 51  ? 29.852  -25.327 -18.607 1.00 23.43  ? 28   HIS A NE2   1 
ATOM   1052 N  N     . ILE E 3 52  ? 28.392  -26.016 -23.134 1.00 19.80  ? 29   ILE A N     1 
ATOM   1053 C  CA    . ILE E 3 52  ? 27.035  -25.650 -23.519 1.00 20.90  ? 29   ILE A CA    1 
ATOM   1054 C  C     . ILE E 3 52  ? 26.115  -25.612 -22.302 1.00 23.61  ? 29   ILE A C     1 
ATOM   1055 O  O     . ILE E 3 52  ? 25.936  -26.619 -21.612 1.00 24.99  ? 29   ILE A O     1 
ATOM   1056 C  CB    . ILE E 3 52  ? 26.497  -26.644 -24.575 1.00 18.68  ? 29   ILE A CB    1 
ATOM   1057 C  CG1   . ILE E 3 52  ? 27.437  -26.648 -25.784 1.00 17.56  ? 29   ILE A CG1   1 
ATOM   1058 C  CG2   . ILE E 3 52  ? 25.092  -26.255 -25.006 1.00 19.05  ? 29   ILE A CG2   1 
ATOM   1059 C  CD1   . ILE E 3 52  ? 27.045  -27.599 -26.882 1.00 19.61  ? 29   ILE A CD1   1 
ATOM   1060 N  N     . ASP E 3 53  ? 25.527  -24.443 -22.055 1.00 25.30  ? 30   ASP A N     1 
ATOM   1061 C  CA    . ASP E 3 53  ? 24.650  -24.228 -20.906 1.00 26.90  ? 30   ASP A CA    1 
ATOM   1062 C  C     . ASP E 3 53  ? 23.220  -23.861 -21.300 1.00 27.39  ? 30   ASP A C     1 
ATOM   1063 O  O     . ASP E 3 53  ? 22.978  -22.790 -21.857 1.00 31.13  ? 30   ASP A O     1 
ATOM   1064 C  CB    . ASP E 3 53  ? 25.249  -23.114 -20.026 1.00 27.69  ? 30   ASP A CB    1 
ATOM   1065 C  CG    . ASP E 3 53  ? 24.431  -22.841 -18.769 1.00 31.10  ? 30   ASP A CG    1 
ATOM   1066 O  OD1   . ASP E 3 53  ? 23.201  -22.657 -18.887 1.00 32.07  ? 30   ASP A OD1   1 
ATOM   1067 O  OD2   . ASP E 3 53  ? 25.023  -22.795 -17.664 1.00 31.53  ? 30   ASP A OD2   1 
ATOM   1068 N  N     . MET E 3 54  ? 22.272  -24.745 -21.006 1.00 25.31  ? 31   MET A N     1 
ATOM   1069 C  CA    . MET E 3 54  ? 20.866  -24.483 -21.311 1.00 23.96  ? 31   MET A CA    1 
ATOM   1070 C  C     . MET E 3 54  ? 20.448  -23.159 -20.660 1.00 22.44  ? 31   MET A C     1 
ATOM   1071 O  O     . MET E 3 54  ? 20.688  -22.953 -19.473 1.00 20.33  ? 31   MET A O     1 
ATOM   1072 C  CB    . MET E 3 54  ? 19.993  -25.611 -20.753 1.00 25.22  ? 31   MET A CB    1 
ATOM   1073 C  CG    . MET E 3 54  ? 20.334  -26.985 -21.284 1.00 27.33  ? 31   MET A CG    1 
ATOM   1074 S  SD    . MET E 3 54  ? 19.610  -27.292 -22.903 1.00 33.70  ? 31   MET A SD    1 
ATOM   1075 C  CE    . MET E 3 54  ? 18.794  -28.840 -22.623 1.00 30.49  ? 31   MET A CE    1 
ATOM   1076 N  N     . ASN E 3 55  ? 19.826  -22.269 -21.433 1.00 21.31  ? 32   ASN A N     1 
ATOM   1077 C  CA    . ASN E 3 55  ? 19.370  -20.976 -20.911 1.00 21.23  ? 32   ASN A CA    1 
ATOM   1078 C  C     . ASN E 3 55  ? 18.127  -21.153 -20.044 1.00 20.13  ? 32   ASN A C     1 
ATOM   1079 O  O     . ASN E 3 55  ? 17.192  -21.844 -20.440 1.00 21.07  ? 32   ASN A O     1 
ATOM   1080 C  CB    . ASN E 3 55  ? 19.029  -20.023 -22.055 1.00 23.44  ? 32   ASN A CB    1 
ATOM   1081 C  CG    . ASN E 3 55  ? 20.166  -19.860 -23.038 1.00 25.49  ? 32   ASN A CG    1 
ATOM   1082 O  OD1   . ASN E 3 55  ? 21.290  -19.542 -22.655 1.00 26.99  ? 32   ASN A OD1   1 
ATOM   1083 N  ND2   . ASN E 3 55  ? 19.876  -20.070 -24.316 1.00 24.36  ? 32   ASN A ND2   1 
ATOM   1084 N  N     . ALA E 3 56  ? 18.114  -20.516 -18.873 1.00 18.36  ? 33   ALA A N     1 
ATOM   1085 C  CA    . ALA E 3 56  ? 16.981  -20.615 -17.946 1.00 16.53  ? 33   ALA A CA    1 
ATOM   1086 C  C     . ALA E 3 56  ? 16.321  -21.981 -18.084 1.00 15.97  ? 33   ALA A C     1 
ATOM   1087 O  O     . ALA E 3 56  ? 15.128  -22.087 -18.364 1.00 14.88  ? 33   ALA A O     1 
ATOM   1088 C  CB    . ALA E 3 56  ? 15.966  -19.505 -18.227 1.00 13.83  ? 33   ALA A CB    1 
ATOM   1089 N  N     . PHE E 3 57  ? 17.114  -23.026 -17.882 1.00 16.32  ? 34   PHE A N     1 
ATOM   1090 C  CA    . PHE E 3 57  ? 16.637  -24.394 -18.014 1.00 16.64  ? 34   PHE A CA    1 
ATOM   1091 C  C     . PHE E 3 57  ? 15.234  -24.652 -17.477 1.00 15.65  ? 34   PHE A C     1 
ATOM   1092 O  O     . PHE E 3 57  ? 14.300  -24.812 -18.256 1.00 17.09  ? 34   PHE A O     1 
ATOM   1093 C  CB    . PHE E 3 57  ? 17.623  -25.360 -17.361 1.00 16.79  ? 34   PHE A CB    1 
ATOM   1094 C  CG    . PHE E 3 57  ? 17.369  -26.791 -17.702 1.00 16.02  ? 34   PHE A CG    1 
ATOM   1095 C  CD1   . PHE E 3 57  ? 17.088  -27.163 -19.011 1.00 15.93  ? 34   PHE A CD1   1 
ATOM   1096 C  CD2   . PHE E 3 57  ? 17.432  -27.773 -16.726 1.00 16.84  ? 34   PHE A CD2   1 
ATOM   1097 C  CE1   . PHE E 3 57  ? 16.870  -28.493 -19.347 1.00 16.10  ? 34   PHE A CE1   1 
ATOM   1098 C  CE2   . PHE E 3 57  ? 17.216  -29.108 -17.052 1.00 18.43  ? 34   PHE A CE2   1 
ATOM   1099 C  CZ    . PHE E 3 57  ? 16.936  -29.468 -18.368 1.00 16.44  ? 34   PHE A CZ    1 
ATOM   1100 N  N     . PHE E 3 58  ? 15.085  -24.701 -16.156 1.00 14.42  ? 35   PHE A N     1 
ATOM   1101 C  CA    . PHE E 3 58  ? 13.778  -24.953 -15.546 1.00 15.91  ? 35   PHE A CA    1 
ATOM   1102 C  C     . PHE E 3 58  ? 12.673  -24.112 -16.183 1.00 17.47  ? 35   PHE A C     1 
ATOM   1103 O  O     . PHE E 3 58  ? 11.576  -24.610 -16.457 1.00 17.87  ? 35   PHE A O     1 
ATOM   1104 C  CB    . PHE E 3 58  ? 13.829  -24.671 -14.041 1.00 15.13  ? 35   PHE A CB    1 
ATOM   1105 C  CG    . PHE E 3 58  ? 14.585  -25.702 -13.249 1.00 16.46  ? 35   PHE A CG    1 
ATOM   1106 C  CD1   . PHE E 3 58  ? 15.574  -26.484 -13.844 1.00 16.81  ? 35   PHE A CD1   1 
ATOM   1107 C  CD2   . PHE E 3 58  ? 14.346  -25.853 -11.890 1.00 16.13  ? 35   PHE A CD2   1 
ATOM   1108 C  CE1   . PHE E 3 58  ? 16.315  -27.390 -13.097 1.00 16.67  ? 35   PHE A CE1   1 
ATOM   1109 C  CE2   . PHE E 3 58  ? 15.081  -26.756 -11.134 1.00 17.51  ? 35   PHE A CE2   1 
ATOM   1110 C  CZ    . PHE E 3 58  ? 16.068  -27.526 -11.738 1.00 18.19  ? 35   PHE A CZ    1 
ATOM   1111 N  N     . ALA E 3 59  ? 12.967  -22.836 -16.419 1.00 17.22  ? 36   ALA A N     1 
ATOM   1112 C  CA    . ALA E 3 59  ? 12.004  -21.923 -17.020 1.00 16.19  ? 36   ALA A CA    1 
ATOM   1113 C  C     . ALA E 3 59  ? 11.631  -22.390 -18.419 1.00 17.32  ? 36   ALA A C     1 
ATOM   1114 O  O     . ALA E 3 59  ? 10.474  -22.303 -18.830 1.00 16.88  ? 36   ALA A O     1 
ATOM   1115 C  CB    . ALA E 3 59  ? 12.588  -20.531 -17.076 1.00 16.71  ? 36   ALA A CB    1 
ATOM   1116 N  N     . GLN E 3 60  ? 12.626  -22.887 -19.146 1.00 19.11  ? 37   GLN A N     1 
ATOM   1117 C  CA    . GLN E 3 60  ? 12.423  -23.379 -20.501 1.00 19.77  ? 37   GLN A CA    1 
ATOM   1118 C  C     . GLN E 3 60  ? 11.592  -24.650 -20.539 1.00 21.13  ? 37   GLN A C     1 
ATOM   1119 O  O     . GLN E 3 60  ? 10.630  -24.742 -21.299 1.00 23.66  ? 37   GLN A O     1 
ATOM   1120 C  CB    . GLN E 3 60  ? 13.760  -23.662 -21.183 1.00 18.93  ? 37   GLN A CB    1 
ATOM   1121 C  CG    . GLN E 3 60  ? 14.534  -22.437 -21.610 1.00 18.69  ? 37   GLN A CG    1 
ATOM   1122 C  CD    . GLN E 3 60  ? 15.369  -22.704 -22.844 1.00 17.66  ? 37   GLN A CD    1 
ATOM   1123 O  OE1   . GLN E 3 60  ? 14.837  -23.060 -23.894 1.00 18.33  ? 37   GLN A OE1   1 
ATOM   1124 N  NE2   . GLN E 3 60  ? 16.679  -22.535 -22.727 1.00 15.99  ? 37   GLN A NE2   1 
ATOM   1125 N  N     . VAL E 3 61  ? 11.960  -25.634 -19.724 1.00 21.04  ? 38   VAL A N     1 
ATOM   1126 C  CA    . VAL E 3 61  ? 11.229  -26.893 -19.722 1.00 22.49  ? 38   VAL A CA    1 
ATOM   1127 C  C     . VAL E 3 61  ? 9.748   -26.687 -19.405 1.00 23.50  ? 38   VAL A C     1 
ATOM   1128 O  O     . VAL E 3 61  ? 8.891   -27.316 -20.027 1.00 24.26  ? 38   VAL A O     1 
ATOM   1129 C  CB    . VAL E 3 61  ? 11.835  -27.904 -18.724 1.00 21.03  ? 38   VAL A CB    1 
ATOM   1130 C  CG1   . VAL E 3 61  ? 13.354  -27.877 -18.804 1.00 19.80  ? 38   VAL A CG1   1 
ATOM   1131 C  CG2   . VAL E 3 61  ? 11.361  -27.607 -17.340 1.00 23.70  ? 38   VAL A CG2   1 
ATOM   1132 N  N     . GLU E 3 62  ? 9.445   -25.805 -18.452 1.00 23.40  ? 39   GLU A N     1 
ATOM   1133 C  CA    . GLU E 3 62  ? 8.053   -25.533 -18.092 1.00 23.10  ? 39   GLU A CA    1 
ATOM   1134 C  C     . GLU E 3 62  ? 7.353   -24.844 -19.260 1.00 23.69  ? 39   GLU A C     1 
ATOM   1135 O  O     . GLU E 3 62  ? 6.156   -25.025 -19.481 1.00 23.30  ? 39   GLU A O     1 
ATOM   1136 C  CB    . GLU E 3 62  ? 7.973   -24.650 -16.843 1.00 22.10  ? 39   GLU A CB    1 
ATOM   1137 C  CG    . GLU E 3 62  ? 8.510   -25.300 -15.572 1.00 21.87  ? 39   GLU A CG    1 
ATOM   1138 C  CD    . GLU E 3 62  ? 7.968   -26.705 -15.346 1.00 22.52  ? 39   GLU A CD    1 
ATOM   1139 O  OE1   . GLU E 3 62  ? 6.755   -26.926 -15.566 1.00 22.00  ? 39   GLU A OE1   1 
ATOM   1140 O  OE2   . GLU E 3 62  ? 8.756   -27.587 -14.937 1.00 20.07  ? 39   GLU A OE2   1 
ATOM   1141 N  N     . GLN E 3 63  ? 8.114   -24.049 -20.003 1.00 24.22  ? 40   GLN A N     1 
ATOM   1142 C  CA    . GLN E 3 63  ? 7.592   -23.350 -21.168 1.00 25.77  ? 40   GLN A CA    1 
ATOM   1143 C  C     . GLN E 3 63  ? 7.190   -24.359 -22.234 1.00 26.77  ? 40   GLN A C     1 
ATOM   1144 O  O     . GLN E 3 63  ? 6.108   -24.277 -22.813 1.00 28.35  ? 40   GLN A O     1 
ATOM   1145 C  CB    . GLN E 3 63  ? 8.661   -22.436 -21.748 1.00 27.75  ? 40   GLN A CB    1 
ATOM   1146 C  CG    . GLN E 3 63  ? 8.458   -22.113 -23.217 1.00 30.52  ? 40   GLN A CG    1 
ATOM   1147 C  CD    . GLN E 3 63  ? 9.685   -21.484 -23.832 1.00 34.40  ? 40   GLN A CD    1 
ATOM   1148 O  OE1   . GLN E 3 63  ? 10.199  -20.478 -23.332 1.00 37.66  ? 40   GLN A OE1   1 
ATOM   1149 N  NE2   . GLN E 3 63  ? 10.167  -22.071 -24.923 1.00 35.05  ? 40   GLN A NE2   1 
ATOM   1150 N  N     . MET E 3 64  ? 8.086   -25.302 -22.496 1.00 25.94  ? 41   MET A N     1 
ATOM   1151 C  CA    . MET E 3 64  ? 7.853   -26.333 -23.493 1.00 26.11  ? 41   MET A CA    1 
ATOM   1152 C  C     . MET E 3 64  ? 6.720   -27.263 -23.089 1.00 25.53  ? 41   MET A C     1 
ATOM   1153 O  O     . MET E 3 64  ? 5.946   -27.711 -23.932 1.00 25.86  ? 41   MET A O     1 
ATOM   1154 C  CB    . MET E 3 64  ? 9.132   -27.142 -23.707 1.00 27.94  ? 41   MET A CB    1 
ATOM   1155 C  CG    . MET E 3 64  ? 10.255  -26.373 -24.388 1.00 30.09  ? 41   MET A CG    1 
ATOM   1156 S  SD    . MET E 3 64  ? 9.936   -26.134 -26.146 1.00 35.00  ? 41   MET A SD    1 
ATOM   1157 C  CE    . MET E 3 64  ? 9.041   -24.559 -26.149 1.00 35.84  ? 41   MET A CE    1 
ATOM   1158 N  N     . ARG E 3 65  ? 6.622   -27.550 -21.796 1.00 24.98  ? 42   ARG A N     1 
ATOM   1159 C  CA    . ARG E 3 65  ? 5.584   -28.444 -21.307 1.00 24.56  ? 42   ARG A CA    1 
ATOM   1160 C  C     . ARG E 3 65  ? 4.205   -27.860 -21.508 1.00 25.08  ? 42   ARG A C     1 
ATOM   1161 O  O     . ARG E 3 65  ? 3.267   -28.579 -21.839 1.00 26.20  ? 42   ARG A O     1 
ATOM   1162 C  CB    . ARG E 3 65  ? 5.787   -28.744 -19.823 1.00 24.39  ? 42   ARG A CB    1 
ATOM   1163 C  CG    . ARG E 3 65  ? 4.812   -29.769 -19.250 1.00 23.82  ? 42   ARG A CG    1 
ATOM   1164 C  CD    . ARG E 3 65  ? 5.100   -30.034 -17.776 1.00 24.28  ? 42   ARG A CD    1 
ATOM   1165 N  NE    . ARG E 3 65  ? 4.803   -28.859 -16.967 1.00 25.96  ? 42   ARG A NE    1 
ATOM   1166 C  CZ    . ARG E 3 65  ? 3.573   -28.460 -16.668 1.00 26.91  ? 42   ARG A CZ    1 
ATOM   1167 N  NH1   . ARG E 3 65  ? 2.528   -29.152 -17.102 1.00 26.15  ? 42   ARG A NH1   1 
ATOM   1168 N  NH2   . ARG E 3 65  ? 3.386   -27.357 -15.957 1.00 27.36  ? 42   ARG A NH2   1 
ATOM   1169 N  N     . CYS E 3 66  ? 4.080   -26.554 -21.316 1.00 25.88  ? 43   CYS A N     1 
ATOM   1170 C  CA    . CYS E 3 66  ? 2.787   -25.903 -21.465 1.00 28.47  ? 43   CYS A CA    1 
ATOM   1171 C  C     . CYS E 3 66  ? 2.562   -25.319 -22.857 1.00 28.44  ? 43   CYS A C     1 
ATOM   1172 O  O     . CYS E 3 66  ? 1.641   -24.533 -23.069 1.00 26.79  ? 43   CYS A O     1 
ATOM   1173 C  CB    . CYS E 3 66  ? 2.638   -24.823 -20.395 1.00 30.73  ? 43   CYS A CB    1 
ATOM   1174 S  SG    . CYS E 3 66  ? 2.869   -25.461 -18.710 1.00 34.95  ? 43   CYS A SG    1 
ATOM   1175 N  N     . GLY E 3 67  ? 3.414   -25.714 -23.798 1.00 29.98  ? 44   GLY A N     1 
ATOM   1176 C  CA    . GLY E 3 67  ? 3.294   -25.249 -25.169 1.00 32.10  ? 44   GLY A CA    1 
ATOM   1177 C  C     . GLY E 3 67  ? 3.318   -23.747 -25.361 1.00 33.29  ? 44   GLY A C     1 
ATOM   1178 O  O     . GLY E 3 67  ? 2.668   -23.214 -26.264 1.00 32.56  ? 44   GLY A O     1 
ATOM   1179 N  N     . LEU E 3 68  ? 4.064   -23.057 -24.510 1.00 34.86  ? 45   LEU A N     1 
ATOM   1180 C  CA    . LEU E 3 68  ? 4.173   -21.611 -24.608 1.00 37.23  ? 45   LEU A CA    1 
ATOM   1181 C  C     . LEU E 3 68  ? 5.289   -21.291 -25.595 1.00 39.19  ? 45   LEU A C     1 
ATOM   1182 O  O     . LEU E 3 68  ? 6.060   -22.176 -25.973 1.00 40.31  ? 45   LEU A O     1 
ATOM   1183 C  CB    . LEU E 3 68  ? 4.483   -21.018 -23.232 1.00 36.81  ? 45   LEU A CB    1 
ATOM   1184 C  CG    . LEU E 3 68  ? 3.421   -21.292 -22.161 1.00 35.85  ? 45   LEU A CG    1 
ATOM   1185 C  CD1   . LEU E 3 68  ? 3.899   -20.816 -20.803 1.00 36.87  ? 45   LEU A CD1   1 
ATOM   1186 C  CD2   . LEU E 3 68  ? 2.136   -20.595 -22.546 1.00 36.28  ? 45   LEU A CD2   1 
ATOM   1187 N  N     . SER E 3 69  ? 5.369   -20.034 -26.022 1.00 40.42  ? 46   SER A N     1 
ATOM   1188 C  CA    . SER E 3 69  ? 6.399   -19.619 -26.970 1.00 41.29  ? 46   SER A CA    1 
ATOM   1189 C  C     . SER E 3 69  ? 7.640   -19.126 -26.240 1.00 42.00  ? 46   SER A C     1 
ATOM   1190 O  O     . SER E 3 69  ? 7.571   -18.736 -25.075 1.00 43.04  ? 46   SER A O     1 
ATOM   1191 C  CB    . SER E 3 69  ? 5.865   -18.522 -27.897 1.00 40.97  ? 46   SER A CB    1 
ATOM   1192 O  OG    . SER E 3 69  ? 5.396   -17.408 -27.161 1.00 40.78  ? 46   SER A OG    1 
ATOM   1193 N  N     . LYS E 3 70  ? 8.773   -19.146 -26.931 1.00 42.38  ? 47   LYS A N     1 
ATOM   1194 C  CA    . LYS E 3 70  ? 10.036  -18.716 -26.345 1.00 43.87  ? 47   LYS A CA    1 
ATOM   1195 C  C     . LYS E 3 70  ? 10.031  -17.264 -25.861 1.00 45.20  ? 47   LYS A C     1 
ATOM   1196 O  O     . LYS E 3 70  ? 10.822  -16.898 -24.990 1.00 46.31  ? 47   LYS A O     1 
ATOM   1197 C  CB    . LYS E 3 70  ? 11.171  -18.921 -27.355 1.00 44.45  ? 47   LYS A CB    1 
ATOM   1198 C  CG    . LYS E 3 70  ? 12.494  -18.285 -26.956 1.00 45.18  ? 47   LYS A CG    1 
ATOM   1199 C  CD    . LYS E 3 70  ? 13.539  -18.405 -28.060 1.00 45.86  ? 47   LYS A CD    1 
ATOM   1200 C  CE    . LYS E 3 70  ? 14.769  -17.540 -27.769 1.00 48.04  ? 47   LYS A CE    1 
ATOM   1201 N  NZ    . LYS E 3 70  ? 15.449  -17.854 -26.470 1.00 47.23  ? 47   LYS A NZ    1 
ATOM   1202 N  N     . GLU E 3 71  ? 9.140   -16.442 -26.413 1.00 45.24  ? 48   GLU A N     1 
ATOM   1203 C  CA    . GLU E 3 71  ? 9.066   -15.031 -26.035 1.00 44.61  ? 48   GLU A CA    1 
ATOM   1204 C  C     . GLU E 3 71  ? 8.147   -14.732 -24.856 1.00 42.80  ? 48   GLU A C     1 
ATOM   1205 O  O     . GLU E 3 71  ? 8.042   -13.582 -24.435 1.00 42.41  ? 48   GLU A O     1 
ATOM   1206 C  CB    . GLU E 3 71  ? 8.619   -14.178 -27.227 1.00 48.54  ? 48   GLU A CB    1 
ATOM   1207 C  CG    . GLU E 3 71  ? 9.616   -14.093 -28.374 1.00 54.55  ? 48   GLU A CG    1 
ATOM   1208 C  CD    . GLU E 3 71  ? 9.801   -15.411 -29.106 1.00 58.49  ? 48   GLU A CD    1 
ATOM   1209 O  OE1   . GLU E 3 71  ? 8.809   -15.945 -29.654 1.00 59.03  ? 48   GLU A OE1   1 
ATOM   1210 O  OE2   . GLU E 3 71  ? 10.946  -15.913 -29.137 1.00 61.24  ? 48   GLU A OE2   1 
ATOM   1211 N  N     . ASP E 3 72  ? 7.479   -15.750 -24.323 1.00 41.49  ? 49   ASP A N     1 
ATOM   1212 C  CA    . ASP E 3 72  ? 6.576   -15.544 -23.193 1.00 40.34  ? 49   ASP A CA    1 
ATOM   1213 C  C     . ASP E 3 72  ? 7.293   -15.320 -21.866 1.00 38.29  ? 49   ASP A C     1 
ATOM   1214 O  O     . ASP E 3 72  ? 8.294   -15.970 -21.565 1.00 37.47  ? 49   ASP A O     1 
ATOM   1215 C  CB    . ASP E 3 72  ? 5.615   -16.724 -23.045 1.00 43.47  ? 49   ASP A CB    1 
ATOM   1216 C  CG    . ASP E 3 72  ? 4.493   -16.687 -24.059 1.00 47.51  ? 49   ASP A CG    1 
ATOM   1217 O  OD1   . ASP E 3 72  ? 3.840   -15.627 -24.179 1.00 49.14  ? 49   ASP A OD1   1 
ATOM   1218 O  OD2   . ASP E 3 72  ? 4.258   -17.717 -24.729 1.00 51.05  ? 49   ASP A OD2   1 
ATOM   1219 N  N     . PRO E 3 73  ? 6.783   -14.385 -21.052 1.00 35.75  ? 50   PRO A N     1 
ATOM   1220 C  CA    . PRO E 3 73  ? 7.361   -14.062 -19.746 1.00 34.39  ? 50   PRO A CA    1 
ATOM   1221 C  C     . PRO E 3 73  ? 7.055   -15.135 -18.703 1.00 32.56  ? 50   PRO A C     1 
ATOM   1222 O  O     . PRO E 3 73  ? 6.413   -14.872 -17.690 1.00 31.51  ? 50   PRO A O     1 
ATOM   1223 C  CB    . PRO E 3 73  ? 6.713   -12.725 -19.414 1.00 34.95  ? 50   PRO A CB    1 
ATOM   1224 C  CG    . PRO E 3 73  ? 5.353   -12.873 -20.019 1.00 35.63  ? 50   PRO A CG    1 
ATOM   1225 C  CD    . PRO E 3 73  ? 5.667   -13.475 -21.367 1.00 35.44  ? 50   PRO A CD    1 
ATOM   1226 N  N     . VAL E 3 74  ? 7.519   -16.349 -18.964 1.00 31.18  ? 51   VAL A N     1 
ATOM   1227 C  CA    . VAL E 3 74  ? 7.298   -17.463 -18.055 1.00 30.49  ? 51   VAL A CA    1 
ATOM   1228 C  C     . VAL E 3 74  ? 8.366   -17.476 -16.965 1.00 29.72  ? 51   VAL A C     1 
ATOM   1229 O  O     . VAL E 3 74  ? 9.473   -16.986 -17.168 1.00 29.95  ? 51   VAL A O     1 
ATOM   1230 C  CB    . VAL E 3 74  ? 7.323   -18.799 -18.827 1.00 30.03  ? 51   VAL A CB    1 
ATOM   1231 C  CG1   . VAL E 3 74  ? 8.571   -18.874 -19.676 1.00 31.84  ? 51   VAL A CG1   1 
ATOM   1232 C  CG2   . VAL E 3 74  ? 7.271   -19.967 -17.864 1.00 30.64  ? 51   VAL A CG2   1 
ATOM   1233 N  N     . VAL E 3 75  ? 8.028   -18.030 -15.805 1.00 29.57  ? 52   VAL A N     1 
ATOM   1234 C  CA    . VAL E 3 75  ? 8.965   -18.094 -14.688 1.00 28.91  ? 52   VAL A CA    1 
ATOM   1235 C  C     . VAL E 3 75  ? 8.710   -19.322 -13.814 1.00 28.53  ? 52   VAL A C     1 
ATOM   1236 O  O     . VAL E 3 75  ? 7.567   -19.614 -13.460 1.00 28.69  ? 52   VAL A O     1 
ATOM   1237 C  CB    . VAL E 3 75  ? 8.859   -16.833 -13.816 1.00 28.56  ? 52   VAL A CB    1 
ATOM   1238 C  CG1   . VAL E 3 75  ? 7.450   -16.686 -13.283 1.00 29.20  ? 52   VAL A CG1   1 
ATOM   1239 C  CG2   . VAL E 3 75  ? 9.833   -16.917 -12.680 1.00 30.11  ? 52   VAL A CG2   1 
ATOM   1240 N  N     . CYS E 3 76  ? 9.774   -20.043 -13.468 1.00 27.67  ? 53   CYS A N     1 
ATOM   1241 C  CA    . CYS E 3 76  ? 9.632   -21.236 -12.643 1.00 28.19  ? 53   CYS A CA    1 
ATOM   1242 C  C     . CYS E 3 76  ? 9.550   -20.876 -11.166 1.00 28.80  ? 53   CYS A C     1 
ATOM   1243 O  O     . CYS E 3 76  ? 10.461  -20.266 -10.604 1.00 29.40  ? 53   CYS A O     1 
ATOM   1244 C  CB    . CYS E 3 76  ? 10.801  -22.194 -12.877 1.00 28.82  ? 53   CYS A CB    1 
ATOM   1245 S  SG    . CYS E 3 76  ? 10.722  -23.706 -11.879 1.00 27.48  ? 53   CYS A SG    1 
ATOM   1246 N  N     . VAL E 3 77  ? 8.454   -21.274 -10.534 1.00 28.55  ? 54   VAL A N     1 
ATOM   1247 C  CA    . VAL E 3 77  ? 8.246   -20.966 -9.132  1.00 29.13  ? 54   VAL A CA    1 
ATOM   1248 C  C     . VAL E 3 77  ? 8.256   -22.171 -8.192  1.00 29.82  ? 54   VAL A C     1 
ATOM   1249 O  O     . VAL E 3 77  ? 7.729   -23.243 -8.504  1.00 29.57  ? 54   VAL A O     1 
ATOM   1250 C  CB    . VAL E 3 77  ? 6.918   -20.213 -8.942  1.00 28.99  ? 54   VAL A CB    1 
ATOM   1251 C  CG1   . VAL E 3 77  ? 6.730   -19.861 -7.485  1.00 30.11  ? 54   VAL A CG1   1 
ATOM   1252 C  CG2   . VAL E 3 77  ? 6.904   -18.964 -9.802  1.00 29.04  ? 54   VAL A CG2   1 
ATOM   1253 N  N     . GLN E 3 78  ? 8.866   -21.959 -7.031  1.00 29.23  ? 55   GLN A N     1 
ATOM   1254 C  CA    . GLN E 3 78  ? 8.973   -22.956 -5.976  1.00 28.53  ? 55   GLN A CA    1 
ATOM   1255 C  C     . GLN E 3 78  ? 8.515   -22.257 -4.695  1.00 28.68  ? 55   GLN A C     1 
ATOM   1256 O  O     . GLN E 3 78  ? 9.235   -21.426 -4.139  1.00 29.97  ? 55   GLN A O     1 
ATOM   1257 C  CB    . GLN E 3 78  ? 10.426  -23.425 -5.845  1.00 27.27  ? 55   GLN A CB    1 
ATOM   1258 C  CG    . GLN E 3 78  ? 10.740  -24.156 -4.559  1.00 27.72  ? 55   GLN A CG    1 
ATOM   1259 C  CD    . GLN E 3 78  ? 12.189  -24.584 -4.483  1.00 30.31  ? 55   GLN A CD    1 
ATOM   1260 O  OE1   . GLN E 3 78  ? 12.537  -25.706 -4.848  1.00 30.82  ? 55   GLN A OE1   1 
ATOM   1261 N  NE2   . GLN E 3 78  ? 13.048  -23.682 -4.021  1.00 31.87  ? 55   GLN A NE2   1 
ATOM   1262 N  N     . TRP E 3 79  ? 7.311   -22.588 -4.239  1.00 27.45  ? 56   TRP A N     1 
ATOM   1263 C  CA    . TRP E 3 79  ? 6.746   -21.970 -3.046  1.00 26.60  ? 56   TRP A CA    1 
ATOM   1264 C  C     . TRP E 3 79  ? 6.479   -20.500 -3.346  1.00 28.27  ? 56   TRP A C     1 
ATOM   1265 O  O     . TRP E 3 79  ? 5.498   -20.170 -4.011  1.00 30.53  ? 56   TRP A O     1 
ATOM   1266 C  CB    . TRP E 3 79  ? 7.705   -22.097 -1.866  1.00 21.82  ? 56   TRP A CB    1 
ATOM   1267 C  CG    . TRP E 3 79  ? 8.047   -23.507 -1.518  1.00 19.25  ? 56   TRP A CG    1 
ATOM   1268 C  CD1   . TRP E 3 79  ? 9.220   -23.946 -0.986  1.00 19.25  ? 56   TRP A CD1   1 
ATOM   1269 C  CD2   . TRP E 3 79  ? 7.212   -24.667 -1.660  1.00 18.37  ? 56   TRP A CD2   1 
ATOM   1270 N  NE1   . TRP E 3 79  ? 9.176   -25.303 -0.787  1.00 19.84  ? 56   TRP A NE1   1 
ATOM   1271 C  CE2   . TRP E 3 79  ? 7.955   -25.773 -1.191  1.00 18.15  ? 56   TRP A CE2   1 
ATOM   1272 C  CE3   . TRP E 3 79  ? 5.912   -24.879 -2.136  1.00 19.19  ? 56   TRP A CE3   1 
ATOM   1273 C  CZ2   . TRP E 3 79  ? 7.442   -27.077 -1.184  1.00 15.32  ? 56   TRP A CZ2   1 
ATOM   1274 C  CZ3   . TRP E 3 79  ? 5.400   -26.179 -2.129  1.00 18.52  ? 56   TRP A CZ3   1 
ATOM   1275 C  CH2   . TRP E 3 79  ? 6.168   -27.260 -1.655  1.00 16.74  ? 56   TRP A CH2   1 
ATOM   1276 N  N     . ASN E 3 80  ? 7.355   -19.619 -2.870  1.00 28.53  ? 57   ASN A N     1 
ATOM   1277 C  CA    . ASN E 3 80  ? 7.190   -18.186 -3.104  1.00 29.05  ? 57   ASN A CA    1 
ATOM   1278 C  C     . ASN E 3 80  ? 8.353   -17.580 -3.876  1.00 29.18  ? 57   ASN A C     1 
ATOM   1279 O  O     . ASN E 3 80  ? 8.278   -16.445 -4.345  1.00 29.18  ? 57   ASN A O     1 
ATOM   1280 C  CB    . ASN E 3 80  ? 7.028   -17.448 -1.775  1.00 28.66  ? 57   ASN A CB    1 
ATOM   1281 C  CG    . ASN E 3 80  ? 5.671   -17.672 -1.148  1.00 30.50  ? 57   ASN A CG    1 
ATOM   1282 O  OD1   . ASN E 3 80  ? 5.409   -17.216 -0.036  1.00 33.04  ? 57   ASN A OD1   1 
ATOM   1283 N  ND2   . ASN E 3 80  ? 4.794   -18.371 -1.860  1.00 28.99  ? 57   ASN A ND2   1 
ATOM   1284 N  N     . SER E 3 81  ? 9.430   -18.342 -4.012  1.00 29.50  ? 58   SER A N     1 
ATOM   1285 C  CA    . SER E 3 81  ? 10.604  -17.854 -4.716  1.00 29.36  ? 58   SER A CA    1 
ATOM   1286 C  C     . SER E 3 81  ? 10.642  -18.274 -6.180  1.00 27.84  ? 58   SER A C     1 
ATOM   1287 O  O     . SER E 3 81  ? 9.980   -19.229 -6.592  1.00 27.81  ? 58   SER A O     1 
ATOM   1288 C  CB    . SER E 3 81  ? 11.867  -18.340 -4.007  1.00 31.21  ? 58   SER A CB    1 
ATOM   1289 O  OG    . SER E 3 81  ? 11.873  -17.905 -2.659  1.00 35.31  ? 58   SER A OG    1 
ATOM   1290 N  N     . ILE E 3 82  ? 11.415  -17.533 -6.964  1.00 24.67  ? 59   ILE A N     1 
ATOM   1291 C  CA    . ILE E 3 82  ? 11.575  -17.822 -8.378  1.00 21.74  ? 59   ILE A CA    1 
ATOM   1292 C  C     . ILE E 3 82  ? 12.944  -18.460 -8.522  1.00 22.13  ? 59   ILE A C     1 
ATOM   1293 O  O     . ILE E 3 82  ? 13.949  -17.853 -8.160  1.00 22.77  ? 59   ILE A O     1 
ATOM   1294 C  CB    . ILE E 3 82  ? 11.515  -16.532 -9.216  1.00 18.61  ? 59   ILE A CB    1 
ATOM   1295 C  CG1   . ILE E 3 82  ? 10.067  -16.050 -9.321  1.00 15.56  ? 59   ILE A CG1   1 
ATOM   1296 C  CG2   . ILE E 3 82  ? 12.123  -16.775 -10.584 1.00 18.62  ? 59   ILE A CG2   1 
ATOM   1297 C  CD1   . ILE E 3 82  ? 9.911   -14.720 -10.013 1.00 13.59  ? 59   ILE A CD1   1 
ATOM   1298 N  N     . ILE E 3 83  ? 12.990  -19.684 -9.038  1.00 21.96  ? 60   ILE A N     1 
ATOM   1299 C  CA    . ILE E 3 83  ? 14.265  -20.367 -9.191  1.00 21.49  ? 60   ILE A CA    1 
ATOM   1300 C  C     . ILE E 3 83  ? 14.789  -20.367 -10.623 1.00 20.10  ? 60   ILE A C     1 
ATOM   1301 O  O     . ILE E 3 83  ? 15.939  -20.718 -10.865 1.00 20.28  ? 60   ILE A O     1 
ATOM   1302 C  CB    . ILE E 3 83  ? 14.188  -21.817 -8.645  1.00 21.84  ? 60   ILE A CB    1 
ATOM   1303 C  CG1   . ILE E 3 83  ? 13.202  -22.659 -9.456  1.00 21.63  ? 60   ILE A CG1   1 
ATOM   1304 C  CG2   . ILE E 3 83  ? 13.733  -21.787 -7.191  1.00 22.56  ? 60   ILE A CG2   1 
ATOM   1305 C  CD1   . ILE E 3 83  ? 13.072  -24.095 -8.943  1.00 17.84  ? 60   ILE A CD1   1 
ATOM   1306 N  N     . ALA E 3 84  ? 13.950  -19.956 -11.565 1.00 19.00  ? 61   ALA A N     1 
ATOM   1307 C  CA    . ALA E 3 84  ? 14.346  -19.892 -12.968 1.00 18.19  ? 61   ALA A CA    1 
ATOM   1308 C  C     . ALA E 3 84  ? 13.626  -18.732 -13.646 1.00 17.97  ? 61   ALA A C     1 
ATOM   1309 O  O     . ALA E 3 84  ? 12.403  -18.615 -13.559 1.00 18.09  ? 61   ALA A O     1 
ATOM   1310 C  CB    . ALA E 3 84  ? 14.014  -21.194 -13.665 1.00 19.72  ? 61   ALA A CB    1 
ATOM   1311 N  N     . VAL E 3 85  ? 14.389  -17.882 -14.326 1.00 15.72  ? 62   VAL A N     1 
ATOM   1312 C  CA    . VAL E 3 85  ? 13.831  -16.713 -14.996 1.00 15.36  ? 62   VAL A CA    1 
ATOM   1313 C  C     . VAL E 3 85  ? 14.068  -16.685 -16.497 1.00 17.61  ? 62   VAL A C     1 
ATOM   1314 O  O     . VAL E 3 85  ? 15.198  -16.501 -16.955 1.00 19.48  ? 62   VAL A O     1 
ATOM   1315 C  CB    . VAL E 3 85  ? 14.419  -15.425 -14.410 1.00 14.62  ? 62   VAL A CB    1 
ATOM   1316 C  CG1   . VAL E 3 85  ? 13.923  -14.225 -15.182 1.00 15.01  ? 62   VAL A CG1   1 
ATOM   1317 C  CG2   . VAL E 3 85  ? 14.041  -15.311 -12.950 1.00 17.16  ? 62   VAL A CG2   1 
ATOM   1318 N  N     . SER E 3 86  ? 12.996  -16.850 -17.264 1.00 17.50  ? 63   SER A N     1 
ATOM   1319 C  CA    . SER E 3 86  ? 13.094  -16.828 -18.718 1.00 16.86  ? 63   SER A CA    1 
ATOM   1320 C  C     . SER E 3 86  ? 13.576  -15.452 -19.162 1.00 17.11  ? 63   SER A C     1 
ATOM   1321 O  O     . SER E 3 86  ? 13.188  -14.437 -18.586 1.00 17.55  ? 63   SER A O     1 
ATOM   1322 C  CB    . SER E 3 86  ? 11.730  -17.102 -19.343 1.00 16.52  ? 63   SER A CB    1 
ATOM   1323 O  OG    . SER E 3 86  ? 10.846  -16.023 -19.095 1.00 16.41  ? 63   SER A OG    1 
ATOM   1324 N  N     . TYR E 3 87  ? 14.413  -15.416 -20.191 1.00 17.44  ? 64   TYR A N     1 
ATOM   1325 C  CA    . TYR E 3 87  ? 14.933  -14.150 -20.690 1.00 17.61  ? 64   TYR A CA    1 
ATOM   1326 C  C     . TYR E 3 87  ? 13.847  -13.201 -21.175 1.00 19.12  ? 64   TYR A C     1 
ATOM   1327 O  O     . TYR E 3 87  ? 14.069  -11.998 -21.297 1.00 20.71  ? 64   TYR A O     1 
ATOM   1328 C  CB    . TYR E 3 87  ? 15.956  -14.399 -21.797 1.00 14.15  ? 64   TYR A CB    1 
ATOM   1329 C  CG    . TYR E 3 87  ? 17.256  -14.923 -21.248 1.00 13.31  ? 64   TYR A CG    1 
ATOM   1330 C  CD1   . TYR E 3 87  ? 17.379  -16.250 -20.846 1.00 13.03  ? 64   TYR A CD1   1 
ATOM   1331 C  CD2   . TYR E 3 87  ? 18.340  -14.069 -21.049 1.00 12.89  ? 64   TYR A CD2   1 
ATOM   1332 C  CE1   . TYR E 3 87  ? 18.548  -16.713 -20.252 1.00 13.93  ? 64   TYR A CE1   1 
ATOM   1333 C  CE2   . TYR E 3 87  ? 19.510  -14.522 -20.456 1.00 12.12  ? 64   TYR A CE2   1 
ATOM   1334 C  CZ    . TYR E 3 87  ? 19.605  -15.843 -20.060 1.00 13.29  ? 64   TYR A CZ    1 
ATOM   1335 O  OH    . TYR E 3 87  ? 20.754  -16.298 -19.464 1.00 17.11  ? 64   TYR A OH    1 
ATOM   1336 N  N     . ALA E 3 88  ? 12.668  -13.738 -21.453 1.00 19.91  ? 65   ALA A N     1 
ATOM   1337 C  CA    . ALA E 3 88  ? 11.571  -12.899 -21.895 1.00 21.16  ? 65   ALA A CA    1 
ATOM   1338 C  C     . ALA E 3 88  ? 11.139  -12.033 -20.712 1.00 22.47  ? 65   ALA A C     1 
ATOM   1339 O  O     . ALA E 3 88  ? 10.895  -10.839 -20.864 1.00 24.23  ? 65   ALA A O     1 
ATOM   1340 C  CB    . ALA E 3 88  ? 10.414  -13.762 -22.372 1.00 20.82  ? 65   ALA A CB    1 
ATOM   1341 N  N     . ALA E 3 89  ? 11.066  -12.644 -19.532 1.00 22.94  ? 66   ALA A N     1 
ATOM   1342 C  CA    . ALA E 3 89  ? 10.656  -11.950 -18.314 1.00 23.81  ? 66   ALA A CA    1 
ATOM   1343 C  C     . ALA E 3 89  ? 11.763  -11.085 -17.711 1.00 25.47  ? 66   ALA A C     1 
ATOM   1344 O  O     . ALA E 3 89  ? 11.505  -10.241 -16.852 1.00 26.56  ? 66   ALA A O     1 
ATOM   1345 C  CB    . ALA E 3 89  ? 10.173  -12.962 -17.283 1.00 21.56  ? 66   ALA A CB    1 
ATOM   1346 N  N     . ARG E 3 90  ? 12.995  -11.294 -18.158 1.00 26.50  ? 67   ARG A N     1 
ATOM   1347 C  CA    . ARG E 3 90  ? 14.119  -10.524 -17.641 1.00 26.23  ? 67   ARG A CA    1 
ATOM   1348 C  C     . ARG E 3 90  ? 14.080  -9.072  -18.108 1.00 26.66  ? 67   ARG A C     1 
ATOM   1349 O  O     . ARG E 3 90  ? 14.705  -8.200  -17.498 1.00 26.59  ? 67   ARG A O     1 
ATOM   1350 C  CB    . ARG E 3 90  ? 15.442  -11.173 -18.057 1.00 24.97  ? 67   ARG A CB    1 
ATOM   1351 C  CG    . ARG E 3 90  ? 15.605  -12.588 -17.535 1.00 26.22  ? 67   ARG A CG    1 
ATOM   1352 C  CD    . ARG E 3 90  ? 17.044  -13.065 -17.599 1.00 27.96  ? 67   ARG A CD    1 
ATOM   1353 N  NE    . ARG E 3 90  ? 17.191  -14.390 -17.003 1.00 30.44  ? 67   ARG A NE    1 
ATOM   1354 C  CZ    . ARG E 3 90  ? 18.349  -15.030 -16.872 1.00 30.96  ? 67   ARG A CZ    1 
ATOM   1355 N  NH1   . ARG E 3 90  ? 19.470  -14.463 -17.299 1.00 30.27  ? 67   ARG A NH1   1 
ATOM   1356 N  NH2   . ARG E 3 90  ? 18.384  -16.234 -16.312 1.00 29.88  ? 67   ARG A NH2   1 
ATOM   1357 N  N     . LYS E 3 91  ? 13.344  -8.815  -19.187 1.00 26.22  ? 68   LYS A N     1 
ATOM   1358 C  CA    . LYS E 3 91  ? 13.235  -7.463  -19.718 1.00 26.17  ? 68   LYS A CA    1 
ATOM   1359 C  C     . LYS E 3 91  ? 12.488  -6.581  -18.733 1.00 24.95  ? 68   LYS A C     1 
ATOM   1360 O  O     . LYS E 3 91  ? 12.605  -5.358  -18.773 1.00 24.27  ? 68   LYS A O     1 
ATOM   1361 C  CB    . LYS E 3 91  ? 12.491  -7.459  -21.053 1.00 28.00  ? 68   LYS A CB    1 
ATOM   1362 C  CG    . LYS E 3 91  ? 13.199  -8.174  -22.188 1.00 30.31  ? 68   LYS A CG    1 
ATOM   1363 C  CD    . LYS E 3 91  ? 12.435  -7.977  -23.492 1.00 31.84  ? 68   LYS A CD    1 
ATOM   1364 C  CE    . LYS E 3 91  ? 13.061  -8.760  -24.634 1.00 34.45  ? 68   LYS A CE    1 
ATOM   1365 N  NZ    . LYS E 3 91  ? 12.972  -10.238 -24.422 1.00 37.22  ? 68   LYS A NZ    1 
ATOM   1366 N  N     . TYR E 3 92  ? 11.716  -7.213  -17.853 1.00 23.45  ? 69   TYR A N     1 
ATOM   1367 C  CA    . TYR E 3 92  ? 10.944  -6.488  -16.859 1.00 22.35  ? 69   TYR A CA    1 
ATOM   1368 C  C     . TYR E 3 92  ? 11.741  -6.296  -15.583 1.00 22.36  ? 69   TYR A C     1 
ATOM   1369 O  O     . TYR E 3 92  ? 11.201  -5.872  -14.563 1.00 24.43  ? 69   TYR A O     1 
ATOM   1370 C  CB    . TYR E 3 92  ? 9.636   -7.227  -16.556 1.00 23.06  ? 69   TYR A CB    1 
ATOM   1371 C  CG    . TYR E 3 92  ? 8.742   -7.374  -17.765 1.00 24.10  ? 69   TYR A CG    1 
ATOM   1372 C  CD1   . TYR E 3 92  ? 8.846   -8.478  -18.603 1.00 25.80  ? 69   TYR A CD1   1 
ATOM   1373 C  CD2   . TYR E 3 92  ? 7.838   -6.372  -18.110 1.00 24.82  ? 69   TYR A CD2   1 
ATOM   1374 C  CE1   . TYR E 3 92  ? 8.075   -8.579  -19.759 1.00 27.93  ? 69   TYR A CE1   1 
ATOM   1375 C  CE2   . TYR E 3 92  ? 7.067   -6.462  -19.260 1.00 26.40  ? 69   TYR A CE2   1 
ATOM   1376 C  CZ    . TYR E 3 92  ? 7.191   -7.566  -20.081 1.00 27.83  ? 69   TYR A CZ    1 
ATOM   1377 O  OH    . TYR E 3 92  ? 6.442   -7.648  -21.232 1.00 30.03  ? 69   TYR A OH    1 
ATOM   1378 N  N     . GLY E 3 93  ? 13.030  -6.607  -15.642 1.00 21.67  ? 70   GLY A N     1 
ATOM   1379 C  CA    . GLY E 3 93  ? 13.878  -6.441  -14.478 1.00 22.43  ? 70   GLY A CA    1 
ATOM   1380 C  C     . GLY E 3 93  ? 13.746  -7.542  -13.441 1.00 23.26  ? 70   GLY A C     1 
ATOM   1381 O  O     . GLY E 3 93  ? 14.326  -7.448  -12.358 1.00 25.08  ? 70   GLY A O     1 
ATOM   1382 N  N     . ILE E 3 94  ? 12.983  -8.582  -13.759 1.00 21.93  ? 71   ILE A N     1 
ATOM   1383 C  CA    . ILE E 3 94  ? 12.805  -9.696  -12.838 1.00 21.20  ? 71   ILE A CA    1 
ATOM   1384 C  C     . ILE E 3 94  ? 14.094  -10.504 -12.766 1.00 22.97  ? 71   ILE A C     1 
ATOM   1385 O  O     . ILE E 3 94  ? 14.740  -10.751 -13.783 1.00 24.65  ? 71   ILE A O     1 
ATOM   1386 C  CB    . ILE E 3 94  ? 11.667  -10.606 -13.296 1.00 20.25  ? 71   ILE A CB    1 
ATOM   1387 C  CG1   . ILE E 3 94  ? 10.350  -9.828  -13.259 1.00 19.04  ? 71   ILE A CG1   1 
ATOM   1388 C  CG2   . ILE E 3 94  ? 11.603  -11.840 -12.413 1.00 19.62  ? 71   ILE A CG2   1 
ATOM   1389 C  CD1   . ILE E 3 94  ? 9.187   -10.566 -13.865 1.00 17.87  ? 71   ILE A CD1   1 
ATOM   1390 N  N     . SER E 3 95  ? 14.470  -10.909 -11.559 1.00 24.09  ? 72   SER A N     1 
ATOM   1391 C  CA    . SER E 3 95  ? 15.697  -11.668 -11.356 1.00 23.81  ? 72   SER A CA    1 
ATOM   1392 C  C     . SER E 3 95  ? 15.444  -12.882 -10.477 1.00 24.72  ? 72   SER A C     1 
ATOM   1393 O  O     . SER E 3 95  ? 14.420  -12.954 -9.799  1.00 25.60  ? 72   SER A O     1 
ATOM   1394 C  CB    . SER E 3 95  ? 16.749  -10.775 -10.711 1.00 22.73  ? 72   SER A CB    1 
ATOM   1395 O  OG    . SER E 3 95  ? 17.969  -11.466 -10.567 1.00 27.55  ? 72   SER A OG    1 
ATOM   1396 N  N     . ARG E 3 96  ? 16.374  -13.833 -10.478 1.00 25.91  ? 73   ARG A N     1 
ATOM   1397 C  CA    . ARG E 3 96  ? 16.200  -15.040 -9.680  1.00 27.95  ? 73   ARG A CA    1 
ATOM   1398 C  C     . ARG E 3 96  ? 16.028  -14.774 -8.195  1.00 30.32  ? 73   ARG A C     1 
ATOM   1399 O  O     . ARG E 3 96  ? 16.649  -13.872 -7.630  1.00 31.79  ? 73   ARG A O     1 
ATOM   1400 C  CB    . ARG E 3 96  ? 17.366  -16.012 -9.875  1.00 27.00  ? 73   ARG A CB    1 
ATOM   1401 C  CG    . ARG E 3 96  ? 17.287  -17.232 -8.948  1.00 27.69  ? 73   ARG A CG    1 
ATOM   1402 C  CD    . ARG E 3 96  ? 17.638  -18.522 -9.668  1.00 27.86  ? 73   ARG A CD    1 
ATOM   1403 N  NE    . ARG E 3 96  ? 19.019  -18.524 -10.135 1.00 30.14  ? 73   ARG A NE    1 
ATOM   1404 C  CZ    . ARG E 3 96  ? 19.468  -19.262 -11.147 1.00 31.54  ? 73   ARG A CZ    1 
ATOM   1405 N  NH1   . ARG E 3 96  ? 18.643  -20.064 -11.807 1.00 30.46  ? 73   ARG A NH1   1 
ATOM   1406 N  NH2   . ARG E 3 96  ? 20.744  -19.192 -11.507 1.00 32.40  ? 73   ARG A NH2   1 
ATOM   1407 N  N     . MET E 3 97  ? 15.166  -15.579 -7.580  1.00 32.25  ? 74   MET A N     1 
ATOM   1408 C  CA    . MET E 3 97  ? 14.870  -15.499 -6.158  1.00 33.54  ? 74   MET A CA    1 
ATOM   1409 C  C     . MET E 3 97  ? 14.004  -14.314 -5.729  1.00 35.61  ? 74   MET A C     1 
ATOM   1410 O  O     . MET E 3 97  ? 13.778  -14.104 -4.539  1.00 35.76  ? 74   MET A O     1 
ATOM   1411 C  CB    . MET E 3 97  ? 16.171  -15.534 -5.361  1.00 31.46  ? 74   MET A CB    1 
ATOM   1412 C  CG    . MET E 3 97  ? 16.879  -16.878 -5.419  1.00 29.84  ? 74   MET A CG    1 
ATOM   1413 S  SD    . MET E 3 97  ? 15.939  -18.188 -4.605  1.00 30.78  ? 74   MET A SD    1 
ATOM   1414 C  CE    . MET E 3 97  ? 15.431  -19.172 -5.994  1.00 30.70  ? 74   MET A CE    1 
ATOM   1415 N  N     . ASP E 3 98  ? 13.532  -13.526 -6.689  1.00 37.91  ? 75   ASP A N     1 
ATOM   1416 C  CA    . ASP E 3 98  ? 12.640  -12.423 -6.358  1.00 39.78  ? 75   ASP A CA    1 
ATOM   1417 C  C     . ASP E 3 98  ? 11.359  -13.155 -5.984  1.00 40.55  ? 75   ASP A C     1 
ATOM   1418 O  O     . ASP E 3 98  ? 11.058  -14.201 -6.559  1.00 41.26  ? 75   ASP A O     1 
ATOM   1419 C  CB    . ASP E 3 98  ? 12.359  -11.538 -7.580  1.00 42.71  ? 75   ASP A CB    1 
ATOM   1420 C  CG    . ASP E 3 98  ? 13.513  -10.616 -7.923  1.00 46.23  ? 75   ASP A CG    1 
ATOM   1421 O  OD1   . ASP E 3 98  ? 13.355  -9.799  -8.859  1.00 45.68  ? 75   ASP A OD1   1 
ATOM   1422 O  OD2   . ASP E 3 98  ? 14.571  -10.704 -7.261  1.00 49.24  ? 75   ASP A OD2   1 
ATOM   1423 N  N     . THR E 3 99  ? 10.607  -12.636 -5.022  1.00 41.28  ? 76   THR A N     1 
ATOM   1424 C  CA    . THR E 3 99  ? 9.363   -13.296 -4.645  1.00 40.76  ? 76   THR A CA    1 
ATOM   1425 C  C     . THR E 3 99  ? 8.365   -13.097 -5.785  1.00 40.28  ? 76   THR A C     1 
ATOM   1426 O  O     . THR E 3 99  ? 8.413   -12.088 -6.488  1.00 41.01  ? 76   THR A O     1 
ATOM   1427 C  CB    . THR E 3 99  ? 8.793   -12.707 -3.347  1.00 39.27  ? 76   THR A CB    1 
ATOM   1428 O  OG1   . THR E 3 99  ? 8.470   -11.328 -3.546  1.00 39.46  ? 76   THR A OG1   1 
ATOM   1429 C  CG2   . THR E 3 99  ? 9.817   -12.810 -2.237  1.00 40.03  ? 76   THR A CG2   1 
ATOM   1430 N  N     . ILE E 3 100 ? 7.473   -14.061 -5.981  1.00 39.33  ? 77   ILE A N     1 
ATOM   1431 C  CA    . ILE E 3 100 ? 6.487   -13.953 -7.047  1.00 39.21  ? 77   ILE A CA    1 
ATOM   1432 C  C     . ILE E 3 100 ? 5.753   -12.622 -6.910  1.00 40.43  ? 77   ILE A C     1 
ATOM   1433 O  O     . ILE E 3 100 ? 5.434   -11.970 -7.904  1.00 40.99  ? 77   ILE A O     1 
ATOM   1434 C  CB    . ILE E 3 100 ? 5.441   -15.084 -6.971  1.00 38.64  ? 77   ILE A CB    1 
ATOM   1435 C  CG1   . ILE E 3 100 ? 6.105   -16.394 -6.550  1.00 38.37  ? 77   ILE A CG1   1 
ATOM   1436 C  CG2   . ILE E 3 100 ? 4.785   -15.268 -8.328  1.00 37.64  ? 77   ILE A CG2   1 
ATOM   1437 C  CD1   . ILE E 3 100 ? 5.119   -17.457 -6.122  0.00 38.85  ? 77   ILE A CD1   1 
ATOM   1438 N  N     . GLN E 3 101 ? 5.497   -12.225 -5.665  1.00 40.82  ? 78   GLN A N     1 
ATOM   1439 C  CA    . GLN E 3 101 ? 4.790   -10.984 -5.373  1.00 41.55  ? 78   GLN A CA    1 
ATOM   1440 C  C     . GLN E 3 101 ? 5.511   -9.786  -5.972  1.00 40.85  ? 78   GLN A C     1 
ATOM   1441 O  O     . GLN E 3 101 ? 4.888   -8.913  -6.570  1.00 41.70  ? 78   GLN A O     1 
ATOM   1442 C  CB    . GLN E 3 101 ? 4.667   -10.783 -3.864  1.00 44.82  ? 78   GLN A CB    1 
ATOM   1443 C  CG    . GLN E 3 101 ? 4.540   -12.068 -3.054  1.00 51.23  ? 78   GLN A CG    1 
ATOM   1444 C  CD    . GLN E 3 101 ? 3.413   -12.968 -3.524  1.00 53.05  ? 78   GLN A CD    1 
ATOM   1445 O  OE1   . GLN E 3 101 ? 2.269   -12.531 -3.673  1.00 53.99  ? 78   GLN A OE1   1 
ATOM   1446 N  NE2   . GLN E 3 101 ? 3.731   -14.241 -3.749  1.00 53.05  ? 78   GLN A NE2   1 
ATOM   1447 N  N     . GLU E 3 102 ? 6.827   -9.744  -5.799  1.00 39.81  ? 79   GLU A N     1 
ATOM   1448 C  CA    . GLU E 3 102 ? 7.624   -8.646  -6.326  1.00 39.16  ? 79   GLU A CA    1 
ATOM   1449 C  C     . GLU E 3 102 ? 7.608   -8.658  -7.845  1.00 37.10  ? 79   GLU A C     1 
ATOM   1450 O  O     . GLU E 3 102 ? 7.361   -7.636  -8.480  1.00 38.06  ? 79   GLU A O     1 
ATOM   1451 C  CB    . GLU E 3 102 ? 9.069   -8.741  -5.824  1.00 41.77  ? 79   GLU A CB    1 
ATOM   1452 C  CG    . GLU E 3 102 ? 9.229   -8.527  -4.320  1.00 46.76  ? 79   GLU A CG    1 
ATOM   1453 C  CD    . GLU E 3 102 ? 10.675  -8.638  -3.849  1.00 49.72  ? 79   GLU A CD    1 
ATOM   1454 O  OE1   . GLU E 3 102 ? 10.922  -8.462  -2.634  1.00 50.31  ? 79   GLU A OE1   1 
ATOM   1455 O  OE2   . GLU E 3 102 ? 11.564  -8.899  -4.690  1.00 50.64  ? 79   GLU A OE2   1 
ATOM   1456 N  N     . ALA E 3 103 ? 7.865   -9.823  -8.426  1.00 34.66  ? 80   ALA A N     1 
ATOM   1457 C  CA    . ALA E 3 103 ? 7.886   -9.959  -9.874  1.00 32.44  ? 80   ALA A CA    1 
ATOM   1458 C  C     . ALA E 3 103 ? 6.601   -9.435  -10.504 1.00 31.27  ? 80   ALA A C     1 
ATOM   1459 O  O     . ALA E 3 103 ? 6.644   -8.612  -11.416 1.00 31.78  ? 80   ALA A O     1 
ATOM   1460 C  CB    . ALA E 3 103 ? 8.100   -11.414 -10.256 1.00 31.30  ? 80   ALA A CB    1 
ATOM   1461 N  N     . LEU E 3 104 ? 5.462   -9.906  -10.008 1.00 28.71  ? 81   LEU A N     1 
ATOM   1462 C  CA    . LEU E 3 104 ? 4.168   -9.492  -10.536 1.00 27.26  ? 81   LEU A CA    1 
ATOM   1463 C  C     . LEU E 3 104 ? 3.976   -7.984  -10.529 1.00 27.71  ? 81   LEU A C     1 
ATOM   1464 O  O     . LEU E 3 104 ? 3.164   -7.457  -11.285 1.00 28.69  ? 81   LEU A O     1 
ATOM   1465 C  CB    . LEU E 3 104 ? 3.037   -10.171 -9.755  1.00 26.04  ? 81   LEU A CB    1 
ATOM   1466 C  CG    . LEU E 3 104 ? 2.768   -11.637 -10.118 1.00 24.79  ? 81   LEU A CG    1 
ATOM   1467 C  CD1   . LEU E 3 104 ? 2.098   -12.354 -8.961  1.00 21.62  ? 81   LEU A CD1   1 
ATOM   1468 C  CD2   . LEU E 3 104 ? 1.914   -11.701 -11.379 1.00 23.41  ? 81   LEU A CD2   1 
ATOM   1469 N  N     . LYS E 3 105 ? 4.720   -7.288  -9.676  1.00 29.17  ? 82   LYS A N     1 
ATOM   1470 C  CA    . LYS E 3 105 ? 4.619   -5.836  -9.605  1.00 30.00  ? 82   LYS A CA    1 
ATOM   1471 C  C     . LYS E 3 105 ? 5.492   -5.235  -10.697 1.00 29.48  ? 82   LYS A C     1 
ATOM   1472 O  O     . LYS E 3 105 ? 5.458   -4.032  -10.946 1.00 30.72  ? 82   LYS A O     1 
ATOM   1473 C  CB    . LYS E 3 105 ? 5.084   -5.325  -8.240  1.00 32.12  ? 82   LYS A CB    1 
ATOM   1474 C  CG    . LYS E 3 105 ? 4.194   -5.706  -7.074  1.00 36.15  ? 82   LYS A CG    1 
ATOM   1475 C  CD    . LYS E 3 105 ? 4.813   -5.222  -5.764  1.00 42.50  ? 82   LYS A CD    1 
ATOM   1476 C  CE    . LYS E 3 105 ? 3.998   -5.653  -4.544  1.00 45.78  ? 82   LYS A CE    1 
ATOM   1477 N  NZ    . LYS E 3 105 ? 4.661   -5.265  -3.264  1.00 46.20  ? 82   LYS A NZ    1 
ATOM   1478 N  N     . LYS E 3 106 ? 6.285   -6.084  -11.339 1.00 28.92  ? 83   LYS A N     1 
ATOM   1479 C  CA    . LYS E 3 106 ? 7.161   -5.640  -12.412 1.00 28.90  ? 83   LYS A CA    1 
ATOM   1480 C  C     . LYS E 3 106 ? 6.553   -5.994  -13.764 1.00 27.91  ? 83   LYS A C     1 
ATOM   1481 O  O     . LYS E 3 106 ? 6.678   -5.243  -14.725 1.00 26.71  ? 83   LYS A O     1 
ATOM   1482 C  CB    . LYS E 3 106 ? 8.540   -6.280  -12.263 1.00 30.38  ? 83   LYS A CB    1 
ATOM   1483 C  CG    . LYS E 3 106 ? 9.260   -5.869  -10.985 1.00 32.85  ? 83   LYS A CG    1 
ATOM   1484 C  CD    . LYS E 3 106 ? 10.734  -6.257  -11.008 1.00 33.63  ? 83   LYS A CD    1 
ATOM   1485 C  CE    . LYS E 3 106 ? 11.441  -5.785  -9.746  1.00 32.92  ? 83   LYS A CE    1 
ATOM   1486 N  NZ    . LYS E 3 106 ? 12.897  -6.076  -9.777  1.00 33.89  ? 83   LYS A NZ    1 
ATOM   1487 N  N     . CYS E 3 107 ? 5.887   -7.142  -13.822 1.00 28.16  ? 84   CYS A N     1 
ATOM   1488 C  CA    . CYS E 3 107 ? 5.239   -7.604  -15.043 1.00 29.31  ? 84   CYS A CA    1 
ATOM   1489 C  C     . CYS E 3 107 ? 3.945   -8.310  -14.668 1.00 27.72  ? 84   CYS A C     1 
ATOM   1490 O  O     . CYS E 3 107 ? 3.921   -9.522  -14.483 1.00 28.01  ? 84   CYS A O     1 
ATOM   1491 C  CB    . CYS E 3 107 ? 6.153   -8.569  -15.801 1.00 33.12  ? 84   CYS A CB    1 
ATOM   1492 S  SG    . CYS E 3 107 ? 5.471   -9.175  -17.368 1.00 41.03  ? 84   CYS A SG    1 
ATOM   1493 N  N     . SER E 3 108 ? 2.870   -7.544  -14.549 1.00 27.40  ? 85   SER A N     1 
ATOM   1494 C  CA    . SER E 3 108 ? 1.577   -8.101  -14.182 1.00 27.46  ? 85   SER A CA    1 
ATOM   1495 C  C     . SER E 3 108 ? 1.158   -9.273  -15.070 1.00 28.52  ? 85   SER A C     1 
ATOM   1496 O  O     . SER E 3 108 ? 0.320   -10.079 -14.670 1.00 29.31  ? 85   SER A O     1 
ATOM   1497 C  CB    . SER E 3 108 ? 0.507   -7.008  -14.226 1.00 26.25  ? 85   SER A CB    1 
ATOM   1498 O  OG    . SER E 3 108 ? 0.395   -6.453  -15.524 1.00 26.84  ? 85   SER A OG    1 
ATOM   1499 N  N     . ASN E 3 109 ? 1.741   -9.369  -16.266 1.00 29.86  ? 86   ASN A N     1 
ATOM   1500 C  CA    . ASN E 3 109 ? 1.418   -10.449 -17.205 1.00 29.63  ? 86   ASN A CA    1 
ATOM   1501 C  C     . ASN E 3 109 ? 2.402   -11.608 -17.133 1.00 27.97  ? 86   ASN A C     1 
ATOM   1502 O  O     . ASN E 3 109 ? 2.498   -12.411 -18.057 1.00 28.66  ? 86   ASN A O     1 
ATOM   1503 C  CB    . ASN E 3 109 ? 1.388   -9.932  -18.645 1.00 32.00  ? 86   ASN A CB    1 
ATOM   1504 C  CG    . ASN E 3 109 ? 0.281   -8.933  -18.884 1.00 34.67  ? 86   ASN A CG    1 
ATOM   1505 O  OD1   . ASN E 3 109 ? -0.864  -9.153  -18.486 1.00 36.93  ? 86   ASN A OD1   1 
ATOM   1506 N  ND2   . ASN E 3 109 ? 0.612   -7.831  -19.552 1.00 34.33  ? 86   ASN A ND2   1 
ATOM   1507 N  N     . LEU E 3 110 ? 3.137   -11.686 -16.035 1.00 26.80  ? 87   LEU A N     1 
ATOM   1508 C  CA    . LEU E 3 110 ? 4.109   -12.748 -15.836 1.00 24.50  ? 87   LEU A CA    1 
ATOM   1509 C  C     . LEU E 3 110 ? 3.380   -14.089 -15.866 1.00 23.39  ? 87   LEU A C     1 
ATOM   1510 O  O     . LEU E 3 110 ? 2.219   -14.182 -15.481 1.00 22.29  ? 87   LEU A O     1 
ATOM   1511 C  CB    . LEU E 3 110 ? 4.791   -12.560 -14.482 1.00 25.67  ? 87   LEU A CB    1 
ATOM   1512 C  CG    . LEU E 3 110 ? 6.079   -13.329 -14.218 1.00 26.38  ? 87   LEU A CG    1 
ATOM   1513 C  CD1   . LEU E 3 110 ? 7.172   -12.811 -15.138 1.00 27.36  ? 87   LEU A CD1   1 
ATOM   1514 C  CD2   . LEU E 3 110 ? 6.482   -13.153 -12.768 1.00 26.24  ? 87   LEU A CD2   1 
ATOM   1515 N  N     . ILE E 3 111 ? 4.058   -15.129 -16.327 1.00 23.31  ? 88   ILE A N     1 
ATOM   1516 C  CA    . ILE E 3 111 ? 3.442   -16.447 -16.386 1.00 22.72  ? 88   ILE A CA    1 
ATOM   1517 C  C     . ILE E 3 111 ? 4.150   -17.384 -15.420 1.00 22.89  ? 88   ILE A C     1 
ATOM   1518 O  O     . ILE E 3 111 ? 5.054   -18.126 -15.799 1.00 23.13  ? 88   ILE A O     1 
ATOM   1519 C  CB    . ILE E 3 111 ? 3.515   -17.042 -17.804 1.00 22.11  ? 88   ILE A CB    1 
ATOM   1520 C  CG1   . ILE E 3 111 ? 2.866   -16.083 -18.804 1.00 22.82  ? 88   ILE A CG1   1 
ATOM   1521 C  CG2   . ILE E 3 111 ? 2.811   -18.388 -17.836 1.00 18.89  ? 88   ILE A CG2   1 
ATOM   1522 C  CD1   . ILE E 3 111 ? 3.093   -16.461 -20.256 1.00 24.68  ? 88   ILE A CD1   1 
ATOM   1523 N  N     . PRO E 3 112 ? 3.756   -17.348 -14.145 1.00 23.06  ? 89   PRO A N     1 
ATOM   1524 C  CA    . PRO E 3 112 ? 4.380   -18.215 -13.147 1.00 23.44  ? 89   PRO A CA    1 
ATOM   1525 C  C     . PRO E 3 112 ? 3.852   -19.643 -13.214 1.00 23.31  ? 89   PRO A C     1 
ATOM   1526 O  O     . PRO E 3 112 ? 2.647   -19.870 -13.334 1.00 22.97  ? 89   PRO A O     1 
ATOM   1527 C  CB    . PRO E 3 112 ? 4.036   -17.525 -11.835 1.00 22.66  ? 89   PRO A CB    1 
ATOM   1528 C  CG    . PRO E 3 112 ? 2.683   -16.972 -12.119 1.00 23.79  ? 89   PRO A CG    1 
ATOM   1529 C  CD    . PRO E 3 112 ? 2.839   -16.389 -13.507 1.00 23.00  ? 89   PRO A CD    1 
ATOM   1530 N  N     . ILE E 3 113 ? 4.775   -20.595 -13.153 1.00 22.50  ? 90   ILE A N     1 
ATOM   1531 C  CA    . ILE E 3 113 ? 4.447   -22.011 -13.182 1.00 21.33  ? 90   ILE A CA    1 
ATOM   1532 C  C     . ILE E 3 113 ? 5.218   -22.648 -12.033 1.00 22.96  ? 90   ILE A C     1 
ATOM   1533 O  O     . ILE E 3 113 ? 6.440   -22.512 -11.945 1.00 24.01  ? 90   ILE A O     1 
ATOM   1534 C  CB    . ILE E 3 113 ? 4.883   -22.661 -14.511 1.00 19.34  ? 90   ILE A CB    1 
ATOM   1535 C  CG1   . ILE E 3 113 ? 4.215   -21.941 -15.684 1.00 19.03  ? 90   ILE A CG1   1 
ATOM   1536 C  CG2   . ILE E 3 113 ? 4.508   -24.133 -14.519 1.00 17.06  ? 90   ILE A CG2   1 
ATOM   1537 C  CD1   . ILE E 3 113 ? 4.658   -22.435 -17.049 1.00 18.19  ? 90   ILE A CD1   1 
ATOM   1538 N  N     . HIS E 3 114 ? 4.500   -23.329 -11.149 1.00 23.26  ? 91   HIS A N     1 
ATOM   1539 C  CA    . HIS E 3 114 ? 5.107   -23.977 -9.993  1.00 22.40  ? 91   HIS A CA    1 
ATOM   1540 C  C     . HIS E 3 114 ? 5.588   -25.366 -10.386 1.00 22.04  ? 91   HIS A C     1 
ATOM   1541 O  O     . HIS E 3 114 ? 4.947   -26.043 -11.189 1.00 22.79  ? 91   HIS A O     1 
ATOM   1542 C  CB    . HIS E 3 114 ? 4.069   -24.075 -8.871  1.00 24.41  ? 91   HIS A CB    1 
ATOM   1543 C  CG    . HIS E 3 114 ? 4.639   -24.451 -7.539  1.00 25.28  ? 91   HIS A CG    1 
ATOM   1544 N  ND1   . HIS E 3 114 ? 5.275   -25.652 -7.311  1.00 26.87  ? 91   HIS A ND1   1 
ATOM   1545 C  CD2   . HIS E 3 114 ? 4.651   -23.788 -6.359  1.00 24.99  ? 91   HIS A CD2   1 
ATOM   1546 C  CE1   . HIS E 3 114 ? 5.656   -25.713 -6.047  1.00 26.83  ? 91   HIS A CE1   1 
ATOM   1547 N  NE2   . HIS E 3 114 ? 5.289   -24.594 -5.448  1.00 27.04  ? 91   HIS A NE2   1 
ATOM   1548 N  N     . THR E 3 115 ? 6.715   -25.788 -9.823  1.00 21.65  ? 92   THR A N     1 
ATOM   1549 C  CA    . THR E 3 115 ? 7.265   -27.106 -10.120 1.00 20.87  ? 92   THR A CA    1 
ATOM   1550 C  C     . THR E 3 115 ? 6.259   -28.182 -9.742  1.00 22.58  ? 92   THR A C     1 
ATOM   1551 O  O     . THR E 3 115 ? 5.279   -27.918 -9.041  1.00 22.65  ? 92   THR A O     1 
ATOM   1552 C  CB    . THR E 3 115 ? 8.541   -27.402 -9.305  1.00 19.91  ? 92   THR A CB    1 
ATOM   1553 O  OG1   . THR E 3 115 ? 8.185   -27.641 -7.934  1.00 14.61  ? 92   THR A OG1   1 
ATOM   1554 C  CG2   . THR E 3 115 ? 9.519   -26.238 -9.392  1.00 19.18  ? 92   THR A CG2   1 
ATOM   1555 N  N     . ALA E 3 116 ? 6.508   -29.398 -10.213 1.00 23.34  ? 93   ALA A N     1 
ATOM   1556 C  CA    . ALA E 3 116 ? 5.650   -30.523 -9.887  1.00 22.89  ? 93   ALA A CA    1 
ATOM   1557 C  C     . ALA E 3 116 ? 5.929   -30.780 -8.414  1.00 23.03  ? 93   ALA A C     1 
ATOM   1558 O  O     . ALA E 3 116 ? 6.946   -30.319 -7.894  1.00 23.56  ? 93   ALA A O     1 
ATOM   1559 C  CB    . ALA E 3 116 ? 6.041   -31.723 -10.714 1.00 23.35  ? 93   ALA A CB    1 
ATOM   1560 N  N     . VAL E 3 117 ? 5.044   -31.505 -7.735  1.00 22.53  ? 94   VAL A N     1 
ATOM   1561 C  CA    . VAL E 3 117 ? 5.249   -31.778 -6.316  1.00 23.48  ? 94   VAL A CA    1 
ATOM   1562 C  C     . VAL E 3 117 ? 4.712   -33.121 -5.837  1.00 25.11  ? 94   VAL A C     1 
ATOM   1563 O  O     . VAL E 3 117 ? 3.873   -33.743 -6.488  1.00 24.56  ? 94   VAL A O     1 
ATOM   1564 C  CB    . VAL E 3 117 ? 4.601   -30.692 -5.440  1.00 22.27  ? 94   VAL A CB    1 
ATOM   1565 C  CG1   . VAL E 3 117 ? 5.269   -29.358 -5.680  1.00 24.21  ? 94   VAL A CG1   1 
ATOM   1566 C  CG2   . VAL E 3 117 ? 3.120   -30.602 -5.745  1.00 22.15  ? 94   VAL A CG2   1 
ATOM   1567 N  N     . PHE E 3 118 ? 5.219   -33.554 -4.687  1.00 26.79  ? 95   PHE A N     1 
ATOM   1568 C  CA    . PHE E 3 118 ? 4.802   -34.800 -4.053  1.00 28.66  ? 95   PHE A CA    1 
ATOM   1569 C  C     . PHE E 3 118 ? 3.908   -34.436 -2.877  1.00 31.01  ? 95   PHE A C     1 
ATOM   1570 O  O     . PHE E 3 118 ? 4.224   -33.505 -2.131  1.00 31.36  ? 95   PHE A O     1 
ATOM   1571 C  CB    . PHE E 3 118 ? 6.001   -35.564 -3.489  1.00 28.15  ? 95   PHE A CB    1 
ATOM   1572 C  CG    . PHE E 3 118 ? 6.706   -36.434 -4.481  1.00 27.72  ? 95   PHE A CG    1 
ATOM   1573 C  CD1   . PHE E 3 118 ? 7.914   -36.033 -5.043  1.00 27.19  ? 95   PHE A CD1   1 
ATOM   1574 C  CD2   . PHE E 3 118 ? 6.186   -37.678 -4.821  1.00 27.65  ? 95   PHE A CD2   1 
ATOM   1575 C  CE1   . PHE E 3 118 ? 8.597   -36.863 -5.926  1.00 26.88  ? 95   PHE A CE1   1 
ATOM   1576 C  CE2   . PHE E 3 118 ? 6.859   -38.516 -5.702  1.00 27.19  ? 95   PHE A CE2   1 
ATOM   1577 C  CZ    . PHE E 3 118 ? 8.069   -38.108 -6.256  1.00 27.56  ? 95   PHE A CZ    1 
ATOM   1578 N  N     . LYS E 3 119 ? 2.804   -35.155 -2.700  1.00 32.52  ? 96   LYS A N     1 
ATOM   1579 C  CA    . LYS E 3 119 ? 1.934   -34.878 -1.564  1.00 34.44  ? 96   LYS A CA    1 
ATOM   1580 C  C     . LYS E 3 119 ? 2.222   -35.908 -0.486  1.00 35.34  ? 96   LYS A C     1 
ATOM   1581 O  O     . LYS E 3 119 ? 2.352   -37.096 -0.776  1.00 35.58  ? 96   LYS A O     1 
ATOM   1582 C  CB    . LYS E 3 119 ? 0.459   -34.944 -1.953  1.00 34.86  ? 96   LYS A CB    1 
ATOM   1583 C  CG    . LYS E 3 119 ? -0.473  -34.594 -0.802  1.00 35.92  ? 96   LYS A CG    1 
ATOM   1584 C  CD    . LYS E 3 119 ? -1.890  -34.348 -1.287  1.00 39.94  ? 96   LYS A CD    1 
ATOM   1585 C  CE    . LYS E 3 119 ? -2.824  -34.022 -0.133  1.00 40.50  ? 96   LYS A CE    1 
ATOM   1586 N  NZ    . LYS E 3 119 ? -2.935  -35.171 0.807   1.00 44.02  ? 96   LYS A NZ    1 
ATOM   1587 N  N     . LYS E 3 120 ? 2.336   -35.446 0.754   1.00 35.95  ? 97   LYS A N     1 
ATOM   1588 C  CA    . LYS E 3 120 ? 2.621   -36.336 1.868   1.00 36.11  ? 97   LYS A CA    1 
ATOM   1589 C  C     . LYS E 3 120 ? 1.713   -37.558 1.802   1.00 36.39  ? 97   LYS A C     1 
ATOM   1590 O  O     . LYS E 3 120 ? 0.489   -37.431 1.751   1.00 36.42  ? 97   LYS A O     1 
ATOM   1591 C  CB    . LYS E 3 120 ? 2.414   -35.602 3.194   1.00 36.94  ? 97   LYS A CB    1 
ATOM   1592 C  CG    . LYS E 3 120 ? 2.884   -36.385 4.407   1.00 38.48  ? 97   LYS A CG    1 
ATOM   1593 C  CD    . LYS E 3 120 ? 2.677   -35.605 5.695   1.00 39.00  ? 97   LYS A CD    1 
ATOM   1594 C  CE    . LYS E 3 120 ? 1.206   -35.379 5.988   1.00 38.50  ? 97   LYS A CE    1 
ATOM   1595 N  NZ    . LYS E 3 120 ? 1.019   -34.648 7.271   1.00 40.52  ? 97   LYS A NZ    1 
ATOM   1596 N  N     . GLY E 3 121 ? 2.318   -38.741 1.779   1.00 36.63  ? 98   GLY A N     1 
ATOM   1597 C  CA    . GLY E 3 121 ? 1.535   -39.961 1.721   1.00 39.46  ? 98   GLY A CA    1 
ATOM   1598 C  C     . GLY E 3 121 ? 1.470   -40.649 0.367   1.00 40.05  ? 98   GLY A C     1 
ATOM   1599 O  O     . GLY E 3 121 ? 1.440   -41.882 0.308   1.00 41.69  ? 98   GLY A O     1 
ATOM   1600 N  N     . GLU E 3 122 ? 1.441   -39.872 -0.715  1.00 38.61  ? 99   GLU A N     1 
ATOM   1601 C  CA    . GLU E 3 122 ? 1.372   -40.439 -2.063  1.00 38.52  ? 99   GLU A CA    1 
ATOM   1602 C  C     . GLU E 3 122 ? 2.762   -40.749 -2.622  1.00 37.11  ? 99   GLU A C     1 
ATOM   1603 O  O     . GLU E 3 122 ? 3.731   -40.060 -2.316  1.00 37.65  ? 99   GLU A O     1 
ATOM   1604 C  CB    . GLU E 3 122 ? 0.629   -39.481 -2.997  1.00 40.41  ? 99   GLU A CB    1 
ATOM   1605 C  CG    . GLU E 3 122 ? -0.729  -39.048 -2.464  1.00 44.07  ? 99   GLU A CG    1 
ATOM   1606 C  CD    . GLU E 3 122 ? -1.510  -38.195 -3.446  1.00 46.55  ? 99   GLU A CD    1 
ATOM   1607 O  OE1   . GLU E 3 122 ? -0.954  -37.194 -3.946  1.00 48.90  ? 99   GLU A OE1   1 
ATOM   1608 O  OE2   . GLU E 3 122 ? -2.685  -38.524 -3.713  1.00 48.92  ? 99   GLU A OE2   1 
ATOM   1609 N  N     . ASP E 3 123 ? 2.849   -41.786 -3.450  1.00 36.19  ? 100  ASP A N     1 
ATOM   1610 C  CA    . ASP E 3 123 ? 4.121   -42.211 -4.030  1.00 36.49  ? 100  ASP A CA    1 
ATOM   1611 C  C     . ASP E 3 123 ? 4.334   -41.767 -5.477  1.00 35.69  ? 100  ASP A C     1 
ATOM   1612 O  O     . ASP E 3 123 ? 4.934   -42.493 -6.272  1.00 34.46  ? 100  ASP A O     1 
ATOM   1613 C  CB    . ASP E 3 123 ? 4.228   -43.734 -3.945  1.00 38.74  ? 100  ASP A CB    1 
ATOM   1614 C  CG    . ASP E 3 123 ? 3.027   -44.438 -4.562  1.00 41.23  ? 100  ASP A CG    1 
ATOM   1615 O  OD1   . ASP E 3 123 ? 2.922   -45.677 -4.424  1.00 42.25  ? 100  ASP A OD1   1 
ATOM   1616 O  OD2   . ASP E 3 123 ? 2.188   -43.753 -5.188  1.00 41.84  ? 100  ASP A OD2   1 
ATOM   1617 N  N     . PHE E 3 124 ? 3.856   -40.571 -5.811  1.00 33.84  ? 101  PHE A N     1 
ATOM   1618 C  CA    . PHE E 3 124 ? 3.994   -40.047 -7.165  1.00 31.18  ? 101  PHE A CA    1 
ATOM   1619 C  C     . PHE E 3 124 ? 3.901   -38.530 -7.157  1.00 30.79  ? 101  PHE A C     1 
ATOM   1620 O  O     . PHE E 3 124 ? 3.108   -37.960 -6.408  1.00 30.31  ? 101  PHE A O     1 
ATOM   1621 C  CB    . PHE E 3 124 ? 2.888   -40.619 -8.057  1.00 28.80  ? 101  PHE A CB    1 
ATOM   1622 C  CG    . PHE E 3 124 ? 1.507   -40.149 -7.688  1.00 27.75  ? 101  PHE A CG    1 
ATOM   1623 C  CD1   . PHE E 3 124 ? 0.992   -38.971 -8.221  1.00 28.02  ? 101  PHE A CD1   1 
ATOM   1624 C  CD2   . PHE E 3 124 ? 0.729   -40.869 -6.784  1.00 28.38  ? 101  PHE A CD2   1 
ATOM   1625 C  CE1   . PHE E 3 124 ? -0.281  -38.515 -7.859  1.00 28.21  ? 101  PHE A CE1   1 
ATOM   1626 C  CE2   . PHE E 3 124 ? -0.546  -40.422 -6.414  1.00 26.94  ? 101  PHE A CE2   1 
ATOM   1627 C  CZ    . PHE E 3 124 ? -1.049  -39.243 -6.952  1.00 27.03  ? 101  PHE A CZ    1 
ATOM   1628 N  N     . TRP E 3 125 ? 4.711   -37.874 -7.984  1.00 30.69  ? 102  TRP A N     1 
ATOM   1629 C  CA    . TRP E 3 125 ? 4.670   -36.419 -8.059  1.00 30.08  ? 102  TRP A CA    1 
ATOM   1630 C  C     . TRP E 3 125 ? 3.657   -35.991 -9.114  1.00 29.86  ? 102  TRP A C     1 
ATOM   1631 O  O     . TRP E 3 125 ? 3.273   -36.781 -9.974  1.00 27.94  ? 102  TRP A O     1 
ATOM   1632 C  CB    . TRP E 3 125 ? 6.048   -35.841 -8.374  1.00 28.31  ? 102  TRP A CB    1 
ATOM   1633 C  CG    . TRP E 3 125 ? 6.691   -36.415 -9.571  1.00 26.82  ? 102  TRP A CG    1 
ATOM   1634 C  CD1   . TRP E 3 125 ? 7.583   -37.442 -9.607  1.00 27.68  ? 102  TRP A CD1   1 
ATOM   1635 C  CD2   . TRP E 3 125 ? 6.524   -35.978 -10.921 1.00 26.72  ? 102  TRP A CD2   1 
ATOM   1636 N  NE1   . TRP E 3 125 ? 7.991   -37.670 -10.899 1.00 28.31  ? 102  TRP A NE1   1 
ATOM   1637 C  CE2   . TRP E 3 125 ? 7.355   -36.784 -11.726 1.00 26.36  ? 102  TRP A CE2   1 
ATOM   1638 C  CE3   . TRP E 3 125 ? 5.752   -34.982 -11.530 1.00 25.74  ? 102  TRP A CE3   1 
ATOM   1639 C  CZ2   . TRP E 3 125 ? 7.439   -36.623 -13.108 1.00 25.21  ? 102  TRP A CZ2   1 
ATOM   1640 C  CZ3   . TRP E 3 125 ? 5.836   -34.823 -12.906 1.00 24.27  ? 102  TRP A CZ3   1 
ATOM   1641 C  CH2   . TRP E 3 125 ? 6.674   -35.639 -13.679 1.00 24.57  ? 102  TRP A CH2   1 
ATOM   1642 N  N     . GLN E 3 126 ? 3.242   -34.731 -9.060  1.00 30.59  ? 103  GLN A N     1 
ATOM   1643 C  CA    . GLN E 3 126 ? 2.225   -34.248 -9.979  1.00 32.01  ? 103  GLN A CA    1 
ATOM   1644 C  C     . GLN E 3 126 ? 2.327   -32.739 -10.245 1.00 32.61  ? 103  GLN A C     1 
ATOM   1645 O  O     . GLN E 3 126 ? 2.948   -32.008 -9.472  1.00 34.83  ? 103  GLN A O     1 
ATOM   1646 C  CB    . GLN E 3 126 ? 0.872   -34.586 -9.360  1.00 31.98  ? 103  GLN A CB    1 
ATOM   1647 C  CG    . GLN E 3 126 ? -0.319  -34.486 -10.263 1.00 35.60  ? 103  GLN A CG    1 
ATOM   1648 C  CD    . GLN E 3 126 ? -1.564  -34.998 -9.577  1.00 36.74  ? 103  GLN A CD    1 
ATOM   1649 O  OE1   . GLN E 3 126 ? -2.063  -34.382 -8.633  1.00 38.27  ? 103  GLN A OE1   1 
ATOM   1650 N  NE2   . GLN E 3 126 ? -2.063  -36.142 -10.032 1.00 36.59  ? 103  GLN A NE2   1 
ATOM   1651 N  N     . TYR E 3 127 ? 1.730   -32.280 -11.345 1.00 30.83  ? 104  TYR A N     1 
ATOM   1652 C  CA    . TYR E 3 127 ? 1.735   -30.855 -11.679 1.00 29.20  ? 104  TYR A CA    1 
ATOM   1653 C  C     . TYR E 3 127 ? 0.375   -30.264 -11.346 1.00 30.30  ? 104  TYR A C     1 
ATOM   1654 O  O     . TYR E 3 127 ? -0.654  -30.777 -11.778 1.00 30.94  ? 104  TYR A O     1 
ATOM   1655 C  CB    . TYR E 3 127 ? 2.013   -30.616 -13.166 1.00 25.74  ? 104  TYR A CB    1 
ATOM   1656 C  CG    . TYR E 3 127 ? 3.471   -30.460 -13.536 1.00 23.26  ? 104  TYR A CG    1 
ATOM   1657 C  CD1   . TYR E 3 127 ? 4.220   -31.547 -13.975 1.00 23.50  ? 104  TYR A CD1   1 
ATOM   1658 C  CD2   . TYR E 3 127 ? 4.097   -29.217 -13.476 1.00 22.95  ? 104  TYR A CD2   1 
ATOM   1659 C  CE1   . TYR E 3 127 ? 5.553   -31.402 -14.351 1.00 23.14  ? 104  TYR A CE1   1 
ATOM   1660 C  CE2   . TYR E 3 127 ? 5.433   -29.060 -13.848 1.00 21.80  ? 104  TYR A CE2   1 
ATOM   1661 C  CZ    . TYR E 3 127 ? 6.152   -30.159 -14.286 1.00 22.90  ? 104  TYR A CZ    1 
ATOM   1662 O  OH    . TYR E 3 127 ? 7.466   -30.023 -14.666 1.00 23.15  ? 104  TYR A OH    1 
ATOM   1663 N  N     . HIS E 3 128 ? 0.372   -29.183 -10.578 1.00 31.92  ? 105  HIS A N     1 
ATOM   1664 C  CA    . HIS E 3 128 ? -0.869  -28.532 -10.199 1.00 33.81  ? 105  HIS A CA    1 
ATOM   1665 C  C     . HIS E 3 128 ? -0.981  -27.189 -10.897 1.00 35.38  ? 105  HIS A C     1 
ATOM   1666 O  O     . HIS E 3 128 ? -1.062  -26.144 -10.255 1.00 35.17  ? 105  HIS A O     1 
ATOM   1667 C  CB    . HIS E 3 128 ? -0.919  -28.355 -8.683  1.00 35.24  ? 105  HIS A CB    1 
ATOM   1668 C  CG    . HIS E 3 128 ? -0.869  -29.647 -7.928  1.00 39.03  ? 105  HIS A CG    1 
ATOM   1669 N  ND1   . HIS E 3 128 ? -0.789  -29.704 -6.553  1.00 41.30  ? 105  HIS A ND1   1 
ATOM   1670 C  CD2   . HIS E 3 128 ? -0.888  -30.932 -8.355  1.00 40.32  ? 105  HIS A CD2   1 
ATOM   1671 C  CE1   . HIS E 3 128 ? -0.761  -30.967 -6.167  1.00 41.74  ? 105  HIS A CE1   1 
ATOM   1672 N  NE2   . HIS E 3 128 ? -0.820  -31.733 -7.242  1.00 41.14  ? 105  HIS A NE2   1 
ATOM   1673 N  N     . ASP E 3 129 ? -0.983  -27.231 -12.225 1.00 38.02  ? 106  ASP A N     1 
ATOM   1674 C  CA    . ASP E 3 129 ? -1.084  -26.024 -13.034 1.00 39.96  ? 106  ASP A CA    1 
ATOM   1675 C  C     . ASP E 3 129 ? -2.324  -25.215 -12.690 1.00 40.87  ? 106  ASP A C     1 
ATOM   1676 O  O     . ASP E 3 129 ? -3.421  -25.758 -12.574 1.00 40.74  ? 106  ASP A O     1 
ATOM   1677 C  CB    . ASP E 3 129 ? -1.091  -26.388 -14.519 1.00 40.32  ? 106  ASP A CB    1 
ATOM   1678 C  CG    . ASP E 3 129 ? 0.292   -26.731 -15.034 1.00 41.71  ? 106  ASP A CG    1 
ATOM   1679 O  OD1   . ASP E 3 129 ? 1.149   -25.820 -15.065 1.00 41.71  ? 106  ASP A OD1   1 
ATOM   1680 O  OD2   . ASP E 3 129 ? 0.526   -27.905 -15.397 1.00 41.18  ? 106  ASP A OD2   1 
ATOM   1681 N  N     . GLY E 3 130 ? -2.133  -23.909 -12.525 1.00 42.07  ? 107  GLY A N     1 
ATOM   1682 C  CA    . GLY E 3 130 ? -3.235  -23.032 -12.183 1.00 42.70  ? 107  GLY A CA    1 
ATOM   1683 C  C     . GLY E 3 130 ? -3.312  -22.827 -10.685 1.00 43.21  ? 107  GLY A C     1 
ATOM   1684 O  O     . GLY E 3 130 ? -4.234  -22.186 -10.181 1.00 43.52  ? 107  GLY A O     1 
ATOM   1685 N  N     . CYS E 3 131 ? -2.335  -23.377 -9.971  1.00 43.30  ? 108  CYS A N     1 
ATOM   1686 C  CA    . CYS E 3 131 ? -2.286  -23.257 -8.520  1.00 43.59  ? 108  CYS A CA    1 
ATOM   1687 C  C     . CYS E 3 131 ? -0.986  -22.589 -8.095  1.00 43.43  ? 108  CYS A C     1 
ATOM   1688 O  O     . CYS E 3 131 ? 0.037   -22.729 -8.759  1.00 43.03  ? 108  CYS A O     1 
ATOM   1689 C  CB    . CYS E 3 131 ? -2.392  -24.640 -7.873  1.00 43.69  ? 108  CYS A CB    1 
ATOM   1690 S  SG    . CYS E 3 131 ? -3.843  -25.594 -8.379  1.00 43.33  ? 108  CYS A SG    1 
ATOM   1691 N  N     . GLY E 3 132 ? -1.037  -21.861 -6.985  1.00 43.84  ? 109  GLY A N     1 
ATOM   1692 C  CA    . GLY E 3 132 ? 0.143   -21.176 -6.490  1.00 44.20  ? 109  GLY A CA    1 
ATOM   1693 C  C     . GLY E 3 132 ? -0.221  -20.078 -5.511  1.00 44.70  ? 109  GLY A C     1 
ATOM   1694 O  O     . GLY E 3 132 ? -1.344  -19.570 -5.528  1.00 44.21  ? 109  GLY A O     1 
ATOM   1695 N  N     . SER E 3 133 ? 0.729   -19.708 -4.659  1.00 44.76  ? 110  SER A N     1 
ATOM   1696 C  CA    . SER E 3 133 ? 0.502   -18.667 -3.663  1.00 46.11  ? 110  SER A CA    1 
ATOM   1697 C  C     . SER E 3 133 ? 0.003   -17.370 -4.294  1.00 46.88  ? 110  SER A C     1 
ATOM   1698 O  O     . SER E 3 133 ? -0.723  -16.601 -3.664  1.00 46.95  ? 110  SER A O     1 
ATOM   1699 C  CB    . SER E 3 133 ? 1.791   -18.392 -2.887  1.00 45.97  ? 110  SER A CB    1 
ATOM   1700 O  OG    . SER E 3 133 ? 2.820   -17.939 -3.747  1.00 46.49  ? 110  SER A OG    1 
ATOM   1701 N  N     . TRP E 3 134 ? 0.395   -17.135 -5.542  1.00 47.25  ? 111  TRP A N     1 
ATOM   1702 C  CA    . TRP E 3 134 ? -0.002  -15.927 -6.253  1.00 48.02  ? 111  TRP A CA    1 
ATOM   1703 C  C     . TRP E 3 134 ? -1.471  -15.965 -6.664  1.00 49.26  ? 111  TRP A C     1 
ATOM   1704 O  O     . TRP E 3 134 ? -2.044  -14.940 -7.034  1.00 49.47  ? 111  TRP A O     1 
ATOM   1705 C  CB    . TRP E 3 134 ? 0.889   -15.731 -7.491  1.00 46.51  ? 111  TRP A CB    1 
ATOM   1706 C  CG    . TRP E 3 134 ? 0.709   -16.778 -8.561  1.00 44.00  ? 111  TRP A CG    1 
ATOM   1707 C  CD1   . TRP E 3 134 ? -0.267  -16.818 -9.516  1.00 43.42  ? 111  TRP A CD1   1 
ATOM   1708 C  CD2   . TRP E 3 134 ? 1.513   -17.946 -8.763  1.00 41.98  ? 111  TRP A CD2   1 
ATOM   1709 N  NE1   . TRP E 3 134 ? -0.121  -17.938 -10.299 1.00 41.92  ? 111  TRP A NE1   1 
ATOM   1710 C  CE2   . TRP E 3 134 ? 0.964   -18.647 -9.857  1.00 41.43  ? 111  TRP A CE2   1 
ATOM   1711 C  CE3   . TRP E 3 134 ? 2.643   -18.468 -8.124  1.00 41.47  ? 111  TRP A CE3   1 
ATOM   1712 C  CZ2   . TRP E 3 134 ? 1.509   -19.843 -10.327 1.00 41.70  ? 111  TRP A CZ2   1 
ATOM   1713 C  CZ3   . TRP E 3 134 ? 3.184   -19.659 -8.594  1.00 40.24  ? 111  TRP A CZ3   1 
ATOM   1714 C  CH2   . TRP E 3 134 ? 2.616   -20.332 -9.684  1.00 39.78  ? 111  TRP A CH2   1 
ATOM   1715 N  N     . VAL E 3 135 ? -2.078  -17.146 -6.591  1.00 50.36  ? 112  VAL A N     1 
ATOM   1716 C  CA    . VAL E 3 135 ? -3.477  -17.307 -6.968  1.00 52.58  ? 112  VAL A CA    1 
ATOM   1717 C  C     . VAL E 3 135 ? -4.432  -16.923 -5.839  1.00 55.49  ? 112  VAL A C     1 
ATOM   1718 O  O     . VAL E 3 135 ? -4.299  -17.390 -4.707  1.00 56.11  ? 112  VAL A O     1 
ATOM   1719 C  CB    . VAL E 3 135 ? -3.763  -18.754 -7.398  1.00 51.21  ? 112  VAL A CB    1 
ATOM   1720 C  CG1   . VAL E 3 135 ? -5.212  -18.889 -7.827  1.00 50.26  ? 112  VAL A CG1   1 
ATOM   1721 C  CG2   . VAL E 3 135 ? -2.832  -19.146 -8.533  1.00 50.46  ? 112  VAL A CG2   1 
ATOM   1722 N  N     . GLN E 3 136 ? -5.397  -16.068 -6.167  1.00 58.32  ? 113  GLN A N     1 
ATOM   1723 C  CA    . GLN E 3 136 ? -6.388  -15.584 -5.211  1.00 60.86  ? 113  GLN A CA    1 
ATOM   1724 C  C     . GLN E 3 136 ? -7.190  -16.718 -4.577  1.00 61.39  ? 113  GLN A C     1 
ATOM   1725 O  O     . GLN E 3 136 ? -7.241  -16.843 -3.353  1.00 62.37  ? 113  GLN A O     1 
ATOM   1726 C  CB    . GLN E 3 136 ? -7.340  -14.612 -5.909  1.00 63.59  ? 113  GLN A CB    1 
ATOM   1727 C  CG    . GLN E 3 136 ? -6.634  -13.484 -6.647  1.00 67.57  ? 113  GLN A CG    1 
ATOM   1728 C  CD    . GLN E 3 136 ? -5.898  -12.544 -5.713  1.00 69.94  ? 113  GLN A CD    1 
ATOM   1729 O  OE1   . GLN E 3 136 ? -6.515  -11.814 -4.936  1.00 71.75  ? 113  GLN A OE1   1 
ATOM   1730 N  NE2   . GLN E 3 136 ? -4.570  -12.560 -5.780  1.00 70.49  ? 113  GLN A NE2   1 
ATOM   1731 N  N     . ASP E 3 137 ? -7.820  -17.535 -5.415  1.00 60.83  ? 114  ASP A N     1 
ATOM   1732 C  CA    . ASP E 3 137 ? -8.623  -18.661 -4.947  1.00 60.78  ? 114  ASP A CA    1 
ATOM   1733 C  C     . ASP E 3 137 ? -7.888  -19.465 -3.869  1.00 60.43  ? 114  ASP A C     1 
ATOM   1734 O  O     . ASP E 3 137 ? -6.833  -20.048 -4.123  1.00 60.32  ? 114  ASP A O     1 
ATOM   1735 C  CB    . ASP E 3 137 ? -8.963  -19.574 -6.127  1.00 62.66  ? 114  ASP A CB    1 
ATOM   1736 C  CG    . ASP E 3 137 ? -9.984  -20.632 -5.770  1.00 64.48  ? 114  ASP A CG    1 
ATOM   1737 O  OD1   . ASP E 3 137 ? -9.772  -21.356 -4.777  1.00 65.66  ? 114  ASP A OD1   1 
ATOM   1738 O  OD2   . ASP E 3 137 ? -10.999 -20.742 -6.488  1.00 66.55  ? 114  ASP A OD2   1 
ATOM   1739 N  N     . PRO E 3 138 ? -8.447  -19.512 -2.650  1.00 59.75  ? 115  PRO A N     1 
ATOM   1740 C  CA    . PRO E 3 138 ? -7.849  -20.243 -1.527  1.00 59.03  ? 115  PRO A CA    1 
ATOM   1741 C  C     . PRO E 3 138 ? -7.801  -21.756 -1.726  1.00 57.39  ? 115  PRO A C     1 
ATOM   1742 O  O     . PRO E 3 138 ? -7.004  -22.449 -1.098  1.00 57.14  ? 115  PRO A O     1 
ATOM   1743 C  CB    . PRO E 3 138 ? -8.733  -19.841 -0.353  1.00 59.23  ? 115  PRO A CB    1 
ATOM   1744 C  CG    . PRO E 3 138 ? -10.070 -19.694 -1.001  1.00 60.36  ? 115  PRO A CG    1 
ATOM   1745 C  CD    . PRO E 3 138 ? -9.736  -18.919 -2.256  1.00 59.79  ? 115  PRO A CD    1 
ATOM   1746 N  N     . ALA E 3 139 ? -8.660  -22.266 -2.597  1.00 56.26  ? 116  ALA A N     1 
ATOM   1747 C  CA    . ALA E 3 139 ? -8.692  -23.694 -2.866  1.00 56.58  ? 116  ALA A CA    1 
ATOM   1748 C  C     . ALA E 3 139 ? -7.441  -24.102 -3.639  1.00 56.02  ? 116  ALA A C     1 
ATOM   1749 O  O     . ALA E 3 139 ? -6.688  -24.976 -3.208  1.00 56.46  ? 116  ALA A O     1 
ATOM   1750 C  CB    . ALA E 3 139 ? -9.940  -24.047 -3.665  1.00 58.49  ? 116  ALA A CB    1 
ATOM   1751 N  N     . LYS E 3 140 ? -7.227  -23.456 -4.781  1.00 53.96  ? 117  LYS A N     1 
ATOM   1752 C  CA    . LYS E 3 140 ? -6.076  -23.737 -5.630  1.00 51.79  ? 117  LYS A CA    1 
ATOM   1753 C  C     . LYS E 3 140 ? -4.786  -23.262 -4.962  1.00 49.72  ? 117  LYS A C     1 
ATOM   1754 O  O     . LYS E 3 140 ? -4.321  -22.153 -5.212  1.00 49.78  ? 117  LYS A O     1 
ATOM   1755 C  CB    . LYS E 3 140 ? -6.252  -23.035 -6.977  1.00 52.10  ? 117  LYS A CB    1 
ATOM   1756 C  CG    . LYS E 3 140 ? -7.644  -23.191 -7.558  1.00 53.77  ? 117  LYS A CG    1 
ATOM   1757 C  CD    . LYS E 3 140 ? -7.804  -22.401 -8.843  1.00 55.86  ? 117  LYS A CD    1 
ATOM   1758 C  CE    . LYS E 3 140 ? -9.258  -22.380 -9.288  1.00 56.80  ? 117  LYS A CE    1 
ATOM   1759 N  NZ    . LYS E 3 140 ? -9.820  -23.754 -9.415  1.00 57.59  ? 117  LYS A NZ    1 
ATOM   1760 N  N     . GLN E 3 141 ? -4.211  -24.113 -4.118  1.00 46.92  ? 118  GLN A N     1 
ATOM   1761 C  CA    . GLN E 3 141 ? -2.985  -23.780 -3.400  1.00 44.33  ? 118  GLN A CA    1 
ATOM   1762 C  C     . GLN E 3 141 ? -2.055  -24.983 -3.253  1.00 43.88  ? 118  GLN A C     1 
ATOM   1763 O  O     . GLN E 3 141 ? -2.498  -26.132 -3.255  1.00 44.88  ? 118  GLN A O     1 
ATOM   1764 C  CB    . GLN E 3 141 ? -3.331  -23.253 -2.008  1.00 43.68  ? 118  GLN A CB    1 
ATOM   1765 C  CG    . GLN E 3 141 ? -4.038  -21.915 -1.983  1.00 42.47  ? 118  GLN A CG    1 
ATOM   1766 C  CD    . GLN E 3 141 ? -3.114  -20.770 -2.323  1.00 43.14  ? 118  GLN A CD    1 
ATOM   1767 O  OE1   . GLN E 3 141 ? -2.002  -20.681 -1.800  1.00 43.77  ? 118  GLN A OE1   1 
ATOM   1768 N  NE2   . GLN E 3 141 ? -3.570  -19.879 -3.196  1.00 42.89  ? 118  GLN A NE2   1 
ATOM   1769 N  N     . ILE E 3 142 ? -0.762  -24.709 -3.115  1.00 41.96  ? 119  ILE A N     1 
ATOM   1770 C  CA    . ILE E 3 142 ? 0.236   -25.761 -2.947  1.00 40.69  ? 119  ILE A CA    1 
ATOM   1771 C  C     . ILE E 3 142 ? 0.924   -25.520 -1.609  1.00 41.03  ? 119  ILE A C     1 
ATOM   1772 O  O     . ILE E 3 142 ? 2.017   -24.953 -1.554  1.00 40.50  ? 119  ILE A O     1 
ATOM   1773 C  CB    . ILE E 3 142 ? 1.298   -25.715 -4.070  1.00 39.27  ? 119  ILE A CB    1 
ATOM   1774 C  CG1   . ILE E 3 142 ? 0.622   -25.830 -5.436  1.00 36.68  ? 119  ILE A CG1   1 
ATOM   1775 C  CG2   . ILE E 3 142 ? 2.298   -26.845 -3.889  1.00 39.10  ? 119  ILE A CG2   1 
ATOM   1776 C  CD1   . ILE E 3 142 ? 1.570   -25.654 -6.595  1.00 34.93  ? 119  ILE A CD1   1 
ATOM   1777 N  N     . SER E 3 143 ? 0.279   -25.954 -0.530  1.00 41.39  ? 120  SER A N     1 
ATOM   1778 C  CA    . SER E 3 143 ? 0.821   -25.751 0.809   1.00 42.25  ? 120  SER A CA    1 
ATOM   1779 C  C     . SER E 3 143 ? 2.140   -26.466 1.066   1.00 40.77  ? 120  SER A C     1 
ATOM   1780 O  O     . SER E 3 143 ? 2.200   -27.692 1.132   1.00 40.69  ? 120  SER A O     1 
ATOM   1781 C  CB    . SER E 3 143 ? -0.202  -26.167 1.873   1.00 44.04  ? 120  SER A CB    1 
ATOM   1782 O  OG    . SER E 3 143 ? -0.411  -27.567 1.876   1.00 47.57  ? 120  SER A OG    1 
ATOM   1783 N  N     . VAL E 3 144 ? 3.196   -25.678 1.219   1.00 40.22  ? 121  VAL A N     1 
ATOM   1784 C  CA    . VAL E 3 144 ? 4.524   -26.206 1.486   1.00 40.05  ? 121  VAL A CA    1 
ATOM   1785 C  C     . VAL E 3 144 ? 4.509   -27.106 2.725   1.00 39.55  ? 121  VAL A C     1 
ATOM   1786 O  O     . VAL E 3 144 ? 5.370   -27.968 2.886   1.00 39.87  ? 121  VAL A O     1 
ATOM   1787 C  CB    . VAL E 3 144 ? 5.532   -25.044 1.685   1.00 39.22  ? 121  VAL A CB    1 
ATOM   1788 C  CG1   . VAL E 3 144 ? 4.984   -24.054 2.693   1.00 40.42  ? 121  VAL A CG1   1 
ATOM   1789 C  CG2   . VAL E 3 144 ? 6.874   -25.578 2.144   1.00 39.64  ? 121  VAL A CG2   1 
ATOM   1790 N  N     . GLU E 3 145 ? 3.517   -26.914 3.589   1.00 39.80  ? 122  GLU A N     1 
ATOM   1791 C  CA    . GLU E 3 145 ? 3.402   -27.706 4.809   1.00 39.07  ? 122  GLU A CA    1 
ATOM   1792 C  C     . GLU E 3 145 ? 3.432   -29.207 4.532   1.00 38.65  ? 122  GLU A C     1 
ATOM   1793 O  O     . GLU E 3 145 ? 4.178   -29.945 5.176   1.00 38.14  ? 122  GLU A O     1 
ATOM   1794 C  CB    . GLU E 3 145 ? 2.116   -27.343 5.560   1.00 39.13  ? 122  GLU A CB    1 
ATOM   1795 C  CG    . GLU E 3 145 ? 0.839   -27.586 4.773   0.00 40.93  ? 122  GLU A CG    1 
ATOM   1796 C  CD    . GLU E 3 145 ? -0.406  -27.199 5.548   0.00 41.65  ? 122  GLU A CD    1 
ATOM   1797 O  OE1   . GLU E 3 145 ? -0.529  -26.015 5.925   0.00 42.10  ? 122  GLU A OE1   1 
ATOM   1798 O  OE2   . GLU E 3 145 ? -1.261  -28.080 5.780   0.00 42.10  ? 122  GLU A OE2   1 
ATOM   1799 N  N     . ASP E 3 146 ? 2.629   -29.655 3.570   1.00 38.54  ? 123  ASP A N     1 
ATOM   1800 C  CA    . ASP E 3 146 ? 2.577   -31.074 3.230   1.00 38.11  ? 123  ASP A CA    1 
ATOM   1801 C  C     . ASP E 3 146 ? 2.783   -31.354 1.738   1.00 35.89  ? 123  ASP A C     1 
ATOM   1802 O  O     . ASP E 3 146 ? 1.975   -32.030 1.100   1.00 34.14  ? 123  ASP A O     1 
ATOM   1803 C  CB    . ASP E 3 146 ? 1.249   -31.674 3.709   1.00 41.07  ? 123  ASP A CB    1 
ATOM   1804 C  CG    . ASP E 3 146 ? 0.046   -30.998 3.089   1.00 43.61  ? 123  ASP A CG    1 
ATOM   1805 O  OD1   . ASP E 3 146 ? -1.090  -31.273 3.534   1.00 44.61  ? 123  ASP A OD1   1 
ATOM   1806 O  OD2   . ASP E 3 146 ? 0.237   -30.196 2.151   1.00 46.13  ? 123  ASP A OD2   1 
ATOM   1807 N  N     . HIS E 3 147 ? 3.883   -30.831 1.201   1.00 34.06  ? 124  HIS A N     1 
ATOM   1808 C  CA    . HIS E 3 147 ? 4.257   -31.012 -0.199  1.00 32.28  ? 124  HIS A CA    1 
ATOM   1809 C  C     . HIS E 3 147 ? 5.776   -30.995 -0.322  1.00 31.72  ? 124  HIS A C     1 
ATOM   1810 O  O     . HIS E 3 147 ? 6.458   -30.285 0.420   1.00 31.78  ? 124  HIS A O     1 
ATOM   1811 C  CB    . HIS E 3 147 ? 3.679   -29.892 -1.071  1.00 31.56  ? 124  HIS A CB    1 
ATOM   1812 C  CG    . HIS E 3 147 ? 2.247   -30.095 -1.454  1.00 31.88  ? 124  HIS A CG    1 
ATOM   1813 N  ND1   . HIS E 3 147 ? 1.834   -31.128 -2.268  1.00 32.12  ? 124  HIS A ND1   1 
ATOM   1814 C  CD2   . HIS E 3 147 ? 1.129   -29.403 -1.128  1.00 31.82  ? 124  HIS A CD2   1 
ATOM   1815 C  CE1   . HIS E 3 147 ? 0.524   -31.064 -2.427  1.00 32.23  ? 124  HIS A CE1   1 
ATOM   1816 N  NE2   . HIS E 3 147 ? 0.072   -30.027 -1.745  1.00 33.25  ? 124  HIS A NE2   1 
ATOM   1817 N  N     . LYS E 3 148 ? 6.301   -31.786 -1.254  1.00 29.86  ? 125  LYS A N     1 
ATOM   1818 C  CA    . LYS E 3 148 ? 7.737   -31.844 -1.497  1.00 27.72  ? 125  LYS A CA    1 
ATOM   1819 C  C     . LYS E 3 148 ? 8.011   -31.558 -2.968  1.00 28.39  ? 125  LYS A C     1 
ATOM   1820 O  O     . LYS E 3 148 ? 7.372   -32.128 -3.854  1.00 27.03  ? 125  LYS A O     1 
ATOM   1821 C  CB    . LYS E 3 148 ? 8.298   -33.218 -1.133  1.00 26.38  ? 125  LYS A CB    1 
ATOM   1822 C  CG    . LYS E 3 148 ? 9.706   -33.436 -1.658  1.00 27.25  ? 125  LYS A CG    1 
ATOM   1823 C  CD    . LYS E 3 148 ? 10.268  -34.799 -1.296  1.00 25.81  ? 125  LYS A CD    1 
ATOM   1824 C  CE    . LYS E 3 148 ? 11.534  -35.089 -2.103  1.00 24.38  ? 125  LYS A CE    1 
ATOM   1825 N  NZ    . LYS E 3 148 ? 12.541  -33.989 -2.007  1.00 23.23  ? 125  LYS A NZ    1 
ATOM   1826 N  N     . VAL E 3 149 ? 8.963   -30.670 -3.226  1.00 29.22  ? 126  VAL A N     1 
ATOM   1827 C  CA    . VAL E 3 149 ? 9.303   -30.317 -4.596  1.00 30.40  ? 126  VAL A CA    1 
ATOM   1828 C  C     . VAL E 3 149 ? 9.905   -31.504 -5.327  1.00 30.47  ? 126  VAL A C     1 
ATOM   1829 O  O     . VAL E 3 149 ? 10.693  -32.258 -4.760  1.00 31.15  ? 126  VAL A O     1 
ATOM   1830 C  CB    . VAL E 3 149 ? 10.315  -29.149 -4.649  1.00 30.58  ? 126  VAL A CB    1 
ATOM   1831 C  CG1   . VAL E 3 149 ? 10.652  -28.815 -6.094  1.00 31.06  ? 126  VAL A CG1   1 
ATOM   1832 C  CG2   . VAL E 3 149 ? 9.738   -27.930 -3.952  1.00 31.36  ? 126  VAL A CG2   1 
ATOM   1833 N  N     . SER E 3 150 ? 9.514   -31.670 -6.585  1.00 30.32  ? 127  SER A N     1 
ATOM   1834 C  CA    . SER E 3 150 ? 10.027  -32.750 -7.413  1.00 29.80  ? 127  SER A CA    1 
ATOM   1835 C  C     . SER E 3 150 ? 10.827  -32.130 -8.541  1.00 29.42  ? 127  SER A C     1 
ATOM   1836 O  O     . SER E 3 150 ? 10.322  -31.282 -9.275  1.00 30.29  ? 127  SER A O     1 
ATOM   1837 C  CB    . SER E 3 150 ? 8.884   -33.579 -7.999  1.00 29.72  ? 127  SER A CB    1 
ATOM   1838 O  OG    . SER E 3 150 ? 9.390   -34.620 -8.822  1.00 30.42  ? 127  SER A OG    1 
ATOM   1839 N  N     . LEU E 3 151 ? 12.078  -32.548 -8.674  1.00 29.21  ? 128  LEU A N     1 
ATOM   1840 C  CA    . LEU E 3 151 ? 12.940  -32.026 -9.724  1.00 28.08  ? 128  LEU A CA    1 
ATOM   1841 C  C     . LEU E 3 151 ? 13.085  -33.045 -10.843 1.00 28.63  ? 128  LEU A C     1 
ATOM   1842 O  O     . LEU E 3 151 ? 13.883  -32.865 -11.759 1.00 28.61  ? 128  LEU A O     1 
ATOM   1843 C  CB    . LEU E 3 151 ? 14.319  -31.684 -9.152  1.00 25.14  ? 128  LEU A CB    1 
ATOM   1844 C  CG    . LEU E 3 151 ? 14.332  -30.655 -8.020  1.00 22.52  ? 128  LEU A CG    1 
ATOM   1845 C  CD1   . LEU E 3 151 ? 15.763  -30.314 -7.670  1.00 20.12  ? 128  LEU A CD1   1 
ATOM   1846 C  CD2   . LEU E 3 151 ? 13.580  -29.404 -8.441  1.00 21.45  ? 128  LEU A CD2   1 
ATOM   1847 N  N     . GLU E 3 152 ? 12.302  -34.114 -10.766 1.00 30.14  ? 129  GLU A N     1 
ATOM   1848 C  CA    . GLU E 3 152 ? 12.358  -35.164 -11.770 1.00 31.61  ? 129  GLU A CA    1 
ATOM   1849 C  C     . GLU E 3 152 ? 12.159  -34.659 -13.199 1.00 29.69  ? 129  GLU A C     1 
ATOM   1850 O  O     . GLU E 3 152 ? 12.868  -35.082 -14.109 1.00 30.84  ? 129  GLU A O     1 
ATOM   1851 C  CB    . GLU E 3 152 ? 11.338  -36.257 -11.450 1.00 35.78  ? 129  GLU A CB    1 
ATOM   1852 C  CG    . GLU E 3 152 ? 11.234  -37.330 -12.526 1.00 42.79  ? 129  GLU A CG    1 
ATOM   1853 C  CD    . GLU E 3 152 ? 10.612  -38.615 -12.011 1.00 47.36  ? 129  GLU A CD    1 
ATOM   1854 O  OE1   . GLU E 3 152 ? 10.155  -39.435 -12.839 1.00 48.74  ? 129  GLU A OE1   1 
ATOM   1855 O  OE2   . GLU E 3 152 ? 10.591  -38.811 -10.775 1.00 51.35  ? 129  GLU A OE2   1 
ATOM   1856 N  N     . PRO E 3 153 ? 11.189  -33.756 -13.420 1.00 27.15  ? 130  PRO A N     1 
ATOM   1857 C  CA    . PRO E 3 153 ? 10.974  -33.250 -14.780 1.00 25.70  ? 130  PRO A CA    1 
ATOM   1858 C  C     . PRO E 3 153 ? 12.241  -32.690 -15.432 1.00 24.83  ? 130  PRO A C     1 
ATOM   1859 O  O     . PRO E 3 153 ? 12.525  -32.955 -16.600 1.00 25.26  ? 130  PRO A O     1 
ATOM   1860 C  CB    . PRO E 3 153 ? 9.904   -32.186 -14.577 1.00 24.55  ? 130  PRO A CB    1 
ATOM   1861 C  CG    . PRO E 3 153 ? 9.081   -32.776 -13.489 1.00 24.69  ? 130  PRO A CG    1 
ATOM   1862 C  CD    . PRO E 3 153 ? 10.132  -33.272 -12.516 1.00 25.62  ? 130  PRO A CD    1 
ATOM   1863 N  N     . TYR E 3 154 ? 13.006  -31.920 -14.672 1.00 23.50  ? 131  TYR A N     1 
ATOM   1864 C  CA    . TYR E 3 154 ? 14.230  -31.334 -15.195 1.00 24.56  ? 131  TYR A CA    1 
ATOM   1865 C  C     . TYR E 3 154 ? 15.277  -32.416 -15.409 1.00 25.42  ? 131  TYR A C     1 
ATOM   1866 O  O     . TYR E 3 154 ? 16.135  -32.300 -16.283 1.00 25.24  ? 131  TYR A O     1 
ATOM   1867 C  CB    . TYR E 3 154 ? 14.731  -30.264 -14.226 1.00 23.68  ? 131  TYR A CB    1 
ATOM   1868 C  CG    . TYR E 3 154 ? 13.604  -29.372 -13.774 1.00 24.70  ? 131  TYR A CG    1 
ATOM   1869 C  CD1   . TYR E 3 154 ? 13.181  -29.361 -12.442 1.00 25.43  ? 131  TYR A CD1   1 
ATOM   1870 C  CD2   . TYR E 3 154 ? 12.886  -28.617 -14.697 1.00 22.00  ? 131  TYR A CD2   1 
ATOM   1871 C  CE1   . TYR E 3 154 ? 12.059  -28.627 -12.050 1.00 25.87  ? 131  TYR A CE1   1 
ATOM   1872 C  CE2   . TYR E 3 154 ? 11.770  -27.884 -14.316 1.00 23.29  ? 131  TYR A CE2   1 
ATOM   1873 C  CZ    . TYR E 3 154 ? 11.357  -27.894 -13.000 1.00 25.08  ? 131  TYR A CZ    1 
ATOM   1874 O  OH    . TYR E 3 154 ? 10.220  -27.201 -12.655 1.00 25.92  ? 131  TYR A OH    1 
ATOM   1875 N  N     . ARG E 3 155 ? 15.193  -33.475 -14.608 1.00 26.76  ? 132  ARG A N     1 
ATOM   1876 C  CA    . ARG E 3 155 ? 16.120  -34.596 -14.708 1.00 25.96  ? 132  ARG A CA    1 
ATOM   1877 C  C     . ARG E 3 155 ? 15.970  -35.224 -16.078 1.00 25.02  ? 132  ARG A C     1 
ATOM   1878 O  O     . ARG E 3 155 ? 16.930  -35.307 -16.837 1.00 23.92  ? 132  ARG A O     1 
ATOM   1879 C  CB    . ARG E 3 155 ? 15.799  -35.646 -13.648 1.00 28.02  ? 132  ARG A CB    1 
ATOM   1880 C  CG    . ARG E 3 155 ? 15.950  -35.173 -12.230 1.00 30.36  ? 132  ARG A CG    1 
ATOM   1881 C  CD    . ARG E 3 155 ? 17.385  -35.268 -11.767 1.00 33.34  ? 132  ARG A CD    1 
ATOM   1882 N  NE    . ARG E 3 155 ? 17.526  -34.717 -10.425 1.00 37.56  ? 132  ARG A NE    1 
ATOM   1883 C  CZ    . ARG E 3 155 ? 16.835  -35.134 -9.369  1.00 38.80  ? 132  ARG A CZ    1 
ATOM   1884 N  NH1   . ARG E 3 155 ? 15.948  -36.118 -9.494  1.00 37.17  ? 132  ARG A NH1   1 
ATOM   1885 N  NH2   . ARG E 3 155 ? 17.019  -34.552 -8.189  1.00 38.89  ? 132  ARG A NH2   1 
ATOM   1886 N  N     . ARG E 3 156 ? 14.751  -35.662 -16.377 1.00 25.60  ? 133  ARG A N     1 
ATOM   1887 C  CA    . ARG E 3 156 ? 14.436  -36.296 -17.648 1.00 28.05  ? 133  ARG A CA    1 
ATOM   1888 C  C     . ARG E 3 156 ? 14.947  -35.503 -18.843 1.00 28.10  ? 133  ARG A C     1 
ATOM   1889 O  O     . ARG E 3 156 ? 15.772  -35.995 -19.614 1.00 27.83  ? 133  ARG A O     1 
ATOM   1890 C  CB    . ARG E 3 156 ? 12.926  -36.491 -17.782 1.00 32.73  ? 133  ARG A CB    1 
ATOM   1891 C  CG    . ARG E 3 156 ? 12.339  -37.508 -16.825 1.00 40.91  ? 133  ARG A CG    1 
ATOM   1892 C  CD    . ARG E 3 156 ? 11.294  -38.357 -17.537 1.00 48.75  ? 133  ARG A CD    1 
ATOM   1893 N  NE    . ARG E 3 156 ? 10.196  -37.554 -18.066 1.00 55.76  ? 133  ARG A NE    1 
ATOM   1894 C  CZ    . ARG E 3 156 ? 9.276   -38.013 -18.909 1.00 59.63  ? 133  ARG A CZ    1 
ATOM   1895 N  NH1   . ARG E 3 156 ? 8.307   -37.213 -19.338 1.00 61.96  ? 133  ARG A NH1   1 
ATOM   1896 N  NH2   . ARG E 3 156 ? 9.330   -39.269 -19.334 1.00 60.95  ? 133  ARG A NH2   1 
ATOM   1897 N  N     . GLU E 3 157 ? 14.449  -34.280 -18.999 1.00 27.08  ? 134  GLU A N     1 
ATOM   1898 C  CA    . GLU E 3 157 ? 14.865  -33.432 -20.106 1.00 26.46  ? 134  GLU A CA    1 
ATOM   1899 C  C     . GLU E 3 157 ? 16.380  -33.395 -20.195 1.00 25.74  ? 134  GLU A C     1 
ATOM   1900 O  O     . GLU E 3 157 ? 16.956  -33.558 -21.266 1.00 26.35  ? 134  GLU A O     1 
ATOM   1901 C  CB    . GLU E 3 157 ? 14.314  -32.022 -19.922 1.00 26.29  ? 134  GLU A CB    1 
ATOM   1902 C  CG    . GLU E 3 157 ? 12.807  -31.982 -19.904 1.00 27.58  ? 134  GLU A CG    1 
ATOM   1903 C  CD    . GLU E 3 157 ? 12.204  -32.731 -21.077 1.00 30.03  ? 134  GLU A CD    1 
ATOM   1904 O  OE1   . GLU E 3 157 ? 12.430  -32.321 -22.238 1.00 30.76  ? 134  GLU A OE1   1 
ATOM   1905 O  OE2   . GLU E 3 157 ? 11.507  -33.739 -20.834 1.00 31.61  ? 134  GLU A OE2   1 
ATOM   1906 N  N     . SER E 3 158 ? 17.021  -33.183 -19.056 1.00 25.54  ? 135  SER A N     1 
ATOM   1907 C  CA    . SER E 3 158 ? 18.470  -33.146 -18.992 1.00 25.18  ? 135  SER A CA    1 
ATOM   1908 C  C     . SER E 3 158 ? 19.018  -34.426 -19.608 1.00 26.54  ? 135  SER A C     1 
ATOM   1909 O  O     . SER E 3 158 ? 19.878  -34.387 -20.485 1.00 25.79  ? 135  SER A O     1 
ATOM   1910 C  CB    . SER E 3 158 ? 18.914  -33.036 -17.533 1.00 25.41  ? 135  SER A CB    1 
ATOM   1911 O  OG    . SER E 3 158 ? 20.319  -33.142 -17.412 1.00 26.25  ? 135  SER A OG    1 
ATOM   1912 N  N     . ARG E 3 159 ? 18.498  -35.561 -19.148 1.00 28.84  ? 136  ARG A N     1 
ATOM   1913 C  CA    . ARG E 3 159 ? 18.925  -36.868 -19.632 1.00 30.58  ? 136  ARG A CA    1 
ATOM   1914 C  C     . ARG E 3 159 ? 18.755  -37.014 -21.143 1.00 30.32  ? 136  ARG A C     1 
ATOM   1915 O  O     . ARG E 3 159 ? 19.543  -37.691 -21.802 1.00 30.27  ? 136  ARG A O     1 
ATOM   1916 C  CB    . ARG E 3 159 ? 18.139  -37.974 -18.925 1.00 33.87  ? 136  ARG A CB    1 
ATOM   1917 C  CG    . ARG E 3 159 ? 18.855  -39.307 -18.927 1.00 40.18  ? 136  ARG A CG    1 
ATOM   1918 C  CD    . ARG E 3 159 ? 20.112  -39.215 -18.081 1.00 45.48  ? 136  ARG A CD    1 
ATOM   1919 N  NE    . ARG E 3 159 ? 21.179  -40.080 -18.571 1.00 50.88  ? 136  ARG A NE    1 
ATOM   1920 C  CZ    . ARG E 3 159 ? 22.395  -40.138 -18.037 1.00 53.96  ? 136  ARG A CZ    1 
ATOM   1921 N  NH1   . ARG E 3 159 ? 22.700  -39.379 -16.989 1.00 53.72  ? 136  ARG A NH1   1 
ATOM   1922 N  NH2   . ARG E 3 159 ? 23.313  -40.946 -18.555 1.00 55.92  ? 136  ARG A NH2   1 
ATOM   1923 N  N     . LYS E 3 160 ? 17.719  -36.389 -21.689 1.00 29.32  ? 137  LYS A N     1 
ATOM   1924 C  CA    . LYS E 3 160 ? 17.478  -36.456 -23.122 1.00 29.24  ? 137  LYS A CA    1 
ATOM   1925 C  C     . LYS E 3 160 ? 18.584  -35.716 -23.860 1.00 30.29  ? 137  LYS A C     1 
ATOM   1926 O  O     . LYS E 3 160 ? 19.278  -36.288 -24.699 1.00 31.35  ? 137  LYS A O     1 
ATOM   1927 C  CB    . LYS E 3 160 ? 16.125  -35.836 -23.454 1.00 29.30  ? 137  LYS A CB    1 
ATOM   1928 C  CG    . LYS E 3 160 ? 14.963  -36.571 -22.820 1.00 33.06  ? 137  LYS A CG    1 
ATOM   1929 C  CD    . LYS E 3 160 ? 13.629  -35.982 -23.234 1.00 34.02  ? 137  LYS A CD    1 
ATOM   1930 C  CE    . LYS E 3 160 ? 12.478  -36.742 -22.601 1.00 34.45  ? 137  LYS A CE    1 
ATOM   1931 N  NZ    . LYS E 3 160 ? 11.170  -36.164 -23.002 1.00 37.23  ? 137  LYS A NZ    1 
ATOM   1932 N  N     . ALA E 3 161 ? 18.750  -34.440 -23.540 1.00 30.19  ? 138  ALA A N     1 
ATOM   1933 C  CA    . ALA E 3 161 ? 19.781  -33.633 -24.169 1.00 30.47  ? 138  ALA A CA    1 
ATOM   1934 C  C     . ALA E 3 161 ? 21.121  -34.355 -24.110 1.00 30.12  ? 138  ALA A C     1 
ATOM   1935 O  O     . ALA E 3 161 ? 21.924  -34.268 -25.035 1.00 32.23  ? 138  ALA A O     1 
ATOM   1936 C  CB    . ALA E 3 161 ? 19.883  -32.279 -23.474 1.00 29.91  ? 138  ALA A CB    1 
ATOM   1937 N  N     . LEU E 3 162 ? 21.357  -35.080 -23.024 1.00 29.36  ? 139  LEU A N     1 
ATOM   1938 C  CA    . LEU E 3 162 ? 22.612  -35.803 -22.860 1.00 28.93  ? 139  LEU A CA    1 
ATOM   1939 C  C     . LEU E 3 162 ? 22.798  -36.904 -23.907 1.00 28.21  ? 139  LEU A C     1 
ATOM   1940 O  O     . LEU E 3 162 ? 23.900  -37.089 -24.423 1.00 27.95  ? 139  LEU A O     1 
ATOM   1941 C  CB    . LEU E 3 162 ? 22.698  -36.400 -21.452 1.00 28.10  ? 139  LEU A CB    1 
ATOM   1942 C  CG    . LEU E 3 162 ? 24.066  -36.939 -21.023 1.00 27.61  ? 139  LEU A CG    1 
ATOM   1943 C  CD1   . LEU E 3 162 ? 25.112  -35.841 -21.123 1.00 25.65  ? 139  LEU A CD1   1 
ATOM   1944 C  CD2   . LEU E 3 162 ? 23.981  -37.454 -19.597 1.00 29.35  ? 139  LEU A CD2   1 
ATOM   1945 N  N     . LYS E 3 163 ? 21.725  -37.632 -24.218 1.00 27.37  ? 140  LYS A N     1 
ATOM   1946 C  CA    . LYS E 3 163 ? 21.788  -38.707 -25.210 1.00 26.20  ? 140  LYS A CA    1 
ATOM   1947 C  C     . LYS E 3 163 ? 22.066  -38.158 -26.605 1.00 26.37  ? 140  LYS A C     1 
ATOM   1948 O  O     . LYS E 3 163 ? 22.711  -38.815 -27.422 1.00 27.17  ? 140  LYS A O     1 
ATOM   1949 C  CB    . LYS E 3 163 ? 20.480  -39.503 -25.233 1.00 23.93  ? 140  LYS A CB    1 
ATOM   1950 C  CG    . LYS E 3 163 ? 20.222  -40.302 -23.978 1.00 25.27  ? 140  LYS A CG    1 
ATOM   1951 C  CD    . LYS E 3 163 ? 18.919  -41.071 -24.076 1.00 26.73  ? 140  LYS A CD    1 
ATOM   1952 C  CE    . LYS E 3 163 ? 18.596  -41.771 -22.768 1.00 28.02  ? 140  LYS A CE    1 
ATOM   1953 N  NZ    . LYS E 3 163 ? 17.288  -42.482 -22.830 1.00 30.49  ? 140  LYS A NZ    1 
ATOM   1954 N  N     . ILE E 3 164 ? 21.570  -36.957 -26.880 1.00 25.21  ? 141  ILE A N     1 
ATOM   1955 C  CA    . ILE E 3 164 ? 21.792  -36.335 -28.174 1.00 24.29  ? 141  ILE A CA    1 
ATOM   1956 C  C     . ILE E 3 164 ? 23.247  -35.878 -28.245 1.00 24.45  ? 141  ILE A C     1 
ATOM   1957 O  O     . ILE E 3 164 ? 23.891  -35.975 -29.286 1.00 25.09  ? 141  ILE A O     1 
ATOM   1958 C  CB    . ILE E 3 164 ? 20.852  -35.126 -28.378 1.00 23.37  ? 141  ILE A CB    1 
ATOM   1959 C  CG1   . ILE E 3 164 ? 19.397  -35.602 -28.398 1.00 24.04  ? 141  ILE A CG1   1 
ATOM   1960 C  CG2   . ILE E 3 164 ? 21.183  -34.420 -29.678 1.00 20.69  ? 141  ILE A CG2   1 
ATOM   1961 C  CD1   . ILE E 3 164 ? 18.377  -34.480 -28.480 1.00 24.91  ? 141  ILE A CD1   1 
ATOM   1962 N  N     . PHE E 3 165 ? 23.765  -35.392 -27.125 1.00 23.99  ? 142  PHE A N     1 
ATOM   1963 C  CA    . PHE E 3 165 ? 25.143  -34.930 -27.065 1.00 25.52  ? 142  PHE A CA    1 
ATOM   1964 C  C     . PHE E 3 165 ? 26.131  -36.060 -27.299 1.00 27.19  ? 142  PHE A C     1 
ATOM   1965 O  O     . PHE E 3 165 ? 27.118  -35.895 -28.015 1.00 28.90  ? 142  PHE A O     1 
ATOM   1966 C  CB    . PHE E 3 165 ? 25.429  -34.288 -25.708 1.00 24.37  ? 142  PHE A CB    1 
ATOM   1967 C  CG    . PHE E 3 165 ? 24.914  -32.886 -25.579 1.00 23.46  ? 142  PHE A CG    1 
ATOM   1968 C  CD1   . PHE E 3 165 ? 24.206  -32.495 -24.448 1.00 20.88  ? 142  PHE A CD1   1 
ATOM   1969 C  CD2   . PHE E 3 165 ? 25.164  -31.948 -26.574 1.00 21.49  ? 142  PHE A CD2   1 
ATOM   1970 C  CE1   . PHE E 3 165 ? 23.760  -31.194 -24.307 1.00 18.75  ? 142  PHE A CE1   1 
ATOM   1971 C  CE2   . PHE E 3 165 ? 24.722  -30.643 -26.439 1.00 19.60  ? 142  PHE A CE2   1 
ATOM   1972 C  CZ    . PHE E 3 165 ? 24.018  -30.266 -25.302 1.00 18.38  ? 142  PHE A CZ    1 
ATOM   1973 N  N     . LYS E 3 166 ? 25.864  -37.211 -26.692 1.00 27.83  ? 143  LYS A N     1 
ATOM   1974 C  CA    . LYS E 3 166 ? 26.750  -38.356 -26.834 1.00 28.33  ? 143  LYS A CA    1 
ATOM   1975 C  C     . LYS E 3 166 ? 26.701  -38.972 -28.228 1.00 29.44  ? 143  LYS A C     1 
ATOM   1976 O  O     . LYS E 3 166 ? 27.655  -39.619 -28.662 1.00 29.80  ? 143  LYS A O     1 
ATOM   1977 C  CB    . LYS E 3 166 ? 26.412  -39.404 -25.775 1.00 27.21  ? 143  LYS A CB    1 
ATOM   1978 C  CG    . LYS E 3 166 ? 26.666  -38.921 -24.364 1.00 27.89  ? 143  LYS A CG    1 
ATOM   1979 C  CD    . LYS E 3 166 ? 26.742  -40.081 -23.388 1.00 32.17  ? 143  LYS A CD    1 
ATOM   1980 C  CE    . LYS E 3 166 ? 27.353  -39.640 -22.062 1.00 34.71  ? 143  LYS A CE    1 
ATOM   1981 N  NZ    . LYS E 3 166 ? 27.580  -40.788 -21.142 1.00 37.44  ? 143  LYS A NZ    1 
ATOM   1982 N  N     . SER E 3 167 ? 25.596  -38.759 -28.933 1.00 30.24  ? 144  SER A N     1 
ATOM   1983 C  CA    . SER E 3 167 ? 25.440  -39.300 -30.276 1.00 30.32  ? 144  SER A CA    1 
ATOM   1984 C  C     . SER E 3 167 ? 26.207  -38.458 -31.281 1.00 31.33  ? 144  SER A C     1 
ATOM   1985 O  O     . SER E 3 167 ? 26.466  -38.905 -32.395 1.00 34.62  ? 144  SER A O     1 
ATOM   1986 C  CB    . SER E 3 167 ? 23.965  -39.325 -30.681 1.00 31.01  ? 144  SER A CB    1 
ATOM   1987 O  OG    . SER E 3 167 ? 23.515  -38.032 -31.059 1.00 30.33  ? 144  SER A OG    1 
ATOM   1988 N  N     . ALA E 3 168 ? 26.567  -37.239 -30.897 1.00 30.74  ? 145  ALA A N     1 
ATOM   1989 C  CA    . ALA E 3 168 ? 27.291  -36.354 -31.801 1.00 31.07  ? 145  ALA A CA    1 
ATOM   1990 C  C     . ALA E 3 168 ? 28.765  -36.186 -31.435 1.00 31.79  ? 145  ALA A C     1 
ATOM   1991 O  O     . ALA E 3 168 ? 29.576  -35.794 -32.275 1.00 32.79  ? 145  ALA A O     1 
ATOM   1992 C  CB    . ALA E 3 168 ? 26.609  -34.996 -31.847 1.00 30.61  ? 145  ALA A CB    1 
ATOM   1993 N  N     . CYS E 3 169 ? 29.109  -36.479 -30.185 1.00 30.32  ? 146  CYS A N     1 
ATOM   1994 C  CA    . CYS E 3 169 ? 30.487  -36.350 -29.731 1.00 29.69  ? 146  CYS A CA    1 
ATOM   1995 C  C     . CYS E 3 169 ? 30.895  -37.582 -28.930 1.00 29.84  ? 146  CYS A C     1 
ATOM   1996 O  O     . CYS E 3 169 ? 30.122  -38.089 -28.117 1.00 30.49  ? 146  CYS A O     1 
ATOM   1997 C  CB    . CYS E 3 169 ? 30.640  -35.092 -28.877 1.00 29.68  ? 146  CYS A CB    1 
ATOM   1998 S  SG    . CYS E 3 169 ? 32.341  -34.718 -28.389 1.00 33.73  ? 146  CYS A SG    1 
ATOM   1999 N  N     . ASP E 3 170 ? 32.115  -38.053 -29.162 1.00 29.58  ? 147  ASP A N     1 
ATOM   2000 C  CA    . ASP E 3 170 ? 32.633  -39.236 -28.482 1.00 29.63  ? 147  ASP A CA    1 
ATOM   2001 C  C     . ASP E 3 170 ? 33.344  -38.889 -27.186 1.00 28.67  ? 147  ASP A C     1 
ATOM   2002 O  O     . ASP E 3 170 ? 34.330  -39.522 -26.822 1.00 28.82  ? 147  ASP A O     1 
ATOM   2003 C  CB    . ASP E 3 170 ? 33.600  -39.975 -29.400 1.00 32.93  ? 147  ASP A CB    1 
ATOM   2004 C  CG    . ASP E 3 170 ? 34.816  -39.142 -29.745 1.00 36.72  ? 147  ASP A CG    1 
ATOM   2005 O  OD1   . ASP E 3 170 ? 34.638  -37.963 -30.126 1.00 39.74  ? 147  ASP A OD1   1 
ATOM   2006 O  OD2   . ASP E 3 170 ? 35.946  -39.664 -29.639 1.00 39.47  ? 147  ASP A OD2   1 
ATOM   2007 N  N     . LEU E 3 171 ? 32.844  -37.878 -26.492 1.00 27.80  ? 148  LEU A N     1 
ATOM   2008 C  CA    . LEU E 3 171 ? 33.436  -37.460 -25.230 1.00 26.18  ? 148  LEU A CA    1 
ATOM   2009 C  C     . LEU E 3 171 ? 32.657  -36.269 -24.693 1.00 25.39  ? 148  LEU A C     1 
ATOM   2010 O  O     . LEU E 3 171 ? 32.842  -35.141 -25.145 1.00 25.20  ? 148  LEU A O     1 
ATOM   2011 C  CB    . LEU E 3 171 ? 34.906  -37.088 -25.431 1.00 24.22  ? 148  LEU A CB    1 
ATOM   2012 C  CG    . LEU E 3 171 ? 35.714  -36.835 -24.159 1.00 23.30  ? 148  LEU A CG    1 
ATOM   2013 C  CD1   . LEU E 3 171 ? 35.632  -38.045 -23.249 1.00 21.38  ? 148  LEU A CD1   1 
ATOM   2014 C  CD2   . LEU E 3 171 ? 37.157  -36.541 -24.529 1.00 24.20  ? 148  LEU A CD2   1 
ATOM   2015 N  N     . VAL E 3 172 ? 31.780  -36.537 -23.731 1.00 24.41  ? 149  VAL A N     1 
ATOM   2016 C  CA    . VAL E 3 172 ? 30.943  -35.509 -23.130 1.00 23.48  ? 149  VAL A CA    1 
ATOM   2017 C  C     . VAL E 3 172 ? 31.006  -35.529 -21.611 1.00 24.80  ? 149  VAL A C     1 
ATOM   2018 O  O     . VAL E 3 172 ? 30.738  -36.550 -20.984 1.00 25.82  ? 149  VAL A O     1 
ATOM   2019 C  CB    . VAL E 3 172 ? 29.473  -35.696 -23.531 1.00 21.28  ? 149  VAL A CB    1 
ATOM   2020 C  CG1   . VAL E 3 172 ? 28.618  -34.651 -22.848 1.00 21.57  ? 149  VAL A CG1   1 
ATOM   2021 C  CG2   . VAL E 3 172 ? 29.329  -35.616 -25.036 1.00 20.24  ? 149  VAL A CG2   1 
ATOM   2022 N  N     . GLU E 3 173 ? 31.350  -34.394 -21.020 1.00 26.55  ? 150  GLU A N     1 
ATOM   2023 C  CA    . GLU E 3 173 ? 31.419  -34.300 -19.571 1.00 29.47  ? 150  GLU A CA    1 
ATOM   2024 C  C     . GLU E 3 173 ? 30.208  -33.520 -19.063 1.00 29.91  ? 150  GLU A C     1 
ATOM   2025 O  O     . GLU E 3 173 ? 30.002  -32.365 -19.433 1.00 30.75  ? 150  GLU A O     1 
ATOM   2026 C  CB    . GLU E 3 173 ? 32.706  -33.594 -19.139 1.00 30.07  ? 150  GLU A CB    1 
ATOM   2027 C  CG    . GLU E 3 173 ? 32.858  -33.482 -17.637 1.00 34.38  ? 150  GLU A CG    1 
ATOM   2028 C  CD    . GLU E 3 173 ? 34.040  -32.631 -17.234 1.00 38.33  ? 150  GLU A CD    1 
ATOM   2029 O  OE1   . GLU E 3 173 ? 34.061  -31.441 -17.607 1.00 41.99  ? 150  GLU A OE1   1 
ATOM   2030 O  OE2   . GLU E 3 173 ? 34.947  -33.146 -16.544 1.00 40.71  ? 150  GLU A OE2   1 
ATOM   2031 N  N     . ARG E 3 174 ? 29.401  -34.154 -18.224 1.00 29.19  ? 151  ARG A N     1 
ATOM   2032 C  CA    . ARG E 3 174 ? 28.227  -33.494 -17.679 1.00 30.01  ? 151  ARG A CA    1 
ATOM   2033 C  C     . ARG E 3 174 ? 28.644  -32.729 -16.427 1.00 30.42  ? 151  ARG A C     1 
ATOM   2034 O  O     . ARG E 3 174 ? 28.752  -33.308 -15.349 1.00 32.90  ? 151  ARG A O     1 
ATOM   2035 C  CB    . ARG E 3 174 ? 27.161  -34.534 -17.339 1.00 30.83  ? 151  ARG A CB    1 
ATOM   2036 C  CG    . ARG E 3 174 ? 25.886  -33.954 -16.776 1.00 34.84  ? 151  ARG A CG    1 
ATOM   2037 C  CD    . ARG E 3 174 ? 24.897  -35.051 -16.441 1.00 40.73  ? 151  ARG A CD    1 
ATOM   2038 N  NE    . ARG E 3 174 ? 23.653  -34.512 -15.899 1.00 46.99  ? 151  ARG A NE    1 
ATOM   2039 C  CZ    . ARG E 3 174 ? 22.630  -35.256 -15.492 1.00 48.89  ? 151  ARG A CZ    1 
ATOM   2040 N  NH1   . ARG E 3 174 ? 22.701  -36.580 -15.566 1.00 51.44  ? 151  ARG A NH1   1 
ATOM   2041 N  NH2   . ARG E 3 174 ? 21.538  -34.679 -15.007 1.00 49.08  ? 151  ARG A NH2   1 
ATOM   2042 N  N     . ALA E 3 175 ? 28.881  -31.428 -16.573 1.00 29.50  ? 152  ALA A N     1 
ATOM   2043 C  CA    . ALA E 3 175 ? 29.306  -30.595 -15.449 1.00 28.53  ? 152  ALA A CA    1 
ATOM   2044 C  C     . ALA E 3 175 ? 28.200  -30.349 -14.430 1.00 27.52  ? 152  ALA A C     1 
ATOM   2045 O  O     . ALA E 3 175 ? 28.464  -30.194 -13.239 1.00 27.47  ? 152  ALA A O     1 
ATOM   2046 C  CB    . ALA E 3 175 ? 29.837  -29.269 -15.961 1.00 30.10  ? 152  ALA A CB    1 
ATOM   2047 N  N     . SER E 3 176 ? 26.963  -30.298 -14.906 1.00 26.36  ? 153  SER A N     1 
ATOM   2048 C  CA    . SER E 3 176 ? 25.816  -30.083 -14.034 1.00 25.52  ? 153  SER A CA    1 
ATOM   2049 C  C     . SER E 3 176 ? 24.548  -30.559 -14.725 1.00 25.37  ? 153  SER A C     1 
ATOM   2050 O  O     . SER E 3 176 ? 24.602  -31.199 -15.775 1.00 25.39  ? 153  SER A O     1 
ATOM   2051 C  CB    . SER E 3 176 ? 25.691  -28.602 -13.651 1.00 25.36  ? 153  SER A CB    1 
ATOM   2052 O  OG    . SER E 3 176 ? 25.604  -27.766 -14.790 1.00 24.06  ? 153  SER A OG    1 
ATOM   2053 N  N     . ILE E 3 177 ? 23.402  -30.242 -14.141 1.00 24.78  ? 154  ILE A N     1 
ATOM   2054 C  CA    . ILE E 3 177 ? 22.143  -30.677 -14.717 1.00 24.22  ? 154  ILE A CA    1 
ATOM   2055 C  C     . ILE E 3 177 ? 21.860  -30.080 -16.093 1.00 24.49  ? 154  ILE A C     1 
ATOM   2056 O  O     . ILE E 3 177 ? 21.129  -30.668 -16.883 1.00 25.54  ? 154  ILE A O     1 
ATOM   2057 C  CB    . ILE E 3 177 ? 20.964  -30.351 -13.782 1.00 22.47  ? 154  ILE A CB    1 
ATOM   2058 C  CG1   . ILE E 3 177 ? 19.676  -30.937 -14.365 1.00 20.51  ? 154  ILE A CG1   1 
ATOM   2059 C  CG2   . ILE E 3 177 ? 20.858  -28.845 -13.585 1.00 21.43  ? 154  ILE A CG2   1 
ATOM   2060 C  CD1   . ILE E 3 177 ? 18.487  -30.832 -13.459 1.00 21.32  ? 154  ILE A CD1   1 
ATOM   2061 N  N     . ASP E 3 178 ? 22.433  -28.918 -16.385 1.00 23.86  ? 155  ASP A N     1 
ATOM   2062 C  CA    . ASP E 3 178 ? 22.195  -28.291 -17.677 1.00 24.34  ? 155  ASP A CA    1 
ATOM   2063 C  C     . ASP E 3 178 ? 23.464  -27.766 -18.326 1.00 25.42  ? 155  ASP A C     1 
ATOM   2064 O  O     . ASP E 3 178 ? 23.429  -26.779 -19.062 1.00 27.83  ? 155  ASP A O     1 
ATOM   2065 C  CB    . ASP E 3 178 ? 21.176  -27.151 -17.544 1.00 25.79  ? 155  ASP A CB    1 
ATOM   2066 C  CG    . ASP E 3 178 ? 21.743  -25.914 -16.848 1.00 28.62  ? 155  ASP A CG    1 
ATOM   2067 O  OD1   . ASP E 3 178 ? 21.114  -24.842 -16.979 1.00 29.17  ? 155  ASP A OD1   1 
ATOM   2068 O  OD2   . ASP E 3 178 ? 22.795  -25.997 -16.171 1.00 29.46  ? 155  ASP A OD2   1 
ATOM   2069 N  N     . GLU E 3 179 ? 24.586  -28.424 -18.055 1.00 24.31  ? 156  GLU A N     1 
ATOM   2070 C  CA    . GLU E 3 179 ? 25.859  -28.012 -18.633 1.00 24.28  ? 156  GLU A CA    1 
ATOM   2071 C  C     . GLU E 3 179 ? 26.669  -29.223 -19.067 1.00 23.41  ? 156  GLU A C     1 
ATOM   2072 O  O     . GLU E 3 179 ? 26.633  -30.266 -18.416 1.00 23.10  ? 156  GLU A O     1 
ATOM   2073 C  CB    . GLU E 3 179 ? 26.684  -27.217 -17.618 1.00 26.80  ? 156  GLU A CB    1 
ATOM   2074 C  CG    . GLU E 3 179 ? 26.028  -25.959 -17.099 1.00 33.25  ? 156  GLU A CG    1 
ATOM   2075 C  CD    . GLU E 3 179 ? 26.929  -25.202 -16.142 1.00 37.41  ? 156  GLU A CD    1 
ATOM   2076 O  OE1   . GLU E 3 179 ? 26.475  -24.186 -15.565 1.00 39.63  ? 156  GLU A OE1   1 
ATOM   2077 O  OE2   . GLU E 3 179 ? 28.094  -25.628 -15.973 1.00 37.66  ? 156  GLU A OE2   1 
ATOM   2078 N  N     . VAL E 3 180 ? 27.399  -29.083 -20.167 1.00 21.98  ? 157  VAL A N     1 
ATOM   2079 C  CA    . VAL E 3 180 ? 28.238  -30.167 -20.658 1.00 21.29  ? 157  VAL A CA    1 
ATOM   2080 C  C     . VAL E 3 180 ? 29.438  -29.625 -21.417 1.00 20.20  ? 157  VAL A C     1 
ATOM   2081 O  O     . VAL E 3 180 ? 29.386  -28.538 -21.989 1.00 19.46  ? 157  VAL A O     1 
ATOM   2082 C  CB    . VAL E 3 180 ? 27.468  -31.121 -21.612 1.00 21.68  ? 157  VAL A CB    1 
ATOM   2083 C  CG1   . VAL E 3 180 ? 26.243  -31.693 -20.917 1.00 23.01  ? 157  VAL A CG1   1 
ATOM   2084 C  CG2   . VAL E 3 180 ? 27.078  -30.385 -22.880 1.00 22.05  ? 157  VAL A CG2   1 
ATOM   2085 N  N     . PHE E 3 181 ? 30.524  -30.390 -21.396 1.00 19.80  ? 158  PHE A N     1 
ATOM   2086 C  CA    . PHE E 3 181 ? 31.738  -30.039 -22.118 1.00 18.40  ? 158  PHE A CA    1 
ATOM   2087 C  C     . PHE E 3 181 ? 31.891  -31.048 -23.254 1.00 19.05  ? 158  PHE A C     1 
ATOM   2088 O  O     . PHE E 3 181 ? 31.601  -32.232 -23.088 1.00 18.19  ? 158  PHE A O     1 
ATOM   2089 C  CB    . PHE E 3 181 ? 32.970  -30.135 -21.225 1.00 16.85  ? 158  PHE A CB    1 
ATOM   2090 C  CG    . PHE E 3 181 ? 33.097  -29.029 -20.226 1.00 17.61  ? 158  PHE A CG    1 
ATOM   2091 C  CD1   . PHE E 3 181 ? 32.520  -29.138 -18.972 1.00 18.96  ? 158  PHE A CD1   1 
ATOM   2092 C  CD2   . PHE E 3 181 ? 33.848  -27.898 -20.521 1.00 18.74  ? 158  PHE A CD2   1 
ATOM   2093 C  CE1   . PHE E 3 181 ? 32.697  -28.136 -18.020 1.00 20.40  ? 158  PHE A CE1   1 
ATOM   2094 C  CE2   . PHE E 3 181 ? 34.031  -26.890 -19.579 1.00 17.74  ? 158  PHE A CE2   1 
ATOM   2095 C  CZ    . PHE E 3 181 ? 33.458  -27.009 -18.327 1.00 18.42  ? 158  PHE A CZ    1 
ATOM   2096 N  N     . LEU E 3 182 ? 32.346  -30.574 -24.405 1.00 19.04  ? 159  LEU A N     1 
ATOM   2097 C  CA    . LEU E 3 182 ? 32.546  -31.440 -25.554 1.00 18.32  ? 159  LEU A CA    1 
ATOM   2098 C  C     . LEU E 3 182 ? 33.973  -31.315 -26.041 1.00 20.22  ? 159  LEU A C     1 
ATOM   2099 O  O     . LEU E 3 182 ? 34.551  -30.228 -26.026 1.00 20.32  ? 159  LEU A O     1 
ATOM   2100 C  CB    . LEU E 3 182 ? 31.606  -31.051 -26.688 1.00 17.81  ? 159  LEU A CB    1 
ATOM   2101 C  CG    . LEU E 3 182 ? 30.120  -31.110 -26.368 1.00 19.97  ? 159  LEU A CG    1 
ATOM   2102 C  CD1   . LEU E 3 182 ? 29.316  -30.681 -27.587 1.00 20.63  ? 159  LEU A CD1   1 
ATOM   2103 C  CD2   . LEU E 3 182 ? 29.761  -32.518 -25.951 1.00 19.98  ? 159  LEU A CD2   1 
ATOM   2104 N  N     . ASP E 3 183 ? 34.545  -32.436 -26.461 1.00 22.06  ? 160  ASP A N     1 
ATOM   2105 C  CA    . ASP E 3 183 ? 35.897  -32.445 -26.986 1.00 23.49  ? 160  ASP A CA    1 
ATOM   2106 C  C     . ASP E 3 183 ? 35.727  -32.738 -28.467 1.00 24.87  ? 160  ASP A C     1 
ATOM   2107 O  O     . ASP E 3 183 ? 35.585  -33.893 -28.869 1.00 26.85  ? 160  ASP A O     1 
ATOM   2108 C  CB    . ASP E 3 183 ? 36.724  -33.541 -26.325 1.00 23.84  ? 160  ASP A CB    1 
ATOM   2109 C  CG    . ASP E 3 183 ? 38.185  -33.472 -26.709 1.00 28.00  ? 160  ASP A CG    1 
ATOM   2110 O  OD1   . ASP E 3 183 ? 38.484  -33.384 -27.917 1.00 31.00  ? 160  ASP A OD1   1 
ATOM   2111 O  OD2   . ASP E 3 183 ? 39.040  -33.512 -25.803 1.00 32.66  ? 160  ASP A OD2   1 
ATOM   2112 N  N     . LEU E 3 184 ? 35.718  -31.683 -29.273 1.00 24.60  ? 161  LEU A N     1 
ATOM   2113 C  CA    . LEU E 3 184 ? 35.544  -31.813 -30.711 1.00 26.40  ? 161  LEU A CA    1 
ATOM   2114 C  C     . LEU E 3 184 ? 36.807  -32.288 -31.426 1.00 27.79  ? 161  LEU A C     1 
ATOM   2115 O  O     . LEU E 3 184 ? 36.928  -32.148 -32.643 1.00 28.70  ? 161  LEU A O     1 
ATOM   2116 C  CB    . LEU E 3 184 ? 35.099  -30.472 -31.291 1.00 27.03  ? 161  LEU A CB    1 
ATOM   2117 C  CG    . LEU E 3 184 ? 33.661  -30.011 -31.033 1.00 27.53  ? 161  LEU A CG    1 
ATOM   2118 C  CD1   . LEU E 3 184 ? 33.293  -30.161 -29.576 1.00 27.86  ? 161  LEU A CD1   1 
ATOM   2119 C  CD2   . LEU E 3 184 ? 33.531  -28.562 -31.464 1.00 30.10  ? 161  LEU A CD2   1 
ATOM   2120 N  N     . GLY E 3 185 ? 37.740  -32.857 -30.670 1.00 28.26  ? 162  GLY A N     1 
ATOM   2121 C  CA    . GLY E 3 185 ? 38.984  -33.332 -31.253 1.00 28.31  ? 162  GLY A CA    1 
ATOM   2122 C  C     . GLY E 3 185 ? 38.831  -34.197 -32.491 1.00 28.75  ? 162  GLY A C     1 
ATOM   2123 O  O     . GLY E 3 185 ? 39.151  -33.774 -33.602 1.00 27.46  ? 162  GLY A O     1 
ATOM   2124 N  N     . ARG E 3 186 ? 38.340  -35.416 -32.298 1.00 29.40  ? 163  ARG A N     1 
ATOM   2125 C  CA    . ARG E 3 186 ? 38.156  -36.352 -33.399 1.00 29.53  ? 163  ARG A CA    1 
ATOM   2126 C  C     . ARG E 3 186 ? 37.356  -35.777 -34.568 1.00 28.63  ? 163  ARG A C     1 
ATOM   2127 O  O     . ARG E 3 186 ? 37.716  -35.985 -35.725 1.00 29.34  ? 163  ARG A O     1 
ATOM   2128 C  CB    . ARG E 3 186 ? 37.484  -37.639 -32.891 1.00 30.70  ? 163  ARG A CB    1 
ATOM   2129 C  CG    . ARG E 3 186 ? 38.422  -38.629 -32.193 1.00 32.36  ? 163  ARG A CG    1 
ATOM   2130 C  CD    . ARG E 3 186 ? 39.175  -38.002 -31.023 1.00 35.46  ? 163  ARG A CD    1 
ATOM   2131 N  NE    . ARG E 3 186 ? 38.325  -37.742 -29.865 1.00 37.57  ? 163  ARG A NE    1 
ATOM   2132 C  CZ    . ARG E 3 186 ? 38.653  -36.922 -28.870 1.00 39.53  ? 163  ARG A CZ    1 
ATOM   2133 N  NH1   . ARG E 3 186 ? 37.823  -36.746 -27.849 1.00 39.71  ? 163  ARG A NH1   1 
ATOM   2134 N  NH2   . ARG E 3 186 ? 39.805  -36.264 -28.901 1.00 37.93  ? 163  ARG A NH2   1 
ATOM   2135 N  N     . ILE E 3 187 ? 36.281  -35.051 -34.276 1.00 27.21  ? 164  ILE A N     1 
ATOM   2136 C  CA    . ILE E 3 187 ? 35.459  -34.491 -35.342 1.00 27.00  ? 164  ILE A CA    1 
ATOM   2137 C  C     . ILE E 3 187 ? 36.238  -33.511 -36.207 1.00 27.58  ? 164  ILE A C     1 
ATOM   2138 O  O     . ILE E 3 187 ? 36.342  -33.688 -37.420 1.00 29.04  ? 164  ILE A O     1 
ATOM   2139 C  CB    . ILE E 3 187 ? 34.219  -33.769 -34.789 1.00 26.41  ? 164  ILE A CB    1 
ATOM   2140 C  CG1   . ILE E 3 187 ? 33.423  -34.713 -33.887 1.00 27.83  ? 164  ILE A CG1   1 
ATOM   2141 C  CG2   . ILE E 3 187 ? 33.335  -33.315 -35.938 1.00 25.85  ? 164  ILE A CG2   1 
ATOM   2142 C  CD1   . ILE E 3 187 ? 32.114  -34.134 -33.379 1.00 27.65  ? 164  ILE A CD1   1 
ATOM   2143 N  N     . CYS E 3 188 ? 36.781  -32.477 -35.577 1.00 27.25  ? 165  CYS A N     1 
ATOM   2144 C  CA    . CYS E 3 188 ? 37.547  -31.466 -36.291 1.00 27.04  ? 165  CYS A CA    1 
ATOM   2145 C  C     . CYS E 3 188 ? 38.688  -32.066 -37.103 1.00 26.32  ? 165  CYS A C     1 
ATOM   2146 O  O     . CYS E 3 188 ? 38.915  -31.678 -38.247 1.00 25.09  ? 165  CYS A O     1 
ATOM   2147 C  CB    . CYS E 3 188 ? 38.108  -30.440 -35.307 1.00 28.16  ? 165  CYS A CB    1 
ATOM   2148 S  SG    . CYS E 3 188 ? 36.855  -29.441 -34.482 1.00 31.39  ? 165  CYS A SG    1 
ATOM   2149 N  N     . PHE E 3 189 ? 39.409  -33.011 -36.511 1.00 27.06  ? 166  PHE A N     1 
ATOM   2150 C  CA    . PHE E 3 189 ? 40.526  -33.631 -37.209 1.00 27.50  ? 166  PHE A CA    1 
ATOM   2151 C  C     . PHE E 3 189 ? 40.055  -34.321 -38.476 1.00 29.41  ? 166  PHE A C     1 
ATOM   2152 O  O     . PHE E 3 189 ? 40.485  -33.970 -39.574 1.00 29.89  ? 166  PHE A O     1 
ATOM   2153 C  CB    . PHE E 3 189 ? 41.234  -34.653 -36.324 1.00 25.25  ? 166  PHE A CB    1 
ATOM   2154 C  CG    . PHE E 3 189 ? 42.440  -35.257 -36.971 1.00 24.19  ? 166  PHE A CG    1 
ATOM   2155 C  CD1   . PHE E 3 189 ? 43.606  -34.518 -37.113 1.00 24.45  ? 166  PHE A CD1   1 
ATOM   2156 C  CD2   . PHE E 3 189 ? 42.399  -36.548 -37.484 1.00 25.33  ? 166  PHE A CD2   1 
ATOM   2157 C  CE1   . PHE E 3 189 ? 44.717  -35.055 -37.761 1.00 24.79  ? 166  PHE A CE1   1 
ATOM   2158 C  CE2   . PHE E 3 189 ? 43.504  -37.096 -38.136 1.00 24.18  ? 166  PHE A CE2   1 
ATOM   2159 C  CZ    . PHE E 3 189 ? 44.665  -36.348 -38.274 1.00 23.07  ? 166  PHE A CZ    1 
ATOM   2160 N  N     . ASN E 3 190 ? 39.175  -35.306 -38.320 1.00 30.70  ? 167  ASN A N     1 
ATOM   2161 C  CA    . ASN E 3 190 ? 38.656  -36.039 -39.467 1.00 33.18  ? 167  ASN A CA    1 
ATOM   2162 C  C     . ASN E 3 190 ? 38.034  -35.103 -40.491 1.00 33.13  ? 167  ASN A C     1 
ATOM   2163 O  O     . ASN E 3 190 ? 38.279  -35.231 -41.691 1.00 33.73  ? 167  ASN A O     1 
ATOM   2164 C  CB    . ASN E 3 190 ? 37.619  -37.076 -39.029 1.00 35.75  ? 167  ASN A CB    1 
ATOM   2165 C  CG    . ASN E 3 190 ? 38.243  -38.272 -38.332 1.00 37.67  ? 167  ASN A CG    1 
ATOM   2166 O  OD1   . ASN E 3 190 ? 39.196  -38.872 -38.831 1.00 37.97  ? 167  ASN A OD1   1 
ATOM   2167 N  ND2   . ASN E 3 190 ? 37.696  -38.632 -37.177 1.00 39.57  ? 167  ASN A ND2   1 
ATOM   2168 N  N     . MET E 3 191 ? 37.224  -34.161 -40.022 1.00 32.53  ? 168  MET A N     1 
ATOM   2169 C  CA    . MET E 3 191 ? 36.594  -33.222 -40.935 1.00 33.09  ? 168  MET A CA    1 
ATOM   2170 C  C     . MET E 3 191 ? 37.686  -32.498 -41.714 1.00 32.82  ? 168  MET A C     1 
ATOM   2171 O  O     . MET E 3 191 ? 37.559  -32.259 -42.915 1.00 33.58  ? 168  MET A O     1 
ATOM   2172 C  CB    . MET E 3 191 ? 35.746  -32.209 -40.164 1.00 33.56  ? 168  MET A CB    1 
ATOM   2173 C  CG    . MET E 3 191 ? 35.052  -31.197 -41.059 1.00 36.94  ? 168  MET A CG    1 
ATOM   2174 S  SD    . MET E 3 191 ? 34.020  -30.036 -40.149 1.00 41.03  ? 168  MET A SD    1 
ATOM   2175 C  CE    . MET E 3 191 ? 32.443  -30.900 -40.169 1.00 41.59  ? 168  MET A CE    1 
ATOM   2176 N  N     . LEU E 3 192 ? 38.767  -32.170 -41.016 1.00 31.12  ? 169  LEU A N     1 
ATOM   2177 C  CA    . LEU E 3 192 ? 39.895  -31.466 -41.607 1.00 29.35  ? 169  LEU A CA    1 
ATOM   2178 C  C     . LEU E 3 192 ? 40.650  -32.279 -42.649 1.00 30.43  ? 169  LEU A C     1 
ATOM   2179 O  O     . LEU E 3 192 ? 41.079  -31.742 -43.665 1.00 31.30  ? 169  LEU A O     1 
ATOM   2180 C  CB    . LEU E 3 192 ? 40.874  -31.045 -40.509 1.00 28.02  ? 169  LEU A CB    1 
ATOM   2181 C  CG    . LEU E 3 192 ? 42.183  -30.378 -40.945 1.00 25.87  ? 169  LEU A CG    1 
ATOM   2182 C  CD1   . LEU E 3 192 ? 41.876  -29.060 -41.608 1.00 27.46  ? 169  LEU A CD1   1 
ATOM   2183 C  CD2   . LEU E 3 192 ? 43.082  -30.149 -39.745 1.00 26.59  ? 169  LEU A CD2   1 
ATOM   2184 N  N     . MET E 3 193 ? 40.808  -33.574 -42.402 1.00 31.65  ? 170  MET A N     1 
ATOM   2185 C  CA    . MET E 3 193 ? 41.562  -34.426 -43.314 1.00 32.42  ? 170  MET A CA    1 
ATOM   2186 C  C     . MET E 3 193 ? 40.749  -35.253 -44.304 1.00 33.07  ? 170  MET A C     1 
ATOM   2187 O  O     . MET E 3 193 ? 41.233  -35.546 -45.398 1.00 33.42  ? 170  MET A O     1 
ATOM   2188 C  CB    . MET E 3 193 ? 42.462  -35.379 -42.511 1.00 33.15  ? 170  MET A CB    1 
ATOM   2189 C  CG    . MET E 3 193 ? 43.416  -34.709 -41.525 1.00 35.26  ? 170  MET A CG    1 
ATOM   2190 S  SD    . MET E 3 193 ? 44.874  -33.952 -42.276 1.00 35.06  ? 170  MET A SD    1 
ATOM   2191 C  CE    . MET E 3 193 ? 44.197  -32.405 -42.833 1.00 37.54  ? 170  MET A CE    1 
ATOM   2192 N  N     . PHE E 3 194 ? 39.526  -35.634 -43.944 1.00 33.44  ? 171  PHE A N     1 
ATOM   2193 C  CA    . PHE E 3 194 ? 38.742  -36.472 -44.844 1.00 33.88  ? 171  PHE A CA    1 
ATOM   2194 C  C     . PHE E 3 194 ? 37.398  -35.981 -45.356 1.00 35.99  ? 171  PHE A C     1 
ATOM   2195 O  O     . PHE E 3 194 ? 36.884  -36.530 -46.327 1.00 36.20  ? 171  PHE A O     1 
ATOM   2196 C  CB    . PHE E 3 194 ? 38.544  -37.851 -44.221 1.00 31.72  ? 171  PHE A CB    1 
ATOM   2197 C  CG    . PHE E 3 194 ? 39.823  -38.560 -43.910 1.00 29.65  ? 171  PHE A CG    1 
ATOM   2198 C  CD1   . PHE E 3 194 ? 40.550  -38.236 -42.774 1.00 28.42  ? 171  PHE A CD1   1 
ATOM   2199 C  CD2   . PHE E 3 194 ? 40.317  -39.534 -44.769 1.00 29.34  ? 171  PHE A CD2   1 
ATOM   2200 C  CE1   . PHE E 3 194 ? 41.751  -38.870 -42.493 1.00 29.46  ? 171  PHE A CE1   1 
ATOM   2201 C  CE2   . PHE E 3 194 ? 41.519  -40.175 -44.497 1.00 30.61  ? 171  PHE A CE2   1 
ATOM   2202 C  CZ    . PHE E 3 194 ? 42.239  -39.842 -43.357 1.00 29.94  ? 171  PHE A CZ    1 
ATOM   2203 N  N     . ASP E 3 195 ? 36.811  -34.971 -44.728 1.00 39.25  ? 172  ASP A N     1 
ATOM   2204 C  CA    . ASP E 3 195 ? 35.518  -34.493 -45.207 1.00 42.70  ? 172  ASP A CA    1 
ATOM   2205 C  C     . ASP E 3 195 ? 35.643  -33.976 -46.638 1.00 45.97  ? 172  ASP A C     1 
ATOM   2206 O  O     . ASP E 3 195 ? 36.447  -33.083 -46.920 1.00 46.42  ? 172  ASP A O     1 
ATOM   2207 C  CB    . ASP E 3 195 ? 34.977  -33.387 -44.302 1.00 42.01  ? 172  ASP A CB    1 
ATOM   2208 C  CG    . ASP E 3 195 ? 33.583  -32.951 -44.698 1.00 41.47  ? 172  ASP A CG    1 
ATOM   2209 O  OD1   . ASP E 3 195 ? 33.416  -32.467 -45.836 1.00 41.48  ? 172  ASP A OD1   1 
ATOM   2210 O  OD2   . ASP E 3 195 ? 32.652  -33.097 -43.879 1.00 42.40  ? 172  ASP A OD2   1 
ATOM   2211 N  N     . ASN E 3 196 ? 34.849  -34.541 -47.542 1.00 48.64  ? 173  ASN A N     1 
ATOM   2212 C  CA    . ASN E 3 196 ? 34.895  -34.130 -48.938 1.00 52.54  ? 173  ASN A CA    1 
ATOM   2213 C  C     . ASN E 3 196 ? 33.574  -33.563 -49.429 1.00 55.48  ? 173  ASN A C     1 
ATOM   2214 O  O     . ASN E 3 196 ? 33.420  -33.273 -50.613 1.00 55.87  ? 173  ASN A O     1 
ATOM   2215 C  CB    . ASN E 3 196 ? 35.296  -35.312 -49.818 1.00 52.85  ? 173  ASN A CB    1 
ATOM   2216 C  CG    . ASN E 3 196 ? 36.704  -35.789 -49.540 1.00 53.57  ? 173  ASN A CG    1 
ATOM   2217 O  OD1   . ASN E 3 196 ? 37.659  -35.013 -49.611 1.00 53.53  ? 173  ASN A OD1   1 
ATOM   2218 N  ND2   . ASN E 3 196 ? 36.844  -37.074 -49.226 1.00 52.71  ? 173  ASN A ND2   1 
ATOM   2219 N  N     . GLU E 3 197 ? 32.624  -33.403 -48.517 1.00 59.10  ? 174  GLU A N     1 
ATOM   2220 C  CA    . GLU E 3 197 ? 31.313  -32.872 -48.868 1.00 62.74  ? 174  GLU A CA    1 
ATOM   2221 C  C     . GLU E 3 197 ? 31.245  -31.370 -48.601 1.00 64.51  ? 174  GLU A C     1 
ATOM   2222 O  O     . GLU E 3 197 ? 30.729  -30.605 -49.415 1.00 64.84  ? 174  GLU A O     1 
ATOM   2223 C  CB    . GLU E 3 197 ? 30.224  -33.567 -48.045 1.00 64.44  ? 174  GLU A CB    1 
ATOM   2224 C  CG    . GLU E 3 197 ? 30.320  -35.085 -47.995 1.00 69.22  ? 174  GLU A CG    1 
ATOM   2225 C  CD    . GLU E 3 197 ? 30.113  -35.738 -49.349 1.00 72.10  ? 174  GLU A CD    1 
ATOM   2226 O  OE1   . GLU E 3 197 ? 30.990  -35.584 -50.229 1.00 72.82  ? 174  GLU A OE1   1 
ATOM   2227 O  OE2   . GLU E 3 197 ? 29.068  -36.404 -49.532 1.00 73.02  ? 174  GLU A OE2   1 
ATOM   2228 N  N     . TYR E 3 198 ? 31.780  -30.964 -47.454 1.00 66.93  ? 175  TYR A N     1 
ATOM   2229 C  CA    . TYR E 3 198 ? 31.768  -29.571 -47.020 1.00 68.68  ? 175  TYR A CA    1 
ATOM   2230 C  C     . TYR E 3 198 ? 32.163  -28.550 -48.077 1.00 70.23  ? 175  TYR A C     1 
ATOM   2231 O  O     . TYR E 3 198 ? 33.089  -28.768 -48.859 1.00 71.05  ? 175  TYR A O     1 
ATOM   2232 C  CB    . TYR E 3 198 ? 32.671  -29.397 -45.798 1.00 68.41  ? 175  TYR A CB    1 
ATOM   2233 C  CG    . TYR E 3 198 ? 32.434  -28.101 -45.061 1.00 69.16  ? 175  TYR A CG    1 
ATOM   2234 C  CD1   . TYR E 3 198 ? 31.199  -27.832 -44.473 1.00 70.09  ? 175  TYR A CD1   1 
ATOM   2235 C  CD2   . TYR E 3 198 ? 33.440  -27.142 -44.952 1.00 69.31  ? 175  TYR A CD2   1 
ATOM   2236 C  CE1   . TYR E 3 198 ? 30.969  -26.640 -43.795 1.00 70.80  ? 175  TYR A CE1   1 
ATOM   2237 C  CE2   . TYR E 3 198 ? 33.222  -25.946 -44.276 1.00 70.11  ? 175  TYR A CE2   1 
ATOM   2238 C  CZ    . TYR E 3 198 ? 31.984  -25.703 -43.700 1.00 71.38  ? 175  TYR A CZ    1 
ATOM   2239 O  OH    . TYR E 3 198 ? 31.761  -24.524 -43.028 1.00 74.04  ? 175  TYR A OH    1 
ATOM   2240 N  N     . GLU E 3 199 ? 31.450  -27.426 -48.077 1.00 71.52  ? 176  GLU A N     1 
ATOM   2241 C  CA    . GLU E 3 199 ? 31.693  -26.333 -49.012 1.00 72.96  ? 176  GLU A CA    1 
ATOM   2242 C  C     . GLU E 3 199 ? 32.071  -25.070 -48.232 1.00 73.10  ? 176  GLU A C     1 
ATOM   2243 O  O     . GLU E 3 199 ? 31.502  -24.798 -47.176 1.00 74.04  ? 176  GLU A O     1 
ATOM   2244 C  CB    . GLU E 3 199 ? 30.431  -26.054 -49.835 1.00 74.56  ? 176  GLU A CB    1 
ATOM   2245 C  CG    . GLU E 3 199 ? 29.891  -27.249 -50.611 1.00 76.25  ? 176  GLU A CG    1 
ATOM   2246 C  CD    . GLU E 3 199 ? 28.566  -26.949 -51.299 1.00 77.43  ? 176  GLU A CD    1 
ATOM   2247 O  OE1   . GLU E 3 199 ? 27.566  -26.698 -50.591 1.00 77.21  ? 176  GLU A OE1   1 
ATOM   2248 O  OE2   . GLU E 3 199 ? 28.526  -26.962 -52.549 1.00 77.93  ? 176  GLU A OE2   1 
ATOM   2249 N  N     . LEU E 3 200 ? 33.029  -24.306 -48.751 1.00 72.63  ? 177  LEU A N     1 
ATOM   2250 C  CA    . LEU E 3 200 ? 33.463  -23.068 -48.102 1.00 72.11  ? 177  LEU A CA    1 
ATOM   2251 C  C     . LEU E 3 200 ? 32.738  -21.886 -48.735 1.00 72.06  ? 177  LEU A C     1 
ATOM   2252 O  O     . LEU E 3 200 ? 32.331  -20.943 -48.052 1.00 72.01  ? 177  LEU A O     1 
ATOM   2253 C  CB    . LEU E 3 200 ? 34.974  -22.876 -48.261 1.00 71.99  ? 177  LEU A CB    1 
ATOM   2254 C  CG    . LEU E 3 200 ? 35.906  -23.767 -47.438 1.00 72.13  ? 177  LEU A CG    1 
ATOM   2255 C  CD1   . LEU E 3 200 ? 35.633  -25.233 -47.729 1.00 73.45  ? 177  LEU A CD1   1 
ATOM   2256 C  CD2   . LEU E 3 200 ? 37.346  -23.414 -47.769 1.00 72.29  ? 177  LEU A CD2   1 
ATOM   2257 N  N     . THR E 3 201 ? 32.600  -21.953 -50.054 1.00 71.73  ? 178  THR A N     1 
ATOM   2258 C  CA    . THR E 3 201 ? 31.923  -20.932 -50.842 1.00 70.67  ? 178  THR A CA    1 
ATOM   2259 C  C     . THR E 3 201 ? 31.383  -21.663 -52.068 1.00 71.11  ? 178  THR A C     1 
ATOM   2260 O  O     . THR E 3 201 ? 30.820  -22.752 -51.952 1.00 70.66  ? 178  THR A O     1 
ATOM   2261 C  CB    . THR E 3 201 ? 32.902  -19.819 -51.304 1.00 69.83  ? 178  THR A CB    1 
ATOM   2262 O  OG1   . THR E 3 201 ? 33.873  -20.372 -52.201 1.00 67.91  ? 178  THR A OG1   1 
ATOM   2263 C  CG2   . THR E 3 201 ? 33.622  -19.203 -50.110 1.00 69.16  ? 178  THR A CG2   1 
ATOM   2264 N  N     . GLY E 3 202 ? 31.556  -21.065 -53.239 1.00 71.82  ? 179  GLY A N     1 
ATOM   2265 C  CA    . GLY E 3 202 ? 31.104  -21.698 -54.462 1.00 71.82  ? 179  GLY A CA    1 
ATOM   2266 C  C     . GLY E 3 202 ? 32.327  -22.229 -55.177 1.00 71.96  ? 179  GLY A C     1 
ATOM   2267 O  O     . GLY E 3 202 ? 33.423  -21.697 -54.997 1.00 72.10  ? 179  GLY A O     1 
ATOM   2268 N  N     . ASP E 3 203 ? 32.153  -23.272 -55.982 1.00 72.20  ? 180  ASP A N     1 
ATOM   2269 C  CA    . ASP E 3 203 ? 33.266  -23.871 -56.715 1.00 72.46  ? 180  ASP A CA    1 
ATOM   2270 C  C     . ASP E 3 203 ? 34.536  -23.944 -55.862 1.00 71.37  ? 180  ASP A C     1 
ATOM   2271 O  O     . ASP E 3 203 ? 35.622  -23.569 -56.309 1.00 71.61  ? 180  ASP A O     1 
ATOM   2272 C  CB    . ASP E 3 203 ? 33.541  -23.086 -58.010 1.00 73.34  ? 180  ASP A CB    1 
ATOM   2273 C  CG    . ASP E 3 203 ? 33.858  -21.622 -57.756 0.00 73.22  ? 180  ASP A CG    1 
ATOM   2274 O  OD1   . ASP E 3 203 ? 34.892  -21.332 -57.119 0.00 73.44  ? 180  ASP A OD1   1 
ATOM   2275 O  OD2   . ASP E 3 203 ? 33.069  -20.759 -58.195 0.00 73.44  ? 180  ASP A OD2   1 
ATOM   2276 N  N     . LEU E 3 204 ? 34.385  -24.423 -54.629 1.00 69.62  ? 181  LEU A N     1 
ATOM   2277 C  CA    . LEU E 3 204 ? 35.509  -24.562 -53.702 1.00 67.38  ? 181  LEU A CA    1 
ATOM   2278 C  C     . LEU E 3 204 ? 35.151  -25.463 -52.521 1.00 65.48  ? 181  LEU A C     1 
ATOM   2279 O  O     . LEU E 3 204 ? 34.258  -25.147 -51.732 1.00 65.14  ? 181  LEU A O     1 
ATOM   2280 C  CB    . LEU E 3 204 ? 35.950  -23.191 -53.178 1.00 66.29  ? 181  LEU A CB    1 
ATOM   2281 C  CG    . LEU E 3 204 ? 37.066  -23.216 -52.127 1.00 65.00  ? 181  LEU A CG    1 
ATOM   2282 C  CD1   . LEU E 3 204 ? 38.311  -23.872 -52.704 1.00 64.38  ? 181  LEU A CD1   1 
ATOM   2283 C  CD2   . LEU E 3 204 ? 37.370  -21.801 -51.669 1.00 64.82  ? 181  LEU A CD2   1 
ATOM   2284 N  N     . LYS E 3 205 ? 35.854  -26.585 -52.406 1.00 62.72  ? 182  LYS A N     1 
ATOM   2285 C  CA    . LYS E 3 205 ? 35.610  -27.530 -51.325 1.00 60.66  ? 182  LYS A CA    1 
ATOM   2286 C  C     . LYS E 3 205 ? 36.843  -27.671 -50.440 1.00 59.00  ? 182  LYS A C     1 
ATOM   2287 O  O     . LYS E 3 205 ? 37.969  -27.433 -50.886 1.00 59.12  ? 182  LYS A O     1 
ATOM   2288 C  CB    . LYS E 3 205 ? 35.228  -28.903 -51.891 1.00 60.45  ? 182  LYS A CB    1 
ATOM   2289 C  CG    . LYS E 3 205 ? 33.915  -28.937 -52.661 0.00 60.44  ? 182  LYS A CG    1 
ATOM   2290 C  CD    . LYS E 3 205 ? 34.021  -28.215 -53.993 0.00 60.29  ? 182  LYS A CD    1 
ATOM   2291 C  CE    . LYS E 3 205 ? 32.722  -28.311 -54.775 0.00 60.21  ? 182  LYS A CE    1 
ATOM   2292 N  NZ    . LYS E 3 205 ? 32.829  -27.660 -56.109 0.00 60.15  ? 182  LYS A NZ    1 
ATOM   2293 N  N     . LEU E 3 206 ? 36.627  -28.054 -49.184 1.00 55.29  ? 183  LEU A N     1 
ATOM   2294 C  CA    . LEU E 3 206 ? 37.728  -28.233 -48.249 1.00 52.30  ? 183  LEU A CA    1 
ATOM   2295 C  C     . LEU E 3 206 ? 38.810  -29.112 -48.857 1.00 51.30  ? 183  LEU A C     1 
ATOM   2296 O  O     . LEU E 3 206 ? 39.999  -28.827 -48.727 1.00 50.37  ? 183  LEU A O     1 
ATOM   2297 C  CB    . LEU E 3 206 ? 37.237  -28.881 -46.950 1.00 51.06  ? 183  LEU A CB    1 
ATOM   2298 C  CG    . LEU E 3 206 ? 36.891  -28.005 -45.744 1.00 48.60  ? 183  LEU A CG    1 
ATOM   2299 C  CD1   . LEU E 3 206 ? 36.511  -28.895 -44.576 1.00 47.72  ? 183  LEU A CD1   1 
ATOM   2300 C  CD2   . LEU E 3 206 ? 38.079  -27.145 -45.365 1.00 47.74  ? 183  LEU A CD2   1 
ATOM   2301 N  N     . LYS E 3 207 ? 38.392  -30.179 -49.528 1.00 50.54  ? 184  LYS A N     1 
ATOM   2302 C  CA    . LYS E 3 207 ? 39.341  -31.102 -50.128 1.00 51.07  ? 184  LYS A CA    1 
ATOM   2303 C  C     . LYS E 3 207 ? 40.305  -30.437 -51.103 1.00 49.88  ? 184  LYS A C     1 
ATOM   2304 O  O     . LYS E 3 207 ? 41.491  -30.764 -51.119 1.00 49.88  ? 184  LYS A O     1 
ATOM   2305 C  CB    . LYS E 3 207 ? 38.605  -32.255 -50.822 1.00 53.58  ? 184  LYS A CB    1 
ATOM   2306 C  CG    . LYS E 3 207 ? 37.744  -31.854 -52.003 1.00 55.93  ? 184  LYS A CG    1 
ATOM   2307 C  CD    . LYS E 3 207 ? 37.197  -33.089 -52.705 1.00 57.23  ? 184  LYS A CD    1 
ATOM   2308 C  CE    . LYS E 3 207 ? 36.408  -32.715 -53.947 1.00 59.88  ? 184  LYS A CE    1 
ATOM   2309 N  NZ    . LYS E 3 207 ? 37.241  -31.968 -54.933 1.00 61.27  ? 184  LYS A NZ    1 
ATOM   2310 N  N     . ASP E 3 208 ? 39.809  -29.502 -51.907 1.00 48.98  ? 185  ASP A N     1 
ATOM   2311 C  CA    . ASP E 3 208 ? 40.663  -28.819 -52.876 1.00 48.07  ? 185  ASP A CA    1 
ATOM   2312 C  C     . ASP E 3 208 ? 41.409  -27.643 -52.259 1.00 47.10  ? 185  ASP A C     1 
ATOM   2313 O  O     . ASP E 3 208 ? 42.501  -27.293 -52.700 1.00 46.37  ? 185  ASP A O     1 
ATOM   2314 C  CB    . ASP E 3 208 ? 39.837  -28.341 -54.070 1.00 49.42  ? 185  ASP A CB    1 
ATOM   2315 C  CG    . ASP E 3 208 ? 39.166  -29.486 -54.808 1.00 51.73  ? 185  ASP A CG    1 
ATOM   2316 O  OD1   . ASP E 3 208 ? 39.859  -30.478 -55.120 1.00 53.20  ? 185  ASP A OD1   1 
ATOM   2317 O  OD2   . ASP E 3 208 ? 37.950  -29.394 -55.083 1.00 53.29  ? 185  ASP A OD2   1 
ATOM   2318 N  N     . ALA E 3 209 ? 40.815  -27.039 -51.236 1.00 46.43  ? 186  ALA A N     1 
ATOM   2319 C  CA    . ALA E 3 209 ? 41.429  -25.910 -50.552 1.00 46.17  ? 186  ALA A CA    1 
ATOM   2320 C  C     . ALA E 3 209 ? 42.517  -26.403 -49.603 1.00 46.67  ? 186  ALA A C     1 
ATOM   2321 O  O     . ALA E 3 209 ? 43.511  -25.716 -49.373 1.00 46.93  ? 186  ALA A O     1 
ATOM   2322 C  CB    . ALA E 3 209 ? 40.372  -25.138 -49.777 1.00 46.84  ? 186  ALA A CB    1 
ATOM   2323 N  N     . LEU E 3 210 ? 42.319  -27.596 -49.052 1.00 46.74  ? 187  LEU A N     1 
ATOM   2324 C  CA    . LEU E 3 210 ? 43.275  -28.196 -48.126 1.00 46.56  ? 187  LEU A CA    1 
ATOM   2325 C  C     . LEU E 3 210 ? 43.950  -29.412 -48.758 1.00 47.44  ? 187  LEU A C     1 
ATOM   2326 O  O     . LEU E 3 210 ? 43.855  -30.524 -48.239 1.00 47.89  ? 187  LEU A O     1 
ATOM   2327 C  CB    . LEU E 3 210 ? 42.564  -28.621 -46.838 1.00 44.94  ? 187  LEU A CB    1 
ATOM   2328 C  CG    . LEU E 3 210 ? 42.023  -27.521 -45.924 1.00 43.59  ? 187  LEU A CG    1 
ATOM   2329 C  CD1   . LEU E 3 210 ? 41.202  -28.145 -44.815 1.00 41.49  ? 187  LEU A CD1   1 
ATOM   2330 C  CD2   . LEU E 3 210 ? 43.176  -26.715 -45.349 1.00 43.94  ? 187  LEU A CD2   1 
ATOM   2331 N  N     . SER E 3 211 ? 44.639  -29.193 -49.872 1.00 48.14  ? 188  SER A N     1 
ATOM   2332 C  CA    . SER E 3 211 ? 45.313  -30.274 -50.579 1.00 48.34  ? 188  SER A CA    1 
ATOM   2333 C  C     . SER E 3 211 ? 46.679  -30.624 -50.001 1.00 48.40  ? 188  SER A C     1 
ATOM   2334 O  O     . SER E 3 211 ? 46.933  -31.779 -49.661 1.00 48.92  ? 188  SER A O     1 
ATOM   2335 C  CB    . SER E 3 211 ? 45.463  -29.915 -52.057 1.00 48.72  ? 188  SER A CB    1 
ATOM   2336 O  OG    . SER E 3 211 ? 44.199  -29.673 -52.650 1.00 49.85  ? 188  SER A OG    1 
ATOM   2337 N  N     . ASN E 3 212 ? 47.558  -29.631 -49.894 1.00 48.07  ? 189  ASN A N     1 
ATOM   2338 C  CA    . ASN E 3 212 ? 48.899  -29.860 -49.365 1.00 48.28  ? 189  ASN A CA    1 
ATOM   2339 C  C     . ASN E 3 212 ? 48.889  -30.646 -48.063 1.00 46.55  ? 189  ASN A C     1 
ATOM   2340 O  O     . ASN E 3 212 ? 49.463  -31.730 -47.981 1.00 47.68  ? 189  ASN A O     1 
ATOM   2341 C  CB    . ASN E 3 212 ? 49.640  -28.535 -49.131 1.00 50.00  ? 189  ASN A CB    1 
ATOM   2342 C  CG    . ASN E 3 212 ? 50.087  -27.871 -50.423 1.00 52.63  ? 189  ASN A CG    1 
ATOM   2343 O  OD1   . ASN E 3 212 ? 50.662  -28.517 -51.303 1.00 55.03  ? 189  ASN A OD1   1 
ATOM   2344 N  ND2   . ASN E 3 212 ? 49.839  -26.571 -50.537 1.00 53.29  ? 189  ASN A ND2   1 
ATOM   2345 N  N     . ILE E 3 213 ? 48.228  -30.100 -47.050 1.00 43.57  ? 190  ILE A N     1 
ATOM   2346 C  CA    . ILE E 3 213 ? 48.183  -30.742 -45.747 1.00 40.62  ? 190  ILE A CA    1 
ATOM   2347 C  C     . ILE E 3 213 ? 47.610  -32.159 -45.804 1.00 38.96  ? 190  ILE A C     1 
ATOM   2348 O  O     . ILE E 3 213 ? 48.159  -33.073 -45.191 1.00 38.29  ? 190  ILE A O     1 
ATOM   2349 C  CB    . ILE E 3 213 ? 47.392  -29.862 -44.739 1.00 40.06  ? 190  ILE A CB    1 
ATOM   2350 C  CG1   . ILE E 3 213 ? 47.876  -30.129 -43.312 1.00 37.80  ? 190  ILE A CG1   1 
ATOM   2351 C  CG2   . ILE E 3 213 ? 45.902  -30.106 -44.877 1.00 40.27  ? 190  ILE A CG2   1 
ATOM   2352 C  CD1   . ILE E 3 213 ? 47.568  -31.506 -42.788 1.00 39.36  ? 190  ILE A CD1   1 
ATOM   2353 N  N     . ARG E 3 214 ? 46.524  -32.354 -46.547 1.00 37.58  ? 191  ARG A N     1 
ATOM   2354 C  CA    . ARG E 3 214 ? 45.922  -33.684 -46.652 1.00 36.56  ? 191  ARG A CA    1 
ATOM   2355 C  C     . ARG E 3 214 ? 46.814  -34.668 -47.407 1.00 37.35  ? 191  ARG A C     1 
ATOM   2356 O  O     . ARG E 3 214 ? 46.912  -35.839 -47.036 1.00 38.04  ? 191  ARG A O     1 
ATOM   2357 C  CB    . ARG E 3 214 ? 44.558  -33.618 -47.346 1.00 32.71  ? 191  ARG A CB    1 
ATOM   2358 C  CG    . ARG E 3 214 ? 43.462  -32.983 -46.520 1.00 30.45  ? 191  ARG A CG    1 
ATOM   2359 C  CD    . ARG E 3 214 ? 42.117  -33.152 -47.200 1.00 28.19  ? 191  ARG A CD    1 
ATOM   2360 N  NE    . ARG E 3 214 ? 41.021  -32.633 -46.388 1.00 29.24  ? 191  ARG A NE    1 
ATOM   2361 C  CZ    . ARG E 3 214 ? 39.733  -32.853 -46.639 1.00 29.90  ? 191  ARG A CZ    1 
ATOM   2362 N  NH1   . ARG E 3 214 ? 39.376  -33.588 -47.684 1.00 30.98  ? 191  ARG A NH1   1 
ATOM   2363 N  NH2   . ARG E 3 214 ? 38.801  -32.342 -45.846 1.00 28.07  ? 191  ARG A NH2   1 
ATOM   2364 N  N     . GLU E 3 215 ? 47.464  -34.194 -48.465 1.00 37.08  ? 192  GLU A N     1 
ATOM   2365 C  CA    . GLU E 3 215 ? 48.329  -35.050 -49.261 1.00 36.72  ? 192  GLU A CA    1 
ATOM   2366 C  C     . GLU E 3 215 ? 49.666  -35.316 -48.562 1.00 35.92  ? 192  GLU A C     1 
ATOM   2367 O  O     . GLU E 3 215 ? 50.397  -36.237 -48.926 1.00 35.98  ? 192  GLU A O     1 
ATOM   2368 C  CB    . GLU E 3 215 ? 48.560  -34.418 -50.637 1.00 38.55  ? 192  GLU A CB    1 
ATOM   2369 C  CG    . GLU E 3 215 ? 49.142  -35.374 -51.673 1.00 40.94  ? 192  GLU A CG    1 
ATOM   2370 C  CD    . GLU E 3 215 ? 49.425  -34.697 -52.998 0.00 40.48  ? 192  GLU A CD    1 
ATOM   2371 O  OE1   . GLU E 3 215 ? 50.228  -33.741 -53.018 0.00 40.75  ? 192  GLU A OE1   1 
ATOM   2372 O  OE2   . GLU E 3 215 ? 48.846  -35.122 -54.020 0.00 40.75  ? 192  GLU A OE2   1 
ATOM   2373 N  N     . ALA E 3 216 ? 49.982  -34.512 -47.553 1.00 35.32  ? 193  ALA A N     1 
ATOM   2374 C  CA    . ALA E 3 216 ? 51.226  -34.685 -46.807 1.00 34.23  ? 193  ALA A CA    1 
ATOM   2375 C  C     . ALA E 3 216 ? 50.971  -35.620 -45.636 1.00 33.04  ? 193  ALA A C     1 
ATOM   2376 O  O     . ALA E 3 216 ? 51.886  -36.273 -45.133 1.00 31.83  ? 193  ALA A O     1 
ATOM   2377 C  CB    . ALA E 3 216 ? 51.728  -33.339 -46.297 1.00 34.63  ? 193  ALA A CB    1 
ATOM   2378 N  N     . PHE E 3 217 ? 49.711  -35.672 -45.212 1.00 31.74  ? 194  PHE A N     1 
ATOM   2379 C  CA    . PHE E 3 217 ? 49.298  -36.514 -44.097 1.00 30.39  ? 194  PHE A CA    1 
ATOM   2380 C  C     . PHE E 3 217 ? 49.320  -37.994 -44.462 1.00 30.98  ? 194  PHE A C     1 
ATOM   2381 O  O     . PHE E 3 217 ? 49.929  -38.800 -43.757 1.00 31.62  ? 194  PHE A O     1 
ATOM   2382 C  CB    . PHE E 3 217 ? 47.898  -36.105 -43.626 1.00 27.11  ? 194  PHE A CB    1 
ATOM   2383 C  CG    . PHE E 3 217 ? 47.345  -36.974 -42.533 1.00 24.69  ? 194  PHE A CG    1 
ATOM   2384 C  CD1   . PHE E 3 217 ? 48.102  -37.264 -41.401 1.00 22.53  ? 194  PHE A CD1   1 
ATOM   2385 C  CD2   . PHE E 3 217 ? 46.055  -37.489 -42.626 1.00 23.12  ? 194  PHE A CD2   1 
ATOM   2386 C  CE1   . PHE E 3 217 ? 47.586  -38.054 -40.380 1.00 21.62  ? 194  PHE A CE1   1 
ATOM   2387 C  CE2   . PHE E 3 217 ? 45.530  -38.279 -41.611 1.00 22.70  ? 194  PHE A CE2   1 
ATOM   2388 C  CZ    . PHE E 3 217 ? 46.298  -38.561 -40.484 1.00 22.46  ? 194  PHE A CZ    1 
ATOM   2389 N  N     . ILE E 3 218 ? 48.654  -38.355 -45.555 1.00 30.30  ? 195  ILE A N     1 
ATOM   2390 C  CA    . ILE E 3 218 ? 48.634  -39.747 -45.980 1.00 30.45  ? 195  ILE A CA    1 
ATOM   2391 C  C     . ILE E 3 218 ? 50.049  -40.169 -46.348 1.00 31.04  ? 195  ILE A C     1 
ATOM   2392 O  O     . ILE E 3 218 ? 50.481  -41.278 -46.022 1.00 32.52  ? 195  ILE A O     1 
ATOM   2393 C  CB    . ILE E 3 218 ? 47.713  -39.961 -47.193 1.00 30.21  ? 195  ILE A CB    1 
ATOM   2394 C  CG1   . ILE E 3 218 ? 46.265  -39.657 -46.805 1.00 31.48  ? 195  ILE A CG1   1 
ATOM   2395 C  CG2   . ILE E 3 218 ? 47.818  -41.399 -47.676 1.00 29.82  ? 195  ILE A CG2   1 
ATOM   2396 C  CD1   . ILE E 3 218 ? 45.702  -40.593 -45.756 1.00 32.15  ? 195  ILE A CD1   1 
ATOM   2397 N  N     . GLY E 3 219 ? 50.769  -39.278 -47.023 1.00 29.48  ? 196  GLY A N     1 
ATOM   2398 C  CA    . GLY E 3 219 ? 52.133  -39.583 -47.406 1.00 27.55  ? 196  GLY A CA    1 
ATOM   2399 C  C     . GLY E 3 219 ? 52.889  -40.071 -46.191 1.00 25.95  ? 196  GLY A C     1 
ATOM   2400 O  O     . GLY E 3 219 ? 53.634  -41.043 -46.262 1.00 25.91  ? 196  GLY A O     1 
ATOM   2401 N  N     . GLY E 3 220 ? 52.685  -39.387 -45.070 1.00 26.02  ? 197  GLY A N     1 
ATOM   2402 C  CA    . GLY E 3 220 ? 53.335  -39.759 -43.826 1.00 28.44  ? 197  GLY A CA    1 
ATOM   2403 C  C     . GLY E 3 220 ? 54.851  -39.707 -43.818 1.00 29.63  ? 197  GLY A C     1 
ATOM   2404 O  O     . GLY E 3 220 ? 55.497  -40.401 -43.027 1.00 28.38  ? 197  GLY A O     1 
ATOM   2405 N  N     . ASN E 3 221 ? 55.427  -38.881 -44.684 1.00 31.06  ? 198  ASN A N     1 
ATOM   2406 C  CA    . ASN E 3 221 ? 56.877  -38.771 -44.755 1.00 33.71  ? 198  ASN A CA    1 
ATOM   2407 C  C     . ASN E 3 221 ? 57.383  -37.703 -43.796 1.00 34.54  ? 198  ASN A C     1 
ATOM   2408 O  O     . ASN E 3 221 ? 58.463  -37.144 -43.980 1.00 36.10  ? 198  ASN A O     1 
ATOM   2409 C  CB    . ASN E 3 221 ? 57.307  -38.437 -46.183 1.00 34.78  ? 198  ASN A CB    1 
ATOM   2410 C  CG    . ASN E 3 221 ? 56.722  -39.390 -47.203 1.00 36.43  ? 198  ASN A CG    1 
ATOM   2411 O  OD1   . ASN E 3 221 ? 55.554  -39.278 -47.574 1.00 37.14  ? 198  ASN A OD1   1 
ATOM   2412 N  ND2   . ASN E 3 221 ? 57.529  -40.346 -47.654 1.00 38.21  ? 198  ASN A ND2   1 
ATOM   2413 N  N     . TYR E 3 222 ? 56.601  -37.435 -42.760 1.00 34.01  ? 199  TYR A N     1 
ATOM   2414 C  CA    . TYR E 3 222 ? 56.958  -36.421 -41.784 1.00 34.68  ? 199  TYR A CA    1 
ATOM   2415 C  C     . TYR E 3 222 ? 57.324  -37.040 -40.442 1.00 35.71  ? 199  TYR A C     1 
ATOM   2416 O  O     . TYR E 3 222 ? 56.986  -38.190 -40.168 1.00 36.95  ? 199  TYR A O     1 
ATOM   2417 C  CB    . TYR E 3 222 ? 55.776  -35.469 -41.606 1.00 34.08  ? 199  TYR A CB    1 
ATOM   2418 C  CG    . TYR E 3 222 ? 54.508  -36.175 -41.174 1.00 34.35  ? 199  TYR A CG    1 
ATOM   2419 C  CD1   . TYR E 3 222 ? 54.385  -36.701 -39.887 1.00 34.34  ? 199  TYR A CD1   1 
ATOM   2420 C  CD2   . TYR E 3 222 ? 53.451  -36.359 -42.062 1.00 33.80  ? 199  TYR A CD2   1 
ATOM   2421 C  CE1   . TYR E 3 222 ? 53.249  -37.394 -39.497 1.00 33.25  ? 199  TYR A CE1   1 
ATOM   2422 C  CE2   . TYR E 3 222 ? 52.306  -37.055 -41.680 1.00 33.35  ? 199  TYR A CE2   1 
ATOM   2423 C  CZ    . TYR E 3 222 ? 52.216  -37.570 -40.397 1.00 33.58  ? 199  TYR A CZ    1 
ATOM   2424 O  OH    . TYR E 3 222 ? 51.100  -38.271 -40.012 1.00 35.15  ? 199  TYR A OH    1 
ATOM   2425 N  N     . ASP E 3 223 ? 58.022  -36.272 -39.612 1.00 37.03  ? 200  ASP A N     1 
ATOM   2426 C  CA    . ASP E 3 223 ? 58.400  -36.721 -38.276 1.00 39.22  ? 200  ASP A CA    1 
ATOM   2427 C  C     . ASP E 3 223 ? 57.420  -36.025 -37.336 1.00 40.30  ? 200  ASP A C     1 
ATOM   2428 O  O     . ASP E 3 223 ? 57.184  -34.827 -37.468 1.00 40.61  ? 200  ASP A O     1 
ATOM   2429 C  CB    . ASP E 3 223 ? 59.834  -36.298 -37.944 1.00 39.83  ? 200  ASP A CB    1 
ATOM   2430 C  CG    . ASP E 3 223 ? 60.224  -36.626 -36.516 0.00 40.19  ? 200  ASP A CG    1 
ATOM   2431 O  OD1   . ASP E 3 223 ? 60.214  -37.821 -36.153 0.00 40.51  ? 200  ASP A OD1   1 
ATOM   2432 O  OD2   . ASP E 3 223 ? 60.539  -35.687 -35.755 0.00 40.51  ? 200  ASP A OD2   1 
ATOM   2433 N  N     . ILE E 3 224 ? 56.845  -36.770 -36.398 1.00 41.76  ? 201  ILE A N     1 
ATOM   2434 C  CA    . ILE E 3 224 ? 55.873  -36.196 -35.472 1.00 42.61  ? 201  ILE A CA    1 
ATOM   2435 C  C     . ILE E 3 224 ? 56.284  -34.844 -34.894 1.00 42.80  ? 201  ILE A C     1 
ATOM   2436 O  O     . ILE E 3 224 ? 55.429  -34.007 -34.606 1.00 42.30  ? 201  ILE A O     1 
ATOM   2437 C  CB    . ILE E 3 224 ? 55.563  -37.158 -34.301 1.00 43.21  ? 201  ILE A CB    1 
ATOM   2438 C  CG1   . ILE E 3 224 ? 56.822  -37.413 -33.474 1.00 43.20  ? 201  ILE A CG1   1 
ATOM   2439 C  CG2   . ILE E 3 224 ? 55.001  -38.463 -34.842 1.00 44.00  ? 201  ILE A CG2   1 
ATOM   2440 C  CD1   . ILE E 3 224 ? 56.589  -38.325 -32.287 1.00 43.23  ? 201  ILE A CD1   1 
ATOM   2441 N  N     . ASN E 3 225 ? 57.585  -34.624 -34.733 1.00 43.15  ? 202  ASN A N     1 
ATOM   2442 C  CA    . ASN E 3 225 ? 58.057  -33.358 -34.188 1.00 44.32  ? 202  ASN A CA    1 
ATOM   2443 C  C     . ASN E 3 225 ? 58.378  -32.288 -35.227 1.00 43.66  ? 202  ASN A C     1 
ATOM   2444 O  O     . ASN E 3 225 ? 58.916  -31.233 -34.891 1.00 43.16  ? 202  ASN A O     1 
ATOM   2445 C  CB    . ASN E 3 225 ? 59.265  -33.584 -33.282 1.00 47.61  ? 202  ASN A CB    1 
ATOM   2446 C  CG    . ASN E 3 225 ? 58.893  -33.559 -31.811 1.00 52.03  ? 202  ASN A CG    1 
ATOM   2447 O  OD1   . ASN E 3 225 ? 58.405  -32.549 -31.297 1.00 53.79  ? 202  ASN A OD1   1 
ATOM   2448 N  ND2   . ASN E 3 225 ? 59.114  -34.672 -31.126 1.00 54.30  ? 202  ASN A ND2   1 
ATOM   2449 N  N     . SER E 3 226 ? 58.049  -32.559 -36.487 1.00 43.23  ? 203  SER A N     1 
ATOM   2450 C  CA    . SER E 3 226 ? 58.275  -31.593 -37.559 1.00 42.37  ? 203  SER A CA    1 
ATOM   2451 C  C     . SER E 3 226 ? 57.154  -30.567 -37.478 1.00 41.81  ? 203  SER A C     1 
ATOM   2452 O  O     . SER E 3 226 ? 56.133  -30.806 -36.830 1.00 41.39  ? 203  SER A O     1 
ATOM   2453 C  CB    . SER E 3 226 ? 58.228  -32.269 -38.934 1.00 42.12  ? 203  SER A CB    1 
ATOM   2454 O  OG    . SER E 3 226 ? 59.280  -33.200 -39.097 1.00 44.49  ? 203  SER A OG    1 
ATOM   2455 N  N     . HIS E 3 227 ? 57.338  -29.432 -38.144 1.00 40.61  ? 204  HIS A N     1 
ATOM   2456 C  CA    . HIS E 3 227 ? 56.334  -28.379 -38.134 1.00 37.99  ? 204  HIS A CA    1 
ATOM   2457 C  C     . HIS E 3 227 ? 55.394  -28.469 -39.326 1.00 37.09  ? 204  HIS A C     1 
ATOM   2458 O  O     . HIS E 3 227 ? 55.800  -28.823 -40.435 1.00 36.91  ? 204  HIS A O     1 
ATOM   2459 C  CB    . HIS E 3 227 ? 57.022  -27.018 -38.092 1.00 36.58  ? 204  HIS A CB    1 
ATOM   2460 C  CG    . HIS E 3 227 ? 57.617  -26.696 -36.760 1.00 36.46  ? 204  HIS A CG    1 
ATOM   2461 N  ND1   . HIS E 3 227 ? 56.916  -26.040 -35.772 1.00 37.00  ? 204  HIS A ND1   1 
ATOM   2462 C  CD2   . HIS E 3 227 ? 58.829  -26.989 -36.231 1.00 37.04  ? 204  HIS A CD2   1 
ATOM   2463 C  CE1   . HIS E 3 227 ? 57.669  -25.941 -34.691 1.00 37.72  ? 204  HIS A CE1   1 
ATOM   2464 N  NE2   . HIS E 3 227 ? 58.835  -26.509 -34.943 1.00 38.61  ? 204  HIS A NE2   1 
ATOM   2465 N  N     . LEU E 3 228 ? 54.128  -28.157 -39.081 1.00 35.47  ? 205  LEU A N     1 
ATOM   2466 C  CA    . LEU E 3 228 ? 53.117  -28.201 -40.122 1.00 34.61  ? 205  LEU A CA    1 
ATOM   2467 C  C     . LEU E 3 228 ? 53.383  -27.121 -41.153 1.00 33.65  ? 205  LEU A C     1 
ATOM   2468 O  O     . LEU E 3 228 ? 54.008  -26.106 -40.855 1.00 33.22  ? 205  LEU A O     1 
ATOM   2469 C  CB    . LEU E 3 228 ? 51.734  -27.978 -39.517 1.00 35.87  ? 205  LEU A CB    1 
ATOM   2470 C  CG    . LEU E 3 228 ? 51.290  -28.908 -38.391 1.00 36.42  ? 205  LEU A CG    1 
ATOM   2471 C  CD1   . LEU E 3 228 ? 49.938  -28.446 -37.881 1.00 37.94  ? 205  LEU A CD1   1 
ATOM   2472 C  CD2   . LEU E 3 228 ? 51.214  -30.342 -38.890 1.00 37.31  ? 205  LEU A CD2   1 
ATOM   2473 N  N     . PRO E 3 229 ? 52.911  -27.328 -42.389 1.00 33.50  ? 206  PRO A N     1 
ATOM   2474 C  CA    . PRO E 3 229 ? 53.118  -26.332 -43.441 1.00 34.42  ? 206  PRO A CA    1 
ATOM   2475 C  C     . PRO E 3 229 ? 52.206  -25.137 -43.176 1.00 34.89  ? 206  PRO A C     1 
ATOM   2476 O  O     . PRO E 3 229 ? 51.152  -25.284 -42.560 1.00 36.31  ? 206  PRO A O     1 
ATOM   2477 C  CB    . PRO E 3 229 ? 52.732  -27.091 -44.706 1.00 33.63  ? 206  PRO A CB    1 
ATOM   2478 C  CG    . PRO E 3 229 ? 51.625  -27.974 -44.222 1.00 33.33  ? 206  PRO A CG    1 
ATOM   2479 C  CD    . PRO E 3 229 ? 52.181  -28.497 -42.910 1.00 33.70  ? 206  PRO A CD    1 
ATOM   2480 N  N     . LEU E 3 230 ? 52.611  -23.956 -43.626 1.00 34.04  ? 207  LEU A N     1 
ATOM   2481 C  CA    . LEU E 3 230 ? 51.798  -22.765 -43.424 1.00 33.16  ? 207  LEU A CA    1 
ATOM   2482 C  C     . LEU E 3 230 ? 50.422  -22.997 -44.026 1.00 32.08  ? 207  LEU A C     1 
ATOM   2483 O  O     . LEU E 3 230 ? 50.301  -23.545 -45.120 1.00 31.25  ? 207  LEU A O     1 
ATOM   2484 C  CB    . LEU E 3 230 ? 52.454  -21.560 -44.094 1.00 34.84  ? 207  LEU A CB    1 
ATOM   2485 C  CG    . LEU E 3 230 ? 53.835  -21.207 -43.544 1.00 37.28  ? 207  LEU A CG    1 
ATOM   2486 C  CD1   . LEU E 3 230 ? 54.544  -20.252 -44.491 1.00 38.92  ? 207  LEU A CD1   1 
ATOM   2487 C  CD2   . LEU E 3 230 ? 53.687  -20.602 -42.156 1.00 37.33  ? 207  LEU A CD2   1 
ATOM   2488 N  N     . ILE E 3 231 ? 49.382  -22.593 -43.308 1.00 30.93  ? 208  ILE A N     1 
ATOM   2489 C  CA    . ILE E 3 231 ? 48.034  -22.771 -43.817 1.00 31.62  ? 208  ILE A CA    1 
ATOM   2490 C  C     . ILE E 3 231 ? 47.959  -22.195 -45.225 1.00 31.74  ? 208  ILE A C     1 
ATOM   2491 O  O     . ILE E 3 231 ? 48.666  -21.243 -45.556 1.00 30.22  ? 208  ILE A O     1 
ATOM   2492 C  CB    . ILE E 3 231 ? 46.987  -22.057 -42.937 1.00 31.86  ? 208  ILE A CB    1 
ATOM   2493 C  CG1   . ILE E 3 231 ? 47.296  -20.560 -42.868 1.00 32.11  ? 208  ILE A CG1   1 
ATOM   2494 C  CG2   . ILE E 3 231 ? 46.970  -22.672 -41.549 1.00 31.24  ? 208  ILE A CG2   1 
ATOM   2495 C  CD1   . ILE E 3 231 ? 46.232  -19.752 -42.160 1.00 32.23  ? 208  ILE A CD1   1 
ATOM   2496 N  N     . PRO E 3 232 ? 47.109  -22.781 -46.077 1.00 32.73  ? 209  PRO A N     1 
ATOM   2497 C  CA    . PRO E 3 232 ? 46.927  -22.337 -47.460 1.00 34.40  ? 209  PRO A CA    1 
ATOM   2498 C  C     . PRO E 3 232 ? 46.091  -21.061 -47.539 1.00 35.88  ? 209  PRO A C     1 
ATOM   2499 O  O     . PRO E 3 232 ? 45.015  -20.973 -46.949 1.00 37.23  ? 209  PRO A O     1 
ATOM   2500 C  CB    . PRO E 3 232 ? 46.235  -23.530 -48.106 1.00 33.98  ? 209  PRO A CB    1 
ATOM   2501 C  CG    . PRO E 3 232 ? 45.380  -24.038 -46.994 1.00 34.41  ? 209  PRO A CG    1 
ATOM   2502 C  CD    . PRO E 3 232 ? 46.326  -24.003 -45.817 1.00 33.84  ? 209  PRO A CD    1 
ATOM   2503 N  N     . GLU E 3 233 ? 46.594  -20.075 -48.272 1.00 36.41  ? 210  GLU A N     1 
ATOM   2504 C  CA    . GLU E 3 233 ? 45.903  -18.804 -48.423 1.00 37.41  ? 210  GLU A CA    1 
ATOM   2505 C  C     . GLU E 3 233 ? 44.413  -19.013 -48.684 1.00 37.26  ? 210  GLU A C     1 
ATOM   2506 O  O     . GLU E 3 233 ? 43.591  -18.164 -48.349 1.00 36.84  ? 210  GLU A O     1 
ATOM   2507 C  CB    . GLU E 3 233 ? 46.530  -18.013 -49.575 1.00 39.51  ? 210  GLU A CB    1 
ATOM   2508 C  CG    . GLU E 3 233 ? 46.096  -16.561 -49.664 1.00 43.05  ? 210  GLU A CG    1 
ATOM   2509 C  CD    . GLU E 3 233 ? 46.426  -15.775 -48.405 1.00 46.45  ? 210  GLU A CD    1 
ATOM   2510 O  OE1   . GLU E 3 233 ? 47.593  -15.837 -47.951 1.00 46.41  ? 210  GLU A OE1   1 
ATOM   2511 O  OE2   . GLU E 3 233 ? 45.518  -15.093 -47.874 1.00 46.99  ? 210  GLU A OE2   1 
ATOM   2512 N  N     . LYS E 3 234 ? 44.071  -20.156 -49.269 1.00 38.16  ? 211  LYS A N     1 
ATOM   2513 C  CA    . LYS E 3 234 ? 42.683  -20.470 -49.585 1.00 40.43  ? 211  LYS A CA    1 
ATOM   2514 C  C     . LYS E 3 234 ? 41.813  -20.841 -48.386 1.00 40.42  ? 211  LYS A C     1 
ATOM   2515 O  O     . LYS E 3 234 ? 40.621  -20.531 -48.360 1.00 40.34  ? 211  LYS A O     1 
ATOM   2516 C  CB    . LYS E 3 234 ? 42.630  -21.592 -50.625 1.00 42.82  ? 211  LYS A CB    1 
ATOM   2517 C  CG    . LYS E 3 234 ? 43.034  -21.144 -52.020 1.00 46.80  ? 211  LYS A CG    1 
ATOM   2518 C  CD    . LYS E 3 234 ? 43.040  -22.296 -53.022 1.00 49.24  ? 211  LYS A CD    1 
ATOM   2519 C  CE    . LYS E 3 234 ? 44.180  -23.275 -52.758 1.00 49.17  ? 211  LYS A CE    1 
ATOM   2520 N  NZ    . LYS E 3 234 ? 44.277  -24.315 -53.825 1.00 47.86  ? 211  LYS A NZ    1 
ATOM   2521 N  N     . ILE E 3 235 ? 42.398  -21.501 -47.392 1.00 40.14  ? 212  ILE A N     1 
ATOM   2522 C  CA    . ILE E 3 235 ? 41.633  -21.899 -46.215 1.00 40.12  ? 212  ILE A CA    1 
ATOM   2523 C  C     . ILE E 3 235 ? 41.083  -20.693 -45.457 1.00 40.41  ? 212  ILE A C     1 
ATOM   2524 O  O     . ILE E 3 235 ? 40.154  -20.825 -44.661 1.00 41.22  ? 212  ILE A O     1 
ATOM   2525 C  CB    . ILE E 3 235 ? 42.487  -22.751 -45.242 1.00 38.91  ? 212  ILE A CB    1 
ATOM   2526 C  CG1   . ILE E 3 235 ? 41.594  -23.354 -44.153 1.00 36.91  ? 212  ILE A CG1   1 
ATOM   2527 C  CG2   . ILE E 3 235 ? 43.565  -21.891 -44.597 1.00 38.96  ? 212  ILE A CG2   1 
ATOM   2528 C  CD1   . ILE E 3 235 ? 40.512  -24.270 -44.681 1.00 33.49  ? 212  ILE A CD1   1 
ATOM   2529 N  N     . LYS E 3 236 ? 41.654  -19.518 -45.710 1.00 40.69  ? 213  LYS A N     1 
ATOM   2530 C  CA    . LYS E 3 236 ? 41.219  -18.294 -45.042 1.00 40.46  ? 213  LYS A CA    1 
ATOM   2531 C  C     . LYS E 3 236 ? 39.783  -17.898 -45.373 1.00 40.53  ? 213  LYS A C     1 
ATOM   2532 O  O     . LYS E 3 236 ? 39.256  -16.945 -44.804 1.00 38.94  ? 213  LYS A O     1 
ATOM   2533 C  CB    . LYS E 3 236 ? 42.164  -17.137 -45.383 1.00 40.36  ? 213  LYS A CB    1 
ATOM   2534 C  CG    . LYS E 3 236 ? 43.560  -17.296 -44.801 1.00 41.92  ? 213  LYS A CG    1 
ATOM   2535 C  CD    . LYS E 3 236 ? 44.476  -16.132 -45.154 1.00 40.83  ? 213  LYS A CD    1 
ATOM   2536 C  CE    . LYS E 3 236 ? 45.860  -16.337 -44.549 1.00 41.17  ? 213  LYS A CE    1 
ATOM   2537 N  NZ    . LYS E 3 236 ? 46.827  -15.256 -44.898 1.00 41.85  ? 213  LYS A NZ    1 
ATOM   2538 N  N     . SER E 3 237 ? 39.150  -18.625 -46.289 1.00 42.20  ? 214  SER A N     1 
ATOM   2539 C  CA    . SER E 3 237 ? 37.771  -18.327 -46.668 1.00 43.98  ? 214  SER A CA    1 
ATOM   2540 C  C     . SER E 3 237 ? 36.796  -19.165 -45.842 1.00 43.63  ? 214  SER A C     1 
ATOM   2541 O  O     . SER E 3 237 ? 35.596  -19.213 -46.127 1.00 43.23  ? 214  SER A O     1 
ATOM   2542 C  CB    . SER E 3 237 ? 37.554  -18.593 -48.163 1.00 45.64  ? 214  SER A CB    1 
ATOM   2543 O  OG    . SER E 3 237 ? 37.702  -19.968 -48.469 1.00 49.50  ? 214  SER A OG    1 
ATOM   2544 N  N     . LEU E 3 238 ? 37.334  -19.834 -44.825 1.00 42.59  ? 215  LEU A N     1 
ATOM   2545 C  CA    . LEU E 3 238 ? 36.538  -20.662 -43.927 1.00 41.03  ? 215  LEU A CA    1 
ATOM   2546 C  C     . LEU E 3 238 ? 35.918  -19.704 -42.923 1.00 40.53  ? 215  LEU A C     1 
ATOM   2547 O  O     . LEU E 3 238 ? 36.614  -18.862 -42.358 1.00 40.46  ? 215  LEU A O     1 
ATOM   2548 C  CB    . LEU E 3 238 ? 37.436  -21.677 -43.211 1.00 39.87  ? 215  LEU A CB    1 
ATOM   2549 C  CG    . LEU E 3 238 ? 36.798  -22.617 -42.184 1.00 37.36  ? 215  LEU A CG    1 
ATOM   2550 C  CD1   . LEU E 3 238 ? 35.639  -23.370 -42.819 1.00 37.45  ? 215  LEU A CD1   1 
ATOM   2551 C  CD2   . LEU E 3 238 ? 37.850  -23.581 -41.663 1.00 33.89  ? 215  LEU A CD2   1 
ATOM   2552 N  N     . LYS E 3 239 ? 34.615  -19.829 -42.698 1.00 39.70  ? 216  LYS A N     1 
ATOM   2553 C  CA    . LYS E 3 239 ? 33.926  -18.929 -41.784 1.00 39.85  ? 216  LYS A CA    1 
ATOM   2554 C  C     . LYS E 3 239 ? 33.550  -19.521 -40.429 1.00 38.47  ? 216  LYS A C     1 
ATOM   2555 O  O     . LYS E 3 239 ? 33.210  -20.699 -40.326 1.00 38.81  ? 216  LYS A O     1 
ATOM   2556 C  CB    . LYS E 3 239 ? 32.674  -18.375 -42.472 1.00 41.94  ? 216  LYS A CB    1 
ATOM   2557 C  CG    . LYS E 3 239 ? 32.977  -17.617 -43.766 1.00 46.31  ? 216  LYS A CG    1 
ATOM   2558 C  CD    . LYS E 3 239 ? 31.730  -16.990 -44.386 1.00 47.83  ? 216  LYS A CD    1 
ATOM   2559 C  CE    . LYS E 3 239 ? 30.747  -18.043 -44.884 1.00 48.49  ? 216  LYS A CE    1 
ATOM   2560 N  NZ    . LYS E 3 239 ? 29.518  -17.423 -45.459 1.00 47.63  ? 216  LYS A NZ    1 
ATOM   2561 N  N     . PHE E 3 240 ? 33.622  -18.688 -39.392 1.00 36.71  ? 217  PHE A N     1 
ATOM   2562 C  CA    . PHE E 3 240 ? 33.264  -19.106 -38.040 1.00 36.62  ? 217  PHE A CA    1 
ATOM   2563 C  C     . PHE E 3 240 ? 31.761  -18.989 -37.832 1.00 36.84  ? 217  PHE A C     1 
ATOM   2564 O  O     . PHE E 3 240 ? 31.141  -18.024 -38.274 1.00 37.77  ? 217  PHE A O     1 
ATOM   2565 C  CB    . PHE E 3 240 ? 33.932  -18.225 -36.990 1.00 35.53  ? 217  PHE A CB    1 
ATOM   2566 C  CG    . PHE E 3 240 ? 35.404  -18.415 -36.881 1.00 36.45  ? 217  PHE A CG    1 
ATOM   2567 C  CD1   . PHE E 3 240 ? 36.274  -17.595 -37.582 1.00 37.65  ? 217  PHE A CD1   1 
ATOM   2568 C  CD2   . PHE E 3 240 ? 35.928  -19.395 -36.046 1.00 37.12  ? 217  PHE A CD2   1 
ATOM   2569 C  CE1   . PHE E 3 240 ? 37.650  -17.747 -37.454 1.00 38.35  ? 217  PHE A CE1   1 
ATOM   2570 C  CE2   . PHE E 3 240 ? 37.300  -19.557 -35.911 1.00 37.27  ? 217  PHE A CE2   1 
ATOM   2571 C  CZ    . PHE E 3 240 ? 38.164  -18.729 -36.614 1.00 37.82  ? 217  PHE A CZ    1 
ATOM   2572 N  N     . GLU E 3 241 ? 31.177  -19.961 -37.144 1.00 37.01  ? 218  GLU A N     1 
ATOM   2573 C  CA    . GLU E 3 241 ? 29.751  -19.922 -36.869 1.00 37.23  ? 218  GLU A CA    1 
ATOM   2574 C  C     . GLU E 3 241 ? 29.577  -19.377 -35.458 1.00 37.28  ? 218  GLU A C     1 
ATOM   2575 O  O     . GLU E 3 241 ? 29.972  -20.020 -34.483 1.00 38.14  ? 218  GLU A O     1 
ATOM   2576 C  CB    . GLU E 3 241 ? 29.148  -21.319 -36.959 1.00 38.66  ? 218  GLU A CB    1 
ATOM   2577 C  CG    . GLU E 3 241 ? 27.639  -21.318 -36.973 1.00 42.95  ? 218  GLU A CG    1 
ATOM   2578 C  CD    . GLU E 3 241 ? 27.077  -20.581 -38.173 1.00 46.90  ? 218  GLU A CD    1 
ATOM   2579 O  OE1   . GLU E 3 241 ? 27.436  -20.945 -39.316 1.00 48.36  ? 218  GLU A OE1   1 
ATOM   2580 O  OE2   . GLU E 3 241 ? 26.275  -19.642 -37.974 1.00 49.10  ? 218  GLU A OE2   1 
ATOM   2581 N  N     . GLY E 3 242 ? 28.996  -18.187 -35.354 1.00 35.53  ? 219  GLY A N     1 
ATOM   2582 C  CA    . GLY E 3 242 ? 28.801  -17.577 -34.053 1.00 33.50  ? 219  GLY A CA    1 
ATOM   2583 C  C     . GLY E 3 242 ? 29.579  -16.283 -33.928 1.00 32.47  ? 219  GLY A C     1 
ATOM   2584 O  O     . GLY E 3 242 ? 30.132  -15.797 -34.911 1.00 32.71  ? 219  GLY A O     1 
ATOM   2585 N  N     . ASP E 3 243 ? 29.627  -15.726 -32.721 1.00 32.49  ? 220  ASP A N     1 
ATOM   2586 C  CA    . ASP E 3 243 ? 30.339  -14.475 -32.476 1.00 32.29  ? 220  ASP A CA    1 
ATOM   2587 C  C     . ASP E 3 243 ? 31.803  -14.711 -32.130 1.00 31.95  ? 220  ASP A C     1 
ATOM   2588 O  O     . ASP E 3 243 ? 32.112  -15.346 -31.125 1.00 30.98  ? 220  ASP A O     1 
ATOM   2589 C  CB    . ASP E 3 243 ? 29.674  -13.706 -31.333 1.00 34.51  ? 220  ASP A CB    1 
ATOM   2590 C  CG    . ASP E 3 243 ? 28.255  -13.283 -31.662 1.00 39.24  ? 220  ASP A CG    1 
ATOM   2591 O  OD1   . ASP E 3 243 ? 27.460  -14.144 -32.098 1.00 41.75  ? 220  ASP A OD1   1 
ATOM   2592 O  OD2   . ASP E 3 243 ? 27.927  -12.091 -31.476 1.00 42.58  ? 220  ASP A OD2   1 
ATOM   2593 N  N     . VAL E 3 244 ? 32.700  -14.198 -32.968 1.00 31.42  ? 221  VAL A N     1 
ATOM   2594 C  CA    . VAL E 3 244 ? 34.133  -14.342 -32.741 1.00 30.92  ? 221  VAL A CA    1 
ATOM   2595 C  C     . VAL E 3 244 ? 34.646  -13.125 -31.985 1.00 32.81  ? 221  VAL A C     1 
ATOM   2596 O  O     . VAL E 3 244 ? 34.817  -12.054 -32.566 1.00 32.90  ? 221  VAL A O     1 
ATOM   2597 C  CB    . VAL E 3 244 ? 34.907  -14.454 -34.070 1.00 29.25  ? 221  VAL A CB    1 
ATOM   2598 C  CG1   . VAL E 3 244 ? 36.402  -14.517 -33.798 1.00 26.65  ? 221  VAL A CG1   1 
ATOM   2599 C  CG2   . VAL E 3 244 ? 34.459  -15.688 -34.828 1.00 27.70  ? 221  VAL A CG2   1 
ATOM   2600 N  N     . PHE E 3 245 ? 34.891  -13.293 -30.690 1.00 35.00  ? 222  PHE A N     1 
ATOM   2601 C  CA    . PHE E 3 245 ? 35.380  -12.197 -29.859 1.00 38.57  ? 222  PHE A CA    1 
ATOM   2602 C  C     . PHE E 3 245 ? 36.672  -11.598 -30.407 1.00 39.68  ? 222  PHE A C     1 
ATOM   2603 O  O     . PHE E 3 245 ? 37.770  -12.048 -30.071 1.00 38.75  ? 222  PHE A O     1 
ATOM   2604 C  CB    . PHE E 3 245 ? 35.629  -12.682 -28.436 1.00 39.89  ? 222  PHE A CB    1 
ATOM   2605 C  CG    . PHE E 3 245 ? 35.918  -11.574 -27.472 1.00 41.95  ? 222  PHE A CG    1 
ATOM   2606 C  CD1   . PHE E 3 245 ? 34.882  -10.823 -26.930 1.00 42.79  ? 222  PHE A CD1   1 
ATOM   2607 C  CD2   . PHE E 3 245 ? 37.226  -11.268 -27.119 1.00 42.46  ? 222  PHE A CD2   1 
ATOM   2608 C  CE1   . PHE E 3 245 ? 35.142  -9.780  -26.053 1.00 44.09  ? 222  PHE A CE1   1 
ATOM   2609 C  CE2   . PHE E 3 245 ? 37.498  -10.225 -26.243 1.00 43.85  ? 222  PHE A CE2   1 
ATOM   2610 C  CZ    . PHE E 3 245 ? 36.454  -9.480  -25.707 1.00 44.91  ? 222  PHE A CZ    1 
ATOM   2611 N  N     . ASN E 3 246 ? 36.541  -10.570 -31.239 1.00 40.80  ? 223  ASN A N     1 
ATOM   2612 C  CA    . ASN E 3 246 ? 37.708  -9.932  -31.827 1.00 41.63  ? 223  ASN A CA    1 
ATOM   2613 C  C     . ASN E 3 246 ? 37.665  -8.413  -31.695 1.00 41.67  ? 223  ASN A C     1 
ATOM   2614 O  O     . ASN E 3 246 ? 37.438  -7.704  -32.673 1.00 40.67  ? 223  ASN A O     1 
ATOM   2615 C  CB    . ASN E 3 246 ? 37.812  -10.314 -33.301 1.00 42.62  ? 223  ASN A CB    1 
ATOM   2616 C  CG    . ASN E 3 246 ? 39.181  -10.036 -33.875 1.00 44.35  ? 223  ASN A CG    1 
ATOM   2617 O  OD1   . ASN E 3 246 ? 39.430  -10.280 -35.054 1.00 45.08  ? 223  ASN A OD1   1 
ATOM   2618 N  ND2   . ASN E 3 246 ? 40.085  -9.526  -33.039 1.00 45.17  ? 223  ASN A ND2   1 
ATOM   2619 N  N     . PRO E 3 247 ? 37.885  -7.895  -30.479 1.00 42.53  ? 224  PRO A N     1 
ATOM   2620 C  CA    . PRO E 3 247 ? 37.863  -6.448  -30.260 1.00 43.97  ? 224  PRO A CA    1 
ATOM   2621 C  C     . PRO E 3 247 ? 38.983  -5.717  -31.009 1.00 45.84  ? 224  PRO A C     1 
ATOM   2622 O  O     . PRO E 3 247 ? 38.727  -4.747  -31.725 1.00 47.68  ? 224  PRO A O     1 
ATOM   2623 C  CB    . PRO E 3 247 ? 37.985  -6.331  -28.742 1.00 42.71  ? 224  PRO A CB    1 
ATOM   2624 C  CG    . PRO E 3 247 ? 38.798  -7.528  -28.380 1.00 42.88  ? 224  PRO A CG    1 
ATOM   2625 C  CD    . PRO E 3 247 ? 38.169  -8.609  -29.223 1.00 43.08  ? 224  PRO A CD    1 
ATOM   2626 N  N     . GLU E 3 248 ? 40.217  -6.187  -30.852 1.00 45.70  ? 225  GLU A N     1 
ATOM   2627 C  CA    . GLU E 3 248 ? 41.354  -5.566  -31.521 1.00 44.94  ? 225  GLU A CA    1 
ATOM   2628 C  C     . GLU E 3 248 ? 41.363  -5.834  -33.029 1.00 44.20  ? 225  GLU A C     1 
ATOM   2629 O  O     . GLU E 3 248 ? 42.370  -5.610  -33.704 1.00 45.02  ? 225  GLU A O     1 
ATOM   2630 C  CB    . GLU E 3 248 ? 42.660  -6.057  -30.894 1.00 47.76  ? 225  GLU A CB    1 
ATOM   2631 C  CG    . GLU E 3 248 ? 42.896  -5.559  -29.471 1.00 52.82  ? 225  GLU A CG    1 
ATOM   2632 C  CD    . GLU E 3 248 ? 43.055  -4.044  -29.393 1.00 55.93  ? 225  GLU A CD    1 
ATOM   2633 O  OE1   . GLU E 3 248 ? 43.977  -3.502  -30.043 1.00 57.18  ? 225  GLU A OE1   1 
ATOM   2634 O  OE2   . GLU E 3 248 ? 42.259  -3.395  -28.680 1.00 57.82  ? 225  GLU A OE2   1 
ATOM   2635 N  N     . GLY E 3 249 ? 40.238  -6.310  -33.552 1.00 42.37  ? 226  GLY A N     1 
ATOM   2636 C  CA    . GLY E 3 249 ? 40.131  -6.589  -34.974 1.00 39.80  ? 226  GLY A CA    1 
ATOM   2637 C  C     . GLY E 3 249 ? 41.328  -7.306  -35.570 1.00 39.13  ? 226  GLY A C     1 
ATOM   2638 O  O     . GLY E 3 249 ? 42.054  -6.736  -36.384 1.00 38.96  ? 226  GLY A O     1 
ATOM   2639 N  N     . ARG E 3 250 ? 41.526  -8.559  -35.166 1.00 37.97  ? 227  ARG A N     1 
ATOM   2640 C  CA    . ARG E 3 250 ? 42.630  -9.383  -35.652 1.00 36.50  ? 227  ARG A CA    1 
ATOM   2641 C  C     . ARG E 3 250 ? 42.179  -10.249 -36.826 1.00 36.76  ? 227  ARG A C     1 
ATOM   2642 O  O     . ARG E 3 250 ? 40.994  -10.317 -37.136 1.00 36.35  ? 227  ARG A O     1 
ATOM   2643 C  CB    . ARG E 3 250 ? 43.127  -10.296 -34.534 1.00 35.75  ? 227  ARG A CB    1 
ATOM   2644 C  CG    . ARG E 3 250 ? 43.525  -9.576  -33.266 1.00 35.41  ? 227  ARG A CG    1 
ATOM   2645 C  CD    . ARG E 3 250 ? 43.844  -10.574 -32.164 1.00 36.27  ? 227  ARG A CD    1 
ATOM   2646 N  NE    . ARG E 3 250 ? 44.349  -9.915  -30.966 1.00 36.14  ? 227  ARG A NE    1 
ATOM   2647 C  CZ    . ARG E 3 250 ? 45.494  -9.244  -30.916 1.00 35.70  ? 227  ARG A CZ    1 
ATOM   2648 N  NH1   . ARG E 3 250 ? 46.255  -9.146  -31.998 1.00 36.61  ? 227  ARG A NH1   1 
ATOM   2649 N  NH2   . ARG E 3 250 ? 45.874  -8.663  -29.788 1.00 36.44  ? 227  ARG A NH2   1 
ATOM   2650 N  N     . ASP E 3 251 ? 43.128  -10.914 -37.476 1.00 38.95  ? 228  ASP A N     1 
ATOM   2651 C  CA    . ASP E 3 251 ? 42.801  -11.787 -38.601 1.00 41.28  ? 228  ASP A CA    1 
ATOM   2652 C  C     . ASP E 3 251 ? 42.191  -13.072 -38.058 1.00 40.69  ? 228  ASP A C     1 
ATOM   2653 O  O     . ASP E 3 251 ? 42.791  -13.750 -37.223 1.00 42.17  ? 228  ASP A O     1 
ATOM   2654 C  CB    . ASP E 3 251 ? 44.057  -12.102 -39.415 1.00 44.40  ? 228  ASP A CB    1 
ATOM   2655 C  CG    . ASP E 3 251 ? 44.516  -10.926 -40.253 1.00 46.79  ? 228  ASP A CG    1 
ATOM   2656 O  OD1   . ASP E 3 251 ? 45.652  -10.965 -40.774 1.00 48.38  ? 228  ASP A OD1   1 
ATOM   2657 O  OD2   . ASP E 3 251 ? 43.732  -9.964  -40.397 1.00 48.56  ? 228  ASP A OD2   1 
ATOM   2658 N  N     . LEU E 3 252 ? 40.996  -13.398 -38.537 1.00 38.21  ? 229  LEU A N     1 
ATOM   2659 C  CA    . LEU E 3 252 ? 40.281  -14.581 -38.083 1.00 35.94  ? 229  LEU A CA    1 
ATOM   2660 C  C     . LEU E 3 252 ? 41.012  -15.899 -38.319 1.00 36.35  ? 229  LEU A C     1 
ATOM   2661 O  O     . LEU E 3 252 ? 40.927  -16.810 -37.498 1.00 37.36  ? 229  LEU A O     1 
ATOM   2662 C  CB    . LEU E 3 252 ? 38.904  -14.636 -38.745 1.00 34.47  ? 229  LEU A CB    1 
ATOM   2663 C  CG    . LEU E 3 252 ? 38.030  -13.381 -38.638 1.00 33.24  ? 229  LEU A CG    1 
ATOM   2664 C  CD1   . LEU E 3 252 ? 36.705  -13.640 -39.331 1.00 32.61  ? 229  LEU A CD1   1 
ATOM   2665 C  CD2   . LEU E 3 252 ? 37.797  -13.014 -37.182 1.00 33.57  ? 229  LEU A CD2   1 
ATOM   2666 N  N     . ILE E 3 253 ? 41.732  -16.005 -39.431 1.00 35.69  ? 230  ILE A N     1 
ATOM   2667 C  CA    . ILE E 3 253 ? 42.450  -17.237 -39.750 1.00 34.51  ? 230  ILE A CA    1 
ATOM   2668 C  C     . ILE E 3 253 ? 43.927  -16.975 -40.047 1.00 35.42  ? 230  ILE A C     1 
ATOM   2669 O  O     . ILE E 3 253 ? 44.259  -16.385 -41.076 1.00 36.60  ? 230  ILE A O     1 
ATOM   2670 C  CB    . ILE E 3 253 ? 41.824  -17.933 -40.986 1.00 33.13  ? 230  ILE A CB    1 
ATOM   2671 C  CG1   . ILE E 3 253 ? 40.320  -18.129 -40.784 1.00 31.47  ? 230  ILE A CG1   1 
ATOM   2672 C  CG2   . ILE E 3 253 ? 42.489  -19.277 -41.224 1.00 33.32  ? 230  ILE A CG2   1 
ATOM   2673 C  CD1   . ILE E 3 253 ? 39.967  -19.100 -39.696 1.00 30.93  ? 230  ILE A CD1   1 
ATOM   2674 N  N     . THR E 3 254 ? 44.813  -17.413 -39.157 1.00 34.72  ? 231  THR A N     1 
ATOM   2675 C  CA    . THR E 3 254 ? 46.245  -17.218 -39.371 1.00 35.77  ? 231  THR A CA    1 
ATOM   2676 C  C     . THR E 3 254 ? 47.019  -18.533 -39.285 1.00 36.43  ? 231  THR A C     1 
ATOM   2677 O  O     . THR E 3 254 ? 48.077  -18.677 -39.901 1.00 37.55  ? 231  THR A O     1 
ATOM   2678 C  CB    . THR E 3 254 ? 46.848  -16.208 -38.357 1.00 37.05  ? 231  THR A CB    1 
ATOM   2679 O  OG1   . THR E 3 254 ? 46.940  -16.803 -37.055 1.00 37.96  ? 231  THR A OG1   1 
ATOM   2680 C  CG2   . THR E 3 254 ? 45.976  -14.966 -38.277 1.00 38.45  ? 231  THR A CG2   1 
ATOM   2681 N  N     . ASP E 3 255 ? 46.491  -19.488 -38.522 1.00 36.28  ? 232  ASP A N     1 
ATOM   2682 C  CA    . ASP E 3 255 ? 47.132  -20.794 -38.377 1.00 35.16  ? 232  ASP A CA    1 
ATOM   2683 C  C     . ASP E 3 255 ? 46.084  -21.888 -38.185 1.00 34.89  ? 232  ASP A C     1 
ATOM   2684 O  O     . ASP E 3 255 ? 44.883  -21.616 -38.143 1.00 35.85  ? 232  ASP A O     1 
ATOM   2685 C  CB    . ASP E 3 255 ? 48.101  -20.801 -37.193 1.00 35.08  ? 232  ASP A CB    1 
ATOM   2686 C  CG    . ASP E 3 255 ? 49.304  -21.701 -37.432 1.00 35.89  ? 232  ASP A CG    1 
ATOM   2687 O  OD1   . ASP E 3 255 ? 49.129  -22.806 -37.987 1.00 36.27  ? 232  ASP A OD1   1 
ATOM   2688 O  OD2   . ASP E 3 255 ? 50.429  -21.306 -37.058 1.00 36.01  ? 232  ASP A OD2   1 
ATOM   2689 N  N     . TRP E 3 256 ? 46.550  -23.125 -38.047 1.00 33.29  ? 233  TRP A N     1 
ATOM   2690 C  CA    . TRP E 3 256 ? 45.669  -24.275 -37.895 1.00 31.47  ? 233  TRP A CA    1 
ATOM   2691 C  C     . TRP E 3 256 ? 44.696  -24.254 -36.728 1.00 30.98  ? 233  TRP A C     1 
ATOM   2692 O  O     . TRP E 3 256 ? 43.571  -24.736 -36.862 1.00 31.14  ? 233  TRP A O     1 
ATOM   2693 C  CB    . TRP E 3 256 ? 46.502  -25.556 -37.862 1.00 30.48  ? 233  TRP A CB    1 
ATOM   2694 C  CG    . TRP E 3 256 ? 47.267  -25.735 -39.130 1.00 29.77  ? 233  TRP A CG    1 
ATOM   2695 C  CD1   . TRP E 3 256 ? 48.615  -25.593 -39.309 1.00 28.22  ? 233  TRP A CD1   1 
ATOM   2696 C  CD2   . TRP E 3 256 ? 46.716  -26.005 -40.427 1.00 29.20  ? 233  TRP A CD2   1 
ATOM   2697 N  NE1   . TRP E 3 256 ? 48.934  -25.754 -40.637 1.00 28.57  ? 233  TRP A NE1   1 
ATOM   2698 C  CE2   . TRP E 3 256 ? 47.788  -26.007 -41.345 1.00 27.78  ? 233  TRP A CE2   1 
ATOM   2699 C  CE3   . TRP E 3 256 ? 45.417  -26.243 -40.901 1.00 28.19  ? 233  TRP A CE3   1 
ATOM   2700 C  CZ2   . TRP E 3 256 ? 47.602  -26.237 -42.712 1.00 27.24  ? 233  TRP A CZ2   1 
ATOM   2701 C  CZ3   . TRP E 3 256 ? 45.232  -26.473 -42.265 1.00 27.99  ? 233  TRP A CZ3   1 
ATOM   2702 C  CH2   . TRP E 3 256 ? 46.320  -26.468 -43.152 1.00 27.05  ? 233  TRP A CH2   1 
ATOM   2703 N  N     . ASP E 3 257 ? 45.107  -23.711 -35.585 1.00 30.61  ? 234  ASP A N     1 
ATOM   2704 C  CA    . ASP E 3 257 ? 44.199  -23.666 -34.444 1.00 29.33  ? 234  ASP A CA    1 
ATOM   2705 C  C     . ASP E 3 257 ? 42.948  -22.876 -34.812 1.00 28.83  ? 234  ASP A C     1 
ATOM   2706 O  O     . ASP E 3 257 ? 41.862  -23.137 -34.294 1.00 28.92  ? 234  ASP A O     1 
ATOM   2707 C  CB    . ASP E 3 257 ? 44.880  -23.056 -33.211 1.00 28.72  ? 234  ASP A CB    1 
ATOM   2708 C  CG    . ASP E 3 257 ? 45.664  -21.805 -33.529 1.00 30.26  ? 234  ASP A CG    1 
ATOM   2709 O  OD1   . ASP E 3 257 ? 45.527  -21.284 -34.656 1.00 33.89  ? 234  ASP A OD1   1 
ATOM   2710 O  OD2   . ASP E 3 257 ? 46.415  -21.338 -32.644 1.00 27.67  ? 234  ASP A OD2   1 
ATOM   2711 N  N     . ASP E 3 258 ? 43.101  -21.919 -35.721 1.00 27.64  ? 235  ASP A N     1 
ATOM   2712 C  CA    . ASP E 3 258 ? 41.967  -21.121 -36.163 1.00 28.02  ? 235  ASP A CA    1 
ATOM   2713 C  C     . ASP E 3 258 ? 41.105  -21.955 -37.112 1.00 26.83  ? 235  ASP A C     1 
ATOM   2714 O  O     . ASP E 3 258 ? 39.878  -21.838 -37.127 1.00 25.96  ? 235  ASP A O     1 
ATOM   2715 C  CB    . ASP E 3 258 ? 42.452  -19.846 -36.857 1.00 31.86  ? 235  ASP A CB    1 
ATOM   2716 C  CG    . ASP E 3 258 ? 43.087  -18.859 -35.887 1.00 36.00  ? 235  ASP A CG    1 
ATOM   2717 O  OD1   . ASP E 3 258 ? 42.440  -18.531 -34.867 1.00 36.00  ? 235  ASP A OD1   1 
ATOM   2718 O  OD2   . ASP E 3 258 ? 44.227  -18.407 -36.143 1.00 36.68  ? 235  ASP A OD2   1 
ATOM   2719 N  N     . VAL E 3 259 ? 41.751  -22.804 -37.902 1.00 24.54  ? 236  VAL A N     1 
ATOM   2720 C  CA    . VAL E 3 259 ? 41.023  -23.659 -38.823 1.00 22.96  ? 236  VAL A CA    1 
ATOM   2721 C  C     . VAL E 3 259 ? 40.256  -24.678 -37.994 1.00 22.27  ? 236  VAL A C     1 
ATOM   2722 O  O     . VAL E 3 259 ? 39.048  -24.858 -38.169 1.00 22.88  ? 236  VAL A O     1 
ATOM   2723 C  CB    . VAL E 3 259 ? 41.972  -24.403 -39.778 1.00 23.23  ? 236  VAL A CB    1 
ATOM   2724 C  CG1   . VAL E 3 259 ? 41.176  -25.301 -40.702 1.00 24.59  ? 236  VAL A CG1   1 
ATOM   2725 C  CG2   . VAL E 3 259 ? 42.772  -23.407 -40.589 1.00 24.45  ? 236  VAL A CG2   1 
ATOM   2726 N  N     . ILE E 3 260 ? 40.963  -25.340 -37.083 1.00 19.77  ? 237  ILE A N     1 
ATOM   2727 C  CA    . ILE E 3 260 ? 40.334  -26.331 -36.224 1.00 18.76  ? 237  ILE A CA    1 
ATOM   2728 C  C     . ILE E 3 260 ? 39.174  -25.692 -35.471 1.00 19.50  ? 237  ILE A C     1 
ATOM   2729 O  O     . ILE E 3 260 ? 38.086  -26.269 -35.372 1.00 18.22  ? 237  ILE A O     1 
ATOM   2730 C  CB    . ILE E 3 260 ? 41.333  -26.904 -35.199 1.00 17.71  ? 237  ILE A CB    1 
ATOM   2731 C  CG1   . ILE E 3 260 ? 42.389  -27.745 -35.916 1.00 17.93  ? 237  ILE A CG1   1 
ATOM   2732 C  CG2   . ILE E 3 260 ? 40.597  -27.740 -34.166 1.00 15.57  ? 237  ILE A CG2   1 
ATOM   2733 C  CD1   . ILE E 3 260 ? 41.815  -28.911 -36.701 1.00 16.28  ? 237  ILE A CD1   1 
ATOM   2734 N  N     . LEU E 3 261 ? 39.408  -24.489 -34.954 1.00 19.26  ? 238  LEU A N     1 
ATOM   2735 C  CA    . LEU E 3 261 ? 38.382  -23.780 -34.204 1.00 18.79  ? 238  LEU A CA    1 
ATOM   2736 C  C     . LEU E 3 261 ? 37.202  -23.429 -35.089 1.00 18.91  ? 238  LEU A C     1 
ATOM   2737 O  O     . LEU E 3 261 ? 36.053  -23.538 -34.665 1.00 19.55  ? 238  LEU A O     1 
ATOM   2738 C  CB    . LEU E 3 261 ? 38.946  -22.503 -33.590 1.00 16.99  ? 238  LEU A CB    1 
ATOM   2739 C  CG    . LEU E 3 261 ? 37.983  -21.859 -32.596 1.00 17.25  ? 238  LEU A CG    1 
ATOM   2740 C  CD1   . LEU E 3 261 ? 37.765  -22.815 -31.427 1.00 15.98  ? 238  LEU A CD1   1 
ATOM   2741 C  CD2   . LEU E 3 261 ? 38.541  -20.528 -32.109 1.00 18.07  ? 238  LEU A CD2   1 
ATOM   2742 N  N     . ALA E 3 262 ? 37.493  -23.007 -36.317 1.00 20.44  ? 239  ALA A N     1 
ATOM   2743 C  CA    . ALA E 3 262 ? 36.453  -22.638 -37.275 1.00 20.83  ? 239  ALA A CA    1 
ATOM   2744 C  C     . ALA E 3 262 ? 35.533  -23.823 -37.546 1.00 20.06  ? 239  ALA A C     1 
ATOM   2745 O  O     . ALA E 3 262 ? 34.311  -23.704 -37.453 1.00 18.08  ? 239  ALA A O     1 
ATOM   2746 C  CB    . ALA E 3 262 ? 37.083  -22.156 -38.576 1.00 21.27  ? 239  ALA A CB    1 
ATOM   2747 N  N     . LEU E 3 263 ? 36.124  -24.965 -37.887 1.00 20.27  ? 240  LEU A N     1 
ATOM   2748 C  CA    . LEU E 3 263 ? 35.338  -26.164 -38.150 1.00 20.96  ? 240  LEU A CA    1 
ATOM   2749 C  C     . LEU E 3 263 ? 34.572  -26.528 -36.883 1.00 20.20  ? 240  LEU A C     1 
ATOM   2750 O  O     . LEU E 3 263 ? 33.393  -26.867 -36.937 1.00 17.17  ? 240  LEU A O     1 
ATOM   2751 C  CB    . LEU E 3 263 ? 36.249  -27.323 -38.567 1.00 21.48  ? 240  LEU A CB    1 
ATOM   2752 C  CG    . LEU E 3 263 ? 37.007  -27.143 -39.886 1.00 23.00  ? 240  LEU A CG    1 
ATOM   2753 C  CD1   . LEU E 3 263 ? 37.851  -28.372 -40.176 1.00 22.34  ? 240  LEU A CD1   1 
ATOM   2754 C  CD2   . LEU E 3 263 ? 36.013  -26.911 -41.016 1.00 24.20  ? 240  LEU A CD2   1 
ATOM   2755 N  N     . GLY E 3 264 ? 35.258  -26.442 -35.745 1.00 21.71  ? 241  GLY A N     1 
ATOM   2756 C  CA    . GLY E 3 264 ? 34.637  -26.749 -34.471 1.00 22.01  ? 241  GLY A CA    1 
ATOM   2757 C  C     . GLY E 3 264 ? 33.357  -25.962 -34.283 1.00 23.24  ? 241  GLY A C     1 
ATOM   2758 O  O     . GLY E 3 264 ? 32.310  -26.536 -33.983 1.00 23.43  ? 241  GLY A O     1 
ATOM   2759 N  N     . SER E 3 265 ? 33.436  -24.647 -34.472 1.00 23.94  ? 242  SER A N     1 
ATOM   2760 C  CA    . SER E 3 265 ? 32.269  -23.778 -34.323 1.00 25.34  ? 242  SER A CA    1 
ATOM   2761 C  C     . SER E 3 265 ? 31.146  -24.200 -35.264 1.00 25.31  ? 242  SER A C     1 
ATOM   2762 O  O     . SER E 3 265 ? 29.971  -24.092 -34.924 1.00 25.03  ? 242  SER A O     1 
ATOM   2763 C  CB    . SER E 3 265 ? 32.645  -22.324 -34.607 1.00 25.99  ? 242  SER A CB    1 
ATOM   2764 O  OG    . SER E 3 265 ? 32.981  -22.142 -35.970 1.00 27.27  ? 242  SER A OG    1 
ATOM   2765 N  N     . GLN E 3 266 ? 31.513  -24.668 -36.452 1.00 26.43  ? 243  GLN A N     1 
ATOM   2766 C  CA    . GLN E 3 266 ? 30.531  -25.120 -37.431 1.00 26.96  ? 243  GLN A CA    1 
ATOM   2767 C  C     . GLN E 3 266 ? 29.826  -26.356 -36.889 1.00 25.67  ? 243  GLN A C     1 
ATOM   2768 O  O     . GLN E 3 266 ? 28.604  -26.384 -36.749 1.00 24.60  ? 243  GLN A O     1 
ATOM   2769 C  CB    . GLN E 3 266 ? 31.221  -25.474 -38.751 1.00 30.27  ? 243  GLN A CB    1 
ATOM   2770 C  CG    . GLN E 3 266 ? 31.604  -24.288 -39.612 1.00 34.42  ? 243  GLN A CG    1 
ATOM   2771 C  CD    . GLN E 3 266 ? 30.391  -23.550 -40.132 1.00 38.80  ? 243  GLN A CD    1 
ATOM   2772 O  OE1   . GLN E 3 266 ? 29.479  -24.152 -40.707 1.00 40.68  ? 243  GLN A OE1   1 
ATOM   2773 N  NE2   . GLN E 3 266 ? 30.374  -22.237 -39.941 1.00 41.94  ? 243  GLN A NE2   1 
ATOM   2774 N  N     . VAL E 3 267 ? 30.619  -27.379 -36.591 1.00 24.65  ? 244  VAL A N     1 
ATOM   2775 C  CA    . VAL E 3 267 ? 30.107  -28.631 -36.059 1.00 24.50  ? 244  VAL A CA    1 
ATOM   2776 C  C     . VAL E 3 267 ? 29.250  -28.370 -34.838 1.00 24.44  ? 244  VAL A C     1 
ATOM   2777 O  O     . VAL E 3 267 ? 28.160  -28.927 -34.685 1.00 24.62  ? 244  VAL A O     1 
ATOM   2778 C  CB    . VAL E 3 267 ? 31.256  -29.563 -35.641 1.00 24.15  ? 244  VAL A CB    1 
ATOM   2779 C  CG1   . VAL E 3 267 ? 30.699  -30.793 -34.942 1.00 23.98  ? 244  VAL A CG1   1 
ATOM   2780 C  CG2   . VAL E 3 267 ? 32.067  -29.961 -36.862 1.00 25.19  ? 244  VAL A CG2   1 
ATOM   2781 N  N     . CYS E 3 268 ? 29.763  -27.512 -33.970 1.00 23.96  ? 245  CYS A N     1 
ATOM   2782 C  CA    . CYS E 3 268 ? 29.087  -27.161 -32.736 1.00 24.09  ? 245  CYS A CA    1 
ATOM   2783 C  C     . CYS E 3 268 ? 27.681  -26.608 -32.984 1.00 24.25  ? 245  CYS A C     1 
ATOM   2784 O  O     . CYS E 3 268 ? 26.729  -26.972 -32.293 1.00 24.80  ? 245  CYS A O     1 
ATOM   2785 C  CB    . CYS E 3 268 ? 29.932  -26.142 -31.984 1.00 23.56  ? 245  CYS A CB    1 
ATOM   2786 S  SG    . CYS E 3 268 ? 29.679  -26.187 -30.228 1.00 27.61  ? 245  CYS A SG    1 
ATOM   2787 N  N     . LYS E 3 269 ? 27.556  -25.729 -33.973 1.00 23.71  ? 246  LYS A N     1 
ATOM   2788 C  CA    . LYS E 3 269 ? 26.269  -25.137 -34.315 1.00 21.98  ? 246  LYS A CA    1 
ATOM   2789 C  C     . LYS E 3 269 ? 25.251  -26.221 -34.640 1.00 20.26  ? 246  LYS A C     1 
ATOM   2790 O  O     . LYS E 3 269 ? 24.104  -26.154 -34.205 1.00 19.73  ? 246  LYS A O     1 
ATOM   2791 C  CB    . LYS E 3 269 ? 26.423  -24.210 -35.516 1.00 23.63  ? 246  LYS A CB    1 
ATOM   2792 C  CG    . LYS E 3 269 ? 25.110  -23.710 -36.095 1.00 27.12  ? 246  LYS A CG    1 
ATOM   2793 C  CD    . LYS E 3 269 ? 24.437  -22.695 -35.184 1.00 29.89  ? 246  LYS A CD    1 
ATOM   2794 C  CE    . LYS E 3 269 ? 23.190  -22.121 -35.852 1.00 32.31  ? 246  LYS A CE    1 
ATOM   2795 N  NZ    . LYS E 3 269 ? 22.581  -21.014 -35.062 1.00 34.43  ? 246  LYS A NZ    1 
ATOM   2796 N  N     . GLY E 3 270 ? 25.674  -27.217 -35.412 1.00 18.19  ? 247  GLY A N     1 
ATOM   2797 C  CA    . GLY E 3 270 ? 24.778  -28.298 -35.775 1.00 16.76  ? 247  GLY A CA    1 
ATOM   2798 C  C     . GLY E 3 270 ? 24.175  -28.954 -34.551 1.00 17.76  ? 247  GLY A C     1 
ATOM   2799 O  O     . GLY E 3 270 ? 22.955  -28.989 -34.396 1.00 17.09  ? 247  GLY A O     1 
ATOM   2800 N  N     . ILE E 3 271 ? 25.038  -29.468 -33.678 1.00 18.01  ? 248  ILE A N     1 
ATOM   2801 C  CA    . ILE E 3 271 ? 24.612  -30.129 -32.448 1.00 17.42  ? 248  ILE A CA    1 
ATOM   2802 C  C     . ILE E 3 271 ? 23.589  -29.313 -31.669 1.00 18.81  ? 248  ILE A C     1 
ATOM   2803 O  O     . ILE E 3 271 ? 22.533  -29.820 -31.289 1.00 18.05  ? 248  ILE A O     1 
ATOM   2804 C  CB    . ILE E 3 271 ? 25.805  -30.393 -31.519 1.00 15.69  ? 248  ILE A CB    1 
ATOM   2805 C  CG1   . ILE E 3 271 ? 26.795  -31.334 -32.198 1.00 16.15  ? 248  ILE A CG1   1 
ATOM   2806 C  CG2   . ILE E 3 271 ? 25.319  -30.987 -30.210 1.00 16.14  ? 248  ILE A CG2   1 
ATOM   2807 C  CD1   . ILE E 3 271 ? 28.022  -31.640 -31.363 1.00 15.92  ? 248  ILE A CD1   1 
ATOM   2808 N  N     . ARG E 3 272 ? 23.914  -28.050 -31.418 1.00 21.13  ? 249  ARG A N     1 
ATOM   2809 C  CA    . ARG E 3 272 ? 23.015  -27.173 -30.682 1.00 25.37  ? 249  ARG A CA    1 
ATOM   2810 C  C     . ARG E 3 272 ? 21.655  -27.078 -31.371 1.00 28.51  ? 249  ARG A C     1 
ATOM   2811 O  O     . ARG E 3 272 ? 20.613  -27.082 -30.712 1.00 29.91  ? 249  ARG A O     1 
ATOM   2812 C  CB    . ARG E 3 272 ? 23.632  -25.782 -30.548 1.00 24.05  ? 249  ARG A CB    1 
ATOM   2813 C  CG    . ARG E 3 272 ? 24.854  -25.738 -29.648 1.00 24.60  ? 249  ARG A CG    1 
ATOM   2814 C  CD    . ARG E 3 272 ? 25.450  -24.343 -29.615 1.00 24.39  ? 249  ARG A CD    1 
ATOM   2815 N  NE    . ARG E 3 272 ? 24.457  -23.355 -29.216 1.00 22.80  ? 249  ARG A NE    1 
ATOM   2816 C  CZ    . ARG E 3 272 ? 24.390  -22.129 -29.720 1.00 24.02  ? 249  ARG A CZ    1 
ATOM   2817 N  NH1   . ARG E 3 272 ? 25.262  -21.745 -30.641 1.00 23.36  ? 249  ARG A NH1   1 
ATOM   2818 N  NH2   . ARG E 3 272 ? 23.439  -21.295 -29.319 1.00 25.42  ? 249  ARG A NH2   1 
ATOM   2819 N  N     . ASP E 3 273 ? 21.669  -26.992 -32.697 1.00 31.29  ? 250  ASP A N     1 
ATOM   2820 C  CA    . ASP E 3 273 ? 20.431  -26.911 -33.461 1.00 33.48  ? 250  ASP A CA    1 
ATOM   2821 C  C     . ASP E 3 273 ? 19.660  -28.217 -33.300 1.00 34.75  ? 250  ASP A C     1 
ATOM   2822 O  O     . ASP E 3 273 ? 18.430  -28.218 -33.242 1.00 35.23  ? 250  ASP A O     1 
ATOM   2823 C  CB    . ASP E 3 273 ? 20.729  -26.655 -34.942 1.00 36.18  ? 250  ASP A CB    1 
ATOM   2824 C  CG    . ASP E 3 273 ? 21.298  -25.268 -35.195 1.00 39.65  ? 250  ASP A CG    1 
ATOM   2825 O  OD1   . ASP E 3 273 ? 20.663  -24.278 -34.772 1.00 42.68  ? 250  ASP A OD1   1 
ATOM   2826 O  OD2   . ASP E 3 273 ? 22.375  -25.162 -35.821 1.00 41.37  ? 250  ASP A OD2   1 
ATOM   2827 N  N     . SER E 3 274 ? 20.390  -29.328 -33.224 1.00 34.85  ? 251  SER A N     1 
ATOM   2828 C  CA    . SER E 3 274 ? 19.776  -30.642 -33.055 1.00 34.97  ? 251  SER A CA    1 
ATOM   2829 C  C     . SER E 3 274 ? 18.907  -30.617 -31.810 1.00 34.93  ? 251  SER A C     1 
ATOM   2830 O  O     . SER E 3 274 ? 17.853  -31.248 -31.749 1.00 36.18  ? 251  SER A O     1 
ATOM   2831 C  CB    . SER E 3 274 ? 20.848  -31.721 -32.887 1.00 35.53  ? 251  SER A CB    1 
ATOM   2832 O  OG    . SER E 3 274 ? 21.701  -31.782 -34.013 1.00 38.37  ? 251  SER A OG    1 
ATOM   2833 N  N     . ILE E 3 275 ? 19.368  -29.876 -30.814 1.00 33.95  ? 252  ILE A N     1 
ATOM   2834 C  CA    . ILE E 3 275 ? 18.655  -29.748 -29.560 1.00 33.65  ? 252  ILE A CA    1 
ATOM   2835 C  C     . ILE E 3 275 ? 17.432  -28.850 -29.704 1.00 34.85  ? 252  ILE A C     1 
ATOM   2836 O  O     . ILE E 3 275 ? 16.337  -29.209 -29.268 1.00 35.20  ? 252  ILE A O     1 
ATOM   2837 C  CB    . ILE E 3 275 ? 19.600  -29.206 -28.495 1.00 32.40  ? 252  ILE A CB    1 
ATOM   2838 C  CG1   . ILE E 3 275 ? 20.685  -30.245 -28.248 1.00 31.55  ? 252  ILE A CG1   1 
ATOM   2839 C  CG2   . ILE E 3 275 ? 18.850  -28.883 -27.221 1.00 32.45  ? 252  ILE A CG2   1 
ATOM   2840 C  CD1   . ILE E 3 275 ? 21.741  -29.788 -27.326 1.00 33.62  ? 252  ILE A CD1   1 
ATOM   2841 N  N     . LYS E 3 276 ? 17.611  -27.688 -30.323 1.00 34.86  ? 253  LYS A N     1 
ATOM   2842 C  CA    . LYS E 3 276 ? 16.496  -26.774 -30.519 1.00 35.76  ? 253  LYS A CA    1 
ATOM   2843 C  C     . LYS E 3 276 ? 15.410  -27.440 -31.358 1.00 36.25  ? 253  LYS A C     1 
ATOM   2844 O  O     . LYS E 3 276 ? 14.230  -27.126 -31.223 1.00 36.83  ? 253  LYS A O     1 
ATOM   2845 C  CB    . LYS E 3 276 ? 16.965  -25.496 -31.215 1.00 36.97  ? 253  LYS A CB    1 
ATOM   2846 C  CG    . LYS E 3 276 ? 15.837  -24.537 -31.578 1.00 38.89  ? 253  LYS A CG    1 
ATOM   2847 C  CD    . LYS E 3 276 ? 15.055  -24.112 -30.341 1.00 43.10  ? 253  LYS A CD    1 
ATOM   2848 C  CE    . LYS E 3 276 ? 13.877  -23.204 -30.689 1.00 44.58  ? 253  LYS A CE    1 
ATOM   2849 N  NZ    . LYS E 3 276 ? 12.864  -23.888 -31.548 1.00 45.66  ? 253  LYS A NZ    1 
ATOM   2850 N  N     . ASP E 3 277 ? 15.812  -28.366 -32.221 1.00 36.94  ? 254  ASP A N     1 
ATOM   2851 C  CA    . ASP E 3 277 ? 14.865  -29.061 -33.083 1.00 38.68  ? 254  ASP A CA    1 
ATOM   2852 C  C     . ASP E 3 277 ? 14.180  -30.248 -32.417 1.00 37.54  ? 254  ASP A C     1 
ATOM   2853 O  O     . ASP E 3 277 ? 12.975  -30.441 -32.578 1.00 39.66  ? 254  ASP A O     1 
ATOM   2854 C  CB    . ASP E 3 277 ? 15.564  -29.523 -34.362 1.00 43.77  ? 254  ASP A CB    1 
ATOM   2855 C  CG    . ASP E 3 277 ? 15.751  -28.398 -35.366 1.00 48.19  ? 254  ASP A CG    1 
ATOM   2856 O  OD1   . ASP E 3 277 ? 16.142  -27.284 -34.951 1.00 50.33  ? 254  ASP A OD1   1 
ATOM   2857 O  OD2   . ASP E 3 277 ? 15.513  -28.633 -36.572 1.00 51.00  ? 254  ASP A OD2   1 
ATOM   2858 N  N     . ILE E 3 278 ? 14.937  -31.042 -31.669 1.00 34.26  ? 255  ILE A N     1 
ATOM   2859 C  CA    . ILE E 3 278 ? 14.365  -32.206 -31.001 1.00 31.97  ? 255  ILE A CA    1 
ATOM   2860 C  C     . ILE E 3 278 ? 13.632  -31.855 -29.703 1.00 30.44  ? 255  ILE A C     1 
ATOM   2861 O  O     . ILE E 3 278 ? 12.491  -32.264 -29.498 1.00 29.93  ? 255  ILE A O     1 
ATOM   2862 C  CB    . ILE E 3 278 ? 15.455  -33.259 -30.675 1.00 31.86  ? 255  ILE A CB    1 
ATOM   2863 C  CG1   . ILE E 3 278 ? 16.158  -33.707 -31.958 1.00 30.96  ? 255  ILE A CG1   1 
ATOM   2864 C  CG2   . ILE E 3 278 ? 14.827  -34.462 -29.990 1.00 30.07  ? 255  ILE A CG2   1 
ATOM   2865 C  CD1   . ILE E 3 278 ? 17.278  -34.703 -31.725 1.00 29.78  ? 255  ILE A CD1   1 
ATOM   2866 N  N     . LEU E 3 279 ? 14.284  -31.088 -28.836 1.00 28.45  ? 256  LEU A N     1 
ATOM   2867 C  CA    . LEU E 3 279 ? 13.695  -30.720 -27.554 1.00 26.92  ? 256  LEU A CA    1 
ATOM   2868 C  C     . LEU E 3 279 ? 13.183  -29.281 -27.501 1.00 27.08  ? 256  LEU A C     1 
ATOM   2869 O  O     . LEU E 3 279 ? 12.298  -28.958 -26.702 1.00 27.37  ? 256  LEU A O     1 
ATOM   2870 C  CB    . LEU E 3 279 ? 14.726  -30.944 -26.449 1.00 24.72  ? 256  LEU A CB    1 
ATOM   2871 C  CG    . LEU E 3 279 ? 15.420  -32.300 -26.567 1.00 23.50  ? 256  LEU A CG    1 
ATOM   2872 C  CD1   . LEU E 3 279 ? 16.578  -32.393 -25.586 1.00 24.64  ? 256  LEU A CD1   1 
ATOM   2873 C  CD2   . LEU E 3 279 ? 14.403  -33.395 -26.325 1.00 21.25  ? 256  LEU A CD2   1 
ATOM   2874 N  N     . GLY E 3 280 ? 13.747  -28.417 -28.339 1.00 25.19  ? 257  GLY A N     1 
ATOM   2875 C  CA    . GLY E 3 280 ? 13.321  -27.031 -28.355 1.00 23.93  ? 257  GLY A CA    1 
ATOM   2876 C  C     . GLY E 3 280 ? 13.860  -26.188 -27.212 1.00 23.17  ? 257  GLY A C     1 
ATOM   2877 O  O     . GLY E 3 280 ? 13.159  -25.314 -26.706 1.00 24.29  ? 257  GLY A O     1 
ATOM   2878 N  N     . TYR E 3 281 ? 15.098  -26.449 -26.803 1.00 21.35  ? 258  TYR A N     1 
ATOM   2879 C  CA    . TYR E 3 281 ? 15.735  -25.697 -25.722 1.00 20.66  ? 258  TYR A CA    1 
ATOM   2880 C  C     . TYR E 3 281 ? 16.832  -24.811 -26.314 1.00 21.00  ? 258  TYR A C     1 
ATOM   2881 O  O     . TYR E 3 281 ? 17.638  -25.275 -27.118 1.00 23.65  ? 258  TYR A O     1 
ATOM   2882 C  CB    . TYR E 3 281 ? 16.347  -26.661 -24.691 1.00 18.96  ? 258  TYR A CB    1 
ATOM   2883 C  CG    . TYR E 3 281 ? 15.334  -27.480 -23.910 1.00 19.77  ? 258  TYR A CG    1 
ATOM   2884 C  CD1   . TYR E 3 281 ? 15.608  -28.798 -23.538 1.00 18.87  ? 258  TYR A CD1   1 
ATOM   2885 C  CD2   . TYR E 3 281 ? 14.103  -26.938 -23.540 1.00 20.37  ? 258  TYR A CD2   1 
ATOM   2886 C  CE1   . TYR E 3 281 ? 14.681  -29.554 -22.819 1.00 16.95  ? 258  TYR A CE1   1 
ATOM   2887 C  CE2   . TYR E 3 281 ? 13.174  -27.683 -22.822 1.00 18.40  ? 258  TYR A CE2   1 
ATOM   2888 C  CZ    . TYR E 3 281 ? 13.467  -28.988 -22.466 1.00 18.06  ? 258  TYR A CZ    1 
ATOM   2889 O  OH    . TYR E 3 281 ? 12.540  -29.719 -21.758 1.00 17.40  ? 258  TYR A OH    1 
ATOM   2890 N  N     . THR E 3 282 ? 16.859  -23.536 -25.941 1.00 19.55  ? 259  THR A N     1 
ATOM   2891 C  CA    . THR E 3 282 ? 17.892  -22.643 -26.455 1.00 18.88  ? 259  THR A CA    1 
ATOM   2892 C  C     . THR E 3 282 ? 19.099  -22.810 -25.560 1.00 18.68  ? 259  THR A C     1 
ATOM   2893 O  O     . THR E 3 282 ? 18.969  -23.238 -24.415 1.00 18.28  ? 259  THR A O     1 
ATOM   2894 C  CB    . THR E 3 282 ? 17.467  -21.155 -26.428 1.00 19.57  ? 259  THR A CB    1 
ATOM   2895 O  OG1   . THR E 3 282 ? 17.406  -20.687 -25.073 1.00 19.18  ? 259  THR A OG1   1 
ATOM   2896 C  CG2   . THR E 3 282 ? 16.113  -20.978 -27.091 1.00 18.76  ? 259  THR A CG2   1 
ATOM   2897 N  N     . THR E 3 283 ? 20.274  -22.473 -26.075 1.00 18.89  ? 260  THR A N     1 
ATOM   2898 C  CA    . THR E 3 283 ? 21.490  -22.610 -25.291 1.00 20.31  ? 260  THR A CA    1 
ATOM   2899 C  C     . THR E 3 283 ? 22.572  -21.629 -25.683 1.00 19.93  ? 260  THR A C     1 
ATOM   2900 O  O     . THR E 3 283 ? 22.519  -21.006 -26.740 1.00 20.67  ? 260  THR A O     1 
ATOM   2901 C  CB    . THR E 3 283 ? 22.089  -24.016 -25.441 1.00 21.73  ? 260  THR A CB    1 
ATOM   2902 O  OG1   . THR E 3 283 ? 22.092  -24.383 -26.828 1.00 22.46  ? 260  THR A OG1   1 
ATOM   2903 C  CG2   . THR E 3 283 ? 21.293  -25.028 -24.640 1.00 23.82  ? 260  THR A CG2   1 
ATOM   2904 N  N     . SER E 3 284 ? 23.553  -21.497 -24.803 1.00 18.90  ? 261  SER A N     1 
ATOM   2905 C  CA    . SER E 3 284 ? 24.694  -20.641 -25.048 1.00 18.34  ? 261  SER A CA    1 
ATOM   2906 C  C     . SER E 3 284 ? 25.888  -21.571 -25.054 1.00 19.96  ? 261  SER A C     1 
ATOM   2907 O  O     . SER E 3 284 ? 25.958  -22.523 -24.276 1.00 20.64  ? 261  SER A O     1 
ATOM   2908 C  CB    . SER E 3 284 ? 24.833  -19.584 -23.964 1.00 16.35  ? 261  SER A CB    1 
ATOM   2909 O  OG    . SER E 3 284 ? 23.907  -18.539 -24.194 1.00 17.09  ? 261  SER A OG    1 
ATOM   2910 N  N     . CYS E 3 285 ? 26.824  -21.296 -25.945 1.00 19.97  ? 262  CYS A N     1 
ATOM   2911 C  CA    . CYS E 3 285 ? 27.992  -22.134 -26.095 1.00 20.34  ? 262  CYS A CA    1 
ATOM   2912 C  C     . CYS E 3 285 ? 29.262  -21.300 -26.168 1.00 21.97  ? 262  CYS A C     1 
ATOM   2913 O  O     . CYS E 3 285 ? 29.228  -20.138 -26.568 1.00 24.96  ? 262  CYS A O     1 
ATOM   2914 C  CB    . CYS E 3 285 ? 27.825  -22.970 -27.366 1.00 19.09  ? 262  CYS A CB    1 
ATOM   2915 S  SG    . CYS E 3 285 ? 29.242  -23.956 -27.828 1.00 20.44  ? 262  CYS A SG    1 
ATOM   2916 N  N     . GLY E 3 286 ? 30.381  -21.897 -25.776 1.00 21.47  ? 263  GLY A N     1 
ATOM   2917 C  CA    . GLY E 3 286 ? 31.646  -21.194 -25.821 1.00 20.60  ? 263  GLY A CA    1 
ATOM   2918 C  C     . GLY E 3 286 ? 32.758  -22.108 -26.289 1.00 20.70  ? 263  GLY A C     1 
ATOM   2919 O  O     . GLY E 3 286 ? 32.977  -23.169 -25.713 1.00 21.62  ? 263  GLY A O     1 
ATOM   2920 N  N     . LEU E 3 287 ? 33.456  -21.710 -27.344 1.00 20.31  ? 264  LEU A N     1 
ATOM   2921 C  CA    . LEU E 3 287 ? 34.552  -22.512 -27.855 1.00 22.12  ? 264  LEU A CA    1 
ATOM   2922 C  C     . LEU E 3 287 ? 35.875  -21.831 -27.591 1.00 23.78  ? 264  LEU A C     1 
ATOM   2923 O  O     . LEU E 3 287 ? 35.960  -20.608 -27.569 1.00 26.69  ? 264  LEU A O     1 
ATOM   2924 C  CB    . LEU E 3 287 ? 34.409  -22.760 -29.358 1.00 23.52  ? 264  LEU A CB    1 
ATOM   2925 C  CG    . LEU E 3 287 ? 33.382  -23.808 -29.796 1.00 25.95  ? 264  LEU A CG    1 
ATOM   2926 C  CD1   . LEU E 3 287 ? 31.976  -23.235 -29.686 1.00 24.91  ? 264  LEU A CD1   1 
ATOM   2927 C  CD2   . LEU E 3 287 ? 33.673  -24.234 -31.226 1.00 27.79  ? 264  LEU A CD2   1 
ATOM   2928 N  N     . SER E 3 288 ? 36.904  -22.641 -27.385 1.00 25.10  ? 265  SER A N     1 
ATOM   2929 C  CA    . SER E 3 288 ? 38.253  -22.159 -27.130 1.00 26.39  ? 265  SER A CA    1 
ATOM   2930 C  C     . SER E 3 288 ? 39.106  -23.402 -26.956 1.00 28.57  ? 265  SER A C     1 
ATOM   2931 O  O     . SER E 3 288 ? 38.617  -24.520 -27.132 1.00 29.44  ? 265  SER A O     1 
ATOM   2932 C  CB    . SER E 3 288 ? 38.304  -21.304 -25.860 1.00 25.70  ? 265  SER A CB    1 
ATOM   2933 O  OG    . SER E 3 288 ? 38.074  -22.084 -24.702 1.00 26.22  ? 265  SER A OG    1 
ATOM   2934 N  N     . SER E 3 289 ? 40.372  -23.219 -26.609 1.00 29.48  ? 266  SER A N     1 
ATOM   2935 C  CA    . SER E 3 289 ? 41.262  -24.355 -26.436 1.00 30.28  ? 266  SER A CA    1 
ATOM   2936 C  C     . SER E 3 289 ? 41.325  -24.827 -24.991 1.00 31.89  ? 266  SER A C     1 
ATOM   2937 O  O     . SER E 3 289 ? 42.133  -25.692 -24.656 1.00 33.95  ? 266  SER A O     1 
ATOM   2938 C  CB    . SER E 3 289 ? 42.665  -23.990 -26.921 1.00 29.45  ? 266  SER A CB    1 
ATOM   2939 O  OG    . SER E 3 289 ? 43.143  -22.844 -26.242 1.00 29.58  ? 266  SER A OG    1 
ATOM   2940 N  N     . THR E 3 290 ? 40.468  -24.277 -24.136 1.00 32.60  ? 267  THR A N     1 
ATOM   2941 C  CA    . THR E 3 290 ? 40.478  -24.658 -22.727 1.00 34.30  ? 267  THR A CA    1 
ATOM   2942 C  C     . THR E 3 290 ? 39.083  -24.718 -22.112 1.00 34.23  ? 267  THR A C     1 
ATOM   2943 O  O     . THR E 3 290 ? 38.193  -23.959 -22.498 1.00 35.57  ? 267  THR A O     1 
ATOM   2944 C  CB    . THR E 3 290 ? 41.317  -23.664 -21.911 1.00 36.50  ? 267  THR A CB    1 
ATOM   2945 O  OG1   . THR E 3 290 ? 42.580  -23.465 -22.556 1.00 38.85  ? 267  THR A OG1   1 
ATOM   2946 C  CG2   . THR E 3 290 ? 41.556  -24.194 -20.510 1.00 39.68  ? 267  THR A CG2   1 
ATOM   2947 N  N     . LYS E 3 291 ? 38.897  -25.615 -21.147 1.00 33.01  ? 268  LYS A N     1 
ATOM   2948 C  CA    . LYS E 3 291 ? 37.605  -25.744 -20.485 1.00 31.98  ? 268  LYS A CA    1 
ATOM   2949 C  C     . LYS E 3 291 ? 37.240  -24.491 -19.707 1.00 32.30  ? 268  LYS A C     1 
ATOM   2950 O  O     . LYS E 3 291 ? 36.085  -24.066 -19.715 1.00 32.36  ? 268  LYS A O     1 
ATOM   2951 C  CB    . LYS E 3 291 ? 37.593  -26.938 -19.531 1.00 31.30  ? 268  LYS A CB    1 
ATOM   2952 C  CG    . LYS E 3 291 ? 37.513  -28.274 -20.227 1.00 32.28  ? 268  LYS A CG    1 
ATOM   2953 C  CD    . LYS E 3 291 ? 36.795  -29.312 -19.370 1.00 31.79  ? 268  LYS A CD    1 
ATOM   2954 C  CE    . LYS E 3 291 ? 37.562  -29.649 -18.103 1.00 31.43  ? 268  LYS A CE    1 
ATOM   2955 N  NZ    . LYS E 3 291 ? 36.970  -30.827 -17.406 1.00 29.20  ? 268  LYS A NZ    1 
ATOM   2956 N  N     . ASN E 3 292 ? 38.226  -23.904 -19.034 1.00 32.60  ? 269  ASN A N     1 
ATOM   2957 C  CA    . ASN E 3 292 ? 38.001  -22.701 -18.240 1.00 33.17  ? 269  ASN A CA    1 
ATOM   2958 C  C     . ASN E 3 292 ? 37.588  -21.498 -19.074 1.00 31.08  ? 269  ASN A C     1 
ATOM   2959 O  O     . ASN E 3 292 ? 36.701  -20.744 -18.675 1.00 30.64  ? 269  ASN A O     1 
ATOM   2960 C  CB    . ASN E 3 292 ? 39.249  -22.373 -17.421 1.00 37.56  ? 269  ASN A CB    1 
ATOM   2961 C  CG    . ASN E 3 292 ? 39.503  -23.394 -16.323 1.00 42.87  ? 269  ASN A CG    1 
ATOM   2962 O  OD1   . ASN E 3 292 ? 38.782  -23.444 -15.324 1.00 44.82  ? 269  ASN A OD1   1 
ATOM   2963 N  ND2   . ASN E 3 292 ? 40.521  -24.226 -16.513 1.00 45.76  ? 269  ASN A ND2   1 
ATOM   2964 N  N     . VAL E 3 293 ? 38.219  -21.315 -20.230 1.00 28.65  ? 270  VAL A N     1 
ATOM   2965 C  CA    . VAL E 3 293 ? 37.869  -20.194 -21.089 1.00 26.88  ? 270  VAL A CA    1 
ATOM   2966 C  C     . VAL E 3 293 ? 36.504  -20.440 -21.730 1.00 27.52  ? 270  VAL A C     1 
ATOM   2967 O  O     . VAL E 3 293 ? 35.734  -19.503 -21.931 1.00 28.98  ? 270  VAL A O     1 
ATOM   2968 C  CB    . VAL E 3 293 ? 38.915  -19.976 -22.184 1.00 26.22  ? 270  VAL A CB    1 
ATOM   2969 C  CG1   . VAL E 3 293 ? 38.629  -18.681 -22.920 1.00 25.26  ? 270  VAL A CG1   1 
ATOM   2970 C  CG2   . VAL E 3 293 ? 40.295  -19.939 -21.573 1.00 26.71  ? 270  VAL A CG2   1 
ATOM   2971 N  N     . CYS E 3 294 ? 36.205  -21.697 -22.055 1.00 26.19  ? 271  CYS A N     1 
ATOM   2972 C  CA    . CYS E 3 294 ? 34.908  -22.040 -22.632 1.00 26.17  ? 271  CYS A CA    1 
ATOM   2973 C  C     . CYS E 3 294 ? 33.825  -21.648 -21.634 1.00 28.32  ? 271  CYS A C     1 
ATOM   2974 O  O     . CYS E 3 294 ? 32.838  -21.007 -21.989 1.00 29.50  ? 271  CYS A O     1 
ATOM   2975 C  CB    . CYS E 3 294 ? 34.804  -23.542 -22.884 1.00 25.35  ? 271  CYS A CB    1 
ATOM   2976 S  SG    . CYS E 3 294 ? 35.745  -24.154 -24.272 1.00 27.44  ? 271  CYS A SG    1 
ATOM   2977 N  N     . LYS E 3 295 ? 34.031  -22.053 -20.382 1.00 29.44  ? 272  LYS A N     1 
ATOM   2978 C  CA    . LYS E 3 295 ? 33.112  -21.778 -19.282 1.00 29.84  ? 272  LYS A CA    1 
ATOM   2979 C  C     . LYS E 3 295 ? 32.780  -20.288 -19.198 1.00 29.87  ? 272  LYS A C     1 
ATOM   2980 O  O     . LYS E 3 295 ? 31.626  -19.911 -18.976 1.00 30.38  ? 272  LYS A O     1 
ATOM   2981 C  CB    . LYS E 3 295 ? 33.744  -22.239 -17.967 1.00 32.63  ? 272  LYS A CB    1 
ATOM   2982 C  CG    . LYS E 3 295 ? 32.810  -22.233 -16.766 1.00 37.52  ? 272  LYS A CG    1 
ATOM   2983 C  CD    . LYS E 3 295 ? 31.803  -23.374 -16.831 1.00 41.95  ? 272  LYS A CD    1 
ATOM   2984 C  CE    . LYS E 3 295 ? 30.903  -23.404 -15.597 1.00 45.52  ? 272  LYS A CE    1 
ATOM   2985 N  NZ    . LYS E 3 295 ? 29.990  -22.222 -15.514 1.00 47.81  ? 272  LYS A NZ    1 
ATOM   2986 N  N     . LEU E 3 296 ? 33.798  -19.446 -19.367 1.00 27.67  ? 273  LEU A N     1 
ATOM   2987 C  CA    . LEU E 3 296 ? 33.612  -18.001 -19.320 1.00 26.79  ? 273  LEU A CA    1 
ATOM   2988 C  C     . LEU E 3 296 ? 32.922  -17.515 -20.591 1.00 28.09  ? 273  LEU A C     1 
ATOM   2989 O  O     . LEU E 3 296 ? 32.030  -16.668 -20.541 1.00 29.30  ? 273  LEU A O     1 
ATOM   2990 C  CB    . LEU E 3 296 ? 34.958  -17.284 -19.191 1.00 25.01  ? 273  LEU A CB    1 
ATOM   2991 C  CG    . LEU E 3 296 ? 35.859  -17.507 -17.975 1.00 25.16  ? 273  LEU A CG    1 
ATOM   2992 C  CD1   . LEU E 3 296 ? 37.131  -16.696 -18.158 1.00 23.81  ? 273  LEU A CD1   1 
ATOM   2993 C  CD2   . LEU E 3 296 ? 35.149  -17.093 -16.699 1.00 25.21  ? 273  LEU A CD2   1 
ATOM   2994 N  N     . ALA E 3 297 ? 33.344  -18.060 -21.728 1.00 28.07  ? 274  ALA A N     1 
ATOM   2995 C  CA    . ALA E 3 297 ? 32.798  -17.680 -23.026 1.00 28.97  ? 274  ALA A CA    1 
ATOM   2996 C  C     . ALA E 3 297 ? 31.320  -18.001 -23.184 1.00 30.65  ? 274  ALA A C     1 
ATOM   2997 O  O     . ALA E 3 297 ? 30.563  -17.205 -23.741 1.00 30.74  ? 274  ALA A O     1 
ATOM   2998 C  CB    . ALA E 3 297 ? 33.587  -18.354 -24.133 1.00 28.65  ? 274  ALA A CB    1 
ATOM   2999 N  N     . SER E 3 298 ? 30.911  -19.168 -22.703 1.00 31.71  ? 275  SER A N     1 
ATOM   3000 C  CA    . SER E 3 298 ? 29.519  -19.578 -22.812 1.00 32.83  ? 275  SER A CA    1 
ATOM   3001 C  C     . SER E 3 298 ? 28.634  -18.635 -22.018 1.00 33.99  ? 275  SER A C     1 
ATOM   3002 O  O     . SER E 3 298 ? 27.453  -18.482 -22.316 1.00 34.45  ? 275  SER A O     1 
ATOM   3003 C  CB    . SER E 3 298 ? 29.334  -20.997 -22.280 1.00 33.89  ? 275  SER A CB    1 
ATOM   3004 O  OG    . SER E 3 298 ? 29.456  -21.025 -20.867 1.00 35.43  ? 275  SER A OG    1 
ATOM   3005 N  N     . ASN E 3 299 ? 29.212  -18.007 -21.001 1.00 35.47  ? 276  ASN A N     1 
ATOM   3006 C  CA    . ASN E 3 299 ? 28.459  -17.088 -20.158 1.00 37.02  ? 276  ASN A CA    1 
ATOM   3007 C  C     . ASN E 3 299 ? 28.526  -15.650 -20.657 1.00 36.86  ? 276  ASN A C     1 
ATOM   3008 O  O     . ASN E 3 299 ? 27.710  -14.816 -20.263 1.00 37.71  ? 276  ASN A O     1 
ATOM   3009 C  CB    . ASN E 3 299 ? 28.972  -17.153 -18.719 1.00 39.51  ? 276  ASN A CB    1 
ATOM   3010 C  CG    . ASN E 3 299 ? 27.863  -17.421 -17.721 1.00 42.40  ? 276  ASN A CG    1 
ATOM   3011 O  OD1   . ASN E 3 299 ? 26.806  -16.791 -17.768 1.00 43.41  ? 276  ASN A OD1   1 
ATOM   3012 N  ND2   . ASN E 3 299 ? 28.101  -18.357 -16.807 1.00 44.60  ? 276  ASN A ND2   1 
ATOM   3013 N  N     . TYR E 3 300 ? 29.493  -15.367 -21.525 1.00 36.35  ? 277  TYR A N     1 
ATOM   3014 C  CA    . TYR E 3 300 ? 29.674  -14.025 -22.075 1.00 34.90  ? 277  TYR A CA    1 
ATOM   3015 C  C     . TYR E 3 300 ? 28.402  -13.459 -22.711 1.00 34.54  ? 277  TYR A C     1 
ATOM   3016 O  O     . TYR E 3 300 ? 28.077  -12.290 -22.509 1.00 35.75  ? 277  TYR A O     1 
ATOM   3017 C  CB    . TYR E 3 300 ? 30.802  -14.027 -23.107 1.00 34.74  ? 277  TYR A CB    1 
ATOM   3018 C  CG    . TYR E 3 300 ? 31.218  -12.645 -23.557 1.00 35.10  ? 277  TYR A CG    1 
ATOM   3019 C  CD1   . TYR E 3 300 ? 31.961  -11.812 -22.721 1.00 33.79  ? 277  TYR A CD1   1 
ATOM   3020 C  CD2   . TYR E 3 300 ? 30.866  -12.167 -24.821 1.00 35.39  ? 277  TYR A CD2   1 
ATOM   3021 C  CE1   . TYR E 3 300 ? 32.345  -10.538 -23.133 1.00 34.33  ? 277  TYR A CE1   1 
ATOM   3022 C  CE2   . TYR E 3 300 ? 31.242  -10.898 -25.241 1.00 34.95  ? 277  TYR A CE2   1 
ATOM   3023 C  CZ    . TYR E 3 300 ? 31.982  -10.089 -24.395 1.00 35.03  ? 277  TYR A CZ    1 
ATOM   3024 O  OH    . TYR E 3 300 ? 32.359  -8.837  -24.816 1.00 35.20  ? 277  TYR A OH    1 
ATOM   3025 N  N     . LYS E 3 301 ? 27.686  -14.273 -23.483 1.00 33.19  ? 278  LYS A N     1 
ATOM   3026 C  CA    . LYS E 3 301 ? 26.453  -13.807 -24.112 1.00 32.18  ? 278  LYS A CA    1 
ATOM   3027 C  C     . LYS E 3 301 ? 25.292  -14.787 -23.983 1.00 31.20  ? 278  LYS A C     1 
ATOM   3028 O  O     . LYS E 3 301 ? 25.428  -15.977 -24.260 1.00 31.20  ? 278  LYS A O     1 
ATOM   3029 C  CB    . LYS E 3 301 ? 26.680  -13.499 -25.589 1.00 34.12  ? 278  LYS A CB    1 
ATOM   3030 C  CG    . LYS E 3 301 ? 25.436  -12.938 -26.269 1.00 35.79  ? 278  LYS A CG    1 
ATOM   3031 C  CD    . LYS E 3 301 ? 25.706  -12.533 -27.708 1.00 37.55  ? 278  LYS A CD    1 
ATOM   3032 C  CE    . LYS E 3 301 ? 24.478  -11.881 -28.319 1.00 38.41  ? 278  LYS A CE    1 
ATOM   3033 N  NZ    . LYS E 3 301 ? 24.756  -11.352 -29.680 1.00 41.01  ? 278  LYS A NZ    1 
ATOM   3034 N  N     . LYS E 3 302 ? 24.142  -14.269 -23.572 1.00 29.46  ? 279  LYS A N     1 
ATOM   3035 C  CA    . LYS E 3 302 ? 22.952  -15.087 -23.399 1.00 28.58  ? 279  LYS A CA    1 
ATOM   3036 C  C     . LYS E 3 302 ? 21.719  -14.245 -23.705 1.00 28.33  ? 279  LYS A C     1 
ATOM   3037 O  O     . LYS E 3 302 ? 21.726  -13.029 -23.505 1.00 28.91  ? 279  LYS A O     1 
ATOM   3038 C  CB    . LYS E 3 302 ? 22.874  -15.605 -21.959 1.00 28.83  ? 279  LYS A CB    1 
ATOM   3039 C  CG    . LYS E 3 302 ? 24.044  -16.480 -21.540 1.00 29.23  ? 279  LYS A CG    1 
ATOM   3040 C  CD    . LYS E 3 302 ? 23.952  -16.882 -20.078 1.00 29.15  ? 279  LYS A CD    1 
ATOM   3041 C  CE    . LYS E 3 302 ? 24.089  -15.675 -19.163 1.00 31.61  ? 279  LYS A CE    1 
ATOM   3042 N  NZ    . LYS E 3 302 ? 24.075  -16.040 -17.713 1.00 33.73  ? 279  LYS A NZ    1 
ATOM   3043 N  N     . PRO E 3 303 ? 20.636  -14.884 -24.179 1.00 26.21  ? 280  PRO A N     1 
ATOM   3044 C  CA    . PRO E 3 303 ? 20.536  -16.321 -24.433 1.00 26.81  ? 280  PRO A CA    1 
ATOM   3045 C  C     . PRO E 3 303 ? 20.822  -16.665 -25.889 1.00 29.34  ? 280  PRO A C     1 
ATOM   3046 O  O     . PRO E 3 303 ? 21.130  -15.785 -26.696 1.00 30.44  ? 280  PRO A O     1 
ATOM   3047 C  CB    . PRO E 3 303 ? 19.096  -16.611 -24.074 1.00 24.88  ? 280  PRO A CB    1 
ATOM   3048 C  CG    . PRO E 3 303 ? 18.417  -15.426 -24.661 1.00 23.04  ? 280  PRO A CG    1 
ATOM   3049 C  CD    . PRO E 3 303 ? 19.299  -14.269 -24.223 1.00 23.49  ? 280  PRO A CD    1 
ATOM   3050 N  N     . ASP E 3 304 ? 20.704  -17.954 -26.205 1.00 30.31  ? 281  ASP A N     1 
ATOM   3051 C  CA    . ASP E 3 304 ? 20.909  -18.490 -27.551 1.00 29.49  ? 281  ASP A CA    1 
ATOM   3052 C  C     . ASP E 3 304 ? 22.036  -17.861 -28.366 1.00 29.09  ? 281  ASP A C     1 
ATOM   3053 O  O     . ASP E 3 304 ? 21.804  -17.347 -29.458 1.00 28.58  ? 281  ASP A O     1 
ATOM   3054 C  CB    . ASP E 3 304 ? 19.605  -18.396 -28.338 1.00 29.94  ? 281  ASP A CB    1 
ATOM   3055 C  CG    . ASP E 3 304 ? 19.758  -18.869 -29.758 1.00 33.38  ? 281  ASP A CG    1 
ATOM   3056 O  OD1   . ASP E 3 304 ? 20.256  -20.000 -29.955 1.00 36.22  ? 281  ASP A OD1   1 
ATOM   3057 O  OD2   . ASP E 3 304 ? 19.387  -18.108 -30.676 1.00 36.00  ? 281  ASP A OD2   1 
ATOM   3058 N  N     . ALA E 3 305 ? 23.256  -17.921 -27.844 1.00 29.84  ? 282  ALA A N     1 
ATOM   3059 C  CA    . ALA E 3 305 ? 24.411  -17.351 -28.528 1.00 29.85  ? 282  ALA A CA    1 
ATOM   3060 C  C     . ALA E 3 305 ? 25.569  -18.338 -28.537 1.00 30.19  ? 282  ALA A C     1 
ATOM   3061 O  O     . ALA E 3 305 ? 25.444  -19.450 -28.037 1.00 31.73  ? 282  ALA A O     1 
ATOM   3062 C  CB    . ALA E 3 305 ? 24.832  -16.057 -27.842 1.00 29.21  ? 282  ALA A CB    1 
ATOM   3063 N  N     . GLN E 3 306 ? 26.697  -17.927 -29.107 1.00 30.66  ? 283  GLN A N     1 
ATOM   3064 C  CA    . GLN E 3 306 ? 27.874  -18.785 -29.178 1.00 29.65  ? 283  GLN A CA    1 
ATOM   3065 C  C     . GLN E 3 306 ? 29.131  -17.931 -29.295 1.00 27.94  ? 283  GLN A C     1 
ATOM   3066 O  O     . GLN E 3 306 ? 29.470  -17.464 -30.380 1.00 28.57  ? 283  GLN A O     1 
ATOM   3067 C  CB    . GLN E 3 306 ? 27.769  -19.709 -30.389 1.00 30.92  ? 283  GLN A CB    1 
ATOM   3068 C  CG    . GLN E 3 306 ? 28.660  -20.930 -30.321 1.00 34.67  ? 283  GLN A CG    1 
ATOM   3069 C  CD    . GLN E 3 306 ? 28.546  -21.799 -31.559 1.00 36.81  ? 283  GLN A CD    1 
ATOM   3070 O  OE1   . GLN E 3 306 ? 28.902  -22.978 -31.543 1.00 38.89  ? 283  GLN A OE1   1 
ATOM   3071 N  NE2   . GLN E 3 306 ? 28.056  -21.216 -32.644 1.00 36.57  ? 283  GLN A NE2   1 
ATOM   3072 N  N     . THR E 3 307 ? 29.815  -17.722 -28.176 1.00 25.44  ? 284  THR A N     1 
ATOM   3073 C  CA    . THR E 3 307 ? 31.028  -16.917 -28.170 1.00 24.88  ? 284  THR A CA    1 
ATOM   3074 C  C     . THR E 3 307 ? 32.254  -17.777 -28.492 1.00 24.83  ? 284  THR A C     1 
ATOM   3075 O  O     . THR E 3 307 ? 32.448  -18.849 -27.918 1.00 25.75  ? 284  THR A O     1 
ATOM   3076 C  CB    . THR E 3 307 ? 31.216  -16.212 -26.804 1.00 25.82  ? 284  THR A CB    1 
ATOM   3077 O  OG1   . THR E 3 307 ? 30.115  -15.326 -26.570 1.00 25.20  ? 284  THR A OG1   1 
ATOM   3078 C  CG2   . THR E 3 307 ? 32.511  -15.405 -26.784 1.00 26.39  ? 284  THR A CG2   1 
ATOM   3079 N  N     . ILE E 3 308 ? 33.077  -17.283 -29.412 1.00 22.61  ? 285  ILE A N     1 
ATOM   3080 C  CA    . ILE E 3 308 ? 34.276  -17.972 -29.873 1.00 20.09  ? 285  ILE A CA    1 
ATOM   3081 C  C     . ILE E 3 308 ? 35.547  -17.189 -29.528 1.00 21.05  ? 285  ILE A C     1 
ATOM   3082 O  O     . ILE E 3 308 ? 35.739  -16.060 -29.982 1.00 22.42  ? 285  ILE A O     1 
ATOM   3083 C  CB    . ILE E 3 308 ? 34.191  -18.166 -31.400 1.00 17.50  ? 285  ILE A CB    1 
ATOM   3084 C  CG1   . ILE E 3 308 ? 32.878  -18.869 -31.743 1.00 15.64  ? 285  ILE A CG1   1 
ATOM   3085 C  CG2   . ILE E 3 308 ? 35.384  -18.956 -31.909 1.00 15.82  ? 285  ILE A CG2   1 
ATOM   3086 C  CD1   . ILE E 3 308 ? 32.498  -18.776 -33.200 1.00 15.69  ? 285  ILE A CD1   1 
ATOM   3087 N  N     . VAL E 3 309 ? 36.420  -17.796 -28.733 1.00 21.20  ? 286  VAL A N     1 
ATOM   3088 C  CA    . VAL E 3 309 ? 37.658  -17.143 -28.330 1.00 22.16  ? 286  VAL A CA    1 
ATOM   3089 C  C     . VAL E 3 309 ? 38.885  -17.794 -28.956 1.00 23.27  ? 286  VAL A C     1 
ATOM   3090 O  O     . VAL E 3 309 ? 39.276  -18.893 -28.568 1.00 23.80  ? 286  VAL A O     1 
ATOM   3091 C  CB    . VAL E 3 309 ? 37.819  -17.171 -26.792 1.00 22.80  ? 286  VAL A CB    1 
ATOM   3092 C  CG1   . VAL E 3 309 ? 39.135  -16.531 -26.392 1.00 23.62  ? 286  VAL A CG1   1 
ATOM   3093 C  CG2   . VAL E 3 309 ? 36.660  -16.439 -26.134 1.00 23.38  ? 286  VAL A CG2   1 
ATOM   3094 N  N     . LYS E 3 310 ? 39.490  -17.111 -29.926 1.00 24.46  ? 287  LYS A N     1 
ATOM   3095 C  CA    . LYS E 3 310 ? 40.686  -17.623 -30.586 1.00 25.08  ? 287  LYS A CA    1 
ATOM   3096 C  C     . LYS E 3 310 ? 41.855  -17.525 -29.610 1.00 27.73  ? 287  LYS A C     1 
ATOM   3097 O  O     . LYS E 3 310 ? 41.830  -16.712 -28.689 1.00 29.67  ? 287  LYS A O     1 
ATOM   3098 C  CB    . LYS E 3 310 ? 41.017  -16.797 -31.826 1.00 23.88  ? 287  LYS A CB    1 
ATOM   3099 C  CG    . LYS E 3 310 ? 39.844  -16.487 -32.732 1.00 24.72  ? 287  LYS A CG    1 
ATOM   3100 C  CD    . LYS E 3 310 ? 40.330  -16.262 -34.163 1.00 26.66  ? 287  LYS A CD    1 
ATOM   3101 C  CE    . LYS E 3 310 ? 41.470  -15.250 -34.227 1.00 26.84  ? 287  LYS A CE    1 
ATOM   3102 N  NZ    . LYS E 3 310 ? 42.288  -15.413 -35.458 1.00 24.88  ? 287  LYS A NZ    1 
ATOM   3103 N  N     . ASN E 3 311 ? 42.884  -18.340 -29.813 1.00 29.32  ? 288  ASN A N     1 
ATOM   3104 C  CA    . ASN E 3 311 ? 44.042  -18.313 -28.928 1.00 30.76  ? 288  ASN A CA    1 
ATOM   3105 C  C     . ASN E 3 311 ? 44.738  -16.954 -28.930 1.00 32.07  ? 288  ASN A C     1 
ATOM   3106 O  O     . ASN E 3 311 ? 45.284  -16.525 -27.909 1.00 32.31  ? 288  ASN A O     1 
ATOM   3107 C  CB    . ASN E 3 311 ? 45.034  -19.407 -29.326 1.00 31.65  ? 288  ASN A CB    1 
ATOM   3108 C  CG    . ASN E 3 311 ? 44.510  -20.798 -29.032 1.00 34.23  ? 288  ASN A CG    1 
ATOM   3109 O  OD1   . ASN E 3 311 ? 45.133  -21.799 -29.387 1.00 35.43  ? 288  ASN A OD1   1 
ATOM   3110 N  ND2   . ASN E 3 311 ? 43.359  -20.868 -28.374 1.00 36.65  ? 288  ASN A ND2   1 
ATOM   3111 N  N     . ASP E 3 312 ? 44.709  -16.273 -30.072 1.00 33.42  ? 289  ASP A N     1 
ATOM   3112 C  CA    . ASP E 3 312 ? 45.348  -14.967 -30.192 1.00 34.22  ? 289  ASP A CA    1 
ATOM   3113 C  C     . ASP E 3 312 ? 44.476  -13.840 -29.642 1.00 33.59  ? 289  ASP A C     1 
ATOM   3114 O  O     . ASP E 3 312 ? 44.812  -12.663 -29.774 1.00 33.46  ? 289  ASP A O     1 
ATOM   3115 C  CB    . ASP E 3 312 ? 45.711  -14.689 -31.657 1.00 37.12  ? 289  ASP A CB    1 
ATOM   3116 C  CG    . ASP E 3 312 ? 46.806  -15.614 -32.178 1.00 39.68  ? 289  ASP A CG    1 
ATOM   3117 O  OD1   . ASP E 3 312 ? 47.907  -15.636 -31.585 1.00 41.13  ? 289  ASP A OD1   1 
ATOM   3118 O  OD2   . ASP E 3 312 ? 46.571  -16.318 -33.183 1.00 41.93  ? 289  ASP A OD2   1 
ATOM   3119 N  N     . CYS E 3 313 ? 43.360  -14.207 -29.016 1.00 32.93  ? 290  CYS A N     1 
ATOM   3120 C  CA    . CYS E 3 313 ? 42.445  -13.230 -28.433 1.00 31.90  ? 290  CYS A CA    1 
ATOM   3121 C  C     . CYS E 3 313 ? 42.157  -13.556 -26.974 1.00 29.42  ? 290  CYS A C     1 
ATOM   3122 O  O     . CYS E 3 313 ? 41.308  -12.931 -26.344 1.00 28.15  ? 290  CYS A O     1 
ATOM   3123 C  CB    . CYS E 3 313 ? 41.133  -13.200 -29.214 1.00 32.86  ? 290  CYS A CB    1 
ATOM   3124 S  SG    . CYS E 3 313 ? 41.318  -12.678 -30.927 1.00 38.09  ? 290  CYS A SG    1 
ATOM   3125 N  N     . LEU E 3 314 ? 42.873  -14.539 -26.446 1.00 28.43  ? 291  LEU A N     1 
ATOM   3126 C  CA    . LEU E 3 314 ? 42.696  -14.951 -25.062 1.00 28.03  ? 291  LEU A CA    1 
ATOM   3127 C  C     . LEU E 3 314 ? 42.864  -13.786 -24.094 1.00 28.53  ? 291  LEU A C     1 
ATOM   3128 O  O     . LEU E 3 314 ? 41.979  -13.513 -23.286 1.00 28.99  ? 291  LEU A O     1 
ATOM   3129 C  CB    . LEU E 3 314 ? 43.689  -16.062 -24.714 1.00 25.56  ? 291  LEU A CB    1 
ATOM   3130 C  CG    . LEU E 3 314 ? 43.403  -17.427 -25.340 1.00 23.89  ? 291  LEU A CG    1 
ATOM   3131 C  CD1   . LEU E 3 314 ? 44.561  -18.372 -25.075 1.00 23.65  ? 291  LEU A CD1   1 
ATOM   3132 C  CD2   . LEU E 3 314 ? 42.106  -17.983 -24.770 1.00 22.16  ? 291  LEU A CD2   1 
ATOM   3133 N  N     . LEU E 3 315 ? 43.998  -13.098 -24.178 1.00 28.34  ? 292  LEU A N     1 
ATOM   3134 C  CA    . LEU E 3 315 ? 44.257  -11.972 -23.291 1.00 27.78  ? 292  LEU A CA    1 
ATOM   3135 C  C     . LEU E 3 315 ? 43.254  -10.844 -23.511 1.00 29.03  ? 292  LEU A C     1 
ATOM   3136 O  O     . LEU E 3 315 ? 42.780  -10.235 -22.552 1.00 29.16  ? 292  LEU A O     1 
ATOM   3137 C  CB    . LEU E 3 315 ? 45.679  -11.449 -23.492 1.00 26.16  ? 292  LEU A CB    1 
ATOM   3138 C  CG    . LEU E 3 315 ? 46.814  -12.458 -23.318 1.00 25.98  ? 292  LEU A CG    1 
ATOM   3139 C  CD1   . LEU E 3 315 ? 48.140  -11.726 -23.382 1.00 25.51  ? 292  LEU A CD1   1 
ATOM   3140 C  CD2   . LEU E 3 315 ? 46.681  -13.183 -21.992 1.00 27.21  ? 292  LEU A CD2   1 
ATOM   3141 N  N     . ASP E 3 316 ? 42.927  -10.561 -24.768 1.00 29.80  ? 293  ASP A N     1 
ATOM   3142 C  CA    . ASP E 3 316 ? 41.966  -9.507  -25.052 1.00 31.36  ? 293  ASP A CA    1 
ATOM   3143 C  C     . ASP E 3 316 ? 40.660  -9.853  -24.346 1.00 31.90  ? 293  ASP A C     1 
ATOM   3144 O  O     . ASP E 3 316 ? 39.984  -8.978  -23.808 1.00 33.27  ? 293  ASP A O     1 
ATOM   3145 C  CB    . ASP E 3 316 ? 41.707  -9.382  -26.558 1.00 33.32  ? 293  ASP A CB    1 
ATOM   3146 C  CG    . ASP E 3 316 ? 42.972  -9.141  -27.356 1.00 36.06  ? 293  ASP A CG    1 
ATOM   3147 O  OD1   . ASP E 3 316 ? 43.930  -8.554  -26.803 1.00 35.14  ? 293  ASP A OD1   1 
ATOM   3148 O  OD2   . ASP E 3 316 ? 42.997  -9.530  -28.545 1.00 36.64  ? 293  ASP A OD2   1 
ATOM   3149 N  N     . PHE E 3 317 ? 40.319  -11.138 -24.350 1.00 31.45  ? 294  PHE A N     1 
ATOM   3150 C  CA    . PHE E 3 317 ? 39.096  -11.628 -23.719 1.00 31.46  ? 294  PHE A CA    1 
ATOM   3151 C  C     . PHE E 3 317 ? 39.191  -11.580 -22.197 1.00 31.83  ? 294  PHE A C     1 
ATOM   3152 O  O     . PHE E 3 317 ? 38.311  -11.042 -21.523 1.00 31.63  ? 294  PHE A O     1 
ATOM   3153 C  CB    . PHE E 3 317 ? 38.830  -13.066 -24.164 1.00 31.30  ? 294  PHE A CB    1 
ATOM   3154 C  CG    . PHE E 3 317 ? 37.562  -13.651 -23.612 1.00 29.87  ? 294  PHE A CG    1 
ATOM   3155 C  CD1   . PHE E 3 317 ? 36.319  -13.189 -24.043 1.00 28.77  ? 294  PHE A CD1   1 
ATOM   3156 C  CD2   . PHE E 3 317 ? 37.609  -14.678 -22.675 1.00 27.92  ? 294  PHE A CD2   1 
ATOM   3157 C  CE1   . PHE E 3 317 ? 35.137  -13.747 -23.550 1.00 28.04  ? 294  PHE A CE1   1 
ATOM   3158 C  CE2   . PHE E 3 317 ? 36.437  -15.242 -22.175 1.00 28.87  ? 294  PHE A CE2   1 
ATOM   3159 C  CZ    . PHE E 3 317 ? 35.195  -14.776 -22.615 1.00 28.02  ? 294  PHE A CZ    1 
ATOM   3160 N  N     . LEU E 3 318 ? 40.262  -12.152 -21.661 1.00 32.07  ? 295  LEU A N     1 
ATOM   3161 C  CA    . LEU E 3 318 ? 40.475  -12.175 -20.222 1.00 32.90  ? 295  LEU A CA    1 
ATOM   3162 C  C     . LEU E 3 318 ? 40.657  -10.773 -19.648 1.00 34.83  ? 295  LEU A C     1 
ATOM   3163 O  O     . LEU E 3 318 ? 40.515  -10.569 -18.443 1.00 36.96  ? 295  LEU A O     1 
ATOM   3164 C  CB    . LEU E 3 318 ? 41.692  -13.049 -19.896 1.00 30.63  ? 295  LEU A CB    1 
ATOM   3165 C  CG    . LEU E 3 318 ? 41.440  -14.465 -19.350 1.00 28.54  ? 295  LEU A CG    1 
ATOM   3166 C  CD1   . LEU E 3 318 ? 40.129  -15.032 -19.861 1.00 26.32  ? 295  LEU A CD1   1 
ATOM   3167 C  CD2   . LEU E 3 318 ? 42.608  -15.356 -19.742 1.00 26.85  ? 295  LEU A CD2   1 
ATOM   3168 N  N     . ASP E 3 319 ? 40.961  -9.807  -20.509 1.00 36.23  ? 296  ASP A N     1 
ATOM   3169 C  CA    . ASP E 3 319 ? 41.152  -8.428  -20.067 1.00 37.52  ? 296  ASP A CA    1 
ATOM   3170 C  C     . ASP E 3 319 ? 40.056  -7.480  -20.546 1.00 38.60  ? 296  ASP A C     1 
ATOM   3171 O  O     . ASP E 3 319 ? 40.215  -6.263  -20.470 1.00 38.72  ? 296  ASP A O     1 
ATOM   3172 C  CB    . ASP E 3 319 ? 42.501  -7.885  -20.549 1.00 37.66  ? 296  ASP A CB    1 
ATOM   3173 C  CG    . ASP E 3 319 ? 43.678  -8.634  -19.965 1.00 38.22  ? 296  ASP A CG    1 
ATOM   3174 O  OD1   . ASP E 3 319 ? 43.590  -9.058  -18.793 1.00 41.04  ? 296  ASP A OD1   1 
ATOM   3175 O  OD2   . ASP E 3 319 ? 44.699  -8.781  -20.671 1.00 36.09  ? 296  ASP A OD2   1 
ATOM   3176 N  N     . CYS E 3 320 ? 38.949  -8.027  -21.036 1.00 40.15  ? 297  CYS A N     1 
ATOM   3177 C  CA    . CYS E 3 320 ? 37.856  -7.196  -21.534 1.00 41.33  ? 297  CYS A CA    1 
ATOM   3178 C  C     . CYS E 3 320 ? 37.316  -6.272  -20.448 1.00 42.50  ? 297  CYS A C     1 
ATOM   3179 O  O     . CYS E 3 320 ? 36.886  -5.154  -20.733 1.00 42.22  ? 297  CYS A O     1 
ATOM   3180 C  CB    . CYS E 3 320 ? 36.719  -8.069  -22.071 1.00 41.19  ? 297  CYS A CB    1 
ATOM   3181 S  SG    . CYS E 3 320 ? 35.793  -8.960  -20.801 1.00 40.63  ? 297  CYS A SG    1 
ATOM   3182 N  N     . GLY E 3 321 ? 37.337  -6.746  -19.206 1.00 43.56  ? 298  GLY A N     1 
ATOM   3183 C  CA    . GLY E 3 321 ? 36.847  -5.944  -18.101 1.00 44.35  ? 298  GLY A CA    1 
ATOM   3184 C  C     . GLY E 3 321 ? 35.655  -6.557  -17.388 1.00 44.92  ? 298  GLY A C     1 
ATOM   3185 O  O     . GLY E 3 321 ? 35.002  -5.898  -16.577 1.00 46.33  ? 298  GLY A O     1 
ATOM   3186 N  N     . LYS E 3 322 ? 35.365  -7.818  -17.681 1.00 43.76  ? 299  LYS A N     1 
ATOM   3187 C  CA    . LYS E 3 322 ? 34.243  -8.488  -17.042 1.00 43.21  ? 299  LYS A CA    1 
ATOM   3188 C  C     . LYS E 3 322 ? 34.683  -9.620  -16.130 1.00 42.40  ? 299  LYS A C     1 
ATOM   3189 O  O     . LYS E 3 322 ? 33.867  -10.188 -15.408 1.00 42.53  ? 299  LYS A O     1 
ATOM   3190 C  CB    . LYS E 3 322 ? 33.285  -9.045  -18.093 1.00 43.80  ? 299  LYS A CB    1 
ATOM   3191 C  CG    . LYS E 3 322 ? 32.555  -7.990  -18.882 1.00 45.98  ? 299  LYS A CG    1 
ATOM   3192 C  CD    . LYS E 3 322 ? 31.503  -8.630  -19.762 1.00 48.17  ? 299  LYS A CD    1 
ATOM   3193 C  CE    . LYS E 3 322 ? 30.693  -7.584  -20.502 1.00 48.98  ? 299  LYS A CE    1 
ATOM   3194 N  NZ    . LYS E 3 322 ? 29.675  -8.219  -21.383 1.00 51.19  ? 299  LYS A NZ    1 
ATOM   3195 N  N     . PHE E 3 323 ? 35.967  -9.951  -16.157 1.00 40.84  ? 300  PHE A N     1 
ATOM   3196 C  CA    . PHE E 3 323 ? 36.457  -11.041 -15.331 1.00 40.94  ? 300  PHE A CA    1 
ATOM   3197 C  C     . PHE E 3 323 ? 37.481  -10.595 -14.313 1.00 42.96  ? 300  PHE A C     1 
ATOM   3198 O  O     . PHE E 3 323 ? 38.073  -9.525  -14.433 1.00 45.11  ? 300  PHE A O     1 
ATOM   3199 C  CB    . PHE E 3 323 ? 37.072  -12.132 -16.205 1.00 39.22  ? 300  PHE A CB    1 
ATOM   3200 C  CG    . PHE E 3 323 ? 36.230  -12.507 -17.385 1.00 35.50  ? 300  PHE A CG    1 
ATOM   3201 C  CD1   . PHE E 3 323 ? 36.624  -12.164 -18.669 1.00 33.37  ? 300  PHE A CD1   1 
ATOM   3202 C  CD2   . PHE E 3 323 ? 35.034  -13.185 -17.212 1.00 34.31  ? 300  PHE A CD2   1 
ATOM   3203 C  CE1   . PHE E 3 323 ? 35.842  -12.490 -19.759 1.00 32.09  ? 300  PHE A CE1   1 
ATOM   3204 C  CE2   . PHE E 3 323 ? 34.245  -13.515 -18.300 1.00 34.22  ? 300  PHE A CE2   1 
ATOM   3205 C  CZ    . PHE E 3 323 ? 34.650  -13.165 -19.575 1.00 32.48  ? 300  PHE A CZ    1 
ATOM   3206 N  N     . GLU E 3 324 ? 37.686  -11.444 -13.313 1.00 44.20  ? 301  GLU A N     1 
ATOM   3207 C  CA    . GLU E 3 324 ? 38.639  -11.194 -12.243 1.00 46.24  ? 301  GLU A CA    1 
ATOM   3208 C  C     . GLU E 3 324 ? 39.146  -12.548 -11.769 1.00 46.86  ? 301  GLU A C     1 
ATOM   3209 O  O     . GLU E 3 324 ? 38.604  -13.581 -12.159 1.00 47.91  ? 301  GLU A O     1 
ATOM   3210 C  CB    . GLU E 3 324 ? 37.953  -10.474 -11.083 1.00 47.59  ? 301  GLU A CB    1 
ATOM   3211 C  CG    . GLU E 3 324 ? 37.445  -9.088  -11.418 1.00 49.58  ? 301  GLU A CG    1 
ATOM   3212 C  CD    . GLU E 3 324 ? 38.567  -8.139  -11.785 1.00 51.96  ? 301  GLU A CD    1 
ATOM   3213 O  OE1   . GLU E 3 324 ? 39.549  -8.060  -11.016 1.00 52.85  ? 301  GLU A OE1   1 
ATOM   3214 O  OE2   . GLU E 3 324 ? 38.467  -7.469  -12.836 1.00 53.04  ? 301  GLU A OE2   1 
ATOM   3215 N  N     . ILE E 3 325 ? 40.186  -12.552 -10.943 1.00 47.01  ? 302  ILE A N     1 
ATOM   3216 C  CA    . ILE E 3 325 ? 40.716  -13.808 -10.425 1.00 47.43  ? 302  ILE A CA    1 
ATOM   3217 C  C     . ILE E 3 325 ? 39.571  -14.514 -9.713  1.00 47.74  ? 302  ILE A C     1 
ATOM   3218 O  O     . ILE E 3 325 ? 39.490  -15.740 -9.692  1.00 46.79  ? 302  ILE A O     1 
ATOM   3219 C  CB    . ILE E 3 325 ? 41.848  -13.576 -9.402  1.00 47.37  ? 302  ILE A CB    1 
ATOM   3220 C  CG1   . ILE E 3 325 ? 42.266  -14.912 -8.785  1.00 46.58  ? 302  ILE A CG1   1 
ATOM   3221 C  CG2   . ILE E 3 325 ? 41.382  -12.613 -8.317  1.00 48.06  ? 302  ILE A CG2   1 
ATOM   3222 C  CD1   . ILE E 3 325 ? 43.244  -14.787 -7.644  1.00 46.95  ? 302  ILE A CD1   1 
ATOM   3223 N  N     . THR E 3 326 ? 38.685  -13.711 -9.135  1.00 48.86  ? 303  THR A N     1 
ATOM   3224 C  CA    . THR E 3 326 ? 37.530  -14.215 -8.407  1.00 50.44  ? 303  THR A CA    1 
ATOM   3225 C  C     . THR E 3 326 ? 36.429  -14.641 -9.374  1.00 50.44  ? 303  THR A C     1 
ATOM   3226 O  O     . THR E 3 326 ? 35.395  -15.171 -8.964  1.00 49.72  ? 303  THR A O     1 
ATOM   3227 C  CB    . THR E 3 326 ? 36.972  -13.130 -7.460  1.00 50.90  ? 303  THR A CB    1 
ATOM   3228 O  OG1   . THR E 3 326 ? 35.925  -13.685 -6.654  1.00 52.81  ? 303  THR A OG1   1 
ATOM   3229 C  CG2   . THR E 3 326 ? 36.425  -11.953 -8.263  1.00 49.87  ? 303  THR A CG2   1 
ATOM   3230 N  N     . SER E 3 327 ? 36.664  -14.411 -10.661 1.00 50.83  ? 304  SER A N     1 
ATOM   3231 C  CA    . SER E 3 327 ? 35.694  -14.754 -11.692 1.00 51.52  ? 304  SER A CA    1 
ATOM   3232 C  C     . SER E 3 327 ? 35.966  -16.132 -12.292 1.00 51.98  ? 304  SER A C     1 
ATOM   3233 O  O     . SER E 3 327 ? 35.136  -16.676 -13.022 1.00 52.18  ? 304  SER A O     1 
ATOM   3234 C  CB    . SER E 3 327 ? 35.710  -13.689 -12.793 1.00 51.53  ? 304  SER A CB    1 
ATOM   3235 O  OG    . SER E 3 327 ? 34.570  -13.794 -13.627 1.00 52.60  ? 304  SER A OG    1 
ATOM   3236 N  N     . PHE E 3 328 ? 37.130  -16.696 -11.984 1.00 52.53  ? 305  PHE A N     1 
ATOM   3237 C  CA    . PHE E 3 328 ? 37.493  -18.014 -12.496 1.00 53.55  ? 305  PHE A CA    1 
ATOM   3238 C  C     . PHE E 3 328 ? 36.763  -19.123 -11.750 1.00 54.24  ? 305  PHE A C     1 
ATOM   3239 O  O     . PHE E 3 328 ? 35.850  -18.864 -10.967 1.00 56.11  ? 305  PHE A O     1 
ATOM   3240 C  CB    . PHE E 3 328 ? 39.010  -18.228 -12.398 1.00 52.76  ? 305  PHE A CB    1 
ATOM   3241 C  CG    . PHE E 3 328 ? 39.798  -17.529 -13.480 1.00 52.60  ? 305  PHE A CG    1 
ATOM   3242 C  CD1   . PHE E 3 328 ? 41.164  -17.321 -13.338 1.00 52.08  ? 305  PHE A CD1   1 
ATOM   3243 C  CD2   . PHE E 3 328 ? 39.176  -17.091 -14.648 1.00 52.11  ? 305  PHE A CD2   1 
ATOM   3244 C  CE1   . PHE E 3 328 ? 41.896  -16.688 -14.338 1.00 50.75  ? 305  PHE A CE1   1 
ATOM   3245 C  CE2   . PHE E 3 328 ? 39.901  -16.458 -15.652 1.00 50.08  ? 305  PHE A CE2   1 
ATOM   3246 C  CZ    . PHE E 3 328 ? 41.263  -16.257 -15.495 1.00 50.01  ? 305  PHE A CZ    1 
ATOM   3247 N  N     . TRP E 3 329 ? 37.171  -20.360 -11.998 1.00 54.16  ? 306  TRP A N     1 
ATOM   3248 C  CA    . TRP E 3 329 ? 36.556  -21.515 -11.362 1.00 54.12  ? 306  TRP A CA    1 
ATOM   3249 C  C     . TRP E 3 329 ? 37.142  -21.734 -9.965  1.00 54.11  ? 306  TRP A C     1 
ATOM   3250 O  O     . TRP E 3 329 ? 38.330  -21.513 -9.746  1.00 55.96  ? 306  TRP A O     1 
ATOM   3251 C  CB    . TRP E 3 329 ? 36.800  -22.748 -12.232 1.00 55.41  ? 306  TRP A CB    1 
ATOM   3252 C  CG    . TRP E 3 329 ? 36.020  -23.952 -11.837 1.00 56.90  ? 306  TRP A CG    1 
ATOM   3253 C  CD1   . TRP E 3 329 ? 36.507  -25.210 -11.640 1.00 57.68  ? 306  TRP A CD1   1 
ATOM   3254 C  CD2   . TRP E 3 329 ? 34.606  -24.030 -11.631 1.00 58.32  ? 306  TRP A CD2   1 
ATOM   3255 N  NE1   . TRP E 3 329 ? 35.482  -26.071 -11.323 1.00 58.20  ? 306  TRP A NE1   1 
ATOM   3256 C  CE2   . TRP E 3 329 ? 34.304  -25.373 -11.312 1.00 58.05  ? 306  TRP A CE2   1 
ATOM   3257 C  CE3   . TRP E 3 329 ? 33.562  -23.097 -11.687 1.00 60.20  ? 306  TRP A CE3   1 
ATOM   3258 C  CZ2   . TRP E 3 329 ? 33.002  -25.808 -11.048 1.00 58.94  ? 306  TRP A CZ2   1 
ATOM   3259 C  CZ3   . TRP E 3 329 ? 32.264  -23.530 -11.424 1.00 61.05  ? 306  TRP A CZ3   1 
ATOM   3260 C  CH2   . TRP E 3 329 ? 31.998  -24.876 -11.109 1.00 60.46  ? 306  TRP A CH2   1 
ATOM   3261 N  N     . THR E 3 330 ? 36.300  -22.159 -9.026  1.00 52.98  ? 307  THR A N     1 
ATOM   3262 C  CA    . THR E 3 330 ? 36.711  -22.431 -7.643  1.00 50.88  ? 307  THR A CA    1 
ATOM   3263 C  C     . THR E 3 330 ? 37.380  -21.277 -6.903  1.00 50.84  ? 307  THR A C     1 
ATOM   3264 O  O     . THR E 3 330 ? 38.010  -21.488 -5.867  1.00 50.55  ? 307  THR A O     1 
ATOM   3265 C  CB    . THR E 3 330 ? 37.672  -23.647 -7.553  1.00 49.26  ? 307  THR A CB    1 
ATOM   3266 O  OG1   . THR E 3 330 ? 38.845  -23.403 -8.339  1.00 45.37  ? 307  THR A OG1   1 
ATOM   3267 C  CG2   . THR E 3 330 ? 36.985  -24.907 -8.038  1.00 49.15  ? 307  THR A CG2   1 
ATOM   3268 N  N     . LEU E 3 331 ? 37.248  -20.063 -7.424  1.00 50.43  ? 308  LEU A N     1 
ATOM   3269 C  CA    . LEU E 3 331 ? 37.856  -18.906 -6.781  1.00 50.32  ? 308  LEU A CA    1 
ATOM   3270 C  C     . LEU E 3 331 ? 36.853  -17.788 -6.524  1.00 51.55  ? 308  LEU A C     1 
ATOM   3271 O  O     . LEU E 3 331 ? 37.234  -16.667 -6.188  1.00 51.88  ? 308  LEU A O     1 
ATOM   3272 C  CB    . LEU E 3 331 ? 39.011  -18.378 -7.634  1.00 47.86  ? 308  LEU A CB    1 
ATOM   3273 C  CG    . LEU E 3 331 ? 40.390  -19.009 -7.433  1.00 45.80  ? 308  LEU A CG    1 
ATOM   3274 C  CD1   . LEU E 3 331 ? 40.314  -20.515 -7.535  1.00 46.34  ? 308  LEU A CD1   1 
ATOM   3275 C  CD2   . LEU E 3 331 ? 41.339  -18.456 -8.479  1.00 47.44  ? 308  LEU A CD2   1 
ATOM   3276 N  N     . GLY E 3 332 ? 35.570  -18.099 -6.674  1.00 52.84  ? 309  GLY A N     1 
ATOM   3277 C  CA    . GLY E 3 332 ? 34.543  -17.099 -6.452  1.00 54.35  ? 309  GLY A CA    1 
ATOM   3278 C  C     . GLY E 3 332 ? 34.124  -16.986 -4.999  1.00 55.43  ? 309  GLY A C     1 
ATOM   3279 O  O     . GLY E 3 332 ? 33.173  -16.274 -4.677  1.00 55.71  ? 309  GLY A O     1 
ATOM   3280 N  N     . GLY E 3 333 ? 34.838  -17.682 -4.118  1.00 56.59  ? 310  GLY A N     1 
ATOM   3281 C  CA    . GLY E 3 333 ? 34.506  -17.645 -2.704  1.00 57.80  ? 310  GLY A CA    1 
ATOM   3282 C  C     . GLY E 3 333 ? 35.574  -17.021 -1.827  1.00 57.98  ? 310  GLY A C     1 
ATOM   3283 O  O     . GLY E 3 333 ? 36.275  -16.102 -2.252  1.00 58.52  ? 310  GLY A O     1 
ATOM   3284 N  N     . VAL E 3 334 ? 35.695  -17.516 -0.599  1.00 58.05  ? 311  VAL A N     1 
ATOM   3285 C  CA    . VAL E 3 334 ? 36.688  -16.996 0.334   1.00 59.27  ? 311  VAL A CA    1 
ATOM   3286 C  C     . VAL E 3 334 ? 38.102  -17.228 -0.189  1.00 58.68  ? 311  VAL A C     1 
ATOM   3287 O  O     . VAL E 3 334 ? 38.979  -16.379 -0.020  1.00 58.40  ? 311  VAL A O     1 
ATOM   3288 C  CB    . VAL E 3 334 ? 36.550  -17.645 1.740   1.00 60.41  ? 311  VAL A CB    1 
ATOM   3289 C  CG1   . VAL E 3 334 ? 35.257  -17.192 2.400   1.00 61.21  ? 311  VAL A CG1   1 
ATOM   3290 C  CG2   . VAL E 3 334 ? 36.575  -19.160 1.625   1.00 61.55  ? 311  VAL A CG2   1 
ATOM   3291 N  N     . LEU E 3 335 ? 38.324  -18.373 -0.828  1.00 58.36  ? 312  LEU A N     1 
ATOM   3292 C  CA    . LEU E 3 335 ? 39.642  -18.681 -1.374  1.00 58.52  ? 312  LEU A CA    1 
ATOM   3293 C  C     . LEU E 3 335 ? 40.034  -17.586 -2.355  1.00 59.44  ? 312  LEU A C     1 
ATOM   3294 O  O     . LEU E 3 335 ? 41.216  -17.295 -2.542  1.00 59.67  ? 312  LEU A O     1 
ATOM   3295 C  CB    . LEU E 3 335 ? 39.633  -20.034 -2.091  1.00 56.40  ? 312  LEU A CB    1 
ATOM   3296 C  CG    . LEU E 3 335 ? 40.937  -20.423 -2.800  1.00 54.25  ? 312  LEU A CG    1 
ATOM   3297 C  CD1   . LEU E 3 335 ? 42.088  -20.449 -1.810  1.00 52.42  ? 312  LEU A CD1   1 
ATOM   3298 C  CD2   . LEU E 3 335 ? 40.770  -21.781 -3.453  1.00 53.24  ? 312  LEU A CD2   1 
ATOM   3299 N  N     . GLY E 3 336 ? 39.026  -16.986 -2.979  1.00 60.10  ? 313  GLY A N     1 
ATOM   3300 C  CA    . GLY E 3 336 ? 39.274  -15.921 -3.930  1.00 60.72  ? 313  GLY A CA    1 
ATOM   3301 C  C     . GLY E 3 336 ? 39.610  -14.632 -3.211  1.00 61.58  ? 313  GLY A C     1 
ATOM   3302 O  O     . GLY E 3 336 ? 40.655  -14.030 -3.456  1.00 62.22  ? 313  GLY A O     1 
ATOM   3303 N  N     . LYS E 3 337 ? 38.726  -14.210 -2.313  1.00 62.40  ? 314  LYS A N     1 
ATOM   3304 C  CA    . LYS E 3 337 ? 38.940  -12.983 -1.561  1.00 63.14  ? 314  LYS A CA    1 
ATOM   3305 C  C     . LYS E 3 337 ? 40.245  -13.021 -0.772  1.00 63.31  ? 314  LYS A C     1 
ATOM   3306 O  O     . LYS E 3 337 ? 40.749  -11.980 -0.351  1.00 64.09  ? 314  LYS A O     1 
ATOM   3307 C  CB    . LYS E 3 337 ? 37.758  -12.724 -0.621  1.00 63.78  ? 314  LYS A CB    1 
ATOM   3308 C  CG    . LYS E 3 337 ? 36.469  -12.352 -1.347  1.00 64.47  ? 314  LYS A CG    1 
ATOM   3309 C  CD    . LYS E 3 337 ? 35.327  -12.098 -0.373  1.00 65.65  ? 314  LYS A CD    1 
ATOM   3310 C  CE    . LYS E 3 337 ? 34.040  -11.738 -1.105  1.00 65.59  ? 314  LYS A CE    1 
ATOM   3311 N  NZ    . LYS E 3 337 ? 32.890  -11.563 -0.169  1.00 64.62  ? 314  LYS A NZ    1 
ATOM   3312 N  N     . GLU E 3 338 ? 40.794  -14.217 -0.577  1.00 63.45  ? 315  GLU A N     1 
ATOM   3313 C  CA    . GLU E 3 338 ? 42.053  -14.358 0.148   1.00 63.10  ? 315  GLU A CA    1 
ATOM   3314 C  C     . GLU E 3 338 ? 43.217  -14.108 -0.800  1.00 63.02  ? 315  GLU A C     1 
ATOM   3315 O  O     . GLU E 3 338 ? 44.083  -13.280 -0.527  1.00 62.67  ? 315  GLU A O     1 
ATOM   3316 C  CB    . GLU E 3 338 ? 42.193  -15.757 0.749   1.00 63.60  ? 315  GLU A CB    1 
ATOM   3317 C  CG    . GLU E 3 338 ? 43.459  -15.924 1.587   1.00 65.47  ? 315  GLU A CG    1 
ATOM   3318 C  CD    . GLU E 3 338 ? 43.677  -17.347 2.073   1.00 67.03  ? 315  GLU A CD    1 
ATOM   3319 O  OE1   . GLU E 3 338 ? 42.767  -17.907 2.722   1.00 68.57  ? 315  GLU A OE1   1 
ATOM   3320 O  OE2   . GLU E 3 338 ? 44.764  -17.905 1.812   1.00 66.87  ? 315  GLU A OE2   1 
ATOM   3321 N  N     . LEU E 3 339 ? 43.230  -14.832 -1.915  1.00 63.59  ? 316  LEU A N     1 
ATOM   3322 C  CA    . LEU E 3 339 ? 44.287  -14.693 -2.909  1.00 64.20  ? 316  LEU A CA    1 
ATOM   3323 C  C     . LEU E 3 339 ? 44.502  -13.235 -3.294  1.00 65.03  ? 316  LEU A C     1 
ATOM   3324 O  O     . LEU E 3 339 ? 45.587  -12.855 -3.738  1.00 65.67  ? 316  LEU A O     1 
ATOM   3325 C  CB    . LEU E 3 339 ? 43.954  -15.517 -4.154  1.00 63.56  ? 316  LEU A CB    1 
ATOM   3326 C  CG    . LEU E 3 339 ? 43.999  -17.036 -3.972  1.00 63.69  ? 316  LEU A CG    1 
ATOM   3327 C  CD1   . LEU E 3 339 ? 43.560  -17.719 -5.255  1.00 64.39  ? 316  LEU A CD1   1 
ATOM   3328 C  CD2   . LEU E 3 339 ? 45.408  -17.463 -3.594  1.00 62.62  ? 316  LEU A CD2   1 
ATOM   3329 N  N     . ILE E 3 340 ? 43.464  -12.422 -3.121  1.00 65.01  ? 317  ILE A N     1 
ATOM   3330 C  CA    . ILE E 3 340 ? 43.544  -11.000 -3.436  1.00 65.84  ? 317  ILE A CA    1 
ATOM   3331 C  C     . ILE E 3 340 ? 44.330  -10.287 -2.332  1.00 67.46  ? 317  ILE A C     1 
ATOM   3332 O  O     . ILE E 3 340 ? 45.346  -9.638  -2.594  1.00 67.30  ? 317  ILE A O     1 
ATOM   3333 C  CB    . ILE E 3 340 ? 42.132  -10.367 -3.541  1.00 64.80  ? 317  ILE A CB    1 
ATOM   3334 C  CG1   . ILE E 3 340 ? 41.307  -11.100 -4.599  1.00 63.44  ? 317  ILE A CG1   1 
ATOM   3335 C  CG2   . ILE E 3 340 ? 42.240  -8.891  -3.905  1.00 63.75  ? 317  ILE A CG2   1 
ATOM   3336 C  CD1   . ILE E 3 340 ? 39.902  -10.565 -4.752  1.00 62.22  ? 317  ILE A CD1   1 
ATOM   3337 N  N     . ASP E 3 341 ? 43.855  -10.423 -1.098  1.00 69.04  ? 318  ASP A N     1 
ATOM   3338 C  CA    . ASP E 3 341 ? 44.496  -9.800  0.057   1.00 71.13  ? 318  ASP A CA    1 
ATOM   3339 C  C     . ASP E 3 341 ? 45.885  -10.393 0.316   1.00 71.46  ? 318  ASP A C     1 
ATOM   3340 O  O     . ASP E 3 341 ? 46.681  -9.825  1.070   1.00 72.16  ? 318  ASP A O     1 
ATOM   3341 C  CB    . ASP E 3 341 ? 43.612  -9.974  1.300   1.00 71.85  ? 318  ASP A CB    1 
ATOM   3342 C  CG    . ASP E 3 341 ? 44.187  -9.296  2.528   0.00 71.72  ? 318  ASP A CG    1 
ATOM   3343 O  OD1   . ASP E 3 341 ? 44.374  -8.062  2.495   0.00 71.87  ? 318  ASP A OD1   1 
ATOM   3344 O  OD2   . ASP E 3 341 ? 44.450  -9.998  3.528   0.00 71.87  ? 318  ASP A OD2   1 
ATOM   3345 N  N     . VAL E 3 342 ? 46.166  -11.534 -0.312  1.00 70.63  ? 319  VAL A N     1 
ATOM   3346 C  CA    . VAL E 3 342 ? 47.454  -12.205 -0.160  1.00 69.98  ? 319  VAL A CA    1 
ATOM   3347 C  C     . VAL E 3 342 ? 48.443  -11.736 -1.217  1.00 70.68  ? 319  VAL A C     1 
ATOM   3348 O  O     . VAL E 3 342 ? 49.461  -11.124 -0.901  1.00 71.21  ? 319  VAL A O     1 
ATOM   3349 C  CB    . VAL E 3 342 ? 47.314  -13.738 -0.284  1.00 68.72  ? 319  VAL A CB    1 
ATOM   3350 C  CG1   . VAL E 3 342 ? 48.689  -14.392 -0.254  1.00 67.37  ? 319  VAL A CG1   1 
ATOM   3351 C  CG2   . VAL E 3 342 ? 46.460  -14.272 0.844   1.00 68.82  ? 319  VAL A CG2   1 
ATOM   3352 N  N     . LEU E 3 343 ? 48.140  -12.033 -2.475  1.00 71.34  ? 320  LEU A N     1 
ATOM   3353 C  CA    . LEU E 3 343 ? 49.005  -11.645 -3.580  1.00 71.91  ? 320  LEU A CA    1 
ATOM   3354 C  C     . LEU E 3 343 ? 49.004  -10.133 -3.784  1.00 72.56  ? 320  LEU A C     1 
ATOM   3355 O  O     . LEU E 3 343 ? 49.627  -9.625  -4.717  1.00 72.55  ? 320  LEU A O     1 
ATOM   3356 C  CB    . LEU E 3 343 ? 48.549  -12.340 -4.863  1.00 71.40  ? 320  LEU A CB    1 
ATOM   3357 C  CG    . LEU E 3 343 ? 48.626  -13.868 -4.865  1.00 70.09  ? 320  LEU A CG    1 
ATOM   3358 C  CD1   . LEU E 3 343 ? 47.921  -14.413 -6.091  1.00 70.88  ? 320  LEU A CD1   1 
ATOM   3359 C  CD2   . LEU E 3 343 ? 50.078  -14.307 -4.839  1.00 69.15  ? 320  LEU A CD2   1 
ATOM   3360 N  N     . ASP E 3 344 ? 48.309  -9.420  -2.902  1.00 73.46  ? 321  ASP A N     1 
ATOM   3361 C  CA    . ASP E 3 344 ? 48.223  -7.967  -2.991  1.00 74.07  ? 321  ASP A CA    1 
ATOM   3362 C  C     . ASP E 3 344 ? 47.755  -7.562  -4.382  1.00 73.34  ? 321  ASP A C     1 
ATOM   3363 O  O     . ASP E 3 344 ? 48.394  -6.757  -5.061  1.00 73.53  ? 321  ASP A O     1 
ATOM   3364 C  CB    . ASP E 3 344 ? 49.586  -7.331  -2.690  1.00 75.78  ? 321  ASP A CB    1 
ATOM   3365 C  CG    . ASP E 3 344 ? 49.936  -7.370  -1.211  1.00 77.61  ? 321  ASP A CG    1 
ATOM   3366 O  OD1   . ASP E 3 344 ? 49.925  -8.471  -0.618  1.00 78.82  ? 321  ASP A OD1   1 
ATOM   3367 O  OD2   . ASP E 3 344 ? 50.227  -6.297  -0.640  1.00 78.30  ? 321  ASP A OD2   1 
ATOM   3368 N  N     . LEU E 3 345 ? 46.633  -8.135  -4.800  1.00 72.04  ? 322  LEU A N     1 
ATOM   3369 C  CA    . LEU E 3 345 ? 46.066  -7.847  -6.108  1.00 71.28  ? 322  LEU A CA    1 
ATOM   3370 C  C     . LEU E 3 345 ? 45.095  -6.680  -5.990  1.00 70.66  ? 322  LEU A C     1 
ATOM   3371 O  O     . LEU E 3 345 ? 44.499  -6.464  -4.936  1.00 70.34  ? 322  LEU A O     1 
ATOM   3372 C  CB    . LEU E 3 345 ? 45.317  -9.073  -6.641  1.00 71.39  ? 322  LEU A CB    1 
ATOM   3373 C  CG    . LEU E 3 345 ? 46.062  -10.409 -6.704  1.00 70.95  ? 322  LEU A CG    1 
ATOM   3374 C  CD1   . LEU E 3 345 ? 45.112  -11.501 -7.180  1.00 69.03  ? 322  LEU A CD1   1 
ATOM   3375 C  CD2   . LEU E 3 345 ? 47.257  -10.291 -7.636  1.00 71.33  ? 322  LEU A CD2   1 
ATOM   3376 N  N     . PRO E 3 346 ? 44.930  -5.906  -7.073  1.00 70.10  ? 323  PRO A N     1 
ATOM   3377 C  CA    . PRO E 3 346 ? 44.014  -4.765  -7.060  1.00 70.01  ? 323  PRO A CA    1 
ATOM   3378 C  C     . PRO E 3 346 ? 42.572  -5.240  -7.174  1.00 70.89  ? 323  PRO A C     1 
ATOM   3379 O  O     . PRO E 3 346 ? 42.296  -6.436  -7.089  1.00 70.16  ? 323  PRO A O     1 
ATOM   3380 C  CB    . PRO E 3 346 ? 44.456  -3.963  -8.275  1.00 69.84  ? 323  PRO A CB    1 
ATOM   3381 C  CG    . PRO E 3 346 ? 44.872  -5.033  -9.227  1.00 69.57  ? 323  PRO A CG    1 
ATOM   3382 C  CD    . PRO E 3 346 ? 45.674  -5.963  -8.343  1.00 69.63  ? 323  PRO A CD    1 
ATOM   3383 N  N     . HIS E 3 347 ? 41.655  -4.301  -7.375  1.00 72.86  ? 324  HIS A N     1 
ATOM   3384 C  CA    . HIS E 3 347 ? 40.244  -4.640  -7.498  1.00 74.69  ? 324  HIS A CA    1 
ATOM   3385 C  C     . HIS E 3 347 ? 39.722  -4.321  -8.890  1.00 74.23  ? 324  HIS A C     1 
ATOM   3386 O  O     . HIS E 3 347 ? 38.529  -4.098  -9.088  1.00 74.64  ? 324  HIS A O     1 
ATOM   3387 C  CB    . HIS E 3 347 ? 39.442  -3.898  -6.431  1.00 76.94  ? 324  HIS A CB    1 
ATOM   3388 C  CG    . HIS E 3 347 ? 39.830  -4.271  -5.034  1.00 79.97  ? 324  HIS A CG    1 
ATOM   3389 N  ND1   . HIS E 3 347 ? 39.678  -5.548  -4.537  1.00 80.79  ? 324  HIS A ND1   1 
ATOM   3390 C  CD2   . HIS E 3 347 ? 40.408  -3.549  -4.045  1.00 80.82  ? 324  HIS A CD2   1 
ATOM   3391 C  CE1   . HIS E 3 347 ? 40.147  -5.598  -3.303  1.00 81.11  ? 324  HIS A CE1   1 
ATOM   3392 N  NE2   . HIS E 3 347 ? 40.597  -4.398  -2.981  1.00 81.43  ? 324  HIS A NE2   1 
ATOM   3393 N  N     . GLU E 3 348 ? 40.643  -4.308  -9.846  1.00 73.27  ? 325  GLU A N     1 
ATOM   3394 C  CA    . GLU E 3 348 ? 40.342  -4.045  -11.245 1.00 72.83  ? 325  GLU A CA    1 
ATOM   3395 C  C     . GLU E 3 348 ? 41.526  -4.533  -12.071 1.00 72.29  ? 325  GLU A C     1 
ATOM   3396 O  O     . GLU E 3 348 ? 42.679  -4.274  -11.724 1.00 73.12  ? 325  GLU A O     1 
ATOM   3397 C  CB    . GLU E 3 348 ? 40.114  -2.549  -11.481 1.00 73.47  ? 325  GLU A CB    1 
ATOM   3398 C  CG    . GLU E 3 348 ? 38.754  -2.049  -11.014 1.00 76.68  ? 325  GLU A CG    1 
ATOM   3399 C  CD    . GLU E 3 348 ? 38.529  -0.576  -11.309 1.00 78.31  ? 325  GLU A CD    1 
ATOM   3400 O  OE1   . GLU E 3 348 ? 37.410  -0.083  -11.047 1.00 78.63  ? 325  GLU A OE1   1 
ATOM   3401 O  OE2   . GLU E 3 348 ? 39.467  0.088   -11.800 1.00 79.29  ? 325  GLU A OE2   1 
ATOM   3402 N  N     . ASN E 3 349 ? 41.239  -5.248  -13.155 1.00 70.41  ? 326  ASN A N     1 
ATOM   3403 C  CA    . ASN E 3 349 ? 42.287  -5.780  -14.017 1.00 68.25  ? 326  ASN A CA    1 
ATOM   3404 C  C     . ASN E 3 349 ? 43.279  -6.594  -13.196 1.00 67.20  ? 326  ASN A C     1 
ATOM   3405 O  O     . ASN E 3 349 ? 44.491  -6.406  -13.304 1.00 67.65  ? 326  ASN A O     1 
ATOM   3406 C  CB    . ASN E 3 349 ? 43.017  -4.643  -14.733 1.00 68.13  ? 326  ASN A CB    1 
ATOM   3407 C  CG    . ASN E 3 349 ? 42.127  -3.906  -15.711 1.00 68.94  ? 326  ASN A CG    1 
ATOM   3408 O  OD1   . ASN E 3 349 ? 41.131  -3.294  -15.326 1.00 69.52  ? 326  ASN A OD1   1 
ATOM   3409 N  ND2   . ASN E 3 349 ? 42.480  -3.965  -16.989 1.00 70.22  ? 326  ASN A ND2   1 
ATOM   3410 N  N     . SER E 3 350 ? 42.753  -7.500  -12.376 1.00 65.34  ? 327  SER A N     1 
ATOM   3411 C  CA    . SER E 3 350 ? 43.579  -8.350  -11.525 1.00 63.39  ? 327  SER A CA    1 
ATOM   3412 C  C     . SER E 3 350 ? 44.201  -9.510  -12.297 1.00 61.89  ? 327  SER A C     1 
ATOM   3413 O  O     . SER E 3 350 ? 45.295  -9.968  -11.964 1.00 61.30  ? 327  SER A O     1 
ATOM   3414 C  CB    . SER E 3 350 ? 42.746  -8.898  -10.362 1.00 64.15  ? 327  SER A CB    1 
ATOM   3415 O  OG    . SER E 3 350 ? 41.636  -9.645  -10.830 1.00 64.24  ? 327  SER A OG    1 
ATOM   3416 N  N     . ILE E 3 351 ? 43.502  -9.987  -13.322 1.00 59.97  ? 328  ILE A N     1 
ATOM   3417 C  CA    . ILE E 3 351 ? 44.004  -11.095 -14.125 1.00 58.18  ? 328  ILE A CA    1 
ATOM   3418 C  C     . ILE E 3 351 ? 45.213  -10.639 -14.934 1.00 57.91  ? 328  ILE A C     1 
ATOM   3419 O  O     . ILE E 3 351 ? 46.187  -11.374 -15.081 1.00 58.32  ? 328  ILE A O     1 
ATOM   3420 C  CB    . ILE E 3 351 ? 42.922  -11.634 -15.093 1.00 57.01  ? 328  ILE A CB    1 
ATOM   3421 C  CG1   . ILE E 3 351 ? 41.681  -12.056 -14.308 1.00 54.32  ? 328  ILE A CG1   1 
ATOM   3422 C  CG2   . ILE E 3 351 ? 43.462  -12.829 -15.868 1.00 55.97  ? 328  ILE A CG2   1 
ATOM   3423 C  CD1   . ILE E 3 351 ? 40.573  -12.595 -15.176 1.00 53.83  ? 328  ILE A CD1   1 
ATOM   3424 N  N     . LYS E 3 352 ? 45.144  -9.420  -15.455 1.00 57.44  ? 329  LYS A N     1 
ATOM   3425 C  CA    . LYS E 3 352 ? 46.241  -8.864  -16.237 1.00 57.67  ? 329  LYS A CA    1 
ATOM   3426 C  C     . LYS E 3 352 ? 47.418  -8.592  -15.309 1.00 57.74  ? 329  LYS A C     1 
ATOM   3427 O  O     . LYS E 3 352 ? 48.575  -8.584  -15.731 1.00 58.07  ? 329  LYS A O     1 
ATOM   3428 C  CB    . LYS E 3 352 ? 45.798  -7.562  -16.903 1.00 57.58  ? 329  LYS A CB    1 
ATOM   3429 C  CG    . LYS E 3 352 ? 46.867  -6.883  -17.734 1.00 56.93  ? 329  LYS A CG    1 
ATOM   3430 C  CD    . LYS E 3 352 ? 46.273  -5.700  -18.480 1.00 59.02  ? 329  LYS A CD    1 
ATOM   3431 C  CE    . LYS E 3 352 ? 47.300  -5.026  -19.370 1.00 59.66  ? 329  LYS A CE    1 
ATOM   3432 N  NZ    . LYS E 3 352 ? 48.406  -4.432  -18.576 1.00 60.12  ? 329  LYS A NZ    1 
ATOM   3433 N  N     . HIS E 3 353 ? 47.103  -8.377  -14.037 1.00 56.86  ? 330  HIS A N     1 
ATOM   3434 C  CA    . HIS E 3 353 ? 48.107  -8.094  -13.027 1.00 55.58  ? 330  HIS A CA    1 
ATOM   3435 C  C     . HIS E 3 353 ? 48.910  -9.343  -12.691 1.00 55.12  ? 330  HIS A C     1 
ATOM   3436 O  O     . HIS E 3 353 ? 50.125  -9.375  -12.878 1.00 55.83  ? 330  HIS A O     1 
ATOM   3437 C  CB    . HIS E 3 353 ? 47.430  -7.557  -11.769 1.00 56.27  ? 330  HIS A CB    1 
ATOM   3438 C  CG    . HIS E 3 353 ? 48.364  -6.856  -10.837 1.00 57.62  ? 330  HIS A CG    1 
ATOM   3439 N  ND1   . HIS E 3 353 ? 49.443  -7.484  -10.251 1.00 58.28  ? 330  HIS A ND1   1 
ATOM   3440 C  CD2   . HIS E 3 353 ? 48.391  -5.576  -10.400 1.00 57.95  ? 330  HIS A CD2   1 
ATOM   3441 C  CE1   . HIS E 3 353 ? 50.094  -6.619  -9.495  1.00 58.31  ? 330  HIS A CE1   1 
ATOM   3442 N  NE2   . HIS E 3 353 ? 49.476  -5.454  -9.568  1.00 59.14  ? 330  HIS A NE2   1 
ATOM   3443 N  N     . ILE E 3 354 ? 48.227  -10.369 -12.194 1.00 54.45  ? 331  ILE A N     1 
ATOM   3444 C  CA    . ILE E 3 354 ? 48.878  -11.625 -11.835 1.00 54.97  ? 331  ILE A CA    1 
ATOM   3445 C  C     . ILE E 3 354 ? 49.785  -12.101 -12.961 1.00 54.97  ? 331  ILE A C     1 
ATOM   3446 O  O     . ILE E 3 354 ? 50.773  -12.799 -12.735 1.00 55.04  ? 331  ILE A O     1 
ATOM   3447 C  CB    . ILE E 3 354 ? 47.843  -12.733 -11.565 1.00 55.09  ? 331  ILE A CB    1 
ATOM   3448 C  CG1   . ILE E 3 354 ? 46.923  -12.314 -10.418 1.00 56.15  ? 331  ILE A CG1   1 
ATOM   3449 C  CG2   . ILE E 3 354 ? 48.552  -14.043 -11.239 1.00 54.51  ? 331  ILE A CG2   1 
ATOM   3450 C  CD1   . ILE E 3 354 ? 45.835  -13.322 -10.103 1.00 56.81  ? 331  ILE A CD1   1 
ATOM   3451 N  N     . ARG E 3 355 ? 49.437  -11.715 -14.179 1.00 55.05  ? 332  ARG A N     1 
ATOM   3452 C  CA    . ARG E 3 355 ? 50.198  -12.111 -15.351 1.00 55.48  ? 332  ARG A CA    1 
ATOM   3453 C  C     . ARG E 3 355 ? 51.481  -11.304 -15.496 1.00 56.61  ? 332  ARG A C     1 
ATOM   3454 O  O     . ARG E 3 355 ? 52.542  -11.856 -15.779 1.00 56.75  ? 332  ARG A O     1 
ATOM   3455 C  CB    . ARG E 3 355 ? 49.337  -11.931 -16.601 1.00 53.76  ? 332  ARG A CB    1 
ATOM   3456 C  CG    . ARG E 3 355 ? 49.911  -12.545 -17.862 1.00 51.56  ? 332  ARG A CG    1 
ATOM   3457 C  CD    . ARG E 3 355 ? 49.192  -12.006 -19.080 1.00 48.96  ? 332  ARG A CD    1 
ATOM   3458 N  NE    . ARG E 3 355 ? 47.747  -12.102 -18.926 1.00 46.66  ? 332  ARG A NE    1 
ATOM   3459 C  CZ    . ARG E 3 355 ? 46.886  -11.240 -19.452 1.00 46.34  ? 332  ARG A CZ    1 
ATOM   3460 N  NH1   . ARG E 3 355 ? 47.327  -10.216 -20.169 1.00 46.10  ? 332  ARG A NH1   1 
ATOM   3461 N  NH2   . ARG E 3 355 ? 45.584  -11.394 -19.251 1.00 46.25  ? 332  ARG A NH2   1 
ATOM   3462 N  N     . GLU E 3 356 ? 51.382  -9.996  -15.293 1.00 58.51  ? 333  GLU A N     1 
ATOM   3463 C  CA    . GLU E 3 356 ? 52.533  -9.116  -15.439 1.00 61.04  ? 333  GLU A CA    1 
ATOM   3464 C  C     . GLU E 3 356 ? 53.504  -9.074  -14.265 1.00 62.29  ? 333  GLU A C     1 
ATOM   3465 O  O     . GLU E 3 356 ? 54.677  -8.750  -14.443 1.00 62.68  ? 333  GLU A O     1 
ATOM   3466 C  CB    . GLU E 3 356 ? 52.055  -7.702  -15.761 1.00 61.31  ? 333  GLU A CB    1 
ATOM   3467 C  CG    . GLU E 3 356 ? 51.409  -7.591  -17.126 1.00 62.42  ? 333  GLU A CG    1 
ATOM   3468 C  CD    . GLU E 3 356 ? 50.891  -6.202  -17.418 1.00 64.24  ? 333  GLU A CD    1 
ATOM   3469 O  OE1   . GLU E 3 356 ? 50.426  -5.974  -18.556 1.00 64.82  ? 333  GLU A OE1   1 
ATOM   3470 O  OE2   . GLU E 3 356 ? 50.944  -5.341  -16.513 1.00 65.36  ? 333  GLU A OE2   1 
ATOM   3471 N  N     . THR E 3 357 ? 53.030  -9.398  -13.069 1.00 63.56  ? 334  THR A N     1 
ATOM   3472 C  CA    . THR E 3 357 ? 53.902  -9.378  -11.903 1.00 64.60  ? 334  THR A CA    1 
ATOM   3473 C  C     . THR E 3 357 ? 54.815  -10.598 -11.892 1.00 65.91  ? 334  THR A C     1 
ATOM   3474 O  O     . THR E 3 357 ? 55.779  -10.657 -11.133 1.00 66.18  ? 334  THR A O     1 
ATOM   3475 C  CB    . THR E 3 357 ? 53.089  -9.346  -10.599 1.00 64.06  ? 334  THR A CB    1 
ATOM   3476 O  OG1   . THR E 3 357 ? 52.197  -8.227  -10.623 1.00 63.26  ? 334  THR A OG1   1 
ATOM   3477 C  CG2   . THR E 3 357 ? 54.013  -9.211  -9.401  1.00 63.75  ? 334  THR A CG2   1 
ATOM   3478 N  N     . TRP E 3 358 ? 54.508  -11.567 -12.746 1.00 68.18  ? 335  TRP A N     1 
ATOM   3479 C  CA    . TRP E 3 358 ? 55.297  -12.792 -12.843 1.00 70.95  ? 335  TRP A CA    1 
ATOM   3480 C  C     . TRP E 3 358 ? 55.285  -13.293 -14.293 1.00 72.34  ? 335  TRP A C     1 
ATOM   3481 O  O     . TRP E 3 358 ? 54.815  -14.396 -14.575 1.00 72.23  ? 335  TRP A O     1 
ATOM   3482 C  CB    . TRP E 3 358 ? 54.705  -13.860 -11.916 1.00 70.76  ? 335  TRP A CB    1 
ATOM   3483 C  CG    . TRP E 3 358 ? 54.642  -13.450 -10.471 1.00 70.41  ? 335  TRP A CG    1 
ATOM   3484 C  CD1   . TRP E 3 358 ? 55.659  -13.485 -9.564  1.00 70.43  ? 335  TRP A CD1   1 
ATOM   3485 C  CD2   . TRP E 3 358 ? 53.504  -12.921 -9.777  1.00 71.27  ? 335  TRP A CD2   1 
ATOM   3486 N  NE1   . TRP E 3 358 ? 55.228  -13.012 -8.347  1.00 70.69  ? 335  TRP A NE1   1 
ATOM   3487 C  CE2   . TRP E 3 358 ? 53.909  -12.658 -8.450  1.00 70.78  ? 335  TRP A CE2   1 
ATOM   3488 C  CE3   . TRP E 3 358 ? 52.180  -12.643 -10.148 1.00 71.92  ? 335  TRP A CE3   1 
ATOM   3489 C  CZ2   . TRP E 3 358 ? 53.038  -12.129 -7.489  1.00 71.02  ? 335  TRP A CZ2   1 
ATOM   3490 C  CZ3   . TRP E 3 358 ? 51.312  -12.116 -9.191  1.00 71.75  ? 335  TRP A CZ3   1 
ATOM   3491 C  CH2   . TRP E 3 358 ? 51.747  -11.866 -7.878  1.00 71.35  ? 335  TRP A CH2   1 
ATOM   3492 N  N     . PRO E 3 359 ? 55.810  -12.484 -15.229 1.00 73.41  ? 336  PRO A N     1 
ATOM   3493 C  CA    . PRO E 3 359 ? 55.861  -12.828 -16.654 1.00 74.49  ? 336  PRO A CA    1 
ATOM   3494 C  C     . PRO E 3 359 ? 57.015  -13.738 -17.062 1.00 75.44  ? 336  PRO A C     1 
ATOM   3495 O  O     . PRO E 3 359 ? 57.446  -13.721 -18.215 1.00 75.42  ? 336  PRO A O     1 
ATOM   3496 C  CB    . PRO E 3 359 ? 55.955  -11.464 -17.321 1.00 74.98  ? 336  PRO A CB    1 
ATOM   3497 C  CG    . PRO E 3 359 ? 56.853  -10.731 -16.378 1.00 74.66  ? 336  PRO A CG    1 
ATOM   3498 C  CD    . PRO E 3 359 ? 56.298  -11.109 -15.011 1.00 73.33  ? 336  PRO A CD    1 
ATOM   3499 N  N     . ASP E 3 360 ? 57.512  -14.534 -16.122 1.00 76.68  ? 337  ASP A N     1 
ATOM   3500 C  CA    . ASP E 3 360 ? 58.619  -15.435 -16.414 1.00 78.15  ? 337  ASP A CA    1 
ATOM   3501 C  C     . ASP E 3 360 ? 58.188  -16.894 -16.349 1.00 78.38  ? 337  ASP A C     1 
ATOM   3502 O  O     . ASP E 3 360 ? 58.284  -17.624 -17.335 1.00 78.30  ? 337  ASP A O     1 
ATOM   3503 C  CB    . ASP E 3 360 ? 59.765  -15.179 -15.437 1.00 79.68  ? 337  ASP A CB    1 
ATOM   3504 C  CG    . ASP E 3 360 ? 60.374  -13.799 -15.607 1.00 81.18  ? 337  ASP A CG    1 
ATOM   3505 O  OD1   . ASP E 3 360 ? 61.212  -13.408 -14.768 1.00 83.07  ? 337  ASP A OD1   1 
ATOM   3506 O  OD2   . ASP E 3 360 ? 60.020  -13.107 -16.585 1.00 81.75  ? 337  ASP A OD2   1 
ATOM   3507 N  N     . ASN E 3 361 ? 57.715  -17.316 -15.183 1.00 79.08  ? 338  ASN A N     1 
ATOM   3508 C  CA    . ASN E 3 361 ? 57.263  -18.688 -14.999 1.00 79.93  ? 338  ASN A CA    1 
ATOM   3509 C  C     . ASN E 3 361 ? 56.583  -18.863 -13.648 1.00 80.09  ? 338  ASN A C     1 
ATOM   3510 O  O     . ASN E 3 361 ? 56.688  -18.003 -12.774 1.00 80.35  ? 338  ASN A O     1 
ATOM   3511 C  CB    . ASN E 3 361 ? 58.441  -19.664 -15.127 1.00 80.09  ? 338  ASN A CB    1 
ATOM   3512 C  CG    . ASN E 3 361 ? 59.534  -19.416 -14.098 1.00 80.18  ? 338  ASN A CG    1 
ATOM   3513 O  OD1   . ASN E 3 361 ? 60.534  -20.132 -14.062 1.00 80.84  ? 338  ASN A OD1   1 
ATOM   3514 N  ND2   . ASN E 3 361 ? 59.350  -18.402 -13.261 1.00 79.17  ? 338  ASN A ND2   1 
ATOM   3515 N  N     . ALA E 3 362 ? 55.883  -19.981 -13.488 1.00 79.99  ? 339  ALA A N     1 
ATOM   3516 C  CA    . ALA E 3 362 ? 55.182  -20.276 -12.246 1.00 79.76  ? 339  ALA A CA    1 
ATOM   3517 C  C     . ALA E 3 362 ? 56.112  -20.125 -11.047 1.00 79.99  ? 339  ALA A C     1 
ATOM   3518 O  O     . ALA E 3 362 ? 55.681  -19.724 -9.965  1.00 79.68  ? 339  ALA A O     1 
ATOM   3519 C  CB    . ALA E 3 362 ? 54.615  -21.687 -12.295 1.00 79.48  ? 339  ALA A CB    1 
ATOM   3520 N  N     . GLY E 3 363 ? 57.388  -20.443 -11.249 1.00 80.54  ? 340  GLY A N     1 
ATOM   3521 C  CA    . GLY E 3 363 ? 58.361  -20.334 -10.176 1.00 80.96  ? 340  GLY A CA    1 
ATOM   3522 C  C     . GLY E 3 363 ? 58.352  -18.962 -9.529  1.00 81.09  ? 340  GLY A C     1 
ATOM   3523 O  O     . GLY E 3 363 ? 58.441  -18.839 -8.306  1.00 80.25  ? 340  GLY A O     1 
ATOM   3524 N  N     . GLN E 3 364 ? 58.242  -17.927 -10.355 1.00 81.47  ? 341  GLN A N     1 
ATOM   3525 C  CA    . GLN E 3 364 ? 58.216  -16.555 -9.867  1.00 82.30  ? 341  GLN A CA    1 
ATOM   3526 C  C     . GLN E 3 364 ? 57.179  -16.418 -8.762  1.00 82.74  ? 341  GLN A C     1 
ATOM   3527 O  O     . GLN E 3 364 ? 57.508  -16.095 -7.622  1.00 83.00  ? 341  GLN A O     1 
ATOM   3528 C  CB    . GLN E 3 364 ? 57.867  -15.592 -11.005 1.00 83.30  ? 341  GLN A CB    1 
ATOM   3529 C  CG    . GLN E 3 364 ? 58.765  -15.706 -12.225 1.00 85.02  ? 341  GLN A CG    1 
ATOM   3530 C  CD    . GLN E 3 364 ? 60.199  -15.304 -11.944 1.00 85.83  ? 341  GLN A CD    1 
ATOM   3531 O  OE1   . GLN E 3 364 ? 61.088  -15.516 -12.770 1.00 86.36  ? 341  GLN A OE1   1 
ATOM   3532 N  NE2   . GLN E 3 364 ? 60.433  -14.713 -10.777 1.00 86.28  ? 341  GLN A NE2   1 
ATOM   3533 N  N     . LEU E 3 365 ? 55.924  -16.677 -9.111  1.00 83.29  ? 342  LEU A N     1 
ATOM   3534 C  CA    . LEU E 3 365 ? 54.822  -16.569 -8.165  1.00 83.48  ? 342  LEU A CA    1 
ATOM   3535 C  C     . LEU E 3 365 ? 54.880  -17.618 -7.056  1.00 83.21  ? 342  LEU A C     1 
ATOM   3536 O  O     . LEU E 3 365 ? 54.364  -17.393 -5.962  1.00 83.23  ? 342  LEU A O     1 
ATOM   3537 C  CB    . LEU E 3 365 ? 53.489  -16.660 -8.919  1.00 84.10  ? 342  LEU A CB    1 
ATOM   3538 C  CG    . LEU E 3 365 ? 52.183  -16.379 -8.166  1.00 84.68  ? 342  LEU A CG    1 
ATOM   3539 C  CD1   . LEU E 3 365 ? 51.102  -15.986 -9.160  1.00 84.78  ? 342  LEU A CD1   1 
ATOM   3540 C  CD2   . LEU E 3 365 ? 51.761  -17.600 -7.366  1.00 85.85  ? 342  LEU A CD2   1 
ATOM   3541 N  N     . LYS E 3 366 ? 55.510  -18.757 -7.330  1.00 83.04  ? 343  LYS A N     1 
ATOM   3542 C  CA    . LYS E 3 366 ? 55.614  -19.818 -6.331  1.00 83.65  ? 343  LYS A CA    1 
ATOM   3543 C  C     . LYS E 3 366 ? 56.367  -19.344 -5.093  1.00 84.59  ? 343  LYS A C     1 
ATOM   3544 O  O     . LYS E 3 366 ? 55.825  -19.343 -3.987  1.00 84.70  ? 343  LYS A O     1 
ATOM   3545 C  CB    . LYS E 3 366 ? 56.325  -21.044 -6.911  1.00 83.09  ? 343  LYS A CB    1 
ATOM   3546 C  CG    . LYS E 3 366 ? 56.488  -22.190 -5.917  1.00 81.67  ? 343  LYS A CG    1 
ATOM   3547 C  CD    . LYS E 3 366 ? 57.316  -23.329 -6.492  0.00 82.10  ? 343  LYS A CD    1 
ATOM   3548 C  CE    . LYS E 3 366 ? 56.639  -23.968 -7.694  0.00 81.90  ? 343  LYS A CE    1 
ATOM   3549 N  NZ    . LYS E 3 366 ? 57.440  -25.100 -8.237  0.00 81.82  ? 343  LYS A NZ    1 
ATOM   3550 N  N     . GLU E 3 367 ? 57.620  -18.944 -5.287  1.00 85.51  ? 344  GLU A N     1 
ATOM   3551 C  CA    . GLU E 3 367 ? 58.453  -18.476 -4.187  1.00 86.51  ? 344  GLU A CA    1 
ATOM   3552 C  C     . GLU E 3 367 ? 57.895  -17.219 -3.534  1.00 86.58  ? 344  GLU A C     1 
ATOM   3553 O  O     . GLU E 3 367 ? 58.322  -16.838 -2.445  1.00 87.52  ? 344  GLU A O     1 
ATOM   3554 C  CB    . GLU E 3 367 ? 59.877  -18.217 -4.679  1.00 87.45  ? 344  GLU A CB    1 
ATOM   3555 C  CG    . GLU E 3 367 ? 60.581  -19.465 -5.184  1.00 89.61  ? 344  GLU A CG    1 
ATOM   3556 C  CD    . GLU E 3 367 ? 61.990  -19.188 -5.669  1.00 90.98  ? 344  GLU A CD    1 
ATOM   3557 O  OE1   . GLU E 3 367 ? 62.147  -18.384 -6.613  1.00 91.82  ? 344  GLU A OE1   1 
ATOM   3558 O  OE2   . GLU E 3 367 ? 62.942  -19.773 -5.106  1.00 91.75  ? 344  GLU A OE2   1 
ATOM   3559 N  N     . PHE E 3 368 ? 56.945  -16.572 -4.201  1.00 86.30  ? 345  PHE A N     1 
ATOM   3560 C  CA    . PHE E 3 368 ? 56.334  -15.369 -3.653  1.00 86.29  ? 345  PHE A CA    1 
ATOM   3561 C  C     . PHE E 3 368 ? 55.321  -15.789 -2.598  1.00 86.92  ? 345  PHE A C     1 
ATOM   3562 O  O     . PHE E 3 368 ? 55.142  -15.112 -1.587  1.00 87.32  ? 345  PHE A O     1 
ATOM   3563 C  CB    . PHE E 3 368 ? 55.623  -14.573 -4.742  1.00 85.45  ? 345  PHE A CB    1 
ATOM   3564 C  CG    . PHE E 3 368 ? 55.127  -13.236 -4.279  1.00 84.46  ? 345  PHE A CG    1 
ATOM   3565 C  CD1   . PHE E 3 368 ? 56.021  -12.203 -4.027  1.00 84.43  ? 345  PHE A CD1   1 
ATOM   3566 C  CD2   . PHE E 3 368 ? 53.771  -13.011 -4.083  1.00 84.46  ? 345  PHE A CD2   1 
ATOM   3567 C  CE1   . PHE E 3 368 ? 55.571  -10.963 -3.586  1.00 84.65  ? 345  PHE A CE1   1 
ATOM   3568 C  CE2   . PHE E 3 368 ? 53.309  -11.774 -3.642  1.00 84.49  ? 345  PHE A CE2   1 
ATOM   3569 C  CZ    . PHE E 3 368 ? 54.211  -10.748 -3.393  1.00 84.63  ? 345  PHE A CZ    1 
ATOM   3570 N  N     . LEU E 3 369 ? 54.652  -16.908 -2.853  1.00 87.36  ? 346  LEU A N     1 
ATOM   3571 C  CA    . LEU E 3 369 ? 53.668  -17.439 -1.921  1.00 87.63  ? 346  LEU A CA    1 
ATOM   3572 C  C     . LEU E 3 369 ? 54.416  -18.073 -0.758  1.00 88.37  ? 346  LEU A C     1 
ATOM   3573 O  O     . LEU E 3 369 ? 54.079  -17.856 0.405   1.00 88.38  ? 346  LEU A O     1 
ATOM   3574 C  CB    . LEU E 3 369 ? 52.790  -18.491 -2.606  1.00 86.71  ? 346  LEU A CB    1 
ATOM   3575 C  CG    . LEU E 3 369 ? 51.800  -18.004 -3.666  1.00 85.89  ? 346  LEU A CG    1 
ATOM   3576 C  CD1   . LEU E 3 369 ? 51.083  -19.193 -4.283  1.00 85.12  ? 346  LEU A CD1   1 
ATOM   3577 C  CD2   . LEU E 3 369 ? 50.800  -17.051 -3.031  1.00 85.83  ? 346  LEU A CD2   1 
ATOM   3578 N  N     . ASP E 3 370 ? 55.441  -18.853 -1.085  1.00 89.40  ? 347  ASP A N     1 
ATOM   3579 C  CA    . ASP E 3 370 ? 56.251  -19.520 -0.074  1.00 90.43  ? 347  ASP A CA    1 
ATOM   3580 C  C     . ASP E 3 370 ? 56.837  -18.513 0.903   1.00 90.47  ? 347  ASP A C     1 
ATOM   3581 O  O     . ASP E 3 370 ? 57.061  -18.827 2.071   1.00 89.89  ? 347  ASP A O     1 
ATOM   3582 C  CB    . ASP E 3 370 ? 57.380  -20.307 -0.741  1.00 91.11  ? 347  ASP A CB    1 
ATOM   3583 C  CG    . ASP E 3 370 ? 56.879  -21.544 -1.454  1.00 91.85  ? 347  ASP A CG    1 
ATOM   3584 O  OD1   . ASP E 3 370 ? 56.335  -22.436 -0.771  1.00 92.28  ? 347  ASP A OD1   1 
ATOM   3585 O  OD2   . ASP E 3 370 ? 57.025  -21.624 -2.693  1.00 92.67  ? 347  ASP A OD2   1 
ATOM   3586 N  N     . ALA E 3 371 ? 57.079  -17.300 0.416   1.00 90.66  ? 348  ALA A N     1 
ATOM   3587 C  CA    . ALA E 3 371 ? 57.638  -16.242 1.243   1.00 91.25  ? 348  ALA A CA    1 
ATOM   3588 C  C     . ALA E 3 371 ? 56.532  -15.462 1.952   1.00 91.75  ? 348  ALA A C     1 
ATOM   3589 O  O     . ALA E 3 371 ? 56.759  -14.861 3.003   1.00 91.72  ? 348  ALA A O     1 
ATOM   3590 C  CB    . ALA E 3 371 ? 58.475  -15.303 0.385   1.00 90.72  ? 348  ALA A CB    1 
ATOM   3591 N  N     . LYS E 3 372 ? 55.335  -15.482 1.376   1.00 92.23  ? 349  LYS A N     1 
ATOM   3592 C  CA    . LYS E 3 372 ? 54.198  -14.770 1.947   1.00 92.95  ? 349  LYS A CA    1 
ATOM   3593 C  C     . LYS E 3 372 ? 53.487  -15.622 2.998   1.00 93.62  ? 349  LYS A C     1 
ATOM   3594 O  O     . LYS E 3 372 ? 52.623  -15.134 3.729   1.00 93.31  ? 349  LYS A O     1 
ATOM   3595 C  CB    . LYS E 3 372 ? 53.216  -14.384 0.836   1.00 92.82  ? 349  LYS A CB    1 
ATOM   3596 C  CG    . LYS E 3 372 ? 52.095  -13.446 1.267   1.00 92.61  ? 349  LYS A CG    1 
ATOM   3597 C  CD    . LYS E 3 372 ? 52.605  -12.042 1.563   1.00 92.03  ? 349  LYS A CD    1 
ATOM   3598 C  CE    . LYS E 3 372 ? 51.459  -11.106 1.925   1.00 91.78  ? 349  LYS A CE    1 
ATOM   3599 N  NZ    . LYS E 3 372 ? 51.914  -9.706  2.158   1.00 91.75  ? 349  LYS A NZ    1 
ATOM   3600 N  N     . VAL E 3 373 ? 53.859  -16.897 3.071   1.00 94.90  ? 350  VAL A N     1 
ATOM   3601 C  CA    . VAL E 3 373 ? 53.257  -17.818 4.028   1.00 96.57  ? 350  VAL A CA    1 
ATOM   3602 C  C     . VAL E 3 373 ? 54.155  -18.053 5.238   1.00 98.05  ? 350  VAL A C     1 
ATOM   3603 O  O     . VAL E 3 373 ? 53.725  -18.638 6.232   1.00 98.43  ? 350  VAL A O     1 
ATOM   3604 C  CB    . VAL E 3 373 ? 52.963  -19.188 3.381   1.00 96.18  ? 350  VAL A CB    1 
ATOM   3605 C  CG1   . VAL E 3 373 ? 51.969  -19.024 2.249   1.00 96.17  ? 350  VAL A CG1   1 
ATOM   3606 C  CG2   . VAL E 3 373 ? 54.254  -19.811 2.872   1.00 95.96  ? 350  VAL A CG2   1 
ATOM   3607 N  N     . LYS E 3 374 ? 55.401  -17.598 5.150   1.00 99.19  ? 351  LYS A N     1 
ATOM   3608 C  CA    . LYS E 3 374 ? 56.355  -17.771 6.241   1.00 100.07 ? 351  LYS A CA    1 
ATOM   3609 C  C     . LYS E 3 374 ? 56.566  -16.470 7.015   1.00 100.99 ? 351  LYS A C     1 
ATOM   3610 O  O     . LYS E 3 374 ? 57.694  -15.994 7.147   1.00 101.17 ? 351  LYS A O     1 
ATOM   3611 C  CB    . LYS E 3 374 ? 57.696  -18.265 5.688   1.00 99.48  ? 351  LYS A CB    1 
ATOM   3612 C  CG    . LYS E 3 374 ? 57.598  -19.534 4.851   1.00 99.22  ? 351  LYS A CG    1 
ATOM   3613 C  CD    . LYS E 3 374 ? 58.945  -19.900 4.241   1.00 98.56  ? 351  LYS A CD    1 
ATOM   3614 C  CE    . LYS E 3 374 ? 58.827  -21.080 3.286   1.00 97.86  ? 351  LYS A CE    1 
ATOM   3615 N  NZ    . LYS E 3 374 ? 58.331  -22.309 3.962   1.00 97.02  ? 351  LYS A NZ    1 
ATOM   3616 N  N     . GLN E 3 375 ? 55.479  -15.903 7.530   1.00 102.21 ? 352  GLN A N     1 
ATOM   3617 C  CA    . GLN E 3 375 ? 55.555  -14.657 8.287   1.00 104.05 ? 352  GLN A CA    1 
ATOM   3618 C  C     . GLN E 3 375 ? 54.356  -14.461 9.211   1.00 105.06 ? 352  GLN A C     1 
ATOM   3619 O  O     . GLN E 3 375 ? 53.573  -15.385 9.430   1.00 105.02 ? 352  GLN A O     1 
ATOM   3620 C  CB    . GLN E 3 375 ? 55.672  -13.469 7.327   1.00 104.50 ? 352  GLN A CB    1 
ATOM   3621 C  CG    . GLN E 3 375 ? 54.614  -13.437 6.235   1.00 104.82 ? 352  GLN A CG    1 
ATOM   3622 C  CD    . GLN E 3 375 ? 54.804  -12.280 5.271   1.00 104.67 ? 352  GLN A CD    1 
ATOM   3623 O  OE1   . GLN E 3 375 ? 54.641  -11.116 5.638   1.00 104.72 ? 352  GLN A OE1   1 
ATOM   3624 N  NE2   . GLN E 3 375 ? 55.157  -12.595 4.031   1.00 104.47 ? 352  GLN A NE2   1 
ATOM   3625 N  N     . SER E 3 376 ? 54.221  -13.253 9.752   1.00 106.42 ? 353  SER A N     1 
ATOM   3626 C  CA    . SER E 3 376 ? 53.123  -12.933 10.659  1.00 107.49 ? 353  SER A CA    1 
ATOM   3627 C  C     . SER E 3 376 ? 51.917  -12.370 9.913   1.00 108.62 ? 353  SER A C     1 
ATOM   3628 O  O     . SER E 3 376 ? 51.351  -11.350 10.311  1.00 108.88 ? 353  SER A O     1 
ATOM   3629 C  CB    . SER E 3 376 ? 53.587  -11.926 11.717  1.00 106.90 ? 353  SER A CB    1 
ATOM   3630 O  OG    . SER E 3 376 ? 53.995  -10.705 11.124  1.00 105.96 ? 353  SER A OG    1 
ATOM   3631 N  N     . ASP E 3 377 ? 51.525  -13.040 8.834   1.00 109.62 ? 354  ASP A N     1 
ATOM   3632 C  CA    . ASP E 3 377 ? 50.383  -12.604 8.039   1.00 110.20 ? 354  ASP A CA    1 
ATOM   3633 C  C     . ASP E 3 377 ? 49.121  -13.419 8.323   1.00 110.73 ? 354  ASP A C     1 
ATOM   3634 O  O     . ASP E 3 377 ? 48.009  -12.920 8.146   1.00 110.72 ? 354  ASP A O     1 
ATOM   3635 C  CB    . ASP E 3 377 ? 50.717  -12.677 6.547   0.00 110.39 ? 354  ASP A CB    1 
ATOM   3636 C  CG    . ASP E 3 377 ? 51.774  -11.669 6.137   0.00 110.52 ? 354  ASP A CG    1 
ATOM   3637 O  OD1   . ASP E 3 377 ? 52.100  -11.607 4.934   0.00 110.61 ? 354  ASP A OD1   1 
ATOM   3638 O  OD2   . ASP E 3 377 ? 52.279  -10.940 7.017   0.00 110.61 ? 354  ASP A OD2   1 
ATOM   3639 N  N     . TYR E 3 378 ? 49.291  -14.666 8.762   1.00 110.98 ? 355  TYR A N     1 
ATOM   3640 C  CA    . TYR E 3 378 ? 48.144  -15.526 9.062   1.00 111.11 ? 355  TYR A CA    1 
ATOM   3641 C  C     . TYR E 3 378 ? 48.538  -16.848 9.727   1.00 111.16 ? 355  TYR A C     1 
ATOM   3642 O  O     . TYR E 3 378 ? 49.722  -17.163 9.855   1.00 111.73 ? 355  TYR A O     1 
ATOM   3643 C  CB    . TYR E 3 378 ? 47.374  -15.838 7.780   0.00 111.01 ? 355  TYR A CB    1 
ATOM   3644 C  CG    . TYR E 3 378 ? 48.085  -16.825 6.882   0.00 110.92 ? 355  TYR A CG    1 
ATOM   3645 C  CD1   . TYR E 3 378 ? 49.294  -16.498 6.270   0.00 110.87 ? 355  TYR A CD1   1 
ATOM   3646 C  CD2   . TYR E 3 378 ? 47.563  -18.098 6.668   0.00 110.87 ? 355  TYR A CD2   1 
ATOM   3647 C  CE1   . TYR E 3 378 ? 49.966  -17.417 5.466   0.00 110.83 ? 355  TYR A CE1   1 
ATOM   3648 C  CE2   . TYR E 3 378 ? 48.225  -19.024 5.867   0.00 110.83 ? 355  TYR A CE2   1 
ATOM   3649 C  CZ    . TYR E 3 378 ? 49.425  -18.678 5.271   0.00 110.82 ? 355  TYR A CZ    1 
ATOM   3650 O  OH    . TYR E 3 378 ? 50.082  -19.594 4.482   0.00 110.80 ? 355  TYR A OH    1 
ATOM   3651 N  N     . ASP E 3 379 ? 47.529  -17.615 10.140  1.00 110.53 ? 356  ASP A N     1 
ATOM   3652 C  CA    . ASP E 3 379 ? 47.733  -18.918 10.776  1.00 109.43 ? 356  ASP A CA    1 
ATOM   3653 C  C     . ASP E 3 379 ? 47.232  -20.034 9.864   1.00 108.22 ? 356  ASP A C     1 
ATOM   3654 O  O     . ASP E 3 379 ? 46.325  -19.827 9.057   1.00 107.97 ? 356  ASP A O     1 
ATOM   3655 C  CB    . ASP E 3 379 ? 46.990  -18.995 12.117  1.00 110.01 ? 356  ASP A CB    1 
ATOM   3656 C  CG    . ASP E 3 379 ? 47.785  -18.398 13.267  1.00 110.69 ? 356  ASP A CG    1 
ATOM   3657 O  OD1   . ASP E 3 379 ? 48.095  -17.188 13.223  1.00 111.47 ? 356  ASP A OD1   1 
ATOM   3658 O  OD2   . ASP E 3 379 ? 48.098  -19.144 14.220  1.00 110.41 ? 356  ASP A OD2   1 
ATOM   3659 N  N     . ARG E 3 380 ? 47.825  -21.217 10.002  1.00 106.85 ? 357  ARG A N     1 
ATOM   3660 C  CA    . ARG E 3 380 ? 47.447  -22.373 9.193   1.00 105.14 ? 357  ARG A CA    1 
ATOM   3661 C  C     . ARG E 3 380 ? 46.105  -22.950 9.636   1.00 104.26 ? 357  ARG A C     1 
ATOM   3662 O  O     . ARG E 3 380 ? 45.883  -24.160 9.562   1.00 103.91 ? 357  ARG A O     1 
ATOM   3663 C  CB    . ARG E 3 380 ? 48.526  -23.459 9.285   1.00 104.61 ? 357  ARG A CB    1 
ATOM   3664 C  CG    . ARG E 3 380 ? 49.891  -23.039 8.766   1.00 103.43 ? 357  ARG A CG    1 
ATOM   3665 C  CD    . ARG E 3 380 ? 50.899  -24.168 8.899   0.00 103.53 ? 357  ARG A CD    1 
ATOM   3666 N  NE    . ARG E 3 380 ? 50.485  -25.356 8.158   0.00 103.20 ? 357  ARG A NE    1 
ATOM   3667 C  CZ    . ARG E 3 380 ? 51.170  -26.494 8.126   0.00 103.11 ? 357  ARG A CZ    1 
ATOM   3668 N  NH1   . ARG E 3 380 ? 52.310  -26.604 8.796   0.00 103.01 ? 357  ARG A NH1   1 
ATOM   3669 N  NH2   . ARG E 3 380 ? 50.716  -27.524 7.425   0.00 103.01 ? 357  ARG A NH2   1 
ATOM   3670 N  N     . SER E 3 381 ? 45.213  -22.081 10.098  1.00 103.13 ? 358  SER A N     1 
ATOM   3671 C  CA    . SER E 3 381 ? 43.894  -22.507 10.547  1.00 101.83 ? 358  SER A CA    1 
ATOM   3672 C  C     . SER E 3 381 ? 42.803  -21.774 9.773   1.00 100.91 ? 358  SER A C     1 
ATOM   3673 O  O     . SER E 3 381 ? 42.005  -22.395 9.071   1.00 100.78 ? 358  SER A O     1 
ATOM   3674 C  CB    . SER E 3 381 ? 43.739  -22.246 12.047  1.00 101.66 ? 358  SER A CB    1 
ATOM   3675 O  OG    . SER E 3 381 ? 44.699  -22.975 12.794  1.00 100.39 ? 358  SER A OG    1 
ATOM   3676 N  N     . THR E 3 382 ? 42.776  -20.451 9.900   1.00 99.64  ? 359  THR A N     1 
ATOM   3677 C  CA    . THR E 3 382 ? 41.782  -19.640 9.209   1.00 98.43  ? 359  THR A CA    1 
ATOM   3678 C  C     . THR E 3 382 ? 42.191  -19.355 7.765   1.00 97.50  ? 359  THR A C     1 
ATOM   3679 O  O     . THR E 3 382 ? 41.721  -18.392 7.158   1.00 97.42  ? 359  THR A O     1 
ATOM   3680 C  CB    . THR E 3 382 ? 41.555  -18.298 9.932   0.00 98.59  ? 359  THR A CB    1 
ATOM   3681 O  OG1   . THR E 3 382 ? 42.786  -17.567 9.985   0.00 98.59  ? 359  THR A OG1   1 
ATOM   3682 C  CG2   . THR E 3 382 ? 41.048  -18.536 11.346  0.00 98.59  ? 359  THR A CG2   1 
ATOM   3683 N  N     . SER E 3 383 ? 43.069  -20.194 7.221   1.00 96.10  ? 360  SER A N     1 
ATOM   3684 C  CA    . SER E 3 383 ? 43.531  -20.035 5.845   1.00 94.13  ? 360  SER A CA    1 
ATOM   3685 C  C     . SER E 3 383 ? 42.973  -21.136 4.955   1.00 92.58  ? 360  SER A C     1 
ATOM   3686 O  O     . SER E 3 383 ? 42.664  -22.230 5.426   1.00 91.87  ? 360  SER A O     1 
ATOM   3687 C  CB    . SER E 3 383 ? 45.058  -20.067 5.778   1.00 94.65  ? 360  SER A CB    1 
ATOM   3688 O  OG    . SER E 3 383 ? 45.505  -20.003 4.433   1.00 94.03  ? 360  SER A OG    1 
ATOM   3689 N  N     . ASN E 3 384 ? 42.859  -20.841 3.665   1.00 90.61  ? 361  ASN A N     1 
ATOM   3690 C  CA    . ASN E 3 384 ? 42.329  -21.801 2.709   1.00 89.24  ? 361  ASN A CA    1 
ATOM   3691 C  C     . ASN E 3 384 ? 43.418  -22.377 1.813   1.00 88.51  ? 361  ASN A C     1 
ATOM   3692 O  O     . ASN E 3 384 ? 43.144  -23.201 0.941   1.00 88.39  ? 361  ASN A O     1 
ATOM   3693 C  CB    . ASN E 3 384 ? 41.248  -21.137 1.856   1.00 89.05  ? 361  ASN A CB    1 
ATOM   3694 C  CG    . ASN E 3 384 ? 40.070  -20.654 2.684   1.00 88.69  ? 361  ASN A CG    1 
ATOM   3695 O  OD1   . ASN E 3 384 ? 39.341  -21.454 3.273   1.00 87.71  ? 361  ASN A OD1   1 
ATOM   3696 N  ND2   . ASN E 3 384 ? 39.883  -19.340 2.738   1.00 88.20  ? 361  ASN A ND2   1 
ATOM   3697 N  N     . ILE E 3 385 ? 44.655  -21.945 2.035   1.00 87.59  ? 362  ILE A N     1 
ATOM   3698 C  CA    . ILE E 3 385 ? 45.781  -22.425 1.243   1.00 86.74  ? 362  ILE A CA    1 
ATOM   3699 C  C     . ILE E 3 385 ? 46.533  -23.537 1.972   1.00 87.68  ? 362  ILE A C     1 
ATOM   3700 O  O     . ILE E 3 385 ? 46.707  -23.484 3.189   1.00 88.29  ? 362  ILE A O     1 
ATOM   3701 C  CB    . ILE E 3 385 ? 46.766  -21.279 0.933   1.00 84.90  ? 362  ILE A CB    1 
ATOM   3702 C  CG1   . ILE E 3 385 ? 46.035  -20.150 0.204   1.00 83.83  ? 362  ILE A CG1   1 
ATOM   3703 C  CG2   . ILE E 3 385 ? 47.916  -21.799 0.085   1.00 83.84  ? 362  ILE A CG2   1 
ATOM   3704 C  CD1   . ILE E 3 385 ? 46.904  -18.956 -0.129  1.00 81.71  ? 362  ILE A CD1   1 
ATOM   3705 N  N     . ASP E 3 386 ? 46.970  -24.546 1.223   1.00 88.23  ? 363  ASP A N     1 
ATOM   3706 C  CA    . ASP E 3 386 ? 47.713  -25.666 1.793   1.00 88.59  ? 363  ASP A CA    1 
ATOM   3707 C  C     . ASP E 3 386 ? 49.171  -25.552 1.362   1.00 88.90  ? 363  ASP A C     1 
ATOM   3708 O  O     . ASP E 3 386 ? 49.562  -26.076 0.321   1.00 89.17  ? 363  ASP A O     1 
ATOM   3709 C  CB    . ASP E 3 386 ? 47.129  -26.995 1.309   0.00 89.06  ? 363  ASP A CB    1 
ATOM   3710 C  CG    . ASP E 3 386 ? 47.776  -28.193 1.975   0.00 89.34  ? 363  ASP A CG    1 
ATOM   3711 O  OD1   . ASP E 3 386 ? 49.002  -28.373 1.819   0.00 89.53  ? 363  ASP A OD1   1 
ATOM   3712 O  OD2   . ASP E 3 386 ? 47.059  -28.953 2.658   0.00 89.53  ? 363  ASP A OD2   1 
ATOM   3713 N  N     . PRO E 3 387 ? 49.996  -24.868 2.172   1.00 89.22  ? 364  PRO A N     1 
ATOM   3714 C  CA    . PRO E 3 387 ? 51.425  -24.638 1.933   1.00 89.35  ? 364  PRO A CA    1 
ATOM   3715 C  C     . PRO E 3 387 ? 52.187  -25.738 1.190   1.00 89.51  ? 364  PRO A C     1 
ATOM   3716 O  O     . PRO E 3 387 ? 52.926  -25.456 0.247   1.00 89.41  ? 364  PRO A O     1 
ATOM   3717 C  CB    . PRO E 3 387 ? 51.964  -24.398 3.337   1.00 88.91  ? 364  PRO A CB    1 
ATOM   3718 C  CG    . PRO E 3 387 ? 50.845  -23.636 3.968   1.00 88.47  ? 364  PRO A CG    1 
ATOM   3719 C  CD    . PRO E 3 387 ? 49.624  -24.423 3.529   1.00 88.82  ? 364  PRO A CD    1 
ATOM   3720 N  N     . LEU E 3 388 ? 52.009  -26.985 1.612   1.00 89.54  ? 365  LEU A N     1 
ATOM   3721 C  CA    . LEU E 3 388 ? 52.701  -28.104 0.979   1.00 89.39  ? 365  LEU A CA    1 
ATOM   3722 C  C     . LEU E 3 388 ? 52.242  -28.331 -0.460  1.00 89.21  ? 365  LEU A C     1 
ATOM   3723 O  O     . LEU E 3 388 ? 52.678  -29.277 -1.117  1.00 89.51  ? 365  LEU A O     1 
ATOM   3724 C  CB    . LEU E 3 388 ? 52.488  -29.381 1.798   1.00 89.61  ? 365  LEU A CB    1 
ATOM   3725 C  CG    . LEU E 3 388 ? 53.018  -29.347 3.235   1.00 89.51  ? 365  LEU A CG    1 
ATOM   3726 C  CD1   . LEU E 3 388 ? 52.591  -30.608 3.969   1.00 89.47  ? 365  LEU A CD1   1 
ATOM   3727 C  CD2   . LEU E 3 388 ? 54.535  -29.214 3.223   1.00 89.04  ? 365  LEU A CD2   1 
ATOM   3728 N  N     . LYS E 3 389 ? 51.368  -27.455 -0.944  1.00 88.65  ? 366  LYS A N     1 
ATOM   3729 C  CA    . LYS E 3 389 ? 50.844  -27.558 -2.302  1.00 87.71  ? 366  LYS A CA    1 
ATOM   3730 C  C     . LYS E 3 389 ? 50.823  -26.191 -2.983  1.00 86.85  ? 366  LYS A C     1 
ATOM   3731 O  O     . LYS E 3 389 ? 50.134  -25.999 -3.986  1.00 86.80  ? 366  LYS A O     1 
ATOM   3732 C  CB    . LYS E 3 389 ? 49.424  -28.136 -2.270  1.00 88.10  ? 366  LYS A CB    1 
ATOM   3733 C  CG    . LYS E 3 389 ? 49.304  -29.484 -1.567  1.00 87.98  ? 366  LYS A CG    1 
ATOM   3734 C  CD    . LYS E 3 389 ? 49.973  -30.606 -2.353  1.00 88.47  ? 366  LYS A CD    1 
ATOM   3735 C  CE    . LYS E 3 389 ? 49.225  -30.909 -3.647  1.00 89.05  ? 366  LYS A CE    1 
ATOM   3736 N  NZ    . LYS E 3 389 ? 49.806  -32.066 -4.388  1.00 88.76  ? 366  LYS A NZ    1 
ATOM   3737 N  N     . THR E 3 390 ? 51.581  -25.245 -2.434  1.00 86.02  ? 367  THR A N     1 
ATOM   3738 C  CA    . THR E 3 390 ? 51.646  -23.893 -2.982  1.00 84.90  ? 367  THR A CA    1 
ATOM   3739 C  C     . THR E 3 390 ? 52.369  -23.853 -4.323  1.00 83.55  ? 367  THR A C     1 
ATOM   3740 O  O     . THR E 3 390 ? 52.474  -22.798 -4.950  1.00 83.23  ? 367  THR A O     1 
ATOM   3741 C  CB    . THR E 3 390 ? 52.370  -22.933 -2.023  1.00 85.51  ? 367  THR A CB    1 
ATOM   3742 O  OG1   . THR E 3 390 ? 52.401  -21.619 -2.595  1.00 86.58  ? 367  THR A OG1   1 
ATOM   3743 C  CG2   . THR E 3 390 ? 53.793  -23.402 -1.779  1.00 85.96  ? 367  THR A CG2   1 
ATOM   3744 N  N     . ALA E 3 391 ? 52.875  -25.003 -4.752  1.00 82.04  ? 368  ALA A N     1 
ATOM   3745 C  CA    . ALA E 3 391 ? 53.578  -25.100 -6.024  1.00 80.39  ? 368  ALA A CA    1 
ATOM   3746 C  C     . ALA E 3 391 ? 52.553  -25.168 -7.153  1.00 79.15  ? 368  ALA A C     1 
ATOM   3747 O  O     . ALA E 3 391 ? 52.742  -24.585 -8.222  1.00 79.02  ? 368  ALA A O     1 
ATOM   3748 C  CB    . ALA E 3 391 ? 54.462  -26.342 -6.039  1.00 80.22  ? 368  ALA A CB    1 
ATOM   3749 N  N     . ASP E 3 392 ? 51.464  -25.886 -6.899  1.00 77.04  ? 369  ASP A N     1 
ATOM   3750 C  CA    . ASP E 3 392 ? 50.393  -26.045 -7.871  1.00 74.06  ? 369  ASP A CA    1 
ATOM   3751 C  C     . ASP E 3 392 ? 49.679  -24.716 -8.044  1.00 71.58  ? 369  ASP A C     1 
ATOM   3752 O  O     . ASP E 3 392 ? 49.585  -24.187 -9.151  1.00 71.20  ? 369  ASP A O     1 
ATOM   3753 C  CB    . ASP E 3 392 ? 49.403  -27.097 -7.378  1.00 75.71  ? 369  ASP A CB    1 
ATOM   3754 C  CG    . ASP E 3 392 ? 50.086  -28.380 -6.961  1.00 77.92  ? 369  ASP A CG    1 
ATOM   3755 O  OD1   . ASP E 3 392 ? 50.654  -29.069 -7.835  1.00 78.97  ? 369  ASP A OD1   1 
ATOM   3756 O  OD2   . ASP E 3 392 ? 50.061  -28.696 -5.754  1.00 79.84  ? 369  ASP A OD2   1 
ATOM   3757 N  N     . LEU E 3 393 ? 49.178  -24.188 -6.933  1.00 68.73  ? 370  LEU A N     1 
ATOM   3758 C  CA    . LEU E 3 393 ? 48.467  -22.918 -6.922  1.00 66.68  ? 370  LEU A CA    1 
ATOM   3759 C  C     . LEU E 3 393 ? 49.139  -21.886 -7.818  1.00 65.76  ? 370  LEU A C     1 
ATOM   3760 O  O     . LEU E 3 393 ? 48.468  -21.085 -8.472  1.00 65.54  ? 370  LEU A O     1 
ATOM   3761 C  CB    . LEU E 3 393 ? 48.394  -22.382 -5.493  1.00 66.57  ? 370  LEU A CB    1 
ATOM   3762 C  CG    . LEU E 3 393 ? 47.902  -20.943 -5.343  1.00 66.28  ? 370  LEU A CG    1 
ATOM   3763 C  CD1   . LEU E 3 393 ? 46.494  -20.818 -5.902  1.00 66.05  ? 370  LEU A CD1   1 
ATOM   3764 C  CD2   . LEU E 3 393 ? 47.942  -20.546 -3.879  1.00 65.95  ? 370  LEU A CD2   1 
ATOM   3765 N  N     . ALA E 3 394 ? 50.467  -21.905 -7.838  1.00 64.08  ? 371  ALA A N     1 
ATOM   3766 C  CA    . ALA E 3 394 ? 51.228  -20.973 -8.658  1.00 62.16  ? 371  ALA A CA    1 
ATOM   3767 C  C     . ALA E 3 394 ? 51.053  -21.306 -10.137 1.00 61.37  ? 371  ALA A C     1 
ATOM   3768 O  O     . ALA E 3 394 ? 50.628  -20.461 -10.926 1.00 61.88  ? 371  ALA A O     1 
ATOM   3769 C  CB    . ALA E 3 394 ? 52.703  -21.026 -8.279  1.00 61.52  ? 371  ALA A CB    1 
ATOM   3770 N  N     . GLU E 3 395 ? 51.377  -22.542 -10.505 1.00 59.59  ? 372  GLU A N     1 
ATOM   3771 C  CA    . GLU E 3 395 ? 51.255  -22.983 -11.891 1.00 58.25  ? 372  GLU A CA    1 
ATOM   3772 C  C     . GLU E 3 395 ? 49.843  -22.731 -12.415 1.00 56.84  ? 372  GLU A C     1 
ATOM   3773 O  O     . GLU E 3 395 ? 49.656  -22.325 -13.564 1.00 56.43  ? 372  GLU A O     1 
ATOM   3774 C  CB    . GLU E 3 395 ? 51.589  -24.473 -12.003 0.00 58.19  ? 372  GLU A CB    1 
ATOM   3775 C  CG    . GLU E 3 395 ? 51.550  -25.015 -13.424 0.00 57.98  ? 372  GLU A CG    1 
ATOM   3776 C  CD    . GLU E 3 395 ? 51.900  -26.489 -13.498 0.00 57.87  ? 372  GLU A CD    1 
ATOM   3777 O  OE1   . GLU E 3 395 ? 51.917  -27.042 -14.618 0.00 57.76  ? 372  GLU A OE1   1 
ATOM   3778 O  OE2   . GLU E 3 395 ? 52.157  -27.096 -12.437 0.00 57.76  ? 372  GLU A OE2   1 
ATOM   3779 N  N     . LYS E 3 396 ? 48.857  -22.974 -11.558 1.00 54.60  ? 373  LYS A N     1 
ATOM   3780 C  CA    . LYS E 3 396 ? 47.456  -22.784 -11.908 1.00 51.89  ? 373  LYS A CA    1 
ATOM   3781 C  C     . LYS E 3 396 ? 47.178  -21.320 -12.233 1.00 50.03  ? 373  LYS A C     1 
ATOM   3782 O  O     . LYS E 3 396 ? 46.839  -20.980 -13.366 1.00 49.93  ? 373  LYS A O     1 
ATOM   3783 C  CB    . LYS E 3 396 ? 46.574  -23.241 -10.745 1.00 52.09  ? 373  LYS A CB    1 
ATOM   3784 C  CG    . LYS E 3 396 ? 45.080  -23.201 -11.010 1.00 51.42  ? 373  LYS A CG    1 
ATOM   3785 C  CD    . LYS E 3 396 ? 44.330  -23.735 -9.798  1.00 51.83  ? 373  LYS A CD    1 
ATOM   3786 C  CE    . LYS E 3 396 ? 42.827  -23.708 -9.997  1.00 51.96  ? 373  LYS A CE    1 
ATOM   3787 N  NZ    . LYS E 3 396 ? 42.109  -24.185 -8.782  1.00 49.91  ? 373  LYS A NZ    1 
ATOM   3788 N  N     . LEU E 3 397 ? 47.322  -20.455 -11.236 1.00 47.64  ? 374  LEU A N     1 
ATOM   3789 C  CA    . LEU E 3 397 ? 47.086  -19.032 -11.435 1.00 46.16  ? 374  LEU A CA    1 
ATOM   3790 C  C     . LEU E 3 397 ? 47.876  -18.513 -12.632 1.00 44.67  ? 374  LEU A C     1 
ATOM   3791 O  O     . LEU E 3 397 ? 47.377  -17.703 -13.410 1.00 42.98  ? 374  LEU A O     1 
ATOM   3792 C  CB    . LEU E 3 397 ? 47.475  -18.254 -10.177 1.00 47.11  ? 374  LEU A CB    1 
ATOM   3793 C  CG    . LEU E 3 397 ? 46.617  -18.499 -8.933  1.00 47.37  ? 374  LEU A CG    1 
ATOM   3794 C  CD1   . LEU E 3 397 ? 47.213  -17.764 -7.737  1.00 46.76  ? 374  LEU A CD1   1 
ATOM   3795 C  CD2   . LEU E 3 397 ? 45.191  -18.033 -9.200  1.00 45.72  ? 374  LEU A CD2   1 
ATOM   3796 N  N     . PHE E 3 398 ? 49.109  -18.985 -12.778 1.00 44.35  ? 375  PHE A N     1 
ATOM   3797 C  CA    . PHE E 3 398 ? 49.956  -18.563 -13.889 1.00 44.49  ? 375  PHE A CA    1 
ATOM   3798 C  C     . PHE E 3 398 ? 49.246  -18.843 -15.214 1.00 43.96  ? 375  PHE A C     1 
ATOM   3799 O  O     . PHE E 3 398 ? 49.023  -17.935 -16.016 1.00 42.84  ? 375  PHE A O     1 
ATOM   3800 C  CB    . PHE E 3 398 ? 51.296  -19.308 -13.853 1.00 44.43  ? 375  PHE A CB    1 
ATOM   3801 C  CG    . PHE E 3 398 ? 52.289  -18.825 -14.878 1.00 44.97  ? 375  PHE A CG    1 
ATOM   3802 C  CD1   . PHE E 3 398 ? 52.893  -17.580 -14.748 1.00 44.66  ? 375  PHE A CD1   1 
ATOM   3803 C  CD2   . PHE E 3 398 ? 52.613  -19.612 -15.981 1.00 45.45  ? 375  PHE A CD2   1 
ATOM   3804 C  CE1   . PHE E 3 398 ? 53.807  -17.126 -15.699 1.00 45.34  ? 375  PHE A CE1   1 
ATOM   3805 C  CE2   . PHE E 3 398 ? 53.527  -19.166 -16.940 1.00 45.01  ? 375  PHE A CE2   1 
ATOM   3806 C  CZ    . PHE E 3 398 ? 54.123  -17.921 -16.798 1.00 44.38  ? 375  PHE A CZ    1 
ATOM   3807 N  N     . LYS E 3 399 ? 48.894  -20.109 -15.430 1.00 43.05  ? 376  LYS A N     1 
ATOM   3808 C  CA    . LYS E 3 399 ? 48.206  -20.537 -16.645 1.00 40.99  ? 376  LYS A CA    1 
ATOM   3809 C  C     . LYS E 3 399 ? 46.869  -19.820 -16.812 1.00 41.17  ? 376  LYS A C     1 
ATOM   3810 O  O     . LYS E 3 399 ? 46.601  -19.230 -17.859 1.00 41.78  ? 376  LYS A O     1 
ATOM   3811 C  CB    . LYS E 3 399 ? 47.956  -22.045 -16.604 1.00 39.91  ? 376  LYS A CB    1 
ATOM   3812 C  CG    . LYS E 3 399 ? 49.203  -22.900 -16.482 1.00 39.09  ? 376  LYS A CG    1 
ATOM   3813 C  CD    . LYS E 3 399 ? 49.997  -22.931 -17.775 1.00 38.62  ? 376  LYS A CD    1 
ATOM   3814 C  CE    . LYS E 3 399 ? 51.112  -23.960 -17.696 1.00 37.97  ? 376  LYS A CE    1 
ATOM   3815 N  NZ    . LYS E 3 399 ? 50.582  -25.323 -17.394 1.00 35.13  ? 376  LYS A NZ    1 
ATOM   3816 N  N     . LEU E 3 400 ? 46.033  -19.883 -15.776 1.00 39.72  ? 377  LEU A N     1 
ATOM   3817 C  CA    . LEU E 3 400 ? 44.716  -19.252 -15.800 1.00 38.48  ? 377  LEU A CA    1 
ATOM   3818 C  C     . LEU E 3 400 ? 44.760  -17.801 -16.253 1.00 38.66  ? 377  LEU A C     1 
ATOM   3819 O  O     . LEU E 3 400 ? 43.888  -17.351 -16.991 1.00 38.11  ? 377  LEU A O     1 
ATOM   3820 C  CB    . LEU E 3 400 ? 44.062  -19.326 -14.416 1.00 37.76  ? 377  LEU A CB    1 
ATOM   3821 C  CG    . LEU E 3 400 ? 43.530  -20.679 -13.934 1.00 37.91  ? 377  LEU A CG    1 
ATOM   3822 C  CD1   . LEU E 3 400 ? 43.008  -20.547 -12.514 1.00 37.13  ? 377  LEU A CD1   1 
ATOM   3823 C  CD2   . LEU E 3 400 ? 42.426  -21.160 -14.860 1.00 37.95  ? 377  LEU A CD2   1 
ATOM   3824 N  N     . SER E 3 401 ? 45.775  -17.071 -15.808 1.00 39.88  ? 378  SER A N     1 
ATOM   3825 C  CA    . SER E 3 401 ? 45.914  -15.666 -16.168 1.00 41.78  ? 378  SER A CA    1 
ATOM   3826 C  C     . SER E 3 401 ? 46.273  -15.494 -17.640 1.00 42.69  ? 378  SER A C     1 
ATOM   3827 O  O     . SER E 3 401 ? 46.180  -14.394 -18.183 1.00 43.71  ? 378  SER A O     1 
ATOM   3828 C  CB    . SER E 3 401 ? 46.990  -15.008 -15.306 1.00 42.37  ? 378  SER A CB    1 
ATOM   3829 O  OG    . SER E 3 401 ? 48.262  -15.572 -15.576 1.00 45.01  ? 378  SER A OG    1 
ATOM   3830 N  N     . ARG E 3 402 ? 46.682  -16.583 -18.282 1.00 42.95  ? 379  ARG A N     1 
ATOM   3831 C  CA    . ARG E 3 402 ? 47.065  -16.543 -19.689 1.00 43.26  ? 379  ARG A CA    1 
ATOM   3832 C  C     . ARG E 3 402 ? 46.138  -17.392 -20.558 1.00 43.57  ? 379  ARG A C     1 
ATOM   3833 O  O     . ARG E 3 402 ? 46.341  -17.516 -21.766 1.00 43.70  ? 379  ARG A O     1 
ATOM   3834 C  CB    . ARG E 3 402 ? 48.514  -17.007 -19.829 1.00 43.35  ? 379  ARG A CB    1 
ATOM   3835 C  CG    . ARG E 3 402 ? 49.472  -16.156 -19.009 1.00 45.32  ? 379  ARG A CG    1 
ATOM   3836 C  CD    . ARG E 3 402 ? 50.779  -16.871 -18.696 1.00 47.27  ? 379  ARG A CD    1 
ATOM   3837 N  NE    . ARG E 3 402 ? 51.452  -16.252 -17.556 1.00 48.44  ? 379  ARG A NE    1 
ATOM   3838 C  CZ    . ARG E 3 402 ? 52.025  -15.054 -17.585 1.00 49.56  ? 379  ARG A CZ    1 
ATOM   3839 N  NH1   . ARG E 3 402 ? 52.019  -14.339 -18.700 1.00 50.67  ? 379  ARG A NH1   1 
ATOM   3840 N  NH2   . ARG E 3 402 ? 52.584  -14.560 -16.490 1.00 51.33  ? 379  ARG A NH2   1 
ATOM   3841 N  N     . GLY E 3 403 ? 45.115  -17.962 -19.927 1.00 44.21  ? 380  GLY A N     1 
ATOM   3842 C  CA    . GLY E 3 403 ? 44.150  -18.782 -20.634 1.00 44.01  ? 380  GLY A CA    1 
ATOM   3843 C  C     . GLY E 3 403 ? 44.712  -20.070 -21.201 1.00 45.65  ? 380  GLY A C     1 
ATOM   3844 O  O     . GLY E 3 403 ? 44.337  -20.474 -22.301 1.00 46.17  ? 380  GLY A O     1 
ATOM   3845 N  N     . ARG E 3 404 ? 45.600  -20.725 -20.457 1.00 46.67  ? 381  ARG A N     1 
ATOM   3846 C  CA    . ARG E 3 404 ? 46.201  -21.969 -20.925 1.00 47.92  ? 381  ARG A CA    1 
ATOM   3847 C  C     . ARG E 3 404 ? 46.202  -23.079 -19.880 1.00 47.82  ? 381  ARG A C     1 
ATOM   3848 O  O     . ARG E 3 404 ? 47.098  -23.926 -19.869 1.00 47.68  ? 381  ARG A O     1 
ATOM   3849 C  CB    . ARG E 3 404 ? 47.631  -21.711 -21.398 1.00 51.26  ? 381  ARG A CB    1 
ATOM   3850 C  CG    . ARG E 3 404 ? 47.719  -20.770 -22.584 1.00 55.08  ? 381  ARG A CG    1 
ATOM   3851 C  CD    . ARG E 3 404 ? 49.161  -20.521 -23.003 1.00 59.35  ? 381  ARG A CD    1 
ATOM   3852 N  NE    . ARG E 3 404 ? 49.229  -19.665 -24.184 1.00 63.86  ? 381  ARG A NE    1 
ATOM   3853 C  CZ    . ARG E 3 404 ? 48.725  -19.989 -25.373 1.00 64.97  ? 381  ARG A CZ    1 
ATOM   3854 N  NH1   . ARG E 3 404 ? 48.118  -21.157 -25.542 1.00 65.62  ? 381  ARG A NH1   1 
ATOM   3855 N  NH2   . ARG E 3 404 ? 48.818  -19.142 -26.391 1.00 64.18  ? 381  ARG A NH2   1 
ATOM   3856 N  N     . TYR E 3 405 ? 45.198  -23.073 -19.007 1.00 48.14  ? 382  TYR A N     1 
ATOM   3857 C  CA    . TYR E 3 405 ? 45.067  -24.088 -17.962 1.00 48.01  ? 382  TYR A CA    1 
ATOM   3858 C  C     . TYR E 3 405 ? 44.066  -25.141 -18.434 1.00 47.20  ? 382  TYR A C     1 
ATOM   3859 O  O     . TYR E 3 405 ? 42.902  -25.136 -18.031 1.00 45.87  ? 382  TYR A O     1 
ATOM   3860 C  CB    . TYR E 3 405 ? 44.575  -23.443 -16.663 1.00 48.98  ? 382  TYR A CB    1 
ATOM   3861 C  CG    . TYR E 3 405 ? 44.461  -24.395 -15.489 1.00 50.47  ? 382  TYR A CG    1 
ATOM   3862 C  CD1   . TYR E 3 405 ? 45.578  -25.074 -15.001 1.00 50.95  ? 382  TYR A CD1   1 
ATOM   3863 C  CD2   . TYR E 3 405 ? 43.238  -24.597 -14.850 1.00 51.41  ? 382  TYR A CD2   1 
ATOM   3864 C  CE1   . TYR E 3 405 ? 45.478  -25.930 -13.902 1.00 52.04  ? 382  TYR A CE1   1 
ATOM   3865 C  CE2   . TYR E 3 405 ? 43.127  -25.450 -13.753 1.00 52.05  ? 382  TYR A CE2   1 
ATOM   3866 C  CZ    . TYR E 3 405 ? 44.249  -26.112 -13.283 1.00 52.59  ? 382  TYR A CZ    1 
ATOM   3867 O  OH    . TYR E 3 405 ? 44.138  -26.948 -12.193 1.00 52.81  ? 382  TYR A OH    1 
ATOM   3868 N  N     . GLY E 3 406 ? 44.532  -26.046 -19.289 1.00 46.65  ? 383  GLY A N     1 
ATOM   3869 C  CA    . GLY E 3 406 ? 43.662  -27.078 -19.826 1.00 46.37  ? 383  GLY A CA    1 
ATOM   3870 C  C     . GLY E 3 406 ? 43.453  -28.309 -18.965 1.00 46.03  ? 383  GLY A C     1 
ATOM   3871 O  O     . GLY E 3 406 ? 44.375  -29.096 -18.753 1.00 45.82  ? 383  GLY A O     1 
ATOM   3872 N  N     . LEU E 3 407 ? 42.229  -28.480 -18.474 1.00 45.40  ? 384  LEU A N     1 
ATOM   3873 C  CA    . LEU E 3 407 ? 41.884  -29.631 -17.647 1.00 44.37  ? 384  LEU A CA    1 
ATOM   3874 C  C     . LEU E 3 407 ? 41.265  -30.714 -18.520 1.00 43.28  ? 384  LEU A C     1 
ATOM   3875 O  O     . LEU E 3 407 ? 40.472  -30.426 -19.414 1.00 43.25  ? 384  LEU A O     1 
ATOM   3876 C  CB    . LEU E 3 407 ? 40.886  -29.229 -16.561 1.00 44.98  ? 384  LEU A CB    1 
ATOM   3877 C  CG    . LEU E 3 407 ? 41.358  -28.192 -15.544 1.00 45.29  ? 384  LEU A CG    1 
ATOM   3878 C  CD1   . LEU E 3 407 ? 40.203  -27.823 -14.624 1.00 43.86  ? 384  LEU A CD1   1 
ATOM   3879 C  CD2   . LEU E 3 407 ? 42.537  -28.752 -14.755 1.00 43.87  ? 384  LEU A CD2   1 
ATOM   3880 N  N     . PRO E 3 408 ? 41.610  -31.981 -18.263 1.00 42.17  ? 385  PRO A N     1 
ATOM   3881 C  CA    . PRO E 3 408 ? 41.071  -33.092 -19.047 1.00 41.83  ? 385  PRO A CA    1 
ATOM   3882 C  C     . PRO E 3 408 ? 39.578  -33.246 -18.808 1.00 41.77  ? 385  PRO A C     1 
ATOM   3883 O  O     . PRO E 3 408 ? 39.101  -33.029 -17.695 1.00 42.46  ? 385  PRO A O     1 
ATOM   3884 C  CB    . PRO E 3 408 ? 41.857  -34.279 -18.519 1.00 41.81  ? 385  PRO A CB    1 
ATOM   3885 C  CG    . PRO E 3 408 ? 41.982  -33.943 -17.065 1.00 40.22  ? 385  PRO A CG    1 
ATOM   3886 C  CD    . PRO E 3 408 ? 42.380  -32.481 -17.110 1.00 41.38  ? 385  PRO A CD    1 
ATOM   3887 N  N     . LEU E 3 409 ? 38.839  -33.611 -19.848 1.00 41.59  ? 386  LEU A N     1 
ATOM   3888 C  CA    . LEU E 3 409 ? 37.405  -33.797 -19.698 1.00 43.10  ? 386  LEU A CA    1 
ATOM   3889 C  C     . LEU E 3 409 ? 37.132  -35.120 -19.003 1.00 44.87  ? 386  LEU A C     1 
ATOM   3890 O  O     . LEU E 3 409 ? 36.740  -36.099 -19.633 1.00 44.61  ? 386  LEU A O     1 
ATOM   3891 C  CB    . LEU E 3 409 ? 36.699  -33.773 -21.055 1.00 40.98  ? 386  LEU A CB    1 
ATOM   3892 C  CG    . LEU E 3 409 ? 36.402  -32.397 -21.653 1.00 39.55  ? 386  LEU A CG    1 
ATOM   3893 C  CD1   . LEU E 3 409 ? 37.693  -31.696 -22.037 1.00 39.66  ? 386  LEU A CD1   1 
ATOM   3894 C  CD2   . LEU E 3 409 ? 35.518  -32.567 -22.869 1.00 39.98  ? 386  LEU A CD2   1 
ATOM   3895 N  N     . SER E 3 410 ? 37.355  -35.143 -17.696 1.00 48.18  ? 387  SER A N     1 
ATOM   3896 C  CA    . SER E 3 410 ? 37.124  -36.345 -16.910 1.00 52.00  ? 387  SER A CA    1 
ATOM   3897 C  C     . SER E 3 410 ? 35.638  -36.697 -16.936 1.00 53.72  ? 387  SER A C     1 
ATOM   3898 O  O     . SER E 3 410 ? 34.821  -35.948 -17.472 1.00 53.92  ? 387  SER A O     1 
ATOM   3899 C  CB    . SER E 3 410 ? 37.585  -36.123 -15.463 1.00 52.99  ? 387  SER A CB    1 
ATOM   3900 O  OG    . SER E 3 410 ? 36.956  -34.986 -14.890 1.00 52.56  ? 387  SER A OG    1 
ATOM   3901 N  N     . SER E 3 411 ? 35.295  -37.845 -16.366 1.00 55.36  ? 388  SER A N     1 
ATOM   3902 C  CA    . SER E 3 411 ? 33.908  -38.273 -16.312 1.00 56.83  ? 388  SER A CA    1 
ATOM   3903 C  C     . SER E 3 411 ? 33.441  -38.144 -14.870 1.00 57.34  ? 388  SER A C     1 
ATOM   3904 O  O     . SER E 3 411 ? 34.248  -38.228 -13.942 1.00 56.61  ? 388  SER A O     1 
ATOM   3905 C  CB    . SER E 3 411 ? 33.776  -39.725 -16.775 1.00 57.47  ? 388  SER A CB    1 
ATOM   3906 O  OG    . SER E 3 411 ? 32.415  -40.122 -16.807 1.00 59.05  ? 388  SER A OG    1 
ATOM   3907 N  N     . ARG E 3 412 ? 32.144  -37.931 -14.679 1.00 58.25  ? 389  ARG A N     1 
ATOM   3908 C  CA    . ARG E 3 412 ? 31.611  -37.799 -13.330 1.00 59.22  ? 389  ARG A CA    1 
ATOM   3909 C  C     . ARG E 3 412 ? 31.790  -39.120 -12.586 1.00 58.49  ? 389  ARG A C     1 
ATOM   3910 O  O     . ARG E 3 412 ? 31.401  -40.182 -13.079 1.00 58.47  ? 389  ARG A O     1 
ATOM   3911 C  CB    . ARG E 3 412 ? 30.127  -37.413 -13.365 1.00 59.98  ? 389  ARG A CB    1 
ATOM   3912 C  CG    . ARG E 3 412 ? 29.561  -37.066 -11.996 0.00 59.92  ? 389  ARG A CG    1 
ATOM   3913 C  CD    . ARG E 3 412 ? 28.094  -36.668 -12.060 0.00 60.18  ? 389  ARG A CD    1 
ATOM   3914 N  NE    . ARG E 3 412 ? 27.226  -37.790 -12.403 0.00 60.29  ? 389  ARG A NE    1 
ATOM   3915 C  CZ    . ARG E 3 412 ? 25.899  -37.721 -12.443 0.00 60.33  ? 389  ARG A CZ    1 
ATOM   3916 N  NH1   . ARG E 3 412 ? 25.283  -36.580 -12.162 0.00 60.34  ? 389  ARG A NH1   1 
ATOM   3917 N  NH2   . ARG E 3 412 ? 25.185  -38.792 -12.760 0.00 60.34  ? 389  ARG A NH2   1 
ATOM   3918 N  N     . PRO E 3 413 ? 32.385  -39.068 -11.385 1.00 57.53  ? 390  PRO A N     1 
ATOM   3919 C  CA    . PRO E 3 413 ? 32.627  -40.254 -10.558 1.00 56.59  ? 390  PRO A CA    1 
ATOM   3920 C  C     . PRO E 3 413 ? 31.341  -40.963 -10.160 1.00 54.86  ? 390  PRO A C     1 
ATOM   3921 O  O     . PRO E 3 413 ? 30.273  -40.352 -10.119 1.00 54.59  ? 390  PRO A O     1 
ATOM   3922 C  CB    . PRO E 3 413 ? 33.371  -39.686 -9.357  1.00 58.19  ? 390  PRO A CB    1 
ATOM   3923 C  CG    . PRO E 3 413 ? 32.764  -38.321 -9.221  1.00 58.98  ? 390  PRO A CG    1 
ATOM   3924 C  CD    . PRO E 3 413 ? 32.748  -37.842 -10.654 1.00 57.93  ? 390  PRO A CD    1 
ATOM   3925 N  N     . VAL E 3 414 ? 31.453  -42.252 -9.861  1.00 53.16  ? 391  VAL A N     1 
ATOM   3926 C  CA    . VAL E 3 414 ? 30.294  -43.046 -9.474  1.00 52.35  ? 391  VAL A CA    1 
ATOM   3927 C  C     . VAL E 3 414 ? 29.634  -42.470 -8.222  1.00 51.41  ? 391  VAL A C     1 
ATOM   3928 O  O     . VAL E 3 414 ? 30.316  -42.073 -7.276  1.00 52.07  ? 391  VAL A O     1 
ATOM   3929 C  CB    . VAL E 3 414 ? 30.690  -44.525 -9.223  1.00 51.96  ? 391  VAL A CB    1 
ATOM   3930 C  CG1   . VAL E 3 414 ? 31.653  -44.619 -8.051  1.00 52.77  ? 391  VAL A CG1   1 
ATOM   3931 C  CG2   . VAL E 3 414 ? 29.445  -45.367 -8.980  1.00 51.17  ? 391  VAL A CG2   1 
ATOM   3932 N  N     . VAL E 3 415 ? 28.305  -42.420 -8.234  1.00 49.46  ? 392  VAL A N     1 
ATOM   3933 C  CA    . VAL E 3 415 ? 27.536  -41.894 -7.113  1.00 48.02  ? 392  VAL A CA    1 
ATOM   3934 C  C     . VAL E 3 415 ? 27.818  -42.666 -5.835  1.00 46.67  ? 392  VAL A C     1 
ATOM   3935 O  O     . VAL E 3 415 ? 27.928  -43.889 -5.849  1.00 46.91  ? 392  VAL A O     1 
ATOM   3936 C  CB    . VAL E 3 415 ? 26.026  -41.972 -7.387  1.00 49.05  ? 392  VAL A CB    1 
ATOM   3937 C  CG1   . VAL E 3 415 ? 25.622  -43.415 -7.642  1.00 50.18  ? 392  VAL A CG1   1 
ATOM   3938 C  CG2   . VAL E 3 415 ? 25.254  -41.414 -6.205  1.00 50.71  ? 392  VAL A CG2   1 
ATOM   3939 N  N     . LYS E 3 416 ? 27.925  -41.946 -4.725  1.00 46.31  ? 393  LYS A N     1 
ATOM   3940 C  CA    . LYS E 3 416 ? 28.193  -42.573 -3.440  1.00 45.18  ? 393  LYS A CA    1 
ATOM   3941 C  C     . LYS E 3 416 ? 26.908  -42.723 -2.638  1.00 43.63  ? 393  LYS A C     1 
ATOM   3942 O  O     . LYS E 3 416 ? 26.701  -43.731 -1.961  1.00 43.83  ? 393  LYS A O     1 
ATOM   3943 C  CB    . LYS E 3 416 ? 29.207  -41.741 -2.651  1.00 45.40  ? 393  LYS A CB    1 
ATOM   3944 C  CG    . LYS E 3 416 ? 30.554  -41.591 -3.345  1.00 47.30  ? 393  LYS A CG    1 
ATOM   3945 C  CD    . LYS E 3 416 ? 31.242  -42.939 -3.527  1.00 47.74  ? 393  LYS A CD    1 
ATOM   3946 C  CE    . LYS E 3 416 ? 32.469  -42.816 -4.414  0.00 47.74  ? 393  LYS A CE    1 
ATOM   3947 N  NZ    . LYS E 3 416 ? 33.398  -41.764 -3.926  0.00 47.61  ? 393  LYS A NZ    1 
ATOM   3948 N  N     . SER E 3 417 ? 26.039  -41.723 -2.721  1.00 41.10  ? 394  SER A N     1 
ATOM   3949 C  CA    . SER E 3 417 ? 24.789  -41.769 -1.982  1.00 39.84  ? 394  SER A CA    1 
ATOM   3950 C  C     . SER E 3 417 ? 23.690  -40.938 -2.622  1.00 40.02  ? 394  SER A C     1 
ATOM   3951 O  O     . SER E 3 417 ? 23.939  -40.134 -3.519  1.00 39.72  ? 394  SER A O     1 
ATOM   3952 C  CB    . SER E 3 417 ? 25.014  -41.292 -0.545  1.00 37.90  ? 394  SER A CB    1 
ATOM   3953 O  OG    . SER E 3 417 ? 25.533  -39.977 -0.518  1.00 33.88  ? 394  SER A OG    1 
ATOM   3954 N  N     . MET E 3 418 ? 22.469  -41.150 -2.148  1.00 39.87  ? 395  MET A N     1 
ATOM   3955 C  CA    . MET E 3 418 ? 21.317  -40.423 -2.642  1.00 40.77  ? 395  MET A CA    1 
ATOM   3956 C  C     . MET E 3 418 ? 20.382  -40.130 -1.493  1.00 40.70  ? 395  MET A C     1 
ATOM   3957 O  O     . MET E 3 418 ? 19.857  -41.045 -0.864  1.00 41.11  ? 395  MET A O     1 
ATOM   3958 C  CB    . MET E 3 418 ? 20.568  -41.231 -3.692  1.00 42.90  ? 395  MET A CB    1 
ATOM   3959 C  CG    . MET E 3 418 ? 21.283  -41.358 -5.014  1.00 46.10  ? 395  MET A CG    1 
ATOM   3960 S  SD    . MET E 3 418 ? 20.118  -41.876 -6.276  1.00 50.44  ? 395  MET A SD    1 
ATOM   3961 C  CE    . MET E 3 418 ? 20.070  -43.637 -5.957  1.00 52.52  ? 395  MET A CE    1 
ATOM   3962 N  N     . MET E 3 419 ? 20.175  -38.850 -1.220  1.00 40.65  ? 396  MET A N     1 
ATOM   3963 C  CA    . MET E 3 419 ? 19.289  -38.448 -0.147  1.00 40.73  ? 396  MET A CA    1 
ATOM   3964 C  C     . MET E 3 419 ? 18.003  -37.859 -0.695  1.00 39.08  ? 396  MET A C     1 
ATOM   3965 O  O     . MET E 3 419 ? 17.942  -37.425 -1.841  1.00 39.83  ? 396  MET A O     1 
ATOM   3966 C  CB    . MET E 3 419 ? 19.960  -37.406 0.741   1.00 44.58  ? 396  MET A CB    1 
ATOM   3967 C  CG    . MET E 3 419 ? 19.070  -36.930 1.877   1.00 49.43  ? 396  MET A CG    1 
ATOM   3968 S  SD    . MET E 3 419 ? 19.651  -35.418 2.643   1.00 55.68  ? 396  MET A SD    1 
ATOM   3969 C  CE    . MET E 3 419 ? 19.001  -34.211 1.482   1.00 54.06  ? 396  MET A CE    1 
ATOM   3970 N  N     . SER E 3 420 ? 16.976  -37.854 0.143   1.00 37.50  ? 397  SER A N     1 
ATOM   3971 C  CA    . SER E 3 420 ? 15.678  -37.300 -0.204  1.00 36.61  ? 397  SER A CA    1 
ATOM   3972 C  C     . SER E 3 420 ? 15.087  -36.831 1.116   1.00 36.55  ? 397  SER A C     1 
ATOM   3973 O  O     . SER E 3 420 ? 14.735  -37.653 1.957   1.00 36.80  ? 397  SER A O     1 
ATOM   3974 C  CB    . SER E 3 420 ? 14.788  -38.371 -0.824  1.00 35.04  ? 397  SER A CB    1 
ATOM   3975 O  OG    . SER E 3 420 ? 13.529  -37.828 -1.171  1.00 35.65  ? 397  SER A OG    1 
ATOM   3976 N  N     . ASN E 3 421 ? 14.984  -35.518 1.309   1.00 36.71  ? 398  ASN A N     1 
ATOM   3977 C  CA    . ASN E 3 421 ? 14.458  -35.001 2.570   1.00 36.98  ? 398  ASN A CA    1 
ATOM   3978 C  C     . ASN E 3 421 ? 13.326  -33.989 2.460   1.00 35.69  ? 398  ASN A C     1 
ATOM   3979 O  O     . ASN E 3 421 ? 12.834  -33.685 1.372   1.00 34.89  ? 398  ASN A O     1 
ATOM   3980 C  CB    . ASN E 3 421 ? 15.595  -34.383 3.392   1.00 38.67  ? 398  ASN A CB    1 
ATOM   3981 C  CG    . ASN E 3 421 ? 15.875  -32.942 3.017   1.00 40.35  ? 398  ASN A CG    1 
ATOM   3982 O  OD1   . ASN E 3 421 ? 15.463  -32.015 3.716   1.00 40.73  ? 398  ASN A OD1   1 
ATOM   3983 N  ND2   . ASN E 3 421 ? 16.571  -32.746 1.903   1.00 42.16  ? 398  ASN A ND2   1 
ATOM   3984 N  N     . LYS E 3 422 ? 12.926  -33.478 3.619   1.00 35.42  ? 399  LYS A N     1 
ATOM   3985 C  CA    . LYS E 3 422 ? 11.868  -32.486 3.726   1.00 35.96  ? 399  LYS A CA    1 
ATOM   3986 C  C     . LYS E 3 422 ? 12.042  -31.683 5.010   1.00 38.11  ? 399  LYS A C     1 
ATOM   3987 O  O     . LYS E 3 422 ? 11.748  -32.183 6.095   1.00 39.11  ? 399  LYS A O     1 
ATOM   3988 C  CB    . LYS E 3 422 ? 10.498  -33.165 3.743   1.00 32.73  ? 399  LYS A CB    1 
ATOM   3989 C  CG    . LYS E 3 422 ? 9.338   -32.224 4.035   1.00 28.56  ? 399  LYS A CG    1 
ATOM   3990 C  CD    . LYS E 3 422 ? 9.270   -31.108 3.012   1.00 27.89  ? 399  LYS A CD    1 
ATOM   3991 C  CE    . LYS E 3 422 ? 8.093   -30.185 3.259   1.00 26.65  ? 399  LYS A CE    1 
ATOM   3992 N  NZ    . LYS E 3 422 ? 8.045   -29.092 2.253   1.00 25.85  ? 399  LYS A NZ    1 
ATOM   3993 N  N     . ASN E 3 423 ? 12.538  -30.452 4.900   1.00 39.33  ? 400  ASN A N     1 
ATOM   3994 C  CA    . ASN E 3 423 ? 12.694  -29.622 6.087   1.00 40.20  ? 400  ASN A CA    1 
ATOM   3995 C  C     . ASN E 3 423 ? 11.294  -29.238 6.529   1.00 39.63  ? 400  ASN A C     1 
ATOM   3996 O  O     . ASN E 3 423 ? 10.673  -28.325 5.984   1.00 38.65  ? 400  ASN A O     1 
ATOM   3997 C  CB    . ASN E 3 423 ? 13.535  -28.379 5.793   1.00 43.23  ? 400  ASN A CB    1 
ATOM   3998 C  CG    . ASN E 3 423 ? 15.025  -28.676 5.797   1.00 47.70  ? 400  ASN A CG    1 
ATOM   3999 O  OD1   . ASN E 3 423 ? 15.515  -29.455 4.979   1.00 49.58  ? 400  ASN A OD1   1 
ATOM   4000 N  ND2   . ASN E 3 423 ? 15.752  -28.063 6.730   1.00 49.09  ? 400  ASN A ND2   1 
ATOM   4001 N  N     . LEU E 3 424 ? 10.806  -29.970 7.520   1.00 39.33  ? 401  LEU A N     1 
ATOM   4002 C  CA    . LEU E 3 424 ? 9.472   -29.783 8.055   1.00 39.48  ? 401  LEU A CA    1 
ATOM   4003 C  C     . LEU E 3 424 ? 9.231   -28.451 8.750   1.00 41.13  ? 401  LEU A C     1 
ATOM   4004 O  O     . LEU E 3 424 ? 10.037  -27.994 9.564   1.00 41.52  ? 401  LEU A O     1 
ATOM   4005 C  CB    . LEU E 3 424 ? 9.156   -30.931 9.012   1.00 37.36  ? 401  LEU A CB    1 
ATOM   4006 C  CG    . LEU E 3 424 ? 9.334   -32.316 8.388   1.00 35.68  ? 401  LEU A CG    1 
ATOM   4007 C  CD1   . LEU E 3 424 ? 9.418   -33.367 9.472   1.00 36.12  ? 401  LEU A CD1   1 
ATOM   4008 C  CD2   . LEU E 3 424 ? 8.189   -32.598 7.432   1.00 35.68  ? 401  LEU A CD2   1 
ATOM   4009 N  N     . ARG E 3 425 ? 8.108   -27.834 8.405   1.00 42.39  ? 402  ARG A N     1 
ATOM   4010 C  CA    . ARG E 3 425 ? 7.696   -26.570 8.993   1.00 44.35  ? 402  ARG A CA    1 
ATOM   4011 C  C     . ARG E 3 425 ? 6.264   -26.820 9.483   1.00 45.16  ? 402  ARG A C     1 
ATOM   4012 O  O     . ARG E 3 425 ? 5.483   -27.506 8.815   1.00 45.61  ? 402  ARG A O     1 
ATOM   4013 C  CB    . ARG E 3 425 ? 7.729   -25.456 7.939   1.00 44.28  ? 402  ARG A CB    1 
ATOM   4014 C  CG    . ARG E 3 425 ? 7.739   -24.042 8.512   0.00 45.32  ? 402  ARG A CG    1 
ATOM   4015 C  CD    . ARG E 3 425 ? 6.432   -23.692 9.207   0.00 45.86  ? 402  ARG A CD    1 
ATOM   4016 N  NE    . ARG E 3 425 ? 5.315   -23.614 8.270   0.00 46.33  ? 402  ARG A NE    1 
ATOM   4017 C  CZ    . ARG E 3 425 ? 5.220   -22.719 7.291   0.00 46.53  ? 402  ARG A CZ    1 
ATOM   4018 N  NH1   . ARG E 3 425 ? 6.178   -21.819 7.116   0.00 46.66  ? 402  ARG A NH1   1 
ATOM   4019 N  NH2   . ARG E 3 425 ? 4.166   -22.724 6.487   0.00 46.66  ? 402  ARG A NH2   1 
ATOM   4020 N  N     . GLY E 3 426 ? 5.929   -26.290 10.655  1.00 44.25  ? 403  GLY A N     1 
ATOM   4021 C  CA    . GLY E 3 426 ? 4.598   -26.493 11.196  1.00 43.41  ? 403  GLY A CA    1 
ATOM   4022 C  C     . GLY E 3 426 ? 4.500   -27.820 11.920  1.00 43.08  ? 403  GLY A C     1 
ATOM   4023 O  O     . GLY E 3 426 ? 5.516   -28.436 12.222  1.00 42.55  ? 403  GLY A O     1 
ATOM   4024 N  N     . LYS E 3 427 ? 3.281   -28.262 12.206  1.00 44.58  ? 404  LYS A N     1 
ATOM   4025 C  CA    . LYS E 3 427 ? 3.086   -29.532 12.894  1.00 46.51  ? 404  LYS A CA    1 
ATOM   4026 C  C     . LYS E 3 427 ? 2.772   -30.650 11.908  1.00 47.21  ? 404  LYS A C     1 
ATOM   4027 O  O     . LYS E 3 427 ? 1.981   -31.543 12.207  1.00 47.19  ? 404  LYS A O     1 
ATOM   4028 C  CB    . LYS E 3 427 ? 1.948   -29.428 13.911  1.00 47.34  ? 404  LYS A CB    1 
ATOM   4029 C  CG    . LYS E 3 427 ? 2.119   -28.324 14.935  1.00 50.75  ? 404  LYS A CG    1 
ATOM   4030 C  CD    . LYS E 3 427 ? 1.136   -28.486 16.091  1.00 54.07  ? 404  LYS A CD    1 
ATOM   4031 C  CE    . LYS E 3 427 ? -0.312  -28.495 15.616  1.00 55.20  ? 404  LYS A CE    1 
ATOM   4032 N  NZ    . LYS E 3 427 ? -0.692  -27.216 14.953  1.00 57.95  ? 404  LYS A NZ    1 
ATOM   4033 N  N     . SER E 3 428 ? 3.383   -30.601 10.729  1.00 48.28  ? 405  SER A N     1 
ATOM   4034 C  CA    . SER E 3 428 ? 3.149   -31.638 9.736   1.00 49.18  ? 405  SER A CA    1 
ATOM   4035 C  C     . SER E 3 428 ? 3.483   -32.993 10.351  1.00 49.34  ? 405  SER A C     1 
ATOM   4036 O  O     . SER E 3 428 ? 2.599   -33.702 10.837  1.00 51.10  ? 405  SER A O     1 
ATOM   4037 C  CB    . SER E 3 428 ? 4.019   -31.409 8.502   1.00 49.50  ? 405  SER A CB    1 
ATOM   4038 O  OG    . SER E 3 428 ? 3.873   -32.484 7.589   1.00 50.26  ? 405  SER A OG    1 
ATOM   4039 N  N     . CYS E 3 429 ? 4.765   -33.341 10.335  1.00 47.23  ? 406  CYS A N     1 
ATOM   4040 C  CA    . CYS E 3 429 ? 5.226   -34.604 10.895  1.00 44.49  ? 406  CYS A CA    1 
ATOM   4041 C  C     . CYS E 3 429 ? 5.091   -34.572 12.416  1.00 43.40  ? 406  CYS A C     1 
ATOM   4042 O  O     . CYS E 3 429 ? 6.060   -34.345 13.139  1.00 42.91  ? 406  CYS A O     1 
ATOM   4043 C  CB    . CYS E 3 429 ? 6.680   -34.839 10.508  1.00 42.66  ? 406  CYS A CB    1 
ATOM   4044 S  SG    . CYS E 3 429 ? 7.247   -36.494 10.867  1.00 42.09  ? 406  CYS A SG    1 
ATOM   4045 N  N     . ASN E 3 430 ? 3.878   -34.823 12.892  1.00 42.75  ? 407  ASN A N     1 
ATOM   4046 C  CA    . ASN E 3 430 ? 3.588   -34.789 14.315  1.00 42.74  ? 407  ASN A CA    1 
ATOM   4047 C  C     . ASN E 3 430 ? 3.433   -36.162 14.981  1.00 41.39  ? 407  ASN A C     1 
ATOM   4048 O  O     . ASN E 3 430 ? 3.348   -36.255 16.206  1.00 41.50  ? 407  ASN A O     1 
ATOM   4049 C  CB    . ASN E 3 430 ? 2.324   -33.958 14.530  1.00 45.16  ? 407  ASN A CB    1 
ATOM   4050 C  CG    . ASN E 3 430 ? 2.002   -33.760 15.985  1.00 47.55  ? 407  ASN A CG    1 
ATOM   4051 O  OD1   . ASN E 3 430 ? 2.801   -33.205 16.743  1.00 49.12  ? 407  ASN A OD1   1 
ATOM   4052 N  ND2   . ASN E 3 430 ? 0.822   -34.214 16.391  1.00 49.93  ? 407  ASN A ND2   1 
ATOM   4053 N  N     . SER E 3 431 ? 3.398   -37.224 14.181  1.00 38.84  ? 408  SER A N     1 
ATOM   4054 C  CA    . SER E 3 431 ? 3.251   -38.574 14.717  1.00 36.07  ? 408  SER A CA    1 
ATOM   4055 C  C     . SER E 3 431 ? 4.092   -39.576 13.934  1.00 36.42  ? 408  SER A C     1 
ATOM   4056 O  O     . SER E 3 431 ? 4.863   -39.206 13.051  1.00 37.06  ? 408  SER A O     1 
ATOM   4057 C  CB    . SER E 3 431 ? 1.789   -39.004 14.660  1.00 34.51  ? 408  SER A CB    1 
ATOM   4058 O  OG    . SER E 3 431 ? 1.354   -39.101 13.317  1.00 32.95  ? 408  SER A OG    1 
ATOM   4059 N  N     . ILE E 3 432 ? 3.937   -40.853 14.262  1.00 35.77  ? 409  ILE A N     1 
ATOM   4060 C  CA    . ILE E 3 432 ? 4.677   -41.900 13.577  1.00 35.22  ? 409  ILE A CA    1 
ATOM   4061 C  C     . ILE E 3 432 ? 4.130   -42.067 12.157  1.00 34.74  ? 409  ILE A C     1 
ATOM   4062 O  O     . ILE E 3 432 ? 4.895   -42.120 11.194  1.00 34.02  ? 409  ILE A O     1 
ATOM   4063 C  CB    . ILE E 3 432 ? 4.567   -43.245 14.333  1.00 35.21  ? 409  ILE A CB    1 
ATOM   4064 C  CG1   . ILE E 3 432 ? 5.469   -44.292 13.681  1.00 34.69  ? 409  ILE A CG1   1 
ATOM   4065 C  CG2   . ILE E 3 432 ? 3.130   -43.731 14.326  1.00 37.18  ? 409  ILE A CG2   1 
ATOM   4066 C  CD1   . ILE E 3 432 ? 6.937   -43.932 13.698  1.00 35.41  ? 409  ILE A CD1   1 
ATOM   4067 N  N     . VAL E 3 433 ? 2.806   -42.138 12.031  1.00 33.77  ? 410  VAL A N     1 
ATOM   4068 C  CA    . VAL E 3 433 ? 2.186   -42.293 10.722  1.00 33.98  ? 410  VAL A CA    1 
ATOM   4069 C  C     . VAL E 3 433 ? 2.634   -41.150 9.827   1.00 35.02  ? 410  VAL A C     1 
ATOM   4070 O  O     . VAL E 3 433 ? 2.902   -41.349 8.640   1.00 35.37  ? 410  VAL A O     1 
ATOM   4071 C  CB    . VAL E 3 433 ? 0.644   -42.299 10.808  1.00 31.66  ? 410  VAL A CB    1 
ATOM   4072 C  CG1   . VAL E 3 433 ? 0.187   -43.430 11.693  1.00 33.59  ? 410  VAL A CG1   1 
ATOM   4073 C  CG2   . VAL E 3 433 ? 0.140   -40.984 11.341  1.00 32.20  ? 410  VAL A CG2   1 
ATOM   4074 N  N     . ASP E 3 434 ? 2.722   -39.951 10.398  1.00 35.10  ? 411  ASP A N     1 
ATOM   4075 C  CA    . ASP E 3 434 ? 3.166   -38.795 9.633   1.00 35.76  ? 411  ASP A CA    1 
ATOM   4076 C  C     . ASP E 3 434 ? 4.549   -39.076 9.063   1.00 34.27  ? 411  ASP A C     1 
ATOM   4077 O  O     . ASP E 3 434 ? 4.806   -38.805 7.893   1.00 33.67  ? 411  ASP A O     1 
ATOM   4078 C  CB    . ASP E 3 434 ? 3.208   -37.541 10.508  1.00 38.71  ? 411  ASP A CB    1 
ATOM   4079 C  CG    . ASP E 3 434 ? 1.880   -36.812 10.545  1.00 41.91  ? 411  ASP A CG    1 
ATOM   4080 O  OD1   . ASP E 3 434 ? 1.349   -36.498 9.457   1.00 43.61  ? 411  ASP A OD1   1 
ATOM   4081 O  OD2   . ASP E 3 434 ? 1.370   -36.545 11.654  1.00 44.12  ? 411  ASP A OD2   1 
ATOM   4082 N  N     . CYS E 3 435 ? 5.437   -39.620 9.893   1.00 32.28  ? 412  CYS A N     1 
ATOM   4083 C  CA    . CYS E 3 435 ? 6.784   -39.952 9.445   1.00 30.58  ? 412  CYS A CA    1 
ATOM   4084 C  C     . CYS E 3 435 ? 6.675   -40.919 8.277   1.00 29.42  ? 412  CYS A C     1 
ATOM   4085 O  O     . CYS E 3 435 ? 7.268   -40.712 7.221   1.00 29.04  ? 412  CYS A O     1 
ATOM   4086 C  CB    . CYS E 3 435 ? 7.583   -40.617 10.565  1.00 30.73  ? 412  CYS A CB    1 
ATOM   4087 S  SG    . CYS E 3 435 ? 8.050   -39.537 11.924  1.00 33.21  ? 412  CYS A SG    1 
ATOM   4088 N  N     . ILE E 3 436 ? 5.901   -41.978 8.475   1.00 27.74  ? 413  ILE A N     1 
ATOM   4089 C  CA    . ILE E 3 436 ? 5.721   -42.977 7.440   1.00 27.53  ? 413  ILE A CA    1 
ATOM   4090 C  C     . ILE E 3 436 ? 5.227   -42.359 6.139   1.00 27.51  ? 413  ILE A C     1 
ATOM   4091 O  O     . ILE E 3 436 ? 5.786   -42.622 5.077   1.00 28.88  ? 413  ILE A O     1 
ATOM   4092 C  CB    . ILE E 3 436 ? 4.739   -44.072 7.896   1.00 28.01  ? 413  ILE A CB    1 
ATOM   4093 C  CG1   . ILE E 3 436 ? 5.317   -44.795 9.117   1.00 27.47  ? 413  ILE A CG1   1 
ATOM   4094 C  CG2   . ILE E 3 436 ? 4.484   -45.054 6.761   1.00 26.76  ? 413  ILE A CG2   1 
ATOM   4095 C  CD1   . ILE E 3 436 ? 4.459   -45.923 9.630   1.00 26.96  ? 413  ILE A CD1   1 
ATOM   4096 N  N     . SER E 3 437 ? 4.190   -41.532 6.216   1.00 26.95  ? 414  SER A N     1 
ATOM   4097 C  CA    . SER E 3 437 ? 3.657   -40.896 5.015   1.00 26.84  ? 414  SER A CA    1 
ATOM   4098 C  C     . SER E 3 437 ? 4.743   -40.236 4.175   1.00 27.51  ? 414  SER A C     1 
ATOM   4099 O  O     . SER E 3 437 ? 4.742   -40.369 2.952   1.00 28.94  ? 414  SER A O     1 
ATOM   4100 C  CB    . SER E 3 437 ? 2.593   -39.862 5.374   1.00 24.57  ? 414  SER A CB    1 
ATOM   4101 O  OG    . SER E 3 437 ? 1.398   -40.503 5.769   1.00 24.29  ? 414  SER A OG    1 
ATOM   4102 N  N     . TRP E 3 438 ? 5.662   -39.523 4.826   1.00 26.63  ? 415  TRP A N     1 
ATOM   4103 C  CA    . TRP E 3 438 ? 6.750   -38.864 4.111   1.00 25.86  ? 415  TRP A CA    1 
ATOM   4104 C  C     . TRP E 3 438 ? 7.698   -39.912 3.539   1.00 27.27  ? 415  TRP A C     1 
ATOM   4105 O  O     . TRP E 3 438 ? 8.219   -39.749 2.435   1.00 27.90  ? 415  TRP A O     1 
ATOM   4106 C  CB    . TRP E 3 438 ? 7.532   -37.924 5.034   1.00 25.06  ? 415  TRP A CB    1 
ATOM   4107 C  CG    . TRP E 3 438 ? 6.831   -36.633 5.348   1.00 24.23  ? 415  TRP A CG    1 
ATOM   4108 C  CD1   . TRP E 3 438 ? 6.336   -36.241 6.557   1.00 25.48  ? 415  TRP A CD1   1 
ATOM   4109 C  CD2   . TRP E 3 438 ? 6.532   -35.575 4.433   1.00 23.29  ? 415  TRP A CD2   1 
ATOM   4110 N  NE1   . TRP E 3 438 ? 5.744   -35.005 6.453   1.00 23.65  ? 415  TRP A NE1   1 
ATOM   4111 C  CE2   . TRP E 3 438 ? 5.849   -34.575 5.158   1.00 22.63  ? 415  TRP A CE2   1 
ATOM   4112 C  CE3   . TRP E 3 438 ? 6.775   -35.374 3.069   1.00 23.82  ? 415  TRP A CE3   1 
ATOM   4113 C  CZ2   . TRP E 3 438 ? 5.403   -33.393 4.567   1.00 22.51  ? 415  TRP A CZ2   1 
ATOM   4114 C  CZ3   . TRP E 3 438 ? 6.332   -34.196 2.479   1.00 22.75  ? 415  TRP A CZ3   1 
ATOM   4115 C  CH2   . TRP E 3 438 ? 5.652   -33.221 3.230   1.00 23.56  ? 415  TRP A CH2   1 
ATOM   4116 N  N     . LEU E 3 439 ? 7.917   -40.987 4.295   1.00 27.59  ? 416  LEU A N     1 
ATOM   4117 C  CA    . LEU E 3 439 ? 8.799   -42.072 3.865   1.00 26.97  ? 416  LEU A CA    1 
ATOM   4118 C  C     . LEU E 3 439 ? 8.352   -42.604 2.518   1.00 27.27  ? 416  LEU A C     1 
ATOM   4119 O  O     . LEU E 3 439 ? 9.171   -42.928 1.661   1.00 25.76  ? 416  LEU A O     1 
ATOM   4120 C  CB    . LEU E 3 439 ? 8.785   -43.216 4.879   1.00 26.36  ? 416  LEU A CB    1 
ATOM   4121 C  CG    . LEU E 3 439 ? 9.387   -42.928 6.252   1.00 26.51  ? 416  LEU A CG    1 
ATOM   4122 C  CD1   . LEU E 3 439 ? 9.276   -44.176 7.112   1.00 26.50  ? 416  LEU A CD1   1 
ATOM   4123 C  CD2   . LEU E 3 439 ? 10.842  -42.500 6.101   1.00 26.33  ? 416  LEU A CD2   1 
ATOM   4124 N  N     . GLU E 3 440 ? 7.041   -42.702 2.341   1.00 28.56  ? 417  GLU A N     1 
ATOM   4125 C  CA    . GLU E 3 440 ? 6.498   -43.184 1.087   1.00 31.59  ? 417  GLU A CA    1 
ATOM   4126 C  C     . GLU E 3 440 ? 6.974   -42.277 -0.034  1.00 31.44  ? 417  GLU A C     1 
ATOM   4127 O  O     . GLU E 3 440 ? 7.323   -42.741 -1.119  1.00 32.95  ? 417  GLU A O     1 
ATOM   4128 C  CB    . GLU E 3 440 ? 4.975   -43.194 1.138   1.00 34.55  ? 417  GLU A CB    1 
ATOM   4129 C  CG    . GLU E 3 440 ? 4.405   -44.113 2.195   1.00 40.78  ? 417  GLU A CG    1 
ATOM   4130 C  CD    . GLU E 3 440 ? 2.932   -44.375 1.975   1.00 45.60  ? 417  GLU A CD    1 
ATOM   4131 O  OE1   . GLU E 3 440 ? 2.593   -44.974 0.930   1.00 47.47  ? 417  GLU A OE1   1 
ATOM   4132 O  OE2   . GLU E 3 440 ? 2.117   -43.977 2.838   1.00 47.40  ? 417  GLU A OE2   1 
ATOM   4133 N  N     . VAL E 3 441 ? 6.993   -40.977 0.234   1.00 30.51  ? 418  VAL A N     1 
ATOM   4134 C  CA    . VAL E 3 441 ? 7.443   -40.020 -0.762  1.00 29.79  ? 418  VAL A CA    1 
ATOM   4135 C  C     . VAL E 3 441 ? 8.923   -40.238 -1.072  1.00 30.13  ? 418  VAL A C     1 
ATOM   4136 O  O     . VAL E 3 441 ? 9.288   -40.463 -2.223  1.00 31.26  ? 418  VAL A O     1 
ATOM   4137 C  CB    . VAL E 3 441 ? 7.232   -38.563 -0.285  1.00 29.22  ? 418  VAL A CB    1 
ATOM   4138 C  CG1   . VAL E 3 441 ? 7.812   -37.592 -1.302  1.00 29.04  ? 418  VAL A CG1   1 
ATOM   4139 C  CG2   . VAL E 3 441 ? 5.750   -38.286 -0.099  1.00 27.44  ? 418  VAL A CG2   1 
ATOM   4140 N  N     . PHE E 3 442 ? 9.770   -40.192 -0.046  1.00 30.31  ? 419  PHE A N     1 
ATOM   4141 C  CA    . PHE E 3 442 ? 11.207  -40.373 -0.241  1.00 31.05  ? 419  PHE A CA    1 
ATOM   4142 C  C     . PHE E 3 442 ? 11.567  -41.627 -1.027  1.00 32.48  ? 419  PHE A C     1 
ATOM   4143 O  O     . PHE E 3 442 ? 12.521  -41.619 -1.802  1.00 33.46  ? 419  PHE A O     1 
ATOM   4144 C  CB    . PHE E 3 442 ? 11.943  -40.398 1.102   1.00 29.23  ? 419  PHE A CB    1 
ATOM   4145 C  CG    . PHE E 3 442 ? 11.674  -39.201 1.964   1.00 27.01  ? 419  PHE A CG    1 
ATOM   4146 C  CD1   . PHE E 3 442 ? 11.510  -37.943 1.401   1.00 26.84  ? 419  PHE A CD1   1 
ATOM   4147 C  CD2   . PHE E 3 442 ? 11.593  -39.330 3.345   1.00 26.84  ? 419  PHE A CD2   1 
ATOM   4148 C  CE1   . PHE E 3 442 ? 11.263  -36.833 2.200   1.00 27.61  ? 419  PHE A CE1   1 
ATOM   4149 C  CE2   . PHE E 3 442 ? 11.348  -38.227 4.153   1.00 26.15  ? 419  PHE A CE2   1 
ATOM   4150 C  CZ    . PHE E 3 442 ? 11.183  -36.976 3.581   1.00 26.22  ? 419  PHE A CZ    1 
ATOM   4151 N  N     . CYS E 3 443 ? 10.818  -42.706 -0.825  1.00 33.70  ? 420  CYS A N     1 
ATOM   4152 C  CA    . CYS E 3 443 ? 11.093  -43.945 -1.545  1.00 36.49  ? 420  CYS A CA    1 
ATOM   4153 C  C     . CYS E 3 443 ? 10.724  -43.820 -3.015  1.00 36.00  ? 420  CYS A C     1 
ATOM   4154 O  O     . CYS E 3 443 ? 11.505  -44.188 -3.894  1.00 35.39  ? 420  CYS A O     1 
ATOM   4155 C  CB    . CYS E 3 443 ? 10.327  -45.114 -0.925  1.00 39.03  ? 420  CYS A CB    1 
ATOM   4156 S  SG    . CYS E 3 443 ? 11.039  -45.703 0.625   1.00 49.82  ? 420  CYS A SG    1 
ATOM   4157 N  N     . ALA E 3 444 ? 9.529   -43.304 -3.278  1.00 35.80  ? 421  ALA A N     1 
ATOM   4158 C  CA    . ALA E 3 444 ? 9.072   -43.129 -4.647  1.00 35.41  ? 421  ALA A CA    1 
ATOM   4159 C  C     . ALA E 3 444 ? 10.104  -42.324 -5.428  1.00 35.56  ? 421  ALA A C     1 
ATOM   4160 O  O     . ALA E 3 444 ? 10.381  -42.622 -6.588  1.00 37.02  ? 421  ALA A O     1 
ATOM   4161 C  CB    . ALA E 3 444 ? 7.723   -42.420 -4.665  1.00 35.10  ? 421  ALA A CB    1 
ATOM   4162 N  N     . GLU E 3 445 ? 10.680  -41.309 -4.790  1.00 35.05  ? 422  GLU A N     1 
ATOM   4163 C  CA    . GLU E 3 445 ? 11.676  -40.487 -5.458  1.00 36.29  ? 422  GLU A CA    1 
ATOM   4164 C  C     . GLU E 3 445 ? 13.005  -41.216 -5.602  1.00 36.53  ? 422  GLU A C     1 
ATOM   4165 O  O     . GLU E 3 445 ? 13.549  -41.302 -6.700  1.00 36.25  ? 422  GLU A O     1 
ATOM   4166 C  CB    . GLU E 3 445 ? 11.885  -39.163 -4.717  1.00 37.82  ? 422  GLU A CB    1 
ATOM   4167 C  CG    . GLU E 3 445 ? 12.974  -38.295 -5.348  1.00 41.20  ? 422  GLU A CG    1 
ATOM   4168 C  CD    . GLU E 3 445 ? 12.890  -36.832 -4.948  1.00 43.51  ? 422  GLU A CD    1 
ATOM   4169 O  OE1   . GLU E 3 445 ? 11.947  -36.139 -5.393  1.00 43.90  ? 422  GLU A OE1   1 
ATOM   4170 O  OE2   . GLU E 3 445 ? 13.771  -36.375 -4.190  1.00 46.09  ? 422  GLU A OE2   1 
ATOM   4171 N  N     . LEU E 3 446 ? 13.534  -41.736 -4.500  1.00 37.71  ? 423  LEU A N     1 
ATOM   4172 C  CA    . LEU E 3 446 ? 14.800  -42.457 -4.559  1.00 38.51  ? 423  LEU A CA    1 
ATOM   4173 C  C     . LEU E 3 446 ? 14.713  -43.541 -5.629  1.00 40.04  ? 423  LEU A C     1 
ATOM   4174 O  O     . LEU E 3 446 ? 15.593  -43.649 -6.482  1.00 40.00  ? 423  LEU A O     1 
ATOM   4175 C  CB    . LEU E 3 446 ? 15.127  -43.079 -3.202  1.00 37.83  ? 423  LEU A CB    1 
ATOM   4176 C  CG    . LEU E 3 446 ? 15.505  -42.091 -2.097  1.00 38.54  ? 423  LEU A CG    1 
ATOM   4177 C  CD1   . LEU E 3 446 ? 15.714  -42.849 -0.802  1.00 40.54  ? 423  LEU A CD1   1 
ATOM   4178 C  CD2   . LEU E 3 446 ? 16.770  -41.334 -2.478  1.00 38.99  ? 423  LEU A CD2   1 
ATOM   4179 N  N     . THR E 3 447 ? 13.643  -44.332 -5.583  1.00 41.10  ? 424  THR A N     1 
ATOM   4180 C  CA    . THR E 3 447 ? 13.423  -45.395 -6.559  1.00 42.15  ? 424  THR A CA    1 
ATOM   4181 C  C     . THR E 3 447 ? 13.547  -44.817 -7.964  1.00 43.21  ? 424  THR A C     1 
ATOM   4182 O  O     . THR E 3 447 ? 14.237  -45.366 -8.818  1.00 44.69  ? 424  THR A O     1 
ATOM   4183 C  CB    . THR E 3 447 ? 12.017  -46.008 -6.410  1.00 42.36  ? 424  THR A CB    1 
ATOM   4184 O  OG1   . THR E 3 447 ? 11.932  -46.719 -5.169  1.00 41.48  ? 424  THR A OG1   1 
ATOM   4185 C  CG2   . THR E 3 447 ? 11.720  -46.957 -7.562  1.00 42.30  ? 424  THR A CG2   1 
ATOM   4186 N  N     . SER E 3 448 ? 12.863  -43.703 -8.190  1.00 44.16  ? 425  SER A N     1 
ATOM   4187 C  CA    . SER E 3 448 ? 12.891  -43.020 -9.475  1.00 45.57  ? 425  SER A CA    1 
ATOM   4188 C  C     . SER E 3 448 ? 14.329  -42.687 -9.876  1.00 46.86  ? 425  SER A C     1 
ATOM   4189 O  O     . SER E 3 448 ? 14.755  -42.958 -10.999 1.00 47.12  ? 425  SER A O     1 
ATOM   4190 C  CB    . SER E 3 448 ? 12.062  -41.733 -9.384  1.00 44.84  ? 425  SER A CB    1 
ATOM   4191 O  OG    . SER E 3 448 ? 12.274  -40.892 -10.503 1.00 43.01  ? 425  SER A OG    1 
ATOM   4192 N  N     . ARG E 3 449 ? 15.075  -42.106 -8.944  1.00 48.23  ? 426  ARG A N     1 
ATOM   4193 C  CA    . ARG E 3 449 ? 16.456  -41.720 -9.193  1.00 50.15  ? 426  ARG A CA    1 
ATOM   4194 C  C     . ARG E 3 449 ? 17.386  -42.907 -9.426  1.00 51.51  ? 426  ARG A C     1 
ATOM   4195 O  O     . ARG E 3 449 ? 18.412  -42.774 -10.090 1.00 51.76  ? 426  ARG A O     1 
ATOM   4196 C  CB    . ARG E 3 449 ? 16.977  -40.884 -8.028  1.00 50.06  ? 426  ARG A CB    1 
ATOM   4197 C  CG    . ARG E 3 449 ? 16.072  -39.726 -7.660  1.00 50.32  ? 426  ARG A CG    1 
ATOM   4198 C  CD    . ARG E 3 449 ? 16.812  -38.759 -6.777  1.00 50.62  ? 426  ARG A CD    1 
ATOM   4199 N  NE    . ARG E 3 449 ? 17.946  -38.193 -7.492  1.00 51.66  ? 426  ARG A NE    1 
ATOM   4200 C  CZ    . ARG E 3 449 ? 18.977  -37.602 -6.904  1.00 54.40  ? 426  ARG A CZ    1 
ATOM   4201 N  NH1   . ARG E 3 449 ? 19.020  -37.502 -5.580  1.00 54.91  ? 426  ARG A NH1   1 
ATOM   4202 N  NH2   . ARG E 3 449 ? 19.965  -37.111 -7.643  1.00 55.45  ? 426  ARG A NH2   1 
ATOM   4203 N  N     . ILE E 3 450 ? 17.037  -44.061 -8.868  1.00 53.21  ? 427  ILE A N     1 
ATOM   4204 C  CA    . ILE E 3 450 ? 17.852  -45.256 -9.045  1.00 55.18  ? 427  ILE A CA    1 
ATOM   4205 C  C     . ILE E 3 450 ? 17.770  -45.693 -10.505 1.00 56.78  ? 427  ILE A C     1 
ATOM   4206 O  O     . ILE E 3 450 ? 18.765  -46.115 -11.093 1.00 57.72  ? 427  ILE A O     1 
ATOM   4207 C  CB    . ILE E 3 450 ? 17.369  -46.412 -8.140  1.00 55.57  ? 427  ILE A CB    1 
ATOM   4208 C  CG1   . ILE E 3 450 ? 17.572  -46.044 -6.668  1.00 56.71  ? 427  ILE A CG1   1 
ATOM   4209 C  CG2   . ILE E 3 450 ? 18.132  -47.685 -8.469  1.00 56.42  ? 427  ILE A CG2   1 
ATOM   4210 C  CD1   . ILE E 3 450 ? 17.062  -47.095 -5.687  1.00 56.08  ? 427  ILE A CD1   1 
ATOM   4211 N  N     . GLN E 3 451 ? 16.581  -45.587 -11.090 1.00 58.07  ? 428  GLN A N     1 
ATOM   4212 C  CA    . GLN E 3 451 ? 16.393  -45.958 -12.487 1.00 59.14  ? 428  GLN A CA    1 
ATOM   4213 C  C     . GLN E 3 451 ? 17.243  -45.036 -13.357 1.00 60.19  ? 428  GLN A C     1 
ATOM   4214 O  O     . GLN E 3 451 ? 17.971  -45.496 -14.235 1.00 61.95  ? 428  GLN A O     1 
ATOM   4215 C  CB    . GLN E 3 451 ? 14.917  -45.840 -12.880 1.00 58.82  ? 428  GLN A CB    1 
ATOM   4216 C  CG    . GLN E 3 451 ? 13.988  -46.738 -12.080 0.00 59.20  ? 428  GLN A CG    1 
ATOM   4217 C  CD    . GLN E 3 451 ? 12.540  -46.604 -12.506 0.00 59.24  ? 428  GLN A CD    1 
ATOM   4218 O  OE1   . GLN E 3 451 ? 11.960  -45.521 -12.439 0.00 59.27  ? 428  GLN A OE1   1 
ATOM   4219 N  NE2   . GLN E 3 451 ? 11.949  -47.707 -12.948 0.00 59.27  ? 428  GLN A NE2   1 
ATOM   4220 N  N     . ASP E 3 452 ? 17.157  -43.734 -13.102 1.00 60.07  ? 429  ASP A N     1 
ATOM   4221 C  CA    . ASP E 3 452 ? 17.932  -42.757 -13.857 1.00 60.14  ? 429  ASP A CA    1 
ATOM   4222 C  C     . ASP E 3 452 ? 19.416  -43.114 -13.802 1.00 58.91  ? 429  ASP A C     1 
ATOM   4223 O  O     . ASP E 3 452 ? 20.147  -42.918 -14.774 1.00 58.50  ? 429  ASP A O     1 
ATOM   4224 C  CB    . ASP E 3 452 ? 17.711  -41.354 -13.284 1.00 63.91  ? 429  ASP A CB    1 
ATOM   4225 C  CG    . ASP E 3 452 ? 18.454  -40.276 -14.063 1.00 67.68  ? 429  ASP A CG    1 
ATOM   4226 O  OD1   . ASP E 3 452 ? 18.201  -40.127 -15.281 1.00 69.03  ? 429  ASP A OD1   1 
ATOM   4227 O  OD2   . ASP E 3 452 ? 19.289  -39.572 -13.452 1.00 69.56  ? 429  ASP A OD2   1 
ATOM   4228 N  N     . LEU E 3 453 ? 19.856  -43.640 -12.663 1.00 57.82  ? 430  LEU A N     1 
ATOM   4229 C  CA    . LEU E 3 453 ? 21.253  -44.026 -12.497 1.00 57.26  ? 430  LEU A CA    1 
ATOM   4230 C  C     . LEU E 3 453 ? 21.625  -45.147 -13.445 1.00 57.16  ? 430  LEU A C     1 
ATOM   4231 O  O     . LEU E 3 453 ? 22.605  -45.045 -14.180 1.00 58.12  ? 430  LEU A O     1 
ATOM   4232 C  CB    . LEU E 3 453 ? 21.532  -44.480 -11.063 1.00 56.59  ? 430  LEU A CB    1 
ATOM   4233 C  CG    . LEU E 3 453 ? 21.940  -43.410 -10.052 1.00 55.25  ? 430  LEU A CG    1 
ATOM   4234 C  CD1   . LEU E 3 453 ? 22.193  -44.065 -8.706  1.00 54.97  ? 430  LEU A CD1   1 
ATOM   4235 C  CD2   . LEU E 3 453 ? 23.191  -42.696 -10.539 1.00 54.06  ? 430  LEU A CD2   1 
ATOM   4236 N  N     . GLU E 3 454 ? 20.844  -46.222 -13.423 1.00 57.03  ? 431  GLU A N     1 
ATOM   4237 C  CA    . GLU E 3 454 ? 21.112  -47.357 -14.291 1.00 57.17  ? 431  GLU A CA    1 
ATOM   4238 C  C     . GLU E 3 454 ? 21.200  -46.891 -15.739 1.00 58.04  ? 431  GLU A C     1 
ATOM   4239 O  O     . GLU E 3 454 ? 22.018  -47.386 -16.510 1.00 58.59  ? 431  GLU A O     1 
ATOM   4240 C  CB    . GLU E 3 454 ? 20.019  -48.421 -14.144 1.00 56.36  ? 431  GLU A CB    1 
ATOM   4241 C  CG    . GLU E 3 454 ? 19.860  -48.955 -12.726 1.00 57.06  ? 431  GLU A CG    1 
ATOM   4242 C  CD    . GLU E 3 454 ? 18.993  -50.206 -12.646 1.00 58.00  ? 431  GLU A CD    1 
ATOM   4243 O  OE1   . GLU E 3 454 ? 17.840  -50.183 -13.135 1.00 56.90  ? 431  GLU A OE1   1 
ATOM   4244 O  OE2   . GLU E 3 454 ? 19.469  -51.216 -12.081 1.00 58.41  ? 431  GLU A OE2   1 
ATOM   4245 N  N     . GLN E 3 455 ? 20.367  -45.927 -16.110 1.00 58.52  ? 432  GLN A N     1 
ATOM   4246 C  CA    . GLN E 3 455 ? 20.390  -45.424 -17.473 1.00 60.30  ? 432  GLN A CA    1 
ATOM   4247 C  C     . GLN E 3 455 ? 21.734  -44.814 -17.834 1.00 61.36  ? 432  GLN A C     1 
ATOM   4248 O  O     . GLN E 3 455 ? 22.187  -44.929 -18.972 1.00 62.26  ? 432  GLN A O     1 
ATOM   4249 C  CB    . GLN E 3 455 ? 19.292  -44.384 -17.684 1.00 60.20  ? 432  GLN A CB    1 
ATOM   4250 C  CG    . GLN E 3 455 ? 17.917  -44.984 -17.877 1.00 61.97  ? 432  GLN A CG    1 
ATOM   4251 C  CD    . GLN E 3 455 ? 16.973  -44.024 -18.563 1.00 63.18  ? 432  GLN A CD    1 
ATOM   4252 O  OE1   . GLN E 3 455 ? 17.285  -43.490 -19.627 1.00 63.75  ? 432  GLN A OE1   1 
ATOM   4253 N  NE2   . GLN E 3 455 ? 15.810  -43.800 -17.961 1.00 63.86  ? 432  GLN A NE2   1 
ATOM   4254 N  N     . GLU E 3 456 ? 22.373  -44.168 -16.864 1.00 62.67  ? 433  GLU A N     1 
ATOM   4255 C  CA    . GLU E 3 456 ? 23.663  -43.530 -17.096 1.00 64.03  ? 433  GLU A CA    1 
ATOM   4256 C  C     . GLU E 3 456 ? 24.825  -44.519 -17.118 1.00 63.50  ? 433  GLU A C     1 
ATOM   4257 O  O     . GLU E 3 456 ? 25.633  -44.517 -18.047 1.00 64.07  ? 433  GLU A O     1 
ATOM   4258 C  CB    . GLU E 3 456 ? 23.925  -42.468 -16.025 1.00 66.64  ? 433  GLU A CB    1 
ATOM   4259 C  CG    . GLU E 3 456 ? 25.179  -41.640 -16.272 1.00 70.36  ? 433  GLU A CG    1 
ATOM   4260 C  CD    . GLU E 3 456 ? 25.431  -40.619 -15.178 1.00 72.48  ? 433  GLU A CD    1 
ATOM   4261 O  OE1   . GLU E 3 456 ? 25.686  -41.037 -14.026 1.00 72.58  ? 433  GLU A OE1   1 
ATOM   4262 O  OE2   . GLU E 3 456 ? 25.369  -39.402 -15.471 1.00 72.50  ? 433  GLU A OE2   1 
ATOM   4263 N  N     . TYR E 3 457 ? 24.912  -45.357 -16.090 1.00 62.21  ? 434  TYR A N     1 
ATOM   4264 C  CA    . TYR E 3 457 ? 25.986  -46.342 -15.997 1.00 60.75  ? 434  TYR A CA    1 
ATOM   4265 C  C     . TYR E 3 457 ? 25.671  -47.585 -16.821 1.00 57.67  ? 434  TYR A C     1 
ATOM   4266 O  O     . TYR E 3 457 ? 26.524  -48.451 -17.010 1.00 56.71  ? 434  TYR A O     1 
ATOM   4267 C  CB    . TYR E 3 457 ? 26.209  -46.753 -14.537 1.00 63.85  ? 434  TYR A CB    1 
ATOM   4268 C  CG    . TYR E 3 457 ? 26.500  -45.609 -13.587 1.00 66.13  ? 434  TYR A CG    1 
ATOM   4269 C  CD1   . TYR E 3 457 ? 27.407  -44.605 -13.928 1.00 67.59  ? 434  TYR A CD1   1 
ATOM   4270 C  CD2   . TYR E 3 457 ? 25.894  -45.550 -12.330 1.00 67.14  ? 434  TYR A CD2   1 
ATOM   4271 C  CE1   . TYR E 3 457 ? 27.704  -43.570 -13.043 1.00 69.51  ? 434  TYR A CE1   1 
ATOM   4272 C  CE2   . TYR E 3 457 ? 26.184  -44.521 -11.435 1.00 68.60  ? 434  TYR A CE2   1 
ATOM   4273 C  CZ    . TYR E 3 457 ? 27.090  -43.534 -11.798 1.00 70.10  ? 434  TYR A CZ    1 
ATOM   4274 O  OH    . TYR E 3 457 ? 27.385  -42.512 -10.921 1.00 70.45  ? 434  TYR A OH    1 
ATOM   4275 N  N     . ASN E 3 458 ? 24.438  -47.662 -17.305 1.00 54.67  ? 435  ASN A N     1 
ATOM   4276 C  CA    . ASN E 3 458 ? 23.980  -48.797 -18.094 1.00 52.24  ? 435  ASN A CA    1 
ATOM   4277 C  C     . ASN E 3 458 ? 24.263  -50.117 -17.383 1.00 51.49  ? 435  ASN A C     1 
ATOM   4278 O  O     . ASN E 3 458 ? 24.388  -51.165 -18.017 1.00 50.84  ? 435  ASN A O     1 
ATOM   4279 C  CB    . ASN E 3 458 ? 24.638  -48.796 -19.474 1.00 50.22  ? 435  ASN A CB    1 
ATOM   4280 C  CG    . ASN E 3 458 ? 23.994  -49.789 -20.422 1.00 47.88  ? 435  ASN A CG    1 
ATOM   4281 O  OD1   . ASN E 3 458 ? 22.823  -49.657 -20.779 1.00 44.35  ? 435  ASN A OD1   1 
ATOM   4282 N  ND2   . ASN E 3 458 ? 24.756  -50.795 -20.829 1.00 49.00  ? 435  ASN A ND2   1 
ATOM   4283 N  N     . LYS E 3 459 ? 24.371  -50.055 -16.059 1.00 51.54  ? 436  LYS A N     1 
ATOM   4284 C  CA    . LYS E 3 459 ? 24.608  -51.245 -15.249 1.00 51.65  ? 436  LYS A CA    1 
ATOM   4285 C  C     . LYS E 3 459 ? 23.680  -51.228 -14.040 1.00 50.96  ? 436  LYS A C     1 
ATOM   4286 O  O     . LYS E 3 459 ? 23.336  -50.163 -13.532 1.00 51.88  ? 436  LYS A O     1 
ATOM   4287 C  CB    . LYS E 3 459 ? 26.070  -51.315 -14.795 1.00 51.01  ? 436  LYS A CB    1 
ATOM   4288 C  CG    . LYS E 3 459 ? 26.595  -50.072 -14.105 0.00 51.77  ? 436  LYS A CG    1 
ATOM   4289 C  CD    . LYS E 3 459 ? 28.014  -50.306 -13.608 0.00 51.93  ? 436  LYS A CD    1 
ATOM   4290 C  CE    . LYS E 3 459 ? 28.643  -49.030 -13.080 0.00 52.03  ? 436  LYS A CE    1 
ATOM   4291 N  NZ    . LYS E 3 459 ? 28.866  -48.034 -14.164 0.00 51.98  ? 436  LYS A NZ    1 
ATOM   4292 N  N     . ILE E 3 460 ? 23.267  -52.410 -13.594 1.00 49.97  ? 437  ILE A N     1 
ATOM   4293 C  CA    . ILE E 3 460 ? 22.369  -52.528 -12.450 1.00 49.41  ? 437  ILE A CA    1 
ATOM   4294 C  C     . ILE E 3 460 ? 22.929  -51.852 -11.203 1.00 48.17  ? 437  ILE A C     1 
ATOM   4295 O  O     . ILE E 3 460 ? 24.086  -52.061 -10.837 1.00 46.91  ? 437  ILE A O     1 
ATOM   4296 C  CB    . ILE E 3 460 ? 22.090  -54.005 -12.108 1.00 50.94  ? 437  ILE A CB    1 
ATOM   4297 C  CG1   . ILE E 3 460 ? 21.569  -54.742 -13.346 1.00 53.02  ? 437  ILE A CG1   1 
ATOM   4298 C  CG2   . ILE E 3 460 ? 21.086  -54.090 -10.972 1.00 51.02  ? 437  ILE A CG2   1 
ATOM   4299 C  CD1   . ILE E 3 460 ? 20.333  -54.119 -13.970 1.00 54.47  ? 437  ILE A CD1   1 
ATOM   4300 N  N     . VAL E 3 461 ? 22.093  -51.048 -10.553 1.00 47.27  ? 438  VAL A N     1 
ATOM   4301 C  CA    . VAL E 3 461 ? 22.485  -50.333 -9.345  1.00 46.66  ? 438  VAL A CA    1 
ATOM   4302 C  C     . VAL E 3 461 ? 21.440  -50.508 -8.253  1.00 46.91  ? 438  VAL A C     1 
ATOM   4303 O  O     . VAL E 3 461 ? 20.250  -50.279 -8.476  1.00 45.82  ? 438  VAL A O     1 
ATOM   4304 C  CB    . VAL E 3 461 ? 22.653  -48.820 -9.611  1.00 46.06  ? 438  VAL A CB    1 
ATOM   4305 C  CG1   . VAL E 3 461 ? 22.916  -48.085 -8.308  1.00 45.74  ? 438  VAL A CG1   1 
ATOM   4306 C  CG2   . VAL E 3 461 ? 23.798  -48.587 -10.580 1.00 46.54  ? 438  VAL A CG2   1 
ATOM   4307 N  N     . ILE E 3 462 ? 21.891  -50.921 -7.074  1.00 48.16  ? 439  ILE A N     1 
ATOM   4308 C  CA    . ILE E 3 462 ? 20.992  -51.108 -5.942  1.00 49.57  ? 439  ILE A CA    1 
ATOM   4309 C  C     . ILE E 3 462 ? 21.674  -50.784 -4.618  1.00 48.91  ? 439  ILE A C     1 
ATOM   4310 O  O     . ILE E 3 462 ? 22.807  -51.201 -4.368  1.00 48.10  ? 439  ILE A O     1 
ATOM   4311 C  CB    . ILE E 3 462 ? 20.448  -52.551 -5.873  1.00 50.52  ? 439  ILE A CB    1 
ATOM   4312 C  CG1   . ILE E 3 462 ? 21.606  -53.546 -5.857  1.00 50.36  ? 439  ILE A CG1   1 
ATOM   4313 C  CG2   . ILE E 3 462 ? 19.514  -52.815 -7.047  1.00 51.75  ? 439  ILE A CG2   1 
ATOM   4314 C  CD1   . ILE E 3 462 ? 21.156  -54.977 -5.692  1.00 51.52  ? 439  ILE A CD1   1 
ATOM   4315 N  N     . PRO E 3 463 ? 20.986  -50.021 -3.754  1.00 48.55  ? 440  PRO A N     1 
ATOM   4316 C  CA    . PRO E 3 463 ? 21.525  -49.640 -2.448  1.00 48.47  ? 440  PRO A CA    1 
ATOM   4317 C  C     . PRO E 3 463 ? 21.554  -50.842 -1.514  1.00 47.88  ? 440  PRO A C     1 
ATOM   4318 O  O     . PRO E 3 463 ? 20.599  -51.616 -1.451  1.00 46.41  ? 440  PRO A O     1 
ATOM   4319 C  CB    . PRO E 3 463 ? 20.556  -48.561 -1.984  1.00 48.40  ? 440  PRO A CB    1 
ATOM   4320 C  CG    . PRO E 3 463 ? 19.259  -49.037 -2.545  1.00 49.05  ? 440  PRO A CG    1 
ATOM   4321 C  CD    . PRO E 3 463 ? 19.644  -49.445 -3.950  1.00 48.95  ? 440  PRO A CD    1 
ATOM   4322 N  N     . ARG E 3 464 ? 22.659  -50.996 -0.796  1.00 47.90  ? 441  ARG A N     1 
ATOM   4323 C  CA    . ARG E 3 464 ? 22.805  -52.112 0.122   1.00 48.22  ? 441  ARG A CA    1 
ATOM   4324 C  C     . ARG E 3 464 ? 22.571  -51.667 1.562   1.00 47.46  ? 441  ARG A C     1 
ATOM   4325 O  O     . ARG E 3 464 ? 22.567  -52.489 2.481   1.00 47.86  ? 441  ARG A O     1 
ATOM   4326 C  CB    . ARG E 3 464 ? 24.203  -52.722 -0.014  1.00 49.53  ? 441  ARG A CB    1 
ATOM   4327 C  CG    . ARG E 3 464 ? 24.354  -54.068 0.673   1.00 51.93  ? 441  ARG A CG    1 
ATOM   4328 C  CD    . ARG E 3 464 ? 23.402  -55.089 0.071   1.00 54.02  ? 441  ARG A CD    1 
ATOM   4329 N  NE    . ARG E 3 464 ? 23.692  -55.327 -1.339  1.00 55.38  ? 441  ARG A NE    1 
ATOM   4330 C  CZ    . ARG E 3 464 ? 22.940  -56.070 -2.144  1.00 55.92  ? 441  ARG A CZ    1 
ATOM   4331 N  NH1   . ARG E 3 464 ? 21.840  -56.651 -1.679  1.00 55.48  ? 441  ARG A NH1   1 
ATOM   4332 N  NH2   . ARG E 3 464 ? 23.293  -56.239 -3.413  1.00 55.26  ? 441  ARG A NH2   1 
ATOM   4333 N  N     . THR E 3 465 ? 22.367  -50.366 1.755   1.00 45.09  ? 442  THR A N     1 
ATOM   4334 C  CA    . THR E 3 465 ? 22.142  -49.830 3.091   1.00 43.45  ? 442  THR A CA    1 
ATOM   4335 C  C     . THR E 3 465 ? 21.322  -48.538 3.106   1.00 42.52  ? 442  THR A C     1 
ATOM   4336 O  O     . THR E 3 465 ? 21.590  -47.610 2.342   1.00 42.38  ? 442  THR A O     1 
ATOM   4337 C  CB    . THR E 3 465 ? 23.482  -49.575 3.797   1.00 43.53  ? 442  THR A CB    1 
ATOM   4338 O  OG1   . THR E 3 465 ? 23.249  -48.913 5.044   1.00 45.48  ? 442  THR A OG1   1 
ATOM   4339 C  CG2   . THR E 3 465 ? 24.373  -48.709 2.938   1.00 44.90  ? 442  THR A CG2   1 
ATOM   4340 N  N     . VAL E 3 466 ? 20.321  -48.492 3.984   1.00 41.21  ? 443  VAL A N     1 
ATOM   4341 C  CA    . VAL E 3 466 ? 19.455  -47.321 4.128   1.00 39.46  ? 443  VAL A CA    1 
ATOM   4342 C  C     . VAL E 3 466 ? 19.876  -46.555 5.377   1.00 38.50  ? 443  VAL A C     1 
ATOM   4343 O  O     . VAL E 3 466 ? 20.655  -47.052 6.188   1.00 39.03  ? 443  VAL A O     1 
ATOM   4344 C  CB    . VAL E 3 466 ? 17.971  -47.714 4.311   1.00 39.33  ? 443  VAL A CB    1 
ATOM   4345 C  CG1   . VAL E 3 466 ? 17.079  -46.516 4.035   1.00 40.21  ? 443  VAL A CG1   1 
ATOM   4346 C  CG2   . VAL E 3 466 ? 17.617  -48.869 3.406   1.00 41.75  ? 443  VAL A CG2   1 
ATOM   4347 N  N     . SER E 3 467 ? 19.350  -45.348 5.538   1.00 36.74  ? 444  SER A N     1 
ATOM   4348 C  CA    . SER E 3 467 ? 19.679  -44.533 6.698   1.00 34.69  ? 444  SER A CA    1 
ATOM   4349 C  C     . SER E 3 467 ? 18.600  -43.489 6.937   1.00 33.11  ? 444  SER A C     1 
ATOM   4350 O  O     . SER E 3 467 ? 18.243  -42.738 6.034   1.00 34.95  ? 444  SER A O     1 
ATOM   4351 C  CB    . SER E 3 467 ? 21.026  -43.843 6.492   1.00 33.81  ? 444  SER A CB    1 
ATOM   4352 O  OG    . SER E 3 467 ? 21.359  -43.054 7.616   1.00 34.52  ? 444  SER A OG    1 
ATOM   4353 N  N     . ILE E 3 468 ? 18.077  -43.450 8.157   1.00 30.50  ? 445  ILE A N     1 
ATOM   4354 C  CA    . ILE E 3 468 ? 17.039  -42.491 8.503   1.00 27.37  ? 445  ILE A CA    1 
ATOM   4355 C  C     . ILE E 3 468 ? 17.561  -41.517 9.539   1.00 26.75  ? 445  ILE A C     1 
ATOM   4356 O  O     . ILE E 3 468 ? 18.199  -41.912 10.514  1.00 27.68  ? 445  ILE A O     1 
ATOM   4357 C  CB    . ILE E 3 468 ? 15.792  -43.187 9.079   1.00 26.49  ? 445  ILE A CB    1 
ATOM   4358 C  CG1   . ILE E 3 468 ? 15.172  -44.116 8.030   1.00 25.85  ? 445  ILE A CG1   1 
ATOM   4359 C  CG2   . ILE E 3 468 ? 14.790  -42.147 9.538   1.00 26.02  ? 445  ILE A CG2   1 
ATOM   4360 C  CD1   . ILE E 3 468 ? 14.678  -43.412 6.785   1.00 24.73  ? 445  ILE A CD1   1 
ATOM   4361 N  N     . SER E 3 469 ? 17.299  -40.237 9.317   1.00 26.37  ? 446  SER A N     1 
ATOM   4362 C  CA    . SER E 3 469 ? 17.732  -39.204 10.243  1.00 25.67  ? 446  SER A CA    1 
ATOM   4363 C  C     . SER E 3 469 ? 16.643  -38.159 10.347  1.00 25.62  ? 446  SER A C     1 
ATOM   4364 O  O     . SER E 3 469 ? 15.819  -38.010 9.442   1.00 25.44  ? 446  SER A O     1 
ATOM   4365 C  CB    . SER E 3 469 ? 19.043  -38.566 9.776   1.00 25.47  ? 446  SER A CB    1 
ATOM   4366 O  OG    . SER E 3 469 ? 18.980  -38.183 8.415   1.00 27.58  ? 446  SER A OG    1 
ATOM   4367 N  N     . LEU E 3 470 ? 16.634  -37.445 11.465  1.00 26.80  ? 447  LEU A N     1 
ATOM   4368 C  CA    . LEU E 3 470 ? 15.633  -36.416 11.700  1.00 28.08  ? 447  LEU A CA    1 
ATOM   4369 C  C     . LEU E 3 470 ? 16.121  -35.367 12.689  1.00 28.16  ? 447  LEU A C     1 
ATOM   4370 O  O     . LEU E 3 470 ? 17.227  -35.454 13.227  1.00 27.78  ? 447  LEU A O     1 
ATOM   4371 C  CB    . LEU E 3 470 ? 14.345  -37.060 12.226  1.00 26.11  ? 447  LEU A CB    1 
ATOM   4372 C  CG    . LEU E 3 470 ? 14.453  -37.887 13.515  1.00 26.27  ? 447  LEU A CG    1 
ATOM   4373 C  CD1   . LEU E 3 470 ? 14.605  -36.971 14.723  1.00 25.45  ? 447  LEU A CD1   1 
ATOM   4374 C  CD2   . LEU E 3 470 ? 13.203  -38.741 13.673  1.00 25.77  ? 447  LEU A CD2   1 
ATOM   4375 N  N     . LYS E 3 471 ? 15.281  -34.367 12.912  1.00 28.26  ? 448  LYS A N     1 
ATOM   4376 C  CA    . LYS E 3 471 ? 15.587  -33.307 13.852  1.00 28.94  ? 448  LYS A CA    1 
ATOM   4377 C  C     . LYS E 3 471 ? 14.336  -33.030 14.650  1.00 27.84  ? 448  LYS A C     1 
ATOM   4378 O  O     . LYS E 3 471 ? 13.280  -32.725 14.097  1.00 26.55  ? 448  LYS A O     1 
ATOM   4379 C  CB    . LYS E 3 471 ? 16.061  -32.044 13.129  1.00 30.62  ? 448  LYS A CB    1 
ATOM   4380 C  CG    . LYS E 3 471 ? 17.520  -32.108 12.701  1.00 30.26  ? 448  LYS A CG    1 
ATOM   4381 C  CD    . LYS E 3 471 ? 18.013  -30.768 12.204  1.00 30.33  ? 448  LYS A CD    1 
ATOM   4382 C  CE    . LYS E 3 471 ? 19.497  -30.819 11.897  1.00 31.76  ? 448  LYS A CE    1 
ATOM   4383 N  NZ    . LYS E 3 471 ? 20.014  -29.511 11.403  1.00 31.83  ? 448  LYS A NZ    1 
ATOM   4384 N  N     . THR E 3 472 ? 14.475  -33.165 15.962  1.00 27.22  ? 449  THR A N     1 
ATOM   4385 C  CA    . THR E 3 472 ? 13.380  -32.969 16.894  1.00 26.53  ? 449  THR A CA    1 
ATOM   4386 C  C     . THR E 3 472 ? 12.913  -31.520 16.979  1.00 26.84  ? 449  THR A C     1 
ATOM   4387 O  O     . THR E 3 472 ? 13.465  -30.631 16.332  1.00 26.87  ? 449  THR A O     1 
ATOM   4388 C  CB    . THR E 3 472 ? 13.794  -33.438 18.298  1.00 26.31  ? 449  THR A CB    1 
ATOM   4389 O  OG1   . THR E 3 472 ? 14.886  -32.638 18.765  1.00 24.82  ? 449  THR A OG1   1 
ATOM   4390 C  CG2   . THR E 3 472 ? 14.231  -34.895 18.262  1.00 26.61  ? 449  THR A CG2   1 
ATOM   4391 N  N     . LYS E 3 473 ? 11.876  -31.303 17.779  1.00 26.53  ? 450  LYS A N     1 
ATOM   4392 C  CA    . LYS E 3 473 ? 11.311  -29.981 17.998  1.00 24.83  ? 450  LYS A CA    1 
ATOM   4393 C  C     . LYS E 3 473 ? 12.410  -29.001 18.413  1.00 25.41  ? 450  LYS A C     1 
ATOM   4394 O  O     . LYS E 3 473 ? 12.407  -27.846 17.991  1.00 25.37  ? 450  LYS A O     1 
ATOM   4395 C  CB    . LYS E 3 473 ? 10.240  -30.076 19.086  1.00 23.24  ? 450  LYS A CB    1 
ATOM   4396 C  CG    . LYS E 3 473 ? 9.609   -28.768 19.517  1.00 22.28  ? 450  LYS A CG    1 
ATOM   4397 C  CD    . LYS E 3 473 ? 8.516   -29.052 20.531  1.00 21.53  ? 450  LYS A CD    1 
ATOM   4398 C  CE    . LYS E 3 473 ? 7.993   -27.796 21.194  1.00 22.78  ? 450  LYS A CE    1 
ATOM   4399 N  NZ    . LYS E 3 473 ? 6.970   -28.128 22.239  1.00 24.81  ? 450  LYS A NZ    1 
ATOM   4400 N  N     . SER E 3 474 ? 13.352  -29.473 19.231  1.00 26.43  ? 451  SER A N     1 
ATOM   4401 C  CA    . SER E 3 474 ? 14.461  -28.646 19.705  1.00 26.09  ? 451  SER A CA    1 
ATOM   4402 C  C     . SER E 3 474 ? 15.720  -28.755 18.836  1.00 27.27  ? 451  SER A C     1 
ATOM   4403 O  O     . SER E 3 474 ? 16.798  -28.312 19.230  1.00 27.38  ? 451  SER A O     1 
ATOM   4404 C  CB    . SER E 3 474 ? 14.794  -28.990 21.159  1.00 24.52  ? 451  SER A CB    1 
ATOM   4405 O  OG    . SER E 3 474 ? 15.028  -30.375 21.316  1.00 26.86  ? 451  SER A OG    1 
ATOM   4406 N  N     . TYR E 3 475 ? 15.567  -29.350 17.657  1.00 29.52  ? 452  TYR A N     1 
ATOM   4407 C  CA    . TYR E 3 475 ? 16.646  -29.495 16.677  1.00 31.59  ? 452  TYR A CA    1 
ATOM   4408 C  C     . TYR E 3 475 ? 17.747  -30.511 16.965  1.00 32.53  ? 452  TYR A C     1 
ATOM   4409 O  O     . TYR E 3 475 ? 18.846  -30.408 16.423  1.00 33.08  ? 452  TYR A O     1 
ATOM   4410 C  CB    . TYR E 3 475 ? 17.284  -28.128 16.392  1.00 32.11  ? 452  TYR A CB    1 
ATOM   4411 C  CG    . TYR E 3 475 ? 16.286  -27.059 15.994  1.00 33.95  ? 452  TYR A CG    1 
ATOM   4412 C  CD1   . TYR E 3 475 ? 15.881  -26.083 16.907  1.00 34.42  ? 452  TYR A CD1   1 
ATOM   4413 C  CD2   . TYR E 3 475 ? 15.722  -27.042 14.718  1.00 34.62  ? 452  TYR A CD2   1 
ATOM   4414 C  CE1   . TYR E 3 475 ? 14.937  -25.117 16.563  1.00 35.15  ? 452  TYR A CE1   1 
ATOM   4415 C  CE2   . TYR E 3 475 ? 14.773  -26.081 14.362  1.00 36.38  ? 452  TYR A CE2   1 
ATOM   4416 C  CZ    . TYR E 3 475 ? 14.386  -25.122 15.291  1.00 36.48  ? 452  TYR A CZ    1 
ATOM   4417 O  OH    . TYR E 3 475 ? 13.444  -24.174 14.954  1.00 35.84  ? 452  TYR A OH    1 
ATOM   4418 N  N     . GLU E 3 476 ? 17.453  -31.500 17.801  1.00 34.11  ? 453  GLU A N     1 
ATOM   4419 C  CA    . GLU E 3 476 ? 18.430  -32.537 18.125  1.00 33.71  ? 453  GLU A CA    1 
ATOM   4420 C  C     . GLU E 3 476 ? 18.436  -33.538 16.969  1.00 33.00  ? 453  GLU A C     1 
ATOM   4421 O  O     . GLU E 3 476 ? 17.439  -33.681 16.260  1.00 31.90  ? 453  GLU A O     1 
ATOM   4422 C  CB    . GLU E 3 476 ? 18.035  -33.227 19.429  1.00 35.11  ? 453  GLU A CB    1 
ATOM   4423 C  CG    . GLU E 3 476 ? 17.700  -32.241 20.538  1.00 38.19  ? 453  GLU A CG    1 
ATOM   4424 C  CD    . GLU E 3 476 ? 16.860  -32.856 21.642  1.00 41.35  ? 453  GLU A CD    1 
ATOM   4425 O  OE1   . GLU E 3 476 ? 15.811  -33.464 21.326  1.00 41.33  ? 453  GLU A OE1   1 
ATOM   4426 O  OE2   . GLU E 3 476 ? 17.243  -32.721 22.826  1.00 42.45  ? 453  GLU A OE2   1 
ATOM   4427 N  N     . VAL E 3 477 ? 19.553  -34.233 16.781  1.00 33.15  ? 454  VAL A N     1 
ATOM   4428 C  CA    . VAL E 3 477 ? 19.671  -35.192 15.685  1.00 31.63  ? 454  VAL A CA    1 
ATOM   4429 C  C     . VAL E 3 477 ? 19.667  -36.664 16.083  1.00 30.47  ? 454  VAL A C     1 
ATOM   4430 O  O     . VAL E 3 477 ? 20.513  -37.116 16.852  1.00 29.51  ? 454  VAL A O     1 
ATOM   4431 C  CB    . VAL E 3 477 ? 20.951  -34.923 14.860  1.00 31.60  ? 454  VAL A CB    1 
ATOM   4432 C  CG1   . VAL E 3 477 ? 21.081  -35.942 13.742  1.00 31.44  ? 454  VAL A CG1   1 
ATOM   4433 C  CG2   . VAL E 3 477 ? 20.907  -33.517 14.285  1.00 33.18  ? 454  VAL A CG2   1 
ATOM   4434 N  N     . TYR E 3 478 ? 18.700  -37.403 15.546  1.00 30.26  ? 455  TYR A N     1 
ATOM   4435 C  CA    . TYR E 3 478 ? 18.576  -38.838 15.784  1.00 30.37  ? 455  TYR A CA    1 
ATOM   4436 C  C     . TYR E 3 478 ? 18.791  -39.474 14.421  1.00 30.98  ? 455  TYR A C     1 
ATOM   4437 O  O     . TYR E 3 478 ? 18.465  -38.870 13.400  1.00 32.18  ? 455  TYR A O     1 
ATOM   4438 C  CB    . TYR E 3 478 ? 17.177  -39.194 16.300  1.00 30.60  ? 455  TYR A CB    1 
ATOM   4439 C  CG    . TYR E 3 478 ? 16.922  -38.827 17.748  1.00 32.43  ? 455  TYR A CG    1 
ATOM   4440 C  CD1   . TYR E 3 478 ? 17.202  -37.547 18.222  1.00 35.18  ? 455  TYR A CD1   1 
ATOM   4441 C  CD2   . TYR E 3 478 ? 16.374  -39.752 18.637  1.00 31.78  ? 455  TYR A CD2   1 
ATOM   4442 C  CE1   . TYR E 3 478 ? 16.942  -37.193 19.545  1.00 37.20  ? 455  TYR A CE1   1 
ATOM   4443 C  CE2   . TYR E 3 478 ? 16.109  -39.409 19.963  1.00 34.03  ? 455  TYR A CE2   1 
ATOM   4444 C  CZ    . TYR E 3 478 ? 16.395  -38.126 20.410  1.00 35.77  ? 455  TYR A CZ    1 
ATOM   4445 O  OH    . TYR E 3 478 ? 16.129  -37.762 21.710  1.00 34.24  ? 455  TYR A OH    1 
ATOM   4446 N  N     . ARG E 3 479 ? 19.341  -40.681 14.390  1.00 31.51  ? 456  ARG A N     1 
ATOM   4447 C  CA    . ARG E 3 479 ? 19.581  -41.344 13.116  1.00 31.50  ? 456  ARG A CA    1 
ATOM   4448 C  C     . ARG E 3 479 ? 19.942  -42.809 13.282  1.00 32.92  ? 456  ARG A C     1 
ATOM   4449 O  O     . ARG E 3 479 ? 20.794  -43.166 14.093  1.00 32.48  ? 456  ARG A O     1 
ATOM   4450 C  CB    . ARG E 3 479 ? 20.691  -40.614 12.362  1.00 32.17  ? 456  ARG A CB    1 
ATOM   4451 C  CG    . ARG E 3 479 ? 21.121  -41.257 11.048  1.00 34.81  ? 456  ARG A CG    1 
ATOM   4452 C  CD    . ARG E 3 479 ? 21.979  -40.282 10.254  1.00 34.08  ? 456  ARG A CD    1 
ATOM   4453 N  NE    . ARG E 3 479 ? 22.992  -39.669 11.108  1.00 36.45  ? 456  ARG A NE    1 
ATOM   4454 C  CZ    . ARG E 3 479 ? 23.459  -38.434 10.953  1.00 36.85  ? 456  ARG A CZ    1 
ATOM   4455 N  NH1   . ARG E 3 479 ? 24.382  -37.965 11.783  1.00 37.39  ? 456  ARG A NH1   1 
ATOM   4456 N  NH2   . ARG E 3 479 ? 22.999  -37.663 9.975   1.00 36.03  ? 456  ARG A NH2   1 
ATOM   4457 N  N     . LYS E 3 480 ? 19.275  -43.656 12.507  1.00 35.24  ? 457  LYS A N     1 
ATOM   4458 C  CA    . LYS E 3 480 ? 19.519  -45.090 12.550  1.00 37.74  ? 457  LYS A CA    1 
ATOM   4459 C  C     . LYS E 3 480 ? 19.963  -45.552 11.166  1.00 38.64  ? 457  LYS A C     1 
ATOM   4460 O  O     . LYS E 3 480 ? 19.288  -45.294 10.170  1.00 37.91  ? 457  LYS A O     1 
ATOM   4461 C  CB    . LYS E 3 480 ? 18.245  -45.833 12.967  1.00 38.37  ? 457  LYS A CB    1 
ATOM   4462 C  CG    . LYS E 3 480 ? 18.432  -47.330 13.231  1.00 39.20  ? 457  LYS A CG    1 
ATOM   4463 C  CD    . LYS E 3 480 ? 17.086  -48.014 13.438  1.00 41.35  ? 457  LYS A CD    1 
ATOM   4464 C  CE    . LYS E 3 480 ? 17.224  -49.505 13.703  1.00 41.88  ? 457  LYS A CE    1 
ATOM   4465 N  NZ    . LYS E 3 480 ? 17.738  -49.783 15.071  1.00 43.17  ? 457  LYS A NZ    1 
ATOM   4466 N  N     . SER E 3 481 ? 21.107  -46.226 11.114  1.00 40.55  ? 458  SER A N     1 
ATOM   4467 C  CA    . SER E 3 481 ? 21.652  -46.732 9.859   1.00 42.90  ? 458  SER A CA    1 
ATOM   4468 C  C     . SER E 3 481 ? 21.703  -48.257 9.887   1.00 44.00  ? 458  SER A C     1 
ATOM   4469 O  O     . SER E 3 481 ? 21.991  -48.854 10.924  1.00 45.87  ? 458  SER A O     1 
ATOM   4470 C  CB    . SER E 3 481 ? 23.055  -46.169 9.636   1.00 43.68  ? 458  SER A CB    1 
ATOM   4471 O  OG    . SER E 3 481 ? 23.654  -46.731 8.483   1.00 46.31  ? 458  SER A OG    1 
ATOM   4472 N  N     . GLY E 3 482 ? 21.422  -48.884 8.749   1.00 44.18  ? 459  GLY A N     1 
ATOM   4473 C  CA    . GLY E 3 482 ? 21.441  -50.334 8.685   1.00 44.86  ? 459  GLY A CA    1 
ATOM   4474 C  C     . GLY E 3 482 ? 21.337  -50.867 7.270   1.00 46.20  ? 459  GLY A C     1 
ATOM   4475 O  O     . GLY E 3 482 ? 20.948  -50.137 6.364   1.00 46.26  ? 459  GLY A O     1 
ATOM   4476 N  N     . PRO E 3 483 ? 21.673  -52.147 7.048   1.00 48.10  ? 460  PRO A N     1 
ATOM   4477 C  CA    . PRO E 3 483 ? 21.623  -52.790 5.731   1.00 49.46  ? 460  PRO A CA    1 
ATOM   4478 C  C     . PRO E 3 483 ? 20.227  -53.197 5.265   1.00 50.29  ? 460  PRO A C     1 
ATOM   4479 O  O     . PRO E 3 483 ? 19.441  -53.736 6.040   1.00 50.26  ? 460  PRO A O     1 
ATOM   4480 C  CB    . PRO E 3 483 ? 22.526  -53.999 5.920   1.00 49.13  ? 460  PRO A CB    1 
ATOM   4481 C  CG    . PRO E 3 483 ? 22.204  -54.400 7.322   1.00 47.70  ? 460  PRO A CG    1 
ATOM   4482 C  CD    . PRO E 3 483 ? 22.230  -53.072 8.052   1.00 47.93  ? 460  PRO A CD    1 
ATOM   4483 N  N     . VAL E 3 484 ? 19.927  -52.938 3.996   1.00 52.69  ? 461  VAL A N     1 
ATOM   4484 C  CA    . VAL E 3 484 ? 18.634  -53.304 3.424   1.00 56.41  ? 461  VAL A CA    1 
ATOM   4485 C  C     . VAL E 3 484 ? 18.798  -54.602 2.637   1.00 59.23  ? 461  VAL A C     1 
ATOM   4486 O  O     . VAL E 3 484 ? 19.655  -54.705 1.757   1.00 58.94  ? 461  VAL A O     1 
ATOM   4487 C  CB    . VAL E 3 484 ? 18.087  -52.202 2.483   1.00 55.33  ? 461  VAL A CB    1 
ATOM   4488 C  CG1   . VAL E 3 484 ? 19.068  -51.933 1.361   1.00 55.57  ? 461  VAL A CG1   1 
ATOM   4489 C  CG2   . VAL E 3 484 ? 16.743  -52.625 1.916   1.00 54.94  ? 461  VAL A CG2   1 
ATOM   4490 N  N     . ALA E 3 485 ? 17.976  -55.595 2.963   1.00 62.92  ? 462  ALA A N     1 
ATOM   4491 C  CA    . ALA E 3 485 ? 18.047  -56.893 2.304   1.00 66.15  ? 462  ALA A CA    1 
ATOM   4492 C  C     . ALA E 3 485 ? 16.979  -57.067 1.234   1.00 68.44  ? 462  ALA A C     1 
ATOM   4493 O  O     . ALA E 3 485 ? 15.812  -56.735 1.444   1.00 69.01  ? 462  ALA A O     1 
ATOM   4494 C  CB    . ALA E 3 485 ? 17.931  -58.006 3.340   1.00 65.99  ? 462  ALA A CB    1 
ATOM   4495 N  N     . TYR E 3 486 ? 17.389  -57.597 0.087   1.00 71.14  ? 463  TYR A N     1 
ATOM   4496 C  CA    . TYR E 3 486 ? 16.477  -57.825 -1.025  1.00 73.92  ? 463  TYR A CA    1 
ATOM   4497 C  C     . TYR E 3 486 ? 16.268  -59.318 -1.269  1.00 76.28  ? 463  TYR A C     1 
ATOM   4498 O  O     . TYR E 3 486 ? 17.225  -60.065 -1.476  1.00 76.96  ? 463  TYR A O     1 
ATOM   4499 C  CB    . TYR E 3 486 ? 17.026  -57.159 -2.288  1.00 73.16  ? 463  TYR A CB    1 
ATOM   4500 C  CG    . TYR E 3 486 ? 17.058  -55.649 -2.215  1.00 72.82  ? 463  TYR A CG    1 
ATOM   4501 C  CD1   . TYR E 3 486 ? 15.878  -54.908 -2.203  1.00 72.75  ? 463  TYR A CD1   1 
ATOM   4502 C  CD2   . TYR E 3 486 ? 18.269  -54.959 -2.163  1.00 73.07  ? 463  TYR A CD2   1 
ATOM   4503 C  CE1   . TYR E 3 486 ? 15.900  -53.519 -2.144  1.00 73.21  ? 463  TYR A CE1   1 
ATOM   4504 C  CE2   . TYR E 3 486 ? 18.303  -53.568 -2.103  1.00 73.22  ? 463  TYR A CE2   1 
ATOM   4505 C  CZ    . TYR E 3 486 ? 17.115  -52.855 -2.096  1.00 73.13  ? 463  TYR A CZ    1 
ATOM   4506 O  OH    . TYR E 3 486 ? 17.143  -51.480 -2.052  1.00 74.03  ? 463  TYR A OH    1 
ATOM   4507 N  N     . LYS E 3 487 ? 15.012  -59.747 -1.241  0.00 78.58  ? 464  LYS A N     1 
ATOM   4508 C  CA    . LYS E 3 487 ? 14.682  -61.150 -1.457  0.00 80.93  ? 464  LYS A CA    1 
ATOM   4509 C  C     . LYS E 3 487 ? 13.489  -61.304 -2.393  0.00 82.52  ? 464  LYS A C     1 
ATOM   4510 O  O     . LYS E 3 487 ? 12.400  -60.801 -2.117  0.00 82.61  ? 464  LYS A O     1 
ATOM   4511 C  CB    . LYS E 3 487 ? 14.382  -61.830 -0.119  0.00 81.15  ? 464  LYS A CB    1 
ATOM   4512 C  CG    . LYS E 3 487 ? 13.314  -61.132 0.709   0.00 81.57  ? 464  LYS A CG    1 
ATOM   4513 C  CD    . LYS E 3 487 ? 13.048  -61.853 2.025   0.00 81.86  ? 464  LYS A CD    1 
ATOM   4514 C  CE    . LYS E 3 487 ? 12.361  -63.197 1.814   0.00 82.05  ? 464  LYS A CE    1 
ATOM   4515 N  NZ    . LYS E 3 487 ? 13.204  -64.176 1.073   0.00 82.23  ? 464  LYS A NZ    1 
ATOM   4516 N  N     . GLY E 3 488 ? 13.703  -62.002 -3.503  0.00 84.28  ? 465  GLY A N     1 
ATOM   4517 C  CA    . GLY E 3 488 ? 12.632  -62.212 -4.458  0.00 86.57  ? 465  GLY A CA    1 
ATOM   4518 C  C     . GLY E 3 488 ? 12.877  -61.555 -5.803  0.00 88.22  ? 465  GLY A C     1 
ATOM   4519 O  O     . GLY E 3 488 ? 13.447  -62.168 -6.706  0.00 88.27  ? 465  GLY A O     1 
ATOM   4520 N  N     . ILE E 3 489 ? 12.448  -60.304 -5.937  0.00 89.93  ? 466  ILE A N     1 
ATOM   4521 C  CA    . ILE E 3 489 ? 12.612  -59.570 -7.187  0.00 91.79  ? 466  ILE A CA    1 
ATOM   4522 C  C     . ILE E 3 489 ? 13.328  -58.237 -6.965  0.00 93.00  ? 466  ILE A C     1 
ATOM   4523 O  O     . ILE E 3 489 ? 13.103  -57.270 -7.694  0.00 93.17  ? 466  ILE A O     1 
ATOM   4524 C  CB    . ILE E 3 489 ? 11.239  -59.302 -7.846  0.00 91.82  ? 466  ILE A CB    1 
ATOM   4525 C  CG1   . ILE E 3 489 ? 10.386  -60.572 -7.802  0.00 91.96  ? 466  ILE A CG1   1 
ATOM   4526 C  CG2   . ILE E 3 489 ? 11.428  -58.873 -9.295  0.00 91.93  ? 466  ILE A CG2   1 
ATOM   4527 C  CD1   . ILE E 3 489 ? 8.979   -60.390 -8.335  0.00 92.04  ? 466  ILE A CD1   1 
ATOM   4528 N  N     . ASN E 3 490 ? 14.191  -58.196 -5.954  1.00 94.57  ? 467  ASN A N     1 
ATOM   4529 C  CA    . ASN E 3 490 ? 14.956  -56.994 -5.620  1.00 95.84  ? 467  ASN A CA    1 
ATOM   4530 C  C     . ASN E 3 490 ? 14.184  -55.676 -5.779  1.00 96.59  ? 467  ASN A C     1 
ATOM   4531 O  O     . ASN E 3 490 ? 14.711  -54.700 -6.321  1.00 96.62  ? 467  ASN A O     1 
ATOM   4532 C  CB    . ASN E 3 490 ? 16.254  -56.950 -6.447  1.00 95.63  ? 467  ASN A CB    1 
ATOM   4533 C  CG    . ASN E 3 490 ? 16.010  -57.099 -7.943  1.00 95.63  ? 467  ASN A CG    1 
ATOM   4534 O  OD1   . ASN E 3 490 ? 15.404  -56.235 -8.577  1.00 95.80  ? 467  ASN A OD1   1 
ATOM   4535 N  ND2   . ASN E 3 490 ? 16.486  -58.202 -8.512  1.00 94.83  ? 467  ASN A ND2   1 
ATOM   4536 N  N     . PHE E 3 491 ? 12.941  -55.657 -5.295  1.00 96.67  ? 468  PHE A N     1 
ATOM   4537 C  CA    . PHE E 3 491 ? 12.085  -54.469 -5.363  1.00 95.62  ? 468  PHE A CA    1 
ATOM   4538 C  C     . PHE E 3 491 ? 12.693  -53.308 -4.581  1.00 94.61  ? 468  PHE A C     1 
ATOM   4539 O  O     . PHE E 3 491 ? 12.337  -53.079 -3.423  1.00 94.00  ? 468  PHE A O     1 
ATOM   4540 C  CB    . PHE E 3 491 ? 10.691  -54.770 -4.790  1.00 96.03  ? 468  PHE A CB    1 
ATOM   4541 C  CG    . PHE E 3 491 ? 9.791   -55.549 -5.716  1.00 96.77  ? 468  PHE A CG    1 
ATOM   4542 C  CD1   . PHE E 3 491 ? 8.584   -56.067 -5.249  1.00 97.14  ? 468  PHE A CD1   1 
ATOM   4543 C  CD2   . PHE E 3 491 ? 10.134  -55.757 -7.051  1.00 97.46  ? 468  PHE A CD2   1 
ATOM   4544 C  CE1   . PHE E 3 491 ? 7.731   -56.781 -6.093  1.00 97.07  ? 468  PHE A CE1   1 
ATOM   4545 C  CE2   . PHE E 3 491 ? 9.286   -56.469 -7.905  1.00 98.15  ? 468  PHE A CE2   1 
ATOM   4546 C  CZ    . PHE E 3 491 ? 8.083   -56.983 -7.422  1.00 97.49  ? 468  PHE A CZ    1 
ATOM   4547 N  N     . GLN E 3 492 ? 13.605  -52.575 -5.214  1.00 93.97  ? 469  GLN A N     1 
ATOM   4548 C  CA    . GLN E 3 492 ? 14.245  -51.438 -4.561  1.00 92.58  ? 469  GLN A CA    1 
ATOM   4549 C  C     . GLN E 3 492 ? 13.283  -50.251 -4.488  1.00 91.11  ? 469  GLN A C     1 
ATOM   4550 O  O     . GLN E 3 492 ? 13.695  -49.094 -4.598  1.00 91.32  ? 469  GLN A O     1 
ATOM   4551 C  CB    . GLN E 3 492 ? 15.525  -51.037 -5.311  1.00 91.93  ? 469  GLN A CB    1 
ATOM   4552 C  CG    . GLN E 3 492 ? 15.311  -50.600 -6.753  1.00 92.31  ? 469  GLN A CG    1 
ATOM   4553 C  CD    . GLN E 3 492 ? 14.837  -51.729 -7.647  0.00 92.20  ? 469  GLN A CD    1 
ATOM   4554 O  OE1   . GLN E 3 492 ? 15.537  -52.724 -7.834  0.00 92.25  ? 469  GLN A OE1   1 
ATOM   4555 N  NE2   . GLN E 3 492 ? 13.642  -51.578 -8.207  0.00 92.25  ? 469  GLN A NE2   1 
ATOM   4556 N  N     . SER E 3 493 ? 11.999  -50.554 -4.297  1.00 88.31  ? 470  SER A N     1 
ATOM   4557 C  CA    . SER E 3 493 ? 10.959  -49.535 -4.202  1.00 84.81  ? 470  SER A CA    1 
ATOM   4558 C  C     . SER E 3 493 ? 9.902   -49.951 -3.187  1.00 82.48  ? 470  SER A C     1 
ATOM   4559 O  O     . SER E 3 493 ? 8.839   -49.336 -3.097  1.00 82.36  ? 470  SER A O     1 
ATOM   4560 C  CB    . SER E 3 493 ? 10.303  -49.320 -5.568  0.00 85.14  ? 470  SER A CB    1 
ATOM   4561 O  OG    . SER E 3 493 ? 9.303   -48.318 -5.501  0.00 84.98  ? 470  SER A OG    1 
ATOM   4562 N  N     . HIS E 3 494 ? 10.200  -51.002 -2.429  1.00 79.78  ? 471  HIS A N     1 
ATOM   4563 C  CA    . HIS E 3 494 ? 9.286   -51.509 -1.410  1.00 77.27  ? 471  HIS A CA    1 
ATOM   4564 C  C     . HIS E 3 494 ? 10.048  -51.914 -0.157  1.00 73.55  ? 471  HIS A C     1 
ATOM   4565 O  O     . HIS E 3 494 ? 9.822   -51.369 0.921   1.00 73.45  ? 471  HIS A O     1 
ATOM   4566 C  CB    . HIS E 3 494 ? 8.503   -52.714 -1.939  1.00 80.58  ? 471  HIS A CB    1 
ATOM   4567 C  CG    . HIS E 3 494 ? 7.708   -53.427 -0.888  1.00 83.61  ? 471  HIS A CG    1 
ATOM   4568 N  ND1   . HIS E 3 494 ? 8.296   -54.097 0.164   1.00 84.80  ? 471  HIS A ND1   1 
ATOM   4569 C  CD2   . HIS E 3 494 ? 6.371   -53.563 -0.719  1.00 85.36  ? 471  HIS A CD2   1 
ATOM   4570 C  CE1   . HIS E 3 494 ? 7.356   -54.613 0.936   1.00 85.61  ? 471  HIS A CE1   1 
ATOM   4571 N  NE2   . HIS E 3 494 ? 6.179   -54.304 0.423   1.00 86.42  ? 471  HIS A NE2   1 
ATOM   4572 N  N     . GLU E 3 495 ? 10.948  -52.878 -0.302  1.00 69.45  ? 472  GLU A N     1 
ATOM   4573 C  CA    . GLU E 3 495 ? 11.734  -53.342 0.830   1.00 65.18  ? 472  GLU A CA    1 
ATOM   4574 C  C     . GLU E 3 495 ? 12.569  -52.204 1.395   1.00 60.00  ? 472  GLU A C     1 
ATOM   4575 O  O     . GLU E 3 495 ? 13.010  -52.254 2.541   1.00 59.95  ? 472  GLU A O     1 
ATOM   4576 C  CB    . GLU E 3 495 ? 12.630  -54.504 0.408   1.00 67.84  ? 472  GLU A CB    1 
ATOM   4577 C  CG    . GLU E 3 495 ? 11.840  -55.715 -0.053  1.00 71.93  ? 472  GLU A CG    1 
ATOM   4578 C  CD    . GLU E 3 495 ? 12.700  -56.947 -0.218  1.00 74.69  ? 472  GLU A CD    1 
ATOM   4579 O  OE1   . GLU E 3 495 ? 13.626  -56.917 -1.056  1.00 76.30  ? 472  GLU A OE1   1 
ATOM   4580 O  OE2   . GLU E 3 495 ? 12.449  -57.945 0.492   1.00 76.48  ? 472  GLU A OE2   1 
ATOM   4581 N  N     . LEU E 3 496 ? 12.777  -51.177 0.580   1.00 54.08  ? 473  LEU A N     1 
ATOM   4582 C  CA    . LEU E 3 496 ? 13.537  -50.011 1.001   1.00 47.37  ? 473  LEU A CA    1 
ATOM   4583 C  C     . LEU E 3 496 ? 12.672  -49.298 2.037   1.00 43.67  ? 473  LEU A C     1 
ATOM   4584 O  O     . LEU E 3 496 ? 13.136  -48.929 3.114   1.00 42.97  ? 473  LEU A O     1 
ATOM   4585 C  CB    . LEU E 3 496 ? 13.786  -49.095 -0.198  1.00 47.28  ? 473  LEU A CB    1 
ATOM   4586 C  CG    . LEU E 3 496 ? 15.063  -48.252 -0.220  1.00 46.39  ? 473  LEU A CG    1 
ATOM   4587 C  CD1   . LEU E 3 496 ? 15.024  -47.326 -1.421  1.00 44.96  ? 473  LEU A CD1   1 
ATOM   4588 C  CD2   . LEU E 3 496 ? 15.190  -47.449 1.058   1.00 48.10  ? 473  LEU A CD2   1 
ATOM   4589 N  N     . LEU E 3 497 ? 11.400  -49.122 1.699   1.00 39.40  ? 474  LEU A N     1 
ATOM   4590 C  CA    . LEU E 3 497 ? 10.441  -48.472 2.581   1.00 36.75  ? 474  LEU A CA    1 
ATOM   4591 C  C     . LEU E 3 497 ? 10.194  -49.313 3.828   1.00 37.24  ? 474  LEU A C     1 
ATOM   4592 O  O     . LEU E 3 497 ? 9.961   -48.784 4.912   1.00 38.29  ? 474  LEU A O     1 
ATOM   4593 C  CB    . LEU E 3 497 ? 9.120   -48.263 1.842   1.00 34.01  ? 474  LEU A CB    1 
ATOM   4594 C  CG    . LEU E 3 497 ? 7.900   -47.846 2.662   1.00 32.07  ? 474  LEU A CG    1 
ATOM   4595 C  CD1   . LEU E 3 497 ? 8.098   -46.457 3.248   1.00 33.56  ? 474  LEU A CD1   1 
ATOM   4596 C  CD2   . LEU E 3 497 ? 6.680   -47.871 1.767   1.00 30.29  ? 474  LEU A CD2   1 
ATOM   4597 N  N     . LYS E 3 498 ? 10.238  -50.629 3.664   1.00 37.40  ? 475  LYS A N     1 
ATOM   4598 C  CA    . LYS E 3 498 ? 10.014  -51.554 4.768   1.00 35.69  ? 475  LYS A CA    1 
ATOM   4599 C  C     . LYS E 3 498 ? 11.026  -51.297 5.872   1.00 34.04  ? 475  LYS A C     1 
ATOM   4600 O  O     . LYS E 3 498 ? 10.668  -51.205 7.047   1.00 33.02  ? 475  LYS A O     1 
ATOM   4601 C  CB    . LYS E 3 498 ? 10.139  -52.992 4.267   1.00 38.05  ? 475  LYS A CB    1 
ATOM   4602 C  CG    . LYS E 3 498 ? 9.826   -54.059 5.298   1.00 40.91  ? 475  LYS A CG    1 
ATOM   4603 C  CD    . LYS E 3 498 ? 9.939   -55.444 4.676   1.00 43.81  ? 475  LYS A CD    1 
ATOM   4604 C  CE    . LYS E 3 498 ? 9.678   -56.546 5.691   1.00 45.47  ? 475  LYS A CE    1 
ATOM   4605 N  NZ    . LYS E 3 498 ? 9.813   -57.900 5.076   1.00 46.16  ? 475  LYS A NZ    1 
ATOM   4606 N  N     . VAL E 3 499 ? 12.292  -51.182 5.485   1.00 32.90  ? 476  VAL A N     1 
ATOM   4607 C  CA    . VAL E 3 499 ? 13.364  -50.929 6.439   1.00 32.94  ? 476  VAL A CA    1 
ATOM   4608 C  C     . VAL E 3 499 ? 13.211  -49.522 7.007   1.00 32.14  ? 476  VAL A C     1 
ATOM   4609 O  O     . VAL E 3 499 ? 13.401  -49.297 8.203   1.00 30.69  ? 476  VAL A O     1 
ATOM   4610 C  CB    . VAL E 3 499 ? 14.759  -51.056 5.771   1.00 32.24  ? 476  VAL A CB    1 
ATOM   4611 C  CG1   . VAL E 3 499 ? 15.856  -50.757 6.785   1.00 31.35  ? 476  VAL A CG1   1 
ATOM   4612 C  CG2   . VAL E 3 499 ? 14.937  -52.451 5.202   1.00 30.77  ? 476  VAL A CG2   1 
ATOM   4613 N  N     . GLY E 3 500 ? 12.865  -48.579 6.137   1.00 31.82  ? 477  GLY A N     1 
ATOM   4614 C  CA    . GLY E 3 500 ? 12.689  -47.207 6.569   1.00 30.10  ? 477  GLY A CA    1 
ATOM   4615 C  C     . GLY E 3 500 ? 11.714  -47.118 7.724   1.00 29.24  ? 477  GLY A C     1 
ATOM   4616 O  O     . GLY E 3 500 ? 11.990  -46.470 8.731   1.00 31.47  ? 477  GLY A O     1 
ATOM   4617 N  N     . ILE E 3 501 ? 10.574  -47.783 7.587   1.00 26.91  ? 478  ILE A N     1 
ATOM   4618 C  CA    . ILE E 3 501 ? 9.561   -47.763 8.629   1.00 25.80  ? 478  ILE A CA    1 
ATOM   4619 C  C     . ILE E 3 501 ? 10.086  -48.298 9.959   1.00 27.49  ? 478  ILE A C     1 
ATOM   4620 O  O     . ILE E 3 501 ? 9.893   -47.680 11.003  1.00 27.68  ? 478  ILE A O     1 
ATOM   4621 C  CB    . ILE E 3 501 ? 8.329   -48.571 8.209   1.00 23.29  ? 478  ILE A CB    1 
ATOM   4622 C  CG1   . ILE E 3 501 ? 7.788   -48.027 6.884   1.00 23.65  ? 478  ILE A CG1   1 
ATOM   4623 C  CG2   . ILE E 3 501 ? 7.268   -48.481 9.283   1.00 21.58  ? 478  ILE A CG2   1 
ATOM   4624 C  CD1   . ILE E 3 501 ? 6.587   -48.766 6.347   1.00 20.76  ? 478  ILE A CD1   1 
ATOM   4625 N  N     . LYS E 3 502 ? 10.750  -49.447 9.930   1.00 28.76  ? 479  LYS A N     1 
ATOM   4626 C  CA    . LYS E 3 502 ? 11.286  -50.007 11.163  1.00 29.47  ? 479  LYS A CA    1 
ATOM   4627 C  C     . LYS E 3 502 ? 12.145  -48.943 11.844  1.00 29.92  ? 479  LYS A C     1 
ATOM   4628 O  O     . LYS E 3 502 ? 11.894  -48.561 12.988  1.00 29.97  ? 479  LYS A O     1 
ATOM   4629 C  CB    . LYS E 3 502 ? 12.124  -51.251 10.860  1.00 29.33  ? 479  LYS A CB    1 
ATOM   4630 C  CG    . LYS E 3 502 ? 12.737  -51.904 12.092  1.00 33.18  ? 479  LYS A CG    1 
ATOM   4631 C  CD    . LYS E 3 502 ? 13.434  -53.217 11.738  1.00 36.80  ? 479  LYS A CD    1 
ATOM   4632 C  CE    . LYS E 3 502 ? 14.165  -53.819 12.936  1.00 37.21  ? 479  LYS A CE    1 
ATOM   4633 N  NZ    . LYS E 3 502 ? 15.292  -52.959 13.407  1.00 37.79  ? 479  LYS A NZ    1 
ATOM   4634 N  N     . PHE E 3 503 ? 13.145  -48.457 11.117  1.00 30.11  ? 480  PHE A N     1 
ATOM   4635 C  CA    . PHE E 3 503 ? 14.063  -47.438 11.611  1.00 28.59  ? 480  PHE A CA    1 
ATOM   4636 C  C     . PHE E 3 503 ? 13.348  -46.220 12.182  1.00 28.48  ? 480  PHE A C     1 
ATOM   4637 O  O     . PHE E 3 503 ? 13.640  -45.784 13.297  1.00 27.47  ? 480  PHE A O     1 
ATOM   4638 C  CB    . PHE E 3 503 ? 14.996  -47.000 10.481  1.00 29.73  ? 480  PHE A CB    1 
ATOM   4639 C  CG    . PHE E 3 503 ? 16.096  -47.976 10.189  1.00 32.63  ? 480  PHE A CG    1 
ATOM   4640 C  CD1   . PHE E 3 503 ? 15.906  -49.341 10.374  1.00 33.81  ? 480  PHE A CD1   1 
ATOM   4641 C  CD2   . PHE E 3 503 ? 17.323  -47.530 9.715   1.00 35.46  ? 480  PHE A CD2   1 
ATOM   4642 C  CE1   . PHE E 3 503 ? 16.922  -50.248 10.091  1.00 35.43  ? 480  PHE A CE1   1 
ATOM   4643 C  CE2   . PHE E 3 503 ? 18.348  -48.431 9.427   1.00 36.85  ? 480  PHE A CE2   1 
ATOM   4644 C  CZ    . PHE E 3 503 ? 18.146  -49.792 9.618   1.00 36.39  ? 480  PHE A CZ    1 
ATOM   4645 N  N     . VAL E 3 504 ? 12.417  -45.660 11.420  1.00 27.49  ? 481  VAL A N     1 
ATOM   4646 C  CA    . VAL E 3 504 ? 11.698  -44.494 11.901  1.00 28.03  ? 481  VAL A CA    1 
ATOM   4647 C  C     . VAL E 3 504 ? 10.888  -44.888 13.141  1.00 29.08  ? 481  VAL A C     1 
ATOM   4648 O  O     . VAL E 3 504 ? 10.645  -44.063 14.021  1.00 29.91  ? 481  VAL A O     1 
ATOM   4649 C  CB    . VAL E 3 504 ? 10.763  -43.913 10.806  1.00 26.40  ? 481  VAL A CB    1 
ATOM   4650 C  CG1   . VAL E 3 504 ? 9.514   -44.752 10.678  1.00 26.73  ? 481  VAL A CG1   1 
ATOM   4651 C  CG2   . VAL E 3 504 ? 10.411  -42.476 11.132  1.00 27.46  ? 481  VAL A CG2   1 
ATOM   4652 N  N     . THR E 3 505 ? 10.493  -46.158 13.215  1.00 29.23  ? 482  THR A N     1 
ATOM   4653 C  CA    . THR E 3 505 ? 9.717   -46.648 14.350  1.00 29.04  ? 482  THR A CA    1 
ATOM   4654 C  C     . THR E 3 505 ? 10.598  -46.889 15.566  1.00 29.62  ? 482  THR A C     1 
ATOM   4655 O  O     . THR E 3 505 ? 10.178  -46.646 16.694  1.00 29.64  ? 482  THR A O     1 
ATOM   4656 C  CB    . THR E 3 505 ? 8.974   -47.962 14.012  1.00 29.16  ? 482  THR A CB    1 
ATOM   4657 O  OG1   . THR E 3 505 ? 7.967   -47.705 13.025  1.00 28.04  ? 482  THR A OG1   1 
ATOM   4658 C  CG2   . THR E 3 505 ? 8.306   -48.536 15.253  1.00 27.32  ? 482  THR A CG2   1 
ATOM   4659 N  N     . ASP E 3 506 ? 11.815  -47.371 15.336  1.00 31.48  ? 483  ASP A N     1 
ATOM   4660 C  CA    . ASP E 3 506 ? 12.748  -47.632 16.430  1.00 34.60  ? 483  ASP A CA    1 
ATOM   4661 C  C     . ASP E 3 506 ? 13.172  -46.320 17.086  1.00 33.67  ? 483  ASP A C     1 
ATOM   4662 O  O     . ASP E 3 506 ? 13.457  -46.274 18.282  1.00 33.39  ? 483  ASP A O     1 
ATOM   4663 C  CB    . ASP E 3 506 ? 13.992  -48.370 15.919  1.00 39.13  ? 483  ASP A CB    1 
ATOM   4664 C  CG    . ASP E 3 506 ? 13.673  -49.755 15.365  1.00 45.29  ? 483  ASP A CG    1 
ATOM   4665 O  OD1   . ASP E 3 506 ? 14.630  -50.485 15.022  1.00 48.34  ? 483  ASP A OD1   1 
ATOM   4666 O  OD2   . ASP E 3 506 ? 12.477  -50.117 15.269  1.00 47.12  ? 483  ASP A OD2   1 
ATOM   4667 N  N     . LEU E 3 507 ? 13.214  -45.258 16.286  1.00 32.79  ? 484  LEU A N     1 
ATOM   4668 C  CA    . LEU E 3 507 ? 13.592  -43.937 16.771  1.00 30.67  ? 484  LEU A CA    1 
ATOM   4669 C  C     . LEU E 3 507 ? 12.423  -43.312 17.518  1.00 30.20  ? 484  LEU A C     1 
ATOM   4670 O  O     . LEU E 3 507 ? 12.616  -42.515 18.432  1.00 31.44  ? 484  LEU A O     1 
ATOM   4671 C  CB    . LEU E 3 507 ? 14.004  -43.042 15.599  1.00 29.10  ? 484  LEU A CB    1 
ATOM   4672 C  CG    . LEU E 3 507 ? 15.287  -43.459 14.877  1.00 27.77  ? 484  LEU A CG    1 
ATOM   4673 C  CD1   . LEU E 3 507 ? 15.453  -42.666 13.598  1.00 27.10  ? 484  LEU A CD1   1 
ATOM   4674 C  CD2   . LEU E 3 507 ? 16.473  -43.242 15.803  1.00 28.43  ? 484  LEU A CD2   1 
ATOM   4675 N  N     . ASP E 3 508 ? 11.209  -43.675 17.119  1.00 29.05  ? 485  ASP A N     1 
ATOM   4676 C  CA    . ASP E 3 508 ? 10.013  -43.160 17.771  1.00 29.00  ? 485  ASP A CA    1 
ATOM   4677 C  C     . ASP E 3 508 ? 10.014  -43.664 19.207  1.00 29.68  ? 485  ASP A C     1 
ATOM   4678 O  O     . ASP E 3 508 ? 9.518   -42.997 20.116  1.00 29.87  ? 485  ASP A O     1 
ATOM   4679 C  CB    . ASP E 3 508 ? 8.756   -43.665 17.065  1.00 28.13  ? 485  ASP A CB    1 
ATOM   4680 C  CG    . ASP E 3 508 ? 7.483   -43.170 17.722  1.00 26.79  ? 485  ASP A CG    1 
ATOM   4681 O  OD1   . ASP E 3 508 ? 7.172   -41.968 17.589  1.00 24.35  ? 485  ASP A OD1   1 
ATOM   4682 O  OD2   . ASP E 3 508 ? 6.800   -43.982 18.379  1.00 27.02  ? 485  ASP A OD2   1 
ATOM   4683 N  N     . ILE E 3 509 ? 10.576  -44.853 19.396  1.00 30.09  ? 486  ILE A N     1 
ATOM   4684 C  CA    . ILE E 3 509 ? 10.656  -45.475 20.711  1.00 30.01  ? 486  ILE A CA    1 
ATOM   4685 C  C     . ILE E 3 509 ? 11.832  -44.928 21.510  1.00 30.56  ? 486  ILE A C     1 
ATOM   4686 O  O     . ILE E 3 509 ? 11.773  -44.848 22.736  1.00 30.46  ? 486  ILE A O     1 
ATOM   4687 C  CB    . ILE E 3 509 ? 10.809  -47.014 20.592  1.00 28.71  ? 486  ILE A CB    1 
ATOM   4688 C  CG1   . ILE E 3 509 ? 9.542   -47.618 19.980  1.00 28.82  ? 486  ILE A CG1   1 
ATOM   4689 C  CG2   . ILE E 3 509 ? 11.080  -47.625 21.957  1.00 27.50  ? 486  ILE A CG2   1 
ATOM   4690 C  CD1   . ILE E 3 509 ? 9.585   -49.130 19.836  1.00 29.24  ? 486  ILE A CD1   1 
ATOM   4691 N  N     . LYS E 3 510 ? 12.896  -44.539 20.814  1.00 31.09  ? 487  LYS A N     1 
ATOM   4692 C  CA    . LYS E 3 510 ? 14.076  -44.026 21.492  1.00 33.25  ? 487  LYS A CA    1 
ATOM   4693 C  C     . LYS E 3 510 ? 13.877  -42.639 22.100  1.00 34.08  ? 487  LYS A C     1 
ATOM   4694 O  O     . LYS E 3 510 ? 14.658  -42.214 22.955  1.00 35.13  ? 487  LYS A O     1 
ATOM   4695 C  CB    . LYS E 3 510 ? 15.277  -44.013 20.540  1.00 34.44  ? 487  LYS A CB    1 
ATOM   4696 C  CG    . LYS E 3 510 ? 16.606  -43.804 21.259  1.00 37.73  ? 487  LYS A CG    1 
ATOM   4697 C  CD    . LYS E 3 510 ? 17.809  -44.018 20.350  1.00 41.89  ? 487  LYS A CD    1 
ATOM   4698 C  CE    . LYS E 3 510 ? 17.914  -42.944 19.275  1.00 43.36  ? 487  LYS A CE    1 
ATOM   4699 N  NZ    . LYS E 3 510 ? 19.107  -43.148 18.402  1.00 43.50  ? 487  LYS A NZ    1 
ATOM   4700 N  N     . GLY E 3 511 ? 12.832  -41.938 21.674  1.00 33.30  ? 488  GLY A N     1 
ATOM   4701 C  CA    . GLY E 3 511 ? 12.581  -40.612 22.211  1.00 32.89  ? 488  GLY A CA    1 
ATOM   4702 C  C     . GLY E 3 511 ? 11.139  -40.414 22.631  1.00 33.57  ? 488  GLY A C     1 
ATOM   4703 O  O     . GLY E 3 511 ? 10.475  -39.495 22.158  1.00 35.30  ? 488  GLY A O     1 
ATOM   4704 N  N     . LYS E 3 512 ? 10.654  -41.271 23.527  1.00 32.19  ? 489  LYS A N     1 
ATOM   4705 C  CA    . LYS E 3 512 ? 9.275   -41.194 24.000  1.00 31.12  ? 489  LYS A CA    1 
ATOM   4706 C  C     . LYS E 3 512 ? 8.958   -40.062 24.981  1.00 30.86  ? 489  LYS A C     1 
ATOM   4707 O  O     . LYS E 3 512 ? 7.940   -39.371 24.831  1.00 30.00  ? 489  LYS A O     1 
ATOM   4708 C  CB    . LYS E 3 512 ? 8.863   -42.531 24.619  1.00 30.64  ? 489  LYS A CB    1 
ATOM   4709 C  CG    . LYS E 3 512 ? 8.231   -43.494 23.633  1.00 31.94  ? 489  LYS A CG    1 
ATOM   4710 C  CD    . LYS E 3 512 ? 6.936   -42.920 23.078  1.00 32.44  ? 489  LYS A CD    1 
ATOM   4711 C  CE    . LYS E 3 512 ? 6.383   -43.779 21.959  1.00 33.81  ? 489  LYS A CE    1 
ATOM   4712 N  NZ    . LYS E 3 512 ? 5.256   -43.102 21.265  1.00 34.78  ? 489  LYS A NZ    1 
ATOM   4713 N  N     . ASN E 3 513 ? 9.808   -39.879 25.987  1.00 27.68  ? 490  ASN A N     1 
ATOM   4714 C  CA    . ASN E 3 513 ? 9.585   -38.832 26.972  1.00 27.35  ? 490  ASN A CA    1 
ATOM   4715 C  C     . ASN E 3 513 ? 10.664  -37.766 26.857  1.00 28.78  ? 490  ASN A C     1 
ATOM   4716 O  O     . ASN E 3 513 ? 11.159  -37.243 27.857  1.00 28.76  ? 490  ASN A O     1 
ATOM   4717 C  CB    . ASN E 3 513 ? 9.562   -39.429 28.381  1.00 27.90  ? 490  ASN A CB    1 
ATOM   4718 C  CG    . ASN E 3 513 ? 9.162   -38.415 29.441  1.00 27.97  ? 490  ASN A CG    1 
ATOM   4719 O  OD1   . ASN E 3 513 ? 8.218   -37.649 29.262  1.00 29.19  ? 490  ASN A OD1   1 
ATOM   4720 N  ND2   . ASN E 3 513 ? 9.874   -38.418 30.557  1.00 27.52  ? 490  ASN A ND2   1 
ATOM   4721 N  N     . LYS E 3 514 ? 11.024  -37.452 25.617  1.00 29.91  ? 491  LYS A N     1 
ATOM   4722 C  CA    . LYS E 3 514 ? 12.033  -36.441 25.337  1.00 30.88  ? 491  LYS A CA    1 
ATOM   4723 C  C     . LYS E 3 514 ? 11.550  -35.486 24.255  1.00 30.88  ? 491  LYS A C     1 
ATOM   4724 O  O     . LYS E 3 514 ? 10.524  -35.720 23.617  1.00 32.25  ? 491  LYS A O     1 
ATOM   4725 C  CB    . LYS E 3 514 ? 13.337  -37.106 24.892  1.00 30.41  ? 491  LYS A CB    1 
ATOM   4726 C  CG    . LYS E 3 514 ? 13.999  -37.901 25.994  1.00 32.22  ? 491  LYS A CG    1 
ATOM   4727 C  CD    . LYS E 3 514 ? 15.349  -38.440 25.579  1.00 33.03  ? 491  LYS A CD    1 
ATOM   4728 C  CE    . LYS E 3 514 ? 16.103  -38.975 26.792  1.00 35.94  ? 491  LYS A CE    1 
ATOM   4729 N  NZ    . LYS E 3 514 ? 16.375  -37.909 27.814  1.00 34.41  ? 491  LYS A NZ    1 
ATOM   4730 N  N     . SER E 3 515 ? 12.284  -34.398 24.061  1.00 29.60  ? 492  SER A N     1 
ATOM   4731 C  CA    . SER E 3 515 ? 11.924  -33.435 23.038  1.00 27.47  ? 492  SER A CA    1 
ATOM   4732 C  C     . SER E 3 515 ? 12.020  -34.198 21.724  1.00 26.68  ? 492  SER A C     1 
ATOM   4733 O  O     . SER E 3 515 ? 13.088  -34.702 21.376  1.00 27.41  ? 492  SER A O     1 
ATOM   4734 C  CB    . SER E 3 515 ? 12.906  -32.264 23.051  1.00 27.83  ? 492  SER A CB    1 
ATOM   4735 O  OG    . SER E 3 515 ? 12.472  -31.225 22.195  1.00 29.55  ? 492  SER A OG    1 
ATOM   4736 N  N     . TYR E 3 516 ? 10.901  -34.299 21.010  1.00 25.95  ? 493  TYR A N     1 
ATOM   4737 C  CA    . TYR E 3 516 ? 10.863  -35.022 19.742  1.00 25.07  ? 493  TYR A CA    1 
ATOM   4738 C  C     . TYR E 3 516 ? 9.914   -34.353 18.733  1.00 25.61  ? 493  TYR A C     1 
ATOM   4739 O  O     . TYR E 3 516 ? 10.343  -33.511 17.944  1.00 24.76  ? 493  TYR A O     1 
ATOM   4740 C  CB    . TYR E 3 516 ? 10.443  -36.471 20.008  1.00 24.52  ? 493  TYR A CB    1 
ATOM   4741 C  CG    . TYR E 3 516 ? 10.899  -37.467 18.965  1.00 24.62  ? 493  TYR A CG    1 
ATOM   4742 C  CD1   . TYR E 3 516 ? 10.005  -37.993 18.034  1.00 23.91  ? 493  TYR A CD1   1 
ATOM   4743 C  CD2   . TYR E 3 516 ? 12.225  -37.894 18.918  1.00 25.52  ? 493  TYR A CD2   1 
ATOM   4744 C  CE1   . TYR E 3 516 ? 10.420  -38.920 17.082  1.00 26.04  ? 493  TYR A CE1   1 
ATOM   4745 C  CE2   . TYR E 3 516 ? 12.652  -38.822 17.968  1.00 26.57  ? 493  TYR A CE2   1 
ATOM   4746 C  CZ    . TYR E 3 516 ? 11.745  -39.331 17.054  1.00 26.57  ? 493  TYR A CZ    1 
ATOM   4747 O  OH    . TYR E 3 516 ? 12.160  -40.246 16.112  1.00 27.05  ? 493  TYR A OH    1 
ATOM   4748 N  N     . TYR E 3 517 ? 8.635   -34.726 18.755  1.00 25.74  ? 494  TYR A N     1 
ATOM   4749 C  CA    . TYR E 3 517 ? 7.646   -34.145 17.841  1.00 25.96  ? 494  TYR A CA    1 
ATOM   4750 C  C     . TYR E 3 517 ? 7.236   -32.743 18.300  1.00 26.92  ? 494  TYR A C     1 
ATOM   4751 O  O     . TYR E 3 517 ? 7.188   -32.465 19.500  1.00 29.26  ? 494  TYR A O     1 
ATOM   4752 C  CB    . TYR E 3 517 ? 6.386   -35.010 17.779  1.00 26.67  ? 494  TYR A CB    1 
ATOM   4753 C  CG    . TYR E 3 517 ? 6.564   -36.398 17.205  1.00 26.66  ? 494  TYR A CG    1 
ATOM   4754 C  CD1   . TYR E 3 517 ? 7.080   -36.590 15.925  1.00 27.91  ? 494  TYR A CD1   1 
ATOM   4755 C  CD2   . TYR E 3 517 ? 6.162   -37.519 17.926  1.00 25.24  ? 494  TYR A CD2   1 
ATOM   4756 C  CE1   . TYR E 3 517 ? 7.188   -37.870 15.378  1.00 27.80  ? 494  TYR A CE1   1 
ATOM   4757 C  CE2   . TYR E 3 517 ? 6.263   -38.796 17.390  1.00 25.68  ? 494  TYR A CE2   1 
ATOM   4758 C  CZ    . TYR E 3 517 ? 6.776   -38.967 16.119  1.00 27.12  ? 494  TYR A CZ    1 
ATOM   4759 O  OH    . TYR E 3 517 ? 6.870   -40.236 15.592  1.00 28.02  ? 494  TYR A OH    1 
ATOM   4760 N  N     . PRO E 3 518 ? 6.907   -31.846 17.353  1.00 25.89  ? 495  PRO A N     1 
ATOM   4761 C  CA    . PRO E 3 518 ? 6.899   -32.051 15.900  1.00 25.41  ? 495  PRO A CA    1 
ATOM   4762 C  C     . PRO E 3 518 ? 8.313   -32.060 15.330  1.00 24.60  ? 495  PRO A C     1 
ATOM   4763 O  O     . PRO E 3 518 ? 9.132   -31.204 15.679  1.00 25.81  ? 495  PRO A O     1 
ATOM   4764 C  CB    . PRO E 3 518 ? 6.097   -30.854 15.385  1.00 24.58  ? 495  PRO A CB    1 
ATOM   4765 C  CG    . PRO E 3 518 ? 5.258   -30.456 16.560  1.00 23.93  ? 495  PRO A CG    1 
ATOM   4766 C  CD    . PRO E 3 518 ? 6.243   -30.577 17.684  1.00 24.87  ? 495  PRO A CD    1 
ATOM   4767 N  N     . LEU E 3 519 ? 8.599   -33.020 14.456  1.00 21.83  ? 496  LEU A N     1 
ATOM   4768 C  CA    . LEU E 3 519 ? 9.922   -33.101 13.853  1.00 19.82  ? 496  LEU A CA    1 
ATOM   4769 C  C     . LEU E 3 519 ? 10.142  -31.889 12.959  1.00 20.19  ? 496  LEU A C     1 
ATOM   4770 O  O     . LEU E 3 519 ? 9.209   -31.391 12.331  1.00 19.09  ? 496  LEU A O     1 
ATOM   4771 C  CB    . LEU E 3 519 ? 10.063  -34.387 13.042  1.00 16.40  ? 496  LEU A CB    1 
ATOM   4772 C  CG    . LEU E 3 519 ? 9.878   -35.685 13.829  1.00 14.48  ? 496  LEU A CG    1 
ATOM   4773 C  CD1   . LEU E 3 519 ? 10.086  -36.867 12.903  1.00 13.29  ? 496  LEU A CD1   1 
ATOM   4774 C  CD2   . LEU E 3 519 ? 10.859  -35.742 14.985  1.00 13.97  ? 496  LEU A CD2   1 
ATOM   4775 N  N     . THR E 3 520 ? 11.381  -31.415 12.913  1.00 21.44  ? 497  THR A N     1 
ATOM   4776 C  CA    . THR E 3 520 ? 11.728  -30.250 12.112  1.00 23.27  ? 497  THR A CA    1 
ATOM   4777 C  C     . THR E 3 520 ? 12.435  -30.638 10.810  1.00 25.09  ? 497  THR A C     1 
ATOM   4778 O  O     . THR E 3 520 ? 12.548  -29.829 9.886   1.00 24.28  ? 497  THR A O     1 
ATOM   4779 C  CB    . THR E 3 520 ? 12.627  -29.297 12.921  1.00 23.06  ? 497  THR A CB    1 
ATOM   4780 O  OG1   . THR E 3 520 ? 13.824  -29.979 13.310  1.00 25.10  ? 497  THR A OG1   1 
ATOM   4781 C  CG2   . THR E 3 520 ? 11.908  -28.833 14.170  1.00 21.99  ? 497  THR A CG2   1 
ATOM   4782 N  N     . LYS E 3 521 ? 12.908  -31.879 10.743  1.00 26.76  ? 498  LYS A N     1 
ATOM   4783 C  CA    . LYS E 3 521 ? 13.589  -32.380 9.556   1.00 28.76  ? 498  LYS A CA    1 
ATOM   4784 C  C     . LYS E 3 521 ? 13.527  -33.909 9.548   1.00 29.21  ? 498  LYS A C     1 
ATOM   4785 O  O     . LYS E 3 521 ? 13.583  -34.547 10.599  1.00 30.15  ? 498  LYS A O     1 
ATOM   4786 C  CB    . LYS E 3 521 ? 15.045  -31.903 9.542   1.00 30.94  ? 498  LYS A CB    1 
ATOM   4787 C  CG    . LYS E 3 521 ? 15.733  -32.036 8.189   1.00 35.52  ? 498  LYS A CG    1 
ATOM   4788 C  CD    . LYS E 3 521 ? 17.092  -31.339 8.183   1.00 38.06  ? 498  LYS A CD    1 
ATOM   4789 C  CE    . LYS E 3 521 ? 17.678  -31.251 6.775   1.00 39.59  ? 498  LYS A CE    1 
ATOM   4790 N  NZ    . LYS E 3 521 ? 17.855  -32.594 6.142   1.00 41.20  ? 498  LYS A NZ    1 
ATOM   4791 N  N     . LEU E 3 522 ? 13.400  -34.488 8.359   1.00 29.04  ? 499  LEU A N     1 
ATOM   4792 C  CA    . LEU E 3 522 ? 13.318  -35.938 8.204   1.00 27.86  ? 499  LEU A CA    1 
ATOM   4793 C  C     . LEU E 3 522 ? 13.862  -36.330 6.835   1.00 27.31  ? 499  LEU A C     1 
ATOM   4794 O  O     . LEU E 3 522 ? 13.383  -35.840 5.814   1.00 26.44  ? 499  LEU A O     1 
ATOM   4795 C  CB    . LEU E 3 522 ? 11.859  -36.389 8.330   1.00 26.65  ? 499  LEU A CB    1 
ATOM   4796 C  CG    . LEU E 3 522 ? 11.550  -37.875 8.129   1.00 25.91  ? 499  LEU A CG    1 
ATOM   4797 C  CD1   . LEU E 3 522 ? 12.221  -38.701 9.216   1.00 25.85  ? 499  LEU A CD1   1 
ATOM   4798 C  CD2   . LEU E 3 522 ? 10.046  -38.083 8.158   1.00 24.83  ? 499  LEU A CD2   1 
ATOM   4799 N  N     . SER E 3 523 ? 14.856  -37.212 6.805   1.00 27.44  ? 500  SER A N     1 
ATOM   4800 C  CA    . SER E 3 523 ? 15.437  -37.621 5.529   1.00 28.08  ? 500  SER A CA    1 
ATOM   4801 C  C     . SER E 3 523 ? 15.887  -39.075 5.450   1.00 27.94  ? 500  SER A C     1 
ATOM   4802 O  O     . SER E 3 523 ? 16.353  -39.648 6.436   1.00 27.34  ? 500  SER A O     1 
ATOM   4803 C  CB    . SER E 3 523 ? 16.623  -36.719 5.184   1.00 28.13  ? 500  SER A CB    1 
ATOM   4804 O  OG    . SER E 3 523 ? 17.648  -36.835 6.150   1.00 29.83  ? 500  SER A OG    1 
ATOM   4805 N  N     . MET E 3 524 ? 15.740  -39.652 4.255   1.00 27.88  ? 501  MET A N     1 
ATOM   4806 C  CA    . MET E 3 524 ? 16.132  -41.033 3.964   1.00 26.52  ? 501  MET A CA    1 
ATOM   4807 C  C     . MET E 3 524 ? 17.319  -41.002 3.007   1.00 25.77  ? 501  MET A C     1 
ATOM   4808 O  O     . MET E 3 524 ? 17.320  -40.238 2.046   1.00 25.87  ? 501  MET A O     1 
ATOM   4809 C  CB    . MET E 3 524 ? 14.978  -41.793 3.306   1.00 25.92  ? 501  MET A CB    1 
ATOM   4810 C  CG    . MET E 3 524 ? 15.320  -43.225 2.912   1.00 25.15  ? 501  MET A CG    1 
ATOM   4811 S  SD    . MET E 3 524 ? 13.991  -44.040 1.989   1.00 27.58  ? 501  MET A SD    1 
ATOM   4812 C  CE    . MET E 3 524 ? 13.082  -44.835 3.295   1.00 26.62  ? 501  MET A CE    1 
ATOM   4813 N  N     . THR E 3 525 ? 18.325  -41.829 3.269   1.00 26.39  ? 502  THR A N     1 
ATOM   4814 C  CA    . THR E 3 525 ? 19.514  -41.876 2.424   1.00 26.69  ? 502  THR A CA    1 
ATOM   4815 C  C     . THR E 3 525 ? 19.954  -43.301 2.131   1.00 27.66  ? 502  THR A C     1 
ATOM   4816 O  O     . THR E 3 525 ? 19.783  -44.195 2.959   1.00 29.27  ? 502  THR A O     1 
ATOM   4817 C  CB    . THR E 3 525 ? 20.694  -41.163 3.083   1.00 25.53  ? 502  THR A CB    1 
ATOM   4818 O  OG1   . THR E 3 525 ? 20.310  -39.833 3.436   1.00 27.73  ? 502  THR A OG1   1 
ATOM   4819 C  CG2   . THR E 3 525 ? 21.867  -41.102 2.130   1.00 26.10  ? 502  THR A CG2   1 
ATOM   4820 N  N     . ILE E 3 526 ? 20.531  -43.506 0.953   1.00 27.21  ? 503  ILE A N     1 
ATOM   4821 C  CA    . ILE E 3 526 ? 21.002  -44.824 0.565   1.00 27.73  ? 503  ILE A CA    1 
ATOM   4822 C  C     . ILE E 3 526 ? 22.454  -44.769 0.104   1.00 30.14  ? 503  ILE A C     1 
ATOM   4823 O  O     . ILE E 3 526 ? 22.825  -43.919 -0.703  1.00 30.12  ? 503  ILE A O     1 
ATOM   4824 C  CB    . ILE E 3 526 ? 20.113  -45.422 -0.548  1.00 25.11  ? 503  ILE A CB    1 
ATOM   4825 C  CG1   . ILE E 3 526 ? 19.899  -44.396 -1.661  1.00 23.46  ? 503  ILE A CG1   1 
ATOM   4826 C  CG2   . ILE E 3 526 ? 18.778  -45.856 0.038   1.00 24.66  ? 503  ILE A CG2   1 
ATOM   4827 C  CD1   . ILE E 3 526 ? 18.935  -44.855 -2.746  1.00 19.30  ? 503  ILE A CD1   1 
ATOM   4828 N  N     . THR E 3 527 ? 23.273  -45.669 0.643   1.00 33.39  ? 504  THR A N     1 
ATOM   4829 C  CA    . THR E 3 527 ? 24.692  -45.745 0.302   1.00 36.62  ? 504  THR A CA    1 
ATOM   4830 C  C     . THR E 3 527 ? 25.119  -47.180 0.003   1.00 39.07  ? 504  THR A C     1 
ATOM   4831 O  O     . THR E 3 527 ? 24.283  -48.079 -0.085  1.00 38.99  ? 504  THR A O     1 
ATOM   4832 C  CB    . THR E 3 527 ? 25.576  -45.203 1.442   1.00 36.42  ? 504  THR A CB    1 
ATOM   4833 O  OG1   . THR E 3 527 ? 25.232  -45.857 2.668   1.00 37.89  ? 504  THR A OG1   1 
ATOM   4834 C  CG2   . THR E 3 527 ? 25.381  -43.713 1.602   1.00 37.26  ? 504  THR A CG2   1 
ATOM   4835 N  N     . ASN E 3 528 ? 26.424  -47.390 -0.142  1.00 42.74  ? 505  ASN A N     1 
ATOM   4836 C  CA    . ASN E 3 528 ? 26.953  -48.711 -0.454  1.00 46.89  ? 505  ASN A CA    1 
ATOM   4837 C  C     . ASN E 3 528 ? 26.177  -49.304 -1.621  1.00 50.24  ? 505  ASN A C     1 
ATOM   4838 O  O     . ASN E 3 528 ? 25.247  -50.092 -1.435  1.00 50.22  ? 505  ASN A O     1 
ATOM   4839 C  CB    . ASN E 3 528 ? 26.861  -49.635 0.762   1.00 47.91  ? 505  ASN A CB    1 
ATOM   4840 C  CG    . ASN E 3 528 ? 27.723  -49.162 1.915   1.00 50.96  ? 505  ASN A CG    1 
ATOM   4841 O  OD1   . ASN E 3 528 ? 28.873  -48.767 1.720   1.00 52.41  ? 505  ASN A OD1   1 
ATOM   4842 N  ND2   . ASN E 3 528 ? 27.177  -49.206 3.124   1.00 52.42  ? 505  ASN A ND2   1 
ATOM   4843 N  N     . PHE E 3 529 ? 26.567  -48.904 -2.827  1.00 53.67  ? 506  PHE A N     1 
ATOM   4844 C  CA    . PHE E 3 529 ? 25.930  -49.368 -4.049  1.00 57.04  ? 506  PHE A CA    1 
ATOM   4845 C  C     . PHE E 3 529 ? 26.742  -50.465 -4.726  1.00 60.84  ? 506  PHE A C     1 
ATOM   4846 O  O     . PHE E 3 529 ? 27.960  -50.348 -4.879  1.00 60.55  ? 506  PHE A O     1 
ATOM   4847 C  CB    . PHE E 3 529 ? 25.764  -48.204 -5.028  1.00 56.36  ? 506  PHE A CB    1 
ATOM   4848 C  CG    . PHE E 3 529 ? 24.704  -47.218 -4.635  1.00 55.32  ? 506  PHE A CG    1 
ATOM   4849 C  CD1   . PHE E 3 529 ? 23.368  -47.597 -4.588  1.00 55.17  ? 506  PHE A CD1   1 
ATOM   4850 C  CD2   . PHE E 3 529 ? 25.038  -45.902 -4.331  1.00 54.34  ? 506  PHE A CD2   1 
ATOM   4851 C  CE1   . PHE E 3 529 ? 22.379  -46.679 -4.248  1.00 54.42  ? 506  PHE A CE1   1 
ATOM   4852 C  CE2   . PHE E 3 529 ? 24.056  -44.978 -3.988  1.00 53.39  ? 506  PHE A CE2   1 
ATOM   4853 C  CZ    . PHE E 3 529 ? 22.725  -45.367 -3.948  1.00 53.46  ? 506  PHE A CZ    1 
ATOM   4854 N  N     . ASP E 3 530 ? 26.058  -51.531 -5.129  1.00 65.48  ? 507  ASP A N     1 
ATOM   4855 C  CA    . ASP E 3 530 ? 26.705  -52.638 -5.821  1.00 69.83  ? 507  ASP A CA    1 
ATOM   4856 C  C     . ASP E 3 530 ? 26.449  -52.446 -7.309  1.00 71.24  ? 507  ASP A C     1 
ATOM   4857 O  O     . ASP E 3 530 ? 25.403  -52.846 -7.822  1.00 72.10  ? 507  ASP A O     1 
ATOM   4858 C  CB    . ASP E 3 530 ? 26.125  -53.984 -5.368  1.00 72.63  ? 507  ASP A CB    1 
ATOM   4859 C  CG    . ASP E 3 530 ? 26.518  -54.344 -3.944  1.00 75.34  ? 507  ASP A CG    1 
ATOM   4860 O  OD1   . ASP E 3 530 ? 27.734  -54.403 -3.657  1.00 76.58  ? 507  ASP A OD1   1 
ATOM   4861 O  OD2   . ASP E 3 530 ? 25.612  -54.576 -3.114  1.00 76.91  ? 507  ASP A OD2   1 
ATOM   4862 N  N     . ILE E 3 531 ? 27.400  -51.816 -7.991  1.00 72.88  ? 508  ILE A N     1 
ATOM   4863 C  CA    . ILE E 3 531 ? 27.284  -51.561 -9.423  1.00 74.23  ? 508  ILE A CA    1 
ATOM   4864 C  C     . ILE E 3 531 ? 27.460  -52.823 -10.264 1.00 74.06  ? 508  ILE A C     1 
ATOM   4865 O  O     . ILE E 3 531 ? 28.193  -52.824 -11.251 1.00 73.95  ? 508  ILE A O     1 
ATOM   4866 C  CB    . ILE E 3 531 ? 28.313  -50.491 -9.885  1.00 74.86  ? 508  ILE A CB    1 
ATOM   4867 C  CG1   . ILE E 3 531 ? 29.623  -50.625 -9.096  1.00 75.76  ? 508  ILE A CG1   1 
ATOM   4868 C  CG2   . ILE E 3 531 ? 27.730  -49.100 -9.700  1.00 74.45  ? 508  ILE A CG2   1 
ATOM   4869 C  CD1   . ILE E 3 531 ? 30.342  -51.952 -9.271  1.00 76.50  ? 508  ILE A CD1   1 
ATOM   4870 N  N     . ILE E 3 532 ? 26.774  -53.891 -9.871  1.00 74.97  ? 509  ILE A N     1 
ATOM   4871 C  CA    . ILE E 3 532 ? 26.849  -55.161 -10.586 1.00 76.00  ? 509  ILE A CA    1 
ATOM   4872 C  C     . ILE E 3 532 ? 26.006  -55.119 -11.862 1.00 76.69  ? 509  ILE A C     1 
ATOM   4873 O  O     . ILE E 3 532 ? 26.332  -55.768 -12.859 1.00 77.12  ? 509  ILE A O     1 
ATOM   4874 C  CB    . ILE E 3 532 ? 26.353  -56.332 -9.702  1.00 75.76  ? 509  ILE A CB    1 
ATOM   4875 C  CG1   . ILE E 3 532 ? 24.850  -56.196 -9.444  1.00 75.01  ? 509  ILE A CG1   1 
ATOM   4876 C  CG2   . ILE E 3 532 ? 27.112  -56.341 -8.379  1.00 75.22  ? 509  ILE A CG2   1 
ATOM   4877 C  CD1   . ILE E 3 532 ? 24.253  -57.352 -8.668  1.00 75.18  ? 509  ILE A CD1   1 
ATOM   4878 N  N     . MET F 3 24  ? 8.205   -59.899 -28.573 1.00 44.92  ? 1    MET B N     1 
ATOM   4879 C  CA    . MET F 3 24  ? 9.356   -59.453 -27.739 1.00 45.59  ? 1    MET B CA    1 
ATOM   4880 C  C     . MET F 3 24  ? 10.693  -59.857 -28.364 1.00 45.46  ? 1    MET B C     1 
ATOM   4881 O  O     . MET F 3 24  ? 10.818  -60.938 -28.944 1.00 46.04  ? 1    MET B O     1 
ATOM   4882 C  CB    . MET F 3 24  ? 9.255   -60.060 -26.341 1.00 47.14  ? 1    MET B CB    1 
ATOM   4883 C  CG    . MET F 3 24  ? 9.752   -59.140 -25.244 1.00 50.53  ? 1    MET B CG    1 
ATOM   4884 S  SD    . MET F 3 24  ? 8.629   -57.735 -24.989 1.00 56.35  ? 1    MET B SD    1 
ATOM   4885 C  CE    . MET F 3 24  ? 9.280   -56.499 -26.131 1.00 53.67  ? 1    MET B CE    1 
ATOM   4886 N  N     . SER F 3 25  ? 11.693  -58.989 -28.232 1.00 44.07  ? 2    SER B N     1 
ATOM   4887 C  CA    . SER F 3 25  ? 13.020  -59.254 -28.777 1.00 40.73  ? 2    SER B CA    1 
ATOM   4888 C  C     . SER F 3 25  ? 13.838  -60.170 -27.877 1.00 39.69  ? 2    SER B C     1 
ATOM   4889 O  O     . SER F 3 25  ? 13.625  -60.238 -26.667 1.00 39.97  ? 2    SER B O     1 
ATOM   4890 C  CB    . SER F 3 25  ? 13.784  -57.947 -28.986 1.00 40.39  ? 2    SER B CB    1 
ATOM   4891 O  OG    . SER F 3 25  ? 15.115  -58.206 -29.394 1.00 40.00  ? 2    SER B OG    1 
ATOM   4892 N  N     . LYS F 3 26  ? 14.790  -60.864 -28.483 1.00 38.39  ? 3    LYS B N     1 
ATOM   4893 C  CA    . LYS F 3 26  ? 15.650  -61.782 -27.760 1.00 37.45  ? 3    LYS B CA    1 
ATOM   4894 C  C     . LYS F 3 26  ? 16.731  -61.043 -26.972 1.00 37.08  ? 3    LYS B C     1 
ATOM   4895 O  O     . LYS F 3 26  ? 17.436  -61.645 -26.167 1.00 37.01  ? 3    LYS B O     1 
ATOM   4896 C  CB    . LYS F 3 26  ? 16.279  -62.752 -28.758 1.00 38.45  ? 3    LYS B CB    1 
ATOM   4897 C  CG    . LYS F 3 26  ? 17.274  -63.741 -28.179 1.00 41.41  ? 3    LYS B CG    1 
ATOM   4898 C  CD    . LYS F 3 26  ? 17.665  -64.776 -29.233 1.00 43.61  ? 3    LYS B CD    1 
ATOM   4899 C  CE    . LYS F 3 26  ? 18.115  -64.104 -30.525 1.00 46.18  ? 3    LYS B CE    1 
ATOM   4900 N  NZ    . LYS F 3 26  ? 18.364  -65.073 -31.627 1.00 50.40  ? 3    LYS B NZ    1 
ATOM   4901 N  N     . PHE F 3 27  ? 16.849  -59.736 -27.196 1.00 36.95  ? 4    PHE B N     1 
ATOM   4902 C  CA    . PHE F 3 27  ? 17.856  -58.928 -26.507 1.00 35.75  ? 4    PHE B CA    1 
ATOM   4903 C  C     . PHE F 3 27  ? 17.269  -57.846 -25.609 1.00 36.39  ? 4    PHE B C     1 
ATOM   4904 O  O     . PHE F 3 27  ? 16.120  -57.442 -25.767 1.00 37.97  ? 4    PHE B O     1 
ATOM   4905 C  CB    . PHE F 3 27  ? 18.795  -58.268 -27.516 1.00 33.79  ? 4    PHE B CB    1 
ATOM   4906 C  CG    . PHE F 3 27  ? 19.480  -59.236 -28.426 1.00 32.18  ? 4    PHE B CG    1 
ATOM   4907 C  CD1   . PHE F 3 27  ? 18.782  -59.852 -29.456 1.00 31.59  ? 4    PHE B CD1   1 
ATOM   4908 C  CD2   . PHE F 3 27  ? 20.819  -59.553 -28.240 1.00 32.45  ? 4    PHE B CD2   1 
ATOM   4909 C  CE1   . PHE F 3 27  ? 19.406  -60.770 -30.288 1.00 30.47  ? 4    PHE B CE1   1 
ATOM   4910 C  CE2   . PHE F 3 27  ? 21.454  -60.471 -29.067 1.00 31.80  ? 4    PHE B CE2   1 
ATOM   4911 C  CZ    . PHE F 3 27  ? 20.744  -61.082 -30.093 1.00 30.95  ? 4    PHE B CZ    1 
ATOM   4912 N  N     . THR F 3 28  ? 18.090  -57.365 -24.682 1.00 36.12  ? 5    THR B N     1 
ATOM   4913 C  CA    . THR F 3 28  ? 17.690  -56.334 -23.730 1.00 36.21  ? 5    THR B CA    1 
ATOM   4914 C  C     . THR F 3 28  ? 18.243  -54.960 -24.111 1.00 35.25  ? 5    THR B C     1 
ATOM   4915 O  O     . THR F 3 28  ? 19.103  -54.855 -24.985 1.00 36.04  ? 5    THR B O     1 
ATOM   4916 C  CB    . THR F 3 28  ? 18.197  -56.688 -22.324 1.00 37.70  ? 5    THR B CB    1 
ATOM   4917 O  OG1   . THR F 3 28  ? 19.631  -56.629 -22.305 1.00 37.94  ? 5    THR B OG1   1 
ATOM   4918 C  CG2   . THR F 3 28  ? 17.752  -58.097 -21.945 1.00 36.94  ? 5    THR B CG2   1 
ATOM   4919 N  N     . TRP F 3 29  ? 17.753  -53.910 -23.454 1.00 32.91  ? 6    TRP B N     1 
ATOM   4920 C  CA    . TRP F 3 29  ? 18.226  -52.558 -23.742 1.00 31.02  ? 6    TRP B CA    1 
ATOM   4921 C  C     . TRP F 3 29  ? 19.682  -52.378 -23.350 1.00 31.18  ? 6    TRP B C     1 
ATOM   4922 O  O     . TRP F 3 29  ? 20.414  -51.627 -23.988 1.00 31.34  ? 6    TRP B O     1 
ATOM   4923 C  CB    . TRP F 3 29  ? 17.387  -51.510 -23.012 1.00 29.01  ? 6    TRP B CB    1 
ATOM   4924 C  CG    . TRP F 3 29  ? 16.092  -51.211 -23.681 1.00 27.66  ? 6    TRP B CG    1 
ATOM   4925 C  CD1   . TRP F 3 29  ? 14.909  -51.865 -23.510 1.00 28.18  ? 6    TRP B CD1   1 
ATOM   4926 C  CD2   . TRP F 3 29  ? 15.855  -50.199 -24.664 1.00 26.33  ? 6    TRP B CD2   1 
ATOM   4927 N  NE1   . TRP F 3 29  ? 13.945  -51.324 -24.328 1.00 28.38  ? 6    TRP B NE1   1 
ATOM   4928 C  CE2   . TRP F 3 29  ? 14.501  -50.299 -25.048 1.00 26.88  ? 6    TRP B CE2   1 
ATOM   4929 C  CE3   . TRP F 3 29  ? 16.657  -49.218 -25.260 1.00 26.19  ? 6    TRP B CE3   1 
ATOM   4930 C  CZ2   . TRP F 3 29  ? 13.927  -49.453 -26.002 1.00 26.31  ? 6    TRP B CZ2   1 
ATOM   4931 C  CZ3   . TRP F 3 29  ? 16.087  -48.375 -26.209 1.00 26.15  ? 6    TRP B CZ3   1 
ATOM   4932 C  CH2   . TRP F 3 29  ? 14.734  -48.500 -26.570 1.00 26.80  ? 6    TRP B CH2   1 
ATOM   4933 N  N     . LYS F 3 30  ? 20.100  -53.065 -22.294 1.00 32.20  ? 7    LYS B N     1 
ATOM   4934 C  CA    . LYS F 3 30  ? 21.477  -52.969 -21.835 1.00 31.84  ? 7    LYS B CA    1 
ATOM   4935 C  C     . LYS F 3 30  ? 22.389  -53.340 -22.990 1.00 30.81  ? 7    LYS B C     1 
ATOM   4936 O  O     . LYS F 3 30  ? 23.322  -52.611 -23.321 1.00 31.29  ? 7    LYS B O     1 
ATOM   4937 C  CB    . LYS F 3 30  ? 21.721  -53.918 -20.661 1.00 33.53  ? 7    LYS B CB    1 
ATOM   4938 C  CG    . LYS F 3 30  ? 23.094  -53.761 -20.030 1.00 38.06  ? 7    LYS B CG    1 
ATOM   4939 C  CD    . LYS F 3 30  ? 23.278  -54.670 -18.818 1.00 41.58  ? 7    LYS B CD    1 
ATOM   4940 C  CE    . LYS F 3 30  ? 24.557  -54.327 -18.046 1.00 42.14  ? 7    LYS B CE    1 
ATOM   4941 N  NZ    . LYS F 3 30  ? 25.798  -54.429 -18.877 1.00 42.12  ? 7    LYS B NZ    1 
ATOM   4942 N  N     . GLU F 3 31  ? 22.099  -54.477 -23.611 1.00 29.10  ? 8    GLU B N     1 
ATOM   4943 C  CA    . GLU F 3 31  ? 22.888  -54.963 -24.732 1.00 28.37  ? 8    GLU B CA    1 
ATOM   4944 C  C     . GLU F 3 31  ? 22.954  -53.949 -25.876 1.00 27.38  ? 8    GLU B C     1 
ATOM   4945 O  O     . GLU F 3 31  ? 24.023  -53.701 -26.431 1.00 26.53  ? 8    GLU B O     1 
ATOM   4946 C  CB    . GLU F 3 31  ? 22.308  -56.286 -25.221 1.00 29.50  ? 8    GLU B CB    1 
ATOM   4947 C  CG    . GLU F 3 31  ? 22.326  -57.368 -24.159 1.00 32.31  ? 8    GLU B CG    1 
ATOM   4948 C  CD    . GLU F 3 31  ? 21.566  -58.608 -24.579 1.00 36.43  ? 8    GLU B CD    1 
ATOM   4949 O  OE1   . GLU F 3 31  ? 20.340  -58.507 -24.796 1.00 38.46  ? 8    GLU B OE1   1 
ATOM   4950 O  OE2   . GLU F 3 31  ? 22.192  -59.684 -24.694 1.00 38.75  ? 8    GLU B OE2   1 
ATOM   4951 N  N     . LEU F 3 32  ? 21.815  -53.360 -26.223 1.00 26.39  ? 9    LEU B N     1 
ATOM   4952 C  CA    . LEU F 3 32  ? 21.775  -52.372 -27.294 1.00 24.57  ? 9    LEU B CA    1 
ATOM   4953 C  C     . LEU F 3 32  ? 22.568  -51.138 -26.890 1.00 25.13  ? 9    LEU B C     1 
ATOM   4954 O  O     . LEU F 3 32  ? 23.557  -50.785 -27.531 1.00 25.52  ? 9    LEU B O     1 
ATOM   4955 C  CB    . LEU F 3 32  ? 20.333  -51.968 -27.603 1.00 20.87  ? 9    LEU B CB    1 
ATOM   4956 C  CG    . LEU F 3 32  ? 20.204  -50.999 -28.780 1.00 18.25  ? 9    LEU B CG    1 
ATOM   4957 C  CD1   . LEU F 3 32  ? 20.825  -51.620 -30.016 1.00 15.57  ? 9    LEU B CD1   1 
ATOM   4958 C  CD2   . LEU F 3 32  ? 18.750  -50.676 -29.030 1.00 18.34  ? 9    LEU B CD2   1 
ATOM   4959 N  N     . ILE F 3 33  ? 22.122  -50.486 -25.822 1.00 25.90  ? 10   ILE B N     1 
ATOM   4960 C  CA    . ILE F 3 33  ? 22.779  -49.289 -25.310 1.00 27.74  ? 10   ILE B CA    1 
ATOM   4961 C  C     . ILE F 3 33  ? 24.287  -49.507 -25.218 1.00 28.92  ? 10   ILE B C     1 
ATOM   4962 O  O     . ILE F 3 33  ? 25.080  -48.614 -25.523 1.00 29.94  ? 10   ILE B O     1 
ATOM   4963 C  CB    . ILE F 3 33  ? 22.261  -48.925 -23.891 1.00 27.55  ? 10   ILE B CB    1 
ATOM   4964 C  CG1   . ILE F 3 33  ? 20.743  -48.735 -23.908 1.00 28.25  ? 10   ILE B CG1   1 
ATOM   4965 C  CG2   . ILE F 3 33  ? 22.929  -47.653 -23.399 1.00 26.56  ? 10   ILE B CG2   1 
ATOM   4966 C  CD1   . ILE F 3 33  ? 20.276  -47.556 -24.730 1.00 29.56  ? 10   ILE B CD1   1 
ATOM   4967 N  N     . GLN F 3 34  ? 24.671  -50.708 -24.804 1.00 28.13  ? 11   GLN B N     1 
ATOM   4968 C  CA    . GLN F 3 34  ? 26.071  -51.058 -24.638 1.00 29.30  ? 11   GLN B CA    1 
ATOM   4969 C  C     . GLN F 3 34  ? 26.948  -50.810 -25.865 1.00 29.63  ? 11   GLN B C     1 
ATOM   4970 O  O     . GLN F 3 34  ? 28.148  -50.569 -25.737 1.00 28.77  ? 11   GLN B O     1 
ATOM   4971 C  CB    . GLN F 3 34  ? 26.177  -52.519 -24.211 1.00 31.10  ? 11   GLN B CB    1 
ATOM   4972 C  CG    . GLN F 3 34  ? 27.577  -52.944 -23.840 1.00 33.45  ? 11   GLN B CG    1 
ATOM   4973 C  CD    . GLN F 3 34  ? 27.626  -54.337 -23.249 1.00 35.57  ? 11   GLN B CD    1 
ATOM   4974 O  OE1   . GLN F 3 34  ? 27.201  -55.308 -23.875 1.00 34.55  ? 11   GLN B OE1   1 
ATOM   4975 N  NE2   . GLN F 3 34  ? 28.156  -54.443 -22.034 1.00 37.91  ? 11   GLN B NE2   1 
ATOM   4976 N  N     . LEU F 3 35  ? 26.358  -50.871 -27.051 1.00 30.75  ? 12   LEU B N     1 
ATOM   4977 C  CA    . LEU F 3 35  ? 27.118  -50.649 -28.276 1.00 33.70  ? 12   LEU B CA    1 
ATOM   4978 C  C     . LEU F 3 35  ? 27.778  -49.270 -28.314 1.00 36.97  ? 12   LEU B C     1 
ATOM   4979 O  O     . LEU F 3 35  ? 28.637  -49.011 -29.159 1.00 37.44  ? 12   LEU B O     1 
ATOM   4980 C  CB    . LEU F 3 35  ? 26.212  -50.792 -29.500 1.00 32.55  ? 12   LEU B CB    1 
ATOM   4981 C  CG    . LEU F 3 35  ? 25.549  -52.143 -29.765 1.00 33.00  ? 12   LEU B CG    1 
ATOM   4982 C  CD1   . LEU F 3 35  ? 24.800  -52.072 -31.088 1.00 31.97  ? 12   LEU B CD1   1 
ATOM   4983 C  CD2   . LEU F 3 35  ? 26.597  -53.247 -29.804 1.00 31.51  ? 12   LEU B CD2   1 
ATOM   4984 N  N     . GLY F 3 36  ? 27.375  -48.389 -27.401 1.00 39.52  ? 13   GLY B N     1 
ATOM   4985 C  CA    . GLY F 3 36  ? 27.929  -47.047 -27.371 1.00 40.58  ? 13   GLY B CA    1 
ATOM   4986 C  C     . GLY F 3 36  ? 29.191  -46.883 -26.548 1.00 43.29  ? 13   GLY B C     1 
ATOM   4987 O  O     . GLY F 3 36  ? 29.943  -45.937 -26.759 1.00 44.52  ? 13   GLY B O     1 
ATOM   4988 N  N     . SER F 3 37  ? 29.431  -47.790 -25.607 1.00 45.20  ? 14   SER B N     1 
ATOM   4989 C  CA    . SER F 3 37  ? 30.622  -47.707 -24.770 1.00 47.29  ? 14   SER B CA    1 
ATOM   4990 C  C     . SER F 3 37  ? 31.782  -48.472 -25.392 1.00 48.15  ? 14   SER B C     1 
ATOM   4991 O  O     . SER F 3 37  ? 31.682  -49.674 -25.634 1.00 49.26  ? 14   SER B O     1 
ATOM   4992 C  CB    . SER F 3 37  ? 30.332  -48.270 -23.377 1.00 49.20  ? 14   SER B CB    1 
ATOM   4993 O  OG    . SER F 3 37  ? 31.490  -48.220 -22.557 1.00 50.25  ? 14   SER B OG    1 
ATOM   4994 N  N     . PRO F 3 38  ? 32.903  -47.781 -25.655 1.00 48.51  ? 15   PRO B N     1 
ATOM   4995 C  CA    . PRO F 3 38  ? 34.107  -48.372 -26.252 1.00 49.49  ? 15   PRO B CA    1 
ATOM   4996 C  C     . PRO F 3 38  ? 34.728  -49.449 -25.366 1.00 51.03  ? 15   PRO B C     1 
ATOM   4997 O  O     . PRO F 3 38  ? 35.498  -50.289 -25.832 1.00 50.84  ? 15   PRO B O     1 
ATOM   4998 C  CB    . PRO F 3 38  ? 35.038  -47.172 -26.412 1.00 48.50  ? 15   PRO B CB    1 
ATOM   4999 C  CG    . PRO F 3 38  ? 34.095  -46.020 -26.552 1.00 48.67  ? 15   PRO B CG    1 
ATOM   5000 C  CD    . PRO F 3 38  ? 33.061  -46.326 -25.507 1.00 47.94  ? 15   PRO B CD    1 
ATOM   5001 N  N     . SER F 3 39  ? 34.379  -49.416 -24.085 1.00 53.69  ? 16   SER B N     1 
ATOM   5002 C  CA    . SER F 3 39  ? 34.911  -50.359 -23.111 1.00 56.37  ? 16   SER B CA    1 
ATOM   5003 C  C     . SER F 3 39  ? 34.261  -51.740 -23.102 1.00 56.95  ? 16   SER B C     1 
ATOM   5004 O  O     . SER F 3 39  ? 34.955  -52.752 -23.189 1.00 58.41  ? 16   SER B O     1 
ATOM   5005 C  CB    . SER F 3 39  ? 34.822  -49.752 -21.711 1.00 57.38  ? 16   SER B CB    1 
ATOM   5006 O  OG    . SER F 3 39  ? 33.482  -49.412 -21.396 1.00 61.00  ? 16   SER B OG    1 
ATOM   5007 N  N     . LYS F 3 40  ? 32.938  -51.792 -22.988 1.00 57.03  ? 17   LYS B N     1 
ATOM   5008 C  CA    . LYS F 3 40  ? 32.253  -53.078 -22.949 1.00 58.29  ? 17   LYS B CA    1 
ATOM   5009 C  C     . LYS F 3 40  ? 31.238  -53.316 -24.064 1.00 58.99  ? 17   LYS B C     1 
ATOM   5010 O  O     . LYS F 3 40  ? 30.191  -53.909 -23.828 1.00 60.18  ? 17   LYS B O     1 
ATOM   5011 C  CB    . LYS F 3 40  ? 31.565  -53.261 -21.588 1.00 58.32  ? 17   LYS B CB    1 
ATOM   5012 C  CG    . LYS F 3 40  ? 32.471  -53.813 -20.491 0.00 58.94  ? 17   LYS B CG    1 
ATOM   5013 C  CD    . LYS F 3 40  ? 33.581  -52.845 -20.101 0.00 59.20  ? 17   LYS B CD    1 
ATOM   5014 C  CE    . LYS F 3 40  ? 33.031  -51.618 -19.391 0.00 59.29  ? 17   LYS B CE    1 
ATOM   5015 N  NZ    . LYS F 3 40  ? 34.119  -50.714 -18.924 0.00 59.25  ? 17   LYS B NZ    1 
ATOM   5016 N  N     . ALA F 3 41  ? 31.552  -52.882 -25.280 1.00 58.86  ? 18   ALA B N     1 
ATOM   5017 C  CA    . ALA F 3 41  ? 30.636  -53.064 -26.403 1.00 58.97  ? 18   ALA B CA    1 
ATOM   5018 C  C     . ALA F 3 41  ? 30.863  -54.380 -27.148 1.00 59.51  ? 18   ALA B C     1 
ATOM   5019 O  O     . ALA F 3 41  ? 30.198  -54.655 -28.148 1.00 59.31  ? 18   ALA B O     1 
ATOM   5020 C  CB    . ALA F 3 41  ? 30.762  -51.892 -27.372 1.00 58.08  ? 18   ALA B CB    1 
ATOM   5021 N  N     . TYR F 3 42  ? 31.790  -55.196 -26.656 1.00 60.03  ? 19   TYR B N     1 
ATOM   5022 C  CA    . TYR F 3 42  ? 32.100  -56.466 -27.302 1.00 60.23  ? 19   TYR B CA    1 
ATOM   5023 C  C     . TYR F 3 42  ? 31.453  -57.684 -26.646 1.00 60.16  ? 19   TYR B C     1 
ATOM   5024 O  O     . TYR F 3 42  ? 31.410  -58.762 -27.243 1.00 61.01  ? 19   TYR B O     1 
ATOM   5025 C  CB    . TYR F 3 42  ? 33.614  -56.674 -27.352 1.00 61.70  ? 19   TYR B CB    1 
ATOM   5026 C  CG    . TYR F 3 42  ? 34.261  -56.817 -25.990 1.00 64.39  ? 19   TYR B CG    1 
ATOM   5027 C  CD1   . TYR F 3 42  ? 34.378  -55.725 -25.130 1.00 64.90  ? 19   TYR B CD1   1 
ATOM   5028 C  CD2   . TYR F 3 42  ? 34.757  -58.049 -25.561 1.00 65.11  ? 19   TYR B CD2   1 
ATOM   5029 C  CE1   . TYR F 3 42  ? 34.975  -55.856 -23.877 1.00 65.23  ? 19   TYR B CE1   1 
ATOM   5030 C  CE2   . TYR F 3 42  ? 35.353  -58.189 -24.312 1.00 65.49  ? 19   TYR B CE2   1 
ATOM   5031 C  CZ    . TYR F 3 42  ? 35.460  -57.090 -23.477 1.00 65.45  ? 19   TYR B CZ    1 
ATOM   5032 O  OH    . TYR F 3 42  ? 36.065  -57.228 -22.251 1.00 66.47  ? 19   TYR B OH    1 
ATOM   5033 N  N     . GLU F 3 43  ? 30.961  -57.525 -25.421 1.00 58.24  ? 20   GLU B N     1 
ATOM   5034 C  CA    . GLU F 3 43  ? 30.324  -58.638 -24.725 1.00 57.01  ? 20   GLU B CA    1 
ATOM   5035 C  C     . GLU F 3 43  ? 28.824  -58.610 -24.990 1.00 55.92  ? 20   GLU B C     1 
ATOM   5036 O  O     . GLU F 3 43  ? 28.086  -59.519 -24.596 1.00 56.08  ? 20   GLU B O     1 
ATOM   5037 C  CB    . GLU F 3 43  ? 30.590  -58.547 -23.220 1.00 57.80  ? 20   GLU B CB    1 
ATOM   5038 C  CG    . GLU F 3 43  ? 29.960  -57.341 -22.530 1.00 59.34  ? 20   GLU B CG    1 
ATOM   5039 C  CD    . GLU F 3 43  ? 28.924  -57.734 -21.482 1.00 59.79  ? 20   GLU B CD    1 
ATOM   5040 O  OE1   . GLU F 3 43  ? 28.455  -56.842 -20.742 1.00 58.43  ? 20   GLU B OE1   1 
ATOM   5041 O  OE2   . GLU F 3 43  ? 28.577  -58.934 -21.401 1.00 60.15  ? 20   GLU B OE2   1 
ATOM   5042 N  N     . SER F 3 44  ? 28.397  -57.558 -25.681 1.00 53.62  ? 21   SER B N     1 
ATOM   5043 C  CA    . SER F 3 44  ? 26.996  -57.326 -26.022 1.00 51.45  ? 21   SER B CA    1 
ATOM   5044 C  C     . SER F 3 44  ? 26.225  -58.487 -26.657 1.00 49.62  ? 21   SER B C     1 
ATOM   5045 O  O     . SER F 3 44  ? 25.053  -58.702 -26.335 1.00 49.53  ? 21   SER B O     1 
ATOM   5046 C  CB    . SER F 3 44  ? 26.898  -56.103 -26.941 1.00 50.62  ? 21   SER B CB    1 
ATOM   5047 O  OG    . SER F 3 44  ? 25.557  -55.851 -27.319 1.00 49.82  ? 21   SER B OG    1 
ATOM   5048 N  N     . SER F 3 45  ? 26.883  -59.226 -27.548 1.00 46.67  ? 22   SER B N     1 
ATOM   5049 C  CA    . SER F 3 45  ? 26.261  -60.340 -28.271 1.00 43.42  ? 22   SER B CA    1 
ATOM   5050 C  C     . SER F 3 45  ? 25.555  -59.708 -29.465 1.00 39.54  ? 22   SER B C     1 
ATOM   5051 O  O     . SER F 3 45  ? 25.248  -60.371 -30.455 1.00 38.44  ? 22   SER B O     1 
ATOM   5052 C  CB    . SER F 3 45  ? 25.249  -61.083 -27.392 1.00 45.69  ? 22   SER B CB    1 
ATOM   5053 O  OG    . SER F 3 45  ? 25.844  -61.506 -26.176 1.00 48.92  ? 22   SER B OG    1 
ATOM   5054 N  N     . LEU F 3 46  ? 25.307  -58.406 -29.338 1.00 35.11  ? 23   LEU B N     1 
ATOM   5055 C  CA    . LEU F 3 46  ? 24.678  -57.594 -30.371 1.00 30.37  ? 23   LEU B CA    1 
ATOM   5056 C  C     . LEU F 3 46  ? 25.799  -56.837 -31.073 1.00 30.15  ? 23   LEU B C     1 
ATOM   5057 O  O     . LEU F 3 46  ? 25.563  -56.069 -32.007 1.00 30.67  ? 23   LEU B O     1 
ATOM   5058 C  CB    . LEU F 3 46  ? 23.728  -56.578 -29.748 1.00 26.29  ? 23   LEU B CB    1 
ATOM   5059 C  CG    . LEU F 3 46  ? 22.237  -56.866 -29.713 1.00 22.61  ? 23   LEU B CG    1 
ATOM   5060 C  CD1   . LEU F 3 46  ? 21.521  -55.670 -29.126 1.00 20.83  ? 23   LEU B CD1   1 
ATOM   5061 C  CD2   . LEU F 3 46  ? 21.737  -57.134 -31.113 1.00 22.80  ? 23   LEU B CD2   1 
ATOM   5062 N  N     . ALA F 3 47  ? 27.020  -57.058 -30.600 1.00 28.65  ? 24   ALA B N     1 
ATOM   5063 C  CA    . ALA F 3 47  ? 28.201  -56.408 -31.151 1.00 28.49  ? 24   ALA B CA    1 
ATOM   5064 C  C     . ALA F 3 47  ? 28.357  -56.631 -32.653 1.00 27.37  ? 24   ALA B C     1 
ATOM   5065 O  O     . ALA F 3 47  ? 27.844  -57.604 -33.208 1.00 28.74  ? 24   ALA B O     1 
ATOM   5066 C  CB    . ALA F 3 47  ? 29.448  -56.902 -30.420 1.00 28.37  ? 24   ALA B CB    1 
ATOM   5067 N  N     . CYS F 3 48  ? 29.066  -55.716 -33.305 1.00 24.17  ? 25   CYS B N     1 
ATOM   5068 C  CA    . CYS F 3 48  ? 29.312  -55.816 -34.734 1.00 22.64  ? 25   CYS B CA    1 
ATOM   5069 C  C     . CYS F 3 48  ? 30.789  -55.571 -34.985 1.00 22.05  ? 25   CYS B C     1 
ATOM   5070 O  O     . CYS F 3 48  ? 31.234  -54.426 -35.068 1.00 23.85  ? 25   CYS B O     1 
ATOM   5071 C  CB    . CYS F 3 48  ? 28.483  -54.785 -35.494 1.00 24.04  ? 25   CYS B CB    1 
ATOM   5072 S  SG    . CYS F 3 48  ? 28.752  -54.812 -37.280 1.00 27.26  ? 25   CYS B SG    1 
ATOM   5073 N  N     . ILE F 3 49  ? 31.550  -56.654 -35.095 1.00 20.63  ? 26   ILE B N     1 
ATOM   5074 C  CA    . ILE F 3 49  ? 32.986  -56.564 -35.326 1.00 18.51  ? 26   ILE B CA    1 
ATOM   5075 C  C     . ILE F 3 49  ? 33.288  -56.809 -36.796 1.00 16.63  ? 26   ILE B C     1 
ATOM   5076 O  O     . ILE F 3 49  ? 32.518  -57.462 -37.492 1.00 16.58  ? 26   ILE B O     1 
ATOM   5077 C  CB    . ILE F 3 49  ? 33.749  -57.606 -34.473 1.00 19.77  ? 26   ILE B CB    1 
ATOM   5078 C  CG1   . ILE F 3 49  ? 33.339  -57.475 -33.004 1.00 19.27  ? 26   ILE B CG1   1 
ATOM   5079 C  CG2   . ILE F 3 49  ? 35.252  -57.404 -34.609 1.00 19.25  ? 26   ILE B CG2   1 
ATOM   5080 C  CD1   . ILE F 3 49  ? 33.619  -56.115 -32.411 1.00 19.33  ? 26   ILE B CD1   1 
ATOM   5081 N  N     . ALA F 3 50  ? 34.409  -56.276 -37.263 1.00 15.34  ? 27   ALA B N     1 
ATOM   5082 C  CA    . ALA F 3 50  ? 34.814  -56.442 -38.651 1.00 15.61  ? 27   ALA B CA    1 
ATOM   5083 C  C     . ALA F 3 50  ? 36.313  -56.691 -38.719 1.00 16.45  ? 27   ALA B C     1 
ATOM   5084 O  O     . ALA F 3 50  ? 37.076  -56.167 -37.908 1.00 18.70  ? 27   ALA B O     1 
ATOM   5085 C  CB    . ALA F 3 50  ? 34.460  -55.200 -39.452 1.00 15.37  ? 27   ALA B CB    1 
ATOM   5086 N  N     . HIS F 3 51  ? 36.730  -57.505 -39.680 1.00 15.24  ? 28   HIS B N     1 
ATOM   5087 C  CA    . HIS F 3 51  ? 38.139  -57.810 -39.864 1.00 14.97  ? 28   HIS B CA    1 
ATOM   5088 C  C     . HIS F 3 51  ? 38.449  -57.601 -41.335 1.00 15.84  ? 28   HIS B C     1 
ATOM   5089 O  O     . HIS F 3 51  ? 37.739  -58.105 -42.203 1.00 16.19  ? 28   HIS B O     1 
ATOM   5090 C  CB    . HIS F 3 51  ? 38.433  -59.256 -39.451 1.00 14.78  ? 28   HIS B CB    1 
ATOM   5091 C  CG    . HIS F 3 51  ? 39.863  -59.664 -39.639 1.00 15.54  ? 28   HIS B CG    1 
ATOM   5092 N  ND1   . HIS F 3 51  ? 40.310  -60.317 -40.768 1.00 15.45  ? 28   HIS B ND1   1 
ATOM   5093 C  CD2   . HIS F 3 51  ? 40.951  -59.491 -38.850 1.00 14.64  ? 28   HIS B CD2   1 
ATOM   5094 C  CE1   . HIS F 3 51  ? 41.611  -60.529 -40.665 1.00 16.45  ? 28   HIS B CE1   1 
ATOM   5095 N  NE2   . HIS F 3 51  ? 42.024  -60.037 -39.510 1.00 12.70  ? 28   HIS B NE2   1 
ATOM   5096 N  N     . ILE F 3 52  ? 39.502  -56.843 -41.614 1.00 16.74  ? 29   ILE B N     1 
ATOM   5097 C  CA    . ILE F 3 52  ? 39.879  -56.563 -42.992 1.00 17.85  ? 29   ILE B CA    1 
ATOM   5098 C  C     . ILE F 3 52  ? 41.312  -56.999 -43.292 1.00 19.92  ? 29   ILE B C     1 
ATOM   5099 O  O     . ILE F 3 52  ? 42.232  -56.717 -42.524 1.00 22.39  ? 29   ILE B O     1 
ATOM   5100 C  CB    . ILE F 3 52  ? 39.712  -55.063 -43.291 1.00 15.22  ? 29   ILE B CB    1 
ATOM   5101 C  CG1   . ILE F 3 52  ? 38.271  -54.646 -42.987 1.00 14.53  ? 29   ILE B CG1   1 
ATOM   5102 C  CG2   . ILE F 3 52  ? 40.054  -54.777 -44.742 1.00 16.38  ? 29   ILE B CG2   1 
ATOM   5103 C  CD1   . ILE F 3 52  ? 37.979  -53.186 -43.211 1.00 14.28  ? 29   ILE B CD1   1 
ATOM   5104 N  N     . ASP F 3 53  ? 41.491  -57.698 -44.410 1.00 20.96  ? 30   ASP B N     1 
ATOM   5105 C  CA    . ASP F 3 53  ? 42.805  -58.186 -44.817 1.00 22.06  ? 30   ASP B CA    1 
ATOM   5106 C  C     . ASP F 3 53  ? 43.137  -57.728 -46.235 1.00 21.50  ? 30   ASP B C     1 
ATOM   5107 O  O     . ASP F 3 53  ? 42.299  -57.796 -47.129 1.00 22.25  ? 30   ASP B O     1 
ATOM   5108 C  CB    . ASP F 3 53  ? 42.834  -59.721 -44.735 1.00 25.40  ? 30   ASP B CB    1 
ATOM   5109 C  CG    . ASP F 3 53  ? 44.166  -60.316 -45.186 1.00 29.79  ? 30   ASP B CG    1 
ATOM   5110 O  OD1   . ASP F 3 53  ? 44.478  -60.240 -46.396 1.00 32.67  ? 30   ASP B OD1   1 
ATOM   5111 O  OD2   . ASP F 3 53  ? 44.901  -60.863 -44.331 1.00 28.77  ? 30   ASP B OD2   1 
ATOM   5112 N  N     . MET F 3 54  ? 44.359  -57.248 -46.432 1.00 20.71  ? 31   MET B N     1 
ATOM   5113 C  CA    . MET F 3 54  ? 44.799  -56.796 -47.745 1.00 21.00  ? 31   MET B CA    1 
ATOM   5114 C  C     . MET F 3 54  ? 45.139  -58.026 -48.581 1.00 21.51  ? 31   MET B C     1 
ATOM   5115 O  O     . MET F 3 54  ? 45.827  -58.931 -48.107 1.00 20.34  ? 31   MET B O     1 
ATOM   5116 C  CB    . MET F 3 54  ? 46.043  -55.911 -47.614 1.00 21.80  ? 31   MET B CB    1 
ATOM   5117 C  CG    . MET F 3 54  ? 45.853  -54.679 -46.747 1.00 24.78  ? 31   MET B CG    1 
ATOM   5118 S  SD    . MET F 3 54  ? 45.030  -53.316 -47.586 1.00 29.09  ? 31   MET B SD    1 
ATOM   5119 C  CE    . MET F 3 54  ? 46.251  -52.024 -47.396 1.00 28.74  ? 31   MET B CE    1 
ATOM   5120 N  N     . ASN F 3 55  ? 44.657  -58.063 -49.819 1.00 21.08  ? 32   ASN B N     1 
ATOM   5121 C  CA    . ASN F 3 55  ? 44.935  -59.188 -50.704 1.00 21.38  ? 32   ASN B CA    1 
ATOM   5122 C  C     . ASN F 3 55  ? 46.334  -59.042 -51.296 1.00 21.17  ? 32   ASN B C     1 
ATOM   5123 O  O     . ASN F 3 55  ? 46.681  -57.984 -51.816 1.00 21.35  ? 32   ASN B O     1 
ATOM   5124 C  CB    . ASN F 3 55  ? 43.908  -59.239 -51.833 1.00 22.54  ? 32   ASN B CB    1 
ATOM   5125 C  CG    . ASN F 3 55  ? 42.494  -59.066 -51.335 1.00 24.35  ? 32   ASN B CG    1 
ATOM   5126 O  OD1   . ASN F 3 55  ? 42.046  -59.782 -50.440 1.00 25.63  ? 32   ASN B OD1   1 
ATOM   5127 N  ND2   . ASN F 3 55  ? 41.777  -58.111 -51.915 1.00 25.46  ? 32   ASN B ND2   1 
ATOM   5128 N  N     . ALA F 3 56  ? 47.132  -60.105 -51.211 1.00 21.60  ? 33   ALA B N     1 
ATOM   5129 C  CA    . ALA F 3 56  ? 48.498  -60.099 -51.734 1.00 21.44  ? 33   ALA B CA    1 
ATOM   5130 C  C     . ALA F 3 56  ? 49.131  -58.734 -51.501 1.00 20.62  ? 33   ALA B C     1 
ATOM   5131 O  O     . ALA F 3 56  ? 49.547  -58.061 -52.442 1.00 20.20  ? 33   ALA B O     1 
ATOM   5132 C  CB    . ALA F 3 56  ? 48.485  -60.423 -53.225 1.00 22.80  ? 33   ALA B CB    1 
ATOM   5133 N  N     . PHE F 3 57  ? 49.205  -58.333 -50.239 1.00 19.28  ? 34   PHE B N     1 
ATOM   5134 C  CA    . PHE F 3 57  ? 49.747  -57.032 -49.896 1.00 19.25  ? 34   PHE B CA    1 
ATOM   5135 C  C     . PHE F 3 57  ? 51.037  -56.660 -50.623 1.00 19.82  ? 34   PHE B C     1 
ATOM   5136 O  O     . PHE F 3 57  ? 51.009  -55.891 -51.585 1.00 19.20  ? 34   PHE B O     1 
ATOM   5137 C  CB    . PHE F 3 57  ? 49.946  -56.928 -48.386 1.00 17.68  ? 34   PHE B CB    1 
ATOM   5138 C  CG    . PHE F 3 57  ? 50.122  -55.523 -47.909 1.00 17.70  ? 34   PHE B CG    1 
ATOM   5139 C  CD1   . PHE F 3 57  ? 49.382  -54.490 -48.483 1.00 16.35  ? 34   PHE B CD1   1 
ATOM   5140 C  CD2   . PHE F 3 57  ? 51.011  -55.228 -46.884 1.00 17.66  ? 34   PHE B CD2   1 
ATOM   5141 C  CE1   . PHE F 3 57  ? 49.522  -53.186 -48.046 1.00 16.79  ? 34   PHE B CE1   1 
ATOM   5142 C  CE2   . PHE F 3 57  ? 51.161  -53.923 -46.435 1.00 18.52  ? 34   PHE B CE2   1 
ATOM   5143 C  CZ    . PHE F 3 57  ? 50.414  -52.898 -47.018 1.00 19.73  ? 34   PHE B CZ    1 
ATOM   5144 N  N     . PHE F 3 58  ? 52.164  -57.195 -50.163 1.00 19.47  ? 35   PHE B N     1 
ATOM   5145 C  CA    . PHE F 3 58  ? 53.451  -56.902 -50.781 1.00 18.92  ? 35   PHE B CA    1 
ATOM   5146 C  C     . PHE F 3 58  ? 53.350  -56.933 -52.307 1.00 21.09  ? 35   PHE B C     1 
ATOM   5147 O  O     . PHE F 3 58  ? 53.980  -56.129 -52.996 1.00 24.23  ? 35   PHE B O     1 
ATOM   5148 C  CB    . PHE F 3 58  ? 54.506  -57.898 -50.291 1.00 16.87  ? 35   PHE B CB    1 
ATOM   5149 C  CG    . PHE F 3 58  ? 54.974  -57.652 -48.877 1.00 16.16  ? 35   PHE B CG    1 
ATOM   5150 C  CD1   . PHE F 3 58  ? 54.100  -57.165 -47.907 1.00 14.13  ? 35   PHE B CD1   1 
ATOM   5151 C  CD2   . PHE F 3 58  ? 56.279  -57.955 -48.502 1.00 16.11  ? 35   PHE B CD2   1 
ATOM   5152 C  CE1   . PHE F 3 58  ? 54.510  -56.991 -46.591 1.00 11.04  ? 35   PHE B CE1   1 
ATOM   5153 C  CE2   . PHE F 3 58  ? 56.699  -57.782 -47.183 1.00 14.59  ? 35   PHE B CE2   1 
ATOM   5154 C  CZ    . PHE F 3 58  ? 55.808  -57.300 -46.228 1.00 12.52  ? 35   PHE B CZ    1 
ATOM   5155 N  N     . ALA F 3 59  ? 52.549  -57.848 -52.841 1.00 21.25  ? 36   ALA B N     1 
ATOM   5156 C  CA    . ALA F 3 59  ? 52.383  -57.925 -54.289 1.00 20.46  ? 36   ALA B CA    1 
ATOM   5157 C  C     . ALA F 3 59  ? 51.639  -56.680 -54.763 1.00 19.74  ? 36   ALA B C     1 
ATOM   5158 O  O     . ALA F 3 59  ? 52.071  -56.014 -55.698 1.00 19.84  ? 36   ALA B O     1 
ATOM   5159 C  CB    . ALA F 3 59  ? 51.609  -59.178 -54.667 1.00 22.46  ? 36   ALA B CB    1 
ATOM   5160 N  N     . GLN F 3 60  ? 50.525  -56.362 -54.105 1.00 19.93  ? 37   GLN B N     1 
ATOM   5161 C  CA    . GLN F 3 60  ? 49.734  -55.188 -54.469 1.00 18.90  ? 37   GLN B CA    1 
ATOM   5162 C  C     . GLN F 3 60  ? 50.514  -53.881 -54.353 1.00 18.93  ? 37   GLN B C     1 
ATOM   5163 O  O     . GLN F 3 60  ? 50.367  -53.000 -55.195 1.00 18.64  ? 37   GLN B O     1 
ATOM   5164 C  CB    . GLN F 3 60  ? 48.463  -55.081 -53.614 1.00 16.33  ? 37   GLN B CB    1 
ATOM   5165 C  CG    . GLN F 3 60  ? 47.351  -56.047 -53.988 1.00 14.99  ? 37   GLN B CG    1 
ATOM   5166 C  CD    . GLN F 3 60  ? 45.963  -55.500 -53.658 1.00 15.04  ? 37   GLN B CD    1 
ATOM   5167 O  OE1   . GLN F 3 60  ? 45.468  -54.590 -54.322 1.00 13.24  ? 37   GLN B OE1   1 
ATOM   5168 N  NE2   . GLN F 3 60  ? 45.337  -56.051 -52.626 1.00 14.47  ? 37   GLN B NE2   1 
ATOM   5169 N  N     . VAL F 3 61  ? 51.338  -53.742 -53.318 1.00 19.06  ? 38   VAL B N     1 
ATOM   5170 C  CA    . VAL F 3 61  ? 52.096  -52.507 -53.168 1.00 20.91  ? 38   VAL B CA    1 
ATOM   5171 C  C     . VAL F 3 61  ? 53.103  -52.369 -54.306 1.00 22.34  ? 38   VAL B C     1 
ATOM   5172 O  O     . VAL F 3 61  ? 53.330  -51.266 -54.808 1.00 24.65  ? 38   VAL B O     1 
ATOM   5173 C  CB    . VAL F 3 61  ? 52.852  -52.439 -51.828 1.00 20.04  ? 38   VAL B CB    1 
ATOM   5174 C  CG1   . VAL F 3 61  ? 51.902  -52.664 -50.671 1.00 21.13  ? 38   VAL B CG1   1 
ATOM   5175 C  CG2   . VAL F 3 61  ? 53.948  -53.446 -51.818 1.00 23.55  ? 38   VAL B CG2   1 
ATOM   5176 N  N     . GLU F 3 62  ? 53.708  -53.480 -54.719 1.00 22.02  ? 39   GLU B N     1 
ATOM   5177 C  CA    . GLU F 3 62  ? 54.667  -53.425 -55.814 1.00 22.59  ? 39   GLU B CA    1 
ATOM   5178 C  C     . GLU F 3 62  ? 53.934  -53.218 -57.135 1.00 23.75  ? 39   GLU B C     1 
ATOM   5179 O  O     . GLU F 3 62  ? 54.467  -52.618 -58.063 1.00 25.84  ? 39   GLU B O     1 
ATOM   5180 C  CB    . GLU F 3 62  ? 55.501  -54.702 -55.876 1.00 20.64  ? 39   GLU B CB    1 
ATOM   5181 C  CG    . GLU F 3 62  ? 56.463  -54.876 -54.709 1.00 24.92  ? 39   GLU B CG    1 
ATOM   5182 C  CD    . GLU F 3 62  ? 57.269  -53.618 -54.400 1.00 26.67  ? 39   GLU B CD    1 
ATOM   5183 O  OE1   . GLU F 3 62  ? 57.618  -52.881 -55.349 1.00 25.58  ? 39   GLU B OE1   1 
ATOM   5184 O  OE2   . GLU F 3 62  ? 57.566  -53.375 -53.206 1.00 25.99  ? 39   GLU B OE2   1 
ATOM   5185 N  N     . GLN F 3 63  ? 52.704  -53.710 -57.212 1.00 23.70  ? 40   GLN B N     1 
ATOM   5186 C  CA    . GLN F 3 63  ? 51.899  -53.565 -58.417 1.00 24.11  ? 40   GLN B CA    1 
ATOM   5187 C  C     . GLN F 3 63  ? 51.532  -52.103 -58.642 1.00 24.92  ? 40   GLN B C     1 
ATOM   5188 O  O     . GLN F 3 63  ? 51.642  -51.589 -59.753 1.00 24.93  ? 40   GLN B O     1 
ATOM   5189 C  CB    . GLN F 3 63  ? 50.619  -54.388 -58.293 1.00 25.04  ? 40   GLN B CB    1 
ATOM   5190 C  CG    . GLN F 3 63  ? 49.622  -54.140 -59.405 1.00 26.73  ? 40   GLN B CG    1 
ATOM   5191 C  CD    . GLN F 3 63  ? 48.193  -54.149 -58.904 1.00 28.97  ? 40   GLN B CD    1 
ATOM   5192 O  OE1   . GLN F 3 63  ? 47.724  -55.140 -58.343 1.00 30.60  ? 40   GLN B OE1   1 
ATOM   5193 N  NE2   . GLN F 3 63  ? 47.493  -53.039 -59.101 1.00 28.57  ? 40   GLN B NE2   1 
ATOM   5194 N  N     . MET F 3 64  ? 51.082  -51.444 -57.578 1.00 25.83  ? 41   MET B N     1 
ATOM   5195 C  CA    . MET F 3 64  ? 50.687  -50.040 -57.640 1.00 25.65  ? 41   MET B CA    1 
ATOM   5196 C  C     . MET F 3 64  ? 51.880  -49.121 -57.860 1.00 26.25  ? 41   MET B C     1 
ATOM   5197 O  O     . MET F 3 64  ? 51.818  -48.189 -58.666 1.00 26.56  ? 41   MET B O     1 
ATOM   5198 C  CB    . MET F 3 64  ? 49.978  -49.635 -56.348 1.00 25.24  ? 41   MET B CB    1 
ATOM   5199 C  CG    . MET F 3 64  ? 48.515  -50.025 -56.280 1.00 27.05  ? 41   MET B CG    1 
ATOM   5200 S  SD    . MET F 3 64  ? 47.495  -49.077 -57.430 1.00 29.40  ? 41   MET B SD    1 
ATOM   5201 C  CE    . MET F 3 64  ? 46.637  -50.397 -58.303 1.00 30.64  ? 41   MET B CE    1 
ATOM   5202 N  N     . ARG F 3 65  ? 52.963  -49.386 -57.137 1.00 24.83  ? 42   ARG B N     1 
ATOM   5203 C  CA    . ARG F 3 65  ? 54.165  -48.573 -57.247 1.00 24.01  ? 42   ARG B CA    1 
ATOM   5204 C  C     . ARG F 3 65  ? 54.644  -48.430 -58.686 1.00 25.05  ? 42   ARG B C     1 
ATOM   5205 O  O     . ARG F 3 65  ? 55.127  -47.369 -59.080 1.00 26.70  ? 42   ARG B O     1 
ATOM   5206 C  CB    . ARG F 3 65  ? 55.289  -49.171 -56.398 1.00 20.38  ? 42   ARG B CB    1 
ATOM   5207 C  CG    . ARG F 3 65  ? 56.558  -48.339 -56.385 1.00 16.86  ? 42   ARG B CG    1 
ATOM   5208 C  CD    . ARG F 3 65  ? 57.610  -48.975 -55.500 1.00 18.19  ? 42   ARG B CD    1 
ATOM   5209 N  NE    . ARG F 3 65  ? 58.086  -50.247 -56.034 1.00 19.04  ? 42   ARG B NE    1 
ATOM   5210 C  CZ    . ARG F 3 65  ? 58.976  -50.359 -57.015 1.00 18.09  ? 42   ARG B CZ    1 
ATOM   5211 N  NH1   . ARG F 3 65  ? 59.496  -49.273 -57.567 1.00 17.99  ? 42   ARG B NH1   1 
ATOM   5212 N  NH2   . ARG F 3 65  ? 59.338  -51.556 -57.453 1.00 18.17  ? 42   ARG B NH2   1 
ATOM   5213 N  N     . CYS F 3 66  ? 54.498  -49.491 -59.472 1.00 25.30  ? 43   CYS B N     1 
ATOM   5214 C  CA    . CYS F 3 66  ? 54.953  -49.475 -60.856 1.00 26.06  ? 43   CYS B CA    1 
ATOM   5215 C  C     . CYS F 3 66  ? 53.866  -49.219 -61.890 1.00 27.77  ? 43   CYS B C     1 
ATOM   5216 O  O     . CYS F 3 66  ? 54.022  -49.572 -63.060 1.00 29.97  ? 43   CYS B O     1 
ATOM   5217 C  CB    . CYS F 3 66  ? 55.664  -50.787 -61.165 1.00 24.59  ? 43   CYS B CB    1 
ATOM   5218 S  SG    . CYS F 3 66  ? 56.974  -51.147 -59.986 1.00 27.54  ? 43   CYS B SG    1 
ATOM   5219 N  N     . GLY F 3 67  ? 52.770  -48.606 -61.455 1.00 28.93  ? 44   GLY B N     1 
ATOM   5220 C  CA    . GLY F 3 67  ? 51.677  -48.291 -62.358 1.00 29.94  ? 44   GLY B CA    1 
ATOM   5221 C  C     . GLY F 3 67  ? 51.028  -49.476 -63.050 1.00 31.38  ? 44   GLY B C     1 
ATOM   5222 O  O     . GLY F 3 67  ? 50.286  -49.304 -64.017 1.00 31.50  ? 44   GLY B O     1 
ATOM   5223 N  N     . LEU F 3 68  ? 51.301  -50.680 -62.562 1.00 32.02  ? 45   LEU B N     1 
ATOM   5224 C  CA    . LEU F 3 68  ? 50.726  -51.883 -63.151 1.00 33.07  ? 45   LEU B CA    1 
ATOM   5225 C  C     . LEU F 3 68  ? 49.272  -52.050 -62.700 1.00 35.10  ? 45   LEU B C     1 
ATOM   5226 O  O     . LEU F 3 68  ? 48.812  -51.346 -61.799 1.00 34.81  ? 45   LEU B O     1 
ATOM   5227 C  CB    . LEU F 3 68  ? 51.562  -53.098 -62.748 1.00 31.67  ? 45   LEU B CB    1 
ATOM   5228 C  CG    . LEU F 3 68  ? 53.016  -53.056 -63.231 1.00 30.66  ? 45   LEU B CG    1 
ATOM   5229 C  CD1   . LEU F 3 68  ? 53.855  -54.087 -62.495 1.00 31.19  ? 45   LEU B CD1   1 
ATOM   5230 C  CD2   . LEU F 3 68  ? 53.054  -53.298 -64.725 1.00 31.08  ? 45   LEU B CD2   1 
ATOM   5231 N  N     . SER F 3 69  ? 48.550  -52.974 -63.334 1.00 36.46  ? 46   SER B N     1 
ATOM   5232 C  CA    . SER F 3 69  ? 47.147  -53.214 -63.001 1.00 37.91  ? 46   SER B CA    1 
ATOM   5233 C  C     . SER F 3 69  ? 46.928  -54.532 -62.272 1.00 39.58  ? 46   SER B C     1 
ATOM   5234 O  O     . SER F 3 69  ? 47.825  -55.370 -62.191 1.00 40.09  ? 46   SER B O     1 
ATOM   5235 C  CB    . SER F 3 69  ? 46.289  -53.209 -64.265 1.00 37.84  ? 46   SER B CB    1 
ATOM   5236 O  OG    . SER F 3 69  ? 46.567  -54.344 -65.065 1.00 38.57  ? 46   SER B OG    1 
ATOM   5237 N  N     . LYS F 3 70  ? 45.718  -54.711 -61.753 1.00 41.44  ? 47   LYS B N     1 
ATOM   5238 C  CA    . LYS F 3 70  ? 45.364  -55.922 -61.025 1.00 43.28  ? 47   LYS B CA    1 
ATOM   5239 C  C     . LYS F 3 70  ? 45.380  -57.124 -61.960 1.00 44.78  ? 47   LYS B C     1 
ATOM   5240 O  O     . LYS F 3 70  ? 45.284  -58.268 -61.517 1.00 45.87  ? 47   LYS B O     1 
ATOM   5241 C  CB    . LYS F 3 70  ? 43.972  -55.768 -60.407 1.00 42.96  ? 47   LYS B CB    1 
ATOM   5242 C  CG    . LYS F 3 70  ? 43.542  -56.928 -59.527 0.00 44.55  ? 47   LYS B CG    1 
ATOM   5243 C  CD    . LYS F 3 70  ? 42.140  -56.708 -58.985 0.00 45.40  ? 47   LYS B CD    1 
ATOM   5244 C  CE    . LYS F 3 70  ? 41.707  -57.854 -58.088 0.00 46.04  ? 47   LYS B CE    1 
ATOM   5245 N  NZ    . LYS F 3 70  ? 42.591  -57.990 -56.898 0.00 46.49  ? 47   LYS B NZ    1 
ATOM   5246 N  N     . GLU F 3 71  ? 45.517  -56.852 -63.254 1.00 46.43  ? 48   GLU B N     1 
ATOM   5247 C  CA    . GLU F 3 71  ? 45.529  -57.888 -64.281 1.00 47.67  ? 48   GLU B CA    1 
ATOM   5248 C  C     . GLU F 3 71  ? 46.903  -58.514 -64.541 1.00 47.07  ? 48   GLU B C     1 
ATOM   5249 O  O     . GLU F 3 71  ? 46.990  -59.663 -64.975 1.00 46.80  ? 48   GLU B O     1 
ATOM   5250 C  CB    . GLU F 3 71  ? 44.985  -57.304 -65.586 1.00 50.97  ? 48   GLU B CB    1 
ATOM   5251 C  CG    . GLU F 3 71  ? 43.576  -56.742 -65.476 1.00 56.93  ? 48   GLU B CG    1 
ATOM   5252 C  CD    . GLU F 3 71  ? 42.504  -57.800 -65.668 1.00 61.14  ? 48   GLU B CD    1 
ATOM   5253 O  OE1   . GLU F 3 71  ? 42.593  -58.868 -65.024 1.00 64.15  ? 48   GLU B OE1   1 
ATOM   5254 O  OE2   . GLU F 3 71  ? 41.569  -57.562 -66.462 1.00 63.14  ? 48   GLU B OE2   1 
ATOM   5255 N  N     . ASP F 3 72  ? 47.969  -57.763 -64.277 1.00 46.57  ? 49   ASP B N     1 
ATOM   5256 C  CA    . ASP F 3 72  ? 49.330  -58.248 -64.510 1.00 45.59  ? 49   ASP B CA    1 
ATOM   5257 C  C     . ASP F 3 72  ? 49.818  -59.228 -63.453 1.00 44.97  ? 49   ASP B C     1 
ATOM   5258 O  O     . ASP F 3 72  ? 49.784  -58.938 -62.255 1.00 45.96  ? 49   ASP B O     1 
ATOM   5259 C  CB    . ASP F 3 72  ? 50.299  -57.072 -64.581 1.00 47.28  ? 49   ASP B CB    1 
ATOM   5260 C  CG    . ASP F 3 72  ? 49.886  -56.043 -65.609 1.00 50.28  ? 49   ASP B CG    1 
ATOM   5261 O  OD1   . ASP F 3 72  ? 49.783  -56.405 -66.802 1.00 52.41  ? 49   ASP B OD1   1 
ATOM   5262 O  OD2   . ASP F 3 72  ? 49.663  -54.874 -65.225 1.00 50.49  ? 49   ASP B OD2   1 
ATOM   5263 N  N     . PRO F 3 73  ? 50.286  -60.407 -63.887 1.00 43.11  ? 50   PRO B N     1 
ATOM   5264 C  CA    . PRO F 3 73  ? 50.786  -61.435 -62.970 1.00 40.99  ? 50   PRO B CA    1 
ATOM   5265 C  C     . PRO F 3 73  ? 52.110  -61.039 -62.330 1.00 38.29  ? 50   PRO B C     1 
ATOM   5266 O  O     . PRO F 3 73  ? 53.179  -61.382 -62.826 1.00 37.69  ? 50   PRO B O     1 
ATOM   5267 C  CB    . PRO F 3 73  ? 50.917  -62.658 -63.870 1.00 41.73  ? 50   PRO B CB    1 
ATOM   5268 C  CG    . PRO F 3 73  ? 51.293  -62.051 -65.184 1.00 42.56  ? 50   PRO B CG    1 
ATOM   5269 C  CD    . PRO F 3 73  ? 50.340  -60.880 -65.281 1.00 42.62  ? 50   PRO B CD    1 
ATOM   5270 N  N     . VAL F 3 74  ? 52.030  -60.309 -61.226 1.00 36.21  ? 51   VAL B N     1 
ATOM   5271 C  CA    . VAL F 3 74  ? 53.225  -59.870 -60.521 1.00 35.14  ? 51   VAL B CA    1 
ATOM   5272 C  C     . VAL F 3 74  ? 53.404  -60.631 -59.217 1.00 33.44  ? 51   VAL B C     1 
ATOM   5273 O  O     . VAL F 3 74  ? 52.433  -60.977 -58.548 1.00 33.08  ? 51   VAL B O     1 
ATOM   5274 C  CB    . VAL F 3 74  ? 53.168  -58.352 -60.203 1.00 35.66  ? 51   VAL B CB    1 
ATOM   5275 C  CG1   . VAL F 3 74  ? 51.880  -58.018 -59.477 1.00 37.06  ? 51   VAL B CG1   1 
ATOM   5276 C  CG2   . VAL F 3 74  ? 54.359  -57.950 -59.349 1.00 35.67  ? 51   VAL B CG2   1 
ATOM   5277 N  N     . VAL F 3 75  ? 54.655  -60.904 -58.871 1.00 32.26  ? 52   VAL B N     1 
ATOM   5278 C  CA    . VAL F 3 75  ? 54.970  -61.597 -57.635 1.00 32.12  ? 52   VAL B CA    1 
ATOM   5279 C  C     . VAL F 3 75  ? 56.112  -60.854 -56.974 1.00 32.74  ? 52   VAL B C     1 
ATOM   5280 O  O     . VAL F 3 75  ? 57.062  -60.440 -57.638 1.00 34.02  ? 52   VAL B O     1 
ATOM   5281 C  CB    . VAL F 3 75  ? 55.397  -63.059 -57.875 1.00 32.01  ? 52   VAL B CB    1 
ATOM   5282 C  CG1   . VAL F 3 75  ? 54.259  -63.829 -58.513 1.00 33.12  ? 52   VAL B CG1   1 
ATOM   5283 C  CG2   . VAL F 3 75  ? 56.637  -63.111 -58.746 1.00 31.00  ? 52   VAL B CG2   1 
ATOM   5284 N  N     . CYS F 3 76  ? 56.003  -60.665 -55.667 1.00 32.85  ? 53   CYS B N     1 
ATOM   5285 C  CA    . CYS F 3 76  ? 57.031  -59.970 -54.909 1.00 32.91  ? 53   CYS B CA    1 
ATOM   5286 C  C     . CYS F 3 76  ? 58.059  -61.002 -54.466 1.00 32.63  ? 53   CYS B C     1 
ATOM   5287 O  O     . CYS F 3 76  ? 57.763  -61.884 -53.658 1.00 32.63  ? 53   CYS B O     1 
ATOM   5288 C  CB    . CYS F 3 76  ? 56.407  -59.278 -53.696 1.00 32.29  ? 53   CYS B CB    1 
ATOM   5289 S  SG    . CYS F 3 76  ? 57.568  -58.348 -52.686 1.00 31.90  ? 53   CYS B SG    1 
ATOM   5290 N  N     . VAL F 3 77  ? 59.266  -60.895 -55.005 1.00 31.41  ? 54   VAL B N     1 
ATOM   5291 C  CA    . VAL F 3 77  ? 60.316  -61.842 -54.672 1.00 31.82  ? 54   VAL B CA    1 
ATOM   5292 C  C     . VAL F 3 77  ? 61.351  -61.292 -53.712 1.00 31.58  ? 54   VAL B C     1 
ATOM   5293 O  O     . VAL F 3 77  ? 61.459  -60.085 -53.506 1.00 32.14  ? 54   VAL B O     1 
ATOM   5294 C  CB    . VAL F 3 77  ? 61.057  -62.323 -55.933 1.00 32.04  ? 54   VAL B CB    1 
ATOM   5295 C  CG1   . VAL F 3 77  ? 60.090  -63.009 -56.876 1.00 33.17  ? 54   VAL B CG1   1 
ATOM   5296 C  CG2   . VAL F 3 77  ? 61.724  -61.150 -56.615 1.00 32.68  ? 54   VAL B CG2   1 
ATOM   5297 N  N     . GLN F 3 78  ? 62.114  -62.208 -53.133 1.00 31.46  ? 55   GLN B N     1 
ATOM   5298 C  CA    . GLN F 3 78  ? 63.169  -61.873 -52.196 1.00 33.28  ? 55   GLN B CA    1 
ATOM   5299 C  C     . GLN F 3 78  ? 64.285  -62.874 -52.445 1.00 34.21  ? 55   GLN B C     1 
ATOM   5300 O  O     . GLN F 3 78  ? 64.102  -64.070 -52.227 1.00 35.82  ? 55   GLN B O     1 
ATOM   5301 C  CB    . GLN F 3 78  ? 62.667  -62.010 -50.759 1.00 33.29  ? 55   GLN B CB    1 
ATOM   5302 C  CG    . GLN F 3 78  ? 63.655  -61.533 -49.715 1.00 34.02  ? 55   GLN B CG    1 
ATOM   5303 C  CD    . GLN F 3 78  ? 63.186  -61.801 -48.302 1.00 35.03  ? 55   GLN B CD    1 
ATOM   5304 O  OE1   . GLN F 3 78  ? 62.025  -61.565 -47.964 1.00 35.56  ? 55   GLN B OE1   1 
ATOM   5305 N  NE2   . GLN F 3 78  ? 64.093  -62.286 -47.460 1.00 36.40  ? 55   GLN B NE2   1 
ATOM   5306 N  N     . TRP F 3 79  ? 65.432  -62.389 -52.913 1.00 34.15  ? 56   TRP B N     1 
ATOM   5307 C  CA    . TRP F 3 79  ? 66.572  -63.255 -53.197 1.00 34.47  ? 56   TRP B CA    1 
ATOM   5308 C  C     . TRP F 3 79  ? 66.239  -64.235 -54.318 1.00 34.77  ? 56   TRP B C     1 
ATOM   5309 O  O     . TRP F 3 79  ? 66.351  -63.900 -55.496 1.00 36.74  ? 56   TRP B O     1 
ATOM   5310 C  CB    . TRP F 3 79  ? 66.974  -64.040 -51.946 1.00 34.19  ? 56   TRP B CB    1 
ATOM   5311 C  CG    . TRP F 3 79  ? 67.335  -63.187 -50.771 1.00 34.64  ? 56   TRP B CG    1 
ATOM   5312 C  CD1   . TRP F 3 79  ? 67.044  -63.437 -49.464 1.00 33.69  ? 56   TRP B CD1   1 
ATOM   5313 C  CD2   . TRP F 3 79  ? 68.074  -61.958 -50.790 1.00 35.26  ? 56   TRP B CD2   1 
ATOM   5314 N  NE1   . TRP F 3 79  ? 67.554  -62.444 -48.665 1.00 34.10  ? 56   TRP B NE1   1 
ATOM   5315 C  CE2   . TRP F 3 79  ? 68.191  -61.523 -49.452 1.00 33.80  ? 56   TRP B CE2   1 
ATOM   5316 C  CE3   . TRP F 3 79  ? 68.649  -61.184 -51.808 1.00 35.85  ? 56   TRP B CE3   1 
ATOM   5317 C  CZ2   . TRP F 3 79  ? 68.857  -60.348 -49.103 1.00 33.41  ? 56   TRP B CZ2   1 
ATOM   5318 C  CZ3   . TRP F 3 79  ? 69.311  -60.014 -51.460 1.00 35.90  ? 56   TRP B CZ3   1 
ATOM   5319 C  CH2   . TRP F 3 79  ? 69.409  -59.609 -50.116 1.00 35.89  ? 56   TRP B CH2   1 
ATOM   5320 N  N     . ASN F 3 80  ? 65.826  -65.442 -53.940 1.00 34.38  ? 57   ASN B N     1 
ATOM   5321 C  CA    . ASN F 3 80  ? 65.484  -66.490 -54.898 1.00 33.79  ? 57   ASN B CA    1 
ATOM   5322 C  C     . ASN F 3 80  ? 64.071  -67.008 -54.715 1.00 33.68  ? 57   ASN B C     1 
ATOM   5323 O  O     . ASN F 3 80  ? 63.558  -67.730 -55.565 1.00 35.05  ? 57   ASN B O     1 
ATOM   5324 C  CB    . ASN F 3 80  ? 66.448  -67.667 -54.757 1.00 33.78  ? 57   ASN B CB    1 
ATOM   5325 C  CG    . ASN F 3 80  ? 67.808  -67.383 -55.352 1.00 35.06  ? 57   ASN B CG    1 
ATOM   5326 O  OD1   . ASN F 3 80  ? 68.779  -68.084 -55.067 1.00 34.25  ? 57   ASN B OD1   1 
ATOM   5327 N  ND2   . ASN F 3 80  ? 67.886  -66.357 -56.193 1.00 36.11  ? 57   ASN B ND2   1 
ATOM   5328 N  N     . SER F 3 81  ? 63.445  -66.645 -53.603 1.00 33.44  ? 58   SER B N     1 
ATOM   5329 C  CA    . SER F 3 81  ? 62.093  -67.103 -53.314 1.00 32.58  ? 58   SER B CA    1 
ATOM   5330 C  C     . SER F 3 81  ? 61.011  -66.056 -53.558 1.00 31.00  ? 58   SER B C     1 
ATOM   5331 O  O     . SER F 3 81  ? 61.290  -64.864 -53.659 1.00 32.85  ? 58   SER B O     1 
ATOM   5332 C  CB    . SER F 3 81  ? 62.014  -67.582 -51.864 1.00 34.15  ? 58   SER B CB    1 
ATOM   5333 O  OG    . SER F 3 81  ? 62.404  -66.550 -50.975 1.00 36.85  ? 58   SER B OG    1 
ATOM   5334 N  N     . ILE F 3 82  ? 59.772  -66.526 -53.655 1.00 29.02  ? 59   ILE B N     1 
ATOM   5335 C  CA    . ILE F 3 82  ? 58.615  -65.664 -53.865 1.00 27.63  ? 59   ILE B CA    1 
ATOM   5336 C  C     . ILE F 3 82  ? 57.925  -65.499 -52.517 1.00 26.68  ? 59   ILE B C     1 
ATOM   5337 O  O     . ILE F 3 82  ? 57.649  -66.486 -51.834 1.00 27.02  ? 59   ILE B O     1 
ATOM   5338 C  CB    . ILE F 3 82  ? 57.621  -66.299 -54.856 1.00 27.48  ? 59   ILE B CB    1 
ATOM   5339 C  CG1   . ILE F 3 82  ? 58.247  -66.365 -56.247 1.00 27.73  ? 59   ILE B CG1   1 
ATOM   5340 C  CG2   . ILE F 3 82  ? 56.328  -65.507 -54.880 1.00 27.49  ? 59   ILE B CG2   1 
ATOM   5341 C  CD1   . ILE F 3 82  ? 57.340  -66.973 -57.292 1.00 28.87  ? 59   ILE B CD1   1 
ATOM   5342 N  N     . ILE F 3 83  ? 57.641  -64.259 -52.132 1.00 25.33  ? 60   ILE B N     1 
ATOM   5343 C  CA    . ILE F 3 83  ? 57.001  -64.015 -50.847 1.00 24.12  ? 60   ILE B CA    1 
ATOM   5344 C  C     . ILE F 3 83  ? 55.575  -63.483 -50.933 1.00 23.32  ? 60   ILE B C     1 
ATOM   5345 O  O     . ILE F 3 83  ? 54.901  -63.372 -49.916 1.00 22.78  ? 60   ILE B O     1 
ATOM   5346 C  CB    . ILE F 3 83  ? 57.850  -63.054 -49.983 1.00 23.87  ? 60   ILE B CB    1 
ATOM   5347 C  CG1   . ILE F 3 83  ? 57.943  -61.680 -50.647 1.00 25.56  ? 60   ILE B CG1   1 
ATOM   5348 C  CG2   . ILE F 3 83  ? 59.248  -63.623 -49.802 1.00 22.76  ? 60   ILE B CG2   1 
ATOM   5349 C  CD1   . ILE F 3 83  ? 58.741  -60.662 -49.836 1.00 26.51  ? 60   ILE B CD1   1 
ATOM   5350 N  N     . ALA F 3 84  ? 55.117  -63.161 -52.140 1.00 23.31  ? 61   ALA B N     1 
ATOM   5351 C  CA    . ALA F 3 84  ? 53.759  -62.650 -52.347 1.00 23.51  ? 61   ALA B CA    1 
ATOM   5352 C  C     . ALA F 3 84  ? 53.325  -62.917 -53.782 1.00 24.43  ? 61   ALA B C     1 
ATOM   5353 O  O     . ALA F 3 84  ? 54.123  -62.784 -54.709 1.00 25.88  ? 61   ALA B O     1 
ATOM   5354 C  CB    . ALA F 3 84  ? 53.707  -61.165 -52.059 1.00 23.35  ? 61   ALA B CB    1 
ATOM   5355 N  N     . VAL F 3 85  ? 52.059  -63.277 -53.969 1.00 24.41  ? 62   VAL B N     1 
ATOM   5356 C  CA    . VAL F 3 85  ? 51.557  -63.589 -55.305 1.00 23.24  ? 62   VAL B CA    1 
ATOM   5357 C  C     . VAL F 3 85  ? 50.223  -62.943 -55.658 1.00 24.25  ? 62   VAL B C     1 
ATOM   5358 O  O     . VAL F 3 85  ? 49.193  -63.267 -55.070 1.00 24.22  ? 62   VAL B O     1 
ATOM   5359 C  CB    . VAL F 3 85  ? 51.396  -65.111 -55.482 1.00 21.40  ? 62   VAL B CB    1 
ATOM   5360 C  CG1   . VAL F 3 85  ? 50.814  -65.415 -56.850 1.00 22.64  ? 62   VAL B CG1   1 
ATOM   5361 C  CG2   . VAL F 3 85  ? 52.737  -65.799 -55.309 1.00 19.74  ? 62   VAL B CG2   1 
ATOM   5362 N  N     . SER F 3 86  ? 50.244  -62.041 -56.634 1.00 24.30  ? 63   SER B N     1 
ATOM   5363 C  CA    . SER F 3 86  ? 49.024  -61.381 -57.067 1.00 25.18  ? 63   SER B CA    1 
ATOM   5364 C  C     . SER F 3 86  ? 48.065  -62.474 -57.501 1.00 25.94  ? 63   SER B C     1 
ATOM   5365 O  O     . SER F 3 86  ? 48.489  -63.515 -57.992 1.00 25.00  ? 63   SER B O     1 
ATOM   5366 C  CB    . SER F 3 86  ? 49.305  -60.445 -58.244 1.00 27.22  ? 63   SER B CB    1 
ATOM   5367 O  OG    . SER F 3 86  ? 49.761  -61.161 -59.379 1.00 26.89  ? 63   SER B OG    1 
ATOM   5368 N  N     . TYR F 3 87  ? 46.772  -62.237 -57.321 1.00 28.00  ? 64   TYR B N     1 
ATOM   5369 C  CA    . TYR F 3 87  ? 45.768  -63.221 -57.687 1.00 29.68  ? 64   TYR B CA    1 
ATOM   5370 C  C     . TYR F 3 87  ? 45.703  -63.497 -59.182 1.00 30.83  ? 64   TYR B C     1 
ATOM   5371 O  O     . TYR F 3 87  ? 45.260  -64.566 -59.602 1.00 32.00  ? 64   TYR B O     1 
ATOM   5372 C  CB    . TYR F 3 87  ? 44.396  -62.791 -57.159 1.00 29.40  ? 64   TYR B CB    1 
ATOM   5373 C  CG    . TYR F 3 87  ? 44.262  -62.988 -55.667 1.00 29.38  ? 64   TYR B CG    1 
ATOM   5374 C  CD1   . TYR F 3 87  ? 44.957  -62.178 -54.773 1.00 30.91  ? 64   TYR B CD1   1 
ATOM   5375 C  CD2   . TYR F 3 87  ? 43.494  -64.029 -55.148 1.00 29.28  ? 64   TYR B CD2   1 
ATOM   5376 C  CE1   . TYR F 3 87  ? 44.899  -62.403 -53.398 1.00 31.71  ? 64   TYR B CE1   1 
ATOM   5377 C  CE2   . TYR F 3 87  ? 43.428  -64.264 -53.778 1.00 29.95  ? 64   TYR B CE2   1 
ATOM   5378 C  CZ    . TYR F 3 87  ? 44.136  -63.448 -52.908 1.00 31.02  ? 64   TYR B CZ    1 
ATOM   5379 O  OH    . TYR F 3 87  ? 44.101  -63.680 -51.551 1.00 30.55  ? 64   TYR B OH    1 
ATOM   5380 N  N     . ALA F 3 88  ? 46.148  -62.542 -59.988 1.00 32.37  ? 65   ALA B N     1 
ATOM   5381 C  CA    . ALA F 3 88  ? 46.137  -62.724 -61.433 1.00 33.39  ? 65   ALA B CA    1 
ATOM   5382 C  C     . ALA F 3 88  ? 47.221  -63.728 -61.801 1.00 33.46  ? 65   ALA B C     1 
ATOM   5383 O  O     . ALA F 3 88  ? 47.184  -64.341 -62.867 1.00 33.40  ? 65   ALA B O     1 
ATOM   5384 C  CB    . ALA F 3 88  ? 46.390  -61.395 -62.132 1.00 33.02  ? 65   ALA B CB    1 
ATOM   5385 N  N     . ALA F 3 89  ? 48.180  -63.892 -60.896 1.00 34.43  ? 66   ALA B N     1 
ATOM   5386 C  CA    . ALA F 3 89  ? 49.293  -64.810 -61.090 1.00 36.25  ? 66   ALA B CA    1 
ATOM   5387 C  C     . ALA F 3 89  ? 48.986  -66.161 -60.463 1.00 37.32  ? 66   ALA B C     1 
ATOM   5388 O  O     . ALA F 3 89  ? 49.613  -67.168 -60.789 1.00 37.84  ? 66   ALA B O     1 
ATOM   5389 C  CB    . ALA F 3 89  ? 50.559  -64.230 -60.473 1.00 36.97  ? 66   ALA B CB    1 
ATOM   5390 N  N     . ARG F 3 90  ? 48.025  -66.177 -59.549 1.00 38.58  ? 67   ARG B N     1 
ATOM   5391 C  CA    . ARG F 3 90  ? 47.643  -67.417 -58.895 1.00 39.01  ? 67   ARG B CA    1 
ATOM   5392 C  C     . ARG F 3 90  ? 46.831  -68.224 -59.896 1.00 39.35  ? 67   ARG B C     1 
ATOM   5393 O  O     . ARG F 3 90  ? 46.860  -69.455 -59.887 1.00 41.25  ? 67   ARG B O     1 
ATOM   5394 C  CB    . ARG F 3 90  ? 46.818  -67.127 -57.635 1.00 38.82  ? 67   ARG B CB    1 
ATOM   5395 C  CG    . ARG F 3 90  ? 47.528  -66.215 -56.640 1.00 37.89  ? 67   ARG B CG    1 
ATOM   5396 C  CD    . ARG F 3 90  ? 46.830  -66.163 -55.292 1.00 37.26  ? 67   ARG B CD    1 
ATOM   5397 N  NE    . ARG F 3 90  ? 47.492  -65.228 -54.383 1.00 38.45  ? 67   ARG B NE    1 
ATOM   5398 C  CZ    . ARG F 3 90  ? 47.207  -65.107 -53.089 1.00 38.15  ? 67   ARG B CZ    1 
ATOM   5399 N  NH1   . ARG F 3 90  ? 46.270  -65.866 -52.540 1.00 38.90  ? 67   ARG B NH1   1 
ATOM   5400 N  NH2   . ARG F 3 90  ? 47.854  -64.219 -52.345 1.00 36.71  ? 67   ARG B NH2   1 
ATOM   5401 N  N     . LYS F 3 91  ? 46.116  -67.525 -60.771 1.00 38.62  ? 68   LYS B N     1 
ATOM   5402 C  CA    . LYS F 3 91  ? 45.316  -68.196 -61.783 1.00 38.68  ? 68   LYS B CA    1 
ATOM   5403 C  C     . LYS F 3 91  ? 46.210  -69.044 -62.678 1.00 38.41  ? 68   LYS B C     1 
ATOM   5404 O  O     . LYS F 3 91  ? 45.722  -69.889 -63.425 1.00 39.29  ? 68   LYS B O     1 
ATOM   5405 C  CB    . LYS F 3 91  ? 44.550  -67.183 -62.638 1.00 38.91  ? 68   LYS B CB    1 
ATOM   5406 C  CG    . LYS F 3 91  ? 43.401  -66.485 -61.915 1.00 40.09  ? 68   LYS B CG    1 
ATOM   5407 C  CD    . LYS F 3 91  ? 42.426  -65.880 -62.921 1.00 42.98  ? 68   LYS B CD    1 
ATOM   5408 C  CE    . LYS F 3 91  ? 41.251  -65.195 -62.244 1.00 43.90  ? 68   LYS B CE    1 
ATOM   5409 N  NZ    . LYS F 3 91  ? 41.677  -63.990 -61.482 1.00 46.14  ? 68   LYS B NZ    1 
ATOM   5410 N  N     . TYR F 3 92  ? 47.518  -68.818 -62.594 1.00 38.49  ? 69   TYR B N     1 
ATOM   5411 C  CA    . TYR F 3 92  ? 48.482  -69.565 -63.396 1.00 38.56  ? 69   TYR B CA    1 
ATOM   5412 C  C     . TYR F 3 92  ? 49.154  -70.672 -62.590 1.00 38.63  ? 69   TYR B C     1 
ATOM   5413 O  O     . TYR F 3 92  ? 50.201  -71.190 -62.982 1.00 38.92  ? 69   TYR B O     1 
ATOM   5414 C  CB    . TYR F 3 92  ? 49.545  -68.621 -63.970 1.00 40.24  ? 69   TYR B CB    1 
ATOM   5415 C  CG    . TYR F 3 92  ? 49.015  -67.687 -65.035 1.00 42.97  ? 69   TYR B CG    1 
ATOM   5416 C  CD1   . TYR F 3 92  ? 48.002  -66.774 -64.747 1.00 45.07  ? 69   TYR B CD1   1 
ATOM   5417 C  CD2   . TYR F 3 92  ? 49.505  -67.736 -66.340 1.00 44.16  ? 69   TYR B CD2   1 
ATOM   5418 C  CE1   . TYR F 3 92  ? 47.484  -65.933 -65.732 1.00 47.76  ? 69   TYR B CE1   1 
ATOM   5419 C  CE2   . TYR F 3 92  ? 48.994  -66.900 -67.335 1.00 46.70  ? 69   TYR B CE2   1 
ATOM   5420 C  CZ    . TYR F 3 92  ? 47.983  -66.002 -67.025 1.00 48.27  ? 69   TYR B CZ    1 
ATOM   5421 O  OH    . TYR F 3 92  ? 47.464  -65.176 -68.002 1.00 48.20  ? 69   TYR B OH    1 
ATOM   5422 N  N     . GLY F 3 93  ? 48.545  -71.028 -61.462 1.00 37.88  ? 70   GLY B N     1 
ATOM   5423 C  CA    . GLY F 3 93  ? 49.086  -72.085 -60.627 1.00 37.89  ? 70   GLY B CA    1 
ATOM   5424 C  C     . GLY F 3 93  ? 50.300  -71.705 -59.803 1.00 37.95  ? 70   GLY B C     1 
ATOM   5425 O  O     . GLY F 3 93  ? 50.934  -72.564 -59.189 1.00 37.39  ? 70   GLY B O     1 
ATOM   5426 N  N     . ILE F 3 94  ? 50.631  -70.421 -59.779 1.00 38.91  ? 71   ILE B N     1 
ATOM   5427 C  CA    . ILE F 3 94  ? 51.784  -69.971 -59.013 1.00 40.39  ? 71   ILE B CA    1 
ATOM   5428 C  C     . ILE F 3 94  ? 51.455  -69.888 -57.527 1.00 41.65  ? 71   ILE B C     1 
ATOM   5429 O  O     . ILE F 3 94  ? 50.362  -69.471 -57.139 1.00 41.79  ? 71   ILE B O     1 
ATOM   5430 C  CB    . ILE F 3 94  ? 52.282  -68.601 -59.511 1.00 39.33  ? 71   ILE B CB    1 
ATOM   5431 C  CG1   . ILE F 3 94  ? 52.718  -68.721 -60.972 1.00 38.42  ? 71   ILE B CG1   1 
ATOM   5432 C  CG2   . ILE F 3 94  ? 53.444  -68.123 -58.655 1.00 37.06  ? 71   ILE B CG2   1 
ATOM   5433 C  CD1   . ILE F 3 94  ? 53.088  -67.408 -61.612 1.00 41.55  ? 71   ILE B CD1   1 
ATOM   5434 N  N     . SER F 3 95  ? 52.413  -70.304 -56.705 1.00 42.34  ? 72   SER B N     1 
ATOM   5435 C  CA    . SER F 3 95  ? 52.260  -70.294 -55.257 1.00 43.35  ? 72   SER B CA    1 
ATOM   5436 C  C     . SER F 3 95  ? 53.547  -69.799 -54.619 1.00 44.46  ? 72   SER B C     1 
ATOM   5437 O  O     . SER F 3 95  ? 54.595  -69.771 -55.260 1.00 45.54  ? 72   SER B O     1 
ATOM   5438 C  CB    . SER F 3 95  ? 51.953  -71.703 -54.747 1.00 42.81  ? 72   SER B CB    1 
ATOM   5439 O  OG    . SER F 3 95  ? 52.991  -72.605 -55.089 0.00 43.51  ? 72   SER B OG    1 
ATOM   5440 N  N     . ARG F 3 96  ? 53.466  -69.420 -53.352 1.00 45.64  ? 73   ARG B N     1 
ATOM   5441 C  CA    . ARG F 3 96  ? 54.628  -68.921 -52.632 1.00 47.47  ? 73   ARG B CA    1 
ATOM   5442 C  C     . ARG F 3 96  ? 55.677  -70.016 -52.456 1.00 49.26  ? 73   ARG B C     1 
ATOM   5443 O  O     . ARG F 3 96  ? 56.796  -69.757 -52.012 1.00 49.35  ? 73   ARG B O     1 
ATOM   5444 C  CB    . ARG F 3 96  ? 54.190  -68.385 -51.271 1.00 46.76  ? 73   ARG B CB    1 
ATOM   5445 C  CG    . ARG F 3 96  ? 55.292  -67.735 -50.471 1.00 48.30  ? 73   ARG B CG    1 
ATOM   5446 C  CD    . ARG F 3 96  ? 54.723  -67.159 -49.195 1.00 50.81  ? 73   ARG B CD    1 
ATOM   5447 N  NE    . ARG F 3 96  ? 53.788  -66.075 -49.463 1.00 53.39  ? 73   ARG B NE    1 
ATOM   5448 C  CZ    . ARG F 3 96  ? 52.606  -65.948 -48.869 1.00 55.94  ? 73   ARG B CZ    1 
ATOM   5449 N  NH1   . ARG F 3 96  ? 52.218  -66.848 -47.976 1.00 57.12  ? 73   ARG B NH1   1 
ATOM   5450 N  NH2   . ARG F 3 96  ? 51.819  -64.918 -49.158 1.00 56.59  ? 73   ARG B NH2   1 
ATOM   5451 N  N     . MET F 3 97  ? 55.305  -71.240 -52.817 1.00 51.23  ? 74   MET B N     1 
ATOM   5452 C  CA    . MET F 3 97  ? 56.195  -72.389 -52.703 1.00 52.89  ? 74   MET B CA    1 
ATOM   5453 C  C     . MET F 3 97  ? 57.053  -72.563 -53.947 1.00 53.44  ? 74   MET B C     1 
ATOM   5454 O  O     . MET F 3 97  ? 57.949  -73.405 -53.989 1.00 53.65  ? 74   MET B O     1 
ATOM   5455 C  CB    . MET F 3 97  ? 55.373  -73.657 -52.476 1.00 54.05  ? 74   MET B CB    1 
ATOM   5456 C  CG    . MET F 3 97  ? 54.697  -73.715 -51.126 1.00 55.61  ? 74   MET B CG    1 
ATOM   5457 S  SD    . MET F 3 97  ? 55.924  -73.696 -49.815 1.00 58.96  ? 74   MET B SD    1 
ATOM   5458 C  CE    . MET F 3 97  ? 56.550  -75.378 -49.916 1.00 58.10  ? 74   MET B CE    1 
ATOM   5459 N  N     . ASP F 3 98  ? 56.773  -71.759 -54.962 1.00 54.53  ? 75   ASP B N     1 
ATOM   5460 C  CA    . ASP F 3 98  ? 57.504  -71.836 -56.214 1.00 55.54  ? 75   ASP B CA    1 
ATOM   5461 C  C     . ASP F 3 98  ? 58.670  -70.859 -56.235 1.00 56.14  ? 75   ASP B C     1 
ATOM   5462 O  O     . ASP F 3 98  ? 58.558  -69.734 -55.746 1.00 56.49  ? 75   ASP B O     1 
ATOM   5463 C  CB    . ASP F 3 98  ? 56.556  -71.533 -57.375 1.00 56.25  ? 75   ASP B CB    1 
ATOM   5464 C  CG    . ASP F 3 98  ? 55.330  -72.424 -57.368 1.00 58.40  ? 75   ASP B CG    1 
ATOM   5465 O  OD1   . ASP F 3 98  ? 54.359  -72.113 -58.091 1.00 58.75  ? 75   ASP B OD1   1 
ATOM   5466 O  OD2   . ASP F 3 98  ? 55.339  -73.440 -56.641 1.00 60.85  ? 75   ASP B OD2   1 
ATOM   5467 N  N     . THR F 3 99  ? 59.793  -71.301 -56.794 1.00 56.32  ? 76   THR B N     1 
ATOM   5468 C  CA    . THR F 3 99  ? 60.975  -70.456 -56.909 1.00 55.74  ? 76   THR B CA    1 
ATOM   5469 C  C     . THR F 3 99  ? 60.769  -69.567 -58.126 1.00 55.16  ? 76   THR B C     1 
ATOM   5470 O  O     . THR F 3 99  ? 60.004  -69.913 -59.029 1.00 54.80  ? 76   THR B O     1 
ATOM   5471 C  CB    . THR F 3 99  ? 62.251  -71.291 -57.124 1.00 56.22  ? 76   THR B CB    1 
ATOM   5472 O  OG1   . THR F 3 99  ? 62.089  -72.125 -58.278 1.00 55.32  ? 76   THR B OG1   1 
ATOM   5473 C  CG2   . THR F 3 99  ? 62.533  -72.158 -55.905 1.00 57.24  ? 76   THR B CG2   1 
ATOM   5474 N  N     . ILE F 3 100 ? 61.442  -68.423 -58.152 1.00 54.41  ? 77   ILE B N     1 
ATOM   5475 C  CA    . ILE F 3 100 ? 61.306  -67.506 -59.275 1.00 54.83  ? 77   ILE B CA    1 
ATOM   5476 C  C     . ILE F 3 100 ? 61.391  -68.291 -60.581 1.00 54.71  ? 77   ILE B C     1 
ATOM   5477 O  O     . ILE F 3 100 ? 60.597  -68.083 -61.497 1.00 53.11  ? 77   ILE B O     1 
ATOM   5478 C  CB    . ILE F 3 100 ? 62.415  -66.434 -59.258 1.00 55.19  ? 77   ILE B CB    1 
ATOM   5479 C  CG1   . ILE F 3 100 ? 62.421  -65.716 -57.906 1.00 55.69  ? 77   ILE B CG1   1 
ATOM   5480 C  CG2   . ILE F 3 100 ? 62.186  -65.430 -60.384 1.00 54.97  ? 77   ILE B CG2   1 
ATOM   5481 C  CD1   . ILE F 3 100 ? 63.508  -64.669 -57.768 0.00 55.64  ? 77   ILE B CD1   1 
ATOM   5482 N  N     . GLN F 3 101 ? 62.349  -69.210 -60.643 1.00 55.77  ? 78   GLN B N     1 
ATOM   5483 C  CA    . GLN F 3 101 ? 62.559  -70.033 -61.828 1.00 56.62  ? 78   GLN B CA    1 
ATOM   5484 C  C     . GLN F 3 101 ? 61.326  -70.847 -62.204 1.00 56.71  ? 78   GLN B C     1 
ATOM   5485 O  O     . GLN F 3 101 ? 60.843  -70.769 -63.335 1.00 56.64  ? 78   GLN B O     1 
ATOM   5486 C  CB    . GLN F 3 101 ? 63.742  -70.977 -61.606 1.00 57.80  ? 78   GLN B CB    1 
ATOM   5487 C  CG    . GLN F 3 101 ? 65.025  -70.276 -61.197 1.00 60.17  ? 78   GLN B CG    1 
ATOM   5488 C  CD    . GLN F 3 101 ? 65.322  -69.060 -62.055 1.00 62.82  ? 78   GLN B CD    1 
ATOM   5489 O  OE1   . GLN F 3 101 ? 65.261  -69.121 -63.288 1.00 63.32  ? 78   GLN B OE1   1 
ATOM   5490 N  NE2   . GLN F 3 101 ? 65.651  -67.946 -61.406 1.00 62.61  ? 78   GLN B NE2   1 
ATOM   5491 N  N     . GLU F 3 102 ? 60.821  -71.629 -61.256 1.00 56.35  ? 79   GLU B N     1 
ATOM   5492 C  CA    . GLU F 3 102 ? 59.647  -72.457 -61.502 1.00 56.09  ? 79   GLU B CA    1 
ATOM   5493 C  C     . GLU F 3 102 ? 58.442  -71.616 -61.900 1.00 55.12  ? 79   GLU B C     1 
ATOM   5494 O  O     . GLU F 3 102 ? 57.803  -71.878 -62.921 1.00 54.59  ? 79   GLU B O     1 
ATOM   5495 C  CB    . GLU F 3 102 ? 59.314  -73.282 -60.260 1.00 57.52  ? 79   GLU B CB    1 
ATOM   5496 C  CG    . GLU F 3 102 ? 60.427  -74.228 -59.845 1.00 60.76  ? 79   GLU B CG    1 
ATOM   5497 C  CD    . GLU F 3 102 ? 60.048  -75.098 -58.662 1.00 62.95  ? 79   GLU B CD    1 
ATOM   5498 O  OE1   . GLU F 3 102 ? 60.901  -75.896 -58.214 1.00 64.13  ? 79   GLU B OE1   1 
ATOM   5499 O  OE2   . GLU F 3 102 ? 58.899  -74.987 -58.180 1.00 64.52  ? 79   GLU B OE2   1 
ATOM   5500 N  N     . ALA F 3 103 ? 58.137  -70.606 -61.092 1.00 53.95  ? 80   ALA B N     1 
ATOM   5501 C  CA    . ALA F 3 103 ? 57.007  -69.728 -61.366 1.00 53.44  ? 80   ALA B CA    1 
ATOM   5502 C  C     . ALA F 3 103 ? 57.054  -69.240 -62.810 1.00 52.98  ? 80   ALA B C     1 
ATOM   5503 O  O     . ALA F 3 103 ? 56.024  -69.141 -63.477 1.00 52.38  ? 80   ALA B O     1 
ATOM   5504 C  CB    . ALA F 3 103 ? 57.025  -68.541 -60.411 1.00 53.43  ? 80   ALA B CB    1 
ATOM   5505 N  N     . LEU F 3 104 ? 58.258  -68.940 -63.287 1.00 52.77  ? 81   LEU B N     1 
ATOM   5506 C  CA    . LEU F 3 104 ? 58.439  -68.463 -64.652 1.00 52.31  ? 81   LEU B CA    1 
ATOM   5507 C  C     . LEU F 3 104 ? 57.945  -69.489 -65.664 1.00 52.97  ? 81   LEU B C     1 
ATOM   5508 O  O     . LEU F 3 104 ? 57.439  -69.125 -66.726 1.00 52.45  ? 81   LEU B O     1 
ATOM   5509 C  CB    . LEU F 3 104 ? 59.915  -68.148 -64.915 1.00 50.84  ? 81   LEU B CB    1 
ATOM   5510 C  CG    . LEU F 3 104 ? 60.529  -66.940 -64.200 1.00 49.90  ? 81   LEU B CG    1 
ATOM   5511 C  CD1   . LEU F 3 104 ? 62.028  -66.909 -64.443 1.00 49.80  ? 81   LEU B CD1   1 
ATOM   5512 C  CD2   . LEU F 3 104 ? 59.885  -65.659 -64.697 1.00 49.01  ? 81   LEU B CD2   1 
ATOM   5513 N  N     . LYS F 3 105 ? 58.088  -70.770 -65.331 1.00 53.87  ? 82   LYS B N     1 
ATOM   5514 C  CA    . LYS F 3 105 ? 57.658  -71.842 -66.224 1.00 54.65  ? 82   LYS B CA    1 
ATOM   5515 C  C     . LYS F 3 105 ? 56.135  -71.935 -66.304 1.00 55.63  ? 82   LYS B C     1 
ATOM   5516 O  O     . LYS F 3 105 ? 55.579  -72.249 -67.360 1.00 55.98  ? 82   LYS B O     1 
ATOM   5517 C  CB    . LYS F 3 105 ? 58.239  -73.181 -65.762 1.00 53.66  ? 82   LYS B CB    1 
ATOM   5518 C  CG    . LYS F 3 105 ? 57.931  -74.343 -66.693 0.00 53.90  ? 82   LYS B CG    1 
ATOM   5519 C  CD    . LYS F 3 105 ? 58.595  -75.624 -66.218 0.00 53.59  ? 82   LYS B CD    1 
ATOM   5520 C  CE    . LYS F 3 105 ? 58.317  -76.775 -67.170 0.00 53.41  ? 82   LYS B CE    1 
ATOM   5521 N  NZ    . LYS F 3 105 ? 58.979  -78.031 -66.723 0.00 53.23  ? 82   LYS B NZ    1 
ATOM   5522 N  N     . LYS F 3 106 ? 55.464  -71.657 -65.189 1.00 55.35  ? 83   LYS B N     1 
ATOM   5523 C  CA    . LYS F 3 106 ? 54.006  -71.707 -65.143 1.00 55.13  ? 83   LYS B CA    1 
ATOM   5524 C  C     . LYS F 3 106 ? 53.404  -70.464 -65.798 1.00 56.62  ? 83   LYS B C     1 
ATOM   5525 O  O     . LYS F 3 106 ? 52.242  -70.470 -66.213 1.00 57.39  ? 83   LYS B O     1 
ATOM   5526 C  CB    . LYS F 3 106 ? 53.524  -71.803 -63.695 1.00 54.27  ? 83   LYS B CB    1 
ATOM   5527 C  CG    . LYS F 3 106 ? 54.091  -72.976 -62.911 1.00 53.19  ? 83   LYS B CG    1 
ATOM   5528 C  CD    . LYS F 3 106 ? 53.523  -73.009 -61.495 1.00 52.50  ? 83   LYS B CD    1 
ATOM   5529 C  CE    . LYS F 3 106 ? 54.112  -74.147 -60.671 1.00 52.39  ? 83   LYS B CE    1 
ATOM   5530 N  NZ    . LYS F 3 106 ? 53.529  -74.207 -59.301 1.00 50.38  ? 83   LYS B NZ    1 
ATOM   5531 N  N     . CYS F 3 107 ? 54.200  -69.401 -65.885 1.00 57.17  ? 84   CYS B N     1 
ATOM   5532 C  CA    . CYS F 3 107 ? 53.759  -68.146 -66.492 1.00 57.26  ? 84   CYS B CA    1 
ATOM   5533 C  C     . CYS F 3 107 ? 54.925  -67.456 -67.198 1.00 56.88  ? 84   CYS B C     1 
ATOM   5534 O  O     . CYS F 3 107 ? 55.856  -66.977 -66.550 1.00 56.69  ? 84   CYS B O     1 
ATOM   5535 C  CB    . CYS F 3 107 ? 53.182  -67.215 -65.421 1.00 57.62  ? 84   CYS B CB    1 
ATOM   5536 S  SG    . CYS F 3 107 ? 52.537  -65.647 -66.051 1.00 57.77  ? 84   CYS B SG    1 
ATOM   5537 N  N     . SER F 3 108 ? 54.868  -67.406 -68.526 1.00 56.39  ? 85   SER B N     1 
ATOM   5538 C  CA    . SER F 3 108 ? 55.930  -66.785 -69.312 1.00 55.58  ? 85   SER B CA    1 
ATOM   5539 C  C     . SER F 3 108 ? 55.898  -65.263 -69.220 1.00 54.47  ? 85   SER B C     1 
ATOM   5540 O  O     . SER F 3 108 ? 56.936  -64.610 -69.308 1.00 55.22  ? 85   SER B O     1 
ATOM   5541 C  CB    . SER F 3 108 ? 55.823  -67.213 -70.777 1.00 56.08  ? 85   SER B CB    1 
ATOM   5542 O  OG    . SER F 3 108 ? 54.617  -66.748 -71.356 1.00 58.99  ? 85   SER B OG    1 
ATOM   5543 N  N     . ASN F 3 109 ? 54.707  -64.701 -69.046 1.00 51.95  ? 86   ASN B N     1 
ATOM   5544 C  CA    . ASN F 3 109 ? 54.565  -63.255 -68.939 1.00 49.86  ? 86   ASN B CA    1 
ATOM   5545 C  C     . ASN F 3 109 ? 54.543  -62.813 -67.475 1.00 47.91  ? 86   ASN B C     1 
ATOM   5546 O  O     . ASN F 3 109 ? 53.897  -61.822 -67.122 1.00 47.66  ? 86   ASN B O     1 
ATOM   5547 C  CB    . ASN F 3 109 ? 53.288  -62.797 -69.655 1.00 51.59  ? 86   ASN B CB    1 
ATOM   5548 C  CG    . ASN F 3 109 ? 52.047  -63.509 -69.151 1.00 53.29  ? 86   ASN B CG    1 
ATOM   5549 O  OD1   . ASN F 3 109 ? 51.993  -64.738 -69.124 1.00 55.06  ? 86   ASN B OD1   1 
ATOM   5550 N  ND2   . ASN F 3 109 ? 51.039  -62.738 -68.755 1.00 54.10  ? 86   ASN B ND2   1 
ATOM   5551 N  N     . LEU F 3 110 ? 55.258  -63.550 -66.628 1.00 44.19  ? 87   LEU B N     1 
ATOM   5552 C  CA    . LEU F 3 110 ? 55.323  -63.236 -65.205 1.00 40.49  ? 87   LEU B CA    1 
ATOM   5553 C  C     . LEU F 3 110 ? 56.153  -61.982 -64.968 1.00 38.50  ? 87   LEU B C     1 
ATOM   5554 O  O     . LEU F 3 110 ? 57.139  -61.745 -65.658 1.00 39.39  ? 87   LEU B O     1 
ATOM   5555 C  CB    . LEU F 3 110 ? 55.935  -64.403 -64.429 1.00 39.98  ? 87   LEU B CB    1 
ATOM   5556 C  CG    . LEU F 3 110 ? 56.013  -64.217 -62.911 1.00 39.68  ? 87   LEU B CG    1 
ATOM   5557 C  CD1   . LEU F 3 110 ? 54.616  -63.978 -62.365 1.00 38.44  ? 87   LEU B CD1   1 
ATOM   5558 C  CD2   . LEU F 3 110 ? 56.641  -65.443 -62.257 1.00 38.87  ? 87   LEU B CD2   1 
ATOM   5559 N  N     . ILE F 3 111 ? 55.750  -61.185 -63.984 1.00 35.47  ? 88   ILE B N     1 
ATOM   5560 C  CA    . ILE F 3 111 ? 56.458  -59.954 -63.664 1.00 31.32  ? 88   ILE B CA    1 
ATOM   5561 C  C     . ILE F 3 111 ? 56.979  -59.962 -62.229 1.00 29.81  ? 88   ILE B C     1 
ATOM   5562 O  O     . ILE F 3 111 ? 56.330  -59.449 -61.318 1.00 29.30  ? 88   ILE B O     1 
ATOM   5563 C  CB    . ILE F 3 111 ? 55.542  -58.734 -63.845 1.00 30.49  ? 88   ILE B CB    1 
ATOM   5564 C  CG1   . ILE F 3 111 ? 55.015  -58.691 -65.277 1.00 29.32  ? 88   ILE B CG1   1 
ATOM   5565 C  CG2   . ILE F 3 111 ? 56.299  -57.460 -63.517 1.00 29.45  ? 88   ILE B CG2   1 
ATOM   5566 C  CD1   . ILE F 3 111 ? 54.098  -57.513 -65.547 1.00 31.31  ? 88   ILE B CD1   1 
ATOM   5567 N  N     . PRO F 3 112 ? 58.160  -60.557 -62.009 1.00 28.14  ? 89   PRO B N     1 
ATOM   5568 C  CA    . PRO F 3 112 ? 58.753  -60.618 -60.673 1.00 27.33  ? 89   PRO B CA    1 
ATOM   5569 C  C     . PRO F 3 112 ? 59.373  -59.273 -60.307 1.00 27.49  ? 89   PRO B C     1 
ATOM   5570 O  O     . PRO F 3 112 ? 59.985  -58.618 -61.152 1.00 29.63  ? 89   PRO B O     1 
ATOM   5571 C  CB    . PRO F 3 112 ? 59.795  -61.716 -60.821 1.00 26.20  ? 89   PRO B CB    1 
ATOM   5572 C  CG    . PRO F 3 112 ? 60.274  -61.505 -62.210 1.00 25.92  ? 89   PRO B CG    1 
ATOM   5573 C  CD    . PRO F 3 112 ? 58.989  -61.292 -62.980 1.00 26.51  ? 89   PRO B CD    1 
ATOM   5574 N  N     . ILE F 3 113 ? 59.205  -58.861 -59.053 1.00 25.82  ? 90   ILE B N     1 
ATOM   5575 C  CA    . ILE F 3 113 ? 59.751  -57.591 -58.580 1.00 23.41  ? 90   ILE B CA    1 
ATOM   5576 C  C     . ILE F 3 113 ? 60.402  -57.778 -57.220 1.00 24.27  ? 90   ILE B C     1 
ATOM   5577 O  O     . ILE F 3 113 ? 59.729  -58.051 -56.227 1.00 25.81  ? 90   ILE B O     1 
ATOM   5578 C  CB    . ILE F 3 113 ? 58.654  -56.520 -58.460 1.00 20.97  ? 90   ILE B CB    1 
ATOM   5579 C  CG1   . ILE F 3 113 ? 57.989  -56.306 -59.824 1.00 18.50  ? 90   ILE B CG1   1 
ATOM   5580 C  CG2   . ILE F 3 113 ? 59.255  -55.225 -57.944 1.00 18.72  ? 90   ILE B CG2   1 
ATOM   5581 C  CD1   . ILE F 3 113 ? 56.788  -55.385 -59.792 1.00 15.75  ? 90   ILE B CD1   1 
ATOM   5582 N  N     . HIS F 3 114 ? 61.718  -57.627 -57.183 1.00 24.93  ? 91   HIS B N     1 
ATOM   5583 C  CA    . HIS F 3 114 ? 62.477  -57.796 -55.952 1.00 25.99  ? 91   HIS B CA    1 
ATOM   5584 C  C     . HIS F 3 114 ? 62.196  -56.663 -54.969 1.00 26.29  ? 91   HIS B C     1 
ATOM   5585 O  O     . HIS F 3 114 ? 62.107  -55.501 -55.365 1.00 27.15  ? 91   HIS B O     1 
ATOM   5586 C  CB    . HIS F 3 114 ? 63.970  -57.842 -56.278 1.00 25.85  ? 91   HIS B CB    1 
ATOM   5587 C  CG    . HIS F 3 114 ? 64.823  -58.340 -55.155 1.00 27.17  ? 91   HIS B CG    1 
ATOM   5588 N  ND1   . HIS F 3 114 ? 64.847  -57.742 -53.914 1.00 27.77  ? 91   HIS B ND1   1 
ATOM   5589 C  CD2   . HIS F 3 114 ? 65.702  -59.369 -55.094 1.00 28.14  ? 91   HIS B CD2   1 
ATOM   5590 C  CE1   . HIS F 3 114 ? 65.705  -58.380 -53.138 1.00 29.31  ? 91   HIS B CE1   1 
ATOM   5591 N  NE2   . HIS F 3 114 ? 66.237  -59.371 -53.829 1.00 28.66  ? 91   HIS B NE2   1 
ATOM   5592 N  N     . THR F 3 115 ? 62.050  -57.007 -53.692 1.00 26.29  ? 92   THR B N     1 
ATOM   5593 C  CA    . THR F 3 115 ? 61.793  -56.013 -52.649 1.00 26.11  ? 92   THR B CA    1 
ATOM   5594 C  C     . THR F 3 115 ? 62.964  -55.034 -52.595 1.00 26.52  ? 92   THR B C     1 
ATOM   5595 O  O     . THR F 3 115 ? 64.076  -55.367 -53.010 1.00 25.96  ? 92   THR B O     1 
ATOM   5596 C  CB    . THR F 3 115 ? 61.681  -56.664 -51.250 1.00 26.05  ? 92   THR B CB    1 
ATOM   5597 O  OG1   . THR F 3 115 ? 62.943  -57.245 -50.899 1.00 26.68  ? 92   THR B OG1   1 
ATOM   5598 C  CG2   . THR F 3 115 ? 60.617  -57.749 -51.235 1.00 25.18  ? 92   THR B CG2   1 
ATOM   5599 N  N     . ALA F 3 116 ? 62.718  -53.831 -52.081 1.00 26.09  ? 93   ALA B N     1 
ATOM   5600 C  CA    . ALA F 3 116 ? 63.780  -52.839 -51.965 1.00 25.06  ? 93   ALA B CA    1 
ATOM   5601 C  C     . ALA F 3 116 ? 64.840  -53.439 -51.052 1.00 24.34  ? 93   ALA B C     1 
ATOM   5602 O  O     . ALA F 3 116 ? 64.559  -54.390 -50.320 1.00 24.02  ? 93   ALA B O     1 
ATOM   5603 C  CB    . ALA F 3 116 ? 63.240  -51.554 -51.371 1.00 25.31  ? 93   ALA B CB    1 
ATOM   5604 N  N     . VAL F 3 117 ? 66.051  -52.892 -51.088 1.00 23.76  ? 94   VAL B N     1 
ATOM   5605 C  CA    . VAL F 3 117 ? 67.133  -53.419 -50.262 1.00 24.93  ? 94   VAL B CA    1 
ATOM   5606 C  C     . VAL F 3 117 ? 68.222  -52.400 -49.936 1.00 26.24  ? 94   VAL B C     1 
ATOM   5607 O  O     . VAL F 3 117 ? 68.272  -51.312 -50.514 1.00 26.78  ? 94   VAL B O     1 
ATOM   5608 C  CB    . VAL F 3 117 ? 67.819  -54.622 -50.954 1.00 24.50  ? 94   VAL B CB    1 
ATOM   5609 C  CG1   . VAL F 3 117 ? 66.884  -55.815 -51.005 1.00 24.63  ? 94   VAL B CG1   1 
ATOM   5610 C  CG2   . VAL F 3 117 ? 68.235  -54.232 -52.360 1.00 24.18  ? 94   VAL B CG2   1 
ATOM   5611 N  N     . PHE F 3 118 ? 69.088  -52.770 -48.995 1.00 27.54  ? 95   PHE B N     1 
ATOM   5612 C  CA    . PHE F 3 118 ? 70.215  -51.935 -48.590 1.00 29.18  ? 95   PHE B CA    1 
ATOM   5613 C  C     . PHE F 3 118 ? 71.469  -52.502 -49.245 1.00 31.44  ? 95   PHE B C     1 
ATOM   5614 O  O     . PHE F 3 118 ? 71.504  -53.671 -49.624 1.00 32.66  ? 95   PHE B O     1 
ATOM   5615 C  CB    . PHE F 3 118 ? 70.432  -51.974 -47.073 1.00 27.33  ? 95   PHE B CB    1 
ATOM   5616 C  CG    . PHE F 3 118 ? 69.466  -51.140 -46.281 1.00 26.11  ? 95   PHE B CG    1 
ATOM   5617 C  CD1   . PHE F 3 118 ? 68.359  -51.720 -45.676 1.00 25.28  ? 95   PHE B CD1   1 
ATOM   5618 C  CD2   . PHE F 3 118 ? 69.700  -49.783 -46.085 1.00 25.18  ? 95   PHE B CD2   1 
ATOM   5619 C  CE1   . PHE F 3 118 ? 67.505  -50.963 -44.882 1.00 25.44  ? 95   PHE B CE1   1 
ATOM   5620 C  CE2   . PHE F 3 118 ? 68.852  -49.019 -45.294 1.00 23.75  ? 95   PHE B CE2   1 
ATOM   5621 C  CZ    . PHE F 3 118 ? 67.753  -49.609 -44.690 1.00 24.12  ? 95   PHE B CZ    1 
ATOM   5622 N  N     . LYS F 3 119 ? 72.499  -51.675 -49.371 1.00 34.41  ? 96   LYS B N     1 
ATOM   5623 C  CA    . LYS F 3 119 ? 73.761  -52.112 -49.953 1.00 36.74  ? 96   LYS B CA    1 
ATOM   5624 C  C     . LYS F 3 119 ? 74.837  -51.805 -48.930 1.00 37.40  ? 96   LYS B C     1 
ATOM   5625 O  O     . LYS F 3 119 ? 74.909  -50.687 -48.423 1.00 38.01  ? 96   LYS B O     1 
ATOM   5626 C  CB    . LYS F 3 119 ? 74.045  -51.360 -51.251 1.00 38.68  ? 96   LYS B CB    1 
ATOM   5627 C  CG    . LYS F 3 119 ? 75.382  -51.699 -51.881 1.00 41.76  ? 96   LYS B CG    1 
ATOM   5628 C  CD    . LYS F 3 119 ? 75.577  -50.933 -53.182 1.00 46.43  ? 96   LYS B CD    1 
ATOM   5629 C  CE    . LYS F 3 119 ? 76.992  -51.101 -53.730 1.00 50.13  ? 96   LYS B CE    1 
ATOM   5630 N  NZ    . LYS F 3 119 ? 78.036  -50.532 -52.820 1.00 52.13  ? 96   LYS B NZ    1 
ATOM   5631 N  N     . LYS F 3 120 ? 75.663  -52.798 -48.617 1.00 38.14  ? 97   LYS B N     1 
ATOM   5632 C  CA    . LYS F 3 120 ? 76.723  -52.616 -47.634 1.00 38.83  ? 97   LYS B CA    1 
ATOM   5633 C  C     . LYS F 3 120 ? 77.394  -51.263 -47.822 1.00 40.01  ? 97   LYS B C     1 
ATOM   5634 O  O     . LYS F 3 120 ? 77.924  -50.969 -48.892 1.00 40.55  ? 97   LYS B O     1 
ATOM   5635 C  CB    . LYS F 3 120 ? 77.763  -53.729 -47.758 1.00 39.34  ? 97   LYS B CB    1 
ATOM   5636 C  CG    . LYS F 3 120 ? 78.822  -53.699 -46.667 1.00 41.71  ? 97   LYS B CG    1 
ATOM   5637 C  CD    . LYS F 3 120 ? 79.822  -54.841 -46.803 1.00 42.75  ? 97   LYS B CD    1 
ATOM   5638 C  CE    . LYS F 3 120 ? 80.674  -54.698 -48.051 1.00 44.24  ? 97   LYS B CE    1 
ATOM   5639 N  NZ    . LYS F 3 120 ? 81.674  -55.794 -48.155 1.00 45.95  ? 97   LYS B NZ    1 
ATOM   5640 N  N     . GLY F 3 121 ? 77.354  -50.435 -46.783 1.00 40.47  ? 98   GLY B N     1 
ATOM   5641 C  CA    . GLY F 3 121 ? 77.970  -49.123 -46.867 1.00 41.76  ? 98   GLY B CA    1 
ATOM   5642 C  C     . GLY F 3 121 ? 76.969  -47.986 -46.911 1.00 42.99  ? 98   GLY B C     1 
ATOM   5643 O  O     . GLY F 3 121 ? 77.060  -47.043 -46.123 1.00 44.60  ? 98   GLY B O     1 
ATOM   5644 N  N     . GLU F 3 122 ? 76.011  -48.070 -47.832 1.00 42.27  ? 99   GLU B N     1 
ATOM   5645 C  CA    . GLU F 3 122 ? 74.995  -47.032 -47.969 1.00 40.75  ? 99   GLU B CA    1 
ATOM   5646 C  C     . GLU F 3 122 ? 73.965  -47.135 -46.854 1.00 39.51  ? 99   GLU B C     1 
ATOM   5647 O  O     . GLU F 3 122 ? 73.475  -48.220 -46.546 1.00 38.72  ? 99   GLU B O     1 
ATOM   5648 C  CB    . GLU F 3 122 ? 74.310  -47.143 -49.331 1.00 40.91  ? 99   GLU B CB    1 
ATOM   5649 C  CG    . GLU F 3 122 ? 75.285  -47.078 -50.493 1.00 45.11  ? 99   GLU B CG    1 
ATOM   5650 C  CD    . GLU F 3 122 ? 74.597  -47.104 -51.841 1.00 47.94  ? 99   GLU B CD    1 
ATOM   5651 O  OE1   . GLU F 3 122 ? 73.801  -48.034 -52.086 1.00 50.67  ? 99   GLU B OE1   1 
ATOM   5652 O  OE2   . GLU F 3 122 ? 74.856  -46.198 -52.660 1.00 49.95  ? 99   GLU B OE2   1 
ATOM   5653 N  N     . ASP F 3 123 ? 73.642  -45.994 -46.252 1.00 39.02  ? 100  ASP B N     1 
ATOM   5654 C  CA    . ASP F 3 123 ? 72.681  -45.943 -45.155 1.00 38.81  ? 100  ASP B CA    1 
ATOM   5655 C  C     . ASP F 3 123 ? 71.270  -45.588 -45.614 1.00 37.63  ? 100  ASP B C     1 
ATOM   5656 O  O     . ASP F 3 123 ? 70.646  -44.668 -45.083 1.00 37.24  ? 100  ASP B O     1 
ATOM   5657 C  CB    . ASP F 3 123 ? 73.142  -44.930 -44.104 1.00 41.00  ? 100  ASP B CB    1 
ATOM   5658 C  CG    . ASP F 3 123 ? 73.229  -43.517 -44.654 1.00 42.76  ? 100  ASP B CG    1 
ATOM   5659 O  OD1   . ASP F 3 123 ? 73.659  -42.612 -43.903 1.00 42.85  ? 100  ASP B OD1   1 
ATOM   5660 O  OD2   . ASP F 3 123 ? 72.866  -43.314 -45.835 1.00 42.70  ? 100  ASP B OD2   1 
ATOM   5661 N  N     . PHE F 3 124 ? 70.772  -46.326 -46.601 1.00 36.01  ? 101  PHE B N     1 
ATOM   5662 C  CA    . PHE F 3 124 ? 69.431  -46.109 -47.128 1.00 33.21  ? 101  PHE B CA    1 
ATOM   5663 C  C     . PHE F 3 124 ? 69.051  -47.268 -48.031 1.00 31.87  ? 101  PHE B C     1 
ATOM   5664 O  O     . PHE F 3 124 ? 69.913  -47.851 -48.688 1.00 32.72  ? 101  PHE B O     1 
ATOM   5665 C  CB    . PHE F 3 124 ? 69.372  -44.787 -47.902 1.00 32.17  ? 101  PHE B CB    1 
ATOM   5666 C  CG    . PHE F 3 124 ? 70.320  -44.714 -49.073 1.00 31.99  ? 101  PHE B CG    1 
ATOM   5667 C  CD1   . PHE F 3 124 ? 69.960  -45.226 -50.317 1.00 31.65  ? 101  PHE B CD1   1 
ATOM   5668 C  CD2   . PHE F 3 124 ? 71.571  -44.116 -48.934 1.00 32.66  ? 101  PHE B CD2   1 
ATOM   5669 C  CE1   . PHE F 3 124 ? 70.830  -45.140 -51.404 1.00 30.66  ? 101  PHE B CE1   1 
ATOM   5670 C  CE2   . PHE F 3 124 ? 72.448  -44.026 -50.015 1.00 30.93  ? 101  PHE B CE2   1 
ATOM   5671 C  CZ    . PHE F 3 124 ? 72.076  -44.538 -51.251 1.00 31.13  ? 101  PHE B CZ    1 
ATOM   5672 N  N     . TRP F 3 125 ? 67.769  -47.626 -48.047 1.00 29.68  ? 102  TRP B N     1 
ATOM   5673 C  CA    . TRP F 3 125 ? 67.324  -48.716 -48.904 1.00 27.24  ? 102  TRP B CA    1 
ATOM   5674 C  C     . TRP F 3 125 ? 66.981  -48.161 -50.275 1.00 26.66  ? 102  TRP B C     1 
ATOM   5675 O  O     . TRP F 3 125 ? 66.813  -46.952 -50.439 1.00 25.12  ? 102  TRP B O     1 
ATOM   5676 C  CB    . TRP F 3 125 ? 66.112  -49.442 -48.309 1.00 25.53  ? 102  TRP B CB    1 
ATOM   5677 C  CG    . TRP F 3 125 ? 64.916  -48.583 -48.052 1.00 22.62  ? 102  TRP B CG    1 
ATOM   5678 C  CD1   . TRP F 3 125 ? 64.500  -48.103 -46.847 1.00 22.44  ? 102  TRP B CD1   1 
ATOM   5679 C  CD2   . TRP F 3 125 ? 63.969  -48.117 -49.018 1.00 21.68  ? 102  TRP B CD2   1 
ATOM   5680 N  NE1   . TRP F 3 125 ? 63.350  -47.370 -46.998 1.00 20.82  ? 102  TRP B NE1   1 
ATOM   5681 C  CE2   . TRP F 3 125 ? 63.001  -47.361 -48.321 1.00 20.59  ? 102  TRP B CE2   1 
ATOM   5682 C  CE3   . TRP F 3 125 ? 63.842  -48.265 -50.404 1.00 21.45  ? 102  TRP B CE3   1 
ATOM   5683 C  CZ2   . TRP F 3 125 ? 61.922  -46.755 -48.960 1.00 19.67  ? 102  TRP B CZ2   1 
ATOM   5684 C  CZ3   . TRP F 3 125 ? 62.768  -47.661 -51.042 1.00 21.79  ? 102  TRP B CZ3   1 
ATOM   5685 C  CH2   . TRP F 3 125 ? 61.822  -46.915 -50.317 1.00 21.82  ? 102  TRP B CH2   1 
ATOM   5686 N  N     . GLN F 3 126 ? 66.866  -49.045 -51.257 1.00 27.48  ? 103  GLN B N     1 
ATOM   5687 C  CA    . GLN F 3 126 ? 66.574  -48.612 -52.613 1.00 28.75  ? 103  GLN B CA    1 
ATOM   5688 C  C     . GLN F 3 126 ? 66.032  -49.739 -53.490 1.00 27.56  ? 103  GLN B C     1 
ATOM   5689 O  O     . GLN F 3 126 ? 66.275  -50.916 -53.225 1.00 28.18  ? 103  GLN B O     1 
ATOM   5690 C  CB    . GLN F 3 126 ? 67.855  -48.045 -53.218 1.00 30.43  ? 103  GLN B CB    1 
ATOM   5691 C  CG    . GLN F 3 126 ? 67.780  -47.702 -54.678 1.00 35.81  ? 103  GLN B CG    1 
ATOM   5692 C  CD    . GLN F 3 126 ? 69.140  -47.357 -55.238 1.00 38.27  ? 103  GLN B CD    1 
ATOM   5693 O  OE1   . GLN F 3 126 ? 69.757  -46.366 -54.838 1.00 38.73  ? 103  GLN B OE1   1 
ATOM   5694 N  NE2   . GLN F 3 126 ? 69.625  -48.181 -56.165 1.00 40.09  ? 103  GLN B NE2   1 
ATOM   5695 N  N     . TYR F 3 127 ? 65.291  -49.369 -54.531 1.00 25.67  ? 104  TYR B N     1 
ATOM   5696 C  CA    . TYR F 3 127 ? 64.727  -50.339 -55.460 1.00 25.46  ? 104  TYR B CA    1 
ATOM   5697 C  C     . TYR F 3 127 ? 65.612  -50.499 -56.688 1.00 26.36  ? 104  TYR B C     1 
ATOM   5698 O  O     . TYR F 3 127 ? 66.211  -49.534 -57.162 1.00 25.92  ? 104  TYR B O     1 
ATOM   5699 C  CB    . TYR F 3 127 ? 63.335  -49.910 -55.929 1.00 24.93  ? 104  TYR B CB    1 
ATOM   5700 C  CG    . TYR F 3 127 ? 62.193  -50.277 -55.008 1.00 25.94  ? 104  TYR B CG    1 
ATOM   5701 C  CD1   . TYR F 3 127 ? 61.744  -49.394 -54.030 1.00 27.77  ? 104  TYR B CD1   1 
ATOM   5702 C  CD2   . TYR F 3 127 ? 61.527  -51.492 -55.149 1.00 27.06  ? 104  TYR B CD2   1 
ATOM   5703 C  CE1   . TYR F 3 127 ? 60.650  -49.710 -53.220 1.00 28.51  ? 104  TYR B CE1   1 
ATOM   5704 C  CE2   . TYR F 3 127 ? 60.435  -51.819 -54.346 1.00 26.77  ? 104  TYR B CE2   1 
ATOM   5705 C  CZ    . TYR F 3 127 ? 60.000  -50.924 -53.389 1.00 27.70  ? 104  TYR B CZ    1 
ATOM   5706 O  OH    . TYR F 3 127 ? 58.904  -51.231 -52.618 1.00 26.47  ? 104  TYR B OH    1 
ATOM   5707 N  N     . HIS F 3 128 ? 65.686  -51.724 -57.199 1.00 29.01  ? 105  HIS B N     1 
ATOM   5708 C  CA    . HIS F 3 128 ? 66.474  -52.026 -58.389 1.00 30.70  ? 105  HIS B CA    1 
ATOM   5709 C  C     . HIS F 3 128 ? 65.589  -52.750 -59.390 1.00 32.80  ? 105  HIS B C     1 
ATOM   5710 O  O     . HIS F 3 128 ? 65.830  -53.910 -59.718 1.00 32.92  ? 105  HIS B O     1 
ATOM   5711 C  CB    . HIS F 3 128 ? 67.672  -52.914 -58.045 1.00 29.26  ? 105  HIS B CB    1 
ATOM   5712 C  CG    . HIS F 3 128 ? 68.677  -52.258 -57.153 1.00 29.05  ? 105  HIS B CG    1 
ATOM   5713 N  ND1   . HIS F 3 128 ? 68.461  -52.062 -55.807 1.00 31.15  ? 105  HIS B ND1   1 
ATOM   5714 C  CD2   . HIS F 3 128 ? 69.897  -51.737 -57.418 1.00 29.94  ? 105  HIS B CD2   1 
ATOM   5715 C  CE1   . HIS F 3 128 ? 69.504  -51.447 -55.280 1.00 30.69  ? 105  HIS B CE1   1 
ATOM   5716 N  NE2   . HIS F 3 128 ? 70.390  -51.238 -56.237 1.00 31.02  ? 105  HIS B NE2   1 
ATOM   5717 N  N     . ASP F 3 129 ? 64.558  -52.065 -59.870 1.00 36.01  ? 106  ASP B N     1 
ATOM   5718 C  CA    . ASP F 3 129 ? 63.641  -52.664 -60.829 1.00 38.95  ? 106  ASP B CA    1 
ATOM   5719 C  C     . ASP F 3 129 ? 64.397  -53.122 -62.069 1.00 41.49  ? 106  ASP B C     1 
ATOM   5720 O  O     . ASP F 3 129 ? 65.148  -52.351 -62.667 1.00 43.48  ? 106  ASP B O     1 
ATOM   5721 C  CB    . ASP F 3 129 ? 62.554  -51.663 -61.229 1.00 38.62  ? 106  ASP B CB    1 
ATOM   5722 C  CG    . ASP F 3 129 ? 61.765  -51.153 -60.039 1.00 38.56  ? 106  ASP B CG    1 
ATOM   5723 O  OD1   . ASP F 3 129 ? 61.381  -51.976 -59.181 1.00 37.90  ? 106  ASP B OD1   1 
ATOM   5724 O  OD2   . ASP F 3 129 ? 61.521  -49.930 -59.969 1.00 38.73  ? 106  ASP B OD2   1 
ATOM   5725 N  N     . GLY F 3 130 ? 64.196  -54.381 -62.447 1.00 43.21  ? 107  GLY B N     1 
ATOM   5726 C  CA    . GLY F 3 130 ? 64.871  -54.920 -63.612 1.00 44.43  ? 107  GLY B CA    1 
ATOM   5727 C  C     . GLY F 3 130 ? 66.038  -55.804 -63.225 1.00 45.75  ? 107  GLY B C     1 
ATOM   5728 O  O     . GLY F 3 130 ? 66.647  -56.450 -64.075 1.00 46.81  ? 107  GLY B O     1 
ATOM   5729 N  N     . CYS F 3 131 ? 66.356  -55.835 -61.937 1.00 46.60  ? 108  CYS B N     1 
ATOM   5730 C  CA    . CYS F 3 131 ? 67.457  -56.652 -61.449 1.00 48.31  ? 108  CYS B CA    1 
ATOM   5731 C  C     . CYS F 3 131 ? 66.933  -57.756 -60.548 1.00 49.77  ? 108  CYS B C     1 
ATOM   5732 O  O     . CYS F 3 131 ? 65.920  -57.589 -59.868 1.00 50.21  ? 108  CYS B O     1 
ATOM   5733 C  CB    . CYS F 3 131 ? 68.451  -55.795 -60.671 1.00 48.54  ? 108  CYS B CB    1 
ATOM   5734 S  SG    . CYS F 3 131 ? 69.083  -54.388 -61.593 1.00 52.26  ? 108  CYS B SG    1 
ATOM   5735 N  N     . GLY F 3 132 ? 67.636  -58.882 -60.545 1.00 50.60  ? 109  GLY B N     1 
ATOM   5736 C  CA    . GLY F 3 132 ? 67.236  -60.006 -59.724 1.00 51.29  ? 109  GLY B CA    1 
ATOM   5737 C  C     . GLY F 3 132 ? 67.894  -61.273 -60.219 1.00 52.20  ? 109  GLY B C     1 
ATOM   5738 O  O     . GLY F 3 132 ? 68.500  -61.282 -61.289 1.00 53.01  ? 109  GLY B O     1 
ATOM   5739 N  N     . SER F 3 133 ? 67.777  -62.344 -59.443 1.00 52.67  ? 110  SER B N     1 
ATOM   5740 C  CA    . SER F 3 133 ? 68.369  -63.621 -59.815 1.00 52.28  ? 110  SER B CA    1 
ATOM   5741 C  C     . SER F 3 133 ? 67.808  -64.154 -61.133 1.00 52.56  ? 110  SER B C     1 
ATOM   5742 O  O     . SER F 3 133 ? 68.461  -64.941 -61.815 1.00 53.13  ? 110  SER B O     1 
ATOM   5743 C  CB    . SER F 3 133 ? 68.137  -64.646 -58.705 1.00 51.35  ? 110  SER B CB    1 
ATOM   5744 O  OG    . SER F 3 133 ? 68.777  -64.246 -57.506 0.00 52.02  ? 110  SER B OG    1 
ATOM   5745 N  N     . TRP F 3 134 ? 66.604  -63.718 -61.493 1.00 52.67  ? 111  TRP B N     1 
ATOM   5746 C  CA    . TRP F 3 134 ? 65.969  -64.173 -62.726 1.00 52.59  ? 111  TRP B CA    1 
ATOM   5747 C  C     . TRP F 3 134 ? 66.484  -63.460 -63.971 1.00 53.72  ? 111  TRP B C     1 
ATOM   5748 O  O     . TRP F 3 134 ? 66.158  -63.847 -65.092 1.00 53.63  ? 111  TRP B O     1 
ATOM   5749 C  CB    . TRP F 3 134 ? 64.450  -64.016 -62.626 1.00 50.84  ? 111  TRP B CB    1 
ATOM   5750 C  CG    . TRP F 3 134 ? 63.991  -62.600 -62.554 1.00 47.88  ? 111  TRP B CG    1 
ATOM   5751 C  CD1   . TRP F 3 134 ? 63.593  -61.810 -63.594 1.00 46.15  ? 111  TRP B CD1   1 
ATOM   5752 C  CD2   . TRP F 3 134 ? 63.887  -61.799 -61.376 1.00 46.94  ? 111  TRP B CD2   1 
ATOM   5753 N  NE1   . TRP F 3 134 ? 63.243  -60.565 -63.134 1.00 45.60  ? 111  TRP B NE1   1 
ATOM   5754 C  CE2   . TRP F 3 134 ? 63.414  -60.530 -61.775 1.00 46.76  ? 111  TRP B CE2   1 
ATOM   5755 C  CE3   . TRP F 3 134 ? 64.147  -62.030 -60.019 1.00 45.21  ? 111  TRP B CE3   1 
ATOM   5756 C  CZ2   . TRP F 3 134 ? 63.195  -59.493 -60.864 1.00 46.87  ? 111  TRP B CZ2   1 
ATOM   5757 C  CZ3   . TRP F 3 134 ? 63.931  -61.001 -59.115 1.00 45.32  ? 111  TRP B CZ3   1 
ATOM   5758 C  CH2   . TRP F 3 134 ? 63.458  -59.747 -59.542 1.00 46.34  ? 111  TRP B CH2   1 
ATOM   5759 N  N     . VAL F 3 135 ? 67.276  -62.411 -63.777 1.00 55.81  ? 112  VAL B N     1 
ATOM   5760 C  CA    . VAL F 3 135 ? 67.847  -61.682 -64.902 1.00 57.98  ? 112  VAL B CA    1 
ATOM   5761 C  C     . VAL F 3 135 ? 69.146  -62.382 -65.270 1.00 60.75  ? 112  VAL B C     1 
ATOM   5762 O  O     . VAL F 3 135 ? 70.001  -62.611 -64.414 1.00 60.92  ? 112  VAL B O     1 
ATOM   5763 C  CB    . VAL F 3 135 ? 68.157  -60.223 -64.542 1.00 57.27  ? 112  VAL B CB    1 
ATOM   5764 C  CG1   . VAL F 3 135 ? 68.803  -59.531 -65.726 1.00 56.41  ? 112  VAL B CG1   1 
ATOM   5765 C  CG2   . VAL F 3 135 ? 66.882  -59.507 -64.135 1.00 56.72  ? 112  VAL B CG2   1 
ATOM   5766 N  N     . GLN F 3 136 ? 69.295  -62.718 -66.545 1.00 63.90  ? 113  GLN B N     1 
ATOM   5767 C  CA    . GLN F 3 136 ? 70.480  -63.425 -67.010 1.00 66.23  ? 113  GLN B CA    1 
ATOM   5768 C  C     . GLN F 3 136 ? 71.716  -62.560 -67.238 1.00 66.35  ? 113  GLN B C     1 
ATOM   5769 O  O     . GLN F 3 136 ? 72.755  -63.065 -67.662 1.00 66.87  ? 113  GLN B O     1 
ATOM   5770 C  CB    . GLN F 3 136 ? 70.137  -64.196 -68.283 1.00 68.59  ? 113  GLN B CB    1 
ATOM   5771 C  CG    . GLN F 3 136 ? 69.003  -65.188 -68.085 1.00 71.74  ? 113  GLN B CG    1 
ATOM   5772 C  CD    . GLN F 3 136 ? 68.588  -65.870 -69.372 1.00 74.10  ? 113  GLN B CD    1 
ATOM   5773 O  OE1   . GLN F 3 136 ? 68.121  -65.223 -70.312 1.00 75.10  ? 113  GLN B OE1   1 
ATOM   5774 N  NE2   . GLN F 3 136 ? 68.758  -67.185 -69.423 1.00 75.27  ? 113  GLN B NE2   1 
ATOM   5775 N  N     . ASP F 3 137 ? 71.612  -61.265 -66.959 1.00 66.22  ? 114  ASP B N     1 
ATOM   5776 C  CA    . ASP F 3 137 ? 72.754  -60.372 -67.135 1.00 65.70  ? 114  ASP B CA    1 
ATOM   5777 C  C     . ASP F 3 137 ? 73.524  -60.315 -65.818 1.00 65.13  ? 114  ASP B C     1 
ATOM   5778 O  O     . ASP F 3 137 ? 72.980  -59.926 -64.785 1.00 64.88  ? 114  ASP B O     1 
ATOM   5779 C  CB    . ASP F 3 137 ? 72.286  -58.966 -67.528 1.00 66.48  ? 114  ASP B CB    1 
ATOM   5780 C  CG    . ASP F 3 137 ? 73.418  -58.098 -68.052 1.00 66.71  ? 114  ASP B CG    1 
ATOM   5781 O  OD1   . ASP F 3 137 ? 74.451  -57.975 -67.361 1.00 67.23  ? 114  ASP B OD1   1 
ATOM   5782 O  OD2   . ASP F 3 137 ? 73.272  -57.534 -69.157 1.00 66.74  ? 114  ASP B OD2   1 
ATOM   5783 N  N     . PRO F 3 138 ? 74.807  -60.705 -65.841 1.00 64.41  ? 115  PRO B N     1 
ATOM   5784 C  CA    . PRO F 3 138 ? 75.658  -60.705 -64.647 1.00 63.30  ? 115  PRO B CA    1 
ATOM   5785 C  C     . PRO F 3 138 ? 75.806  -59.344 -63.975 1.00 62.05  ? 115  PRO B C     1 
ATOM   5786 O  O     . PRO F 3 138 ? 76.195  -59.265 -62.810 1.00 61.04  ? 115  PRO B O     1 
ATOM   5787 C  CB    . PRO F 3 138 ? 76.985  -61.239 -65.177 1.00 63.39  ? 115  PRO B CB    1 
ATOM   5788 C  CG    . PRO F 3 138 ? 77.001  -60.731 -66.580 1.00 64.08  ? 115  PRO B CG    1 
ATOM   5789 C  CD    . PRO F 3 138 ? 75.596  -61.034 -67.039 1.00 64.18  ? 115  PRO B CD    1 
ATOM   5790 N  N     . ALA F 3 139 ? 75.491  -58.281 -64.709 1.00 61.88  ? 116  ALA B N     1 
ATOM   5791 C  CA    . ALA F 3 139 ? 75.598  -56.921 -64.183 1.00 61.23  ? 116  ALA B CA    1 
ATOM   5792 C  C     . ALA F 3 139 ? 74.357  -56.491 -63.405 1.00 60.64  ? 116  ALA B C     1 
ATOM   5793 O  O     . ALA F 3 139 ? 74.449  -55.689 -62.476 1.00 61.66  ? 116  ALA B O     1 
ATOM   5794 C  CB    . ALA F 3 139 ? 75.861  -55.941 -65.321 1.00 61.38  ? 116  ALA B CB    1 
ATOM   5795 N  N     . LYS F 3 140 ? 73.198  -57.017 -63.788 1.00 58.74  ? 117  LYS B N     1 
ATOM   5796 C  CA    . LYS F 3 140 ? 71.951  -56.674 -63.111 1.00 56.54  ? 117  LYS B CA    1 
ATOM   5797 C  C     . LYS F 3 140 ? 71.589  -57.708 -62.049 1.00 53.96  ? 117  LYS B C     1 
ATOM   5798 O  O     . LYS F 3 140 ? 70.597  -58.425 -62.181 1.00 54.47  ? 117  LYS B O     1 
ATOM   5799 C  CB    . LYS F 3 140 ? 70.811  -56.557 -64.128 1.00 57.12  ? 117  LYS B CB    1 
ATOM   5800 C  CG    . LYS F 3 140 ? 70.980  -55.418 -65.120 1.00 58.63  ? 117  LYS B CG    1 
ATOM   5801 C  CD    . LYS F 3 140 ? 69.784  -55.317 -66.056 1.00 60.05  ? 117  LYS B CD    1 
ATOM   5802 C  CE    . LYS F 3 140 ? 69.925  -54.142 -67.011 1.00 60.96  ? 117  LYS B CE    1 
ATOM   5803 N  NZ    . LYS F 3 140 ? 70.016  -52.844 -66.285 0.00 61.38  ? 117  LYS B NZ    1 
ATOM   5804 N  N     . GLN F 3 141 ? 72.393  -57.771 -60.992 1.00 50.32  ? 118  GLN B N     1 
ATOM   5805 C  CA    . GLN F 3 141 ? 72.166  -58.723 -59.909 1.00 48.13  ? 118  GLN B CA    1 
ATOM   5806 C  C     . GLN F 3 141 ? 71.972  -58.050 -58.554 1.00 46.49  ? 118  GLN B C     1 
ATOM   5807 O  O     . GLN F 3 141 ? 72.219  -56.856 -58.400 1.00 47.77  ? 118  GLN B O     1 
ATOM   5808 C  CB    . GLN F 3 141 ? 73.345  -59.695 -59.809 1.00 46.77  ? 118  GLN B CB    1 
ATOM   5809 C  CG    . GLN F 3 141 ? 73.512  -60.606 -61.006 1.00 45.26  ? 118  GLN B CG    1 
ATOM   5810 C  CD    . GLN F 3 141 ? 72.280  -61.441 -61.267 1.00 43.51  ? 118  GLN B CD    1 
ATOM   5811 O  OE1   . GLN F 3 141 ? 71.758  -62.092 -60.361 1.00 42.57  ? 118  GLN B OE1   1 
ATOM   5812 N  NE2   . GLN F 3 141 ? 71.809  -61.433 -62.509 1.00 42.31  ? 118  GLN B NE2   1 
ATOM   5813 N  N     . ILE F 3 142 ? 71.521  -58.827 -57.575 1.00 43.26  ? 119  ILE B N     1 
ATOM   5814 C  CA    . ILE F 3 142 ? 71.325  -58.326 -56.223 1.00 40.56  ? 119  ILE B CA    1 
ATOM   5815 C  C     . ILE F 3 142 ? 71.965  -59.338 -55.285 1.00 40.39  ? 119  ILE B C     1 
ATOM   5816 O  O     . ILE F 3 142 ? 71.286  -60.155 -54.668 1.00 39.71  ? 119  ILE B O     1 
ATOM   5817 C  CB    . ILE F 3 142 ? 69.832  -58.170 -55.877 1.00 39.55  ? 119  ILE B CB    1 
ATOM   5818 C  CG1   . ILE F 3 142 ? 69.154  -57.266 -56.906 1.00 40.36  ? 119  ILE B CG1   1 
ATOM   5819 C  CG2   . ILE F 3 142 ? 69.681  -57.557 -54.499 1.00 38.16  ? 119  ILE B CG2   1 
ATOM   5820 C  CD1   . ILE F 3 142 ? 67.697  -56.982 -56.613 1.00 40.27  ? 119  ILE B CD1   1 
ATOM   5821 N  N     . SER F 3 143 ? 73.289  -59.276 -55.205 1.00 41.26  ? 120  SER B N     1 
ATOM   5822 C  CA    . SER F 3 143 ? 74.070  -60.175 -54.369 1.00 43.09  ? 120  SER B CA    1 
ATOM   5823 C  C     . SER F 3 143 ? 73.591  -60.207 -52.929 1.00 43.77  ? 120  SER B C     1 
ATOM   5824 O  O     . SER F 3 143 ? 73.781  -59.251 -52.178 1.00 45.09  ? 120  SER B O     1 
ATOM   5825 C  CB    . SER F 3 143 ? 75.541  -59.761 -54.398 1.00 45.31  ? 120  SER B CB    1 
ATOM   5826 O  OG    . SER F 3 143 ? 75.704  -58.436 -53.917 1.00 50.04  ? 120  SER B OG    1 
ATOM   5827 N  N     . VAL F 3 144 ? 72.974  -61.315 -52.541 1.00 44.37  ? 121  VAL B N     1 
ATOM   5828 C  CA    . VAL F 3 144 ? 72.485  -61.463 -51.181 1.00 46.04  ? 121  VAL B CA    1 
ATOM   5829 C  C     . VAL F 3 144 ? 73.661  -61.281 -50.224 1.00 45.69  ? 121  VAL B C     1 
ATOM   5830 O  O     . VAL F 3 144 ? 73.492  -60.901 -49.067 1.00 44.72  ? 121  VAL B O     1 
ATOM   5831 C  CB    . VAL F 3 144 ? 71.863  -62.861 -50.969 1.00 46.93  ? 121  VAL B CB    1 
ATOM   5832 C  CG1   . VAL F 3 144 ? 72.917  -63.932 -51.177 1.00 48.06  ? 121  VAL B CG1   1 
ATOM   5833 C  CG2   . VAL F 3 144 ? 71.262  -62.964 -49.576 1.00 48.38  ? 121  VAL B CG2   1 
ATOM   5834 N  N     . GLU F 3 145 ? 74.859  -61.544 -50.730 1.00 46.59  ? 122  GLU B N     1 
ATOM   5835 C  CA    . GLU F 3 145 ? 76.071  -61.426 -49.937 1.00 48.80  ? 122  GLU B CA    1 
ATOM   5836 C  C     . GLU F 3 145 ? 76.340  -60.012 -49.431 1.00 48.06  ? 122  GLU B C     1 
ATOM   5837 O  O     . GLU F 3 145 ? 76.908  -59.834 -48.353 1.00 48.58  ? 122  GLU B O     1 
ATOM   5838 C  CB    . GLU F 3 145 ? 77.269  -61.913 -50.755 1.00 52.43  ? 122  GLU B CB    1 
ATOM   5839 C  CG    . GLU F 3 145 ? 78.609  -61.719 -50.065 1.00 58.58  ? 122  GLU B CG    1 
ATOM   5840 C  CD    . GLU F 3 145 ? 79.765  -62.285 -50.867 1.00 62.64  ? 122  GLU B CD    1 
ATOM   5841 O  OE1   . GLU F 3 145 ? 79.874  -61.949 -52.069 1.00 64.37  ? 122  GLU B OE1   1 
ATOM   5842 O  OE2   . GLU F 3 145 ? 80.565  -63.061 -50.294 1.00 64.39  ? 122  GLU B OE2   1 
ATOM   5843 N  N     . ASP F 3 146 ? 75.929  -59.008 -50.199 1.00 47.13  ? 123  ASP B N     1 
ATOM   5844 C  CA    . ASP F 3 146 ? 76.166  -57.621 -49.811 1.00 45.98  ? 123  ASP B CA    1 
ATOM   5845 C  C     . ASP F 3 146 ? 74.930  -56.734 -49.773 1.00 43.30  ? 123  ASP B C     1 
ATOM   5846 O  O     . ASP F 3 146 ? 75.018  -55.523 -49.965 1.00 43.83  ? 123  ASP B O     1 
ATOM   5847 C  CB    . ASP F 3 146 ? 77.212  -57.003 -50.741 1.00 49.16  ? 123  ASP B CB    1 
ATOM   5848 C  CG    . ASP F 3 146 ? 78.633  -57.306 -50.300 1.00 52.52  ? 123  ASP B CG    1 
ATOM   5849 O  OD1   . ASP F 3 146 ? 78.926  -58.479 -49.982 1.00 54.31  ? 123  ASP B OD1   1 
ATOM   5850 O  OD2   . ASP F 3 146 ? 79.460  -56.368 -50.273 1.00 53.88  ? 123  ASP B OD2   1 
ATOM   5851 N  N     . HIS F 3 147 ? 73.777  -57.332 -49.512 1.00 40.34  ? 124  HIS B N     1 
ATOM   5852 C  CA    . HIS F 3 147 ? 72.540  -56.567 -49.451 1.00 36.60  ? 124  HIS B CA    1 
ATOM   5853 C  C     . HIS F 3 147 ? 71.647  -57.050 -48.318 1.00 33.93  ? 124  HIS B C     1 
ATOM   5854 O  O     . HIS F 3 147 ? 71.895  -58.096 -47.721 1.00 32.89  ? 124  HIS B O     1 
ATOM   5855 C  CB    . HIS F 3 147 ? 71.796  -56.664 -50.787 1.00 35.46  ? 124  HIS B CB    1 
ATOM   5856 C  CG    . HIS F 3 147 ? 72.474  -55.937 -51.906 1.00 36.09  ? 124  HIS B CG    1 
ATOM   5857 N  ND1   . HIS F 3 147 ? 72.642  -54.568 -51.909 1.00 36.83  ? 124  HIS B ND1   1 
ATOM   5858 C  CD2   . HIS F 3 147 ? 73.043  -56.388 -53.048 1.00 36.01  ? 124  HIS B CD2   1 
ATOM   5859 C  CE1   . HIS F 3 147 ? 73.285  -54.208 -53.005 1.00 35.89  ? 124  HIS B CE1   1 
ATOM   5860 N  NE2   . HIS F 3 147 ? 73.540  -55.293 -53.713 1.00 36.56  ? 124  HIS B NE2   1 
ATOM   5861 N  N     . LYS F 3 148 ? 70.615  -56.272 -48.016 1.00 31.38  ? 125  LYS B N     1 
ATOM   5862 C  CA    . LYS F 3 148 ? 69.680  -56.631 -46.964 1.00 29.17  ? 125  LYS B CA    1 
ATOM   5863 C  C     . LYS F 3 148 ? 68.285  -56.155 -47.331 1.00 27.73  ? 125  LYS B C     1 
ATOM   5864 O  O     . LYS F 3 148 ? 68.091  -55.007 -47.722 1.00 26.65  ? 125  LYS B O     1 
ATOM   5865 C  CB    . LYS F 3 148 ? 70.113  -56.020 -45.633 1.00 28.35  ? 125  LYS B CB    1 
ATOM   5866 C  CG    . LYS F 3 148 ? 69.326  -56.540 -44.447 1.00 29.32  ? 125  LYS B CG    1 
ATOM   5867 C  CD    . LYS F 3 148 ? 69.986  -56.158 -43.135 1.00 29.83  ? 125  LYS B CD    1 
ATOM   5868 C  CE    . LYS F 3 148 ? 69.175  -56.659 -41.952 1.00 32.02  ? 125  LYS B CE    1 
ATOM   5869 N  NZ    . LYS F 3 148 ? 68.972  -58.139 -41.989 1.00 32.24  ? 125  LYS B NZ    1 
ATOM   5870 N  N     . VAL F 3 149 ? 67.317  -57.056 -47.213 1.00 27.43  ? 126  VAL B N     1 
ATOM   5871 C  CA    . VAL F 3 149 ? 65.932  -56.746 -47.539 1.00 26.61  ? 126  VAL B CA    1 
ATOM   5872 C  C     . VAL F 3 149 ? 65.345  -55.727 -46.571 1.00 26.44  ? 126  VAL B C     1 
ATOM   5873 O  O     . VAL F 3 149 ? 65.529  -55.828 -45.359 1.00 26.85  ? 126  VAL B O     1 
ATOM   5874 C  CB    . VAL F 3 149 ? 65.061  -58.017 -47.500 1.00 25.82  ? 126  VAL B CB    1 
ATOM   5875 C  CG1   . VAL F 3 149 ? 63.632  -57.684 -47.872 1.00 26.57  ? 126  VAL B CG1   1 
ATOM   5876 C  CG2   . VAL F 3 149 ? 65.625  -59.056 -48.443 1.00 25.86  ? 126  VAL B CG2   1 
ATOM   5877 N  N     . SER F 3 150 ? 64.638  -54.745 -47.115 1.00 26.42  ? 127  SER B N     1 
ATOM   5878 C  CA    . SER F 3 150 ? 64.005  -53.713 -46.301 1.00 28.36  ? 127  SER B CA    1 
ATOM   5879 C  C     . SER F 3 150 ? 62.496  -53.777 -46.499 1.00 28.93  ? 127  SER B C     1 
ATOM   5880 O  O     . SER F 3 150 ? 62.004  -53.672 -47.625 1.00 30.69  ? 127  SER B O     1 
ATOM   5881 C  CB    . SER F 3 150 ? 64.517  -52.324 -46.704 1.00 29.58  ? 127  SER B CB    1 
ATOM   5882 O  OG    . SER F 3 150 ? 63.799  -51.290 -46.045 1.00 28.74  ? 127  SER B OG    1 
ATOM   5883 N  N     . LEU F 3 151 ? 61.760  -53.952 -45.407 1.00 27.46  ? 128  LEU B N     1 
ATOM   5884 C  CA    . LEU F 3 151 ? 60.310  -54.025 -45.497 1.00 27.61  ? 128  LEU B CA    1 
ATOM   5885 C  C     . LEU F 3 151 ? 59.633  -52.680 -45.238 1.00 27.76  ? 128  LEU B C     1 
ATOM   5886 O  O     . LEU F 3 151 ? 58.409  -52.602 -45.177 1.00 26.86  ? 128  LEU B O     1 
ATOM   5887 C  CB    . LEU F 3 151 ? 59.779  -55.071 -44.515 1.00 27.02  ? 128  LEU B CB    1 
ATOM   5888 C  CG    . LEU F 3 151 ? 60.292  -56.493 -44.743 1.00 25.73  ? 128  LEU B CG    1 
ATOM   5889 C  CD1   . LEU F 3 151 ? 59.600  -57.451 -43.785 1.00 22.14  ? 128  LEU B CD1   1 
ATOM   5890 C  CD2   . LEU F 3 151 ? 60.031  -56.898 -46.187 1.00 26.64  ? 128  LEU B CD2   1 
ATOM   5891 N  N     . GLU F 3 152 ? 60.426  -51.621 -45.099 1.00 27.91  ? 129  GLU B N     1 
ATOM   5892 C  CA    . GLU F 3 152 ? 59.862  -50.301 -44.842 1.00 26.93  ? 129  GLU B CA    1 
ATOM   5893 C  C     . GLU F 3 152 ? 58.753  -49.902 -45.809 1.00 24.47  ? 129  GLU B C     1 
ATOM   5894 O  O     . GLU F 3 152 ? 57.699  -49.447 -45.378 1.00 24.43  ? 129  GLU B O     1 
ATOM   5895 C  CB    . GLU F 3 152 ? 60.949  -49.221 -44.852 1.00 29.59  ? 129  GLU B CB    1 
ATOM   5896 C  CG    . GLU F 3 152 ? 60.377  -47.795 -44.795 1.00 34.84  ? 129  GLU B CG    1 
ATOM   5897 C  CD    . GLU F 3 152 ? 61.430  -46.711 -44.558 1.00 37.88  ? 129  GLU B CD    1 
ATOM   5898 O  OE1   . GLU F 3 152 ? 61.113  -45.520 -44.763 1.00 37.72  ? 129  GLU B OE1   1 
ATOM   5899 O  OE2   . GLU F 3 152 ? 62.567  -47.040 -44.156 1.00 40.49  ? 129  GLU B OE2   1 
ATOM   5900 N  N     . PRO F 3 153 ? 58.965  -50.075 -47.125 1.00 22.69  ? 130  PRO B N     1 
ATOM   5901 C  CA    . PRO F 3 153 ? 57.922  -49.696 -48.085 1.00 20.62  ? 130  PRO B CA    1 
ATOM   5902 C  C     . PRO F 3 153 ? 56.548  -50.234 -47.709 1.00 19.77  ? 130  PRO B C     1 
ATOM   5903 O  O     . PRO F 3 153 ? 55.555  -49.505 -47.732 1.00 18.68  ? 130  PRO B O     1 
ATOM   5904 C  CB    . PRO F 3 153 ? 58.433  -50.285 -49.395 1.00 20.35  ? 130  PRO B CB    1 
ATOM   5905 C  CG    . PRO F 3 153 ? 59.912  -50.204 -49.238 1.00 21.24  ? 130  PRO B CG    1 
ATOM   5906 C  CD    . PRO F 3 153 ? 60.102  -50.700 -47.821 1.00 22.40  ? 130  PRO B CD    1 
ATOM   5907 N  N     . TYR F 3 154 ? 56.507  -51.514 -47.353 1.00 19.46  ? 131  TYR B N     1 
ATOM   5908 C  CA    . TYR F 3 154 ? 55.265  -52.173 -46.971 1.00 19.32  ? 131  TYR B CA    1 
ATOM   5909 C  C     . TYR F 3 154 ? 54.731  -51.616 -45.662 1.00 20.55  ? 131  TYR B C     1 
ATOM   5910 O  O     . TYR F 3 154 ? 53.530  -51.400 -45.526 1.00 20.72  ? 131  TYR B O     1 
ATOM   5911 C  CB    . TYR F 3 154 ? 55.490  -53.685 -46.850 1.00 19.31  ? 131  TYR B CB    1 
ATOM   5912 C  CG    . TYR F 3 154 ? 56.237  -54.255 -48.032 1.00 19.58  ? 131  TYR B CG    1 
ATOM   5913 C  CD1   . TYR F 3 154 ? 57.562  -54.676 -47.911 1.00 19.72  ? 131  TYR B CD1   1 
ATOM   5914 C  CD2   . TYR F 3 154 ? 55.660  -54.264 -49.297 1.00 18.66  ? 131  TYR B CD2   1 
ATOM   5915 C  CE1   . TYR F 3 154 ? 58.292  -55.078 -49.030 1.00 21.71  ? 131  TYR B CE1   1 
ATOM   5916 C  CE2   . TYR F 3 154 ? 56.381  -54.661 -50.417 1.00 19.74  ? 131  TYR B CE2   1 
ATOM   5917 C  CZ    . TYR F 3 154 ? 57.692  -55.059 -50.281 1.00 20.79  ? 131  TYR B CZ    1 
ATOM   5918 O  OH    . TYR F 3 154 ? 58.408  -55.377 -51.410 1.00 21.67  ? 131  TYR B OH    1 
ATOM   5919 N  N     . ARG F 3 155 ? 55.623  -51.382 -44.701 1.00 23.11  ? 132  ARG B N     1 
ATOM   5920 C  CA    . ARG F 3 155 ? 55.215  -50.839 -43.409 1.00 24.85  ? 132  ARG B CA    1 
ATOM   5921 C  C     . ARG F 3 155 ? 54.663  -49.434 -43.588 1.00 26.08  ? 132  ARG B C     1 
ATOM   5922 O  O     . ARG F 3 155 ? 53.785  -49.006 -42.841 1.00 27.69  ? 132  ARG B O     1 
ATOM   5923 C  CB    . ARG F 3 155 ? 56.388  -50.818 -42.425 1.00 25.15  ? 132  ARG B CB    1 
ATOM   5924 C  CG    . ARG F 3 155 ? 56.760  -52.193 -41.899 1.00 29.78  ? 132  ARG B CG    1 
ATOM   5925 C  CD    . ARG F 3 155 ? 57.551  -52.128 -40.592 1.00 32.26  ? 132  ARG B CD    1 
ATOM   5926 N  NE    . ARG F 3 155 ? 58.964  -52.462 -40.760 1.00 33.65  ? 132  ARG B NE    1 
ATOM   5927 C  CZ    . ARG F 3 155 ? 59.917  -51.581 -41.043 1.00 35.32  ? 132  ARG B CZ    1 
ATOM   5928 N  NH1   . ARG F 3 155 ? 59.617  -50.297 -41.188 1.00 36.60  ? 132  ARG B NH1   1 
ATOM   5929 N  NH2   . ARG F 3 155 ? 61.171  -51.985 -41.182 1.00 36.11  ? 132  ARG B NH2   1 
ATOM   5930 N  N     . ARG F 3 156 ? 55.183  -48.722 -44.582 1.00 26.97  ? 133  ARG B N     1 
ATOM   5931 C  CA    . ARG F 3 156 ? 54.728  -47.371 -44.877 1.00 26.75  ? 133  ARG B CA    1 
ATOM   5932 C  C     . ARG F 3 156 ? 53.293  -47.451 -45.377 1.00 26.36  ? 133  ARG B C     1 
ATOM   5933 O  O     . ARG F 3 156 ? 52.397  -46.814 -44.828 1.00 26.78  ? 133  ARG B O     1 
ATOM   5934 C  CB    . ARG F 3 156 ? 55.598  -46.736 -45.963 1.00 30.20  ? 133  ARG B CB    1 
ATOM   5935 C  CG    . ARG F 3 156 ? 56.993  -46.313 -45.525 1.00 33.55  ? 133  ARG B CG    1 
ATOM   5936 C  CD    . ARG F 3 156 ? 56.961  -45.068 -44.648 1.00 37.35  ? 133  ARG B CD    1 
ATOM   5937 N  NE    . ARG F 3 156 ? 58.282  -44.446 -44.529 1.00 39.51  ? 133  ARG B NE    1 
ATOM   5938 C  CZ    . ARG F 3 156 ? 58.538  -43.353 -43.814 1.00 40.21  ? 133  ARG B CZ    1 
ATOM   5939 N  NH1   . ARG F 3 156 ? 57.567  -42.747 -43.143 1.00 41.70  ? 133  ARG B NH1   1 
ATOM   5940 N  NH2   . ARG F 3 156 ? 59.768  -42.859 -43.771 1.00 40.46  ? 133  ARG B NH2   1 
ATOM   5941 N  N     . GLU F 3 157 ? 53.082  -48.239 -46.426 1.00 25.60  ? 134  GLU B N     1 
ATOM   5942 C  CA    . GLU F 3 157 ? 51.751  -48.398 -46.998 1.00 26.39  ? 134  GLU B CA    1 
ATOM   5943 C  C     . GLU F 3 157 ? 50.747  -48.918 -45.977 1.00 26.79  ? 134  GLU B C     1 
ATOM   5944 O  O     . GLU F 3 157 ? 49.563  -48.581 -46.032 1.00 27.58  ? 134  GLU B O     1 
ATOM   5945 C  CB    . GLU F 3 157 ? 51.804  -49.332 -48.207 1.00 25.53  ? 134  GLU B CB    1 
ATOM   5946 C  CG    . GLU F 3 157 ? 52.467  -48.704 -49.421 1.00 25.47  ? 134  GLU B CG    1 
ATOM   5947 C  CD    . GLU F 3 157 ? 51.777  -47.423 -49.854 1.00 26.21  ? 134  GLU B CD    1 
ATOM   5948 O  OE1   . GLU F 3 157 ? 50.568  -47.469 -50.175 1.00 24.98  ? 134  GLU B OE1   1 
ATOM   5949 O  OE2   . GLU F 3 157 ? 52.443  -46.368 -49.868 1.00 26.81  ? 134  GLU B OE2   1 
ATOM   5950 N  N     . SER F 3 158 ? 51.224  -49.739 -45.047 1.00 26.17  ? 135  SER B N     1 
ATOM   5951 C  CA    . SER F 3 158 ? 50.371  -50.296 -44.005 1.00 24.23  ? 135  SER B CA    1 
ATOM   5952 C  C     . SER F 3 158 ? 49.797  -49.151 -43.175 1.00 25.23  ? 135  SER B C     1 
ATOM   5953 O  O     . SER F 3 158 ? 48.627  -49.168 -42.797 1.00 24.96  ? 135  SER B O     1 
ATOM   5954 C  CB    . SER F 3 158 ? 51.191  -51.233 -43.113 1.00 22.45  ? 135  SER B CB    1 
ATOM   5955 O  OG    . SER F 3 158 ? 50.399  -51.803 -42.086 1.00 20.08  ? 135  SER B OG    1 
ATOM   5956 N  N     . ARG F 3 159 ? 50.635  -48.151 -42.912 1.00 26.63  ? 136  ARG B N     1 
ATOM   5957 C  CA    . ARG F 3 159 ? 50.256  -46.979 -42.127 1.00 27.39  ? 136  ARG B CA    1 
ATOM   5958 C  C     . ARG F 3 159 ? 49.209  -46.120 -42.825 1.00 26.41  ? 136  ARG B C     1 
ATOM   5959 O  O     . ARG F 3 159 ? 48.340  -45.548 -42.171 1.00 26.09  ? 136  ARG B O     1 
ATOM   5960 C  CB    . ARG F 3 159 ? 51.490  -46.120 -41.838 1.00 31.29  ? 136  ARG B CB    1 
ATOM   5961 C  CG    . ARG F 3 159 ? 51.726  -45.834 -40.368 1.00 38.33  ? 136  ARG B CG    1 
ATOM   5962 C  CD    . ARG F 3 159 ? 51.990  -47.125 -39.621 1.00 46.23  ? 136  ARG B CD    1 
ATOM   5963 N  NE    . ARG F 3 159 ? 52.243  -46.911 -38.200 1.00 52.80  ? 136  ARG B NE    1 
ATOM   5964 C  CZ    . ARG F 3 159 ? 52.455  -47.893 -37.328 1.00 56.48  ? 136  ARG B CZ    1 
ATOM   5965 N  NH1   . ARG F 3 159 ? 52.442  -49.158 -37.731 1.00 58.01  ? 136  ARG B NH1   1 
ATOM   5966 N  NH2   . ARG F 3 159 ? 52.688  -47.612 -36.055 1.00 58.35  ? 136  ARG B NH2   1 
ATOM   5967 N  N     . LYS F 3 160 ? 49.302  -46.016 -44.148 1.00 25.38  ? 137  LYS B N     1 
ATOM   5968 C  CA    . LYS F 3 160 ? 48.351  -45.215 -44.909 1.00 24.62  ? 137  LYS B CA    1 
ATOM   5969 C  C     . LYS F 3 160 ? 46.943  -45.761 -44.747 1.00 24.71  ? 137  LYS B C     1 
ATOM   5970 O  O     . LYS F 3 160 ? 45.982  -45.002 -44.612 1.00 24.67  ? 137  LYS B O     1 
ATOM   5971 C  CB    . LYS F 3 160 ? 48.723  -45.196 -46.395 1.00 24.53  ? 137  LYS B CB    1 
ATOM   5972 C  CG    . LYS F 3 160 ? 49.974  -44.399 -46.714 1.00 25.42  ? 137  LYS B CG    1 
ATOM   5973 C  CD    . LYS F 3 160 ? 50.232  -44.335 -48.215 1.00 26.99  ? 137  LYS B CD    1 
ATOM   5974 C  CE    . LYS F 3 160 ? 51.537  -43.601 -48.510 1.00 27.67  ? 137  LYS B CE    1 
ATOM   5975 N  NZ    . LYS F 3 160 ? 51.863  -43.535 -49.962 1.00 29.07  ? 137  LYS B NZ    1 
ATOM   5976 N  N     . ALA F 3 161 ? 46.826  -47.084 -44.757 1.00 24.75  ? 138  ALA B N     1 
ATOM   5977 C  CA    . ALA F 3 161 ? 45.533  -47.733 -44.614 1.00 24.71  ? 138  ALA B CA    1 
ATOM   5978 C  C     . ALA F 3 161 ? 45.001  -47.513 -43.213 1.00 24.91  ? 138  ALA B C     1 
ATOM   5979 O  O     . ALA F 3 161 ? 43.820  -47.219 -43.020 1.00 26.95  ? 138  ALA B O     1 
ATOM   5980 C  CB    . ALA F 3 161 ? 45.662  -49.213 -44.892 1.00 25.16  ? 138  ALA B CB    1 
ATOM   5981 N  N     . LEU F 3 162 ? 45.882  -47.648 -42.233 1.00 24.20  ? 139  LEU B N     1 
ATOM   5982 C  CA    . LEU F 3 162 ? 45.494  -47.462 -40.847 1.00 25.36  ? 139  LEU B CA    1 
ATOM   5983 C  C     . LEU F 3 162 ? 44.880  -46.076 -40.644 1.00 25.67  ? 139  LEU B C     1 
ATOM   5984 O  O     . LEU F 3 162 ? 43.757  -45.955 -40.156 1.00 27.27  ? 139  LEU B O     1 
ATOM   5985 C  CB    . LEU F 3 162 ? 46.708  -47.640 -39.938 1.00 25.29  ? 139  LEU B CB    1 
ATOM   5986 C  CG    . LEU F 3 162 ? 46.367  -47.873 -38.470 1.00 26.52  ? 139  LEU B CG    1 
ATOM   5987 C  CD1   . LEU F 3 162 ? 45.468  -49.090 -38.348 1.00 26.50  ? 139  LEU B CD1   1 
ATOM   5988 C  CD2   . LEU F 3 162 ? 47.644  -48.068 -37.671 1.00 29.74  ? 139  LEU B CD2   1 
ATOM   5989 N  N     . LYS F 3 163 ? 45.617  -45.036 -41.025 1.00 24.85  ? 140  LYS B N     1 
ATOM   5990 C  CA    . LYS F 3 163 ? 45.138  -43.664 -40.889 1.00 23.64  ? 140  LYS B CA    1 
ATOM   5991 C  C     . LYS F 3 163 ? 43.728  -43.505 -41.447 1.00 22.90  ? 140  LYS B C     1 
ATOM   5992 O  O     . LYS F 3 163 ? 42.900  -42.800 -40.869 1.00 22.98  ? 140  LYS B O     1 
ATOM   5993 C  CB    . LYS F 3 163 ? 46.084  -42.696 -41.606 1.00 24.65  ? 140  LYS B CB    1 
ATOM   5994 C  CG    . LYS F 3 163 ? 47.444  -42.561 -40.938 1.00 27.74  ? 140  LYS B CG    1 
ATOM   5995 C  CD    . LYS F 3 163 ? 48.307  -41.503 -41.613 1.00 29.22  ? 140  LYS B CD    1 
ATOM   5996 C  CE    . LYS F 3 163 ? 49.626  -41.326 -40.870 1.00 29.85  ? 140  LYS B CE    1 
ATOM   5997 N  NZ    . LYS F 3 163 ? 50.549  -40.385 -41.563 1.00 30.57  ? 140  LYS B NZ    1 
ATOM   5998 N  N     . ILE F 3 164 ? 43.461  -44.158 -42.573 1.00 20.90  ? 141  ILE B N     1 
ATOM   5999 C  CA    . ILE F 3 164 ? 42.146  -44.084 -43.192 1.00 20.49  ? 141  ILE B CA    1 
ATOM   6000 C  C     . ILE F 3 164 ? 41.139  -44.853 -42.348 1.00 20.58  ? 141  ILE B C     1 
ATOM   6001 O  O     . ILE F 3 164 ? 39.997  -44.430 -42.180 1.00 19.49  ? 141  ILE B O     1 
ATOM   6002 C  CB    . ILE F 3 164 ? 42.161  -44.669 -44.624 1.00 20.27  ? 141  ILE B CB    1 
ATOM   6003 C  CG1   . ILE F 3 164 ? 43.017  -43.786 -45.534 1.00 19.37  ? 141  ILE B CG1   1 
ATOM   6004 C  CG2   . ILE F 3 164 ? 40.738  -44.775 -45.169 1.00 17.42  ? 141  ILE B CG2   1 
ATOM   6005 C  CD1   . ILE F 3 164 ? 43.050  -44.247 -46.979 1.00 19.97  ? 141  ILE B CD1   1 
ATOM   6006 N  N     . PHE F 3 165 ? 41.569  -45.989 -41.814 1.00 21.43  ? 142  PHE B N     1 
ATOM   6007 C  CA    . PHE F 3 165 ? 40.693  -46.806 -40.983 1.00 22.68  ? 142  PHE B CA    1 
ATOM   6008 C  C     . PHE F 3 165 ? 40.235  -46.044 -39.746 1.00 24.56  ? 142  PHE B C     1 
ATOM   6009 O  O     . PHE F 3 165 ? 39.036  -45.933 -39.491 1.00 27.52  ? 142  PHE B O     1 
ATOM   6010 C  CB    . PHE F 3 165 ? 41.407  -48.093 -40.562 1.00 18.69  ? 142  PHE B CB    1 
ATOM   6011 C  CG    . PHE F 3 165 ? 41.354  -49.178 -41.593 1.00 12.86  ? 142  PHE B CG    1 
ATOM   6012 C  CD1   . PHE F 3 165 ? 42.502  -49.872 -41.949 1.00 11.10  ? 142  PHE B CD1   1 
ATOM   6013 C  CD2   . PHE F 3 165 ? 40.151  -49.521 -42.192 1.00 9.67   ? 142  PHE B CD2   1 
ATOM   6014 C  CE1   . PHE F 3 165 ? 42.453  -50.891 -42.886 1.00 8.96   ? 142  PHE B CE1   1 
ATOM   6015 C  CE2   . PHE F 3 165 ? 40.091  -50.539 -43.128 1.00 10.01  ? 142  PHE B CE2   1 
ATOM   6016 C  CZ    . PHE F 3 165 ? 41.245  -51.227 -43.476 1.00 10.03  ? 142  PHE B CZ    1 
ATOM   6017 N  N     . LYS F 3 166 ? 41.188  -45.518 -38.984 1.00 24.16  ? 143  LYS B N     1 
ATOM   6018 C  CA    . LYS F 3 166 ? 40.866  -44.772 -37.778 1.00 25.54  ? 143  LYS B CA    1 
ATOM   6019 C  C     . LYS F 3 166 ? 39.971  -43.558 -38.063 1.00 27.28  ? 143  LYS B C     1 
ATOM   6020 O  O     . LYS F 3 166 ? 39.180  -43.149 -37.212 1.00 28.44  ? 143  LYS B O     1 
ATOM   6021 C  CB    . LYS F 3 166 ? 42.156  -44.325 -37.086 1.00 25.24  ? 143  LYS B CB    1 
ATOM   6022 C  CG    . LYS F 3 166 ? 43.070  -45.472 -36.662 1.00 24.29  ? 143  LYS B CG    1 
ATOM   6023 C  CD    . LYS F 3 166 ? 44.325  -44.950 -35.966 1.00 24.59  ? 143  LYS B CD    1 
ATOM   6024 C  CE    . LYS F 3 166 ? 45.246  -46.082 -35.542 0.00 25.06  ? 143  LYS B CE    1 
ATOM   6025 N  NZ    . LYS F 3 166 ? 46.471  -45.573 -34.860 0.00 25.11  ? 143  LYS B NZ    1 
ATOM   6026 N  N     . SER F 3 167 ? 40.087  -42.992 -39.261 1.00 28.05  ? 144  SER B N     1 
ATOM   6027 C  CA    . SER F 3 167 ? 39.286  -41.828 -39.634 1.00 28.39  ? 144  SER B CA    1 
ATOM   6028 C  C     . SER F 3 167 ? 37.809  -42.171 -39.769 1.00 28.33  ? 144  SER B C     1 
ATOM   6029 O  O     . SER F 3 167 ? 36.957  -41.285 -39.730 1.00 30.18  ? 144  SER B O     1 
ATOM   6030 C  CB    . SER F 3 167 ? 39.772  -41.239 -40.965 1.00 30.21  ? 144  SER B CB    1 
ATOM   6031 O  OG    . SER F 3 167 ? 39.237  -41.949 -42.076 1.00 29.01  ? 144  SER B OG    1 
ATOM   6032 N  N     . ALA F 3 168 ? 37.504  -43.453 -39.932 1.00 27.09  ? 145  ALA B N     1 
ATOM   6033 C  CA    . ALA F 3 168 ? 36.122  -43.882 -40.088 1.00 26.90  ? 145  ALA B CA    1 
ATOM   6034 C  C     . ALA F 3 168 ? 35.637  -44.798 -38.971 1.00 26.70  ? 145  ALA B C     1 
ATOM   6035 O  O     . ALA F 3 168 ? 34.500  -45.266 -39.004 1.00 25.92  ? 145  ALA B O     1 
ATOM   6036 C  CB    . ALA F 3 168 ? 35.949  -44.568 -41.431 1.00 27.95  ? 145  ALA B CB    1 
ATOM   6037 N  N     . CYS F 3 169 ? 36.494  -45.052 -37.986 1.00 26.65  ? 146  CYS B N     1 
ATOM   6038 C  CA    . CYS F 3 169 ? 36.133  -45.915 -36.866 1.00 27.44  ? 146  CYS B CA    1 
ATOM   6039 C  C     . CYS F 3 169 ? 36.881  -45.518 -35.595 1.00 28.29  ? 146  CYS B C     1 
ATOM   6040 O  O     . CYS F 3 169 ? 38.111  -45.466 -35.573 1.00 28.21  ? 146  CYS B O     1 
ATOM   6041 C  CB    . CYS F 3 169 ? 36.432  -47.371 -37.209 1.00 26.18  ? 146  CYS B CB    1 
ATOM   6042 S  SG    . CYS F 3 169 ? 35.770  -48.532 -36.014 1.00 29.68  ? 146  CYS B SG    1 
ATOM   6043 N  N     . ASP F 3 170 ? 36.129  -45.253 -34.532 1.00 29.60  ? 147  ASP B N     1 
ATOM   6044 C  CA    . ASP F 3 170 ? 36.714  -44.836 -33.263 1.00 31.99  ? 147  ASP B CA    1 
ATOM   6045 C  C     . ASP F 3 170 ? 37.356  -45.957 -32.448 1.00 32.59  ? 147  ASP B C     1 
ATOM   6046 O  O     . ASP F 3 170 ? 37.649  -45.783 -31.262 1.00 33.12  ? 147  ASP B O     1 
ATOM   6047 C  CB    . ASP F 3 170 ? 35.658  -44.119 -32.420 1.00 34.42  ? 147  ASP B CB    1 
ATOM   6048 C  CG    . ASP F 3 170 ? 34.437  -44.975 -32.168 1.00 37.75  ? 147  ASP B CG    1 
ATOM   6049 O  OD1   . ASP F 3 170 ? 33.877  -45.516 -33.148 1.00 39.13  ? 147  ASP B OD1   1 
ATOM   6050 O  OD2   . ASP F 3 170 ? 34.035  -45.098 -30.990 1.00 40.46  ? 147  ASP B OD2   1 
ATOM   6051 N  N     . LEU F 3 171 ? 37.582  -47.104 -33.079 1.00 32.19  ? 148  LEU B N     1 
ATOM   6052 C  CA    . LEU F 3 171 ? 38.210  -48.226 -32.392 1.00 30.60  ? 148  LEU B CA    1 
ATOM   6053 C  C     . LEU F 3 171 ? 38.785  -49.216 -33.396 1.00 29.06  ? 148  LEU B C     1 
ATOM   6054 O  O     . LEU F 3 171 ? 38.086  -50.095 -33.899 1.00 28.99  ? 148  LEU B O     1 
ATOM   6055 C  CB    . LEU F 3 171 ? 37.205  -48.920 -31.469 1.00 30.48  ? 148  LEU B CB    1 
ATOM   6056 C  CG    . LEU F 3 171 ? 37.781  -49.968 -30.509 1.00 29.45  ? 148  LEU B CG    1 
ATOM   6057 C  CD1   . LEU F 3 171 ? 39.006  -49.416 -29.805 1.00 27.08  ? 148  LEU B CD1   1 
ATOM   6058 C  CD2   . LEU F 3 171 ? 36.718  -50.371 -29.498 1.00 29.59  ? 148  LEU B CD2   1 
ATOM   6059 N  N     . VAL F 3 172 ? 40.075  -49.053 -33.672 1.00 27.75  ? 149  VAL B N     1 
ATOM   6060 C  CA    . VAL F 3 172 ? 40.801  -49.888 -34.619 1.00 26.15  ? 149  VAL B CA    1 
ATOM   6061 C  C     . VAL F 3 172 ? 41.917  -50.672 -33.931 1.00 25.08  ? 149  VAL B C     1 
ATOM   6062 O  O     . VAL F 3 172 ? 42.574  -50.164 -33.030 1.00 25.55  ? 149  VAL B O     1 
ATOM   6063 C  CB    . VAL F 3 172 ? 41.424  -49.013 -35.736 1.00 25.26  ? 149  VAL B CB    1 
ATOM   6064 C  CG1   . VAL F 3 172 ? 42.271  -49.862 -36.669 1.00 24.28  ? 149  VAL B CG1   1 
ATOM   6065 C  CG2   . VAL F 3 172 ? 40.322  -48.307 -36.512 1.00 25.05  ? 149  VAL B CG2   1 
ATOM   6066 N  N     . GLU F 3 173 ? 42.121  -51.912 -34.359 1.00 24.77  ? 150  GLU B N     1 
ATOM   6067 C  CA    . GLU F 3 173 ? 43.169  -52.752 -33.798 1.00 26.43  ? 150  GLU B CA    1 
ATOM   6068 C  C     . GLU F 3 173 ? 44.049  -53.280 -34.927 1.00 28.06  ? 150  GLU B C     1 
ATOM   6069 O  O     . GLU F 3 173 ? 43.581  -54.006 -35.804 1.00 30.14  ? 150  GLU B O     1 
ATOM   6070 C  CB    . GLU F 3 173 ? 42.564  -53.927 -33.030 1.00 27.97  ? 150  GLU B CB    1 
ATOM   6071 C  CG    . GLU F 3 173 ? 43.600  -54.840 -32.387 1.00 32.38  ? 150  GLU B CG    1 
ATOM   6072 C  CD    . GLU F 3 173 ? 42.984  -56.064 -31.728 1.00 35.54  ? 150  GLU B CD    1 
ATOM   6073 O  OE1   . GLU F 3 173 ? 42.096  -55.894 -30.869 1.00 37.44  ? 150  GLU B OE1   1 
ATOM   6074 O  OE2   . GLU F 3 173 ? 43.391  -57.198 -32.065 1.00 36.74  ? 150  GLU B OE2   1 
ATOM   6075 N  N     . ARG F 3 174 ? 45.323  -52.906 -34.905 1.00 27.76  ? 151  ARG B N     1 
ATOM   6076 C  CA    . ARG F 3 174 ? 46.273  -53.341 -35.918 1.00 27.17  ? 151  ARG B CA    1 
ATOM   6077 C  C     . ARG F 3 174 ? 46.585  -54.808 -35.659 1.00 26.64  ? 151  ARG B C     1 
ATOM   6078 O  O     . ARG F 3 174 ? 47.460  -55.129 -34.859 1.00 27.60  ? 151  ARG B O     1 
ATOM   6079 C  CB    . ARG F 3 174 ? 47.547  -52.503 -35.818 1.00 29.80  ? 151  ARG B CB    1 
ATOM   6080 C  CG    . ARG F 3 174 ? 48.618  -52.788 -36.865 1.00 34.61  ? 151  ARG B CG    1 
ATOM   6081 C  CD    . ARG F 3 174 ? 49.887  -52.000 -36.532 1.00 39.70  ? 151  ARG B CD    1 
ATOM   6082 N  NE    . ARG F 3 174 ? 50.946  -52.108 -37.537 1.00 43.75  ? 151  ARG B NE    1 
ATOM   6083 C  CZ    . ARG F 3 174 ? 50.906  -51.550 -38.745 1.00 45.89  ? 151  ARG B CZ    1 
ATOM   6084 N  NH1   . ARG F 3 174 ? 49.851  -50.836 -39.120 1.00 46.72  ? 151  ARG B NH1   1 
ATOM   6085 N  NH2   . ARG F 3 174 ? 51.932  -51.687 -39.574 1.00 47.32  ? 151  ARG B NH2   1 
ATOM   6086 N  N     . ALA F 3 175 ? 45.857  -55.692 -36.334 1.00 25.90  ? 152  ALA B N     1 
ATOM   6087 C  CA    . ALA F 3 175 ? 46.038  -57.131 -36.180 1.00 24.67  ? 152  ALA B CA    1 
ATOM   6088 C  C     . ALA F 3 175 ? 47.380  -57.620 -36.715 1.00 24.87  ? 152  ALA B C     1 
ATOM   6089 O  O     . ALA F 3 175 ? 47.883  -58.657 -36.286 1.00 27.15  ? 152  ALA B O     1 
ATOM   6090 C  CB    . ALA F 3 175 ? 44.909  -57.868 -36.878 1.00 22.48  ? 152  ALA B CB    1 
ATOM   6091 N  N     . SER F 3 176 ? 47.954  -56.876 -37.655 1.00 24.42  ? 153  SER B N     1 
ATOM   6092 C  CA    . SER F 3 176 ? 49.236  -57.239 -38.254 1.00 22.61  ? 153  SER B CA    1 
ATOM   6093 C  C     . SER F 3 176 ? 49.626  -56.190 -39.284 1.00 22.62  ? 153  SER B C     1 
ATOM   6094 O  O     . SER F 3 176 ? 49.064  -55.094 -39.299 1.00 25.15  ? 153  SER B O     1 
ATOM   6095 C  CB    . SER F 3 176 ? 49.130  -58.598 -38.933 1.00 21.89  ? 153  SER B CB    1 
ATOM   6096 O  OG    . SER F 3 176 ? 48.109  -58.577 -39.912 1.00 21.78  ? 153  SER B OG    1 
ATOM   6097 N  N     . ILE F 3 177 ? 50.577  -56.520 -40.152 1.00 20.41  ? 154  ILE B N     1 
ATOM   6098 C  CA    . ILE F 3 177 ? 51.010  -55.566 -41.166 1.00 18.00  ? 154  ILE B CA    1 
ATOM   6099 C  C     . ILE F 3 177 ? 49.990  -55.380 -42.289 1.00 20.29  ? 154  ILE B C     1 
ATOM   6100 O  O     . ILE F 3 177 ? 50.099  -54.440 -43.073 1.00 22.09  ? 154  ILE B O     1 
ATOM   6101 C  CB    . ILE F 3 177 ? 52.358  -55.968 -41.803 1.00 14.37  ? 154  ILE B CB    1 
ATOM   6102 C  CG1   . ILE F 3 177 ? 52.915  -54.777 -42.590 1.00 15.64  ? 154  ILE B CG1   1 
ATOM   6103 C  CG2   . ILE F 3 177 ? 52.173  -57.162 -42.725 1.00 8.44   ? 154  ILE B CG2   1 
ATOM   6104 C  CD1   . ILE F 3 177 ? 54.315  -54.963 -43.121 1.00 15.52  ? 154  ILE B CD1   1 
ATOM   6105 N  N     . ASP F 3 178 ? 49.002  -56.268 -42.367 1.00 19.62  ? 155  ASP B N     1 
ATOM   6106 C  CA    . ASP F 3 178 ? 47.982  -56.173 -43.407 1.00 19.87  ? 155  ASP B CA    1 
ATOM   6107 C  C     . ASP F 3 178 ? 46.585  -56.492 -42.882 1.00 20.64  ? 155  ASP B C     1 
ATOM   6108 O  O     . ASP F 3 178 ? 45.660  -56.732 -43.664 1.00 20.82  ? 155  ASP B O     1 
ATOM   6109 C  CB    . ASP F 3 178 ? 48.295  -57.128 -44.554 1.00 22.47  ? 155  ASP B CB    1 
ATOM   6110 C  CG    . ASP F 3 178 ? 48.077  -58.583 -44.175 1.00 26.25  ? 155  ASP B CG    1 
ATOM   6111 O  OD1   . ASP F 3 178 ? 47.455  -59.317 -44.974 1.00 28.67  ? 155  ASP B OD1   1 
ATOM   6112 O  OD2   . ASP F 3 178 ? 48.532  -58.996 -43.086 1.00 26.18  ? 155  ASP B OD2   1 
ATOM   6113 N  N     . GLU F 3 179 ? 46.428  -56.507 -41.561 1.00 19.67  ? 156  GLU B N     1 
ATOM   6114 C  CA    . GLU F 3 179 ? 45.129  -56.797 -40.967 1.00 16.81  ? 156  GLU B CA    1 
ATOM   6115 C  C     . GLU F 3 179 ? 44.763  -55.791 -39.881 1.00 14.13  ? 156  GLU B C     1 
ATOM   6116 O  O     . GLU F 3 179 ? 45.634  -55.170 -39.271 1.00 12.00  ? 156  GLU B O     1 
ATOM   6117 C  CB    . GLU F 3 179 ? 45.121  -58.205 -40.370 1.00 18.49  ? 156  GLU B CB    1 
ATOM   6118 C  CG    . GLU F 3 179 ? 45.423  -59.325 -41.355 1.00 22.27  ? 156  GLU B CG    1 
ATOM   6119 C  CD    . GLU F 3 179 ? 45.371  -60.701 -40.705 1.00 24.82  ? 156  GLU B CD    1 
ATOM   6120 O  OE1   . GLU F 3 179 ? 45.710  -61.696 -41.378 1.00 28.07  ? 156  GLU B OE1   1 
ATOM   6121 O  OE2   . GLU F 3 179 ? 44.987  -60.790 -39.521 1.00 25.76  ? 156  GLU B OE2   1 
ATOM   6122 N  N     . VAL F 3 180 ? 43.463  -55.630 -39.660 1.00 11.87  ? 157  VAL B N     1 
ATOM   6123 C  CA    . VAL F 3 180 ? 42.950  -54.728 -38.639 1.00 11.11  ? 157  VAL B CA    1 
ATOM   6124 C  C     . VAL F 3 180 ? 41.553  -55.180 -38.269 1.00 11.81  ? 157  VAL B C     1 
ATOM   6125 O  O     . VAL F 3 180 ? 40.864  -55.811 -39.072 1.00 12.45  ? 157  VAL B O     1 
ATOM   6126 C  CB    . VAL F 3 180 ? 42.836  -53.266 -39.133 1.00 9.30   ? 157  VAL B CB    1 
ATOM   6127 C  CG1   . VAL F 3 180 ? 44.161  -52.780 -39.657 1.00 10.40  ? 157  VAL B CG1   1 
ATOM   6128 C  CG2   . VAL F 3 180 ? 41.764  -53.158 -40.192 1.00 6.36   ? 157  VAL B CG2   1 
ATOM   6129 N  N     . PHE F 3 181 ? 41.144  -54.864 -37.047 1.00 10.90  ? 158  PHE B N     1 
ATOM   6130 C  CA    . PHE F 3 181 ? 39.812  -55.200 -36.578 1.00 11.06  ? 158  PHE B CA    1 
ATOM   6131 C  C     . PHE F 3 181 ? 39.085  -53.885 -36.377 1.00 13.88  ? 158  PHE B C     1 
ATOM   6132 O  O     . PHE F 3 181 ? 39.691  -52.890 -35.988 1.00 14.37  ? 158  PHE B O     1 
ATOM   6133 C  CB    . PHE F 3 181 ? 39.860  -55.944 -35.249 1.00 9.45   ? 158  PHE B CB    1 
ATOM   6134 C  CG    . PHE F 3 181 ? 40.231  -57.393 -35.367 1.00 9.08   ? 158  PHE B CG    1 
ATOM   6135 C  CD1   . PHE F 3 181 ? 41.521  -57.821 -35.081 1.00 7.68   ? 158  PHE B CD1   1 
ATOM   6136 C  CD2   . PHE F 3 181 ? 39.278  -58.337 -35.729 1.00 7.27   ? 158  PHE B CD2   1 
ATOM   6137 C  CE1   . PHE F 3 181 ? 41.851  -59.166 -35.150 1.00 4.41   ? 158  PHE B CE1   1 
ATOM   6138 C  CE2   . PHE F 3 181 ? 39.603  -59.683 -35.800 1.00 4.79   ? 158  PHE B CE2   1 
ATOM   6139 C  CZ    . PHE F 3 181 ? 40.889  -60.096 -35.510 1.00 3.47   ? 158  PHE B CZ    1 
ATOM   6140 N  N     . LEU F 3 182 ? 37.786  -53.879 -36.641 1.00 16.64  ? 159  LEU B N     1 
ATOM   6141 C  CA    . LEU F 3 182 ? 36.993  -52.672 -36.483 1.00 18.32  ? 159  LEU B CA    1 
ATOM   6142 C  C     . LEU F 3 182 ? 35.777  -52.938 -35.615 1.00 21.69  ? 159  LEU B C     1 
ATOM   6143 O  O     . LEU F 3 182 ? 35.008  -53.863 -35.883 1.00 24.19  ? 159  LEU B O     1 
ATOM   6144 C  CB    . LEU F 3 182 ? 36.525  -52.162 -37.847 1.00 16.83  ? 159  LEU B CB    1 
ATOM   6145 C  CG    . LEU F 3 182 ? 37.574  -51.708 -38.864 1.00 19.63  ? 159  LEU B CG    1 
ATOM   6146 C  CD1   . LEU F 3 182 ? 36.894  -51.272 -40.159 1.00 19.51  ? 159  LEU B CD1   1 
ATOM   6147 C  CD2   . LEU F 3 182 ? 38.374  -50.564 -38.283 1.00 21.18  ? 159  LEU B CD2   1 
ATOM   6148 N  N     . ASP F 3 183 ? 35.615  -52.144 -34.560 1.00 23.54  ? 160  ASP B N     1 
ATOM   6149 C  CA    . ASP F 3 183 ? 34.450  -52.280 -33.697 1.00 24.26  ? 160  ASP B CA    1 
ATOM   6150 C  C     . ASP F 3 183 ? 33.479  -51.213 -34.183 1.00 24.16  ? 160  ASP B C     1 
ATOM   6151 O  O     . ASP F 3 183 ? 33.636  -50.034 -33.873 1.00 23.99  ? 160  ASP B O     1 
ATOM   6152 C  CB    . ASP F 3 183 ? 34.807  -52.021 -32.236 1.00 25.63  ? 160  ASP B CB    1 
ATOM   6153 C  CG    . ASP F 3 183 ? 33.590  -52.062 -31.333 1.00 28.38  ? 160  ASP B CG    1 
ATOM   6154 O  OD1   . ASP F 3 183 ? 32.962  -53.134 -31.239 1.00 33.19  ? 160  ASP B OD1   1 
ATOM   6155 O  OD2   . ASP F 3 183 ? 33.249  -51.027 -30.725 1.00 28.67  ? 160  ASP B OD2   1 
ATOM   6156 N  N     . LEU F 3 184 ? 32.486  -51.628 -34.960 1.00 23.81  ? 161  LEU B N     1 
ATOM   6157 C  CA    . LEU F 3 184 ? 31.511  -50.695 -35.508 1.00 25.36  ? 161  LEU B CA    1 
ATOM   6158 C  C     . LEU F 3 184 ? 30.364  -50.351 -34.551 1.00 26.57  ? 161  LEU B C     1 
ATOM   6159 O  O     . LEU F 3 184 ? 29.381  -49.716 -34.946 1.00 24.89  ? 161  LEU B O     1 
ATOM   6160 C  CB    . LEU F 3 184 ? 30.960  -51.255 -36.824 1.00 25.04  ? 161  LEU B CB    1 
ATOM   6161 C  CG    . LEU F 3 184 ? 31.826  -51.094 -38.082 1.00 23.53  ? 161  LEU B CG    1 
ATOM   6162 C  CD1   . LEU F 3 184 ? 33.229  -51.591 -37.836 1.00 22.15  ? 161  LEU B CD1   1 
ATOM   6163 C  CD2   . LEU F 3 184 ? 31.186  -51.853 -39.233 1.00 24.73  ? 161  LEU B CD2   1 
ATOM   6164 N  N     . GLY F 3 185 ? 30.513  -50.759 -33.292 1.00 27.59  ? 162  GLY B N     1 
ATOM   6165 C  CA    . GLY F 3 185 ? 29.503  -50.496 -32.282 1.00 27.36  ? 162  GLY B CA    1 
ATOM   6166 C  C     . GLY F 3 185 ? 28.841  -49.128 -32.342 1.00 27.29  ? 162  GLY B C     1 
ATOM   6167 O  O     . GLY F 3 185 ? 27.646  -49.039 -32.611 1.00 28.11  ? 162  GLY B O     1 
ATOM   6168 N  N     . ARG F 3 186 ? 29.602  -48.064 -32.097 1.00 27.58  ? 163  ARG B N     1 
ATOM   6169 C  CA    . ARG F 3 186 ? 29.048  -46.707 -32.116 1.00 27.99  ? 163  ARG B CA    1 
ATOM   6170 C  C     . ARG F 3 186 ? 28.353  -46.321 -33.413 1.00 27.87  ? 163  ARG B C     1 
ATOM   6171 O  O     . ARG F 3 186 ? 27.212  -45.868 -33.394 1.00 29.42  ? 163  ARG B O     1 
ATOM   6172 C  CB    . ARG F 3 186 ? 30.132  -45.667 -31.805 1.00 28.69  ? 163  ARG B CB    1 
ATOM   6173 C  CG    . ARG F 3 186 ? 30.368  -45.428 -30.315 1.00 30.86  ? 163  ARG B CG    1 
ATOM   6174 C  CD    . ARG F 3 186 ? 30.937  -46.661 -29.630 1.00 33.06  ? 163  ARG B CD    1 
ATOM   6175 N  NE    . ARG F 3 186 ? 32.306  -46.935 -30.054 1.00 34.38  ? 163  ARG B NE    1 
ATOM   6176 C  CZ    . ARG F 3 186 ? 32.958  -48.063 -29.792 1.00 36.44  ? 163  ARG B CZ    1 
ATOM   6177 N  NH1   . ARG F 3 186 ? 34.204  -48.222 -30.217 1.00 37.09  ? 163  ARG B NH1   1 
ATOM   6178 N  NH2   . ARG F 3 186 ? 32.360  -49.035 -29.114 1.00 38.24  ? 163  ARG B NH2   1 
ATOM   6179 N  N     . ILE F 3 187 ? 29.037  -46.493 -34.538 1.00 27.46  ? 164  ILE B N     1 
ATOM   6180 C  CA    . ILE F 3 187 ? 28.457  -46.145 -35.827 1.00 26.21  ? 164  ILE B CA    1 
ATOM   6181 C  C     . ILE F 3 187 ? 27.087  -46.784 -36.001 1.00 27.06  ? 164  ILE B C     1 
ATOM   6182 O  O     . ILE F 3 187 ? 26.094  -46.091 -36.234 1.00 28.09  ? 164  ILE B O     1 
ATOM   6183 C  CB    . ILE F 3 187 ? 29.368  -46.585 -36.975 1.00 26.43  ? 164  ILE B CB    1 
ATOM   6184 C  CG1   . ILE F 3 187 ? 30.731  -45.907 -36.827 1.00 28.08  ? 164  ILE B CG1   1 
ATOM   6185 C  CG2   . ILE F 3 187 ? 28.734  -46.224 -38.308 1.00 26.47  ? 164  ILE B CG2   1 
ATOM   6186 C  CD1   . ILE F 3 187 ? 31.748  -46.319 -37.869 1.00 30.63  ? 164  ILE B CD1   1 
ATOM   6187 N  N     . CYS F 3 188 ? 27.031  -48.106 -35.880 1.00 26.42  ? 165  CYS B N     1 
ATOM   6188 C  CA    . CYS F 3 188 ? 25.770  -48.823 -36.025 1.00 25.71  ? 165  CYS B CA    1 
ATOM   6189 C  C     . CYS F 3 188 ? 24.694  -48.225 -35.130 1.00 24.99  ? 165  CYS B C     1 
ATOM   6190 O  O     . CYS F 3 188 ? 23.624  -47.836 -35.600 1.00 25.05  ? 165  CYS B O     1 
ATOM   6191 C  CB    . CYS F 3 188 ? 25.957  -50.297 -35.674 1.00 26.74  ? 165  CYS B CB    1 
ATOM   6192 S  SG    . CYS F 3 188 ? 27.133  -51.152 -36.738 1.00 31.24  ? 165  CYS B SG    1 
ATOM   6193 N  N     . PHE F 3 189 ? 24.993  -48.153 -33.836 1.00 24.38  ? 166  PHE B N     1 
ATOM   6194 C  CA    . PHE F 3 189 ? 24.063  -47.613 -32.852 1.00 23.58  ? 166  PHE B CA    1 
ATOM   6195 C  C     . PHE F 3 189 ? 23.549  -46.234 -33.232 1.00 22.65  ? 166  PHE B C     1 
ATOM   6196 O  O     . PHE F 3 189 ? 22.341  -46.014 -33.303 1.00 22.00  ? 166  PHE B O     1 
ATOM   6197 C  CB    . PHE F 3 189 ? 24.730  -47.527 -31.481 1.00 24.48  ? 166  PHE B CB    1 
ATOM   6198 C  CG    . PHE F 3 189 ? 23.807  -47.056 -30.396 1.00 27.35  ? 166  PHE B CG    1 
ATOM   6199 C  CD1   . PHE F 3 189 ? 22.838  -47.907 -29.874 1.00 28.45  ? 166  PHE B CD1   1 
ATOM   6200 C  CD2   . PHE F 3 189 ? 23.883  -45.750 -29.916 1.00 27.32  ? 166  PHE B CD2   1 
ATOM   6201 C  CE1   . PHE F 3 189 ? 21.956  -47.462 -28.892 1.00 28.75  ? 166  PHE B CE1   1 
ATOM   6202 C  CE2   . PHE F 3 189 ? 23.005  -45.297 -28.936 1.00 26.10  ? 166  PHE B CE2   1 
ATOM   6203 C  CZ    . PHE F 3 189 ? 22.042  -46.153 -28.423 1.00 27.14  ? 166  PHE B CZ    1 
ATOM   6204 N  N     . ASN F 3 190 ? 24.467  -45.302 -33.463 1.00 22.03  ? 167  ASN B N     1 
ATOM   6205 C  CA    . ASN F 3 190 ? 24.085  -43.946 -33.825 1.00 23.16  ? 167  ASN B CA    1 
ATOM   6206 C  C     . ASN F 3 190 ? 23.257  -43.956 -35.097 1.00 23.52  ? 167  ASN B C     1 
ATOM   6207 O  O     . ASN F 3 190 ? 22.249  -43.257 -35.198 1.00 22.69  ? 167  ASN B O     1 
ATOM   6208 C  CB    . ASN F 3 190 ? 25.324  -43.065 -34.000 1.00 23.31  ? 167  ASN B CB    1 
ATOM   6209 C  CG    . ASN F 3 190 ? 26.089  -42.872 -32.700 1.00 24.85  ? 167  ASN B CG    1 
ATOM   6210 O  OD1   . ASN F 3 190 ? 25.508  -42.529 -31.667 1.00 23.97  ? 167  ASN B OD1   1 
ATOM   6211 N  ND2   . ASN F 3 190 ? 27.400  -43.087 -32.747 1.00 26.38  ? 167  ASN B ND2   1 
ATOM   6212 N  N     . MET F 3 191 ? 23.682  -44.745 -36.074 1.00 24.39  ? 168  MET B N     1 
ATOM   6213 C  CA    . MET F 3 191 ? 22.926  -44.836 -37.309 1.00 26.06  ? 168  MET B CA    1 
ATOM   6214 C  C     . MET F 3 191 ? 21.518  -45.249 -36.934 1.00 27.21  ? 168  MET B C     1 
ATOM   6215 O  O     . MET F 3 191 ? 20.546  -44.598 -37.301 1.00 29.68  ? 168  MET B O     1 
ATOM   6216 C  CB    . MET F 3 191 ? 23.512  -45.897 -38.229 1.00 26.76  ? 168  MET B CB    1 
ATOM   6217 C  CG    . MET F 3 191 ? 24.527  -45.387 -39.213 1.00 29.60  ? 168  MET B CG    1 
ATOM   6218 S  SD    . MET F 3 191 ? 24.713  -46.581 -40.542 1.00 35.08  ? 168  MET B SD    1 
ATOM   6219 C  CE    . MET F 3 191 ? 23.296  -46.171 -41.568 1.00 28.71  ? 168  MET B CE    1 
ATOM   6220 N  N     . LEU F 3 192 ? 21.427  -46.339 -36.185 1.00 26.95  ? 169  LEU B N     1 
ATOM   6221 C  CA    . LEU F 3 192 ? 20.152  -46.880 -35.754 1.00 27.29  ? 169  LEU B CA    1 
ATOM   6222 C  C     . LEU F 3 192 ? 19.242  -45.890 -35.033 1.00 27.69  ? 169  LEU B C     1 
ATOM   6223 O  O     . LEU F 3 192 ? 18.038  -45.876 -35.263 1.00 29.41  ? 169  LEU B O     1 
ATOM   6224 C  CB    . LEU F 3 192 ? 20.386  -48.086 -34.846 1.00 28.30  ? 169  LEU B CB    1 
ATOM   6225 C  CG    . LEU F 3 192 ? 19.119  -48.786 -34.356 1.00 28.00  ? 169  LEU B CG    1 
ATOM   6226 C  CD1   . LEU F 3 192 ? 18.490  -49.534 -35.516 1.00 29.67  ? 169  LEU B CD1   1 
ATOM   6227 C  CD2   . LEU F 3 192 ? 19.453  -49.747 -33.235 1.00 28.32  ? 169  LEU B CD2   1 
ATOM   6228 N  N     . MET F 3 193 ? 19.806  -45.057 -34.168 1.00 27.74  ? 170  MET B N     1 
ATOM   6229 C  CA    . MET F 3 193 ? 18.987  -44.116 -33.409 1.00 28.82  ? 170  MET B CA    1 
ATOM   6230 C  C     . MET F 3 193 ? 18.813  -42.707 -33.976 1.00 30.11  ? 170  MET B C     1 
ATOM   6231 O  O     . MET F 3 193 ? 17.686  -42.251 -34.157 1.00 30.45  ? 170  MET B O     1 
ATOM   6232 C  CB    . MET F 3 193 ? 19.521  -44.001 -31.977 1.00 28.62  ? 170  MET B CB    1 
ATOM   6233 C  CG    . MET F 3 193 ? 19.542  -45.302 -31.187 1.00 28.89  ? 170  MET B CG    1 
ATOM   6234 S  SD    . MET F 3 193 ? 17.917  -45.872 -30.656 1.00 27.40  ? 170  MET B SD    1 
ATOM   6235 C  CE    . MET F 3 193 ? 17.426  -46.822 -32.066 1.00 30.00  ? 170  MET B CE    1 
ATOM   6236 N  N     . PHE F 3 194 ? 19.919  -42.020 -34.259 1.00 31.71  ? 171  PHE B N     1 
ATOM   6237 C  CA    . PHE F 3 194 ? 19.851  -40.640 -34.739 1.00 32.31  ? 171  PHE B CA    1 
ATOM   6238 C  C     . PHE F 3 194 ? 20.062  -40.346 -36.220 1.00 33.19  ? 171  PHE B C     1 
ATOM   6239 O  O     . PHE F 3 194 ? 20.029  -39.184 -36.618 1.00 32.72  ? 171  PHE B O     1 
ATOM   6240 C  CB    . PHE F 3 194 ? 20.823  -39.775 -33.930 1.00 31.98  ? 171  PHE B CB    1 
ATOM   6241 C  CG    . PHE F 3 194 ? 20.685  -39.941 -32.448 1.00 31.32  ? 171  PHE B CG    1 
ATOM   6242 C  CD1   . PHE F 3 194 ? 21.228  -41.050 -31.809 1.00 30.64  ? 171  PHE B CD1   1 
ATOM   6243 C  CD2   . PHE F 3 194 ? 19.974  -39.013 -31.697 1.00 31.47  ? 171  PHE B CD2   1 
ATOM   6244 C  CE1   . PHE F 3 194 ? 21.062  -41.234 -30.443 1.00 31.98  ? 171  PHE B CE1   1 
ATOM   6245 C  CE2   . PHE F 3 194 ? 19.801  -39.187 -30.330 1.00 32.13  ? 171  PHE B CE2   1 
ATOM   6246 C  CZ    . PHE F 3 194 ? 20.345  -40.301 -29.701 1.00 32.89  ? 171  PHE B CZ    1 
ATOM   6247 N  N     . ASP F 3 195 ? 20.281  -41.363 -37.042 1.00 35.17  ? 172  ASP B N     1 
ATOM   6248 C  CA    . ASP F 3 195 ? 20.484  -41.105 -38.463 1.00 37.71  ? 172  ASP B CA    1 
ATOM   6249 C  C     . ASP F 3 195 ? 19.162  -40.680 -39.091 1.00 39.26  ? 172  ASP B C     1 
ATOM   6250 O  O     . ASP F 3 195 ? 18.135  -41.323 -38.880 1.00 39.56  ? 172  ASP B O     1 
ATOM   6251 C  CB    . ASP F 3 195 ? 21.024  -42.351 -39.173 1.00 37.82  ? 172  ASP B CB    1 
ATOM   6252 C  CG    . ASP F 3 195 ? 21.432  -42.072 -40.612 1.00 37.66  ? 172  ASP B CG    1 
ATOM   6253 O  OD1   . ASP F 3 195 ? 20.564  -41.668 -41.415 1.00 37.38  ? 172  ASP B OD1   1 
ATOM   6254 O  OD2   . ASP F 3 195 ? 22.623  -42.255 -40.941 1.00 37.16  ? 172  ASP B OD2   1 
ATOM   6255 N  N     . ASN F 3 196 ? 19.187  -39.595 -39.857 1.00 41.26  ? 173  ASN B N     1 
ATOM   6256 C  CA    . ASN F 3 196 ? 17.975  -39.107 -40.501 1.00 44.10  ? 173  ASN B CA    1 
ATOM   6257 C  C     . ASN F 3 196 ? 18.142  -38.869 -41.996 1.00 45.90  ? 173  ASN B C     1 
ATOM   6258 O  O     . ASN F 3 196 ? 17.367  -38.130 -42.601 1.00 45.49  ? 173  ASN B O     1 
ATOM   6259 C  CB    . ASN F 3 196 ? 17.498  -37.822 -39.824 1.00 44.34  ? 173  ASN B CB    1 
ATOM   6260 C  CG    . ASN F 3 196 ? 16.972  -38.066 -38.425 1.00 45.76  ? 173  ASN B CG    1 
ATOM   6261 O  OD1   . ASN F 3 196 ? 16.108  -38.921 -38.215 1.00 47.07  ? 173  ASN B OD1   1 
ATOM   6262 N  ND2   . ASN F 3 196 ? 17.484  -37.312 -37.457 1.00 46.57  ? 173  ASN B ND2   1 
ATOM   6263 N  N     . GLU F 3 197 ? 19.147  -39.506 -42.589 1.00 48.15  ? 174  GLU B N     1 
ATOM   6264 C  CA    . GLU F 3 197 ? 19.402  -39.361 -44.016 1.00 49.90  ? 174  GLU B CA    1 
ATOM   6265 C  C     . GLU F 3 197 ? 19.269  -40.697 -44.750 1.00 50.46  ? 174  GLU B C     1 
ATOM   6266 O  O     . GLU F 3 197 ? 18.646  -40.770 -45.808 1.00 51.21  ? 174  GLU B O     1 
ATOM   6267 C  CB    . GLU F 3 197 ? 20.804  -38.787 -44.245 1.00 51.88  ? 174  GLU B CB    1 
ATOM   6268 C  CG    . GLU F 3 197 ? 21.058  -37.434 -43.583 1.00 56.64  ? 174  GLU B CG    1 
ATOM   6269 C  CD    . GLU F 3 197 ? 20.228  -36.305 -44.176 1.00 58.78  ? 174  GLU B CD    1 
ATOM   6270 O  OE1   . GLU F 3 197 ? 18.990  -36.311 -44.008 1.00 60.62  ? 174  GLU B OE1   1 
ATOM   6271 O  OE2   . GLU F 3 197 ? 20.818  -35.408 -44.814 0.00 59.11  ? 174  GLU B OE2   1 
ATOM   6272 N  N     . TYR F 3 198 ? 19.846  -41.750 -44.178 1.00 50.53  ? 175  TYR B N     1 
ATOM   6273 C  CA    . TYR F 3 198 ? 19.812  -43.081 -44.783 1.00 50.84  ? 175  TYR B CA    1 
ATOM   6274 C  C     . TYR F 3 198 ? 18.429  -43.469 -45.290 1.00 51.52  ? 175  TYR B C     1 
ATOM   6275 O  O     . TYR F 3 198 ? 17.419  -43.174 -44.652 1.00 51.24  ? 175  TYR B O     1 
ATOM   6276 C  CB    . TYR F 3 198 ? 20.283  -44.133 -43.776 1.00 51.41  ? 175  TYR B CB    1 
ATOM   6277 C  CG    . TYR F 3 198 ? 20.760  -45.423 -44.411 1.00 50.64  ? 175  TYR B CG    1 
ATOM   6278 C  CD1   . TYR F 3 198 ? 22.034  -45.515 -44.971 1.00 49.88  ? 175  TYR B CD1   1 
ATOM   6279 C  CD2   . TYR F 3 198 ? 19.933  -46.544 -44.468 1.00 49.88  ? 175  TYR B CD2   1 
ATOM   6280 C  CE1   . TYR F 3 198 ? 22.474  -46.691 -45.572 1.00 50.31  ? 175  TYR B CE1   1 
ATOM   6281 C  CE2   . TYR F 3 198 ? 20.363  -47.726 -45.070 1.00 50.73  ? 175  TYR B CE2   1 
ATOM   6282 C  CZ    . TYR F 3 198 ? 21.635  -47.792 -45.619 1.00 51.04  ? 175  TYR B CZ    1 
ATOM   6283 O  OH    . TYR F 3 198 ? 22.069  -48.958 -46.213 1.00 52.08  ? 175  TYR B OH    1 
ATOM   6284 N  N     . GLU F 3 199 ? 18.398  -44.145 -46.436 1.00 52.89  ? 176  GLU B N     1 
ATOM   6285 C  CA    . GLU F 3 199 ? 17.150  -44.594 -47.050 1.00 55.00  ? 176  GLU B CA    1 
ATOM   6286 C  C     . GLU F 3 199 ? 17.154  -46.111 -47.221 1.00 55.75  ? 176  GLU B C     1 
ATOM   6287 O  O     . GLU F 3 199 ? 18.206  -46.713 -47.442 1.00 56.57  ? 176  GLU B O     1 
ATOM   6288 C  CB    . GLU F 3 199 ? 16.980  -43.964 -48.430 1.00 56.78  ? 176  GLU B CB    1 
ATOM   6289 C  CG    . GLU F 3 199 ? 17.052  -42.458 -48.473 1.00 59.02  ? 176  GLU B CG    1 
ATOM   6290 C  CD    . GLU F 3 199 ? 17.054  -41.942 -49.898 1.00 60.41  ? 176  GLU B CD    1 
ATOM   6291 O  OE1   . GLU F 3 199 ? 18.024  -42.232 -50.633 1.00 59.76  ? 176  GLU B OE1   1 
ATOM   6292 O  OE2   . GLU F 3 199 ? 16.082  -41.257 -50.284 1.00 61.90  ? 176  GLU B OE2   1 
ATOM   6293 N  N     . LEU F 3 200 ? 15.980  -46.727 -47.131 1.00 56.38  ? 177  LEU B N     1 
ATOM   6294 C  CA    . LEU F 3 200 ? 15.871  -48.172 -47.303 1.00 58.56  ? 177  LEU B CA    1 
ATOM   6295 C  C     . LEU F 3 200 ? 15.439  -48.489 -48.729 1.00 60.32  ? 177  LEU B C     1 
ATOM   6296 O  O     . LEU F 3 200 ? 15.905  -49.459 -49.331 1.00 60.60  ? 177  LEU B O     1 
ATOM   6297 C  CB    . LEU F 3 200 ? 14.860  -48.766 -46.315 1.00 57.40  ? 177  LEU B CB    1 
ATOM   6298 C  CG    . LEU F 3 200 ? 15.335  -49.001 -44.878 1.00 56.09  ? 177  LEU B CG    1 
ATOM   6299 C  CD1   . LEU F 3 200 ? 15.739  -47.688 -44.248 1.00 56.99  ? 177  LEU B CD1   1 
ATOM   6300 C  CD2   . LEU F 3 200 ? 14.227  -49.652 -44.073 1.00 55.74  ? 177  LEU B CD2   1 
ATOM   6301 N  N     . THR F 3 201 ? 14.547  -47.658 -49.260 1.00 62.01  ? 178  THR B N     1 
ATOM   6302 C  CA    . THR F 3 201 ? 14.037  -47.823 -50.616 1.00 63.58  ? 178  THR B CA    1 
ATOM   6303 C  C     . THR F 3 201 ? 13.950  -46.471 -51.328 1.00 64.50  ? 178  THR B C     1 
ATOM   6304 O  O     . THR F 3 201 ? 14.970  -45.882 -51.693 1.00 64.28  ? 178  THR B O     1 
ATOM   6305 C  CB    . THR F 3 201 ? 12.635  -48.476 -50.608 1.00 63.49  ? 178  THR B CB    1 
ATOM   6306 O  OG1   . THR F 3 201 ? 11.762  -47.725 -49.754 1.00 63.22  ? 178  THR B OG1   1 
ATOM   6307 C  CG2   . THR F 3 201 ? 12.715  -49.912 -50.115 1.00 63.39  ? 178  THR B CG2   1 
ATOM   6308 N  N     . GLY F 3 202 ? 12.726  -45.988 -51.519 1.00 64.61  ? 179  GLY B N     1 
ATOM   6309 C  CA    . GLY F 3 202 ? 12.521  -44.714 -52.182 1.00 65.41  ? 179  GLY B CA    1 
ATOM   6310 C  C     . GLY F 3 202 ? 11.329  -43.997 -51.585 1.00 65.81  ? 179  GLY B C     1 
ATOM   6311 O  O     . GLY F 3 202 ? 10.876  -42.971 -52.096 1.00 67.36  ? 179  GLY B O     1 
ATOM   6312 N  N     . ASP F 3 203 ? 10.819  -44.551 -50.492 1.00 64.64  ? 180  ASP B N     1 
ATOM   6313 C  CA    . ASP F 3 203 ? 9.676   -43.982 -49.796 1.00 63.99  ? 180  ASP B CA    1 
ATOM   6314 C  C     . ASP F 3 203 ? 9.742   -44.397 -48.333 1.00 62.70  ? 180  ASP B C     1 
ATOM   6315 O  O     . ASP F 3 203 ? 8.793   -44.204 -47.572 1.00 62.06  ? 180  ASP B O     1 
ATOM   6316 C  CB    . ASP F 3 203 ? 8.374   -44.483 -50.427 1.00 64.87  ? 180  ASP B CB    1 
ATOM   6317 C  CG    . ASP F 3 203 ? 8.209   -44.029 -51.863 0.00 65.15  ? 180  ASP B CG    1 
ATOM   6318 O  OD1   . ASP F 3 203 ? 8.167   -42.803 -52.098 0.00 65.41  ? 180  ASP B OD1   1 
ATOM   6319 O  OD2   . ASP F 3 203 ? 8.124   -44.897 -52.757 0.00 65.41  ? 180  ASP B OD2   1 
ATOM   6320 N  N     . LEU F 3 204 ? 10.879  -44.968 -47.947 1.00 60.90  ? 181  LEU B N     1 
ATOM   6321 C  CA    . LEU F 3 204 ? 11.076  -45.425 -46.580 1.00 58.81  ? 181  LEU B CA    1 
ATOM   6322 C  C     . LEU F 3 204 ? 12.463  -45.079 -46.059 1.00 58.42  ? 181  LEU B C     1 
ATOM   6323 O  O     . LEU F 3 204 ? 13.472  -45.544 -46.590 1.00 58.26  ? 181  LEU B O     1 
ATOM   6324 C  CB    . LEU F 3 204 ? 10.862  -46.938 -46.501 1.00 56.92  ? 181  LEU B CB    1 
ATOM   6325 C  CG    . LEU F 3 204 ? 11.016  -47.594 -45.128 1.00 56.06  ? 181  LEU B CG    1 
ATOM   6326 C  CD1   . LEU F 3 204 ? 10.053  -46.959 -44.137 1.00 55.75  ? 181  LEU B CD1   1 
ATOM   6327 C  CD2   . LEU F 3 204 ? 10.750  -49.085 -45.247 1.00 55.73  ? 181  LEU B CD2   1 
ATOM   6328 N  N     . LYS F 3 205 ? 12.499  -44.253 -45.018 1.00 57.56  ? 182  LYS B N     1 
ATOM   6329 C  CA    . LYS F 3 205 ? 13.751  -43.844 -44.397 1.00 56.81  ? 182  LYS B CA    1 
ATOM   6330 C  C     . LYS F 3 205 ? 13.869  -44.533 -43.040 1.00 56.61  ? 182  LYS B C     1 
ATOM   6331 O  O     . LYS F 3 205 ? 12.875  -45.016 -42.495 1.00 56.75  ? 182  LYS B O     1 
ATOM   6332 C  CB    . LYS F 3 205 ? 13.789  -42.322 -44.210 1.00 56.77  ? 182  LYS B CB    1 
ATOM   6333 C  CG    . LYS F 3 205 ? 13.838  -41.517 -45.500 0.00 57.12  ? 182  LYS B CG    1 
ATOM   6334 C  CD    . LYS F 3 205 ? 12.531  -41.598 -46.268 0.00 57.21  ? 182  LYS B CD    1 
ATOM   6335 C  CE    . LYS F 3 205 ? 12.579  -40.741 -47.521 0.00 57.24  ? 182  LYS B CE    1 
ATOM   6336 N  NZ    . LYS F 3 205 ? 11.289  -40.772 -48.263 0.00 57.20  ? 182  LYS B NZ    1 
ATOM   6337 N  N     . LEU F 3 206 ? 15.083  -44.582 -42.499 1.00 55.49  ? 183  LEU B N     1 
ATOM   6338 C  CA    . LEU F 3 206 ? 15.312  -45.213 -41.206 1.00 53.76  ? 183  LEU B CA    1 
ATOM   6339 C  C     . LEU F 3 206 ? 14.454  -44.599 -40.117 1.00 53.36  ? 183  LEU B C     1 
ATOM   6340 O  O     . LEU F 3 206 ? 13.777  -45.306 -39.377 1.00 52.92  ? 183  LEU B O     1 
ATOM   6341 C  CB    . LEU F 3 206 ? 16.780  -45.094 -40.805 1.00 53.90  ? 183  LEU B CB    1 
ATOM   6342 C  CG    . LEU F 3 206 ? 17.730  -46.182 -41.297 1.00 54.22  ? 183  LEU B CG    1 
ATOM   6343 C  CD1   . LEU F 3 206 ? 19.140  -45.874 -40.821 1.00 53.94  ? 183  LEU B CD1   1 
ATOM   6344 C  CD2   . LEU F 3 206 ? 17.275  -47.533 -40.765 1.00 53.99  ? 183  LEU B CD2   1 
ATOM   6345 N  N     . LYS F 3 207 ? 14.488  -43.276 -40.021 1.00 54.43  ? 184  LYS B N     1 
ATOM   6346 C  CA    . LYS F 3 207 ? 13.720  -42.569 -39.008 1.00 56.35  ? 184  LYS B CA    1 
ATOM   6347 C  C     . LYS F 3 207 ? 12.241  -42.929 -39.071 1.00 56.10  ? 184  LYS B C     1 
ATOM   6348 O  O     . LYS F 3 207 ? 11.523  -42.798 -38.080 1.00 57.37  ? 184  LYS B O     1 
ATOM   6349 C  CB    . LYS F 3 207 ? 13.899  -41.055 -39.167 1.00 57.93  ? 184  LYS B CB    1 
ATOM   6350 C  CG    . LYS F 3 207 ? 13.432  -40.503 -40.503 1.00 60.76  ? 184  LYS B CG    1 
ATOM   6351 C  CD    . LYS F 3 207 ? 13.746  -39.019 -40.618 1.00 62.75  ? 184  LYS B CD    1 
ATOM   6352 C  CE    . LYS F 3 207 ? 13.324  -38.463 -41.970 1.00 64.34  ? 184  LYS B CE    1 
ATOM   6353 N  NZ    . LYS F 3 207 ? 13.753  -37.046 -42.148 1.00 64.46  ? 184  LYS B NZ    1 
ATOM   6354 N  N     . ASP F 3 208 ? 11.791  -43.388 -40.234 1.00 54.87  ? 185  ASP B N     1 
ATOM   6355 C  CA    . ASP F 3 208 ? 10.393  -43.765 -40.415 1.00 53.49  ? 185  ASP B CA    1 
ATOM   6356 C  C     . ASP F 3 208 ? 10.173  -45.228 -40.046 1.00 51.54  ? 185  ASP B C     1 
ATOM   6357 O  O     . ASP F 3 208 ? 9.196   -45.577 -39.387 1.00 51.48  ? 185  ASP B O     1 
ATOM   6358 C  CB    . ASP F 3 208 ? 9.962   -43.536 -41.870 1.00 55.50  ? 185  ASP B CB    1 
ATOM   6359 C  CG    . ASP F 3 208 ? 10.068  -42.077 -42.292 1.00 57.66  ? 185  ASP B CG    1 
ATOM   6360 O  OD1   . ASP F 3 208 ? 9.437   -41.216 -41.640 1.00 58.98  ? 185  ASP B OD1   1 
ATOM   6361 O  OD2   . ASP F 3 208 ? 10.779  -41.791 -43.280 1.00 59.06  ? 185  ASP B OD2   1 
ATOM   6362 N  N     . ALA F 3 209 ? 11.095  -46.079 -40.476 1.00 49.29  ? 186  ALA B N     1 
ATOM   6363 C  CA    . ALA F 3 209 ? 11.002  -47.502 -40.206 1.00 46.21  ? 186  ALA B CA    1 
ATOM   6364 C  C     . ALA F 3 209 ? 11.297  -47.827 -38.748 1.00 45.24  ? 186  ALA B C     1 
ATOM   6365 O  O     . ALA F 3 209 ? 10.850  -48.850 -38.239 1.00 45.86  ? 186  ALA B O     1 
ATOM   6366 C  CB    . ALA F 3 209 ? 11.960  -48.257 -41.112 1.00 46.24  ? 186  ALA B CB    1 
ATOM   6367 N  N     . LEU F 3 210 ? 12.038  -46.952 -38.075 1.00 44.17  ? 187  LEU B N     1 
ATOM   6368 C  CA    . LEU F 3 210 ? 12.399  -47.176 -36.678 1.00 43.06  ? 187  LEU B CA    1 
ATOM   6369 C  C     . LEU F 3 210 ? 11.864  -46.108 -35.725 1.00 44.29  ? 187  LEU B C     1 
ATOM   6370 O  O     . LEU F 3 210 ? 12.615  -45.559 -34.920 1.00 45.52  ? 187  LEU B O     1 
ATOM   6371 C  CB    . LEU F 3 210 ? 13.920  -47.245 -36.545 1.00 39.63  ? 187  LEU B CB    1 
ATOM   6372 C  CG    . LEU F 3 210 ? 14.642  -48.237 -37.455 1.00 37.96  ? 187  LEU B CG    1 
ATOM   6373 C  CD1   . LEU F 3 210 ? 16.139  -48.087 -37.273 1.00 36.94  ? 187  LEU B CD1   1 
ATOM   6374 C  CD2   . LEU F 3 210 ? 14.201  -49.650 -37.137 1.00 36.65  ? 187  LEU B CD2   1 
ATOM   6375 N  N     . SER F 3 211 ? 10.569  -45.822 -35.807 1.00 44.54  ? 188  SER B N     1 
ATOM   6376 C  CA    . SER F 3 211 ? 9.957   -44.817 -34.941 1.00 44.42  ? 188  SER B CA    1 
ATOM   6377 C  C     . SER F 3 211 ? 9.881   -45.299 -33.496 1.00 44.40  ? 188  SER B C     1 
ATOM   6378 O  O     . SER F 3 211 ? 10.428  -44.675 -32.589 1.00 44.07  ? 188  SER B O     1 
ATOM   6379 C  CB    . SER F 3 211 ? 8.547   -44.490 -35.430 1.00 44.91  ? 188  SER B CB    1 
ATOM   6380 O  OG    . SER F 3 211 ? 8.554   -44.107 -36.793 1.00 46.94  ? 188  SER B OG    1 
ATOM   6381 N  N     . ASN F 3 212 ? 9.193   -46.419 -33.300 1.00 44.39  ? 189  ASN B N     1 
ATOM   6382 C  CA    . ASN F 3 212 ? 9.006   -47.014 -31.982 1.00 43.73  ? 189  ASN B CA    1 
ATOM   6383 C  C     . ASN F 3 212 ? 10.291  -47.188 -31.177 1.00 42.07  ? 189  ASN B C     1 
ATOM   6384 O  O     . ASN F 3 212 ? 10.396  -46.687 -30.058 1.00 42.61  ? 189  ASN B O     1 
ATOM   6385 C  CB    . ASN F 3 212 ? 8.304   -48.363 -32.133 1.00 46.03  ? 189  ASN B CB    1 
ATOM   6386 C  CG    . ASN F 3 212 ? 6.945   -48.238 -32.801 1.00 50.04  ? 189  ASN B CG    1 
ATOM   6387 O  OD1   . ASN F 3 212 ? 6.804   -47.573 -33.833 1.00 51.00  ? 189  ASN B OD1   1 
ATOM   6388 N  ND2   . ASN F 3 212 ? 5.937   -48.881 -32.217 1.00 51.56  ? 189  ASN B ND2   1 
ATOM   6389 N  N     . ILE F 3 213 ? 11.265  -47.898 -31.738 1.00 39.73  ? 190  ILE B N     1 
ATOM   6390 C  CA    . ILE F 3 213 ? 12.525  -48.125 -31.041 1.00 37.08  ? 190  ILE B CA    1 
ATOM   6391 C  C     . ILE F 3 213 ? 13.149  -46.799 -30.605 1.00 37.29  ? 190  ILE B C     1 
ATOM   6392 O  O     . ILE F 3 213 ? 13.540  -46.641 -29.450 1.00 36.80  ? 190  ILE B O     1 
ATOM   6393 C  CB    . ILE F 3 213 ? 13.526  -48.905 -31.931 1.00 34.95  ? 190  ILE B CB    1 
ATOM   6394 C  CG1   . ILE F 3 213 ? 14.820  -49.172 -31.161 1.00 32.30  ? 190  ILE B CG1   1 
ATOM   6395 C  CG2   . ILE F 3 213 ? 13.813  -48.128 -33.199 1.00 34.41  ? 190  ILE B CG2   1 
ATOM   6396 C  CD1   . ILE F 3 213 ? 14.637  -50.025 -29.930 1.00 30.15  ? 190  ILE B CD1   1 
ATOM   6397 N  N     . ARG F 3 214 ? 13.222  -45.844 -31.529 1.00 37.18  ? 191  ARG B N     1 
ATOM   6398 C  CA    . ARG F 3 214 ? 13.794  -44.531 -31.240 1.00 36.71  ? 191  ARG B CA    1 
ATOM   6399 C  C     . ARG F 3 214 ? 12.946  -43.747 -30.249 1.00 36.06  ? 191  ARG B C     1 
ATOM   6400 O  O     . ARG F 3 214 ? 13.444  -43.268 -29.231 1.00 35.81  ? 191  ARG B O     1 
ATOM   6401 C  CB    . ARG F 3 214 ? 13.925  -43.716 -32.525 1.00 36.55  ? 191  ARG B CB    1 
ATOM   6402 C  CG    . ARG F 3 214 ? 14.898  -44.283 -33.525 1.00 36.15  ? 191  ARG B CG    1 
ATOM   6403 C  CD    . ARG F 3 214 ? 14.983  -43.396 -34.746 1.00 35.36  ? 191  ARG B CD    1 
ATOM   6404 N  NE    . ARG F 3 214 ? 16.005  -43.864 -35.673 1.00 35.96  ? 191  ARG B NE    1 
ATOM   6405 C  CZ    . ARG F 3 214 ? 16.442  -43.167 -36.715 1.00 37.18  ? 191  ARG B CZ    1 
ATOM   6406 N  NH1   . ARG F 3 214 ? 15.945  -41.961 -36.969 1.00 37.90  ? 191  ARG B NH1   1 
ATOM   6407 N  NH2   . ARG F 3 214 ? 17.383  -43.671 -37.500 1.00 36.71  ? 191  ARG B NH2   1 
ATOM   6408 N  N     . GLU F 3 215 ? 11.664  -43.606 -30.568 1.00 36.04  ? 192  GLU B N     1 
ATOM   6409 C  CA    . GLU F 3 215 ? 10.735  -42.884 -29.714 1.00 36.47  ? 192  GLU B CA    1 
ATOM   6410 C  C     . GLU F 3 215 ? 10.886  -43.402 -28.295 1.00 34.22  ? 192  GLU B C     1 
ATOM   6411 O  O     . GLU F 3 215 ? 10.828  -42.643 -27.328 1.00 33.54  ? 192  GLU B O     1 
ATOM   6412 C  CB    . GLU F 3 215 ? 9.304   -43.101 -30.201 1.00 40.43  ? 192  GLU B CB    1 
ATOM   6413 C  CG    . GLU F 3 215 ? 8.290   -42.186 -29.545 1.00 47.93  ? 192  GLU B CG    1 
ATOM   6414 C  CD    . GLU F 3 215 ? 6.944   -42.219 -30.244 1.00 52.04  ? 192  GLU B CD    1 
ATOM   6415 O  OE1   . GLU F 3 215 ? 6.903   -41.947 -31.467 1.00 52.63  ? 192  GLU B OE1   1 
ATOM   6416 O  OE2   . GLU F 3 215 ? 5.930   -42.511 -29.571 1.00 54.44  ? 192  GLU B OE2   1 
ATOM   6417 N  N     . ALA F 3 216 ? 11.091  -44.709 -28.187 1.00 32.16  ? 193  ALA B N     1 
ATOM   6418 C  CA    . ALA F 3 216 ? 11.271  -45.353 -26.900 1.00 28.80  ? 193  ALA B CA    1 
ATOM   6419 C  C     . ALA F 3 216 ? 12.563  -44.857 -26.268 1.00 28.31  ? 193  ALA B C     1 
ATOM   6420 O  O     . ALA F 3 216 ? 12.558  -44.372 -25.142 1.00 29.12  ? 193  ALA B O     1 
ATOM   6421 C  CB    . ALA F 3 216 ? 11.320  -46.858 -27.079 1.00 25.98  ? 193  ALA B CB    1 
ATOM   6422 N  N     . PHE F 3 217 ? 13.664  -44.971 -27.008 1.00 28.07  ? 194  PHE B N     1 
ATOM   6423 C  CA    . PHE F 3 217 ? 14.978  -44.546 -26.527 1.00 26.79  ? 194  PHE B CA    1 
ATOM   6424 C  C     . PHE F 3 217 ? 14.966  -43.156 -25.890 1.00 28.80  ? 194  PHE B C     1 
ATOM   6425 O  O     . PHE F 3 217 ? 15.194  -43.024 -24.686 1.00 30.83  ? 194  PHE B O     1 
ATOM   6426 C  CB    . PHE F 3 217 ? 15.999  -44.583 -27.667 1.00 21.93  ? 194  PHE B CB    1 
ATOM   6427 C  CG    . PHE F 3 217 ? 17.398  -44.254 -27.234 1.00 18.45  ? 194  PHE B CG    1 
ATOM   6428 C  CD1   . PHE F 3 217 ? 17.979  -44.920 -26.158 1.00 17.34  ? 194  PHE B CD1   1 
ATOM   6429 C  CD2   . PHE F 3 217 ? 18.135  -43.278 -27.895 1.00 18.31  ? 194  PHE B CD2   1 
ATOM   6430 C  CE1   . PHE F 3 217 ? 19.276  -44.618 -25.742 1.00 16.23  ? 194  PHE B CE1   1 
ATOM   6431 C  CE2   . PHE F 3 217 ? 19.437  -42.964 -27.490 1.00 18.63  ? 194  PHE B CE2   1 
ATOM   6432 C  CZ    . PHE F 3 217 ? 20.008  -43.637 -26.409 1.00 17.99  ? 194  PHE B CZ    1 
ATOM   6433 N  N     . ILE F 3 218 ? 14.715  -42.121 -26.688 1.00 28.69  ? 195  ILE B N     1 
ATOM   6434 C  CA    . ILE F 3 218 ? 14.670  -40.769 -26.148 1.00 29.47  ? 195  ILE B CA    1 
ATOM   6435 C  C     . ILE F 3 218 ? 13.616  -40.703 -25.048 1.00 32.15  ? 195  ILE B C     1 
ATOM   6436 O  O     . ILE F 3 218 ? 13.764  -39.962 -24.073 1.00 33.39  ? 195  ILE B O     1 
ATOM   6437 C  CB    . ILE F 3 218 ? 14.336  -39.731 -27.242 1.00 26.98  ? 195  ILE B CB    1 
ATOM   6438 C  CG1   . ILE F 3 218 ? 15.617  -39.286 -27.943 1.00 25.81  ? 195  ILE B CG1   1 
ATOM   6439 C  CG2   . ILE F 3 218 ? 13.652  -38.521 -26.633 1.00 27.98  ? 195  ILE B CG2   1 
ATOM   6440 C  CD1   . ILE F 3 218 ? 16.572  -38.519 -27.049 1.00 22.91  ? 195  ILE B CD1   1 
ATOM   6441 N  N     . GLY F 3 219 ? 12.557  -41.492 -25.211 1.00 33.25  ? 196  GLY B N     1 
ATOM   6442 C  CA    . GLY F 3 219 ? 11.491  -41.522 -24.227 1.00 34.25  ? 196  GLY B CA    1 
ATOM   6443 C  C     . GLY F 3 219 ? 12.006  -41.675 -22.811 1.00 34.13  ? 196  GLY B C     1 
ATOM   6444 O  O     . GLY F 3 219 ? 11.502  -41.035 -21.892 1.00 34.53  ? 196  GLY B O     1 
ATOM   6445 N  N     . GLY F 3 220 ? 13.007  -42.532 -22.637 1.00 35.45  ? 197  GLY B N     1 
ATOM   6446 C  CA    . GLY F 3 220 ? 13.588  -42.745 -21.324 1.00 38.62  ? 197  GLY B CA    1 
ATOM   6447 C  C     . GLY F 3 220 ? 12.897  -43.767 -20.438 1.00 40.80  ? 197  GLY B C     1 
ATOM   6448 O  O     . GLY F 3 220 ? 13.491  -44.244 -19.469 1.00 41.00  ? 197  GLY B O     1 
ATOM   6449 N  N     . ASN F 3 221 ? 11.651  -44.108 -20.755 1.00 42.79  ? 198  ASN B N     1 
ATOM   6450 C  CA    . ASN F 3 221 ? 10.908  -45.077 -19.955 1.00 44.47  ? 198  ASN B CA    1 
ATOM   6451 C  C     . ASN F 3 221 ? 11.173  -46.518 -20.368 1.00 44.69  ? 198  ASN B C     1 
ATOM   6452 O  O     . ASN F 3 221 ? 10.509  -47.053 -21.258 1.00 46.72  ? 198  ASN B O     1 
ATOM   6453 C  CB    . ASN F 3 221 ? 9.407   -44.793 -20.032 1.00 46.85  ? 198  ASN B CB    1 
ATOM   6454 C  CG    . ASN F 3 221 ? 9.034   -43.474 -19.390 1.00 51.08  ? 198  ASN B CG    1 
ATOM   6455 O  OD1   . ASN F 3 221 ? 9.402   -42.405 -19.880 1.00 53.08  ? 198  ASN B OD1   1 
ATOM   6456 N  ND2   . ASN F 3 221 ? 8.307   -43.541 -18.277 1.00 53.69  ? 198  ASN B ND2   1 
ATOM   6457 N  N     . TYR F 3 222 ? 12.150  -47.141 -19.718 1.00 42.73  ? 199  TYR B N     1 
ATOM   6458 C  CA    . TYR F 3 222 ? 12.498  -48.524 -20.002 1.00 41.95  ? 199  TYR B CA    1 
ATOM   6459 C  C     . TYR F 3 222 ? 13.520  -49.023 -18.992 1.00 43.24  ? 199  TYR B C     1 
ATOM   6460 O  O     . TYR F 3 222 ? 14.428  -48.291 -18.599 1.00 44.38  ? 199  TYR B O     1 
ATOM   6461 C  CB    . TYR F 3 222 ? 13.039  -48.669 -21.441 1.00 38.54  ? 199  TYR B CB    1 
ATOM   6462 C  CG    . TYR F 3 222 ? 14.328  -47.923 -21.736 1.00 35.79  ? 199  TYR B CG    1 
ATOM   6463 C  CD1   . TYR F 3 222 ? 15.549  -48.368 -21.232 1.00 34.22  ? 199  TYR B CD1   1 
ATOM   6464 C  CD2   . TYR F 3 222 ? 14.323  -46.753 -22.498 1.00 35.07  ? 199  TYR B CD2   1 
ATOM   6465 C  CE1   . TYR F 3 222 ? 16.730  -47.668 -21.470 1.00 31.76  ? 199  TYR B CE1   1 
ATOM   6466 C  CE2   . TYR F 3 222 ? 15.502  -46.042 -22.743 1.00 32.53  ? 199  TYR B CE2   1 
ATOM   6467 C  CZ    . TYR F 3 222 ? 16.700  -46.506 -22.223 1.00 32.05  ? 199  TYR B CZ    1 
ATOM   6468 O  OH    . TYR F 3 222 ? 17.863  -45.797 -22.430 1.00 30.89  ? 199  TYR B OH    1 
ATOM   6469 N  N     . ASP F 3 223 ? 13.349  -50.263 -18.549 1.00 44.67  ? 200  ASP B N     1 
ATOM   6470 C  CA    . ASP F 3 223 ? 14.271  -50.867 -17.598 1.00 45.57  ? 200  ASP B CA    1 
ATOM   6471 C  C     . ASP F 3 223 ? 15.416  -51.379 -18.454 1.00 44.20  ? 200  ASP B C     1 
ATOM   6472 O  O     . ASP F 3 223 ? 15.186  -52.075 -19.441 1.00 43.87  ? 200  ASP B O     1 
ATOM   6473 C  CB    . ASP F 3 223 ? 13.588  -52.029 -16.865 1.00 49.79  ? 200  ASP B CB    1 
ATOM   6474 C  CG    . ASP F 3 223 ? 14.419  -52.571 -15.708 1.00 53.50  ? 200  ASP B CG    1 
ATOM   6475 O  OD1   . ASP F 3 223 ? 14.721  -51.797 -14.771 1.00 56.95  ? 200  ASP B OD1   1 
ATOM   6476 O  OD2   . ASP F 3 223 ? 14.765  -53.772 -15.731 1.00 54.53  ? 200  ASP B OD2   1 
ATOM   6477 N  N     . ILE F 3 224 ? 16.644  -51.026 -18.095 1.00 43.39  ? 201  ILE B N     1 
ATOM   6478 C  CA    . ILE F 3 224 ? 17.795  -51.459 -18.876 1.00 43.25  ? 201  ILE B CA    1 
ATOM   6479 C  C     . ILE F 3 224 ? 17.849  -52.976 -18.978 1.00 43.19  ? 201  ILE B C     1 
ATOM   6480 O  O     . ILE F 3 224 ? 18.606  -53.524 -19.776 1.00 43.52  ? 201  ILE B O     1 
ATOM   6481 C  CB    . ILE F 3 224 ? 19.122  -50.973 -18.258 1.00 43.39  ? 201  ILE B CB    1 
ATOM   6482 C  CG1   . ILE F 3 224 ? 19.400  -51.727 -16.957 1.00 43.45  ? 201  ILE B CG1   1 
ATOM   6483 C  CG2   . ILE F 3 224 ? 19.054  -49.475 -17.994 1.00 43.58  ? 201  ILE B CG2   1 
ATOM   6484 C  CD1   . ILE F 3 224 ? 20.797  -51.511 -16.421 1.00 43.39  ? 201  ILE B CD1   1 
ATOM   6485 N  N     . ASN F 3 225 ? 17.039  -53.652 -18.172 1.00 43.40  ? 202  ASN B N     1 
ATOM   6486 C  CA    . ASN F 3 225 ? 17.021  -55.107 -18.176 1.00 43.82  ? 202  ASN B CA    1 
ATOM   6487 C  C     . ASN F 3 225 ? 15.816  -55.712 -18.896 1.00 43.65  ? 202  ASN B C     1 
ATOM   6488 O  O     . ASN F 3 225 ? 15.622  -56.925 -18.875 1.00 43.29  ? 202  ASN B O     1 
ATOM   6489 C  CB    . ASN F 3 225 ? 17.084  -55.624 -16.740 1.00 44.31  ? 202  ASN B CB    1 
ATOM   6490 C  CG    . ASN F 3 225 ? 18.182  -56.643 -16.543 1.00 46.31  ? 202  ASN B CG    1 
ATOM   6491 O  OD1   . ASN F 3 225 ? 18.158  -57.721 -17.140 1.00 46.81  ? 202  ASN B OD1   1 
ATOM   6492 N  ND2   . ASN F 3 225 ? 19.160  -56.305 -15.709 1.00 47.86  ? 202  ASN B ND2   1 
ATOM   6493 N  N     . SER F 3 226 ? 15.010  -54.866 -19.531 1.00 44.10  ? 203  SER B N     1 
ATOM   6494 C  CA    . SER F 3 226 ? 13.835  -55.329 -20.263 1.00 44.35  ? 203  SER B CA    1 
ATOM   6495 C  C     . SER F 3 226 ? 14.256  -55.749 -21.661 1.00 44.67  ? 203  SER B C     1 
ATOM   6496 O  O     . SER F 3 226 ? 15.310  -55.343 -22.148 1.00 45.66  ? 203  SER B O     1 
ATOM   6497 C  CB    . SER F 3 226 ? 12.798  -54.212 -20.386 1.00 45.57  ? 203  SER B CB    1 
ATOM   6498 O  OG    . SER F 3 226 ? 12.403  -53.726 -19.118 1.00 49.41  ? 203  SER B OG    1 
ATOM   6499 N  N     . HIS F 3 227 ? 13.430  -56.562 -22.308 1.00 43.85  ? 204  HIS B N     1 
ATOM   6500 C  CA    . HIS F 3 227 ? 13.721  -57.003 -23.662 1.00 42.27  ? 204  HIS B CA    1 
ATOM   6501 C  C     . HIS F 3 227 ? 13.296  -55.894 -24.617 1.00 40.58  ? 204  HIS B C     1 
ATOM   6502 O  O     . HIS F 3 227 ? 12.316  -55.194 -24.365 1.00 41.26  ? 204  HIS B O     1 
ATOM   6503 C  CB    . HIS F 3 227 ? 12.952  -58.287 -23.983 1.00 44.06  ? 204  HIS B CB    1 
ATOM   6504 C  CG    . HIS F 3 227 ? 13.435  -59.489 -23.232 1.00 46.45  ? 204  HIS B CG    1 
ATOM   6505 N  ND1   . HIS F 3 227 ? 14.686  -60.035 -23.425 1.00 47.09  ? 204  HIS B ND1   1 
ATOM   6506 C  CD2   . HIS F 3 227 ? 12.832  -60.256 -22.292 1.00 47.34  ? 204  HIS B CD2   1 
ATOM   6507 C  CE1   . HIS F 3 227 ? 14.832  -61.086 -22.638 1.00 47.13  ? 204  HIS B CE1   1 
ATOM   6508 N  NE2   . HIS F 3 227 ? 13.721  -61.242 -21.941 1.00 46.89  ? 204  HIS B NE2   1 
ATOM   6509 N  N     . LEU F 3 228 ? 14.046  -55.722 -25.701 1.00 37.97  ? 205  LEU B N     1 
ATOM   6510 C  CA    . LEU F 3 228 ? 13.730  -54.705 -26.695 1.00 34.73  ? 205  LEU B CA    1 
ATOM   6511 C  C     . LEU F 3 228 ? 12.437  -55.111 -27.381 1.00 32.38  ? 205  LEU B C     1 
ATOM   6512 O  O     . LEU F 3 228 ? 11.958  -56.224 -27.195 1.00 32.81  ? 205  LEU B O     1 
ATOM   6513 C  CB    . LEU F 3 228 ? 14.840  -54.628 -27.743 1.00 35.37  ? 205  LEU B CB    1 
ATOM   6514 C  CG    . LEU F 3 228 ? 16.242  -54.234 -27.286 1.00 35.72  ? 205  LEU B CG    1 
ATOM   6515 C  CD1   . LEU F 3 228 ? 17.213  -54.367 -28.452 1.00 34.87  ? 205  LEU B CD1   1 
ATOM   6516 C  CD2   . LEU F 3 228 ? 16.219  -52.809 -26.763 1.00 35.86  ? 205  LEU B CD2   1 
ATOM   6517 N  N     . PRO F 3 229 ? 11.844  -54.209 -28.171 1.00 30.22  ? 206  PRO B N     1 
ATOM   6518 C  CA    . PRO F 3 229 ? 10.602  -54.559 -28.861 1.00 30.17  ? 206  PRO B CA    1 
ATOM   6519 C  C     . PRO F 3 229 ? 10.901  -55.293 -30.171 1.00 30.42  ? 206  PRO B C     1 
ATOM   6520 O  O     . PRO F 3 229 ? 11.982  -55.141 -30.741 1.00 31.40  ? 206  PRO B O     1 
ATOM   6521 C  CB    . PRO F 3 229 ? 9.950   -53.200 -29.087 1.00 29.75  ? 206  PRO B CB    1 
ATOM   6522 C  CG    . PRO F 3 229 ? 11.117  -52.317 -29.317 1.00 28.50  ? 206  PRO B CG    1 
ATOM   6523 C  CD    . PRO F 3 229 ? 12.080  -52.756 -28.235 1.00 30.50  ? 206  PRO B CD    1 
ATOM   6524 N  N     . LEU F 3 230 ? 9.951   -56.096 -30.639 1.00 29.81  ? 207  LEU B N     1 
ATOM   6525 C  CA    . LEU F 3 230 ? 10.130  -56.832 -31.888 1.00 29.23  ? 207  LEU B CA    1 
ATOM   6526 C  C     . LEU F 3 230 ? 10.500  -55.870 -33.006 1.00 27.70  ? 207  LEU B C     1 
ATOM   6527 O  O     . LEU F 3 230 ? 9.925   -54.790 -33.114 1.00 28.35  ? 207  LEU B O     1 
ATOM   6528 C  CB    . LEU F 3 230 ? 8.841   -57.564 -32.266 1.00 29.85  ? 207  LEU B CB    1 
ATOM   6529 C  CG    . LEU F 3 230 ? 8.496   -58.811 -31.454 1.00 30.80  ? 207  LEU B CG    1 
ATOM   6530 C  CD1   . LEU F 3 230 ? 7.063   -59.227 -31.726 1.00 31.09  ? 207  LEU B CD1   1 
ATOM   6531 C  CD2   . LEU F 3 230 ? 9.461   -59.926 -31.818 1.00 31.74  ? 207  LEU B CD2   1 
ATOM   6532 N  N     . ILE F 3 231 ? 11.462  -56.254 -33.833 1.00 26.27  ? 208  ILE B N     1 
ATOM   6533 C  CA    . ILE F 3 231 ? 11.867  -55.400 -34.940 1.00 25.62  ? 208  ILE B CA    1 
ATOM   6534 C  C     . ILE F 3 231 ? 10.637  -55.116 -35.795 1.00 26.14  ? 208  ILE B C     1 
ATOM   6535 O  O     . ILE F 3 231 ? 9.793   -55.986 -35.979 1.00 27.37  ? 208  ILE B O     1 
ATOM   6536 C  CB    . ILE F 3 231 ? 12.936  -56.086 -35.818 1.00 24.36  ? 208  ILE B CB    1 
ATOM   6537 C  CG1   . ILE F 3 231 ? 12.439  -57.464 -36.255 1.00 20.34  ? 208  ILE B CG1   1 
ATOM   6538 C  CG2   . ILE F 3 231 ? 14.251  -56.207 -35.054 1.00 23.83  ? 208  ILE B CG2   1 
ATOM   6539 C  CD1   . ILE F 3 231 ? 13.335  -58.134 -37.260 1.00 18.16  ? 208  ILE B CD1   1 
ATOM   6540 N  N     . PRO F 3 232 ? 10.514  -53.891 -36.321 1.00 27.22  ? 209  PRO B N     1 
ATOM   6541 C  CA    . PRO F 3 232 ? 9.367   -53.526 -37.158 1.00 29.19  ? 209  PRO B CA    1 
ATOM   6542 C  C     . PRO F 3 232 ? 9.415   -54.227 -38.516 1.00 31.09  ? 209  PRO B C     1 
ATOM   6543 O  O     . PRO F 3 232 ? 10.475  -54.326 -39.133 1.00 31.70  ? 209  PRO B O     1 
ATOM   6544 C  CB    . PRO F 3 232 ? 9.506   -52.015 -37.281 1.00 28.99  ? 209  PRO B CB    1 
ATOM   6545 C  CG    . PRO F 3 232 ? 10.983  -51.841 -37.314 1.00 30.05  ? 209  PRO B CG    1 
ATOM   6546 C  CD    . PRO F 3 232 ? 11.450  -52.761 -36.200 1.00 28.68  ? 209  PRO B CD    1 
ATOM   6547 N  N     . GLU F 3 233 ? 8.265   -54.704 -38.977 1.00 32.40  ? 210  GLU B N     1 
ATOM   6548 C  CA    . GLU F 3 233 ? 8.184   -55.409 -40.251 1.00 34.20  ? 210  GLU B CA    1 
ATOM   6549 C  C     . GLU F 3 233 ? 8.920   -54.678 -41.371 1.00 33.07  ? 210  GLU B C     1 
ATOM   6550 O  O     . GLU F 3 233 ? 9.500   -55.306 -42.259 1.00 31.82  ? 210  GLU B O     1 
ATOM   6551 C  CB    . GLU F 3 233 ? 6.719   -55.603 -40.647 1.00 38.61  ? 210  GLU B CB    1 
ATOM   6552 C  CG    . GLU F 3 233 ? 6.505   -56.557 -41.809 1.00 45.34  ? 210  GLU B CG    1 
ATOM   6553 C  CD    . GLU F 3 233 ? 6.929   -57.972 -41.472 1.00 50.78  ? 210  GLU B CD    1 
ATOM   6554 O  OE1   . GLU F 3 233 ? 6.421   -58.520 -40.470 1.00 53.69  ? 210  GLU B OE1   1 
ATOM   6555 O  OE2   . GLU F 3 233 ? 7.769   -58.537 -42.207 1.00 54.34  ? 210  GLU B OE2   1 
ATOM   6556 N  N     . LYS F 3 234 ? 8.904   -53.349 -41.318 1.00 31.64  ? 211  LYS B N     1 
ATOM   6557 C  CA    . LYS F 3 234 ? 9.553   -52.542 -42.342 1.00 30.27  ? 211  LYS B CA    1 
ATOM   6558 C  C     . LYS F 3 234 ? 11.073  -52.590 -42.333 1.00 29.12  ? 211  LYS B C     1 
ATOM   6559 O  O     . LYS F 3 234 ? 11.695  -52.471 -43.385 1.00 29.46  ? 211  LYS B O     1 
ATOM   6560 C  CB    . LYS F 3 234 ? 9.093   -51.086 -42.238 1.00 31.36  ? 211  LYS B CB    1 
ATOM   6561 C  CG    . LYS F 3 234 ? 7.626   -50.878 -42.575 1.00 33.58  ? 211  LYS B CG    1 
ATOM   6562 C  CD    . LYS F 3 234 ? 7.247   -49.404 -42.562 1.00 33.88  ? 211  LYS B CD    1 
ATOM   6563 C  CE    . LYS F 3 234 ? 7.362   -48.810 -41.169 0.00 34.31  ? 211  LYS B CE    1 
ATOM   6564 N  NZ    . LYS F 3 234 ? 6.949   -47.380 -41.148 0.00 34.34  ? 211  LYS B NZ    1 
ATOM   6565 N  N     . ILE F 3 235 ? 11.680  -52.763 -41.162 1.00 27.74  ? 212  ILE B N     1 
ATOM   6566 C  CA    . ILE F 3 235 ? 13.139  -52.806 -41.090 1.00 24.89  ? 212  ILE B CA    1 
ATOM   6567 C  C     . ILE F 3 235 ? 13.705  -53.994 -41.864 1.00 25.86  ? 212  ILE B C     1 
ATOM   6568 O  O     . ILE F 3 235 ? 14.892  -54.021 -42.186 1.00 26.52  ? 212  ILE B O     1 
ATOM   6569 C  CB    . ILE F 3 235 ? 13.645  -52.873 -39.631 1.00 20.60  ? 212  ILE B CB    1 
ATOM   6570 C  CG1   . ILE F 3 235 ? 15.158  -52.647 -39.594 1.00 18.53  ? 212  ILE B CG1   1 
ATOM   6571 C  CG2   . ILE F 3 235 ? 13.324  -54.218 -39.026 1.00 19.07  ? 212  ILE B CG2   1 
ATOM   6572 C  CD1   . ILE F 3 235 ? 15.596  -51.294 -40.126 1.00 15.20  ? 212  ILE B CD1   1 
ATOM   6573 N  N     . LYS F 3 236 ? 12.857  -54.973 -42.168 1.00 26.61  ? 213  LYS B N     1 
ATOM   6574 C  CA    . LYS F 3 236 ? 13.295  -56.148 -42.915 1.00 26.54  ? 213  LYS B CA    1 
ATOM   6575 C  C     . LYS F 3 236 ? 13.652  -55.798 -44.361 1.00 25.97  ? 213  LYS B C     1 
ATOM   6576 O  O     . LYS F 3 236 ? 14.200  -56.626 -45.087 1.00 23.79  ? 213  LYS B O     1 
ATOM   6577 C  CB    . LYS F 3 236 ? 12.212  -57.230 -42.910 1.00 27.08  ? 213  LYS B CB    1 
ATOM   6578 C  CG    . LYS F 3 236 ? 11.991  -57.909 -41.571 1.00 28.58  ? 213  LYS B CG    1 
ATOM   6579 C  CD    . LYS F 3 236 ? 10.929  -58.991 -41.697 1.00 30.09  ? 213  LYS B CD    1 
ATOM   6580 C  CE    . LYS F 3 236 ? 10.580  -59.604 -40.352 1.00 31.09  ? 213  LYS B CE    1 
ATOM   6581 N  NZ    . LYS F 3 236 ? 9.555   -60.675 -40.489 1.00 31.34  ? 213  LYS B NZ    1 
ATOM   6582 N  N     . SER F 3 237 ? 13.332  -54.577 -44.779 1.00 26.64  ? 214  SER B N     1 
ATOM   6583 C  CA    . SER F 3 237 ? 13.645  -54.149 -46.136 1.00 28.79  ? 214  SER B CA    1 
ATOM   6584 C  C     . SER F 3 237 ? 14.984  -53.411 -46.149 1.00 28.75  ? 214  SER B C     1 
ATOM   6585 O  O     . SER F 3 237 ? 15.242  -52.558 -47.003 1.00 30.84  ? 214  SER B O     1 
ATOM   6586 C  CB    . SER F 3 237 ? 12.523  -53.268 -46.707 1.00 30.60  ? 214  SER B CB    1 
ATOM   6587 O  OG    . SER F 3 237 ? 12.269  -52.137 -45.896 1.00 33.68  ? 214  SER B OG    1 
ATOM   6588 N  N     . LEU F 3 238 ? 15.829  -53.757 -45.183 1.00 27.14  ? 215  LEU B N     1 
ATOM   6589 C  CA    . LEU F 3 238 ? 17.163  -53.188 -45.054 1.00 25.43  ? 215  LEU B CA    1 
ATOM   6590 C  C     . LEU F 3 238 ? 18.101  -54.176 -45.738 1.00 25.89  ? 215  LEU B C     1 
ATOM   6591 O  O     . LEU F 3 238 ? 17.979  -55.386 -45.539 1.00 27.21  ? 215  LEU B O     1 
ATOM   6592 C  CB    . LEU F 3 238 ? 17.531  -53.051 -43.578 1.00 24.09  ? 215  LEU B CB    1 
ATOM   6593 C  CG    . LEU F 3 238 ? 18.943  -52.565 -43.267 1.00 22.68  ? 215  LEU B CG    1 
ATOM   6594 C  CD1   . LEU F 3 238 ? 19.155  -51.194 -43.879 1.00 22.69  ? 215  LEU B CD1   1 
ATOM   6595 C  CD2   . LEU F 3 238 ? 19.146  -52.526 -41.765 1.00 21.90  ? 215  LEU B CD2   1 
ATOM   6596 N  N     . LYS F 3 239 ? 19.042  -53.670 -46.531 1.00 26.29  ? 216  LYS B N     1 
ATOM   6597 C  CA    . LYS F 3 239 ? 19.960  -54.540 -47.266 1.00 25.67  ? 216  LYS B CA    1 
ATOM   6598 C  C     . LYS F 3 239 ? 21.339  -54.742 -46.675 1.00 24.60  ? 216  LYS B C     1 
ATOM   6599 O  O     . LYS F 3 239 ? 21.952  -53.806 -46.172 1.00 25.88  ? 216  LYS B O     1 
ATOM   6600 C  CB    . LYS F 3 239 ? 20.119  -54.039 -48.707 1.00 25.69  ? 216  LYS B CB    1 
ATOM   6601 C  CG    . LYS F 3 239 ? 18.968  -54.415 -49.628 1.00 27.67  ? 216  LYS B CG    1 
ATOM   6602 C  CD    . LYS F 3 239 ? 19.023  -53.663 -50.947 1.00 27.99  ? 216  LYS B CD    1 
ATOM   6603 C  CE    . LYS F 3 239 ? 18.729  -52.186 -50.746 1.00 30.40  ? 216  LYS B CE    1 
ATOM   6604 N  NZ    . LYS F 3 239 ? 18.587  -51.453 -52.040 1.00 33.06  ? 216  LYS B NZ    1 
ATOM   6605 N  N     . PHE F 3 240 ? 21.811  -55.984 -46.739 1.00 24.67  ? 217  PHE B N     1 
ATOM   6606 C  CA    . PHE F 3 240 ? 23.142  -56.342 -46.268 1.00 24.15  ? 217  PHE B CA    1 
ATOM   6607 C  C     . PHE F 3 240 ? 24.055  -56.070 -47.443 1.00 26.36  ? 217  PHE B C     1 
ATOM   6608 O  O     . PHE F 3 240 ? 23.670  -56.294 -48.589 1.00 28.47  ? 217  PHE B O     1 
ATOM   6609 C  CB    . PHE F 3 240 ? 23.263  -57.831 -45.975 1.00 21.91  ? 217  PHE B CB    1 
ATOM   6610 C  CG    . PHE F 3 240 ? 22.740  -58.248 -44.645 1.00 21.81  ? 217  PHE B CG    1 
ATOM   6611 C  CD1   . PHE F 3 240 ? 21.407  -58.594 -44.486 1.00 22.42  ? 217  PHE B CD1   1 
ATOM   6612 C  CD2   . PHE F 3 240 ? 23.599  -58.359 -43.557 1.00 22.71  ? 217  PHE B CD2   1 
ATOM   6613 C  CE1   . PHE F 3 240 ? 20.938  -59.056 -43.264 1.00 21.86  ? 217  PHE B CE1   1 
ATOM   6614 C  CE2   . PHE F 3 240 ? 23.141  -58.818 -42.332 1.00 21.47  ? 217  PHE B CE2   1 
ATOM   6615 C  CZ    . PHE F 3 240 ? 21.807  -59.168 -42.184 1.00 21.13  ? 217  PHE B CZ    1 
ATOM   6616 N  N     . GLU F 3 241 ? 25.264  -55.606 -47.171 1.00 27.90  ? 218  GLU B N     1 
ATOM   6617 C  CA    . GLU F 3 241 ? 26.208  -55.355 -48.246 1.00 29.53  ? 218  GLU B CA    1 
ATOM   6618 C  C     . GLU F 3 241 ? 27.201  -56.512 -48.249 1.00 29.90  ? 218  GLU B C     1 
ATOM   6619 O  O     . GLU F 3 241 ? 27.860  -56.773 -47.241 1.00 32.50  ? 218  GLU B O     1 
ATOM   6620 C  CB    . GLU F 3 241 ? 26.935  -54.035 -48.015 1.00 31.22  ? 218  GLU B CB    1 
ATOM   6621 C  CG    . GLU F 3 241 ? 27.769  -53.588 -49.195 1.00 34.64  ? 218  GLU B CG    1 
ATOM   6622 C  CD    . GLU F 3 241 ? 26.960  -53.507 -50.475 1.00 37.05  ? 218  GLU B CD    1 
ATOM   6623 O  OE1   . GLU F 3 241 ? 25.838  -52.955 -50.436 1.00 39.84  ? 218  GLU B OE1   1 
ATOM   6624 O  OE2   . GLU F 3 241 ? 27.449  -53.988 -51.520 1.00 37.54  ? 218  GLU B OE2   1 
ATOM   6625 N  N     . GLY F 3 242 ? 27.294  -57.219 -49.371 1.00 28.23  ? 219  GLY B N     1 
ATOM   6626 C  CA    . GLY F 3 242 ? 28.214  -58.340 -49.449 1.00 26.49  ? 219  GLY B CA    1 
ATOM   6627 C  C     . GLY F 3 242 ? 27.509  -59.678 -49.367 1.00 24.93  ? 219  GLY B C     1 
ATOM   6628 O  O     . GLY F 3 242 ? 26.283  -59.731 -49.347 1.00 26.48  ? 219  GLY B O     1 
ATOM   6629 N  N     . ASP F 3 243 ? 28.279  -60.760 -49.307 1.00 23.88  ? 220  ASP B N     1 
ATOM   6630 C  CA    . ASP F 3 243 ? 27.712  -62.106 -49.242 1.00 24.64  ? 220  ASP B CA    1 
ATOM   6631 C  C     . ASP F 3 243 ? 27.293  -62.520 -47.833 1.00 22.98  ? 220  ASP B C     1 
ATOM   6632 O  O     . ASP F 3 243 ? 28.091  -62.474 -46.894 1.00 24.26  ? 220  ASP B O     1 
ATOM   6633 C  CB    . ASP F 3 243 ? 28.714  -63.126 -49.788 1.00 29.12  ? 220  ASP B CB    1 
ATOM   6634 C  CG    . ASP F 3 243 ? 29.219  -62.765 -51.172 1.00 34.80  ? 220  ASP B CG    1 
ATOM   6635 O  OD1   . ASP F 3 243 ? 29.947  -61.756 -51.299 1.00 39.13  ? 220  ASP B OD1   1 
ATOM   6636 O  OD2   . ASP F 3 243 ? 28.883  -63.487 -52.136 1.00 38.01  ? 220  ASP B OD2   1 
ATOM   6637 N  N     . VAL F 3 244 ? 26.039  -62.937 -47.700 1.00 19.33  ? 221  VAL B N     1 
ATOM   6638 C  CA    . VAL F 3 244 ? 25.490  -63.367 -46.419 1.00 15.89  ? 221  VAL B CA    1 
ATOM   6639 C  C     . VAL F 3 244 ? 25.476  -64.894 -46.307 1.00 15.45  ? 221  VAL B C     1 
ATOM   6640 O  O     . VAL F 3 244 ? 24.533  -65.544 -46.743 1.00 16.09  ? 221  VAL B O     1 
ATOM   6641 C  CB    . VAL F 3 244 ? 24.049  -62.837 -46.240 1.00 13.46  ? 221  VAL B CB    1 
ATOM   6642 C  CG1   . VAL F 3 244 ? 23.448  -63.361 -44.951 1.00 13.44  ? 221  VAL B CG1   1 
ATOM   6643 C  CG2   . VAL F 3 244 ? 24.054  -61.330 -46.247 1.00 10.47  ? 221  VAL B CG2   1 
ATOM   6644 N  N     . PHE F 3 245 ? 26.528  -65.458 -45.722 1.00 16.06  ? 222  PHE B N     1 
ATOM   6645 C  CA    . PHE F 3 245 ? 26.641  -66.905 -45.545 1.00 16.67  ? 222  PHE B CA    1 
ATOM   6646 C  C     . PHE F 3 245 ? 25.335  -67.443 -44.974 1.00 17.06  ? 222  PHE B C     1 
ATOM   6647 O  O     . PHE F 3 245 ? 24.958  -67.101 -43.855 1.00 17.94  ? 222  PHE B O     1 
ATOM   6648 C  CB    . PHE F 3 245 ? 27.784  -67.224 -44.581 1.00 17.09  ? 222  PHE B CB    1 
ATOM   6649 C  CG    . PHE F 3 245 ? 28.197  -68.660 -44.594 1.00 18.88  ? 222  PHE B CG    1 
ATOM   6650 C  CD1   . PHE F 3 245 ? 29.000  -69.152 -45.621 1.00 19.34  ? 222  PHE B CD1   1 
ATOM   6651 C  CD2   . PHE F 3 245 ? 27.762  -69.533 -43.603 1.00 18.29  ? 222  PHE B CD2   1 
ATOM   6652 C  CE1   . PHE F 3 245 ? 29.361  -70.495 -45.663 1.00 18.71  ? 222  PHE B CE1   1 
ATOM   6653 C  CE2   . PHE F 3 245 ? 28.118  -70.880 -43.638 1.00 19.92  ? 222  PHE B CE2   1 
ATOM   6654 C  CZ    . PHE F 3 245 ? 28.918  -71.361 -44.669 1.00 18.79  ? 222  PHE B CZ    1 
ATOM   6655 N  N     . ASN F 3 246 ? 24.650  -68.294 -45.732 1.00 17.10  ? 223  ASN B N     1 
ATOM   6656 C  CA    . ASN F 3 246 ? 23.373  -68.833 -45.282 1.00 16.70  ? 223  ASN B CA    1 
ATOM   6657 C  C     . ASN F 3 246 ? 22.930  -70.047 -46.099 1.00 18.37  ? 223  ASN B C     1 
ATOM   6658 O  O     . ASN F 3 246 ? 21.880  -70.025 -46.739 1.00 17.29  ? 223  ASN B O     1 
ATOM   6659 C  CB    . ASN F 3 246 ? 22.311  -67.742 -45.382 1.00 16.05  ? 223  ASN B CB    1 
ATOM   6660 C  CG    . ASN F 3 246 ? 21.003  -68.147 -44.759 1.00 19.15  ? 223  ASN B CG    1 
ATOM   6661 O  OD1   . ASN F 3 246 ? 19.976  -67.512 -44.983 1.00 19.74  ? 223  ASN B OD1   1 
ATOM   6662 N  ND2   . ASN F 3 246 ? 21.030  -69.205 -43.960 1.00 22.93  ? 223  ASN B ND2   1 
ATOM   6663 N  N     . PRO F 3 247 ? 23.719  -71.131 -46.072 1.00 21.25  ? 224  PRO B N     1 
ATOM   6664 C  CA    . PRO F 3 247 ? 23.410  -72.356 -46.816 1.00 23.34  ? 224  PRO B CA    1 
ATOM   6665 C  C     . PRO F 3 247 ? 22.086  -73.012 -46.445 1.00 26.10  ? 224  PRO B C     1 
ATOM   6666 O  O     . PRO F 3 247 ? 21.483  -73.702 -47.265 1.00 28.26  ? 224  PRO B O     1 
ATOM   6667 C  CB    . PRO F 3 247 ? 24.606  -73.253 -46.514 1.00 23.21  ? 224  PRO B CB    1 
ATOM   6668 C  CG    . PRO F 3 247 ? 24.994  -72.830 -45.139 1.00 24.42  ? 224  PRO B CG    1 
ATOM   6669 C  CD    . PRO F 3 247 ? 24.911  -71.323 -45.229 1.00 23.58  ? 224  PRO B CD    1 
ATOM   6670 N  N     . GLU F 3 248 ? 21.638  -72.805 -45.212 1.00 28.20  ? 225  GLU B N     1 
ATOM   6671 C  CA    . GLU F 3 248 ? 20.376  -73.382 -44.767 1.00 29.94  ? 225  GLU B CA    1 
ATOM   6672 C  C     . GLU F 3 248 ? 19.214  -72.488 -45.191 1.00 30.65  ? 225  GLU B C     1 
ATOM   6673 O  O     . GLU F 3 248 ? 18.048  -72.802 -44.938 1.00 31.37  ? 225  GLU B O     1 
ATOM   6674 C  CB    . GLU F 3 248 ? 20.371  -73.555 -43.247 1.00 32.50  ? 225  GLU B CB    1 
ATOM   6675 C  CG    . GLU F 3 248 ? 21.437  -74.501 -42.719 1.00 37.24  ? 225  GLU B CG    1 
ATOM   6676 C  CD    . GLU F 3 248 ? 21.375  -75.879 -43.359 1.00 40.92  ? 225  GLU B CD    1 
ATOM   6677 O  OE1   . GLU F 3 248 ? 20.279  -76.483 -43.387 1.00 41.63  ? 225  GLU B OE1   1 
ATOM   6678 O  OE2   . GLU F 3 248 ? 22.429  -76.360 -43.829 1.00 42.99  ? 225  GLU B OE2   1 
ATOM   6679 N  N     . GLY F 3 249 ? 19.543  -71.369 -45.831 1.00 29.69  ? 226  GLY B N     1 
ATOM   6680 C  CA    . GLY F 3 249 ? 18.525  -70.445 -46.300 1.00 29.11  ? 226  GLY B CA    1 
ATOM   6681 C  C     . GLY F 3 249 ? 17.590  -69.889 -45.242 1.00 28.70  ? 226  GLY B C     1 
ATOM   6682 O  O     . GLY F 3 249 ? 16.367  -69.976 -45.378 1.00 28.43  ? 226  GLY B O     1 
ATOM   6683 N  N     . ARG F 3 250 ? 18.159  -69.310 -44.190 1.00 27.79  ? 227  ARG B N     1 
ATOM   6684 C  CA    . ARG F 3 250 ? 17.365  -68.726 -43.118 1.00 27.74  ? 227  ARG B CA    1 
ATOM   6685 C  C     . ARG F 3 250 ? 16.963  -67.319 -43.540 1.00 27.84  ? 227  ARG B C     1 
ATOM   6686 O  O     . ARG F 3 250 ? 17.451  -66.812 -44.546 1.00 29.79  ? 227  ARG B O     1 
ATOM   6687 C  CB    . ARG F 3 250 ? 18.196  -68.662 -41.844 1.00 27.20  ? 227  ARG B CB    1 
ATOM   6688 C  CG    . ARG F 3 250 ? 18.829  -69.983 -41.475 1.00 29.05  ? 227  ARG B CG    1 
ATOM   6689 C  CD    . ARG F 3 250 ? 19.843  -69.819 -40.354 1.00 30.71  ? 227  ARG B CD    1 
ATOM   6690 N  NE    . ARG F 3 250 ? 20.496  -71.086 -40.042 1.00 28.96  ? 227  ARG B NE    1 
ATOM   6691 C  CZ    . ARG F 3 250 ? 19.870  -72.125 -39.507 1.00 27.77  ? 227  ARG B CZ    1 
ATOM   6692 N  NH1   . ARG F 3 250 ? 18.579  -72.040 -39.220 1.00 27.17  ? 227  ARG B NH1   1 
ATOM   6693 N  NH2   . ARG F 3 250 ? 20.530  -73.251 -39.271 1.00 27.76  ? 227  ARG B NH2   1 
ATOM   6694 N  N     . ASP F 3 251 ? 16.071  -66.687 -42.787 1.00 27.48  ? 228  ASP B N     1 
ATOM   6695 C  CA    . ASP F 3 251 ? 15.666  -65.329 -43.120 1.00 27.36  ? 228  ASP B CA    1 
ATOM   6696 C  C     . ASP F 3 251 ? 16.819  -64.386 -42.808 1.00 25.69  ? 228  ASP B C     1 
ATOM   6697 O  O     . ASP F 3 251 ? 17.674  -64.697 -41.984 1.00 25.83  ? 228  ASP B O     1 
ATOM   6698 C  CB    . ASP F 3 251 ? 14.421  -64.928 -42.336 1.00 32.08  ? 228  ASP B CB    1 
ATOM   6699 C  CG    . ASP F 3 251 ? 13.172  -65.602 -42.858 1.00 36.06  ? 228  ASP B CG    1 
ATOM   6700 O  OD1   . ASP F 3 251 ? 12.067  -65.278 -42.372 1.00 39.32  ? 228  ASP B OD1   1 
ATOM   6701 O  OD2   . ASP F 3 251 ? 13.297  -66.459 -43.759 1.00 40.16  ? 228  ASP B OD2   1 
ATOM   6702 N  N     . LEU F 3 252 ? 16.836  -63.232 -43.461 1.00 23.05  ? 229  LEU B N     1 
ATOM   6703 C  CA    . LEU F 3 252 ? 17.918  -62.277 -43.277 1.00 21.26  ? 229  LEU B CA    1 
ATOM   6704 C  C     . LEU F 3 252 ? 17.802  -61.338 -42.077 1.00 20.89  ? 229  LEU B C     1 
ATOM   6705 O  O     . LEU F 3 252 ? 18.728  -61.248 -41.270 1.00 21.05  ? 229  LEU B O     1 
ATOM   6706 C  CB    . LEU F 3 252 ? 18.094  -61.471 -44.564 1.00 20.93  ? 229  LEU B CB    1 
ATOM   6707 C  CG    . LEU F 3 252 ? 18.226  -62.327 -45.827 1.00 17.78  ? 229  LEU B CG    1 
ATOM   6708 C  CD1   . LEU F 3 252 ? 18.558  -61.437 -47.005 1.00 18.13  ? 229  LEU B CD1   1 
ATOM   6709 C  CD2   . LEU F 3 252 ? 19.306  -63.373 -45.638 1.00 16.96  ? 229  LEU B CD2   1 
ATOM   6710 N  N     . ILE F 3 253 ? 16.683  -60.632 -41.961 1.00 18.76  ? 230  ILE B N     1 
ATOM   6711 C  CA    . ILE F 3 253 ? 16.480  -59.719 -40.841 1.00 17.70  ? 230  ILE B CA    1 
ATOM   6712 C  C     . ILE F 3 253 ? 15.376  -60.257 -39.933 1.00 18.01  ? 230  ILE B C     1 
ATOM   6713 O  O     . ILE F 3 253 ? 14.191  -60.079 -40.211 1.00 17.92  ? 230  ILE B O     1 
ATOM   6714 C  CB    . ILE F 3 253 ? 16.074  -58.319 -41.331 1.00 17.80  ? 230  ILE B CB    1 
ATOM   6715 C  CG1   . ILE F 3 253 ? 17.121  -57.786 -42.306 1.00 15.87  ? 230  ILE B CG1   1 
ATOM   6716 C  CG2   . ILE F 3 253 ? 15.925  -57.370 -40.144 1.00 18.40  ? 230  ILE B CG2   1 
ATOM   6717 C  CD1   . ILE F 3 253 ? 18.446  -57.517 -41.673 1.00 16.45  ? 230  ILE B CD1   1 
ATOM   6718 N  N     . THR F 3 254 ? 15.767  -60.908 -38.843 1.00 17.90  ? 231  THR B N     1 
ATOM   6719 C  CA    . THR F 3 254 ? 14.793  -61.481 -37.922 1.00 20.08  ? 231  THR B CA    1 
ATOM   6720 C  C     . THR F 3 254 ? 14.858  -60.886 -36.522 1.00 20.80  ? 231  THR B C     1 
ATOM   6721 O  O     . THR F 3 254 ? 13.923  -61.038 -35.740 1.00 21.90  ? 231  THR B O     1 
ATOM   6722 C  CB    . THR F 3 254 ? 14.975  -62.999 -37.798 1.00 20.95  ? 231  THR B CB    1 
ATOM   6723 O  OG1   . THR F 3 254 ? 16.088  -63.278 -36.940 1.00 22.56  ? 231  THR B OG1   1 
ATOM   6724 C  CG2   . THR F 3 254 ? 15.234  -63.610 -39.169 1.00 21.38  ? 231  THR B CG2   1 
ATOM   6725 N  N     . ASP F 3 255 ? 15.964  -60.224 -36.197 1.00 21.26  ? 232  ASP B N     1 
ATOM   6726 C  CA    . ASP F 3 255 ? 16.103  -59.602 -34.886 1.00 21.62  ? 232  ASP B CA    1 
ATOM   6727 C  C     . ASP F 3 255 ? 17.108  -58.460 -34.941 1.00 21.42  ? 232  ASP B C     1 
ATOM   6728 O  O     . ASP F 3 255 ? 17.851  -58.320 -35.913 1.00 21.32  ? 232  ASP B O     1 
ATOM   6729 C  CB    . ASP F 3 255 ? 16.545  -60.623 -33.839 1.00 23.99  ? 232  ASP B CB    1 
ATOM   6730 C  CG    . ASP F 3 255 ? 15.969  -60.330 -32.461 1.00 25.63  ? 232  ASP B CG    1 
ATOM   6731 O  OD1   . ASP F 3 255 ? 15.900  -59.143 -32.081 1.00 26.72  ? 232  ASP B OD1   1 
ATOM   6732 O  OD2   . ASP F 3 255 ? 15.593  -61.287 -31.753 1.00 26.44  ? 232  ASP B OD2   1 
ATOM   6733 N  N     . TRP F 3 256 ? 17.129  -57.648 -33.889 1.00 19.97  ? 233  TRP B N     1 
ATOM   6734 C  CA    . TRP F 3 256 ? 18.025  -56.504 -33.826 1.00 18.19  ? 233  TRP B CA    1 
ATOM   6735 C  C     . TRP F 3 256 ? 19.482  -56.787 -34.172 1.00 17.38  ? 233  TRP B C     1 
ATOM   6736 O  O     . TRP F 3 256 ? 20.156  -55.918 -34.722 1.00 18.23  ? 233  TRP B O     1 
ATOM   6737 C  CB    . TRP F 3 256 ? 17.920  -55.837 -32.457 1.00 17.10  ? 233  TRP B CB    1 
ATOM   6738 C  CG    . TRP F 3 256 ? 16.572  -55.223 -32.235 1.00 18.02  ? 233  TRP B CG    1 
ATOM   6739 C  CD1   . TRP F 3 256 ? 15.580  -55.684 -31.415 1.00 18.98  ? 233  TRP B CD1   1 
ATOM   6740 C  CD2   . TRP F 3 256 ? 16.042  -54.066 -32.892 1.00 17.78  ? 233  TRP B CD2   1 
ATOM   6741 N  NE1   . TRP F 3 256 ? 14.465  -54.885 -31.522 1.00 17.53  ? 233  TRP B NE1   1 
ATOM   6742 C  CE2   . TRP F 3 256 ? 14.721  -53.885 -32.422 1.00 16.58  ? 233  TRP B CE2   1 
ATOM   6743 C  CE3   . TRP F 3 256 ? 16.555  -53.163 -33.833 1.00 17.41  ? 233  TRP B CE3   1 
ATOM   6744 C  CZ2   . TRP F 3 256 ? 13.907  -52.841 -32.862 1.00 15.61  ? 233  TRP B CZ2   1 
ATOM   6745 C  CZ3   . TRP F 3 256 ? 15.745  -52.123 -34.271 1.00 17.38  ? 233  TRP B CZ3   1 
ATOM   6746 C  CH2   . TRP F 3 256 ? 14.435  -51.972 -33.783 1.00 17.67  ? 233  TRP B CH2   1 
ATOM   6747 N  N     . ASP F 3 257 ? 19.978  -57.985 -33.869 1.00 16.61  ? 234  ASP B N     1 
ATOM   6748 C  CA    . ASP F 3 257 ? 21.363  -58.295 -34.205 1.00 15.65  ? 234  ASP B CA    1 
ATOM   6749 C  C     . ASP F 3 257 ? 21.580  -58.200 -35.712 1.00 16.34  ? 234  ASP B C     1 
ATOM   6750 O  O     . ASP F 3 257 ? 22.549  -57.593 -36.164 1.00 17.02  ? 234  ASP B O     1 
ATOM   6751 C  CB    . ASP F 3 257 ? 21.783  -59.681 -33.685 1.00 16.21  ? 234  ASP B CB    1 
ATOM   6752 C  CG    . ASP F 3 257 ? 20.705  -60.745 -33.851 1.00 19.52  ? 234  ASP B CG    1 
ATOM   6753 O  OD1   . ASP F 3 257 ? 19.747  -60.551 -34.635 1.00 18.88  ? 234  ASP B OD1   1 
ATOM   6754 O  OD2   . ASP F 3 257 ? 20.837  -61.799 -33.187 1.00 19.58  ? 234  ASP B OD2   1 
ATOM   6755 N  N     . ASP F 3 258 ? 20.671  -58.784 -36.489 1.00 17.88  ? 235  ASP B N     1 
ATOM   6756 C  CA    . ASP F 3 258 ? 20.766  -58.731 -37.948 1.00 18.02  ? 235  ASP B CA    1 
ATOM   6757 C  C     . ASP F 3 258 ? 20.782  -57.266 -38.366 1.00 17.80  ? 235  ASP B C     1 
ATOM   6758 O  O     . ASP F 3 258 ? 21.653  -56.831 -39.114 1.00 16.47  ? 235  ASP B O     1 
ATOM   6759 C  CB    . ASP F 3 258 ? 19.565  -59.424 -38.597 1.00 21.43  ? 235  ASP B CB    1 
ATOM   6760 C  CG    . ASP F 3 258 ? 19.397  -60.862 -38.140 1.00 26.46  ? 235  ASP B CG    1 
ATOM   6761 O  OD1   . ASP F 3 258 ? 20.382  -61.627 -38.210 1.00 29.70  ? 235  ASP B OD1   1 
ATOM   6762 O  OD2   . ASP F 3 258 ? 18.278  -61.232 -37.718 1.00 28.11  ? 235  ASP B OD2   1 
ATOM   6763 N  N     . VAL F 3 259 ? 19.806  -56.513 -37.872 1.00 18.73  ? 236  VAL B N     1 
ATOM   6764 C  CA    . VAL F 3 259 ? 19.701  -55.090 -38.166 1.00 20.95  ? 236  VAL B CA    1 
ATOM   6765 C  C     . VAL F 3 259 ? 21.060  -54.414 -38.024 1.00 21.19  ? 236  VAL B C     1 
ATOM   6766 O  O     . VAL F 3 259 ? 21.542  -53.765 -38.950 1.00 22.09  ? 236  VAL B O     1 
ATOM   6767 C  CB    . VAL F 3 259 ? 18.712  -54.391 -37.206 1.00 21.30  ? 236  VAL B CB    1 
ATOM   6768 C  CG1   . VAL F 3 259 ? 18.731  -52.892 -37.444 1.00 21.28  ? 236  VAL B CG1   1 
ATOM   6769 C  CG2   . VAL F 3 259 ? 17.313  -54.940 -37.408 1.00 22.14  ? 236  VAL B CG2   1 
ATOM   6770 N  N     . ILE F 3 260 ? 21.671  -54.567 -36.854 1.00 21.06  ? 237  ILE B N     1 
ATOM   6771 C  CA    . ILE F 3 260 ? 22.975  -53.973 -36.591 1.00 21.72  ? 237  ILE B CA    1 
ATOM   6772 C  C     . ILE F 3 260 ? 24.018  -54.492 -37.581 1.00 21.09  ? 237  ILE B C     1 
ATOM   6773 O  O     . ILE F 3 260 ? 24.812  -53.724 -38.125 1.00 22.28  ? 237  ILE B O     1 
ATOM   6774 C  CB    . ILE F 3 260 ? 23.460  -54.294 -35.153 1.00 21.47  ? 237  ILE B CB    1 
ATOM   6775 C  CG1   . ILE F 3 260 ? 22.479  -53.720 -34.127 1.00 21.24  ? 237  ILE B CG1   1 
ATOM   6776 C  CG2   . ILE F 3 260 ? 24.859  -53.726 -34.935 1.00 20.15  ? 237  ILE B CG2   1 
ATOM   6777 C  CD1   . ILE F 3 260 ? 22.407  -52.196 -34.104 1.00 21.59  ? 237  ILE B CD1   1 
ATOM   6778 N  N     . LEU F 3 261 ? 24.006  -55.799 -37.817 1.00 17.72  ? 238  LEU B N     1 
ATOM   6779 C  CA    . LEU F 3 261 ? 24.966  -56.408 -38.727 1.00 15.80  ? 238  LEU B CA    1 
ATOM   6780 C  C     . LEU F 3 261 ? 24.864  -55.851 -40.146 1.00 15.82  ? 238  LEU B C     1 
ATOM   6781 O  O     . LEU F 3 261 ? 25.877  -55.579 -40.792 1.00 15.09  ? 238  LEU B O     1 
ATOM   6782 C  CB    . LEU F 3 261 ? 24.769  -57.923 -38.750 1.00 11.41  ? 238  LEU B CB    1 
ATOM   6783 C  CG    . LEU F 3 261 ? 25.864  -58.703 -39.470 1.00 10.33  ? 238  LEU B CG    1 
ATOM   6784 C  CD1   . LEU F 3 261 ? 27.193  -58.468 -38.779 1.00 7.28   ? 238  LEU B CD1   1 
ATOM   6785 C  CD2   . LEU F 3 261 ? 25.515  -60.182 -39.482 1.00 12.13  ? 238  LEU B CD2   1 
ATOM   6786 N  N     . ALA F 3 262 ? 23.639  -55.683 -40.628 1.00 16.09  ? 239  ALA B N     1 
ATOM   6787 C  CA    . ALA F 3 262 ? 23.419  -55.163 -41.969 1.00 15.72  ? 239  ALA B CA    1 
ATOM   6788 C  C     . ALA F 3 262 ? 23.971  -53.741 -42.094 1.00 15.92  ? 239  ALA B C     1 
ATOM   6789 O  O     . ALA F 3 262 ? 24.729  -53.439 -43.020 1.00 14.72  ? 239  ALA B O     1 
ATOM   6790 C  CB    . ALA F 3 262 ? 21.930  -55.189 -42.298 1.00 14.62  ? 239  ALA B CB    1 
ATOM   6791 N  N     . LEU F 3 263 ? 23.590  -52.872 -41.161 1.00 15.43  ? 240  LEU B N     1 
ATOM   6792 C  CA    . LEU F 3 263 ? 24.061  -51.490 -41.175 1.00 15.29  ? 240  LEU B CA    1 
ATOM   6793 C  C     . LEU F 3 263 ? 25.582  -51.484 -41.149 1.00 15.88  ? 240  LEU B C     1 
ATOM   6794 O  O     . LEU F 3 263 ? 26.225  -50.656 -41.791 1.00 16.35  ? 240  LEU B O     1 
ATOM   6795 C  CB    . LEU F 3 263 ? 23.524  -50.726 -39.964 1.00 14.18  ? 240  LEU B CB    1 
ATOM   6796 C  CG    . LEU F 3 263 ? 22.010  -50.546 -39.865 1.00 12.84  ? 240  LEU B CG    1 
ATOM   6797 C  CD1   . LEU F 3 263 ? 21.675  -49.956 -38.519 1.00 13.59  ? 240  LEU B CD1   1 
ATOM   6798 C  CD2   . LEU F 3 263 ? 21.512  -49.648 -40.983 1.00 11.61  ? 240  LEU B CD2   1 
ATOM   6799 N  N     . GLY F 3 264 ? 26.153  -52.419 -40.401 1.00 16.29  ? 241  GLY B N     1 
ATOM   6800 C  CA    . GLY F 3 264 ? 27.596  -52.510 -40.322 1.00 16.57  ? 241  GLY B CA    1 
ATOM   6801 C  C     . GLY F 3 264 ? 28.206  -52.846 -41.669 1.00 16.35  ? 241  GLY B C     1 
ATOM   6802 O  O     . GLY F 3 264 ? 29.205  -52.247 -42.064 1.00 16.29  ? 241  GLY B O     1 
ATOM   6803 N  N     . SER F 3 265 ? 27.605  -53.794 -42.385 1.00 15.52  ? 242  SER B N     1 
ATOM   6804 C  CA    . SER F 3 265 ? 28.133  -54.189 -43.687 1.00 16.88  ? 242  SER B CA    1 
ATOM   6805 C  C     . SER F 3 265 ? 28.139  -53.019 -44.665 1.00 18.43  ? 242  SER B C     1 
ATOM   6806 O  O     . SER F 3 265 ? 29.023  -52.927 -45.517 1.00 19.07  ? 242  SER B O     1 
ATOM   6807 C  CB    . SER F 3 265 ? 27.335  -55.361 -44.275 1.00 14.50  ? 242  SER B CB    1 
ATOM   6808 O  OG    . SER F 3 265 ? 26.041  -54.963 -44.677 1.00 15.01  ? 242  SER B OG    1 
ATOM   6809 N  N     . GLN F 3 266 ? 27.154  -52.132 -44.541 1.00 19.34  ? 243  GLN B N     1 
ATOM   6810 C  CA    . GLN F 3 266 ? 27.063  -50.957 -45.407 1.00 20.12  ? 243  GLN B CA    1 
ATOM   6811 C  C     . GLN F 3 266 ? 28.246  -50.047 -45.087 1.00 20.33  ? 243  GLN B C     1 
ATOM   6812 O  O     . GLN F 3 266 ? 29.067  -49.731 -45.951 1.00 18.40  ? 243  GLN B O     1 
ATOM   6813 C  CB    . GLN F 3 266 ? 25.758  -50.195 -45.141 1.00 23.99  ? 243  GLN B CB    1 
ATOM   6814 C  CG    . GLN F 3 266 ? 24.475  -50.903 -45.569 1.00 28.62  ? 243  GLN B CG    1 
ATOM   6815 C  CD    . GLN F 3 266 ? 24.331  -50.982 -47.074 1.00 32.60  ? 243  GLN B CD    1 
ATOM   6816 O  OE1   . GLN F 3 266 ? 24.493  -49.981 -47.774 1.00 36.78  ? 243  GLN B OE1   1 
ATOM   6817 N  NE2   . GLN F 3 266 ? 24.019  -52.171 -47.583 1.00 32.46  ? 243  GLN B NE2   1 
ATOM   6818 N  N     . VAL F 3 267 ? 28.319  -49.626 -43.830 1.00 20.86  ? 244  VAL B N     1 
ATOM   6819 C  CA    . VAL F 3 267 ? 29.394  -48.763 -43.366 1.00 21.80  ? 244  VAL B CA    1 
ATOM   6820 C  C     . VAL F 3 267 ? 30.741  -49.354 -43.769 1.00 22.88  ? 244  VAL B C     1 
ATOM   6821 O  O     . VAL F 3 267 ? 31.609  -48.662 -44.302 1.00 24.52  ? 244  VAL B O     1 
ATOM   6822 C  CB    . VAL F 3 267 ? 29.355  -48.622 -41.822 1.00 21.62  ? 244  VAL B CB    1 
ATOM   6823 C  CG1   . VAL F 3 267 ? 30.601  -47.905 -41.321 1.00 20.48  ? 244  VAL B CG1   1 
ATOM   6824 C  CG2   . VAL F 3 267 ? 28.099  -47.872 -41.402 1.00 20.51  ? 244  VAL B CG2   1 
ATOM   6825 N  N     . CYS F 3 268 ? 30.899  -50.646 -43.519 1.00 22.77  ? 245  CYS B N     1 
ATOM   6826 C  CA    . CYS F 3 268 ? 32.139  -51.337 -43.820 1.00 22.74  ? 245  CYS B CA    1 
ATOM   6827 C  C     . CYS F 3 268 ? 32.536  -51.279 -45.293 1.00 21.26  ? 245  CYS B C     1 
ATOM   6828 O  O     . CYS F 3 268 ? 33.705  -51.084 -45.612 1.00 20.45  ? 245  CYS B O     1 
ATOM   6829 C  CB    . CYS F 3 268 ? 32.035  -52.787 -43.359 1.00 24.12  ? 245  CYS B CB    1 
ATOM   6830 S  SG    . CYS F 3 268 ? 33.626  -53.564 -43.117 1.00 30.55  ? 245  CYS B SG    1 
ATOM   6831 N  N     . LYS F 3 269 ? 31.569  -51.450 -46.189 1.00 21.67  ? 246  LYS B N     1 
ATOM   6832 C  CA    . LYS F 3 269 ? 31.841  -51.407 -47.628 1.00 22.15  ? 246  LYS B CA    1 
ATOM   6833 C  C     . LYS F 3 269 ? 32.394  -50.046 -48.045 1.00 21.92  ? 246  LYS B C     1 
ATOM   6834 O  O     . LYS F 3 269 ? 33.320  -49.959 -48.848 1.00 19.73  ? 246  LYS B O     1 
ATOM   6835 C  CB    . LYS F 3 269 ? 30.566  -51.692 -48.418 1.00 23.04  ? 246  LYS B CB    1 
ATOM   6836 C  CG    . LYS F 3 269 ? 30.709  -51.511 -49.919 1.00 26.50  ? 246  LYS B CG    1 
ATOM   6837 C  CD    . LYS F 3 269 ? 31.637  -52.552 -50.530 1.00 31.96  ? 246  LYS B CD    1 
ATOM   6838 C  CE    . LYS F 3 269 ? 31.778  -52.345 -52.039 1.00 34.73  ? 246  LYS B CE    1 
ATOM   6839 N  NZ    . LYS F 3 269 ? 32.737  -53.308 -52.669 1.00 37.35  ? 246  LYS B NZ    1 
ATOM   6840 N  N     . GLY F 3 270 ? 31.810  -48.985 -47.499 1.00 22.89  ? 247  GLY B N     1 
ATOM   6841 C  CA    . GLY F 3 270 ? 32.269  -47.646 -47.815 1.00 21.72  ? 247  GLY B CA    1 
ATOM   6842 C  C     . GLY F 3 270 ? 33.725  -47.472 -47.434 1.00 21.83  ? 247  GLY B C     1 
ATOM   6843 O  O     . GLY F 3 270 ? 34.527  -46.982 -48.230 1.00 22.46  ? 247  GLY B O     1 
ATOM   6844 N  N     . ILE F 3 271 ? 34.070  -47.875 -46.214 1.00 20.91  ? 248  ILE B N     1 
ATOM   6845 C  CA    . ILE F 3 271 ? 35.443  -47.767 -45.739 1.00 20.60  ? 248  ILE B CA    1 
ATOM   6846 C  C     . ILE F 3 271 ? 36.387  -48.502 -46.680 1.00 21.60  ? 248  ILE B C     1 
ATOM   6847 O  O     . ILE F 3 271 ? 37.431  -47.980 -47.062 1.00 21.50  ? 248  ILE B O     1 
ATOM   6848 C  CB    . ILE F 3 271 ? 35.605  -48.367 -44.333 1.00 19.23  ? 248  ILE B CB    1 
ATOM   6849 C  CG1   . ILE F 3 271 ? 34.711  -47.621 -43.344 1.00 20.34  ? 248  ILE B CG1   1 
ATOM   6850 C  CG2   . ILE F 3 271 ? 37.060  -48.285 -43.899 1.00 17.61  ? 248  ILE B CG2   1 
ATOM   6851 C  CD1   . ILE F 3 271 ? 34.886  -48.062 -41.902 1.00 21.49  ? 248  ILE B CD1   1 
ATOM   6852 N  N     . ARG F 3 272 ? 36.014  -49.718 -47.055 1.00 22.30  ? 249  ARG B N     1 
ATOM   6853 C  CA    . ARG F 3 272 ? 36.848  -50.503 -47.947 1.00 24.40  ? 249  ARG B CA    1 
ATOM   6854 C  C     . ARG F 3 272 ? 36.962  -49.871 -49.325 1.00 26.64  ? 249  ARG B C     1 
ATOM   6855 O  O     . ARG F 3 272 ? 37.930  -50.121 -50.042 1.00 28.39  ? 249  ARG B O     1 
ATOM   6856 C  CB    . ARG F 3 272 ? 36.312  -51.931 -48.054 1.00 23.37  ? 249  ARG B CB    1 
ATOM   6857 C  CG    . ARG F 3 272 ? 36.555  -52.747 -46.795 1.00 22.37  ? 249  ARG B CG    1 
ATOM   6858 C  CD    . ARG F 3 272 ? 35.935  -54.121 -46.888 1.00 22.31  ? 249  ARG B CD    1 
ATOM   6859 N  NE    . ARG F 3 272 ? 36.368  -54.840 -48.079 1.00 21.55  ? 249  ARG B NE    1 
ATOM   6860 C  CZ    . ARG F 3 272 ? 35.555  -55.198 -49.066 1.00 22.63  ? 249  ARG B CZ    1 
ATOM   6861 N  NH1   . ARG F 3 272 ? 34.264  -54.900 -49.000 1.00 23.32  ? 249  ARG B NH1   1 
ATOM   6862 N  NH2   . ARG F 3 272 ? 36.029  -55.854 -50.117 1.00 24.67  ? 249  ARG B NH2   1 
ATOM   6863 N  N     . ASP F 3 273 ? 35.981  -49.052 -49.697 1.00 27.50  ? 250  ASP B N     1 
ATOM   6864 C  CA    . ASP F 3 273 ? 36.029  -48.391 -50.994 1.00 27.89  ? 250  ASP B CA    1 
ATOM   6865 C  C     . ASP F 3 273 ? 36.968  -47.197 -50.925 1.00 29.04  ? 250  ASP B C     1 
ATOM   6866 O  O     . ASP F 3 273 ? 37.643  -46.878 -51.904 1.00 31.80  ? 250  ASP B O     1 
ATOM   6867 C  CB    . ASP F 3 273 ? 34.636  -47.942 -51.443 1.00 28.46  ? 250  ASP B CB    1 
ATOM   6868 C  CG    . ASP F 3 273 ? 33.769  -49.105 -51.908 1.00 30.98  ? 250  ASP B CG    1 
ATOM   6869 O  OD1   . ASP F 3 273 ? 34.337  -50.116 -52.380 1.00 31.05  ? 250  ASP B OD1   1 
ATOM   6870 O  OD2   . ASP F 3 273 ? 32.523  -49.004 -51.818 1.00 29.76  ? 250  ASP B OD2   1 
ATOM   6871 N  N     . SER F 3 274 ? 37.021  -46.542 -49.769 1.00 28.24  ? 251  SER B N     1 
ATOM   6872 C  CA    . SER F 3 274 ? 37.911  -45.397 -49.601 1.00 28.02  ? 251  SER B CA    1 
ATOM   6873 C  C     . SER F 3 274 ? 39.342  -45.858 -49.821 1.00 26.63  ? 251  SER B C     1 
ATOM   6874 O  O     . SER F 3 274 ? 40.103  -45.222 -50.542 1.00 26.96  ? 251  SER B O     1 
ATOM   6875 C  CB    . SER F 3 274 ? 37.781  -44.805 -48.198 1.00 29.71  ? 251  SER B CB    1 
ATOM   6876 O  OG    . SER F 3 274 ? 36.483  -44.279 -47.988 1.00 36.59  ? 251  SER B OG    1 
ATOM   6877 N  N     . ILE F 3 275 ? 39.698  -46.974 -49.197 1.00 26.31  ? 252  ILE B N     1 
ATOM   6878 C  CA    . ILE F 3 275 ? 41.035  -47.530 -49.324 1.00 26.79  ? 252  ILE B CA    1 
ATOM   6879 C  C     . ILE F 3 275 ? 41.360  -47.871 -50.770 1.00 28.33  ? 252  ILE B C     1 
ATOM   6880 O  O     . ILE F 3 275 ? 42.509  -47.769 -51.198 1.00 27.96  ? 252  ILE B O     1 
ATOM   6881 C  CB    . ILE F 3 275 ? 41.180  -48.794 -48.467 1.00 25.48  ? 252  ILE B CB    1 
ATOM   6882 C  CG1   . ILE F 3 275 ? 41.209  -48.401 -46.995 1.00 25.26  ? 252  ILE B CG1   1 
ATOM   6883 C  CG2   . ILE F 3 275 ? 42.439  -49.553 -48.843 1.00 26.05  ? 252  ILE B CG2   1 
ATOM   6884 C  CD1   . ILE F 3 275 ? 41.311  -49.566 -46.075 1.00 25.49  ? 252  ILE B CD1   1 
ATOM   6885 N  N     . LYS F 3 276 ? 40.343  -48.271 -51.524 1.00 30.65  ? 253  LYS B N     1 
ATOM   6886 C  CA    . LYS F 3 276 ? 40.538  -48.625 -52.921 1.00 33.66  ? 253  LYS B CA    1 
ATOM   6887 C  C     . LYS F 3 276 ? 40.714  -47.373 -53.780 1.00 35.39  ? 253  LYS B C     1 
ATOM   6888 O  O     . LYS F 3 276 ? 41.460  -47.384 -54.760 1.00 36.76  ? 253  LYS B O     1 
ATOM   6889 C  CB    . LYS F 3 276 ? 39.353  -49.450 -53.424 1.00 33.87  ? 253  LYS B CB    1 
ATOM   6890 C  CG    . LYS F 3 276 ? 39.586  -50.099 -54.774 1.00 37.16  ? 253  LYS B CG    1 
ATOM   6891 C  CD    . LYS F 3 276 ? 38.378  -50.912 -55.201 1.00 41.94  ? 253  LYS B CD    1 
ATOM   6892 C  CE    . LYS F 3 276 ? 38.553  -51.484 -56.601 1.00 45.17  ? 253  LYS B CE    1 
ATOM   6893 N  NZ    . LYS F 3 276 ? 37.325  -52.199 -57.060 1.00 48.12  ? 253  LYS B NZ    1 
ATOM   6894 N  N     . ASP F 3 277 ? 40.038  -46.290 -53.408 1.00 35.60  ? 254  ASP B N     1 
ATOM   6895 C  CA    . ASP F 3 277 ? 40.146  -45.047 -54.163 1.00 36.47  ? 254  ASP B CA    1 
ATOM   6896 C  C     . ASP F 3 277 ? 41.398  -44.256 -53.798 1.00 34.50  ? 254  ASP B C     1 
ATOM   6897 O  O     . ASP F 3 277 ? 41.965  -43.558 -54.636 1.00 35.31  ? 254  ASP B O     1 
ATOM   6898 C  CB    . ASP F 3 277 ? 38.916  -44.164 -53.932 1.00 39.97  ? 254  ASP B CB    1 
ATOM   6899 C  CG    . ASP F 3 277 ? 37.625  -44.862 -54.295 1.00 45.40  ? 254  ASP B CG    1 
ATOM   6900 O  OD1   . ASP F 3 277 ? 37.656  -45.720 -55.207 1.00 49.09  ? 254  ASP B OD1   1 
ATOM   6901 O  OD2   . ASP F 3 277 ? 36.579  -44.547 -53.681 1.00 46.34  ? 254  ASP B OD2   1 
ATOM   6902 N  N     . ILE F 3 278 ? 41.832  -44.373 -52.550 1.00 31.10  ? 255  ILE B N     1 
ATOM   6903 C  CA    . ILE F 3 278 ? 43.002  -43.644 -52.086 1.00 28.11  ? 255  ILE B CA    1 
ATOM   6904 C  C     . ILE F 3 278 ? 44.316  -44.409 -52.257 1.00 28.16  ? 255  ILE B C     1 
ATOM   6905 O  O     . ILE F 3 278 ? 45.361  -43.801 -52.474 1.00 29.94  ? 255  ILE B O     1 
ATOM   6906 C  CB    . ILE F 3 278 ? 42.847  -43.254 -50.596 1.00 26.40  ? 255  ILE B CB    1 
ATOM   6907 C  CG1   . ILE F 3 278 ? 41.542  -42.489 -50.392 1.00 23.76  ? 255  ILE B CG1   1 
ATOM   6908 C  CG2   . ILE F 3 278 ? 44.020  -42.395 -50.149 1.00 24.94  ? 255  ILE B CG2   1 
ATOM   6909 C  CD1   . ILE F 3 278 ? 41.269  -42.142 -48.948 1.00 23.92  ? 255  ILE B CD1   1 
ATOM   6910 N  N     . LEU F 3 279 ? 44.277  -45.734 -52.170 1.00 25.25  ? 256  LEU B N     1 
ATOM   6911 C  CA    . LEU F 3 279 ? 45.508  -46.507 -52.303 1.00 23.02  ? 256  LEU B CA    1 
ATOM   6912 C  C     . LEU F 3 279 ? 45.475  -47.561 -53.409 1.00 23.20  ? 256  LEU B C     1 
ATOM   6913 O  O     . LEU F 3 279 ? 46.504  -48.144 -53.748 1.00 22.96  ? 256  LEU B O     1 
ATOM   6914 C  CB    . LEU F 3 279 ? 45.839  -47.165 -50.962 1.00 20.88  ? 256  LEU B CB    1 
ATOM   6915 C  CG    . LEU F 3 279 ? 45.705  -46.239 -49.747 1.00 19.54  ? 256  LEU B CG    1 
ATOM   6916 C  CD1   . LEU F 3 279 ? 46.082  -47.000 -48.488 1.00 19.39  ? 256  LEU B CD1   1 
ATOM   6917 C  CD2   . LEU F 3 279 ? 46.590  -45.015 -49.917 1.00 17.51  ? 256  LEU B CD2   1 
ATOM   6918 N  N     . GLY F 3 280 ? 44.296  -47.806 -53.969 1.00 22.68  ? 257  GLY B N     1 
ATOM   6919 C  CA    . GLY F 3 280 ? 44.174  -48.790 -55.030 1.00 22.88  ? 257  GLY B CA    1 
ATOM   6920 C  C     . GLY F 3 280 ? 44.325  -50.224 -54.561 1.00 23.92  ? 257  GLY B C     1 
ATOM   6921 O  O     . GLY F 3 280 ? 44.401  -51.152 -55.373 1.00 24.87  ? 257  GLY B O     1 
ATOM   6922 N  N     . TYR F 3 281 ? 44.370  -50.409 -53.246 1.00 23.69  ? 258  TYR B N     1 
ATOM   6923 C  CA    . TYR F 3 281 ? 44.506  -51.734 -52.657 1.00 22.92  ? 258  TYR B CA    1 
ATOM   6924 C  C     . TYR F 3 281 ? 43.142  -52.402 -52.507 1.00 23.29  ? 258  TYR B C     1 
ATOM   6925 O  O     . TYR F 3 281 ? 42.152  -51.741 -52.198 1.00 22.91  ? 258  TYR B O     1 
ATOM   6926 C  CB    . TYR F 3 281 ? 45.183  -51.621 -51.290 1.00 21.71  ? 258  TYR B CB    1 
ATOM   6927 C  CG    . TYR F 3 281 ? 46.592  -51.083 -51.358 1.00 22.18  ? 258  TYR B CG    1 
ATOM   6928 C  CD1   . TYR F 3 281 ? 47.192  -50.505 -50.244 1.00 22.96  ? 258  TYR B CD1   1 
ATOM   6929 C  CD2   . TYR F 3 281 ? 47.331  -51.162 -52.538 1.00 23.30  ? 258  TYR B CD2   1 
ATOM   6930 C  CE1   . TYR F 3 281 ? 48.496  -50.014 -50.302 1.00 24.40  ? 258  TYR B CE1   1 
ATOM   6931 C  CE2   . TYR F 3 281 ? 48.630  -50.679 -52.609 1.00 24.03  ? 258  TYR B CE2   1 
ATOM   6932 C  CZ    . TYR F 3 281 ? 49.208  -50.105 -51.490 1.00 24.83  ? 258  TYR B CZ    1 
ATOM   6933 O  OH    . TYR F 3 281 ? 50.493  -49.616 -51.570 1.00 25.81  ? 258  TYR B OH    1 
ATOM   6934 N  N     . THR F 3 282 ? 43.102  -53.712 -52.742 1.00 23.70  ? 259  THR B N     1 
ATOM   6935 C  CA    . THR F 3 282 ? 41.872  -54.494 -52.623 1.00 22.50  ? 259  THR B CA    1 
ATOM   6936 C  C     . THR F 3 282 ? 41.917  -55.306 -51.338 1.00 21.54  ? 259  THR B C     1 
ATOM   6937 O  O     . THR F 3 282 ? 42.970  -55.820 -50.961 1.00 21.56  ? 259  THR B O     1 
ATOM   6938 C  CB    . THR F 3 282 ? 41.701  -55.475 -53.800 1.00 23.20  ? 259  THR B CB    1 
ATOM   6939 O  OG1   . THR F 3 282 ? 42.870  -56.301 -53.911 1.00 23.75  ? 259  THR B OG1   1 
ATOM   6940 C  CG2   . THR F 3 282 ? 41.482  -54.715 -55.101 1.00 24.02  ? 259  THR B CG2   1 
ATOM   6941 N  N     . THR F 3 283 ? 40.775  -55.434 -50.672 1.00 21.34  ? 260  THR B N     1 
ATOM   6942 C  CA    . THR F 3 283 ? 40.724  -56.181 -49.423 1.00 22.04  ? 260  THR B CA    1 
ATOM   6943 C  C     . THR F 3 283 ? 39.538  -57.133 -49.312 1.00 21.67  ? 260  THR B C     1 
ATOM   6944 O  O     . THR F 3 283 ? 38.560  -57.017 -50.049 1.00 21.18  ? 260  THR B O     1 
ATOM   6945 C  CB    . THR F 3 283 ? 40.663  -55.225 -48.221 1.00 22.05  ? 260  THR B CB    1 
ATOM   6946 O  OG1   . THR F 3 283 ? 39.421  -54.511 -48.244 1.00 23.94  ? 260  THR B OG1   1 
ATOM   6947 C  CG2   . THR F 3 283 ? 41.802  -54.227 -48.280 1.00 23.13  ? 260  THR B CG2   1 
ATOM   6948 N  N     . SER F 3 284 ? 39.658  -58.079 -48.381 1.00 22.12  ? 261  SER B N     1 
ATOM   6949 C  CA    . SER F 3 284 ? 38.616  -59.058 -48.076 1.00 21.64  ? 261  SER B CA    1 
ATOM   6950 C  C     . SER F 3 284 ? 38.199  -58.729 -46.649 1.00 22.22  ? 261  SER B C     1 
ATOM   6951 O  O     . SER F 3 284 ? 39.047  -58.482 -45.792 1.00 22.40  ? 261  SER B O     1 
ATOM   6952 C  CB    . SER F 3 284 ? 39.163  -60.484 -48.122 1.00 21.44  ? 261  SER B CB    1 
ATOM   6953 O  OG    . SER F 3 284 ? 39.614  -60.824 -49.417 1.00 24.10  ? 261  SER B OG    1 
ATOM   6954 N  N     . CYS F 3 285 ? 36.900  -58.726 -46.389 1.00 21.86  ? 262  CYS B N     1 
ATOM   6955 C  CA    . CYS F 3 285 ? 36.411  -58.388 -45.062 1.00 21.62  ? 262  CYS B CA    1 
ATOM   6956 C  C     . CYS F 3 285 ? 35.396  -59.386 -44.524 1.00 23.19  ? 262  CYS B C     1 
ATOM   6957 O  O     . CYS F 3 285 ? 34.706  -60.062 -45.289 1.00 24.23  ? 262  CYS B O     1 
ATOM   6958 C  CB    . CYS F 3 285 ? 35.801  -56.989 -45.103 1.00 21.63  ? 262  CYS B CB    1 
ATOM   6959 S  SG    . CYS F 3 285 ? 34.858  -56.521 -43.653 1.00 22.93  ? 262  CYS B SG    1 
ATOM   6960 N  N     . GLY F 3 286 ? 35.316  -59.476 -43.199 1.00 23.42  ? 263  GLY B N     1 
ATOM   6961 C  CA    . GLY F 3 286 ? 34.377  -60.384 -42.565 1.00 23.35  ? 263  GLY B CA    1 
ATOM   6962 C  C     . GLY F 3 286 ? 33.664  -59.737 -41.391 1.00 23.05  ? 263  GLY B C     1 
ATOM   6963 O  O     . GLY F 3 286 ? 34.300  -59.116 -40.543 1.00 23.63  ? 263  GLY B O     1 
ATOM   6964 N  N     . LEU F 3 287 ? 32.342  -59.875 -41.341 1.00 22.89  ? 264  LEU B N     1 
ATOM   6965 C  CA    . LEU F 3 287 ? 31.560  -59.296 -40.255 1.00 23.27  ? 264  LEU B CA    1 
ATOM   6966 C  C     . LEU F 3 287 ? 30.810  -60.334 -39.438 1.00 23.61  ? 264  LEU B C     1 
ATOM   6967 O  O     . LEU F 3 287 ? 30.268  -61.298 -39.975 1.00 24.68  ? 264  LEU B O     1 
ATOM   6968 C  CB    . LEU F 3 287 ? 30.557  -58.263 -40.784 1.00 22.90  ? 264  LEU B CB    1 
ATOM   6969 C  CG    . LEU F 3 287 ? 31.102  -56.887 -41.172 1.00 22.80  ? 264  LEU B CG    1 
ATOM   6970 C  CD1   . LEU F 3 287 ? 31.805  -56.969 -42.514 1.00 22.12  ? 264  LEU B CD1   1 
ATOM   6971 C  CD2   . LEU F 3 287 ? 29.960  -55.892 -41.241 1.00 23.36  ? 264  LEU B CD2   1 
ATOM   6972 N  N     . SER F 3 288 ? 30.789  -60.114 -38.130 1.00 24.81  ? 265  SER B N     1 
ATOM   6973 C  CA    . SER F 3 288 ? 30.112  -60.988 -37.182 1.00 26.15  ? 265  SER B CA    1 
ATOM   6974 C  C     . SER F 3 288 ? 30.244  -60.328 -35.819 1.00 26.98  ? 265  SER B C     1 
ATOM   6975 O  O     . SER F 3 288 ? 30.784  -59.226 -35.710 1.00 27.21  ? 265  SER B O     1 
ATOM   6976 C  CB    . SER F 3 288 ? 30.753  -62.382 -37.155 1.00 27.24  ? 265  SER B CB    1 
ATOM   6977 O  OG    . SER F 3 288 ? 32.080  -62.342 -36.658 1.00 28.24  ? 265  SER B OG    1 
ATOM   6978 N  N     . SER F 3 289 ? 29.766  -61.002 -34.781 1.00 27.58  ? 266  SER B N     1 
ATOM   6979 C  CA    . SER F 3 289 ? 29.824  -60.447 -33.437 1.00 27.17  ? 266  SER B CA    1 
ATOM   6980 C  C     . SER F 3 289 ? 31.053  -60.858 -32.632 1.00 28.54  ? 266  SER B C     1 
ATOM   6981 O  O     . SER F 3 289 ? 31.126  -60.586 -31.433 1.00 30.50  ? 266  SER B O     1 
ATOM   6982 C  CB    . SER F 3 289 ? 28.559  -60.831 -32.679 1.00 25.77  ? 266  SER B CB    1 
ATOM   6983 O  OG    . SER F 3 289 ? 28.290  -62.210 -32.844 1.00 26.79  ? 266  SER B OG    1 
ATOM   6984 N  N     . THR F 3 290 ? 32.021  -61.502 -33.280 1.00 28.19  ? 267  THR B N     1 
ATOM   6985 C  CA    . THR F 3 290 ? 33.236  -61.925 -32.587 1.00 27.54  ? 267  THR B CA    1 
ATOM   6986 C  C     . THR F 3 290 ? 34.477  -61.790 -33.461 1.00 26.50  ? 267  THR B C     1 
ATOM   6987 O  O     . THR F 3 290 ? 34.447  -62.105 -34.646 1.00 26.76  ? 267  THR B O     1 
ATOM   6988 C  CB    . THR F 3 290 ? 33.143  -63.393 -32.123 1.00 28.02  ? 267  THR B CB    1 
ATOM   6989 O  OG1   . THR F 3 290 ? 33.067  -64.254 -33.264 1.00 31.09  ? 267  THR B OG1   1 
ATOM   6990 C  CG2   . THR F 3 290 ? 31.916  -63.604 -31.268 1.00 30.07  ? 267  THR B CG2   1 
ATOM   6991 N  N     . LYS F 3 291 ? 35.570  -61.322 -32.870 1.00 25.68  ? 268  LYS B N     1 
ATOM   6992 C  CA    . LYS F 3 291 ? 36.813  -61.170 -33.611 1.00 25.70  ? 268  LYS B CA    1 
ATOM   6993 C  C     . LYS F 3 291 ? 37.171  -62.485 -34.289 1.00 24.73  ? 268  LYS B C     1 
ATOM   6994 O  O     . LYS F 3 291 ? 37.637  -62.507 -35.432 1.00 22.50  ? 268  LYS B O     1 
ATOM   6995 C  CB    . LYS F 3 291 ? 37.950  -60.768 -32.669 1.00 26.66  ? 268  LYS B CB    1 
ATOM   6996 C  CG    . LYS F 3 291 ? 37.933  -59.313 -32.252 1.00 29.98  ? 268  LYS B CG    1 
ATOM   6997 C  CD    . LYS F 3 291 ? 39.049  -59.001 -31.262 1.00 32.67  ? 268  LYS B CD    1 
ATOM   6998 C  CE    . LYS F 3 291 ? 40.429  -59.206 -31.862 1.00 35.08  ? 268  LYS B CE    1 
ATOM   6999 N  NZ    . LYS F 3 291 ? 41.503  -58.962 -30.851 1.00 36.22  ? 268  LYS B NZ    1 
ATOM   7000 N  N     . ASN F 3 292 ? 36.941  -63.579 -33.575 1.00 24.03  ? 269  ASN B N     1 
ATOM   7001 C  CA    . ASN F 3 292 ? 37.258  -64.901 -34.084 1.00 24.08  ? 269  ASN B CA    1 
ATOM   7002 C  C     . ASN F 3 292 ? 36.567  -65.237 -35.392 1.00 22.77  ? 269  ASN B C     1 
ATOM   7003 O  O     . ASN F 3 292 ? 37.222  -65.598 -36.371 1.00 21.71  ? 269  ASN B O     1 
ATOM   7004 C  CB    . ASN F 3 292 ? 36.905  -65.960 -33.050 1.00 28.26  ? 269  ASN B CB    1 
ATOM   7005 C  CG    . ASN F 3 292 ? 38.051  -66.906 -32.788 1.00 33.21  ? 269  ASN B CG    1 
ATOM   7006 O  OD1   . ASN F 3 292 ? 39.070  -66.516 -32.209 1.00 35.31  ? 269  ASN B OD1   1 
ATOM   7007 N  ND2   . ASN F 3 292 ? 37.904  -68.156 -33.227 1.00 34.50  ? 269  ASN B ND2   1 
ATOM   7008 N  N     . VAL F 3 293 ? 35.243  -65.134 -35.408 1.00 20.68  ? 270  VAL B N     1 
ATOM   7009 C  CA    . VAL F 3 293 ? 34.498  -65.447 -36.615 1.00 19.59  ? 270  VAL B CA    1 
ATOM   7010 C  C     . VAL F 3 293 ? 34.881  -64.488 -37.740 1.00 20.68  ? 270  VAL B C     1 
ATOM   7011 O  O     . VAL F 3 293 ? 34.893  -64.871 -38.907 1.00 22.13  ? 270  VAL B O     1 
ATOM   7012 C  CB    . VAL F 3 293 ? 32.977  -65.398 -36.357 1.00 18.17  ? 270  VAL B CB    1 
ATOM   7013 C  CG1   . VAL F 3 293 ? 32.213  -65.702 -37.636 1.00 17.92  ? 270  VAL B CG1   1 
ATOM   7014 C  CG2   . VAL F 3 293 ? 32.609  -66.416 -35.294 1.00 15.91  ? 270  VAL B CG2   1 
ATOM   7015 N  N     . CYS F 3 294 ? 35.211  -63.249 -37.390 1.00 20.79  ? 271  CYS B N     1 
ATOM   7016 C  CA    . CYS F 3 294 ? 35.610  -62.260 -38.387 1.00 21.93  ? 271  CYS B CA    1 
ATOM   7017 C  C     . CYS F 3 294 ? 36.840  -62.731 -39.146 1.00 22.48  ? 271  CYS B C     1 
ATOM   7018 O  O     . CYS F 3 294 ? 36.866  -62.735 -40.375 1.00 23.03  ? 271  CYS B O     1 
ATOM   7019 C  CB    . CYS F 3 294 ? 35.917  -60.924 -37.720 1.00 21.85  ? 271  CYS B CB    1 
ATOM   7020 S  SG    . CYS F 3 294 ? 34.467  -60.084 -37.095 1.00 28.20  ? 271  CYS B SG    1 
ATOM   7021 N  N     . LYS F 3 295 ? 37.866  -63.118 -38.401 1.00 23.51  ? 272  LYS B N     1 
ATOM   7022 C  CA    . LYS F 3 295 ? 39.102  -63.597 -38.998 1.00 24.46  ? 272  LYS B CA    1 
ATOM   7023 C  C     . LYS F 3 295 ? 38.758  -64.667 -40.031 1.00 24.50  ? 272  LYS B C     1 
ATOM   7024 O  O     . LYS F 3 295 ? 39.166  -64.582 -41.186 1.00 24.71  ? 272  LYS B O     1 
ATOM   7025 C  CB    . LYS F 3 295 ? 39.998  -64.191 -37.912 1.00 26.36  ? 272  LYS B CB    1 
ATOM   7026 C  CG    . LYS F 3 295 ? 41.435  -64.424 -38.331 1.00 27.79  ? 272  LYS B CG    1 
ATOM   7027 C  CD    . LYS F 3 295 ? 42.164  -63.108 -38.514 1.00 30.45  ? 272  LYS B CD    1 
ATOM   7028 C  CE    . LYS F 3 295 ? 43.647  -63.333 -38.746 1.00 31.29  ? 272  LYS B CE    1 
ATOM   7029 N  NZ    . LYS F 3 295 ? 43.893  -64.183 -39.943 1.00 32.81  ? 272  LYS B NZ    1 
ATOM   7030 N  N     . LEU F 3 296 ? 37.993  -65.669 -39.605 1.00 24.61  ? 273  LEU B N     1 
ATOM   7031 C  CA    . LEU F 3 296 ? 37.588  -66.761 -40.485 1.00 23.42  ? 273  LEU B CA    1 
ATOM   7032 C  C     . LEU F 3 296 ? 36.749  -66.261 -41.654 1.00 23.84  ? 273  LEU B C     1 
ATOM   7033 O  O     . LEU F 3 296 ? 36.901  -66.732 -42.778 1.00 26.00  ? 273  LEU B O     1 
ATOM   7034 C  CB    . LEU F 3 296 ? 36.781  -67.812 -39.711 1.00 21.79  ? 273  LEU B CB    1 
ATOM   7035 C  CG    . LEU F 3 296 ? 37.413  -68.588 -38.552 1.00 19.09  ? 273  LEU B CG    1 
ATOM   7036 C  CD1   . LEU F 3 296 ? 36.414  -69.631 -38.064 1.00 16.40  ? 273  LEU B CD1   1 
ATOM   7037 C  CD2   . LEU F 3 296 ? 38.698  -69.260 -38.996 1.00 14.81  ? 273  LEU B CD2   1 
ATOM   7038 N  N     . ALA F 3 297 ? 35.865  -65.306 -41.384 1.00 23.42  ? 274  ALA B N     1 
ATOM   7039 C  CA    . ALA F 3 297 ? 34.988  -64.756 -42.412 1.00 23.74  ? 274  ALA B CA    1 
ATOM   7040 C  C     . ALA F 3 297 ? 35.713  -63.992 -43.517 1.00 24.62  ? 274  ALA B C     1 
ATOM   7041 O  O     . ALA F 3 297 ? 35.380  -64.146 -44.691 1.00 25.62  ? 274  ALA B O     1 
ATOM   7042 C  CB    . ALA F 3 297 ? 33.935  -63.856 -41.771 1.00 22.11  ? 274  ALA B CB    1 
ATOM   7043 N  N     . SER F 3 298 ? 36.698  -63.175 -43.148 1.00 24.46  ? 275  SER B N     1 
ATOM   7044 C  CA    . SER F 3 298 ? 37.440  -62.383 -44.129 1.00 24.57  ? 275  SER B CA    1 
ATOM   7045 C  C     . SER F 3 298 ? 38.356  -63.218 -45.013 1.00 25.23  ? 275  SER B C     1 
ATOM   7046 O  O     . SER F 3 298 ? 38.855  -62.737 -46.028 1.00 25.29  ? 275  SER B O     1 
ATOM   7047 C  CB    . SER F 3 298 ? 38.271  -61.300 -43.433 1.00 25.04  ? 275  SER B CB    1 
ATOM   7048 O  OG    . SER F 3 298 ? 39.352  -61.859 -42.709 1.00 24.57  ? 275  SER B OG    1 
ATOM   7049 N  N     . ASN F 3 299 ? 38.578  -64.467 -44.632 1.00 26.18  ? 276  ASN B N     1 
ATOM   7050 C  CA    . ASN F 3 299 ? 39.442  -65.337 -45.415 1.00 28.73  ? 276  ASN B CA    1 
ATOM   7051 C  C     . ASN F 3 299 ? 38.609  -66.268 -46.289 1.00 29.57  ? 276  ASN B C     1 
ATOM   7052 O  O     . ASN F 3 299 ? 39.096  -66.824 -47.273 1.00 29.89  ? 276  ASN B O     1 
ATOM   7053 C  CB    . ASN F 3 299 ? 40.334  -66.155 -44.485 1.00 30.81  ? 276  ASN B CB    1 
ATOM   7054 C  CG    . ASN F 3 299 ? 41.490  -66.801 -45.212 1.00 33.15  ? 276  ASN B CG    1 
ATOM   7055 O  OD1   . ASN F 3 299 ? 41.298  -67.647 -46.084 1.00 35.54  ? 276  ASN B OD1   1 
ATOM   7056 N  ND2   . ASN F 3 299 ? 42.705  -66.399 -44.861 1.00 35.73  ? 276  ASN B ND2   1 
ATOM   7057 N  N     . TYR F 3 300 ? 37.342  -66.420 -45.923 1.00 30.40  ? 277  TYR B N     1 
ATOM   7058 C  CA    . TYR F 3 300 ? 36.420  -67.285 -46.643 1.00 30.67  ? 277  TYR B CA    1 
ATOM   7059 C  C     . TYR F 3 300 ? 36.370  -67.033 -48.150 1.00 31.47  ? 277  TYR B C     1 
ATOM   7060 O  O     . TYR F 3 300 ? 36.073  -67.944 -48.921 1.00 31.99  ? 277  TYR B O     1 
ATOM   7061 C  CB    . TYR F 3 300 ? 35.018  -67.136 -46.058 1.00 30.04  ? 277  TYR B CB    1 
ATOM   7062 C  CG    . TYR F 3 300 ? 34.034  -68.131 -46.609 1.00 29.68  ? 277  TYR B CG    1 
ATOM   7063 C  CD1   . TYR F 3 300 ? 34.095  -69.472 -46.242 1.00 28.83  ? 277  TYR B CD1   1 
ATOM   7064 C  CD2   . TYR F 3 300 ? 33.053  -67.737 -47.515 1.00 31.05  ? 277  TYR B CD2   1 
ATOM   7065 C  CE1   . TYR F 3 300 ? 33.203  -70.399 -46.761 1.00 31.36  ? 277  TYR B CE1   1 
ATOM   7066 C  CE2   . TYR F 3 300 ? 32.155  -68.655 -48.043 1.00 33.44  ? 277  TYR B CE2   1 
ATOM   7067 C  CZ    . TYR F 3 300 ? 32.235  -69.985 -47.663 1.00 33.52  ? 277  TYR B CZ    1 
ATOM   7068 O  OH    . TYR F 3 300 ? 31.354  -70.902 -48.193 1.00 35.29  ? 277  TYR B OH    1 
ATOM   7069 N  N     . LYS F 3 301 ? 36.648  -65.805 -48.575 1.00 32.64  ? 278  LYS B N     1 
ATOM   7070 C  CA    . LYS F 3 301 ? 36.618  -65.492 -50.001 1.00 34.73  ? 278  LYS B CA    1 
ATOM   7071 C  C     . LYS F 3 301 ? 37.506  -64.305 -50.365 1.00 36.75  ? 278  LYS B C     1 
ATOM   7072 O  O     . LYS F 3 301 ? 37.450  -63.251 -49.730 1.00 38.54  ? 278  LYS B O     1 
ATOM   7073 C  CB    . LYS F 3 301 ? 35.179  -65.219 -50.449 1.00 33.56  ? 278  LYS B CB    1 
ATOM   7074 C  CG    . LYS F 3 301 ? 35.021  -64.984 -51.950 1.00 33.45  ? 278  LYS B CG    1 
ATOM   7075 C  CD    . LYS F 3 301 ? 33.562  -64.771 -52.340 1.00 32.12  ? 278  LYS B CD    1 
ATOM   7076 C  CE    . LYS F 3 301 ? 33.411  -64.555 -53.837 0.00 32.51  ? 278  LYS B CE    1 
ATOM   7077 N  NZ    . LYS F 3 301 ? 31.984  -64.388 -54.226 0.00 32.21  ? 278  LYS B NZ    1 
ATOM   7078 N  N     . LYS F 3 302 ? 38.325  -64.489 -51.395 1.00 36.73  ? 279  LYS B N     1 
ATOM   7079 C  CA    . LYS F 3 302 ? 39.230  -63.449 -51.871 1.00 37.35  ? 279  LYS B CA    1 
ATOM   7080 C  C     . LYS F 3 302 ? 39.070  -63.427 -53.389 1.00 39.19  ? 279  LYS B C     1 
ATOM   7081 O  O     . LYS F 3 302 ? 38.455  -64.329 -53.952 1.00 41.66  ? 279  LYS B O     1 
ATOM   7082 C  CB    . LYS F 3 302 ? 40.661  -63.817 -51.494 1.00 36.16  ? 279  LYS B CB    1 
ATOM   7083 C  CG    . LYS F 3 302 ? 40.800  -64.340 -50.074 1.00 34.13  ? 279  LYS B CG    1 
ATOM   7084 C  CD    . LYS F 3 302 ? 42.164  -64.974 -49.864 1.00 33.75  ? 279  LYS B CD    1 
ATOM   7085 C  CE    . LYS F 3 302 ? 42.214  -65.753 -48.564 1.00 34.68  ? 279  LYS B CE    1 
ATOM   7086 N  NZ    . LYS F 3 302 ? 43.516  -66.466 -48.420 1.00 36.74  ? 279  LYS B NZ    1 
ATOM   7087 N  N     . PRO F 3 303 ? 39.626  -62.419 -54.083 1.00 39.17  ? 280  PRO B N     1 
ATOM   7088 C  CA    . PRO F 3 303 ? 40.412  -61.249 -53.683 1.00 39.58  ? 280  PRO B CA    1 
ATOM   7089 C  C     . PRO F 3 303 ? 39.563  -60.167 -53.036 1.00 39.74  ? 280  PRO B C     1 
ATOM   7090 O  O     . PRO F 3 303 ? 39.863  -59.706 -51.936 1.00 41.38  ? 280  PRO B O     1 
ATOM   7091 C  CB    . PRO F 3 303 ? 41.016  -60.770 -55.002 1.00 40.32  ? 280  PRO B CB    1 
ATOM   7092 C  CG    . PRO F 3 303 ? 41.001  -61.989 -55.864 1.00 39.73  ? 280  PRO B CG    1 
ATOM   7093 C  CD    . PRO F 3 303 ? 39.663  -62.565 -55.544 1.00 39.88  ? 280  PRO B CD    1 
ATOM   7094 N  N     . ASP F 3 304 ? 38.517  -59.743 -53.734 1.00 38.57  ? 281  ASP B N     1 
ATOM   7095 C  CA    . ASP F 3 304 ? 37.625  -58.721 -53.201 1.00 38.63  ? 281  ASP B CA    1 
ATOM   7096 C  C     . ASP F 3 304 ? 36.666  -59.427 -52.257 1.00 38.00  ? 281  ASP B C     1 
ATOM   7097 O  O     . ASP F 3 304 ? 37.085  -60.222 -51.421 1.00 42.05  ? 281  ASP B O     1 
ATOM   7098 C  CB    . ASP F 3 304 ? 36.854  -58.058 -54.338 1.00 40.46  ? 281  ASP B CB    1 
ATOM   7099 C  CG    . ASP F 3 304 ? 37.197  -56.597 -54.491 1.00 43.02  ? 281  ASP B CG    1 
ATOM   7100 O  OD1   . ASP F 3 304 ? 36.788  -55.991 -55.503 1.00 43.87  ? 281  ASP B OD1   1 
ATOM   7101 O  OD2   . ASP F 3 304 ? 37.872  -56.051 -53.594 1.00 46.98  ? 281  ASP B OD2   1 
ATOM   7102 N  N     . ALA F 3 305 ? 35.381  -59.140 -52.378 1.00 35.07  ? 282  ALA B N     1 
ATOM   7103 C  CA    . ALA F 3 305 ? 34.392  -59.808 -51.543 1.00 32.46  ? 282  ALA B CA    1 
ATOM   7104 C  C     . ALA F 3 305 ? 34.443  -59.477 -50.061 1.00 29.40  ? 282  ALA B C     1 
ATOM   7105 O  O     . ALA F 3 305 ? 35.489  -59.152 -49.500 1.00 26.85  ? 282  ALA B O     1 
ATOM   7106 C  CB    . ALA F 3 305 ? 34.497  -61.319 -51.728 1.00 33.26  ? 282  ALA B CB    1 
ATOM   7107 N  N     . GLN F 3 306 ? 33.277  -59.599 -49.441 1.00 27.26  ? 283  GLN B N     1 
ATOM   7108 C  CA    . GLN F 3 306 ? 33.080  -59.326 -48.032 1.00 26.03  ? 283  GLN B CA    1 
ATOM   7109 C  C     . GLN F 3 306 ? 32.033  -60.323 -47.537 1.00 25.70  ? 283  GLN B C     1 
ATOM   7110 O  O     . GLN F 3 306 ? 30.895  -60.318 -48.003 1.00 26.08  ? 283  GLN B O     1 
ATOM   7111 C  CB    . GLN F 3 306 ? 32.586  -57.891 -47.884 1.00 24.53  ? 283  GLN B CB    1 
ATOM   7112 C  CG    . GLN F 3 306 ? 32.022  -57.535 -46.544 1.00 27.01  ? 283  GLN B CG    1 
ATOM   7113 C  CD    . GLN F 3 306 ? 31.515  -56.111 -46.522 1.00 29.17  ? 283  GLN B CD    1 
ATOM   7114 O  OE1   . GLN F 3 306 ? 32.292  -55.161 -46.619 1.00 31.23  ? 283  GLN B OE1   1 
ATOM   7115 N  NE2   . GLN F 3 306 ? 30.203  -55.953 -46.406 1.00 29.81  ? 283  GLN B NE2   1 
ATOM   7116 N  N     . THR F 3 307 ? 32.422  -61.184 -46.604 1.00 24.40  ? 284  THR B N     1 
ATOM   7117 C  CA    . THR F 3 307 ? 31.513  -62.196 -46.077 1.00 23.98  ? 284  THR B CA    1 
ATOM   7118 C  C     . THR F 3 307 ? 30.870  -61.799 -44.753 1.00 23.66  ? 284  THR B C     1 
ATOM   7119 O  O     . THR F 3 307 ? 31.532  -61.255 -43.869 1.00 24.35  ? 284  THR B O     1 
ATOM   7120 C  CB    . THR F 3 307 ? 32.244  -63.522 -45.876 1.00 25.08  ? 284  THR B CB    1 
ATOM   7121 O  OG1   . THR F 3 307 ? 32.972  -63.843 -47.066 1.00 29.46  ? 284  THR B OG1   1 
ATOM   7122 C  CG2   . THR F 3 307 ? 31.257  -64.628 -45.587 1.00 25.31  ? 284  THR B CG2   1 
ATOM   7123 N  N     . ILE F 3 308 ? 29.580  -62.093 -44.622 1.00 21.46  ? 285  ILE B N     1 
ATOM   7124 C  CA    . ILE F 3 308 ? 28.818  -61.769 -43.420 1.00 19.49  ? 285  ILE B CA    1 
ATOM   7125 C  C     . ILE F 3 308 ? 28.330  -63.043 -42.732 1.00 19.77  ? 285  ILE B C     1 
ATOM   7126 O  O     . ILE F 3 308 ? 27.763  -63.924 -43.374 1.00 21.02  ? 285  ILE B O     1 
ATOM   7127 C  CB    . ILE F 3 308 ? 27.596  -60.909 -43.780 1.00 19.59  ? 285  ILE B CB    1 
ATOM   7128 C  CG1   . ILE F 3 308 ? 28.051  -59.669 -44.554 1.00 20.65  ? 285  ILE B CG1   1 
ATOM   7129 C  CG2   . ILE F 3 308 ? 26.832  -60.535 -42.523 1.00 18.41  ? 285  ILE B CG2   1 
ATOM   7130 C  CD1   . ILE F 3 308 ? 26.918  -58.812 -45.078 1.00 19.83  ? 285  ILE B CD1   1 
ATOM   7131 N  N     . VAL F 3 309 ? 28.536  -63.137 -41.423 1.00 19.25  ? 286  VAL B N     1 
ATOM   7132 C  CA    . VAL F 3 309 ? 28.113  -64.320 -40.680 1.00 17.57  ? 286  VAL B CA    1 
ATOM   7133 C  C     . VAL F 3 309 ? 27.111  -63.984 -39.580 1.00 18.64  ? 286  VAL B C     1 
ATOM   7134 O  O     . VAL F 3 309 ? 27.488  -63.522 -38.507 1.00 19.55  ? 286  VAL B O     1 
ATOM   7135 C  CB    . VAL F 3 309 ? 29.324  -65.029 -40.052 1.00 16.26  ? 286  VAL B CB    1 
ATOM   7136 C  CG1   . VAL F 3 309 ? 28.875  -66.258 -39.296 1.00 16.61  ? 286  VAL B CG1   1 
ATOM   7137 C  CG2   . VAL F 3 309 ? 30.311  -65.416 -41.137 1.00 16.82  ? 286  VAL B CG2   1 
ATOM   7138 N  N     . LYS F 3 310 ? 25.831  -64.227 -39.852 1.00 20.75  ? 287  LYS B N     1 
ATOM   7139 C  CA    . LYS F 3 310 ? 24.776  -63.948 -38.882 1.00 20.15  ? 287  LYS B CA    1 
ATOM   7140 C  C     . LYS F 3 310 ? 24.932  -64.867 -37.687 1.00 21.20  ? 287  LYS B C     1 
ATOM   7141 O  O     . LYS F 3 310 ? 25.529  -65.935 -37.794 1.00 22.07  ? 287  LYS B O     1 
ATOM   7142 C  CB    . LYS F 3 310 ? 23.388  -64.179 -39.492 1.00 19.88  ? 287  LYS B CB    1 
ATOM   7143 C  CG    . LYS F 3 310 ? 23.107  -63.445 -40.795 1.00 20.72  ? 287  LYS B CG    1 
ATOM   7144 C  CD    . LYS F 3 310 ? 21.627  -63.104 -40.917 1.00 18.50  ? 287  LYS B CD    1 
ATOM   7145 C  CE    . LYS F 3 310 ? 20.753  -64.328 -40.737 1.00 18.72  ? 287  LYS B CE    1 
ATOM   7146 N  NZ    . LYS F 3 310 ? 19.376  -63.963 -40.296 1.00 17.83  ? 287  LYS B NZ    1 
ATOM   7147 N  N     . ASN F 3 311 ? 24.386  -64.461 -36.548 1.00 22.82  ? 288  ASN B N     1 
ATOM   7148 C  CA    . ASN F 3 311 ? 24.475  -65.284 -35.353 1.00 22.10  ? 288  ASN B CA    1 
ATOM   7149 C  C     . ASN F 3 311 ? 23.784  -66.620 -35.582 1.00 23.33  ? 288  ASN B C     1 
ATOM   7150 O  O     . ASN F 3 311 ? 24.322  -67.665 -35.225 1.00 25.44  ? 288  ASN B O     1 
ATOM   7151 C  CB    . ASN F 3 311 ? 23.860  -64.551 -34.163 1.00 19.87  ? 288  ASN B CB    1 
ATOM   7152 C  CG    . ASN F 3 311 ? 24.806  -63.526 -33.565 1.00 20.87  ? 288  ASN B CG    1 
ATOM   7153 O  OD1   . ASN F 3 311 ? 24.379  -62.489 -33.050 1.00 21.47  ? 288  ASN B OD1   1 
ATOM   7154 N  ND2   . ASN F 3 311 ? 26.102  -63.818 -33.619 1.00 18.41  ? 288  ASN B ND2   1 
ATOM   7155 N  N     . ASP F 3 312 ? 22.608  -66.597 -36.201 1.00 23.88  ? 289  ASP B N     1 
ATOM   7156 C  CA    . ASP F 3 312 ? 21.883  -67.837 -36.455 1.00 26.04  ? 289  ASP B CA    1 
ATOM   7157 C  C     . ASP F 3 312 ? 22.599  -68.741 -37.462 1.00 25.67  ? 289  ASP B C     1 
ATOM   7158 O  O     . ASP F 3 312 ? 22.151  -69.857 -37.737 1.00 25.56  ? 289  ASP B O     1 
ATOM   7159 C  CB    . ASP F 3 312 ? 20.458  -67.544 -36.944 1.00 30.24  ? 289  ASP B CB    1 
ATOM   7160 C  CG    . ASP F 3 312 ? 19.611  -66.828 -35.897 1.00 35.39  ? 289  ASP B CG    1 
ATOM   7161 O  OD1   . ASP F 3 312 ? 19.731  -67.150 -34.691 1.00 38.28  ? 289  ASP B OD1   1 
ATOM   7162 O  OD2   . ASP F 3 312 ? 18.811  -65.950 -36.282 1.00 37.91  ? 289  ASP B OD2   1 
ATOM   7163 N  N     . CYS F 3 313 ? 23.718  -68.267 -38.003 1.00 24.87  ? 290  CYS B N     1 
ATOM   7164 C  CA    . CYS F 3 313 ? 24.479  -69.050 -38.974 1.00 23.22  ? 290  CYS B CA    1 
ATOM   7165 C  C     . CYS F 3 313 ? 25.862  -69.461 -38.477 1.00 22.23  ? 290  CYS B C     1 
ATOM   7166 O  O     . CYS F 3 313 ? 26.574  -70.193 -39.159 1.00 22.97  ? 290  CYS B O     1 
ATOM   7167 C  CB    . CYS F 3 313 ? 24.622  -68.277 -40.288 1.00 21.73  ? 290  CYS B CB    1 
ATOM   7168 S  SG    . CYS F 3 313 ? 23.078  -68.071 -41.196 1.00 23.30  ? 290  CYS B SG    1 
ATOM   7169 N  N     . LEU F 3 314 ? 26.241  -68.999 -37.289 1.00 20.55  ? 291  LEU B N     1 
ATOM   7170 C  CA    . LEU F 3 314 ? 27.546  -69.337 -36.735 1.00 19.23  ? 291  LEU B CA    1 
ATOM   7171 C  C     . LEU F 3 314 ? 27.866  -70.819 -36.857 1.00 18.89  ? 291  LEU B C     1 
ATOM   7172 O  O     . LEU F 3 314 ? 28.875  -71.187 -37.441 1.00 19.39  ? 291  LEU B O     1 
ATOM   7173 C  CB    . LEU F 3 314 ? 27.631  -68.919 -35.269 1.00 18.49  ? 291  LEU B CB    1 
ATOM   7174 C  CG    . LEU F 3 314 ? 27.716  -67.415 -35.012 1.00 17.34  ? 291  LEU B CG    1 
ATOM   7175 C  CD1   . LEU F 3 314 ? 27.679  -67.158 -33.518 1.00 16.16  ? 291  LEU B CD1   1 
ATOM   7176 C  CD2   . LEU F 3 314 ? 28.993  -66.856 -35.626 1.00 16.20  ? 291  LEU B CD2   1 
ATOM   7177 N  N     . LEU F 3 315 ? 27.006  -71.671 -36.314 1.00 19.88  ? 292  LEU B N     1 
ATOM   7178 C  CA    . LEU F 3 315 ? 27.238  -73.108 -36.379 1.00 20.39  ? 292  LEU B CA    1 
ATOM   7179 C  C     . LEU F 3 315 ? 27.279  -73.591 -37.822 1.00 21.35  ? 292  LEU B C     1 
ATOM   7180 O  O     . LEU F 3 315 ? 28.162  -74.366 -38.201 1.00 21.99  ? 292  LEU B O     1 
ATOM   7181 C  CB    . LEU F 3 315 ? 26.154  -73.856 -35.601 1.00 19.16  ? 292  LEU B CB    1 
ATOM   7182 C  CG    . LEU F 3 315 ? 26.088  -73.492 -34.114 1.00 17.95  ? 292  LEU B CG    1 
ATOM   7183 C  CD1   . LEU F 3 315 ? 24.978  -74.269 -33.443 1.00 15.89  ? 292  LEU B CD1   1 
ATOM   7184 C  CD2   . LEU F 3 315 ? 27.421  -73.786 -33.456 1.00 16.84  ? 292  LEU B CD2   1 
ATOM   7185 N  N     . ASP F 3 316 ? 26.330  -73.129 -38.630 1.00 21.25  ? 293  ASP B N     1 
ATOM   7186 C  CA    . ASP F 3 316 ? 26.295  -73.519 -40.034 1.00 22.57  ? 293  ASP B CA    1 
ATOM   7187 C  C     . ASP F 3 316 ? 27.636  -73.162 -40.677 1.00 22.12  ? 293  ASP B C     1 
ATOM   7188 O  O     . ASP F 3 316 ? 28.167  -73.902 -41.502 1.00 22.83  ? 293  ASP B O     1 
ATOM   7189 C  CB    . ASP F 3 316 ? 25.158  -72.793 -40.770 1.00 24.82  ? 293  ASP B CB    1 
ATOM   7190 C  CG    . ASP F 3 316 ? 23.773  -73.168 -40.245 1.00 28.96  ? 293  ASP B CG    1 
ATOM   7191 O  OD1   . ASP F 3 316 ? 23.451  -74.379 -40.200 1.00 29.91  ? 293  ASP B OD1   1 
ATOM   7192 O  OD2   . ASP F 3 316 ? 23.002  -72.249 -39.887 1.00 29.86  ? 293  ASP B OD2   1 
ATOM   7193 N  N     . PHE F 3 317 ? 28.185  -72.024 -40.272 1.00 22.04  ? 294  PHE B N     1 
ATOM   7194 C  CA    . PHE F 3 317 ? 29.451  -71.532 -40.798 1.00 21.49  ? 294  PHE B CA    1 
ATOM   7195 C  C     . PHE F 3 317 ? 30.669  -72.263 -40.238 1.00 22.95  ? 294  PHE B C     1 
ATOM   7196 O  O     . PHE F 3 317 ? 31.611  -72.548 -40.975 1.00 24.54  ? 294  PHE B O     1 
ATOM   7197 C  CB    . PHE F 3 317 ? 29.567  -70.035 -40.514 1.00 18.63  ? 294  PHE B CB    1 
ATOM   7198 C  CG    . PHE F 3 317 ? 30.843  -69.420 -40.994 1.00 17.48  ? 294  PHE B CG    1 
ATOM   7199 C  CD1   . PHE F 3 317 ? 31.134  -69.359 -42.350 1.00 16.50  ? 294  PHE B CD1   1 
ATOM   7200 C  CD2   . PHE F 3 317 ? 31.746  -68.873 -40.088 1.00 17.96  ? 294  PHE B CD2   1 
ATOM   7201 C  CE1   . PHE F 3 317 ? 32.306  -68.760 -42.800 1.00 15.59  ? 294  PHE B CE1   1 
ATOM   7202 C  CE2   . PHE F 3 317 ? 32.922  -68.271 -40.527 1.00 18.22  ? 294  PHE B CE2   1 
ATOM   7203 C  CZ    . PHE F 3 317 ? 33.201  -68.215 -41.888 1.00 16.97  ? 294  PHE B CZ    1 
ATOM   7204 N  N     . LEU F 3 318 ? 30.655  -72.564 -38.941 1.00 23.06  ? 295  LEU B N     1 
ATOM   7205 C  CA    . LEU F 3 318 ? 31.779  -73.256 -38.318 1.00 23.34  ? 295  LEU B CA    1 
ATOM   7206 C  C     . LEU F 3 318 ? 31.937  -74.689 -38.815 1.00 24.79  ? 295  LEU B C     1 
ATOM   7207 O  O     . LEU F 3 318 ? 33.051  -75.214 -38.864 1.00 23.91  ? 295  LEU B O     1 
ATOM   7208 C  CB    . LEU F 3 318 ? 31.646  -73.255 -36.789 1.00 21.66  ? 295  LEU B CB    1 
ATOM   7209 C  CG    . LEU F 3 318 ? 32.159  -72.030 -36.017 1.00 20.17  ? 295  LEU B CG    1 
ATOM   7210 C  CD1   . LEU F 3 318 ? 33.579  -71.725 -36.444 1.00 19.02  ? 295  LEU B CD1   1 
ATOM   7211 C  CD2   . LEU F 3 318 ? 31.286  -70.829 -36.270 1.00 20.65  ? 295  LEU B CD2   1 
ATOM   7212 N  N     . ASP F 3 319 ? 30.830  -75.320 -39.191 1.00 26.39  ? 296  ASP B N     1 
ATOM   7213 C  CA    . ASP F 3 319 ? 30.890  -76.692 -39.680 1.00 27.88  ? 296  ASP B CA    1 
ATOM   7214 C  C     . ASP F 3 319 ? 30.755  -76.756 -41.198 1.00 29.97  ? 296  ASP B C     1 
ATOM   7215 O  O     . ASP F 3 319 ? 30.430  -77.806 -41.747 1.00 30.30  ? 296  ASP B O     1 
ATOM   7216 C  CB    . ASP F 3 319 ? 29.783  -77.541 -39.048 1.00 26.40  ? 296  ASP B CB    1 
ATOM   7217 C  CG    . ASP F 3 319 ? 29.725  -77.409 -37.537 1.00 25.87  ? 296  ASP B CG    1 
ATOM   7218 O  OD1   . ASP F 3 319 ? 30.789  -77.443 -36.886 1.00 26.33  ? 296  ASP B OD1   1 
ATOM   7219 O  OD2   . ASP F 3 319 ? 28.607  -77.285 -36.999 1.00 24.30  ? 296  ASP B OD2   1 
ATOM   7220 N  N     . CYS F 3 320 ? 31.012  -75.644 -41.881 1.00 31.75  ? 297  CYS B N     1 
ATOM   7221 C  CA    . CYS F 3 320 ? 30.885  -75.626 -43.332 1.00 33.74  ? 297  CYS B CA    1 
ATOM   7222 C  C     . CYS F 3 320 ? 31.867  -76.584 -43.998 1.00 35.49  ? 297  CYS B C     1 
ATOM   7223 O  O     . CYS F 3 320 ? 31.758  -76.859 -45.194 1.00 37.41  ? 297  CYS B O     1 
ATOM   7224 C  CB    . CYS F 3 320 ? 31.088  -74.210 -43.874 1.00 34.31  ? 297  CYS B CB    1 
ATOM   7225 S  SG    . CYS F 3 320 ? 32.794  -73.632 -43.876 1.00 39.67  ? 297  CYS B SG    1 
ATOM   7226 N  N     . GLY F 3 321 ? 32.827  -77.086 -43.226 1.00 36.29  ? 298  GLY B N     1 
ATOM   7227 C  CA    . GLY F 3 321 ? 33.796  -78.025 -43.766 1.00 36.11  ? 298  GLY B CA    1 
ATOM   7228 C  C     . GLY F 3 321 ? 35.103  -77.429 -44.253 1.00 35.85  ? 298  GLY B C     1 
ATOM   7229 O  O     . GLY F 3 321 ? 35.766  -78.009 -45.115 1.00 36.00  ? 298  GLY B O     1 
ATOM   7230 N  N     . LYS F 3 322 ? 35.480  -76.278 -43.704 1.00 35.42  ? 299  LYS B N     1 
ATOM   7231 C  CA    . LYS F 3 322 ? 36.719  -75.616 -44.096 1.00 35.26  ? 299  LYS B CA    1 
ATOM   7232 C  C     . LYS F 3 322 ? 37.525  -75.208 -42.879 1.00 34.55  ? 299  LYS B C     1 
ATOM   7233 O  O     . LYS F 3 322 ? 38.742  -75.028 -42.958 1.00 33.85  ? 299  LYS B O     1 
ATOM   7234 C  CB    . LYS F 3 322 ? 36.424  -74.371 -44.934 1.00 37.24  ? 299  LYS B CB    1 
ATOM   7235 C  CG    . LYS F 3 322 ? 35.809  -74.667 -46.291 1.00 42.28  ? 299  LYS B CG    1 
ATOM   7236 C  CD    . LYS F 3 322 ? 35.700  -73.403 -47.130 1.00 45.51  ? 299  LYS B CD    1 
ATOM   7237 C  CE    . LYS F 3 322 ? 35.179  -73.709 -48.526 1.00 48.00  ? 299  LYS B CE    1 
ATOM   7238 N  NZ    . LYS F 3 322 ? 35.091  -72.481 -49.369 1.00 50.18  ? 299  LYS B NZ    1 
ATOM   7239 N  N     . PHE F 3 323 ? 36.836  -75.072 -41.751 1.00 34.57  ? 300  PHE B N     1 
ATOM   7240 C  CA    . PHE F 3 323 ? 37.474  -74.661 -40.507 1.00 32.87  ? 300  PHE B CA    1 
ATOM   7241 C  C     . PHE F 3 323 ? 37.632  -75.785 -39.494 1.00 33.94  ? 300  PHE B C     1 
ATOM   7242 O  O     . PHE F 3 323 ? 36.775  -76.661 -39.362 1.00 34.68  ? 300  PHE B O     1 
ATOM   7243 C  CB    . PHE F 3 323 ? 36.675  -73.528 -39.862 1.00 29.60  ? 300  PHE B CB    1 
ATOM   7244 C  CG    . PHE F 3 323 ? 36.318  -72.425 -40.809 1.00 27.14  ? 300  PHE B CG    1 
ATOM   7245 C  CD1   . PHE F 3 323 ? 34.991  -72.164 -41.117 1.00 27.19  ? 300  PHE B CD1   1 
ATOM   7246 C  CD2   . PHE F 3 323 ? 37.305  -71.652 -41.402 1.00 27.01  ? 300  PHE B CD2   1 
ATOM   7247 C  CE1   . PHE F 3 323 ? 34.650  -71.148 -42.000 1.00 27.32  ? 300  PHE B CE1   1 
ATOM   7248 C  CE2   . PHE F 3 323 ? 36.976  -70.631 -42.288 1.00 26.76  ? 300  PHE B CE2   1 
ATOM   7249 C  CZ    . PHE F 3 323 ? 35.646  -70.379 -42.588 1.00 27.25  ? 300  PHE B CZ    1 
ATOM   7250 N  N     . GLU F 3 324 ? 38.744  -75.735 -38.773 1.00 35.56  ? 301  GLU B N     1 
ATOM   7251 C  CA    . GLU F 3 324 ? 39.051  -76.704 -37.734 1.00 37.43  ? 301  GLU B CA    1 
ATOM   7252 C  C     . GLU F 3 324 ? 39.499  -75.913 -36.515 1.00 37.20  ? 301  GLU B C     1 
ATOM   7253 O  O     . GLU F 3 324 ? 39.808  -74.727 -36.620 1.00 37.15  ? 301  GLU B O     1 
ATOM   7254 C  CB    . GLU F 3 324 ? 40.169  -77.638 -38.186 1.00 38.95  ? 301  GLU B CB    1 
ATOM   7255 C  CG    . GLU F 3 324 ? 39.802  -78.515 -39.364 1.00 42.37  ? 301  GLU B CG    1 
ATOM   7256 C  CD    . GLU F 3 324 ? 38.675  -79.475 -39.043 1.00 44.69  ? 301  GLU B CD    1 
ATOM   7257 O  OE1   . GLU F 3 324 ? 38.744  -80.136 -37.982 1.00 44.70  ? 301  GLU B OE1   1 
ATOM   7258 O  OE2   . GLU F 3 324 ? 37.729  -79.575 -39.855 1.00 46.42  ? 301  GLU B OE2   1 
ATOM   7259 N  N     . ILE F 3 325 ? 39.537  -76.570 -35.363 1.00 37.66  ? 302  ILE B N     1 
ATOM   7260 C  CA    . ILE F 3 325 ? 39.937  -75.911 -34.126 1.00 37.12  ? 302  ILE B CA    1 
ATOM   7261 C  C     . ILE F 3 325 ? 41.239  -75.119 -34.282 1.00 36.36  ? 302  ILE B C     1 
ATOM   7262 O  O     . ILE F 3 325 ? 41.387  -74.039 -33.711 1.00 36.54  ? 302  ILE B O     1 
ATOM   7263 C  CB    . ILE F 3 325 ? 40.092  -76.943 -32.983 1.00 36.99  ? 302  ILE B CB    1 
ATOM   7264 C  CG1   . ILE F 3 325 ? 40.450  -76.227 -31.680 1.00 36.74  ? 302  ILE B CG1   1 
ATOM   7265 C  CG2   . ILE F 3 325 ? 41.142  -77.980 -33.352 1.00 36.84  ? 302  ILE B CG2   1 
ATOM   7266 C  CD1   . ILE F 3 325 ? 39.402  -75.230 -31.232 1.00 37.48  ? 302  ILE B CD1   1 
ATOM   7267 N  N     . THR F 3 326 ? 42.168  -75.646 -35.072 1.00 34.86  ? 303  THR B N     1 
ATOM   7268 C  CA    . THR F 3 326 ? 43.448  -74.986 -35.283 1.00 34.43  ? 303  THR B CA    1 
ATOM   7269 C  C     . THR F 3 326 ? 43.351  -73.840 -36.277 1.00 34.97  ? 303  THR B C     1 
ATOM   7270 O  O     . THR F 3 326 ? 44.367  -73.274 -36.677 1.00 35.47  ? 303  THR B O     1 
ATOM   7271 C  CB    . THR F 3 326 ? 44.491  -75.967 -35.806 1.00 34.31  ? 303  THR B CB    1 
ATOM   7272 O  OG1   . THR F 3 326 ? 44.173  -76.325 -37.155 1.00 34.27  ? 303  THR B OG1   1 
ATOM   7273 C  CG2   . THR F 3 326 ? 44.504  -77.216 -34.954 1.00 35.47  ? 303  THR B CG2   1 
ATOM   7274 N  N     . SER F 3 327 ? 42.132  -73.506 -36.681 1.00 35.48  ? 304  SER B N     1 
ATOM   7275 C  CA    . SER F 3 327 ? 41.921  -72.418 -37.628 1.00 36.46  ? 304  SER B CA    1 
ATOM   7276 C  C     . SER F 3 327 ? 41.571  -71.140 -36.883 1.00 38.04  ? 304  SER B C     1 
ATOM   7277 O  O     . SER F 3 327 ? 41.574  -70.052 -37.453 1.00 38.88  ? 304  SER B O     1 
ATOM   7278 C  CB    . SER F 3 327 ? 40.794  -72.769 -38.600 1.00 34.74  ? 304  SER B CB    1 
ATOM   7279 O  OG    . SER F 3 327 ? 41.121  -73.912 -39.367 1.00 33.88  ? 304  SER B OG    1 
ATOM   7280 N  N     . PHE F 3 328 ? 41.275  -71.280 -35.599 1.00 40.20  ? 305  PHE B N     1 
ATOM   7281 C  CA    . PHE F 3 328 ? 40.915  -70.143 -34.773 1.00 43.85  ? 305  PHE B CA    1 
ATOM   7282 C  C     . PHE F 3 328 ? 42.085  -69.208 -34.498 1.00 46.26  ? 305  PHE B C     1 
ATOM   7283 O  O     . PHE F 3 328 ? 43.240  -69.531 -34.767 1.00 46.16  ? 305  PHE B O     1 
ATOM   7284 C  CB    . PHE F 3 328 ? 40.338  -70.633 -33.442 1.00 45.91  ? 305  PHE B CB    1 
ATOM   7285 C  CG    . PHE F 3 328 ? 38.912  -71.097 -33.527 1.00 47.17  ? 305  PHE B CG    1 
ATOM   7286 C  CD1   . PHE F 3 328 ? 38.319  -71.744 -32.451 1.00 47.91  ? 305  PHE B CD1   1 
ATOM   7287 C  CD2   . PHE F 3 328 ? 38.150  -70.859 -34.666 1.00 48.01  ? 305  PHE B CD2   1 
ATOM   7288 C  CE1   . PHE F 3 328 ? 36.989  -72.146 -32.506 1.00 49.21  ? 305  PHE B CE1   1 
ATOM   7289 C  CE2   . PHE F 3 328 ? 36.819  -71.257 -34.730 1.00 48.74  ? 305  PHE B CE2   1 
ATOM   7290 C  CZ    . PHE F 3 328 ? 36.237  -71.901 -33.647 1.00 49.32  ? 305  PHE B CZ    1 
ATOM   7291 N  N     . TRP F 3 329 ? 41.763  -68.037 -33.961 1.00 49.58  ? 306  TRP B N     1 
ATOM   7292 C  CA    . TRP F 3 329 ? 42.760  -67.038 -33.609 1.00 52.84  ? 306  TRP B CA    1 
ATOM   7293 C  C     . TRP F 3 329 ? 43.410  -67.542 -32.324 1.00 52.92  ? 306  TRP B C     1 
ATOM   7294 O  O     . TRP F 3 329 ? 42.724  -68.077 -31.454 1.00 54.23  ? 306  TRP B O     1 
ATOM   7295 C  CB    . TRP F 3 329 ? 42.073  -65.695 -33.343 1.00 57.14  ? 306  TRP B CB    1 
ATOM   7296 C  CG    . TRP F 3 329 ? 42.993  -64.501 -33.228 1.00 62.30  ? 306  TRP B CG    1 
ATOM   7297 C  CD1   . TRP F 3 329 ? 42.793  -63.387 -32.454 1.00 62.74  ? 306  TRP B CD1   1 
ATOM   7298 C  CD2   . TRP F 3 329 ? 44.205  -64.262 -33.963 1.00 64.25  ? 306  TRP B CD2   1 
ATOM   7299 N  NE1   . TRP F 3 329 ? 43.799  -62.474 -32.666 1.00 64.11  ? 306  TRP B NE1   1 
ATOM   7300 C  CE2   . TRP F 3 329 ? 44.677  -62.983 -33.587 1.00 64.84  ? 306  TRP B CE2   1 
ATOM   7301 C  CE3   . TRP F 3 329 ? 44.935  -65.002 -34.907 1.00 64.38  ? 306  TRP B CE3   1 
ATOM   7302 C  CZ2   . TRP F 3 329 ? 45.847  -62.429 -34.122 1.00 64.95  ? 306  TRP B CZ2   1 
ATOM   7303 C  CZ3   . TRP F 3 329 ? 46.099  -64.448 -35.437 1.00 63.67  ? 306  TRP B CZ3   1 
ATOM   7304 C  CH2   . TRP F 3 329 ? 46.540  -63.174 -35.043 1.00 64.22  ? 306  TRP B CH2   1 
ATOM   7305 N  N     . THR F 3 330 ? 44.724  -67.373 -32.213 1.00 51.97  ? 307  THR B N     1 
ATOM   7306 C  CA    . THR F 3 330 ? 45.489  -67.798 -31.037 1.00 50.48  ? 307  THR B CA    1 
ATOM   7307 C  C     . THR F 3 330 ? 45.662  -69.314 -30.930 1.00 49.59  ? 307  THR B C     1 
ATOM   7308 O  O     . THR F 3 330 ? 46.512  -69.792 -30.180 1.00 49.34  ? 307  THR B O     1 
ATOM   7309 C  CB    . THR F 3 330 ? 44.864  -67.273 -29.709 1.00 49.79  ? 307  THR B CB    1 
ATOM   7310 O  OG1   . THR F 3 330 ? 43.738  -68.077 -29.346 1.00 49.76  ? 307  THR B OG1   1 
ATOM   7311 C  CG2   . THR F 3 330 ? 44.408  -65.831 -29.867 1.00 50.07  ? 307  THR B CG2   1 
ATOM   7312 N  N     . LEU F 3 331 ? 44.862  -70.070 -31.675 1.00 49.60  ? 308  LEU B N     1 
ATOM   7313 C  CA    . LEU F 3 331 ? 44.963  -71.529 -31.653 1.00 49.33  ? 308  LEU B CA    1 
ATOM   7314 C  C     . LEU F 3 331 ? 45.547  -72.072 -32.953 1.00 49.84  ? 308  LEU B C     1 
ATOM   7315 O  O     . LEU F 3 331 ? 45.321  -73.226 -33.314 1.00 49.96  ? 308  LEU B O     1 
ATOM   7316 C  CB    . LEU F 3 331 ? 43.592  -72.168 -31.397 1.00 47.02  ? 308  LEU B CB    1 
ATOM   7317 C  CG    . LEU F 3 331 ? 43.202  -72.426 -29.938 1.00 44.91  ? 308  LEU B CG    1 
ATOM   7318 C  CD1   . LEU F 3 331 ? 43.169  -71.124 -29.168 1.00 45.76  ? 308  LEU B CD1   1 
ATOM   7319 C  CD2   . LEU F 3 331 ? 41.847  -73.105 -29.889 1.00 44.52  ? 308  LEU B CD2   1 
ATOM   7320 N  N     . GLY F 3 332 ? 46.297  -71.230 -33.654 1.00 50.56  ? 309  GLY B N     1 
ATOM   7321 C  CA    . GLY F 3 332 ? 46.914  -71.651 -34.897 1.00 50.68  ? 309  GLY B CA    1 
ATOM   7322 C  C     . GLY F 3 332 ? 48.393  -71.886 -34.669 1.00 50.91  ? 309  GLY B C     1 
ATOM   7323 O  O     . GLY F 3 332 ? 49.176  -71.982 -35.613 1.00 50.38  ? 309  GLY B O     1 
ATOM   7324 N  N     . GLY F 3 333 ? 48.772  -71.977 -33.399 1.00 51.74  ? 310  GLY B N     1 
ATOM   7325 C  CA    . GLY F 3 333 ? 50.163  -72.194 -33.056 1.00 53.94  ? 310  GLY B CA    1 
ATOM   7326 C  C     . GLY F 3 333 ? 50.409  -73.523 -32.370 1.00 55.28  ? 310  GLY B C     1 
ATOM   7327 O  O     . GLY F 3 333 ? 49.610  -74.456 -32.485 1.00 55.77  ? 310  GLY B O     1 
ATOM   7328 N  N     . VAL F 3 334 ? 51.524  -73.602 -31.650 1.00 55.41  ? 311  VAL B N     1 
ATOM   7329 C  CA    . VAL F 3 334 ? 51.903  -74.816 -30.938 1.00 54.32  ? 311  VAL B CA    1 
ATOM   7330 C  C     . VAL F 3 334 ? 50.818  -75.290 -29.974 1.00 52.70  ? 311  VAL B C     1 
ATOM   7331 O  O     . VAL F 3 334 ? 50.642  -76.493 -29.776 1.00 51.61  ? 311  VAL B O     1 
ATOM   7332 C  CB    . VAL F 3 334 ? 53.215  -74.603 -30.150 1.00 55.41  ? 311  VAL B CB    1 
ATOM   7333 C  CG1   . VAL F 3 334 ? 54.342  -74.234 -31.108 1.00 54.81  ? 311  VAL B CG1   1 
ATOM   7334 C  CG2   . VAL F 3 334 ? 53.025  -73.512 -29.106 1.00 54.72  ? 311  VAL B CG2   1 
ATOM   7335 N  N     . LEU F 3 335 ? 50.092  -74.349 -29.376 1.00 50.90  ? 312  LEU B N     1 
ATOM   7336 C  CA    . LEU F 3 335 ? 49.030  -74.707 -28.444 1.00 49.72  ? 312  LEU B CA    1 
ATOM   7337 C  C     . LEU F 3 335 ? 47.914  -75.434 -29.176 1.00 49.91  ? 312  LEU B C     1 
ATOM   7338 O  O     . LEU F 3 335 ? 47.322  -76.376 -28.650 1.00 49.81  ? 312  LEU B O     1 
ATOM   7339 C  CB    . LEU F 3 335 ? 48.459  -73.463 -27.761 1.00 47.25  ? 312  LEU B CB    1 
ATOM   7340 C  CG    . LEU F 3 335 ? 47.260  -73.732 -26.846 1.00 45.13  ? 312  LEU B CG    1 
ATOM   7341 C  CD1   . LEU F 3 335 ? 47.636  -74.761 -25.797 1.00 44.12  ? 312  LEU B CD1   1 
ATOM   7342 C  CD2   . LEU F 3 335 ? 46.807  -72.440 -26.191 1.00 44.91  ? 312  LEU B CD2   1 
ATOM   7343 N  N     . GLY F 3 336 ? 47.634  -74.987 -30.395 1.00 49.91  ? 313  GLY B N     1 
ATOM   7344 C  CA    . GLY F 3 336 ? 46.589  -75.608 -31.183 1.00 50.33  ? 313  GLY B CA    1 
ATOM   7345 C  C     . GLY F 3 336 ? 46.838  -77.083 -31.422 1.00 50.84  ? 313  GLY B C     1 
ATOM   7346 O  O     . GLY F 3 336 ? 46.015  -77.925 -31.059 1.00 50.86  ? 313  GLY B O     1 
ATOM   7347 N  N     . LYS F 3 337 ? 47.978  -77.399 -32.029 1.00 51.15  ? 314  LYS B N     1 
ATOM   7348 C  CA    . LYS F 3 337 ? 48.324  -78.783 -32.323 1.00 50.91  ? 314  LYS B CA    1 
ATOM   7349 C  C     . LYS F 3 337 ? 48.380  -79.646 -31.065 1.00 50.36  ? 314  LYS B C     1 
ATOM   7350 O  O     . LYS F 3 337 ? 47.997  -80.816 -31.092 1.00 49.86  ? 314  LYS B O     1 
ATOM   7351 C  CB    . LYS F 3 337 ? 49.656  -78.844 -33.079 1.00 51.94  ? 314  LYS B CB    1 
ATOM   7352 C  CG    . LYS F 3 337 ? 49.596  -78.194 -34.458 1.00 54.29  ? 314  LYS B CG    1 
ATOM   7353 C  CD    . LYS F 3 337 ? 50.901  -78.339 -35.248 1.00 56.62  ? 314  LYS B CD    1 
ATOM   7354 C  CE    . LYS F 3 337 ? 51.127  -79.759 -35.772 1.00 57.08  ? 314  LYS B CE    1 
ATOM   7355 N  NZ    . LYS F 3 337 ? 51.379  -80.760 -34.699 1.00 56.38  ? 314  LYS B NZ    1 
ATOM   7356 N  N     . GLU F 3 338 ? 48.848  -79.072 -29.961 1.00 49.65  ? 315  GLU B N     1 
ATOM   7357 C  CA    . GLU F 3 338 ? 48.922  -79.822 -28.713 1.00 49.31  ? 315  GLU B CA    1 
ATOM   7358 C  C     . GLU F 3 338 ? 47.514  -80.211 -28.302 1.00 49.10  ? 315  GLU B C     1 
ATOM   7359 O  O     . GLU F 3 338 ? 47.264  -81.351 -27.918 1.00 50.20  ? 315  GLU B O     1 
ATOM   7360 C  CB    . GLU F 3 338 ? 49.562  -78.984 -27.605 1.00 49.60  ? 315  GLU B CB    1 
ATOM   7361 C  CG    . GLU F 3 338 ? 49.748  -79.745 -26.302 1.00 50.60  ? 315  GLU B CG    1 
ATOM   7362 C  CD    . GLU F 3 338 ? 50.417  -78.916 -25.221 1.00 52.34  ? 315  GLU B CD    1 
ATOM   7363 O  OE1   . GLU F 3 338 ? 51.514  -78.375 -25.476 1.00 53.29  ? 315  GLU B OE1   1 
ATOM   7364 O  OE2   . GLU F 3 338 ? 49.850  -78.809 -24.114 1.00 53.04  ? 315  GLU B OE2   1 
ATOM   7365 N  N     . LEU F 3 339 ? 46.595  -79.254 -28.390 1.00 48.55  ? 316  LEU B N     1 
ATOM   7366 C  CA    . LEU F 3 339 ? 45.202  -79.488 -28.034 1.00 47.09  ? 316  LEU B CA    1 
ATOM   7367 C  C     . LEU F 3 339 ? 44.611  -80.642 -28.832 1.00 47.92  ? 316  LEU B C     1 
ATOM   7368 O  O     . LEU F 3 339 ? 43.800  -81.407 -28.314 1.00 48.18  ? 316  LEU B O     1 
ATOM   7369 C  CB    . LEU F 3 339 ? 44.375  -78.221 -28.263 1.00 44.86  ? 316  LEU B CB    1 
ATOM   7370 C  CG    . LEU F 3 339 ? 44.582  -77.104 -27.239 1.00 43.61  ? 316  LEU B CG    1 
ATOM   7371 C  CD1   . LEU F 3 339 ? 43.720  -75.904 -27.584 1.00 42.18  ? 316  LEU B CD1   1 
ATOM   7372 C  CD2   . LEU F 3 339 ? 44.230  -77.628 -25.857 1.00 43.58  ? 316  LEU B CD2   1 
ATOM   7373 N  N     . ILE F 3 340 ? 45.018  -80.769 -30.090 1.00 49.35  ? 317  ILE B N     1 
ATOM   7374 C  CA    . ILE F 3 340 ? 44.519  -81.849 -30.932 1.00 52.17  ? 317  ILE B CA    1 
ATOM   7375 C  C     . ILE F 3 340 ? 44.856  -83.199 -30.306 1.00 54.30  ? 317  ILE B C     1 
ATOM   7376 O  O     . ILE F 3 340 ? 44.176  -84.195 -30.553 1.00 55.29  ? 317  ILE B O     1 
ATOM   7377 C  CB    . ILE F 3 340 ? 45.139  -81.800 -32.343 1.00 51.97  ? 317  ILE B CB    1 
ATOM   7378 C  CG1   . ILE F 3 340 ? 44.741  -80.501 -33.043 1.00 52.58  ? 317  ILE B CG1   1 
ATOM   7379 C  CG2   . ILE F 3 340 ? 44.676  -82.999 -33.160 1.00 51.21  ? 317  ILE B CG2   1 
ATOM   7380 C  CD1   . ILE F 3 340 ? 45.272  -80.386 -34.461 1.00 53.60  ? 317  ILE B CD1   1 
ATOM   7381 N  N     . ASP F 3 341 ? 45.907  -83.225 -29.493 1.00 56.19  ? 318  ASP B N     1 
ATOM   7382 C  CA    . ASP F 3 341 ? 46.338  -84.454 -28.835 1.00 56.87  ? 318  ASP B CA    1 
ATOM   7383 C  C     . ASP F 3 341 ? 45.732  -84.563 -27.434 1.00 55.44  ? 318  ASP B C     1 
ATOM   7384 O  O     . ASP F 3 341 ? 45.185  -85.603 -27.062 1.00 56.10  ? 318  ASP B O     1 
ATOM   7385 C  CB    . ASP F 3 341 ? 47.869  -84.490 -28.753 1.00 59.98  ? 318  ASP B CB    1 
ATOM   7386 C  CG    . ASP F 3 341 ? 48.415  -85.893 -28.518 1.00 64.32  ? 318  ASP B CG    1 
ATOM   7387 O  OD1   . ASP F 3 341 ? 49.656  -86.042 -28.445 1.00 65.30  ? 318  ASP B OD1   1 
ATOM   7388 O  OD2   . ASP F 3 341 ? 47.608  -86.846 -28.411 1.00 66.92  ? 318  ASP B OD2   1 
ATOM   7389 N  N     . VAL F 3 342 ? 45.825  -83.481 -26.666 1.00 53.15  ? 319  VAL B N     1 
ATOM   7390 C  CA    . VAL F 3 342 ? 45.293  -83.446 -25.309 1.00 51.74  ? 319  VAL B CA    1 
ATOM   7391 C  C     . VAL F 3 342 ? 43.797  -83.752 -25.267 1.00 51.10  ? 319  VAL B C     1 
ATOM   7392 O  O     . VAL F 3 342 ? 43.363  -84.648 -24.544 1.00 50.42  ? 319  VAL B O     1 
ATOM   7393 C  CB    . VAL F 3 342 ? 45.529  -82.070 -24.657 1.00 51.48  ? 319  VAL B CB    1 
ATOM   7394 C  CG1   . VAL F 3 342 ? 44.974  -82.061 -23.243 1.00 51.54  ? 319  VAL B CG1   1 
ATOM   7395 C  CG2   . VAL F 3 342 ? 47.011  -81.752 -24.646 1.00 51.51  ? 319  VAL B CG2   1 
ATOM   7396 N  N     . LEU F 3 343 ? 43.016  -82.999 -26.038 1.00 50.76  ? 320  LEU B N     1 
ATOM   7397 C  CA    . LEU F 3 343 ? 41.567  -83.190 -26.095 1.00 49.58  ? 320  LEU B CA    1 
ATOM   7398 C  C     . LEU F 3 343 ? 41.216  -84.386 -26.966 1.00 48.39  ? 320  LEU B C     1 
ATOM   7399 O  O     . LEU F 3 343 ? 40.087  -84.876 -26.941 1.00 47.37  ? 320  LEU B O     1 
ATOM   7400 C  CB    . LEU F 3 343 ? 40.887  -81.942 -26.657 1.00 49.57  ? 320  LEU B CB    1 
ATOM   7401 C  CG    . LEU F 3 343 ? 41.003  -80.672 -25.815 1.00 50.30  ? 320  LEU B CG    1 
ATOM   7402 C  CD1   . LEU F 3 343 ? 40.407  -79.496 -26.572 1.00 49.89  ? 320  LEU B CD1   1 
ATOM   7403 C  CD2   . LEU F 3 343 ? 40.291  -80.878 -24.486 1.00 51.01  ? 320  LEU B CD2   1 
ATOM   7404 N  N     . ASP F 3 344 ? 42.192  -84.845 -27.739 1.00 47.68  ? 321  ASP B N     1 
ATOM   7405 C  CA    . ASP F 3 344 ? 41.998  -85.984 -28.621 1.00 47.42  ? 321  ASP B CA    1 
ATOM   7406 C  C     . ASP F 3 344 ? 40.848  -85.696 -29.582 1.00 45.28  ? 321  ASP B C     1 
ATOM   7407 O  O     . ASP F 3 344 ? 39.821  -86.375 -29.570 1.00 45.23  ? 321  ASP B O     1 
ATOM   7408 C  CB    . ASP F 3 344 ? 41.702  -87.235 -27.791 1.00 50.58  ? 321  ASP B CB    1 
ATOM   7409 C  CG    . ASP F 3 344 ? 41.800  -88.511 -28.604 1.00 54.28  ? 321  ASP B CG    1 
ATOM   7410 O  OD1   . ASP F 3 344 ? 42.880  -88.770 -29.183 1.00 55.56  ? 321  ASP B OD1   1 
ATOM   7411 O  OD2   . ASP F 3 344 ? 40.799  -89.257 -28.660 1.00 55.62  ? 321  ASP B OD2   1 
ATOM   7412 N  N     . LEU F 3 345 ? 41.038  -84.676 -30.413 1.00 42.90  ? 322  LEU B N     1 
ATOM   7413 C  CA    . LEU F 3 345 ? 40.035  -84.263 -31.385 1.00 40.78  ? 322  LEU B CA    1 
ATOM   7414 C  C     . LEU F 3 345 ? 40.262  -84.956 -32.721 1.00 39.69  ? 322  LEU B C     1 
ATOM   7415 O  O     . LEU F 3 345 ? 41.394  -85.264 -33.084 1.00 40.88  ? 322  LEU B O     1 
ATOM   7416 C  CB    . LEU F 3 345 ? 40.102  -82.750 -31.586 1.00 39.07  ? 322  LEU B CB    1 
ATOM   7417 C  CG    . LEU F 3 345 ? 40.106  -81.906 -30.311 1.00 39.17  ? 322  LEU B CG    1 
ATOM   7418 C  CD1   . LEU F 3 345 ? 40.265  -80.442 -30.673 1.00 38.50  ? 322  LEU B CD1   1 
ATOM   7419 C  CD2   . LEU F 3 345 ? 38.819  -82.136 -29.535 1.00 39.88  ? 322  LEU B CD2   1 
ATOM   7420 N  N     . PRO F 3 346 ? 39.184  -85.210 -33.475 1.00 38.82  ? 323  PRO B N     1 
ATOM   7421 C  CA    . PRO F 3 346 ? 39.315  -85.870 -34.776 1.00 39.27  ? 323  PRO B CA    1 
ATOM   7422 C  C     . PRO F 3 346 ? 40.121  -85.021 -35.755 1.00 40.06  ? 323  PRO B C     1 
ATOM   7423 O  O     . PRO F 3 346 ? 40.438  -83.871 -35.464 1.00 38.93  ? 323  PRO B O     1 
ATOM   7424 C  CB    . PRO F 3 346 ? 37.865  -86.056 -35.211 1.00 38.73  ? 323  PRO B CB    1 
ATOM   7425 C  CG    . PRO F 3 346 ? 37.172  -84.893 -34.570 1.00 38.64  ? 323  PRO B CG    1 
ATOM   7426 C  CD    . PRO F 3 346 ? 37.778  -84.874 -33.194 1.00 38.52  ? 323  PRO B CD    1 
ATOM   7427 N  N     . HIS F 3 347 ? 40.459  -85.589 -36.909 1.00 42.50  ? 324  HIS B N     1 
ATOM   7428 C  CA    . HIS F 3 347 ? 41.230  -84.853 -37.907 1.00 45.49  ? 324  HIS B CA    1 
ATOM   7429 C  C     . HIS F 3 347 ? 40.319  -84.253 -38.973 1.00 45.13  ? 324  HIS B C     1 
ATOM   7430 O  O     . HIS F 3 347 ? 40.742  -83.991 -40.101 1.00 45.18  ? 324  HIS B O     1 
ATOM   7431 C  CB    . HIS F 3 347 ? 42.280  -85.766 -38.548 1.00 49.39  ? 324  HIS B CB    1 
ATOM   7432 C  CG    . HIS F 3 347 ? 43.274  -86.315 -37.570 1.00 54.67  ? 324  HIS B CG    1 
ATOM   7433 N  ND1   . HIS F 3 347 ? 43.935  -85.522 -36.656 1.00 56.50  ? 324  HIS B ND1   1 
ATOM   7434 C  CD2   . HIS F 3 347 ? 43.713  -87.579 -37.356 1.00 56.29  ? 324  HIS B CD2   1 
ATOM   7435 C  CE1   . HIS F 3 347 ? 44.736  -86.272 -35.920 1.00 57.03  ? 324  HIS B CE1   1 
ATOM   7436 N  NE2   . HIS F 3 347 ? 44.620  -87.525 -36.324 1.00 57.97  ? 324  HIS B NE2   1 
ATOM   7437 N  N     . GLU F 3 348 ? 39.063  -84.036 -38.591 1.00 44.09  ? 325  GLU B N     1 
ATOM   7438 C  CA    . GLU F 3 348 ? 38.053  -83.458 -39.468 1.00 41.69  ? 325  GLU B CA    1 
ATOM   7439 C  C     . GLU F 3 348 ? 36.825  -83.195 -38.602 1.00 38.97  ? 325  GLU B C     1 
ATOM   7440 O  O     . GLU F 3 348 ? 36.404  -84.062 -37.845 1.00 38.49  ? 325  GLU B O     1 
ATOM   7441 C  CB    . GLU F 3 348 ? 37.723  -84.428 -40.597 1.00 44.06  ? 325  GLU B CB    1 
ATOM   7442 C  CG    . GLU F 3 348 ? 37.009  -83.799 -41.775 1.00 49.80  ? 325  GLU B CG    1 
ATOM   7443 C  CD    . GLU F 3 348 ? 37.588  -84.258 -43.105 1.00 54.30  ? 325  GLU B CD    1 
ATOM   7444 O  OE1   . GLU F 3 348 ? 36.969  -83.984 -44.156 1.00 58.08  ? 325  GLU B OE1   1 
ATOM   7445 O  OE2   . GLU F 3 348 ? 38.670  -84.886 -43.100 1.00 55.20  ? 325  GLU B OE2   1 
ATOM   7446 N  N     . ASN F 3 349 ? 36.266  -81.994 -38.712 1.00 36.79  ? 326  ASN B N     1 
ATOM   7447 C  CA    . ASN F 3 349 ? 35.107  -81.588 -37.917 1.00 33.32  ? 326  ASN B CA    1 
ATOM   7448 C  C     . ASN F 3 349 ? 35.403  -81.673 -36.429 1.00 31.35  ? 326  ASN B C     1 
ATOM   7449 O  O     . ASN F 3 349 ? 34.629  -82.242 -35.665 1.00 31.16  ? 326  ASN B O     1 
ATOM   7450 C  CB    . ASN F 3 349 ? 33.878  -82.443 -38.233 1.00 33.46  ? 326  ASN B CB    1 
ATOM   7451 C  CG    . ASN F 3 349 ? 33.180  -82.012 -39.503 1.00 34.90  ? 326  ASN B CG    1 
ATOM   7452 O  OD1   . ASN F 3 349 ? 33.535  -82.444 -40.600 1.00 36.21  ? 326  ASN B OD1   1 
ATOM   7453 N  ND2   . ASN F 3 349 ? 32.186  -81.140 -39.362 1.00 34.94  ? 326  ASN B ND2   1 
ATOM   7454 N  N     . SER F 3 350 ? 36.524  -81.094 -36.020 1.00 29.89  ? 327  SER B N     1 
ATOM   7455 C  CA    . SER F 3 350 ? 36.921  -81.112 -34.620 1.00 28.85  ? 327  SER B CA    1 
ATOM   7456 C  C     . SER F 3 350 ? 36.185  -80.064 -33.804 1.00 28.16  ? 327  SER B C     1 
ATOM   7457 O  O     . SER F 3 350 ? 36.118  -80.158 -32.579 1.00 28.85  ? 327  SER B O     1 
ATOM   7458 C  CB    . SER F 3 350 ? 38.429  -80.886 -34.495 1.00 29.28  ? 327  SER B CB    1 
ATOM   7459 O  OG    . SER F 3 350 ? 38.828  -79.701 -35.161 1.00 30.81  ? 327  SER B OG    1 
ATOM   7460 N  N     . ILE F 3 351 ? 35.632  -79.063 -34.480 1.00 27.52  ? 328  ILE B N     1 
ATOM   7461 C  CA    . ILE F 3 351 ? 34.917  -78.006 -33.781 1.00 26.30  ? 328  ILE B CA    1 
ATOM   7462 C  C     . ILE F 3 351 ? 33.577  -78.534 -33.295 1.00 26.84  ? 328  ILE B C     1 
ATOM   7463 O  O     . ILE F 3 351 ? 33.219  -78.361 -32.127 1.00 27.25  ? 328  ILE B O     1 
ATOM   7464 C  CB    . ILE F 3 351 ? 34.693  -76.789 -34.692 1.00 25.57  ? 328  ILE B CB    1 
ATOM   7465 C  CG1   . ILE F 3 351 ? 35.989  -76.464 -35.438 1.00 27.20  ? 328  ILE B CG1   1 
ATOM   7466 C  CG2   . ILE F 3 351 ? 34.273  -75.586 -33.855 1.00 24.00  ? 328  ILE B CG2   1 
ATOM   7467 C  CD1   . ILE F 3 351 ? 35.914  -75.233 -36.320 1.00 27.87  ? 328  ILE B CD1   1 
ATOM   7468 N  N     . LYS F 3 352 ? 32.842  -79.185 -34.191 1.00 26.84  ? 329  LYS B N     1 
ATOM   7469 C  CA    . LYS F 3 352 ? 31.545  -79.749 -33.840 1.00 26.98  ? 329  LYS B CA    1 
ATOM   7470 C  C     . LYS F 3 352 ? 31.724  -80.770 -32.724 1.00 28.19  ? 329  LYS B C     1 
ATOM   7471 O  O     . LYS F 3 352 ? 30.878  -80.890 -31.836 1.00 28.65  ? 329  LYS B O     1 
ATOM   7472 C  CB    . LYS F 3 352 ? 30.908  -80.422 -35.054 1.00 26.68  ? 329  LYS B CB    1 
ATOM   7473 C  CG    . LYS F 3 352 ? 29.541  -81.019 -34.768 1.00 26.06  ? 329  LYS B CG    1 
ATOM   7474 C  CD    . LYS F 3 352 ? 28.912  -81.609 -36.020 1.00 24.58  ? 329  LYS B CD    1 
ATOM   7475 C  CE    . LYS F 3 352 ? 27.550  -82.190 -35.698 1.00 25.32  ? 329  LYS B CE    1 
ATOM   7476 N  NZ    . LYS F 3 352 ? 26.880  -82.725 -36.905 1.00 27.94  ? 329  LYS B NZ    1 
ATOM   7477 N  N     . HIS F 3 353 ? 32.834  -81.501 -32.773 1.00 27.84  ? 330  HIS B N     1 
ATOM   7478 C  CA    . HIS F 3 353 ? 33.143  -82.507 -31.764 1.00 27.48  ? 330  HIS B CA    1 
ATOM   7479 C  C     . HIS F 3 353 ? 33.221  -81.880 -30.374 1.00 26.37  ? 330  HIS B C     1 
ATOM   7480 O  O     . HIS F 3 353 ? 32.680  -82.416 -29.411 1.00 24.96  ? 330  HIS B O     1 
ATOM   7481 C  CB    . HIS F 3 353 ? 34.468  -83.198 -32.108 1.00 30.53  ? 330  HIS B CB    1 
ATOM   7482 C  CG    . HIS F 3 353 ? 34.894  -84.236 -31.115 1.00 33.53  ? 330  HIS B CG    1 
ATOM   7483 N  ND1   . HIS F 3 353 ? 35.282  -83.923 -29.829 1.00 35.99  ? 330  HIS B ND1   1 
ATOM   7484 C  CD2   . HIS F 3 353 ? 35.018  -85.579 -31.228 1.00 34.05  ? 330  HIS B CD2   1 
ATOM   7485 C  CE1   . HIS F 3 353 ? 35.631  -85.028 -29.194 1.00 35.50  ? 330  HIS B CE1   1 
ATOM   7486 N  NE2   . HIS F 3 353 ? 35.479  -86.047 -30.021 1.00 36.15  ? 330  HIS B NE2   1 
ATOM   7487 N  N     . ILE F 3 354 ? 33.890  -80.739 -30.269 1.00 26.75  ? 331  ILE B N     1 
ATOM   7488 C  CA    . ILE F 3 354 ? 34.011  -80.070 -28.985 1.00 28.02  ? 331  ILE B CA    1 
ATOM   7489 C  C     . ILE F 3 354 ? 32.638  -79.626 -28.489 1.00 29.64  ? 331  ILE B C     1 
ATOM   7490 O  O     . ILE F 3 354 ? 32.431  -79.446 -27.288 1.00 29.06  ? 331  ILE B O     1 
ATOM   7491 C  CB    . ILE F 3 354 ? 34.946  -78.848 -29.079 1.00 27.55  ? 331  ILE B CB    1 
ATOM   7492 C  CG1   . ILE F 3 354 ? 36.317  -79.295 -29.593 1.00 27.82  ? 331  ILE B CG1   1 
ATOM   7493 C  CG2   . ILE F 3 354 ? 35.089  -78.190 -27.709 1.00 24.42  ? 331  ILE B CG2   1 
ATOM   7494 C  CD1   . ILE F 3 354 ? 37.346  -78.184 -29.672 1.00 28.11  ? 331  ILE B CD1   1 
ATOM   7495 N  N     . ARG F 3 355 ? 31.698  -79.448 -29.412 1.00 30.84  ? 332  ARG B N     1 
ATOM   7496 C  CA    . ARG F 3 355 ? 30.352  -79.041 -29.027 1.00 33.57  ? 332  ARG B CA    1 
ATOM   7497 C  C     . ARG F 3 355 ? 29.544  -80.239 -28.545 1.00 35.69  ? 332  ARG B C     1 
ATOM   7498 O  O     . ARG F 3 355 ? 28.883  -80.180 -27.507 1.00 36.80  ? 332  ARG B O     1 
ATOM   7499 C  CB    . ARG F 3 355 ? 29.608  -78.391 -30.198 1.00 30.73  ? 332  ARG B CB    1 
ATOM   7500 C  CG    . ARG F 3 355 ? 29.920  -76.926 -30.425 1.00 31.02  ? 332  ARG B CG    1 
ATOM   7501 C  CD    . ARG F 3 355 ? 28.718  -76.210 -31.042 1.00 28.89  ? 332  ARG B CD    1 
ATOM   7502 N  NE    . ARG F 3 355 ? 28.305  -76.795 -32.315 1.00 26.13  ? 332  ARG B NE    1 
ATOM   7503 C  CZ    . ARG F 3 355 ? 28.982  -76.679 -33.454 1.00 25.89  ? 332  ARG B CZ    1 
ATOM   7504 N  NH1   . ARG F 3 355 ? 30.116  -75.991 -33.494 1.00 25.38  ? 332  ARG B NH1   1 
ATOM   7505 N  NH2   . ARG F 3 355 ? 28.529  -77.262 -34.554 1.00 24.35  ? 332  ARG B NH2   1 
ATOM   7506 N  N     . GLU F 3 356 ? 29.609  -81.327 -29.307 1.00 36.41  ? 333  GLU B N     1 
ATOM   7507 C  CA    . GLU F 3 356 ? 28.869  -82.543 -28.988 1.00 36.85  ? 333  GLU B CA    1 
ATOM   7508 C  C     . GLU F 3 356 ? 29.410  -83.281 -27.765 1.00 36.39  ? 333  GLU B C     1 
ATOM   7509 O  O     . GLU F 3 356 ? 28.639  -83.731 -26.922 1.00 37.70  ? 333  GLU B O     1 
ATOM   7510 C  CB    . GLU F 3 356 ? 28.875  -83.484 -30.198 1.00 38.15  ? 333  GLU B CB    1 
ATOM   7511 C  CG    . GLU F 3 356 ? 28.578  -82.798 -31.532 1.00 41.41  ? 333  GLU B CG    1 
ATOM   7512 C  CD    . GLU F 3 356 ? 27.164  -82.241 -31.631 1.00 43.92  ? 333  GLU B CD    1 
ATOM   7513 O  OE1   . GLU F 3 356 ? 26.759  -81.456 -30.744 1.00 44.52  ? 333  GLU B OE1   1 
ATOM   7514 O  OE2   . GLU F 3 356 ? 26.461  -82.583 -32.608 1.00 44.59  ? 333  GLU B OE2   1 
ATOM   7515 N  N     . THR F 3 357 ? 30.733  -83.398 -27.670 1.00 34.93  ? 334  THR B N     1 
ATOM   7516 C  CA    . THR F 3 357 ? 31.376  -84.101 -26.561 1.00 33.24  ? 334  THR B CA    1 
ATOM   7517 C  C     . THR F 3 357 ? 31.120  -83.491 -25.183 1.00 33.24  ? 334  THR B C     1 
ATOM   7518 O  O     . THR F 3 357 ? 30.983  -84.212 -24.196 1.00 33.49  ? 334  THR B O     1 
ATOM   7519 C  CB    . THR F 3 357 ? 32.898  -84.200 -26.788 1.00 32.63  ? 334  THR B CB    1 
ATOM   7520 O  OG1   . THR F 3 357 ? 33.157  -85.001 -27.947 1.00 30.01  ? 334  THR B OG1   1 
ATOM   7521 C  CG2   . THR F 3 357 ? 33.574  -84.835 -25.596 1.00 33.03  ? 334  THR B CG2   1 
ATOM   7522 N  N     . TRP F 3 358 ? 31.063  -82.166 -25.116 1.00 33.73  ? 335  TRP B N     1 
ATOM   7523 C  CA    . TRP F 3 358 ? 30.815  -81.465 -23.856 1.00 34.61  ? 335  TRP B CA    1 
ATOM   7524 C  C     . TRP F 3 358 ? 29.706  -80.455 -24.093 1.00 35.37  ? 335  TRP B C     1 
ATOM   7525 O  O     . TRP F 3 358 ? 29.942  -79.247 -24.097 1.00 36.34  ? 335  TRP B O     1 
ATOM   7526 C  CB    . TRP F 3 358 ? 32.083  -80.747 -23.397 1.00 32.86  ? 335  TRP B CB    1 
ATOM   7527 C  CG    . TRP F 3 358 ? 33.221  -81.680 -23.190 1.00 33.11  ? 335  TRP B CG    1 
ATOM   7528 C  CD1   . TRP F 3 358 ? 33.376  -82.567 -22.165 1.00 33.59  ? 335  TRP B CD1   1 
ATOM   7529 C  CD2   . TRP F 3 358 ? 34.343  -81.871 -24.060 1.00 33.29  ? 335  TRP B CD2   1 
ATOM   7530 N  NE1   . TRP F 3 358 ? 34.523  -83.303 -22.342 1.00 33.67  ? 335  TRP B NE1   1 
ATOM   7531 C  CE2   . TRP F 3 358 ? 35.137  -82.896 -23.497 1.00 33.49  ? 335  TRP B CE2   1 
ATOM   7532 C  CE3   . TRP F 3 358 ? 34.755  -81.278 -25.261 1.00 32.29  ? 335  TRP B CE3   1 
ATOM   7533 C  CZ2   . TRP F 3 358 ? 36.321  -83.343 -24.095 1.00 31.21  ? 335  TRP B CZ2   1 
ATOM   7534 C  CZ3   . TRP F 3 358 ? 35.932  -81.722 -25.856 1.00 31.68  ? 335  TRP B CZ3   1 
ATOM   7535 C  CH2   . TRP F 3 358 ? 36.700  -82.746 -25.269 1.00 31.09  ? 335  TRP B CH2   1 
ATOM   7536 N  N     . PRO F 3 359 ? 28.475  -80.943 -24.297 1.00 35.65  ? 336  PRO B N     1 
ATOM   7537 C  CA    . PRO F 3 359 ? 27.313  -80.093 -24.549 1.00 37.73  ? 336  PRO B CA    1 
ATOM   7538 C  C     . PRO F 3 359 ? 26.467  -79.802 -23.321 1.00 39.98  ? 336  PRO B C     1 
ATOM   7539 O  O     . PRO F 3 359 ? 25.478  -80.489 -23.083 1.00 42.21  ? 336  PRO B O     1 
ATOM   7540 C  CB    . PRO F 3 359 ? 26.544  -80.900 -25.576 1.00 37.51  ? 336  PRO B CB    1 
ATOM   7541 C  CG    . PRO F 3 359 ? 26.697  -82.288 -25.021 1.00 36.45  ? 336  PRO B CG    1 
ATOM   7542 C  CD    . PRO F 3 359 ? 28.147  -82.357 -24.552 1.00 33.99  ? 336  PRO B CD    1 
ATOM   7543 N  N     . ASP F 3 360 ? 26.847  -78.782 -22.556 1.00 41.32  ? 337  ASP B N     1 
ATOM   7544 C  CA    . ASP F 3 360 ? 26.105  -78.399 -21.355 1.00 43.19  ? 337  ASP B CA    1 
ATOM   7545 C  C     . ASP F 3 360 ? 26.727  -77.182 -20.679 1.00 43.77  ? 337  ASP B C     1 
ATOM   7546 O  O     . ASP F 3 360 ? 26.033  -76.218 -20.351 1.00 43.64  ? 337  ASP B O     1 
ATOM   7547 C  CB    . ASP F 3 360 ? 26.049  -79.570 -20.360 1.00 44.72  ? 337  ASP B CB    1 
ATOM   7548 C  CG    . ASP F 3 360 ? 24.825  -80.467 -20.564 1.00 46.40  ? 337  ASP B CG    1 
ATOM   7549 O  OD1   . ASP F 3 360 ? 24.837  -81.617 -20.067 1.00 44.82  ? 337  ASP B OD1   1 
ATOM   7550 O  OD2   . ASP F 3 360 ? 23.848  -80.023 -21.211 1.00 45.88  ? 337  ASP B OD2   1 
ATOM   7551 N  N     . ASN F 3 361 ? 28.039  -77.231 -20.480 1.00 45.03  ? 338  ASN B N     1 
ATOM   7552 C  CA    . ASN F 3 361 ? 28.762  -76.143 -19.830 1.00 45.44  ? 338  ASN B CA    1 
ATOM   7553 C  C     . ASN F 3 361 ? 30.270  -76.380 -19.923 1.00 45.18  ? 338  ASN B C     1 
ATOM   7554 O  O     . ASN F 3 361 ? 30.722  -77.518 -20.063 1.00 44.22  ? 338  ASN B O     1 
ATOM   7555 C  CB    . ASN F 3 361 ? 28.347  -76.053 -18.360 1.00 45.91  ? 338  ASN B CB    1 
ATOM   7556 C  CG    . ASN F 3 361 ? 28.688  -77.312 -17.583 1.00 46.08  ? 338  ASN B CG    1 
ATOM   7557 O  OD1   . ASN F 3 361 ? 29.853  -77.571 -17.274 1.00 46.72  ? 338  ASN B OD1   1 
ATOM   7558 N  ND2   . ASN F 3 361 ? 27.672  -78.110 -17.278 1.00 45.24  ? 338  ASN B ND2   1 
ATOM   7559 N  N     . ALA F 3 362 ? 31.039  -75.300 -19.836 1.00 44.66  ? 339  ALA B N     1 
ATOM   7560 C  CA    . ALA F 3 362 ? 32.490  -75.384 -19.912 1.00 44.59  ? 339  ALA B CA    1 
ATOM   7561 C  C     . ALA F 3 362 ? 33.038  -76.384 -18.903 1.00 44.59  ? 339  ALA B C     1 
ATOM   7562 O  O     . ALA F 3 362 ? 33.987  -77.115 -19.193 1.00 43.74  ? 339  ALA B O     1 
ATOM   7563 C  CB    . ALA F 3 362 ? 33.097  -74.016 -19.667 1.00 45.97  ? 339  ALA B CB    1 
ATOM   7564 N  N     . GLY F 3 363 ? 32.431  -76.409 -17.721 1.00 45.02  ? 340  GLY B N     1 
ATOM   7565 C  CA    . GLY F 3 363 ? 32.864  -77.315 -16.672 1.00 45.15  ? 340  GLY B CA    1 
ATOM   7566 C  C     . GLY F 3 363 ? 33.199  -78.710 -17.161 1.00 44.89  ? 340  GLY B C     1 
ATOM   7567 O  O     . GLY F 3 363 ? 34.259  -79.247 -16.844 1.00 44.10  ? 340  GLY B O     1 
ATOM   7568 N  N     . GLN F 3 364 ? 32.297  -79.300 -17.935 1.00 45.42  ? 341  GLN B N     1 
ATOM   7569 C  CA    . GLN F 3 364 ? 32.514  -80.639 -18.457 1.00 46.99  ? 341  GLN B CA    1 
ATOM   7570 C  C     . GLN F 3 364 ? 33.843  -80.738 -19.197 1.00 47.37  ? 341  GLN B C     1 
ATOM   7571 O  O     . GLN F 3 364 ? 34.464  -81.799 -19.227 1.00 48.04  ? 341  GLN B O     1 
ATOM   7572 C  CB    . GLN F 3 364 ? 31.374  -81.028 -19.396 1.00 48.17  ? 341  GLN B CB    1 
ATOM   7573 C  CG    . GLN F 3 364 ? 30.003  -80.954 -18.759 1.00 50.27  ? 341  GLN B CG    1 
ATOM   7574 C  CD    . GLN F 3 364 ? 28.908  -81.429 -19.689 1.00 51.44  ? 341  GLN B CD    1 
ATOM   7575 O  OE1   . GLN F 3 364 ? 28.699  -80.862 -20.763 1.00 51.78  ? 341  GLN B OE1   1 
ATOM   7576 N  NE2   . GLN F 3 364 ? 28.202  -82.477 -19.284 1.00 53.00  ? 341  GLN B NE2   1 
ATOM   7577 N  N     . LEU F 3 365 ? 34.273  -79.634 -19.799 1.00 47.37  ? 342  LEU B N     1 
ATOM   7578 C  CA    . LEU F 3 365 ? 35.534  -79.616 -20.532 1.00 47.42  ? 342  LEU B CA    1 
ATOM   7579 C  C     . LEU F 3 365 ? 36.687  -79.393 -19.565 1.00 47.78  ? 342  LEU B C     1 
ATOM   7580 O  O     . LEU F 3 365 ? 37.782  -79.925 -19.748 1.00 46.74  ? 342  LEU B O     1 
ATOM   7581 C  CB    . LEU F 3 365 ? 35.525  -78.508 -21.589 1.00 46.69  ? 342  LEU B CB    1 
ATOM   7582 C  CG    . LEU F 3 365 ? 36.789  -78.390 -22.448 1.00 46.05  ? 342  LEU B CG    1 
ATOM   7583 C  CD1   . LEU F 3 365 ? 37.046  -79.705 -23.169 1.00 45.44  ? 342  LEU B CD1   1 
ATOM   7584 C  CD2   . LEU F 3 365 ? 36.631  -77.253 -23.445 1.00 44.51  ? 342  LEU B CD2   1 
ATOM   7585 N  N     . LYS F 3 366 ? 36.424  -78.600 -18.533 1.00 49.59  ? 343  LYS B N     1 
ATOM   7586 C  CA    . LYS F 3 366 ? 37.419  -78.297 -17.514 1.00 50.82  ? 343  LYS B CA    1 
ATOM   7587 C  C     . LYS F 3 366 ? 37.885  -79.606 -16.884 1.00 51.69  ? 343  LYS B C     1 
ATOM   7588 O  O     . LYS F 3 366 ? 39.085  -79.873 -16.802 1.00 51.60  ? 343  LYS B O     1 
ATOM   7589 C  CB    . LYS F 3 366 ? 36.798  -77.380 -16.452 1.00 51.37  ? 343  LYS B CB    1 
ATOM   7590 C  CG    . LYS F 3 366 ? 37.778  -76.739 -15.476 1.00 53.22  ? 343  LYS B CG    1 
ATOM   7591 C  CD    . LYS F 3 366 ? 38.257  -77.719 -14.415 1.00 55.59  ? 343  LYS B CD    1 
ATOM   7592 C  CE    . LYS F 3 366 ? 39.155  -77.034 -13.392 1.00 54.09  ? 343  LYS B CE    1 
ATOM   7593 N  NZ    . LYS F 3 366 ? 39.624  -77.988 -12.355 1.00 52.57  ? 343  LYS B NZ    1 
ATOM   7594 N  N     . GLU F 3 367 ? 36.920  -80.423 -16.463 1.00 52.70  ? 344  GLU B N     1 
ATOM   7595 C  CA    . GLU F 3 367 ? 37.185  -81.713 -15.830 1.00 51.66  ? 344  GLU B CA    1 
ATOM   7596 C  C     . GLU F 3 367 ? 37.968  -82.678 -16.718 1.00 51.12  ? 344  GLU B C     1 
ATOM   7597 O  O     . GLU F 3 367 ? 38.732  -83.504 -16.220 1.00 51.58  ? 344  GLU B O     1 
ATOM   7598 C  CB    . GLU F 3 367 ? 35.866  -82.365 -15.404 1.00 51.66  ? 344  GLU B CB    1 
ATOM   7599 C  CG    . GLU F 3 367 ? 35.067  -81.546 -14.401 0.00 52.52  ? 344  GLU B CG    1 
ATOM   7600 C  CD    . GLU F 3 367 ? 35.834  -81.285 -13.119 0.00 52.77  ? 344  GLU B CD    1 
ATOM   7601 O  OE1   . GLU F 3 367 ? 36.206  -82.263 -12.437 0.00 52.97  ? 344  GLU B OE1   1 
ATOM   7602 O  OE2   . GLU F 3 367 ? 36.066  -80.102 -12.794 0.00 52.97  ? 344  GLU B OE2   1 
ATOM   7603 N  N     . PHE F 3 368 ? 37.776  -82.581 -18.028 1.00 50.55  ? 345  PHE B N     1 
ATOM   7604 C  CA    . PHE F 3 368 ? 38.483  -83.458 -18.952 1.00 50.61  ? 345  PHE B CA    1 
ATOM   7605 C  C     . PHE F 3 368 ? 39.928  -82.996 -19.099 1.00 51.90  ? 345  PHE B C     1 
ATOM   7606 O  O     . PHE F 3 368 ? 40.839  -83.809 -19.258 1.00 52.18  ? 345  PHE B O     1 
ATOM   7607 C  CB    . PHE F 3 368 ? 37.809  -83.452 -20.324 1.00 49.20  ? 345  PHE B CB    1 
ATOM   7608 C  CG    . PHE F 3 368 ? 38.399  -84.439 -21.290 1.00 47.32  ? 345  PHE B CG    1 
ATOM   7609 C  CD1   . PHE F 3 368 ? 38.032  -85.777 -21.246 1.00 47.27  ? 345  PHE B CD1   1 
ATOM   7610 C  CD2   . PHE F 3 368 ? 39.343  -84.035 -22.229 1.00 47.60  ? 345  PHE B CD2   1 
ATOM   7611 C  CE1   . PHE F 3 368 ? 38.599  -86.702 -22.122 1.00 47.80  ? 345  PHE B CE1   1 
ATOM   7612 C  CE2   . PHE F 3 368 ? 39.917  -84.950 -23.109 1.00 46.86  ? 345  PHE B CE2   1 
ATOM   7613 C  CZ    . PHE F 3 368 ? 39.543  -86.285 -23.055 1.00 47.45  ? 345  PHE B CZ    1 
ATOM   7614 N  N     . LEU F 3 369 ? 40.134  -81.684 -19.053 1.00 53.14  ? 346  LEU B N     1 
ATOM   7615 C  CA    . LEU F 3 369 ? 41.474  -81.127 -19.179 1.00 54.90  ? 346  LEU B CA    1 
ATOM   7616 C  C     . LEU F 3 369 ? 42.329  -81.570 -17.994 1.00 55.54  ? 346  LEU B C     1 
ATOM   7617 O  O     . LEU F 3 369 ? 43.506  -81.891 -18.149 1.00 54.55  ? 346  LEU B O     1 
ATOM   7618 C  CB    . LEU F 3 369 ? 41.410  -79.596 -19.242 1.00 55.69  ? 346  LEU B CB    1 
ATOM   7619 C  CG    . LEU F 3 369 ? 40.706  -78.977 -20.453 0.00 55.99  ? 346  LEU B CG    1 
ATOM   7620 C  CD1   . LEU F 3 369 ? 40.628  -77.467 -20.285 0.00 56.36  ? 346  LEU B CD1   1 
ATOM   7621 C  CD2   . LEU F 3 369 ? 41.460  -79.335 -21.723 0.00 56.36  ? 346  LEU B CD2   1 
ATOM   7622 N  N     . ASP F 3 370 ? 41.725  -81.595 -16.811 1.00 57.06  ? 347  ASP B N     1 
ATOM   7623 C  CA    . ASP F 3 370 ? 42.429  -82.005 -15.602 1.00 58.74  ? 347  ASP B CA    1 
ATOM   7624 C  C     . ASP F 3 370 ? 42.931  -83.438 -15.736 1.00 59.78  ? 347  ASP B C     1 
ATOM   7625 O  O     . ASP F 3 370 ? 44.125  -83.700 -15.622 1.00 59.70  ? 347  ASP B O     1 
ATOM   7626 C  CB    . ASP F 3 370 ? 41.503  -81.900 -14.389 1.00 58.65  ? 347  ASP B CB    1 
ATOM   7627 C  CG    . ASP F 3 370 ? 40.877  -80.525 -14.251 1.00 59.89  ? 347  ASP B CG    1 
ATOM   7628 O  OD1   . ASP F 3 370 ? 41.617  -79.521 -14.339 1.00 59.76  ? 347  ASP B OD1   1 
ATOM   7629 O  OD2   . ASP F 3 370 ? 39.645  -80.449 -14.046 1.00 60.50  ? 347  ASP B OD2   1 
ATOM   7630 N  N     . ALA F 3 371 ? 42.009  -84.362 -15.981 1.00 61.45  ? 348  ALA B N     1 
ATOM   7631 C  CA    . ALA F 3 371 ? 42.353  -85.769 -16.130 1.00 63.58  ? 348  ALA B CA    1 
ATOM   7632 C  C     . ALA F 3 371 ? 43.510  -85.959 -17.102 1.00 65.37  ? 348  ALA B C     1 
ATOM   7633 O  O     . ALA F 3 371 ? 44.309  -86.885 -16.959 1.00 65.86  ? 348  ALA B O     1 
ATOM   7634 C  CB    . ALA F 3 371 ? 41.139  -86.549 -16.611 1.00 63.68  ? 348  ALA B CB    1 
ATOM   7635 N  N     . LYS F 3 372 ? 43.599  -85.076 -18.090 1.00 67.68  ? 349  LYS B N     1 
ATOM   7636 C  CA    . LYS F 3 372 ? 44.656  -85.159 -19.088 1.00 70.54  ? 349  LYS B CA    1 
ATOM   7637 C  C     . LYS F 3 372 ? 46.010  -84.648 -18.604 1.00 72.88  ? 349  LYS B C     1 
ATOM   7638 O  O     . LYS F 3 372 ? 47.036  -85.277 -18.860 1.00 73.05  ? 349  LYS B O     1 
ATOM   7639 C  CB    . LYS F 3 372 ? 44.237  -84.403 -20.351 1.00 70.27  ? 349  LYS B CB    1 
ATOM   7640 C  CG    . LYS F 3 372 ? 43.252  -85.162 -21.221 1.00 69.83  ? 349  LYS B CG    1 
ATOM   7641 C  CD    . LYS F 3 372 ? 43.904  -86.404 -21.803 1.00 70.13  ? 349  LYS B CD    1 
ATOM   7642 C  CE    . LYS F 3 372 ? 42.943  -87.176 -22.685 1.00 70.95  ? 349  LYS B CE    1 
ATOM   7643 N  NZ    . LYS F 3 372 ? 43.613  -88.335 -23.332 1.00 72.00  ? 349  LYS B NZ    1 
ATOM   7644 N  N     . VAL F 3 373 ? 46.017  -83.513 -17.908 1.00 75.60  ? 350  VAL B N     1 
ATOM   7645 C  CA    . VAL F 3 373 ? 47.265  -82.940 -17.410 1.00 77.68  ? 350  VAL B CA    1 
ATOM   7646 C  C     . VAL F 3 373 ? 47.992  -83.903 -16.482 1.00 79.25  ? 350  VAL B C     1 
ATOM   7647 O  O     . VAL F 3 373 ? 49.200  -83.784 -16.274 1.00 79.42  ? 350  VAL B O     1 
ATOM   7648 C  CB    . VAL F 3 373 ? 47.025  -81.617 -16.649 1.00 77.95  ? 350  VAL B CB    1 
ATOM   7649 C  CG1   . VAL F 3 373 ? 46.339  -80.618 -17.557 1.00 78.20  ? 350  VAL B CG1   1 
ATOM   7650 C  CG2   . VAL F 3 373 ? 46.199  -81.868 -15.397 1.00 77.70  ? 350  VAL B CG2   1 
ATOM   7651 N  N     . LYS F 3 374 ? 47.248  -84.854 -15.926 1.00 81.08  ? 351  LYS B N     1 
ATOM   7652 C  CA    . LYS F 3 374 ? 47.817  -85.847 -15.023 1.00 83.14  ? 351  LYS B CA    1 
ATOM   7653 C  C     . LYS F 3 374 ? 47.811  -87.227 -15.665 1.00 84.49  ? 351  LYS B C     1 
ATOM   7654 O  O     . LYS F 3 374 ? 47.437  -88.214 -15.033 1.00 85.11  ? 351  LYS B O     1 
ATOM   7655 C  CB    . LYS F 3 374 ? 47.033  -85.880 -13.706 1.00 82.99  ? 351  LYS B CB    1 
ATOM   7656 C  CG    . LYS F 3 374 ? 47.252  -84.658 -12.826 1.00 84.26  ? 351  LYS B CG    1 
ATOM   7657 C  CD    . LYS F 3 374 ? 46.479  -84.760 -11.522 1.00 85.01  ? 351  LYS B CD    1 
ATOM   7658 C  CE    . LYS F 3 374 ? 44.981  -84.656 -11.755 1.00 86.07  ? 351  LYS B CE    1 
ATOM   7659 N  NZ    . LYS F 3 374 ? 44.608  -83.339 -12.346 1.00 86.11  ? 351  LYS B NZ    1 
ATOM   7660 N  N     . GLN F 3 375 ? 48.231  -87.288 -16.924 1.00 86.51  ? 352  GLN B N     1 
ATOM   7661 C  CA    . GLN F 3 375 ? 48.277  -88.545 -17.660 1.00 88.33  ? 352  GLN B CA    1 
ATOM   7662 C  C     . GLN F 3 375 ? 49.699  -89.097 -17.626 1.00 88.93  ? 352  GLN B C     1 
ATOM   7663 O  O     . GLN F 3 375 ? 50.470  -88.774 -16.723 1.00 89.46  ? 352  GLN B O     1 
ATOM   7664 C  CB    . GLN F 3 375 ? 47.840  -88.325 -19.111 1.00 89.80  ? 352  GLN B CB    1 
ATOM   7665 C  CG    . GLN F 3 375 ? 47.163  -89.530 -19.746 1.00 91.72  ? 352  GLN B CG    1 
ATOM   7666 C  CD    . GLN F 3 375 ? 45.797  -89.813 -19.143 1.00 92.43  ? 352  GLN B CD    1 
ATOM   7667 O  OE1   . GLN F 3 375 ? 44.873  -89.009 -19.268 1.00 92.46  ? 352  GLN B OE1   1 
ATOM   7668 N  NE2   . GLN F 3 375 ? 45.666  -90.957 -18.481 1.00 93.24  ? 352  GLN B NE2   1 
ATOM   7669 N  N     . SER F 3 376 ? 50.048  -89.920 -18.610 1.00 89.80  ? 353  SER B N     1 
ATOM   7670 C  CA    . SER F 3 376 ? 51.382  -90.513 -18.670 1.00 90.58  ? 353  SER B CA    1 
ATOM   7671 C  C     . SER F 3 376 ? 52.223  -89.994 -19.835 1.00 90.90  ? 353  SER B C     1 
ATOM   7672 O  O     . SER F 3 376 ? 53.452  -89.968 -19.754 1.00 90.60  ? 353  SER B O     1 
ATOM   7673 C  CB    . SER F 3 376 ? 51.272  -92.037 -18.762 0.00 90.70  ? 353  SER B CB    1 
ATOM   7674 O  OG    . SER F 3 376 ? 50.623  -92.571 -17.621 0.00 91.05  ? 353  SER B OG    1 
ATOM   7675 N  N     . ASP F 3 377 ? 51.560  -89.589 -20.916 1.00 91.53  ? 354  ASP B N     1 
ATOM   7676 C  CA    . ASP F 3 377 ? 52.246  -89.072 -22.098 1.00 91.58  ? 354  ASP B CA    1 
ATOM   7677 C  C     . ASP F 3 377 ? 52.078  -87.560 -22.208 1.00 91.54  ? 354  ASP B C     1 
ATOM   7678 O  O     . ASP F 3 377 ? 51.603  -87.049 -23.224 1.00 91.42  ? 354  ASP B O     1 
ATOM   7679 C  CB    . ASP F 3 377 ? 51.700  -89.742 -23.362 0.00 92.02  ? 354  ASP B CB    1 
ATOM   7680 C  CG    . ASP F 3 377 ? 51.910  -91.244 -23.364 0.00 92.29  ? 354  ASP B CG    1 
ATOM   7681 O  OD1   . ASP F 3 377 ? 51.500  -91.899 -24.345 0.00 92.47  ? 354  ASP B OD1   1 
ATOM   7682 O  OD2   . ASP F 3 377 ? 52.484  -91.769 -22.387 0.00 92.47  ? 354  ASP B OD2   1 
ATOM   7683 N  N     . TYR F 3 378 ? 52.478  -86.853 -21.155 1.00 91.36  ? 355  TYR B N     1 
ATOM   7684 C  CA    . TYR F 3 378 ? 52.371  -85.398 -21.103 1.00 91.47  ? 355  TYR B CA    1 
ATOM   7685 C  C     . TYR F 3 378 ? 53.314  -84.830 -20.044 1.00 91.49  ? 355  TYR B C     1 
ATOM   7686 O  O     . TYR F 3 378 ? 53.285  -85.253 -18.889 1.00 92.49  ? 355  TYR B O     1 
ATOM   7687 C  CB    . TYR F 3 378 ? 50.932  -84.996 -20.773 1.00 91.28  ? 355  TYR B CB    1 
ATOM   7688 C  CG    . TYR F 3 378 ? 50.748  -83.528 -20.466 1.00 91.25  ? 355  TYR B CG    1 
ATOM   7689 C  CD1   . TYR F 3 378 ? 50.868  -82.563 -21.465 1.00 91.34  ? 355  TYR B CD1   1 
ATOM   7690 C  CD2   . TYR F 3 378 ? 50.459  -83.103 -19.170 1.00 91.51  ? 355  TYR B CD2   1 
ATOM   7691 C  CE1   . TYR F 3 378 ? 50.704  -81.207 -21.179 1.00 91.67  ? 355  TYR B CE1   1 
ATOM   7692 C  CE2   . TYR F 3 378 ? 50.295  -81.754 -18.873 1.00 91.88  ? 355  TYR B CE2   1 
ATOM   7693 C  CZ    . TYR F 3 378 ? 50.418  -80.811 -19.879 1.00 91.75  ? 355  TYR B CZ    1 
ATOM   7694 O  OH    . TYR F 3 378 ? 50.258  -79.477 -19.580 1.00 91.77  ? 355  TYR B OH    1 
ATOM   7695 N  N     . ASP F 3 379 ? 54.144  -83.871 -20.439 1.00 90.68  ? 356  ASP B N     1 
ATOM   7696 C  CA    . ASP F 3 379 ? 55.087  -83.253 -19.512 1.00 89.90  ? 356  ASP B CA    1 
ATOM   7697 C  C     . ASP F 3 379 ? 55.087  -81.738 -19.664 1.00 88.83  ? 356  ASP B C     1 
ATOM   7698 O  O     . ASP F 3 379 ? 55.204  -81.226 -20.776 1.00 88.25  ? 356  ASP B O     1 
ATOM   7699 C  CB    . ASP F 3 379 ? 56.500  -83.787 -19.760 0.00 90.42  ? 356  ASP B CB    1 
ATOM   7700 C  CG    . ASP F 3 379 ? 56.605  -85.284 -19.550 0.00 90.80  ? 356  ASP B CG    1 
ATOM   7701 O  OD1   . ASP F 3 379 ? 55.917  -86.037 -20.270 0.00 91.04  ? 356  ASP B OD1   1 
ATOM   7702 O  OD2   . ASP F 3 379 ? 57.376  -85.707 -18.663 0.00 91.04  ? 356  ASP B OD2   1 
ATOM   7703 N  N     . ARG F 3 380 ? 54.959  -81.026 -18.546 1.00 87.76  ? 357  ARG B N     1 
ATOM   7704 C  CA    . ARG F 3 380 ? 54.955  -79.566 -18.569 1.00 87.16  ? 357  ARG B CA    1 
ATOM   7705 C  C     . ARG F 3 380 ? 56.167  -79.020 -19.310 1.00 87.76  ? 357  ARG B C     1 
ATOM   7706 O  O     . ARG F 3 380 ? 56.199  -77.850 -19.692 1.00 87.67  ? 357  ARG B O     1 
ATOM   7707 C  CB    . ARG F 3 380 ? 54.956  -79.002 -17.151 1.00 85.94  ? 357  ARG B CB    1 
ATOM   7708 C  CG    . ARG F 3 380 ? 53.676  -79.207 -16.390 1.00 85.37  ? 357  ARG B CG    1 
ATOM   7709 C  CD    . ARG F 3 380 ? 53.691  -78.350 -15.145 1.00 85.90  ? 357  ARG B CD    1 
ATOM   7710 N  NE    . ARG F 3 380 ? 52.480  -78.508 -14.353 1.00 86.29  ? 357  ARG B NE    1 
ATOM   7711 C  CZ    . ARG F 3 380 ? 52.217  -77.814 -13.252 1.00 86.27  ? 357  ARG B CZ    1 
ATOM   7712 N  NH1   . ARG F 3 380 ? 53.083  -76.911 -12.814 1.00 86.70  ? 357  ARG B NH1   1 
ATOM   7713 N  NH2   . ARG F 3 380 ? 51.092  -78.025 -12.586 1.00 86.98  ? 357  ARG B NH2   1 
ATOM   7714 N  N     . SER F 3 381 ? 57.168  -79.873 -19.496 1.00 88.38  ? 358  SER B N     1 
ATOM   7715 C  CA    . SER F 3 381 ? 58.388  -79.491 -20.194 1.00 88.25  ? 358  SER B CA    1 
ATOM   7716 C  C     . SER F 3 381 ? 58.018  -78.798 -21.499 1.00 87.74  ? 358  SER B C     1 
ATOM   7717 O  O     . SER F 3 381 ? 58.221  -77.595 -21.656 1.00 87.69  ? 358  SER B O     1 
ATOM   7718 C  CB    . SER F 3 381 ? 59.233  -80.733 -20.493 1.00 89.22  ? 358  SER B CB    1 
ATOM   7719 O  OG    . SER F 3 381 ? 59.512  -81.467 -19.312 1.00 89.57  ? 358  SER B OG    1 
ATOM   7720 N  N     . THR F 3 382 ? 57.464  -79.571 -22.428 1.00 87.30  ? 359  THR B N     1 
ATOM   7721 C  CA    . THR F 3 382 ? 57.053  -79.055 -23.726 1.00 86.90  ? 359  THR B CA    1 
ATOM   7722 C  C     . THR F 3 382 ? 55.535  -78.878 -23.777 1.00 86.68  ? 359  THR B C     1 
ATOM   7723 O  O     . THR F 3 382 ? 54.866  -79.433 -24.650 1.00 87.09  ? 359  THR B O     1 
ATOM   7724 C  CB    . THR F 3 382 ? 57.482  -80.012 -24.859 1.00 86.63  ? 359  THR B CB    1 
ATOM   7725 O  OG1   . THR F 3 382 ? 56.878  -81.296 -24.657 0.00 87.15  ? 359  THR B OG1   1 
ATOM   7726 C  CG2   . THR F 3 382 ? 58.995  -80.168 -24.880 0.00 87.15  ? 359  THR B CG2   1 
ATOM   7727 N  N     . SER F 3 383 ? 54.997  -78.105 -22.837 1.00 85.74  ? 360  SER B N     1 
ATOM   7728 C  CA    . SER F 3 383 ? 53.558  -77.862 -22.779 1.00 84.67  ? 360  SER B CA    1 
ATOM   7729 C  C     . SER F 3 383 ? 53.206  -76.385 -22.853 1.00 83.36  ? 360  SER B C     1 
ATOM   7730 O  O     . SER F 3 383 ? 53.958  -75.531 -22.384 1.00 83.87  ? 360  SER B O     1 
ATOM   7731 C  CB    . SER F 3 383 ? 52.967  -78.440 -21.494 1.00 85.73  ? 360  SER B CB    1 
ATOM   7732 O  OG    . SER F 3 383 ? 51.612  -78.048 -21.349 1.00 86.43  ? 360  SER B OG    1 
ATOM   7733 N  N     . ASN F 3 384 ? 52.047  -76.095 -23.436 1.00 81.04  ? 361  ASN B N     1 
ATOM   7734 C  CA    . ASN F 3 384 ? 51.579  -74.726 -23.577 1.00 78.92  ? 361  ASN B CA    1 
ATOM   7735 C  C     . ASN F 3 384 ? 50.290  -74.544 -22.791 1.00 77.96  ? 361  ASN B C     1 
ATOM   7736 O  O     . ASN F 3 384 ? 49.547  -73.585 -23.007 1.00 77.41  ? 361  ASN B O     1 
ATOM   7737 C  CB    . ASN F 3 384 ? 51.329  -74.411 -25.049 1.00 78.81  ? 361  ASN B CB    1 
ATOM   7738 C  CG    . ASN F 3 384 ? 52.547  -74.667 -25.911 1.00 79.27  ? 361  ASN B CG    1 
ATOM   7739 O  OD1   . ASN F 3 384 ? 53.593  -74.044 -25.729 1.00 79.71  ? 361  ASN B OD1   1 
ATOM   7740 N  ND2   . ASN F 3 384 ? 52.418  -75.592 -26.856 1.00 78.66  ? 361  ASN B ND2   1 
ATOM   7741 N  N     . ILE F 3 385 ? 50.031  -75.472 -21.876 1.00 76.64  ? 362  ILE B N     1 
ATOM   7742 C  CA    . ILE F 3 385 ? 48.827  -75.424 -21.060 1.00 75.25  ? 362  ILE B CA    1 
ATOM   7743 C  C     . ILE F 3 385 ? 49.147  -75.324 -19.576 1.00 75.10  ? 362  ILE B C     1 
ATOM   7744 O  O     . ILE F 3 385 ? 49.927  -76.114 -19.045 1.00 74.78  ? 362  ILE B O     1 
ATOM   7745 C  CB    . ILE F 3 385 ? 47.964  -76.673 -21.281 1.00 74.17  ? 362  ILE B CB    1 
ATOM   7746 C  CG1   . ILE F 3 385 ? 47.648  -76.827 -22.768 1.00 73.96  ? 362  ILE B CG1   1 
ATOM   7747 C  CG2   . ILE F 3 385 ? 46.681  -76.560 -20.478 1.00 72.81  ? 362  ILE B CG2   1 
ATOM   7748 C  CD1   . ILE F 3 385 ? 46.943  -78.118 -23.114 1.00 74.55  ? 362  ILE B CD1   1 
ATOM   7749 N  N     . ASP F 3 386 ? 48.536  -74.348 -18.914 1.00 75.34  ? 363  ASP B N     1 
ATOM   7750 C  CA    . ASP F 3 386 ? 48.735  -74.136 -17.487 1.00 76.49  ? 363  ASP B CA    1 
ATOM   7751 C  C     . ASP F 3 386 ? 47.607  -74.822 -16.725 1.00 76.25  ? 363  ASP B C     1 
ATOM   7752 O  O     . ASP F 3 386 ? 46.521  -74.263 -16.570 1.00 76.38  ? 363  ASP B O     1 
ATOM   7753 C  CB    . ASP F 3 386 ? 48.742  -72.638 -17.168 1.00 78.76  ? 363  ASP B CB    1 
ATOM   7754 C  CG    . ASP F 3 386 ? 48.937  -72.354 -15.688 1.00 81.00  ? 363  ASP B CG    1 
ATOM   7755 O  OD1   . ASP F 3 386 ? 48.098  -72.798 -14.877 1.00 82.27  ? 363  ASP B OD1   1 
ATOM   7756 O  OD2   . ASP F 3 386 ? 49.929  -71.682 -15.335 1.00 82.71  ? 363  ASP B OD2   1 
ATOM   7757 N  N     . PRO F 3 387 ? 47.853  -76.046 -16.237 1.00 75.77  ? 364  PRO B N     1 
ATOM   7758 C  CA    . PRO F 3 387 ? 46.851  -76.811 -15.491 1.00 75.35  ? 364  PRO B CA    1 
ATOM   7759 C  C     . PRO F 3 387 ? 46.307  -76.114 -14.248 1.00 74.94  ? 364  PRO B C     1 
ATOM   7760 O  O     . PRO F 3 387 ? 45.397  -76.624 -13.595 1.00 74.63  ? 364  PRO B O     1 
ATOM   7761 C  CB    . PRO F 3 387 ? 47.581  -78.112 -15.165 1.00 75.52  ? 364  PRO B CB    1 
ATOM   7762 C  CG    . PRO F 3 387 ? 49.020  -77.698 -15.127 1.00 76.00  ? 364  PRO B CG    1 
ATOM   7763 C  CD    . PRO F 3 387 ? 49.123  -76.789 -16.314 1.00 75.56  ? 364  PRO B CD    1 
ATOM   7764 N  N     . LEU F 3 388 ? 46.857  -74.950 -13.924 1.00 74.79  ? 365  LEU B N     1 
ATOM   7765 C  CA    . LEU F 3 388 ? 46.398  -74.207 -12.758 1.00 75.70  ? 365  LEU B CA    1 
ATOM   7766 C  C     . LEU F 3 388 ? 45.363  -73.166 -13.183 1.00 75.01  ? 365  LEU B C     1 
ATOM   7767 O  O     . LEU F 3 388 ? 44.860  -72.396 -12.364 1.00 75.29  ? 365  LEU B O     1 
ATOM   7768 C  CB    . LEU F 3 388 ? 47.583  -73.531 -12.056 1.00 77.11  ? 365  LEU B CB    1 
ATOM   7769 C  CG    . LEU F 3 388 ? 47.316  -72.900 -10.684 1.00 79.01  ? 365  LEU B CG    1 
ATOM   7770 C  CD1   . LEU F 3 388 ? 46.713  -73.936 -9.740  1.00 79.09  ? 365  LEU B CD1   1 
ATOM   7771 C  CD2   . LEU F 3 388 ? 48.614  -72.349 -10.112 1.00 78.98  ? 365  LEU B CD2   1 
ATOM   7772 N  N     . LYS F 3 389 ? 45.049  -73.154 -14.475 1.00 73.98  ? 366  LYS B N     1 
ATOM   7773 C  CA    . LYS F 3 389 ? 44.071  -72.224 -15.028 1.00 72.80  ? 366  LYS B CA    1 
ATOM   7774 C  C     . LYS F 3 389 ? 43.339  -72.850 -16.213 1.00 71.25  ? 366  LYS B C     1 
ATOM   7775 O  O     . LYS F 3 389 ? 43.086  -72.186 -17.218 1.00 71.28  ? 366  LYS B O     1 
ATOM   7776 C  CB    . LYS F 3 389 ? 44.752  -70.925 -15.477 1.00 73.48  ? 366  LYS B CB    1 
ATOM   7777 C  CG    . LYS F 3 389 ? 45.153  -69.989 -14.347 1.00 74.31  ? 366  LYS B CG    1 
ATOM   7778 C  CD    . LYS F 3 389 ? 45.738  -68.690 -14.893 1.00 74.52  ? 366  LYS B CD    1 
ATOM   7779 C  CE    . LYS F 3 389 ? 46.055  -67.703 -13.780 1.00 74.70  ? 366  LYS B CE    1 
ATOM   7780 N  NZ    . LYS F 3 389 ? 47.015  -68.268 -12.791 0.00 74.91  ? 366  LYS B NZ    1 
ATOM   7781 N  N     . THR F 3 390 ? 43.004  -74.130 -16.094 1.00 68.72  ? 367  THR B N     1 
ATOM   7782 C  CA    . THR F 3 390 ? 42.298  -74.825 -17.162 1.00 65.88  ? 367  THR B CA    1 
ATOM   7783 C  C     . THR F 3 390 ? 40.847  -74.366 -17.222 1.00 64.85  ? 367  THR B C     1 
ATOM   7784 O  O     . THR F 3 390 ? 40.146  -74.628 -18.198 1.00 64.90  ? 367  THR B O     1 
ATOM   7785 C  CB    . THR F 3 390 ? 42.317  -76.350 -16.955 1.00 65.20  ? 367  THR B CB    1 
ATOM   7786 O  OG1   . THR F 3 390 ? 41.781  -76.665 -15.664 1.00 63.92  ? 367  THR B OG1   1 
ATOM   7787 C  CG2   . THR F 3 390 ? 43.733  -76.887 -17.062 1.00 64.35  ? 367  THR B CG2   1 
ATOM   7788 N  N     . ALA F 3 391 ? 40.405  -73.680 -16.172 1.00 63.07  ? 368  ALA B N     1 
ATOM   7789 C  CA    . ALA F 3 391 ? 39.036  -73.182 -16.101 1.00 60.99  ? 368  ALA B CA    1 
ATOM   7790 C  C     . ALA F 3 391 ? 38.777  -72.164 -17.205 1.00 59.23  ? 368  ALA B C     1 
ATOM   7791 O  O     . ALA F 3 391 ? 37.690  -72.117 -17.781 1.00 59.05  ? 368  ALA B O     1 
ATOM   7792 C  CB    . ALA F 3 391 ? 38.782  -72.550 -14.738 1.00 61.83  ? 368  ALA B CB    1 
ATOM   7793 N  N     . ASP F 3 392 ? 39.784  -71.350 -17.495 1.00 57.06  ? 369  ASP B N     1 
ATOM   7794 C  CA    . ASP F 3 392 ? 39.670  -70.331 -18.530 1.00 54.03  ? 369  ASP B CA    1 
ATOM   7795 C  C     . ASP F 3 392 ? 39.796  -70.931 -19.932 1.00 51.49  ? 369  ASP B C     1 
ATOM   7796 O  O     . ASP F 3 392 ? 39.046  -70.567 -20.833 1.00 51.56  ? 369  ASP B O     1 
ATOM   7797 C  CB    . ASP F 3 392 ? 40.729  -69.242 -18.305 1.00 53.98  ? 369  ASP B CB    1 
ATOM   7798 C  CG    . ASP F 3 392 ? 40.408  -68.350 -17.109 1.00 53.24  ? 369  ASP B CG    1 
ATOM   7799 O  OD1   . ASP F 3 392 ? 41.286  -67.565 -16.688 1.00 52.01  ? 369  ASP B OD1   1 
ATOM   7800 O  OD2   . ASP F 3 392 ? 39.270  -68.428 -16.596 1.00 52.05  ? 369  ASP B OD2   1 
ATOM   7801 N  N     . LEU F 3 393 ? 40.735  -71.854 -20.115 1.00 48.69  ? 370  LEU B N     1 
ATOM   7802 C  CA    . LEU F 3 393 ? 40.918  -72.492 -21.416 1.00 45.85  ? 370  LEU B CA    1 
ATOM   7803 C  C     . LEU F 3 393 ? 39.650  -73.243 -21.799 1.00 45.16  ? 370  LEU B C     1 
ATOM   7804 O  O     . LEU F 3 393 ? 39.370  -73.447 -22.980 1.00 45.05  ? 370  LEU B O     1 
ATOM   7805 C  CB    . LEU F 3 393 ? 42.098  -73.470 -21.380 1.00 43.95  ? 370  LEU B CB    1 
ATOM   7806 C  CG    . LEU F 3 393 ? 42.311  -74.325 -22.637 1.00 42.28  ? 370  LEU B CG    1 
ATOM   7807 C  CD1   . LEU F 3 393 ? 42.613  -73.434 -23.823 1.00 42.35  ? 370  LEU B CD1   1 
ATOM   7808 C  CD2   . LEU F 3 393 ? 43.449  -75.299 -22.413 1.00 41.31  ? 370  LEU B CD2   1 
ATOM   7809 N  N     . ALA F 3 394 ? 38.887  -73.656 -20.792 1.00 44.53  ? 371  ALA B N     1 
ATOM   7810 C  CA    . ALA F 3 394 ? 37.647  -74.386 -21.021 1.00 43.87  ? 371  ALA B CA    1 
ATOM   7811 C  C     . ALA F 3 394 ? 36.568  -73.433 -21.505 1.00 43.00  ? 371  ALA B C     1 
ATOM   7812 O  O     . ALA F 3 394 ? 35.887  -73.706 -22.494 1.00 43.75  ? 371  ALA B O     1 
ATOM   7813 C  CB    . ALA F 3 394 ? 37.197  -75.078 -19.741 1.00 43.90  ? 371  ALA B CB    1 
ATOM   7814 N  N     . GLU F 3 395 ? 36.408  -72.314 -20.804 1.00 41.68  ? 372  GLU B N     1 
ATOM   7815 C  CA    . GLU F 3 395 ? 35.409  -71.324 -21.190 1.00 40.15  ? 372  GLU B CA    1 
ATOM   7816 C  C     . GLU F 3 395 ? 35.720  -70.854 -22.608 1.00 38.40  ? 372  GLU B C     1 
ATOM   7817 O  O     . GLU F 3 395 ? 34.815  -70.582 -23.397 1.00 39.07  ? 372  GLU B O     1 
ATOM   7818 C  CB    . GLU F 3 395 ? 35.431  -70.129 -20.228 1.00 38.89  ? 372  GLU B CB    1 
ATOM   7819 C  CG    . GLU F 3 395 ? 34.410  -69.051 -20.554 0.00 39.56  ? 372  GLU B CG    1 
ATOM   7820 C  CD    . GLU F 3 395 ? 34.473  -67.876 -19.597 0.00 39.64  ? 372  GLU B CD    1 
ATOM   7821 O  OE1   . GLU F 3 395 ? 33.668  -66.934 -19.758 0.00 39.85  ? 372  GLU B OE1   1 
ATOM   7822 O  OE2   . GLU F 3 395 ? 35.327  -67.892 -18.685 0.00 39.85  ? 372  GLU B OE2   1 
ATOM   7823 N  N     . LYS F 3 396 ? 37.007  -70.779 -22.928 1.00 35.71  ? 373  LYS B N     1 
ATOM   7824 C  CA    . LYS F 3 396 ? 37.442  -70.343 -24.246 1.00 33.60  ? 373  LYS B CA    1 
ATOM   7825 C  C     . LYS F 3 396 ? 37.008  -71.348 -25.304 1.00 32.58  ? 373  LYS B C     1 
ATOM   7826 O  O     . LYS F 3 396 ? 36.264  -71.009 -26.222 1.00 33.67  ? 373  LYS B O     1 
ATOM   7827 C  CB    . LYS F 3 396 ? 38.964  -70.179 -24.274 1.00 33.71  ? 373  LYS B CB    1 
ATOM   7828 C  CG    . LYS F 3 396 ? 39.510  -69.559 -25.557 1.00 34.13  ? 373  LYS B CG    1 
ATOM   7829 C  CD    . LYS F 3 396 ? 41.029  -69.449 -25.510 1.00 33.73  ? 373  LYS B CD    1 
ATOM   7830 C  CE    . LYS F 3 396 ? 41.591  -68.856 -26.790 1.00 32.83  ? 373  LYS B CE    1 
ATOM   7831 N  NZ    . LYS F 3 396 ? 43.079  -68.827 -26.759 1.00 31.88  ? 373  LYS B NZ    1 
ATOM   7832 N  N     . LEU F 3 397 ? 37.469  -72.586 -25.172 1.00 30.72  ? 374  LEU B N     1 
ATOM   7833 C  CA    . LEU F 3 397 ? 37.118  -73.624 -26.129 1.00 28.71  ? 374  LEU B CA    1 
ATOM   7834 C  C     . LEU F 3 397 ? 35.612  -73.855 -26.182 1.00 28.26  ? 374  LEU B C     1 
ATOM   7835 O  O     . LEU F 3 397 ? 35.057  -74.153 -27.237 1.00 27.11  ? 374  LEU B O     1 
ATOM   7836 C  CB    . LEU F 3 397 ? 37.837  -74.927 -25.778 1.00 29.84  ? 374  LEU B CB    1 
ATOM   7837 C  CG    . LEU F 3 397 ? 39.339  -74.957 -26.074 1.00 31.92  ? 374  LEU B CG    1 
ATOM   7838 C  CD1   . LEU F 3 397 ? 39.946  -76.271 -25.599 1.00 33.20  ? 374  LEU B CD1   1 
ATOM   7839 C  CD2   . LEU F 3 397 ? 39.557  -74.785 -27.570 1.00 32.52  ? 374  LEU B CD2   1 
ATOM   7840 N  N     . PHE F 3 398 ? 34.947  -73.704 -25.043 1.00 28.63  ? 375  PHE B N     1 
ATOM   7841 C  CA    . PHE F 3 398 ? 33.507  -73.909 -24.989 1.00 28.43  ? 375  PHE B CA    1 
ATOM   7842 C  C     . PHE F 3 398 ? 32.753  -72.910 -25.861 1.00 28.68  ? 375  PHE B C     1 
ATOM   7843 O  O     . PHE F 3 398 ? 31.850  -73.286 -26.611 1.00 28.23  ? 375  PHE B O     1 
ATOM   7844 C  CB    . PHE F 3 398 ? 32.996  -73.796 -23.554 1.00 27.69  ? 375  PHE B CB    1 
ATOM   7845 C  CG    . PHE F 3 398 ? 31.553  -74.167 -23.409 1.00 27.99  ? 375  PHE B CG    1 
ATOM   7846 C  CD1   . PHE F 3 398 ? 31.136  -75.475 -23.646 1.00 27.56  ? 375  PHE B CD1   1 
ATOM   7847 C  CD2   . PHE F 3 398 ? 30.602  -73.211 -23.078 1.00 27.62  ? 375  PHE B CD2   1 
ATOM   7848 C  CE1   . PHE F 3 398 ? 29.795  -75.826 -23.554 1.00 26.69  ? 375  PHE B CE1   1 
ATOM   7849 C  CE2   . PHE F 3 398 ? 29.255  -73.552 -22.984 1.00 28.25  ? 375  PHE B CE2   1 
ATOM   7850 C  CZ    . PHE F 3 398 ? 28.852  -74.865 -23.226 1.00 27.78  ? 375  PHE B CZ    1 
ATOM   7851 N  N     . LYS F 3 399 ? 33.123  -71.636 -25.750 1.00 28.49  ? 376  LYS B N     1 
ATOM   7852 C  CA    . LYS F 3 399 ? 32.483  -70.579 -26.525 1.00 27.68  ? 376  LYS B CA    1 
ATOM   7853 C  C     . LYS F 3 399 ? 32.959  -70.517 -27.978 1.00 27.64  ? 376  LYS B C     1 
ATOM   7854 O  O     . LYS F 3 399 ? 32.167  -70.259 -28.882 1.00 28.38  ? 376  LYS B O     1 
ATOM   7855 C  CB    . LYS F 3 399 ? 32.710  -69.226 -25.852 1.00 26.20  ? 376  LYS B CB    1 
ATOM   7856 C  CG    . LYS F 3 399 ? 32.073  -69.112 -24.485 1.00 26.63  ? 376  LYS B CG    1 
ATOM   7857 C  CD    . LYS F 3 399 ? 32.175  -67.698 -23.947 1.00 27.90  ? 376  LYS B CD    1 
ATOM   7858 C  CE    . LYS F 3 399 ? 31.417  -67.561 -22.642 1.00 29.99  ? 376  LYS B CE    1 
ATOM   7859 N  NZ    . LYS F 3 399 ? 31.443  -66.161 -22.147 1.00 34.46  ? 376  LYS B NZ    1 
ATOM   7860 N  N     . LEU F 3 400 ? 34.248  -70.750 -28.203 1.00 26.29  ? 377  LEU B N     1 
ATOM   7861 C  CA    . LEU F 3 400 ? 34.793  -70.720 -29.553 1.00 26.43  ? 377  LEU B CA    1 
ATOM   7862 C  C     . LEU F 3 400 ? 34.065  -71.689 -30.475 1.00 27.88  ? 377  LEU B C     1 
ATOM   7863 O  O     . LEU F 3 400 ? 33.644  -71.315 -31.568 1.00 29.25  ? 377  LEU B O     1 
ATOM   7864 C  CB    . LEU F 3 400 ? 36.286  -71.062 -29.539 1.00 25.14  ? 377  LEU B CB    1 
ATOM   7865 C  CG    . LEU F 3 400 ? 37.279  -69.977 -29.116 1.00 24.91  ? 377  LEU B CG    1 
ATOM   7866 C  CD1   . LEU F 3 400 ? 38.664  -70.580 -28.983 1.00 24.92  ? 377  LEU B CD1   1 
ATOM   7867 C  CD2   . LEU F 3 400 ? 37.285  -68.856 -30.137 1.00 22.97  ? 377  LEU B CD2   1 
ATOM   7868 N  N     . SER F 3 401 ? 33.919  -72.934 -30.032 1.00 29.05  ? 378  SER B N     1 
ATOM   7869 C  CA    . SER F 3 401 ? 33.256  -73.962 -30.830 1.00 30.63  ? 378  SER B CA    1 
ATOM   7870 C  C     . SER F 3 401 ? 31.807  -73.598 -31.124 1.00 30.41  ? 378  SER B C     1 
ATOM   7871 O  O     . SER F 3 401 ? 31.238  -74.039 -32.121 1.00 29.98  ? 378  SER B O     1 
ATOM   7872 C  CB    . SER F 3 401 ? 33.290  -75.295 -30.097 1.00 32.13  ? 378  SER B CB    1 
ATOM   7873 O  OG    . SER F 3 401 ? 32.486  -75.227 -28.933 1.00 39.46  ? 378  SER B OG    1 
ATOM   7874 N  N     . ARG F 3 402 ? 31.214  -72.802 -30.243 1.00 30.20  ? 379  ARG B N     1 
ATOM   7875 C  CA    . ARG F 3 402 ? 29.832  -72.370 -30.401 1.00 30.76  ? 379  ARG B CA    1 
ATOM   7876 C  C     . ARG F 3 402 ? 29.786  -71.026 -31.128 1.00 30.89  ? 379  ARG B C     1 
ATOM   7877 O  O     . ARG F 3 402 ? 28.713  -70.495 -31.413 1.00 32.13  ? 379  ARG B O     1 
ATOM   7878 C  CB    . ARG F 3 402 ? 29.166  -72.258 -29.026 1.00 31.14  ? 379  ARG B CB    1 
ATOM   7879 C  CG    . ARG F 3 402 ? 28.036  -73.256 -28.781 1.00 32.88  ? 379  ARG B CG    1 
ATOM   7880 C  CD    . ARG F 3 402 ? 27.803  -73.482 -27.290 1.00 34.25  ? 379  ARG B CD    1 
ATOM   7881 N  NE    . ARG F 3 402 ? 28.829  -74.349 -26.713 1.00 37.02  ? 379  ARG B NE    1 
ATOM   7882 C  CZ    . ARG F 3 402 ? 28.886  -75.664 -26.903 1.00 38.88  ? 379  ARG B CZ    1 
ATOM   7883 N  NH1   . ARG F 3 402 ? 27.970  -76.266 -27.647 1.00 40.71  ? 379  ARG B NH1   1 
ATOM   7884 N  NH2   . ARG F 3 402 ? 29.870  -76.377 -26.370 1.00 39.68  ? 379  ARG B NH2   1 
ATOM   7885 N  N     . GLY F 3 403 ? 30.962  -70.483 -31.424 1.00 30.20  ? 380  GLY B N     1 
ATOM   7886 C  CA    . GLY F 3 403 ? 31.046  -69.214 -32.124 1.00 29.63  ? 380  GLY B CA    1 
ATOM   7887 C  C     . GLY F 3 403 ? 30.740  -67.968 -31.310 1.00 29.73  ? 380  GLY B C     1 
ATOM   7888 O  O     . GLY F 3 403 ? 30.418  -66.930 -31.884 1.00 29.83  ? 380  GLY B O     1 
ATOM   7889 N  N     . ARG F 3 404 ? 30.858  -68.042 -29.987 1.00 30.84  ? 381  ARG B N     1 
ATOM   7890 C  CA    . ARG F 3 404 ? 30.555  -66.881 -29.149 1.00 32.95  ? 381  ARG B CA    1 
ATOM   7891 C  C     . ARG F 3 404 ? 31.609  -66.499 -28.106 1.00 33.82  ? 381  ARG B C     1 
ATOM   7892 O  O     . ARG F 3 404 ? 31.271  -66.227 -26.952 1.00 33.89  ? 381  ARG B O     1 
ATOM   7893 C  CB    . ARG F 3 404 ? 29.205  -67.093 -28.452 1.00 34.07  ? 381  ARG B CB    1 
ATOM   7894 C  CG    . ARG F 3 404 ? 28.025  -67.188 -29.411 1.00 34.65  ? 381  ARG B CG    1 
ATOM   7895 C  CD    . ARG F 3 404 ? 26.746  -67.567 -28.693 1.00 35.77  ? 381  ARG B CD    1 
ATOM   7896 N  NE    . ARG F 3 404 ? 25.613  -67.697 -29.609 1.00 38.76  ? 381  ARG B NE    1 
ATOM   7897 C  CZ    . ARG F 3 404 ? 24.976  -66.674 -30.175 1.00 39.17  ? 381  ARG B CZ    1 
ATOM   7898 N  NH1   . ARG F 3 404 ? 25.354  -65.425 -29.922 1.00 39.97  ? 381  ARG B NH1   1 
ATOM   7899 N  NH2   . ARG F 3 404 ? 23.955  -66.899 -30.992 1.00 36.87  ? 381  ARG B NH2   1 
ATOM   7900 N  N     . TYR F 3 405 ? 32.875  -66.465 -28.514 1.00 35.03  ? 382  TYR B N     1 
ATOM   7901 C  CA    . TYR F 3 405 ? 33.970  -66.098 -27.614 1.00 36.47  ? 382  TYR B CA    1 
ATOM   7902 C  C     . TYR F 3 405 ? 34.368  -64.652 -27.888 1.00 37.91  ? 382  TYR B C     1 
ATOM   7903 O  O     . TYR F 3 405 ? 35.139  -64.376 -28.806 1.00 39.69  ? 382  TYR B O     1 
ATOM   7904 C  CB    . TYR F 3 405 ? 35.172  -67.022 -27.837 1.00 36.52  ? 382  TYR B CB    1 
ATOM   7905 C  CG    . TYR F 3 405 ? 36.398  -66.674 -27.013 1.00 37.67  ? 382  TYR B CG    1 
ATOM   7906 C  CD1   . TYR F 3 405 ? 36.345  -66.630 -25.619 1.00 37.07  ? 382  TYR B CD1   1 
ATOM   7907 C  CD2   . TYR F 3 405 ? 37.620  -66.414 -27.631 1.00 39.15  ? 382  TYR B CD2   1 
ATOM   7908 C  CE1   . TYR F 3 405 ? 37.481  -66.339 -24.862 1.00 38.45  ? 382  TYR B CE1   1 
ATOM   7909 C  CE2   . TYR F 3 405 ? 38.760  -66.124 -26.885 1.00 40.25  ? 382  TYR B CE2   1 
ATOM   7910 C  CZ    . TYR F 3 405 ? 38.688  -66.088 -25.504 1.00 40.39  ? 382  TYR B CZ    1 
ATOM   7911 O  OH    . TYR F 3 405 ? 39.829  -65.816 -24.778 1.00 40.29  ? 382  TYR B OH    1 
ATOM   7912 N  N     . GLY F 3 406 ? 33.847  -63.734 -27.082 1.00 38.90  ? 383  GLY B N     1 
ATOM   7913 C  CA    . GLY F 3 406 ? 34.133  -62.323 -27.280 1.00 40.62  ? 383  GLY B CA    1 
ATOM   7914 C  C     . GLY F 3 406 ? 35.426  -61.772 -26.712 1.00 41.64  ? 383  GLY B C     1 
ATOM   7915 O  O     . GLY F 3 406 ? 35.666  -61.818 -25.507 1.00 42.88  ? 383  GLY B O     1 
ATOM   7916 N  N     . LEU F 3 407 ? 36.262  -61.239 -27.595 1.00 42.22  ? 384  LEU B N     1 
ATOM   7917 C  CA    . LEU F 3 407 ? 37.530  -60.648 -27.198 1.00 42.53  ? 384  LEU B CA    1 
ATOM   7918 C  C     . LEU F 3 407 ? 37.467  -59.150 -27.444 1.00 43.84  ? 384  LEU B C     1 
ATOM   7919 O  O     . LEU F 3 407 ? 36.895  -58.698 -28.435 1.00 44.09  ? 384  LEU B O     1 
ATOM   7920 C  CB    . LEU F 3 407 ? 38.680  -61.246 -28.009 1.00 42.52  ? 384  LEU B CB    1 
ATOM   7921 C  CG    . LEU F 3 407 ? 39.095  -62.676 -27.665 1.00 43.45  ? 384  LEU B CG    1 
ATOM   7922 C  CD1   . LEU F 3 407 ? 40.172  -63.142 -28.633 1.00 42.16  ? 384  LEU B CD1   1 
ATOM   7923 C  CD2   . LEU F 3 407 ? 39.596  -62.729 -26.223 1.00 43.04  ? 384  LEU B CD2   1 
ATOM   7924 N  N     . PRO F 3 408 ? 38.050  -58.354 -26.539 1.00 45.07  ? 385  PRO B N     1 
ATOM   7925 C  CA    . PRO F 3 408 ? 38.036  -56.898 -26.703 1.00 45.47  ? 385  PRO B CA    1 
ATOM   7926 C  C     . PRO F 3 408 ? 39.091  -56.480 -27.725 1.00 45.64  ? 385  PRO B C     1 
ATOM   7927 O  O     . PRO F 3 408 ? 39.973  -57.271 -28.067 1.00 45.65  ? 385  PRO B O     1 
ATOM   7928 C  CB    . PRO F 3 408 ? 38.366  -56.405 -25.301 1.00 45.69  ? 385  PRO B CB    1 
ATOM   7929 C  CG    . PRO F 3 408 ? 39.374  -57.430 -24.847 1.00 44.00  ? 385  PRO B CG    1 
ATOM   7930 C  CD    . PRO F 3 408 ? 38.739  -58.738 -25.291 1.00 44.35  ? 385  PRO B CD    1 
ATOM   7931 N  N     . LEU F 3 409 ? 39.005  -55.249 -28.219 1.00 45.26  ? 386  LEU B N     1 
ATOM   7932 C  CA    . LEU F 3 409 ? 39.992  -54.772 -29.180 1.00 45.88  ? 386  LEU B CA    1 
ATOM   7933 C  C     . LEU F 3 409 ? 41.189  -54.171 -28.453 1.00 47.49  ? 386  LEU B C     1 
ATOM   7934 O  O     . LEU F 3 409 ? 41.379  -52.957 -28.428 1.00 48.41  ? 386  LEU B O     1 
ATOM   7935 C  CB    . LEU F 3 409 ? 39.371  -53.747 -30.132 1.00 41.81  ? 386  LEU B CB    1 
ATOM   7936 C  CG    . LEU F 3 409 ? 38.869  -54.338 -31.453 1.00 39.20  ? 386  LEU B CG    1 
ATOM   7937 C  CD1   . LEU F 3 409 ? 37.813  -55.393 -31.186 1.00 37.28  ? 386  LEU B CD1   1 
ATOM   7938 C  CD2   . LEU F 3 409 ? 38.315  -53.232 -32.330 1.00 39.99  ? 386  LEU B CD2   1 
ATOM   7939 N  N     . SER F 3 410 ? 41.998  -55.045 -27.867 1.00 50.63  ? 387  SER B N     1 
ATOM   7940 C  CA    . SER F 3 410 ? 43.177  -54.633 -27.118 1.00 54.48  ? 387  SER B CA    1 
ATOM   7941 C  C     . SER F 3 410 ? 44.282  -54.068 -27.998 1.00 55.72  ? 387  SER B C     1 
ATOM   7942 O  O     . SER F 3 410 ? 44.483  -54.510 -29.129 1.00 55.50  ? 387  SER B O     1 
ATOM   7943 C  CB    . SER F 3 410 ? 43.736  -55.817 -26.323 1.00 55.67  ? 387  SER B CB    1 
ATOM   7944 O  OG    . SER F 3 410 ? 42.790  -56.309 -25.389 1.00 59.40  ? 387  SER B OG    1 
ATOM   7945 N  N     . SER F 3 411 ? 44.994  -53.081 -27.464 1.00 57.17  ? 388  SER B N     1 
ATOM   7946 C  CA    . SER F 3 411 ? 46.104  -52.472 -28.173 1.00 58.31  ? 388  SER B CA    1 
ATOM   7947 C  C     . SER F 3 411 ? 47.236  -53.485 -28.092 1.00 59.74  ? 388  SER B C     1 
ATOM   7948 O  O     . SER F 3 411 ? 47.059  -54.571 -27.541 1.00 59.90  ? 388  SER B O     1 
ATOM   7949 C  CB    . SER F 3 411 ? 46.516  -51.166 -27.492 1.00 58.73  ? 388  SER B CB    1 
ATOM   7950 O  OG    . SER F 3 411 ? 47.618  -50.566 -28.152 1.00 58.42  ? 388  SER B OG    1 
ATOM   7951 N  N     . ARG F 3 412 ? 48.398  -53.139 -28.632 1.00 62.08  ? 389  ARG B N     1 
ATOM   7952 C  CA    . ARG F 3 412 ? 49.535  -54.050 -28.599 1.00 64.35  ? 389  ARG B CA    1 
ATOM   7953 C  C     . ARG F 3 412 ? 50.576  -53.588 -27.587 1.00 63.98  ? 389  ARG B C     1 
ATOM   7954 O  O     . ARG F 3 412 ? 50.934  -52.410 -27.542 1.00 63.83  ? 389  ARG B O     1 
ATOM   7955 C  CB    . ARG F 3 412 ? 50.165  -54.155 -29.990 1.00 67.08  ? 389  ARG B CB    1 
ATOM   7956 C  CG    . ARG F 3 412 ? 51.299  -55.162 -30.092 1.00 69.94  ? 389  ARG B CG    1 
ATOM   7957 C  CD    . ARG F 3 412 ? 51.728  -55.337 -31.539 1.00 73.45  ? 389  ARG B CD    1 
ATOM   7958 N  NE    . ARG F 3 412 ? 52.135  -54.071 -32.144 1.00 76.07  ? 389  ARG B NE    1 
ATOM   7959 C  CZ    . ARG F 3 412 ? 52.490  -53.931 -33.418 1.00 76.65  ? 389  ARG B CZ    1 
ATOM   7960 N  NH1   . ARG F 3 412 ? 52.488  -54.982 -34.229 1.00 76.91  ? 389  ARG B NH1   1 
ATOM   7961 N  NH2   . ARG F 3 412 ? 52.851  -52.741 -33.881 1.00 75.92  ? 389  ARG B NH2   1 
ATOM   7962 N  N     . PRO F 3 413 ? 51.074  -54.517 -26.755 1.00 63.46  ? 390  PRO B N     1 
ATOM   7963 C  CA    . PRO F 3 413 ? 52.079  -54.161 -25.752 1.00 62.69  ? 390  PRO B CA    1 
ATOM   7964 C  C     . PRO F 3 413 ? 53.322  -53.560 -26.400 1.00 62.52  ? 390  PRO B C     1 
ATOM   7965 O  O     . PRO F 3 413 ? 53.878  -54.125 -27.344 1.00 62.24  ? 390  PRO B O     1 
ATOM   7966 C  CB    . PRO F 3 413 ? 52.358  -55.492 -25.060 1.00 61.88  ? 390  PRO B CB    1 
ATOM   7967 C  CG    . PRO F 3 413 ? 52.126  -56.488 -26.149 1.00 61.79  ? 390  PRO B CG    1 
ATOM   7968 C  CD    . PRO F 3 413 ? 50.859  -55.974 -26.782 1.00 62.89  ? 390  PRO B CD    1 
ATOM   7969 N  N     . VAL F 3 414 ? 53.740  -52.405 -25.893 1.00 61.99  ? 391  VAL B N     1 
ATOM   7970 C  CA    . VAL F 3 414 ? 54.913  -51.713 -26.409 1.00 60.38  ? 391  VAL B CA    1 
ATOM   7971 C  C     . VAL F 3 414 ? 56.087  -52.680 -26.564 1.00 59.32  ? 391  VAL B C     1 
ATOM   7972 O  O     . VAL F 3 414 ? 56.192  -53.675 -25.845 1.00 58.35  ? 391  VAL B O     1 
ATOM   7973 C  CB    . VAL F 3 414 ? 55.314  -50.546 -25.477 1.00 60.37  ? 391  VAL B CB    1 
ATOM   7974 C  CG1   . VAL F 3 414 ? 55.573  -51.065 -24.075 1.00 60.61  ? 391  VAL B CG1   1 
ATOM   7975 C  CG2   . VAL F 3 414 ? 56.538  -49.835 -26.025 1.00 61.41  ? 391  VAL B CG2   1 
ATOM   7976 N  N     . VAL F 3 415 ? 56.964  -52.381 -27.515 1.00 58.29  ? 392  VAL B N     1 
ATOM   7977 C  CA    . VAL F 3 415 ? 58.120  -53.225 -27.788 1.00 56.91  ? 392  VAL B CA    1 
ATOM   7978 C  C     . VAL F 3 415 ? 59.201  -53.075 -26.721 1.00 54.79  ? 392  VAL B C     1 
ATOM   7979 O  O     . VAL F 3 415 ? 59.441  -51.973 -26.224 1.00 53.52  ? 392  VAL B O     1 
ATOM   7980 C  CB    . VAL F 3 415 ? 58.717  -52.888 -29.174 1.00 57.77  ? 392  VAL B CB    1 
ATOM   7981 C  CG1   . VAL F 3 415 ? 59.240  -51.457 -29.184 1.00 56.85  ? 392  VAL B CG1   1 
ATOM   7982 C  CG2   . VAL F 3 415 ? 59.812  -53.875 -29.524 1.00 59.17  ? 392  VAL B CG2   1 
ATOM   7983 N  N     . LYS F 3 416 ? 59.847  -54.188 -26.370 1.00 52.62  ? 393  LYS B N     1 
ATOM   7984 C  CA    . LYS F 3 416 ? 60.907  -54.177 -25.362 1.00 50.71  ? 393  LYS B CA    1 
ATOM   7985 C  C     . LYS F 3 416 ? 62.285  -53.991 -25.987 1.00 49.25  ? 393  LYS B C     1 
ATOM   7986 O  O     . LYS F 3 416 ? 63.167  -53.367 -25.393 1.00 48.78  ? 393  LYS B O     1 
ATOM   7987 C  CB    . LYS F 3 416 ? 60.914  -55.479 -24.551 1.00 50.92  ? 393  LYS B CB    1 
ATOM   7988 C  CG    . LYS F 3 416 ? 59.692  -55.720 -23.673 1.00 52.42  ? 393  LYS B CG    1 
ATOM   7989 C  CD    . LYS F 3 416 ? 58.552  -56.346 -24.463 1.00 54.83  ? 393  LYS B CD    1 
ATOM   7990 C  CE    . LYS F 3 416 ? 57.450  -56.855 -23.542 1.00 54.80  ? 393  LYS B CE    1 
ATOM   7991 N  NZ    . LYS F 3 416 ? 56.436  -57.668 -24.278 1.00 53.48  ? 393  LYS B NZ    1 
ATOM   7992 N  N     . SER F 3 417 ? 62.470  -54.537 -27.184 1.00 47.91  ? 394  SER B N     1 
ATOM   7993 C  CA    . SER F 3 417 ? 63.753  -54.430 -27.868 1.00 46.32  ? 394  SER B CA    1 
ATOM   7994 C  C     . SER F 3 417 ? 63.640  -54.578 -29.379 1.00 45.53  ? 394  SER B C     1 
ATOM   7995 O  O     . SER F 3 417 ? 62.609  -54.996 -29.904 1.00 45.90  ? 394  SER B O     1 
ATOM   7996 C  CB    . SER F 3 417 ? 64.713  -55.492 -27.335 1.00 46.32  ? 394  SER B CB    1 
ATOM   7997 O  OG    . SER F 3 417 ? 64.204  -56.793 -27.565 1.00 45.54  ? 394  SER B OG    1 
ATOM   7998 N  N     . MET F 3 418 ? 64.717  -54.228 -30.071 1.00 44.50  ? 395  MET B N     1 
ATOM   7999 C  CA    . MET F 3 418 ? 64.769  -54.331 -31.520 1.00 43.44  ? 395  MET B CA    1 
ATOM   8000 C  C     . MET F 3 418 ? 66.157  -54.782 -31.953 1.00 42.17  ? 395  MET B C     1 
ATOM   8001 O  O     . MET F 3 418 ? 67.168  -54.328 -31.416 1.00 41.78  ? 395  MET B O     1 
ATOM   8002 C  CB    . MET F 3 418 ? 64.434  -52.989 -32.173 1.00 43.38  ? 395  MET B CB    1 
ATOM   8003 C  CG    . MET F 3 418 ? 62.993  -52.559 -31.997 1.00 44.64  ? 395  MET B CG    1 
ATOM   8004 S  SD    . MET F 3 418 ? 62.563  -51.181 -33.076 1.00 46.23  ? 395  MET B SD    1 
ATOM   8005 C  CE    . MET F 3 418 ? 62.847  -49.782 -31.990 1.00 46.53  ? 395  MET B CE    1 
ATOM   8006 N  N     . MET F 3 419 ? 66.197  -55.680 -32.927 1.00 40.68  ? 396  MET B N     1 
ATOM   8007 C  CA    . MET F 3 419 ? 67.458  -56.196 -33.423 1.00 38.86  ? 396  MET B CA    1 
ATOM   8008 C  C     . MET F 3 419 ? 67.547  -56.142 -34.936 1.00 37.31  ? 396  MET B C     1 
ATOM   8009 O  O     . MET F 3 419 ? 66.546  -56.268 -35.640 1.00 36.87  ? 396  MET B O     1 
ATOM   8010 C  CB    . MET F 3 419 ? 67.648  -57.643 -32.973 1.00 40.00  ? 396  MET B CB    1 
ATOM   8011 C  CG    . MET F 3 419 ? 68.855  -58.319 -33.599 1.00 42.72  ? 396  MET B CG    1 
ATOM   8012 S  SD    . MET F 3 419 ? 68.828  -60.108 -33.412 1.00 46.93  ? 396  MET B SD    1 
ATOM   8013 C  CE    . MET F 3 419 ? 69.680  -60.302 -31.821 1.00 46.65  ? 396  MET B CE    1 
ATOM   8014 N  N     . SER F 3 420 ? 68.765  -55.941 -35.420 1.00 36.01  ? 397  SER B N     1 
ATOM   8015 C  CA    . SER F 3 420 ? 69.046  -55.910 -36.845 1.00 36.01  ? 397  SER B CA    1 
ATOM   8016 C  C     . SER F 3 420 ? 70.335  -56.701 -36.953 1.00 35.30  ? 397  SER B C     1 
ATOM   8017 O  O     . SER F 3 420 ? 71.348  -56.324 -36.367 1.00 36.15  ? 397  SER B O     1 
ATOM   8018 C  CB    . SER F 3 420 ? 69.256  -54.480 -37.338 1.00 36.60  ? 397  SER B CB    1 
ATOM   8019 O  OG    . SER F 3 420 ? 69.467  -54.466 -38.739 1.00 36.61  ? 397  SER B OG    1 
ATOM   8020 N  N     . ASN F 3 421 ? 70.290  -57.806 -37.686 1.00 33.85  ? 398  ASN B N     1 
ATOM   8021 C  CA    . ASN F 3 421 ? 71.450  -58.673 -37.824 1.00 33.46  ? 398  ASN B CA    1 
ATOM   8022 C  C     . ASN F 3 421 ? 71.736  -59.083 -39.261 1.00 32.43  ? 398  ASN B C     1 
ATOM   8023 O  O     . ASN F 3 421 ? 70.897  -58.921 -40.144 1.00 33.61  ? 398  ASN B O     1 
ATOM   8024 C  CB    . ASN F 3 421 ? 71.244  -59.913 -36.936 1.00 34.98  ? 398  ASN B CB    1 
ATOM   8025 C  CG    . ASN F 3 421 ? 71.961  -61.149 -37.455 1.00 36.50  ? 398  ASN B CG    1 
ATOM   8026 O  OD1   . ASN F 3 421 ? 71.547  -61.755 -38.450 1.00 34.95  ? 398  ASN B OD1   1 
ATOM   8027 N  ND2   . ASN F 3 421 ? 73.041  -61.531 -36.780 1.00 37.23  ? 398  ASN B ND2   1 
ATOM   8028 N  N     . LYS F 3 422 ? 72.934  -59.607 -39.489 1.00 30.62  ? 399  LYS B N     1 
ATOM   8029 C  CA    . LYS F 3 422 ? 73.323  -60.055 -40.813 1.00 30.24  ? 399  LYS B CA    1 
ATOM   8030 C  C     . LYS F 3 422 ? 74.208  -61.288 -40.747 1.00 32.11  ? 399  LYS B C     1 
ATOM   8031 O  O     . LYS F 3 422 ? 75.269  -61.272 -40.119 1.00 31.99  ? 399  LYS B O     1 
ATOM   8032 C  CB    . LYS F 3 422 ? 74.064  -58.951 -41.555 1.00 29.02  ? 399  LYS B CB    1 
ATOM   8033 C  CG    . LYS F 3 422 ? 74.586  -59.374 -42.915 1.00 27.21  ? 399  LYS B CG    1 
ATOM   8034 C  CD    . LYS F 3 422 ? 73.456  -59.781 -43.842 1.00 27.52  ? 399  LYS B CD    1 
ATOM   8035 C  CE    . LYS F 3 422 ? 73.989  -60.127 -45.220 1.00 27.36  ? 399  LYS B CE    1 
ATOM   8036 N  NZ    . LYS F 3 422 ? 72.907  -60.464 -46.183 1.00 25.28  ? 399  LYS B NZ    1 
ATOM   8037 N  N     . ASN F 3 423 ? 73.761  -62.361 -41.391 1.00 33.53  ? 400  ASN B N     1 
ATOM   8038 C  CA    . ASN F 3 423 ? 74.530  -63.594 -41.426 1.00 33.90  ? 400  ASN B CA    1 
ATOM   8039 C  C     . ASN F 3 423 ? 75.546  -63.400 -42.531 1.00 33.50  ? 400  ASN B C     1 
ATOM   8040 O  O     . ASN F 3 423 ? 75.217  -63.458 -43.714 1.00 33.62  ? 400  ASN B O     1 
ATOM   8041 C  CB    . ASN F 3 423 ? 73.625  -64.786 -41.725 1.00 35.62  ? 400  ASN B CB    1 
ATOM   8042 C  CG    . ASN F 3 423 ? 72.646  -65.062 -40.601 1.00 38.24  ? 400  ASN B CG    1 
ATOM   8043 O  OD1   . ASN F 3 423 ? 73.043  -65.277 -39.453 1.00 38.31  ? 400  ASN B OD1   1 
ATOM   8044 N  ND2   . ASN F 3 423 ? 71.355  -65.053 -40.925 1.00 40.89  ? 400  ASN B ND2   1 
ATOM   8045 N  N     . LEU F 3 424 ? 76.784  -63.149 -42.124 1.00 33.70  ? 401  LEU B N     1 
ATOM   8046 C  CA    . LEU F 3 424 ? 77.870  -62.894 -43.055 1.00 33.33  ? 401  LEU B CA    1 
ATOM   8047 C  C     . LEU F 3 424 ? 78.475  -64.153 -43.647 1.00 33.59  ? 401  LEU B C     1 
ATOM   8048 O  O     . LEU F 3 424 ? 78.786  -65.104 -42.931 1.00 33.72  ? 401  LEU B O     1 
ATOM   8049 C  CB    . LEU F 3 424 ? 78.948  -62.070 -42.351 1.00 31.97  ? 401  LEU B CB    1 
ATOM   8050 C  CG    . LEU F 3 424 ? 78.418  -60.761 -41.758 1.00 29.22  ? 401  LEU B CG    1 
ATOM   8051 C  CD1   . LEU F 3 424 ? 79.439  -60.162 -40.815 1.00 29.18  ? 401  LEU B CD1   1 
ATOM   8052 C  CD2   . LEU F 3 424 ? 78.076  -59.802 -42.885 1.00 27.30  ? 401  LEU B CD2   1 
ATOM   8053 N  N     . ARG F 3 425 ? 78.631  -64.142 -44.967 1.00 33.20  ? 402  ARG B N     1 
ATOM   8054 C  CA    . ARG F 3 425 ? 79.205  -65.257 -45.700 1.00 33.71  ? 402  ARG B CA    1 
ATOM   8055 C  C     . ARG F 3 425 ? 80.394  -64.732 -46.494 1.00 36.35  ? 402  ARG B C     1 
ATOM   8056 O  O     . ARG F 3 425 ? 80.347  -63.634 -47.052 1.00 36.98  ? 402  ARG B O     1 
ATOM   8057 C  CB    . ARG F 3 425 ? 78.166  -65.864 -46.645 1.00 31.46  ? 402  ARG B CB    1 
ATOM   8058 C  CG    . ARG F 3 425 ? 76.942  -66.413 -45.937 0.00 33.00  ? 402  ARG B CG    1 
ATOM   8059 C  CD    . ARG F 3 425 ? 75.959  -67.020 -46.921 0.00 33.07  ? 402  ARG B CD    1 
ATOM   8060 N  NE    . ARG F 3 425 ? 74.777  -67.548 -46.248 0.00 33.55  ? 402  ARG B NE    1 
ATOM   8061 C  CZ    . ARG F 3 425 ? 73.763  -68.138 -46.872 0.00 33.71  ? 402  ARG B CZ    1 
ATOM   8062 N  NH1   . ARG F 3 425 ? 73.783  -68.278 -48.191 0.00 33.87  ? 402  ARG B NH1   1 
ATOM   8063 N  NH2   . ARG F 3 425 ? 72.727  -68.589 -46.177 0.00 33.87  ? 402  ARG B NH2   1 
ATOM   8064 N  N     . GLY F 3 426 ? 81.466  -65.514 -46.539 1.00 38.68  ? 403  GLY B N     1 
ATOM   8065 C  CA    . GLY F 3 426 ? 82.642  -65.084 -47.265 1.00 40.28  ? 403  GLY B CA    1 
ATOM   8066 C  C     . GLY F 3 426 ? 83.282  -63.890 -46.588 1.00 41.71  ? 403  GLY B C     1 
ATOM   8067 O  O     . GLY F 3 426 ? 83.132  -63.694 -45.380 1.00 41.85  ? 403  GLY B O     1 
ATOM   8068 N  N     . LYS F 3 427 ? 83.986  -63.082 -47.369 1.00 42.50  ? 404  LYS B N     1 
ATOM   8069 C  CA    . LYS F 3 427 ? 84.662  -61.909 -46.837 1.00 43.23  ? 404  LYS B CA    1 
ATOM   8070 C  C     . LYS F 3 427 ? 83.793  -60.652 -46.886 1.00 43.03  ? 404  LYS B C     1 
ATOM   8071 O  O     . LYS F 3 427 ? 84.303  -59.543 -47.057 1.00 42.41  ? 404  LYS B O     1 
ATOM   8072 C  CB    . LYS F 3 427 ? 85.965  -61.680 -47.608 1.00 44.76  ? 404  LYS B CB    1 
ATOM   8073 C  CG    . LYS F 3 427 ? 86.964  -62.821 -47.467 1.00 45.69  ? 404  LYS B CG    1 
ATOM   8074 C  CD    . LYS F 3 427 ? 88.211  -62.594 -48.307 1.00 47.73  ? 404  LYS B CD    1 
ATOM   8075 C  CE    . LYS F 3 427 ? 89.230  -63.707 -48.088 1.00 49.66  ? 404  LYS B CE    1 
ATOM   8076 N  NZ    . LYS F 3 427 ? 90.420  -63.588 -48.982 1.00 50.86  ? 404  LYS B NZ    1 
ATOM   8077 N  N     . SER F 3 428 ? 82.485  -60.828 -46.719 1.00 42.98  ? 405  SER B N     1 
ATOM   8078 C  CA    . SER F 3 428 ? 81.556  -59.702 -46.753 1.00 43.34  ? 405  SER B CA    1 
ATOM   8079 C  C     . SER F 3 428 ? 81.968  -58.612 -45.765 1.00 42.66  ? 405  SER B C     1 
ATOM   8080 O  O     . SER F 3 428 ? 81.918  -57.424 -46.083 1.00 44.37  ? 405  SER B O     1 
ATOM   8081 C  CB    . SER F 3 428 ? 80.136  -60.177 -46.442 1.00 44.41  ? 405  SER B CB    1 
ATOM   8082 O  OG    . SER F 3 428 ? 79.190  -59.151 -46.692 1.00 45.70  ? 405  SER B OG    1 
ATOM   8083 N  N     . CYS F 3 429 ? 82.371  -59.020 -44.567 1.00 40.90  ? 406  CYS B N     1 
ATOM   8084 C  CA    . CYS F 3 429 ? 82.809  -58.078 -43.543 1.00 40.75  ? 406  CYS B CA    1 
ATOM   8085 C  C     . CYS F 3 429 ? 84.251  -58.422 -43.187 1.00 42.19  ? 406  CYS B C     1 
ATOM   8086 O  O     . CYS F 3 429 ? 84.533  -58.921 -42.097 1.00 42.79  ? 406  CYS B O     1 
ATOM   8087 C  CB    . CYS F 3 429 ? 81.921  -58.192 -42.303 1.00 40.07  ? 406  CYS B CB    1 
ATOM   8088 S  SG    . CYS F 3 429 ? 82.366  -57.068 -40.961 1.00 36.93  ? 406  CYS B SG    1 
ATOM   8089 N  N     . ASN F 3 430 ? 85.162  -58.139 -44.112 1.00 42.90  ? 407  ASN B N     1 
ATOM   8090 C  CA    . ASN F 3 430 ? 86.571  -58.457 -43.928 1.00 43.64  ? 407  ASN B CA    1 
ATOM   8091 C  C     . ASN F 3 430 ? 87.398  -57.509 -43.058 1.00 44.02  ? 407  ASN B C     1 
ATOM   8092 O  O     . ASN F 3 430 ? 88.282  -57.953 -42.326 1.00 44.32  ? 407  ASN B O     1 
ATOM   8093 C  CB    . ASN F 3 430 ? 87.243  -58.587 -45.292 1.00 44.29  ? 407  ASN B CB    1 
ATOM   8094 C  CG    . ASN F 3 430 ? 88.524  -59.379 -45.226 1.00 46.64  ? 407  ASN B CG    1 
ATOM   8095 O  OD1   . ASN F 3 430 ? 89.394  -59.103 -44.403 1.00 49.46  ? 407  ASN B OD1   1 
ATOM   8096 N  ND2   . ASN F 3 430 ? 88.650  -60.375 -46.094 1.00 48.08  ? 407  ASN B ND2   1 
ATOM   8097 N  N     . SER F 3 431 ? 87.127  -56.212 -43.138 1.00 44.18  ? 408  SER B N     1 
ATOM   8098 C  CA    . SER F 3 431 ? 87.885  -55.236 -42.360 1.00 44.00  ? 408  SER B CA    1 
ATOM   8099 C  C     . SER F 3 431 ? 87.044  -54.487 -41.335 1.00 43.60  ? 408  SER B C     1 
ATOM   8100 O  O     . SER F 3 431 ? 85.848  -54.732 -41.197 1.00 44.62  ? 408  SER B O     1 
ATOM   8101 C  CB    . SER F 3 431 ? 88.552  -54.229 -43.302 1.00 44.93  ? 408  SER B CB    1 
ATOM   8102 O  OG    . SER F 3 431 ? 87.604  -53.648 -44.183 1.00 44.33  ? 408  SER B OG    1 
ATOM   8103 N  N     . ILE F 3 432 ? 87.683  -53.574 -40.611 1.00 43.29  ? 409  ILE B N     1 
ATOM   8104 C  CA    . ILE F 3 432 ? 86.988  -52.775 -39.608 1.00 42.59  ? 409  ILE B CA    1 
ATOM   8105 C  C     . ILE F 3 432 ? 86.140  -51.740 -40.334 1.00 42.15  ? 409  ILE B C     1 
ATOM   8106 O  O     . ILE F 3 432 ? 85.121  -51.281 -39.816 1.00 41.87  ? 409  ILE B O     1 
ATOM   8107 C  CB    . ILE F 3 432 ? 87.985  -52.055 -38.670 1.00 41.82  ? 409  ILE B CB    1 
ATOM   8108 C  CG1   . ILE F 3 432 ? 87.233  -51.118 -37.720 1.00 40.30  ? 409  ILE B CG1   1 
ATOM   8109 C  CG2   . ILE F 3 432 ? 89.012  -51.292 -39.491 1.00 41.96  ? 409  ILE B CG2   1 
ATOM   8110 C  CD1   . ILE F 3 432 ? 86.227  -51.810 -36.825 1.00 38.77  ? 409  ILE B CD1   1 
ATOM   8111 N  N     . VAL F 3 433 ? 86.572  -51.385 -41.542 1.00 41.99  ? 410  VAL B N     1 
ATOM   8112 C  CA    . VAL F 3 433 ? 85.858  -50.418 -42.364 1.00 41.71  ? 410  VAL B CA    1 
ATOM   8113 C  C     . VAL F 3 433 ? 84.733  -51.129 -43.103 1.00 42.28  ? 410  VAL B C     1 
ATOM   8114 O  O     . VAL F 3 433 ? 84.184  -50.612 -44.073 1.00 43.49  ? 410  VAL B O     1 
ATOM   8115 C  CB    . VAL F 3 433 ? 86.790  -49.743 -43.400 1.00 40.50  ? 410  VAL B CB    1 
ATOM   8116 C  CG1   . VAL F 3 433 ? 87.992  -49.141 -42.696 1.00 40.34  ? 410  VAL B CG1   1 
ATOM   8117 C  CG2   . VAL F 3 433 ? 87.228  -50.747 -44.452 1.00 40.77  ? 410  VAL B CG2   1 
ATOM   8118 N  N     . ASP F 3 434 ? 84.412  -52.333 -42.646 1.00 42.36  ? 411  ASP B N     1 
ATOM   8119 C  CA    . ASP F 3 434 ? 83.337  -53.111 -43.237 1.00 42.61  ? 411  ASP B CA    1 
ATOM   8120 C  C     . ASP F 3 434 ? 82.253  -53.277 -42.185 1.00 41.83  ? 411  ASP B C     1 
ATOM   8121 O  O     . ASP F 3 434 ? 81.062  -53.196 -42.488 1.00 42.43  ? 411  ASP B O     1 
ATOM   8122 C  CB    . ASP F 3 434 ? 83.844  -54.477 -43.708 1.00 44.53  ? 411  ASP B CB    1 
ATOM   8123 C  CG    . ASP F 3 434 ? 84.462  -54.420 -45.091 1.00 46.25  ? 411  ASP B CG    1 
ATOM   8124 O  OD1   . ASP F 3 434 ? 84.841  -55.482 -45.633 1.00 46.36  ? 411  ASP B OD1   1 
ATOM   8125 O  OD2   . ASP F 3 434 ? 84.563  -53.304 -45.640 1.00 48.89  ? 411  ASP B OD2   1 
ATOM   8126 N  N     . CYS F 3 435 ? 82.672  -53.507 -40.945 1.00 40.12  ? 412  CYS B N     1 
ATOM   8127 C  CA    . CYS F 3 435 ? 81.723  -53.652 -39.852 1.00 39.17  ? 412  CYS B CA    1 
ATOM   8128 C  C     . CYS F 3 435 ? 80.868  -52.397 -39.861 1.00 37.99  ? 412  CYS B C     1 
ATOM   8129 O  O     . CYS F 3 435 ? 79.645  -52.466 -39.951 1.00 38.84  ? 412  CYS B O     1 
ATOM   8130 C  CB    . CYS F 3 435 ? 82.452  -53.768 -38.512 1.00 39.48  ? 412  CYS B CB    1 
ATOM   8131 S  SG    . CYS F 3 435 ? 83.477  -55.246 -38.346 1.00 40.31  ? 412  CYS B SG    1 
ATOM   8132 N  N     . ILE F 3 436 ? 81.531  -51.249 -39.789 1.00 35.99  ? 413  ILE B N     1 
ATOM   8133 C  CA    . ILE F 3 436 ? 80.851  -49.963 -39.793 1.00 34.44  ? 413  ILE B CA    1 
ATOM   8134 C  C     . ILE F 3 436 ? 79.907  -49.857 -40.991 1.00 34.26  ? 413  ILE B C     1 
ATOM   8135 O  O     . ILE F 3 436 ? 78.776  -49.385 -40.864 1.00 33.27  ? 413  ILE B O     1 
ATOM   8136 C  CB    . ILE F 3 436 ? 81.867  -48.815 -39.849 1.00 33.38  ? 413  ILE B CB    1 
ATOM   8137 C  CG1   . ILE F 3 436 ? 82.874  -48.977 -38.710 1.00 34.40  ? 413  ILE B CG1   1 
ATOM   8138 C  CG2   . ILE F 3 436 ? 81.148  -47.480 -39.749 1.00 31.89  ? 413  ILE B CG2   1 
ATOM   8139 C  CD1   . ILE F 3 436 ? 84.025  -48.008 -38.755 1.00 34.69  ? 413  ILE B CD1   1 
ATOM   8140 N  N     . SER F 3 437 ? 80.374  -50.298 -42.154 1.00 32.75  ? 414  SER B N     1 
ATOM   8141 C  CA    . SER F 3 437 ? 79.553  -50.251 -43.353 1.00 31.65  ? 414  SER B CA    1 
ATOM   8142 C  C     . SER F 3 437 ? 78.244  -50.981 -43.089 1.00 31.76  ? 414  SER B C     1 
ATOM   8143 O  O     . SER F 3 437 ? 77.189  -50.572 -43.574 1.00 33.44  ? 414  SER B O     1 
ATOM   8144 C  CB    . SER F 3 437 ? 80.288  -50.897 -44.522 1.00 32.56  ? 414  SER B CB    1 
ATOM   8145 O  OG    . SER F 3 437 ? 81.509  -50.226 -44.772 1.00 34.16  ? 414  SER B OG    1 
ATOM   8146 N  N     . TRP F 3 438 ? 78.313  -52.063 -42.319 1.00 29.21  ? 415  TRP B N     1 
ATOM   8147 C  CA    . TRP F 3 438 ? 77.114  -52.821 -41.988 1.00 28.08  ? 415  TRP B CA    1 
ATOM   8148 C  C     . TRP F 3 438 ? 76.331  -52.111 -40.893 1.00 29.91  ? 415  TRP B C     1 
ATOM   8149 O  O     . TRP F 3 438 ? 75.103  -52.021 -40.956 1.00 30.54  ? 415  TRP B O     1 
ATOM   8150 C  CB    . TRP F 3 438 ? 77.469  -54.242 -41.537 1.00 24.73  ? 415  TRP B CB    1 
ATOM   8151 C  CG    . TRP F 3 438 ? 77.730  -55.166 -42.683 1.00 21.27  ? 415  TRP B CG    1 
ATOM   8152 C  CD1   . TRP F 3 438 ? 78.933  -55.674 -43.071 1.00 19.26  ? 415  TRP B CD1   1 
ATOM   8153 C  CD2   . TRP F 3 438 ? 76.767  -55.643 -43.629 1.00 18.92  ? 415  TRP B CD2   1 
ATOM   8154 N  NE1   . TRP F 3 438 ? 78.782  -56.435 -44.203 1.00 17.28  ? 415  TRP B NE1   1 
ATOM   8155 C  CE2   . TRP F 3 438 ? 77.462  -56.431 -44.568 1.00 18.32  ? 415  TRP B CE2   1 
ATOM   8156 C  CE3   . TRP F 3 438 ? 75.383  -55.477 -43.776 1.00 18.78  ? 415  TRP B CE3   1 
ATOM   8157 C  CZ2   . TRP F 3 438 ? 76.822  -57.055 -45.643 1.00 21.02  ? 415  TRP B CZ2   1 
ATOM   8158 C  CZ3   . TRP F 3 438 ? 74.745  -56.095 -44.843 1.00 19.56  ? 415  TRP B CZ3   1 
ATOM   8159 C  CH2   . TRP F 3 438 ? 75.466  -56.875 -45.764 1.00 22.53  ? 415  TRP B CH2   1 
ATOM   8160 N  N     . LEU F 3 439 ? 77.048  -51.608 -39.892 1.00 30.75  ? 416  LEU B N     1 
ATOM   8161 C  CA    . LEU F 3 439 ? 76.429  -50.891 -38.784 1.00 31.41  ? 416  LEU B CA    1 
ATOM   8162 C  C     . LEU F 3 439 ? 75.573  -49.737 -39.297 1.00 32.36  ? 416  LEU B C     1 
ATOM   8163 O  O     . LEU F 3 439 ? 74.579  -49.372 -38.672 1.00 32.32  ? 416  LEU B O     1 
ATOM   8164 C  CB    . LEU F 3 439 ? 77.502  -50.359 -37.828 1.00 31.53  ? 416  LEU B CB    1 
ATOM   8165 C  CG    . LEU F 3 439 ? 78.063  -51.326 -36.780 1.00 31.54  ? 416  LEU B CG    1 
ATOM   8166 C  CD1   . LEU F 3 439 ? 77.015  -51.595 -35.720 1.00 33.42  ? 416  LEU B CD1   1 
ATOM   8167 C  CD2   . LEU F 3 439 ? 78.488  -52.620 -37.436 1.00 31.55  ? 416  LEU B CD2   1 
ATOM   8168 N  N     . GLU F 3 440 ? 75.965  -49.160 -40.431 1.00 33.17  ? 417  GLU B N     1 
ATOM   8169 C  CA    . GLU F 3 440 ? 75.199  -48.064 -41.013 1.00 34.22  ? 417  GLU B CA    1 
ATOM   8170 C  C     . GLU F 3 440 ? 73.825  -48.604 -41.377 1.00 32.74  ? 417  GLU B C     1 
ATOM   8171 O  O     . GLU F 3 440 ? 72.805  -47.991 -41.064 1.00 33.44  ? 417  GLU B O     1 
ATOM   8172 C  CB    . GLU F 3 440 ? 75.875  -47.516 -42.276 1.00 37.08  ? 417  GLU B CB    1 
ATOM   8173 C  CG    . GLU F 3 440 ? 77.165  -46.734 -42.041 1.00 41.77  ? 417  GLU B CG    1 
ATOM   8174 C  CD    . GLU F 3 440 ? 77.669  -46.049 -43.308 1.00 44.01  ? 417  GLU B CD    1 
ATOM   8175 O  OE1   . GLU F 3 440 ? 77.034  -45.066 -43.749 1.00 44.53  ? 417  GLU B OE1   1 
ATOM   8176 O  OE2   . GLU F 3 440 ? 78.693  -46.498 -43.868 1.00 45.47  ? 417  GLU B OE2   1 
ATOM   8177 N  N     . VAL F 3 441 ? 73.812  -49.758 -42.038 1.00 30.66  ? 418  VAL B N     1 
ATOM   8178 C  CA    . VAL F 3 441 ? 72.570  -50.403 -42.447 1.00 28.70  ? 418  VAL B CA    1 
ATOM   8179 C  C     . VAL F 3 441 ? 71.720  -50.734 -41.232 1.00 28.55  ? 418  VAL B C     1 
ATOM   8180 O  O     . VAL F 3 441 ? 70.571  -50.307 -41.137 1.00 28.71  ? 418  VAL B O     1 
ATOM   8181 C  CB    . VAL F 3 441 ? 72.831  -51.719 -43.207 1.00 27.57  ? 418  VAL B CB    1 
ATOM   8182 C  CG1   . VAL F 3 441 ? 71.512  -52.349 -43.616 1.00 25.08  ? 418  VAL B CG1   1 
ATOM   8183 C  CG2   . VAL F 3 441 ? 73.694  -51.459 -44.422 1.00 27.54  ? 418  VAL B CG2   1 
ATOM   8184 N  N     . PHE F 3 442 ? 72.288  -51.503 -40.307 1.00 28.32  ? 419  PHE B N     1 
ATOM   8185 C  CA    . PHE F 3 442 ? 71.568  -51.887 -39.103 1.00 28.77  ? 419  PHE B CA    1 
ATOM   8186 C  C     . PHE F 3 442 ? 70.984  -50.647 -38.447 1.00 29.45  ? 419  PHE B C     1 
ATOM   8187 O  O     . PHE F 3 442 ? 69.845  -50.646 -37.986 1.00 30.23  ? 419  PHE B O     1 
ATOM   8188 C  CB    . PHE F 3 442 ? 72.495  -52.584 -38.106 1.00 29.68  ? 419  PHE B CB    1 
ATOM   8189 C  CG    . PHE F 3 442 ? 73.161  -53.820 -38.641 1.00 31.08  ? 419  PHE B CG    1 
ATOM   8190 C  CD1   . PHE F 3 442 ? 72.517  -54.639 -39.565 1.00 31.92  ? 419  PHE B CD1   1 
ATOM   8191 C  CD2   . PHE F 3 442 ? 74.420  -54.196 -38.175 1.00 31.71  ? 419  PHE B CD2   1 
ATOM   8192 C  CE1   . PHE F 3 442 ? 73.120  -55.813 -40.017 1.00 33.37  ? 419  PHE B CE1   1 
ATOM   8193 C  CE2   . PHE F 3 442 ? 75.031  -55.367 -38.617 1.00 31.88  ? 419  PHE B CE2   1 
ATOM   8194 C  CZ    . PHE F 3 442 ? 74.381  -56.178 -39.538 1.00 33.61  ? 419  PHE B CZ    1 
ATOM   8195 N  N     . CYS F 3 443 ? 71.779  -49.587 -38.414 1.00 30.57  ? 420  CYS B N     1 
ATOM   8196 C  CA    . CYS F 3 443 ? 71.362  -48.329 -37.813 1.00 31.49  ? 420  CYS B CA    1 
ATOM   8197 C  C     . CYS F 3 443 ? 70.200  -47.710 -38.588 1.00 31.12  ? 420  CYS B C     1 
ATOM   8198 O  O     . CYS F 3 443 ? 69.224  -47.245 -37.999 1.00 31.31  ? 420  CYS B O     1 
ATOM   8199 C  CB    . CYS F 3 443 ? 72.546  -47.363 -37.780 1.00 32.77  ? 420  CYS B CB    1 
ATOM   8200 S  SG    . CYS F 3 443 ? 72.223  -45.827 -36.913 1.00 38.74  ? 420  CYS B SG    1 
ATOM   8201 N  N     . ALA F 3 444 ? 70.312  -47.717 -39.912 1.00 30.80  ? 421  ALA B N     1 
ATOM   8202 C  CA    . ALA F 3 444 ? 69.283  -47.158 -40.781 1.00 30.22  ? 421  ALA B CA    1 
ATOM   8203 C  C     . ALA F 3 444 ? 67.946  -47.879 -40.635 1.00 31.00  ? 421  ALA B C     1 
ATOM   8204 O  O     . ALA F 3 444 ? 66.893  -47.244 -40.568 1.00 30.66  ? 421  ALA B O     1 
ATOM   8205 C  CB    . ALA F 3 444 ? 69.749  -47.217 -42.224 1.00 30.38  ? 421  ALA B CB    1 
ATOM   8206 N  N     . GLU F 3 445 ? 67.992  -49.206 -40.588 1.00 33.06  ? 422  GLU B N     1 
ATOM   8207 C  CA    . GLU F 3 445 ? 66.782  -50.010 -40.451 1.00 35.37  ? 422  GLU B CA    1 
ATOM   8208 C  C     . GLU F 3 445 ? 66.088  -49.775 -39.116 1.00 33.67  ? 422  GLU B C     1 
ATOM   8209 O  O     . GLU F 3 445 ? 64.876  -49.582 -39.072 1.00 35.22  ? 422  GLU B O     1 
ATOM   8210 C  CB    . GLU F 3 445 ? 67.109  -51.495 -40.582 1.00 39.87  ? 422  GLU B CB    1 
ATOM   8211 C  CG    . GLU F 3 445 ? 65.890  -52.399 -40.498 1.00 48.98  ? 422  GLU B CG    1 
ATOM   8212 C  CD    . GLU F 3 445 ? 66.263  -53.866 -40.366 1.00 56.11  ? 422  GLU B CD    1 
ATOM   8213 O  OE1   . GLU F 3 445 ? 66.982  -54.380 -41.253 1.00 58.51  ? 422  GLU B OE1   1 
ATOM   8214 O  OE2   . GLU F 3 445 ? 65.839  -54.506 -39.374 1.00 59.58  ? 422  GLU B OE2   1 
ATOM   8215 N  N     . LEU F 3 446 ? 66.857  -49.803 -38.031 1.00 31.56  ? 423  LEU B N     1 
ATOM   8216 C  CA    . LEU F 3 446 ? 66.307  -49.596 -36.693 1.00 29.05  ? 423  LEU B CA    1 
ATOM   8217 C  C     . LEU F 3 446 ? 65.646  -48.222 -36.567 1.00 28.74  ? 423  LEU B C     1 
ATOM   8218 O  O     . LEU F 3 446 ? 64.509  -48.112 -36.097 1.00 28.18  ? 423  LEU B O     1 
ATOM   8219 C  CB    . LEU F 3 446 ? 67.409  -49.755 -35.638 1.00 26.22  ? 423  LEU B CB    1 
ATOM   8220 C  CG    . LEU F 3 446 ? 68.054  -51.142 -35.517 1.00 22.69  ? 423  LEU B CG    1 
ATOM   8221 C  CD1   . LEU F 3 446 ? 69.216  -51.093 -34.537 1.00 22.62  ? 423  LEU B CD1   1 
ATOM   8222 C  CD2   . LEU F 3 446 ? 67.021  -52.149 -35.063 1.00 20.91  ? 423  LEU B CD2   1 
ATOM   8223 N  N     . THR F 3 447 ? 66.360  -47.180 -36.986 1.00 27.78  ? 424  THR B N     1 
ATOM   8224 C  CA    . THR F 3 447 ? 65.829  -45.819 -36.942 1.00 27.67  ? 424  THR B CA    1 
ATOM   8225 C  C     . THR F 3 447 ? 64.469  -45.819 -37.622 1.00 27.23  ? 424  THR B C     1 
ATOM   8226 O  O     . THR F 3 447 ? 63.500  -45.260 -37.119 1.00 26.31  ? 424  THR B O     1 
ATOM   8227 C  CB    . THR F 3 447 ? 66.735  -44.841 -37.705 1.00 27.41  ? 424  THR B CB    1 
ATOM   8228 O  OG1   . THR F 3 447 ? 68.024  -44.800 -37.083 1.00 27.20  ? 424  THR B OG1   1 
ATOM   8229 C  CG2   . THR F 3 447 ? 66.127  -43.449 -37.714 1.00 26.68  ? 424  THR B CG2   1 
ATOM   8230 N  N     . SER F 3 448 ? 64.421  -46.455 -38.784 1.00 28.14  ? 425  SER B N     1 
ATOM   8231 C  CA    . SER F 3 448 ? 63.198  -46.562 -39.556 1.00 29.77  ? 425  SER B CA    1 
ATOM   8232 C  C     . SER F 3 448 ? 62.082  -47.116 -38.670 1.00 29.50  ? 425  SER B C     1 
ATOM   8233 O  O     . SER F 3 448 ? 61.040  -46.487 -38.497 1.00 28.33  ? 425  SER B O     1 
ATOM   8234 C  CB    . SER F 3 448 ? 63.438  -47.485 -40.755 1.00 30.30  ? 425  SER B CB    1 
ATOM   8235 O  OG    . SER F 3 448 ? 62.251  -47.697 -41.495 1.00 34.63  ? 425  SER B OG    1 
ATOM   8236 N  N     . ARG F 3 449 ? 62.320  -48.290 -38.097 1.00 30.61  ? 426  ARG B N     1 
ATOM   8237 C  CA    . ARG F 3 449 ? 61.344  -48.941 -37.236 1.00 32.64  ? 426  ARG B CA    1 
ATOM   8238 C  C     . ARG F 3 449 ? 60.986  -48.123 -36.003 1.00 32.82  ? 426  ARG B C     1 
ATOM   8239 O  O     . ARG F 3 449 ? 59.912  -48.302 -35.424 1.00 31.97  ? 426  ARG B O     1 
ATOM   8240 C  CB    . ARG F 3 449 ? 61.855  -50.317 -36.816 1.00 34.40  ? 426  ARG B CB    1 
ATOM   8241 C  CG    . ARG F 3 449 ? 61.952  -51.305 -37.967 1.00 38.00  ? 426  ARG B CG    1 
ATOM   8242 C  CD    . ARG F 3 449 ? 62.449  -52.648 -37.480 1.00 41.74  ? 426  ARG B CD    1 
ATOM   8243 N  NE    . ARG F 3 449 ? 61.559  -53.215 -36.474 1.00 43.89  ? 426  ARG B NE    1 
ATOM   8244 C  CZ    . ARG F 3 449 ? 61.864  -54.262 -35.716 1.00 45.60  ? 426  ARG B CZ    1 
ATOM   8245 N  NH1   . ARG F 3 449 ? 63.045  -54.858 -35.849 1.00 45.43  ? 426  ARG B NH1   1 
ATOM   8246 N  NH2   . ARG F 3 449 ? 60.988  -54.716 -34.829 1.00 44.85  ? 426  ARG B NH2   1 
ATOM   8247 N  N     . ILE F 3 450 ? 61.883  -47.234 -35.593 1.00 33.19  ? 427  ILE B N     1 
ATOM   8248 C  CA    . ILE F 3 450 ? 61.612  -46.392 -34.434 1.00 34.24  ? 427  ILE B CA    1 
ATOM   8249 C  C     . ILE F 3 450 ? 60.572  -45.352 -34.838 1.00 35.90  ? 427  ILE B C     1 
ATOM   8250 O  O     . ILE F 3 450 ? 59.584  -45.142 -34.135 1.00 36.43  ? 427  ILE B O     1 
ATOM   8251 C  CB    . ILE F 3 450 ? 62.885  -45.664 -33.940 1.00 32.28  ? 427  ILE B CB    1 
ATOM   8252 C  CG1   . ILE F 3 450 ? 63.908  -46.682 -33.443 1.00 31.72  ? 427  ILE B CG1   1 
ATOM   8253 C  CG2   . ILE F 3 450 ? 62.533  -44.704 -32.818 1.00 30.47  ? 427  ILE B CG2   1 
ATOM   8254 C  CD1   . ILE F 3 450 ? 65.199  -46.058 -32.969 1.00 32.84  ? 427  ILE B CD1   1 
ATOM   8255 N  N     . GLN F 3 451 ? 60.800  -44.712 -35.982 1.00 37.30  ? 428  GLN B N     1 
ATOM   8256 C  CA    . GLN F 3 451 ? 59.885  -43.700 -36.487 1.00 40.09  ? 428  GLN B CA    1 
ATOM   8257 C  C     . GLN F 3 451 ? 58.511  -44.319 -36.672 1.00 41.42  ? 428  GLN B C     1 
ATOM   8258 O  O     . GLN F 3 451 ? 57.492  -43.704 -36.363 1.00 42.89  ? 428  GLN B O     1 
ATOM   8259 C  CB    . GLN F 3 451 ? 60.371  -43.157 -37.831 1.00 41.80  ? 428  GLN B CB    1 
ATOM   8260 C  CG    . GLN F 3 451 ? 61.775  -42.584 -37.815 1.00 46.86  ? 428  GLN B CG    1 
ATOM   8261 C  CD    . GLN F 3 451 ? 62.186  -42.037 -39.168 1.00 50.17  ? 428  GLN B CD    1 
ATOM   8262 O  OE1   . GLN F 3 451 ? 61.593  -41.080 -39.667 1.00 53.55  ? 428  GLN B OE1   1 
ATOM   8263 N  NE2   . GLN F 3 451 ? 63.200  -42.649 -39.774 1.00 50.85  ? 428  GLN B NE2   1 
ATOM   8264 N  N     . ASP F 3 452 ? 58.492  -45.545 -37.181 1.00 41.80  ? 429  ASP B N     1 
ATOM   8265 C  CA    . ASP F 3 452 ? 57.242  -46.246 -37.411 1.00 42.35  ? 429  ASP B CA    1 
ATOM   8266 C  C     . ASP F 3 452 ? 56.475  -46.359 -36.100 1.00 41.90  ? 429  ASP B C     1 
ATOM   8267 O  O     . ASP F 3 452 ? 55.245  -46.351 -36.089 1.00 41.95  ? 429  ASP B O     1 
ATOM   8268 C  CB    . ASP F 3 452 ? 57.519  -47.635 -37.990 1.00 45.53  ? 429  ASP B CB    1 
ATOM   8269 C  CG    . ASP F 3 452 ? 56.255  -48.337 -38.457 1.00 48.74  ? 429  ASP B CG    1 
ATOM   8270 O  OD1   . ASP F 3 452 ? 55.534  -47.768 -39.310 1.00 48.75  ? 429  ASP B OD1   1 
ATOM   8271 O  OD2   . ASP F 3 452 ? 55.987  -49.458 -37.971 1.00 49.19  ? 429  ASP B OD2   1 
ATOM   8272 N  N     . LEU F 3 453 ? 57.202  -46.458 -34.993 1.00 41.21  ? 430  LEU B N     1 
ATOM   8273 C  CA    . LEU F 3 453 ? 56.565  -46.555 -33.687 1.00 42.18  ? 430  LEU B CA    1 
ATOM   8274 C  C     . LEU F 3 453 ? 56.067  -45.194 -33.227 1.00 43.98  ? 430  LEU B C     1 
ATOM   8275 O  O     . LEU F 3 453 ? 54.977  -45.081 -32.669 1.00 43.61  ? 430  LEU B O     1 
ATOM   8276 C  CB    . LEU F 3 453 ? 57.536  -47.125 -32.655 1.00 41.15  ? 430  LEU B CB    1 
ATOM   8277 C  CG    . LEU F 3 453 ? 57.755  -48.634 -32.725 1.00 40.00  ? 430  LEU B CG    1 
ATOM   8278 C  CD1   . LEU F 3 453 ? 58.753  -49.057 -31.662 1.00 41.06  ? 430  LEU B CD1   1 
ATOM   8279 C  CD2   . LEU F 3 453 ? 56.430  -49.348 -32.523 1.00 37.95  ? 430  LEU B CD2   1 
ATOM   8280 N  N     . GLU F 3 454 ? 56.867  -44.159 -33.462 1.00 46.34  ? 431  GLU B N     1 
ATOM   8281 C  CA    . GLU F 3 454 ? 56.485  -42.807 -33.077 1.00 48.88  ? 431  GLU B CA    1 
ATOM   8282 C  C     . GLU F 3 454 ? 55.208  -42.434 -33.815 1.00 50.03  ? 431  GLU B C     1 
ATOM   8283 O  O     . GLU F 3 454 ? 54.586  -41.410 -33.534 1.00 50.62  ? 431  GLU B O     1 
ATOM   8284 C  CB    . GLU F 3 454 ? 57.594  -41.813 -33.424 1.00 50.73  ? 431  GLU B CB    1 
ATOM   8285 C  CG    . GLU F 3 454 ? 58.928  -42.131 -32.778 1.00 54.15  ? 431  GLU B CG    1 
ATOM   8286 C  CD    . GLU F 3 454 ? 59.912  -40.988 -32.894 1.00 56.24  ? 431  GLU B CD    1 
ATOM   8287 O  OE1   . GLU F 3 454 ? 60.136  -40.514 -34.027 1.00 57.26  ? 431  GLU B OE1   1 
ATOM   8288 O  OE2   . GLU F 3 454 ? 60.460  -40.566 -31.852 1.00 58.29  ? 431  GLU B OE2   1 
ATOM   8289 N  N     . GLN F 3 455 ? 54.832  -43.274 -34.771 1.00 50.88  ? 432  GLN B N     1 
ATOM   8290 C  CA    . GLN F 3 455 ? 53.622  -43.067 -35.546 1.00 51.90  ? 432  GLN B CA    1 
ATOM   8291 C  C     . GLN F 3 455 ? 52.476  -43.693 -34.762 1.00 52.90  ? 432  GLN B C     1 
ATOM   8292 O  O     . GLN F 3 455 ? 51.430  -43.078 -34.563 1.00 53.92  ? 432  GLN B O     1 
ATOM   8293 C  CB    . GLN F 3 455 ? 53.745  -43.751 -36.907 1.00 51.70  ? 432  GLN B CB    1 
ATOM   8294 C  CG    . GLN F 3 455 ? 54.915  -43.267 -37.741 1.00 52.51  ? 432  GLN B CG    1 
ATOM   8295 C  CD    . GLN F 3 455 ? 54.716  -41.867 -38.280 1.00 52.85  ? 432  GLN B CD    1 
ATOM   8296 O  OE1   . GLN F 3 455 ? 53.828  -41.626 -39.102 1.00 52.99  ? 432  GLN B OE1   1 
ATOM   8297 N  NE2   . GLN F 3 455 ? 55.542  -40.933 -37.822 1.00 52.60  ? 432  GLN B NE2   1 
ATOM   8298 N  N     . GLU F 3 456 ? 52.694  -44.922 -34.306 1.00 53.27  ? 433  GLU B N     1 
ATOM   8299 C  CA    . GLU F 3 456 ? 51.686  -45.649 -33.549 1.00 54.35  ? 433  GLU B CA    1 
ATOM   8300 C  C     . GLU F 3 456 ? 51.460  -45.020 -32.176 1.00 54.65  ? 433  GLU B C     1 
ATOM   8301 O  O     . GLU F 3 456 ? 50.319  -44.833 -31.754 1.00 56.16  ? 433  GLU B O     1 
ATOM   8302 C  CB    . GLU F 3 456 ? 52.110  -47.115 -33.395 1.00 55.16  ? 433  GLU B CB    1 
ATOM   8303 C  CG    . GLU F 3 456 ? 50.987  -48.062 -32.990 1.00 58.36  ? 433  GLU B CG    1 
ATOM   8304 C  CD    . GLU F 3 456 ? 51.252  -49.504 -33.409 1.00 60.20  ? 433  GLU B CD    1 
ATOM   8305 O  OE1   . GLU F 3 456 ? 51.355  -49.759 -34.630 1.00 59.33  ? 433  GLU B OE1   1 
ATOM   8306 O  OE2   . GLU F 3 456 ? 51.355  -50.380 -32.520 1.00 60.75  ? 433  GLU B OE2   1 
ATOM   8307 N  N     . TYR F 3 457 ? 52.545  -44.684 -31.484 1.00 53.39  ? 434  TYR B N     1 
ATOM   8308 C  CA    . TYR F 3 457 ? 52.442  -44.088 -30.156 1.00 51.21  ? 434  TYR B CA    1 
ATOM   8309 C  C     . TYR F 3 457 ? 52.244  -42.580 -30.230 1.00 50.07  ? 434  TYR B C     1 
ATOM   8310 O  O     . TYR F 3 457 ? 51.765  -41.961 -29.280 1.00 50.09  ? 434  TYR B O     1 
ATOM   8311 C  CB    . TYR F 3 457 ? 53.705  -44.376 -29.337 1.00 51.33  ? 434  TYR B CB    1 
ATOM   8312 C  CG    . TYR F 3 457 ? 54.148  -45.823 -29.333 1.00 53.05  ? 434  TYR B CG    1 
ATOM   8313 C  CD1   . TYR F 3 457 ? 53.243  -46.854 -29.080 1.00 53.64  ? 434  TYR B CD1   1 
ATOM   8314 C  CD2   . TYR F 3 457 ? 55.484  -46.160 -29.559 1.00 54.44  ? 434  TYR B CD2   1 
ATOM   8315 C  CE1   . TYR F 3 457 ? 53.656  -48.186 -29.053 1.00 54.96  ? 434  TYR B CE1   1 
ATOM   8316 C  CE2   . TYR F 3 457 ? 55.909  -47.487 -29.532 1.00 55.43  ? 434  TYR B CE2   1 
ATOM   8317 C  CZ    . TYR F 3 457 ? 54.991  -48.494 -29.279 1.00 56.21  ? 434  TYR B CZ    1 
ATOM   8318 O  OH    . TYR F 3 457 ? 55.408  -49.808 -29.251 1.00 58.00  ? 434  TYR B OH    1 
ATOM   8319 N  N     . ASN F 3 458 ? 52.614  -41.995 -31.364 1.00 48.01  ? 435  ASN B N     1 
ATOM   8320 C  CA    . ASN F 3 458 ? 52.505  -40.554 -31.556 1.00 46.11  ? 435  ASN B CA    1 
ATOM   8321 C  C     . ASN F 3 458 ? 53.332  -39.861 -30.475 1.00 46.15  ? 435  ASN B C     1 
ATOM   8322 O  O     . ASN F 3 458 ? 53.081  -38.709 -30.124 1.00 45.61  ? 435  ASN B O     1 
ATOM   8323 C  CB    . ASN F 3 458 ? 51.042  -40.109 -31.470 1.00 42.97  ? 435  ASN B CB    1 
ATOM   8324 C  CG    . ASN F 3 458 ? 50.841  -38.677 -31.930 1.00 39.72  ? 435  ASN B CG    1 
ATOM   8325 O  OD1   . ASN F 3 458 ? 51.215  -38.313 -33.043 1.00 36.51  ? 435  ASN B OD1   1 
ATOM   8326 N  ND2   . ASN F 3 458 ? 50.240  -37.859 -31.076 1.00 38.76  ? 435  ASN B ND2   1 
ATOM   8327 N  N     . LYS F 3 459 ? 54.319  -40.584 -29.953 1.00 46.80  ? 436  LYS B N     1 
ATOM   8328 C  CA    . LYS F 3 459 ? 55.203  -40.065 -28.915 1.00 48.46  ? 436  LYS B CA    1 
ATOM   8329 C  C     . LYS F 3 459 ? 56.665  -40.288 -29.283 1.00 48.39  ? 436  LYS B C     1 
ATOM   8330 O  O     . LYS F 3 459 ? 56.972  -41.020 -30.223 1.00 48.88  ? 436  LYS B O     1 
ATOM   8331 C  CB    . LYS F 3 459 ? 54.908  -40.743 -27.575 1.00 50.05  ? 436  LYS B CB    1 
ATOM   8332 C  CG    . LYS F 3 459 ? 53.516  -40.475 -27.034 1.00 53.32  ? 436  LYS B CG    1 
ATOM   8333 C  CD    . LYS F 3 459 ? 53.369  -40.976 -25.606 1.00 54.64  ? 436  LYS B CD    1 
ATOM   8334 C  CE    . LYS F 3 459 ? 51.996  -40.630 -25.045 1.00 56.75  ? 436  LYS B CE    1 
ATOM   8335 N  NZ    . LYS F 3 459 ? 51.719  -39.161 -25.080 1.00 56.89  ? 436  LYS B NZ    1 
ATOM   8336 N  N     . ILE F 3 460 ? 57.564  -39.655 -28.534 1.00 48.44  ? 437  ILE B N     1 
ATOM   8337 C  CA    . ILE F 3 460 ? 58.998  -39.785 -28.773 1.00 47.69  ? 437  ILE B CA    1 
ATOM   8338 C  C     . ILE F 3 460 ? 59.523  -41.111 -28.239 1.00 47.83  ? 437  ILE B C     1 
ATOM   8339 O  O     . ILE F 3 460 ? 59.402  -41.397 -27.047 1.00 48.17  ? 437  ILE B O     1 
ATOM   8340 C  CB    . ILE F 3 460 ? 59.794  -38.653 -28.084 1.00 46.96  ? 437  ILE B CB    1 
ATOM   8341 C  CG1   . ILE F 3 460 ? 59.423  -37.302 -28.695 1.00 46.21  ? 437  ILE B CG1   1 
ATOM   8342 C  CG2   . ILE F 3 460 ? 61.288  -38.906 -28.226 1.00 46.39  ? 437  ILE B CG2   1 
ATOM   8343 C  CD1   . ILE F 3 460 ? 59.714  -37.211 -30.168 1.00 46.01  ? 437  ILE B CD1   1 
ATOM   8344 N  N     . VAL F 3 461 ? 60.104  -41.914 -29.123 1.00 47.02  ? 438  VAL B N     1 
ATOM   8345 C  CA    . VAL F 3 461 ? 60.661  -43.202 -28.731 1.00 45.71  ? 438  VAL B CA    1 
ATOM   8346 C  C     . VAL F 3 461 ? 62.174  -43.142 -28.916 1.00 45.53  ? 438  VAL B C     1 
ATOM   8347 O  O     . VAL F 3 461 ? 62.661  -42.821 -30.000 1.00 44.33  ? 438  VAL B O     1 
ATOM   8348 C  CB    . VAL F 3 461 ? 60.070  -44.356 -29.582 1.00 44.98  ? 438  VAL B CB    1 
ATOM   8349 C  CG1   . VAL F 3 461 ? 60.642  -45.690 -29.128 1.00 43.67  ? 438  VAL B CG1   1 
ATOM   8350 C  CG2   . VAL F 3 461 ? 58.556  -44.373 -29.453 1.00 43.52  ? 438  VAL B CG2   1 
ATOM   8351 N  N     . ILE F 3 462 ? 62.911  -43.440 -27.850 1.00 46.39  ? 439  ILE B N     1 
ATOM   8352 C  CA    . ILE F 3 462 ? 64.370  -43.406 -27.889 1.00 47.55  ? 439  ILE B CA    1 
ATOM   8353 C  C     . ILE F 3 462 ? 65.038  -44.484 -27.042 1.00 47.45  ? 439  ILE B C     1 
ATOM   8354 O  O     . ILE F 3 462 ? 64.790  -44.588 -25.839 1.00 47.93  ? 439  ILE B O     1 
ATOM   8355 C  CB    . ILE F 3 462 ? 64.902  -42.038 -27.420 1.00 48.76  ? 439  ILE B CB    1 
ATOM   8356 C  CG1   . ILE F 3 462 ? 64.164  -41.606 -26.149 1.00 49.53  ? 439  ILE B CG1   1 
ATOM   8357 C  CG2   . ILE F 3 462 ? 64.748  -41.011 -28.528 1.00 50.52  ? 439  ILE B CG2   1 
ATOM   8358 C  CD1   . ILE F 3 462 ? 64.544  -40.225 -25.656 1.00 51.80  ? 439  ILE B CD1   1 
ATOM   8359 N  N     . PRO F 3 463 ? 65.901  -45.302 -27.668 1.00 46.83  ? 440  PRO B N     1 
ATOM   8360 C  CA    . PRO F 3 463 ? 66.626  -46.381 -26.992 1.00 46.32  ? 440  PRO B CA    1 
ATOM   8361 C  C     . PRO F 3 463 ? 67.803  -45.814 -26.200 1.00 47.77  ? 440  PRO B C     1 
ATOM   8362 O  O     . PRO F 3 463 ? 68.547  -44.974 -26.708 1.00 48.56  ? 440  PRO B O     1 
ATOM   8363 C  CB    . PRO F 3 463 ? 67.077  -47.256 -28.152 1.00 45.38  ? 440  PRO B CB    1 
ATOM   8364 C  CG    . PRO F 3 463 ? 67.359  -46.251 -29.217 1.00 44.11  ? 440  PRO B CG    1 
ATOM   8365 C  CD    . PRO F 3 463 ? 66.166  -45.329 -29.118 1.00 45.84  ? 440  PRO B CD    1 
ATOM   8366 N  N     . ARG F 3 464 ? 67.971  -46.273 -24.961 1.00 48.35  ? 441  ARG B N     1 
ATOM   8367 C  CA    . ARG F 3 464 ? 69.057  -45.789 -24.111 1.00 48.12  ? 441  ARG B CA    1 
ATOM   8368 C  C     . ARG F 3 464 ? 70.132  -46.843 -23.857 1.00 46.54  ? 441  ARG B C     1 
ATOM   8369 O  O     . ARG F 3 464 ? 70.948  -46.699 -22.944 1.00 46.62  ? 441  ARG B O     1 
ATOM   8370 C  CB    . ARG F 3 464 ? 68.495  -45.298 -22.775 1.00 51.44  ? 441  ARG B CB    1 
ATOM   8371 C  CG    . ARG F 3 464 ? 67.468  -44.181 -22.905 1.00 55.26  ? 441  ARG B CG    1 
ATOM   8372 C  CD    . ARG F 3 464 ? 66.971  -43.715 -21.541 1.00 58.33  ? 441  ARG B CD    1 
ATOM   8373 N  NE    . ARG F 3 464 ? 65.909  -42.715 -21.649 1.00 60.64  ? 441  ARG B NE    1 
ATOM   8374 C  CZ    . ARG F 3 464 ? 66.052  -41.522 -22.219 1.00 61.60  ? 441  ARG B CZ    1 
ATOM   8375 N  NH1   . ARG F 3 464 ? 67.219  -41.163 -22.741 1.00 61.64  ? 441  ARG B NH1   1 
ATOM   8376 N  NH2   . ARG F 3 464 ? 65.023  -40.686 -22.271 1.00 61.49  ? 441  ARG B NH2   1 
ATOM   8377 N  N     . THR F 3 465 ? 70.131  -47.897 -24.666 1.00 44.10  ? 442  THR B N     1 
ATOM   8378 C  CA    . THR F 3 465 ? 71.109  -48.972 -24.530 1.00 41.10  ? 442  THR B CA    1 
ATOM   8379 C  C     . THR F 3 465 ? 71.324  -49.683 -25.863 1.00 40.69  ? 442  THR B C     1 
ATOM   8380 O  O     . THR F 3 465 ? 70.367  -49.995 -26.571 1.00 39.73  ? 442  THR B O     1 
ATOM   8381 C  CB    . THR F 3 465 ? 70.653  -50.010 -23.487 1.00 38.68  ? 442  THR B CB    1 
ATOM   8382 O  OG1   . THR F 3 465 ? 70.397  -49.353 -22.243 1.00 37.73  ? 442  THR B OG1   1 
ATOM   8383 C  CG2   . THR F 3 465 ? 71.726  -51.061 -23.277 1.00 37.69  ? 442  THR B CG2   1 
ATOM   8384 N  N     . VAL F 3 466 ? 72.585  -49.930 -26.203 1.00 39.94  ? 443  VAL B N     1 
ATOM   8385 C  CA    . VAL F 3 466 ? 72.921  -50.613 -27.445 1.00 39.04  ? 443  VAL B CA    1 
ATOM   8386 C  C     . VAL F 3 466 ? 73.768  -51.827 -27.129 1.00 39.15  ? 443  VAL B C     1 
ATOM   8387 O  O     . VAL F 3 466 ? 74.414  -51.886 -26.084 1.00 40.52  ? 443  VAL B O     1 
ATOM   8388 C  CB    . VAL F 3 466 ? 73.738  -49.725 -28.394 1.00 39.08  ? 443  VAL B CB    1 
ATOM   8389 C  CG1   . VAL F 3 466 ? 73.790  -50.366 -29.773 1.00 39.38  ? 443  VAL B CG1   1 
ATOM   8390 C  CG2   . VAL F 3 466 ? 73.139  -48.335 -28.463 1.00 41.53  ? 443  VAL B CG2   1 
ATOM   8391 N  N     . SER F 3 467 ? 73.771  -52.791 -28.040 1.00 38.26  ? 444  SER B N     1 
ATOM   8392 C  CA    . SER F 3 467 ? 74.551  -54.002 -27.852 1.00 35.75  ? 444  SER B CA    1 
ATOM   8393 C  C     . SER F 3 467 ? 75.026  -54.528 -29.193 1.00 34.16  ? 444  SER B C     1 
ATOM   8394 O  O     . SER F 3 467 ? 74.220  -54.842 -30.059 1.00 36.00  ? 444  SER B O     1 
ATOM   8395 C  CB    . SER F 3 467 ? 73.707  -55.062 -27.151 1.00 34.62  ? 444  SER B CB    1 
ATOM   8396 O  OG    . SER F 3 467 ? 74.419  -56.280 -27.054 1.00 37.23  ? 444  SER B OG    1 
ATOM   8397 N  N     . ILE F 3 468 ? 76.337  -54.615 -29.368 1.00 33.29  ? 445  ILE B N     1 
ATOM   8398 C  CA    . ILE F 3 468 ? 76.888  -55.120 -30.615 1.00 33.61  ? 445  ILE B CA    1 
ATOM   8399 C  C     . ILE F 3 468 ? 77.418  -56.533 -30.421 1.00 35.51  ? 445  ILE B C     1 
ATOM   8400 O  O     . ILE F 3 468 ? 78.421  -56.741 -29.742 1.00 36.21  ? 445  ILE B O     1 
ATOM   8401 C  CB    . ILE F 3 468 ? 78.032  -54.231 -31.127 1.00 31.39  ? 445  ILE B CB    1 
ATOM   8402 C  CG1   . ILE F 3 468 ? 77.511  -52.822 -31.405 1.00 30.53  ? 445  ILE B CG1   1 
ATOM   8403 C  CG2   . ILE F 3 468 ? 78.624  -54.829 -32.391 1.00 30.24  ? 445  ILE B CG2   1 
ATOM   8404 C  CD1   . ILE F 3 468 ? 76.433  -52.766 -32.468 1.00 30.88  ? 445  ILE B CD1   1 
ATOM   8405 N  N     . SER F 3 469 ? 76.728  -57.502 -31.013 1.00 37.19  ? 446  SER B N     1 
ATOM   8406 C  CA    . SER F 3 469 ? 77.127  -58.900 -30.923 1.00 38.85  ? 446  SER B CA    1 
ATOM   8407 C  C     . SER F 3 469 ? 77.671  -59.336 -32.275 1.00 39.06  ? 446  SER B C     1 
ATOM   8408 O  O     . SER F 3 469 ? 77.124  -58.974 -33.316 1.00 39.18  ? 446  SER B O     1 
ATOM   8409 C  CB    . SER F 3 469 ? 75.928  -59.773 -30.543 1.00 40.68  ? 446  SER B CB    1 
ATOM   8410 O  OG    . SER F 3 469 ? 76.297  -61.140 -30.461 1.00 44.93  ? 446  SER B OG    1 
ATOM   8411 N  N     . LEU F 3 470 ? 78.752  -60.107 -32.260 1.00 39.52  ? 447  LEU B N     1 
ATOM   8412 C  CA    . LEU F 3 470 ? 79.354  -60.571 -33.501 1.00 41.37  ? 447  LEU B CA    1 
ATOM   8413 C  C     . LEU F 3 470 ? 80.070  -61.898 -33.324 1.00 42.13  ? 447  LEU B C     1 
ATOM   8414 O  O     . LEU F 3 470 ? 80.718  -62.136 -32.303 1.00 42.90  ? 447  LEU B O     1 
ATOM   8415 C  CB    . LEU F 3 470 ? 80.333  -59.519 -34.038 1.00 42.73  ? 447  LEU B CB    1 
ATOM   8416 C  CG    . LEU F 3 470 ? 81.532  -59.097 -33.177 1.00 43.39  ? 447  LEU B CG    1 
ATOM   8417 C  CD1   . LEU F 3 470 ? 82.629  -60.155 -33.223 1.00 43.20  ? 447  LEU B CD1   1 
ATOM   8418 C  CD2   . LEU F 3 470 ? 82.072  -57.776 -33.698 1.00 43.11  ? 447  LEU B CD2   1 
ATOM   8419 N  N     . LYS F 3 471 ? 79.946  -62.765 -34.321 1.00 42.53  ? 448  LYS B N     1 
ATOM   8420 C  CA    . LYS F 3 471 ? 80.599  -64.061 -34.268 1.00 43.31  ? 448  LYS B CA    1 
ATOM   8421 C  C     . LYS F 3 471 ? 81.771  -64.030 -35.239 1.00 43.01  ? 448  LYS B C     1 
ATOM   8422 O  O     . LYS F 3 471 ? 81.598  -63.847 -36.444 1.00 42.54  ? 448  LYS B O     1 
ATOM   8423 C  CB    . LYS F 3 471 ? 79.614  -65.178 -34.627 1.00 44.28  ? 448  LYS B CB    1 
ATOM   8424 C  CG    . LYS F 3 471 ? 80.073  -66.555 -34.170 1.00 45.83  ? 448  LYS B CG    1 
ATOM   8425 C  CD    . LYS F 3 471 ? 78.986  -67.610 -34.324 1.00 47.09  ? 448  LYS B CD    1 
ATOM   8426 C  CE    . LYS F 3 471 ? 77.841  -67.384 -33.347 1.00 47.56  ? 448  LYS B CE    1 
ATOM   8427 N  NZ    . LYS F 3 471 ? 76.792  -68.438 -33.471 1.00 47.82  ? 448  LYS B NZ    1 
ATOM   8428 N  N     . THR F 3 472 ? 82.965  -64.205 -34.686 1.00 42.99  ? 449  THR B N     1 
ATOM   8429 C  CA    . THR F 3 472 ? 84.211  -64.171 -35.439 1.00 42.20  ? 449  THR B CA    1 
ATOM   8430 C  C     . THR F 3 472 ? 84.380  -65.280 -36.480 1.00 41.01  ? 449  THR B C     1 
ATOM   8431 O  O     . THR F 3 472 ? 83.450  -66.033 -36.762 1.00 42.03  ? 449  THR B O     1 
ATOM   8432 C  CB    . THR F 3 472 ? 85.399  -64.218 -34.473 1.00 42.83  ? 449  THR B CB    1 
ATOM   8433 O  OG1   . THR F 3 472 ? 86.590  -63.829 -35.163 1.00 47.33  ? 449  THR B OG1   1 
ATOM   8434 C  CG2   . THR F 3 472 ? 85.573  -65.621 -33.917 1.00 42.08  ? 449  THR B CG2   1 
ATOM   8435 N  N     . LYS F 3 473 ? 85.580  -65.362 -37.051 1.00 39.60  ? 450  LYS B N     1 
ATOM   8436 C  CA    . LYS F 3 473 ? 85.914  -66.364 -38.064 1.00 37.74  ? 450  LYS B CA    1 
ATOM   8437 C  C     . LYS F 3 473 ? 86.024  -67.750 -37.441 1.00 37.03  ? 450  LYS B C     1 
ATOM   8438 O  O     . LYS F 3 473 ? 85.663  -68.750 -38.061 1.00 35.92  ? 450  LYS B O     1 
ATOM   8439 C  CB    . LYS F 3 473 ? 87.244  -66.013 -38.734 1.00 37.29  ? 450  LYS B CB    1 
ATOM   8440 C  CG    . LYS F 3 473 ? 87.747  -67.059 -39.721 1.00 36.20  ? 450  LYS B CG    1 
ATOM   8441 C  CD    . LYS F 3 473 ? 89.118  -66.683 -40.275 1.00 35.14  ? 450  LYS B CD    1 
ATOM   8442 C  CE    . LYS F 3 473 ? 89.546  -67.624 -41.390 1.00 33.97  ? 450  LYS B CE    1 
ATOM   8443 N  NZ    . LYS F 3 473 ? 90.839  -67.213 -41.999 1.00 33.59  ? 450  LYS B NZ    1 
ATOM   8444 N  N     . SER F 3 474 ? 86.544  -67.795 -36.219 1.00 36.16  ? 451  SER B N     1 
ATOM   8445 C  CA    . SER F 3 474 ? 86.701  -69.045 -35.489 1.00 35.26  ? 451  SER B CA    1 
ATOM   8446 C  C     . SER F 3 474 ? 85.409  -69.346 -34.738 1.00 35.13  ? 451  SER B C     1 
ATOM   8447 O  O     . SER F 3 474 ? 85.343  -70.271 -33.930 1.00 35.87  ? 451  SER B O     1 
ATOM   8448 C  CB    . SER F 3 474 ? 87.871  -68.934 -34.509 1.00 36.08  ? 451  SER B CB    1 
ATOM   8449 O  OG    . SER F 3 474 ? 87.741  -67.792 -33.679 1.00 36.98  ? 451  SER B OG    1 
ATOM   8450 N  N     . TYR F 3 475 ? 84.389  -68.542 -35.022 1.00 34.86  ? 452  TYR B N     1 
ATOM   8451 C  CA    . TYR F 3 475 ? 83.066  -68.667 -34.422 1.00 34.26  ? 452  TYR B CA    1 
ATOM   8452 C  C     . TYR F 3 475 ? 82.998  -68.349 -32.930 1.00 35.61  ? 452  TYR B C     1 
ATOM   8453 O  O     . TYR F 3 475 ? 82.170  -68.912 -32.209 1.00 34.30  ? 452  TYR B O     1 
ATOM   8454 C  CB    . TYR F 3 475 ? 82.488  -70.063 -34.679 1.00 32.72  ? 452  TYR B CB    1 
ATOM   8455 C  CG    . TYR F 3 475 ? 82.325  -70.393 -36.145 1.00 31.96  ? 452  TYR B CG    1 
ATOM   8456 C  CD1   . TYR F 3 475 ? 83.437  -70.630 -36.951 1.00 32.81  ? 452  TYR B CD1   1 
ATOM   8457 C  CD2   . TYR F 3 475 ? 81.061  -70.441 -36.737 1.00 30.61  ? 452  TYR B CD2   1 
ATOM   8458 C  CE1   . TYR F 3 475 ? 83.302  -70.905 -38.310 1.00 31.77  ? 452  TYR B CE1   1 
ATOM   8459 C  CE2   . TYR F 3 475 ? 80.913  -70.716 -38.099 1.00 29.74  ? 452  TYR B CE2   1 
ATOM   8460 C  CZ    . TYR F 3 475 ? 82.041  -70.944 -38.879 1.00 31.17  ? 452  TYR B CZ    1 
ATOM   8461 O  OH    . TYR F 3 475 ? 81.924  -71.186 -40.229 1.00 30.45  ? 452  TYR B OH    1 
ATOM   8462 N  N     . GLU F 3 476 ? 83.864  -67.451 -32.465 1.00 37.18  ? 453  GLU B N     1 
ATOM   8463 C  CA    . GLU F 3 476 ? 83.842  -67.059 -31.062 1.00 39.66  ? 453  GLU B CA    1 
ATOM   8464 C  C     . GLU F 3 476 ? 82.976  -65.810 -30.940 1.00 41.36  ? 453  GLU B C     1 
ATOM   8465 O  O     . GLU F 3 476 ? 82.983  -64.948 -31.821 1.00 41.43  ? 453  GLU B O     1 
ATOM   8466 C  CB    . GLU F 3 476 ? 85.247  -66.762 -30.534 1.00 39.28  ? 453  GLU B CB    1 
ATOM   8467 C  CG    . GLU F 3 476 ? 85.275  -66.603 -29.016 1.00 41.57  ? 453  GLU B CG    1 
ATOM   8468 C  CD    . GLU F 3 476 ? 86.643  -66.247 -28.471 1.00 42.92  ? 453  GLU B CD    1 
ATOM   8469 O  OE1   . GLU F 3 476 ? 87.620  -66.950 -28.798 1.00 44.51  ? 453  GLU B OE1   1 
ATOM   8470 O  OE2   . GLU F 3 476 ? 86.739  -65.267 -27.703 1.00 44.95  ? 453  GLU B OE2   1 
ATOM   8471 N  N     . VAL F 3 477 ? 82.233  -65.712 -29.846 1.00 42.97  ? 454  VAL B N     1 
ATOM   8472 C  CA    . VAL F 3 477 ? 81.349  -64.576 -29.639 1.00 43.88  ? 454  VAL B CA    1 
ATOM   8473 C  C     . VAL F 3 477 ? 81.966  -63.419 -28.861 1.00 44.62  ? 454  VAL B C     1 
ATOM   8474 O  O     . VAL F 3 477 ? 82.627  -63.613 -27.839 1.00 44.37  ? 454  VAL B O     1 
ATOM   8475 C  CB    . VAL F 3 477 ? 80.058  -65.022 -28.925 1.00 44.11  ? 454  VAL B CB    1 
ATOM   8476 C  CG1   . VAL F 3 477 ? 79.136  -63.831 -28.710 1.00 45.43  ? 454  VAL B CG1   1 
ATOM   8477 C  CG2   . VAL F 3 477 ? 79.362  -66.086 -29.754 1.00 44.76  ? 454  VAL B CG2   1 
ATOM   8478 N  N     . TYR F 3 478 ? 81.741  -62.213 -29.376 1.00 46.03  ? 455  TYR B N     1 
ATOM   8479 C  CA    . TYR F 3 478 ? 82.216  -60.978 -28.764 1.00 46.97  ? 455  TYR B CA    1 
ATOM   8480 C  C     . TYR F 3 478 ? 81.027  -60.033 -28.677 1.00 47.44  ? 455  TYR B C     1 
ATOM   8481 O  O     . TYR F 3 478 ? 80.231  -59.946 -29.612 1.00 46.75  ? 455  TYR B O     1 
ATOM   8482 C  CB    . TYR F 3 478 ? 83.311  -60.321 -29.613 1.00 47.99  ? 455  TYR B CB    1 
ATOM   8483 C  CG    . TYR F 3 478 ? 84.662  -60.995 -29.540 1.00 49.44  ? 455  TYR B CG    1 
ATOM   8484 C  CD1   . TYR F 3 478 ? 85.082  -61.874 -30.540 1.00 50.16  ? 455  TYR B CD1   1 
ATOM   8485 C  CD2   . TYR F 3 478 ? 85.520  -60.759 -28.467 1.00 49.16  ? 455  TYR B CD2   1 
ATOM   8486 C  CE1   . TYR F 3 478 ? 86.326  -62.501 -30.472 1.00 49.82  ? 455  TYR B CE1   1 
ATOM   8487 C  CE2   . TYR F 3 478 ? 86.764  -61.382 -28.389 1.00 49.38  ? 455  TYR B CE2   1 
ATOM   8488 C  CZ    . TYR F 3 478 ? 87.160  -62.250 -29.393 1.00 49.28  ? 455  TYR B CZ    1 
ATOM   8489 O  OH    . TYR F 3 478 ? 88.386  -62.872 -29.314 1.00 49.59  ? 455  TYR B OH    1 
ATOM   8490 N  N     . ARG F 3 479 ? 80.902  -59.329 -27.558 1.00 48.50  ? 456  ARG B N     1 
ATOM   8491 C  CA    . ARG F 3 479 ? 79.799  -58.394 -27.386 1.00 50.64  ? 456  ARG B CA    1 
ATOM   8492 C  C     . ARG F 3 479 ? 80.071  -57.346 -26.318 1.00 50.47  ? 456  ARG B C     1 
ATOM   8493 O  O     . ARG F 3 479 ? 80.845  -57.570 -25.388 1.00 50.65  ? 456  ARG B O     1 
ATOM   8494 C  CB    . ARG F 3 479 ? 78.514  -59.148 -27.039 1.00 53.26  ? 456  ARG B CB    1 
ATOM   8495 C  CG    . ARG F 3 479 ? 78.590  -59.961 -25.757 1.00 57.31  ? 456  ARG B CG    1 
ATOM   8496 C  CD    . ARG F 3 479 ? 77.282  -60.690 -25.492 1.00 61.45  ? 456  ARG B CD    1 
ATOM   8497 N  NE    . ARG F 3 479 ? 76.865  -61.484 -26.646 1.00 65.74  ? 456  ARG B NE    1 
ATOM   8498 C  CZ    . ARG F 3 479 ? 75.791  -62.267 -26.671 1.00 67.17  ? 456  ARG B CZ    1 
ATOM   8499 N  NH1   . ARG F 3 479 ? 75.492  -62.948 -27.769 1.00 67.56  ? 456  ARG B NH1   1 
ATOM   8500 N  NH2   . ARG F 3 479 ? 75.020  -62.374 -25.596 1.00 67.77  ? 456  ARG B NH2   1 
ATOM   8501 N  N     . LYS F 3 480 ? 79.427  -56.194 -26.473 1.00 50.02  ? 457  LYS B N     1 
ATOM   8502 C  CA    . LYS F 3 480 ? 79.550  -55.091 -25.533 1.00 49.16  ? 457  LYS B CA    1 
ATOM   8503 C  C     . LYS F 3 480 ? 78.173  -54.448 -25.514 1.00 49.10  ? 457  LYS B C     1 
ATOM   8504 O  O     . LYS F 3 480 ? 77.562  -54.274 -26.565 1.00 49.91  ? 457  LYS B O     1 
ATOM   8505 C  CB    . LYS F 3 480 ? 80.606  -54.095 -26.014 1.00 49.03  ? 457  LYS B CB    1 
ATOM   8506 C  CG    . LYS F 3 480 ? 81.070  -53.118 -24.945 1.00 50.10  ? 457  LYS B CG    1 
ATOM   8507 C  CD    . LYS F 3 480 ? 82.332  -52.388 -25.383 1.00 50.97  ? 457  LYS B CD    1 
ATOM   8508 C  CE    . LYS F 3 480 ? 82.905  -51.531 -24.264 1.00 50.97  ? 457  LYS B CE    1 
ATOM   8509 N  NZ    . LYS F 3 480 ? 84.219  -50.938 -24.651 1.00 50.72  ? 457  LYS B NZ    1 
ATOM   8510 N  N     . SER F 3 481 ? 77.677  -54.109 -24.330 1.00 48.98  ? 458  SER B N     1 
ATOM   8511 C  CA    . SER F 3 481 ? 76.351  -53.517 -24.225 1.00 49.71  ? 458  SER B CA    1 
ATOM   8512 C  C     . SER F 3 481 ? 76.250  -52.355 -23.243 1.00 50.62  ? 458  SER B C     1 
ATOM   8513 O  O     . SER F 3 481 ? 75.692  -52.499 -22.157 1.00 52.50  ? 458  SER B O     1 
ATOM   8514 C  CB    . SER F 3 481 ? 75.341  -54.600 -23.836 1.00 48.96  ? 458  SER B CB    1 
ATOM   8515 O  OG    . SER F 3 481 ? 74.060  -54.044 -23.597 1.00 50.53  ? 458  SER B OG    1 
ATOM   8516 N  N     . GLY F 3 482 ? 76.773  -51.198 -23.630 1.00 50.64  ? 459  GLY B N     1 
ATOM   8517 C  CA    . GLY F 3 482 ? 76.706  -50.042 -22.755 1.00 52.47  ? 459  GLY B CA    1 
ATOM   8518 C  C     . GLY F 3 482 ? 75.538  -49.119 -23.066 1.00 53.30  ? 459  GLY B C     1 
ATOM   8519 O  O     . GLY F 3 482 ? 74.623  -49.499 -23.798 1.00 51.74  ? 459  GLY B O     1 
ATOM   8520 N  N     . PRO F 3 483 ? 75.532  -47.899 -22.504 1.00 54.98  ? 460  PRO B N     1 
ATOM   8521 C  CA    . PRO F 3 483 ? 74.455  -46.933 -22.742 1.00 56.46  ? 460  PRO B CA    1 
ATOM   8522 C  C     . PRO F 3 483 ? 74.744  -46.008 -23.922 1.00 57.15  ? 460  PRO B C     1 
ATOM   8523 O  O     . PRO F 3 483 ? 75.886  -45.887 -24.366 1.00 57.00  ? 460  PRO B O     1 
ATOM   8524 C  CB    . PRO F 3 483 ? 74.390  -46.172 -21.425 1.00 56.24  ? 460  PRO B CB    1 
ATOM   8525 C  CG    . PRO F 3 483 ? 75.834  -46.086 -21.052 1.00 55.59  ? 460  PRO B CG    1 
ATOM   8526 C  CD    . PRO F 3 483 ? 76.346  -47.489 -21.342 1.00 55.20  ? 460  PRO B CD    1 
ATOM   8527 N  N     . VAL F 3 484 ? 73.701  -45.359 -24.426 1.00 58.04  ? 461  VAL B N     1 
ATOM   8528 C  CA    . VAL F 3 484 ? 73.843  -44.435 -25.541 1.00 59.67  ? 461  VAL B CA    1 
ATOM   8529 C  C     . VAL F 3 484 ? 73.383  -43.049 -25.101 1.00 61.18  ? 461  VAL B C     1 
ATOM   8530 O  O     . VAL F 3 484 ? 72.267  -42.884 -24.612 1.00 61.39  ? 461  VAL B O     1 
ATOM   8531 C  CB    . VAL F 3 484 ? 73.010  -44.895 -26.753 1.00 59.19  ? 461  VAL B CB    1 
ATOM   8532 C  CG1   . VAL F 3 484 ? 71.580  -45.166 -26.327 1.00 59.04  ? 461  VAL B CG1   1 
ATOM   8533 C  CG2   . VAL F 3 484 ? 73.053  -43.835 -27.846 1.00 59.22  ? 461  VAL B CG2   1 
ATOM   8534 N  N     . ALA F 3 485 ? 74.251  -42.057 -25.271 1.00 63.31  ? 462  ALA B N     1 
ATOM   8535 C  CA    . ALA F 3 485 ? 73.939  -40.689 -24.872 1.00 65.46  ? 462  ALA B CA    1 
ATOM   8536 C  C     . ALA F 3 485 ? 73.453  -39.832 -26.035 1.00 67.09  ? 462  ALA B C     1 
ATOM   8537 O  O     . ALA F 3 485 ? 73.922  -39.972 -27.165 1.00 67.61  ? 462  ALA B O     1 
ATOM   8538 C  CB    . ALA F 3 485 ? 75.161  -40.049 -24.231 1.00 66.07  ? 462  ALA B CB    1 
ATOM   8539 N  N     . TYR F 3 486 ? 72.518  -38.933 -25.743 1.00 68.58  ? 463  TYR B N     1 
ATOM   8540 C  CA    . TYR F 3 486 ? 71.954  -38.052 -26.757 1.00 70.37  ? 463  TYR B CA    1 
ATOM   8541 C  C     . TYR F 3 486 ? 72.110  -36.577 -26.402 1.00 71.43  ? 463  TYR B C     1 
ATOM   8542 O  O     . TYR F 3 486 ? 71.494  -36.089 -25.455 1.00 71.15  ? 463  TYR B O     1 
ATOM   8543 C  CB    . TYR F 3 486 ? 70.472  -38.373 -26.953 1.00 70.44  ? 463  TYR B CB    1 
ATOM   8544 C  CG    . TYR F 3 486 ? 70.208  -39.776 -27.448 1.00 70.48  ? 463  TYR B CG    1 
ATOM   8545 C  CD1   . TYR F 3 486 ? 70.694  -40.203 -28.684 1.00 70.53  ? 463  TYR B CD1   1 
ATOM   8546 C  CD2   . TYR F 3 486 ? 69.467  -40.679 -26.684 1.00 70.18  ? 463  TYR B CD2   1 
ATOM   8547 C  CE1   . TYR F 3 486 ? 70.450  -41.493 -29.149 1.00 70.48  ? 463  TYR B CE1   1 
ATOM   8548 C  CE2   . TYR F 3 486 ? 69.215  -41.973 -27.141 1.00 70.38  ? 463  TYR B CE2   1 
ATOM   8549 C  CZ    . TYR F 3 486 ? 69.710  -42.371 -28.374 1.00 70.37  ? 463  TYR B CZ    1 
ATOM   8550 O  OH    . TYR F 3 486 ? 69.462  -43.643 -28.835 1.00 69.75  ? 463  TYR B OH    1 
ATOM   8551 N  N     . LYS F 3 487 ? 72.933  -35.871 -27.174 1.00 72.94  ? 464  LYS B N     1 
ATOM   8552 C  CA    . LYS F 3 487 ? 73.164  -34.449 -26.948 1.00 74.49  ? 464  LYS B CA    1 
ATOM   8553 C  C     . LYS F 3 487 ? 71.992  -33.630 -27.475 1.00 75.56  ? 464  LYS B C     1 
ATOM   8554 O  O     . LYS F 3 487 ? 72.171  -32.702 -28.262 1.00 74.90  ? 464  LYS B O     1 
ATOM   8555 C  CB    . LYS F 3 487 ? 74.460  -34.007 -27.634 0.00 75.33  ? 464  LYS B CB    1 
ATOM   8556 C  CG    . LYS F 3 487 ? 74.543  -34.368 -29.109 0.00 76.24  ? 464  LYS B CG    1 
ATOM   8557 C  CD    . LYS F 3 487 ? 75.792  -33.789 -29.762 0.00 77.00  ? 464  LYS B CD    1 
ATOM   8558 C  CE    . LYS F 3 487 ? 75.687  -32.281 -29.956 0.00 77.49  ? 464  LYS B CE    1 
ATOM   8559 N  NZ    . LYS F 3 487 ? 75.544  -31.531 -28.677 0.00 77.95  ? 464  LYS B NZ    1 
ATOM   8560 N  N     . GLY F 3 488 ? 70.791  -33.984 -27.029 1.00 77.42  ? 465  GLY B N     1 
ATOM   8561 C  CA    . GLY F 3 488 ? 69.595  -33.282 -27.455 1.00 80.31  ? 465  GLY B CA    1 
ATOM   8562 C  C     . GLY F 3 488 ? 68.336  -33.970 -26.960 1.00 82.83  ? 465  GLY B C     1 
ATOM   8563 O  O     . GLY F 3 488 ? 68.221  -34.290 -25.777 1.00 83.30  ? 465  GLY B O     1 
ATOM   8564 N  N     . ILE F 3 489 ? 67.388  -34.195 -27.867 1.00 85.25  ? 466  ILE B N     1 
ATOM   8565 C  CA    . ILE F 3 489 ? 66.129  -34.857 -27.531 1.00 86.36  ? 466  ILE B CA    1 
ATOM   8566 C  C     . ILE F 3 489 ? 65.617  -35.665 -28.724 1.00 87.24  ? 466  ILE B C     1 
ATOM   8567 O  O     . ILE F 3 489 ? 65.378  -35.115 -29.802 1.00 86.58  ? 466  ILE B O     1 
ATOM   8568 C  CB    . ILE F 3 489 ? 65.036  -33.836 -27.134 1.00 86.46  ? 466  ILE B CB    1 
ATOM   8569 C  CG1   . ILE F 3 489 ? 65.499  -33.009 -25.933 1.00 86.42  ? 466  ILE B CG1   1 
ATOM   8570 C  CG2   . ILE F 3 489 ? 63.744  -34.564 -26.794 1.00 85.99  ? 466  ILE B CG2   1 
ATOM   8571 C  CD1   . ILE F 3 489 ? 64.554  -31.883 -25.561 0.00 86.53  ? 466  ILE B CD1   1 
ATOM   8572 N  N     . ASN F 3 490 ? 65.457  -36.970 -28.518 1.00 88.60  ? 467  ASN B N     1 
ATOM   8573 C  CA    . ASN F 3 490 ? 64.967  -37.881 -29.554 1.00 89.60  ? 467  ASN B CA    1 
ATOM   8574 C  C     . ASN F 3 490 ? 65.972  -38.130 -30.681 1.00 89.33  ? 467  ASN B C     1 
ATOM   8575 O  O     . ASN F 3 490 ? 66.713  -39.116 -30.661 1.00 88.79  ? 467  ASN B O     1 
ATOM   8576 C  CB    . ASN F 3 490 ? 63.654  -37.346 -30.143 1.00 90.18  ? 467  ASN B CB    1 
ATOM   8577 C  CG    . ASN F 3 490 ? 63.107  -38.231 -31.246 0.00 90.35  ? 467  ASN B CG    1 
ATOM   8578 O  OD1   . ASN F 3 490 ? 62.819  -39.408 -31.028 0.00 90.58  ? 467  ASN B OD1   1 
ATOM   8579 N  ND2   . ASN F 3 490 ? 62.957  -37.666 -32.439 0.00 90.58  ? 467  ASN B ND2   1 
ATOM   8580 N  N     . PHE F 3 491 ? 65.975  -37.228 -31.660 1.00 88.79  ? 468  PHE B N     1 
ATOM   8581 C  CA    . PHE F 3 491 ? 66.853  -37.292 -32.829 1.00 87.02  ? 468  PHE B CA    1 
ATOM   8582 C  C     . PHE F 3 491 ? 68.156  -38.053 -32.588 1.00 85.24  ? 468  PHE B C     1 
ATOM   8583 O  O     . PHE F 3 491 ? 69.148  -37.474 -32.141 1.00 85.53  ? 468  PHE B O     1 
ATOM   8584 C  CB    . PHE F 3 491 ? 67.161  -35.865 -33.302 0.00 87.02  ? 468  PHE B CB    1 
ATOM   8585 C  CG    . PHE F 3 491 ? 67.841  -35.793 -34.643 0.00 86.95  ? 468  PHE B CG    1 
ATOM   8586 C  CD1   . PHE F 3 491 ? 69.145  -36.247 -34.810 0.00 86.92  ? 468  PHE B CD1   1 
ATOM   8587 C  CD2   . PHE F 3 491 ? 67.176  -35.252 -35.739 0.00 86.92  ? 468  PHE B CD2   1 
ATOM   8588 C  CE1   . PHE F 3 491 ? 69.778  -36.165 -36.048 0.00 86.85  ? 468  PHE B CE1   1 
ATOM   8589 C  CE2   . PHE F 3 491 ? 67.800  -35.165 -36.982 0.00 86.85  ? 468  PHE B CE2   1 
ATOM   8590 C  CZ    . PHE F 3 491 ? 69.104  -35.622 -37.136 0.00 86.83  ? 468  PHE B CZ    1 
ATOM   8591 N  N     . GLN F 3 492 ? 68.153  -39.349 -32.891 1.00 83.08  ? 469  GLN B N     1 
ATOM   8592 C  CA    . GLN F 3 492 ? 69.344  -40.169 -32.709 1.00 80.81  ? 469  GLN B CA    1 
ATOM   8593 C  C     . GLN F 3 492 ? 70.106  -40.369 -34.019 1.00 78.47  ? 469  GLN B C     1 
ATOM   8594 O  O     . GLN F 3 492 ? 70.944  -39.545 -34.378 1.00 79.02  ? 469  GLN B O     1 
ATOM   8595 C  CB    . GLN F 3 492 ? 68.985  -41.531 -32.083 1.00 82.11  ? 469  GLN B CB    1 
ATOM   8596 C  CG    . GLN F 3 492 ? 67.954  -42.380 -32.829 1.00 81.63  ? 469  GLN B CG    1 
ATOM   8597 C  CD    . GLN F 3 492 ? 66.542  -41.860 -32.678 1.00 81.96  ? 469  GLN B CD    1 
ATOM   8598 O  OE1   . GLN F 3 492 ? 66.049  -41.682 -31.563 1.00 82.01  ? 469  GLN B OE1   1 
ATOM   8599 N  NE2   . GLN F 3 492 ? 65.879  -41.620 -33.802 1.00 82.62  ? 469  GLN B NE2   1 
ATOM   8600 N  N     . SER F 3 493 ? 69.813  -41.454 -34.730 1.00 75.95  ? 470  SER B N     1 
ATOM   8601 C  CA    . SER F 3 493 ? 70.476  -41.756 -35.995 1.00 73.93  ? 470  SER B CA    1 
ATOM   8602 C  C     . SER F 3 493 ? 71.996  -41.763 -35.843 1.00 72.93  ? 470  SER B C     1 
ATOM   8603 O  O     . SER F 3 493 ? 72.579  -42.744 -35.384 1.00 73.35  ? 470  SER B O     1 
ATOM   8604 C  CB    . SER F 3 493 ? 70.071  -40.735 -37.063 0.00 74.19  ? 470  SER B CB    1 
ATOM   8605 O  OG    . SER F 3 493 ? 70.732  -40.992 -38.290 0.00 74.16  ? 470  SER B OG    1 
ATOM   8606 N  N     . HIS F 3 494 ? 72.629  -40.660 -36.227 1.00 70.71  ? 471  HIS B N     1 
ATOM   8607 C  CA    . HIS F 3 494 ? 74.077  -40.528 -36.145 1.00 67.88  ? 471  HIS B CA    1 
ATOM   8608 C  C     . HIS F 3 494 ? 74.602  -40.785 -34.734 1.00 64.61  ? 471  HIS B C     1 
ATOM   8609 O  O     . HIS F 3 494 ? 75.596  -41.483 -34.556 1.00 64.11  ? 471  HIS B O     1 
ATOM   8610 C  CB    . HIS F 3 494 ? 74.487  -39.129 -36.619 1.00 72.48  ? 471  HIS B CB    1 
ATOM   8611 C  CG    . HIS F 3 494 ? 75.967  -38.894 -36.640 1.00 77.34  ? 471  HIS B CG    1 
ATOM   8612 N  ND1   . HIS F 3 494 ? 76.734  -38.852 -35.495 1.00 79.48  ? 471  HIS B ND1   1 
ATOM   8613 C  CD2   . HIS F 3 494 ? 76.818  -38.662 -37.669 1.00 78.45  ? 471  HIS B CD2   1 
ATOM   8614 C  CE1   . HIS F 3 494 ? 77.992  -38.603 -35.816 1.00 79.86  ? 471  HIS B CE1   1 
ATOM   8615 N  NE2   . HIS F 3 494 ? 78.069  -38.483 -37.130 1.00 80.05  ? 471  HIS B NE2   1 
ATOM   8616 N  N     . GLU F 3 495 ? 73.926  -40.233 -33.732 1.00 61.71  ? 472  GLU B N     1 
ATOM   8617 C  CA    . GLU F 3 495 ? 74.356  -40.399 -32.347 1.00 59.97  ? 472  GLU B CA    1 
ATOM   8618 C  C     . GLU F 3 495 ? 74.118  -41.793 -31.779 1.00 57.59  ? 472  GLU B C     1 
ATOM   8619 O  O     . GLU F 3 495 ? 74.457  -42.065 -30.627 1.00 58.00  ? 472  GLU B O     1 
ATOM   8620 C  CB    . GLU F 3 495 ? 73.680  -39.351 -31.460 1.00 63.01  ? 472  GLU B CB    1 
ATOM   8621 C  CG    . GLU F 3 495 ? 74.027  -37.917 -31.844 1.00 68.12  ? 472  GLU B CG    1 
ATOM   8622 C  CD    . GLU F 3 495 ? 75.529  -37.658 -31.858 1.00 71.40  ? 472  GLU B CD    1 
ATOM   8623 O  OE1   . GLU F 3 495 ? 76.156  -37.724 -30.779 1.00 73.26  ? 472  GLU B OE1   1 
ATOM   8624 O  OE2   . GLU F 3 495 ? 76.085  -37.394 -32.948 1.00 72.44  ? 472  GLU B OE2   1 
ATOM   8625 N  N     . LEU F 3 496 ? 73.535  -42.672 -32.588 1.00 54.24  ? 473  LEU B N     1 
ATOM   8626 C  CA    . LEU F 3 496 ? 73.274  -44.051 -32.177 1.00 49.57  ? 473  LEU B CA    1 
ATOM   8627 C  C     . LEU F 3 496 ? 74.338  -44.923 -32.833 1.00 46.90  ? 473  LEU B C     1 
ATOM   8628 O  O     . LEU F 3 496 ? 74.800  -45.905 -32.257 1.00 45.99  ? 473  LEU B O     1 
ATOM   8629 C  CB    . LEU F 3 496 ? 71.870  -44.478 -32.628 1.00 49.43  ? 473  LEU B CB    1 
ATOM   8630 C  CG    . LEU F 3 496 ? 71.302  -45.878 -32.341 1.00 47.99  ? 473  LEU B CG    1 
ATOM   8631 C  CD1   . LEU F 3 496 ? 71.906  -46.892 -33.293 1.00 48.46  ? 473  LEU B CD1   1 
ATOM   8632 C  CD2   . LEU F 3 496 ? 71.551  -46.260 -30.896 1.00 46.11  ? 473  LEU B CD2   1 
ATOM   8633 N  N     . LEU F 3 497 ? 74.730  -44.535 -34.042 1.00 44.64  ? 474  LEU B N     1 
ATOM   8634 C  CA    . LEU F 3 497 ? 75.746  -45.248 -34.805 1.00 43.15  ? 474  LEU B CA    1 
ATOM   8635 C  C     . LEU F 3 497 ? 77.115  -45.118 -34.142 1.00 43.76  ? 474  LEU B C     1 
ATOM   8636 O  O     . LEU F 3 497 ? 77.936  -46.029 -34.212 1.00 43.50  ? 474  LEU B O     1 
ATOM   8637 C  CB    . LEU F 3 497 ? 75.815  -44.692 -36.231 1.00 40.64  ? 474  LEU B CB    1 
ATOM   8638 C  CG    . LEU F 3 497 ? 76.843  -45.318 -37.174 1.00 39.14  ? 474  LEU B CG    1 
ATOM   8639 C  CD1   . LEU F 3 497 ? 76.503  -46.784 -37.390 1.00 39.07  ? 474  LEU B CD1   1 
ATOM   8640 C  CD2   . LEU F 3 497 ? 76.849  -44.571 -38.499 1.00 37.98  ? 474  LEU B CD2   1 
ATOM   8641 N  N     . LYS F 3 498 ? 77.359  -43.979 -33.502 1.00 44.96  ? 475  LYS B N     1 
ATOM   8642 C  CA    . LYS F 3 498 ? 78.634  -43.744 -32.836 1.00 45.67  ? 475  LYS B CA    1 
ATOM   8643 C  C     . LYS F 3 498 ? 78.937  -44.799 -31.794 1.00 44.40  ? 475  LYS B C     1 
ATOM   8644 O  O     . LYS F 3 498 ? 79.997  -45.423 -31.820 1.00 44.75  ? 475  LYS B O     1 
ATOM   8645 C  CB    . LYS F 3 498 ? 78.653  -42.365 -32.178 1.00 48.43  ? 475  LYS B CB    1 
ATOM   8646 C  CG    . LYS F 3 498 ? 79.312  -41.300 -33.034 1.00 53.11  ? 475  LYS B CG    1 
ATOM   8647 C  CD    . LYS F 3 498 ? 80.774  -41.644 -33.294 1.00 55.19  ? 475  LYS B CD    1 
ATOM   8648 C  CE    . LYS F 3 498 ? 81.406  -40.677 -34.284 1.00 56.71  ? 475  LYS B CE    1 
ATOM   8649 N  NZ    . LYS F 3 498 ? 80.750  -40.743 -35.620 1.00 56.83  ? 475  LYS B NZ    1 
ATOM   8650 N  N     . VAL F 3 499 ? 78.006  -44.991 -30.869 1.00 42.45  ? 476  VAL B N     1 
ATOM   8651 C  CA    . VAL F 3 499 ? 78.196  -45.980 -29.825 1.00 41.65  ? 476  VAL B CA    1 
ATOM   8652 C  C     . VAL F 3 499 ? 78.604  -47.295 -30.468 1.00 40.67  ? 476  VAL B C     1 
ATOM   8653 O  O     . VAL F 3 499 ? 79.604  -47.904 -30.091 1.00 39.84  ? 476  VAL B O     1 
ATOM   8654 C  CB    . VAL F 3 499 ? 76.905  -46.205 -29.037 1.00 43.10  ? 476  VAL B CB    1 
ATOM   8655 C  CG1   . VAL F 3 499 ? 77.175  -47.126 -27.862 1.00 43.74  ? 476  VAL B CG1   1 
ATOM   8656 C  CG2   . VAL F 3 499 ? 76.346  -44.874 -28.569 1.00 44.88  ? 476  VAL B CG2   1 
ATOM   8657 N  N     . GLY F 3 500 ? 77.821  -47.719 -31.453 1.00 39.76  ? 477  GLY B N     1 
ATOM   8658 C  CA    . GLY F 3 500 ? 78.106  -48.962 -32.142 1.00 38.16  ? 477  GLY B CA    1 
ATOM   8659 C  C     . GLY F 3 500 ? 79.531  -49.029 -32.641 1.00 36.63  ? 477  GLY B C     1 
ATOM   8660 O  O     . GLY F 3 500 ? 80.246  -49.988 -32.368 1.00 36.30  ? 477  GLY B O     1 
ATOM   8661 N  N     . ILE F 3 501 ? 79.946  -47.999 -33.368 1.00 37.19  ? 478  ILE B N     1 
ATOM   8662 C  CA    . ILE F 3 501 ? 81.294  -47.946 -33.916 1.00 37.74  ? 478  ILE B CA    1 
ATOM   8663 C  C     . ILE F 3 501 ? 82.345  -48.031 -32.808 1.00 37.66  ? 478  ILE B C     1 
ATOM   8664 O  O     . ILE F 3 501 ? 83.380  -48.674 -32.977 1.00 37.10  ? 478  ILE B O     1 
ATOM   8665 C  CB    . ILE F 3 501 ? 81.498  -46.661 -34.748 1.00 36.91  ? 478  ILE B CB    1 
ATOM   8666 C  CG1   . ILE F 3 501 ? 80.378  -46.546 -35.787 1.00 37.60  ? 478  ILE B CG1   1 
ATOM   8667 C  CG2   . ILE F 3 501 ? 82.840  -46.708 -35.461 1.00 35.47  ? 478  ILE B CG2   1 
ATOM   8668 C  CD1   . ILE F 3 501 ? 80.387  -45.261 -36.586 1.00 38.67  ? 478  ILE B CD1   1 
ATOM   8669 N  N     . LYS F 3 502 ? 82.088  -47.390 -31.673 1.00 38.10  ? 479  LYS B N     1 
ATOM   8670 C  CA    . LYS F 3 502 ? 83.042  -47.458 -30.572 1.00 38.98  ? 479  LYS B CA    1 
ATOM   8671 C  C     . LYS F 3 502 ? 83.112  -48.921 -30.151 1.00 38.90  ? 479  LYS B C     1 
ATOM   8672 O  O     . LYS F 3 502 ? 84.189  -49.511 -30.081 1.00 38.24  ? 479  LYS B O     1 
ATOM   8673 C  CB    . LYS F 3 502 ? 82.582  -46.596 -29.391 1.00 37.80  ? 479  LYS B CB    1 
ATOM   8674 C  CG    . LYS F 3 502 ? 83.558  -46.589 -28.217 1.00 37.34  ? 479  LYS B CG    1 
ATOM   8675 C  CD    . LYS F 3 502 ? 84.907  -45.995 -28.600 0.00 38.03  ? 479  LYS B CD    1 
ATOM   8676 C  CE    . LYS F 3 502 ? 84.791  -44.516 -28.931 0.00 38.10  ? 479  LYS B CE    1 
ATOM   8677 N  NZ    . LYS F 3 502 ? 84.279  -43.731 -27.774 0.00 38.14  ? 479  LYS B NZ    1 
ATOM   8678 N  N     . PHE F 3 503 ? 81.942  -49.496 -29.892 1.00 39.61  ? 480  PHE B N     1 
ATOM   8679 C  CA    . PHE F 3 503 ? 81.816  -50.891 -29.487 1.00 40.00  ? 480  PHE B CA    1 
ATOM   8680 C  C     . PHE F 3 503 ? 82.522  -51.836 -30.450 1.00 40.49  ? 480  PHE B C     1 
ATOM   8681 O  O     . PHE F 3 503 ? 83.500  -52.485 -30.084 1.00 40.77  ? 480  PHE B O     1 
ATOM   8682 C  CB    . PHE F 3 503 ? 80.336  -51.269 -29.399 1.00 40.08  ? 480  PHE B CB    1 
ATOM   8683 C  CG    . PHE F 3 503 ? 79.663  -50.797 -28.147 1.00 39.03  ? 480  PHE B CG    1 
ATOM   8684 C  CD1   . PHE F 3 503 ? 80.077  -49.633 -27.514 1.00 39.42  ? 480  PHE B CD1   1 
ATOM   8685 C  CD2   . PHE F 3 503 ? 78.609  -51.516 -27.603 1.00 39.22  ? 480  PHE B CD2   1 
ATOM   8686 C  CE1   . PHE F 3 503 ? 79.452  -49.192 -26.355 1.00 40.39  ? 480  PHE B CE1   1 
ATOM   8687 C  CE2   . PHE F 3 503 ? 77.976  -51.084 -26.445 1.00 40.03  ? 480  PHE B CE2   1 
ATOM   8688 C  CZ    . PHE F 3 503 ? 78.399  -49.919 -25.820 1.00 40.35  ? 480  PHE B CZ    1 
ATOM   8689 N  N     . VAL F 3 504 ? 82.022  -51.914 -31.678 1.00 41.07  ? 481  VAL B N     1 
ATOM   8690 C  CA    . VAL F 3 504 ? 82.612  -52.787 -32.682 1.00 42.91  ? 481  VAL B CA    1 
ATOM   8691 C  C     . VAL F 3 504 ? 84.128  -52.581 -32.738 1.00 44.95  ? 481  VAL B C     1 
ATOM   8692 O  O     . VAL F 3 504 ? 84.871  -53.473 -33.150 1.00 46.16  ? 481  VAL B O     1 
ATOM   8693 C  CB    . VAL F 3 504 ? 81.990  -52.527 -34.079 1.00 42.29  ? 481  VAL B CB    1 
ATOM   8694 C  CG1   . VAL F 3 504 ? 82.392  -51.154 -34.587 1.00 42.85  ? 481  VAL B CG1   1 
ATOM   8695 C  CG2   . VAL F 3 504 ? 82.420  -53.608 -35.052 1.00 42.48  ? 481  VAL B CG2   1 
ATOM   8696 N  N     . THR F 3 505 ? 84.580  -51.403 -32.312 1.00 46.63  ? 482  THR B N     1 
ATOM   8697 C  CA    . THR F 3 505 ? 86.004  -51.078 -32.297 1.00 48.50  ? 482  THR B CA    1 
ATOM   8698 C  C     . THR F 3 505 ? 86.686  -51.624 -31.043 1.00 49.35  ? 482  THR B C     1 
ATOM   8699 O  O     . THR F 3 505 ? 87.777  -52.190 -31.121 1.00 50.14  ? 482  THR B O     1 
ATOM   8700 C  CB    . THR F 3 505 ? 86.237  -49.550 -32.362 1.00 48.21  ? 482  THR B CB    1 
ATOM   8701 O  OG1   . THR F 3 505 ? 85.950  -49.076 -33.683 1.00 48.29  ? 482  THR B OG1   1 
ATOM   8702 C  CG2   . THR F 3 505 ? 87.677  -49.212 -32.015 1.00 47.86  ? 482  THR B CG2   1 
ATOM   8703 N  N     . ASP F 3 506 ? 86.049  -51.443 -29.889 1.00 49.33  ? 483  ASP B N     1 
ATOM   8704 C  CA    . ASP F 3 506 ? 86.605  -51.940 -28.638 1.00 49.92  ? 483  ASP B CA    1 
ATOM   8705 C  C     . ASP F 3 506 ? 86.811  -53.446 -28.758 1.00 49.46  ? 483  ASP B C     1 
ATOM   8706 O  O     . ASP F 3 506 ? 87.766  -54.001 -28.214 1.00 49.17  ? 483  ASP B O     1 
ATOM   8707 C  CB    . ASP F 3 506 ? 85.656  -51.646 -27.474 1.00 52.94  ? 483  ASP B CB    1 
ATOM   8708 C  CG    . ASP F 3 506 ? 85.462  -50.162 -27.241 1.00 56.60  ? 483  ASP B CG    1 
ATOM   8709 O  OD1   . ASP F 3 506 ? 86.462  -49.460 -26.981 1.00 59.44  ? 483  ASP B OD1   1 
ATOM   8710 O  OD2   . ASP F 3 506 ? 84.306  -49.694 -27.317 1.00 59.65  ? 483  ASP B OD2   1 
ATOM   8711 N  N     . LEU F 3 507 ? 85.906  -54.098 -29.482 1.00 48.46  ? 484  LEU B N     1 
ATOM   8712 C  CA    . LEU F 3 507 ? 85.976  -55.538 -29.685 1.00 47.45  ? 484  LEU B CA    1 
ATOM   8713 C  C     . LEU F 3 507 ? 87.085  -55.901 -30.665 1.00 48.27  ? 484  LEU B C     1 
ATOM   8714 O  O     . LEU F 3 507 ? 87.830  -56.854 -30.442 1.00 48.41  ? 484  LEU B O     1 
ATOM   8715 C  CB    . LEU F 3 507 ? 84.637  -56.066 -30.206 1.00 44.83  ? 484  LEU B CB    1 
ATOM   8716 C  CG    . LEU F 3 507 ? 83.411  -55.790 -29.335 1.00 42.17  ? 484  LEU B CG    1 
ATOM   8717 C  CD1   . LEU F 3 507 ? 82.200  -56.458 -29.948 1.00 40.15  ? 484  LEU B CD1   1 
ATOM   8718 C  CD2   . LEU F 3 507 ? 83.646  -56.306 -27.930 1.00 42.18  ? 484  LEU B CD2   1 
ATOM   8719 N  N     . ASP F 3 508 ? 87.192  -55.142 -31.752 1.00 49.04  ? 485  ASP B N     1 
ATOM   8720 C  CA    . ASP F 3 508 ? 88.224  -55.398 -32.751 1.00 50.96  ? 485  ASP B CA    1 
ATOM   8721 C  C     . ASP F 3 508 ? 89.602  -55.398 -32.098 1.00 52.37  ? 485  ASP B C     1 
ATOM   8722 O  O     . ASP F 3 508 ? 90.541  -56.012 -32.606 1.00 52.22  ? 485  ASP B O     1 
ATOM   8723 C  CB    . ASP F 3 508 ? 88.178  -54.339 -33.853 1.00 50.25  ? 485  ASP B CB    1 
ATOM   8724 C  CG    . ASP F 3 508 ? 89.262  -54.538 -34.895 1.00 48.66  ? 485  ASP B CG    1 
ATOM   8725 O  OD1   . ASP F 3 508 ? 89.327  -55.635 -35.486 1.00 48.43  ? 485  ASP B OD1   1 
ATOM   8726 O  OD2   . ASP F 3 508 ? 90.048  -53.597 -35.124 1.00 46.85  ? 485  ASP B OD2   1 
ATOM   8727 N  N     . ILE F 3 509 ? 89.710  -54.704 -30.969 1.00 53.87  ? 486  ILE B N     1 
ATOM   8728 C  CA    . ILE F 3 509 ? 90.961  -54.622 -30.226 1.00 55.70  ? 486  ILE B CA    1 
ATOM   8729 C  C     . ILE F 3 509 ? 91.154  -55.870 -29.363 1.00 57.62  ? 486  ILE B C     1 
ATOM   8730 O  O     . ILE F 3 509 ? 92.252  -56.424 -29.304 1.00 58.72  ? 486  ILE B O     1 
ATOM   8731 C  CB    . ILE F 3 509 ? 90.983  -53.376 -29.311 1.00 55.63  ? 486  ILE B CB    1 
ATOM   8732 C  CG1   . ILE F 3 509 ? 90.964  -52.104 -30.162 1.00 55.49  ? 486  ILE B CG1   1 
ATOM   8733 C  CG2   . ILE F 3 509 ? 92.214  -53.401 -28.418 1.00 55.51  ? 486  ILE B CG2   1 
ATOM   8734 C  CD1   . ILE F 3 509 ? 90.954  -50.821 -29.345 1.00 54.67  ? 486  ILE B CD1   1 
ATOM   8735 N  N     . LYS F 3 510 ? 90.085  -56.309 -28.701 1.00 58.35  ? 487  LYS B N     1 
ATOM   8736 C  CA    . LYS F 3 510 ? 90.139  -57.488 -27.838 1.00 58.17  ? 487  LYS B CA    1 
ATOM   8737 C  C     . LYS F 3 510 ? 90.437  -58.766 -28.619 1.00 57.76  ? 487  LYS B C     1 
ATOM   8738 O  O     . LYS F 3 510 ? 90.625  -59.831 -28.030 1.00 58.08  ? 487  LYS B O     1 
ATOM   8739 C  CB    . LYS F 3 510 ? 88.819  -57.648 -27.079 1.00 58.52  ? 487  LYS B CB    1 
ATOM   8740 C  CG    . LYS F 3 510 ? 88.495  -56.492 -26.144 1.00 61.31  ? 487  LYS B CG    1 
ATOM   8741 C  CD    . LYS F 3 510 ? 87.093  -56.618 -25.550 1.00 64.35  ? 487  LYS B CD    1 
ATOM   8742 C  CE    . LYS F 3 510 ? 86.968  -57.819 -24.625 1.00 65.58  ? 487  LYS B CE    1 
ATOM   8743 N  NZ    . LYS F 3 510 ? 87.822  -57.675 -23.413 1.00 68.18  ? 487  LYS B NZ    1 
ATOM   8744 N  N     . GLY F 3 511 ? 90.481  -58.656 -29.942 1.00 57.61  ? 488  GLY B N     1 
ATOM   8745 C  CA    . GLY F 3 511 ? 90.762  -59.813 -30.773 1.00 57.74  ? 488  GLY B CA    1 
ATOM   8746 C  C     . GLY F 3 511 ? 91.765  -59.506 -31.868 1.00 58.69  ? 488  GLY B C     1 
ATOM   8747 O  O     . GLY F 3 511 ? 91.566  -59.882 -33.020 1.00 58.34  ? 488  GLY B O     1 
ATOM   8748 N  N     . LYS F 3 512 ? 92.846  -58.819 -31.513 1.00 60.00  ? 489  LYS B N     1 
ATOM   8749 C  CA    . LYS F 3 512 ? 93.876  -58.469 -32.483 1.00 61.49  ? 489  LYS B CA    1 
ATOM   8750 C  C     . LYS F 3 512 ? 94.639  -59.716 -32.923 1.00 62.66  ? 489  LYS B C     1 
ATOM   8751 O  O     . LYS F 3 512 ? 94.754  -59.998 -34.117 1.00 63.03  ? 489  LYS B O     1 
ATOM   8752 C  CB    . LYS F 3 512 ? 94.850  -57.453 -31.881 0.00 62.03  ? 489  LYS B CB    1 
ATOM   8753 C  CG    . LYS F 3 512 ? 95.926  -56.976 -32.846 0.00 62.63  ? 489  LYS B CG    1 
ATOM   8754 C  CD    . LYS F 3 512 ? 95.320  -56.272 -34.051 0.00 63.01  ? 489  LYS B CD    1 
ATOM   8755 C  CE    . LYS F 3 512 ? 96.399  -55.792 -35.008 0.00 63.18  ? 489  LYS B CE    1 
ATOM   8756 N  NZ    . LYS F 3 512 ? 97.342  -54.846 -34.350 0.00 63.28  ? 489  LYS B NZ    1 
ATOM   8757 N  N     . ASN F 3 513 ? 95.158  -60.461 -31.950 1.00 63.01  ? 490  ASN B N     1 
ATOM   8758 C  CA    . ASN F 3 513 ? 95.907  -61.679 -32.236 1.00 62.29  ? 490  ASN B CA    1 
ATOM   8759 C  C     . ASN F 3 513 ? 94.976  -62.786 -32.737 1.00 61.89  ? 490  ASN B C     1 
ATOM   8760 O  O     . ASN F 3 513 ? 95.115  -63.255 -33.868 1.00 62.27  ? 490  ASN B O     1 
ATOM   8761 C  CB    . ASN F 3 513 ? 96.646  -62.150 -30.982 0.00 62.80  ? 490  ASN B CB    1 
ATOM   8762 C  CG    . ASN F 3 513 ? 97.597  -61.100 -30.437 0.00 63.07  ? 490  ASN B CG    1 
ATOM   8763 O  OD1   . ASN F 3 513 ? 98.527  -60.671 -31.121 0.00 63.30  ? 490  ASN B OD1   1 
ATOM   8764 N  ND2   . ASN F 3 513 ? 97.366  -60.680 -29.199 0.00 63.30  ? 490  ASN B ND2   1 
ATOM   8765 N  N     . LYS F 3 514 ? 94.030  -63.194 -31.891 1.00 60.69  ? 491  LYS B N     1 
ATOM   8766 C  CA    . LYS F 3 514 ? 93.068  -64.247 -32.230 1.00 58.92  ? 491  LYS B CA    1 
ATOM   8767 C  C     . LYS F 3 514 ? 92.509  -64.064 -33.635 1.00 57.92  ? 491  LYS B C     1 
ATOM   8768 O  O     . LYS F 3 514 ? 92.377  -62.939 -34.109 1.00 59.67  ? 491  LYS B O     1 
ATOM   8769 C  CB    . LYS F 3 514 ? 91.905  -64.249 -31.231 1.00 57.96  ? 491  LYS B CB    1 
ATOM   8770 C  CG    . LYS F 3 514 ? 92.310  -64.500 -29.788 1.00 57.43  ? 491  LYS B CG    1 
ATOM   8771 C  CD    . LYS F 3 514 ? 91.103  -64.477 -28.867 0.00 58.08  ? 491  LYS B CD    1 
ATOM   8772 C  CE    . LYS F 3 514 ? 91.507  -64.754 -27.430 0.00 58.15  ? 491  LYS B CE    1 
ATOM   8773 N  NZ    . LYS F 3 514 ? 92.172  -66.079 -27.293 0.00 58.23  ? 491  LYS B NZ    1 
ATOM   8774 N  N     . SER F 3 515 ? 92.188  -65.165 -34.306 1.00 56.10  ? 492  SER B N     1 
ATOM   8775 C  CA    . SER F 3 515 ? 91.633  -65.075 -35.650 1.00 55.12  ? 492  SER B CA    1 
ATOM   8776 C  C     . SER F 3 515 ? 90.290  -64.363 -35.506 1.00 53.06  ? 492  SER B C     1 
ATOM   8777 O  O     . SER F 3 515 ? 89.369  -64.895 -34.889 1.00 54.04  ? 492  SER B O     1 
ATOM   8778 C  CB    . SER F 3 515 ? 91.442  -66.475 -36.243 1.00 56.22  ? 492  SER B CB    1 
ATOM   8779 O  OG    . SER F 3 515 ? 91.123  -66.405 -37.624 1.00 59.38  ? 492  SER B OG    1 
ATOM   8780 N  N     . TYR F 3 516 ? 90.190  -63.161 -36.070 1.00 49.92  ? 493  TYR B N     1 
ATOM   8781 C  CA    . TYR F 3 516 ? 88.978  -62.350 -35.969 1.00 45.34  ? 493  TYR B CA    1 
ATOM   8782 C  C     . TYR F 3 516 ? 88.200  -62.242 -37.283 1.00 44.17  ? 493  TYR B C     1 
ATOM   8783 O  O     . TYR F 3 516 ? 87.034  -62.620 -37.348 1.00 44.27  ? 493  TYR B O     1 
ATOM   8784 C  CB    . TYR F 3 516 ? 89.355  -60.951 -35.481 1.00 44.36  ? 493  TYR B CB    1 
ATOM   8785 C  CG    . TYR F 3 516 ? 88.229  -60.136 -34.885 1.00 43.52  ? 493  TYR B CG    1 
ATOM   8786 C  CD1   . TYR F 3 516 ? 87.758  -60.388 -33.594 1.00 42.53  ? 493  TYR B CD1   1 
ATOM   8787 C  CD2   . TYR F 3 516 ? 87.673  -59.070 -35.589 1.00 42.72  ? 493  TYR B CD2   1 
ATOM   8788 C  CE1   . TYR F 3 516 ? 86.765  -59.588 -33.022 1.00 41.03  ? 493  TYR B CE1   1 
ATOM   8789 C  CE2   . TYR F 3 516 ? 86.685  -58.269 -35.031 1.00 41.74  ? 493  TYR B CE2   1 
ATOM   8790 C  CZ    . TYR F 3 516 ? 86.238  -58.530 -33.750 1.00 40.70  ? 493  TYR B CZ    1 
ATOM   8791 O  OH    . TYR F 3 516 ? 85.271  -57.720 -33.207 1.00 41.09  ? 493  TYR B OH    1 
ATOM   8792 N  N     . TYR F 3 517 ? 88.837  -61.717 -38.326 1.00 42.38  ? 494  TYR B N     1 
ATOM   8793 C  CA    . TYR F 3 517 ? 88.166  -61.573 -39.616 1.00 40.34  ? 494  TYR B CA    1 
ATOM   8794 C  C     . TYR F 3 517 ? 88.485  -62.730 -40.550 1.00 39.75  ? 494  TYR B C     1 
ATOM   8795 O  O     . TYR F 3 517 ? 89.546  -63.344 -40.445 1.00 40.76  ? 494  TYR B O     1 
ATOM   8796 C  CB    . TYR F 3 517 ? 88.573  -60.267 -40.305 1.00 40.66  ? 494  TYR B CB    1 
ATOM   8797 C  CG    . TYR F 3 517 ? 88.233  -59.010 -39.539 1.00 40.00  ? 494  TYR B CG    1 
ATOM   8798 C  CD1   . TYR F 3 517 ? 89.110  -58.486 -38.593 1.00 38.91  ? 494  TYR B CD1   1 
ATOM   8799 C  CD2   . TYR F 3 517 ? 87.032  -58.343 -39.762 1.00 39.60  ? 494  TYR B CD2   1 
ATOM   8800 C  CE1   . TYR F 3 517 ? 88.798  -57.327 -37.889 1.00 38.86  ? 494  TYR B CE1   1 
ATOM   8801 C  CE2   . TYR F 3 517 ? 86.711  -57.187 -39.061 1.00 39.63  ? 494  TYR B CE2   1 
ATOM   8802 C  CZ    . TYR F 3 517 ? 87.595  -56.686 -38.127 1.00 38.90  ? 494  TYR B CZ    1 
ATOM   8803 O  OH    . TYR F 3 517 ? 87.264  -55.553 -37.421 1.00 38.33  ? 494  TYR B OH    1 
ATOM   8804 N  N     . PRO F 3 518 ? 87.568  -63.043 -41.481 1.00 39.08  ? 495  PRO B N     1 
ATOM   8805 C  CA    . PRO F 3 518 ? 86.275  -62.375 -41.689 1.00 38.53  ? 495  PRO B CA    1 
ATOM   8806 C  C     . PRO F 3 518 ? 85.234  -62.778 -40.645 1.00 37.62  ? 495  PRO B C     1 
ATOM   8807 O  O     . PRO F 3 518 ? 85.224  -63.917 -40.178 1.00 37.36  ? 495  PRO B O     1 
ATOM   8808 C  CB    . PRO F 3 518 ? 85.868  -62.831 -43.091 1.00 37.58  ? 495  PRO B CB    1 
ATOM   8809 C  CG    . PRO F 3 518 ? 87.177  -63.110 -43.754 1.00 37.71  ? 495  PRO B CG    1 
ATOM   8810 C  CD    . PRO F 3 518 ? 87.928  -63.833 -42.669 1.00 37.81  ? 495  PRO B CD    1 
ATOM   8811 N  N     . LEU F 3 519 ? 84.358  -61.843 -40.285 1.00 36.77  ? 496  LEU B N     1 
ATOM   8812 C  CA    . LEU F 3 519 ? 83.311  -62.121 -39.306 1.00 35.26  ? 496  LEU B CA    1 
ATOM   8813 C  C     . LEU F 3 519 ? 82.220  -62.974 -39.943 1.00 35.69  ? 496  LEU B C     1 
ATOM   8814 O  O     . LEU F 3 519 ? 81.945  -62.855 -41.138 1.00 35.94  ? 496  LEU B O     1 
ATOM   8815 C  CB    . LEU F 3 519 ? 82.693  -60.820 -38.789 1.00 32.17  ? 496  LEU B CB    1 
ATOM   8816 C  CG    . LEU F 3 519 ? 83.562  -59.876 -37.962 1.00 29.41  ? 496  LEU B CG    1 
ATOM   8817 C  CD1   . LEU F 3 519 ? 82.718  -58.696 -37.515 1.00 29.02  ? 496  LEU B CD1   1 
ATOM   8818 C  CD2   . LEU F 3 519 ? 84.126  -60.604 -36.759 1.00 28.68  ? 496  LEU B CD2   1 
ATOM   8819 N  N     . THR F 3 520 ? 81.597  -63.831 -39.141 1.00 35.27  ? 497  THR B N     1 
ATOM   8820 C  CA    . THR F 3 520 ? 80.539  -64.703 -39.633 1.00 36.40  ? 497  THR B CA    1 
ATOM   8821 C  C     . THR F 3 520 ? 79.163  -64.161 -39.259 1.00 37.03  ? 497  THR B C     1 
ATOM   8822 O  O     . THR F 3 520 ? 78.166  -64.469 -39.913 1.00 37.31  ? 497  THR B O     1 
ATOM   8823 C  CB    . THR F 3 520 ? 80.664  -66.125 -39.047 1.00 36.94  ? 497  THR B CB    1 
ATOM   8824 O  OG1   . THR F 3 520 ? 80.497  -66.071 -37.626 1.00 38.41  ? 497  THR B OG1   1 
ATOM   8825 C  CG2   . THR F 3 520 ? 82.021  -66.720 -39.365 1.00 36.76  ? 497  THR B CG2   1 
ATOM   8826 N  N     . LYS F 3 521 ? 79.115  -63.347 -38.210 1.00 37.04  ? 498  LYS B N     1 
ATOM   8827 C  CA    . LYS F 3 521 ? 77.853  -62.793 -37.745 1.00 35.87  ? 498  LYS B CA    1 
ATOM   8828 C  C     . LYS F 3 521 ? 78.060  -61.441 -37.072 1.00 34.90  ? 498  LYS B C     1 
ATOM   8829 O  O     . LYS F 3 521 ? 78.978  -61.266 -36.274 1.00 33.89  ? 498  LYS B O     1 
ATOM   8830 C  CB    . LYS F 3 521 ? 77.221  -63.770 -36.756 1.00 37.17  ? 498  LYS B CB    1 
ATOM   8831 C  CG    . LYS F 3 521 ? 75.709  -63.809 -36.761 1.00 40.29  ? 498  LYS B CG    1 
ATOM   8832 C  CD    . LYS F 3 521 ? 75.240  -64.979 -35.916 1.00 42.39  ? 498  LYS B CD    1 
ATOM   8833 C  CE    . LYS F 3 521 ? 73.788  -65.322 -36.166 1.00 44.28  ? 498  LYS B CE    1 
ATOM   8834 N  NZ    . LYS F 3 521 ? 73.445  -66.626 -35.526 1.00 47.16  ? 498  LYS B NZ    1 
ATOM   8835 N  N     . LEU F 3 522 ? 77.192  -60.491 -37.399 1.00 34.35  ? 499  LEU B N     1 
ATOM   8836 C  CA    . LEU F 3 522 ? 77.256  -59.148 -36.836 1.00 33.34  ? 499  LEU B CA    1 
ATOM   8837 C  C     . LEU F 3 522 ? 75.834  -58.677 -36.550 1.00 34.13  ? 499  LEU B C     1 
ATOM   8838 O  O     . LEU F 3 522 ? 74.919  -58.964 -37.323 1.00 34.88  ? 499  LEU B O     1 
ATOM   8839 C  CB    . LEU F 3 522 ? 77.927  -58.200 -37.829 1.00 31.44  ? 499  LEU B CB    1 
ATOM   8840 C  CG    . LEU F 3 522 ? 78.122  -56.746 -37.405 1.00 29.86  ? 499  LEU B CG    1 
ATOM   8841 C  CD1   . LEU F 3 522 ? 79.037  -56.664 -36.197 1.00 27.10  ? 499  LEU B CD1   1 
ATOM   8842 C  CD2   . LEU F 3 522 ? 78.708  -55.974 -38.569 1.00 29.90  ? 499  LEU B CD2   1 
ATOM   8843 N  N     . SER F 3 523 ? 75.643  -57.955 -35.450 1.00 34.36  ? 500  SER B N     1 
ATOM   8844 C  CA    . SER F 3 523 ? 74.307  -57.482 -35.104 1.00 33.78  ? 500  SER B CA    1 
ATOM   8845 C  C     . SER F 3 523 ? 74.304  -56.310 -34.143 1.00 34.21  ? 500  SER B C     1 
ATOM   8846 O  O     . SER F 3 523 ? 75.191  -56.177 -33.302 1.00 34.67  ? 500  SER B O     1 
ATOM   8847 C  CB    . SER F 3 523 ? 73.496  -58.608 -34.471 1.00 34.30  ? 500  SER B CB    1 
ATOM   8848 O  OG    . SER F 3 523 ? 73.913  -58.822 -33.133 1.00 33.90  ? 500  SER B OG    1 
ATOM   8849 N  N     . MET F 3 524 ? 73.282  -55.472 -34.272 1.00 35.24  ? 501  MET B N     1 
ATOM   8850 C  CA    . MET F 3 524 ? 73.101  -54.308 -33.413 1.00 35.36  ? 501  MET B CA    1 
ATOM   8851 C  C     . MET F 3 524 ? 71.714  -54.418 -32.790 1.00 34.82  ? 501  MET B C     1 
ATOM   8852 O  O     . MET F 3 524 ? 70.711  -54.469 -33.504 1.00 35.10  ? 501  MET B O     1 
ATOM   8853 C  CB    . MET F 3 524 ? 73.201  -53.016 -34.229 1.00 36.87  ? 501  MET B CB    1 
ATOM   8854 C  CG    . MET F 3 524 ? 72.921  -51.756 -33.424 1.00 38.71  ? 501  MET B CG    1 
ATOM   8855 S  SD    . MET F 3 524 ? 73.097  -50.249 -34.390 1.00 41.14  ? 501  MET B SD    1 
ATOM   8856 C  CE    . MET F 3 524 ? 74.742  -49.770 -33.959 1.00 39.35  ? 501  MET B CE    1 
ATOM   8857 N  N     . THR F 3 525 ? 71.660  -54.463 -31.463 1.00 33.38  ? 502  THR B N     1 
ATOM   8858 C  CA    . THR F 3 525 ? 70.388  -54.579 -30.761 1.00 32.76  ? 502  THR B CA    1 
ATOM   8859 C  C     . THR F 3 525 ? 70.183  -53.474 -29.730 1.00 32.54  ? 502  THR B C     1 
ATOM   8860 O  O     . THR F 3 525 ? 70.945  -53.361 -28.770 1.00 33.45  ? 502  THR B O     1 
ATOM   8861 C  CB    . THR F 3 525 ? 70.280  -55.935 -30.046 1.00 31.75  ? 502  THR B CB    1 
ATOM   8862 O  OG1   . THR F 3 525 ? 70.502  -56.989 -30.991 1.00 32.37  ? 502  THR B OG1   1 
ATOM   8863 C  CG2   . THR F 3 525 ? 68.903  -56.103 -29.432 1.00 30.00  ? 502  THR B CG2   1 
ATOM   8864 N  N     . ILE F 3 526 ? 69.147  -52.664 -29.932 1.00 31.67  ? 503  ILE B N     1 
ATOM   8865 C  CA    . ILE F 3 526 ? 68.839  -51.573 -29.013 1.00 32.34  ? 503  ILE B CA    1 
ATOM   8866 C  C     . ILE F 3 526 ? 67.704  -51.957 -28.064 1.00 33.56  ? 503  ILE B C     1 
ATOM   8867 O  O     . ILE F 3 526 ? 66.750  -52.619 -28.462 1.00 33.55  ? 503  ILE B O     1 
ATOM   8868 C  CB    . ILE F 3 526 ? 68.454  -50.284 -29.784 1.00 30.24  ? 503  ILE B CB    1 
ATOM   8869 C  CG1   . ILE F 3 526 ? 67.259  -50.549 -30.703 1.00 28.66  ? 503  ILE B CG1   1 
ATOM   8870 C  CG2   . ILE F 3 526 ? 69.650  -49.785 -30.583 1.00 28.99  ? 503  ILE B CG2   1 
ATOM   8871 C  CD1   . ILE F 3 526 ? 66.819  -49.342 -31.508 1.00 25.08  ? 503  ILE B CD1   1 
ATOM   8872 N  N     . THR F 3 527 ? 67.819  -51.550 -26.803 1.00 36.67  ? 504  THR B N     1 
ATOM   8873 C  CA    . THR F 3 527 ? 66.805  -51.861 -25.797 1.00 40.64  ? 504  THR B CA    1 
ATOM   8874 C  C     . THR F 3 527 ? 66.632  -50.721 -24.796 1.00 42.13  ? 504  THR B C     1 
ATOM   8875 O  O     . THR F 3 527 ? 67.273  -49.677 -24.912 1.00 41.57  ? 504  THR B O     1 
ATOM   8876 C  CB    . THR F 3 527 ? 67.169  -53.135 -25.005 1.00 41.11  ? 504  THR B CB    1 
ATOM   8877 O  OG1   . THR F 3 527 ? 68.354  -52.897 -24.236 1.00 42.82  ? 504  THR B OG1   1 
ATOM   8878 C  CG2   . THR F 3 527 ? 67.414  -54.301 -25.947 1.00 41.67  ? 504  THR B CG2   1 
ATOM   8879 N  N     . ASN F 3 528 ? 65.770  -50.937 -23.807 1.00 45.17  ? 505  ASN B N     1 
ATOM   8880 C  CA    . ASN F 3 528 ? 65.499  -49.932 -22.781 1.00 48.90  ? 505  ASN B CA    1 
ATOM   8881 C  C     . ASN F 3 528 ? 64.985  -48.649 -23.422 1.00 49.86  ? 505  ASN B C     1 
ATOM   8882 O  O     . ASN F 3 528 ? 65.679  -47.632 -23.448 1.00 50.88  ? 505  ASN B O     1 
ATOM   8883 C  CB    . ASN F 3 528 ? 66.765  -49.631 -21.969 1.00 50.05  ? 505  ASN B CB    1 
ATOM   8884 C  CG    . ASN F 3 528 ? 67.329  -50.864 -21.288 1.00 51.69  ? 505  ASN B CG    1 
ATOM   8885 O  OD1   . ASN F 3 528 ? 66.614  -51.587 -20.591 1.00 52.49  ? 505  ASN B OD1   1 
ATOM   8886 N  ND2   . ASN F 3 528 ? 68.620  -51.109 -21.484 1.00 52.42  ? 505  ASN B ND2   1 
ATOM   8887 N  N     . PHE F 3 529 ? 63.763  -48.709 -23.937 1.00 50.49  ? 506  PHE B N     1 
ATOM   8888 C  CA    . PHE F 3 529 ? 63.143  -47.564 -24.590 1.00 51.53  ? 506  PHE B CA    1 
ATOM   8889 C  C     . PHE F 3 529 ? 62.406  -46.679 -23.598 1.00 52.57  ? 506  PHE B C     1 
ATOM   8890 O  O     . PHE F 3 529 ? 62.058  -47.110 -22.501 1.00 52.55  ? 506  PHE B O     1 
ATOM   8891 C  CB    . PHE F 3 529 ? 62.146  -48.040 -25.642 1.00 52.18  ? 506  PHE B CB    1 
ATOM   8892 C  CG    . PHE F 3 529 ? 62.767  -48.795 -26.776 1.00 51.62  ? 506  PHE B CG    1 
ATOM   8893 C  CD1   . PHE F 3 529 ? 63.466  -48.127 -27.772 1.00 52.67  ? 506  PHE B CD1   1 
ATOM   8894 C  CD2   . PHE F 3 529 ? 62.629  -50.173 -26.864 1.00 51.25  ? 506  PHE B CD2   1 
ATOM   8895 C  CE1   . PHE F 3 529 ? 64.018  -48.826 -28.844 1.00 53.10  ? 506  PHE B CE1   1 
ATOM   8896 C  CE2   . PHE F 3 529 ? 63.176  -50.878 -27.929 1.00 51.99  ? 506  PHE B CE2   1 
ATOM   8897 C  CZ    . PHE F 3 529 ? 63.871  -50.203 -28.921 1.00 52.13  ? 506  PHE B CZ    1 
ATOM   8898 N  N     . ASP F 3 530 ? 62.161  -45.439 -24.005 1.00 54.40  ? 507  ASP B N     1 
ATOM   8899 C  CA    . ASP F 3 530 ? 61.444  -44.473 -23.184 1.00 57.14  ? 507  ASP B CA    1 
ATOM   8900 C  C     . ASP F 3 530 ? 60.495  -43.696 -24.081 1.00 58.15  ? 507  ASP B C     1 
ATOM   8901 O  O     . ASP F 3 530 ? 60.934  -42.955 -24.960 1.00 58.95  ? 507  ASP B O     1 
ATOM   8902 C  CB    . ASP F 3 530 ? 62.419  -43.505 -22.506 1.00 59.10  ? 507  ASP B CB    1 
ATOM   8903 C  CG    . ASP F 3 530 ? 62.659  -43.843 -21.044 1.00 61.08  ? 507  ASP B CG    1 
ATOM   8904 O  OD1   . ASP F 3 530 ? 61.670  -43.915 -20.283 1.00 62.17  ? 507  ASP B OD1   1 
ATOM   8905 O  OD2   . ASP F 3 530 ? 63.833  -44.031 -20.654 1.00 61.72  ? 507  ASP B OD2   1 
ATOM   8906 N  N     . ILE F 3 531 ? 59.195  -43.868 -23.864 1.00 59.29  ? 508  ILE B N     1 
ATOM   8907 C  CA    . ILE F 3 531 ? 58.193  -43.177 -24.669 1.00 60.38  ? 508  ILE B CA    1 
ATOM   8908 C  C     . ILE F 3 531 ? 57.820  -41.810 -24.089 1.00 61.03  ? 508  ILE B C     1 
ATOM   8909 O  O     . ILE F 3 531 ? 56.962  -41.701 -23.211 1.00 61.28  ? 508  ILE B O     1 
ATOM   8910 C  CB    . ILE F 3 531 ? 56.916  -44.043 -24.827 1.00 59.82  ? 508  ILE B CB    1 
ATOM   8911 C  CG1   . ILE F 3 531 ? 56.390  -44.467 -23.454 1.00 61.12  ? 508  ILE B CG1   1 
ATOM   8912 C  CG2   . ILE F 3 531 ? 57.227  -45.273 -25.668 1.00 57.61  ? 508  ILE B CG2   1 
ATOM   8913 C  CD1   . ILE F 3 531 ? 55.083  -45.234 -23.509 1.00 63.22  ? 508  ILE B CD1   1 
ATOM   8914 N  N     . ILE F 3 532 ? 58.472  -40.766 -24.593 1.00 61.32  ? 509  ILE B N     1 
ATOM   8915 C  CA    . ILE F 3 532 ? 58.225  -39.405 -24.131 1.00 62.33  ? 509  ILE B CA    1 
ATOM   8916 C  C     . ILE F 3 532 ? 56.919  -38.848 -24.697 1.00 62.43  ? 509  ILE B C     1 
ATOM   8917 O  O     . ILE F 3 532 ? 56.923  -37.959 -25.549 1.00 62.64  ? 509  ILE B O     1 
ATOM   8918 C  CB    . ILE F 3 532 ? 59.394  -38.473 -24.530 1.00 62.58  ? 509  ILE B CB    1 
ATOM   8919 C  CG1   . ILE F 3 532 ? 60.712  -39.057 -24.014 1.00 63.03  ? 509  ILE B CG1   1 
ATOM   8920 C  CG2   . ILE F 3 532 ? 59.179  -37.079 -23.950 1.00 62.16  ? 509  ILE B CG2   1 
ATOM   8921 C  CD1   . ILE F 3 532 ? 61.937  -38.239 -24.371 1.00 64.83  ? 509  ILE B CD1   1 
HETATM 8922 PT PT1   . CPT G 4 .   ? 19.381  -19.261 -1.405  1.00 42.13  ? 45   CPT U PT1   1 
HETATM 8923 N  N1    . CPT G 4 .   ? 20.965  -18.107 -1.085  1.00 38.75  ? 45   CPT U N1    1 
HETATM 8924 N  N2    . CPT G 4 .   ? 20.564  -20.848 -1.501  1.00 39.39  ? 45   CPT U N2    1 
HETATM 8925 PT PT1   . CPT H 4 .   ? 54.433  -71.578 -45.012 1.00 50.01  ? 45   CPT T PT1   1 
HETATM 8926 N  N1    . CPT H 4 .   ? 52.678  -71.126 -44.174 1.00 55.09  ? 45   CPT T N1    1 
HETATM 8927 N  N2    . CPT H 4 .   ? 55.335  -70.267 -43.835 1.00 57.14  ? 45   CPT T N2    1 
HETATM 8928 CA CA    . CA  I 5 .   ? 25.813  -21.635 -15.359 1.00 91.37  ? 1501 CA  A CA    1 
HETATM 8929 CA CA    . CA  J 5 .   ? 21.838  -22.723 -17.306 1.00 21.24  ? 1502 CA  A CA    1 
HETATM 8930 N  N1    . DCP K 6 .   ? 19.184  -23.299 -10.008 1.00 32.84  ? 2001 DCP A N1    1 
HETATM 8931 C  C2    . DCP K 6 .   ? 18.646  -23.264 -8.720  1.00 30.50  ? 2001 DCP A C2    1 
HETATM 8932 N  N3    . DCP K 6 .   ? 19.198  -22.530 -7.712  1.00 31.22  ? 2001 DCP A N3    1 
HETATM 8933 C  C4    . DCP K 6 .   ? 20.355  -21.752 -7.908  1.00 32.24  ? 2001 DCP A C4    1 
HETATM 8934 C  C5    . DCP K 6 .   ? 21.000  -21.693 -9.147  1.00 32.85  ? 2001 DCP A C5    1 
HETATM 8935 C  C6    . DCP K 6 .   ? 20.335  -22.535 -10.229 1.00 33.55  ? 2001 DCP A C6    1 
HETATM 8936 O  O2    . DCP K 6 .   ? 17.619  -23.909 -8.411  1.00 29.01  ? 2001 DCP A O2    1 
HETATM 8937 N  N4    . DCP K 6 .   ? 20.824  -21.062 -6.855  1.00 36.05  ? 2001 DCP A N4    1 
HETATM 8938 C  "C1'" . DCP K 6 .   ? 18.560  -24.111 -11.110 1.00 33.18  ? 2001 DCP A "C1'" 1 
HETATM 8939 C  "C2'" . DCP K 6 .   ? 17.847  -23.207 -12.097 1.00 33.38  ? 2001 DCP A "C2'" 1 
HETATM 8940 C  "C3'" . DCP K 6 .   ? 18.267  -23.713 -13.459 1.00 34.12  ? 2001 DCP A "C3'" 1 
HETATM 8941 C  "C4'" . DCP K 6 .   ? 19.370  -24.766 -13.260 1.00 34.73  ? 2001 DCP A "C4'" 1 
HETATM 8942 O  "O4'" . DCP K 6 .   ? 19.570  -24.788 -11.823 1.00 32.67  ? 2001 DCP A "O4'" 1 
HETATM 8943 O  "O3'" . DCP K 6 .   ? 17.249  -24.365 -14.176 1.00 38.48  ? 2001 DCP A "O3'" 1 
HETATM 8944 C  "C5'" . DCP K 6 .   ? 20.404  -24.133 -14.105 1.00 34.44  ? 2001 DCP A "C5'" 1 
HETATM 8945 O  "O5'" . DCP K 6 .   ? 21.496  -23.555 -13.445 1.00 33.58  ? 2001 DCP A "O5'" 1 
HETATM 8946 P  PA    . DCP K 6 .   ? 21.915  -22.020 -13.955 1.00 34.04  ? 2001 DCP A PA    1 
HETATM 8947 O  O1A   . DCP K 6 .   ? 22.727  -22.207 -15.246 1.00 35.01  ? 2001 DCP A O1A   1 
HETATM 8948 O  O2A   . DCP K 6 .   ? 22.747  -21.375 -12.821 1.00 33.74  ? 2001 DCP A O2A   1 
HETATM 8949 O  O3A   . DCP K 6 .   ? 20.422  -21.288 -14.100 1.00 34.77  ? 2001 DCP A O3A   1 
HETATM 8950 P  PB    . DCP K 6 .   ? 19.663  -20.734 -15.459 1.00 35.34  ? 2001 DCP A PB    1 
HETATM 8951 O  O1B   . DCP K 6 .   ? 18.341  -20.295 -14.802 1.00 39.12  ? 2001 DCP A O1B   1 
HETATM 8952 O  O2B   . DCP K 6 .   ? 19.435  -21.884 -16.475 1.00 35.16  ? 2001 DCP A O2B   1 
HETATM 8953 O  O3B   . DCP K 6 .   ? 20.283  -19.335 -16.174 1.00 36.02  ? 2001 DCP A O3B   1 
HETATM 8954 P  PG    . DCP K 6 .   ? 21.639  -19.249 -17.137 1.00 35.37  ? 2001 DCP A PG    1 
HETATM 8955 O  O1G   . DCP K 6 .   ? 22.847  -19.699 -16.246 1.00 40.38  ? 2001 DCP A O1G   1 
HETATM 8956 O  O2G   . DCP K 6 .   ? 21.749  -17.755 -17.555 1.00 37.94  ? 2001 DCP A O2G   1 
HETATM 8957 O  O3G   . DCP K 6 .   ? 21.399  -20.213 -18.320 1.00 38.20  ? 2001 DCP A O3G   1 
HETATM 8958 CA CA    . CA  L 5 .   ? 47.352  -61.472 -43.213 1.00 39.44  ? 1701 CA  B CA    1 
HETATM 8959 CA CA    . CA  M 5 .   ? 46.808  -60.708 -46.484 1.00 21.32  ? 1702 CA  B CA    1 
HETATM 8960 N  N1    . DCP N 6 .   ? 54.446  -62.935 -46.369 1.00 48.01  ? 3001 DCP B N1    1 
HETATM 8961 C  C2    . DCP N 6 .   ? 55.828  -63.148 -46.433 1.00 47.59  ? 3001 DCP B C2    1 
HETATM 8962 N  N3    . DCP N 6 .   ? 56.401  -64.368 -46.223 1.00 48.80  ? 3001 DCP B N3    1 
HETATM 8963 C  C4    . DCP N 6 .   ? 55.632  -65.506 -45.930 1.00 48.84  ? 3001 DCP B C4    1 
HETATM 8964 C  C5    . DCP N 6 .   ? 54.233  -65.446 -45.829 1.00 48.20  ? 3001 DCP B C5    1 
HETATM 8965 C  C6    . DCP N 6 .   ? 53.649  -64.054 -46.074 1.00 48.00  ? 3001 DCP B C6    1 
HETATM 8966 O  O2    . DCP N 6 .   ? 56.632  -62.224 -46.687 1.00 47.60  ? 3001 DCP B O2    1 
HETATM 8967 N  N4    . DCP N 6 .   ? 56.295  -66.659 -45.746 1.00 50.86  ? 3001 DCP B N4    1 
HETATM 8968 C  "C1'" . DCP N 6 .   ? 53.854  -61.569 -46.619 1.00 47.70  ? 3001 DCP B "C1'" 1 
HETATM 8969 C  "C2'" . DCP N 6 .   ? 52.968  -61.574 -47.853 1.00 47.20  ? 3001 DCP B "C2'" 1 
HETATM 8970 C  "C3'" . DCP N 6 .   ? 52.003  -60.438 -47.575 1.00 46.48  ? 3001 DCP B "C3'" 1 
HETATM 8971 C  "C4'" . DCP N 6 .   ? 52.050  -60.169 -46.054 1.00 46.24  ? 3001 DCP B "C4'" 1 
HETATM 8972 O  "O4'" . DCP N 6 .   ? 52.996  -61.175 -45.574 1.00 47.18  ? 3001 DCP B "O4'" 1 
HETATM 8973 O  "O3'" . DCP N 6 .   ? 52.360  -59.222 -48.178 1.00 49.26  ? 3001 DCP B "O3'" 1 
HETATM 8974 C  "C5'" . DCP N 6 .   ? 50.606  -60.362 -45.747 1.00 42.68  ? 3001 DCP B "C5'" 1 
HETATM 8975 O  "O5'" . DCP N 6 .   ? 50.306  -61.524 -45.033 1.00 38.76  ? 3001 DCP B "O5'" 1 
HETATM 8976 P  PA    . DCP N 6 .   ? 49.454  -62.742 -45.799 1.00 39.11  ? 3001 DCP B PA    1 
HETATM 8977 O  O1A   . DCP N 6 .   ? 47.966  -62.548 -45.454 1.00 41.20  ? 3001 DCP B O1A   1 
HETATM 8978 O  O2A   . DCP N 6 .   ? 50.010  -64.071 -45.236 1.00 40.94  ? 3001 DCP B O2A   1 
HETATM 8979 O  O3A   . DCP N 6 .   ? 49.849  -62.600 -47.415 1.00 37.70  ? 3001 DCP B O3A   1 
HETATM 8980 P  PB    . DCP N 6 .   ? 48.814  -62.265 -48.646 1.00 33.39  ? 3001 DCP B PB    1 
HETATM 8981 O  O1B   . DCP N 6 .   ? 49.772  -62.257 -49.848 1.00 34.59  ? 3001 DCP B O1B   1 
HETATM 8982 O  O2B   . DCP N 6 .   ? 48.174  -60.872 -48.472 1.00 34.19  ? 3001 DCP B O2B   1 
HETATM 8983 O  O3B   . DCP N 6 .   ? 47.697  -63.489 -48.881 1.00 32.67  ? 3001 DCP B O3B   1 
HETATM 8984 P  PG    . DCP N 6 .   ? 46.053  -63.231 -49.002 1.00 32.70  ? 3001 DCP B PG    1 
HETATM 8985 O  O1G   . DCP N 6 .   ? 45.565  -62.584 -47.657 1.00 33.30  ? 3001 DCP B O1G   1 
HETATM 8986 O  O2G   . DCP N 6 .   ? 45.454  -64.644 -49.240 1.00 35.21  ? 3001 DCP B O2G   1 
HETATM 8987 O  O3G   . DCP N 6 .   ? 45.862  -62.270 -50.194 1.00 33.67  ? 3001 DCP B O3G   1 
HETATM 8988 O  O     . HOH O 7 .   ? 26.419  -25.716 1.807   1.00 34.75  ? 14   HOH Q O     1 
HETATM 8989 O  O     . HOH O 7 .   ? 37.855  -22.905 -1.239  1.00 25.27  ? 15   HOH Q O     1 
HETATM 8990 O  O     . HOH O 7 .   ? 31.332  -32.730 13.408  1.00 37.00  ? 16   HOH Q O     1 
HETATM 8991 O  O     . HOH O 7 .   ? 27.687  -34.365 5.923   1.00 42.97  ? 17   HOH Q O     1 
HETATM 8992 O  O     . HOH P 7 .   ? 38.184  -24.212 18.159  1.00 36.06  ? 46   HOH U O     1 
HETATM 8993 O  O     . HOH P 7 .   ? 19.104  -30.883 0.354   1.00 36.92  ? 47   HOH U O     1 
HETATM 8994 O  O     . HOH P 7 .   ? 21.152  -12.927 0.116   1.00 23.22  ? 48   HOH U O     1 
HETATM 8995 O  O     . HOH Q 7 .   ? 59.863  -76.129 -32.651 1.00 42.25  ? 14   HOH P O     1 
HETATM 8996 O  O     . HOH Q 7 .   ? 57.707  -74.569 -30.841 1.00 28.13  ? 15   HOH P O     1 
HETATM 8997 O  O     . HOH R 7 .   ? 68.369  -65.980 -42.121 1.00 37.50  ? 46   HOH T O     1 
HETATM 8998 O  O     . HOH R 7 .   ? 48.708  -73.911 -46.828 1.00 35.66  ? 47   HOH T O     1 
HETATM 8999 O  O     . HOH S 7 .   ? 49.038  -16.901 -34.434 1.00 14.71  ? 2002 HOH A O     1 
HETATM 9000 O  O     . HOH S 7 .   ? -0.612  -43.349 1.188   1.00 15.55  ? 2003 HOH A O     1 
HETATM 9001 O  O     . HOH S 7 .   ? 27.058  -20.884 -17.610 1.00 61.34  ? 2004 HOH A O     1 
HETATM 9002 O  O     . HOH S 7 .   ? 30.550  -36.872 -16.956 1.00 50.95  ? 2005 HOH A O     1 
HETATM 9003 O  O     . HOH S 7 .   ? 48.882  -8.769  2.165   1.00 47.83  ? 2006 HOH A O     1 
HETATM 9004 O  O     . HOH S 7 .   ? 0.515   -12.472 -15.186 1.00 15.92  ? 2007 HOH A O     1 
HETATM 9005 O  O     . HOH S 7 .   ? 36.830  -39.592 -15.146 1.00 31.27  ? 2008 HOH A O     1 
HETATM 9006 O  O     . HOH S 7 .   ? 28.656  -24.586 -56.262 1.00 44.75  ? 2009 HOH A O     1 
HETATM 9007 O  O     . HOH S 7 .   ? 14.901  -46.018 -16.458 1.00 22.42  ? 2010 HOH A O     1 
HETATM 9008 O  O     . HOH S 7 .   ? 28.397  -16.982 -25.269 1.00 24.47  ? 2011 HOH A O     1 
HETATM 9009 O  O     . HOH S 7 .   ? 13.720  -15.949 -2.973  1.00 24.87  ? 2012 HOH A O     1 
HETATM 9010 O  O     . HOH S 7 .   ? 32.947  -20.941 -44.860 1.00 34.31  ? 2013 HOH A O     1 
HETATM 9011 O  O     . HOH S 7 .   ? 30.932  -16.152 -16.444 1.00 44.17  ? 2014 HOH A O     1 
HETATM 9012 O  O     . HOH S 7 .   ? 11.367  -39.983 -15.139 1.00 40.51  ? 2015 HOH A O     1 
HETATM 9013 O  O     . HOH S 7 .   ? 9.797   -19.343 -1.014  1.00 2.52   ? 2016 HOH A O     1 
HETATM 9014 O  O     . HOH S 7 .   ? 10.225  -24.452 6.659   1.00 8.30   ? 2017 HOH A O     1 
HETATM 9015 O  O     . HOH S 7 .   ? 28.440  -47.120 -2.762  1.00 26.07  ? 2018 HOH A O     1 
HETATM 9016 O  O     . HOH S 7 .   ? 8.843   -29.452 -11.385 1.00 18.22  ? 2019 HOH A O     1 
HETATM 9017 O  O     . HOH S 7 .   ? 18.749  -13.705 -12.481 1.00 22.55  ? 2020 HOH A O     1 
HETATM 9018 O  O     . HOH S 7 .   ? 44.594  -26.920 -54.571 1.00 25.82  ? 2021 HOH A O     1 
HETATM 9019 O  O     . HOH S 7 .   ? 11.725  -41.381 25.808  1.00 29.46  ? 2022 HOH A O     1 
HETATM 9020 O  O     . HOH S 7 .   ? 0.190   -7.197  -11.145 1.00 36.84  ? 2023 HOH A O     1 
HETATM 9021 O  O     . HOH S 7 .   ? 8.747   -30.473 23.942  1.00 11.20  ? 2024 HOH A O     1 
HETATM 9022 O  O     . HOH S 7 .   ? 23.719  -11.189 -21.657 1.00 27.16  ? 2025 HOH A O     1 
HETATM 9023 O  O     . HOH S 7 .   ? 22.980  -41.760 -26.772 1.00 24.69  ? 2026 HOH A O     1 
HETATM 9024 O  O     . HOH S 7 .   ? 43.400  -7.357  5.233   1.00 49.10  ? 2027 HOH A O     1 
HETATM 9025 O  O     . HOH S 7 .   ? 22.805  -19.357 -30.857 1.00 34.00  ? 2028 HOH A O     1 
HETATM 9026 O  O     . HOH S 7 .   ? 60.302  -18.487 -38.060 1.00 37.70  ? 2029 HOH A O     1 
HETATM 9027 O  O     . HOH S 7 .   ? 49.904  -21.889 -40.643 1.00 22.64  ? 2030 HOH A O     1 
HETATM 9028 O  O     . HOH S 7 .   ? 56.176  -23.224 -44.557 1.00 44.53  ? 2031 HOH A O     1 
HETATM 9029 O  O     . HOH S 7 .   ? 24.191  -34.061 -13.122 1.00 17.29  ? 2032 HOH A O     1 
HETATM 9030 O  O     . HOH S 7 .   ? 47.169  -18.450 -34.457 1.00 34.49  ? 2033 HOH A O     1 
HETATM 9031 O  O     . HOH S 7 .   ? 1.633   -23.376 -11.621 1.00 34.51  ? 2034 HOH A O     1 
HETATM 9032 O  O     . HOH S 7 .   ? -0.513  -42.767 4.250   1.00 24.89  ? 2035 HOH A O     1 
HETATM 9033 O  O     . HOH S 7 .   ? 17.635  -34.906 9.027   1.00 35.52  ? 2036 HOH A O     1 
HETATM 9034 O  O     . HOH S 7 .   ? 13.948  -37.968 -11.046 1.00 29.73  ? 2037 HOH A O     1 
HETATM 9035 O  O     . HOH S 7 .   ? 35.690  -42.172 -3.167  1.00 37.47  ? 2038 HOH A O     1 
HETATM 9036 O  O     . HOH S 7 .   ? 1.227   -35.868 -5.313  1.00 31.63  ? 2039 HOH A O     1 
HETATM 9037 O  O     . HOH S 7 .   ? 14.714  -30.152 24.656  1.00 32.71  ? 2040 HOH A O     1 
HETATM 9038 O  O     . HOH S 7 .   ? 47.837  -33.053 -55.659 1.00 35.98  ? 2041 HOH A O     1 
HETATM 9039 O  O     . HOH S 7 .   ? 6.214   -31.137 11.891  1.00 30.21  ? 2042 HOH A O     1 
HETATM 9040 O  O     . HOH S 7 .   ? 37.626  -20.510 -15.358 1.00 48.30  ? 2043 HOH A O     1 
HETATM 9041 O  O     . HOH S 7 .   ? 13.539  -53.873 -9.787  1.00 29.79  ? 2044 HOH A O     1 
HETATM 9042 O  O     . HOH S 7 .   ? 40.331  -8.448  -15.205 1.00 41.29  ? 2045 HOH A O     1 
HETATM 9043 O  O     . HOH S 7 .   ? 5.146   -40.350 25.016  1.00 47.62  ? 2046 HOH A O     1 
HETATM 9044 O  O     . HOH S 7 .   ? 2.994   -7.277  -20.733 1.00 43.21  ? 2047 HOH A O     1 
HETATM 9045 O  O     . HOH S 7 .   ? 42.443  -20.706 -32.015 1.00 11.41  ? 2048 HOH A O     1 
HETATM 9046 O  O     . HOH S 7 .   ? 0.742   -11.389 -5.448  1.00 36.09  ? 2049 HOH A O     1 
HETATM 9047 O  O     . HOH S 7 .   ? 27.170  -22.131 -55.841 1.00 35.67  ? 2050 HOH A O     1 
HETATM 9048 O  O     . HOH T 7 .   ? 16.884  -64.998 -34.149 1.00 9.05   ? 3002 HOH B O     1 
HETATM 9049 O  O     . HOH T 7 .   ? 45.590  -88.437 -26.917 1.00 33.56  ? 3003 HOH B O     1 
HETATM 9050 O  O     . HOH T 7 .   ? 37.643  -80.254 -43.907 1.00 19.33  ? 3004 HOH B O     1 
HETATM 9051 O  O     . HOH T 7 .   ? 73.392  -57.960 -30.159 1.00 16.54  ? 3005 HOH B O     1 
HETATM 9052 O  O     . HOH T 7 .   ? 33.216  -79.326 -37.375 1.00 4.01   ? 3006 HOH B O     1 
HETATM 9053 O  O     . HOH T 7 .   ? 54.095  -41.542 -49.574 1.00 36.88  ? 3007 HOH B O     1 
HETATM 9054 O  O     . HOH T 7 .   ? 79.240  -45.571 -46.485 1.00 26.45  ? 3008 HOH B O     1 
HETATM 9055 O  O     . HOH T 7 .   ? 24.749  -69.206 -48.554 1.00 12.14  ? 3009 HOH B O     1 
HETATM 9056 O  O     . HOH T 7 .   ? 58.717  -40.522 -37.797 1.00 19.10  ? 3010 HOH B O     1 
HETATM 9057 O  O     . HOH T 7 .   ? 51.729  -54.508 -36.823 1.00 17.27  ? 3011 HOH B O     1 
HETATM 9058 O  O     . HOH T 7 .   ? 73.251  -63.801 -54.161 1.00 19.37  ? 3012 HOH B O     1 
HETATM 9059 O  O     . HOH T 7 .   ? 44.226  -52.498 -24.893 1.00 44.28  ? 3013 HOH B O     1 
HETATM 9060 O  O     . HOH T 7 .   ? 17.517  -65.915 -38.805 1.00 7.23   ? 3014 HOH B O     1 
HETATM 9061 O  O     . HOH T 7 .   ? 7.519   -57.563 -45.187 1.00 29.06  ? 3015 HOH B O     1 
HETATM 9062 O  O     . HOH T 7 .   ? 51.315  -58.854 -35.497 1.00 23.49  ? 3016 HOH B O     1 
HETATM 9063 O  O     . HOH T 7 .   ? 28.815  -42.179 -35.498 1.00 12.48  ? 3017 HOH B O     1 
HETATM 9064 O  O     . HOH T 7 .   ? 19.229  -50.327 -47.411 1.00 31.39  ? 3018 HOH B O     1 
HETATM 9065 O  O     . HOH T 7 .   ? 11.356  -61.305 -33.829 1.00 28.80  ? 3019 HOH B O     1 
HETATM 9066 O  O     . HOH T 7 .   ? 50.342  -45.056 -51.958 1.00 12.78  ? 3020 HOH B O     1 
HETATM 9067 O  O     . HOH T 7 .   ? 46.894  -72.482 -22.243 1.00 32.84  ? 3021 HOH B O     1 
HETATM 9068 O  O     . HOH T 7 .   ? 41.236  -46.871 -32.135 1.00 17.08  ? 3022 HOH B O     1 
HETATM 9069 O  O     . HOH T 7 .   ? 68.206  -62.038 -68.858 1.00 24.36  ? 3023 HOH B O     1 
HETATM 9070 O  O     . HOH T 7 .   ? 32.777  -57.282 -21.387 1.00 39.64  ? 3024 HOH B O     1 
HETATM 9071 O  O     . HOH T 7 .   ? 37.595  -64.451 -30.740 1.00 27.64  ? 3025 HOH B O     1 
HETATM 9072 O  O     . HOH T 7 .   ? 22.492  -71.593 -42.952 1.00 7.54   ? 3026 HOH B O     1 
HETATM 9073 O  O     . HOH T 7 .   ? 46.069  -59.304 -57.317 1.00 41.50  ? 3027 HOH B O     1 
HETATM 9074 O  O     . HOH T 7 .   ? 36.409  -62.626 -55.146 1.00 38.64  ? 3028 HOH B O     1 
HETATM 9075 O  O     . HOH T 7 .   ? 26.254  -70.069 -30.995 1.00 8.92   ? 3029 HOH B O     1 
HETATM 9076 O  O     . HOH T 7 .   ? 55.326  -46.911 -49.668 1.00 47.35  ? 3030 HOH B O     1 
HETATM 9077 O  O     . HOH T 7 .   ? 44.903  -54.025 -57.217 1.00 23.65  ? 3031 HOH B O     1 
HETATM 9078 O  O     . HOH T 7 .   ? 45.370  -68.660 -49.059 1.00 26.90  ? 3032 HOH B O     1 
HETATM 9079 O  O     . HOH T 7 .   ? 35.179  -60.237 -30.196 1.00 36.32  ? 3033 HOH B O     1 
HETATM 9080 O  O     . HOH T 7 .   ? 22.711  -35.296 -42.311 1.00 56.56  ? 3034 HOH B O     1 
HETATM 9081 O  O     . HOH T 7 .   ? 71.963  -44.843 -40.132 1.00 26.51  ? 3035 HOH B O     1 
HETATM 9082 O  O     . HOH T 7 .   ? 50.165  -65.037 -51.774 1.00 28.94  ? 3036 HOH B O     1 
HETATM 9083 O  O     . HOH T 7 .   ? 59.382  -69.375 -52.777 1.00 34.53  ? 3037 HOH B O     1 
HETATM 9084 O  O     . HOH T 7 .   ? 32.200  -47.395 -33.910 1.00 31.62  ? 3038 HOH B O     1 
HETATM 9085 O  O     . HOH T 7 .   ? 37.516  -42.524 -44.139 1.00 47.68  ? 3039 HOH B O     1 
HETATM 9086 O  O     . HOH T 7 .   ? 49.948  -41.339 -51.271 1.00 18.22  ? 3040 HOH B O     1 
HETATM 9087 O  O     . HOH T 7 .   ? 38.975  -81.521 -46.536 1.00 40.15  ? 3041 HOH B O     1 
HETATM 9088 O  O     . HOH T 7 .   ? 57.905  -43.757 -20.857 1.00 36.14  ? 3042 HOH B O     1 
HETATM 9089 O  O     . HOH T 7 .   ? 84.286  -55.222 -49.064 1.00 45.10  ? 3043 HOH B O     1 
HETATM 9090 O  O     . HOH T 7 .   ? 10.776  -61.860 -37.749 1.00 44.61  ? 3044 HOH B O     1 
HETATM 9091 O  O     . HOH T 7 .   ? 74.356  -58.529 -71.665 1.00 47.85  ? 3045 HOH B O     1 
HETATM 9092 O  O     . HOH T 7 .   ? 16.267  -53.500 -13.299 1.00 51.44  ? 3046 HOH B O     1 
HETATM 9093 O  O     . HOH T 7 .   ? 25.370  -75.269 -27.117 1.00 3.14   ? 3047 HOH B O     1 
HETATM 9094 O  O     . HOH T 7 .   ? 19.932  -58.272 -47.941 1.00 13.10  ? 3048 HOH B O     1 
HETATM 9095 O  O     . HOH T 7 .   ? 39.415  -66.995 -35.419 1.00 42.33  ? 3049 HOH B O     1 
HETATM 9096 O  O     . HOH T 7 .   ? 38.548  -67.577 -51.757 1.00 41.13  ? 3050 HOH B O     1 
HETATM 9097 O  O     . HOH T 7 .   ? 29.131  -69.305 -49.138 1.00 25.55  ? 3051 HOH B O     1 
HETATM 9098 O  O     . HOH T 7 .   ? 60.787  -41.728 -45.855 1.00 39.85  ? 3052 HOH B O     1 
HETATM 9099 O  O     . HOH T 7 .   ? 22.892  -62.778 -26.355 1.00 31.06  ? 3053 HOH B O     1 
HETATM 9100 O  O     . HOH T 7 .   ? 66.570  -38.130 -23.744 1.00 47.89  ? 3054 HOH B O     1 
HETATM 9101 O  O     . HOH T 7 .   ? 55.298  -44.893 -40.917 1.00 30.93  ? 3055 HOH B O     1 
HETATM 9102 O  O     . HOH T 7 .   ? 47.589  -66.852 -49.171 1.00 36.95  ? 3056 HOH B O     1 
HETATM 9103 O  O     . HOH T 7 .   ? 32.843  -55.723 -51.094 1.00 29.47  ? 3057 HOH B O     1 
HETATM 9104 O  O     . HOH T 7 .   ? 66.585  -56.268 -66.807 1.00 40.67  ? 3058 HOH B O     1 
HETATM 9105 O  O     . HOH T 7 .   ? 70.353  -43.573 -56.851 1.00 54.73  ? 3059 HOH B O     1 
HETATM 9106 O  O     . HOH T 7 .   ? 36.424  -69.251 -16.094 1.00 23.90  ? 3060 HOH B O     1 
HETATM 9107 O  O     . HOH T 7 .   ? 63.918  -55.714 -58.673 1.00 22.62  ? 3061 HOH B O     1 
HETATM 9108 O  O     . HOH T 7 .   ? 74.886  -43.399 -41.682 1.00 35.54  ? 3062 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   5   5   DG  DG  Q . n 
A 1 2   DT  2   6   6   DT  DT  Q . n 
A 1 3   DG  3   7   7   DG  DG  Q . n 
A 1 4   DG  4   8   8   DG  DG  Q . n 
A 1 5   DA  5   9   9   DA  DA  Q . n 
A 1 6   DT  6   10  10  DT  DT  Q . n 
A 1 7   DG  7   11  11  DG  DG  Q . n 
A 1 8   DA  8   12  12  DA  DA  Q . n 
A 1 9   DG  9   13  13  DG  DG  Q . n 
B 2 1   DG  1   4   4   DG  DG  U . n 
B 2 2   DG  2   5   5   DG  DG  U . n 
B 2 3   DC  3   6   6   DC  DC  U . n 
B 2 4   DT  4   7   7   DT  DT  U . n 
B 2 5   DC  5   8   8   DC  DC  U . n 
B 2 6   DA  6   9   9   DA  DA  U . n 
B 2 7   DT  7   10  10  DT  DT  U . n 
B 2 8   DC  8   11  11  DC  DC  U . n 
B 2 9   DC  9   12  12  DC  DC  U . n 
B 2 10  DA  10  13  13  DA  DA  U . n 
B 2 11  DC  11  14  14  DC  DC  U . n 
C 1 1   DG  1   5   5   DG  DG  P . n 
C 1 2   DT  2   6   6   DT  DT  P . n 
C 1 3   DG  3   7   7   DG  DG  P . n 
C 1 4   DG  4   8   8   DG  DG  P . n 
C 1 5   DA  5   9   9   DA  DA  P . n 
C 1 6   DT  6   10  10  DT  DT  P . n 
C 1 7   DG  7   11  11  DG  DG  P . n 
C 1 8   DA  8   12  12  DA  DA  P . n 
C 1 9   DG  9   13  13  DG  DG  P . n 
D 2 1   DG  1   4   4   DG  DG  T . n 
D 2 2   DG  2   5   5   DG  DG  T . n 
D 2 3   DC  3   6   6   DC  DC  T . n 
D 2 4   DT  4   7   7   DT  DT  T . n 
D 2 5   DC  5   8   8   DC  DC  T . n 
D 2 6   DA  6   9   9   DA  DA  T . n 
D 2 7   DT  7   10  10  DT  DT  T . n 
D 2 8   DC  8   11  11  DC  DC  T . n 
D 2 9   DC  9   12  12  DC  DC  T . n 
D 2 10  DA  10  13  13  DA  DA  T . n 
D 2 11  DC  11  14  14  DC  DC  T . n 
E 3 1   MET 1   -22 ?   ?   ?   A . n 
E 3 2   ALA 2   -21 ?   ?   ?   A . n 
E 3 3   SER 3   -20 ?   ?   ?   A . n 
E 3 4   TRP 4   -19 ?   ?   ?   A . n 
E 3 5   SER 5   -18 ?   ?   ?   A . n 
E 3 6   HIS 6   -17 ?   ?   ?   A . n 
E 3 7   PRO 7   -16 ?   ?   ?   A . n 
E 3 8   GLN 8   -15 ?   ?   ?   A . n 
E 3 9   PHE 9   -14 ?   ?   ?   A . n 
E 3 10  GLU 10  -13 ?   ?   ?   A . n 
E 3 11  LYS 11  -12 ?   ?   ?   A . n 
E 3 12  GLY 12  -11 ?   ?   ?   A . n 
E 3 13  ALA 13  -10 ?   ?   ?   A . n 
E 3 14  SER 14  -9  ?   ?   ?   A . n 
E 3 15  THR 15  -8  ?   ?   ?   A . n 
E 3 16  SER 16  -7  ?   ?   ?   A . n 
E 3 17  LEU 17  -6  ?   ?   ?   A . n 
E 3 18  TYR 18  -5  ?   ?   ?   A . n 
E 3 19  LYS 19  -4  ?   ?   ?   A . n 
E 3 20  LYS 20  -3  ?   ?   ?   A . n 
E 3 21  ALA 21  -2  ?   ?   ?   A . n 
E 3 22  GLY 22  -1  -1  GLY GLY A . n 
E 3 23  ARG 23  0   0   ARG ARG A . n 
E 3 24  MET 24  1   1   MET MET A . n 
E 3 25  SER 25  2   2   SER SER A . n 
E 3 26  LYS 26  3   3   LYS LYS A . n 
E 3 27  PHE 27  4   4   PHE PHE A . n 
E 3 28  THR 28  5   5   THR THR A . n 
E 3 29  TRP 29  6   6   TRP TRP A . n 
E 3 30  LYS 30  7   7   LYS LYS A . n 
E 3 31  GLU 31  8   8   GLU GLU A . n 
E 3 32  LEU 32  9   9   LEU LEU A . n 
E 3 33  ILE 33  10  10  ILE ILE A . n 
E 3 34  GLN 34  11  11  GLN GLN A . n 
E 3 35  LEU 35  12  12  LEU LEU A . n 
E 3 36  GLY 36  13  13  GLY GLY A . n 
E 3 37  SER 37  14  14  SER SER A . n 
E 3 38  PRO 38  15  15  PRO PRO A . n 
E 3 39  SER 39  16  16  SER SER A . n 
E 3 40  LYS 40  17  17  LYS LYS A . n 
E 3 41  ALA 41  18  18  ALA ALA A . n 
E 3 42  TYR 42  19  19  TYR TYR A . n 
E 3 43  GLU 43  20  20  GLU GLU A . n 
E 3 44  SER 44  21  21  SER SER A . n 
E 3 45  SER 45  22  22  SER SER A . n 
E 3 46  LEU 46  23  23  LEU LEU A . n 
E 3 47  ALA 47  24  24  ALA ALA A . n 
E 3 48  CYS 48  25  25  CYS CYS A . n 
E 3 49  ILE 49  26  26  ILE ILE A . n 
E 3 50  ALA 50  27  27  ALA ALA A . n 
E 3 51  HIS 51  28  28  HIS HIS A . n 
E 3 52  ILE 52  29  29  ILE ILE A . n 
E 3 53  ASP 53  30  30  ASP ASP A . n 
E 3 54  MET 54  31  31  MET MET A . n 
E 3 55  ASN 55  32  32  ASN ASN A . n 
E 3 56  ALA 56  33  33  ALA ALA A . n 
E 3 57  PHE 57  34  34  PHE PHE A . n 
E 3 58  PHE 58  35  35  PHE PHE A . n 
E 3 59  ALA 59  36  36  ALA ALA A . n 
E 3 60  GLN 60  37  37  GLN GLN A . n 
E 3 61  VAL 61  38  38  VAL VAL A . n 
E 3 62  GLU 62  39  39  GLU GLU A . n 
E 3 63  GLN 63  40  40  GLN GLN A . n 
E 3 64  MET 64  41  41  MET MET A . n 
E 3 65  ARG 65  42  42  ARG ARG A . n 
E 3 66  CYS 66  43  43  CYS CYS A . n 
E 3 67  GLY 67  44  44  GLY GLY A . n 
E 3 68  LEU 68  45  45  LEU LEU A . n 
E 3 69  SER 69  46  46  SER SER A . n 
E 3 70  LYS 70  47  47  LYS LYS A . n 
E 3 71  GLU 71  48  48  GLU GLU A . n 
E 3 72  ASP 72  49  49  ASP ASP A . n 
E 3 73  PRO 73  50  50  PRO PRO A . n 
E 3 74  VAL 74  51  51  VAL VAL A . n 
E 3 75  VAL 75  52  52  VAL VAL A . n 
E 3 76  CYS 76  53  53  CYS CYS A . n 
E 3 77  VAL 77  54  54  VAL VAL A . n 
E 3 78  GLN 78  55  55  GLN GLN A . n 
E 3 79  TRP 79  56  56  TRP TRP A . n 
E 3 80  ASN 80  57  57  ASN ASN A . n 
E 3 81  SER 81  58  58  SER SER A . n 
E 3 82  ILE 82  59  59  ILE ILE A . n 
E 3 83  ILE 83  60  60  ILE ILE A . n 
E 3 84  ALA 84  61  61  ALA ALA A . n 
E 3 85  VAL 85  62  62  VAL VAL A . n 
E 3 86  SER 86  63  63  SER SER A . n 
E 3 87  TYR 87  64  64  TYR TYR A . n 
E 3 88  ALA 88  65  65  ALA ALA A . n 
E 3 89  ALA 89  66  66  ALA ALA A . n 
E 3 90  ARG 90  67  67  ARG ARG A . n 
E 3 91  LYS 91  68  68  LYS LYS A . n 
E 3 92  TYR 92  69  69  TYR TYR A . n 
E 3 93  GLY 93  70  70  GLY GLY A . n 
E 3 94  ILE 94  71  71  ILE ILE A . n 
E 3 95  SER 95  72  72  SER SER A . n 
E 3 96  ARG 96  73  73  ARG ARG A . n 
E 3 97  MET 97  74  74  MET MET A . n 
E 3 98  ASP 98  75  75  ASP ASP A . n 
E 3 99  THR 99  76  76  THR THR A . n 
E 3 100 ILE 100 77  77  ILE ILE A . n 
E 3 101 GLN 101 78  78  GLN GLN A . n 
E 3 102 GLU 102 79  79  GLU GLU A . n 
E 3 103 ALA 103 80  80  ALA ALA A . n 
E 3 104 LEU 104 81  81  LEU LEU A . n 
E 3 105 LYS 105 82  82  LYS LYS A . n 
E 3 106 LYS 106 83  83  LYS LYS A . n 
E 3 107 CYS 107 84  84  CYS CYS A . n 
E 3 108 SER 108 85  85  SER SER A . n 
E 3 109 ASN 109 86  86  ASN ASN A . n 
E 3 110 LEU 110 87  87  LEU LEU A . n 
E 3 111 ILE 111 88  88  ILE ILE A . n 
E 3 112 PRO 112 89  89  PRO PRO A . n 
E 3 113 ILE 113 90  90  ILE ILE A . n 
E 3 114 HIS 114 91  91  HIS HIS A . n 
E 3 115 THR 115 92  92  THR THR A . n 
E 3 116 ALA 116 93  93  ALA ALA A . n 
E 3 117 VAL 117 94  94  VAL VAL A . n 
E 3 118 PHE 118 95  95  PHE PHE A . n 
E 3 119 LYS 119 96  96  LYS LYS A . n 
E 3 120 LYS 120 97  97  LYS LYS A . n 
E 3 121 GLY 121 98  98  GLY GLY A . n 
E 3 122 GLU 122 99  99  GLU GLU A . n 
E 3 123 ASP 123 100 100 ASP ASP A . n 
E 3 124 PHE 124 101 101 PHE PHE A . n 
E 3 125 TRP 125 102 102 TRP TRP A . n 
E 3 126 GLN 126 103 103 GLN GLN A . n 
E 3 127 TYR 127 104 104 TYR TYR A . n 
E 3 128 HIS 128 105 105 HIS HIS A . n 
E 3 129 ASP 129 106 106 ASP ASP A . n 
E 3 130 GLY 130 107 107 GLY GLY A . n 
E 3 131 CYS 131 108 108 CYS CYS A . n 
E 3 132 GLY 132 109 109 GLY GLY A . n 
E 3 133 SER 133 110 110 SER SER A . n 
E 3 134 TRP 134 111 111 TRP TRP A . n 
E 3 135 VAL 135 112 112 VAL VAL A . n 
E 3 136 GLN 136 113 113 GLN GLN A . n 
E 3 137 ASP 137 114 114 ASP ASP A . n 
E 3 138 PRO 138 115 115 PRO PRO A . n 
E 3 139 ALA 139 116 116 ALA ALA A . n 
E 3 140 LYS 140 117 117 LYS LYS A . n 
E 3 141 GLN 141 118 118 GLN GLN A . n 
E 3 142 ILE 142 119 119 ILE ILE A . n 
E 3 143 SER 143 120 120 SER SER A . n 
E 3 144 VAL 144 121 121 VAL VAL A . n 
E 3 145 GLU 145 122 122 GLU GLU A . n 
E 3 146 ASP 146 123 123 ASP ASP A . n 
E 3 147 HIS 147 124 124 HIS HIS A . n 
E 3 148 LYS 148 125 125 LYS LYS A . n 
E 3 149 VAL 149 126 126 VAL VAL A . n 
E 3 150 SER 150 127 127 SER SER A . n 
E 3 151 LEU 151 128 128 LEU LEU A . n 
E 3 152 GLU 152 129 129 GLU GLU A . n 
E 3 153 PRO 153 130 130 PRO PRO A . n 
E 3 154 TYR 154 131 131 TYR TYR A . n 
E 3 155 ARG 155 132 132 ARG ARG A . n 
E 3 156 ARG 156 133 133 ARG ARG A . n 
E 3 157 GLU 157 134 134 GLU GLU A . n 
E 3 158 SER 158 135 135 SER SER A . n 
E 3 159 ARG 159 136 136 ARG ARG A . n 
E 3 160 LYS 160 137 137 LYS LYS A . n 
E 3 161 ALA 161 138 138 ALA ALA A . n 
E 3 162 LEU 162 139 139 LEU LEU A . n 
E 3 163 LYS 163 140 140 LYS LYS A . n 
E 3 164 ILE 164 141 141 ILE ILE A . n 
E 3 165 PHE 165 142 142 PHE PHE A . n 
E 3 166 LYS 166 143 143 LYS LYS A . n 
E 3 167 SER 167 144 144 SER SER A . n 
E 3 168 ALA 168 145 145 ALA ALA A . n 
E 3 169 CYS 169 146 146 CYS CYS A . n 
E 3 170 ASP 170 147 147 ASP ASP A . n 
E 3 171 LEU 171 148 148 LEU LEU A . n 
E 3 172 VAL 172 149 149 VAL VAL A . n 
E 3 173 GLU 173 150 150 GLU GLU A . n 
E 3 174 ARG 174 151 151 ARG ARG A . n 
E 3 175 ALA 175 152 152 ALA ALA A . n 
E 3 176 SER 176 153 153 SER SER A . n 
E 3 177 ILE 177 154 154 ILE ILE A . n 
E 3 178 ASP 178 155 155 ASP ASP A . n 
E 3 179 GLU 179 156 156 GLU GLU A . n 
E 3 180 VAL 180 157 157 VAL VAL A . n 
E 3 181 PHE 181 158 158 PHE PHE A . n 
E 3 182 LEU 182 159 159 LEU LEU A . n 
E 3 183 ASP 183 160 160 ASP ASP A . n 
E 3 184 LEU 184 161 161 LEU LEU A . n 
E 3 185 GLY 185 162 162 GLY GLY A . n 
E 3 186 ARG 186 163 163 ARG ARG A . n 
E 3 187 ILE 187 164 164 ILE ILE A . n 
E 3 188 CYS 188 165 165 CYS CYS A . n 
E 3 189 PHE 189 166 166 PHE PHE A . n 
E 3 190 ASN 190 167 167 ASN ASN A . n 
E 3 191 MET 191 168 168 MET MET A . n 
E 3 192 LEU 192 169 169 LEU LEU A . n 
E 3 193 MET 193 170 170 MET MET A . n 
E 3 194 PHE 194 171 171 PHE PHE A . n 
E 3 195 ASP 195 172 172 ASP ASP A . n 
E 3 196 ASN 196 173 173 ASN ASN A . n 
E 3 197 GLU 197 174 174 GLU GLU A . n 
E 3 198 TYR 198 175 175 TYR TYR A . n 
E 3 199 GLU 199 176 176 GLU GLU A . n 
E 3 200 LEU 200 177 177 LEU LEU A . n 
E 3 201 THR 201 178 178 THR THR A . n 
E 3 202 GLY 202 179 179 GLY GLY A . n 
E 3 203 ASP 203 180 180 ASP ASP A . n 
E 3 204 LEU 204 181 181 LEU LEU A . n 
E 3 205 LYS 205 182 182 LYS LYS A . n 
E 3 206 LEU 206 183 183 LEU LEU A . n 
E 3 207 LYS 207 184 184 LYS LYS A . n 
E 3 208 ASP 208 185 185 ASP ASP A . n 
E 3 209 ALA 209 186 186 ALA ALA A . n 
E 3 210 LEU 210 187 187 LEU LEU A . n 
E 3 211 SER 211 188 188 SER SER A . n 
E 3 212 ASN 212 189 189 ASN ASN A . n 
E 3 213 ILE 213 190 190 ILE ILE A . n 
E 3 214 ARG 214 191 191 ARG ARG A . n 
E 3 215 GLU 215 192 192 GLU GLU A . n 
E 3 216 ALA 216 193 193 ALA ALA A . n 
E 3 217 PHE 217 194 194 PHE PHE A . n 
E 3 218 ILE 218 195 195 ILE ILE A . n 
E 3 219 GLY 219 196 196 GLY GLY A . n 
E 3 220 GLY 220 197 197 GLY GLY A . n 
E 3 221 ASN 221 198 198 ASN ASN A . n 
E 3 222 TYR 222 199 199 TYR TYR A . n 
E 3 223 ASP 223 200 200 ASP ASP A . n 
E 3 224 ILE 224 201 201 ILE ILE A . n 
E 3 225 ASN 225 202 202 ASN ASN A . n 
E 3 226 SER 226 203 203 SER SER A . n 
E 3 227 HIS 227 204 204 HIS HIS A . n 
E 3 228 LEU 228 205 205 LEU LEU A . n 
E 3 229 PRO 229 206 206 PRO PRO A . n 
E 3 230 LEU 230 207 207 LEU LEU A . n 
E 3 231 ILE 231 208 208 ILE ILE A . n 
E 3 232 PRO 232 209 209 PRO PRO A . n 
E 3 233 GLU 233 210 210 GLU GLU A . n 
E 3 234 LYS 234 211 211 LYS LYS A . n 
E 3 235 ILE 235 212 212 ILE ILE A . n 
E 3 236 LYS 236 213 213 LYS LYS A . n 
E 3 237 SER 237 214 214 SER SER A . n 
E 3 238 LEU 238 215 215 LEU LEU A . n 
E 3 239 LYS 239 216 216 LYS LYS A . n 
E 3 240 PHE 240 217 217 PHE PHE A . n 
E 3 241 GLU 241 218 218 GLU GLU A . n 
E 3 242 GLY 242 219 219 GLY GLY A . n 
E 3 243 ASP 243 220 220 ASP ASP A . n 
E 3 244 VAL 244 221 221 VAL VAL A . n 
E 3 245 PHE 245 222 222 PHE PHE A . n 
E 3 246 ASN 246 223 223 ASN ASN A . n 
E 3 247 PRO 247 224 224 PRO PRO A . n 
E 3 248 GLU 248 225 225 GLU GLU A . n 
E 3 249 GLY 249 226 226 GLY GLY A . n 
E 3 250 ARG 250 227 227 ARG ARG A . n 
E 3 251 ASP 251 228 228 ASP ASP A . n 
E 3 252 LEU 252 229 229 LEU LEU A . n 
E 3 253 ILE 253 230 230 ILE ILE A . n 
E 3 254 THR 254 231 231 THR THR A . n 
E 3 255 ASP 255 232 232 ASP ASP A . n 
E 3 256 TRP 256 233 233 TRP TRP A . n 
E 3 257 ASP 257 234 234 ASP ASP A . n 
E 3 258 ASP 258 235 235 ASP ASP A . n 
E 3 259 VAL 259 236 236 VAL VAL A . n 
E 3 260 ILE 260 237 237 ILE ILE A . n 
E 3 261 LEU 261 238 238 LEU LEU A . n 
E 3 262 ALA 262 239 239 ALA ALA A . n 
E 3 263 LEU 263 240 240 LEU LEU A . n 
E 3 264 GLY 264 241 241 GLY GLY A . n 
E 3 265 SER 265 242 242 SER SER A . n 
E 3 266 GLN 266 243 243 GLN GLN A . n 
E 3 267 VAL 267 244 244 VAL VAL A . n 
E 3 268 CYS 268 245 245 CYS CYS A . n 
E 3 269 LYS 269 246 246 LYS LYS A . n 
E 3 270 GLY 270 247 247 GLY GLY A . n 
E 3 271 ILE 271 248 248 ILE ILE A . n 
E 3 272 ARG 272 249 249 ARG ARG A . n 
E 3 273 ASP 273 250 250 ASP ASP A . n 
E 3 274 SER 274 251 251 SER SER A . n 
E 3 275 ILE 275 252 252 ILE ILE A . n 
E 3 276 LYS 276 253 253 LYS LYS A . n 
E 3 277 ASP 277 254 254 ASP ASP A . n 
E 3 278 ILE 278 255 255 ILE ILE A . n 
E 3 279 LEU 279 256 256 LEU LEU A . n 
E 3 280 GLY 280 257 257 GLY GLY A . n 
E 3 281 TYR 281 258 258 TYR TYR A . n 
E 3 282 THR 282 259 259 THR THR A . n 
E 3 283 THR 283 260 260 THR THR A . n 
E 3 284 SER 284 261 261 SER SER A . n 
E 3 285 CYS 285 262 262 CYS CYS A . n 
E 3 286 GLY 286 263 263 GLY GLY A . n 
E 3 287 LEU 287 264 264 LEU LEU A . n 
E 3 288 SER 288 265 265 SER SER A . n 
E 3 289 SER 289 266 266 SER SER A . n 
E 3 290 THR 290 267 267 THR THR A . n 
E 3 291 LYS 291 268 268 LYS LYS A . n 
E 3 292 ASN 292 269 269 ASN ASN A . n 
E 3 293 VAL 293 270 270 VAL VAL A . n 
E 3 294 CYS 294 271 271 CYS CYS A . n 
E 3 295 LYS 295 272 272 LYS LYS A . n 
E 3 296 LEU 296 273 273 LEU LEU A . n 
E 3 297 ALA 297 274 274 ALA ALA A . n 
E 3 298 SER 298 275 275 SER SER A . n 
E 3 299 ASN 299 276 276 ASN ASN A . n 
E 3 300 TYR 300 277 277 TYR TYR A . n 
E 3 301 LYS 301 278 278 LYS LYS A . n 
E 3 302 LYS 302 279 279 LYS LYS A . n 
E 3 303 PRO 303 280 280 PRO PRO A . n 
E 3 304 ASP 304 281 281 ASP ASP A . n 
E 3 305 ALA 305 282 282 ALA ALA A . n 
E 3 306 GLN 306 283 283 GLN GLN A . n 
E 3 307 THR 307 284 284 THR THR A . n 
E 3 308 ILE 308 285 285 ILE ILE A . n 
E 3 309 VAL 309 286 286 VAL VAL A . n 
E 3 310 LYS 310 287 287 LYS LYS A . n 
E 3 311 ASN 311 288 288 ASN ASN A . n 
E 3 312 ASP 312 289 289 ASP ASP A . n 
E 3 313 CYS 313 290 290 CYS CYS A . n 
E 3 314 LEU 314 291 291 LEU LEU A . n 
E 3 315 LEU 315 292 292 LEU LEU A . n 
E 3 316 ASP 316 293 293 ASP ASP A . n 
E 3 317 PHE 317 294 294 PHE PHE A . n 
E 3 318 LEU 318 295 295 LEU LEU A . n 
E 3 319 ASP 319 296 296 ASP ASP A . n 
E 3 320 CYS 320 297 297 CYS CYS A . n 
E 3 321 GLY 321 298 298 GLY GLY A . n 
E 3 322 LYS 322 299 299 LYS LYS A . n 
E 3 323 PHE 323 300 300 PHE PHE A . n 
E 3 324 GLU 324 301 301 GLU GLU A . n 
E 3 325 ILE 325 302 302 ILE ILE A . n 
E 3 326 THR 326 303 303 THR THR A . n 
E 3 327 SER 327 304 304 SER SER A . n 
E 3 328 PHE 328 305 305 PHE PHE A . n 
E 3 329 TRP 329 306 306 TRP TRP A . n 
E 3 330 THR 330 307 307 THR THR A . n 
E 3 331 LEU 331 308 308 LEU LEU A . n 
E 3 332 GLY 332 309 309 GLY GLY A . n 
E 3 333 GLY 333 310 310 GLY GLY A . n 
E 3 334 VAL 334 311 311 VAL VAL A . n 
E 3 335 LEU 335 312 312 LEU LEU A . n 
E 3 336 GLY 336 313 313 GLY GLY A . n 
E 3 337 LYS 337 314 314 LYS LYS A . n 
E 3 338 GLU 338 315 315 GLU GLU A . n 
E 3 339 LEU 339 316 316 LEU LEU A . n 
E 3 340 ILE 340 317 317 ILE ILE A . n 
E 3 341 ASP 341 318 318 ASP ASP A . n 
E 3 342 VAL 342 319 319 VAL VAL A . n 
E 3 343 LEU 343 320 320 LEU LEU A . n 
E 3 344 ASP 344 321 321 ASP ASP A . n 
E 3 345 LEU 345 322 322 LEU LEU A . n 
E 3 346 PRO 346 323 323 PRO PRO A . n 
E 3 347 HIS 347 324 324 HIS HIS A . n 
E 3 348 GLU 348 325 325 GLU GLU A . n 
E 3 349 ASN 349 326 326 ASN ASN A . n 
E 3 350 SER 350 327 327 SER SER A . n 
E 3 351 ILE 351 328 328 ILE ILE A . n 
E 3 352 LYS 352 329 329 LYS LYS A . n 
E 3 353 HIS 353 330 330 HIS HIS A . n 
E 3 354 ILE 354 331 331 ILE ILE A . n 
E 3 355 ARG 355 332 332 ARG ARG A . n 
E 3 356 GLU 356 333 333 GLU GLU A . n 
E 3 357 THR 357 334 334 THR THR A . n 
E 3 358 TRP 358 335 335 TRP TRP A . n 
E 3 359 PRO 359 336 336 PRO PRO A . n 
E 3 360 ASP 360 337 337 ASP ASP A . n 
E 3 361 ASN 361 338 338 ASN ASN A . n 
E 3 362 ALA 362 339 339 ALA ALA A . n 
E 3 363 GLY 363 340 340 GLY GLY A . n 
E 3 364 GLN 364 341 341 GLN GLN A . n 
E 3 365 LEU 365 342 342 LEU LEU A . n 
E 3 366 LYS 366 343 343 LYS LYS A . n 
E 3 367 GLU 367 344 344 GLU GLU A . n 
E 3 368 PHE 368 345 345 PHE PHE A . n 
E 3 369 LEU 369 346 346 LEU LEU A . n 
E 3 370 ASP 370 347 347 ASP ASP A . n 
E 3 371 ALA 371 348 348 ALA ALA A . n 
E 3 372 LYS 372 349 349 LYS LYS A . n 
E 3 373 VAL 373 350 350 VAL VAL A . n 
E 3 374 LYS 374 351 351 LYS LYS A . n 
E 3 375 GLN 375 352 352 GLN GLN A . n 
E 3 376 SER 376 353 353 SER SER A . n 
E 3 377 ASP 377 354 354 ASP ASP A . n 
E 3 378 TYR 378 355 355 TYR TYR A . n 
E 3 379 ASP 379 356 356 ASP ASP A . n 
E 3 380 ARG 380 357 357 ARG ARG A . n 
E 3 381 SER 381 358 358 SER SER A . n 
E 3 382 THR 382 359 359 THR THR A . n 
E 3 383 SER 383 360 360 SER SER A . n 
E 3 384 ASN 384 361 361 ASN ASN A . n 
E 3 385 ILE 385 362 362 ILE ILE A . n 
E 3 386 ASP 386 363 363 ASP ASP A . n 
E 3 387 PRO 387 364 364 PRO PRO A . n 
E 3 388 LEU 388 365 365 LEU LEU A . n 
E 3 389 LYS 389 366 366 LYS LYS A . n 
E 3 390 THR 390 367 367 THR THR A . n 
E 3 391 ALA 391 368 368 ALA ALA A . n 
E 3 392 ASP 392 369 369 ASP ASP A . n 
E 3 393 LEU 393 370 370 LEU LEU A . n 
E 3 394 ALA 394 371 371 ALA ALA A . n 
E 3 395 GLU 395 372 372 GLU GLU A . n 
E 3 396 LYS 396 373 373 LYS LYS A . n 
E 3 397 LEU 397 374 374 LEU LEU A . n 
E 3 398 PHE 398 375 375 PHE PHE A . n 
E 3 399 LYS 399 376 376 LYS LYS A . n 
E 3 400 LEU 400 377 377 LEU LEU A . n 
E 3 401 SER 401 378 378 SER SER A . n 
E 3 402 ARG 402 379 379 ARG ARG A . n 
E 3 403 GLY 403 380 380 GLY GLY A . n 
E 3 404 ARG 404 381 381 ARG ARG A . n 
E 3 405 TYR 405 382 382 TYR TYR A . n 
E 3 406 GLY 406 383 383 GLY GLY A . n 
E 3 407 LEU 407 384 384 LEU LEU A . n 
E 3 408 PRO 408 385 385 PRO PRO A . n 
E 3 409 LEU 409 386 386 LEU LEU A . n 
E 3 410 SER 410 387 387 SER SER A . n 
E 3 411 SER 411 388 388 SER SER A . n 
E 3 412 ARG 412 389 389 ARG ARG A . n 
E 3 413 PRO 413 390 390 PRO PRO A . n 
E 3 414 VAL 414 391 391 VAL VAL A . n 
E 3 415 VAL 415 392 392 VAL VAL A . n 
E 3 416 LYS 416 393 393 LYS LYS A . n 
E 3 417 SER 417 394 394 SER SER A . n 
E 3 418 MET 418 395 395 MET MET A . n 
E 3 419 MET 419 396 396 MET MET A . n 
E 3 420 SER 420 397 397 SER SER A . n 
E 3 421 ASN 421 398 398 ASN ASN A . n 
E 3 422 LYS 422 399 399 LYS LYS A . n 
E 3 423 ASN 423 400 400 ASN ASN A . n 
E 3 424 LEU 424 401 401 LEU LEU A . n 
E 3 425 ARG 425 402 402 ARG ARG A . n 
E 3 426 GLY 426 403 403 GLY GLY A . n 
E 3 427 LYS 427 404 404 LYS LYS A . n 
E 3 428 SER 428 405 405 SER SER A . n 
E 3 429 CYS 429 406 406 CYS CYS A . n 
E 3 430 ASN 430 407 407 ASN ASN A . n 
E 3 431 SER 431 408 408 SER SER A . n 
E 3 432 ILE 432 409 409 ILE ILE A . n 
E 3 433 VAL 433 410 410 VAL VAL A . n 
E 3 434 ASP 434 411 411 ASP ASP A . n 
E 3 435 CYS 435 412 412 CYS CYS A . n 
E 3 436 ILE 436 413 413 ILE ILE A . n 
E 3 437 SER 437 414 414 SER SER A . n 
E 3 438 TRP 438 415 415 TRP TRP A . n 
E 3 439 LEU 439 416 416 LEU LEU A . n 
E 3 440 GLU 440 417 417 GLU GLU A . n 
E 3 441 VAL 441 418 418 VAL VAL A . n 
E 3 442 PHE 442 419 419 PHE PHE A . n 
E 3 443 CYS 443 420 420 CYS CYS A . n 
E 3 444 ALA 444 421 421 ALA ALA A . n 
E 3 445 GLU 445 422 422 GLU GLU A . n 
E 3 446 LEU 446 423 423 LEU LEU A . n 
E 3 447 THR 447 424 424 THR THR A . n 
E 3 448 SER 448 425 425 SER SER A . n 
E 3 449 ARG 449 426 426 ARG ARG A . n 
E 3 450 ILE 450 427 427 ILE ILE A . n 
E 3 451 GLN 451 428 428 GLN GLN A . n 
E 3 452 ASP 452 429 429 ASP ASP A . n 
E 3 453 LEU 453 430 430 LEU LEU A . n 
E 3 454 GLU 454 431 431 GLU GLU A . n 
E 3 455 GLN 455 432 432 GLN GLN A . n 
E 3 456 GLU 456 433 433 GLU GLU A . n 
E 3 457 TYR 457 434 434 TYR TYR A . n 
E 3 458 ASN 458 435 435 ASN ASN A . n 
E 3 459 LYS 459 436 436 LYS LYS A . n 
E 3 460 ILE 460 437 437 ILE ILE A . n 
E 3 461 VAL 461 438 438 VAL VAL A . n 
E 3 462 ILE 462 439 439 ILE ILE A . n 
E 3 463 PRO 463 440 440 PRO PRO A . n 
E 3 464 ARG 464 441 441 ARG ARG A . n 
E 3 465 THR 465 442 442 THR THR A . n 
E 3 466 VAL 466 443 443 VAL VAL A . n 
E 3 467 SER 467 444 444 SER SER A . n 
E 3 468 ILE 468 445 445 ILE ILE A . n 
E 3 469 SER 469 446 446 SER SER A . n 
E 3 470 LEU 470 447 447 LEU LEU A . n 
E 3 471 LYS 471 448 448 LYS LYS A . n 
E 3 472 THR 472 449 449 THR THR A . n 
E 3 473 LYS 473 450 450 LYS LYS A . n 
E 3 474 SER 474 451 451 SER SER A . n 
E 3 475 TYR 475 452 452 TYR TYR A . n 
E 3 476 GLU 476 453 453 GLU GLU A . n 
E 3 477 VAL 477 454 454 VAL VAL A . n 
E 3 478 TYR 478 455 455 TYR TYR A . n 
E 3 479 ARG 479 456 456 ARG ARG A . n 
E 3 480 LYS 480 457 457 LYS LYS A . n 
E 3 481 SER 481 458 458 SER SER A . n 
E 3 482 GLY 482 459 459 GLY GLY A . n 
E 3 483 PRO 483 460 460 PRO PRO A . n 
E 3 484 VAL 484 461 461 VAL VAL A . n 
E 3 485 ALA 485 462 462 ALA ALA A . n 
E 3 486 TYR 486 463 463 TYR TYR A . n 
E 3 487 LYS 487 464 464 LYS LYS A . n 
E 3 488 GLY 488 465 465 GLY GLY A . n 
E 3 489 ILE 489 466 466 ILE ILE A . n 
E 3 490 ASN 490 467 467 ASN ASN A . n 
E 3 491 PHE 491 468 468 PHE PHE A . n 
E 3 492 GLN 492 469 469 GLN GLN A . n 
E 3 493 SER 493 470 470 SER SER A . n 
E 3 494 HIS 494 471 471 HIS HIS A . n 
E 3 495 GLU 495 472 472 GLU GLU A . n 
E 3 496 LEU 496 473 473 LEU LEU A . n 
E 3 497 LEU 497 474 474 LEU LEU A . n 
E 3 498 LYS 498 475 475 LYS LYS A . n 
E 3 499 VAL 499 476 476 VAL VAL A . n 
E 3 500 GLY 500 477 477 GLY GLY A . n 
E 3 501 ILE 501 478 478 ILE ILE A . n 
E 3 502 LYS 502 479 479 LYS LYS A . n 
E 3 503 PHE 503 480 480 PHE PHE A . n 
E 3 504 VAL 504 481 481 VAL VAL A . n 
E 3 505 THR 505 482 482 THR THR A . n 
E 3 506 ASP 506 483 483 ASP ASP A . n 
E 3 507 LEU 507 484 484 LEU LEU A . n 
E 3 508 ASP 508 485 485 ASP ASP A . n 
E 3 509 ILE 509 486 486 ILE ILE A . n 
E 3 510 LYS 510 487 487 LYS LYS A . n 
E 3 511 GLY 511 488 488 GLY GLY A . n 
E 3 512 LYS 512 489 489 LYS LYS A . n 
E 3 513 ASN 513 490 490 ASN ASN A . n 
E 3 514 LYS 514 491 491 LYS LYS A . n 
E 3 515 SER 515 492 492 SER SER A . n 
E 3 516 TYR 516 493 493 TYR TYR A . n 
E 3 517 TYR 517 494 494 TYR TYR A . n 
E 3 518 PRO 518 495 495 PRO PRO A . n 
E 3 519 LEU 519 496 496 LEU LEU A . n 
E 3 520 THR 520 497 497 THR THR A . n 
E 3 521 LYS 521 498 498 LYS LYS A . n 
E 3 522 LEU 522 499 499 LEU LEU A . n 
E 3 523 SER 523 500 500 SER SER A . n 
E 3 524 MET 524 501 501 MET MET A . n 
E 3 525 THR 525 502 502 THR THR A . n 
E 3 526 ILE 526 503 503 ILE ILE A . n 
E 3 527 THR 527 504 504 THR THR A . n 
E 3 528 ASN 528 505 505 ASN ASN A . n 
E 3 529 PHE 529 506 506 PHE PHE A . n 
E 3 530 ASP 530 507 507 ASP ASP A . n 
E 3 531 ILE 531 508 508 ILE ILE A . n 
E 3 532 ILE 532 509 509 ILE ILE A . n 
E 3 533 ASP 533 510 ?   ?   ?   A . n 
E 3 534 LEU 534 511 ?   ?   ?   A . n 
E 3 535 GLN 535 512 ?   ?   ?   A . n 
E 3 536 LYS 536 513 ?   ?   ?   A . n 
E 3 537 THR 537 514 ?   ?   ?   A . n 
E 3 538 VAL 538 515 ?   ?   ?   A . n 
E 3 539 VAL 539 516 ?   ?   ?   A . n 
E 3 540 ASP 540 517 ?   ?   ?   A . n 
E 3 541 MET 541 518 ?   ?   ?   A . n 
E 3 542 PHE 542 519 ?   ?   ?   A . n 
E 3 543 GLY 543 520 ?   ?   ?   A . n 
E 3 544 ASN 544 521 ?   ?   ?   A . n 
E 3 545 GLN 545 522 ?   ?   ?   A . n 
E 3 546 VAL 546 523 ?   ?   ?   A . n 
E 3 547 HIS 547 524 ?   ?   ?   A . n 
E 3 548 THR 548 525 ?   ?   ?   A . n 
E 3 549 PHE 549 526 ?   ?   ?   A . n 
E 3 550 LYS 550 527 ?   ?   ?   A . n 
E 3 551 SER 551 528 ?   ?   ?   A . n 
E 3 552 SER 552 529 ?   ?   ?   A . n 
E 3 553 ALA 553 530 ?   ?   ?   A . n 
E 3 554 GLY 554 531 ?   ?   ?   A . n 
F 3 1   MET 1   -22 ?   ?   ?   B . n 
F 3 2   ALA 2   -21 ?   ?   ?   B . n 
F 3 3   SER 3   -20 ?   ?   ?   B . n 
F 3 4   TRP 4   -19 ?   ?   ?   B . n 
F 3 5   SER 5   -18 ?   ?   ?   B . n 
F 3 6   HIS 6   -17 ?   ?   ?   B . n 
F 3 7   PRO 7   -16 ?   ?   ?   B . n 
F 3 8   GLN 8   -15 ?   ?   ?   B . n 
F 3 9   PHE 9   -14 ?   ?   ?   B . n 
F 3 10  GLU 10  -13 ?   ?   ?   B . n 
F 3 11  LYS 11  -12 ?   ?   ?   B . n 
F 3 12  GLY 12  -11 ?   ?   ?   B . n 
F 3 13  ALA 13  -10 ?   ?   ?   B . n 
F 3 14  SER 14  -9  ?   ?   ?   B . n 
F 3 15  THR 15  -8  ?   ?   ?   B . n 
F 3 16  SER 16  -7  ?   ?   ?   B . n 
F 3 17  LEU 17  -6  ?   ?   ?   B . n 
F 3 18  TYR 18  -5  ?   ?   ?   B . n 
F 3 19  LYS 19  -4  ?   ?   ?   B . n 
F 3 20  LYS 20  -3  ?   ?   ?   B . n 
F 3 21  ALA 21  -2  ?   ?   ?   B . n 
F 3 22  GLY 22  -1  ?   ?   ?   B . n 
F 3 23  ARG 23  0   ?   ?   ?   B . n 
F 3 24  MET 24  1   1   MET MET B . n 
F 3 25  SER 25  2   2   SER SER B . n 
F 3 26  LYS 26  3   3   LYS LYS B . n 
F 3 27  PHE 27  4   4   PHE PHE B . n 
F 3 28  THR 28  5   5   THR THR B . n 
F 3 29  TRP 29  6   6   TRP TRP B . n 
F 3 30  LYS 30  7   7   LYS LYS B . n 
F 3 31  GLU 31  8   8   GLU GLU B . n 
F 3 32  LEU 32  9   9   LEU LEU B . n 
F 3 33  ILE 33  10  10  ILE ILE B . n 
F 3 34  GLN 34  11  11  GLN GLN B . n 
F 3 35  LEU 35  12  12  LEU LEU B . n 
F 3 36  GLY 36  13  13  GLY GLY B . n 
F 3 37  SER 37  14  14  SER SER B . n 
F 3 38  PRO 38  15  15  PRO PRO B . n 
F 3 39  SER 39  16  16  SER SER B . n 
F 3 40  LYS 40  17  17  LYS LYS B . n 
F 3 41  ALA 41  18  18  ALA ALA B . n 
F 3 42  TYR 42  19  19  TYR TYR B . n 
F 3 43  GLU 43  20  20  GLU GLU B . n 
F 3 44  SER 44  21  21  SER SER B . n 
F 3 45  SER 45  22  22  SER SER B . n 
F 3 46  LEU 46  23  23  LEU LEU B . n 
F 3 47  ALA 47  24  24  ALA ALA B . n 
F 3 48  CYS 48  25  25  CYS CYS B . n 
F 3 49  ILE 49  26  26  ILE ILE B . n 
F 3 50  ALA 50  27  27  ALA ALA B . n 
F 3 51  HIS 51  28  28  HIS HIS B . n 
F 3 52  ILE 52  29  29  ILE ILE B . n 
F 3 53  ASP 53  30  30  ASP ASP B . n 
F 3 54  MET 54  31  31  MET MET B . n 
F 3 55  ASN 55  32  32  ASN ASN B . n 
F 3 56  ALA 56  33  33  ALA ALA B . n 
F 3 57  PHE 57  34  34  PHE PHE B . n 
F 3 58  PHE 58  35  35  PHE PHE B . n 
F 3 59  ALA 59  36  36  ALA ALA B . n 
F 3 60  GLN 60  37  37  GLN GLN B . n 
F 3 61  VAL 61  38  38  VAL VAL B . n 
F 3 62  GLU 62  39  39  GLU GLU B . n 
F 3 63  GLN 63  40  40  GLN GLN B . n 
F 3 64  MET 64  41  41  MET MET B . n 
F 3 65  ARG 65  42  42  ARG ARG B . n 
F 3 66  CYS 66  43  43  CYS CYS B . n 
F 3 67  GLY 67  44  44  GLY GLY B . n 
F 3 68  LEU 68  45  45  LEU LEU B . n 
F 3 69  SER 69  46  46  SER SER B . n 
F 3 70  LYS 70  47  47  LYS LYS B . n 
F 3 71  GLU 71  48  48  GLU GLU B . n 
F 3 72  ASP 72  49  49  ASP ASP B . n 
F 3 73  PRO 73  50  50  PRO PRO B . n 
F 3 74  VAL 74  51  51  VAL VAL B . n 
F 3 75  VAL 75  52  52  VAL VAL B . n 
F 3 76  CYS 76  53  53  CYS CYS B . n 
F 3 77  VAL 77  54  54  VAL VAL B . n 
F 3 78  GLN 78  55  55  GLN GLN B . n 
F 3 79  TRP 79  56  56  TRP TRP B . n 
F 3 80  ASN 80  57  57  ASN ASN B . n 
F 3 81  SER 81  58  58  SER SER B . n 
F 3 82  ILE 82  59  59  ILE ILE B . n 
F 3 83  ILE 83  60  60  ILE ILE B . n 
F 3 84  ALA 84  61  61  ALA ALA B . n 
F 3 85  VAL 85  62  62  VAL VAL B . n 
F 3 86  SER 86  63  63  SER SER B . n 
F 3 87  TYR 87  64  64  TYR TYR B . n 
F 3 88  ALA 88  65  65  ALA ALA B . n 
F 3 89  ALA 89  66  66  ALA ALA B . n 
F 3 90  ARG 90  67  67  ARG ARG B . n 
F 3 91  LYS 91  68  68  LYS LYS B . n 
F 3 92  TYR 92  69  69  TYR TYR B . n 
F 3 93  GLY 93  70  70  GLY GLY B . n 
F 3 94  ILE 94  71  71  ILE ILE B . n 
F 3 95  SER 95  72  72  SER SER B . n 
F 3 96  ARG 96  73  73  ARG ARG B . n 
F 3 97  MET 97  74  74  MET MET B . n 
F 3 98  ASP 98  75  75  ASP ASP B . n 
F 3 99  THR 99  76  76  THR THR B . n 
F 3 100 ILE 100 77  77  ILE ILE B . n 
F 3 101 GLN 101 78  78  GLN GLN B . n 
F 3 102 GLU 102 79  79  GLU GLU B . n 
F 3 103 ALA 103 80  80  ALA ALA B . n 
F 3 104 LEU 104 81  81  LEU LEU B . n 
F 3 105 LYS 105 82  82  LYS LYS B . n 
F 3 106 LYS 106 83  83  LYS LYS B . n 
F 3 107 CYS 107 84  84  CYS CYS B . n 
F 3 108 SER 108 85  85  SER SER B . n 
F 3 109 ASN 109 86  86  ASN ASN B . n 
F 3 110 LEU 110 87  87  LEU LEU B . n 
F 3 111 ILE 111 88  88  ILE ILE B . n 
F 3 112 PRO 112 89  89  PRO PRO B . n 
F 3 113 ILE 113 90  90  ILE ILE B . n 
F 3 114 HIS 114 91  91  HIS HIS B . n 
F 3 115 THR 115 92  92  THR THR B . n 
F 3 116 ALA 116 93  93  ALA ALA B . n 
F 3 117 VAL 117 94  94  VAL VAL B . n 
F 3 118 PHE 118 95  95  PHE PHE B . n 
F 3 119 LYS 119 96  96  LYS LYS B . n 
F 3 120 LYS 120 97  97  LYS LYS B . n 
F 3 121 GLY 121 98  98  GLY GLY B . n 
F 3 122 GLU 122 99  99  GLU GLU B . n 
F 3 123 ASP 123 100 100 ASP ASP B . n 
F 3 124 PHE 124 101 101 PHE PHE B . n 
F 3 125 TRP 125 102 102 TRP TRP B . n 
F 3 126 GLN 126 103 103 GLN GLN B . n 
F 3 127 TYR 127 104 104 TYR TYR B . n 
F 3 128 HIS 128 105 105 HIS HIS B . n 
F 3 129 ASP 129 106 106 ASP ASP B . n 
F 3 130 GLY 130 107 107 GLY GLY B . n 
F 3 131 CYS 131 108 108 CYS CYS B . n 
F 3 132 GLY 132 109 109 GLY GLY B . n 
F 3 133 SER 133 110 110 SER SER B . n 
F 3 134 TRP 134 111 111 TRP TRP B . n 
F 3 135 VAL 135 112 112 VAL VAL B . n 
F 3 136 GLN 136 113 113 GLN GLN B . n 
F 3 137 ASP 137 114 114 ASP ASP B . n 
F 3 138 PRO 138 115 115 PRO PRO B . n 
F 3 139 ALA 139 116 116 ALA ALA B . n 
F 3 140 LYS 140 117 117 LYS LYS B . n 
F 3 141 GLN 141 118 118 GLN GLN B . n 
F 3 142 ILE 142 119 119 ILE ILE B . n 
F 3 143 SER 143 120 120 SER SER B . n 
F 3 144 VAL 144 121 121 VAL VAL B . n 
F 3 145 GLU 145 122 122 GLU GLU B . n 
F 3 146 ASP 146 123 123 ASP ASP B . n 
F 3 147 HIS 147 124 124 HIS HIS B . n 
F 3 148 LYS 148 125 125 LYS LYS B . n 
F 3 149 VAL 149 126 126 VAL VAL B . n 
F 3 150 SER 150 127 127 SER SER B . n 
F 3 151 LEU 151 128 128 LEU LEU B . n 
F 3 152 GLU 152 129 129 GLU GLU B . n 
F 3 153 PRO 153 130 130 PRO PRO B . n 
F 3 154 TYR 154 131 131 TYR TYR B . n 
F 3 155 ARG 155 132 132 ARG ARG B . n 
F 3 156 ARG 156 133 133 ARG ARG B . n 
F 3 157 GLU 157 134 134 GLU GLU B . n 
F 3 158 SER 158 135 135 SER SER B . n 
F 3 159 ARG 159 136 136 ARG ARG B . n 
F 3 160 LYS 160 137 137 LYS LYS B . n 
F 3 161 ALA 161 138 138 ALA ALA B . n 
F 3 162 LEU 162 139 139 LEU LEU B . n 
F 3 163 LYS 163 140 140 LYS LYS B . n 
F 3 164 ILE 164 141 141 ILE ILE B . n 
F 3 165 PHE 165 142 142 PHE PHE B . n 
F 3 166 LYS 166 143 143 LYS LYS B . n 
F 3 167 SER 167 144 144 SER SER B . n 
F 3 168 ALA 168 145 145 ALA ALA B . n 
F 3 169 CYS 169 146 146 CYS CYS B . n 
F 3 170 ASP 170 147 147 ASP ASP B . n 
F 3 171 LEU 171 148 148 LEU LEU B . n 
F 3 172 VAL 172 149 149 VAL VAL B . n 
F 3 173 GLU 173 150 150 GLU GLU B . n 
F 3 174 ARG 174 151 151 ARG ARG B . n 
F 3 175 ALA 175 152 152 ALA ALA B . n 
F 3 176 SER 176 153 153 SER SER B . n 
F 3 177 ILE 177 154 154 ILE ILE B . n 
F 3 178 ASP 178 155 155 ASP ASP B . n 
F 3 179 GLU 179 156 156 GLU GLU B . n 
F 3 180 VAL 180 157 157 VAL VAL B . n 
F 3 181 PHE 181 158 158 PHE PHE B . n 
F 3 182 LEU 182 159 159 LEU LEU B . n 
F 3 183 ASP 183 160 160 ASP ASP B . n 
F 3 184 LEU 184 161 161 LEU LEU B . n 
F 3 185 GLY 185 162 162 GLY GLY B . n 
F 3 186 ARG 186 163 163 ARG ARG B . n 
F 3 187 ILE 187 164 164 ILE ILE B . n 
F 3 188 CYS 188 165 165 CYS CYS B . n 
F 3 189 PHE 189 166 166 PHE PHE B . n 
F 3 190 ASN 190 167 167 ASN ASN B . n 
F 3 191 MET 191 168 168 MET MET B . n 
F 3 192 LEU 192 169 169 LEU LEU B . n 
F 3 193 MET 193 170 170 MET MET B . n 
F 3 194 PHE 194 171 171 PHE PHE B . n 
F 3 195 ASP 195 172 172 ASP ASP B . n 
F 3 196 ASN 196 173 173 ASN ASN B . n 
F 3 197 GLU 197 174 174 GLU GLU B . n 
F 3 198 TYR 198 175 175 TYR TYR B . n 
F 3 199 GLU 199 176 176 GLU GLU B . n 
F 3 200 LEU 200 177 177 LEU LEU B . n 
F 3 201 THR 201 178 178 THR THR B . n 
F 3 202 GLY 202 179 179 GLY GLY B . n 
F 3 203 ASP 203 180 180 ASP ASP B . n 
F 3 204 LEU 204 181 181 LEU LEU B . n 
F 3 205 LYS 205 182 182 LYS LYS B . n 
F 3 206 LEU 206 183 183 LEU LEU B . n 
F 3 207 LYS 207 184 184 LYS LYS B . n 
F 3 208 ASP 208 185 185 ASP ASP B . n 
F 3 209 ALA 209 186 186 ALA ALA B . n 
F 3 210 LEU 210 187 187 LEU LEU B . n 
F 3 211 SER 211 188 188 SER SER B . n 
F 3 212 ASN 212 189 189 ASN ASN B . n 
F 3 213 ILE 213 190 190 ILE ILE B . n 
F 3 214 ARG 214 191 191 ARG ARG B . n 
F 3 215 GLU 215 192 192 GLU GLU B . n 
F 3 216 ALA 216 193 193 ALA ALA B . n 
F 3 217 PHE 217 194 194 PHE PHE B . n 
F 3 218 ILE 218 195 195 ILE ILE B . n 
F 3 219 GLY 219 196 196 GLY GLY B . n 
F 3 220 GLY 220 197 197 GLY GLY B . n 
F 3 221 ASN 221 198 198 ASN ASN B . n 
F 3 222 TYR 222 199 199 TYR TYR B . n 
F 3 223 ASP 223 200 200 ASP ASP B . n 
F 3 224 ILE 224 201 201 ILE ILE B . n 
F 3 225 ASN 225 202 202 ASN ASN B . n 
F 3 226 SER 226 203 203 SER SER B . n 
F 3 227 HIS 227 204 204 HIS HIS B . n 
F 3 228 LEU 228 205 205 LEU LEU B . n 
F 3 229 PRO 229 206 206 PRO PRO B . n 
F 3 230 LEU 230 207 207 LEU LEU B . n 
F 3 231 ILE 231 208 208 ILE ILE B . n 
F 3 232 PRO 232 209 209 PRO PRO B . n 
F 3 233 GLU 233 210 210 GLU GLU B . n 
F 3 234 LYS 234 211 211 LYS LYS B . n 
F 3 235 ILE 235 212 212 ILE ILE B . n 
F 3 236 LYS 236 213 213 LYS LYS B . n 
F 3 237 SER 237 214 214 SER SER B . n 
F 3 238 LEU 238 215 215 LEU LEU B . n 
F 3 239 LYS 239 216 216 LYS LYS B . n 
F 3 240 PHE 240 217 217 PHE PHE B . n 
F 3 241 GLU 241 218 218 GLU GLU B . n 
F 3 242 GLY 242 219 219 GLY GLY B . n 
F 3 243 ASP 243 220 220 ASP ASP B . n 
F 3 244 VAL 244 221 221 VAL VAL B . n 
F 3 245 PHE 245 222 222 PHE PHE B . n 
F 3 246 ASN 246 223 223 ASN ASN B . n 
F 3 247 PRO 247 224 224 PRO PRO B . n 
F 3 248 GLU 248 225 225 GLU GLU B . n 
F 3 249 GLY 249 226 226 GLY GLY B . n 
F 3 250 ARG 250 227 227 ARG ARG B . n 
F 3 251 ASP 251 228 228 ASP ASP B . n 
F 3 252 LEU 252 229 229 LEU LEU B . n 
F 3 253 ILE 253 230 230 ILE ILE B . n 
F 3 254 THR 254 231 231 THR THR B . n 
F 3 255 ASP 255 232 232 ASP ASP B . n 
F 3 256 TRP 256 233 233 TRP TRP B . n 
F 3 257 ASP 257 234 234 ASP ASP B . n 
F 3 258 ASP 258 235 235 ASP ASP B . n 
F 3 259 VAL 259 236 236 VAL VAL B . n 
F 3 260 ILE 260 237 237 ILE ILE B . n 
F 3 261 LEU 261 238 238 LEU LEU B . n 
F 3 262 ALA 262 239 239 ALA ALA B . n 
F 3 263 LEU 263 240 240 LEU LEU B . n 
F 3 264 GLY 264 241 241 GLY GLY B . n 
F 3 265 SER 265 242 242 SER SER B . n 
F 3 266 GLN 266 243 243 GLN GLN B . n 
F 3 267 VAL 267 244 244 VAL VAL B . n 
F 3 268 CYS 268 245 245 CYS CYS B . n 
F 3 269 LYS 269 246 246 LYS LYS B . n 
F 3 270 GLY 270 247 247 GLY GLY B . n 
F 3 271 ILE 271 248 248 ILE ILE B . n 
F 3 272 ARG 272 249 249 ARG ARG B . n 
F 3 273 ASP 273 250 250 ASP ASP B . n 
F 3 274 SER 274 251 251 SER SER B . n 
F 3 275 ILE 275 252 252 ILE ILE B . n 
F 3 276 LYS 276 253 253 LYS LYS B . n 
F 3 277 ASP 277 254 254 ASP ASP B . n 
F 3 278 ILE 278 255 255 ILE ILE B . n 
F 3 279 LEU 279 256 256 LEU LEU B . n 
F 3 280 GLY 280 257 257 GLY GLY B . n 
F 3 281 TYR 281 258 258 TYR TYR B . n 
F 3 282 THR 282 259 259 THR THR B . n 
F 3 283 THR 283 260 260 THR THR B . n 
F 3 284 SER 284 261 261 SER SER B . n 
F 3 285 CYS 285 262 262 CYS CYS B . n 
F 3 286 GLY 286 263 263 GLY GLY B . n 
F 3 287 LEU 287 264 264 LEU LEU B . n 
F 3 288 SER 288 265 265 SER SER B . n 
F 3 289 SER 289 266 266 SER SER B . n 
F 3 290 THR 290 267 267 THR THR B . n 
F 3 291 LYS 291 268 268 LYS LYS B . n 
F 3 292 ASN 292 269 269 ASN ASN B . n 
F 3 293 VAL 293 270 270 VAL VAL B . n 
F 3 294 CYS 294 271 271 CYS CYS B . n 
F 3 295 LYS 295 272 272 LYS LYS B . n 
F 3 296 LEU 296 273 273 LEU LEU B . n 
F 3 297 ALA 297 274 274 ALA ALA B . n 
F 3 298 SER 298 275 275 SER SER B . n 
F 3 299 ASN 299 276 276 ASN ASN B . n 
F 3 300 TYR 300 277 277 TYR TYR B . n 
F 3 301 LYS 301 278 278 LYS LYS B . n 
F 3 302 LYS 302 279 279 LYS LYS B . n 
F 3 303 PRO 303 280 280 PRO PRO B . n 
F 3 304 ASP 304 281 281 ASP ASP B . n 
F 3 305 ALA 305 282 282 ALA ALA B . n 
F 3 306 GLN 306 283 283 GLN GLN B . n 
F 3 307 THR 307 284 284 THR THR B . n 
F 3 308 ILE 308 285 285 ILE ILE B . n 
F 3 309 VAL 309 286 286 VAL VAL B . n 
F 3 310 LYS 310 287 287 LYS LYS B . n 
F 3 311 ASN 311 288 288 ASN ASN B . n 
F 3 312 ASP 312 289 289 ASP ASP B . n 
F 3 313 CYS 313 290 290 CYS CYS B . n 
F 3 314 LEU 314 291 291 LEU LEU B . n 
F 3 315 LEU 315 292 292 LEU LEU B . n 
F 3 316 ASP 316 293 293 ASP ASP B . n 
F 3 317 PHE 317 294 294 PHE PHE B . n 
F 3 318 LEU 318 295 295 LEU LEU B . n 
F 3 319 ASP 319 296 296 ASP ASP B . n 
F 3 320 CYS 320 297 297 CYS CYS B . n 
F 3 321 GLY 321 298 298 GLY GLY B . n 
F 3 322 LYS 322 299 299 LYS LYS B . n 
F 3 323 PHE 323 300 300 PHE PHE B . n 
F 3 324 GLU 324 301 301 GLU GLU B . n 
F 3 325 ILE 325 302 302 ILE ILE B . n 
F 3 326 THR 326 303 303 THR THR B . n 
F 3 327 SER 327 304 304 SER SER B . n 
F 3 328 PHE 328 305 305 PHE PHE B . n 
F 3 329 TRP 329 306 306 TRP TRP B . n 
F 3 330 THR 330 307 307 THR THR B . n 
F 3 331 LEU 331 308 308 LEU LEU B . n 
F 3 332 GLY 332 309 309 GLY GLY B . n 
F 3 333 GLY 333 310 310 GLY GLY B . n 
F 3 334 VAL 334 311 311 VAL VAL B . n 
F 3 335 LEU 335 312 312 LEU LEU B . n 
F 3 336 GLY 336 313 313 GLY GLY B . n 
F 3 337 LYS 337 314 314 LYS LYS B . n 
F 3 338 GLU 338 315 315 GLU GLU B . n 
F 3 339 LEU 339 316 316 LEU LEU B . n 
F 3 340 ILE 340 317 317 ILE ILE B . n 
F 3 341 ASP 341 318 318 ASP ASP B . n 
F 3 342 VAL 342 319 319 VAL VAL B . n 
F 3 343 LEU 343 320 320 LEU LEU B . n 
F 3 344 ASP 344 321 321 ASP ASP B . n 
F 3 345 LEU 345 322 322 LEU LEU B . n 
F 3 346 PRO 346 323 323 PRO PRO B . n 
F 3 347 HIS 347 324 324 HIS HIS B . n 
F 3 348 GLU 348 325 325 GLU GLU B . n 
F 3 349 ASN 349 326 326 ASN ASN B . n 
F 3 350 SER 350 327 327 SER SER B . n 
F 3 351 ILE 351 328 328 ILE ILE B . n 
F 3 352 LYS 352 329 329 LYS LYS B . n 
F 3 353 HIS 353 330 330 HIS HIS B . n 
F 3 354 ILE 354 331 331 ILE ILE B . n 
F 3 355 ARG 355 332 332 ARG ARG B . n 
F 3 356 GLU 356 333 333 GLU GLU B . n 
F 3 357 THR 357 334 334 THR THR B . n 
F 3 358 TRP 358 335 335 TRP TRP B . n 
F 3 359 PRO 359 336 336 PRO PRO B . n 
F 3 360 ASP 360 337 337 ASP ASP B . n 
F 3 361 ASN 361 338 338 ASN ASN B . n 
F 3 362 ALA 362 339 339 ALA ALA B . n 
F 3 363 GLY 363 340 340 GLY GLY B . n 
F 3 364 GLN 364 341 341 GLN GLN B . n 
F 3 365 LEU 365 342 342 LEU LEU B . n 
F 3 366 LYS 366 343 343 LYS LYS B . n 
F 3 367 GLU 367 344 344 GLU GLU B . n 
F 3 368 PHE 368 345 345 PHE PHE B . n 
F 3 369 LEU 369 346 346 LEU LEU B . n 
F 3 370 ASP 370 347 347 ASP ASP B . n 
F 3 371 ALA 371 348 348 ALA ALA B . n 
F 3 372 LYS 372 349 349 LYS LYS B . n 
F 3 373 VAL 373 350 350 VAL VAL B . n 
F 3 374 LYS 374 351 351 LYS LYS B . n 
F 3 375 GLN 375 352 352 GLN GLN B . n 
F 3 376 SER 376 353 353 SER SER B . n 
F 3 377 ASP 377 354 354 ASP ASP B . n 
F 3 378 TYR 378 355 355 TYR TYR B . n 
F 3 379 ASP 379 356 356 ASP ASP B . n 
F 3 380 ARG 380 357 357 ARG ARG B . n 
F 3 381 SER 381 358 358 SER SER B . n 
F 3 382 THR 382 359 359 THR THR B . n 
F 3 383 SER 383 360 360 SER SER B . n 
F 3 384 ASN 384 361 361 ASN ASN B . n 
F 3 385 ILE 385 362 362 ILE ILE B . n 
F 3 386 ASP 386 363 363 ASP ASP B . n 
F 3 387 PRO 387 364 364 PRO PRO B . n 
F 3 388 LEU 388 365 365 LEU LEU B . n 
F 3 389 LYS 389 366 366 LYS LYS B . n 
F 3 390 THR 390 367 367 THR THR B . n 
F 3 391 ALA 391 368 368 ALA ALA B . n 
F 3 392 ASP 392 369 369 ASP ASP B . n 
F 3 393 LEU 393 370 370 LEU LEU B . n 
F 3 394 ALA 394 371 371 ALA ALA B . n 
F 3 395 GLU 395 372 372 GLU GLU B . n 
F 3 396 LYS 396 373 373 LYS LYS B . n 
F 3 397 LEU 397 374 374 LEU LEU B . n 
F 3 398 PHE 398 375 375 PHE PHE B . n 
F 3 399 LYS 399 376 376 LYS LYS B . n 
F 3 400 LEU 400 377 377 LEU LEU B . n 
F 3 401 SER 401 378 378 SER SER B . n 
F 3 402 ARG 402 379 379 ARG ARG B . n 
F 3 403 GLY 403 380 380 GLY GLY B . n 
F 3 404 ARG 404 381 381 ARG ARG B . n 
F 3 405 TYR 405 382 382 TYR TYR B . n 
F 3 406 GLY 406 383 383 GLY GLY B . n 
F 3 407 LEU 407 384 384 LEU LEU B . n 
F 3 408 PRO 408 385 385 PRO PRO B . n 
F 3 409 LEU 409 386 386 LEU LEU B . n 
F 3 410 SER 410 387 387 SER SER B . n 
F 3 411 SER 411 388 388 SER SER B . n 
F 3 412 ARG 412 389 389 ARG ARG B . n 
F 3 413 PRO 413 390 390 PRO PRO B . n 
F 3 414 VAL 414 391 391 VAL VAL B . n 
F 3 415 VAL 415 392 392 VAL VAL B . n 
F 3 416 LYS 416 393 393 LYS LYS B . n 
F 3 417 SER 417 394 394 SER SER B . n 
F 3 418 MET 418 395 395 MET MET B . n 
F 3 419 MET 419 396 396 MET MET B . n 
F 3 420 SER 420 397 397 SER SER B . n 
F 3 421 ASN 421 398 398 ASN ASN B . n 
F 3 422 LYS 422 399 399 LYS LYS B . n 
F 3 423 ASN 423 400 400 ASN ASN B . n 
F 3 424 LEU 424 401 401 LEU LEU B . n 
F 3 425 ARG 425 402 402 ARG ARG B . n 
F 3 426 GLY 426 403 403 GLY GLY B . n 
F 3 427 LYS 427 404 404 LYS LYS B . n 
F 3 428 SER 428 405 405 SER SER B . n 
F 3 429 CYS 429 406 406 CYS CYS B . n 
F 3 430 ASN 430 407 407 ASN ASN B . n 
F 3 431 SER 431 408 408 SER SER B . n 
F 3 432 ILE 432 409 409 ILE ILE B . n 
F 3 433 VAL 433 410 410 VAL VAL B . n 
F 3 434 ASP 434 411 411 ASP ASP B . n 
F 3 435 CYS 435 412 412 CYS CYS B . n 
F 3 436 ILE 436 413 413 ILE ILE B . n 
F 3 437 SER 437 414 414 SER SER B . n 
F 3 438 TRP 438 415 415 TRP TRP B . n 
F 3 439 LEU 439 416 416 LEU LEU B . n 
F 3 440 GLU 440 417 417 GLU GLU B . n 
F 3 441 VAL 441 418 418 VAL VAL B . n 
F 3 442 PHE 442 419 419 PHE PHE B . n 
F 3 443 CYS 443 420 420 CYS CYS B . n 
F 3 444 ALA 444 421 421 ALA ALA B . n 
F 3 445 GLU 445 422 422 GLU GLU B . n 
F 3 446 LEU 446 423 423 LEU LEU B . n 
F 3 447 THR 447 424 424 THR THR B . n 
F 3 448 SER 448 425 425 SER SER B . n 
F 3 449 ARG 449 426 426 ARG ARG B . n 
F 3 450 ILE 450 427 427 ILE ILE B . n 
F 3 451 GLN 451 428 428 GLN GLN B . n 
F 3 452 ASP 452 429 429 ASP ASP B . n 
F 3 453 LEU 453 430 430 LEU LEU B . n 
F 3 454 GLU 454 431 431 GLU GLU B . n 
F 3 455 GLN 455 432 432 GLN GLN B . n 
F 3 456 GLU 456 433 433 GLU GLU B . n 
F 3 457 TYR 457 434 434 TYR TYR B . n 
F 3 458 ASN 458 435 435 ASN ASN B . n 
F 3 459 LYS 459 436 436 LYS LYS B . n 
F 3 460 ILE 460 437 437 ILE ILE B . n 
F 3 461 VAL 461 438 438 VAL VAL B . n 
F 3 462 ILE 462 439 439 ILE ILE B . n 
F 3 463 PRO 463 440 440 PRO PRO B . n 
F 3 464 ARG 464 441 441 ARG ARG B . n 
F 3 465 THR 465 442 442 THR THR B . n 
F 3 466 VAL 466 443 443 VAL VAL B . n 
F 3 467 SER 467 444 444 SER SER B . n 
F 3 468 ILE 468 445 445 ILE ILE B . n 
F 3 469 SER 469 446 446 SER SER B . n 
F 3 470 LEU 470 447 447 LEU LEU B . n 
F 3 471 LYS 471 448 448 LYS LYS B . n 
F 3 472 THR 472 449 449 THR THR B . n 
F 3 473 LYS 473 450 450 LYS LYS B . n 
F 3 474 SER 474 451 451 SER SER B . n 
F 3 475 TYR 475 452 452 TYR TYR B . n 
F 3 476 GLU 476 453 453 GLU GLU B . n 
F 3 477 VAL 477 454 454 VAL VAL B . n 
F 3 478 TYR 478 455 455 TYR TYR B . n 
F 3 479 ARG 479 456 456 ARG ARG B . n 
F 3 480 LYS 480 457 457 LYS LYS B . n 
F 3 481 SER 481 458 458 SER SER B . n 
F 3 482 GLY 482 459 459 GLY GLY B . n 
F 3 483 PRO 483 460 460 PRO PRO B . n 
F 3 484 VAL 484 461 461 VAL VAL B . n 
F 3 485 ALA 485 462 462 ALA ALA B . n 
F 3 486 TYR 486 463 463 TYR TYR B . n 
F 3 487 LYS 487 464 464 LYS LYS B . n 
F 3 488 GLY 488 465 465 GLY GLY B . n 
F 3 489 ILE 489 466 466 ILE ILE B . n 
F 3 490 ASN 490 467 467 ASN ASN B . n 
F 3 491 PHE 491 468 468 PHE PHE B . n 
F 3 492 GLN 492 469 469 GLN GLN B . n 
F 3 493 SER 493 470 470 SER SER B . n 
F 3 494 HIS 494 471 471 HIS HIS B . n 
F 3 495 GLU 495 472 472 GLU GLU B . n 
F 3 496 LEU 496 473 473 LEU LEU B . n 
F 3 497 LEU 497 474 474 LEU LEU B . n 
F 3 498 LYS 498 475 475 LYS LYS B . n 
F 3 499 VAL 499 476 476 VAL VAL B . n 
F 3 500 GLY 500 477 477 GLY GLY B . n 
F 3 501 ILE 501 478 478 ILE ILE B . n 
F 3 502 LYS 502 479 479 LYS LYS B . n 
F 3 503 PHE 503 480 480 PHE PHE B . n 
F 3 504 VAL 504 481 481 VAL VAL B . n 
F 3 505 THR 505 482 482 THR THR B . n 
F 3 506 ASP 506 483 483 ASP ASP B . n 
F 3 507 LEU 507 484 484 LEU LEU B . n 
F 3 508 ASP 508 485 485 ASP ASP B . n 
F 3 509 ILE 509 486 486 ILE ILE B . n 
F 3 510 LYS 510 487 487 LYS LYS B . n 
F 3 511 GLY 511 488 488 GLY GLY B . n 
F 3 512 LYS 512 489 489 LYS LYS B . n 
F 3 513 ASN 513 490 490 ASN ASN B . n 
F 3 514 LYS 514 491 491 LYS LYS B . n 
F 3 515 SER 515 492 492 SER SER B . n 
F 3 516 TYR 516 493 493 TYR TYR B . n 
F 3 517 TYR 517 494 494 TYR TYR B . n 
F 3 518 PRO 518 495 495 PRO PRO B . n 
F 3 519 LEU 519 496 496 LEU LEU B . n 
F 3 520 THR 520 497 497 THR THR B . n 
F 3 521 LYS 521 498 498 LYS LYS B . n 
F 3 522 LEU 522 499 499 LEU LEU B . n 
F 3 523 SER 523 500 500 SER SER B . n 
F 3 524 MET 524 501 501 MET MET B . n 
F 3 525 THR 525 502 502 THR THR B . n 
F 3 526 ILE 526 503 503 ILE ILE B . n 
F 3 527 THR 527 504 504 THR THR B . n 
F 3 528 ASN 528 505 505 ASN ASN B . n 
F 3 529 PHE 529 506 506 PHE PHE B . n 
F 3 530 ASP 530 507 507 ASP ASP B . n 
F 3 531 ILE 531 508 508 ILE ILE B . n 
F 3 532 ILE 532 509 509 ILE ILE B . n 
F 3 533 ASP 533 510 ?   ?   ?   B . n 
F 3 534 LEU 534 511 ?   ?   ?   B . n 
F 3 535 GLN 535 512 ?   ?   ?   B . n 
F 3 536 LYS 536 513 ?   ?   ?   B . n 
F 3 537 THR 537 514 ?   ?   ?   B . n 
F 3 538 VAL 538 515 ?   ?   ?   B . n 
F 3 539 VAL 539 516 ?   ?   ?   B . n 
F 3 540 ASP 540 517 ?   ?   ?   B . n 
F 3 541 MET 541 518 ?   ?   ?   B . n 
F 3 542 PHE 542 519 ?   ?   ?   B . n 
F 3 543 GLY 543 520 ?   ?   ?   B . n 
F 3 544 ASN 544 521 ?   ?   ?   B . n 
F 3 545 GLN 545 522 ?   ?   ?   B . n 
F 3 546 VAL 546 523 ?   ?   ?   B . n 
F 3 547 HIS 547 524 ?   ?   ?   B . n 
F 3 548 THR 548 525 ?   ?   ?   B . n 
F 3 549 PHE 549 526 ?   ?   ?   B . n 
F 3 550 LYS 550 527 ?   ?   ?   B . n 
F 3 551 SER 551 528 ?   ?   ?   B . n 
F 3 552 SER 552 529 ?   ?   ?   B . n 
F 3 553 ALA 553 530 ?   ?   ?   B . n 
F 3 554 GLY 554 531 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,I,J,K,O,P,S 
2 1 C,D,F,H,L,M,N,Q,R,T 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N7  ? B DG  1   ? U DG  4    ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N1  ? G CPT .   ? U CPT 45   ? 1_555 89.5  ? 
2  N7  ? B DG  1   ? U DG  4    ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N2  ? G CPT .   ? U CPT 45   ? 1_555 176.2 ? 
3  N1  ? G CPT .   ? U CPT 45   ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N2  ? G CPT .   ? U CPT 45   ? 1_555 89.8  ? 
4  N7  ? B DG  1   ? U DG  4    ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N7  ? B DG  2   ? U DG  5    ? 1_555 91.9  ? 
5  N1  ? G CPT .   ? U CPT 45   ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N7  ? B DG  2   ? U DG  5    ? 1_555 177.8 ? 
6  N2  ? G CPT .   ? U CPT 45   ? 1_555 PT1 ? G CPT . ? U CPT 45   ? 1_555 N7  ? B DG  2   ? U DG  5    ? 1_555 88.7  ? 
7  N7  ? D DG  1   ? T DG  4    ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N1  ? H CPT .   ? T CPT 45   ? 1_555 89.0  ? 
8  N7  ? D DG  1   ? T DG  4    ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N2  ? H CPT .   ? T CPT 45   ? 1_555 176.7 ? 
9  N1  ? H CPT .   ? T CPT 45   ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N2  ? H CPT .   ? T CPT 45   ? 1_555 90.1  ? 
10 N7  ? D DG  1   ? T DG  4    ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N7  ? D DG  2   ? T DG  5    ? 1_555 90.0  ? 
11 N1  ? H CPT .   ? T CPT 45   ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N7  ? D DG  2   ? T DG  5    ? 1_555 178.6 ? 
12 N2  ? H CPT .   ? T CPT 45   ? 1_555 PT1 ? H CPT . ? T CPT 45   ? 1_555 N7  ? D DG  2   ? T DG  5    ? 1_555 91.0  ? 
13 OD1 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O   ? E MET 54  ? A MET 31   ? 1_555 69.0  ? 
14 OD1 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 OD1 ? E ASP 178 ? A ASP 155  ? 1_555 110.4 ? 
15 O   ? E MET 54  ? A MET 31   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 OD1 ? E ASP 178 ? A ASP 155  ? 1_555 83.7  ? 
16 OD1 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O2B ? K DCP .   ? A DCP 2001 ? 1_555 144.2 ? 
17 O   ? E MET 54  ? A MET 31   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O2B ? K DCP .   ? A DCP 2001 ? 1_555 83.3  ? 
18 OD1 ? E ASP 178 ? A ASP 155  ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O2B ? K DCP .   ? A DCP 2001 ? 1_555 87.8  ? 
19 OD1 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O3G ? K DCP .   ? A DCP 2001 ? 1_555 78.2  ? 
20 O   ? E MET 54  ? A MET 31   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O3G ? K DCP .   ? A DCP 2001 ? 1_555 71.7  ? 
21 OD1 ? E ASP 178 ? A ASP 155  ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O3G ? K DCP .   ? A DCP 2001 ? 1_555 149.2 ? 
22 O2B ? K DCP .   ? A DCP 2001 ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O3G ? K DCP .   ? A DCP 2001 ? 1_555 71.6  ? 
23 OD1 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 114.7 ? 
24 O   ? E MET 54  ? A MET 31   ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 171.1 ? 
25 OD1 ? E ASP 178 ? A ASP 155  ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 101.8 ? 
26 O2B ? K DCP .   ? A DCP 2001 ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 89.9  ? 
27 O3G ? K DCP .   ? A DCP 2001 ? 1_555 CA  ? J CA  . ? A CA  1502 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 100.8 ? 
28 OD2 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 OE1 ? E GLU 179 ? A GLU 156  ? 1_555 65.9  ? 
29 OD2 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 O   ? S HOH .   ? A HOH 2004 ? 1_555 62.5  ? 
30 OE1 ? E GLU 179 ? A GLU 156  ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 O   ? S HOH .   ? A HOH 2004 ? 1_555 95.1  ? 
31 OD2 ? E ASP 53  ? A ASP 30   ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 70.4  ? 
32 OE1 ? E GLU 179 ? A GLU 156  ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 94.2  ? 
33 O   ? S HOH .   ? A HOH 2004 ? 1_555 CA  ? I CA  . ? A CA  1501 ? 1_555 O1A ? K DCP .   ? A DCP 2001 ? 1_555 122.5 ? 
34 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 48.3  ? 
35 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O   ? F MET 54  ? B MET 31   ? 1_555 61.2  ? 
36 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O   ? F MET 54  ? B MET 31   ? 1_555 104.7 ? 
37 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 98.1  ? 
38 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 73.1  ? 
39 O   ? F MET 54  ? B MET 31   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 96.3  ? 
40 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1G ? N DCP .   ? B DCP 3001 ? 1_555 71.5  ? 
41 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1G ? N DCP .   ? B DCP 3001 ? 1_555 88.9  ? 
42 O   ? F MET 54  ? B MET 31   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1G ? N DCP .   ? B DCP 3001 ? 1_555 91.8  ? 
43 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1G ? N DCP .   ? B DCP 3001 ? 1_555 161.6 ? 
44 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 127.3 ? 
45 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 87.6  ? 
46 O   ? F MET 54  ? B MET 31   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 166.4 ? 
47 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 92.8  ? 
48 O1G ? N DCP .   ? B DCP 3001 ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 82.4  ? 
49 OD1 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 126.7 ? 
50 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 170.1 ? 
51 O   ? F MET 54  ? B MET 31   ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 75.3  ? 
52 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 116.8 ? 
53 O1G ? N DCP .   ? B DCP 3001 ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 81.2  ? 
54 O1A ? N DCP .   ? B DCP 3001 ? 1_555 CA  ? M CA  . ? B CA  1702 ? 1_555 O2B ? N DCP .   ? B DCP 3001 ? 1_555 91.6  ? 
55 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 66.8  ? 
56 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OD2 ? F ASP 178 ? B ASP 155  ? 1_555 101.6 ? 
57 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OD2 ? F ASP 178 ? B ASP 155  ? 1_555 46.8  ? 
58 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OE1 ? F GLU 179 ? B GLU 156  ? 1_555 74.4  ? 
59 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OE1 ? F GLU 179 ? B GLU 156  ? 1_555 124.3 ? 
60 OD2 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 OE1 ? F GLU 179 ? B GLU 156  ? 1_555 109.4 ? 
61 OD2 ? F ASP 53  ? B ASP 30   ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 87.2  ? 
62 OD1 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 76.3  ? 
63 OD2 ? F ASP 178 ? B ASP 155  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 108.4 ? 
64 OE1 ? F GLU 179 ? B GLU 156  ? 1_555 CA  ? L CA  . ? B CA  1701 ? 1_555 O1A ? N DCP .   ? B DCP 3001 ? 1_555 140.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-12-11 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER phasing          .   ? 1 
CNS    refinement       1.1 ? 2 
XDS    'data reduction' .   ? 3 
XDS    'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N3    U DG 4 ? ? C4    U DG 4 ? ? 1.394 1.350 0.044  0.007 N 
2 1 N7    U DG 4 ? ? C8    U DG 4 ? ? 1.246 1.305 -0.059 0.006 N 
3 1 "O3'" T DG 5 ? ? "C3'" T DG 5 ? ? 1.514 1.435 0.079  0.013 N 
4 1 N3    T DG 5 ? ? C4    T DG 5 ? ? 1.399 1.350 0.049  0.007 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C4'" U DG 4 ? ? "C3'" U DG 4 ? ? "C2'" U DG 4 ? ? 95.35  102.20 -6.85  0.70 N 
2  1 "O4'" U DG 4 ? ? "C1'" U DG 4 ? ? N9    U DG 4 ? ? 113.16 108.30 4.86   0.30 N 
3  1 N7    U DG 4 ? ? C8    U DG 4 ? ? N9    U DG 4 ? ? 116.84 113.10 3.74   0.50 N 
4  1 C8    U DG 4 ? ? N9    U DG 4 ? ? C4    U DG 4 ? ? 103.58 106.40 -2.82  0.40 N 
5  1 N3    U DG 5 ? ? C2    U DG 5 ? ? N2    U DG 5 ? ? 124.50 119.90 4.60   0.70 N 
6  1 "O4'" T DG 4 ? ? "C1'" T DG 4 ? ? N9    T DG 4 ? ? 115.61 108.30 7.31   0.30 N 
7  1 "O3'" T DG 4 ? ? P     T DG 5 ? ? "O5'" T DG 5 ? ? 80.02  104.00 -23.98 1.90 Y 
8  1 "O3'" T DG 4 ? ? P     T DG 5 ? ? OP1   T DG 5 ? ? 117.96 110.50 7.46   1.10 Y 
9  1 "O5'" T DG 5 ? ? P     T DG 5 ? ? OP1   T DG 5 ? ? 82.62  105.70 -23.08 0.90 N 
10 1 "O5'" T DG 5 ? ? P     T DG 5 ? ? OP2   T DG 5 ? ? 87.04  105.70 -18.66 0.90 N 
11 1 N3    T DG 5 ? ? C2    T DG 5 ? ? N2    T DG 5 ? ? 125.05 119.90 5.15   0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 1   ? ? 179.61  139.47  
2  1 ALA A 33  ? ? 31.15   57.28   
3  1 PHE A 34  ? ? -39.51  -74.40  
4  1 TRP A 56  ? ? 67.00   -101.96 
5  1 HIS A 105 ? ? -110.30 60.28   
6  1 LYS A 117 ? ? -69.56  85.83   
7  1 ASP A 147 ? ? -89.89  35.23   
8  1 LEU A 148 ? ? 179.05  100.88  
9  1 THR A 178 ? ? -152.43 -135.49 
10 1 LEU A 181 ? ? -164.75 117.06  
11 1 LEU A 187 ? ? -111.37 60.09   
12 1 PHE A 222 ? ? -56.33  91.72   
13 1 SER A 265 ? ? -179.91 -174.97 
14 1 ASP A 281 ? ? 37.89   58.71   
15 1 THR A 307 ? ? 56.32   15.87   
16 1 VAL A 319 ? ? -90.72  -64.88  
17 1 LEU A 320 ? ? -68.84  4.05    
18 1 LYS A 351 ? ? -104.24 56.49   
19 1 SER A 353 ? ? -91.47  47.86   
20 1 ARG A 357 ? ? -73.81  33.03   
21 1 SER A 358 ? ? -123.01 -61.61  
22 1 LEU A 365 ? ? -66.43  3.96    
23 1 LYS A 404 ? ? -97.77  35.60   
24 1 SER A 405 ? ? -56.31  -83.10  
25 1 CYS A 406 ? ? -69.46  80.94   
26 1 ASN A 467 ? ? 37.95   44.77   
27 1 PHE A 468 ? ? -62.04  83.58   
28 1 GLN A 469 ? ? -75.01  35.25   
29 1 SER A 470 ? ? -143.93 10.66   
30 1 HIS A 471 ? ? -139.69 -61.08  
31 1 TYR A 493 ? ? -144.42 -88.54  
32 1 ASN A 505 ? ? 48.84   82.27   
33 1 ILE A 508 ? ? -72.78  47.32   
34 1 SER B 22  ? ? 84.34   -20.09  
35 1 ALA B 33  ? ? 36.93   59.02   
36 1 PHE B 34  ? ? -44.84  -79.05  
37 1 TRP B 56  ? ? 63.93   -95.77  
38 1 ASN B 86  ? ? -95.40  31.61   
39 1 ASP B 100 ? ? -95.94  52.48   
40 1 SER B 120 ? ? -52.78  108.54  
41 1 LEU B 148 ? ? -160.69 95.18   
42 1 SER B 153 ? ? -179.68 -163.72 
43 1 THR B 178 ? ? -137.98 -107.98 
44 1 ASP B 180 ? ? -153.63 10.60   
45 1 LEU B 187 ? ? -118.32 50.81   
46 1 TYR B 199 ? ? -172.72 139.49  
47 1 ASN B 223 ? ? -164.90 61.87   
48 1 SER B 265 ? ? -175.98 -175.86 
49 1 ASP B 281 ? ? -81.20  -133.10 
50 1 ALA B 282 ? ? 67.53   152.59  
51 1 THR B 307 ? ? 72.70   -16.09  
52 1 GLU B 325 ? ? -172.13 131.88  
53 1 ASP B 337 ? ? -178.62 -48.94  
54 1 GLN B 352 ? ? -98.30  -155.60 
55 1 ASP B 354 ? ? -106.54 56.21   
56 1 THR B 359 ? ? -103.30 56.24   
57 1 PRO B 364 ? ? -57.48  -4.60   
58 1 LYS B 366 ? ? -148.50 40.39   
59 1 VAL B 391 ? ? -47.55  151.33  
60 1 LYS B 404 ? ? -91.15  33.22   
61 1 THR B 449 ? ? -64.44  -171.70 
62 1 ASN B 467 ? ? 70.96   -84.70  
63 1 PHE B 468 ? ? -26.20  92.87   
64 1 GLN B 469 ? ? -99.27  -92.92  
65 1 SER B 470 ? ? 53.94   -99.18  
66 1 ASN B 505 ? ? 58.56   70.37   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 Q DG  13  ? "O3'" ? A DG  9   "O3'" 
2   1 Y 1 P DG  13  ? "O3'" ? C DG  9   "O3'" 
3   1 Y 0 A ARG 0   ? CB    ? E ARG 23  CB    
4   1 Y 0 A ARG 0   ? CG    ? E ARG 23  CG    
5   1 Y 0 A ARG 0   ? CD    ? E ARG 23  CD    
6   1 Y 0 A ARG 0   ? NE    ? E ARG 23  NE    
7   1 Y 0 A ARG 0   ? CZ    ? E ARG 23  CZ    
8   1 Y 0 A ARG 0   ? NH1   ? E ARG 23  NH1   
9   1 Y 0 A ARG 0   ? NH2   ? E ARG 23  NH2   
10  1 Y 0 A GLU 20  ? CG    ? E GLU 43  CG    
11  1 Y 0 A GLU 20  ? CD    ? E GLU 43  CD    
12  1 Y 0 A GLU 20  ? OE1   ? E GLU 43  OE1   
13  1 Y 0 A GLU 20  ? OE2   ? E GLU 43  OE2   
14  1 Y 0 A ILE 77  ? CD1   ? E ILE 100 CD1   
15  1 Y 0 A GLU 122 ? CG    ? E GLU 145 CG    
16  1 Y 0 A GLU 122 ? CD    ? E GLU 145 CD    
17  1 Y 0 A GLU 122 ? OE1   ? E GLU 145 OE1   
18  1 Y 0 A GLU 122 ? OE2   ? E GLU 145 OE2   
19  1 Y 0 A ASP 180 ? CG    ? E ASP 203 CG    
20  1 Y 0 A ASP 180 ? OD1   ? E ASP 203 OD1   
21  1 Y 0 A ASP 180 ? OD2   ? E ASP 203 OD2   
22  1 Y 0 A LYS 182 ? CG    ? E LYS 205 CG    
23  1 Y 0 A LYS 182 ? CD    ? E LYS 205 CD    
24  1 Y 0 A LYS 182 ? CE    ? E LYS 205 CE    
25  1 Y 0 A LYS 182 ? NZ    ? E LYS 205 NZ    
26  1 Y 0 A GLU 192 ? CD    ? E GLU 215 CD    
27  1 Y 0 A GLU 192 ? OE1   ? E GLU 215 OE1   
28  1 Y 0 A GLU 192 ? OE2   ? E GLU 215 OE2   
29  1 Y 0 A ASP 200 ? CG    ? E ASP 223 CG    
30  1 Y 0 A ASP 200 ? OD1   ? E ASP 223 OD1   
31  1 Y 0 A ASP 200 ? OD2   ? E ASP 223 OD2   
32  1 Y 0 A ASP 318 ? CG    ? E ASP 341 CG    
33  1 Y 0 A ASP 318 ? OD1   ? E ASP 341 OD1   
34  1 Y 0 A ASP 318 ? OD2   ? E ASP 341 OD2   
35  1 Y 0 A LYS 343 ? CD    ? E LYS 366 CD    
36  1 Y 0 A LYS 343 ? CE    ? E LYS 366 CE    
37  1 Y 0 A LYS 343 ? NZ    ? E LYS 366 NZ    
38  1 Y 0 A ASP 354 ? CB    ? E ASP 377 CB    
39  1 Y 0 A ASP 354 ? CG    ? E ASP 377 CG    
40  1 Y 0 A ASP 354 ? OD1   ? E ASP 377 OD1   
41  1 Y 0 A ASP 354 ? OD2   ? E ASP 377 OD2   
42  1 Y 0 A TYR 355 ? CB    ? E TYR 378 CB    
43  1 Y 0 A TYR 355 ? CG    ? E TYR 378 CG    
44  1 Y 0 A TYR 355 ? CD1   ? E TYR 378 CD1   
45  1 Y 0 A TYR 355 ? CD2   ? E TYR 378 CD2   
46  1 Y 0 A TYR 355 ? CE1   ? E TYR 378 CE1   
47  1 Y 0 A TYR 355 ? CE2   ? E TYR 378 CE2   
48  1 Y 0 A TYR 355 ? CZ    ? E TYR 378 CZ    
49  1 Y 0 A TYR 355 ? OH    ? E TYR 378 OH    
50  1 Y 0 A ARG 357 ? CD    ? E ARG 380 CD    
51  1 Y 0 A ARG 357 ? NE    ? E ARG 380 NE    
52  1 Y 0 A ARG 357 ? CZ    ? E ARG 380 CZ    
53  1 Y 0 A ARG 357 ? NH1   ? E ARG 380 NH1   
54  1 Y 0 A ARG 357 ? NH2   ? E ARG 380 NH2   
55  1 Y 0 A THR 359 ? CB    ? E THR 382 CB    
56  1 Y 0 A THR 359 ? OG1   ? E THR 382 OG1   
57  1 Y 0 A THR 359 ? CG2   ? E THR 382 CG2   
58  1 Y 0 A ASP 363 ? CB    ? E ASP 386 CB    
59  1 Y 0 A ASP 363 ? CG    ? E ASP 386 CG    
60  1 Y 0 A ASP 363 ? OD1   ? E ASP 386 OD1   
61  1 Y 0 A ASP 363 ? OD2   ? E ASP 386 OD2   
62  1 Y 0 A GLU 372 ? CB    ? E GLU 395 CB    
63  1 Y 0 A GLU 372 ? CG    ? E GLU 395 CG    
64  1 Y 0 A GLU 372 ? CD    ? E GLU 395 CD    
65  1 Y 0 A GLU 372 ? OE1   ? E GLU 395 OE1   
66  1 Y 0 A GLU 372 ? OE2   ? E GLU 395 OE2   
67  1 Y 0 A ARG 389 ? CG    ? E ARG 412 CG    
68  1 Y 0 A ARG 389 ? CD    ? E ARG 412 CD    
69  1 Y 0 A ARG 389 ? NE    ? E ARG 412 NE    
70  1 Y 0 A ARG 389 ? CZ    ? E ARG 412 CZ    
71  1 Y 0 A ARG 389 ? NH1   ? E ARG 412 NH1   
72  1 Y 0 A ARG 389 ? NH2   ? E ARG 412 NH2   
73  1 Y 0 A LYS 393 ? CE    ? E LYS 416 CE    
74  1 Y 0 A LYS 393 ? NZ    ? E LYS 416 NZ    
75  1 Y 0 A ARG 402 ? CG    ? E ARG 425 CG    
76  1 Y 0 A ARG 402 ? CD    ? E ARG 425 CD    
77  1 Y 0 A ARG 402 ? NE    ? E ARG 425 NE    
78  1 Y 0 A ARG 402 ? CZ    ? E ARG 425 CZ    
79  1 Y 0 A ARG 402 ? NH1   ? E ARG 425 NH1   
80  1 Y 0 A ARG 402 ? NH2   ? E ARG 425 NH2   
81  1 Y 0 A GLN 428 ? CG    ? E GLN 451 CG    
82  1 Y 0 A GLN 428 ? CD    ? E GLN 451 CD    
83  1 Y 0 A GLN 428 ? OE1   ? E GLN 451 OE1   
84  1 Y 0 A GLN 428 ? NE2   ? E GLN 451 NE2   
85  1 Y 0 A LYS 436 ? CG    ? E LYS 459 CG    
86  1 Y 0 A LYS 436 ? CD    ? E LYS 459 CD    
87  1 Y 0 A LYS 436 ? CE    ? E LYS 459 CE    
88  1 Y 0 A LYS 436 ? NZ    ? E LYS 459 NZ    
89  1 Y 0 A GLN 469 ? CD    ? E GLN 492 CD    
90  1 Y 0 A GLN 469 ? OE1   ? E GLN 492 OE1   
91  1 Y 0 A GLN 469 ? NE2   ? E GLN 492 NE2   
92  1 Y 0 A SER 470 ? CB    ? E SER 493 CB    
93  1 Y 0 A SER 470 ? OG    ? E SER 493 OG    
94  1 Y 0 B LYS 17  ? CG    ? F LYS 40  CG    
95  1 Y 0 B LYS 17  ? CD    ? F LYS 40  CD    
96  1 Y 0 B LYS 17  ? CE    ? F LYS 40  CE    
97  1 Y 0 B LYS 17  ? NZ    ? F LYS 40  NZ    
98  1 Y 0 B LYS 47  ? CG    ? F LYS 70  CG    
99  1 Y 0 B LYS 47  ? CD    ? F LYS 70  CD    
100 1 Y 0 B LYS 47  ? CE    ? F LYS 70  CE    
101 1 Y 0 B LYS 47  ? NZ    ? F LYS 70  NZ    
102 1 Y 0 B SER 72  ? OG    ? F SER 95  OG    
103 1 Y 0 B ILE 77  ? CD1   ? F ILE 100 CD1   
104 1 Y 0 B LYS 82  ? CG    ? F LYS 105 CG    
105 1 Y 0 B LYS 82  ? CD    ? F LYS 105 CD    
106 1 Y 0 B LYS 82  ? CE    ? F LYS 105 CE    
107 1 Y 0 B LYS 82  ? NZ    ? F LYS 105 NZ    
108 1 Y 0 B SER 110 ? OG    ? F SER 133 OG    
109 1 Y 0 B LYS 117 ? NZ    ? F LYS 140 NZ    
110 1 Y 0 B LYS 143 ? CE    ? F LYS 166 CE    
111 1 Y 0 B LYS 143 ? NZ    ? F LYS 166 NZ    
112 1 Y 0 B GLU 174 ? OE2   ? F GLU 197 OE2   
113 1 Y 0 B ASP 180 ? CG    ? F ASP 203 CG    
114 1 Y 0 B ASP 180 ? OD1   ? F ASP 203 OD1   
115 1 Y 0 B ASP 180 ? OD2   ? F ASP 203 OD2   
116 1 Y 0 B LYS 182 ? CG    ? F LYS 205 CG    
117 1 Y 0 B LYS 182 ? CD    ? F LYS 205 CD    
118 1 Y 0 B LYS 182 ? CE    ? F LYS 205 CE    
119 1 Y 0 B LYS 182 ? NZ    ? F LYS 205 NZ    
120 1 Y 0 B LYS 211 ? CE    ? F LYS 234 CE    
121 1 Y 0 B LYS 211 ? NZ    ? F LYS 234 NZ    
122 1 Y 0 B LYS 278 ? CE    ? F LYS 301 CE    
123 1 Y 0 B LYS 278 ? NZ    ? F LYS 301 NZ    
124 1 Y 0 B GLU 344 ? CG    ? F GLU 367 CG    
125 1 Y 0 B GLU 344 ? CD    ? F GLU 367 CD    
126 1 Y 0 B GLU 344 ? OE1   ? F GLU 367 OE1   
127 1 Y 0 B GLU 344 ? OE2   ? F GLU 367 OE2   
128 1 Y 0 B LEU 346 ? CG    ? F LEU 369 CG    
129 1 Y 0 B LEU 346 ? CD1   ? F LEU 369 CD1   
130 1 Y 0 B LEU 346 ? CD2   ? F LEU 369 CD2   
131 1 Y 0 B SER 353 ? CB    ? F SER 376 CB    
132 1 Y 0 B SER 353 ? OG    ? F SER 376 OG    
133 1 Y 0 B ASP 354 ? CB    ? F ASP 377 CB    
134 1 Y 0 B ASP 354 ? CG    ? F ASP 377 CG    
135 1 Y 0 B ASP 354 ? OD1   ? F ASP 377 OD1   
136 1 Y 0 B ASP 354 ? OD2   ? F ASP 377 OD2   
137 1 Y 0 B ASP 356 ? CB    ? F ASP 379 CB    
138 1 Y 0 B ASP 356 ? CG    ? F ASP 379 CG    
139 1 Y 0 B ASP 356 ? OD1   ? F ASP 379 OD1   
140 1 Y 0 B ASP 356 ? OD2   ? F ASP 379 OD2   
141 1 Y 0 B THR 359 ? OG1   ? F THR 382 OG1   
142 1 Y 0 B THR 359 ? CG2   ? F THR 382 CG2   
143 1 Y 0 B LYS 366 ? NZ    ? F LYS 389 NZ    
144 1 Y 0 B GLU 372 ? CG    ? F GLU 395 CG    
145 1 Y 0 B GLU 372 ? CD    ? F GLU 395 CD    
146 1 Y 0 B GLU 372 ? OE1   ? F GLU 395 OE1   
147 1 Y 0 B GLU 372 ? OE2   ? F GLU 395 OE2   
148 1 Y 0 B ARG 402 ? CG    ? F ARG 425 CG    
149 1 Y 0 B ARG 402 ? CD    ? F ARG 425 CD    
150 1 Y 0 B ARG 402 ? NE    ? F ARG 425 NE    
151 1 Y 0 B ARG 402 ? CZ    ? F ARG 425 CZ    
152 1 Y 0 B ARG 402 ? NH1   ? F ARG 425 NH1   
153 1 Y 0 B ARG 402 ? NH2   ? F ARG 425 NH2   
154 1 Y 0 B LYS 464 ? CB    ? F LYS 487 CB    
155 1 Y 0 B LYS 464 ? CG    ? F LYS 487 CG    
156 1 Y 0 B LYS 464 ? CD    ? F LYS 487 CD    
157 1 Y 0 B LYS 464 ? CE    ? F LYS 487 CE    
158 1 Y 0 B LYS 464 ? NZ    ? F LYS 487 NZ    
159 1 Y 0 B ILE 466 ? CD1   ? F ILE 489 CD1   
160 1 Y 0 B ASN 467 ? CG    ? F ASN 490 CG    
161 1 Y 0 B ASN 467 ? OD1   ? F ASN 490 OD1   
162 1 Y 0 B ASN 467 ? ND2   ? F ASN 490 ND2   
163 1 Y 0 B PHE 468 ? CB    ? F PHE 491 CB    
164 1 Y 0 B PHE 468 ? CG    ? F PHE 491 CG    
165 1 Y 0 B PHE 468 ? CD1   ? F PHE 491 CD1   
166 1 Y 0 B PHE 468 ? CD2   ? F PHE 491 CD2   
167 1 Y 0 B PHE 468 ? CE1   ? F PHE 491 CE1   
168 1 Y 0 B PHE 468 ? CE2   ? F PHE 491 CE2   
169 1 Y 0 B PHE 468 ? CZ    ? F PHE 491 CZ    
170 1 Y 0 B SER 470 ? CB    ? F SER 493 CB    
171 1 Y 0 B SER 470 ? OG    ? F SER 493 OG    
172 1 Y 0 B LYS 479 ? CD    ? F LYS 502 CD    
173 1 Y 0 B LYS 479 ? CE    ? F LYS 502 CE    
174 1 Y 0 B LYS 479 ? NZ    ? F LYS 502 NZ    
175 1 Y 0 B LYS 489 ? CB    ? F LYS 512 CB    
176 1 Y 0 B LYS 489 ? CG    ? F LYS 512 CG    
177 1 Y 0 B LYS 489 ? CD    ? F LYS 512 CD    
178 1 Y 0 B LYS 489 ? CE    ? F LYS 512 CE    
179 1 Y 0 B LYS 489 ? NZ    ? F LYS 512 NZ    
180 1 Y 0 B ASN 490 ? CB    ? F ASN 513 CB    
181 1 Y 0 B ASN 490 ? CG    ? F ASN 513 CG    
182 1 Y 0 B ASN 490 ? OD1   ? F ASN 513 OD1   
183 1 Y 0 B ASN 490 ? ND2   ? F ASN 513 ND2   
184 1 Y 0 B LYS 491 ? CD    ? F LYS 514 CD    
185 1 Y 0 B LYS 491 ? CE    ? F LYS 514 CE    
186 1 Y 0 B LYS 491 ? NZ    ? F LYS 514 NZ    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -22 ? E MET 1   
2  1 Y 1 A ALA -21 ? E ALA 2   
3  1 Y 1 A SER -20 ? E SER 3   
4  1 Y 1 A TRP -19 ? E TRP 4   
5  1 Y 1 A SER -18 ? E SER 5   
6  1 Y 1 A HIS -17 ? E HIS 6   
7  1 Y 1 A PRO -16 ? E PRO 7   
8  1 Y 1 A GLN -15 ? E GLN 8   
9  1 Y 1 A PHE -14 ? E PHE 9   
10 1 Y 1 A GLU -13 ? E GLU 10  
11 1 Y 1 A LYS -12 ? E LYS 11  
12 1 Y 1 A GLY -11 ? E GLY 12  
13 1 Y 1 A ALA -10 ? E ALA 13  
14 1 Y 1 A SER -9  ? E SER 14  
15 1 Y 1 A THR -8  ? E THR 15  
16 1 Y 1 A SER -7  ? E SER 16  
17 1 Y 1 A LEU -6  ? E LEU 17  
18 1 Y 1 A TYR -5  ? E TYR 18  
19 1 Y 1 A LYS -4  ? E LYS 19  
20 1 Y 1 A LYS -3  ? E LYS 20  
21 1 Y 1 A ALA -2  ? E ALA 21  
22 1 Y 0 A LYS 464 ? E LYS 487 
23 1 Y 0 A GLY 465 ? E GLY 488 
24 1 Y 0 A ILE 466 ? E ILE 489 
25 1 Y 1 A ASP 510 ? E ASP 533 
26 1 Y 1 A LEU 511 ? E LEU 534 
27 1 Y 1 A GLN 512 ? E GLN 535 
28 1 Y 1 A LYS 513 ? E LYS 536 
29 1 Y 1 A THR 514 ? E THR 537 
30 1 Y 1 A VAL 515 ? E VAL 538 
31 1 Y 1 A VAL 516 ? E VAL 539 
32 1 Y 1 A ASP 517 ? E ASP 540 
33 1 Y 1 A MET 518 ? E MET 541 
34 1 Y 1 A PHE 519 ? E PHE 542 
35 1 Y 1 A GLY 520 ? E GLY 543 
36 1 Y 1 A ASN 521 ? E ASN 544 
37 1 Y 1 A GLN 522 ? E GLN 545 
38 1 Y 1 A VAL 523 ? E VAL 546 
39 1 Y 1 A HIS 524 ? E HIS 547 
40 1 Y 1 A THR 525 ? E THR 548 
41 1 Y 1 A PHE 526 ? E PHE 549 
42 1 Y 1 A LYS 527 ? E LYS 550 
43 1 Y 1 A SER 528 ? E SER 551 
44 1 Y 1 A SER 529 ? E SER 552 
45 1 Y 1 A ALA 530 ? E ALA 553 
46 1 Y 1 A GLY 531 ? E GLY 554 
47 1 Y 1 B MET -22 ? F MET 1   
48 1 Y 1 B ALA -21 ? F ALA 2   
49 1 Y 1 B SER -20 ? F SER 3   
50 1 Y 1 B TRP -19 ? F TRP 4   
51 1 Y 1 B SER -18 ? F SER 5   
52 1 Y 1 B HIS -17 ? F HIS 6   
53 1 Y 1 B PRO -16 ? F PRO 7   
54 1 Y 1 B GLN -15 ? F GLN 8   
55 1 Y 1 B PHE -14 ? F PHE 9   
56 1 Y 1 B GLU -13 ? F GLU 10  
57 1 Y 1 B LYS -12 ? F LYS 11  
58 1 Y 1 B GLY -11 ? F GLY 12  
59 1 Y 1 B ALA -10 ? F ALA 13  
60 1 Y 1 B SER -9  ? F SER 14  
61 1 Y 1 B THR -8  ? F THR 15  
62 1 Y 1 B SER -7  ? F SER 16  
63 1 Y 1 B LEU -6  ? F LEU 17  
64 1 Y 1 B TYR -5  ? F TYR 18  
65 1 Y 1 B LYS -4  ? F LYS 19  
66 1 Y 1 B LYS -3  ? F LYS 20  
67 1 Y 1 B ALA -2  ? F ALA 21  
68 1 Y 1 B GLY -1  ? F GLY 22  
69 1 Y 1 B ARG 0   ? F ARG 23  
70 1 Y 1 B ASP 510 ? F ASP 533 
71 1 Y 1 B LEU 511 ? F LEU 534 
72 1 Y 1 B GLN 512 ? F GLN 535 
73 1 Y 1 B LYS 513 ? F LYS 536 
74 1 Y 1 B THR 514 ? F THR 537 
75 1 Y 1 B VAL 515 ? F VAL 538 
76 1 Y 1 B VAL 516 ? F VAL 539 
77 1 Y 1 B ASP 517 ? F ASP 540 
78 1 Y 1 B MET 518 ? F MET 541 
79 1 Y 1 B PHE 519 ? F PHE 542 
80 1 Y 1 B GLY 520 ? F GLY 543 
81 1 Y 1 B ASN 521 ? F ASN 544 
82 1 Y 1 B GLN 522 ? F GLN 545 
83 1 Y 1 B VAL 523 ? F VAL 546 
84 1 Y 1 B HIS 524 ? F HIS 547 
85 1 Y 1 B THR 525 ? F THR 548 
86 1 Y 1 B PHE 526 ? F PHE 549 
87 1 Y 1 B LYS 527 ? F LYS 550 
88 1 Y 1 B SER 528 ? F SER 551 
89 1 Y 1 B SER 529 ? F SER 552 
90 1 Y 1 B ALA 530 ? F ALA 553 
91 1 Y 1 B GLY 531 ? F GLY 554 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2R8J 'double helix'        
2R8J 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1 1_555 B DC 11 1_555 0.440  0.152  0.076  -12.400 -6.440  -6.021 1  Q_DG5:DC14_U Q 5  ? U 14 ? 19 1 
1 A DT 2 1_555 B DA 10 1_555 -0.071 0.488  0.106  -3.270  -10.466 0.003  2  Q_DT6:DA13_U Q 6  ? U 13 ? ?  ? 
1 A DG 3 1_555 B DC 9  1_555 -0.210 0.369  0.039  -3.066  -17.615 3.195  3  Q_DG7:DC12_U Q 7  ? U 12 ? ?  1 
1 A DG 4 1_555 B DC 8  1_555 0.650  0.653  -0.126 4.779   -9.557  11.786 4  Q_DG8:DC11_U Q 8  ? U 11 ? ?  1 
1 A DA 5 1_555 B DT 7  1_555 0.662  0.052  -0.393 1.634   -10.294 2.677  5  Q_DA9:DT10_U Q 9  ? U 10 ? 20 1 
1 A DT 6 1_555 B DA 6  1_555 -0.813 -0.015 -0.340 6.396   -5.084  1.671  6  Q_DT10:DA9_U Q 10 ? U 9  ? 20 1 
1 A DG 7 1_555 B DC 5  1_555 -0.679 0.009  -0.393 7.018   2.959   7.009  7  Q_DG11:DC8_U Q 11 ? U 8  ? 19 1 
1 A DA 8 1_555 B DT 4  1_555 0.277  0.103  -0.682 1.149   -1.016  1.689  8  Q_DA12:DT7_U Q 12 ? U 7  ? 20 1 
1 A DG 9 1_555 B DC 3  1_555 -2.563 0.115  -0.334 -13.532 -13.799 24.884 9  Q_DG13:DC6_U Q 13 ? U 6  ? ?  1 
1 C DG 1 1_555 D DC 11 1_555 0.405  -0.116 0.030  -12.718 -0.919  -6.361 10 P_DG5:DC14_T P 5  ? T 14 ? 19 1 
1 C DT 2 1_555 D DA 10 1_555 -1.138 -0.017 0.106  3.015   -13.411 -3.505 11 P_DT6:DA13_T P 6  ? T 13 ? 20 1 
1 C DG 3 1_555 D DC 9  1_555 -0.434 -0.372 0.469  -4.920  -17.173 -1.991 12 P_DG7:DC12_T P 7  ? T 12 ? 19 1 
1 C DG 4 1_555 D DC 8  1_555 -0.775 -0.202 0.551  1.594   -6.345  3.238  13 P_DG8:DC11_T P 8  ? T 11 ? 19 1 
1 C DA 5 1_555 D DT 7  1_555 0.507  0.016  0.604  1.020   -14.980 -4.370 14 P_DA9:DT10_T P 9  ? T 10 ? 20 1 
1 C DT 6 1_555 D DA 6  1_555 0.349  0.037  0.035  12.383  -6.026  0.291  15 P_DT10:DA9_T P 10 ? T 9  ? 20 1 
1 C DG 7 1_555 D DC 5  1_555 1.120  0.061  -0.701 11.374  1.048   -4.285 16 P_DG11:DC8_T P 11 ? T 8  ? 19 1 
1 C DA 8 1_555 D DT 4  1_555 0.517  0.177  -0.009 5.031   -27.140 -5.513 17 P_DA12:DT7_T P 12 ? T 7  ? 20 1 
1 C DG 9 1_555 D DC 3  1_555 -0.008 -0.269 -0.693 -16.069 -20.387 -5.269 18 P_DG13:DC6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1 1_555 B DC 11 1_555 A DT 2 1_555 B DA 10 1_555 0.303  0.245  3.057 0.518  7.030   30.597 -0.794 -0.468 3.041 13.104  
-0.966  31.380 1  QQ_DG5DT6:DA13DC14_UU Q 5  ? U 14 ? Q 6  ? U 13 ? 
1 A DT 2 1_555 B DA 10 1_555 A DG 3 1_555 B DC 9  1_555 -0.049 2.499  3.432 1.506  -11.437 44.997 4.104  0.185  2.749 -14.661 
-1.931  46.378 2  QQ_DT6DG7:DC12DA13_UU Q 6  ? U 13 ? Q 7  ? U 12 ? 
1 A DG 3 1_555 B DC 9  1_555 A DG 4 1_555 B DC 8  1_555 0.716  0.433  3.275 -1.167 6.773   34.667 -0.299 -1.354 3.274 11.231  
1.935   35.321 3  QQ_DG7DG8:DC11DC12_UU Q 7  ? U 12 ? Q 8  ? U 11 ? 
1 A DG 4 1_555 B DC 8  1_555 A DA 5 1_555 B DT 7  1_555 -0.677 -0.156 3.405 -1.416 4.983   35.274 -1.009 0.891  3.376 8.168   
2.321   35.641 4  QQ_DG8DA9:DT10DC11_UU Q 8  ? U 11 ? Q 9  ? U 10 ? 
1 A DA 5 1_555 B DT 7  1_555 A DT 6 1_555 B DA 6  1_555 0.580  -0.666 3.173 -0.130 5.148   22.447 -3.381 -1.497 2.945 13.005  
0.329   23.023 5  QQ_DA9DT10:DA9DT10_UU Q 9  ? U 10 ? Q 10 ? U 9  ? 
1 A DT 6 1_555 B DA 6  1_555 A DG 7 1_555 B DC 5  1_555 0.863  -0.027 3.389 3.271  15.074  27.759 -2.979 -0.946 3.053 28.778  
-6.244  31.683 6  QQ_DT10DG11:DC8DA9_UU Q 10 ? U 9  ? Q 11 ? U 8  ? 
1 A DG 7 1_555 B DC 5  1_555 A DA 8 1_555 B DT 4  1_555 0.047  -0.671 3.450 0.743  16.018  31.286 -3.547 0.035  2.790 27.552  
-1.278  35.065 7  QQ_DG11DA12:DT7DC8_UU Q 11 ? U 8  ? Q 12 ? U 7  ? 
1 A DA 8 1_555 B DT 4  1_555 A DG 9 1_555 B DC 3  1_555 1.317  -1.323 3.773 -2.686 5.756   21.061 -5.856 -4.567 3.114 15.305  
7.142   21.988 8  QQ_DA12DG13:DC6DT7_UU Q 12 ? U 7  ? Q 13 ? U 6  ? 
1 C DG 1 1_555 D DC 11 1_555 C DT 2 1_555 D DA 10 1_555 0.032  -0.180 2.909 1.540  4.469   25.654 -1.480 0.302  2.834 9.957   
-3.432  26.079 9  PP_DG5DT6:DA13DC14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 C DT 2 1_555 D DA 10 1_555 C DG 3 1_555 D DC 9  1_555 0.097  2.886  3.624 0.078  -16.226 52.347 4.113  -0.101 2.687 -17.910 
-0.086  54.634 10 PP_DT6DG7:DC12DA13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 C DG 3 1_555 D DC 9  1_555 C DG 4 1_555 D DC 8  1_555 0.974  1.354  3.195 0.458  2.795   33.379 1.892  -1.615 3.307 4.854   
-0.796  33.495 11 PP_DG7DG8:DC11DC12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 C DG 4 1_555 D DC 8  1_555 C DA 5 1_555 D DT 7  1_555 -0.840 0.981  3.648 -3.496 -2.498  41.844 1.655  0.766  3.641 -3.487  
4.879   42.054 12 PP_DG8DA9:DT10DC11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 C DA 5 1_555 D DT 7  1_555 C DT 6 1_555 D DA 6  1_555 0.976  -0.825 3.136 4.190  -1.513  33.637 -1.176 -1.012 3.263 -2.601  
-7.201  33.923 13 PP_DA9DT10:DA9DT10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 C DT 6 1_555 D DA 6  1_555 C DG 7 1_555 D DC 5  1_555 0.265  -0.262 3.570 6.200  6.047   31.366 -1.626 0.713  3.450 10.927  
-11.204 32.510 14 PP_DT10DG11:DC8DA9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 C DG 7 1_555 D DC 5  1_555 C DA 8 1_555 D DT 4  1_555 -0.910 0.250  3.382 -6.994 3.910   35.555 -0.179 0.421  3.499 6.304   
11.278  36.418 15 PP_DG11DA12:DT7DC8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 C DA 8 1_555 D DT 4  1_555 C DG 9 1_555 D DC 3  1_555 -0.034 -0.477 3.773 1.674  8.567   37.815 -1.912 0.284  3.580 13.008  
-2.541  38.773 16 PP_DA12DG13:DC6DT7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 Cisplatin                          CPT 
5 'CALCIUM ION'                      CA  
6 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
7 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CPT 1  45   45   CPT CPT U . 
H 4 CPT 1  45   45   CPT CPT T . 
I 5 CA  1  1501 1501 CA  CA  A . 
J 5 CA  1  1502 1502 CA  CA  A . 
K 6 DCP 1  2001 2001 DCP DCP A . 
L 5 CA  1  1701 1701 CA  CA  B . 
M 5 CA  1  1702 1702 CA  CA  B . 
N 6 DCP 1  3001 3001 DCP DCP B . 
O 7 HOH 1  14   58   HOH HOH Q . 
O 7 HOH 2  15   101  HOH HOH Q . 
O 7 HOH 3  16   105  HOH HOH Q . 
O 7 HOH 4  17   141  HOH HOH Q . 
P 7 HOH 1  46   131  HOH HOH U . 
P 7 HOH 2  47   134  HOH HOH U . 
P 7 HOH 3  48   5004 HOH HOH U . 
Q 7 HOH 1  14   39   HOH HOH P . 
Q 7 HOH 2  15   86   HOH HOH P . 
R 7 HOH 1  46   14   HOH HOH T . 
R 7 HOH 2  47   126  HOH HOH T . 
S 7 HOH 1  2002 5    HOH HOH A . 
S 7 HOH 2  2003 6    HOH HOH A . 
S 7 HOH 3  2004 8    HOH HOH A . 
S 7 HOH 4  2005 9    HOH HOH A . 
S 7 HOH 5  2006 11   HOH HOH A . 
S 7 HOH 6  2007 13   HOH HOH A . 
S 7 HOH 7  2008 15   HOH HOH A . 
S 7 HOH 8  2009 18   HOH HOH A . 
S 7 HOH 9  2010 19   HOH HOH A . 
S 7 HOH 10 2011 25   HOH HOH A . 
S 7 HOH 11 2012 29   HOH HOH A . 
S 7 HOH 12 2013 33   HOH HOH A . 
S 7 HOH 13 2014 34   HOH HOH A . 
S 7 HOH 14 2015 36   HOH HOH A . 
S 7 HOH 15 2016 40   HOH HOH A . 
S 7 HOH 16 2017 47   HOH HOH A . 
S 7 HOH 17 2018 51   HOH HOH A . 
S 7 HOH 18 2019 56   HOH HOH A . 
S 7 HOH 19 2020 57   HOH HOH A . 
S 7 HOH 20 2021 60   HOH HOH A . 
S 7 HOH 21 2022 62   HOH HOH A . 
S 7 HOH 22 2023 65   HOH HOH A . 
S 7 HOH 23 2024 69   HOH HOH A . 
S 7 HOH 24 2025 76   HOH HOH A . 
S 7 HOH 25 2026 78   HOH HOH A . 
S 7 HOH 26 2027 79   HOH HOH A . 
S 7 HOH 27 2028 83   HOH HOH A . 
S 7 HOH 28 2029 88   HOH HOH A . 
S 7 HOH 29 2030 90   HOH HOH A . 
S 7 HOH 30 2031 91   HOH HOH A . 
S 7 HOH 31 2032 93   HOH HOH A . 
S 7 HOH 32 2033 98   HOH HOH A . 
S 7 HOH 33 2034 100  HOH HOH A . 
S 7 HOH 34 2035 103  HOH HOH A . 
S 7 HOH 35 2036 107  HOH HOH A . 
S 7 HOH 36 2037 109  HOH HOH A . 
S 7 HOH 37 2038 112  HOH HOH A . 
S 7 HOH 38 2039 120  HOH HOH A . 
S 7 HOH 39 2040 122  HOH HOH A . 
S 7 HOH 40 2041 125  HOH HOH A . 
S 7 HOH 41 2042 130  HOH HOH A . 
S 7 HOH 42 2043 138  HOH HOH A . 
S 7 HOH 43 2044 140  HOH HOH A . 
S 7 HOH 44 2045 146  HOH HOH A . 
S 7 HOH 45 2046 150  HOH HOH A . 
S 7 HOH 46 2047 153  HOH HOH A . 
S 7 HOH 47 2048 158  HOH HOH A . 
S 7 HOH 48 2049 165  HOH HOH A . 
S 7 HOH 49 2050 167  HOH HOH A . 
T 7 HOH 1  3002 5002 HOH HOH B . 
T 7 HOH 2  3003 5003 HOH HOH B . 
T 7 HOH 3  3004 10   HOH HOH B . 
T 7 HOH 4  3005 12   HOH HOH B . 
T 7 HOH 5  3006 17   HOH HOH B . 
T 7 HOH 6  3007 20   HOH HOH B . 
T 7 HOH 7  3008 21   HOH HOH B . 
T 7 HOH 8  3009 24   HOH HOH B . 
T 7 HOH 9  3010 27   HOH HOH B . 
T 7 HOH 10 3011 30   HOH HOH B . 
T 7 HOH 11 3012 31   HOH HOH B . 
T 7 HOH 12 3013 38   HOH HOH B . 
T 7 HOH 13 3014 44   HOH HOH B . 
T 7 HOH 14 3015 50   HOH HOH B . 
T 7 HOH 15 3016 52   HOH HOH B . 
T 7 HOH 16 3017 59   HOH HOH B . 
T 7 HOH 17 3018 61   HOH HOH B . 
T 7 HOH 18 3019 64   HOH HOH B . 
T 7 HOH 19 3020 67   HOH HOH B . 
T 7 HOH 20 3021 73   HOH HOH B . 
T 7 HOH 21 3022 80   HOH HOH B . 
T 7 HOH 22 3023 81   HOH HOH B . 
T 7 HOH 23 3024 84   HOH HOH B . 
T 7 HOH 24 3025 89   HOH HOH B . 
T 7 HOH 25 3026 92   HOH HOH B . 
T 7 HOH 26 3027 94   HOH HOH B . 
T 7 HOH 27 3028 95   HOH HOH B . 
T 7 HOH 28 3029 96   HOH HOH B . 
T 7 HOH 29 3030 104  HOH HOH B . 
T 7 HOH 30 3031 106  HOH HOH B . 
T 7 HOH 31 3032 110  HOH HOH B . 
T 7 HOH 32 3033 113  HOH HOH B . 
T 7 HOH 33 3034 114  HOH HOH B . 
T 7 HOH 34 3035 115  HOH HOH B . 
T 7 HOH 35 3036 116  HOH HOH B . 
T 7 HOH 36 3037 117  HOH HOH B . 
T 7 HOH 37 3038 118  HOH HOH B . 
T 7 HOH 38 3039 121  HOH HOH B . 
T 7 HOH 39 3040 123  HOH HOH B . 
T 7 HOH 40 3041 124  HOH HOH B . 
T 7 HOH 41 3042 127  HOH HOH B . 
T 7 HOH 42 3043 128  HOH HOH B . 
T 7 HOH 43 3044 129  HOH HOH B . 
T 7 HOH 44 3045 132  HOH HOH B . 
T 7 HOH 45 3046 133  HOH HOH B . 
T 7 HOH 46 3047 136  HOH HOH B . 
T 7 HOH 47 3048 137  HOH HOH B . 
T 7 HOH 48 3049 139  HOH HOH B . 
T 7 HOH 49 3050 144  HOH HOH B . 
T 7 HOH 50 3051 145  HOH HOH B . 
T 7 HOH 51 3052 148  HOH HOH B . 
T 7 HOH 52 3053 151  HOH HOH B . 
T 7 HOH 53 3054 152  HOH HOH B . 
T 7 HOH 54 3055 154  HOH HOH B . 
T 7 HOH 55 3056 156  HOH HOH B . 
T 7 HOH 56 3057 157  HOH HOH B . 
T 7 HOH 57 3058 159  HOH HOH B . 
T 7 HOH 58 3059 160  HOH HOH B . 
T 7 HOH 59 3060 161  HOH HOH B . 
T 7 HOH 60 3061 164  HOH HOH B . 
T 7 HOH 61 3062 166  HOH HOH B . 
#