data_2RLI
# 
_entry.id   2RLI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2RLI         
RCSB  RCSB150004   
WWPDB D_1000150004 
# 
_pdbx_database_related.db_id          11001 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2RLI 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-07-11 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'                               1 
'Bertini, I.'                             2 
'Ciofi-baffoni, S.'                       3 
'Gerothanassis, I.P.'                     4 
'Leontari, I.'                            5 
'Martinelli, M.'                          6 
'Wang, S.'                                7 
'Structural Proteomics in Europe (SPINE)' 8 
# 
_citation.id                        primary 
_citation.title                     'A Structural Characterization of Human SCO2' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            15 
_citation.page_first                1132 
_citation.page_last                 1140 
_citation.year                      2007 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17850752 
_citation.pdbx_database_id_DOI      10.1016/j.str.2007.07.011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banci, L.'           1 
primary 'Bertini, I.'         2 
primary 'Ciofi-Baffoni, S.'   3 
primary 'Gerothanassis, I.P.' 4 
primary 'Leontari, I.'        5 
primary 'Martinelli, M.'      6 
primary 'Wang, S.'            7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SCO2 protein homolog, mitochondrial' 19492.826 1 ? ? 'soluble domain of human Sco2' ? 
2 non-polymer syn 'COPPER (I) ION'                      63.546    1 ? ? ?                              ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSFTGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVE
AMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVR
RHMAAFRSVLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSFTGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVE
AMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVR
RHMAAFRSVLS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PHE n 
1 4   THR n 
1 5   GLY n 
1 6   GLN n 
1 7   GLY n 
1 8   ASP n 
1 9   PHE n 
1 10  HIS n 
1 11  LEU n 
1 12  LEU n 
1 13  ASP n 
1 14  HIS n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  ALA n 
1 19  ARG n 
1 20  CYS n 
1 21  LYS n 
1 22  ALA n 
1 23  ASP n 
1 24  PHE n 
1 25  ARG n 
1 26  GLY n 
1 27  GLN n 
1 28  TRP n 
1 29  VAL n 
1 30  LEU n 
1 31  MET n 
1 32  TYR n 
1 33  PHE n 
1 34  GLY n 
1 35  PHE n 
1 36  THR n 
1 37  HIS n 
1 38  CYS n 
1 39  PRO n 
1 40  ASP n 
1 41  ILE n 
1 42  CYS n 
1 43  PRO n 
1 44  ASP n 
1 45  GLU n 
1 46  LEU n 
1 47  GLU n 
1 48  LYS n 
1 49  LEU n 
1 50  VAL n 
1 51  GLN n 
1 52  VAL n 
1 53  VAL n 
1 54  ARG n 
1 55  GLN n 
1 56  LEU n 
1 57  GLU n 
1 58  ALA n 
1 59  GLU n 
1 60  PRO n 
1 61  GLY n 
1 62  LEU n 
1 63  PRO n 
1 64  PRO n 
1 65  VAL n 
1 66  GLN n 
1 67  PRO n 
1 68  VAL n 
1 69  PHE n 
1 70  ILE n 
1 71  THR n 
1 72  VAL n 
1 73  ASP n 
1 74  PRO n 
1 75  GLU n 
1 76  ARG n 
1 77  ASP n 
1 78  ASP n 
1 79  VAL n 
1 80  GLU n 
1 81  ALA n 
1 82  MET n 
1 83  ALA n 
1 84  ARG n 
1 85  TYR n 
1 86  VAL n 
1 87  GLN n 
1 88  ASP n 
1 89  PHE n 
1 90  HIS n 
1 91  PRO n 
1 92  ARG n 
1 93  LEU n 
1 94  LEU n 
1 95  GLY n 
1 96  LEU n 
1 97  THR n 
1 98  GLY n 
1 99  SER n 
1 100 THR n 
1 101 LYS n 
1 102 GLN n 
1 103 VAL n 
1 104 ALA n 
1 105 GLN n 
1 106 ALA n 
1 107 SER n 
1 108 HIS n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 VAL n 
1 113 TYR n 
1 114 TYR n 
1 115 ASN n 
1 116 ALA n 
1 117 GLY n 
1 118 PRO n 
1 119 LYS n 
1 120 ASP n 
1 121 GLU n 
1 122 ASP n 
1 123 GLN n 
1 124 ASP n 
1 125 TYR n 
1 126 ILE n 
1 127 VAL n 
1 128 ASP n 
1 129 HIS n 
1 130 SER n 
1 131 ILE n 
1 132 ALA n 
1 133 ILE n 
1 134 TYR n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 PRO n 
1 139 ASP n 
1 140 GLY n 
1 141 LEU n 
1 142 PHE n 
1 143 THR n 
1 144 ASP n 
1 145 TYR n 
1 146 TYR n 
1 147 GLY n 
1 148 ARG n 
1 149 SER n 
1 150 ARG n 
1 151 SER n 
1 152 ALA n 
1 153 GLU n 
1 154 GLN n 
1 155 ILE n 
1 156 SER n 
1 157 ASP n 
1 158 SER n 
1 159 VAL n 
1 160 ARG n 
1 161 ARG n 
1 162 HIS n 
1 163 MET n 
1 164 ALA n 
1 165 ALA n 
1 166 PHE n 
1 167 ARG n 
1 168 SER n 
1 169 VAL n 
1 170 LEU n 
1 171 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SCO2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21DE3 GOLD' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               PETG-30A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SCO2_HUMAN 
_struct_ref.pdbx_db_accession          O43819 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMAR
YVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMA
AFRSVLS
;
_struct_ref.pdbx_align_begin           100 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2RLI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 171 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O43819 
_struct_ref_seq.db_align_beg                  100 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  266 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       100 
_struct_ref_seq.pdbx_auth_seq_align_end       266 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2RLI GLY A 1 ? UNP O43819 ? ? 'EXPRESSION TAG' 96 1 
1 2RLI SER A 2 ? UNP O43819 ? ? 'EXPRESSION TAG' 97 2 
1 2RLI PHE A 3 ? UNP O43819 ? ? 'EXPRESSION TAG' 98 3 
1 2RLI THR A 4 ? UNP O43819 ? ? 'EXPRESSION TAG' 99 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CU1 non-polymer         . 'COPPER (I) ION' ? 'Cu 1'           63.546  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  2 '2D 1H-1H NOESY'  
1 4  1 '3D CBCA(CO)NH'   
1 5  1 '3D HNCO'         
1 6  1 '3D HNCA'         
1 7  1 '3D HCCH-TOCSY'   
1 8  2 '3D 1H-15N NOESY' 
1 9  1 '3D 1H-13C NOESY' 
1 10 1 '3D HN(CO)CA'     
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.05 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.8 mM [U-100% 13C; U-100% 15N] entity_1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'0.8 mM [U-100% 15N] entity_1, 90% H2O/10% D2O'             2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker Avance 1 'Bruker Avance' 
900 Bruker Avance 2 'Bruker Avance' 
600 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2RLI 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2RLI 
_pdbx_nmr_details.text       'the structure was determined using NOE and dihedral angle constrains' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            350 
_pdbx_nmr_ensemble.conformers_submitted_total_number             31 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2RLI 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2RLI 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                         collection                  xwinnmr 3.6 1 
'Bruker Biospin'                                                         processing                  xwinnmr 3.6 2 
'Keller and Wuthrich'                                                    'data analysis'             CARA    2.0 3 
'Keller and Wuthrich'                                                    'chemical shift assignment' CARA    2.0 4 
'Keller and Wuthrich'                                                    'peak picking'              CARA    2.0 5 
'Guntert, Braun and Wuthrich'                                            'structure solution'        DYANA   1.5 6 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Koll' refinement                  AMBER   8.0 7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2RLI 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2RLI 
_struct.title                     'Solution structure of Cu(I) human Sco2' 
_struct.pdbx_descriptor           'SCO2 protein homolog, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2RLI 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            
'Copper protein, thioredoxin fold, Metal transport, Structural Genomics, SPINE2-Complexes, Structural Proteomics in Europe, SPINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 41  ? GLU A 59  ? ILE A 136 GLU A 154 1 ? 19 
HELX_P HELX_P2 2 ASP A 78  ? ASP A 88  ? ASP A 173 ASP A 183 1 ? 11 
HELX_P HELX_P3 3 SER A 99  ? TYR A 110 ? SER A 194 TYR A 205 1 ? 12 
HELX_P HELX_P4 4 SER A 151 ? ARG A 167 ? SER A 246 ARG A 262 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B CU1 . CU ? ? ? 1_555 A CYS 38  SG  ? ? A CU1 267 A CYS 133 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc2 metalc ? ? B CU1 . CU ? ? ? 1_555 A CYS 42  SG  ? ? A CU1 267 A CYS 137 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc3 metalc ? ? B CU1 . CU ? ? ? 1_555 A HIS 129 NE2 ? ? A CU1 267 A HIS 224 1_555 ? ? ? ? ? ? ? 2.161 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 4   A . ? THR 99  A GLY 5   A ? GLY 100 A 1 -6.52 
2 SER 168 A . ? SER 263 A VAL 169 A ? VAL 264 A 1 -3.24 
3 VAL 169 A . ? VAL 264 A LEU 170 A ? LEU 265 A 1 23.67 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 18  ? CYS A 20  ? ALA A 113 CYS A 115 
A 2 HIS A 10  ? ASP A 13  ? HIS A 105 ASP A 108 
A 3 GLY A 95  ? THR A 97  ? GLY A 190 THR A 192 
A 4 VAL A 65  ? THR A 71  ? VAL A 160 THR A 166 
A 5 TRP A 28  ? GLY A 34  ? TRP A 123 GLY A 129 
A 6 ALA A 132 ? LEU A 136 ? ALA A 227 LEU A 231 
A 7 PHE A 142 ? GLY A 147 ? PHE A 237 GLY A 242 
B 1 ASN A 115 ? ALA A 116 ? ASN A 210 ALA A 211 
B 2 VAL A 127 ? ASP A 128 ? VAL A 222 ASP A 223 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 19  ? O ARG A 114 N LEU A 11  ? N LEU A 106 
A 2 3 N LEU A 12  ? N LEU A 107 O THR A 97  ? O THR A 192 
A 3 4 O LEU A 96  ? O LEU A 191 N PHE A 69  ? N PHE A 164 
A 4 5 O ILE A 70  ? O ILE A 165 N GLY A 34  ? N GLY A 129 
A 5 6 N VAL A 29  ? N VAL A 124 O LEU A 136 ? O LEU A 231 
A 6 7 N LEU A 135 ? N LEU A 230 O ASP A 144 ? O ASP A 239 
B 1 2 N ASN A 115 ? N ASN A 210 O ASP A 128 ? O ASP A 223 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CU1 A 267' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 38  ? CYS A 133 . ? 1_555 ? 
2 AC1 4 ILE A 41  ? ILE A 136 . ? 1_555 ? 
3 AC1 4 CYS A 42  ? CYS A 137 . ? 1_555 ? 
4 AC1 4 HIS A 129 ? HIS A 224 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2RLI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . SER A 1 2   ? -20.269 -21.921 12.672  1.00 11.38 ? 97  SER A N    1  
ATOM   2     C  CA   . SER A 1 2   ? -19.656 -22.821 11.677  1.00 11.03 ? 97  SER A CA   1  
ATOM   3     C  C    . SER A 1 2   ? -19.312 -22.055 10.410  1.00 9.96  ? 97  SER A C    1  
ATOM   4     O  O    . SER A 1 2   ? -20.203 -21.371 9.907   1.00 9.79  ? 97  SER A O    1  
ATOM   5     C  CB   . SER A 1 2   ? -20.608 -23.980 11.370  1.00 11.73 ? 97  SER A CB   1  
ATOM   6     O  OG   . SER A 1 2   ? -21.075 -24.498 12.603  1.00 12.58 ? 97  SER A OG   1  
ATOM   7     H  H    . SER A 1 2   ? -19.563 -21.302 13.053  1.00 11.39 ? 97  SER A H    1  
ATOM   8     H  HA   . SER A 1 2   ? -18.741 -23.234 12.103  1.00 11.40 ? 97  SER A HA   1  
ATOM   9     H  HB2  . SER A 1 2   ? -21.459 -23.622 10.787  1.00 11.60 ? 97  SER A HB2  1  
ATOM   10    H  HB3  . SER A 1 2   ? -20.082 -24.755 10.811  1.00 12.02 ? 97  SER A HB3  1  
ATOM   11    H  HG   . SER A 1 2   ? -21.677 -25.254 12.443  1.00 13.17 ? 97  SER A HG   1  
ATOM   12    N  N    . PHE A 1 3   ? -18.062 -22.179 9.927   1.00 9.60  ? 98  PHE A N    1  
ATOM   13    C  CA   . PHE A 1 3   ? -17.464 -21.673 8.668   1.00 8.85  ? 98  PHE A CA   1  
ATOM   14    C  C    . PHE A 1 3   ? -16.604 -20.408 8.886   1.00 10.23 ? 98  PHE A C    1  
ATOM   15    O  O    . PHE A 1 3   ? -16.935 -19.565 9.719   1.00 9.42  ? 98  PHE A O    1  
ATOM   16    C  CB   . PHE A 1 3   ? -18.501 -21.459 7.542   1.00 8.85  ? 98  PHE A CB   1  
ATOM   17    C  CG   . PHE A 1 3   ? -17.906 -21.266 6.156   1.00 9.08  ? 98  PHE A CG   1  
ATOM   18    C  CD1  . PHE A 1 3   ? -17.579 -19.974 5.697   1.00 9.28  ? 98  PHE A CD1  1  
ATOM   19    C  CD2  . PHE A 1 3   ? -17.677 -22.378 5.323   1.00 9.79  ? 98  PHE A CD2  1  
ATOM   20    C  CE1  . PHE A 1 3   ? -17.000 -19.799 4.427   1.00 8.82  ? 98  PHE A CE1  1  
ATOM   21    C  CE2  . PHE A 1 3   ? -17.117 -22.200 4.045   1.00 10.79 ? 98  PHE A CE2  1  
ATOM   22    C  CZ   . PHE A 1 3   ? -16.768 -20.912 3.601   1.00 10.45 ? 98  PHE A CZ   1  
ATOM   23    H  H    . PHE A 1 3   ? -17.408 -22.716 10.492  1.00 10.15 ? 98  PHE A H    1  
ATOM   24    H  HA   . PHE A 1 3   ? -16.784 -22.456 8.325   1.00 9.17  ? 98  PHE A HA   1  
ATOM   25    H  HB2  . PHE A 1 3   ? -19.168 -22.323 7.504   1.00 9.37  ? 98  PHE A HB2  1  
ATOM   26    H  HB3  . PHE A 1 3   ? -19.109 -20.584 7.775   1.00 8.73  ? 98  PHE A HB3  1  
ATOM   27    H  HD1  . PHE A 1 3   ? -17.757 -19.114 6.326   1.00 9.88  ? 98  PHE A HD1  1  
ATOM   28    H  HD2  . PHE A 1 3   ? -17.937 -23.372 5.659   1.00 10.56 ? 98  PHE A HD2  1  
ATOM   29    H  HE1  . PHE A 1 3   ? -16.728 -18.810 4.087   1.00 9.27  ? 98  PHE A HE1  1  
ATOM   30    H  HE2  . PHE A 1 3   ? -16.954 -23.053 3.401   1.00 11.81 ? 98  PHE A HE2  1  
ATOM   31    H  HZ   . PHE A 1 3   ? -16.323 -20.780 2.624   1.00 10.54 ? 98  PHE A HZ   1  
ATOM   32    N  N    . THR A 1 4   ? -15.542 -20.243 8.078   1.00 7.99  ? 99  THR A N    1  
ATOM   33    C  CA   . THR A 1 4   ? -14.712 -19.027 7.967   1.00 7.67  ? 99  THR A CA   1  
ATOM   34    C  C    . THR A 1 4   ? -14.068 -18.963 6.572   1.00 7.44  ? 99  THR A C    1  
ATOM   35    O  O    . THR A 1 4   ? -13.467 -19.945 6.143   1.00 8.13  ? 99  THR A O    1  
ATOM   36    C  CB   . THR A 1 4   ? -13.678 -18.952 9.105   1.00 8.49  ? 99  THR A CB   1  
ATOM   37    O  OG1  . THR A 1 4   ? -12.924 -17.775 8.942   1.00 8.88  ? 99  THR A OG1  1  
ATOM   38    C  CG2  . THR A 1 4   ? -12.694 -20.123 9.186   1.00 9.29  ? 99  THR A CG2  1  
ATOM   39    H  H    . THR A 1 4   ? -15.329 -20.985 7.424   1.00 8.33  ? 99  THR A H    1  
ATOM   40    H  HA   . THR A 1 4   ? -15.359 -18.163 8.096   1.00 7.59  ? 99  THR A HA   1  
ATOM   41    H  HB   . THR A 1 4   ? -14.216 -18.894 10.054  1.00 8.80  ? 99  THR A HB   1  
ATOM   42    H  HG1  . THR A 1 4   ? -12.154 -17.819 9.527   1.00 9.60  ? 99  THR A HG1  1  
ATOM   43    H  HG21 . THR A 1 4   ? -13.236 -21.066 9.262   1.00 9.52  ? 99  THR A HG21 1  
ATOM   44    H  HG22 . THR A 1 4   ? -12.068 -20.014 10.071  1.00 9.70  ? 99  THR A HG22 1  
ATOM   45    H  HG23 . THR A 1 4   ? -12.056 -20.149 8.303   1.00 9.77  ? 99  THR A HG23 1  
ATOM   46    N  N    . GLY A 1 5   ? -14.172 -17.869 5.807   1.00 7.03  ? 100 GLY A N    1  
ATOM   47    C  CA   . GLY A 1 5   ? -14.965 -16.650 6.039   1.00 6.16  ? 100 GLY A CA   1  
ATOM   48    C  C    . GLY A 1 5   ? -14.263 -15.631 6.935   1.00 5.24  ? 100 GLY A C    1  
ATOM   49    O  O    . GLY A 1 5   ? -14.876 -15.108 7.862   1.00 5.09  ? 100 GLY A O    1  
ATOM   50    H  H    . GLY A 1 5   ? -13.679 -17.918 4.921   1.00 7.73  ? 100 GLY A H    1  
ATOM   51    H  HA2  . GLY A 1 5   ? -15.134 -16.162 5.079   1.00 6.45  ? 100 GLY A HA2  1  
ATOM   52    H  HA3  . GLY A 1 5   ? -15.927 -16.897 6.487   1.00 6.36  ? 100 GLY A HA3  1  
ATOM   53    N  N    . GLN A 1 6   ? -12.978 -15.362 6.696   1.00 5.09  ? 101 GLN A N    1  
ATOM   54    C  CA   . GLN A 1 6   ? -12.074 -14.741 7.673   1.00 4.71  ? 101 GLN A CA   1  
ATOM   55    C  C    . GLN A 1 6   ? -12.065 -13.196 7.595   1.00 4.15  ? 101 GLN A C    1  
ATOM   56    O  O    . GLN A 1 6   ? -11.034 -12.558 7.828   1.00 4.72  ? 101 GLN A O    1  
ATOM   57    C  CB   . GLN A 1 6   ? -10.680 -15.384 7.496   1.00 5.32  ? 101 GLN A CB   1  
ATOM   58    C  CG   . GLN A 1 6   ? -9.762  -15.298 8.730   1.00 5.69  ? 101 GLN A CG   1  
ATOM   59    C  CD   . GLN A 1 6   ? -10.306 -16.066 9.936   1.00 6.03  ? 101 GLN A CD   1  
ATOM   60    O  OE1  . GLN A 1 6   ? -10.319 -17.293 9.965   1.00 6.49  ? 101 GLN A OE1  1  
ATOM   61    N  NE2  . GLN A 1 6   ? -10.773 -15.391 10.964  1.00 6.42  ? 101 GLN A NE2  1  
ATOM   62    H  H    . GLN A 1 6   ? -12.581 -15.680 5.819   1.00 5.62  ? 101 GLN A H    1  
ATOM   63    H  HA   . GLN A 1 6   ? -12.452 -14.997 8.664   1.00 5.01  ? 101 GLN A HA   1  
ATOM   64    H  HB2  . GLN A 1 6   ? -10.805 -16.443 7.260   1.00 5.90  ? 101 GLN A HB2  1  
ATOM   65    H  HB3  . GLN A 1 6   ? -10.181 -14.919 6.645   1.00 5.58  ? 101 GLN A HB3  1  
ATOM   66    H  HG2  . GLN A 1 6   ? -8.793  -15.726 8.470   1.00 6.30  ? 101 GLN A HG2  1  
ATOM   67    H  HG3  . GLN A 1 6   ? -9.593  -14.258 9.004   1.00 5.71  ? 101 GLN A HG3  1  
ATOM   68    H  HE21 . GLN A 1 6   ? -10.734 -14.387 10.978  1.00 6.54  ? 101 GLN A HE21 1  
ATOM   69    H  HE22 . GLN A 1 6   ? -11.065 -15.895 11.797  1.00 7.00  ? 101 GLN A HE22 1  
ATOM   70    N  N    . GLY A 1 7   ? -13.196 -12.579 7.227   1.00 3.55  ? 102 GLY A N    1  
ATOM   71    C  CA   . GLY A 1 7   ? -13.304 -11.133 6.974   1.00 3.53  ? 102 GLY A CA   1  
ATOM   72    C  C    . GLY A 1 7   ? -12.558 -10.751 5.697   1.00 2.85  ? 102 GLY A C    1  
ATOM   73    O  O    . GLY A 1 7   ? -11.656 -9.913  5.733   1.00 3.63  ? 102 GLY A O    1  
ATOM   74    H  H    . GLY A 1 7   ? -14.020 -13.153 7.096   1.00 3.60  ? 102 GLY A H    1  
ATOM   75    H  HA2  . GLY A 1 7   ? -14.351 -10.857 6.857   1.00 3.93  ? 102 GLY A HA2  1  
ATOM   76    H  HA3  . GLY A 1 7   ? -12.867 -10.578 7.804   1.00 4.12  ? 102 GLY A HA3  1  
ATOM   77    N  N    . ASP A 1 8   ? -12.866 -11.456 4.611   1.00 1.97  ? 103 ASP A N    1  
ATOM   78    C  CA   . ASP A 1 8   ? -12.036 -11.579 3.409   1.00 1.64  ? 103 ASP A CA   1  
ATOM   79    C  C    . ASP A 1 8   ? -11.973 -10.307 2.535   1.00 1.62  ? 103 ASP A C    1  
ATOM   80    O  O    . ASP A 1 8   ? -12.723 -9.349  2.723   1.00 2.34  ? 103 ASP A O    1  
ATOM   81    C  CB   . ASP A 1 8   ? -12.530 -12.781 2.581   1.00 2.27  ? 103 ASP A CB   1  
ATOM   82    C  CG   . ASP A 1 8   ? -12.895 -14.010 3.423   1.00 2.87  ? 103 ASP A CG   1  
ATOM   83    O  OD1  . ASP A 1 8   ? -11.988 -14.722 3.912   1.00 3.32  ? 103 ASP A OD1  1  
ATOM   84    O  OD2  . ASP A 1 8   ? -14.109 -14.276 3.570   1.00 3.98  ? 103 ASP A OD2  1  
ATOM   85    H  H    . ASP A 1 8   ? -13.649 -12.092 4.682   1.00 2.23  ? 103 ASP A H    1  
ATOM   86    H  HA   . ASP A 1 8   ? -11.022 -11.811 3.729   1.00 1.95  ? 103 ASP A HA   1  
ATOM   87    H  HB2  . ASP A 1 8   ? -13.412 -12.474 2.015   1.00 3.18  ? 103 ASP A HB2  1  
ATOM   88    H  HB3  . ASP A 1 8   ? -11.757 -13.060 1.863   1.00 2.88  ? 103 ASP A HB3  1  
ATOM   89    N  N    . PHE A 1 9   ? -11.088 -10.334 1.532   1.00 1.32  ? 104 PHE A N    1  
ATOM   90    C  CA   . PHE A 1 9   ? -11.017 -9.375  0.425   1.00 1.32  ? 104 PHE A CA   1  
ATOM   91    C  C    . PHE A 1 9   ? -10.335 -10.015 -0.797  1.00 5.18  ? 104 PHE A C    1  
ATOM   92    O  O    . PHE A 1 9   ? -9.598  -10.997 -0.663  1.00 4.16  ? 104 PHE A O    1  
ATOM   93    C  CB   . PHE A 1 9   ? -10.341 -8.059  0.860   1.00 1.50  ? 104 PHE A CB   1  
ATOM   94    C  CG   . PHE A 1 9   ? -8.905  -8.141  1.356   1.00 1.57  ? 104 PHE A CG   1  
ATOM   95    C  CD1  . PHE A 1 9   ? -7.843  -8.337  0.450   1.00 2.19  ? 104 PHE A CD1  1  
ATOM   96    C  CD2  . PHE A 1 9   ? -8.620  -7.933  2.721   1.00 3.35  ? 104 PHE A CD2  1  
ATOM   97    C  CE1  . PHE A 1 9   ? -6.512  -8.329  0.905   1.00 1.93  ? 104 PHE A CE1  1  
ATOM   98    C  CE2  . PHE A 1 9   ? -7.287  -7.914  3.173   1.00 5.94  ? 104 PHE A CE2  1  
ATOM   99    C  CZ   . PHE A 1 9   ? -6.233  -8.114  2.265   1.00 2.54  ? 104 PHE A CZ   1  
ATOM   100   H  H    . PHE A 1 9   ? -10.520 -11.161 1.429   1.00 1.47  ? 104 PHE A H    1  
ATOM   101   H  HA   . PHE A 1 9   ? -12.041 -9.126  0.131   1.00 1.40  ? 104 PHE A HA   1  
ATOM   102   H  HB2  . PHE A 1 9   ? -10.362 -7.367  0.017   1.00 1.54  ? 104 PHE A HB2  1  
ATOM   103   H  HB3  . PHE A 1 9   ? -10.955 -7.606  1.640   1.00 1.65  ? 104 PHE A HB3  1  
ATOM   104   H  HD1  . PHE A 1 9   ? -8.042  -8.474  -0.602  1.00 2.78  ? 104 PHE A HD1  1  
ATOM   105   H  HD2  . PHE A 1 9   ? -9.426  -7.761  3.420   1.00 4.14  ? 104 PHE A HD2  1  
ATOM   106   H  HE1  . PHE A 1 9   ? -5.701  -8.466  0.203   1.00 2.61  ? 104 PHE A HE1  1  
ATOM   107   H  HE2  . PHE A 1 9   ? -7.072  -7.728  4.216   1.00 6.66  ? 104 PHE A HE2  1  
ATOM   108   H  HZ   . PHE A 1 9   ? -5.207  -8.091  2.609   1.00 4.39  ? 104 PHE A HZ   1  
ATOM   109   N  N    . HIS A 1 10  ? -10.570 -9.446  -1.985  1.00 1.34  ? 105 HIS A N    1  
ATOM   110   C  CA   . HIS A 1 10  ? -10.054 -9.938  -3.270  1.00 1.33  ? 105 HIS A CA   1  
ATOM   111   C  C    . HIS A 1 10  ? -9.876  -8.790  -4.292  1.00 1.27  ? 105 HIS A C    1  
ATOM   112   O  O    . HIS A 1 10  ? -10.834 -8.069  -4.582  1.00 1.51  ? 105 HIS A O    1  
ATOM   113   C  CB   . HIS A 1 10  ? -11.009 -11.030 -3.787  1.00 1.41  ? 105 HIS A CB   1  
ATOM   114   C  CG   . HIS A 1 10  ? -10.479 -11.805 -4.962  1.00 2.24  ? 105 HIS A CG   1  
ATOM   115   N  ND1  . HIS A 1 10  ? -11.055 -11.863 -6.232  1.00 3.47  ? 105 HIS A ND1  1  
ATOM   116   C  CD2  . HIS A 1 10  ? -9.378  -12.607 -4.938  1.00 2.59  ? 105 HIS A CD2  1  
ATOM   117   C  CE1  . HIS A 1 10  ? -10.285 -12.707 -6.936  1.00 4.42  ? 105 HIS A CE1  1  
ATOM   118   N  NE2  . HIS A 1 10  ? -9.257  -13.156 -6.192  1.00 3.93  ? 105 HIS A NE2  1  
ATOM   119   H  H    . HIS A 1 10  ? -11.180 -8.642  -2.020  1.00 1.52  ? 105 HIS A H    1  
ATOM   120   H  HA   . HIS A 1 10  ? -9.080  -10.391 -3.096  1.00 1.40  ? 105 HIS A HA   1  
ATOM   121   H  HB2  . HIS A 1 10  ? -11.201 -11.745 -2.987  1.00 1.88  ? 105 HIS A HB2  1  
ATOM   122   H  HB3  . HIS A 1 10  ? -11.961 -10.577 -4.064  1.00 1.77  ? 105 HIS A HB3  1  
ATOM   123   H  HD2  . HIS A 1 10  ? -8.736  -12.776 -4.092  1.00 2.30  ? 105 HIS A HD2  1  
ATOM   124   H  HE1  . HIS A 1 10  ? -10.452 -12.968 -7.972  1.00 5.59  ? 105 HIS A HE1  1  
ATOM   125   H  HE2  . HIS A 1 10  ? -8.494  -13.743 -6.517  1.00 4.63  ? 105 HIS A HE2  1  
ATOM   126   N  N    . LEU A 1 11  ? -8.652  -8.600  -4.801  1.00 1.15  ? 106 LEU A N    1  
ATOM   127   C  CA   . LEU A 1 11  ? -8.254  -7.534  -5.739  1.00 1.14  ? 106 LEU A CA   1  
ATOM   128   C  C    . LEU A 1 11  ? -7.424  -8.143  -6.880  1.00 1.20  ? 106 LEU A C    1  
ATOM   129   O  O    . LEU A 1 11  ? -6.893  -9.241  -6.730  1.00 1.34  ? 106 LEU A O    1  
ATOM   130   C  CB   . LEU A 1 11  ? -7.406  -6.454  -5.023  1.00 1.20  ? 106 LEU A CB   1  
ATOM   131   C  CG   . LEU A 1 11  ? -8.078  -5.464  -4.044  1.00 1.51  ? 106 LEU A CG   1  
ATOM   132   C  CD1  . LEU A 1 11  ? -9.307  -4.772  -4.652  1.00 2.06  ? 106 LEU A CD1  1  
ATOM   133   C  CD2  . LEU A 1 11  ? -8.419  -6.077  -2.677  1.00 2.31  ? 106 LEU A CD2  1  
ATOM   134   H  H    . LEU A 1 11  ? -7.937  -9.287  -4.582  1.00 1.25  ? 106 LEU A H    1  
ATOM   135   H  HA   . LEU A 1 11  ? -9.133  -7.070  -6.190  1.00 1.20  ? 106 LEU A HA   1  
ATOM   136   H  HB2  . LEU A 1 11  ? -6.579  -6.945  -4.506  1.00 1.38  ? 106 LEU A HB2  1  
ATOM   137   H  HB3  . LEU A 1 11  ? -6.956  -5.837  -5.802  1.00 1.37  ? 106 LEU A HB3  1  
ATOM   138   H  HG   . LEU A 1 11  ? -7.342  -4.684  -3.848  1.00 2.79  ? 106 LEU A HG   1  
ATOM   139   H  HD11 . LEU A 1 11  ? -9.036  -4.307  -5.601  1.00 3.05  ? 106 LEU A HD11 1  
ATOM   140   H  HD12 . LEU A 1 11  ? -10.110 -5.488  -4.818  1.00 2.58  ? 106 LEU A HD12 1  
ATOM   141   H  HD13 . LEU A 1 11  ? -9.662  -3.995  -3.974  1.00 2.83  ? 106 LEU A HD13 1  
ATOM   142   H  HD21 . LEU A 1 11  ? -8.667  -5.280  -1.976  1.00 2.90  ? 106 LEU A HD21 1  
ATOM   143   H  HD22 . LEU A 1 11  ? -9.274  -6.743  -2.751  1.00 2.83  ? 106 LEU A HD22 1  
ATOM   144   H  HD23 . LEU A 1 11  ? -7.559  -6.625  -2.292  1.00 3.37  ? 106 LEU A HD23 1  
ATOM   145   N  N    . LEU A 1 12  ? -7.286  -7.441  -8.007  1.00 1.25  ? 107 LEU A N    1  
ATOM   146   C  CA   . LEU A 1 12  ? -6.456  -7.873  -9.137  1.00 1.42  ? 107 LEU A CA   1  
ATOM   147   C  C    . LEU A 1 12  ? -4.985  -7.499  -8.912  1.00 0.92  ? 107 LEU A C    1  
ATOM   148   O  O    . LEU A 1 12  ? -4.697  -6.383  -8.486  1.00 0.89  ? 107 LEU A O    1  
ATOM   149   C  CB   . LEU A 1 12  ? -6.992  -7.286  -10.457 1.00 2.06  ? 107 LEU A CB   1  
ATOM   150   C  CG   . LEU A 1 12  ? -8.166  -8.082  -11.063 1.00 1.97  ? 107 LEU A CG   1  
ATOM   151   C  CD1  . LEU A 1 12  ? -9.432  -8.091  -10.192 1.00 2.60  ? 107 LEU A CD1  1  
ATOM   152   C  CD2  . LEU A 1 12  ? -8.507  -7.505  -12.444 1.00 3.39  ? 107 LEU A CD2  1  
ATOM   153   H  H    . LEU A 1 12  ? -7.707  -6.519  -8.061  1.00 1.23  ? 107 LEU A H    1  
ATOM   154   H  HA   . LEU A 1 12  ? -6.498  -8.955  -9.218  1.00 1.67  ? 107 LEU A HA   1  
ATOM   155   H  HB2  . LEU A 1 12  ? -7.277  -6.243  -10.311 1.00 2.73  ? 107 LEU A HB2  1  
ATOM   156   H  HB3  . LEU A 1 12  ? -6.176  -7.303  -11.182 1.00 2.62  ? 107 LEU A HB3  1  
ATOM   157   H  HG   . LEU A 1 12  ? -7.846  -9.116  -11.196 1.00 2.18  ? 107 LEU A HG   1  
ATOM   158   H  HD11 . LEU A 1 12  ? -10.252 -8.559  -10.736 1.00 2.95  ? 107 LEU A HD11 1  
ATOM   159   H  HD12 . LEU A 1 12  ? -9.257  -8.671  -9.287  1.00 2.99  ? 107 LEU A HD12 1  
ATOM   160   H  HD13 . LEU A 1 12  ? -9.710  -7.071  -9.927  1.00 3.81  ? 107 LEU A HD13 1  
ATOM   161   H  HD21 . LEU A 1 12  ? -9.316  -8.078  -12.898 1.00 3.56  ? 107 LEU A HD21 1  
ATOM   162   H  HD22 . LEU A 1 12  ? -7.634  -7.568  -13.094 1.00 4.01  ? 107 LEU A HD22 1  
ATOM   163   H  HD23 . LEU A 1 12  ? -8.812  -6.462  -12.351 1.00 4.51  ? 107 LEU A HD23 1  
ATOM   164   N  N    . ASP A 1 13  ? -4.078  -8.423  -9.239  1.00 0.86  ? 108 ASP A N    1  
ATOM   165   C  CA   . ASP A 1 13  ? -2.622  -8.234  -9.236  1.00 0.72  ? 108 ASP A CA   1  
ATOM   166   C  C    . ASP A 1 13  ? -2.174  -7.484  -10.502 1.00 0.72  ? 108 ASP A C    1  
ATOM   167   O  O    . ASP A 1 13  ? -2.655  -7.764  -11.604 1.00 1.00  ? 108 ASP A O    1  
ATOM   168   C  CB   . ASP A 1 13  ? -1.888  -9.595  -9.236  1.00 1.29  ? 108 ASP A CB   1  
ATOM   169   C  CG   . ASP A 1 13  ? -2.150  -10.522 -8.040  1.00 1.62  ? 108 ASP A CG   1  
ATOM   170   O  OD1  . ASP A 1 13  ? -3.130  -11.298 -8.118  1.00 2.92  ? 108 ASP A OD1  1  
ATOM   171   O  OD2  . ASP A 1 13  ? -1.310  -10.555 -7.108  1.00 2.03  ? 108 ASP A OD2  1  
ATOM   172   H  H    . ASP A 1 13  ? -4.423  -9.285  -9.643  1.00 1.23  ? 108 ASP A H    1  
ATOM   173   H  HA   . ASP A 1 13  ? -2.322  -7.661  -8.356  1.00 0.80  ? 108 ASP A HA   1  
ATOM   174   H  HB2  . ASP A 1 13  ? -2.157  -10.130 -10.148 1.00 2.48  ? 108 ASP A HB2  1  
ATOM   175   H  HB3  . ASP A 1 13  ? -0.815  -9.402  -9.288  1.00 1.89  ? 108 ASP A HB3  1  
ATOM   176   N  N    . HIS A 1 14  ? -1.143  -6.640  -10.382 1.00 0.77  ? 109 HIS A N    1  
ATOM   177   C  CA   . HIS A 1 14  ? -0.503  -5.890  -11.478 1.00 1.03  ? 109 HIS A CA   1  
ATOM   178   C  C    . HIS A 1 14  ? 0.184   -6.746  -12.582 1.00 1.31  ? 109 HIS A C    1  
ATOM   179   O  O    . HIS A 1 14  ? 0.970   -6.229  -13.377 1.00 1.82  ? 109 HIS A O    1  
ATOM   180   C  CB   . HIS A 1 14  ? 0.455   -4.861  -10.850 1.00 1.20  ? 109 HIS A CB   1  
ATOM   181   C  CG   . HIS A 1 14  ? 1.646   -5.460  -10.146 1.00 1.08  ? 109 HIS A CG   1  
ATOM   182   N  ND1  . HIS A 1 14  ? 1.766   -5.644  -8.767  1.00 1.42  ? 109 HIS A ND1  1  
ATOM   183   C  CD2  . HIS A 1 14  ? 2.800   -5.868  -10.749 1.00 1.27  ? 109 HIS A CD2  1  
ATOM   184   C  CE1  . HIS A 1 14  ? 2.991   -6.161  -8.578  1.00 1.24  ? 109 HIS A CE1  1  
ATOM   185   N  NE2  . HIS A 1 14  ? 3.633   -6.311  -9.747  1.00 1.23  ? 109 HIS A NE2  1  
ATOM   186   H  H    . HIS A 1 14  ? -0.842  -6.410  -9.441  1.00 0.84  ? 109 HIS A H    1  
ATOM   187   H  HA   . HIS A 1 14  ? -1.293  -5.330  -11.982 1.00 1.14  ? 109 HIS A HA   1  
ATOM   188   H  HB2  . HIS A 1 14  ? 0.818   -4.192  -11.629 1.00 1.56  ? 109 HIS A HB2  1  
ATOM   189   H  HB3  . HIS A 1 14  ? -0.097  -4.251  -10.136 1.00 1.32  ? 109 HIS A HB3  1  
ATOM   190   H  HD2  . HIS A 1 14  ? 3.011   -5.829  -11.806 1.00 1.76  ? 109 HIS A HD2  1  
ATOM   191   H  HE1  . HIS A 1 14  ? 3.417   -6.407  -7.615  1.00 1.52  ? 109 HIS A HE1  1  
ATOM   192   H  HE2  . HIS A 1 14  ? 4.579   -6.654  -9.853  1.00 1.55  ? 109 HIS A HE2  1  
ATOM   193   N  N    . ARG A 1 15  ? -0.095  -8.057  -12.641 1.00 1.33  ? 110 ARG A N    1  
ATOM   194   C  CA   . ARG A 1 15  ? 0.321   -8.992  -13.703 1.00 1.78  ? 110 ARG A CA   1  
ATOM   195   C  C    . ARG A 1 15  ? -0.825  -9.935  -14.146 1.00 1.66  ? 110 ARG A C    1  
ATOM   196   O  O    . ARG A 1 15  ? -0.578  -11.015 -14.680 1.00 1.94  ? 110 ARG A O    1  
ATOM   197   C  CB   . ARG A 1 15  ? 1.613   -9.722  -13.268 1.00 2.46  ? 110 ARG A CB   1  
ATOM   198   C  CG   . ARG A 1 15  ? 2.434   -10.290 -14.445 1.00 2.93  ? 110 ARG A CG   1  
ATOM   199   C  CD   . ARG A 1 15  ? 3.824   -10.761 -13.985 1.00 3.57  ? 110 ARG A CD   1  
ATOM   200   N  NE   . ARG A 1 15  ? 4.586   -11.433 -15.056 1.00 4.34  ? 110 ARG A NE   1  
ATOM   201   C  CZ   . ARG A 1 15  ? 5.199   -10.881 -16.099 1.00 5.01  ? 110 ARG A CZ   1  
ATOM   202   N  NH1  . ARG A 1 15  ? 5.120   -9.603  -16.397 1.00 5.37  ? 110 ARG A NH1  1  
ATOM   203   N  NH2  . ARG A 1 15  ? 5.931   -11.617 -16.897 1.00 5.96  ? 110 ARG A NH2  1  
ATOM   204   H  H    . ARG A 1 15  ? -0.752  -8.385  -11.944 1.00 1.33  ? 110 ARG A H    1  
ATOM   205   H  HA   . ARG A 1 15  ? 0.564   -8.390  -14.580 1.00 2.27  ? 110 ARG A HA   1  
ATOM   206   H  HB2  . ARG A 1 15  ? 2.248   -9.005  -12.743 1.00 3.17  ? 110 ARG A HB2  1  
ATOM   207   H  HB3  . ARG A 1 15  ? 1.365   -10.524 -12.571 1.00 2.72  ? 110 ARG A HB3  1  
ATOM   208   H  HG2  . ARG A 1 15  ? 1.912   -11.136 -14.890 1.00 3.14  ? 110 ARG A HG2  1  
ATOM   209   H  HG3  . ARG A 1 15  ? 2.556   -9.515  -15.203 1.00 3.70  ? 110 ARG A HG3  1  
ATOM   210   H  HD2  . ARG A 1 15  ? 4.392   -9.908  -13.611 1.00 4.10  ? 110 ARG A HD2  1  
ATOM   211   H  HD3  . ARG A 1 15  ? 3.697   -11.467 -13.162 1.00 3.88  ? 110 ARG A HD3  1  
ATOM   212   H  HE   . ARG A 1 15  ? 4.687   -12.443 -14.974 1.00 4.91  ? 110 ARG A HE   1  
ATOM   213   H  HH11 . ARG A 1 15  ? 4.546   -8.988  -15.850 1.00 5.12  ? 110 ARG A HH11 1  
ATOM   214   H  HH12 . ARG A 1 15  ? 5.601   -9.276  -17.226 1.00 6.27  ? 110 ARG A HH12 1  
ATOM   215   H  HH21 . ARG A 1 15  ? 6.090   -12.601 -16.707 1.00 6.33  ? 110 ARG A HH21 1  
ATOM   216   H  HH22 . ARG A 1 15  ? 6.377   -11.183 -17.696 1.00 6.62  ? 110 ARG A HH22 1  
ATOM   217   N  N    . GLY A 1 16  ? -2.094  -9.556  -13.929 1.00 1.74  ? 111 GLY A N    1  
ATOM   218   C  CA   . GLY A 1 16  ? -3.263  -10.225 -14.534 1.00 2.39  ? 111 GLY A CA   1  
ATOM   219   C  C    . GLY A 1 16  ? -3.801  -11.441 -13.772 1.00 2.33  ? 111 GLY A C    1  
ATOM   220   O  O    . GLY A 1 16  ? -4.519  -12.250 -14.360 1.00 2.82  ? 111 GLY A O    1  
ATOM   221   H  H    . GLY A 1 16  ? -2.259  -8.692  -13.421 1.00 1.74  ? 111 GLY A H    1  
ATOM   222   H  HA2  . GLY A 1 16  ? -4.081  -9.507  -14.590 1.00 2.85  ? 111 GLY A HA2  1  
ATOM   223   H  HA3  . GLY A 1 16  ? -3.010  -10.561 -15.541 1.00 2.85  ? 111 GLY A HA3  1  
ATOM   224   N  N    . ARG A 1 17  ? -3.474  -11.571 -12.482 1.00 1.98  ? 112 ARG A N    1  
ATOM   225   C  CA   . ARG A 1 17  ? -4.096  -12.531 -11.553 1.00 2.12  ? 112 ARG A CA   1  
ATOM   226   C  C    . ARG A 1 17  ? -5.014  -11.778 -10.577 1.00 2.12  ? 112 ARG A C    1  
ATOM   227   O  O    . ARG A 1 17  ? -5.232  -10.577 -10.747 1.00 2.48  ? 112 ARG A O    1  
ATOM   228   C  CB   . ARG A 1 17  ? -3.007  -13.369 -10.851 1.00 2.16  ? 112 ARG A CB   1  
ATOM   229   C  CG   . ARG A 1 17  ? -2.291  -14.264 -11.875 1.00 3.12  ? 112 ARG A CG   1  
ATOM   230   C  CD   . ARG A 1 17  ? -1.367  -15.313 -11.244 1.00 3.18  ? 112 ARG A CD   1  
ATOM   231   N  NE   . ARG A 1 17  ? -0.806  -16.154 -12.310 1.00 4.13  ? 112 ARG A NE   1  
ATOM   232   C  CZ   . ARG A 1 17  ? -0.530  -17.451 -12.290 1.00 4.46  ? 112 ARG A CZ   1  
ATOM   233   N  NH1  . ARG A 1 17  ? -0.515  -18.182 -11.196 1.00 4.32  ? 112 ARG A NH1  1  
ATOM   234   N  NH2  . ARG A 1 17  ? -0.281  -18.036 -13.435 1.00 5.56  ? 112 ARG A NH2  1  
ATOM   235   H  H    . ARG A 1 17  ? -2.953  -10.813 -12.065 1.00 1.81  ? 112 ARG A H    1  
ATOM   236   H  HA   . ARG A 1 17  ? -4.735  -13.219 -12.107 1.00 2.39  ? 112 ARG A HA   1  
ATOM   237   H  HB2  . ARG A 1 17  ? -2.284  -12.716 -10.359 1.00 2.09  ? 112 ARG A HB2  1  
ATOM   238   H  HB3  . ARG A 1 17  ? -3.469  -14.009 -10.099 1.00 2.51  ? 112 ARG A HB3  1  
ATOM   239   H  HG2  . ARG A 1 17  ? -3.046  -14.788 -12.463 1.00 4.08  ? 112 ARG A HG2  1  
ATOM   240   H  HG3  . ARG A 1 17  ? -1.703  -13.641 -12.551 1.00 3.69  ? 112 ARG A HG3  1  
ATOM   241   H  HD2  . ARG A 1 17  ? -0.562  -14.813 -10.702 1.00 2.95  ? 112 ARG A HD2  1  
ATOM   242   H  HD3  . ARG A 1 17  ? -1.946  -15.924 -10.549 1.00 3.60  ? 112 ARG A HD3  1  
ATOM   243   H  HE   . ARG A 1 17  ? -0.817  -15.746 -13.240 1.00 5.01  ? 112 ARG A HE   1  
ATOM   244   H  HH11 . ARG A 1 17  ? -0.666  -17.763 -10.298 1.00 4.03  ? 112 ARG A HH11 1  
ATOM   245   H  HH12 . ARG A 1 17  ? -0.300  -19.175 -11.268 1.00 4.97  ? 112 ARG A HH12 1  
ATOM   246   H  HH21 . ARG A 1 17  ? -0.338  -17.496 -14.288 1.00 6.28  ? 112 ARG A HH21 1  
ATOM   247   H  HH22 . ARG A 1 17  ? -0.247  -19.045 -13.489 1.00 5.96  ? 112 ARG A HH22 1  
ATOM   248   N  N    . ALA A 1 18  ? -5.577  -12.457 -9.576  1.00 1.92  ? 113 ALA A N    1  
ATOM   249   C  CA   . ALA A 1 18  ? -6.323  -11.794 -8.508  1.00 1.94  ? 113 ALA A CA   1  
ATOM   250   C  C    . ALA A 1 18  ? -6.088  -12.457 -7.144  1.00 1.80  ? 113 ALA A C    1  
ATOM   251   O  O    . ALA A 1 18  ? -6.373  -13.645 -6.961  1.00 2.36  ? 113 ALA A O    1  
ATOM   252   C  CB   . ALA A 1 18  ? -7.801  -11.713 -8.908  1.00 2.71  ? 113 ALA A CB   1  
ATOM   253   H  H    . ALA A 1 18  ? -5.358  -13.432 -9.467  1.00 1.87  ? 113 ALA A H    1  
ATOM   254   H  HA   . ALA A 1 18  ? -5.938  -10.779 -8.413  1.00 1.77  ? 113 ALA A HA   1  
ATOM   255   H  HB1  . ALA A 1 18  ? -8.219  -12.716 -8.998  1.00 2.51  ? 113 ALA A HB1  1  
ATOM   256   H  HB2  . ALA A 1 18  ? -8.348  -11.146 -8.154  1.00 3.25  ? 113 ALA A HB2  1  
ATOM   257   H  HB3  . ALA A 1 18  ? -7.900  -11.197 -9.864  1.00 3.82  ? 113 ALA A HB3  1  
ATOM   258   N  N    . ARG A 1 19  ? -5.575  -11.664 -6.201  1.00 1.58  ? 114 ARG A N    1  
ATOM   259   C  CA   . ARG A 1 19  ? -5.045  -12.073 -4.903  1.00 1.59  ? 114 ARG A CA   1  
ATOM   260   C  C    . ARG A 1 19  ? -6.099  -11.959 -3.801  1.00 1.46  ? 114 ARG A C    1  
ATOM   261   O  O    . ARG A 1 19  ? -6.813  -10.958 -3.706  1.00 1.29  ? 114 ARG A O    1  
ATOM   262   C  CB   . ARG A 1 19  ? -3.827  -11.186 -4.575  1.00 1.62  ? 114 ARG A CB   1  
ATOM   263   C  CG   . ARG A 1 19  ? -2.673  -11.945 -3.912  1.00 1.52  ? 114 ARG A CG   1  
ATOM   264   C  CD   . ARG A 1 19  ? -2.045  -12.980 -4.860  1.00 2.41  ? 114 ARG A CD   1  
ATOM   265   N  NE   . ARG A 1 19  ? -0.742  -13.429 -4.353  1.00 2.72  ? 114 ARG A NE   1  
ATOM   266   C  CZ   . ARG A 1 19  ? 0.426   -12.825 -4.526  1.00 2.97  ? 114 ARG A CZ   1  
ATOM   267   N  NH1  . ARG A 1 19  ? 0.586   -11.810 -5.356  1.00 3.49  ? 114 ARG A NH1  1  
ATOM   268   N  NH2  . ARG A 1 19  ? 1.456   -13.256 -3.830  1.00 3.61  ? 114 ARG A NH2  1  
ATOM   269   H  H    . ARG A 1 19  ? -5.476  -10.685 -6.443  1.00 1.83  ? 114 ARG A H    1  
ATOM   270   H  HA   . ARG A 1 19  ? -4.733  -13.114 -4.984  1.00 1.88  ? 114 ARG A HA   1  
ATOM   271   H  HB2  . ARG A 1 19  ? -3.441  -10.729 -5.486  1.00 2.27  ? 114 ARG A HB2  1  
ATOM   272   H  HB3  . ARG A 1 19  ? -4.134  -10.367 -3.924  1.00 1.86  ? 114 ARG A HB3  1  
ATOM   273   H  HG2  . ARG A 1 19  ? -1.913  -11.215 -3.631  1.00 2.02  ? 114 ARG A HG2  1  
ATOM   274   H  HG3  . ARG A 1 19  ? -3.026  -12.441 -3.007  1.00 2.08  ? 114 ARG A HG3  1  
ATOM   275   H  HD2  . ARG A 1 19  ? -2.704  -13.843 -4.943  1.00 3.19  ? 114 ARG A HD2  1  
ATOM   276   H  HD3  . ARG A 1 19  ? -1.931  -12.552 -5.855  1.00 3.18  ? 114 ARG A HD3  1  
ATOM   277   H  HE   . ARG A 1 19  ? -0.741  -14.262 -3.767  1.00 3.43  ? 114 ARG A HE   1  
ATOM   278   H  HH11 . ARG A 1 19  ? -0.201  -11.447 -5.903  1.00 3.63  ? 114 ARG A HH11 1  
ATOM   279   H  HH12 . ARG A 1 19  ? 1.481   -11.370 -5.448  1.00 4.23  ? 114 ARG A HH12 1  
ATOM   280   H  HH21 . ARG A 1 19  ? 1.293   -13.918 -3.070  1.00 4.03  ? 114 ARG A HH21 1  
ATOM   281   H  HH22 . ARG A 1 19  ? 2.383   -12.863 -3.938  1.00 4.11  ? 114 ARG A HH22 1  
ATOM   282   N  N    . CYS A 1 20  ? -6.183  -12.981 -2.949  1.00 1.76  ? 115 CYS A N    1  
ATOM   283   C  CA   . CYS A 1 20  ? -7.054  -13.020 -1.773  1.00 1.71  ? 115 CYS A CA   1  
ATOM   284   C  C    . CYS A 1 20  ? -6.307  -12.600 -0.495  1.00 1.76  ? 115 CYS A C    1  
ATOM   285   O  O    . CYS A 1 20  ? -5.082  -12.676 -0.413  1.00 1.92  ? 115 CYS A O    1  
ATOM   286   C  CB   . CYS A 1 20  ? -7.654  -14.435 -1.662  1.00 1.76  ? 115 CYS A CB   1  
ATOM   287   S  SG   . CYS A 1 20  ? -6.332  -15.654 -1.379  1.00 2.92  ? 115 CYS A SG   1  
ATOM   288   H  H    . CYS A 1 20  ? -5.534  -13.746 -3.058  1.00 2.08  ? 115 CYS A H    1  
ATOM   289   H  HA   . CYS A 1 20  ? -7.872  -12.310 -1.909  1.00 1.70  ? 115 CYS A HA   1  
ATOM   290   H  HB2  . CYS A 1 20  ? -8.371  -14.474 -0.839  1.00 1.78  ? 115 CYS A HB2  1  
ATOM   291   H  HB3  . CYS A 1 20  ? -8.183  -14.683 -2.585  1.00 2.61  ? 115 CYS A HB3  1  
ATOM   292   H  HG   . CYS A 1 20  ? -7.065  -16.780 -1.411  1.00 3.36  ? 115 CYS A HG   1  
ATOM   293   N  N    . LYS A 1 21  ? -7.063  -12.229 0.542   1.00 1.75  ? 116 LYS A N    1  
ATOM   294   C  CA   . LYS A 1 21  ? -6.548  -11.863 1.873   1.00 1.83  ? 116 LYS A CA   1  
ATOM   295   C  C    . LYS A 1 21  ? -5.519  -12.855 2.464   1.00 1.86  ? 116 LYS A C    1  
ATOM   296   O  O    . LYS A 1 21  ? -4.620  -12.440 3.193   1.00 1.85  ? 116 LYS A O    1  
ATOM   297   C  CB   . LYS A 1 21  ? -7.774  -11.705 2.795   1.00 1.97  ? 116 LYS A CB   1  
ATOM   298   C  CG   . LYS A 1 21  ? -7.405  -11.325 4.237   1.00 2.23  ? 116 LYS A CG   1  
ATOM   299   C  CD   . LYS A 1 21  ? -8.658  -11.063 5.079   1.00 2.54  ? 116 LYS A CD   1  
ATOM   300   C  CE   . LYS A 1 21  ? -8.237  -10.589 6.470   1.00 3.17  ? 116 LYS A CE   1  
ATOM   301   N  NZ   . LYS A 1 21  ? -9.400  -10.346 7.351   1.00 3.34  ? 116 LYS A NZ   1  
ATOM   302   H  H    . LYS A 1 21  ? -8.053  -12.103 0.369   1.00 1.77  ? 116 LYS A H    1  
ATOM   303   H  HA   . LYS A 1 21  ? -6.039  -10.901 1.798   1.00 1.85  ? 116 LYS A HA   1  
ATOM   304   H  HB2  . LYS A 1 21  ? -8.414  -10.924 2.381   1.00 2.13  ? 116 LYS A HB2  1  
ATOM   305   H  HB3  . LYS A 1 21  ? -8.338  -12.639 2.812   1.00 2.30  ? 116 LYS A HB3  1  
ATOM   306   H  HG2  . LYS A 1 21  ? -6.844  -12.136 4.702   1.00 2.66  ? 116 LYS A HG2  1  
ATOM   307   H  HG3  . LYS A 1 21  ? -6.782  -10.430 4.226   1.00 2.54  ? 116 LYS A HG3  1  
ATOM   308   H  HD2  . LYS A 1 21  ? -9.263  -10.293 4.598   1.00 2.91  ? 116 LYS A HD2  1  
ATOM   309   H  HD3  . LYS A 1 21  ? -9.239  -11.984 5.164   1.00 2.90  ? 116 LYS A HD3  1  
ATOM   310   H  HE2  . LYS A 1 21  ? -7.586  -11.340 6.926   1.00 3.62  ? 116 LYS A HE2  1  
ATOM   311   H  HE3  . LYS A 1 21  ? -7.661  -9.665  6.368   1.00 3.75  ? 116 LYS A HE3  1  
ATOM   312   H  HZ1  . LYS A 1 21  ? -9.881  -11.219 7.563   1.00 3.40  ? 116 LYS A HZ1  1  
ATOM   313   H  HZ2  . LYS A 1 21  ? -9.101  -9.915  8.216   1.00 3.81  ? 116 LYS A HZ2  1  
ATOM   314   H  HZ3  . LYS A 1 21  ? -10.085 -9.758  6.887   1.00 3.72  ? 116 LYS A HZ3  1  
ATOM   315   N  N    . ALA A 1 22  ? -5.661  -14.151 2.173   1.00 1.95  ? 117 ALA A N    1  
ATOM   316   C  CA   . ALA A 1 22  ? -4.882  -15.230 2.779   1.00 1.97  ? 117 ALA A CA   1  
ATOM   317   C  C    . ALA A 1 22  ? -3.402  -15.290 2.348   1.00 1.93  ? 117 ALA A C    1  
ATOM   318   O  O    . ALA A 1 22  ? -2.597  -15.866 3.078   1.00 2.07  ? 117 ALA A O    1  
ATOM   319   C  CB   . ALA A 1 22  ? -5.615  -16.543 2.469   1.00 2.11  ? 117 ALA A CB   1  
ATOM   320   H  H    . ALA A 1 22  ? -6.379  -14.408 1.516   1.00 2.08  ? 117 ALA A H    1  
ATOM   321   H  HA   . ALA A 1 22  ? -4.878  -15.092 3.862   1.00 1.97  ? 117 ALA A HA   1  
ATOM   322   H  HB1  . ALA A 1 22  ? -6.657  -16.484 2.787   1.00 2.12  ? 117 ALA A HB1  1  
ATOM   323   H  HB2  . ALA A 1 22  ? -5.570  -16.760 1.400   1.00 3.03  ? 117 ALA A HB2  1  
ATOM   324   H  HB3  . ALA A 1 22  ? -5.143  -17.363 3.010   1.00 2.45  ? 117 ALA A HB3  1  
ATOM   325   N  N    . ASP A 1 23  ? -3.030  -14.720 1.194   1.00 1.87  ? 118 ASP A N    1  
ATOM   326   C  CA   . ASP A 1 23  ? -1.649  -14.758 0.678   1.00 1.95  ? 118 ASP A CA   1  
ATOM   327   C  C    . ASP A 1 23  ? -0.726  -13.827 1.483   1.00 1.84  ? 118 ASP A C    1  
ATOM   328   O  O    . ASP A 1 23  ? 0.413   -14.166 1.793   1.00 2.00  ? 118 ASP A O    1  
ATOM   329   C  CB   . ASP A 1 23  ? -1.665  -14.374 -0.812  1.00 2.10  ? 118 ASP A CB   1  
ATOM   330   C  CG   . ASP A 1 23  ? -0.488  -14.945 -1.614  1.00 2.74  ? 118 ASP A CG   1  
ATOM   331   O  OD1  . ASP A 1 23  ? 0.683   -14.563 -1.395  1.00 3.66  ? 118 ASP A OD1  1  
ATOM   332   O  OD2  . ASP A 1 23  ? -0.765  -15.693 -2.579  1.00 3.21  ? 118 ASP A OD2  1  
ATOM   333   H  H    . ASP A 1 23  ? -3.706  -14.175 0.674   1.00 1.87  ? 118 ASP A H    1  
ATOM   334   H  HA   . ASP A 1 23  ? -1.268  -15.777 0.770   1.00 2.13  ? 118 ASP A HA   1  
ATOM   335   H  HB2  . ASP A 1 23  ? -2.589  -14.750 -1.259  1.00 2.32  ? 118 ASP A HB2  1  
ATOM   336   H  HB3  . ASP A 1 23  ? -1.681  -13.287 -0.912  1.00 2.17  ? 118 ASP A HB3  1  
ATOM   337   N  N    . PHE A 1 24  ? -1.268  -12.667 1.869   1.00 1.69  ? 119 PHE A N    1  
ATOM   338   C  CA   . PHE A 1 24  ? -0.590  -11.583 2.579   1.00 1.75  ? 119 PHE A CA   1  
ATOM   339   C  C    . PHE A 1 24  ? -0.239  -11.906 4.047   1.00 6.66  ? 119 PHE A C    1  
ATOM   340   O  O    . PHE A 1 24  ? 0.501   -11.149 4.679   1.00 5.10  ? 119 PHE A O    1  
ATOM   341   C  CB   . PHE A 1 24  ? -1.506  -10.352 2.496   1.00 1.74  ? 119 PHE A CB   1  
ATOM   342   C  CG   . PHE A 1 24  ? -1.784  -9.855  1.087   1.00 1.77  ? 119 PHE A CG   1  
ATOM   343   C  CD1  . PHE A 1 24  ? -0.846  -9.040  0.423   1.00 3.23  ? 119 PHE A CD1  1  
ATOM   344   C  CD2  . PHE A 1 24  ? -2.981  -10.210 0.435   1.00 2.46  ? 119 PHE A CD2  1  
ATOM   345   C  CE1  . PHE A 1 24  ? -1.108  -8.582  -0.881  1.00 6.27  ? 119 PHE A CE1  1  
ATOM   346   C  CE2  . PHE A 1 24  ? -3.240  -9.756  -0.870  1.00 2.89  ? 119 PHE A CE2  1  
ATOM   347   C  CZ   . PHE A 1 24  ? -2.304  -8.938  -1.528  1.00 2.80  ? 119 PHE A CZ   1  
ATOM   348   H  H    . PHE A 1 24  ? -2.221  -12.498 1.583   1.00 1.65  ? 119 PHE A H    1  
ATOM   349   H  HA   . PHE A 1 24  ? 0.347   -11.364 2.064   1.00 1.91  ? 119 PHE A HA   1  
ATOM   350   H  HB2  . PHE A 1 24  ? -2.452  -10.579 2.991   1.00 1.68  ? 119 PHE A HB2  1  
ATOM   351   H  HB3  . PHE A 1 24  ? -1.046  -9.543  3.054   1.00 2.06  ? 119 PHE A HB3  1  
ATOM   352   H  HD1  . PHE A 1 24  ? 0.080   -8.768  0.910   1.00 3.98  ? 119 PHE A HD1  1  
ATOM   353   H  HD2  . PHE A 1 24  ? -3.701  -10.841 0.934   1.00 3.67  ? 119 PHE A HD2  1  
ATOM   354   H  HE1  . PHE A 1 24  ? -0.384  -7.961  -1.389  1.00 7.20  ? 119 PHE A HE1  1  
ATOM   355   H  HE2  . PHE A 1 24  ? -4.156  -10.042 -1.368  1.00 3.98  ? 119 PHE A HE2  1  
ATOM   356   H  HZ   . PHE A 1 24  ? -2.499  -8.589  -2.533  1.00 4.22  ? 119 PHE A HZ   1  
ATOM   357   N  N    . ARG A 1 25  ? -0.764  -13.009 4.600   1.00 1.85  ? 120 ARG A N    1  
ATOM   358   C  CA   . ARG A 1 25  ? -0.482  -13.468 5.967   1.00 2.06  ? 120 ARG A CA   1  
ATOM   359   C  C    . ARG A 1 25  ? 1.021   -13.764 6.140   1.00 2.28  ? 120 ARG A C    1  
ATOM   360   O  O    . ARG A 1 25  ? 1.683   -14.208 5.201   1.00 3.56  ? 120 ARG A O    1  
ATOM   361   C  CB   . ARG A 1 25  ? -1.365  -14.692 6.265   1.00 2.31  ? 120 ARG A CB   1  
ATOM   362   C  CG   . ARG A 1 25  ? -1.438  -15.038 7.752   1.00 2.65  ? 120 ARG A CG   1  
ATOM   363   C  CD   . ARG A 1 25  ? -2.413  -16.187 8.039   1.00 2.81  ? 120 ARG A CD   1  
ATOM   364   N  NE   . ARG A 1 25  ? -2.459  -16.504 9.478   1.00 2.56  ? 120 ARG A NE   1  
ATOM   365   C  CZ   . ARG A 1 25  ? -1.821  -17.480 10.113  1.00 3.31  ? 120 ARG A CZ   1  
ATOM   366   N  NH1  . ARG A 1 25  ? -0.950  -18.278 9.531   1.00 4.56  ? 120 ARG A NH1  1  
ATOM   367   N  NH2  . ARG A 1 25  ? -2.078  -17.651 11.389  1.00 3.52  ? 120 ARG A NH2  1  
ATOM   368   H  H    . ARG A 1 25  ? -1.320  -13.606 4.003   1.00 1.95  ? 120 ARG A H    1  
ATOM   369   H  HA   . ARG A 1 25  ? -0.759  -12.666 6.653   1.00 2.07  ? 120 ARG A HA   1  
ATOM   370   H  HB2  . ARG A 1 25  ? -2.378  -14.496 5.907   1.00 2.26  ? 120 ARG A HB2  1  
ATOM   371   H  HB3  . ARG A 1 25  ? -0.967  -15.548 5.737   1.00 2.51  ? 120 ARG A HB3  1  
ATOM   372   H  HG2  . ARG A 1 25  ? -0.447  -15.318 8.109   1.00 3.17  ? 120 ARG A HG2  1  
ATOM   373   H  HG3  . ARG A 1 25  ? -1.781  -14.150 8.272   1.00 2.71  ? 120 ARG A HG3  1  
ATOM   374   H  HD2  . ARG A 1 25  ? -3.413  -15.892 7.716   1.00 3.12  ? 120 ARG A HD2  1  
ATOM   375   H  HD3  . ARG A 1 25  ? -2.125  -17.068 7.465   1.00 3.67  ? 120 ARG A HD3  1  
ATOM   376   H  HE   . ARG A 1 25  ? -3.075  -15.939 10.057  1.00 2.60  ? 120 ARG A HE   1  
ATOM   377   H  HH11 . ARG A 1 25  ? -0.743  -18.181 8.538   1.00 5.06  ? 120 ARG A HH11 1  
ATOM   378   H  HH12 . ARG A 1 25  ? -0.395  -18.917 10.086  1.00 5.35  ? 120 ARG A HH12 1  
ATOM   379   H  HH21 . ARG A 1 25  ? -2.734  -17.010 11.825  1.00 3.57  ? 120 ARG A HH21 1  
ATOM   380   H  HH22 . ARG A 1 25  ? -1.769  -18.486 11.875  1.00 4.14  ? 120 ARG A HH22 1  
ATOM   381   N  N    . GLY A 1 26  ? 1.580   -13.505 7.327   1.00 1.97  ? 121 GLY A N    1  
ATOM   382   C  CA   . GLY A 1 26  ? 3.020   -13.658 7.599   1.00 2.17  ? 121 GLY A CA   1  
ATOM   383   C  C    . GLY A 1 26  ? 3.883   -12.461 7.175   1.00 1.87  ? 121 GLY A C    1  
ATOM   384   O  O    . GLY A 1 26  ? 5.088   -12.625 6.987   1.00 2.55  ? 121 GLY A O    1  
ATOM   385   H  H    . GLY A 1 26  ? 0.968   -13.270 8.100   1.00 2.59  ? 121 GLY A H    1  
ATOM   386   H  HA2  . GLY A 1 26  ? 3.164   -13.801 8.669   1.00 2.46  ? 121 GLY A HA2  1  
ATOM   387   H  HA3  . GLY A 1 26  ? 3.399   -14.533 7.068   1.00 2.46  ? 121 GLY A HA3  1  
ATOM   388   N  N    . GLN A 1 27  ? 3.297   -11.268 7.014   1.00 1.31  ? 122 GLN A N    1  
ATOM   389   C  CA   . GLN A 1 27  ? 3.992   -10.031 6.634   1.00 1.16  ? 122 GLN A CA   1  
ATOM   390   C  C    . GLN A 1 27  ? 3.495   -8.823  7.454   1.00 1.03  ? 122 GLN A C    1  
ATOM   391   O  O    . GLN A 1 27  ? 2.436   -8.883  8.081   1.00 1.89  ? 122 GLN A O    1  
ATOM   392   C  CB   . GLN A 1 27  ? 3.776   -9.754  5.136   1.00 1.45  ? 122 GLN A CB   1  
ATOM   393   C  CG   . GLN A 1 27  ? 4.216   -10.913 4.221   1.00 2.50  ? 122 GLN A CG   1  
ATOM   394   C  CD   . GLN A 1 27  ? 4.344   -10.488 2.761   1.00 2.75  ? 122 GLN A CD   1  
ATOM   395   O  OE1  . GLN A 1 27  ? 5.302   -10.839 2.086   1.00 3.03  ? 122 GLN A OE1  1  
ATOM   396   N  NE2  . GLN A 1 27  ? 3.417   -9.704  2.252   1.00 3.33  ? 122 GLN A NE2  1  
ATOM   397   H  H    . GLN A 1 27  ? 2.303   -11.192 7.165   1.00 1.51  ? 122 GLN A H    1  
ATOM   398   H  HA   . GLN A 1 27  ? 5.065   -10.133 6.797   1.00 1.47  ? 122 GLN A HA   1  
ATOM   399   H  HB2  . GLN A 1 27  ? 2.720   -9.546  4.962   1.00 2.18  ? 122 GLN A HB2  1  
ATOM   400   H  HB3  . GLN A 1 27  ? 4.349   -8.864  4.866   1.00 1.67  ? 122 GLN A HB3  1  
ATOM   401   H  HG2  . GLN A 1 27  ? 5.187   -11.281 4.552   1.00 3.03  ? 122 GLN A HG2  1  
ATOM   402   H  HG3  . GLN A 1 27  ? 3.489   -11.723 4.284   1.00 3.48  ? 122 GLN A HG3  1  
ATOM   403   H  HE21 . GLN A 1 27  ? 2.638   -9.402  2.806   1.00 3.71  ? 122 GLN A HE21 1  
ATOM   404   H  HE22 . GLN A 1 27  ? 3.567   -9.310  1.330   1.00 3.75  ? 122 GLN A HE22 1  
ATOM   405   N  N    . TRP A 1 28  ? 4.229   -7.705  7.399   1.00 1.04  ? 123 TRP A N    1  
ATOM   406   C  CA   . TRP A 1 28  ? 3.676   -6.361  7.621   1.00 0.84  ? 123 TRP A CA   1  
ATOM   407   C  C    . TRP A 1 28  ? 3.379   -5.733  6.248   1.00 0.89  ? 123 TRP A C    1  
ATOM   408   O  O    . TRP A 1 28  ? 4.226   -5.775  5.356   1.00 1.19  ? 123 TRP A O    1  
ATOM   409   C  CB   . TRP A 1 28  ? 4.659   -5.497  8.443   1.00 0.92  ? 123 TRP A CB   1  
ATOM   410   C  CG   . TRP A 1 28  ? 4.433   -5.489  9.931   1.00 0.88  ? 123 TRP A CG   1  
ATOM   411   C  CD1  . TRP A 1 28  ? 4.117   -6.569  10.677  1.00 1.55  ? 123 TRP A CD1  1  
ATOM   412   C  CD2  . TRP A 1 28  ? 4.455   -4.362  10.871  1.00 1.22  ? 123 TRP A CD2  1  
ATOM   413   N  NE1  . TRP A 1 28  ? 3.858   -6.185  11.978  1.00 1.59  ? 123 TRP A NE1  1  
ATOM   414   C  CE2  . TRP A 1 28  ? 4.036   -4.832  12.151  1.00 1.12  ? 123 TRP A CE2  1  
ATOM   415   C  CE3  . TRP A 1 28  ? 4.769   -2.986  10.779  1.00 2.27  ? 123 TRP A CE3  1  
ATOM   416   C  CZ2  . TRP A 1 28  ? 3.877   -3.985  13.258  1.00 1.48  ? 123 TRP A CZ2  1  
ATOM   417   C  CZ3  . TRP A 1 28  ? 4.614   -2.123  11.882  1.00 2.86  ? 123 TRP A CZ3  1  
ATOM   418   C  CH2  . TRP A 1 28  ? 4.155   -2.617  13.114  1.00 2.34  ? 123 TRP A CH2  1  
ATOM   419   H  H    . TRP A 1 28  ? 5.092   -7.723  6.872   1.00 1.79  ? 123 TRP A H    1  
ATOM   420   H  HA   . TRP A 1 28  ? 2.735   -6.428  8.169   1.00 0.84  ? 123 TRP A HA   1  
ATOM   421   H  HB2  . TRP A 1 28  ? 5.685   -5.804  8.232   1.00 1.21  ? 123 TRP A HB2  1  
ATOM   422   H  HB3  . TRP A 1 28  ? 4.566   -4.465  8.105   1.00 1.10  ? 123 TRP A HB3  1  
ATOM   423   H  HD1  . TRP A 1 28  ? 4.036   -7.574  10.288  1.00 2.30  ? 123 TRP A HD1  1  
ATOM   424   H  HE1  . TRP A 1 28  ? 3.540   -6.815  12.697  1.00 2.30  ? 123 TRP A HE1  1  
ATOM   425   H  HE3  . TRP A 1 28  ? 5.110   -2.584  9.838   1.00 2.78  ? 123 TRP A HE3  1  
ATOM   426   H  HZ2  . TRP A 1 28  ? 3.535   -4.379  14.202  1.00 1.55  ? 123 TRP A HZ2  1  
ATOM   427   H  HZ3  . TRP A 1 28  ? 4.836   -1.071  11.776  1.00 3.81  ? 123 TRP A HZ3  1  
ATOM   428   H  HH2  . TRP A 1 28  ? 4.017   -1.945  13.945  1.00 2.81  ? 123 TRP A HH2  1  
ATOM   429   N  N    . VAL A 1 29  ? 2.186   -5.165  6.064   1.00 0.82  ? 124 VAL A N    1  
ATOM   430   C  CA   . VAL A 1 29  ? 1.731   -4.607  4.779   1.00 0.94  ? 124 VAL A CA   1  
ATOM   431   C  C    . VAL A 1 29  ? 1.187   -3.189  4.978   1.00 0.85  ? 124 VAL A C    1  
ATOM   432   O  O    . VAL A 1 29  ? 0.350   -2.955  5.847   1.00 0.93  ? 124 VAL A O    1  
ATOM   433   C  CB   . VAL A 1 29  ? 0.691   -5.530  4.094   1.00 1.16  ? 124 VAL A CB   1  
ATOM   434   C  CG1  . VAL A 1 29  ? 0.030   -4.896  2.855   1.00 1.73  ? 124 VAL A CG1  1  
ATOM   435   C  CG2  . VAL A 1 29  ? 1.318   -6.874  3.682   1.00 1.89  ? 124 VAL A CG2  1  
ATOM   436   H  H    . VAL A 1 29  ? 1.520   -5.180  6.837   1.00 0.83  ? 124 VAL A H    1  
ATOM   437   H  HA   . VAL A 1 29  ? 2.591   -4.542  4.121   1.00 1.07  ? 124 VAL A HA   1  
ATOM   438   H  HB   . VAL A 1 29  ? -0.094  -5.751  4.814   1.00 1.89  ? 124 VAL A HB   1  
ATOM   439   H  HG11 . VAL A 1 29  ? -0.539  -4.010  3.136   1.00 2.49  ? 124 VAL A HG11 1  
ATOM   440   H  HG12 . VAL A 1 29  ? 0.789   -4.620  2.124   1.00 2.48  ? 124 VAL A HG12 1  
ATOM   441   H  HG13 . VAL A 1 29  ? -0.661  -5.606  2.398   1.00 2.32  ? 124 VAL A HG13 1  
ATOM   442   H  HG21 . VAL A 1 29  ? 2.125   -6.709  2.968   1.00 2.92  ? 124 VAL A HG21 1  
ATOM   443   H  HG22 . VAL A 1 29  ? 0.563   -7.512  3.222   1.00 2.27  ? 124 VAL A HG22 1  
ATOM   444   H  HG23 . VAL A 1 29  ? 1.711   -7.391  4.557   1.00 2.54  ? 124 VAL A HG23 1  
ATOM   445   N  N    . LEU A 1 30  ? 1.664   -2.244  4.164   1.00 0.84  ? 125 LEU A N    1  
ATOM   446   C  CA   . LEU A 1 30  ? 1.240   -0.841  4.166   1.00 0.81  ? 125 LEU A CA   1  
ATOM   447   C  C    . LEU A 1 30  ? 0.198   -0.633  3.060   1.00 0.74  ? 125 LEU A C    1  
ATOM   448   O  O    . LEU A 1 30  ? 0.513   -0.726  1.872   1.00 0.75  ? 125 LEU A O    1  
ATOM   449   C  CB   . LEU A 1 30  ? 2.496   0.044   4.020   1.00 0.95  ? 125 LEU A CB   1  
ATOM   450   C  CG   . LEU A 1 30  ? 2.287   1.564   4.205   1.00 1.37  ? 125 LEU A CG   1  
ATOM   451   C  CD1  . LEU A 1 30  ? 3.664   2.232   4.334   1.00 2.07  ? 125 LEU A CD1  1  
ATOM   452   C  CD2  . LEU A 1 30  ? 1.525   2.237   3.049   1.00 2.57  ? 125 LEU A CD2  1  
ATOM   453   H  H    . LEU A 1 30  ? 2.311   -2.543  3.437   1.00 0.92  ? 125 LEU A H    1  
ATOM   454   H  HA   . LEU A 1 30  ? 0.772   -0.606  5.123   1.00 0.83  ? 125 LEU A HA   1  
ATOM   455   H  HB2  . LEU A 1 30  ? 3.207   -0.286  4.780   1.00 1.45  ? 125 LEU A HB2  1  
ATOM   456   H  HB3  . LEU A 1 30  ? 2.958   -0.135  3.050   1.00 1.67  ? 125 LEU A HB3  1  
ATOM   457   H  HG   . LEU A 1 30  ? 1.739   1.736   5.133   1.00 1.72  ? 125 LEU A HG   1  
ATOM   458   H  HD11 . LEU A 1 30  ? 4.214   1.798   5.171   1.00 2.18  ? 125 LEU A HD11 1  
ATOM   459   H  HD12 . LEU A 1 30  ? 4.239   2.094   3.417   1.00 2.88  ? 125 LEU A HD12 1  
ATOM   460   H  HD13 . LEU A 1 30  ? 3.540   3.297   4.523   1.00 2.99  ? 125 LEU A HD13 1  
ATOM   461   H  HD21 . LEU A 1 30  ? 1.952   1.938   2.090   1.00 3.40  ? 125 LEU A HD21 1  
ATOM   462   H  HD22 . LEU A 1 30  ? 0.472   1.969   3.079   1.00 3.14  ? 125 LEU A HD22 1  
ATOM   463   H  HD23 . LEU A 1 30  ? 1.585   3.321   3.137   1.00 3.18  ? 125 LEU A HD23 1  
ATOM   464   N  N    . MET A 1 31  ? -1.042  -0.343  3.456   1.00 0.80  ? 126 MET A N    1  
ATOM   465   C  CA   . MET A 1 31  ? -2.167  -0.122  2.543   1.00 0.77  ? 126 MET A CA   1  
ATOM   466   C  C    . MET A 1 31  ? -2.351  1.368   2.240   1.00 0.72  ? 126 MET A C    1  
ATOM   467   O  O    . MET A 1 31  ? -2.571  2.173   3.147   1.00 0.83  ? 126 MET A O    1  
ATOM   468   C  CB   . MET A 1 31  ? -3.450  -0.740  3.120   1.00 0.91  ? 126 MET A CB   1  
ATOM   469   C  CG   . MET A 1 31  ? -3.294  -2.248  3.363   1.00 1.93  ? 126 MET A CG   1  
ATOM   470   S  SD   . MET A 1 31  ? -4.830  -3.084  3.833   1.00 1.98  ? 126 MET A SD   1  
ATOM   471   C  CE   . MET A 1 31  ? -5.033  -4.163  2.393   1.00 2.99  ? 126 MET A CE   1  
ATOM   472   H  H    . MET A 1 31  ? -1.223  -0.253  4.451   1.00 0.90  ? 126 MET A H    1  
ATOM   473   H  HA   . MET A 1 31  ? -1.957  -0.621  1.598   1.00 0.78  ? 126 MET A HA   1  
ATOM   474   H  HB2  . MET A 1 31  ? -3.707  -0.249  4.060   1.00 1.42  ? 126 MET A HB2  1  
ATOM   475   H  HB3  . MET A 1 31  ? -4.266  -0.580  2.413   1.00 1.57  ? 126 MET A HB3  1  
ATOM   476   H  HG2  . MET A 1 31  ? -2.901  -2.711  2.458   1.00 2.82  ? 126 MET A HG2  1  
ATOM   477   H  HG3  . MET A 1 31  ? -2.564  -2.405  4.159   1.00 2.75  ? 126 MET A HG3  1  
ATOM   478   H  HE1  . MET A 1 31  ? -5.217  -3.558  1.505   1.00 3.35  ? 126 MET A HE1  1  
ATOM   479   H  HE2  . MET A 1 31  ? -5.881  -4.829  2.553   1.00 3.61  ? 126 MET A HE2  1  
ATOM   480   H  HE3  . MET A 1 31  ? -4.132  -4.759  2.245   1.00 3.87  ? 126 MET A HE3  1  
ATOM   481   N  N    . TYR A 1 32  ? -2.269  1.717   0.955   1.00 0.68  ? 127 TYR A N    1  
ATOM   482   C  CA   . TYR A 1 32  ? -2.396  3.074   0.421   1.00 0.68  ? 127 TYR A CA   1  
ATOM   483   C  C    . TYR A 1 32  ? -3.585  3.166   -0.553  1.00 0.63  ? 127 TYR A C    1  
ATOM   484   O  O    . TYR A 1 32  ? -3.642  2.416   -1.528  1.00 0.62  ? 127 TYR A O    1  
ATOM   485   C  CB   . TYR A 1 32  ? -1.075  3.427   -0.289  1.00 0.78  ? 127 TYR A CB   1  
ATOM   486   C  CG   . TYR A 1 32  ? -0.918  4.885   -0.679  1.00 0.95  ? 127 TYR A CG   1  
ATOM   487   C  CD1  . TYR A 1 32  ? -1.679  5.441   -1.727  1.00 1.76  ? 127 TYR A CD1  1  
ATOM   488   C  CD2  . TYR A 1 32  ? 0.014   5.688   0.005   1.00 2.19  ? 127 TYR A CD2  1  
ATOM   489   C  CE1  . TYR A 1 32  ? -1.549  6.805   -2.049  1.00 1.94  ? 127 TYR A CE1  1  
ATOM   490   C  CE2  . TYR A 1 32  ? 0.148   7.051   -0.313  1.00 2.56  ? 127 TYR A CE2  1  
ATOM   491   C  CZ   . TYR A 1 32  ? -0.645  7.618   -1.333  1.00 1.81  ? 127 TYR A CZ   1  
ATOM   492   O  OH   . TYR A 1 32  ? -0.537  8.939   -1.632  1.00 2.32  ? 127 TYR A OH   1  
ATOM   493   H  H    . TYR A 1 32  ? -2.033  0.995   0.283   1.00 0.73  ? 127 TYR A H    1  
ATOM   494   H  HA   . TYR A 1 32  ? -2.555  3.779   1.237   1.00 0.77  ? 127 TYR A HA   1  
ATOM   495   H  HB2  . TYR A 1 32  ? -0.250  3.158   0.373   1.00 1.06  ? 127 TYR A HB2  1  
ATOM   496   H  HB3  . TYR A 1 32  ? -0.971  2.819   -1.187  1.00 0.81  ? 127 TYR A HB3  1  
ATOM   497   H  HD1  . TYR A 1 32  ? -2.359  4.827   -2.299  1.00 2.87  ? 127 TYR A HD1  1  
ATOM   498   H  HD2  . TYR A 1 32  ? 0.632   5.258   0.779   1.00 3.25  ? 127 TYR A HD2  1  
ATOM   499   H  HE1  . TYR A 1 32  ? -2.122  7.231   -2.860  1.00 2.93  ? 127 TYR A HE1  1  
ATOM   500   H  HE2  . TYR A 1 32  ? 0.857   7.658   0.224   1.00 3.79  ? 127 TYR A HE2  1  
ATOM   501   H  HH   . TYR A 1 32  ? 0.170   9.381   -1.159  1.00 2.96  ? 127 TYR A HH   1  
ATOM   502   N  N    . PHE A 1 33  ? -4.509  4.106   -0.324  1.00 0.78  ? 128 PHE A N    1  
ATOM   503   C  CA   . PHE A 1 33  ? -5.652  4.366   -1.209  1.00 0.85  ? 128 PHE A CA   1  
ATOM   504   C  C    . PHE A 1 33  ? -5.372  5.570   -2.120  1.00 6.35  ? 128 PHE A C    1  
ATOM   505   O  O    . PHE A 1 33  ? -5.111  6.673   -1.636  1.00 4.85  ? 128 PHE A O    1  
ATOM   506   C  CB   . PHE A 1 33  ? -6.912  4.573   -0.359  1.00 0.97  ? 128 PHE A CB   1  
ATOM   507   C  CG   . PHE A 1 33  ? -7.383  3.310   0.337   1.00 0.97  ? 128 PHE A CG   1  
ATOM   508   C  CD1  . PHE A 1 33  ? -8.077  2.327   -0.394  1.00 2.62  ? 128 PHE A CD1  1  
ATOM   509   C  CD2  . PHE A 1 33  ? -7.123  3.108   1.707   1.00 2.03  ? 128 PHE A CD2  1  
ATOM   510   C  CE1  . PHE A 1 33  ? -8.523  1.156   0.243   1.00 6.17  ? 128 PHE A CE1  1  
ATOM   511   C  CE2  . PHE A 1 33  ? -7.572  1.937   2.344   1.00 1.86  ? 128 PHE A CE2  1  
ATOM   512   C  CZ   . PHE A 1 33  ? -8.275  0.963   1.613   1.00 2.07  ? 128 PHE A CZ   1  
ATOM   513   H  H    . PHE A 1 33  ? -4.394  4.712   0.475   1.00 0.94  ? 128 PHE A H    1  
ATOM   514   H  HA   . PHE A 1 33  ? -5.827  3.499   -1.851  1.00 0.81  ? 128 PHE A HA   1  
ATOM   515   H  HB2  . PHE A 1 33  ? -6.728  5.355   0.380   1.00 1.07  ? 128 PHE A HB2  1  
ATOM   516   H  HB3  . PHE A 1 33  ? -7.717  4.922   -1.004  1.00 1.07  ? 128 PHE A HB3  1  
ATOM   517   H  HD1  . PHE A 1 33  ? -8.273  2.472   -1.448  1.00 3.81  ? 128 PHE A HD1  1  
ATOM   518   H  HD2  . PHE A 1 33  ? -6.581  3.853   2.271   1.00 3.13  ? 128 PHE A HD2  1  
ATOM   519   H  HE1  . PHE A 1 33  ? -9.061  0.408   -0.321  1.00 7.61  ? 128 PHE A HE1  1  
ATOM   520   H  HE2  . PHE A 1 33  ? -7.382  1.787   3.397   1.00 2.80  ? 128 PHE A HE2  1  
ATOM   521   H  HZ   . PHE A 1 33  ? -8.630  0.068   2.105   1.00 3.92  ? 128 PHE A HZ   1  
ATOM   522   N  N    . GLY A 1 34  ? -5.419  5.348   -3.436  1.00 0.97  ? 129 GLY A N    1  
ATOM   523   C  CA   . GLY A 1 34  ? -4.940  6.260   -4.480  1.00 1.03  ? 129 GLY A CA   1  
ATOM   524   C  C    . GLY A 1 34  ? -5.631  6.047   -5.829  1.00 1.04  ? 129 GLY A C    1  
ATOM   525   O  O    . GLY A 1 34  ? -6.611  5.308   -5.941  1.00 1.16  ? 129 GLY A O    1  
ATOM   526   H  H    . GLY A 1 34  ? -5.702  4.420   -3.750  1.00 0.99  ? 129 GLY A H    1  
ATOM   527   H  HA2  . GLY A 1 34  ? -5.073  7.296   -4.171  1.00 1.12  ? 129 GLY A HA2  1  
ATOM   528   H  HA3  . GLY A 1 34  ? -3.871  6.099   -4.618  1.00 1.15  ? 129 GLY A HA3  1  
ATOM   529   N  N    . PHE A 1 35  ? -5.138  6.734   -6.861  1.00 1.22  ? 130 PHE A N    1  
ATOM   530   C  CA   . PHE A 1 35  ? -5.453  6.421   -8.259  1.00 1.68  ? 130 PHE A CA   1  
ATOM   531   C  C    . PHE A 1 35  ? -4.293  6.790   -9.195  1.00 6.49  ? 130 PHE A C    1  
ATOM   532   O  O    . PHE A 1 35  ? -3.451  7.623   -8.859  1.00 4.95  ? 130 PHE A O    1  
ATOM   533   C  CB   . PHE A 1 35  ? -6.798  7.042   -8.693  1.00 2.12  ? 130 PHE A CB   1  
ATOM   534   C  CG   . PHE A 1 35  ? -6.822  8.502   -9.137  1.00 1.78  ? 130 PHE A CG   1  
ATOM   535   C  CD1  . PHE A 1 35  ? -6.062  9.496   -8.486  1.00 3.14  ? 130 PHE A CD1  1  
ATOM   536   C  CD2  . PHE A 1 35  ? -7.677  8.876   -10.195 1.00 2.52  ? 130 PHE A CD2  1  
ATOM   537   C  CE1  . PHE A 1 35  ? -6.152  10.840  -8.893  1.00 3.58  ? 130 PHE A CE1  1  
ATOM   538   C  CE2  . PHE A 1 35  ? -7.774  10.220  -10.595 1.00 2.64  ? 130 PHE A CE2  1  
ATOM   539   C  CZ   . PHE A 1 35  ? -7.013  11.205  -9.943  1.00 2.22  ? 130 PHE A CZ   1  
ATOM   540   H  H    . PHE A 1 35  ? -4.358  7.358   -6.697  1.00 1.31  ? 130 PHE A H    1  
ATOM   541   H  HA   . PHE A 1 35  ? -5.568  5.335   -8.324  1.00 2.11  ? 130 PHE A HA   1  
ATOM   542   H  HB2  . PHE A 1 35  ? -7.170  6.439   -9.523  1.00 2.98  ? 130 PHE A HB2  1  
ATOM   543   H  HB3  . PHE A 1 35  ? -7.523  6.926   -7.888  1.00 2.63  ? 130 PHE A HB3  1  
ATOM   544   H  HD1  . PHE A 1 35  ? -5.412  9.244   -7.662  1.00 4.97  ? 130 PHE A HD1  1  
ATOM   545   H  HD2  . PHE A 1 35  ? -8.284  8.130   -10.688 1.00 3.79  ? 130 PHE A HD2  1  
ATOM   546   H  HE1  . PHE A 1 35  ? -5.569  11.594  -8.382  1.00 4.11  ? 130 PHE A HE1  1  
ATOM   547   H  HE2  . PHE A 1 35  ? -8.448  10.497  -11.394 1.00 3.49  ? 130 PHE A HE2  1  
ATOM   548   H  HZ   . PHE A 1 35  ? -7.102  12.242  -10.237 1.00 3.15  ? 130 PHE A HZ   1  
ATOM   549   N  N    . THR A 1 36  ? -4.259  6.173   -10.381 1.00 1.76  ? 131 THR A N    1  
ATOM   550   C  CA   . THR A 1 36  ? -3.146  6.179   -11.354 1.00 1.97  ? 131 THR A CA   1  
ATOM   551   C  C    . THR A 1 36  ? -3.025  7.506   -12.138 1.00 2.16  ? 131 THR A C    1  
ATOM   552   O  O    . THR A 1 36  ? -2.730  7.513   -13.337 1.00 3.00  ? 131 THR A O    1  
ATOM   553   C  CB   . THR A 1 36  ? -3.281  4.928   -12.256 1.00 2.44  ? 131 THR A CB   1  
ATOM   554   O  OG1  . THR A 1 36  ? -3.772  3.860   -11.471 1.00 3.45  ? 131 THR A OG1  1  
ATOM   555   C  CG2  . THR A 1 36  ? -1.940  4.462   -12.824 1.00 2.77  ? 131 THR A CG2  1  
ATOM   556   H  H    . THR A 1 36  ? -4.945  5.445   -10.537 1.00 2.29  ? 131 THR A H    1  
ATOM   557   H  HA   . THR A 1 36  ? -2.220  6.067   -10.787 1.00 1.99  ? 131 THR A HA   1  
ATOM   558   H  HB   . THR A 1 36  ? -3.984  5.126   -13.068 1.00 2.60  ? 131 THR A HB   1  
ATOM   559   H  HG1  . THR A 1 36  ? -4.139  3.153   -12.050 1.00 3.80  ? 131 THR A HG1  1  
ATOM   560   H  HG21 . THR A 1 36  ? -1.523  5.220   -13.485 1.00 2.75  ? 131 THR A HG21 1  
ATOM   561   H  HG22 . THR A 1 36  ? -1.241  4.267   -12.010 1.00 3.60  ? 131 THR A HG22 1  
ATOM   562   H  HG23 . THR A 1 36  ? -2.086  3.543   -13.390 1.00 3.39  ? 131 THR A HG23 1  
ATOM   563   N  N    . HIS A 1 37  ? -3.303  8.648   -11.483 1.00 1.80  ? 132 HIS A N    1  
ATOM   564   C  CA   . HIS A 1 37  ? -3.429  9.975   -12.102 1.00 2.08  ? 132 HIS A CA   1  
ATOM   565   C  C    . HIS A 1 37  ? -3.348  11.145  -11.092 1.00 1.76  ? 132 HIS A C    1  
ATOM   566   O  O    . HIS A 1 37  ? -3.856  12.228  -11.388 1.00 2.11  ? 132 HIS A O    1  
ATOM   567   C  CB   . HIS A 1 37  ? -4.716  10.014  -12.966 1.00 2.78  ? 132 HIS A CB   1  
ATOM   568   C  CG   . HIS A 1 37  ? -4.646  10.970  -14.134 1.00 3.23  ? 132 HIS A CG   1  
ATOM   569   N  ND1  . HIS A 1 37  ? -4.368  12.324  -14.078 1.00 3.27  ? 132 HIS A ND1  1  
ATOM   570   C  CD2  . HIS A 1 37  ? -4.815  10.640  -15.450 1.00 4.43  ? 132 HIS A CD2  1  
ATOM   571   C  CE1  . HIS A 1 37  ? -4.352  12.808  -15.334 1.00 4.17  ? 132 HIS A CE1  1  
ATOM   572   N  NE2  . HIS A 1 37  ? -4.627  11.798  -16.182 1.00 4.85  ? 132 HIS A NE2  1  
ATOM   573   H  H    . HIS A 1 37  ? -3.506  8.575   -10.494 1.00 1.78  ? 132 HIS A H    1  
ATOM   574   H  HA   . HIS A 1 37  ? -2.572  10.089  -12.768 1.00 2.55  ? 132 HIS A HA   1  
ATOM   575   H  HB2  . HIS A 1 37  ? -4.922  9.023   -13.375 1.00 3.40  ? 132 HIS A HB2  1  
ATOM   576   H  HB3  . HIS A 1 37  ? -5.566  10.279  -12.337 1.00 3.03  ? 132 HIS A HB3  1  
ATOM   577   H  HD1  . HIS A 1 37  ? -4.173  12.835  -13.220 1.00 3.25  ? 132 HIS A HD1  1  
ATOM   578   H  HD2  . HIS A 1 37  ? -5.020  9.651   -15.846 1.00 5.26  ? 132 HIS A HD2  1  
ATOM   579   H  HE1  . HIS A 1 37  ? -4.136  13.832  -15.616 1.00 4.70  ? 132 HIS A HE1  1  
ATOM   580   H  HE2  . HIS A 1 37  ? -4.691  11.870  -17.203 1.00 5.85  ? 132 HIS A HE2  1  
ATOM   581   N  N    . CYS A 1 38  ? -2.723  10.975  -9.923  1.00 2.12  ? 133 CYS A N    1  
ATOM   582   C  CA   . CYS A 1 38  ? -2.457  12.055  -8.994  1.00 1.93  ? 133 CYS A CA   1  
ATOM   583   C  C    . CYS A 1 38  ? -1.320  12.938  -9.545  1.00 2.31  ? 133 CYS A C    1  
ATOM   584   O  O    . CYS A 1 38  ? -0.330  12.416  -10.086 1.00 2.73  ? 133 CYS A O    1  
ATOM   585   C  CB   . CYS A 1 38  ? -2.090  11.495  -7.623  1.00 1.84  ? 133 CYS A CB   1  
ATOM   586   S  SG   . CYS A 1 38  ? -1.812  12.784  -6.380  1.00 2.17  ? 133 CYS A SG   1  
ATOM   587   H  H    . CYS A 1 38  ? -2.185  10.160  -9.747  1.00 2.90  ? 133 CYS A H    1  
ATOM   588   H  HA   . CYS A 1 38  ? -3.380  12.617  -8.874  1.00 1.86  ? 133 CYS A HA   1  
ATOM   589   H  HB2  . CYS A 1 38  ? -2.890  10.843  -7.266  1.00 1.88  ? 133 CYS A HB2  1  
ATOM   590   H  HB3  . CYS A 1 38  ? -1.189  10.887  -7.709  1.00 2.68  ? 133 CYS A HB3  1  
ATOM   591   N  N    . PRO A 1 39  ? -1.471  14.266  -9.470  1.00 2.41  ? 134 PRO A N    1  
ATOM   592   C  CA   . PRO A 1 39  ? -0.505  15.205  -10.011 1.00 2.85  ? 134 PRO A CA   1  
ATOM   593   C  C    . PRO A 1 39  ? 0.717   15.385  -9.101  1.00 2.54  ? 134 PRO A C    1  
ATOM   594   O  O    . PRO A 1 39  ? 1.834   15.347  -9.612  1.00 3.56  ? 134 PRO A O    1  
ATOM   595   C  CB   . PRO A 1 39  ? -1.300  16.495  -10.204 1.00 3.31  ? 134 PRO A CB   1  
ATOM   596   C  CG   . PRO A 1 39  ? -2.374  16.414  -9.121  1.00 2.92  ? 134 PRO A CG   1  
ATOM   597   C  CD   . PRO A 1 39  ? -2.696  14.940  -9.076  1.00 2.46  ? 134 PRO A CD   1  
ATOM   598   H  HA   . PRO A 1 39  ? -0.161  14.866  -10.989 1.00 3.31  ? 134 PRO A HA   1  
ATOM   599   H  HB2  . PRO A 1 39  ? -0.679  17.384  -10.106 1.00 3.59  ? 134 PRO A HB2  1  
ATOM   600   H  HB3  . PRO A 1 39  ? -1.780  16.456  -11.183 1.00 3.80  ? 134 PRO A HB3  1  
ATOM   601   H  HG2  . PRO A 1 39  ? -1.963  16.687  -8.154  1.00 2.85  ? 134 PRO A HG2  1  
ATOM   602   H  HG3  . PRO A 1 39  ? -3.263  16.981  -9.374  1.00 3.23  ? 134 PRO A HG3  1  
ATOM   603   H  HD2  . PRO A 1 39  ? -3.009  14.660  -8.070  1.00 2.14  ? 134 PRO A HD2  1  
ATOM   604   H  HD3  . PRO A 1 39  ? -3.484  14.714  -9.796  1.00 2.78  ? 134 PRO A HD3  1  
ATOM   605   N  N    . ASP A 1 40  ? 0.533   15.563  -7.783  1.00 1.74  ? 135 ASP A N    1  
ATOM   606   C  CA   . ASP A 1 40  ? 1.577   16.137  -6.911  1.00 1.49  ? 135 ASP A CA   1  
ATOM   607   C  C    . ASP A 1 40  ? 1.427   15.816  -5.402  1.00 1.34  ? 135 ASP A C    1  
ATOM   608   O  O    . ASP A 1 40  ? 2.029   16.493  -4.565  1.00 1.56  ? 135 ASP A O    1  
ATOM   609   C  CB   . ASP A 1 40  ? 1.689   17.657  -7.179  1.00 2.07  ? 135 ASP A CB   1  
ATOM   610   C  CG   . ASP A 1 40  ? 3.128   18.171  -7.052  1.00 2.62  ? 135 ASP A CG   1  
ATOM   611   O  OD1  . ASP A 1 40  ? 4.006   17.689  -7.805  1.00 3.28  ? 135 ASP A OD1  1  
ATOM   612   O  OD2  . ASP A 1 40  ? 3.390   19.109  -6.260  1.00 3.42  ? 135 ASP A OD2  1  
ATOM   613   H  H    . ASP A 1 40  ? -0.409  15.522  -7.421  1.00 2.04  ? 135 ASP A H    1  
ATOM   614   H  HA   . ASP A 1 40  ? 2.521   15.686  -7.215  1.00 1.55  ? 135 ASP A HA   1  
ATOM   615   H  HB2  . ASP A 1 40  ? 1.359   17.883  -8.194  1.00 2.57  ? 135 ASP A HB2  1  
ATOM   616   H  HB3  . ASP A 1 40  ? 1.030   18.199  -6.498  1.00 2.63  ? 135 ASP A HB3  1  
ATOM   617   N  N    . ILE A 1 41  ? 0.636   14.791  -5.041  1.00 1.25  ? 136 ILE A N    1  
ATOM   618   C  CA   . ILE A 1 41  ? 0.605   14.217  -3.677  1.00 1.31  ? 136 ILE A CA   1  
ATOM   619   C  C    . ILE A 1 41  ? 1.262   12.830  -3.668  1.00 1.29  ? 136 ILE A C    1  
ATOM   620   O  O    . ILE A 1 41  ? 2.285   12.654  -3.004  1.00 1.28  ? 136 ILE A O    1  
ATOM   621   C  CB   . ILE A 1 41  ? -0.837  14.189  -3.112  1.00 1.67  ? 136 ILE A CB   1  
ATOM   622   C  CG1  . ILE A 1 41  ? -1.525  15.575  -3.113  1.00 2.09  ? 136 ILE A CG1  1  
ATOM   623   C  CG2  . ILE A 1 41  ? -0.860  13.577  -1.698  1.00 2.20  ? 136 ILE A CG2  1  
ATOM   624   C  CD1  . ILE A 1 41  ? -0.840  16.660  -2.269  1.00 2.71  ? 136 ILE A CD1  1  
ATOM   625   H  H    . ILE A 1 41  ? 0.131   14.291  -5.767  1.00 1.36  ? 136 ILE A H    1  
ATOM   626   H  HA   . ILE A 1 41  ? 1.217   14.824  -3.009  1.00 1.34  ? 136 ILE A HA   1  
ATOM   627   H  HB   . ILE A 1 41  ? -1.443  13.542  -3.745  1.00 2.33  ? 136 ILE A HB   1  
ATOM   628   H  HG12 . ILE A 1 41  ? -1.599  15.935  -4.140  1.00 2.74  ? 136 ILE A HG12 1  
ATOM   629   H  HG13 . ILE A 1 41  ? -2.545  15.454  -2.747  1.00 2.79  ? 136 ILE A HG13 1  
ATOM   630   H  HG21 . ILE A 1 41  ? -1.868  13.630  -1.285  1.00 2.50  ? 136 ILE A HG21 1  
ATOM   631   H  HG22 . ILE A 1 41  ? -0.171  14.106  -1.039  1.00 2.94  ? 136 ILE A HG22 1  
ATOM   632   H  HG23 . ILE A 1 41  ? -0.569  12.528  -1.742  1.00 2.97  ? 136 ILE A HG23 1  
ATOM   633   H  HD11 . ILE A 1 41  ? 0.170   16.843  -2.631  1.00 3.43  ? 136 ILE A HD11 1  
ATOM   634   H  HD12 . ILE A 1 41  ? -1.409  17.586  -2.348  1.00 3.09  ? 136 ILE A HD12 1  
ATOM   635   H  HD13 . ILE A 1 41  ? -0.802  16.359  -1.223  1.00 3.40  ? 136 ILE A HD13 1  
ATOM   636   N  N    . CYS A 1 42  ? 0.746   11.870  -4.443  1.00 1.43  ? 137 CYS A N    1  
ATOM   637   C  CA   . CYS A 1 42  ? 1.341   10.541  -4.588  1.00 1.64  ? 137 CYS A CA   1  
ATOM   638   C  C    . CYS A 1 42  ? 2.838   10.543  -4.987  1.00 1.57  ? 137 CYS A C    1  
ATOM   639   O  O    . CYS A 1 42  ? 3.583   9.764   -4.391  1.00 1.82  ? 137 CYS A O    1  
ATOM   640   C  CB   . CYS A 1 42  ? 0.496   9.719   -5.568  1.00 1.83  ? 137 CYS A CB   1  
ATOM   641   S  SG   . CYS A 1 42  ? -1.210  9.424   -5.031  1.00 2.02  ? 137 CYS A SG   1  
ATOM   642   H  H    . CYS A 1 42  ? -0.128  12.029  -4.936  1.00 1.52  ? 137 CYS A H    1  
ATOM   643   H  HA   . CYS A 1 42  ? 1.273   10.049  -3.617  1.00 1.90  ? 137 CYS A HA   1  
ATOM   644   H  HB2  . CYS A 1 42  ? 0.479   10.224  -6.534  1.00 1.89  ? 137 CYS A HB2  1  
ATOM   645   H  HB3  . CYS A 1 42  ? 0.978   8.752   -5.708  1.00 2.05  ? 137 CYS A HB3  1  
ATOM   646   N  N    . PRO A 1 43  ? 3.341   11.369  -5.935  1.00 1.38  ? 138 PRO A N    1  
ATOM   647   C  CA   . PRO A 1 43  ? 4.764   11.355  -6.288  1.00 1.54  ? 138 PRO A CA   1  
ATOM   648   C  C    . PRO A 1 43  ? 5.686   11.969  -5.219  1.00 1.53  ? 138 PRO A C    1  
ATOM   649   O  O    . PRO A 1 43  ? 6.897   11.754  -5.283  1.00 1.82  ? 138 PRO A O    1  
ATOM   650   C  CB   . PRO A 1 43  ? 4.868   12.096  -7.623  1.00 1.54  ? 138 PRO A CB   1  
ATOM   651   C  CG   . PRO A 1 43  ? 3.678   13.047  -7.591  1.00 1.22  ? 138 PRO A CG   1  
ATOM   652   C  CD   . PRO A 1 43  ? 2.614   12.236  -6.858  1.00 1.17  ? 138 PRO A CD   1  
ATOM   653   H  HA   . PRO A 1 43  ? 5.084   10.323  -6.441  1.00 1.79  ? 138 PRO A HA   1  
ATOM   654   H  HB2  . PRO A 1 43  ? 5.810   12.634  -7.720  1.00 1.69  ? 138 PRO A HB2  1  
ATOM   655   H  HB3  . PRO A 1 43  ? 4.747   11.387  -8.444  1.00 1.73  ? 138 PRO A HB3  1  
ATOM   656   H  HG2  . PRO A 1 43  ? 3.937   13.929  -7.004  1.00 1.15  ? 138 PRO A HG2  1  
ATOM   657   H  HG3  . PRO A 1 43  ? 3.356   13.327  -8.594  1.00 1.26  ? 138 PRO A HG3  1  
ATOM   658   H  HD2  . PRO A 1 43  ? 1.940   12.917  -6.350  1.00 1.04  ? 138 PRO A HD2  1  
ATOM   659   H  HD3  . PRO A 1 43  ? 2.059   11.625  -7.571  1.00 1.27  ? 138 PRO A HD3  1  
ATOM   660   N  N    . ASP A 1 44  ? 5.161   12.714  -4.237  1.00 1.30  ? 139 ASP A N    1  
ATOM   661   C  CA   . ASP A 1 44  ? 5.858   12.955  -2.975  1.00 1.19  ? 139 ASP A CA   1  
ATOM   662   C  C    . ASP A 1 44  ? 5.785   11.685  -2.112  1.00 1.19  ? 139 ASP A C    1  
ATOM   663   O  O    . ASP A 1 44  ? 6.781   10.980  -1.979  1.00 1.31  ? 139 ASP A O    1  
ATOM   664   C  CB   . ASP A 1 44  ? 5.300   14.214  -2.290  1.00 1.29  ? 139 ASP A CB   1  
ATOM   665   C  CG   . ASP A 1 44  ? 5.985   14.479  -0.950  1.00 1.59  ? 139 ASP A CG   1  
ATOM   666   O  OD1  . ASP A 1 44  ? 7.054   15.134  -0.930  1.00 2.13  ? 139 ASP A OD1  1  
ATOM   667   O  OD2  . ASP A 1 44  ? 5.467   14.003  0.080   1.00 2.63  ? 139 ASP A OD2  1  
ATOM   668   H  H    . ASP A 1 44  ? 4.155   12.827  -4.190  1.00 1.24  ? 139 ASP A H    1  
ATOM   669   H  HA   . ASP A 1 44  ? 6.912   13.146  -3.177  1.00 1.24  ? 139 ASP A HA   1  
ATOM   670   H  HB2  . ASP A 1 44  ? 5.456   15.072  -2.947  1.00 1.61  ? 139 ASP A HB2  1  
ATOM   671   H  HB3  . ASP A 1 44  ? 4.227   14.109  -2.128  1.00 1.32  ? 139 ASP A HB3  1  
ATOM   672   N  N    . GLU A 1 45  ? 4.605   11.381  -1.562  1.00 1.22  ? 140 GLU A N    1  
ATOM   673   C  CA   . GLU A 1 45  ? 4.367   10.346  -0.554  1.00 1.27  ? 140 GLU A CA   1  
ATOM   674   C  C    . GLU A 1 45  ? 4.855   8.940   -0.933  1.00 1.16  ? 140 GLU A C    1  
ATOM   675   O  O    . GLU A 1 45  ? 5.421   8.269   -0.079  1.00 1.21  ? 140 GLU A O    1  
ATOM   676   C  CB   . GLU A 1 45  ? 2.882   10.329  -0.138  1.00 1.39  ? 140 GLU A CB   1  
ATOM   677   C  CG   . GLU A 1 45  ? 2.613   9.561   1.172   1.00 2.02  ? 140 GLU A CG   1  
ATOM   678   C  CD   . GLU A 1 45  ? 3.283   10.223  2.374   1.00 2.56  ? 140 GLU A CD   1  
ATOM   679   O  OE1  . GLU A 1 45  ? 2.737   11.221  2.892   1.00 2.65  ? 140 GLU A OE1  1  
ATOM   680   O  OE2  . GLU A 1 45  ? 4.445   9.880   2.687   1.00 3.62  ? 140 GLU A OE2  1  
ATOM   681   H  H    . GLU A 1 45  ? 3.863   12.047  -1.717  1.00 1.27  ? 140 GLU A H    1  
ATOM   682   H  HA   . GLU A 1 45  ? 4.939   10.649  0.314   1.00 1.37  ? 140 GLU A HA   1  
ATOM   683   H  HB2  . GLU A 1 45  ? 2.539   11.357  -0.007  1.00 1.74  ? 140 GLU A HB2  1  
ATOM   684   H  HB3  . GLU A 1 45  ? 2.295   9.880   -0.941  1.00 1.85  ? 140 GLU A HB3  1  
ATOM   685   H  HG2  . GLU A 1 45  ? 1.539   9.534   1.352   1.00 2.25  ? 140 GLU A HG2  1  
ATOM   686   H  HG3  . GLU A 1 45  ? 2.960   8.533   1.077   1.00 2.88  ? 140 GLU A HG3  1  
ATOM   687   N  N    . LEU A 1 46  ? 4.723   8.464   -2.176  1.00 1.07  ? 141 LEU A N    1  
ATOM   688   C  CA   . LEU A 1 46  ? 5.249   7.140   -2.545  1.00 1.03  ? 141 LEU A CA   1  
ATOM   689   C  C    . LEU A 1 46  ? 6.780   7.120   -2.470  1.00 1.02  ? 141 LEU A C    1  
ATOM   690   O  O    . LEU A 1 46  ? 7.340   6.195   -1.887  1.00 1.03  ? 141 LEU A O    1  
ATOM   691   C  CB   . LEU A 1 46  ? 4.737   6.686   -3.927  1.00 1.09  ? 141 LEU A CB   1  
ATOM   692   C  CG   . LEU A 1 46  ? 3.390   5.934   -3.892  1.00 1.32  ? 141 LEU A CG   1  
ATOM   693   C  CD1  . LEU A 1 46  ? 2.232   6.737   -3.281  1.00 2.43  ? 141 LEU A CD1  1  
ATOM   694   C  CD2  . LEU A 1 46  ? 3.021   5.503   -5.318  1.00 1.94  ? 141 LEU A CD2  1  
ATOM   695   H  H    . LEU A 1 46  ? 4.264   9.032   -2.883  1.00 1.09  ? 141 LEU A H    1  
ATOM   696   H  HA   . LEU A 1 46  ? 4.911   6.417   -1.801  1.00 1.06  ? 141 LEU A HA   1  
ATOM   697   H  HB2  . LEU A 1 46  ? 4.675   7.537   -4.602  1.00 1.51  ? 141 LEU A HB2  1  
ATOM   698   H  HB3  . LEU A 1 46  ? 5.473   5.998   -4.347  1.00 1.73  ? 141 LEU A HB3  1  
ATOM   699   H  HG   . LEU A 1 46  ? 3.523   5.032   -3.292  1.00 2.53  ? 141 LEU A HG   1  
ATOM   700   H  HD11 . LEU A 1 46  ? 1.317   6.146   -3.312  1.00 3.13  ? 141 LEU A HD11 1  
ATOM   701   H  HD12 . LEU A 1 46  ? 2.075   7.657   -3.839  1.00 3.24  ? 141 LEU A HD12 1  
ATOM   702   H  HD13 . LEU A 1 46  ? 2.444   6.975   -2.240  1.00 3.36  ? 141 LEU A HD13 1  
ATOM   703   H  HD21 . LEU A 1 46  ? 2.100   4.922   -5.303  1.00 2.51  ? 141 LEU A HD21 1  
ATOM   704   H  HD22 . LEU A 1 46  ? 2.882   6.382   -5.948  1.00 2.85  ? 141 LEU A HD22 1  
ATOM   705   H  HD23 . LEU A 1 46  ? 3.815   4.884   -5.738  1.00 2.65  ? 141 LEU A HD23 1  
ATOM   706   N  N    . GLU A 1 47  ? 7.463   8.152   -2.970  1.00 1.03  ? 142 GLU A N    1  
ATOM   707   C  CA   . GLU A 1 47  ? 8.921   8.290   -2.843  1.00 1.08  ? 142 GLU A CA   1  
ATOM   708   C  C    . GLU A 1 47  ? 9.335   8.493   -1.371  1.00 1.06  ? 142 GLU A C    1  
ATOM   709   O  O    . GLU A 1 47  ? 10.352  7.970   -0.905  1.00 1.11  ? 142 GLU A O    1  
ATOM   710   C  CB   . GLU A 1 47  ? 9.377   9.461   -3.731  1.00 1.17  ? 142 GLU A CB   1  
ATOM   711   C  CG   . GLU A 1 47  ? 10.904  9.574   -3.851  1.00 1.45  ? 142 GLU A CG   1  
ATOM   712   C  CD   . GLU A 1 47  ? 11.320  10.651  -4.856  1.00 2.38  ? 142 GLU A CD   1  
ATOM   713   O  OE1  . GLU A 1 47  ? 10.670  11.722  -4.879  1.00 3.02  ? 142 GLU A OE1  1  
ATOM   714   O  OE2  . GLU A 1 47  ? 12.286  10.399  -5.615  1.00 3.57  ? 142 GLU A OE2  1  
ATOM   715   H  H    . GLU A 1 47  ? 6.933   8.936   -3.330  1.00 1.00  ? 142 GLU A H    1  
ATOM   716   H  HA   . GLU A 1 47  ? 9.390   7.377   -3.210  1.00 1.16  ? 142 GLU A HA   1  
ATOM   717   H  HB2  . GLU A 1 47  ? 8.966   9.320   -4.732  1.00 1.23  ? 142 GLU A HB2  1  
ATOM   718   H  HB3  . GLU A 1 47  ? 8.980   10.393  -3.329  1.00 1.16  ? 142 GLU A HB3  1  
ATOM   719   H  HG2  . GLU A 1 47  ? 11.328  9.822   -2.879  1.00 1.62  ? 142 GLU A HG2  1  
ATOM   720   H  HG3  . GLU A 1 47  ? 11.306  8.611   -4.170  1.00 2.02  ? 142 GLU A HG3  1  
ATOM   721   N  N    . LYS A 1 48  ? 8.519   9.218   -0.605  1.00 1.07  ? 143 LYS A N    1  
ATOM   722   C  CA   . LYS A 1 48  ? 8.705   9.498   0.817   1.00 1.13  ? 143 LYS A CA   1  
ATOM   723   C  C    . LYS A 1 48  ? 8.585   8.208   1.658   1.00 1.09  ? 143 LYS A C    1  
ATOM   724   O  O    . LYS A 1 48  ? 9.478   7.899   2.452   1.00 1.21  ? 143 LYS A O    1  
ATOM   725   C  CB   . LYS A 1 48  ? 7.711   10.628  1.185   1.00 1.28  ? 143 LYS A CB   1  
ATOM   726   C  CG   . LYS A 1 48  ? 8.164   11.452  2.393   1.00 1.72  ? 143 LYS A CG   1  
ATOM   727   C  CD   . LYS A 1 48  ? 7.537   12.852  2.512   1.00 1.82  ? 143 LYS A CD   1  
ATOM   728   C  CE   . LYS A 1 48  ? 6.160   12.932  3.181   1.00 2.17  ? 143 LYS A CE   1  
ATOM   729   N  NZ   . LYS A 1 48  ? 5.084   12.484  2.290   1.00 3.16  ? 143 LYS A NZ   1  
ATOM   730   H  H    . LYS A 1 48  ? 7.703   9.628   -1.052  1.00 1.07  ? 143 LYS A H    1  
ATOM   731   H  HA   . LYS A 1 48  ? 9.721   9.868   0.954   1.00 1.22  ? 143 LYS A HA   1  
ATOM   732   H  HB2  . LYS A 1 48  ? 7.657   11.320  0.346   1.00 1.34  ? 143 LYS A HB2  1  
ATOM   733   H  HB3  . LYS A 1 48  ? 6.717   10.219  1.347   1.00 1.25  ? 143 LYS A HB3  1  
ATOM   734   H  HG2  . LYS A 1 48  ? 8.008   10.886  3.311   1.00 2.30  ? 143 LYS A HG2  1  
ATOM   735   H  HG3  . LYS A 1 48  ? 9.222   11.626  2.247   1.00 2.78  ? 143 LYS A HG3  1  
ATOM   736   H  HD2  . LYS A 1 48  ? 8.216   13.461  3.105   1.00 2.61  ? 143 LYS A HD2  1  
ATOM   737   H  HD3  . LYS A 1 48  ? 7.495   13.315  1.526   1.00 2.87  ? 143 LYS A HD3  1  
ATOM   738   H  HE2  . LYS A 1 48  ? 6.146   12.324  4.086   1.00 2.66  ? 143 LYS A HE2  1  
ATOM   739   H  HE3  . LYS A 1 48  ? 5.968   13.972  3.459   1.00 2.91  ? 143 LYS A HE3  1  
ATOM   740   H  HZ1  . LYS A 1 48  ? 5.078   13.005  1.415   1.00 3.45  ? 143 LYS A HZ1  1  
ATOM   741   H  HZ2  . LYS A 1 48  ? 5.170   11.487  2.110   1.00 3.74  ? 143 LYS A HZ2  1  
ATOM   742   H  HZ3  . LYS A 1 48  ? 4.164   12.538  2.725   1.00 4.02  ? 143 LYS A HZ3  1  
ATOM   743   N  N    . LEU A 1 49  ? 7.569   7.379   1.400   1.00 1.02  ? 144 LEU A N    1  
ATOM   744   C  CA   . LEU A 1 49  ? 7.401   6.038   1.967   1.00 1.00  ? 144 LEU A CA   1  
ATOM   745   C  C    . LEU A 1 49  ? 8.459   5.057   1.452   1.00 0.96  ? 144 LEU A C    1  
ATOM   746   O  O    . LEU A 1 49  ? 9.048   4.359   2.272   1.00 1.04  ? 144 LEU A O    1  
ATOM   747   C  CB   . LEU A 1 49  ? 5.978   5.521   1.682   1.00 1.14  ? 144 LEU A CB   1  
ATOM   748   C  CG   . LEU A 1 49  ? 4.854   6.274   2.429   1.00 1.85  ? 144 LEU A CG   1  
ATOM   749   C  CD1  . LEU A 1 49  ? 3.496   5.744   1.948   1.00 2.61  ? 144 LEU A CD1  1  
ATOM   750   C  CD2  . LEU A 1 49  ? 4.966   6.130   3.955   1.00 2.92  ? 144 LEU A CD2  1  
ATOM   751   H  H    . LEU A 1 49  ? 6.848   7.716   0.767   1.00 0.98  ? 144 LEU A H    1  
ATOM   752   H  HA   . LEU A 1 49  ? 7.544   6.093   3.046   1.00 1.05  ? 144 LEU A HA   1  
ATOM   753   H  HB2  . LEU A 1 49  ? 5.792   5.583   0.608   1.00 2.04  ? 144 LEU A HB2  1  
ATOM   754   H  HB3  . LEU A 1 49  ? 5.927   4.468   1.964   1.00 1.91  ? 144 LEU A HB3  1  
ATOM   755   H  HG   . LEU A 1 49  ? 4.906   7.333   2.192   1.00 2.42  ? 144 LEU A HG   1  
ATOM   756   H  HD11 . LEU A 1 49  ? 3.407   5.880   0.870   1.00 3.08  ? 144 LEU A HD11 1  
ATOM   757   H  HD12 . LEU A 1 49  ? 3.400   4.684   2.185   1.00 2.74  ? 144 LEU A HD12 1  
ATOM   758   H  HD13 . LEU A 1 49  ? 2.691   6.297   2.431   1.00 3.73  ? 144 LEU A HD13 1  
ATOM   759   H  HD21 . LEU A 1 49  ? 5.019   5.079   4.234   1.00 3.29  ? 144 LEU A HD21 1  
ATOM   760   H  HD22 . LEU A 1 49  ? 5.856   6.642   4.317   1.00 3.87  ? 144 LEU A HD22 1  
ATOM   761   H  HD23 . LEU A 1 49  ? 4.099   6.588   4.433   1.00 3.47  ? 144 LEU A HD23 1  
ATOM   762   N  N    . VAL A 1 50  ? 8.795   5.042   0.158   1.00 0.93  ? 145 VAL A N    1  
ATOM   763   C  CA   . VAL A 1 50  ? 9.891   4.202   -0.372  1.00 1.00  ? 145 VAL A CA   1  
ATOM   764   C  C    . VAL A 1 50  ? 11.205  4.475   0.374   1.00 1.01  ? 145 VAL A C    1  
ATOM   765   O  O    . VAL A 1 50  ? 11.883  3.526   0.748   1.00 1.12  ? 145 VAL A O    1  
ATOM   766   C  CB   . VAL A 1 50  ? 10.053  4.347   -1.907  1.00 1.11  ? 145 VAL A CB   1  
ATOM   767   C  CG1  . VAL A 1 50  ? 11.418  3.871   -2.440  1.00 1.47  ? 145 VAL A CG1  1  
ATOM   768   C  CG2  . VAL A 1 50  ? 8.963   3.531   -2.627  1.00 1.39  ? 145 VAL A CG2  1  
ATOM   769   H  H    . VAL A 1 50  ? 8.234   5.588   -0.505  1.00 0.92  ? 145 VAL A H    1  
ATOM   770   H  HA   . VAL A 1 50  ? 9.622   3.164   -0.169  1.00 1.08  ? 145 VAL A HA   1  
ATOM   771   H  HB   . VAL A 1 50  ? 9.946   5.399   -2.168  1.00 1.30  ? 145 VAL A HB   1  
ATOM   772   H  HG11 . VAL A 1 50  ? 12.217  4.513   -2.066  1.00 2.27  ? 145 VAL A HG11 1  
ATOM   773   H  HG12 . VAL A 1 50  ? 11.607  2.842   -2.131  1.00 2.21  ? 145 VAL A HG12 1  
ATOM   774   H  HG13 . VAL A 1 50  ? 11.430  3.924   -3.529  1.00 1.91  ? 145 VAL A HG13 1  
ATOM   775   H  HG21 . VAL A 1 50  ? 7.976   3.767   -2.233  1.00 1.85  ? 145 VAL A HG21 1  
ATOM   776   H  HG22 . VAL A 1 50  ? 8.979   3.759   -3.694  1.00 2.00  ? 145 VAL A HG22 1  
ATOM   777   H  HG23 . VAL A 1 50  ? 9.140   2.464   -2.487  1.00 2.32  ? 145 VAL A HG23 1  
ATOM   778   N  N    . GLN A 1 51  ? 11.536  5.730   0.701   1.00 0.98  ? 146 GLN A N    1  
ATOM   779   C  CA   . GLN A 1 51  ? 12.703  6.026   1.545   1.00 1.10  ? 146 GLN A CA   1  
ATOM   780   C  C    . GLN A 1 51  ? 12.589  5.437   2.964   1.00 1.04  ? 146 GLN A C    1  
ATOM   781   O  O    . GLN A 1 51  ? 13.602  5.011   3.513   1.00 1.18  ? 146 GLN A O    1  
ATOM   782   C  CB   . GLN A 1 51  ? 12.935  7.541   1.596   1.00 1.25  ? 146 GLN A CB   1  
ATOM   783   C  CG   . GLN A 1 51  ? 13.536  8.070   0.285   1.00 1.63  ? 146 GLN A CG   1  
ATOM   784   C  CD   . GLN A 1 51  ? 13.387  9.582   0.201   1.00 1.81  ? 146 GLN A CD   1  
ATOM   785   O  OE1  . GLN A 1 51  ? 14.252  10.347  0.609   1.00 2.57  ? 146 GLN A OE1  1  
ATOM   786   N  NE2  . GLN A 1 51  ? 12.261  10.058  -0.279  1.00 1.96  ? 146 GLN A NE2  1  
ATOM   787   H  H    . GLN A 1 51  ? 10.985  6.500   0.326   1.00 0.95  ? 146 GLN A H    1  
ATOM   788   H  HA   . GLN A 1 51  ? 13.587  5.562   1.103   1.00 1.28  ? 146 GLN A HA   1  
ATOM   789   H  HB2  . GLN A 1 51  ? 11.990  8.044   1.803   1.00 1.78  ? 146 GLN A HB2  1  
ATOM   790   H  HB3  . GLN A 1 51  ? 13.628  7.777   2.407   1.00 2.04  ? 146 GLN A HB3  1  
ATOM   791   H  HG2  . GLN A 1 51  ? 14.592  7.804   0.232   1.00 2.45  ? 146 GLN A HG2  1  
ATOM   792   H  HG3  . GLN A 1 51  ? 13.028  7.623   -0.571  1.00 2.32  ? 146 GLN A HG3  1  
ATOM   793   H  HE21 . GLN A 1 51  ? 11.545  9.421   -0.613  1.00 2.27  ? 146 GLN A HE21 1  
ATOM   794   H  HE22 . GLN A 1 51  ? 12.140  11.063  -0.271  1.00 2.31  ? 146 GLN A HE22 1  
ATOM   795   N  N    . VAL A 1 52  ? 11.389  5.356   3.550   1.00 0.96  ? 147 VAL A N    1  
ATOM   796   C  CA   . VAL A 1 52  ? 11.147  4.675   4.841   1.00 1.03  ? 147 VAL A CA   1  
ATOM   797   C  C    . VAL A 1 52  ? 11.282  3.152   4.696   1.00 1.06  ? 147 VAL A C    1  
ATOM   798   O  O    . VAL A 1 52  ? 11.977  2.531   5.494   1.00 1.18  ? 147 VAL A O    1  
ATOM   799   C  CB   . VAL A 1 52  ? 9.781   5.065   5.457   1.00 1.09  ? 147 VAL A CB   1  
ATOM   800   C  CG1  . VAL A 1 52  ? 9.473   4.307   6.760   1.00 1.41  ? 147 VAL A CG1  1  
ATOM   801   C  CG2  . VAL A 1 52  ? 9.720   6.577   5.737   1.00 1.51  ? 147 VAL A CG2  1  
ATOM   802   H  H    . VAL A 1 52  ? 10.584  5.713   3.043   1.00 0.96  ? 147 VAL A H    1  
ATOM   803   H  HA   . VAL A 1 52  ? 11.914  5.002   5.540   1.00 1.15  ? 147 VAL A HA   1  
ATOM   804   H  HB   . VAL A 1 52  ? 8.994   4.830   4.742   1.00 1.50  ? 147 VAL A HB   1  
ATOM   805   H  HG11 . VAL A 1 52  ? 9.364   3.241   6.562   1.00 2.05  ? 147 VAL A HG11 1  
ATOM   806   H  HG12 . VAL A 1 52  ? 10.275  4.458   7.482   1.00 1.86  ? 147 VAL A HG12 1  
ATOM   807   H  HG13 . VAL A 1 52  ? 8.537   4.668   7.185   1.00 2.28  ? 147 VAL A HG13 1  
ATOM   808   H  HG21 . VAL A 1 52  ? 10.376  6.835   6.570   1.00 2.03  ? 147 VAL A HG21 1  
ATOM   809   H  HG22 . VAL A 1 52  ? 10.024  7.150   4.865   1.00 2.29  ? 147 VAL A HG22 1  
ATOM   810   H  HG23 . VAL A 1 52  ? 8.696   6.857   5.975   1.00 2.24  ? 147 VAL A HG23 1  
ATOM   811   N  N    . VAL A 1 53  ? 10.712  2.544   3.650   1.00 0.99  ? 148 VAL A N    1  
ATOM   812   C  CA   . VAL A 1 53  ? 10.886  1.104   3.361   1.00 1.01  ? 148 VAL A CA   1  
ATOM   813   C  C    . VAL A 1 53  ? 12.380  0.758   3.223   1.00 1.09  ? 148 VAL A C    1  
ATOM   814   O  O    . VAL A 1 53  ? 12.840  -0.217  3.808   1.00 1.22  ? 148 VAL A O    1  
ATOM   815   C  CB   . VAL A 1 53  ? 10.103  0.673   2.096   1.00 0.95  ? 148 VAL A CB   1  
ATOM   816   C  CG1  . VAL A 1 53  ? 10.362  -0.793  1.700   1.00 1.63  ? 148 VAL A CG1  1  
ATOM   817   C  CG2  . VAL A 1 53  ? 8.585   0.859   2.281   1.00 1.47  ? 148 VAL A CG2  1  
ATOM   818   H  H    . VAL A 1 53  ? 10.118  3.103   3.039   1.00 0.94  ? 148 VAL A H    1  
ATOM   819   H  HA   . VAL A 1 53  ? 10.487  0.548   4.210   1.00 1.13  ? 148 VAL A HA   1  
ATOM   820   H  HB   . VAL A 1 53  ? 10.420  1.307   1.269   1.00 1.36  ? 148 VAL A HB   1  
ATOM   821   H  HG11 . VAL A 1 53  ? 10.126  -1.454  2.535   1.00 2.44  ? 148 VAL A HG11 1  
ATOM   822   H  HG12 . VAL A 1 53  ? 9.741   -1.063  0.844   1.00 2.21  ? 148 VAL A HG12 1  
ATOM   823   H  HG13 . VAL A 1 53  ? 11.404  -0.931  1.414   1.00 2.37  ? 148 VAL A HG13 1  
ATOM   824   H  HG21 . VAL A 1 53  ? 8.349   1.894   2.521   1.00 1.96  ? 148 VAL A HG21 1  
ATOM   825   H  HG22 . VAL A 1 53  ? 8.063   0.595   1.360   1.00 2.28  ? 148 VAL A HG22 1  
ATOM   826   H  HG23 . VAL A 1 53  ? 8.223   0.222   3.088   1.00 2.33  ? 148 VAL A HG23 1  
ATOM   827   N  N    . ARG A 1 54  ? 13.160  1.593   2.523   1.00 1.09  ? 149 ARG A N    1  
ATOM   828   C  CA   . ARG A 1 54  ? 14.603  1.405   2.307   1.00 1.24  ? 149 ARG A CA   1  
ATOM   829   C  C    . ARG A 1 54  ? 15.430  1.622   3.577   1.00 1.29  ? 149 ARG A C    1  
ATOM   830   O  O    . ARG A 1 54  ? 16.379  0.880   3.810   1.00 1.47  ? 149 ARG A O    1  
ATOM   831   C  CB   . ARG A 1 54  ? 15.087  2.341   1.191   1.00 1.28  ? 149 ARG A CB   1  
ATOM   832   C  CG   . ARG A 1 54  ? 14.451  1.988   -0.161  1.00 1.54  ? 149 ARG A CG   1  
ATOM   833   C  CD   . ARG A 1 54  ? 15.103  0.785   -0.853  1.00 2.24  ? 149 ARG A CD   1  
ATOM   834   N  NE   . ARG A 1 54  ? 16.241  1.189   -1.690  1.00 2.33  ? 149 ARG A NE   1  
ATOM   835   C  CZ   . ARG A 1 54  ? 17.281  0.441   -2.028  1.00 3.30  ? 149 ARG A CZ   1  
ATOM   836   N  NH1  . ARG A 1 54  ? 17.452  -0.785  -1.588  1.00 4.37  ? 149 ARG A NH1  1  
ATOM   837   N  NH2  . ARG A 1 54  ? 18.172  0.949   -2.848  1.00 3.96  ? 149 ARG A NH2  1  
ATOM   838   H  H    . ARG A 1 54  ? 12.710  2.375   2.060   1.00 1.01  ? 149 ARG A H    1  
ATOM   839   H  HA   . ARG A 1 54  ? 14.768  0.375   1.991   1.00 1.39  ? 149 ARG A HA   1  
ATOM   840   H  HB2  . ARG A 1 54  ? 14.821  3.367   1.451   1.00 1.33  ? 149 ARG A HB2  1  
ATOM   841   H  HB3  . ARG A 1 54  ? 16.173  2.284   1.103   1.00 1.51  ? 149 ARG A HB3  1  
ATOM   842   H  HG2  . ARG A 1 54  ? 13.402  1.750   -0.012  1.00 2.20  ? 149 ARG A HG2  1  
ATOM   843   H  HG3  . ARG A 1 54  ? 14.504  2.870   -0.794  1.00 1.75  ? 149 ARG A HG3  1  
ATOM   844   H  HD2  . ARG A 1 54  ? 15.423  0.071   -0.097  1.00 3.15  ? 149 ARG A HD2  1  
ATOM   845   H  HD3  . ARG A 1 54  ? 14.359  0.297   -1.485  1.00 2.97  ? 149 ARG A HD3  1  
ATOM   846   H  HE   . ARG A 1 54  ? 16.202  2.108   -2.121  1.00 2.58  ? 149 ARG A HE   1  
ATOM   847   H  HH11 . ARG A 1 54  ? 16.781  -1.221  -0.951  1.00 4.66  ? 149 ARG A HH11 1  
ATOM   848   H  HH12 . ARG A 1 54  ? 18.263  -1.322  -1.866  1.00 5.33  ? 149 ARG A HH12 1  
ATOM   849   H  HH21 . ARG A 1 54  ? 18.016  1.878   -3.225  1.00 4.08  ? 149 ARG A HH21 1  
ATOM   850   H  HH22 . ARG A 1 54  ? 18.984  0.425   -3.127  1.00 4.80  ? 149 ARG A HH22 1  
ATOM   851   N  N    . GLN A 1 55  ? 15.046  2.570   4.433   1.00 1.26  ? 150 GLN A N    1  
ATOM   852   C  CA   . GLN A 1 55  ? 15.579  2.631   5.809   1.00 1.44  ? 150 GLN A CA   1  
ATOM   853   C  C    . GLN A 1 55  ? 15.368  1.293   6.534   1.00 1.35  ? 150 GLN A C    1  
ATOM   854   O  O    . GLN A 1 55  ? 16.311  0.764   7.114   1.00 1.45  ? 150 GLN A O    1  
ATOM   855   C  CB   . GLN A 1 55  ? 14.930  3.766   6.620   1.00 1.74  ? 150 GLN A CB   1  
ATOM   856   C  CG   . GLN A 1 55  ? 15.488  5.160   6.311   1.00 1.93  ? 150 GLN A CG   1  
ATOM   857   C  CD   . GLN A 1 55  ? 14.513  6.232   6.789   1.00 2.56  ? 150 GLN A CD   1  
ATOM   858   O  OE1  . GLN A 1 55  ? 14.381  6.536   7.966   1.00 3.43  ? 150 GLN A OE1  1  
ATOM   859   N  NE2  . GLN A 1 55  ? 13.710  6.777   5.906   1.00 2.94  ? 150 GLN A NE2  1  
ATOM   860   H  H    . GLN A 1 55  ? 14.311  3.202   4.127   1.00 1.17  ? 150 GLN A H    1  
ATOM   861   H  HA   . GLN A 1 55  ? 16.659  2.793   5.780   1.00 1.61  ? 150 GLN A HA   1  
ATOM   862   H  HB2  . GLN A 1 55  ? 13.857  3.766   6.450   1.00 2.27  ? 150 GLN A HB2  1  
ATOM   863   H  HB3  . GLN A 1 55  ? 15.089  3.578   7.684   1.00 2.12  ? 150 GLN A HB3  1  
ATOM   864   H  HG2  . GLN A 1 55  ? 16.448  5.292   6.811   1.00 2.34  ? 150 GLN A HG2  1  
ATOM   865   H  HG3  . GLN A 1 55  ? 15.644  5.269   5.237   1.00 2.21  ? 150 GLN A HG3  1  
ATOM   866   H  HE21 . GLN A 1 55  ? 13.698  6.400   4.967   1.00 3.11  ? 150 GLN A HE21 1  
ATOM   867   H  HE22 . GLN A 1 55  ? 13.010  7.399   6.262   1.00 3.61  ? 150 GLN A HE22 1  
ATOM   868   N  N    . LEU A 1 56  ? 14.168  0.707   6.466   1.00 1.24  ? 151 LEU A N    1  
ATOM   869   C  CA   . LEU A 1 56  ? 13.873  -0.584  7.098   1.00 1.27  ? 151 LEU A CA   1  
ATOM   870   C  C    . LEU A 1 56  ? 14.501  -1.805  6.391   1.00 1.29  ? 151 LEU A C    1  
ATOM   871   O  O    . LEU A 1 56  ? 14.574  -2.871  6.992   1.00 1.63  ? 151 LEU A O    1  
ATOM   872   C  CB   . LEU A 1 56  ? 12.352  -0.699  7.336   1.00 1.27  ? 151 LEU A CB   1  
ATOM   873   C  CG   . LEU A 1 56  ? 11.915  0.003   8.643   1.00 1.36  ? 151 LEU A CG   1  
ATOM   874   C  CD1  . LEU A 1 56  ? 11.986  1.539   8.632   1.00 1.76  ? 151 LEU A CD1  1  
ATOM   875   C  CD2  . LEU A 1 56  ? 10.483  -0.389  9.016   1.00 2.03  ? 151 LEU A CD2  1  
ATOM   876   H  H    . LEU A 1 56  ? 13.405  1.192   6.002   1.00 1.21  ? 151 LEU A H    1  
ATOM   877   H  HA   . LEU A 1 56  ? 14.357  -0.590  8.078   1.00 1.38  ? 151 LEU A HA   1  
ATOM   878   H  HB2  . LEU A 1 56  ? 11.796  -0.301  6.485   1.00 1.26  ? 151 LEU A HB2  1  
ATOM   879   H  HB3  . LEU A 1 56  ? 12.106  -1.758  7.430   1.00 1.39  ? 151 LEU A HB3  1  
ATOM   880   H  HG   . LEU A 1 56  ? 12.570  -0.352  9.435   1.00 2.05  ? 151 LEU A HG   1  
ATOM   881   H  HD11 . LEU A 1 56  ? 11.659  1.930   9.597   1.00 2.46  ? 151 LEU A HD11 1  
ATOM   882   H  HD12 . LEU A 1 56  ? 13.007  1.879   8.469   1.00 2.54  ? 151 LEU A HD12 1  
ATOM   883   H  HD13 . LEU A 1 56  ? 11.332  1.936   7.858   1.00 2.42  ? 151 LEU A HD13 1  
ATOM   884   H  HD21 . LEU A 1 56  ? 10.238  0.040   9.987   1.00 2.62  ? 151 LEU A HD21 1  
ATOM   885   H  HD22 . LEU A 1 56  ? 9.786   -0.013  8.267   1.00 2.59  ? 151 LEU A HD22 1  
ATOM   886   H  HD23 . LEU A 1 56  ? 10.399  -1.472  9.086   1.00 2.87  ? 151 LEU A HD23 1  
ATOM   887   N  N    . GLU A 1 57  ? 15.004  -1.669  5.158   1.00 1.19  ? 152 GLU A N    1  
ATOM   888   C  CA   . GLU A 1 57  ? 15.948  -2.629  4.561   1.00 1.42  ? 152 GLU A CA   1  
ATOM   889   C  C    . GLU A 1 57  ? 17.355  -2.522  5.187   1.00 1.60  ? 152 GLU A C    1  
ATOM   890   O  O    . GLU A 1 57  ? 18.071  -3.524  5.279   1.00 1.88  ? 152 GLU A O    1  
ATOM   891   C  CB   . GLU A 1 57  ? 16.069  -2.428  3.037   1.00 1.62  ? 152 GLU A CB   1  
ATOM   892   C  CG   . GLU A 1 57  ? 14.798  -2.728  2.224   1.00 1.74  ? 152 GLU A CG   1  
ATOM   893   C  CD   . GLU A 1 57  ? 14.969  -2.393  0.738   1.00 2.52  ? 152 GLU A CD   1  
ATOM   894   O  OE1  . GLU A 1 57  ? 16.114  -2.413  0.227   1.00 3.25  ? 152 GLU A OE1  1  
ATOM   895   O  OE2  . GLU A 1 57  ? 13.961  -2.129  0.048   1.00 3.34  ? 152 GLU A OE2  1  
ATOM   896   H  H    . GLU A 1 57  ? 14.827  -0.802  4.677   1.00 1.20  ? 152 GLU A H    1  
ATOM   897   H  HA   . GLU A 1 57  ? 15.584  -3.641  4.744   1.00 1.53  ? 152 GLU A HA   1  
ATOM   898   H  HB2  . GLU A 1 57  ? 16.385  -1.408  2.831   1.00 2.37  ? 152 GLU A HB2  1  
ATOM   899   H  HB3  . GLU A 1 57  ? 16.857  -3.092  2.677   1.00 2.30  ? 152 GLU A HB3  1  
ATOM   900   H  HG2  . GLU A 1 57  ? 14.555  -3.787  2.323   1.00 2.35  ? 152 GLU A HG2  1  
ATOM   901   H  HG3  . GLU A 1 57  ? 13.967  -2.149  2.619   1.00 2.40  ? 152 GLU A HG3  1  
ATOM   902   N  N    . ALA A 1 58  ? 17.792  -1.307  5.543   1.00 1.57  ? 153 ALA A N    1  
ATOM   903   C  CA   . ALA A 1 58  ? 19.077  -1.032  6.189   1.00 1.88  ? 153 ALA A CA   1  
ATOM   904   C  C    . ALA A 1 58  ? 19.134  -1.377  7.691   1.00 2.14  ? 153 ALA A C    1  
ATOM   905   O  O    . ALA A 1 58  ? 20.167  -1.872  8.147   1.00 2.34  ? 153 ALA A O    1  
ATOM   906   C  CB   . ALA A 1 58  ? 19.451  0.434   5.924   1.00 1.88  ? 153 ALA A CB   1  
ATOM   907   H  H    . ALA A 1 58  ? 17.166  -0.520  5.413   1.00 1.46  ? 153 ALA A H    1  
ATOM   908   H  HA   . ALA A 1 58  ? 19.830  -1.656  5.706   1.00 2.07  ? 153 ALA A HA   1  
ATOM   909   H  HB1  . ALA A 1 58  ? 20.457  0.628   6.299   1.00 2.40  ? 153 ALA A HB1  1  
ATOM   910   H  HB2  . ALA A 1 58  ? 19.432  0.636   4.852   1.00 1.94  ? 153 ALA A HB2  1  
ATOM   911   H  HB3  . ALA A 1 58  ? 18.756  1.104   6.428   1.00 2.56  ? 153 ALA A HB3  1  
ATOM   912   N  N    . GLU A 1 59  ? 18.084  -1.070  8.464   1.00 2.29  ? 154 GLU A N    1  
ATOM   913   C  CA   . GLU A 1 59  ? 18.078  -1.196  9.930   1.00 2.80  ? 154 GLU A CA   1  
ATOM   914   C  C    . GLU A 1 59  ? 17.611  -2.595  10.396  1.00 2.58  ? 154 GLU A C    1  
ATOM   915   O  O    . GLU A 1 59  ? 16.450  -2.955  10.182  1.00 3.00  ? 154 GLU A O    1  
ATOM   916   C  CB   . GLU A 1 59  ? 17.216  -0.101  10.583  1.00 3.64  ? 154 GLU A CB   1  
ATOM   917   C  CG   . GLU A 1 59  ? 17.776  1.314   10.362  1.00 4.41  ? 154 GLU A CG   1  
ATOM   918   C  CD   . GLU A 1 59  ? 17.369  2.266   11.487  1.00 5.35  ? 154 GLU A CD   1  
ATOM   919   O  OE1  . GLU A 1 59  ? 16.162  2.387   11.792  1.00 5.83  ? 154 GLU A OE1  1  
ATOM   920   O  OE2  . GLU A 1 59  ? 18.275  2.861   12.121  1.00 6.07  ? 154 GLU A OE2  1  
ATOM   921   H  H    . GLU A 1 59  ? 17.284  -0.628  8.020   1.00 2.22  ? 154 GLU A H    1  
ATOM   922   H  HA   . GLU A 1 59  ? 19.094  -1.023  10.276  1.00 3.14  ? 154 GLU A HA   1  
ATOM   923   H  HB2  . GLU A 1 59  ? 16.195  -0.151  10.202  1.00 3.86  ? 154 GLU A HB2  1  
ATOM   924   H  HB3  . GLU A 1 59  ? 17.194  -0.298  11.656  1.00 4.06  ? 154 GLU A HB3  1  
ATOM   925   H  HG2  . GLU A 1 59  ? 18.866  1.268   10.329  1.00 4.60  ? 154 GLU A HG2  1  
ATOM   926   H  HG3  . GLU A 1 59  ? 17.424  1.705   9.408   1.00 4.73  ? 154 GLU A HG3  1  
ATOM   927   N  N    . PRO A 1 60  ? 18.476  -3.396  11.056  1.00 2.39  ? 155 PRO A N    1  
ATOM   928   C  CA   . PRO A 1 60  ? 18.205  -4.804  11.326  1.00 2.48  ? 155 PRO A CA   1  
ATOM   929   C  C    . PRO A 1 60  ? 17.240  -4.999  12.502  1.00 2.75  ? 155 PRO A C    1  
ATOM   930   O  O    . PRO A 1 60  ? 17.409  -4.416  13.574  1.00 3.51  ? 155 PRO A O    1  
ATOM   931   C  CB   . PRO A 1 60  ? 19.573  -5.441  11.596  1.00 2.69  ? 155 PRO A CB   1  
ATOM   932   C  CG   . PRO A 1 60  ? 20.389  -4.288  12.180  1.00 2.85  ? 155 PRO A CG   1  
ATOM   933   C  CD   . PRO A 1 60  ? 19.845  -3.073  11.431  1.00 2.59  ? 155 PRO A CD   1  
ATOM   934   H  HA   . PRO A 1 60  ? 17.775  -5.263  10.435  1.00 2.65  ? 155 PRO A HA   1  
ATOM   935   H  HB2  . PRO A 1 60  ? 19.511  -6.284  12.286  1.00 3.00  ? 155 PRO A HB2  1  
ATOM   936   H  HB3  . PRO A 1 60  ? 20.019  -5.756  10.651  1.00 2.81  ? 155 PRO A HB3  1  
ATOM   937   H  HG2  . PRO A 1 60  ? 20.178  -4.189  13.246  1.00 3.11  ? 155 PRO A HG2  1  
ATOM   938   H  HG3  . PRO A 1 60  ? 21.458  -4.422  12.012  1.00 3.21  ? 155 PRO A HG3  1  
ATOM   939   H  HD2  . PRO A 1 60  ? 19.881  -2.190  12.070  1.00 2.96  ? 155 PRO A HD2  1  
ATOM   940   H  HD3  . PRO A 1 60  ? 20.424  -2.908  10.524  1.00 2.56  ? 155 PRO A HD3  1  
ATOM   941   N  N    . GLY A 1 61  ? 16.254  -5.881  12.301  1.00 2.68  ? 156 GLY A N    1  
ATOM   942   C  CA   . GLY A 1 61  ? 15.250  -6.271  13.301  1.00 2.99  ? 156 GLY A CA   1  
ATOM   943   C  C    . GLY A 1 61  ? 13.912  -5.536  13.178  1.00 2.92  ? 156 GLY A C    1  
ATOM   944   O  O    . GLY A 1 61  ? 12.967  -5.892  13.879  1.00 3.49  ? 156 GLY A O    1  
ATOM   945   H  H    . GLY A 1 61  ? 16.178  -6.295  11.382  1.00 2.83  ? 156 GLY A H    1  
ATOM   946   H  HA2  . GLY A 1 61  ? 15.036  -7.333  13.185  1.00 3.21  ? 156 GLY A HA2  1  
ATOM   947   H  HA3  . GLY A 1 61  ? 15.635  -6.085  14.304  1.00 3.29  ? 156 GLY A HA3  1  
ATOM   948   N  N    . LEU A 1 62  ? 13.812  -4.534  12.300  1.00 2.69  ? 157 LEU A N    1  
ATOM   949   C  CA   . LEU A 1 62  ? 12.574  -3.795  12.025  1.00 2.75  ? 157 LEU A CA   1  
ATOM   950   C  C    . LEU A 1 62  ? 11.662  -4.581  11.044  1.00 2.46  ? 157 LEU A C    1  
ATOM   951   O  O    . LEU A 1 62  ? 12.142  -5.490  10.362  1.00 2.38  ? 157 LEU A O    1  
ATOM   952   C  CB   . LEU A 1 62  ? 12.952  -2.382  11.530  1.00 3.03  ? 157 LEU A CB   1  
ATOM   953   C  CG   . LEU A 1 62  ? 13.286  -1.383  12.665  1.00 4.03  ? 157 LEU A CG   1  
ATOM   954   C  CD1  . LEU A 1 62  ? 14.611  -1.686  13.383  1.00 4.38  ? 157 LEU A CD1  1  
ATOM   955   C  CD2  . LEU A 1 62  ? 13.334  0.049   12.114  1.00 4.99  ? 157 LEU A CD2  1  
ATOM   956   H  H    . LEU A 1 62  ? 14.627  -4.303  11.747  1.00 2.78  ? 157 LEU A H    1  
ATOM   957   H  HA   . LEU A 1 62  ? 12.017  -3.697  12.958  1.00 3.03  ? 157 LEU A HA   1  
ATOM   958   H  HB2  . LEU A 1 62  ? 13.790  -2.442  10.831  1.00 2.89  ? 157 LEU A HB2  1  
ATOM   959   H  HB3  . LEU A 1 62  ? 12.113  -1.983  10.969  1.00 3.41  ? 157 LEU A HB3  1  
ATOM   960   H  HG   . LEU A 1 62  ? 12.484  -1.418  13.404  1.00 4.83  ? 157 LEU A HG   1  
ATOM   961   H  HD11 . LEU A 1 62  ? 15.418  -1.785  12.656  1.00 4.31  ? 157 LEU A HD11 1  
ATOM   962   H  HD12 . LEU A 1 62  ? 14.528  -2.607  13.959  1.00 4.60  ? 157 LEU A HD12 1  
ATOM   963   H  HD13 . LEU A 1 62  ? 14.854  -0.879  14.075  1.00 5.41  ? 157 LEU A HD13 1  
ATOM   964   H  HD21 . LEU A 1 62  ? 13.582  0.747   12.911  1.00 5.87  ? 157 LEU A HD21 1  
ATOM   965   H  HD22 . LEU A 1 62  ? 14.088  0.126   11.330  1.00 5.15  ? 157 LEU A HD22 1  
ATOM   966   H  HD23 . LEU A 1 62  ? 12.359  0.323   11.711  1.00 5.44  ? 157 LEU A HD23 1  
ATOM   967   N  N    . PRO A 1 63  ? 10.341  -4.294  10.984  1.00 2.41  ? 158 PRO A N    1  
ATOM   968   C  CA   . PRO A 1 63  ? 9.387   -5.100  10.225  1.00 2.11  ? 158 PRO A CA   1  
ATOM   969   C  C    . PRO A 1 63  ? 9.563   -4.951  8.703   1.00 1.58  ? 158 PRO A C    1  
ATOM   970   O  O    . PRO A 1 63  ? 9.745   -3.831  8.220   1.00 1.57  ? 158 PRO A O    1  
ATOM   971   C  CB   . PRO A 1 63  ? 7.992   -4.633  10.661  1.00 2.37  ? 158 PRO A CB   1  
ATOM   972   C  CG   . PRO A 1 63  ? 8.233   -3.207  11.151  1.00 2.65  ? 158 PRO A CG   1  
ATOM   973   C  CD   . PRO A 1 63  ? 9.611   -3.327  11.790  1.00 2.72  ? 158 PRO A CD   1  
ATOM   974   H  HA   . PRO A 1 63  ? 9.515   -6.140  10.521  1.00 2.27  ? 158 PRO A HA   1  
ATOM   975   H  HB2  . PRO A 1 63  ? 7.275   -4.658  9.840   1.00 2.17  ? 158 PRO A HB2  1  
ATOM   976   H  HB3  . PRO A 1 63  ? 7.641   -5.249  11.490  1.00 2.69  ? 158 PRO A HB3  1  
ATOM   977   H  HG2  . PRO A 1 63  ? 8.272   -2.519  10.305  1.00 2.47  ? 158 PRO A HG2  1  
ATOM   978   H  HG3  . PRO A 1 63  ? 7.482   -2.891  11.875  1.00 3.05  ? 158 PRO A HG3  1  
ATOM   979   H  HD2  . PRO A 1 63  ? 10.097  -2.354  11.824  1.00 2.79  ? 158 PRO A HD2  1  
ATOM   980   H  HD3  . PRO A 1 63  ? 9.484   -3.739  12.789  1.00 3.03  ? 158 PRO A HD3  1  
ATOM   981   N  N    . PRO A 1 64  ? 9.435   -6.046  7.926   1.00 1.44  ? 159 PRO A N    1  
ATOM   982   C  CA   . PRO A 1 64  ? 9.466   -6.002  6.470   1.00 1.25  ? 159 PRO A CA   1  
ATOM   983   C  C    . PRO A 1 64  ? 8.142   -5.426  5.948   1.00 1.20  ? 159 PRO A C    1  
ATOM   984   O  O    . PRO A 1 64  ? 7.212   -6.161  5.628   1.00 1.66  ? 159 PRO A O    1  
ATOM   985   C  CB   . PRO A 1 64  ? 9.728   -7.448  6.031   1.00 1.68  ? 159 PRO A CB   1  
ATOM   986   C  CG   . PRO A 1 64  ? 9.064   -8.274  7.133   1.00 2.00  ? 159 PRO A CG   1  
ATOM   987   C  CD   . PRO A 1 64  ? 9.280   -7.421  8.383   1.00 1.88  ? 159 PRO A CD   1  
ATOM   988   H  HA   . PRO A 1 64  ? 10.291  -5.374  6.129   1.00 1.22  ? 159 PRO A HA   1  
ATOM   989   H  HB2  . PRO A 1 64  ? 9.314   -7.669  5.046   1.00 1.86  ? 159 PRO A HB2  1  
ATOM   990   H  HB3  . PRO A 1 64  ? 10.803  -7.636  6.038   1.00 1.81  ? 159 PRO A HB3  1  
ATOM   991   H  HG2  . PRO A 1 64  ? 7.996   -8.370  6.933   1.00 2.08  ? 159 PRO A HG2  1  
ATOM   992   H  HG3  . PRO A 1 64  ? 9.523   -9.258  7.232   1.00 2.39  ? 159 PRO A HG3  1  
ATOM   993   H  HD2  . PRO A 1 64  ? 8.425   -7.519  9.053   1.00 2.17  ? 159 PRO A HD2  1  
ATOM   994   H  HD3  . PRO A 1 64  ? 10.196  -7.735  8.887   1.00 2.04  ? 159 PRO A HD3  1  
ATOM   995   N  N    . VAL A 1 65  ? 8.069   -4.095  5.883   1.00 1.19  ? 160 VAL A N    1  
ATOM   996   C  CA   . VAL A 1 65  ? 6.882   -3.338  5.451   1.00 1.18  ? 160 VAL A CA   1  
ATOM   997   C  C    . VAL A 1 65  ? 6.740   -3.357  3.922   1.00 1.19  ? 160 VAL A C    1  
ATOM   998   O  O    . VAL A 1 65  ? 7.451   -2.661  3.199   1.00 1.59  ? 160 VAL A O    1  
ATOM   999   C  CB   . VAL A 1 65  ? 6.884   -1.882  5.984   1.00 1.27  ? 160 VAL A CB   1  
ATOM   1000  C  CG1  . VAL A 1 65  ? 6.386   -1.861  7.438   1.00 2.24  ? 160 VAL A CG1  1  
ATOM   1001  C  CG2  . VAL A 1 65  ? 8.256   -1.180  5.920   1.00 2.42  ? 160 VAL A CG2  1  
ATOM   1002  H  H    . VAL A 1 65  ? 8.853   -3.577  6.271   1.00 1.58  ? 160 VAL A H    1  
ATOM   1003  H  HA   . VAL A 1 65  ? 6.003   -3.833  5.867   1.00 1.25  ? 160 VAL A HA   1  
ATOM   1004  H  HB   . VAL A 1 65  ? 6.172   -1.300  5.395   1.00 1.90  ? 160 VAL A HB   1  
ATOM   1005  H  HG11 . VAL A 1 65  ? 5.369   -2.251  7.481   1.00 3.12  ? 160 VAL A HG11 1  
ATOM   1006  H  HG12 . VAL A 1 65  ? 6.379   -0.838  7.816   1.00 2.98  ? 160 VAL A HG12 1  
ATOM   1007  H  HG13 . VAL A 1 65  ? 7.034   -2.471  8.069   1.00 2.89  ? 160 VAL A HG13 1  
ATOM   1008  H  HG21 . VAL A 1 65  ? 8.146   -0.134  6.210   1.00 3.18  ? 160 VAL A HG21 1  
ATOM   1009  H  HG22 . VAL A 1 65  ? 8.663   -1.216  4.912   1.00 3.17  ? 160 VAL A HG22 1  
ATOM   1010  H  HG23 . VAL A 1 65  ? 8.963   -1.658  6.598   1.00 3.14  ? 160 VAL A HG23 1  
ATOM   1011  N  N    . GLN A 1 66  ? 5.802   -4.166  3.424   1.00 1.03  ? 161 GLN A N    1  
ATOM   1012  C  CA   . GLN A 1 66  ? 5.517   -4.308  1.995   1.00 1.19  ? 161 GLN A CA   1  
ATOM   1013  C  C    . GLN A 1 66  ? 4.361   -3.371  1.586   1.00 1.03  ? 161 GLN A C    1  
ATOM   1014  O  O    . GLN A 1 66  ? 3.268   -3.500  2.132   1.00 0.96  ? 161 GLN A O    1  
ATOM   1015  C  CB   . GLN A 1 66  ? 5.192   -5.785  1.716   1.00 1.49  ? 161 GLN A CB   1  
ATOM   1016  C  CG   . GLN A 1 66  ? 4.980   -6.108  0.224   1.00 1.88  ? 161 GLN A CG   1  
ATOM   1017  C  CD   . GLN A 1 66  ? 3.568   -6.612  -0.060  1.00 2.43  ? 161 GLN A CD   1  
ATOM   1018  O  OE1  . GLN A 1 66  ? 3.244   -7.771  0.155   1.00 3.46  ? 161 GLN A OE1  1  
ATOM   1019  N  NE2  . GLN A 1 66  ? 2.671   -5.778  -0.533  1.00 2.74  ? 161 GLN A NE2  1  
ATOM   1020  H  H    . GLN A 1 66  ? 5.274   -4.742  4.076   1.00 1.09  ? 161 GLN A H    1  
ATOM   1021  H  HA   . GLN A 1 66  ? 6.415   -4.056  1.433   1.00 1.38  ? 161 GLN A HA   1  
ATOM   1022  H  HB2  . GLN A 1 66  ? 6.022   -6.395  2.079   1.00 1.94  ? 161 GLN A HB2  1  
ATOM   1023  H  HB3  . GLN A 1 66  ? 4.307   -6.072  2.287   1.00 1.83  ? 161 GLN A HB3  1  
ATOM   1024  H  HG2  . GLN A 1 66  ? 5.185   -5.233  -0.394  1.00 2.65  ? 161 GLN A HG2  1  
ATOM   1025  H  HG3  . GLN A 1 66  ? 5.682   -6.888  -0.071  1.00 2.81  ? 161 GLN A HG3  1  
ATOM   1026  H  HE21 . GLN A 1 66  ? 2.890   -4.812  -0.748  1.00 2.27  ? 161 GLN A HE21 1  
ATOM   1027  H  HE22 . GLN A 1 66  ? 1.747   -6.138  -0.676  1.00 3.85  ? 161 GLN A HE22 1  
ATOM   1028  N  N    . PRO A 1 67  ? 4.544   -2.433  0.637   1.00 1.05  ? 162 PRO A N    1  
ATOM   1029  C  CA   . PRO A 1 67  ? 3.476   -1.524  0.228   1.00 0.93  ? 162 PRO A CA   1  
ATOM   1030  C  C    . PRO A 1 67  ? 2.475   -2.209  -0.711  1.00 0.83  ? 162 PRO A C    1  
ATOM   1031  O  O    . PRO A 1 67  ? 2.869   -3.033  -1.534  1.00 1.02  ? 162 PRO A O    1  
ATOM   1032  C  CB   . PRO A 1 67  ? 4.190   -0.356  -0.459  1.00 1.13  ? 162 PRO A CB   1  
ATOM   1033  C  CG   . PRO A 1 67  ? 5.431   -1.016  -1.062  1.00 1.30  ? 162 PRO A CG   1  
ATOM   1034  C  CD   . PRO A 1 67  ? 5.790   -2.093  -0.039  1.00 1.25  ? 162 PRO A CD   1  
ATOM   1035  H  HA   . PRO A 1 67  ? 2.945   -1.154  1.103   1.00 0.87  ? 162 PRO A HA   1  
ATOM   1036  H  HB2  . PRO A 1 67  ? 3.570   0.118   -1.221  1.00 1.13  ? 162 PRO A HB2  1  
ATOM   1037  H  HB3  . PRO A 1 67  ? 4.495   0.375   0.292   1.00 1.21  ? 162 PRO A HB3  1  
ATOM   1038  H  HG2  . PRO A 1 67  ? 5.170   -1.488  -2.010  1.00 1.30  ? 162 PRO A HG2  1  
ATOM   1039  H  HG3  . PRO A 1 67  ? 6.244   -0.302  -1.201  1.00 1.50  ? 162 PRO A HG3  1  
ATOM   1040  H  HD2  . PRO A 1 67  ? 6.218   -2.958  -0.547  1.00 1.33  ? 162 PRO A HD2  1  
ATOM   1041  H  HD3  . PRO A 1 67  ? 6.497   -1.689  0.688   1.00 1.37  ? 162 PRO A HD3  1  
ATOM   1042  N  N    . VAL A 1 68  ? 1.198   -1.817  -0.624  1.00 0.69  ? 163 VAL A N    1  
ATOM   1043  C  CA   . VAL A 1 68  ? 0.193   -1.991  -1.692  1.00 0.63  ? 163 VAL A CA   1  
ATOM   1044  C  C    . VAL A 1 68  ? -0.472  -0.646  -2.014  1.00 0.57  ? 163 VAL A C    1  
ATOM   1045  O  O    . VAL A 1 68  ? -0.887  0.074   -1.106  1.00 0.62  ? 163 VAL A O    1  
ATOM   1046  C  CB   . VAL A 1 68  ? -0.894  -3.053  -1.375  1.00 0.73  ? 163 VAL A CB   1  
ATOM   1047  C  CG1  . VAL A 1 68  ? -0.301  -4.459  -1.207  1.00 1.68  ? 163 VAL A CG1  1  
ATOM   1048  C  CG2  . VAL A 1 68  ? -1.756  -2.760  -0.135  1.00 1.49  ? 163 VAL A CG2  1  
ATOM   1049  H  H    . VAL A 1 68  ? 0.930   -1.238  0.177   1.00 0.70  ? 163 VAL A H    1  
ATOM   1050  H  HA   . VAL A 1 68  ? 0.713   -2.323  -2.590  1.00 0.66  ? 163 VAL A HA   1  
ATOM   1051  H  HB   . VAL A 1 68  ? -1.565  -3.090  -2.234  1.00 1.66  ? 163 VAL A HB   1  
ATOM   1052  H  HG11 . VAL A 1 68  ? 0.323   -4.495  -0.315  1.00 2.69  ? 163 VAL A HG11 1  
ATOM   1053  H  HG12 . VAL A 1 68  ? -1.103  -5.191  -1.105  1.00 2.22  ? 163 VAL A HG12 1  
ATOM   1054  H  HG13 . VAL A 1 68  ? 0.291   -4.719  -2.080  1.00 2.34  ? 163 VAL A HG13 1  
ATOM   1055  H  HG21 . VAL A 1 68  ? -1.126  -2.664  0.749   1.00 1.92  ? 163 VAL A HG21 1  
ATOM   1056  H  HG22 . VAL A 1 68  ? -2.331  -1.847  -0.280  1.00 2.66  ? 163 VAL A HG22 1  
ATOM   1057  H  HG23 . VAL A 1 68  ? -2.466  -3.573  0.026   1.00 2.26  ? 163 VAL A HG23 1  
ATOM   1058  N  N    . PHE A 1 69  ? -0.579  -0.315  -3.305  1.00 0.56  ? 164 PHE A N    1  
ATOM   1059  C  CA   . PHE A 1 69  ? -1.290  0.862   -3.820  1.00 0.62  ? 164 PHE A CA   1  
ATOM   1060  C  C    . PHE A 1 69  ? -2.620  0.425   -4.450  1.00 5.28  ? 164 PHE A C    1  
ATOM   1061  O  O    . PHE A 1 69  ? -2.637  -0.425  -5.337  1.00 3.99  ? 164 PHE A O    1  
ATOM   1062  C  CB   . PHE A 1 69  ? -0.385  1.585   -4.830  1.00 0.83  ? 164 PHE A CB   1  
ATOM   1063  C  CG   . PHE A 1 69  ? -0.937  2.897   -5.364  1.00 1.10  ? 164 PHE A CG   1  
ATOM   1064  C  CD1  . PHE A 1 69  ? -1.725  2.912   -6.530  1.00 1.56  ? 164 PHE A CD1  1  
ATOM   1065  C  CD2  . PHE A 1 69  ? -0.626  4.112   -4.723  1.00 3.34  ? 164 PHE A CD2  1  
ATOM   1066  C  CE1  . PHE A 1 69  ? -2.192  4.130   -7.058  1.00 1.19  ? 164 PHE A CE1  1  
ATOM   1067  C  CE2  . PHE A 1 69  ? -1.081  5.332   -5.257  1.00 5.58  ? 164 PHE A CE2  1  
ATOM   1068  C  CZ   . PHE A 1 69  ? -1.861  5.342   -6.426  1.00 1.98  ? 164 PHE A CZ   1  
ATOM   1069  H  H    . PHE A 1 69  ? -0.171  -0.944  -3.991  1.00 0.59  ? 164 PHE A H    1  
ATOM   1070  H  HA   . PHE A 1 69  ? -1.505  1.550   -3.003  1.00 0.61  ? 164 PHE A HA   1  
ATOM   1071  H  HB2  . PHE A 1 69  ? 0.575   1.786   -4.353  1.00 0.86  ? 164 PHE A HB2  1  
ATOM   1072  H  HB3  . PHE A 1 69  ? -0.189  0.917   -5.671  1.00 0.90  ? 164 PHE A HB3  1  
ATOM   1073  H  HD1  . PHE A 1 69  ? -1.958  1.985   -7.033  1.00 2.48  ? 164 PHE A HD1  1  
ATOM   1074  H  HD2  . PHE A 1 69  ? -0.019  4.113   -3.829  1.00 4.83  ? 164 PHE A HD2  1  
ATOM   1075  H  HE1  . PHE A 1 69  ? -2.783  4.131   -7.963  1.00 1.75  ? 164 PHE A HE1  1  
ATOM   1076  H  HE2  . PHE A 1 69  ? -0.825  6.268   -4.776  1.00 7.38  ? 164 PHE A HE2  1  
ATOM   1077  H  HZ   . PHE A 1 69  ? -2.191  6.284   -6.842  1.00 3.66  ? 164 PHE A HZ   1  
ATOM   1078  N  N    . ILE A 1 70  ? -3.739  0.980   -3.976  1.00 0.76  ? 165 ILE A N    1  
ATOM   1079  C  CA   . ILE A 1 70  ? -5.101  0.510   -4.283  1.00 0.76  ? 165 ILE A CA   1  
ATOM   1080  C  C    . ILE A 1 70  ? -5.894  1.614   -4.998  1.00 0.75  ? 165 ILE A C    1  
ATOM   1081  O  O    . ILE A 1 70  ? -6.053  2.703   -4.437  1.00 0.82  ? 165 ILE A O    1  
ATOM   1082  C  CB   . ILE A 1 70  ? -5.821  0.079   -2.975  1.00 0.80  ? 165 ILE A CB   1  
ATOM   1083  C  CG1  . ILE A 1 70  ? -4.981  -0.914  -2.130  1.00 1.16  ? 165 ILE A CG1  1  
ATOM   1084  C  CG2  . ILE A 1 70  ? -7.194  -0.533  -3.321  1.00 1.00  ? 165 ILE A CG2  1  
ATOM   1085  C  CD1  . ILE A 1 70  ? -5.577  -1.232  -0.752  1.00 1.37  ? 165 ILE A CD1  1  
ATOM   1086  H  H    . ILE A 1 70  ? -3.651  1.678   -3.243  1.00 0.74  ? 165 ILE A H    1  
ATOM   1087  H  HA   . ILE A 1 70  ? -5.047  -0.356  -4.943  1.00 0.84  ? 165 ILE A HA   1  
ATOM   1088  H  HB   . ILE A 1 70  ? -5.988  0.972   -2.369  1.00 0.96  ? 165 ILE A HB   1  
ATOM   1089  H  HG12 . ILE A 1 70  ? -4.853  -1.844  -2.683  1.00 1.79  ? 165 ILE A HG12 1  
ATOM   1090  H  HG13 . ILE A 1 70  ? -3.992  -0.496  -1.943  1.00 1.94  ? 165 ILE A HG13 1  
ATOM   1091  H  HG21 . ILE A 1 70  ? -7.745  -0.775  -2.413  1.00 1.59  ? 165 ILE A HG21 1  
ATOM   1092  H  HG22 . ILE A 1 70  ? -7.801  0.175   -3.884  1.00 1.77  ? 165 ILE A HG22 1  
ATOM   1093  H  HG23 . ILE A 1 70  ? -7.063  -1.439  -3.914  1.00 1.96  ? 165 ILE A HG23 1  
ATOM   1094  H  HD11 . ILE A 1 70  ? -5.774  -0.306  -0.210  1.00 2.42  ? 165 ILE A HD11 1  
ATOM   1095  H  HD12 . ILE A 1 70  ? -6.499  -1.802  -0.852  1.00 1.83  ? 165 ILE A HD12 1  
ATOM   1096  H  HD13 . ILE A 1 70  ? -4.864  -1.827  -0.182  1.00 1.85  ? 165 ILE A HD13 1  
ATOM   1097  N  N    . THR A 1 71  ? -6.423  1.323   -6.196  1.00 0.81  ? 166 THR A N    1  
ATOM   1098  C  CA   . THR A 1 71  ? -7.296  2.228   -6.970  1.00 0.94  ? 166 THR A CA   1  
ATOM   1099  C  C    . THR A 1 71  ? -8.654  2.412   -6.293  1.00 0.98  ? 166 THR A C    1  
ATOM   1100  O  O    . THR A 1 71  ? -9.375  1.439   -6.094  1.00 1.18  ? 166 THR A O    1  
ATOM   1101  C  CB   . THR A 1 71  ? -7.452  1.707   -8.405  1.00 1.24  ? 166 THR A CB   1  
ATOM   1102  O  OG1  . THR A 1 71  ? -6.260  2.018   -9.075  1.00 1.74  ? 166 THR A OG1  1  
ATOM   1103  C  CG2  . THR A 1 71  ? -8.572  2.373   -9.202  1.00 1.80  ? 166 THR A CG2  1  
ATOM   1104  H  H    . THR A 1 71  ? -6.203  0.422   -6.606  1.00 0.85  ? 166 THR A H    1  
ATOM   1105  H  HA   . THR A 1 71  ? -6.804  3.193   -7.035  1.00 1.03  ? 166 THR A HA   1  
ATOM   1106  H  HB   . THR A 1 71  ? -7.612  0.627   -8.395  1.00 1.67  ? 166 THR A HB   1  
ATOM   1107  H  HG1  . THR A 1 71  ? -6.280  1.571   -9.947  1.00 2.19  ? 166 THR A HG1  1  
ATOM   1108  H  HG21 . THR A 1 71  ? -8.452  3.456   -9.185  1.00 2.56  ? 166 THR A HG21 1  
ATOM   1109  H  HG22 . THR A 1 71  ? -8.546  2.026   -10.234 1.00 2.03  ? 166 THR A HG22 1  
ATOM   1110  H  HG23 . THR A 1 71  ? -9.541  2.099   -8.787  1.00 2.71  ? 166 THR A HG23 1  
ATOM   1111  N  N    . VAL A 1 72  ? -9.019  3.665   -6.004  1.00 1.14  ? 167 VAL A N    1  
ATOM   1112  C  CA   . VAL A 1 72  ? -10.319 4.042   -5.389  1.00 1.32  ? 167 VAL A CA   1  
ATOM   1113  C  C    . VAL A 1 72  ? -11.515 4.154   -6.363  1.00 1.56  ? 167 VAL A C    1  
ATOM   1114  O  O    . VAL A 1 72  ? -12.657 4.213   -5.909  1.00 2.16  ? 167 VAL A O    1  
ATOM   1115  C  CB   . VAL A 1 72  ? -10.223 5.353   -4.567  1.00 1.43  ? 167 VAL A CB   1  
ATOM   1116  C  CG1  . VAL A 1 72  ? -9.210  5.216   -3.418  1.00 2.15  ? 167 VAL A CG1  1  
ATOM   1117  C  CG2  . VAL A 1 72  ? -9.884  6.587   -5.425  1.00 2.26  ? 167 VAL A CG2  1  
ATOM   1118  H  H    . VAL A 1 72  ? -8.278  4.360   -6.057  1.00 1.33  ? 167 VAL A H    1  
ATOM   1119  H  HA   . VAL A 1 72  ? -10.570 3.251   -4.681  1.00 1.60  ? 167 VAL A HA   1  
ATOM   1120  H  HB   . VAL A 1 72  ? -11.192 5.539   -4.103  1.00 2.31  ? 167 VAL A HB   1  
ATOM   1121  H  HG11 . VAL A 1 72  ? -8.205  5.060   -3.806  1.00 2.87  ? 167 VAL A HG11 1  
ATOM   1122  H  HG12 . VAL A 1 72  ? -9.217  6.121   -2.809  1.00 3.07  ? 167 VAL A HG12 1  
ATOM   1123  H  HG13 . VAL A 1 72  ? -9.483  4.370   -2.787  1.00 2.68  ? 167 VAL A HG13 1  
ATOM   1124  H  HG21 . VAL A 1 72  ? -10.657 6.747   -6.177  1.00 2.83  ? 167 VAL A HG21 1  
ATOM   1125  H  HG22 . VAL A 1 72  ? -9.835  7.474   -4.791  1.00 3.20  ? 167 VAL A HG22 1  
ATOM   1126  H  HG23 . VAL A 1 72  ? -8.927  6.457   -5.924  1.00 2.92  ? 167 VAL A HG23 1  
ATOM   1127  N  N    . ASP A 1 73  ? -11.292 4.185   -7.685  1.00 1.45  ? 168 ASP A N    1  
ATOM   1128  C  CA   . ASP A 1 73  ? -12.344 4.281   -8.712  1.00 1.76  ? 168 ASP A CA   1  
ATOM   1129  C  C    . ASP A 1 73  ? -11.823 3.731   -10.059 1.00 1.44  ? 168 ASP A C    1  
ATOM   1130  O  O    . ASP A 1 73  ? -10.753 4.157   -10.505 1.00 1.89  ? 168 ASP A O    1  
ATOM   1131  C  CB   . ASP A 1 73  ? -12.845 5.735   -8.861  1.00 2.67  ? 168 ASP A CB   1  
ATOM   1132  C  CG   . ASP A 1 73  ? -14.065 5.852   -9.791  1.00 3.38  ? 168 ASP A CG   1  
ATOM   1133  O  OD1  . ASP A 1 73  ? -13.959 5.454   -10.969 1.00 3.52  ? 168 ASP A OD1  1  
ATOM   1134  O  OD2  . ASP A 1 73  ? -15.134 6.318   -9.326  1.00 4.44  ? 168 ASP A OD2  1  
ATOM   1135  H  H    . ASP A 1 73  ? -10.346 4.075   -8.019  1.00 1.39  ? 168 ASP A H    1  
ATOM   1136  H  HA   . ASP A 1 73  ? -13.188 3.685   -8.369  1.00 2.04  ? 168 ASP A HA   1  
ATOM   1137  H  HB2  . ASP A 1 73  ? -13.117 6.122   -7.877  1.00 3.15  ? 168 ASP A HB2  1  
ATOM   1138  H  HB3  . ASP A 1 73  ? -12.038 6.358   -9.252  1.00 2.73  ? 168 ASP A HB3  1  
ATOM   1139  N  N    . PRO A 1 74  ? -12.540 2.791   -10.711 1.00 1.34  ? 169 PRO A N    1  
ATOM   1140  C  CA   . PRO A 1 74  ? -12.057 2.098   -11.901 1.00 1.59  ? 169 PRO A CA   1  
ATOM   1141  C  C    . PRO A 1 74  ? -12.230 2.886   -13.209 1.00 1.81  ? 169 PRO A C    1  
ATOM   1142  O  O    . PRO A 1 74  ? -11.684 2.453   -14.220 1.00 2.49  ? 169 PRO A O    1  
ATOM   1143  C  CB   . PRO A 1 74  ? -12.868 0.797   -11.941 1.00 2.07  ? 169 PRO A CB   1  
ATOM   1144  C  CG   . PRO A 1 74  ? -14.217 1.225   -11.369 1.00 2.17  ? 169 PRO A CG   1  
ATOM   1145  C  CD   . PRO A 1 74  ? -13.806 2.209   -10.276 1.00 1.77  ? 169 PRO A CD   1  
ATOM   1146  H  HA   . PRO A 1 74  ? -10.999 1.857   -11.786 1.00 1.79  ? 169 PRO A HA   1  
ATOM   1147  H  HB2  . PRO A 1 74  ? -12.964 0.393   -12.950 1.00 2.46  ? 169 PRO A HB2  1  
ATOM   1148  H  HB3  . PRO A 1 74  ? -12.407 0.062   -11.280 1.00 2.28  ? 169 PRO A HB3  1  
ATOM   1149  H  HG2  . PRO A 1 74  ? -14.797 1.743   -12.135 1.00 2.27  ? 169 PRO A HG2  1  
ATOM   1150  H  HG3  . PRO A 1 74  ? -14.778 0.381   -10.966 1.00 2.70  ? 169 PRO A HG3  1  
ATOM   1151  H  HD2  . PRO A 1 74  ? -14.572 2.975   -10.154 1.00 1.98  ? 169 PRO A HD2  1  
ATOM   1152  H  HD3  . PRO A 1 74  ? -13.653 1.672   -9.339  1.00 2.02  ? 169 PRO A HD3  1  
ATOM   1153  N  N    . GLU A 1 75  ? -12.959 4.014   -13.237 1.00 2.04  ? 170 GLU A N    1  
ATOM   1154  C  CA   . GLU A 1 75  ? -13.337 4.703   -14.485 1.00 2.31  ? 170 GLU A CA   1  
ATOM   1155  C  C    . GLU A 1 75  ? -12.161 5.396   -15.215 1.00 2.25  ? 170 GLU A C    1  
ATOM   1156  O  O    . GLU A 1 75  ? -12.386 6.098   -16.206 1.00 2.69  ? 170 GLU A O    1  
ATOM   1157  C  CB   . GLU A 1 75  ? -14.502 5.690   -14.238 1.00 3.07  ? 170 GLU A CB   1  
ATOM   1158  C  CG   . GLU A 1 75  ? -15.803 5.002   -13.791 1.00 3.55  ? 170 GLU A CG   1  
ATOM   1159  C  CD   . GLU A 1 75  ? -17.010 5.946   -13.841 1.00 4.73  ? 170 GLU A CD   1  
ATOM   1160  O  OE1  . GLU A 1 75  ? -16.971 7.055   -13.258 1.00 5.62  ? 170 GLU A OE1  1  
ATOM   1161  O  OE2  . GLU A 1 75  ? -18.035 5.583   -14.460 1.00 5.30  ? 170 GLU A OE2  1  
ATOM   1162  H  H    . GLU A 1 75  ? -13.337 4.395   -12.366 1.00 2.49  ? 170 GLU A H    1  
ATOM   1163  H  HA   . GLU A 1 75  ? -13.703 3.941   -15.174 1.00 2.41  ? 170 GLU A HA   1  
ATOM   1164  H  HB2  . GLU A 1 75  ? -14.203 6.434   -13.498 1.00 3.34  ? 170 GLU A HB2  1  
ATOM   1165  H  HB3  . GLU A 1 75  ? -14.719 6.212   -15.170 1.00 3.56  ? 170 GLU A HB3  1  
ATOM   1166  H  HG2  . GLU A 1 75  ? -15.996 4.156   -14.452 1.00 3.59  ? 170 GLU A HG2  1  
ATOM   1167  H  HG3  . GLU A 1 75  ? -15.693 4.619   -12.777 1.00 3.75  ? 170 GLU A HG3  1  
ATOM   1168  N  N    . ARG A 1 76  ? -10.909 5.216   -14.761 1.00 2.24  ? 171 ARG A N    1  
ATOM   1169  C  CA   . ARG A 1 76  ? -9.701  5.803   -15.371 1.00 2.64  ? 171 ARG A CA   1  
ATOM   1170  C  C    . ARG A 1 76  ? -8.407  4.963   -15.237 1.00 2.46  ? 171 ARG A C    1  
ATOM   1171  O  O    . ARG A 1 76  ? -7.334  5.470   -15.579 1.00 3.12  ? 171 ARG A O    1  
ATOM   1172  C  CB   . ARG A 1 76  ? -9.499  7.236   -14.821 1.00 3.42  ? 171 ARG A CB   1  
ATOM   1173  C  CG   . ARG A 1 76  ? -9.161  8.242   -15.935 1.00 4.06  ? 171 ARG A CG   1  
ATOM   1174  C  CD   . ARG A 1 76  ? -10.414 8.747   -16.672 1.00 4.26  ? 171 ARG A CD   1  
ATOM   1175  N  NE   . ARG A 1 76  ? -10.227 8.786   -18.130 1.00 4.48  ? 171 ARG A NE   1  
ATOM   1176  C  CZ   . ARG A 1 76  ? -10.528 7.840   -19.011 1.00 4.66  ? 171 ARG A CZ   1  
ATOM   1177  N  NH1  . ARG A 1 76  ? -11.066 6.686   -18.677 1.00 4.96  ? 171 ARG A NH1  1  
ATOM   1178  N  NH2  . ARG A 1 76  ? -10.281 8.055   -20.282 1.00 5.33  ? 171 ARG A NH2  1  
ATOM   1179  H  H    . ARG A 1 76  ? -10.802 4.620   -13.951 1.00 2.29  ? 171 ARG A H    1  
ATOM   1180  H  HA   . ARG A 1 76  ? -9.889  5.866   -16.441 1.00 2.88  ? 171 ARG A HA   1  
ATOM   1181  H  HB2  . ARG A 1 76  ? -10.395 7.581   -14.301 1.00 3.51  ? 171 ARG A HB2  1  
ATOM   1182  H  HB3  . ARG A 1 76  ? -8.690  7.229   -14.089 1.00 3.92  ? 171 ARG A HB3  1  
ATOM   1183  H  HG2  . ARG A 1 76  ? -8.656  9.102   -15.493 1.00 5.07  ? 171 ARG A HG2  1  
ATOM   1184  H  HG3  . ARG A 1 76  ? -8.473  7.777   -16.640 1.00 4.15  ? 171 ARG A HG3  1  
ATOM   1185  H  HD2  . ARG A 1 76  ? -11.274 8.133   -16.428 1.00 4.31  ? 171 ARG A HD2  1  
ATOM   1186  H  HD3  . ARG A 1 76  ? -10.642 9.754   -16.320 1.00 5.03  ? 171 ARG A HD3  1  
ATOM   1187  H  HE   . ARG A 1 76  ? -9.816  9.636   -18.506 1.00 5.12  ? 171 ARG A HE   1  
ATOM   1188  H  HH11 . ARG A 1 76  ? -11.382 6.513   -17.727 1.00 4.89  ? 171 ARG A HH11 1  
ATOM   1189  H  HH12 . ARG A 1 76  ? -11.190 5.962   -19.376 1.00 5.72  ? 171 ARG A HH12 1  
ATOM   1190  H  HH21 . ARG A 1 76  ? -9.921  8.947   -20.596 1.00 5.84  ? 171 ARG A HH21 1  
ATOM   1191  H  HH22 . ARG A 1 76  ? -10.582 7.384   -20.975 1.00 5.71  ? 171 ARG A HH22 1  
ATOM   1192  N  N    . ASP A 1 77  ? -8.489  3.728   -14.727 1.00 1.88  ? 172 ASP A N    1  
ATOM   1193  C  CA   . ASP A 1 77  ? -7.349  2.834   -14.438 1.00 1.93  ? 172 ASP A CA   1  
ATOM   1194  C  C    . ASP A 1 77  ? -7.275  1.604   -15.382 1.00 1.81  ? 172 ASP A C    1  
ATOM   1195  O  O    . ASP A 1 77  ? -8.207  1.329   -16.137 1.00 2.34  ? 172 ASP A O    1  
ATOM   1196  C  CB   . ASP A 1 77  ? -7.470  2.407   -12.960 1.00 2.34  ? 172 ASP A CB   1  
ATOM   1197  C  CG   . ASP A 1 77  ? -6.240  1.685   -12.395 1.00 3.29  ? 172 ASP A CG   1  
ATOM   1198  O  OD1  . ASP A 1 77  ? -5.110  2.011   -12.829 1.00 4.15  ? 172 ASP A OD1  1  
ATOM   1199  O  OD2  . ASP A 1 77  ? -6.431  0.845   -11.482 1.00 4.02  ? 172 ASP A OD2  1  
ATOM   1200  H  H    . ASP A 1 77  ? -9.407  3.349   -14.538 1.00 1.73  ? 172 ASP A H    1  
ATOM   1201  H  HA   . ASP A 1 77  ? -6.417  3.389   -14.553 1.00 2.14  ? 172 ASP A HA   1  
ATOM   1202  H  HB2  . ASP A 1 77  ? -7.632  3.299   -12.352 1.00 2.72  ? 172 ASP A HB2  1  
ATOM   1203  H  HB3  . ASP A 1 77  ? -8.347  1.766   -12.850 1.00 2.67  ? 172 ASP A HB3  1  
ATOM   1204  N  N    . ASP A 1 78  ? -6.175  0.841   -15.319 1.00 1.60  ? 173 ASP A N    1  
ATOM   1205  C  CA   . ASP A 1 78  ? -5.967  -0.435  -16.026 1.00 1.50  ? 173 ASP A CA   1  
ATOM   1206  C  C    . ASP A 1 78  ? -4.921  -1.295  -15.287 1.00 1.26  ? 173 ASP A C    1  
ATOM   1207  O  O    . ASP A 1 78  ? -3.982  -0.778  -14.685 1.00 1.31  ? 173 ASP A O    1  
ATOM   1208  C  CB   . ASP A 1 78  ? -5.555  -0.183  -17.498 1.00 1.85  ? 173 ASP A CB   1  
ATOM   1209  C  CG   . ASP A 1 78  ? -5.503  -1.432  -18.399 1.00 2.34  ? 173 ASP A CG   1  
ATOM   1210  O  OD1  . ASP A 1 78  ? -5.870  -2.546  -17.959 1.00 2.58  ? 173 ASP A OD1  1  
ATOM   1211  O  OD2  . ASP A 1 78  ? -5.076  -1.308  -19.572 1.00 3.37  ? 173 ASP A OD2  1  
ATOM   1212  H  H    . ASP A 1 78  ? -5.471  1.103   -14.629 1.00 1.89  ? 173 ASP A H    1  
ATOM   1213  H  HA   . ASP A 1 78  ? -6.916  -0.974  -16.026 1.00 1.63  ? 173 ASP A HA   1  
ATOM   1214  H  HB2  . ASP A 1 78  ? -6.263  0.515   -17.947 1.00 2.15  ? 173 ASP A HB2  1  
ATOM   1215  H  HB3  . ASP A 1 78  ? -4.573  0.289   -17.510 1.00 2.14  ? 173 ASP A HB3  1  
ATOM   1216  N  N    . VAL A 1 79  ? -5.023  -2.620  -15.403 1.00 1.25  ? 174 VAL A N    1  
ATOM   1217  C  CA   . VAL A 1 79  ? -4.041  -3.576  -14.851 1.00 1.24  ? 174 VAL A CA   1  
ATOM   1218  C  C    . VAL A 1 79  ? -2.665  -3.366  -15.504 1.00 1.15  ? 174 VAL A C    1  
ATOM   1219  O  O    . VAL A 1 79  ? -1.635  -3.458  -14.840 1.00 1.15  ? 174 VAL A O    1  
ATOM   1220  C  CB   . VAL A 1 79  ? -4.505  -5.040  -15.047 1.00 1.52  ? 174 VAL A CB   1  
ATOM   1221  C  CG1  . VAL A 1 79  ? -3.489  -6.056  -14.491 1.00 1.95  ? 174 VAL A CG1  1  
ATOM   1222  C  CG2  . VAL A 1 79  ? -5.865  -5.294  -14.374 1.00 2.38  ? 174 VAL A CG2  1  
ATOM   1223  H  H    . VAL A 1 79  ? -5.714  -2.945  -16.081 1.00 1.33  ? 174 VAL A H    1  
ATOM   1224  H  HA   . VAL A 1 79  ? -3.951  -3.386  -13.781 1.00 1.27  ? 174 VAL A HA   1  
ATOM   1225  H  HB   . VAL A 1 79  ? -4.619  -5.223  -16.118 1.00 2.04  ? 174 VAL A HB   1  
ATOM   1226  H  HG11 . VAL A 1 79  ? -2.559  -6.018  -15.058 1.00 2.62  ? 174 VAL A HG11 1  
ATOM   1227  H  HG12 . VAL A 1 79  ? -3.890  -7.067  -14.573 1.00 2.36  ? 174 VAL A HG12 1  
ATOM   1228  H  HG13 . VAL A 1 79  ? -3.282  -5.837  -13.444 1.00 2.76  ? 174 VAL A HG13 1  
ATOM   1229  H  HG21 . VAL A 1 79  ? -6.172  -6.325  -14.548 1.00 2.69  ? 174 VAL A HG21 1  
ATOM   1230  H  HG22 . VAL A 1 79  ? -5.790  -5.120  -13.300 1.00 3.21  ? 174 VAL A HG22 1  
ATOM   1231  H  HG23 . VAL A 1 79  ? -6.629  -4.639  -14.792 1.00 2.92  ? 174 VAL A HG23 1  
ATOM   1232  N  N    . GLU A 1 80  ? -2.648  -3.034  -16.800 1.00 1.16  ? 175 GLU A N    1  
ATOM   1233  C  CA   . GLU A 1 80  ? -1.430  -2.677  -17.535 1.00 1.23  ? 175 GLU A CA   1  
ATOM   1234  C  C    . GLU A 1 80  ? -0.879  -1.293  -17.132 1.00 1.09  ? 175 GLU A C    1  
ATOM   1235  O  O    . GLU A 1 80  ? 0.335   -1.089  -17.164 1.00 1.15  ? 175 GLU A O    1  
ATOM   1236  C  CB   . GLU A 1 80  ? -1.708  -2.757  -19.045 1.00 1.48  ? 175 GLU A CB   1  
ATOM   1237  C  CG   . GLU A 1 80  ? -2.006  -4.199  -19.498 1.00 2.62  ? 175 GLU A CG   1  
ATOM   1238  C  CD   . GLU A 1 80  ? -2.525  -4.230  -20.930 1.00 3.11  ? 175 GLU A CD   1  
ATOM   1239  O  OE1  . GLU A 1 80  ? -1.766  -3.896  -21.864 1.00 3.20  ? 175 GLU A OE1  1  
ATOM   1240  O  OE2  . GLU A 1 80  ? -3.726  -4.518  -21.136 1.00 4.18  ? 175 GLU A OE2  1  
ATOM   1241  H  H    . GLU A 1 80  ? -3.533  -2.987  -17.290 1.00 1.20  ? 175 GLU A H    1  
ATOM   1242  H  HA   . GLU A 1 80  ? -0.656  -3.408  -17.301 1.00 1.35  ? 175 GLU A HA   1  
ATOM   1243  H  HB2  . GLU A 1 80  ? -2.555  -2.115  -19.286 1.00 1.51  ? 175 GLU A HB2  1  
ATOM   1244  H  HB3  . GLU A 1 80  ? -0.836  -2.393  -19.590 1.00 1.95  ? 175 GLU A HB3  1  
ATOM   1245  H  HG2  . GLU A 1 80  ? -1.094  -4.794  -19.429 1.00 3.14  ? 175 GLU A HG2  1  
ATOM   1246  H  HG3  . GLU A 1 80  ? -2.758  -4.650  -18.850 1.00 3.39  ? 175 GLU A HG3  1  
ATOM   1247  N  N    . ALA A 1 81  ? -1.734  -0.358  -16.691 1.00 1.06  ? 176 ALA A N    1  
ATOM   1248  C  CA   . ALA A 1 81  ? -1.292  0.918   -16.121 1.00 1.09  ? 176 ALA A CA   1  
ATOM   1249  C  C    . ALA A 1 81  ? -0.653  0.709   -14.740 1.00 1.01  ? 176 ALA A C    1  
ATOM   1250  O  O    . ALA A 1 81  ? 0.449   1.201   -14.507 1.00 1.11  ? 176 ALA A O    1  
ATOM   1251  C  CB   . ALA A 1 81  ? -2.468  1.905   -16.089 1.00 1.19  ? 176 ALA A CB   1  
ATOM   1252  H  H    . ALA A 1 81  ? -2.713  -0.588  -16.604 1.00 1.12  ? 176 ALA A H    1  
ATOM   1253  H  HA   . ALA A 1 81  ? -0.518  1.335   -16.767 1.00 1.22  ? 176 ALA A HA   1  
ATOM   1254  H  HB1  . ALA A 1 81  ? -2.898  2.010   -17.085 1.00 1.75  ? 176 ALA A HB1  1  
ATOM   1255  H  HB2  . ALA A 1 81  ? -3.240  1.569   -15.396 1.00 1.82  ? 176 ALA A HB2  1  
ATOM   1256  H  HB3  . ALA A 1 81  ? -2.112  2.882   -15.761 1.00 2.01  ? 176 ALA A HB3  1  
ATOM   1257  N  N    . MET A 1 82  ? -1.275  -0.097  -13.869 1.00 0.93  ? 177 MET A N    1  
ATOM   1258  C  CA   . MET A 1 82  ? -0.690  -0.575  -12.605 1.00 0.92  ? 177 MET A CA   1  
ATOM   1259  C  C    . MET A 1 82  ? 0.678   -1.238  -12.812 1.00 0.87  ? 177 MET A C    1  
ATOM   1260  O  O    . MET A 1 82  ? 1.632   -0.932  -12.093 1.00 0.99  ? 177 MET A O    1  
ATOM   1261  C  CB   . MET A 1 82  ? -1.659  -1.562  -11.931 1.00 0.96  ? 177 MET A CB   1  
ATOM   1262  C  CG   . MET A 1 82  ? -2.705  -0.828  -11.097 1.00 1.27  ? 177 MET A CG   1  
ATOM   1263  S  SD   . MET A 1 82  ? -2.006  -0.076  -9.607  1.00 1.90  ? 177 MET A SD   1  
ATOM   1264  C  CE   . MET A 1 82  ? -3.503  0.732   -9.021  1.00 2.08  ? 177 MET A CE   1  
ATOM   1265  H  H    . MET A 1 82  ? -2.217  -0.401  -14.104 1.00 0.94  ? 177 MET A H    1  
ATOM   1266  H  HA   . MET A 1 82  ? -0.544  0.275   -11.936 1.00 1.03  ? 177 MET A HA   1  
ATOM   1267  H  HB2  . MET A 1 82  ? -2.161  -2.173  -12.680 1.00 1.20  ? 177 MET A HB2  1  
ATOM   1268  H  HB3  . MET A 1 82  ? -1.107  -2.226  -11.265 1.00 1.28  ? 177 MET A HB3  1  
ATOM   1269  H  HG2  . MET A 1 82  ? -3.191  -0.059  -11.704 1.00 1.83  ? 177 MET A HG2  1  
ATOM   1270  H  HG3  . MET A 1 82  ? -3.473  -1.542  -10.794 1.00 1.83  ? 177 MET A HG3  1  
ATOM   1271  H  HE1  . MET A 1 82  ? -4.375  0.289   -9.500  1.00 2.47  ? 177 MET A HE1  1  
ATOM   1272  H  HE2  . MET A 1 82  ? -3.598  0.614   -7.942  1.00 3.04  ? 177 MET A HE2  1  
ATOM   1273  H  HE3  . MET A 1 82  ? -3.467  1.791   -9.280  1.00 2.73  ? 177 MET A HE3  1  
ATOM   1274  N  N    . ALA A 1 83  ? 0.806   -2.103  -13.826 1.00 0.79  ? 178 ALA A N    1  
ATOM   1275  C  CA   . ALA A 1 83  ? 2.058   -2.783  -14.168 1.00 0.86  ? 178 ALA A CA   1  
ATOM   1276  C  C    . ALA A 1 83  ? 3.202   -1.796  -14.457 1.00 0.98  ? 178 ALA A C    1  
ATOM   1277  O  O    . ALA A 1 83  ? 4.329   -2.024  -14.009 1.00 1.12  ? 178 ALA A O    1  
ATOM   1278  C  CB   . ALA A 1 83  ? 1.805   -3.712  -15.363 1.00 0.82  ? 178 ALA A CB   1  
ATOM   1279  H  H    . ALA A 1 83  ? -0.024  -2.330  -14.361 1.00 0.76  ? 178 ALA A H    1  
ATOM   1280  H  HA   . ALA A 1 83  ? 2.364   -3.392  -13.315 1.00 0.96  ? 178 ALA A HA   1  
ATOM   1281  H  HB1  . ALA A 1 83  ? 2.685   -4.332  -15.535 1.00 1.72  ? 178 ALA A HB1  1  
ATOM   1282  H  HB2  . ALA A 1 83  ? 0.953   -4.361  -15.161 1.00 1.61  ? 178 ALA A HB2  1  
ATOM   1283  H  HB3  . ALA A 1 83  ? 1.601   -3.129  -16.261 1.00 1.50  ? 178 ALA A HB3  1  
ATOM   1284  N  N    . ARG A 1 84  ? 2.921   -0.687  -15.154 1.00 1.01  ? 179 ARG A N    1  
ATOM   1285  C  CA   . ARG A 1 84  ? 3.880   0.416   -15.296 1.00 1.18  ? 179 ARG A CA   1  
ATOM   1286  C  C    . ARG A 1 84  ? 4.077   1.173   -13.982 1.00 1.18  ? 179 ARG A C    1  
ATOM   1287  O  O    . ARG A 1 84  ? 5.211   1.340   -13.550 1.00 1.29  ? 179 ARG A O    1  
ATOM   1288  C  CB   . ARG A 1 84  ? 3.451   1.391   -16.398 1.00 1.34  ? 179 ARG A CB   1  
ATOM   1289  C  CG   . ARG A 1 84  ? 3.678   0.805   -17.803 1.00 1.85  ? 179 ARG A CG   1  
ATOM   1290  C  CD   . ARG A 1 84  ? 3.871   1.909   -18.848 1.00 2.08  ? 179 ARG A CD   1  
ATOM   1291  N  NE   . ARG A 1 84  ? 5.120   2.647   -18.596 1.00 2.91  ? 179 ARG A NE   1  
ATOM   1292  C  CZ   . ARG A 1 84  ? 5.765   3.465   -19.409 1.00 3.61  ? 179 ARG A CZ   1  
ATOM   1293  N  NH1  . ARG A 1 84  ? 5.341   3.751   -20.622 1.00 3.87  ? 179 ARG A NH1  1  
ATOM   1294  N  NH2  . ARG A 1 84  ? 6.877   3.992   -18.963 1.00 4.71  ? 179 ARG A NH2  1  
ATOM   1295  H  H    . ARG A 1 84  ? 1.980   -0.564  -15.512 1.00 0.97  ? 179 ARG A H    1  
ATOM   1296  H  HA   . ARG A 1 84  ? 4.852   0.003   -15.568 1.00 1.27  ? 179 ARG A HA   1  
ATOM   1297  H  HB2  . ARG A 1 84  ? 2.403   1.669   -16.281 1.00 1.47  ? 179 ARG A HB2  1  
ATOM   1298  H  HB3  . ARG A 1 84  ? 4.049   2.295   -16.279 1.00 1.96  ? 179 ARG A HB3  1  
ATOM   1299  H  HG2  . ARG A 1 84  ? 4.569   0.175   -17.806 1.00 2.83  ? 179 ARG A HG2  1  
ATOM   1300  H  HG3  . ARG A 1 84  ? 2.821   0.189   -18.077 1.00 2.40  ? 179 ARG A HG3  1  
ATOM   1301  H  HD2  . ARG A 1 84  ? 3.911   1.448   -19.835 1.00 2.58  ? 179 ARG A HD2  1  
ATOM   1302  H  HD3  . ARG A 1 84  ? 3.021   2.594   -18.813 1.00 2.28  ? 179 ARG A HD3  1  
ATOM   1303  H  HE   . ARG A 1 84  ? 5.562   2.524   -17.683 1.00 3.57  ? 179 ARG A HE   1  
ATOM   1304  H  HH11 . ARG A 1 84  ? 4.464   3.388   -20.948 1.00 3.67  ? 179 ARG A HH11 1  
ATOM   1305  H  HH12 . ARG A 1 84  ? 5.857   4.400   -21.208 1.00 4.69  ? 179 ARG A HH12 1  
ATOM   1306  H  HH21 . ARG A 1 84  ? 7.173   3.751   -18.016 1.00 5.17  ? 179 ARG A HH21 1  
ATOM   1307  H  HH22 . ARG A 1 84  ? 7.445   4.608   -19.535 1.00 5.39  ? 179 ARG A HH22 1  
ATOM   1308  N  N    . TYR A 1 85  ? 2.999   1.588   -13.314 1.00 1.09  ? 180 TYR A N    1  
ATOM   1309  C  CA   . TYR A 1 85  ? 3.043   2.401   -12.091 1.00 1.08  ? 180 TYR A CA   1  
ATOM   1310  C  C    . TYR A 1 85  ? 3.856   1.746   -10.959 1.00 1.03  ? 180 TYR A C    1  
ATOM   1311  O  O    . TYR A 1 85  ? 4.592   2.431   -10.256 1.00 1.12  ? 180 TYR A O    1  
ATOM   1312  C  CB   . TYR A 1 85  ? 1.599   2.696   -11.659 1.00 1.14  ? 180 TYR A CB   1  
ATOM   1313  C  CG   . TYR A 1 85  ? 1.468   3.817   -10.648 1.00 1.15  ? 180 TYR A CG   1  
ATOM   1314  C  CD1  . TYR A 1 85  ? 1.661   5.149   -11.064 1.00 1.76  ? 180 TYR A CD1  1  
ATOM   1315  C  CD2  . TYR A 1 85  ? 1.135   3.541   -9.309  1.00 2.05  ? 180 TYR A CD2  1  
ATOM   1316  C  CE1  . TYR A 1 85  ? 1.512   6.206   -10.147 1.00 2.03  ? 180 TYR A CE1  1  
ATOM   1317  C  CE2  . TYR A 1 85  ? 0.983   4.596   -8.388  1.00 2.28  ? 180 TYR A CE2  1  
ATOM   1318  C  CZ   . TYR A 1 85  ? 1.159   5.934   -8.808  1.00 1.84  ? 180 TYR A CZ   1  
ATOM   1319  O  OH   . TYR A 1 85  ? 0.976   6.964   -7.938  1.00 2.29  ? 180 TYR A OH   1  
ATOM   1320  H  H    . TYR A 1 85  ? 2.088   1.404   -13.722 1.00 1.05  ? 180 TYR A H    1  
ATOM   1321  H  HA   . TYR A 1 85  ? 3.532   3.347   -12.328 1.00 1.16  ? 180 TYR A HA   1  
ATOM   1322  H  HB2  . TYR A 1 85  ? 1.021   2.984   -12.537 1.00 1.29  ? 180 TYR A HB2  1  
ATOM   1323  H  HB3  . TYR A 1 85  ? 1.150   1.787   -11.257 1.00 1.38  ? 180 TYR A HB3  1  
ATOM   1324  H  HD1  . TYR A 1 85  ? 1.915   5.361   -12.092 1.00 2.61  ? 180 TYR A HD1  1  
ATOM   1325  H  HD2  . TYR A 1 85  ? 0.982   2.521   -8.984  1.00 2.96  ? 180 TYR A HD2  1  
ATOM   1326  H  HE1  . TYR A 1 85  ? 1.658   7.227   -10.464 1.00 2.93  ? 180 TYR A HE1  1  
ATOM   1327  H  HE2  . TYR A 1 85  ? 0.725   4.379   -7.364  1.00 3.24  ? 180 TYR A HE2  1  
ATOM   1328  H  HH   . TYR A 1 85  ? 0.660   6.675   -7.078  1.00 2.68  ? 180 TYR A HH   1  
ATOM   1329  N  N    . VAL A 1 86  ? 3.789   0.416   -10.851 1.00 0.96  ? 181 VAL A N    1  
ATOM   1330  C  CA   . VAL A 1 86  ? 4.692   -0.399  -10.022 1.00 0.97  ? 181 VAL A CA   1  
ATOM   1331  C  C    . VAL A 1 86  ? 6.144   -0.305  -10.514 1.00 1.00  ? 181 VAL A C    1  
ATOM   1332  O  O    . VAL A 1 86  ? 7.016   0.127   -9.766  1.00 1.05  ? 181 VAL A O    1  
ATOM   1333  C  CB   . VAL A 1 86  ? 4.214   -1.871  -9.984  1.00 1.02  ? 181 VAL A CB   1  
ATOM   1334  C  CG1  . VAL A 1 86  ? 5.273   -2.854  -9.450  1.00 1.43  ? 181 VAL A CG1  1  
ATOM   1335  C  CG2  . VAL A 1 86  ? 2.950   -1.975  -9.120  1.00 1.09  ? 181 VAL A CG2  1  
ATOM   1336  H  H    . VAL A 1 86  ? 3.063   -0.051  -11.397 1.00 0.95  ? 181 VAL A H    1  
ATOM   1337  H  HA   . VAL A 1 86  ? 4.659   -0.006  -9.005  1.00 0.99  ? 181 VAL A HA   1  
ATOM   1338  H  HB   . VAL A 1 86  ? 3.965   -2.180  -11.001 1.00 1.14  ? 181 VAL A HB   1  
ATOM   1339  H  HG11 . VAL A 1 86  ? 5.684   -2.489  -8.512  1.00 2.20  ? 181 VAL A HG11 1  
ATOM   1340  H  HG12 . VAL A 1 86  ? 4.826   -3.833  -9.286  1.00 1.95  ? 181 VAL A HG12 1  
ATOM   1341  H  HG13 . VAL A 1 86  ? 6.084   -2.974  -10.168 1.00 1.92  ? 181 VAL A HG13 1  
ATOM   1342  H  HG21 . VAL A 1 86  ? 3.181   -1.713  -8.087  1.00 2.08  ? 181 VAL A HG21 1  
ATOM   1343  H  HG22 . VAL A 1 86  ? 2.173   -1.307  -9.489  1.00 1.55  ? 181 VAL A HG22 1  
ATOM   1344  H  HG23 . VAL A 1 86  ? 2.570   -2.994  -9.153  1.00 1.76  ? 181 VAL A HG23 1  
ATOM   1345  N  N    . GLN A 1 87  ? 6.424   -0.750  -11.745 1.00 1.09  ? 182 GLN A N    1  
ATOM   1346  C  CA   . GLN A 1 87  ? 7.794   -0.987  -12.213 1.00 1.27  ? 182 GLN A CA   1  
ATOM   1347  C  C    . GLN A 1 87  ? 8.608   0.287   -12.458 1.00 1.29  ? 182 GLN A C    1  
ATOM   1348  O  O    . GLN A 1 87  ? 9.815   0.272   -12.230 1.00 1.46  ? 182 GLN A O    1  
ATOM   1349  C  CB   . GLN A 1 87  ? 7.758   -1.830  -13.495 1.00 1.46  ? 182 GLN A CB   1  
ATOM   1350  C  CG   . GLN A 1 87  ? 7.303   -3.278  -13.244 1.00 2.71  ? 182 GLN A CG   1  
ATOM   1351  C  CD   . GLN A 1 87  ? 7.197   -4.043  -14.558 1.00 3.27  ? 182 GLN A CD   1  
ATOM   1352  O  OE1  . GLN A 1 87  ? 8.027   -4.876  -14.893 1.00 3.44  ? 182 GLN A OE1  1  
ATOM   1353  N  NE2  . GLN A 1 87  ? 6.197   -3.757  -15.362 1.00 3.89  ? 182 GLN A NE2  1  
ATOM   1354  H  H    . GLN A 1 87  ? 5.661   -0.997  -12.363 1.00 1.14  ? 182 GLN A H    1  
ATOM   1355  H  HA   . GLN A 1 87  ? 8.340   -1.539  -11.449 1.00 1.34  ? 182 GLN A HA   1  
ATOM   1356  H  HB2  . GLN A 1 87  ? 7.096   -1.349  -14.218 1.00 1.60  ? 182 GLN A HB2  1  
ATOM   1357  H  HB3  . GLN A 1 87  ? 8.760   -1.861  -13.926 1.00 2.04  ? 182 GLN A HB3  1  
ATOM   1358  H  HG2  . GLN A 1 87  ? 8.023   -3.777  -12.595 1.00 3.40  ? 182 GLN A HG2  1  
ATOM   1359  H  HG3  . GLN A 1 87  ? 6.330   -3.287  -12.753 1.00 3.26  ? 182 GLN A HG3  1  
ATOM   1360  H  HE21 . GLN A 1 87  ? 5.519   -3.062  -15.071 1.00 4.05  ? 182 GLN A HE21 1  
ATOM   1361  H  HE22 . GLN A 1 87  ? 6.220   -4.133  -16.302 1.00 4.28  ? 182 GLN A HE22 1  
ATOM   1362  N  N    . ASP A 1 88  ? 7.980   1.365   -12.935 1.00 1.24  ? 183 ASP A N    1  
ATOM   1363  C  CA   . ASP A 1 88  ? 8.647   2.645   -13.195 1.00 1.39  ? 183 ASP A CA   1  
ATOM   1364  C  C    . ASP A 1 88  ? 8.975   3.429   -11.912 1.00 1.20  ? 183 ASP A C    1  
ATOM   1365  O  O    . ASP A 1 88  ? 9.852   4.295   -11.940 1.00 1.26  ? 183 ASP A O    1  
ATOM   1366  C  CB   . ASP A 1 88  ? 7.849   3.454   -14.236 1.00 1.69  ? 183 ASP A CB   1  
ATOM   1367  C  CG   . ASP A 1 88  ? 7.912   2.835   -15.644 1.00 3.01  ? 183 ASP A CG   1  
ATOM   1368  O  OD1  . ASP A 1 88  ? 8.998   2.342   -16.040 1.00 4.10  ? 183 ASP A OD1  1  
ATOM   1369  O  OD2  . ASP A 1 88  ? 6.901   2.887   -16.384 1.00 3.75  ? 183 ASP A OD2  1  
ATOM   1370  H  H    . ASP A 1 88  ? 6.968   1.338   -13.048 1.00 1.16  ? 183 ASP A H    1  
ATOM   1371  H  HA   . ASP A 1 88  ? 9.617   2.425   -13.635 1.00 1.61  ? 183 ASP A HA   1  
ATOM   1372  H  HB2  . ASP A 1 88  ? 6.812   3.547   -13.910 1.00 1.43  ? 183 ASP A HB2  1  
ATOM   1373  H  HB3  . ASP A 1 88  ? 8.272   4.458   -14.296 1.00 2.28  ? 183 ASP A HB3  1  
ATOM   1374  N  N    . PHE A 1 89  ? 8.354   3.075   -10.778 1.00 1.08  ? 184 PHE A N    1  
ATOM   1375  C  CA   . PHE A 1 89  ? 8.848   3.416   -9.442  1.00 1.08  ? 184 PHE A CA   1  
ATOM   1376  C  C    . PHE A 1 89  ? 9.963   2.431   -9.056  1.00 6.59  ? 184 PHE A C    1  
ATOM   1377  O  O    . PHE A 1 89  ? 11.134  2.811   -9.038  1.00 5.11  ? 184 PHE A O    1  
ATOM   1378  C  CB   . PHE A 1 89  ? 7.684   3.430   -8.426  1.00 1.10  ? 184 PHE A CB   1  
ATOM   1379  C  CG   . PHE A 1 89  ? 7.355   4.803   -7.872  1.00 1.03  ? 184 PHE A CG   1  
ATOM   1380  C  CD1  . PHE A 1 89  ? 8.297   5.471   -7.066  1.00 2.83  ? 184 PHE A CD1  1  
ATOM   1381  C  CD2  . PHE A 1 89  ? 6.105   5.402   -8.123  1.00 2.11  ? 184 PHE A CD2  1  
ATOM   1382  C  CE1  . PHE A 1 89  ? 7.993   6.726   -6.511  1.00 5.03  ? 184 PHE A CE1  1  
ATOM   1383  C  CE2  . PHE A 1 89  ? 5.799   6.656   -7.563  1.00 1.84  ? 184 PHE A CE2  1  
ATOM   1384  C  CZ   . PHE A 1 89  ? 6.741   7.316   -6.752  1.00 1.46  ? 184 PHE A CZ   1  
ATOM   1385  H  H    . PHE A 1 89  ? 7.658   2.345   -10.839 1.00 1.11  ? 184 PHE A H    1  
ATOM   1386  H  HA   . PHE A 1 89  ? 9.294   4.411   -9.473  1.00 1.17  ? 184 PHE A HA   1  
ATOM   1387  H  HB2  . PHE A 1 89  ? 6.791   2.992   -8.873  1.00 1.21  ? 184 PHE A HB2  1  
ATOM   1388  H  HB3  . PHE A 1 89  ? 7.940   2.805   -7.570  1.00 1.19  ? 184 PHE A HB3  1  
ATOM   1389  H  HD1  . PHE A 1 89  ? 9.257   5.017   -6.866  1.00 4.30  ? 184 PHE A HD1  1  
ATOM   1390  H  HD2  . PHE A 1 89  ? 5.371   4.893   -8.734  1.00 3.53  ? 184 PHE A HD2  1  
ATOM   1391  H  HE1  . PHE A 1 89  ? 8.720   7.229   -5.892  1.00 5.55  ? 184 PHE A HE1  1  
ATOM   1392  H  HE2  . PHE A 1 89  ? 4.831   7.102   -7.746  1.00 2.82  ? 184 PHE A HE2  1  
ATOM   1393  H  HZ   . PHE A 1 89  ? 6.501   8.269   -6.299  1.00 3.16  ? 184 PHE A HZ   1  
ATOM   1394  N  N    . HIS A 1 90  ? 9.605   1.168   -8.799  1.00 0.99  ? 185 HIS A N    1  
ATOM   1395  C  CA   . HIS A 1 90  ? 10.498  0.044   -8.490  1.00 1.06  ? 185 HIS A CA   1  
ATOM   1396  C  C    . HIS A 1 90  ? 9.712   -1.285  -8.376  1.00 1.08  ? 185 HIS A C    1  
ATOM   1397  O  O    . HIS A 1 90  ? 8.634   -1.279  -7.783  1.00 1.03  ? 185 HIS A O    1  
ATOM   1398  C  CB   . HIS A 1 90  ? 11.247  0.303   -7.166  1.00 1.19  ? 185 HIS A CB   1  
ATOM   1399  C  CG   . HIS A 1 90  ? 12.378  -0.659  -6.948  1.00 1.38  ? 185 HIS A CG   1  
ATOM   1400  N  ND1  . HIS A 1 90  ? 12.329  -1.838  -6.207  1.00 1.73  ? 185 HIS A ND1  1  
ATOM   1401  C  CD2  . HIS A 1 90  ? 13.580  -0.582  -7.575  1.00 1.97  ? 185 HIS A CD2  1  
ATOM   1402  C  CE1  . HIS A 1 90  ? 13.526  -2.425  -6.382  1.00 1.92  ? 185 HIS A CE1  1  
ATOM   1403  N  NE2  . HIS A 1 90  ? 14.300  -1.696  -7.207  1.00 2.15  ? 185 HIS A NE2  1  
ATOM   1404  H  H    . HIS A 1 90  ? 8.618   0.948   -8.892  1.00 0.96  ? 185 HIS A H    1  
ATOM   1405  H  HA   . HIS A 1 90  ? 11.223  -0.025  -9.301  1.00 1.14  ? 185 HIS A HA   1  
ATOM   1406  H  HB2  . HIS A 1 90  ? 11.668  1.306   -7.158  1.00 1.29  ? 185 HIS A HB2  1  
ATOM   1407  H  HB3  . HIS A 1 90  ? 10.549  0.234   -6.331  1.00 1.33  ? 185 HIS A HB3  1  
ATOM   1408  H  HD2  . HIS A 1 90  ? 13.860  0.187   -8.273  1.00 2.53  ? 185 HIS A HD2  1  
ATOM   1409  H  HE1  . HIS A 1 90  ? 13.826  -3.362  -5.931  1.00 2.29  ? 185 HIS A HE1  1  
ATOM   1410  H  HE2  . HIS A 1 90  ? 15.238  -1.944  -7.523  1.00 2.71  ? 185 HIS A HE2  1  
ATOM   1411  N  N    . PRO A 1 91  ? 10.234  -2.447  -8.824  1.00 1.27  ? 186 PRO A N    1  
ATOM   1412  C  CA   . PRO A 1 91  ? 9.566   -3.749  -8.667  1.00 1.49  ? 186 PRO A CA   1  
ATOM   1413  C  C    . PRO A 1 91  ? 9.326   -4.229  -7.215  1.00 1.60  ? 186 PRO A C    1  
ATOM   1414  O  O    . PRO A 1 91  ? 8.730   -5.291  -7.044  1.00 2.12  ? 186 PRO A O    1  
ATOM   1415  C  CB   . PRO A 1 91  ? 10.407  -4.743  -9.481  1.00 1.79  ? 186 PRO A CB   1  
ATOM   1416  C  CG   . PRO A 1 91  ? 11.782  -4.084  -9.565  1.00 1.69  ? 186 PRO A CG   1  
ATOM   1417  C  CD   . PRO A 1 91  ? 11.432  -2.602  -9.637  1.00 1.44  ? 186 PRO A CD   1  
ATOM   1418  H  HA   . PRO A 1 91  ? 8.581   -3.680  -9.132  1.00 1.50  ? 186 PRO A HA   1  
ATOM   1419  H  HB2  . PRO A 1 91  ? 10.466  -5.728  -9.015  1.00 2.00  ? 186 PRO A HB2  1  
ATOM   1420  H  HB3  . PRO A 1 91  ? 9.988   -4.832  -10.485 1.00 1.94  ? 186 PRO A HB3  1  
ATOM   1421  H  HG2  . PRO A 1 91  ? 12.344  -4.285  -8.651  1.00 1.70  ? 186 PRO A HG2  1  
ATOM   1422  H  HG3  . PRO A 1 91  ? 12.339  -4.412  -10.443 1.00 1.91  ? 186 PRO A HG3  1  
ATOM   1423  H  HD2  . PRO A 1 91  ? 12.266  -2.008  -9.274  1.00 1.40  ? 186 PRO A HD2  1  
ATOM   1424  H  HD3  . PRO A 1 91  ? 11.205  -2.325  -10.668 1.00 1.58  ? 186 PRO A HD3  1  
ATOM   1425  N  N    . ARG A 1 92  ? 9.742   -3.481  -6.179  1.00 1.58  ? 187 ARG A N    1  
ATOM   1426  C  CA   . ARG A 1 92  ? 9.303   -3.665  -4.782  1.00 1.81  ? 187 ARG A CA   1  
ATOM   1427  C  C    . ARG A 1 92  ? 7.900   -3.078  -4.495  1.00 1.52  ? 187 ARG A C    1  
ATOM   1428  O  O    . ARG A 1 92  ? 7.303   -3.413  -3.472  1.00 1.65  ? 187 ARG A O    1  
ATOM   1429  C  CB   . ARG A 1 92  ? 10.385  -3.086  -3.845  1.00 2.17  ? 187 ARG A CB   1  
ATOM   1430  C  CG   . ARG A 1 92  ? 10.090  -3.237  -2.337  1.00 3.18  ? 187 ARG A CG   1  
ATOM   1431  C  CD   . ARG A 1 92  ? 11.365  -3.394  -1.496  1.00 3.65  ? 187 ARG A CD   1  
ATOM   1432  N  NE   . ARG A 1 92  ? 11.891  -4.763  -1.648  1.00 3.29  ? 187 ARG A NE   1  
ATOM   1433  C  CZ   . ARG A 1 92  ? 13.160  -5.118  -1.796  1.00 3.92  ? 187 ARG A CZ   1  
ATOM   1434  N  NH1  . ARG A 1 92  ? 14.163  -4.285  -1.662  1.00 4.96  ? 187 ARG A NH1  1  
ATOM   1435  N  NH2  . ARG A 1 92  ? 13.458  -6.361  -2.093  1.00 4.21  ? 187 ARG A NH2  1  
ATOM   1436  H  H    . ARG A 1 92  ? 10.330  -2.679  -6.367  1.00 1.77  ? 187 ARG A H    1  
ATOM   1437  H  HA   . ARG A 1 92  ? 9.240   -4.736  -4.587  1.00 2.13  ? 187 ARG A HA   1  
ATOM   1438  H  HB2  . ARG A 1 92  ? 11.321  -3.597  -4.076  1.00 2.27  ? 187 ARG A HB2  1  
ATOM   1439  H  HB3  . ARG A 1 92  ? 10.523  -2.025  -4.062  1.00 2.42  ? 187 ARG A HB3  1  
ATOM   1440  H  HG2  . ARG A 1 92  ? 9.543   -2.356  -1.997  1.00 4.06  ? 187 ARG A HG2  1  
ATOM   1441  H  HG3  . ARG A 1 92  ? 9.464   -4.114  -2.166  1.00 3.50  ? 187 ARG A HG3  1  
ATOM   1442  H  HD2  . ARG A 1 92  ? 12.099  -2.647  -1.804  1.00 4.32  ? 187 ARG A HD2  1  
ATOM   1443  H  HD3  . ARG A 1 92  ? 11.125  -3.221  -0.444  1.00 4.24  ? 187 ARG A HD3  1  
ATOM   1444  H  HE   . ARG A 1 92  ? 11.201  -5.492  -1.714  1.00 3.18  ? 187 ARG A HE   1  
ATOM   1445  H  HH11 . ARG A 1 92  ? 14.024  -3.372  -1.218  1.00 5.33  ? 187 ARG A HH11 1  
ATOM   1446  H  HH12 . ARG A 1 92  ? 15.106  -4.629  -1.790  1.00 5.72  ? 187 ARG A HH12 1  
ATOM   1447  H  HH21 . ARG A 1 92  ? 12.754  -7.067  -2.197  1.00 4.07  ? 187 ARG A HH21 1  
ATOM   1448  H  HH22 . ARG A 1 92  ? 14.446  -6.585  -2.211  1.00 5.05  ? 187 ARG A HH22 1  
ATOM   1449  N  N    . LEU A 1 93  ? 7.358   -2.219  -5.368  1.00 1.22  ? 188 LEU A N    1  
ATOM   1450  C  CA   . LEU A 1 93  ? 5.947   -1.792  -5.305  1.00 0.99  ? 188 LEU A CA   1  
ATOM   1451  C  C    . LEU A 1 93  ? 4.992   -2.953  -5.659  1.00 0.96  ? 188 LEU A C    1  
ATOM   1452  O  O    . LEU A 1 93  ? 5.376   -3.916  -6.323  1.00 1.18  ? 188 LEU A O    1  
ATOM   1453  C  CB   . LEU A 1 93  ? 5.705   -0.573  -6.230  1.00 0.85  ? 188 LEU A CB   1  
ATOM   1454  C  CG   . LEU A 1 93  ? 6.068   0.830   -5.697  1.00 1.29  ? 188 LEU A CG   1  
ATOM   1455  C  CD1  . LEU A 1 93  ? 5.135   1.253   -4.551  1.00 2.03  ? 188 LEU A CD1  1  
ATOM   1456  C  CD2  . LEU A 1 93  ? 7.529   0.962   -5.248  1.00 1.71  ? 188 LEU A CD2  1  
ATOM   1457  H  H    . LEU A 1 93  ? 7.907   -1.950  -6.181  1.00 1.24  ? 188 LEU A H    1  
ATOM   1458  H  HA   . LEU A 1 93  ? 5.714   -1.510  -4.279  1.00 1.11  ? 188 LEU A HA   1  
ATOM   1459  H  HB2  . LEU A 1 93  ? 6.238   -0.727  -7.166  1.00 1.38  ? 188 LEU A HB2  1  
ATOM   1460  H  HB3  . LEU A 1 93  ? 4.646   -0.541  -6.491  1.00 1.28  ? 188 LEU A HB3  1  
ATOM   1461  H  HG   . LEU A 1 93  ? 5.914   1.529   -6.522  1.00 1.64  ? 188 LEU A HG   1  
ATOM   1462  H  HD11 . LEU A 1 93  ? 4.095   1.181   -4.873  1.00 2.18  ? 188 LEU A HD11 1  
ATOM   1463  H  HD12 . LEU A 1 93  ? 5.285   0.618   -3.678  1.00 2.88  ? 188 LEU A HD12 1  
ATOM   1464  H  HD13 . LEU A 1 93  ? 5.341   2.287   -4.274  1.00 2.91  ? 188 LEU A HD13 1  
ATOM   1465  H  HD21 . LEU A 1 93  ? 8.190   0.665   -6.059  1.00 2.26  ? 188 LEU A HD21 1  
ATOM   1466  H  HD22 . LEU A 1 93  ? 7.738   2.001   -4.994  1.00 2.48  ? 188 LEU A HD22 1  
ATOM   1467  H  HD23 . LEU A 1 93  ? 7.721   0.340   -4.373  1.00 2.21  ? 188 LEU A HD23 1  
ATOM   1468  N  N    . LEU A 1 94  ? 3.726   -2.832  -5.247  1.00 0.87  ? 189 LEU A N    1  
ATOM   1469  C  CA   . LEU A 1 94  ? 2.624   -3.724  -5.594  1.00 0.89  ? 189 LEU A CA   1  
ATOM   1470  C  C    . LEU A 1 94  ? 1.386   -2.867  -5.907  1.00 0.77  ? 189 LEU A C    1  
ATOM   1471  O  O    . LEU A 1 94  ? 1.050   -1.966  -5.138  1.00 0.80  ? 189 LEU A O    1  
ATOM   1472  C  CB   . LEU A 1 94  ? 2.407   -4.689  -4.409  1.00 1.19  ? 189 LEU A CB   1  
ATOM   1473  C  CG   . LEU A 1 94  ? 1.854   -6.064  -4.806  1.00 1.06  ? 189 LEU A CG   1  
ATOM   1474  C  CD1  . LEU A 1 94  ? 2.005   -7.064  -3.650  1.00 1.76  ? 189 LEU A CD1  1  
ATOM   1475  C  CD2  . LEU A 1 94  ? 0.383   -6.045  -5.246  1.00 2.03  ? 189 LEU A CD2  1  
ATOM   1476  H  H    . LEU A 1 94  ? 3.473   -2.063  -4.653  1.00 0.90  ? 189 LEU A H    1  
ATOM   1477  H  HA   . LEU A 1 94  ? 2.894   -4.289  -6.487  1.00 0.96  ? 189 LEU A HA   1  
ATOM   1478  H  HB2  . LEU A 1 94  ? 3.372   -4.858  -3.925  1.00 1.95  ? 189 LEU A HB2  1  
ATOM   1479  H  HB3  . LEU A 1 94  ? 1.754   -4.225  -3.675  1.00 1.83  ? 189 LEU A HB3  1  
ATOM   1480  H  HG   . LEU A 1 94  ? 2.468   -6.404  -5.632  1.00 1.82  ? 189 LEU A HG   1  
ATOM   1481  H  HD11 . LEU A 1 94  ? 1.379   -6.763  -2.811  1.00 2.50  ? 189 LEU A HD11 1  
ATOM   1482  H  HD12 . LEU A 1 94  ? 1.702   -8.058  -3.979  1.00 2.43  ? 189 LEU A HD12 1  
ATOM   1483  H  HD13 . LEU A 1 94  ? 3.046   -7.109  -3.327  1.00 2.52  ? 189 LEU A HD13 1  
ATOM   1484  H  HD21 . LEU A 1 94  ? 0.275   -5.515  -6.187  1.00 3.06  ? 189 LEU A HD21 1  
ATOM   1485  H  HD22 . LEU A 1 94  ? 0.027   -7.064  -5.401  1.00 2.66  ? 189 LEU A HD22 1  
ATOM   1486  H  HD23 . LEU A 1 94  ? -0.229  -5.567  -4.481  1.00 2.68  ? 189 LEU A HD23 1  
ATOM   1487  N  N    . GLY A 1 95  ? 0.737   -3.122  -7.045  1.00 0.76  ? 190 GLY A N    1  
ATOM   1488  C  CA   . GLY A 1 95  ? -0.454  -2.403  -7.507  1.00 0.78  ? 190 GLY A CA   1  
ATOM   1489  C  C    . GLY A 1 95  ? -1.685  -3.301  -7.481  1.00 0.76  ? 190 GLY A C    1  
ATOM   1490  O  O    . GLY A 1 95  ? -1.629  -4.426  -7.978  1.00 0.87  ? 190 GLY A O    1  
ATOM   1491  H  H    . GLY A 1 95  ? 1.053   -3.900  -7.611  1.00 0.83  ? 190 GLY A H    1  
ATOM   1492  H  HA2  . GLY A 1 95  ? -0.639  -1.517  -6.898  1.00 0.86  ? 190 GLY A HA2  1  
ATOM   1493  H  HA3  . GLY A 1 95  ? -0.307  -2.099  -8.542  1.00 0.90  ? 190 GLY A HA3  1  
ATOM   1494  N  N    . LEU A 1 96  ? -2.790  -2.800  -6.923  1.00 0.83  ? 191 LEU A N    1  
ATOM   1495  C  CA   . LEU A 1 96  ? -4.062  -3.511  -6.785  1.00 0.95  ? 191 LEU A CA   1  
ATOM   1496  C  C    . LEU A 1 96  ? -5.225  -2.680  -7.345  1.00 1.03  ? 191 LEU A C    1  
ATOM   1497  O  O    . LEU A 1 96  ? -5.336  -1.481  -7.073  1.00 1.14  ? 191 LEU A O    1  
ATOM   1498  C  CB   . LEU A 1 96  ? -4.319  -3.839  -5.300  1.00 1.22  ? 191 LEU A CB   1  
ATOM   1499  C  CG   . LEU A 1 96  ? -3.334  -4.832  -4.645  1.00 1.27  ? 191 LEU A CG   1  
ATOM   1500  C  CD1  . LEU A 1 96  ? -3.733  -5.033  -3.175  1.00 2.30  ? 191 LEU A CD1  1  
ATOM   1501  C  CD2  . LEU A 1 96  ? -3.309  -6.202  -5.342  1.00 2.18  ? 191 LEU A CD2  1  
ATOM   1502  H  H    . LEU A 1 96  ? -2.747  -1.857  -6.548  1.00 0.95  ? 191 LEU A H    1  
ATOM   1503  H  HA   . LEU A 1 96  ? -4.014  -4.439  -7.353  1.00 0.95  ? 191 LEU A HA   1  
ATOM   1504  H  HB2  . LEU A 1 96  ? -4.293  -2.904  -4.738  1.00 2.06  ? 191 LEU A HB2  1  
ATOM   1505  H  HB3  . LEU A 1 96  ? -5.324  -4.247  -5.210  1.00 1.64  ? 191 LEU A HB3  1  
ATOM   1506  H  HG   . LEU A 1 96  ? -2.331  -4.405  -4.671  1.00 2.28  ? 191 LEU A HG   1  
ATOM   1507  H  HD11 . LEU A 1 96  ? -4.727  -5.478  -3.111  1.00 2.78  ? 191 LEU A HD11 1  
ATOM   1508  H  HD12 . LEU A 1 96  ? -3.016  -5.692  -2.684  1.00 3.08  ? 191 LEU A HD12 1  
ATOM   1509  H  HD13 . LEU A 1 96  ? -3.739  -4.075  -2.656  1.00 3.26  ? 191 LEU A HD13 1  
ATOM   1510  H  HD21 . LEU A 1 96  ? -2.898  -6.108  -6.345  1.00 3.23  ? 191 LEU A HD21 1  
ATOM   1511  H  HD22 . LEU A 1 96  ? -2.676  -6.892  -4.783  1.00 2.78  ? 191 LEU A HD22 1  
ATOM   1512  H  HD23 . LEU A 1 96  ? -4.316  -6.614  -5.406  1.00 2.83  ? 191 LEU A HD23 1  
ATOM   1513  N  N    . THR A 1 97  ? -6.132  -3.338  -8.076  1.00 1.06  ? 192 THR A N    1  
ATOM   1514  C  CA   . THR A 1 97  ? -7.311  -2.712  -8.703  1.00 1.21  ? 192 THR A CA   1  
ATOM   1515  C  C    . THR A 1 97  ? -8.500  -3.679  -8.746  1.00 1.27  ? 192 THR A C    1  
ATOM   1516  O  O    . THR A 1 97  ? -8.401  -4.806  -8.256  1.00 1.38  ? 192 THR A O    1  
ATOM   1517  C  CB   . THR A 1 97  ? -6.903  -2.100  -10.054 1.00 1.37  ? 192 THR A CB   1  
ATOM   1518  O  OG1  . THR A 1 97  ? -7.886  -1.188  -10.471 1.00 2.26  ? 192 THR A OG1  1  
ATOM   1519  C  CG2  . THR A 1 97  ? -6.666  -3.129  -11.162 1.00 1.49  ? 192 THR A CG2  1  
ATOM   1520  H  H    . THR A 1 97  ? -5.985  -4.329  -8.233  1.00 1.04  ? 192 THR A H    1  
ATOM   1521  H  HA   . THR A 1 97  ? -7.628  -1.879  -8.076  1.00 1.31  ? 192 THR A HA   1  
ATOM   1522  H  HB   . THR A 1 97  ? -5.977  -1.538  -9.907  1.00 1.90  ? 192 THR A HB   1  
ATOM   1523  H  HG1  . THR A 1 97  ? -7.413  -0.460  -10.930 1.00 2.54  ? 192 THR A HG1  1  
ATOM   1524  H  HG21 . THR A 1 97  ? -5.903  -3.841  -10.850 1.00 2.09  ? 192 THR A HG21 1  
ATOM   1525  H  HG22 . THR A 1 97  ? -7.589  -3.661  -11.390 1.00 2.17  ? 192 THR A HG22 1  
ATOM   1526  H  HG23 . THR A 1 97  ? -6.320  -2.615  -12.059 1.00 2.14  ? 192 THR A HG23 1  
ATOM   1527  N  N    . GLY A 1 98  ? -9.646  -3.243  -9.274  1.00 1.43  ? 193 GLY A N    1  
ATOM   1528  C  CA   . GLY A 1 98  ? -10.905 -4.001  -9.230  1.00 1.73  ? 193 GLY A CA   1  
ATOM   1529  C  C    . GLY A 1 98  ? -12.099 -3.272  -9.842  1.00 1.69  ? 193 GLY A C    1  
ATOM   1530  O  O    . GLY A 1 98  ? -11.985 -2.656  -10.898 1.00 1.96  ? 193 GLY A O    1  
ATOM   1531  H  H    . GLY A 1 98  ? -9.632  -2.332  -9.722  1.00 1.50  ? 193 GLY A H    1  
ATOM   1532  H  HA2  . GLY A 1 98  ? -10.770 -4.943  -9.760  1.00 1.90  ? 193 GLY A HA2  1  
ATOM   1533  H  HA3  . GLY A 1 98  ? -11.122 -4.253  -8.192  1.00 2.07  ? 193 GLY A HA3  1  
ATOM   1534  N  N    . SER A 1 99  ? -13.268 -3.374  -9.206  1.00 2.11  ? 194 SER A N    1  
ATOM   1535  C  CA   . SER A 1 99  ? -14.517 -2.751  -9.665  1.00 2.21  ? 194 SER A CA   1  
ATOM   1536  C  C    . SER A 1 99  ? -15.509 -2.509  -8.502  1.00 2.03  ? 194 SER A C    1  
ATOM   1537  O  O    . SER A 1 99  ? -15.206 -2.786  -7.331  1.00 1.99  ? 194 SER A O    1  
ATOM   1538  C  CB   . SER A 1 99  ? -15.135 -3.588  -10.804 1.00 2.33  ? 194 SER A CB   1  
ATOM   1539  O  OG   . SER A 1 99  ? -16.173 -2.873  -11.454 1.00 3.55  ? 194 SER A OG   1  
ATOM   1540  H  H    . SER A 1 99  ? -13.324 -3.902  -8.349  1.00 2.71  ? 194 SER A H    1  
ATOM   1541  H  HA   . SER A 1 99  ? -14.281 -1.773  -10.086 1.00 2.61  ? 194 SER A HA   1  
ATOM   1542  H  HB2  . SER A 1 99  ? -14.364 -3.819  -11.540 1.00 2.66  ? 194 SER A HB2  1  
ATOM   1543  H  HB3  . SER A 1 99  ? -15.526 -4.524  -10.404 1.00 2.32  ? 194 SER A HB3  1  
ATOM   1544  H  HG   . SER A 1 99  ? -16.440 -3.361  -12.268 1.00 3.56  ? 194 SER A HG   1  
ATOM   1545  N  N    . THR A 1 100 ? -16.691 -1.966  -8.834  1.00 2.09  ? 195 THR A N    1  
ATOM   1546  C  CA   . THR A 1 100 ? -17.732 -1.473  -7.916  1.00 2.18  ? 195 THR A CA   1  
ATOM   1547  C  C    . THR A 1 100 ? -18.065 -2.464  -6.807  1.00 2.01  ? 195 THR A C    1  
ATOM   1548  O  O    . THR A 1 100 ? -17.807 -2.176  -5.641  1.00 1.98  ? 195 THR A O    1  
ATOM   1549  C  CB   . THR A 1 100 ? -18.960 -0.968  -8.698  1.00 2.43  ? 195 THR A CB   1  
ATOM   1550  O  OG1  . THR A 1 100 ? -19.934 -0.577  -7.765  1.00 3.66  ? 195 THR A OG1  1  
ATOM   1551  C  CG2  . THR A 1 100 ? -19.600 -1.972  -9.663  1.00 2.89  ? 195 THR A CG2  1  
ATOM   1552  H  H    . THR A 1 100 ? -16.858 -1.857  -9.830  1.00 2.16  ? 195 THR A H    1  
ATOM   1553  H  HA   . THR A 1 100 ? -17.335 -0.599  -7.402  1.00 2.35  ? 195 THR A HA   1  
ATOM   1554  H  HB   . THR A 1 100 ? -18.658 -0.092  -9.276  1.00 2.32  ? 195 THR A HB   1  
ATOM   1555  H  HG1  . THR A 1 100 ? -20.698 -0.202  -8.244  1.00 3.98  ? 195 THR A HG1  1  
ATOM   1556  H  HG21 . THR A 1 100 ? -18.857 -2.374  -10.350 1.00 2.88  ? 195 THR A HG21 1  
ATOM   1557  H  HG22 . THR A 1 100 ? -20.076 -2.784  -9.118  1.00 3.95  ? 195 THR A HG22 1  
ATOM   1558  H  HG23 . THR A 1 100 ? -20.362 -1.463  -10.254 1.00 3.39  ? 195 THR A HG23 1  
ATOM   1559  N  N    . LYS A 1 101 ? -18.553 -3.667  -7.122  1.00 1.99  ? 196 LYS A N    1  
ATOM   1560  C  CA   . LYS A 1 101 ? -18.961 -4.620  -6.081  1.00 2.05  ? 196 LYS A CA   1  
ATOM   1561  C  C    . LYS A 1 101 ? -17.795 -5.229  -5.275  1.00 1.80  ? 196 LYS A C    1  
ATOM   1562  O  O    . LYS A 1 101 ? -18.058 -5.828  -4.231  1.00 1.95  ? 196 LYS A O    1  
ATOM   1563  C  CB   . LYS A 1 101 ? -19.929 -5.677  -6.648  1.00 2.33  ? 196 LYS A CB   1  
ATOM   1564  C  CG   . LYS A 1 101 ? -21.318 -5.068  -6.916  1.00 2.71  ? 196 LYS A CG   1  
ATOM   1565  C  CD   . LYS A 1 101 ? -22.394 -6.149  -7.092  1.00 3.04  ? 196 LYS A CD   1  
ATOM   1566  C  CE   . LYS A 1 101 ? -23.771 -5.497  -7.285  1.00 3.71  ? 196 LYS A CE   1  
ATOM   1567  N  NZ   . LYS A 1 101 ? -24.859 -6.503  -7.277  1.00 4.09  ? 196 LYS A NZ   1  
ATOM   1568  H  H    . LYS A 1 101 ? -18.735 -3.875  -8.092  1.00 2.06  ? 196 LYS A H    1  
ATOM   1569  H  HA   . LYS A 1 101 ? -19.517 -4.051  -5.333  1.00 2.25  ? 196 LYS A HA   1  
ATOM   1570  H  HB2  . LYS A 1 101 ? -19.523 -6.114  -7.562  1.00 2.40  ? 196 LYS A HB2  1  
ATOM   1571  H  HB3  . LYS A 1 101 ? -20.042 -6.471  -5.907  1.00 3.09  ? 196 LYS A HB3  1  
ATOM   1572  H  HG2  . LYS A 1 101 ? -21.604 -4.441  -6.070  1.00 3.56  ? 196 LYS A HG2  1  
ATOM   1573  H  HG3  . LYS A 1 101 ? -21.277 -4.445  -7.811  1.00 2.87  ? 196 LYS A HG3  1  
ATOM   1574  H  HD2  . LYS A 1 101 ? -22.152 -6.769  -7.957  1.00 2.86  ? 196 LYS A HD2  1  
ATOM   1575  H  HD3  . LYS A 1 101 ? -22.417 -6.774  -6.196  1.00 3.73  ? 196 LYS A HD3  1  
ATOM   1576  H  HE2  . LYS A 1 101 ? -23.937 -4.778  -6.476  1.00 4.54  ? 196 LYS A HE2  1  
ATOM   1577  H  HE3  . LYS A 1 101 ? -23.776 -4.945  -8.229  1.00 3.93  ? 196 LYS A HE3  1  
ATOM   1578  H  HZ1  . LYS A 1 101 ? -24.718 -7.211  -7.981  1.00 3.99  ? 196 LYS A HZ1  1  
ATOM   1579  H  HZ2  . LYS A 1 101 ? -24.929 -6.951  -6.365  1.00 4.62  ? 196 LYS A HZ2  1  
ATOM   1580  H  HZ3  . LYS A 1 101 ? -25.759 -6.066  -7.463  1.00 4.64  ? 196 LYS A HZ3  1  
ATOM   1581  N  N    . GLN A 1 102 ? -16.530 -5.063  -5.684  1.00 1.67  ? 197 GLN A N    1  
ATOM   1582  C  CA   . GLN A 1 102 ? -15.400 -5.180  -4.757  1.00 1.71  ? 197 GLN A CA   1  
ATOM   1583  C  C    . GLN A 1 102 ? -15.362 -3.951  -3.839  1.00 1.77  ? 197 GLN A C    1  
ATOM   1584  O  O    . GLN A 1 102 ? -15.635 -4.084  -2.646  1.00 1.88  ? 197 GLN A O    1  
ATOM   1585  C  CB   . GLN A 1 102 ? -14.049 -5.395  -5.475  1.00 1.96  ? 197 GLN A CB   1  
ATOM   1586  C  CG   . GLN A 1 102 ? -13.924 -6.725  -6.245  1.00 1.80  ? 197 GLN A CG   1  
ATOM   1587  C  CD   . GLN A 1 102 ? -14.606 -6.743  -7.615  1.00 2.37  ? 197 GLN A CD   1  
ATOM   1588  O  OE1  . GLN A 1 102 ? -15.123 -5.753  -8.110  1.00 3.38  ? 197 GLN A OE1  1  
ATOM   1589  N  NE2  . GLN A 1 102 ? -14.629 -7.870  -8.292  1.00 2.86  ? 197 GLN A NE2  1  
ATOM   1590  H  H    . GLN A 1 102 ? -16.362 -4.610  -6.577  1.00 1.73  ? 197 GLN A H    1  
ATOM   1591  H  HA   . GLN A 1 102 ? -15.561 -6.037  -4.099  1.00 1.75  ? 197 GLN A HA   1  
ATOM   1592  H  HB2  . GLN A 1 102 ? -13.827 -4.565  -6.143  1.00 2.42  ? 197 GLN A HB2  1  
ATOM   1593  H  HB3  . GLN A 1 102 ? -13.274 -5.398  -4.706  1.00 2.42  ? 197 GLN A HB3  1  
ATOM   1594  H  HG2  . GLN A 1 102 ? -12.864 -6.925  -6.406  1.00 2.46  ? 197 GLN A HG2  1  
ATOM   1595  H  HG3  . GLN A 1 102 ? -14.321 -7.536  -5.634  1.00 2.16  ? 197 GLN A HG3  1  
ATOM   1596  H  HE21 . GLN A 1 102 ? -14.197 -8.702  -7.928  1.00 2.80  ? 197 GLN A HE21 1  
ATOM   1597  H  HE22 . GLN A 1 102 ? -15.061 -7.846  -9.200  1.00 3.85  ? 197 GLN A HE22 1  
ATOM   1598  N  N    . VAL A 1 103 ? -15.052 -2.764  -4.380  1.00 1.81  ? 198 VAL A N    1  
ATOM   1599  C  CA   . VAL A 1 103 ? -14.666 -1.592  -3.563  1.00 1.96  ? 198 VAL A CA   1  
ATOM   1600  C  C    . VAL A 1 103 ? -15.797 -1.094  -2.648  1.00 1.97  ? 198 VAL A C    1  
ATOM   1601  O  O    . VAL A 1 103 ? -15.535 -0.651  -1.529  1.00 2.08  ? 198 VAL A O    1  
ATOM   1602  C  CB   . VAL A 1 103 ? -14.083 -0.428  -4.411  1.00 2.11  ? 198 VAL A CB   1  
ATOM   1603  C  CG1  . VAL A 1 103 ? -12.854 -0.903  -5.206  1.00 2.16  ? 198 VAL A CG1  1  
ATOM   1604  C  CG2  . VAL A 1 103 ? -15.105 0.210   -5.367  1.00 2.83  ? 198 VAL A CG2  1  
ATOM   1605  H  H    . VAL A 1 103 ? -14.984 -2.693  -5.399  1.00 1.80  ? 198 VAL A H    1  
ATOM   1606  H  HA   . VAL A 1 103 ? -13.861 -1.932  -2.909  1.00 2.05  ? 198 VAL A HA   1  
ATOM   1607  H  HB   . VAL A 1 103 ? -13.744 0.352   -3.728  1.00 2.96  ? 198 VAL A HB   1  
ATOM   1608  H  HG11 . VAL A 1 103 ? -12.122 -1.344  -4.527  1.00 3.22  ? 198 VAL A HG11 1  
ATOM   1609  H  HG12 . VAL A 1 103 ? -12.392 -0.054  -5.711  1.00 2.50  ? 198 VAL A HG12 1  
ATOM   1610  H  HG13 . VAL A 1 103 ? -13.138 -1.644  -5.953  1.00 2.60  ? 198 VAL A HG13 1  
ATOM   1611  H  HG21 . VAL A 1 103 ? -14.627 1.005   -5.941  1.00 3.12  ? 198 VAL A HG21 1  
ATOM   1612  H  HG22 . VAL A 1 103 ? -15.493 -0.536  -6.056  1.00 2.98  ? 198 VAL A HG22 1  
ATOM   1613  H  HG23 . VAL A 1 103 ? -15.930 0.645   -4.805  1.00 4.02  ? 198 VAL A HG23 1  
ATOM   1614  N  N    . ALA A 1 104 ? -17.058 -1.227  -3.075  1.00 1.92  ? 199 ALA A N    1  
ATOM   1615  C  CA   . ALA A 1 104 ? -18.235 -0.872  -2.287  1.00 2.02  ? 199 ALA A CA   1  
ATOM   1616  C  C    . ALA A 1 104 ? -18.465 -1.831  -1.108  1.00 2.03  ? 199 ALA A C    1  
ATOM   1617  O  O    . ALA A 1 104 ? -18.727 -1.368  -0.003  1.00 2.16  ? 199 ALA A O    1  
ATOM   1618  C  CB   . ALA A 1 104 ? -19.451 -0.826  -3.223  1.00 2.05  ? 199 ALA A CB   1  
ATOM   1619  H  H    . ALA A 1 104 ? -17.210 -1.575  -4.019  1.00 1.86  ? 199 ALA A H    1  
ATOM   1620  H  HA   . ALA A 1 104 ? -18.091 0.126   -1.868  1.00 2.16  ? 199 ALA A HA   1  
ATOM   1621  H  HB1  . ALA A 1 104 ? -19.646 -1.812  -3.648  1.00 1.96  ? 199 ALA A HB1  1  
ATOM   1622  H  HB2  . ALA A 1 104 ? -20.332 -0.499  -2.668  1.00 3.00  ? 199 ALA A HB2  1  
ATOM   1623  H  HB3  . ALA A 1 104 ? -19.270 -0.122  -4.037  1.00 2.28  ? 199 ALA A HB3  1  
ATOM   1624  N  N    . GLN A 1 105 ? -18.345 -3.149  -1.307  1.00 1.95  ? 200 GLN A N    1  
ATOM   1625  C  CA   . GLN A 1 105 ? -18.525 -4.130  -0.225  1.00 2.02  ? 200 GLN A CA   1  
ATOM   1626  C  C    . GLN A 1 105 ? -17.346 -4.130  0.760   1.00 1.98  ? 200 GLN A C    1  
ATOM   1627  O  O    . GLN A 1 105 ? -17.554 -4.289  1.967   1.00 2.11  ? 200 GLN A O    1  
ATOM   1628  C  CB   . GLN A 1 105 ? -18.798 -5.531  -0.794  1.00 2.13  ? 200 GLN A CB   1  
ATOM   1629  C  CG   . GLN A 1 105 ? -20.141 -5.583  -1.546  1.00 2.98  ? 200 GLN A CG   1  
ATOM   1630  C  CD   . GLN A 1 105 ? -20.534 -7.006  -1.935  1.00 3.06  ? 200 GLN A CD   1  
ATOM   1631  O  OE1  . GLN A 1 105 ? -21.456 -7.595  -1.387  1.00 4.02  ? 200 GLN A OE1  1  
ATOM   1632  N  NE2  . GLN A 1 105 ? -19.862 -7.619  -2.883  1.00 3.13  ? 200 GLN A NE2  1  
ATOM   1633  H  H    . GLN A 1 105 ? -18.007 -3.468  -2.205  1.00 1.87  ? 200 GLN A H    1  
ATOM   1634  H  HA   . GLN A 1 105 ? -19.397 -3.841  0.363   1.00 2.14  ? 200 GLN A HA   1  
ATOM   1635  H  HB2  . GLN A 1 105 ? -17.983 -5.829  -1.455  1.00 2.10  ? 200 GLN A HB2  1  
ATOM   1636  H  HB3  . GLN A 1 105 ? -18.846 -6.235  0.039   1.00 2.47  ? 200 GLN A HB3  1  
ATOM   1637  H  HG2  . GLN A 1 105 ? -20.926 -5.172  -0.910  1.00 3.93  ? 200 GLN A HG2  1  
ATOM   1638  H  HG3  . GLN A 1 105 ? -20.079 -4.976  -2.450  1.00 3.56  ? 200 GLN A HG3  1  
ATOM   1639  H  HE21 . GLN A 1 105 ? -19.093 -7.143  -3.341  1.00 3.34  ? 200 GLN A HE21 1  
ATOM   1640  H  HE22 . GLN A 1 105 ? -20.117 -8.570  -3.086  1.00 3.70  ? 200 GLN A HE22 1  
ATOM   1641  N  N    . ALA A 1 106 ? -16.125 -3.879  0.272   1.00 1.87  ? 201 ALA A N    1  
ATOM   1642  C  CA   . ALA A 1 106 ? -14.979 -3.572  1.122   1.00 1.89  ? 201 ALA A CA   1  
ATOM   1643  C  C    . ALA A 1 106 ? -15.228 -2.320  1.981   1.00 1.97  ? 201 ALA A C    1  
ATOM   1644  O  O    . ALA A 1 106 ? -14.989 -2.358  3.180   1.00 2.06  ? 201 ALA A O    1  
ATOM   1645  C  CB   . ALA A 1 106 ? -13.741 -3.425  0.227   1.00 1.87  ? 201 ALA A CB   1  
ATOM   1646  H  H    . ALA A 1 106 ? -15.978 -3.874  -0.735  1.00 1.81  ? 201 ALA A H    1  
ATOM   1647  H  HA   . ALA A 1 106 ? -14.817 -4.405  1.809   1.00 1.93  ? 201 ALA A HA   1  
ATOM   1648  H  HB1  . ALA A 1 106 ? -13.575 -4.346  -0.333  1.00 2.25  ? 201 ALA A HB1  1  
ATOM   1649  H  HB2  . ALA A 1 106 ? -13.874 -2.601  -0.475  1.00 2.21  ? 201 ALA A HB2  1  
ATOM   1650  H  HB3  . ALA A 1 106 ? -12.865 -3.224  0.846   1.00 2.49  ? 201 ALA A HB3  1  
ATOM   1651  N  N    . SER A 1 107 ? -15.762 -1.239  1.407   1.00 2.03  ? 202 SER A N    1  
ATOM   1652  C  CA   . SER A 1 107 ? -16.071 0.002   2.146   1.00 2.17  ? 202 SER A CA   1  
ATOM   1653  C  C    . SER A 1 107 ? -17.256 -0.137  3.119   1.00 2.27  ? 202 SER A C    1  
ATOM   1654  O  O    . SER A 1 107 ? -17.285 0.508   4.164   1.00 2.43  ? 202 SER A O    1  
ATOM   1655  C  CB   . SER A 1 107 ? -16.391 1.137   1.165   1.00 2.28  ? 202 SER A CB   1  
ATOM   1656  O  OG   . SER A 1 107 ? -15.311 1.413   0.289   1.00 2.27  ? 202 SER A OG   1  
ATOM   1657  H  H    . SER A 1 107 ? -15.957 -1.280  0.417   1.00 2.00  ? 202 SER A H    1  
ATOM   1658  H  HA   . SER A 1 107 ? -15.201 0.295   2.740   1.00 2.22  ? 202 SER A HA   1  
ATOM   1659  H  HB2  . SER A 1 107 ? -17.273 0.873   0.579   1.00 2.70  ? 202 SER A HB2  1  
ATOM   1660  H  HB3  . SER A 1 107 ? -16.616 2.040   1.736   1.00 3.00  ? 202 SER A HB3  1  
ATOM   1661  H  HG   . SER A 1 107 ? -15.178 0.652   -0.302  1.00 2.72  ? 202 SER A HG   1  
ATOM   1662  N  N    . HIS A 1 108 ? -18.243 -0.979  2.799   1.00 2.25  ? 203 HIS A N    1  
ATOM   1663  C  CA   . HIS A 1 108 ? -19.351 -1.330  3.692   1.00 2.41  ? 203 HIS A CA   1  
ATOM   1664  C  C    . HIS A 1 108 ? -18.871 -2.162  4.899   1.00 2.41  ? 203 HIS A C    1  
ATOM   1665  O  O    . HIS A 1 108 ? -19.339 -1.958  6.019   1.00 2.53  ? 203 HIS A O    1  
ATOM   1666  C  CB   . HIS A 1 108 ? -20.397 -2.079  2.849   1.00 2.45  ? 203 HIS A CB   1  
ATOM   1667  C  CG   . HIS A 1 108 ? -21.509 -2.724  3.633   1.00 3.18  ? 203 HIS A CG   1  
ATOM   1668  N  ND1  . HIS A 1 108 ? -21.390 -3.930  4.320   1.00 4.03  ? 203 HIS A ND1  1  
ATOM   1669  C  CD2  . HIS A 1 108 ? -22.798 -2.287  3.727   1.00 3.72  ? 203 HIS A CD2  1  
ATOM   1670  C  CE1  . HIS A 1 108 ? -22.615 -4.211  4.784   1.00 4.86  ? 203 HIS A CE1  1  
ATOM   1671  N  NE2  . HIS A 1 108 ? -23.481 -3.236  4.458   1.00 4.66  ? 203 HIS A NE2  1  
ATOM   1672  H  H    . HIS A 1 108 ? -18.227 -1.407  1.879   1.00 2.17  ? 203 HIS A H    1  
ATOM   1673  H  HA   . HIS A 1 108 ? -19.804 -0.417  4.081   1.00 2.55  ? 203 HIS A HA   1  
ATOM   1674  H  HB2  . HIS A 1 108 ? -20.826 -1.391  2.120   1.00 3.02  ? 203 HIS A HB2  1  
ATOM   1675  H  HB3  . HIS A 1 108 ? -19.896 -2.875  2.303   1.00 2.08  ? 203 HIS A HB3  1  
ATOM   1676  H  HD2  . HIS A 1 108 ? -23.214 -1.400  3.273   1.00 3.82  ? 203 HIS A HD2  1  
ATOM   1677  H  HE1  . HIS A 1 108 ? -22.864 -5.098  5.349   1.00 5.81  ? 203 HIS A HE1  1  
ATOM   1678  H  HE2  . HIS A 1 108 ? -24.471 -3.223  4.699   1.00 5.34  ? 203 HIS A HE2  1  
ATOM   1679  N  N    . SER A 1 109 ? -17.925 -3.075  4.686   1.00 2.34  ? 204 SER A N    1  
ATOM   1680  C  CA   . SER A 1 109 ? -17.304 -3.865  5.756   1.00 2.43  ? 204 SER A CA   1  
ATOM   1681  C  C    . SER A 1 109 ? -16.355 -3.006  6.608   1.00 2.43  ? 204 SER A C    1  
ATOM   1682  O  O    . SER A 1 109 ? -16.420 -3.026  7.838   1.00 2.66  ? 204 SER A O    1  
ATOM   1683  C  CB   . SER A 1 109 ? -16.560 -5.062  5.147   1.00 2.43  ? 204 SER A CB   1  
ATOM   1684  O  OG   . SER A 1 109 ? -17.432 -5.853  4.349   1.00 2.82  ? 204 SER A OG   1  
ATOM   1685  H  H    . SER A 1 109 ? -17.569 -3.171  3.744   1.00 2.27  ? 204 SER A H    1  
ATOM   1686  H  HA   . SER A 1 109 ? -18.077 -4.253  6.422   1.00 2.55  ? 204 SER A HA   1  
ATOM   1687  H  HB2  . SER A 1 109 ? -15.734 -4.706  4.530   1.00 2.26  ? 204 SER A HB2  1  
ATOM   1688  H  HB3  . SER A 1 109 ? -16.155 -5.675  5.953   1.00 3.17  ? 204 SER A HB3  1  
ATOM   1689  H  HG   . SER A 1 109 ? -17.569 -5.390  3.500   1.00 3.14  ? 204 SER A HG   1  
ATOM   1690  N  N    . TYR A 1 110 ? -15.509 -2.208  5.950   1.00 2.28  ? 205 TYR A N    1  
ATOM   1691  C  CA   . TYR A 1 110 ? -14.475 -1.364  6.544   1.00 2.27  ? 205 TYR A CA   1  
ATOM   1692  C  C    . TYR A 1 110 ? -14.705 0.113   6.159   1.00 2.13  ? 205 TYR A C    1  
ATOM   1693  O  O    . TYR A 1 110 ? -14.192 0.612   5.155   1.00 2.32  ? 205 TYR A O    1  
ATOM   1694  C  CB   . TYR A 1 110 ? -13.093 -1.872  6.088   1.00 2.50  ? 205 TYR A CB   1  
ATOM   1695  C  CG   . TYR A 1 110 ? -12.814 -3.345  6.352   1.00 3.11  ? 205 TYR A CG   1  
ATOM   1696  C  CD1  . TYR A 1 110 ? -12.416 -3.774  7.633   1.00 3.96  ? 205 TYR A CD1  1  
ATOM   1697  C  CD2  . TYR A 1 110 ? -12.930 -4.287  5.309   1.00 3.83  ? 205 TYR A CD2  1  
ATOM   1698  C  CE1  . TYR A 1 110 ? -12.127 -5.133  7.869   1.00 4.80  ? 205 TYR A CE1  1  
ATOM   1699  C  CE2  . TYR A 1 110 ? -12.649 -5.649  5.538   1.00 4.75  ? 205 TYR A CE2  1  
ATOM   1700  C  CZ   . TYR A 1 110 ? -12.238 -6.075  6.821   1.00 4.99  ? 205 TYR A CZ   1  
ATOM   1701  O  OH   . TYR A 1 110 ? -11.939 -7.384  7.051   1.00 6.02  ? 205 TYR A OH   1  
ATOM   1702  H  H    . TYR A 1 110 ? -15.520 -2.241  4.935   1.00 2.19  ? 205 TYR A H    1  
ATOM   1703  H  HA   . TYR A 1 110 ? -14.528 -1.450  7.627   1.00 2.44  ? 205 TYR A HA   1  
ATOM   1704  H  HB2  . TYR A 1 110 ? -12.983 -1.691  5.018   1.00 2.62  ? 205 TYR A HB2  1  
ATOM   1705  H  HB3  . TYR A 1 110 ? -12.327 -1.280  6.592   1.00 2.74  ? 205 TYR A HB3  1  
ATOM   1706  H  HD1  . TYR A 1 110 ? -12.327 -3.057  8.437   1.00 4.46  ? 205 TYR A HD1  1  
ATOM   1707  H  HD2  . TYR A 1 110 ? -13.233 -3.960  4.324   1.00 4.22  ? 205 TYR A HD2  1  
ATOM   1708  H  HE1  . TYR A 1 110 ? -11.819 -5.461  8.851   1.00 5.70  ? 205 TYR A HE1  1  
ATOM   1709  H  HE2  . TYR A 1 110 ? -12.740 -6.363  4.731   1.00 5.66  ? 205 TYR A HE2  1  
ATOM   1710  H  HH   . TYR A 1 110 ? -12.073 -7.937  6.272   1.00 6.48  ? 205 TYR A HH   1  
ATOM   1711  N  N    . ARG A 1 111 ? -15.505 0.827   6.963   1.00 2.44  ? 206 ARG A N    1  
ATOM   1712  C  CA   . ARG A 1 111 ? -15.891 2.222   6.691   1.00 2.43  ? 206 ARG A CA   1  
ATOM   1713  C  C    . ARG A 1 111 ? -14.675 3.161   6.761   1.00 2.48  ? 206 ARG A C    1  
ATOM   1714  O  O    . ARG A 1 111 ? -14.009 3.226   7.793   1.00 3.08  ? 206 ARG A O    1  
ATOM   1715  C  CB   . ARG A 1 111 ? -17.015 2.671   7.649   1.00 2.87  ? 206 ARG A CB   1  
ATOM   1716  C  CG   . ARG A 1 111 ? -18.433 2.376   7.122   1.00 3.10  ? 206 ARG A CG   1  
ATOM   1717  C  CD   . ARG A 1 111 ? -18.819 0.892   7.023   1.00 3.35  ? 206 ARG A CD   1  
ATOM   1718  N  NE   . ARG A 1 111 ? -19.075 0.271   8.334   1.00 4.33  ? 206 ARG A NE   1  
ATOM   1719  C  CZ   . ARG A 1 111 ? -20.215 0.261   9.015   1.00 5.09  ? 206 ARG A CZ   1  
ATOM   1720  N  NH1  . ARG A 1 111 ? -21.282 0.932   8.635   1.00 5.20  ? 206 ARG A NH1  1  
ATOM   1721  N  NH2  . ARG A 1 111 ? -20.275 -0.457  10.110  1.00 6.22  ? 206 ARG A NH2  1  
ATOM   1722  H  H    . ARG A 1 111 ? -15.888 0.369   7.776   1.00 2.98  ? 206 ARG A H    1  
ATOM   1723  H  HA   . ARG A 1 111 ? -16.279 2.272   5.673   1.00 2.39  ? 206 ARG A HA   1  
ATOM   1724  H  HB2  . ARG A 1 111 ? -16.879 2.219   8.633   1.00 3.39  ? 206 ARG A HB2  1  
ATOM   1725  H  HB3  . ARG A 1 111 ? -16.945 3.753   7.775   1.00 3.11  ? 206 ARG A HB3  1  
ATOM   1726  H  HG2  . ARG A 1 111 ? -19.154 2.881   7.765   1.00 3.64  ? 206 ARG A HG2  1  
ATOM   1727  H  HG3  . ARG A 1 111 ? -18.523 2.816   6.128   1.00 3.43  ? 206 ARG A HG3  1  
ATOM   1728  H  HD2  . ARG A 1 111 ? -19.713 0.805   6.404   1.00 3.74  ? 206 ARG A HD2  1  
ATOM   1729  H  HD3  . ARG A 1 111 ? -18.029 0.340   6.516   1.00 3.30  ? 206 ARG A HD3  1  
ATOM   1730  H  HE   . ARG A 1 111 ? -18.355 -0.344  8.705   1.00 4.85  ? 206 ARG A HE   1  
ATOM   1731  H  HH11 . ARG A 1 111 ? -21.266 1.468   7.789   1.00 4.84  ? 206 ARG A HH11 1  
ATOM   1732  H  HH12 . ARG A 1 111 ? -22.141 0.870   9.178   1.00 6.01  ? 206 ARG A HH12 1  
ATOM   1733  H  HH21 . ARG A 1 111 ? -19.461 -1.009  10.365  1.00 6.63  ? 206 ARG A HH21 1  
ATOM   1734  H  HH22 . ARG A 1 111 ? -21.127 -0.537  10.642  1.00 6.90  ? 206 ARG A HH22 1  
ATOM   1735  N  N    . VAL A 1 112 ? -14.436 3.911   5.683   1.00 2.34  ? 207 VAL A N    1  
ATOM   1736  C  CA   . VAL A 1 112 ? -13.284 4.809   5.461   1.00 2.45  ? 207 VAL A CA   1  
ATOM   1737  C  C    . VAL A 1 112 ? -13.695 5.978   4.546   1.00 2.25  ? 207 VAL A C    1  
ATOM   1738  O  O    . VAL A 1 112 ? -14.671 5.856   3.806   1.00 2.25  ? 207 VAL A O    1  
ATOM   1739  C  CB   . VAL A 1 112 ? -12.081 4.010   4.893   1.00 2.80  ? 207 VAL A CB   1  
ATOM   1740  C  CG1  . VAL A 1 112 ? -12.338 3.460   3.478   1.00 2.64  ? 207 VAL A CG1  1  
ATOM   1741  C  CG2  . VAL A 1 112 ? -10.778 4.826   4.908   1.00 3.58  ? 207 VAL A CG2  1  
ATOM   1742  H  H    . VAL A 1 112 ? -15.050 3.782   4.893   1.00 2.46  ? 207 VAL A H    1  
ATOM   1743  H  HA   . VAL A 1 112 ? -12.993 5.225   6.427   1.00 2.66  ? 207 VAL A HA   1  
ATOM   1744  H  HB   . VAL A 1 112 ? -11.923 3.155   5.552   1.00 3.75  ? 207 VAL A HB   1  
ATOM   1745  H  HG11 . VAL A 1 112 ? -12.447 4.278   2.765   1.00 2.66  ? 207 VAL A HG11 1  
ATOM   1746  H  HG12 . VAL A 1 112 ? -13.243 2.852   3.466   1.00 3.53  ? 207 VAL A HG12 1  
ATOM   1747  H  HG13 . VAL A 1 112 ? -11.498 2.837   3.169   1.00 3.15  ? 207 VAL A HG13 1  
ATOM   1748  H  HG21 . VAL A 1 112 ? -10.808 5.616   4.158   1.00 3.58  ? 207 VAL A HG21 1  
ATOM   1749  H  HG22 . VAL A 1 112 ? -10.634 5.269   5.893   1.00 4.70  ? 207 VAL A HG22 1  
ATOM   1750  H  HG23 . VAL A 1 112 ? -9.933  4.172   4.689   1.00 4.01  ? 207 VAL A HG23 1  
ATOM   1751  N  N    . TYR A 1 113 ? -12.990 7.115   4.616   1.00 2.32  ? 208 TYR A N    1  
ATOM   1752  C  CA   . TYR A 1 113 ? -13.356 8.358   3.923   1.00 2.33  ? 208 TYR A CA   1  
ATOM   1753  C  C    . TYR A 1 113 ? -12.749 8.490   2.512   1.00 2.20  ? 208 TYR A C    1  
ATOM   1754  O  O    . TYR A 1 113 ? -11.531 8.488   2.340   1.00 2.40  ? 208 TYR A O    1  
ATOM   1755  C  CB   . TYR A 1 113 ? -12.915 9.571   4.760   1.00 2.67  ? 208 TYR A CB   1  
ATOM   1756  C  CG   . TYR A 1 113 ? -13.689 9.824   6.041   1.00 3.39  ? 208 TYR A CG   1  
ATOM   1757  C  CD1  . TYR A 1 113 ? -13.286 9.212   7.243   1.00 4.63  ? 208 TYR A CD1  1  
ATOM   1758  C  CD2  . TYR A 1 113 ? -14.769 10.730  6.047   1.00 3.77  ? 208 TYR A CD2  1  
ATOM   1759  C  CE1  . TYR A 1 113 ? -13.935 9.527   8.451   1.00 5.65  ? 208 TYR A CE1  1  
ATOM   1760  C  CE2  . TYR A 1 113 ? -15.420 11.054  7.255   1.00 4.74  ? 208 TYR A CE2  1  
ATOM   1761  C  CZ   . TYR A 1 113 ? -14.989 10.471  8.467   1.00 5.50  ? 208 TYR A CZ   1  
ATOM   1762  O  OH   . TYR A 1 113 ? -15.567 10.840  9.646   1.00 6.63  ? 208 TYR A OH   1  
ATOM   1763  H  H    . TYR A 1 113 ? -12.154 7.138   5.181   1.00 2.51  ? 208 TYR A H    1  
ATOM   1764  H  HA   . TYR A 1 113 ? -14.442 8.402   3.827   1.00 2.41  ? 208 TYR A HA   1  
ATOM   1765  H  HB2  . TYR A 1 113 ? -11.855 9.469   5.003   1.00 3.06  ? 208 TYR A HB2  1  
ATOM   1766  H  HB3  . TYR A 1 113 ? -13.007 10.464  4.140   1.00 2.69  ? 208 TYR A HB3  1  
ATOM   1767  H  HD1  . TYR A 1 113 ? -12.459 8.517   7.243   1.00 5.19  ? 208 TYR A HD1  1  
ATOM   1768  H  HD2  . TYR A 1 113 ? -15.081 11.204  5.128   1.00 3.97  ? 208 TYR A HD2  1  
ATOM   1769  H  HE1  . TYR A 1 113 ? -13.615 9.054   9.365   1.00 6.85  ? 208 TYR A HE1  1  
ATOM   1770  H  HE2  . TYR A 1 113 ? -16.229 11.770  7.264   1.00 5.36  ? 208 TYR A HE2  1  
ATOM   1771  H  HH   . TYR A 1 113 ? -15.090 10.475  10.405  1.00 7.56  ? 208 TYR A HH   1  
ATOM   1772  N  N    . TYR A 1 114 ? -13.618 8.735   1.529   1.00 2.07  ? 209 TYR A N    1  
ATOM   1773  C  CA   . TYR A 1 114 ? -13.305 9.281   0.201   1.00 2.03  ? 209 TYR A CA   1  
ATOM   1774  C  C    . TYR A 1 114 ? -14.567 9.949   -0.379  1.00 2.07  ? 209 TYR A C    1  
ATOM   1775  O  O    . TYR A 1 114 ? -15.680 9.439   -0.201  1.00 2.23  ? 209 TYR A O    1  
ATOM   1776  C  CB   . TYR A 1 114 ? -12.720 8.205   -0.731  1.00 2.19  ? 209 TYR A CB   1  
ATOM   1777  C  CG   . TYR A 1 114 ? -13.576 6.964   -0.905  1.00 2.11  ? 209 TYR A CG   1  
ATOM   1778  C  CD1  . TYR A 1 114 ? -13.440 5.886   -0.008  1.00 3.20  ? 209 TYR A CD1  1  
ATOM   1779  C  CD2  . TYR A 1 114 ? -14.510 6.889   -1.956  1.00 2.05  ? 209 TYR A CD2  1  
ATOM   1780  C  CE1  . TYR A 1 114 ? -14.248 4.741   -0.145  1.00 3.43  ? 209 TYR A CE1  1  
ATOM   1781  C  CE2  . TYR A 1 114 ? -15.319 5.747   -2.100  1.00 2.31  ? 209 TYR A CE2  1  
ATOM   1782  C  CZ   . TYR A 1 114 ? -15.198 4.675   -1.189  1.00 2.67  ? 209 TYR A CZ   1  
ATOM   1783  O  OH   . TYR A 1 114 ? -16.006 3.586   -1.305  1.00 3.16  ? 209 TYR A OH   1  
ATOM   1784  H  H    . TYR A 1 114 ? -14.600 8.631   1.739   1.00 2.15  ? 209 TYR A H    1  
ATOM   1785  H  HA   . TYR A 1 114 ? -12.545 10.057  0.317   1.00 2.09  ? 209 TYR A HA   1  
ATOM   1786  H  HB2  . TYR A 1 114 ? -12.543 8.654   -1.710  1.00 2.34  ? 209 TYR A HB2  1  
ATOM   1787  H  HB3  . TYR A 1 114 ? -11.746 7.902   -0.344  1.00 2.69  ? 209 TYR A HB3  1  
ATOM   1788  H  HD1  . TYR A 1 114 ? -12.717 5.940   0.793   1.00 4.19  ? 209 TYR A HD1  1  
ATOM   1789  H  HD2  . TYR A 1 114 ? -14.609 7.708   -2.653  1.00 2.67  ? 209 TYR A HD2  1  
ATOM   1790  H  HE1  . TYR A 1 114 ? -14.144 3.921   0.550   1.00 4.53  ? 209 TYR A HE1  1  
ATOM   1791  H  HE2  . TYR A 1 114 ? -16.030 5.686   -2.909  1.00 2.98  ? 209 TYR A HE2  1  
ATOM   1792  H  HH   . TYR A 1 114 ? -15.741 2.889   -0.685  1.00 3.83  ? 209 TYR A HH   1  
ATOM   1793  N  N    . ASN A 1 115 ? -14.421 11.124  -1.001  1.00 2.19  ? 210 ASN A N    1  
ATOM   1794  C  CA   . ASN A 1 115 ? -15.562 12.003  -1.294  1.00 2.58  ? 210 ASN A CA   1  
ATOM   1795  C  C    . ASN A 1 115 ? -16.018 11.943  -2.764  1.00 2.57  ? 210 ASN A C    1  
ATOM   1796  O  O    . ASN A 1 115 ? -15.408 12.567  -3.635  1.00 2.47  ? 210 ASN A O    1  
ATOM   1797  C  CB   . ASN A 1 115 ? -15.221 13.441  -0.874  1.00 3.02  ? 210 ASN A CB   1  
ATOM   1798  C  CG   . ASN A 1 115 ? -16.436 14.356  -0.986  1.00 3.56  ? 210 ASN A CG   1  
ATOM   1799  O  OD1  . ASN A 1 115 ? -17.495 14.071  -0.449  1.00 4.17  ? 210 ASN A OD1  1  
ATOM   1800  N  ND2  . ASN A 1 115 ? -16.335 15.456  -1.706  1.00 4.24  ? 210 ASN A ND2  1  
ATOM   1801  H  H    . ASN A 1 115 ? -13.482 11.479  -1.147  1.00 2.24  ? 210 ASN A H    1  
ATOM   1802  H  HA   . ASN A 1 115 ? -16.409 11.696  -0.677  1.00 3.26  ? 210 ASN A HA   1  
ATOM   1803  H  HB2  . ASN A 1 115 ? -14.881 13.452  0.162   1.00 3.60  ? 210 ASN A HB2  1  
ATOM   1804  H  HB3  . ASN A 1 115 ? -14.417 13.823  -1.501  1.00 3.20  ? 210 ASN A HB3  1  
ATOM   1805  H  HD21 . ASN A 1 115 ? -15.475 15.677  -2.189  1.00 4.61  ? 210 ASN A HD21 1  
ATOM   1806  H  HD22 . ASN A 1 115 ? -17.142 16.051  -1.764  1.00 4.86  ? 210 ASN A HD22 1  
ATOM   1807  N  N    . ALA A 1 116 ? -17.132 11.256  -3.033  1.00 3.46  ? 211 ALA A N    1  
ATOM   1808  C  CA   . ALA A 1 116 ? -17.817 11.303  -4.326  1.00 4.14  ? 211 ALA A CA   1  
ATOM   1809  C  C    . ALA A 1 116 ? -18.656 12.591  -4.430  1.00 4.41  ? 211 ALA A C    1  
ATOM   1810  O  O    . ALA A 1 116 ? -19.518 12.844  -3.585  1.00 4.77  ? 211 ALA A O    1  
ATOM   1811  C  CB   . ALA A 1 116 ? -18.677 10.043  -4.475  1.00 5.21  ? 211 ALA A CB   1  
ATOM   1812  H  H    . ALA A 1 116 ? -17.592 10.768  -2.278  1.00 3.98  ? 211 ALA A H    1  
ATOM   1813  H  HA   . ALA A 1 116 ? -17.075 11.305  -5.128  1.00 4.05  ? 211 ALA A HA   1  
ATOM   1814  H  HB1  . ALA A 1 116 ? -19.411 9.986   -3.668  1.00 6.15  ? 211 ALA A HB1  1  
ATOM   1815  H  HB2  . ALA A 1 116 ? -19.205 10.070  -5.428  1.00 5.30  ? 211 ALA A HB2  1  
ATOM   1816  H  HB3  . ALA A 1 116 ? -18.045 9.154   -4.447  1.00 5.58  ? 211 ALA A HB3  1  
ATOM   1817  N  N    . GLY A 1 117 ? -18.387 13.412  -5.452  1.00 4.45  ? 212 GLY A N    1  
ATOM   1818  C  CA   . GLY A 1 117 ? -18.959 14.757  -5.599  1.00 4.82  ? 212 GLY A CA   1  
ATOM   1819  C  C    . GLY A 1 117 ? -19.980 14.881  -6.741  1.00 4.99  ? 212 GLY A C    1  
ATOM   1820  O  O    . GLY A 1 117 ? -19.860 14.171  -7.746  1.00 5.19  ? 212 GLY A O    1  
ATOM   1821  H  H    . GLY A 1 117 ? -17.713 13.113  -6.141  1.00 4.34  ? 212 GLY A H    1  
ATOM   1822  H  HA2  . GLY A 1 117 ? -19.418 15.056  -4.658  1.00 5.33  ? 212 GLY A HA2  1  
ATOM   1823  H  HA3  . GLY A 1 117 ? -18.160 15.461  -5.826  1.00 4.84  ? 212 GLY A HA3  1  
ATOM   1824  N  N    . PRO A 1 118 ? -20.957 15.803  -6.629  1.00 5.34  ? 213 PRO A N    1  
ATOM   1825  C  CA   . PRO A 1 118 ? -21.821 16.201  -7.732  1.00 5.66  ? 213 PRO A CA   1  
ATOM   1826  C  C    . PRO A 1 118 ? -21.105 17.197  -8.659  1.00 5.00  ? 213 PRO A C    1  
ATOM   1827  O  O    . PRO A 1 118 ? -20.048 17.733  -8.332  1.00 4.85  ? 213 PRO A O    1  
ATOM   1828  C  CB   . PRO A 1 118 ? -23.043 16.833  -7.057  1.00 6.63  ? 213 PRO A CB   1  
ATOM   1829  C  CG   . PRO A 1 118 ? -22.430 17.515  -5.835  1.00 6.55  ? 213 PRO A CG   1  
ATOM   1830  C  CD   . PRO A 1 118 ? -21.303 16.561  -5.431  1.00 5.90  ? 213 PRO A CD   1  
ATOM   1831  H  HA   . PRO A 1 118 ? -22.135 15.333  -8.311  1.00 6.06  ? 213 PRO A HA   1  
ATOM   1832  H  HB2  . PRO A 1 118 ? -23.561 17.543  -7.702  1.00 6.87  ? 213 PRO A HB2  1  
ATOM   1833  H  HB3  . PRO A 1 118 ? -23.727 16.047  -6.733  1.00 7.36  ? 213 PRO A HB3  1  
ATOM   1834  H  HG2  . PRO A 1 118 ? -22.008 18.479  -6.124  1.00 6.26  ? 213 PRO A HG2  1  
ATOM   1835  H  HG3  . PRO A 1 118 ? -23.159 17.641  -5.034  1.00 7.46  ? 213 PRO A HG3  1  
ATOM   1836  H  HD2  . PRO A 1 118 ? -20.448 17.129  -5.063  1.00 5.63  ? 213 PRO A HD2  1  
ATOM   1837  H  HD3  . PRO A 1 118 ? -21.663 15.876  -4.662  1.00 6.45  ? 213 PRO A HD3  1  
ATOM   1838  N  N    . LYS A 1 119 ? -21.723 17.475  -9.809  1.00 5.15  ? 214 LYS A N    1  
ATOM   1839  C  CA   . LYS A 1 119 ? -21.330 18.509  -10.778 1.00 4.86  ? 214 LYS A CA   1  
ATOM   1840  C  C    . LYS A 1 119 ? -22.451 18.746  -11.814 1.00 5.32  ? 214 LYS A C    1  
ATOM   1841  O  O    . LYS A 1 119 ? -23.324 17.888  -11.962 1.00 5.95  ? 214 LYS A O    1  
ATOM   1842  C  CB   . LYS A 1 119 ? -19.983 18.199  -11.465 1.00 4.75  ? 214 LYS A CB   1  
ATOM   1843  C  CG   . LYS A 1 119 ? -19.534 16.738  -11.640 1.00 5.46  ? 214 LYS A CG   1  
ATOM   1844  C  CD   . LYS A 1 119 ? -18.335 16.662  -12.608 1.00 5.97  ? 214 LYS A CD   1  
ATOM   1845  C  CE   . LYS A 1 119 ? -17.017 17.099  -11.942 1.00 6.35  ? 214 LYS A CE   1  
ATOM   1846  N  NZ   . LYS A 1 119 ? -15.879 17.183  -12.896 1.00 7.37  ? 214 LYS A NZ   1  
ATOM   1847  H  H    . LYS A 1 119 ? -22.592 16.992  -10.002 1.00 5.81  ? 214 LYS A H    1  
ATOM   1848  H  HA   . LYS A 1 119 ? -21.212 19.449  -10.236 1.00 4.90  ? 214 LYS A HA   1  
ATOM   1849  H  HB2  . LYS A 1 119 ? -20.108 18.574  -12.465 1.00 5.06  ? 214 LYS A HB2  1  
ATOM   1850  H  HB3  . LYS A 1 119 ? -19.184 18.785  -11.001 1.00 4.73  ? 214 LYS A HB3  1  
ATOM   1851  H  HG2  . LYS A 1 119 ? -19.261 16.302  -10.678 1.00 5.78  ? 214 LYS A HG2  1  
ATOM   1852  H  HG3  . LYS A 1 119 ? -20.360 16.167  -12.063 1.00 6.13  ? 214 LYS A HG3  1  
ATOM   1853  H  HD2  . LYS A 1 119 ? -18.227 15.633  -12.951 1.00 6.70  ? 214 LYS A HD2  1  
ATOM   1854  H  HD3  . LYS A 1 119 ? -18.549 17.285  -13.480 1.00 6.12  ? 214 LYS A HD3  1  
ATOM   1855  H  HE2  . LYS A 1 119 ? -17.147 18.068  -11.453 1.00 6.16  ? 214 LYS A HE2  1  
ATOM   1856  H  HE3  . LYS A 1 119 ? -16.769 16.370  -11.165 1.00 6.72  ? 214 LYS A HE3  1  
ATOM   1857  H  HZ1  . LYS A 1 119 ? -15.002 17.176  -12.384 1.00 7.90  ? 214 LYS A HZ1  1  
ATOM   1858  H  HZ2  . LYS A 1 119 ? -15.847 16.381  -13.520 1.00 7.90  ? 214 LYS A HZ2  1  
ATOM   1859  H  HZ3  . LYS A 1 119 ? -15.887 18.033  -13.455 1.00 7.55  ? 214 LYS A HZ3  1  
ATOM   1860  N  N    . ASP A 1 120 ? -22.441 19.872  -12.548 1.00 5.40  ? 215 ASP A N    1  
ATOM   1861  C  CA   . ASP A 1 120 ? -23.632 20.305  -13.304 1.00 6.21  ? 215 ASP A CA   1  
ATOM   1862  C  C    . ASP A 1 120 ? -23.415 21.119  -14.601 1.00 6.29  ? 215 ASP A C    1  
ATOM   1863  O  O    . ASP A 1 120 ? -24.312 21.095  -15.445 1.00 6.95  ? 215 ASP A O    1  
ATOM   1864  C  CB   . ASP A 1 120 ? -24.538 21.094  -12.331 1.00 6.97  ? 215 ASP A CB   1  
ATOM   1865  C  CG   . ASP A 1 120 ? -26.045 20.943  -12.569 1.00 8.30  ? 215 ASP A CG   1  
ATOM   1866  O  OD1  . ASP A 1 120 ? -26.476 20.110  -13.407 1.00 9.05  ? 215 ASP A OD1  1  
ATOM   1867  O  OD2  . ASP A 1 120 ? -26.816 21.573  -11.810 1.00 9.03  ? 215 ASP A OD2  1  
ATOM   1868  H  H    . ASP A 1 120 ? -21.686 20.539  -12.419 1.00 5.20  ? 215 ASP A H    1  
ATOM   1869  H  HA   . ASP A 1 120 ? -24.163 19.406  -13.616 1.00 6.68  ? 215 ASP A HA   1  
ATOM   1870  H  HB2  . ASP A 1 120 ? -24.354 20.754  -11.309 1.00 7.02  ? 215 ASP A HB2  1  
ATOM   1871  H  HB3  . ASP A 1 120 ? -24.269 22.151  -12.369 1.00 6.96  ? 215 ASP A HB3  1  
ATOM   1872  N  N    . GLU A 1 121 ? -22.295 21.836  -14.805 1.00 6.06  ? 216 GLU A N    1  
ATOM   1873  C  CA   . GLU A 1 121 ? -22.216 22.825  -15.905 1.00 6.55  ? 216 GLU A CA   1  
ATOM   1874  C  C    . GLU A 1 121 ? -20.847 23.317  -16.397 1.00 6.51  ? 216 GLU A C    1  
ATOM   1875  O  O    . GLU A 1 121 ? -20.746 23.666  -17.575 1.00 7.22  ? 216 GLU A O    1  
ATOM   1876  C  CB   . GLU A 1 121 ? -23.063 24.065  -15.547 1.00 7.15  ? 216 GLU A CB   1  
ATOM   1877  C  CG   . GLU A 1 121 ? -22.597 24.766  -14.253 1.00 7.80  ? 216 GLU A CG   1  
ATOM   1878  C  CD   . GLU A 1 121 ? -22.407 26.277  -14.444 1.00 8.58  ? 216 GLU A CD   1  
ATOM   1879  O  OE1  . GLU A 1 121 ? -23.291 26.957  -15.015 1.00 9.33  ? 216 GLU A OE1  1  
ATOM   1880  O  OE2  . GLU A 1 121 ? -21.348 26.816  -14.051 1.00 8.80  ? 216 GLU A OE2  1  
ATOM   1881  H  H    . GLU A 1 121 ? -21.567 21.830  -14.098 1.00 5.90  ? 216 GLU A H    1  
ATOM   1882  H  HA   . GLU A 1 121 ? -22.642 22.362  -16.786 1.00 7.00  ? 216 GLU A HA   1  
ATOM   1883  H  HB2  . GLU A 1 121 ? -23.017 24.759  -16.387 1.00 7.25  ? 216 GLU A HB2  1  
ATOM   1884  H  HB3  . GLU A 1 121 ? -24.108 23.776  -15.431 1.00 7.64  ? 216 GLU A HB3  1  
ATOM   1885  H  HG2  . GLU A 1 121 ? -23.337 24.585  -13.473 1.00 8.32  ? 216 GLU A HG2  1  
ATOM   1886  H  HG3  . GLU A 1 121 ? -21.665 24.316  -13.895 1.00 7.77  ? 216 GLU A HG3  1  
ATOM   1887  N  N    . ASP A 1 122 ? -19.833 23.423  -15.542 1.00 6.11  ? 217 ASP A N    1  
ATOM   1888  C  CA   . ASP A 1 122 ? -18.570 24.115  -15.844 1.00 6.43  ? 217 ASP A CA   1  
ATOM   1889  C  C    . ASP A 1 122 ? -17.465 23.128  -16.296 1.00 6.06  ? 217 ASP A C    1  
ATOM   1890  O  O    . ASP A 1 122 ? -17.512 22.590  -17.403 1.00 6.50  ? 217 ASP A O    1  
ATOM   1891  C  CB   . ASP A 1 122 ? -18.238 24.963  -14.602 1.00 7.10  ? 217 ASP A CB   1  
ATOM   1892  C  CG   . ASP A 1 122 ? -17.164 25.999  -14.895 1.00 7.72  ? 217 ASP A CG   1  
ATOM   1893  O  OD1  . ASP A 1 122 ? -17.554 27.120  -15.308 1.00 8.55  ? 217 ASP A OD1  1  
ATOM   1894  O  OD2  . ASP A 1 122 ? -15.980 25.645  -14.707 1.00 7.78  ? 217 ASP A OD2  1  
ATOM   1895  H  H    . ASP A 1 122 ? -19.985 23.137  -14.583 1.00 5.91  ? 217 ASP A H    1  
ATOM   1896  H  HA   . ASP A 1 122 ? -18.716 24.802  -16.677 1.00 7.07  ? 217 ASP A HA   1  
ATOM   1897  H  HB2  . ASP A 1 122 ? -19.136 25.490  -14.283 1.00 7.60  ? 217 ASP A HB2  1  
ATOM   1898  H  HB3  . ASP A 1 122 ? -17.935 24.325  -13.769 1.00 7.23  ? 217 ASP A HB3  1  
ATOM   1899  N  N    . GLN A 1 123 ? -16.564 22.772  -15.379 1.00 5.78  ? 218 GLN A N    1  
ATOM   1900  C  CA   . GLN A 1 123 ? -16.765 21.578  -14.559 1.00 5.63  ? 218 GLN A CA   1  
ATOM   1901  C  C    . GLN A 1 123 ? -15.533 20.772  -14.116 1.00 5.32  ? 218 GLN A C    1  
ATOM   1902  O  O    . GLN A 1 123 ? -15.435 19.573  -14.385 1.00 5.72  ? 218 GLN A O    1  
ATOM   1903  C  CB   . GLN A 1 123 ? -17.921 20.664  -15.022 1.00 6.26  ? 218 GLN A CB   1  
ATOM   1904  C  CG   . GLN A 1 123 ? -18.563 20.017  -13.809 1.00 6.61  ? 218 GLN A CG   1  
ATOM   1905  C  CD   . GLN A 1 123 ? -19.096 21.024  -12.783 1.00 7.12  ? 218 GLN A CD   1  
ATOM   1906  O  OE1  . GLN A 1 123 ? -20.165 21.591  -12.960 1.00 8.07  ? 218 GLN A OE1  1  
ATOM   1907  N  NE2  . GLN A 1 123 ? -18.379 21.280  -11.707 1.00 7.06  ? 218 GLN A NE2  1  
ATOM   1908  H  H    . GLN A 1 123 ? -16.393 23.545  -14.757 1.00 6.04  ? 218 GLN A H    1  
ATOM   1909  H  HA   . GLN A 1 123 ? -17.069 22.040  -13.627 1.00 5.85  ? 218 GLN A HA   1  
ATOM   1910  H  HB2  . GLN A 1 123 ? -18.720 21.185  -15.533 1.00 6.67  ? 218 GLN A HB2  1  
ATOM   1911  H  HB3  . GLN A 1 123 ? -17.551 19.901  -15.709 1.00 6.62  ? 218 GLN A HB3  1  
ATOM   1912  H  HG2  . GLN A 1 123 ? -19.386 19.419  -14.195 1.00 7.09  ? 218 GLN A HG2  1  
ATOM   1913  H  HG3  . GLN A 1 123 ? -17.835 19.374  -13.323 1.00 6.68  ? 218 GLN A HG3  1  
ATOM   1914  H  HE21 . GLN A 1 123 ? -17.489 20.828  -11.530 1.00 6.73  ? 218 GLN A HE21 1  
ATOM   1915  H  HE22 . GLN A 1 123 ? -18.673 22.039  -11.086 1.00 7.73  ? 218 GLN A HE22 1  
ATOM   1916  N  N    . ASP A 1 124 ? -14.669 21.376  -13.299 1.00 5.20  ? 219 ASP A N    1  
ATOM   1917  C  CA   . ASP A 1 124 ? -13.665 20.633  -12.525 1.00 5.14  ? 219 ASP A CA   1  
ATOM   1918  C  C    . ASP A 1 124 ? -14.289 19.749  -11.407 1.00 4.58  ? 219 ASP A C    1  
ATOM   1919  O  O    . ASP A 1 124 ? -15.507 19.761  -11.193 1.00 5.23  ? 219 ASP A O    1  
ATOM   1920  C  CB   . ASP A 1 124 ? -12.617 21.628  -11.978 1.00 6.28  ? 219 ASP A CB   1  
ATOM   1921  C  CG   . ASP A 1 124 ? -11.187 21.069  -11.917 1.00 6.85  ? 219 ASP A CG   1  
ATOM   1922  O  OD1  . ASP A 1 124 ? -11.011 19.834  -12.023 1.00 7.00  ? 219 ASP A OD1  1  
ATOM   1923  O  OD2  . ASP A 1 124 ? -10.245 21.897  -11.831 1.00 7.76  ? 219 ASP A OD2  1  
ATOM   1924  H  H    . ASP A 1 124 ? -14.748 22.367  -13.122 1.00 5.55  ? 219 ASP A H    1  
ATOM   1925  H  HA   . ASP A 1 124 ? -13.160 19.964  -13.223 1.00 5.28  ? 219 ASP A HA   1  
ATOM   1926  H  HB2  . ASP A 1 124 ? -12.590 22.506  -12.627 1.00 6.63  ? 219 ASP A HB2  1  
ATOM   1927  H  HB3  . ASP A 1 124 ? -12.921 21.964  -10.986 1.00 7.02  ? 219 ASP A HB3  1  
ATOM   1928  N  N    . TYR A 1 125 ? -13.427 18.961  -10.743 1.00 4.19  ? 220 TYR A N    1  
ATOM   1929  C  CA   . TYR A 1 125 ? -13.598 18.044  -9.590  1.00 4.03  ? 220 TYR A CA   1  
ATOM   1930  C  C    . TYR A 1 125 ? -13.507 16.558  -10.003 1.00 3.41  ? 220 TYR A C    1  
ATOM   1931  O  O    . TYR A 1 125 ? -13.996 16.181  -11.067 1.00 3.99  ? 220 TYR A O    1  
ATOM   1932  C  CB   . TYR A 1 125 ? -14.864 18.296  -8.745  1.00 4.83  ? 220 TYR A CB   1  
ATOM   1933  C  CG   . TYR A 1 125 ? -14.862 17.504  -7.447  1.00 5.23  ? 220 TYR A CG   1  
ATOM   1934  C  CD1  . TYR A 1 125 ? -14.118 17.970  -6.346  1.00 6.00  ? 220 TYR A CD1  1  
ATOM   1935  C  CD2  . TYR A 1 125 ? -15.497 16.247  -7.376  1.00 5.67  ? 220 TYR A CD2  1  
ATOM   1936  C  CE1  . TYR A 1 125 ? -13.995 17.184  -5.184  1.00 6.96  ? 220 TYR A CE1  1  
ATOM   1937  C  CE2  . TYR A 1 125 ? -15.364 15.450  -6.223  1.00 6.59  ? 220 TYR A CE2  1  
ATOM   1938  C  CZ   . TYR A 1 125 ? -14.611 15.915  -5.124  1.00 7.16  ? 220 TYR A CZ   1  
ATOM   1939  O  OH   . TYR A 1 125 ? -14.462 15.141  -4.017  1.00 8.42  ? 220 TYR A OH   1  
ATOM   1940  H  H    . TYR A 1 125 ? -12.466 19.058  -11.062 1.00 4.61  ? 220 TYR A H    1  
ATOM   1941  H  HA   . TYR A 1 125 ? -12.749 18.239  -8.933  1.00 4.53  ? 220 TYR A HA   1  
ATOM   1942  H  HB2  . TYR A 1 125 ? -14.926 19.358  -8.502  1.00 5.54  ? 220 TYR A HB2  1  
ATOM   1943  H  HB3  . TYR A 1 125 ? -15.749 18.025  -9.320  1.00 5.22  ? 220 TYR A HB3  1  
ATOM   1944  H  HD1  . TYR A 1 125 ? -13.621 18.927  -6.399  1.00 6.31  ? 220 TYR A HD1  1  
ATOM   1945  H  HD2  . TYR A 1 125 ? -16.051 15.870  -8.224  1.00 5.81  ? 220 TYR A HD2  1  
ATOM   1946  H  HE1  . TYR A 1 125 ? -13.409 17.536  -4.347  1.00 7.92  ? 220 TYR A HE1  1  
ATOM   1947  H  HE2  . TYR A 1 125 ? -15.812 14.468  -6.191  1.00 7.28  ? 220 TYR A HE2  1  
ATOM   1948  H  HH   . TYR A 1 125 ? -14.867 14.267  -4.115  1.00 8.66  ? 220 TYR A HH   1  
ATOM   1949  N  N    . ILE A 1 126 ? -12.928 15.694  -9.151  1.00 3.12  ? 221 ILE A N    1  
ATOM   1950  C  CA   . ILE A 1 126 ? -12.819 14.233  -9.384  1.00 3.18  ? 221 ILE A CA   1  
ATOM   1951  C  C    . ILE A 1 126 ? -13.340 13.443  -8.165  1.00 3.06  ? 221 ILE A C    1  
ATOM   1952  O  O    . ILE A 1 126 ? -14.511 13.068  -8.152  1.00 3.60  ? 221 ILE A O    1  
ATOM   1953  C  CB   . ILE A 1 126 ? -11.384 13.835  -9.841  1.00 3.80  ? 221 ILE A CB   1  
ATOM   1954  C  CG1  . ILE A 1 126 ? -10.945 14.641  -11.092 1.00 4.01  ? 221 ILE A CG1  1  
ATOM   1955  C  CG2  . ILE A 1 126 ? -11.325 12.321  -10.139 1.00 5.36  ? 221 ILE A CG2  1  
ATOM   1956  C  CD1  . ILE A 1 126 ? -9.529  14.325  -11.595 1.00 4.79  ? 221 ILE A CD1  1  
ATOM   1957  H  H    . ILE A 1 126 ? -12.628 16.066  -8.261  1.00 3.53  ? 221 ILE A H    1  
ATOM   1958  H  HA   . ILE A 1 126 ? -13.490 13.954  -10.200 1.00 3.60  ? 221 ILE A HA   1  
ATOM   1959  H  HB   . ILE A 1 126 ? -10.678 14.058  -9.040  1.00 3.98  ? 221 ILE A HB   1  
ATOM   1960  H  HG12 . ILE A 1 126 ? -11.652 14.466  -11.904 1.00 4.78  ? 221 ILE A HG12 1  
ATOM   1961  H  HG13 . ILE A 1 126 ? -10.960 15.704  -10.856 1.00 3.88  ? 221 ILE A HG13 1  
ATOM   1962  H  HG21 . ILE A 1 126 ? -11.652 11.735  -9.282  1.00 6.28  ? 221 ILE A HG21 1  
ATOM   1963  H  HG22 . ILE A 1 126 ? -10.302 12.017  -10.358 1.00 5.66  ? 221 ILE A HG22 1  
ATOM   1964  H  HG23 . ILE A 1 126 ? -11.961 12.082  -10.992 1.00 6.00  ? 221 ILE A HG23 1  
ATOM   1965  H  HD11 . ILE A 1 126 ? -9.261  15.038  -12.375 1.00 5.25  ? 221 ILE A HD11 1  
ATOM   1966  H  HD12 . ILE A 1 126 ? -8.815  14.411  -10.776 1.00 4.93  ? 221 ILE A HD12 1  
ATOM   1967  H  HD13 . ILE A 1 126 ? -9.487  13.322  -12.019 1.00 5.50  ? 221 ILE A HD13 1  
ATOM   1968  N  N    . VAL A 1 127 ? -12.482 13.194  -7.169  1.00 2.66  ? 222 VAL A N    1  
ATOM   1969  C  CA   . VAL A 1 127 ? -12.719 12.529  -5.873  1.00 2.55  ? 222 VAL A CA   1  
ATOM   1970  C  C    . VAL A 1 127 ? -11.618 13.035  -4.927  1.00 2.36  ? 222 VAL A C    1  
ATOM   1971  O  O    . VAL A 1 127 ? -10.485 13.212  -5.378  1.00 2.41  ? 222 VAL A O    1  
ATOM   1972  C  CB   . VAL A 1 127 ? -12.641 10.975  -5.964  1.00 2.71  ? 222 VAL A CB   1  
ATOM   1973  C  CG1  . VAL A 1 127 ? -12.728 10.283  -4.588  1.00 3.27  ? 222 VAL A CG1  1  
ATOM   1974  C  CG2  . VAL A 1 127 ? -13.749 10.369  -6.844  1.00 3.29  ? 222 VAL A CG2  1  
ATOM   1975  H  H    . VAL A 1 127 ? -11.538 13.534  -7.275  1.00 2.68  ? 222 VAL A H    1  
ATOM   1976  H  HA   . VAL A 1 127 ? -13.695 12.828  -5.494  1.00 2.78  ? 222 VAL A HA   1  
ATOM   1977  H  HB   . VAL A 1 127 ? -11.682 10.707  -6.411  1.00 2.65  ? 222 VAL A HB   1  
ATOM   1978  H  HG11 . VAL A 1 127 ? -12.730 9.199   -4.711  1.00 3.91  ? 222 VAL A HG11 1  
ATOM   1979  H  HG12 . VAL A 1 127 ? -11.863 10.538  -3.978  1.00 3.39  ? 222 VAL A HG12 1  
ATOM   1980  H  HG13 . VAL A 1 127 ? -13.639 10.581  -4.070  1.00 3.78  ? 222 VAL A HG13 1  
ATOM   1981  H  HG21 . VAL A 1 127 ? -13.709 9.279   -6.807  1.00 4.08  ? 222 VAL A HG21 1  
ATOM   1982  H  HG22 . VAL A 1 127 ? -14.728 10.700  -6.496  1.00 4.01  ? 222 VAL A HG22 1  
ATOM   1983  H  HG23 . VAL A 1 127 ? -13.604 10.662  -7.883  1.00 3.07  ? 222 VAL A HG23 1  
ATOM   1984  N  N    . ASP A 1 128 ? -11.924 13.260  -3.645  1.00 2.50  ? 223 ASP A N    1  
ATOM   1985  C  CA   . ASP A 1 128 ? -10.919 13.573  -2.615  1.00 2.57  ? 223 ASP A CA   1  
ATOM   1986  C  C    . ASP A 1 128 ? -10.358 12.280  -1.995  1.00 2.32  ? 223 ASP A C    1  
ATOM   1987  O  O    . ASP A 1 128 ? -11.110 11.493  -1.410  1.00 2.69  ? 223 ASP A O    1  
ATOM   1988  C  CB   . ASP A 1 128 ? -11.521 14.490  -1.535  1.00 3.26  ? 223 ASP A CB   1  
ATOM   1989  C  CG   . ASP A 1 128 ? -10.458 15.106  -0.613  1.00 4.11  ? 223 ASP A CG   1  
ATOM   1990  O  OD1  . ASP A 1 128 ? -9.865  14.383  0.217   1.00 5.13  ? 223 ASP A OD1  1  
ATOM   1991  O  OD2  . ASP A 1 128 ? -10.239 16.337  -0.690  1.00 4.40  ? 223 ASP A OD2  1  
ATOM   1992  H  H    . ASP A 1 128 ? -12.877 13.122  -3.346  1.00 2.78  ? 223 ASP A H    1  
ATOM   1993  H  HA   . ASP A 1 128 ? -10.097 14.122  -3.079  1.00 2.59  ? 223 ASP A HA   1  
ATOM   1994  H  HB2  . ASP A 1 128 ? -12.072 15.296  -2.024  1.00 3.30  ? 223 ASP A HB2  1  
ATOM   1995  H  HB3  . ASP A 1 128 ? -12.226 13.922  -0.928  1.00 3.65  ? 223 ASP A HB3  1  
ATOM   1996  N  N    . HIS A 1 129 ? -9.040  12.075  -2.121  1.00 1.97  ? 224 HIS A N    1  
ATOM   1997  C  CA   . HIS A 1 129 ? -8.299  11.000  -1.454  1.00 1.96  ? 224 HIS A CA   1  
ATOM   1998  C  C    . HIS A 1 129 ? -7.480  11.594  -0.287  1.00 2.12  ? 224 HIS A C    1  
ATOM   1999  O  O    . HIS A 1 129 ? -6.384  12.118  -0.468  1.00 2.57  ? 224 HIS A O    1  
ATOM   2000  C  CB   . HIS A 1 129 ? -7.526  10.147  -2.498  1.00 1.91  ? 224 HIS A CB   1  
ATOM   2001  C  CG   . HIS A 1 129 ? -6.027  10.330  -2.674  1.00 1.87  ? 224 HIS A CG   1  
ATOM   2002  N  ND1  . HIS A 1 129 ? -5.091  9.447   -2.217  1.00 2.45  ? 224 HIS A ND1  1  
ATOM   2003  C  CD2  . HIS A 1 129 ? -5.396  11.290  -3.424  1.00 1.85  ? 224 HIS A CD2  1  
ATOM   2004  C  CE1  . HIS A 1 129 ? -3.891  9.820   -2.662  1.00 2.41  ? 224 HIS A CE1  1  
ATOM   2005  N  NE2  . HIS A 1 129 ? -4.036  10.939  -3.392  1.00 1.93  ? 224 HIS A NE2  1  
ATOM   2006  H  H    . HIS A 1 129 ? -8.501  12.777  -2.608  1.00 1.99  ? 224 HIS A H    1  
ATOM   2007  H  HA   . HIS A 1 129 ? -9.029  10.323  -1.008  1.00 2.23  ? 224 HIS A HA   1  
ATOM   2008  H  HB2  . HIS A 1 129 ? -7.682  9.102   -2.227  1.00 2.20  ? 224 HIS A HB2  1  
ATOM   2009  H  HB3  . HIS A 1 129 ? -7.999  10.269  -3.474  1.00 2.03  ? 224 HIS A HB3  1  
ATOM   2010  H  HD1  . HIS A 1 129 ? -5.269  8.560   -1.754  1.00 3.08  ? 224 HIS A HD1  1  
ATOM   2011  H  HD2  . HIS A 1 129 ? -5.871  12.094  -3.969  1.00 2.25  ? 224 HIS A HD2  1  
ATOM   2012  H  HE1  . HIS A 1 129 ? -2.966  9.274   -2.528  1.00 2.97  ? 224 HIS A HE1  1  
ATOM   2013  N  N    . SER A 1 130 ? -8.023  11.554  0.935   1.00 2.21  ? 225 SER A N    1  
ATOM   2014  C  CA   . SER A 1 130 ? -7.543  12.378  2.065   1.00 2.64  ? 225 SER A CA   1  
ATOM   2015  C  C    . SER A 1 130 ? -6.259  11.854  2.769   1.00 2.92  ? 225 SER A C    1  
ATOM   2016  O  O    . SER A 1 130 ? -6.143  11.935  3.992   1.00 4.04  ? 225 SER A O    1  
ATOM   2017  C  CB   . SER A 1 130 ? -8.701  12.627  3.052   1.00 3.39  ? 225 SER A CB   1  
ATOM   2018  O  OG   . SER A 1 130 ? -8.302  13.510  4.090   1.00 4.35  ? 225 SER A OG   1  
ATOM   2019  H  H    . SER A 1 130 ? -8.953  11.162  1.010   1.00 2.31  ? 225 SER A H    1  
ATOM   2020  H  HA   . SER A 1 130 ? -7.280  13.358  1.660   1.00 2.85  ? 225 SER A HA   1  
ATOM   2021  H  HB2  . SER A 1 130 ? -9.546  13.063  2.516   1.00 3.77  ? 225 SER A HB2  1  
ATOM   2022  H  HB3  . SER A 1 130 ? -9.014  11.677  3.488   1.00 3.68  ? 225 SER A HB3  1  
ATOM   2023  H  HG   . SER A 1 130 ? -7.511  13.091  4.484   1.00 4.75  ? 225 SER A HG   1  
ATOM   2024  N  N    . ILE A 1 131 ? -5.293  11.328  2.001   1.00 2.76  ? 226 ILE A N    1  
ATOM   2025  C  CA   . ILE A 1 131 ? -3.889  11.030  2.379   1.00 3.44  ? 226 ILE A CA   1  
ATOM   2026  C  C    . ILE A 1 131 ? -3.677  10.278  3.716   1.00 2.77  ? 226 ILE A C    1  
ATOM   2027  O  O    . ILE A 1 131 ? -2.715  10.510  4.449   1.00 3.65  ? 226 ILE A O    1  
ATOM   2028  C  CB   . ILE A 1 131 ? -3.006  12.286  2.126   1.00 4.95  ? 226 ILE A CB   1  
ATOM   2029  C  CG1  . ILE A 1 131 ? -1.492  12.007  1.980   1.00 6.26  ? 226 ILE A CG1  1  
ATOM   2030  C  CG2  . ILE A 1 131 ? -3.212  13.408  3.159   1.00 5.81  ? 226 ILE A CG2  1  
ATOM   2031  C  CD1  . ILE A 1 131 ? -1.156  10.967  0.905   1.00 7.10  ? 226 ILE A CD1  1  
ATOM   2032  H  H    . ILE A 1 131 ? -5.485  11.362  1.004   1.00 2.90  ? 226 ILE A H    1  
ATOM   2033  H  HA   . ILE A 1 131 ? -3.563  10.291  1.649   1.00 3.98  ? 226 ILE A HA   1  
ATOM   2034  H  HB   . ILE A 1 131 ? -3.319  12.698  1.164   1.00 5.50  ? 226 ILE A HB   1  
ATOM   2035  H  HG12 . ILE A 1 131 ? -1.000  12.939  1.700   1.00 7.29  ? 226 ILE A HG12 1  
ATOM   2036  H  HG13 . ILE A 1 131 ? -1.065  11.685  2.929   1.00 6.43  ? 226 ILE A HG13 1  
ATOM   2037  H  HG21 . ILE A 1 131 ? -4.258  13.708  3.195   1.00 6.18  ? 226 ILE A HG21 1  
ATOM   2038  H  HG22 . ILE A 1 131 ? -2.619  14.281  2.881   1.00 6.85  ? 226 ILE A HG22 1  
ATOM   2039  H  HG23 . ILE A 1 131 ? -2.898  13.074  4.144   1.00 5.92  ? 226 ILE A HG23 1  
ATOM   2040  H  HD11 . ILE A 1 131 ? -1.383  9.963   1.264   1.00 6.97  ? 226 ILE A HD11 1  
ATOM   2041  H  HD12 . ILE A 1 131 ? -1.722  11.169  -0.005  1.00 7.45  ? 226 ILE A HD12 1  
ATOM   2042  H  HD13 . ILE A 1 131 ? -0.093  11.026  0.675   1.00 8.23  ? 226 ILE A HD13 1  
ATOM   2043  N  N    . ALA A 1 132 ? -4.569  9.333   4.022   1.00 1.92  ? 227 ALA A N    1  
ATOM   2044  C  CA   . ALA A 1 132 ? -4.428  8.363   5.111   1.00 2.00  ? 227 ALA A CA   1  
ATOM   2045  C  C    . ALA A 1 132 ? -3.971  6.989   4.586   1.00 1.58  ? 227 ALA A C    1  
ATOM   2046  O  O    . ALA A 1 132 ? -4.361  6.568   3.495   1.00 1.81  ? 227 ALA A O    1  
ATOM   2047  C  CB   . ALA A 1 132 ? -5.766  8.266   5.856   1.00 2.77  ? 227 ALA A CB   1  
ATOM   2048  H  H    . ALA A 1 132 ? -5.347  9.211   3.395   1.00 2.10  ? 227 ALA A H    1  
ATOM   2049  H  HA   . ALA A 1 132 ? -3.673  8.718   5.815   1.00 2.69  ? 227 ALA A HA   1  
ATOM   2050  H  HB1  . ALA A 1 132 ? -6.540  7.896   5.183   1.00 3.19  ? 227 ALA A HB1  1  
ATOM   2051  H  HB2  . ALA A 1 132 ? -6.053  9.250   6.230   1.00 3.45  ? 227 ALA A HB2  1  
ATOM   2052  H  HB3  . ALA A 1 132 ? -5.669  7.580   6.699   1.00 3.46  ? 227 ALA A HB3  1  
ATOM   2053  N  N    . ILE A 1 133 ? -3.170  6.280   5.383   1.00 1.32  ? 228 ILE A N    1  
ATOM   2054  C  CA   . ILE A 1 133 ? -2.625  4.939   5.097   1.00 1.12  ? 228 ILE A CA   1  
ATOM   2055  C  C    . ILE A 1 133 ? -2.751  4.044   6.337   1.00 1.08  ? 228 ILE A C    1  
ATOM   2056  O  O    . ILE A 1 133 ? -2.897  4.552   7.448   1.00 1.31  ? 228 ILE A O    1  
ATOM   2057  C  CB   . ILE A 1 133 ? -1.155  5.023   4.614   1.00 1.23  ? 228 ILE A CB   1  
ATOM   2058  C  CG1  . ILE A 1 133 ? -0.221  5.628   5.687   1.00 2.00  ? 228 ILE A CG1  1  
ATOM   2059  C  CG2  . ILE A 1 133 ? -1.064  5.806   3.294   1.00 2.04  ? 228 ILE A CG2  1  
ATOM   2060  C  CD1  . ILE A 1 133 ? 1.270   5.577   5.336   1.00 2.22  ? 228 ILE A CD1  1  
ATOM   2061  H  H    . ILE A 1 133 ? -2.950  6.665   6.298   1.00 1.57  ? 228 ILE A H    1  
ATOM   2062  H  HA   . ILE A 1 133 ? -3.218  4.467   4.311   1.00 1.24  ? 228 ILE A HA   1  
ATOM   2063  H  HB   . ILE A 1 133 ? -0.819  4.004   4.412   1.00 2.16  ? 228 ILE A HB   1  
ATOM   2064  H  HG12 . ILE A 1 133 ? -0.493  6.669   5.863   1.00 2.51  ? 228 ILE A HG12 1  
ATOM   2065  H  HG13 . ILE A 1 133 ? -0.351  5.075   6.615   1.00 2.97  ? 228 ILE A HG13 1  
ATOM   2066  H  HG21 . ILE A 1 133 ? -1.267  6.865   3.461   1.00 2.64  ? 228 ILE A HG21 1  
ATOM   2067  H  HG22 . ILE A 1 133 ? -0.067  5.702   2.873   1.00 2.73  ? 228 ILE A HG22 1  
ATOM   2068  H  HG23 . ILE A 1 133 ? -1.786  5.416   2.579   1.00 3.04  ? 228 ILE A HG23 1  
ATOM   2069  H  HD11 . ILE A 1 133 ? 1.855   5.946   6.177   1.00 3.14  ? 228 ILE A HD11 1  
ATOM   2070  H  HD12 . ILE A 1 133 ? 1.564   4.550   5.130   1.00 2.67  ? 228 ILE A HD12 1  
ATOM   2071  H  HD13 . ILE A 1 133 ? 1.480   6.205   4.472   1.00 2.19  ? 228 ILE A HD13 1  
ATOM   2072  N  N    . TYR A 1 134 ? -2.681  2.721   6.170   1.00 1.00  ? 229 TYR A N    1  
ATOM   2073  C  CA   . TYR A 1 134 ? -3.003  1.763   7.244   1.00 1.05  ? 229 TYR A CA   1  
ATOM   2074  C  C    . TYR A 1 134 ? -2.036  0.570   7.304   1.00 1.03  ? 229 TYR A C    1  
ATOM   2075  O  O    . TYR A 1 134 ? -1.585  0.074   6.267   1.00 0.97  ? 229 TYR A O    1  
ATOM   2076  C  CB   . TYR A 1 134 ? -4.453  1.280   7.066   1.00 1.09  ? 229 TYR A CB   1  
ATOM   2077  C  CG   . TYR A 1 134 ? -5.469  2.407   6.978   1.00 1.54  ? 229 TYR A CG   1  
ATOM   2078  C  CD1  . TYR A 1 134 ? -5.996  2.976   8.154   1.00 2.06  ? 229 TYR A CD1  1  
ATOM   2079  C  CD2  . TYR A 1 134 ? -5.830  2.934   5.721   1.00 2.94  ? 229 TYR A CD2  1  
ATOM   2080  C  CE1  . TYR A 1 134 ? -6.871  4.077   8.075   1.00 3.06  ? 229 TYR A CE1  1  
ATOM   2081  C  CE2  . TYR A 1 134 ? -6.697  4.040   5.636   1.00 4.05  ? 229 TYR A CE2  1  
ATOM   2082  C  CZ   . TYR A 1 134 ? -7.215  4.617   6.817   1.00 3.91  ? 229 TYR A CZ   1  
ATOM   2083  O  OH   . TYR A 1 134 ? -8.038  5.698   6.744   1.00 5.16  ? 229 TYR A OH   1  
ATOM   2084  H  H    . TYR A 1 134 ? -2.552  2.359   5.231   1.00 1.05  ? 229 TYR A H    1  
ATOM   2085  H  HA   . TYR A 1 134 ? -2.941  2.270   8.207   1.00 1.15  ? 229 TYR A HA   1  
ATOM   2086  H  HB2  . TYR A 1 134 ? -4.518  0.677   6.160   1.00 1.73  ? 229 TYR A HB2  1  
ATOM   2087  H  HB3  . TYR A 1 134 ? -4.715  0.637   7.908   1.00 1.49  ? 229 TYR A HB3  1  
ATOM   2088  H  HD1  . TYR A 1 134 ? -5.708  2.585   9.119   1.00 2.54  ? 229 TYR A HD1  1  
ATOM   2089  H  HD2  . TYR A 1 134 ? -5.408  2.511   4.820   1.00 3.55  ? 229 TYR A HD2  1  
ATOM   2090  H  HE1  . TYR A 1 134 ? -7.266  4.524   8.974   1.00 3.73  ? 229 TYR A HE1  1  
ATOM   2091  H  HE2  . TYR A 1 134 ? -6.949  4.456   4.672   1.00 5.28  ? 229 TYR A HE2  1  
ATOM   2092  H  HH   . TYR A 1 134 ? -8.206  5.960   5.837   1.00 5.96  ? 229 TYR A HH   1  
ATOM   2093  N  N    . LEU A 1 135 ? -1.731  0.089   8.518   1.00 1.11  ? 230 LEU A N    1  
ATOM   2094  C  CA   . LEU A 1 135 ? -0.862  -1.072  8.741   1.00 1.06  ? 230 LEU A CA   1  
ATOM   2095  C  C    . LEU A 1 135 ? -1.697  -2.356  8.911   1.00 1.13  ? 230 LEU A C    1  
ATOM   2096  O  O    . LEU A 1 135 ? -2.415  -2.518  9.901   1.00 1.30  ? 230 LEU A O    1  
ATOM   2097  C  CB   . LEU A 1 135 ? 0.086   -0.805  9.943   1.00 1.11  ? 230 LEU A CB   1  
ATOM   2098  C  CG   . LEU A 1 135 ? 1.574   -1.163  9.720   1.00 1.48  ? 230 LEU A CG   1  
ATOM   2099  C  CD1  . LEU A 1 135 ? 1.737   -2.635  9.309   1.00 2.62  ? 230 LEU A CD1  1  
ATOM   2100  C  CD2  . LEU A 1 135 ? 2.225   -0.254  8.664   1.00 2.18  ? 230 LEU A CD2  1  
ATOM   2101  H  H    . LEU A 1 135 ? -2.125  0.550   9.333   1.00 1.20  ? 230 LEU A H    1  
ATOM   2102  H  HA   . LEU A 1 135 ? -0.251  -1.205  7.849   1.00 1.04  ? 230 LEU A HA   1  
ATOM   2103  H  HB2  . LEU A 1 135 ? 0.038   0.249   10.221  1.00 1.36  ? 230 LEU A HB2  1  
ATOM   2104  H  HB3  . LEU A 1 135 ? -0.264  -1.373  10.805  1.00 1.56  ? 230 LEU A HB3  1  
ATOM   2105  H  HG   . LEU A 1 135 ? 2.109   -0.999  10.666  1.00 1.37  ? 230 LEU A HG   1  
ATOM   2106  H  HD11 . LEU A 1 135 ? 2.782   -2.852  9.112   1.00 3.17  ? 230 LEU A HD11 1  
ATOM   2107  H  HD12 . LEU A 1 135 ? 1.374   -3.287  10.104  1.00 3.40  ? 230 LEU A HD12 1  
ATOM   2108  H  HD13 . LEU A 1 135 ? 1.191   -2.844  8.393   1.00 3.10  ? 230 LEU A HD13 1  
ATOM   2109  H  HD21 . LEU A 1 135 ? 1.788   -0.423  7.680   1.00 3.10  ? 230 LEU A HD21 1  
ATOM   2110  H  HD22 . LEU A 1 135 ? 2.089   0.791   8.942   1.00 2.31  ? 230 LEU A HD22 1  
ATOM   2111  H  HD23 . LEU A 1 135 ? 3.294   -0.464  8.612   1.00 2.97  ? 230 LEU A HD23 1  
ATOM   2112  N  N    . LEU A 1 136 ? -1.575  -3.270  7.944   1.00 1.17  ? 231 LEU A N    1  
ATOM   2113  C  CA   . LEU A 1 136 ? -2.072  -4.649  7.973   1.00 1.32  ? 231 LEU A CA   1  
ATOM   2114  C  C    . LEU A 1 136 ? -0.924  -5.593  8.383   1.00 1.30  ? 231 LEU A C    1  
ATOM   2115  O  O    . LEU A 1 136 ? 0.235   -5.358  8.035   1.00 0.99  ? 231 LEU A O    1  
ATOM   2116  C  CB   . LEU A 1 136 ? -2.648  -4.980  6.581   1.00 1.44  ? 231 LEU A CB   1  
ATOM   2117  C  CG   . LEU A 1 136 ? -3.487  -6.275  6.521   1.00 1.86  ? 231 LEU A CG   1  
ATOM   2118  C  CD1  . LEU A 1 136 ? -4.930  -6.015  6.983   1.00 2.11  ? 231 LEU A CD1  1  
ATOM   2119  C  CD2  . LEU A 1 136 ? -3.512  -6.838  5.093   1.00 3.03  ? 231 LEU A CD2  1  
ATOM   2120  H  H    . LEU A 1 136 ? -0.963  -3.040  7.171   1.00 1.18  ? 231 LEU A H    1  
ATOM   2121  H  HA   . LEU A 1 136 ? -2.865  -4.731  8.714   1.00 1.46  ? 231 LEU A HA   1  
ATOM   2122  H  HB2  . LEU A 1 136 ? -3.271  -4.151  6.242   1.00 1.58  ? 231 LEU A HB2  1  
ATOM   2123  H  HB3  . LEU A 1 136 ? -1.817  -5.055  5.885   1.00 1.54  ? 231 LEU A HB3  1  
ATOM   2124  H  HG   . LEU A 1 136 ? -3.042  -7.032  7.167   1.00 2.55  ? 231 LEU A HG   1  
ATOM   2125  H  HD11 . LEU A 1 136 ? -5.472  -6.959  7.051   1.00 2.96  ? 231 LEU A HD11 1  
ATOM   2126  H  HD12 . LEU A 1 136 ? -4.935  -5.534  7.960   1.00 2.39  ? 231 LEU A HD12 1  
ATOM   2127  H  HD13 . LEU A 1 136 ? -5.439  -5.361  6.273   1.00 2.84  ? 231 LEU A HD13 1  
ATOM   2128  H  HD21 . LEU A 1 136 ? -4.108  -7.751  5.065   1.00 3.73  ? 231 LEU A HD21 1  
ATOM   2129  H  HD22 . LEU A 1 136 ? -3.941  -6.107  4.408   1.00 3.53  ? 231 LEU A HD22 1  
ATOM   2130  H  HD23 . LEU A 1 136 ? -2.497  -7.075  4.772   1.00 3.80  ? 231 LEU A HD23 1  
ATOM   2131  N  N    . ASN A 1 137 ? -1.233  -6.642  9.143   1.00 1.81  ? 232 ASN A N    1  
ATOM   2132  C  CA   . ASN A 1 137 ? -0.266  -7.408  9.940   1.00 1.65  ? 232 ASN A CA   1  
ATOM   2133  C  C    . ASN A 1 137 ? -0.405  -8.952  9.742   1.00 1.57  ? 232 ASN A C    1  
ATOM   2134  O  O    . ASN A 1 137 ? -1.304  -9.394  9.013   1.00 1.79  ? 232 ASN A O    1  
ATOM   2135  C  CB   . ASN A 1 137 ? -0.404  -6.873  11.384  1.00 1.60  ? 232 ASN A CB   1  
ATOM   2136  C  CG   . ASN A 1 137 ? -1.647  -7.365  12.117  1.00 2.27  ? 232 ASN A CG   1  
ATOM   2137  O  OD1  . ASN A 1 137 ? -2.002  -8.535  12.076  1.00 3.56  ? 232 ASN A OD1  1  
ATOM   2138  N  ND2  . ASN A 1 137 ? -2.325  -6.478  12.819  1.00 2.39  ? 232 ASN A ND2  1  
ATOM   2139  H  H    . ASN A 1 137 ? -2.215  -6.812  9.337   1.00 2.23  ? 232 ASN A H    1  
ATOM   2140  H  HA   . ASN A 1 137 ? 0.741   -7.154  9.604   1.00 1.81  ? 232 ASN A HA   1  
ATOM   2141  H  HB2  . ASN A 1 137 ? 0.474   -7.099  11.980  1.00 2.20  ? 232 ASN A HB2  1  
ATOM   2142  H  HB3  . ASN A 1 137 ? -0.433  -5.782  11.340  1.00 2.12  ? 232 ASN A HB3  1  
ATOM   2143  H  HD21 . ASN A 1 137 ? -1.997  -5.522  12.875  1.00 2.33  ? 232 ASN A HD21 1  
ATOM   2144  H  HD22 . ASN A 1 137 ? -3.166  -6.766  13.289  1.00 3.24  ? 232 ASN A HD22 1  
ATOM   2145  N  N    . PRO A 1 138 ? 0.467   -9.798  10.342  1.00 1.43  ? 233 PRO A N    1  
ATOM   2146  C  CA   . PRO A 1 138 ? 0.810   -11.127 9.818   1.00 1.53  ? 233 PRO A CA   1  
ATOM   2147  C  C    . PRO A 1 138 ? -0.203  -12.257 10.092  1.00 1.91  ? 233 PRO A C    1  
ATOM   2148  O  O    . PRO A 1 138 ? 0.139   -13.418 9.897   1.00 2.43  ? 233 PRO A O    1  
ATOM   2149  C  CB   . PRO A 1 138 ? 2.200   -11.436 10.398  1.00 1.41  ? 233 PRO A CB   1  
ATOM   2150  C  CG   . PRO A 1 138 ? 2.182   -10.718 11.738  1.00 1.47  ? 233 PRO A CG   1  
ATOM   2151  C  CD   . PRO A 1 138 ? 1.394   -9.454  11.414  1.00 1.43  ? 233 PRO A CD   1  
ATOM   2152  H  HA   . PRO A 1 138 ? 0.901   -11.046 8.735   1.00 1.64  ? 233 PRO A HA   1  
ATOM   2153  H  HB2  . PRO A 1 138 ? 2.394   -12.501 10.521  1.00 1.52  ? 233 PRO A HB2  1  
ATOM   2154  H  HB3  . PRO A 1 138 ? 2.969   -10.989 9.769   1.00 1.50  ? 233 PRO A HB3  1  
ATOM   2155  H  HG2  . PRO A 1 138 ? 1.637   -11.317 12.470  1.00 1.67  ? 233 PRO A HG2  1  
ATOM   2156  H  HG3  . PRO A 1 138 ? 3.187   -10.490 12.092  1.00 1.63  ? 233 PRO A HG3  1  
ATOM   2157  H  HD2  . PRO A 1 138 ? 0.854   -9.144  12.308  1.00 1.70  ? 233 PRO A HD2  1  
ATOM   2158  H  HD3  . PRO A 1 138 ? 2.070   -8.667  11.076  1.00 1.42  ? 233 PRO A HD3  1  
ATOM   2159  N  N    . ASP A 1 139 ? -1.437  -11.943 10.492  1.00 1.92  ? 234 ASP A N    1  
ATOM   2160  C  CA   . ASP A 1 139 ? -2.570  -12.879 10.649  1.00 2.32  ? 234 ASP A CA   1  
ATOM   2161  C  C    . ASP A 1 139 ? -3.802  -12.421 9.829   1.00 2.64  ? 234 ASP A C    1  
ATOM   2162  O  O    . ASP A 1 139 ? -4.870  -13.026 9.900   1.00 2.95  ? 234 ASP A O    1  
ATOM   2163  C  CB   . ASP A 1 139 ? -2.898  -13.055 12.145  1.00 2.49  ? 234 ASP A CB   1  
ATOM   2164  C  CG   . ASP A 1 139 ? -3.840  -14.237 12.449  1.00 3.30  ? 234 ASP A CG   1  
ATOM   2165  O  OD1  . ASP A 1 139 ? -3.688  -15.325 11.839  1.00 4.32  ? 234 ASP A OD1  1  
ATOM   2166  O  OD2  . ASP A 1 139 ? -4.686  -14.102 13.365  1.00 3.57  ? 234 ASP A OD2  1  
ATOM   2167  H  H    . ASP A 1 139 ? -1.657  -10.964 10.547  1.00 1.80  ? 234 ASP A H    1  
ATOM   2168  H  HA   . ASP A 1 139 ? -2.273  -13.856 10.279  1.00 2.54  ? 234 ASP A HA   1  
ATOM   2169  H  HB2  . ASP A 1 139 ? -1.967  -13.230 12.687  1.00 2.62  ? 234 ASP A HB2  1  
ATOM   2170  H  HB3  . ASP A 1 139 ? -3.332  -12.128 12.525  1.00 2.44  ? 234 ASP A HB3  1  
ATOM   2171  N  N    . GLY A 1 140 ? -3.671  -11.336 9.047   1.00 2.71  ? 235 GLY A N    1  
ATOM   2172  C  CA   . GLY A 1 140 ? -4.765  -10.730 8.275   1.00 3.18  ? 235 GLY A CA   1  
ATOM   2173  C  C    . GLY A 1 140 ? -5.586  -9.701  9.063   1.00 2.87  ? 235 GLY A C    1  
ATOM   2174  O  O    . GLY A 1 140 ? -6.688  -9.350  8.636   1.00 3.27  ? 235 GLY A O    1  
ATOM   2175  H  H    . GLY A 1 140 ? -2.756  -10.903 8.987   1.00 2.52  ? 235 GLY A H    1  
ATOM   2176  H  HA2  . GLY A 1 140 ? -4.338  -10.211 7.417   1.00 3.42  ? 235 GLY A HA2  1  
ATOM   2177  H  HA3  . GLY A 1 140 ? -5.446  -11.511 7.938   1.00 3.78  ? 235 GLY A HA3  1  
ATOM   2178  N  N    . LEU A 1 141 ? -5.074  -9.229  10.203  1.00 2.46  ? 236 LEU A N    1  
ATOM   2179  C  CA   . LEU A 1 141 ? -5.654  -8.152  11.014  1.00 2.33  ? 236 LEU A CA   1  
ATOM   2180  C  C    . LEU A 1 141 ? -4.974  -6.810  10.680  1.00 2.26  ? 236 LEU A C    1  
ATOM   2181  O  O    . LEU A 1 141 ? -3.942  -6.777  10.010  1.00 2.64  ? 236 LEU A O    1  
ATOM   2182  C  CB   . LEU A 1 141 ? -5.510  -8.509  12.512  1.00 2.44  ? 236 LEU A CB   1  
ATOM   2183  C  CG   . LEU A 1 141 ? -6.573  -9.480  13.075  1.00 3.47  ? 236 LEU A CG   1  
ATOM   2184  C  CD1  . LEU A 1 141 ? -6.585  -10.864 12.408  1.00 4.28  ? 236 LEU A CD1  1  
ATOM   2185  C  CD2  . LEU A 1 141 ? -6.334  -9.655  14.583  1.00 4.12  ? 236 LEU A CD2  1  
ATOM   2186  H  H    . LEU A 1 141 ? -4.157  -9.558  10.470  1.00 2.46  ? 236 LEU A H    1  
ATOM   2187  H  HA   . LEU A 1 141 ? -6.713  -8.038  10.779  1.00 2.60  ? 236 LEU A HA   1  
ATOM   2188  H  HB2  . LEU A 1 141 ? -4.518  -8.925  12.690  1.00 2.48  ? 236 LEU A HB2  1  
ATOM   2189  H  HB3  . LEU A 1 141 ? -5.580  -7.588  13.094  1.00 2.55  ? 236 LEU A HB3  1  
ATOM   2190  H  HG   . LEU A 1 141 ? -7.558  -9.029  12.941  1.00 3.90  ? 236 LEU A HG   1  
ATOM   2191  H  HD11 . LEU A 1 141 ? -6.929  -10.784 11.378  1.00 4.76  ? 236 LEU A HD11 1  
ATOM   2192  H  HD12 . LEU A 1 141 ? -5.586  -11.299 12.425  1.00 4.68  ? 236 LEU A HD12 1  
ATOM   2193  H  HD13 . LEU A 1 141 ? -7.268  -11.528 12.938  1.00 4.79  ? 236 LEU A HD13 1  
ATOM   2194  H  HD21 . LEU A 1 141 ? -5.357  -10.108 14.757  1.00 4.57  ? 236 LEU A HD21 1  
ATOM   2195  H  HD22 . LEU A 1 141 ? -6.373  -8.685  15.081  1.00 4.07  ? 236 LEU A HD22 1  
ATOM   2196  H  HD23 . LEU A 1 141 ? -7.107  -10.295 15.010  1.00 4.98  ? 236 LEU A HD23 1  
ATOM   2197  N  N    . PHE A 1 142 ? -5.542  -5.701  11.163  1.00 2.09  ? 237 PHE A N    1  
ATOM   2198  C  CA   . PHE A 1 142 ? -4.913  -4.375  11.141  1.00 2.08  ? 237 PHE A CA   1  
ATOM   2199  C  C    . PHE A 1 142 ? -4.342  -4.007  12.521  1.00 6.33  ? 237 PHE A C    1  
ATOM   2200  O  O    . PHE A 1 142 ? -4.696  -4.626  13.528  1.00 5.02  ? 237 PHE A O    1  
ATOM   2201  C  CB   . PHE A 1 142 ? -5.921  -3.328  10.638  1.00 2.38  ? 237 PHE A CB   1  
ATOM   2202  C  CG   . PHE A 1 142 ? -7.122  -3.108  11.543  1.00 2.35  ? 237 PHE A CG   1  
ATOM   2203  C  CD1  . PHE A 1 142 ? -7.052  -2.179  12.600  1.00 2.72  ? 237 PHE A CD1  1  
ATOM   2204  C  CD2  . PHE A 1 142 ? -8.310  -3.835  11.332  1.00 4.02  ? 237 PHE A CD2  1  
ATOM   2205  C  CE1  . PHE A 1 142 ? -8.159  -1.987  13.446  1.00 4.27  ? 237 PHE A CE1  1  
ATOM   2206  C  CE2  . PHE A 1 142 ? -9.417  -3.642  12.177  1.00 5.38  ? 237 PHE A CE2  1  
ATOM   2207  C  CZ   . PHE A 1 142 ? -9.341  -2.719  13.236  1.00 4.37  ? 237 PHE A CZ   1  
ATOM   2208  H  H    . PHE A 1 142 ? -6.366  -5.796  11.736  1.00 2.16  ? 237 PHE A H    1  
ATOM   2209  H  HA   . PHE A 1 142 ? -4.078  -4.385  10.443  1.00 2.16  ? 237 PHE A HA   1  
ATOM   2210  H  HB2  . PHE A 1 142 ? -5.403  -2.375  10.513  1.00 2.71  ? 237 PHE A HB2  1  
ATOM   2211  H  HB3  . PHE A 1 142 ? -6.271  -3.625  9.649   1.00 3.43  ? 237 PHE A HB3  1  
ATOM   2212  H  HD1  . PHE A 1 142 ? -6.148  -1.611  12.771  1.00 3.95  ? 237 PHE A HD1  1  
ATOM   2213  H  HD2  . PHE A 1 142 ? -8.374  -4.542  10.517  1.00 5.79  ? 237 PHE A HD2  1  
ATOM   2214  H  HE1  . PHE A 1 142 ? -8.097  -1.276  14.258  1.00 5.38  ? 237 PHE A HE1  1  
ATOM   2215  H  HE2  . PHE A 1 142 ? -10.327 -4.200  12.012  1.00 6.47  ? 237 PHE A HE2  1  
ATOM   2216  H  HZ   . PHE A 1 142 ? -10.191 -2.570  13.887  1.00 4.71  ? 237 PHE A HZ   1  
ATOM   2217  N  N    . THR A 1 143 ? -3.460  -3.001  12.558  1.00 1.90  ? 238 THR A N    1  
ATOM   2218  C  CA   . THR A 1 143 ? -2.850  -2.458  13.786  1.00 1.94  ? 238 THR A CA   1  
ATOM   2219  C  C    . THR A 1 143 ? -3.337  -1.034  14.040  1.00 2.08  ? 238 THR A C    1  
ATOM   2220  O  O    . THR A 1 143 ? -4.002  -0.795  15.046  1.00 2.66  ? 238 THR A O    1  
ATOM   2221  C  CB   . THR A 1 143 ? -1.322  -2.542  13.683  1.00 1.69  ? 238 THR A CB   1  
ATOM   2222  O  OG1  . THR A 1 143 ? -0.958  -3.898  13.554  1.00 2.15  ? 238 THR A OG1  1  
ATOM   2223  C  CG2  . THR A 1 143 ? -0.600  -1.981  14.907  1.00 1.67  ? 238 THR A CG2  1  
ATOM   2224  H  H    . THR A 1 143 ? -3.175  -2.602  11.669  1.00 1.96  ? 238 THR A H    1  
ATOM   2225  H  HA   . THR A 1 143 ? -3.171  -3.044  14.647  1.00 2.25  ? 238 THR A HA   1  
ATOM   2226  H  HB   . THR A 1 143 ? -0.989  -2.000  12.798  1.00 1.79  ? 238 THR A HB   1  
ATOM   2227  H  HG1  . THR A 1 143 ? -0.812  -4.248  14.439  1.00 2.83  ? 238 THR A HG1  1  
ATOM   2228  H  HG21 . THR A 1 143 ? -0.956  -2.470  15.815  1.00 2.48  ? 238 THR A HG21 1  
ATOM   2229  H  HG22 . THR A 1 143 ? 0.474   -2.135  14.799  1.00 2.36  ? 238 THR A HG22 1  
ATOM   2230  H  HG23 . THR A 1 143 ? -0.782  -0.909  14.988  1.00 1.84  ? 238 THR A HG23 1  
ATOM   2231  N  N    . ASP A 1 144 ? -3.043  -0.105  13.126  1.00 1.86  ? 239 ASP A N    1  
ATOM   2232  C  CA   . ASP A 1 144 ? -3.434  1.311   13.209  1.00 2.06  ? 239 ASP A CA   1  
ATOM   2233  C  C    . ASP A 1 144 ? -3.153  2.083   11.904  1.00 1.76  ? 239 ASP A C    1  
ATOM   2234  O  O    . ASP A 1 144 ? -2.627  1.522   10.936  1.00 1.58  ? 239 ASP A O    1  
ATOM   2235  C  CB   . ASP A 1 144 ? -2.777  2.012   14.427  1.00 2.35  ? 239 ASP A CB   1  
ATOM   2236  C  CG   . ASP A 1 144 ? -3.806  2.800   15.250  1.00 3.55  ? 239 ASP A CG   1  
ATOM   2237  O  OD1  . ASP A 1 144 ? -4.705  3.429   14.649  1.00 4.11  ? 239 ASP A OD1  1  
ATOM   2238  O  OD2  . ASP A 1 144 ? -3.774  2.717   16.501  1.00 4.65  ? 239 ASP A OD2  1  
ATOM   2239  H  H    . ASP A 1 144 ? -2.528  -0.373  12.301  1.00 1.80  ? 239 ASP A H    1  
ATOM   2240  H  HA   . ASP A 1 144 ? -4.515  1.328   13.352  1.00 2.45  ? 239 ASP A HA   1  
ATOM   2241  H  HB2  . ASP A 1 144 ? -2.283  1.278   15.066  1.00 2.45  ? 239 ASP A HB2  1  
ATOM   2242  H  HB3  . ASP A 1 144 ? -1.996  2.694   14.087  1.00 2.09  ? 239 ASP A HB3  1  
ATOM   2243  N  N    . TYR A 1 145 ? -3.511  3.371   11.887  1.00 1.83  ? 240 TYR A N    1  
ATOM   2244  C  CA   . TYR A 1 145 ? -3.321  4.285   10.753  1.00 1.57  ? 240 TYR A CA   1  
ATOM   2245  C  C    . TYR A 1 145 ? -2.015  5.112   10.800  1.00 1.89  ? 240 TYR A C    1  
ATOM   2246  O  O    . TYR A 1 145 ? -1.285  5.138   11.796  1.00 2.55  ? 240 TYR A O    1  
ATOM   2247  C  CB   . TYR A 1 145 ? -4.560  5.193   10.607  1.00 1.36  ? 240 TYR A CB   1  
ATOM   2248  C  CG   . TYR A 1 145 ? -4.547  6.497   11.395  1.00 1.62  ? 240 TYR A CG   1  
ATOM   2249  C  CD1  . TYR A 1 145 ? -4.768  6.497   12.786  1.00 2.70  ? 240 TYR A CD1  1  
ATOM   2250  C  CD2  . TYR A 1 145 ? -4.331  7.721   10.728  1.00 2.40  ? 240 TYR A CD2  1  
ATOM   2251  C  CE1  . TYR A 1 145 ? -4.771  7.706   13.509  1.00 3.24  ? 240 TYR A CE1  1  
ATOM   2252  C  CE2  . TYR A 1 145 ? -4.332  8.934   11.442  1.00 3.17  ? 240 TYR A CE2  1  
ATOM   2253  C  CZ   . TYR A 1 145 ? -4.555  8.932   12.838  1.00 3.19  ? 240 TYR A CZ   1  
ATOM   2254  O  OH   . TYR A 1 145 ? -4.570  10.107  13.528  1.00 4.07  ? 240 TYR A OH   1  
ATOM   2255  H  H    . TYR A 1 145 ? -3.933  3.744   12.732  1.00 2.15  ? 240 TYR A H    1  
ATOM   2256  H  HA   . TYR A 1 145 ? -3.272  3.684   9.847   1.00 1.60  ? 240 TYR A HA   1  
ATOM   2257  H  HB2  . TYR A 1 145 ? -4.659  5.443   9.550   1.00 1.51  ? 240 TYR A HB2  1  
ATOM   2258  H  HB3  . TYR A 1 145 ? -5.455  4.629   10.874  1.00 1.60  ? 240 TYR A HB3  1  
ATOM   2259  H  HD1  . TYR A 1 145 ? -4.940  5.564   13.304  1.00 3.62  ? 240 TYR A HD1  1  
ATOM   2260  H  HD2  . TYR A 1 145 ? -4.169  7.728   9.659   1.00 3.12  ? 240 TYR A HD2  1  
ATOM   2261  H  HE1  . TYR A 1 145 ? -4.942  7.689   14.576  1.00 4.26  ? 240 TYR A HE1  1  
ATOM   2262  H  HE2  . TYR A 1 145 ? -4.171  9.869   10.926  1.00 4.25  ? 240 TYR A HE2  1  
ATOM   2263  H  HH   . TYR A 1 145 ? -4.739  9.965   14.465  1.00 4.42  ? 240 TYR A HH   1  
ATOM   2264  N  N    . TYR A 1 146 ? -1.763  5.840   9.708   1.00 1.66  ? 241 TYR A N    1  
ATOM   2265  C  CA   . TYR A 1 146 ? -0.765  6.904   9.560   1.00 1.89  ? 241 TYR A CA   1  
ATOM   2266  C  C    . TYR A 1 146 ? -1.165  7.889   8.429   1.00 1.97  ? 241 TYR A C    1  
ATOM   2267  O  O    . TYR A 1 146 ? -2.172  7.685   7.746   1.00 2.23  ? 241 TYR A O    1  
ATOM   2268  C  CB   . TYR A 1 146 ? 0.628   6.276   9.374   1.00 2.38  ? 241 TYR A CB   1  
ATOM   2269  C  CG   . TYR A 1 146 ? 1.750   7.204   9.775   1.00 2.01  ? 241 TYR A CG   1  
ATOM   2270  C  CD1  . TYR A 1 146 ? 2.043   7.394   11.139  1.00 2.70  ? 241 TYR A CD1  1  
ATOM   2271  C  CD2  . TYR A 1 146 ? 2.445   7.940   8.799   1.00 2.80  ? 241 TYR A CD2  1  
ATOM   2272  C  CE1  . TYR A 1 146 ? 3.038   8.307   11.530  1.00 3.47  ? 241 TYR A CE1  1  
ATOM   2273  C  CE2  . TYR A 1 146 ? 3.421   8.870   9.188   1.00 3.77  ? 241 TYR A CE2  1  
ATOM   2274  C  CZ   . TYR A 1 146 ? 3.745   9.037   10.553  1.00 3.89  ? 241 TYR A CZ   1  
ATOM   2275  O  OH   . TYR A 1 146 ? 4.719   9.912   10.922  1.00 5.22  ? 241 TYR A OH   1  
ATOM   2276  H  H    . TYR A 1 146 ? -2.366  5.671   8.905   1.00 1.47  ? 241 TYR A H    1  
ATOM   2277  H  HA   . TYR A 1 146 ? -0.727  7.482   10.482  1.00 1.94  ? 241 TYR A HA   1  
ATOM   2278  H  HB2  . TYR A 1 146 ? 0.712   5.379   9.991   1.00 3.35  ? 241 TYR A HB2  1  
ATOM   2279  H  HB3  . TYR A 1 146 ? 0.759   5.967   8.341   1.00 3.05  ? 241 TYR A HB3  1  
ATOM   2280  H  HD1  . TYR A 1 146 ? 1.499   6.837   11.892  1.00 3.48  ? 241 TYR A HD1  1  
ATOM   2281  H  HD2  . TYR A 1 146 ? 2.218   7.807   7.750   1.00 3.47  ? 241 TYR A HD2  1  
ATOM   2282  H  HE1  . TYR A 1 146 ? 3.248   8.457   12.578  1.00 4.41  ? 241 TYR A HE1  1  
ATOM   2283  H  HE2  . TYR A 1 146 ? 3.918   9.462   8.440   1.00 4.94  ? 241 TYR A HE2  1  
ATOM   2284  H  HH   . TYR A 1 146 ? 4.983   9.798   11.841  1.00 5.55  ? 241 TYR A HH   1  
ATOM   2285  N  N    . GLY A 1 147 ? -0.389  8.962   8.217   1.00 2.37  ? 242 GLY A N    1  
ATOM   2286  C  CA   . GLY A 1 147 ? -0.578  9.931   7.122   1.00 2.83  ? 242 GLY A CA   1  
ATOM   2287  C  C    . GLY A 1 147 ? -1.040  11.313  7.594   1.00 2.46  ? 242 GLY A C    1  
ATOM   2288  O  O    . GLY A 1 147 ? -0.532  11.835  8.588   1.00 3.07  ? 242 GLY A O    1  
ATOM   2289  H  H    . GLY A 1 147 ? 0.412   9.088   8.818   1.00 2.69  ? 242 GLY A H    1  
ATOM   2290  H  HA2  . GLY A 1 147 ? 0.373   10.079  6.609   1.00 3.39  ? 242 GLY A HA2  1  
ATOM   2291  H  HA3  . GLY A 1 147 ? -1.295  9.549   6.393   1.00 3.42  ? 242 GLY A HA3  1  
ATOM   2292  N  N    . ARG A 1 148 ? -1.940  11.943  6.827   1.00 2.67  ? 243 ARG A N    1  
ATOM   2293  C  CA   . ARG A 1 148 ? -2.548  13.277  7.024   1.00 3.03  ? 243 ARG A CA   1  
ATOM   2294  C  C    . ARG A 1 148 ? -1.598  14.435  6.660   1.00 3.16  ? 243 ARG A C    1  
ATOM   2295  O  O    . ARG A 1 148 ? -2.011  15.342  5.946   1.00 4.34  ? 243 ARG A O    1  
ATOM   2296  C  CB   . ARG A 1 148 ? -3.160  13.432  8.434   1.00 3.47  ? 243 ARG A CB   1  
ATOM   2297  C  CG   . ARG A 1 148 ? -4.109  14.642  8.527   1.00 4.07  ? 243 ARG A CG   1  
ATOM   2298  C  CD   . ARG A 1 148 ? -4.841  14.675  9.876   1.00 4.97  ? 243 ARG A CD   1  
ATOM   2299  N  NE   . ARG A 1 148 ? -5.696  15.871  10.010  1.00 5.39  ? 243 ARG A NE   1  
ATOM   2300  C  CZ   . ARG A 1 148 ? -5.415  16.986  10.676  1.00 5.67  ? 243 ARG A CZ   1  
ATOM   2301  N  NH1  . ARG A 1 148 ? -4.325  17.133  11.398  1.00 5.81  ? 243 ARG A NH1  1  
ATOM   2302  N  NH2  . ARG A 1 148 ? -6.255  17.991  10.624  1.00 6.44  ? 243 ARG A NH2  1  
ATOM   2303  H  H    . ARG A 1 148 ? -2.251  11.437  6.000   1.00 3.38  ? 243 ARG A H    1  
ATOM   2304  H  HA   . ARG A 1 148 ? -3.380  13.329  6.321   1.00 3.73  ? 243 ARG A HA   1  
ATOM   2305  H  HB2  . ARG A 1 148 ? -3.729  12.530  8.665   1.00 4.00  ? 243 ARG A HB2  1  
ATOM   2306  H  HB3  . ARG A 1 148 ? -2.370  13.543  9.178   1.00 3.65  ? 243 ARG A HB3  1  
ATOM   2307  H  HG2  . ARG A 1 148 ? -3.533  15.561  8.412   1.00 4.08  ? 243 ARG A HG2  1  
ATOM   2308  H  HG3  . ARG A 1 148 ? -4.848  14.586  7.727   1.00 4.62  ? 243 ARG A HG3  1  
ATOM   2309  H  HD2  . ARG A 1 148 ? -5.464  13.783  9.965   1.00 5.60  ? 243 ARG A HD2  1  
ATOM   2310  H  HD3  . ARG A 1 148 ? -4.102  14.648  10.674  1.00 5.34  ? 243 ARG A HD3  1  
ATOM   2311  H  HE   . ARG A 1 148 ? -6.585  15.857  9.529   1.00 5.93  ? 243 ARG A HE   1  
ATOM   2312  H  HH11 . ARG A 1 148 ? -3.721  16.347  11.588  1.00 5.73  ? 243 ARG A HH11 1  
ATOM   2313  H  HH12 . ARG A 1 148 ? -4.139  18.019  11.859  1.00 6.44  ? 243 ARG A HH12 1  
ATOM   2314  H  HH21 . ARG A 1 148 ? -7.143  17.883  10.146  1.00 6.89  ? 243 ARG A HH21 1  
ATOM   2315  H  HH22 . ARG A 1 148 ? -6.040  18.853  11.119  1.00 6.92  ? 243 ARG A HH22 1  
ATOM   2316  N  N    . SER A 1 149 ? -0.340  14.388  7.112   1.00 2.77  ? 244 SER A N    1  
ATOM   2317  C  CA   . SER A 1 149 ? 0.800   15.293  6.810   1.00 3.37  ? 244 SER A CA   1  
ATOM   2318  C  C    . SER A 1 149 ? 1.972   14.993  7.760   1.00 2.88  ? 244 SER A C    1  
ATOM   2319  O  O    . SER A 1 149 ? 1.842   15.207  8.964   1.00 3.09  ? 244 SER A O    1  
ATOM   2320  C  CB   . SER A 1 149 ? 0.445   16.789  6.908   1.00 4.42  ? 244 SER A CB   1  
ATOM   2321  O  OG   . SER A 1 149 ? -0.221  17.229  5.742   1.00 5.68  ? 244 SER A OG   1  
ATOM   2322  H  H    . SER A 1 149 ? -0.145  13.621  7.744   1.00 2.72  ? 244 SER A H    1  
ATOM   2323  H  HA   . SER A 1 149 ? 1.139   15.112  5.788   1.00 3.89  ? 244 SER A HA   1  
ATOM   2324  H  HB2  . SER A 1 149 ? -0.176  16.967  7.788   1.00 4.25  ? 244 SER A HB2  1  
ATOM   2325  H  HB3  . SER A 1 149 ? 1.363   17.370  7.010   1.00 4.98  ? 244 SER A HB3  1  
ATOM   2326  H  HG   . SER A 1 149 ? -1.034  16.694  5.651   1.00 6.04  ? 244 SER A HG   1  
ATOM   2327  N  N    . ARG A 1 150 ? 3.093   14.465  7.239   1.00 2.69  ? 245 ARG A N    1  
ATOM   2328  C  CA   . ARG A 1 150 ? 4.257   13.915  7.966   1.00 2.34  ? 245 ARG A CA   1  
ATOM   2329  C  C    . ARG A 1 150 ? 5.448   13.844  6.992   1.00 2.25  ? 245 ARG A C    1  
ATOM   2330  O  O    . ARG A 1 150 ? 5.276   14.070  5.797   1.00 2.64  ? 245 ARG A O    1  
ATOM   2331  C  CB   . ARG A 1 150 ? 3.956   12.494  8.509   1.00 2.17  ? 245 ARG A CB   1  
ATOM   2332  C  CG   . ARG A 1 150 ? 2.792   12.366  9.506   1.00 2.78  ? 245 ARG A CG   1  
ATOM   2333  C  CD   . ARG A 1 150 ? 3.030   13.095  10.833  1.00 3.47  ? 245 ARG A CD   1  
ATOM   2334  N  NE   . ARG A 1 150 ? 1.774   13.204  11.590  1.00 4.71  ? 245 ARG A NE   1  
ATOM   2335  C  CZ   . ARG A 1 150 ? 1.609   13.846  12.739  1.00 5.72  ? 245 ARG A CZ   1  
ATOM   2336  N  NH1  . ARG A 1 150 ? 2.617   14.372  13.405  1.00 5.94  ? 245 ARG A NH1  1  
ATOM   2337  N  NH2  . ARG A 1 150 ? 0.397   13.966  13.235  1.00 6.97  ? 245 ARG A NH2  1  
ATOM   2338  H  H    . ARG A 1 150 ? 3.183   14.424  6.231   1.00 3.08  ? 245 ARG A H    1  
ATOM   2339  H  HA   . ARG A 1 150 ? 4.522   14.579  8.789   1.00 2.64  ? 245 ARG A HA   1  
ATOM   2340  H  HB2  . ARG A 1 150 ? 3.738   11.846  7.658   1.00 2.76  ? 245 ARG A HB2  1  
ATOM   2341  H  HB3  . ARG A 1 150 ? 4.851   12.104  8.995   1.00 2.23  ? 245 ARG A HB3  1  
ATOM   2342  H  HG2  . ARG A 1 150 ? 1.876   12.718  9.041   1.00 3.57  ? 245 ARG A HG2  1  
ATOM   2343  H  HG3  . ARG A 1 150 ? 2.619   11.318  9.726   1.00 3.10  ? 245 ARG A HG3  1  
ATOM   2344  H  HD2  . ARG A 1 150 ? 3.770   12.542  11.414  1.00 3.51  ? 245 ARG A HD2  1  
ATOM   2345  H  HD3  . ARG A 1 150 ? 3.412   14.098  10.640  1.00 3.80  ? 245 ARG A HD3  1  
ATOM   2346  H  HE   . ARG A 1 150 ? 0.951   12.857  11.125  1.00 5.19  ? 245 ARG A HE   1  
ATOM   2347  H  HH11 . ARG A 1 150 ? 3.569   14.279  13.050  1.00 5.36  ? 245 ARG A HH11 1  
ATOM   2348  H  HH12 . ARG A 1 150 ? 2.456   14.888  14.251  1.00 7.00  ? 245 ARG A HH12 1  
ATOM   2349  H  HH21 . ARG A 1 150 ? -0.404  13.620  12.735  1.00 7.29  ? 245 ARG A HH21 1  
ATOM   2350  H  HH22 . ARG A 1 150 ? 0.237   14.463  14.108  1.00 7.86  ? 245 ARG A HH22 1  
ATOM   2351  N  N    . SER A 1 151 ? 6.645   13.455  7.434   1.00 1.95  ? 246 SER A N    1  
ATOM   2352  C  CA   . SER A 1 151 ? 7.759   13.138  6.538   1.00 1.92  ? 246 SER A CA   1  
ATOM   2353  C  C    . SER A 1 151 ? 8.690   12.152  7.251   1.00 1.52  ? 246 SER A C    1  
ATOM   2354  O  O    . SER A 1 151 ? 8.518   11.923  8.452   1.00 1.58  ? 246 SER A O    1  
ATOM   2355  C  CB   . SER A 1 151 ? 8.457   14.412  6.036   1.00 2.63  ? 246 SER A CB   1  
ATOM   2356  O  OG   . SER A 1 151 ? 9.585   14.065  5.250   1.00 3.26  ? 246 SER A OG   1  
ATOM   2357  H  H    . SER A 1 151 ? 6.807   13.192  8.402   1.00 1.92  ? 246 SER A H    1  
ATOM   2358  H  HA   . SER A 1 151 ? 7.378   12.616  5.662   1.00 1.97  ? 246 SER A HA   1  
ATOM   2359  H  HB2  . SER A 1 151 ? 7.759   14.986  5.424   1.00 3.07  ? 246 SER A HB2  1  
ATOM   2360  H  HB3  . SER A 1 151 ? 8.750   15.025  6.888   1.00 2.67  ? 246 SER A HB3  1  
ATOM   2361  H  HG   . SER A 1 151 ? 9.833   14.821  4.665   1.00 3.94  ? 246 SER A HG   1  
ATOM   2362  N  N    . ALA A 1 152 ? 9.608   11.526  6.504   1.00 1.42  ? 247 ALA A N    1  
ATOM   2363  C  CA   . ALA A 1 152 ? 10.277  10.260  6.825   1.00 1.22  ? 247 ALA A CA   1  
ATOM   2364  C  C    . ALA A 1 152 ? 10.747  10.145  8.283   1.00 1.19  ? 247 ALA A C    1  
ATOM   2365  O  O    . ALA A 1 152 ? 10.528  9.108   8.903   1.00 1.11  ? 247 ALA A O    1  
ATOM   2366  C  CB   . ALA A 1 152 ? 11.436  10.077  5.836   1.00 1.29  ? 247 ALA A CB   1  
ATOM   2367  H  H    . ALA A 1 152 ? 9.771   11.912  5.581   1.00 1.65  ? 247 ALA A H    1  
ATOM   2368  H  HA   . ALA A 1 152 ? 9.572   9.443   6.664   1.00 1.15  ? 247 ALA A HA   1  
ATOM   2369  H  HB1  . ALA A 1 152 ? 11.935  9.129   6.035   1.00 1.89  ? 247 ALA A HB1  1  
ATOM   2370  H  HB2  . ALA A 1 152 ? 11.057  10.061  4.812   1.00 1.87  ? 247 ALA A HB2  1  
ATOM   2371  H  HB3  . ALA A 1 152 ? 12.161  10.886  5.942   1.00 1.80  ? 247 ALA A HB3  1  
ATOM   2372  N  N    . GLU A 1 153 ? 11.299  11.226  8.844   1.00 1.38  ? 248 GLU A N    1  
ATOM   2373  C  CA   . GLU A 1 153 ? 11.803  11.266  10.217  1.00 1.52  ? 248 GLU A CA   1  
ATOM   2374  C  C    . GLU A 1 153 ? 10.727  10.990  11.283  1.00 1.51  ? 248 GLU A C    1  
ATOM   2375  O  O    . GLU A 1 153 ? 11.007  10.325  12.276  1.00 1.63  ? 248 GLU A O    1  
ATOM   2376  C  CB   . GLU A 1 153 ? 12.543  12.600  10.448  1.00 1.85  ? 248 GLU A CB   1  
ATOM   2377  C  CG   . GLU A 1 153 ? 13.422  12.595  11.707  1.00 1.97  ? 248 GLU A CG   1  
ATOM   2378  C  CD   . GLU A 1 153 ? 14.229  13.888  11.848  1.00 2.87  ? 248 GLU A CD   1  
ATOM   2379  O  OE1  . GLU A 1 153 ? 13.722  14.843  12.483  1.00 3.38  ? 248 GLU A OE1  1  
ATOM   2380  O  OE2  . GLU A 1 153 ? 15.396  13.934  11.385  1.00 3.91  ? 248 GLU A OE2  1  
ATOM   2381  H  H    . GLU A 1 153 ? 11.404  12.048  8.273   1.00 1.50  ? 248 GLU A H    1  
ATOM   2382  H  HA   . GLU A 1 153 ? 12.512  10.457  10.289  1.00 1.51  ? 248 GLU A HA   1  
ATOM   2383  H  HB2  . GLU A 1 153 ? 13.189  12.793  9.590   1.00 2.46  ? 248 GLU A HB2  1  
ATOM   2384  H  HB3  . GLU A 1 153 ? 11.816  13.411  10.516  1.00 2.39  ? 248 GLU A HB3  1  
ATOM   2385  H  HG2  . GLU A 1 153 ? 12.792  12.472  12.589  1.00 2.16  ? 248 GLU A HG2  1  
ATOM   2386  H  HG3  . GLU A 1 153 ? 14.111  11.751  11.658  1.00 2.35  ? 248 GLU A HG3  1  
ATOM   2387  N  N    . GLN A 1 154 ? 9.489   11.454  11.086  1.00 1.50  ? 249 GLN A N    1  
ATOM   2388  C  CA   . GLN A 1 154 ? 8.359   11.059  11.934  1.00 1.53  ? 249 GLN A CA   1  
ATOM   2389  C  C    . GLN A 1 154 ? 7.828   9.650   11.640  1.00 1.39  ? 249 GLN A C    1  
ATOM   2390  O  O    . GLN A 1 154 ? 7.208   9.039   12.508  1.00 1.45  ? 249 GLN A O    1  
ATOM   2391  C  CB   . GLN A 1 154 ? 7.227   12.100  11.864  1.00 1.70  ? 249 GLN A CB   1  
ATOM   2392  C  CG   . GLN A 1 154 ? 7.686   13.501  12.315  1.00 2.63  ? 249 GLN A CG   1  
ATOM   2393  C  CD   . GLN A 1 154 ? 6.548   14.424  12.761  1.00 3.24  ? 249 GLN A CD   1  
ATOM   2394  O  OE1  . GLN A 1 154 ? 5.363   14.125  12.662  1.00 3.66  ? 249 GLN A OE1  1  
ATOM   2395  N  NE2  . GLN A 1 154 ? 6.878   15.579  13.291  1.00 4.19  ? 249 GLN A NE2  1  
ATOM   2396  H  H    . GLN A 1 154 ? 9.286   11.916  10.207  1.00 1.56  ? 249 GLN A H    1  
ATOM   2397  H  HA   . GLN A 1 154 ? 8.706   11.007  12.962  1.00 1.61  ? 249 GLN A HA   1  
ATOM   2398  H  HB2  . GLN A 1 154 ? 6.828   12.154  10.851  1.00 2.10  ? 249 GLN A HB2  1  
ATOM   2399  H  HB3  . GLN A 1 154 ? 6.432   11.762  12.530  1.00 1.61  ? 249 GLN A HB3  1  
ATOM   2400  H  HG2  . GLN A 1 154 ? 8.366   13.392  13.161  1.00 2.92  ? 249 GLN A HG2  1  
ATOM   2401  H  HG3  . GLN A 1 154 ? 8.237   13.982  11.506  1.00 3.74  ? 249 GLN A HG3  1  
ATOM   2402  H  HE21 . GLN A 1 154 ? 7.851   15.874  13.322  1.00 4.57  ? 249 GLN A HE21 1  
ATOM   2403  H  HE22 . GLN A 1 154 ? 6.173   16.109  13.794  1.00 4.84  ? 249 GLN A HE22 1  
ATOM   2404  N  N    . ILE A 1 155 ? 7.992   9.151   10.412  1.00 1.28  ? 250 ILE A N    1  
ATOM   2405  C  CA   . ILE A 1 155 ? 7.451   7.846   9.999   1.00 1.19  ? 250 ILE A CA   1  
ATOM   2406  C  C    . ILE A 1 155 ? 8.269   6.696   10.572  1.00 1.13  ? 250 ILE A C    1  
ATOM   2407  O  O    . ILE A 1 155 ? 7.694   5.806   11.188  1.00 1.14  ? 250 ILE A O    1  
ATOM   2408  C  CB   . ILE A 1 155 ? 7.272   7.738   8.469   1.00 1.18  ? 250 ILE A CB   1  
ATOM   2409  C  CG1  . ILE A 1 155 ? 6.712   9.060   7.892   1.00 1.51  ? 250 ILE A CG1  1  
ATOM   2410  C  CG2  . ILE A 1 155 ? 6.383   6.518   8.152   1.00 1.30  ? 250 ILE A CG2  1  
ATOM   2411  C  CD1  . ILE A 1 155 ? 5.931   8.988   6.580   1.00 1.43  ? 250 ILE A CD1  1  
ATOM   2412  H  H    . ILE A 1 155 ? 8.593   9.652   9.768   1.00 1.30  ? 250 ILE A H    1  
ATOM   2413  H  HA   . ILE A 1 155 ? 6.462   7.737   10.447  1.00 1.25  ? 250 ILE A HA   1  
ATOM   2414  H  HB   . ILE A 1 155 ? 8.251   7.569   8.026   1.00 1.20  ? 250 ILE A HB   1  
ATOM   2415  H  HG12 . ILE A 1 155 ? 6.072   9.538   8.628   1.00 2.01  ? 250 ILE A HG12 1  
ATOM   2416  H  HG13 . ILE A 1 155 ? 7.554   9.722   7.730   1.00 2.32  ? 250 ILE A HG13 1  
ATOM   2417  H  HG21 . ILE A 1 155 ? 6.806   5.615   8.591   1.00 1.31  ? 250 ILE A HG21 1  
ATOM   2418  H  HG22 . ILE A 1 155 ? 5.380   6.667   8.553   1.00 2.10  ? 250 ILE A HG22 1  
ATOM   2419  H  HG23 . ILE A 1 155 ? 6.324   6.361   7.075   1.00 2.18  ? 250 ILE A HG23 1  
ATOM   2420  H  HD11 . ILE A 1 155 ? 5.019   8.403   6.718   1.00 1.75  ? 250 ILE A HD11 1  
ATOM   2421  H  HD12 . ILE A 1 155 ? 5.649   9.999   6.288   1.00 2.18  ? 250 ILE A HD12 1  
ATOM   2422  H  HD13 . ILE A 1 155 ? 6.552   8.543   5.804   1.00 2.29  ? 250 ILE A HD13 1  
ATOM   2423  N  N    . SER A 1 156 ? 9.590   6.709   10.415  1.00 1.18  ? 251 SER A N    1  
ATOM   2424  C  CA   . SER A 1 156 ? 10.450  5.619   10.899  1.00 1.30  ? 251 SER A CA   1  
ATOM   2425  C  C    . SER A 1 156 ? 10.358  5.453   12.428  1.00 1.35  ? 251 SER A C    1  
ATOM   2426  O  O    . SER A 1 156 ? 10.261  4.329   12.919  1.00 1.39  ? 251 SER A O    1  
ATOM   2427  C  CB   . SER A 1 156 ? 11.902  5.853   10.451  1.00 1.50  ? 251 SER A CB   1  
ATOM   2428  O  OG   . SER A 1 156 ? 11.972  6.073   9.050   1.00 2.87  ? 251 SER A OG   1  
ATOM   2429  H  H    . SER A 1 156 ? 10.027  7.451   9.875   1.00 1.27  ? 251 SER A H    1  
ATOM   2430  H  HA   . SER A 1 156 ? 10.116  4.681   10.457  1.00 1.30  ? 251 SER A HA   1  
ATOM   2431  H  HB2  . SER A 1 156 ? 12.303  6.721   10.971  1.00 1.43  ? 251 SER A HB2  1  
ATOM   2432  H  HB3  . SER A 1 156 ? 12.503  4.980   10.712  1.00 2.28  ? 251 SER A HB3  1  
ATOM   2433  H  HG   . SER A 1 156 ? 12.904  6.247   8.794   1.00 3.47  ? 251 SER A HG   1  
ATOM   2434  N  N    . ASP A 1 157 ? 10.287  6.559   13.183  1.00 1.43  ? 252 ASP A N    1  
ATOM   2435  C  CA   . ASP A 1 157 ? 10.016  6.540   14.626  1.00 1.54  ? 252 ASP A CA   1  
ATOM   2436  C  C    . ASP A 1 157 ? 8.581   6.073   14.936  1.00 1.44  ? 252 ASP A C    1  
ATOM   2437  O  O    . ASP A 1 157 ? 8.368   5.305   15.871  1.00 1.47  ? 252 ASP A O    1  
ATOM   2438  C  CB   . ASP A 1 157 ? 10.293  7.937   15.208  1.00 1.83  ? 252 ASP A CB   1  
ATOM   2439  C  CG   . ASP A 1 157 ? 10.138  8.016   16.733  1.00 1.95  ? 252 ASP A CG   1  
ATOM   2440  O  OD1  . ASP A 1 157 ? 10.377  7.016   17.447  1.00 2.53  ? 252 ASP A OD1  1  
ATOM   2441  O  OD2  . ASP A 1 157 ? 9.784   9.099   17.247  1.00 2.64  ? 252 ASP A OD2  1  
ATOM   2442  H  H    . ASP A 1 157 ? 10.362  7.460   12.729  1.00 1.45  ? 252 ASP A H    1  
ATOM   2443  H  HA   . ASP A 1 157 ? 10.701  5.834   15.099  1.00 1.63  ? 252 ASP A HA   1  
ATOM   2444  H  HB2  . ASP A 1 157 ? 11.315  8.226   14.954  1.00 2.21  ? 252 ASP A HB2  1  
ATOM   2445  H  HB3  . ASP A 1 157 ? 9.614   8.654   14.742  1.00 2.21  ? 252 ASP A HB3  1  
ATOM   2446  N  N    . SER A 1 158 ? 7.581   6.460   14.137  1.00 1.41  ? 253 SER A N    1  
ATOM   2447  C  CA   . SER A 1 158 ? 6.224   5.944   14.336  1.00 1.44  ? 253 SER A CA   1  
ATOM   2448  C  C    . SER A 1 158 ? 6.098   4.456   13.996  1.00 1.32  ? 253 SER A C    1  
ATOM   2449  O  O    . SER A 1 158 ? 5.411   3.756   14.724  1.00 1.42  ? 253 SER A O    1  
ATOM   2450  C  CB   . SER A 1 158 ? 5.179   6.729   13.550  1.00 1.59  ? 253 SER A CB   1  
ATOM   2451  O  OG   . SER A 1 158 ? 3.879   6.390   14.017  1.00 1.68  ? 253 SER A OG   1  
ATOM   2452  H  H    . SER A 1 158 ? 7.769   7.107   13.375  1.00 1.41  ? 253 SER A H    1  
ATOM   2453  H  HA   . SER A 1 158 ? 5.973   6.049   15.391  1.00 1.57  ? 253 SER A HA   1  
ATOM   2454  H  HB2  . SER A 1 158 ? 5.337   7.796   13.710  1.00 2.23  ? 253 SER A HB2  1  
ATOM   2455  H  HB3  . SER A 1 158 ? 5.269   6.508   12.486  1.00 2.30  ? 253 SER A HB3  1  
ATOM   2456  H  HG   . SER A 1 158 ? 3.793   5.426   14.101  1.00 2.37  ? 253 SER A HG   1  
ATOM   2457  N  N    . VAL A 1 159 ? 6.755   3.944   12.953  1.00 1.19  ? 254 VAL A N    1  
ATOM   2458  C  CA   . VAL A 1 159 ? 6.772   2.504   12.627  1.00 1.17  ? 254 VAL A CA   1  
ATOM   2459  C  C    . VAL A 1 159 ? 7.492   1.726   13.743  1.00 1.18  ? 254 VAL A C    1  
ATOM   2460  O  O    . VAL A 1 159 ? 7.001   0.671   14.145  1.00 1.26  ? 254 VAL A O    1  
ATOM   2461  C  CB   . VAL A 1 159 ? 7.406   2.249   11.239  1.00 1.20  ? 254 VAL A CB   1  
ATOM   2462  C  CG1  . VAL A 1 159 ? 7.604   0.750   10.958  1.00 1.39  ? 254 VAL A CG1  1  
ATOM   2463  C  CG2  . VAL A 1 159 ? 6.500   2.808   10.125  1.00 1.36  ? 254 VAL A CG2  1  
ATOM   2464  H  H    . VAL A 1 159 ? 7.283   4.594   12.361  1.00 1.18  ? 254 VAL A H    1  
ATOM   2465  H  HA   . VAL A 1 159 ? 5.736   2.140   12.575  1.00 1.24  ? 254 VAL A HA   1  
ATOM   2466  H  HB   . VAL A 1 159 ? 8.376   2.746   11.192  1.00 1.23  ? 254 VAL A HB   1  
ATOM   2467  H  HG11 . VAL A 1 159 ? 6.667   0.215   11.107  1.00 2.29  ? 254 VAL A HG11 1  
ATOM   2468  H  HG12 . VAL A 1 159 ? 7.924   0.609   9.926   1.00 2.30  ? 254 VAL A HG12 1  
ATOM   2469  H  HG13 . VAL A 1 159 ? 8.366   0.337   11.618  1.00 1.44  ? 254 VAL A HG13 1  
ATOM   2470  H  HG21 . VAL A 1 159 ? 6.287   3.862   10.290  1.00 1.97  ? 254 VAL A HG21 1  
ATOM   2471  H  HG22 . VAL A 1 159 ? 6.994   2.703   9.158   1.00 2.10  ? 254 VAL A HG22 1  
ATOM   2472  H  HG23 . VAL A 1 159 ? 5.555   2.264   10.102  1.00 1.70  ? 254 VAL A HG23 1  
ATOM   2473  N  N    . ARG A 1 160 ? 8.580   2.266   14.323  1.00 1.18  ? 255 ARG A N    1  
ATOM   2474  C  CA   . ARG A 1 160 ? 9.204   1.714   15.539  1.00 1.25  ? 255 ARG A CA   1  
ATOM   2475  C  C    . ARG A 1 160 ? 8.234   1.696   16.737  1.00 1.32  ? 255 ARG A C    1  
ATOM   2476  O  O    . ARG A 1 160 ? 8.171   0.692   17.448  1.00 1.41  ? 255 ARG A O    1  
ATOM   2477  C  CB   . ARG A 1 160 ? 10.474  2.502   15.912  1.00 1.33  ? 255 ARG A CB   1  
ATOM   2478  C  CG   . ARG A 1 160 ? 11.715  2.157   15.069  1.00 2.22  ? 255 ARG A CG   1  
ATOM   2479  C  CD   . ARG A 1 160 ? 12.889  3.027   15.544  1.00 2.39  ? 255 ARG A CD   1  
ATOM   2480  N  NE   . ARG A 1 160 ? 14.138  2.784   14.794  1.00 3.45  ? 255 ARG A NE   1  
ATOM   2481  C  CZ   . ARG A 1 160 ? 15.373  2.854   15.283  1.00 3.98  ? 255 ARG A CZ   1  
ATOM   2482  N  NH1  . ARG A 1 160 ? 15.639  2.898   16.571  1.00 3.90  ? 255 ARG A NH1  1  
ATOM   2483  N  NH2  . ARG A 1 160 ? 16.390  2.875   14.464  1.00 5.22  ? 255 ARG A NH2  1  
ATOM   2484  H  H    . ARG A 1 160 ? 8.970   3.121   13.932  1.00 1.18  ? 255 ARG A H    1  
ATOM   2485  H  HA   . ARG A 1 160 ? 9.492   0.681   15.341  1.00 1.29  ? 255 ARG A HA   1  
ATOM   2486  H  HB2  . ARG A 1 160 ? 10.272  3.570   15.835  1.00 1.57  ? 255 ARG A HB2  1  
ATOM   2487  H  HB3  . ARG A 1 160 ? 10.717  2.287   16.954  1.00 1.71  ? 255 ARG A HB3  1  
ATOM   2488  H  HG2  . ARG A 1 160 ? 11.966  1.104   15.204  1.00 2.83  ? 255 ARG A HG2  1  
ATOM   2489  H  HG3  . ARG A 1 160 ? 11.520  2.344   14.014  1.00 2.93  ? 255 ARG A HG3  1  
ATOM   2490  H  HD2  . ARG A 1 160 ? 12.613  4.077   15.426  1.00 2.55  ? 255 ARG A HD2  1  
ATOM   2491  H  HD3  . ARG A 1 160 ? 13.045  2.839   16.607  1.00 2.55  ? 255 ARG A HD3  1  
ATOM   2492  H  HE   . ARG A 1 160 ? 14.067  2.712   13.786  1.00 4.27  ? 255 ARG A HE   1  
ATOM   2493  H  HH11 . ARG A 1 160 ? 14.915  2.687   17.248  1.00 3.55  ? 255 ARG A HH11 1  
ATOM   2494  H  HH12 . ARG A 1 160 ? 16.591  2.981   16.883  1.00 4.69  ? 255 ARG A HH12 1  
ATOM   2495  H  HH21 . ARG A 1 160 ? 16.253  2.790   13.450  1.00 5.86  ? 255 ARG A HH21 1  
ATOM   2496  H  HH22 . ARG A 1 160 ? 17.349  2.899   14.784  1.00 5.80  ? 255 ARG A HH22 1  
ATOM   2497  N  N    . ARG A 1 161 ? 7.448   2.755   16.968  1.00 1.35  ? 256 ARG A N    1  
ATOM   2498  C  CA   . ARG A 1 161 ? 6.463   2.809   18.066  1.00 1.49  ? 256 ARG A CA   1  
ATOM   2499  C  C    . ARG A 1 161 ? 5.244   1.903   17.821  1.00 1.68  ? 256 ARG A C    1  
ATOM   2500  O  O    . ARG A 1 161 ? 4.864   1.151   18.714  1.00 1.86  ? 256 ARG A O    1  
ATOM   2501  C  CB   . ARG A 1 161 ? 6.070   4.263   18.369  1.00 1.58  ? 256 ARG A CB   1  
ATOM   2502  C  CG   . ARG A 1 161 ? 7.252   5.008   19.017  1.00 2.07  ? 256 ARG A CG   1  
ATOM   2503  C  CD   . ARG A 1 161 ? 6.948   6.492   19.238  1.00 3.16  ? 256 ARG A CD   1  
ATOM   2504  N  NE   . ARG A 1 161 ? 8.192   7.272   19.329  1.00 4.16  ? 256 ARG A NE   1  
ATOM   2505  C  CZ   . ARG A 1 161 ? 8.616   8.071   20.299  1.00 5.03  ? 256 ARG A CZ   1  
ATOM   2506  N  NH1  . ARG A 1 161 ? 8.005   8.200   21.458  1.00 5.17  ? 256 ARG A NH1  1  
ATOM   2507  N  NH2  . ARG A 1 161 ? 9.703   8.770   20.076  1.00 6.17  ? 256 ARG A NH2  1  
ATOM   2508  H  H    . ARG A 1 161 ? 7.566   3.574   16.380  1.00 1.32  ? 256 ARG A H    1  
ATOM   2509  H  HA   . ARG A 1 161 ? 6.948   2.427   18.964  1.00 1.54  ? 256 ARG A HA   1  
ATOM   2510  H  HB2  . ARG A 1 161 ? 5.769   4.760   17.445  1.00 1.70  ? 256 ARG A HB2  1  
ATOM   2511  H  HB3  . ARG A 1 161 ? 5.229   4.272   19.064  1.00 1.83  ? 256 ARG A HB3  1  
ATOM   2512  H  HG2  . ARG A 1 161 ? 7.493   4.550   19.977  1.00 2.19  ? 256 ARG A HG2  1  
ATOM   2513  H  HG3  . ARG A 1 161 ? 8.129   4.922   18.376  1.00 2.75  ? 256 ARG A HG3  1  
ATOM   2514  H  HD2  . ARG A 1 161 ? 6.383   6.862   18.382  1.00 3.75  ? 256 ARG A HD2  1  
ATOM   2515  H  HD3  . ARG A 1 161 ? 6.334   6.607   20.132  1.00 3.57  ? 256 ARG A HD3  1  
ATOM   2516  H  HE   . ARG A 1 161 ? 8.821   7.201   18.529  1.00 4.59  ? 256 ARG A HE   1  
ATOM   2517  H  HH11 . ARG A 1 161 ? 7.214   7.615   21.706  1.00 4.69  ? 256 ARG A HH11 1  
ATOM   2518  H  HH12 . ARG A 1 161 ? 8.348   8.858   22.146  1.00 6.04  ? 256 ARG A HH12 1  
ATOM   2519  H  HH21 . ARG A 1 161 ? 10.081  8.763   19.130  1.00 6.44  ? 256 ARG A HH21 1  
ATOM   2520  H  HH22 . ARG A 1 161 ? 10.121  9.353   20.792  1.00 6.95  ? 256 ARG A HH22 1  
ATOM   2521  N  N    . HIS A 1 162 ? 4.690   1.861   16.608  1.00 1.70  ? 257 HIS A N    1  
ATOM   2522  C  CA   . HIS A 1 162 ? 3.647   0.906   16.202  1.00 1.92  ? 257 HIS A CA   1  
ATOM   2523  C  C    . HIS A 1 162 ? 4.128   -0.551  16.380  1.00 1.93  ? 257 HIS A C    1  
ATOM   2524  O  O    . HIS A 1 162 ? 3.385   -1.395  16.880  1.00 2.17  ? 257 HIS A O    1  
ATOM   2525  C  CB   . HIS A 1 162 ? 3.231   1.175   14.739  1.00 1.95  ? 257 HIS A CB   1  
ATOM   2526  C  CG   . HIS A 1 162 ? 2.326   2.367   14.502  1.00 2.46  ? 257 HIS A CG   1  
ATOM   2527  N  ND1  . HIS A 1 162 ? 2.297   3.552   15.241  1.00 3.26  ? 257 HIS A ND1  1  
ATOM   2528  C  CD2  . HIS A 1 162 ? 1.393   2.453   13.506  1.00 2.84  ? 257 HIS A CD2  1  
ATOM   2529  C  CE1  . HIS A 1 162 ? 1.345   4.314   14.674  1.00 3.65  ? 257 HIS A CE1  1  
ATOM   2530  N  NE2  . HIS A 1 162 ? 0.784   3.684   13.628  1.00 3.41  ? 257 HIS A NE2  1  
ATOM   2531  H  H    . HIS A 1 162 ? 4.986   2.547   15.920  1.00 1.60  ? 257 HIS A H    1  
ATOM   2532  H  HA   . HIS A 1 162 ? 2.772   1.042   16.839  1.00 2.16  ? 257 HIS A HA   1  
ATOM   2533  H  HB2  . HIS A 1 162 ? 4.123   1.291   14.123  1.00 1.96  ? 257 HIS A HB2  1  
ATOM   2534  H  HB3  . HIS A 1 162 ? 2.696   0.298   14.375  1.00 1.96  ? 257 HIS A HB3  1  
ATOM   2535  H  HD2  . HIS A 1 162 ? 1.173   1.698   12.767  1.00 3.14  ? 257 HIS A HD2  1  
ATOM   2536  H  HE1  . HIS A 1 162 ? 1.068   5.303   15.014  1.00 4.38  ? 257 HIS A HE1  1  
ATOM   2537  H  HE2  . HIS A 1 162 ? 0.037   4.057   13.042  1.00 3.89  ? 257 HIS A HE2  1  
ATOM   2538  N  N    . MET A 1 163 ? 5.394   -0.839  16.043  1.00 1.73  ? 258 MET A N    1  
ATOM   2539  C  CA   . MET A 1 163 ? 6.066   -2.119  16.315  1.00 1.80  ? 258 MET A CA   1  
ATOM   2540  C  C    . MET A 1 163 ? 6.159   -2.400  17.820  1.00 2.01  ? 258 MET A C    1  
ATOM   2541  O  O    . MET A 1 163 ? 5.779   -3.486  18.248  1.00 2.31  ? 258 MET A O    1  
ATOM   2542  C  CB   . MET A 1 163 ? 7.450   -2.110  15.640  1.00 1.68  ? 258 MET A CB   1  
ATOM   2543  C  CG   . MET A 1 163 ? 8.349   -3.281  16.047  1.00 1.76  ? 258 MET A CG   1  
ATOM   2544  S  SD   . MET A 1 163 ? 10.021  -3.136  15.370  1.00 1.89  ? 258 MET A SD   1  
ATOM   2545  C  CE   . MET A 1 163 ? 10.670  -4.765  15.816  1.00 3.08  ? 258 MET A CE   1  
ATOM   2546  H  H    . MET A 1 163 ? 5.929   -0.111  15.581  1.00 1.58  ? 258 MET A H    1  
ATOM   2547  H  HA   . MET A 1 163 ? 5.481   -2.929  15.877  1.00 1.90  ? 258 MET A HA   1  
ATOM   2548  H  HB2  . MET A 1 163 ? 7.316   -2.127  14.556  1.00 1.82  ? 258 MET A HB2  1  
ATOM   2549  H  HB3  . MET A 1 163 ? 7.974   -1.193  15.891  1.00 1.85  ? 258 MET A HB3  1  
ATOM   2550  H  HG2  . MET A 1 163 ? 8.446   -3.312  17.132  1.00 2.09  ? 258 MET A HG2  1  
ATOM   2551  H  HG3  . MET A 1 163 ? 7.886   -4.211  15.719  1.00 1.93  ? 258 MET A HG3  1  
ATOM   2552  H  HE1  . MET A 1 163 ? 11.752  -4.702  15.940  1.00 3.49  ? 258 MET A HE1  1  
ATOM   2553  H  HE2  . MET A 1 163 ? 10.459  -5.480  15.020  1.00 3.58  ? 258 MET A HE2  1  
ATOM   2554  H  HE3  . MET A 1 163 ? 10.226  -5.111  16.749  1.00 4.04  ? 258 MET A HE3  1  
ATOM   2555  N  N    . ALA A 1 164 ? 6.613   -1.439  18.629  1.00 1.94  ? 259 ALA A N    1  
ATOM   2556  C  CA   . ALA A 1 164 ? 6.706   -1.562  20.089  1.00 2.17  ? 259 ALA A CA   1  
ATOM   2557  C  C    . ALA A 1 164 ? 5.340   -1.637  20.805  1.00 2.52  ? 259 ALA A C    1  
ATOM   2558  O  O    . ALA A 1 164 ? 5.291   -1.978  21.987  1.00 2.87  ? 259 ALA A O    1  
ATOM   2559  C  CB   . ALA A 1 164 ? 7.546   -0.387  20.609  1.00 2.10  ? 259 ALA A CB   1  
ATOM   2560  H  H    . ALA A 1 164 ? 6.967   -0.585  18.209  1.00 1.77  ? 259 ALA A H    1  
ATOM   2561  H  HA   . ALA A 1 164 ? 7.230   -2.490  20.325  1.00 2.24  ? 259 ALA A HA   1  
ATOM   2562  H  HB1  . ALA A 1 164 ? 7.030   0.556   20.422  1.00 2.85  ? 259 ALA A HB1  1  
ATOM   2563  H  HB2  . ALA A 1 164 ? 7.705   -0.494  21.683  1.00 2.23  ? 259 ALA A HB2  1  
ATOM   2564  H  HB3  . ALA A 1 164 ? 8.517   -0.370  20.113  1.00 2.36  ? 259 ALA A HB3  1  
ATOM   2565  N  N    . ALA A 1 165 ? 4.240   -1.311  20.122  1.00 2.54  ? 260 ALA A N    1  
ATOM   2566  C  CA   . ALA A 1 165 ? 2.870   -1.439  20.626  1.00 2.90  ? 260 ALA A CA   1  
ATOM   2567  C  C    . ALA A 1 165 ? 2.245   -2.793  20.246  1.00 2.87  ? 260 ALA A C    1  
ATOM   2568  O  O    . ALA A 1 165 ? 1.740   -3.496  21.115  1.00 2.86  ? 260 ALA A O    1  
ATOM   2569  C  CB   . ALA A 1 165 ? 2.050   -0.254  20.097  1.00 3.07  ? 260 ALA A CB   1  
ATOM   2570  H  H    . ALA A 1 165 ? 4.375   -0.934  19.192  1.00 2.33  ? 260 ALA A H    1  
ATOM   2571  H  HA   . ALA A 1 165 ? 2.871   -1.392  21.717  1.00 3.17  ? 260 ALA A HA   1  
ATOM   2572  H  HB1  . ALA A 1 165 ? 2.505   0.684   20.422  1.00 3.50  ? 260 ALA A HB1  1  
ATOM   2573  H  HB2  . ALA A 1 165 ? 2.012   -0.272  19.007  1.00 3.26  ? 260 ALA A HB2  1  
ATOM   2574  H  HB3  . ALA A 1 165 ? 1.035   -0.309  20.491  1.00 3.41  ? 260 ALA A HB3  1  
ATOM   2575  N  N    . PHE A 1 166 ? 2.315   -3.177  18.965  1.00 3.04  ? 261 PHE A N    1  
ATOM   2576  C  CA   . PHE A 1 166 ? 1.789   -4.449  18.459  1.00 3.06  ? 261 PHE A CA   1  
ATOM   2577  C  C    . PHE A 1 166 ? 2.589   -5.654  18.981  1.00 5.74  ? 261 PHE A C    1  
ATOM   2578  O  O    . PHE A 1 166 ? 1.997   -6.633  19.432  1.00 4.14  ? 261 PHE A O    1  
ATOM   2579  C  CB   . PHE A 1 166 ? 1.798   -4.389  16.925  1.00 3.34  ? 261 PHE A CB   1  
ATOM   2580  C  CG   . PHE A 1 166 ? 1.198   -5.609  16.256  1.00 3.44  ? 261 PHE A CG   1  
ATOM   2581  C  CD1  . PHE A 1 166 ? -0.200  -5.776  16.231  1.00 5.21  ? 261 PHE A CD1  1  
ATOM   2582  C  CD2  . PHE A 1 166 ? 2.030   -6.592  15.685  1.00 3.10  ? 261 PHE A CD2  1  
ATOM   2583  C  CE1  . PHE A 1 166 ? -0.761  -6.916  15.629  1.00 6.51  ? 261 PHE A CE1  1  
ATOM   2584  C  CE2  . PHE A 1 166 ? 1.466   -7.731  15.081  1.00 3.15  ? 261 PHE A CE2  1  
ATOM   2585  C  CZ   . PHE A 1 166 ? 0.070   -7.891  15.051  1.00 3.86  ? 261 PHE A CZ   1  
ATOM   2586  H  H    . PHE A 1 166 ? 2.738   -2.542  18.300  1.00 3.27  ? 261 PHE A H    1  
ATOM   2587  H  HA   . PHE A 1 166 ? 0.760   -4.567  18.804  1.00 3.11  ? 261 PHE A HA   1  
ATOM   2588  H  HB2  . PHE A 1 166 ? 1.234   -3.512  16.611  1.00 3.55  ? 261 PHE A HB2  1  
ATOM   2589  H  HB3  . PHE A 1 166 ? 2.824   -4.256  16.578  1.00 3.49  ? 261 PHE A HB3  1  
ATOM   2590  H  HD1  . PHE A 1 166 ? -0.843  -5.042  16.694  1.00 6.61  ? 261 PHE A HD1  1  
ATOM   2591  H  HD2  . PHE A 1 166 ? 3.105   -6.490  15.734  1.00 3.40  ? 261 PHE A HD2  1  
ATOM   2592  H  HE1  . PHE A 1 166 ? -1.834  -7.052  15.625  1.00 7.66  ? 261 PHE A HE1  1  
ATOM   2593  H  HE2  . PHE A 1 166 ? 2.107   -8.497  14.670  1.00 3.16  ? 261 PHE A HE2  1  
ATOM   2594  H  HZ   . PHE A 1 166 ? -0.366  -8.774  14.603  1.00 4.78  ? 261 PHE A HZ   1  
ATOM   2595  N  N    . ARG A 1 167 ? 3.924   -5.532  18.948  1.00 3.38  ? 262 ARG A N    1  
ATOM   2596  C  CA   . ARG A 1 167 ? 4.942   -6.369  19.595  1.00 4.01  ? 262 ARG A CA   1  
ATOM   2597  C  C    . ARG A 1 167 ? 5.253   -7.701  18.900  1.00 4.18  ? 262 ARG A C    1  
ATOM   2598  O  O    . ARG A 1 167 ? 4.434   -8.324  18.238  1.00 4.61  ? 262 ARG A O    1  
ATOM   2599  C  CB   . ARG A 1 167 ? 4.662   -6.585  21.088  1.00 4.28  ? 262 ARG A CB   1  
ATOM   2600  C  CG   . ARG A 1 167 ? 4.940   -5.284  21.854  1.00 5.78  ? 262 ARG A CG   1  
ATOM   2601  C  CD   . ARG A 1 167 ? 4.777   -5.456  23.361  1.00 6.07  ? 262 ARG A CD   1  
ATOM   2602  N  NE   . ARG A 1 167 ? 5.698   -6.481  23.892  1.00 6.47  ? 262 ARG A NE   1  
ATOM   2603  C  CZ   . ARG A 1 167 ? 5.405   -7.732  24.228  1.00 6.80  ? 262 ARG A CZ   1  
ATOM   2604  N  NH1  . ARG A 1 167 ? 4.173   -8.197  24.270  1.00 6.78  ? 262 ARG A NH1  1  
ATOM   2605  N  NH2  . ARG A 1 167 ? 6.399   -8.544  24.493  1.00 7.74  ? 262 ARG A NH2  1  
ATOM   2606  H  H    . ARG A 1 167 ? 4.279   -4.675  18.542  1.00 3.79  ? 262 ARG A H    1  
ATOM   2607  H  HA   . ARG A 1 167 ? 5.862   -5.787  19.568  1.00 4.71  ? 262 ARG A HA   1  
ATOM   2608  H  HB2  . ARG A 1 167 ? 3.641   -6.922  21.265  1.00 3.78  ? 262 ARG A HB2  1  
ATOM   2609  H  HB3  . ARG A 1 167 ? 5.337   -7.358  21.454  1.00 4.67  ? 262 ARG A HB3  1  
ATOM   2610  H  HG2  . ARG A 1 167 ? 5.959   -4.950  21.653  1.00 6.76  ? 262 ARG A HG2  1  
ATOM   2611  H  HG3  . ARG A 1 167 ? 4.250   -4.511  21.518  1.00 6.31  ? 262 ARG A HG3  1  
ATOM   2612  H  HD2  . ARG A 1 167 ? 5.000   -4.496  23.824  1.00 6.72  ? 262 ARG A HD2  1  
ATOM   2613  H  HD3  . ARG A 1 167 ? 3.738   -5.707  23.565  1.00 6.05  ? 262 ARG A HD3  1  
ATOM   2614  H  HE   . ARG A 1 167 ? 6.686   -6.254  23.871  1.00 6.96  ? 262 ARG A HE   1  
ATOM   2615  H  HH11 . ARG A 1 167 ? 3.398   -7.592  24.052  1.00 6.52  ? 262 ARG A HH11 1  
ATOM   2616  H  HH12 . ARG A 1 167 ? 4.007   -9.160  24.506  1.00 7.41  ? 262 ARG A HH12 1  
ATOM   2617  H  HH21 . ARG A 1 167 ? 7.346   -8.202  24.342  1.00 8.16  ? 262 ARG A HH21 1  
ATOM   2618  H  HH22 . ARG A 1 167 ? 6.276   -9.538  24.630  1.00 8.34  ? 262 ARG A HH22 1  
ATOM   2619  N  N    . SER A 1 168 ? 6.475   -8.158  19.146  1.00 4.59  ? 263 SER A N    1  
ATOM   2620  C  CA   . SER A 1 168 ? 6.885   -9.563  19.150  1.00 5.08  ? 263 SER A CA   1  
ATOM   2621  C  C    . SER A 1 168 ? 7.341   -9.860  20.598  1.00 5.96  ? 263 SER A C    1  
ATOM   2622  O  O    . SER A 1 168 ? 7.963   -8.996  21.218  1.00 6.68  ? 263 SER A O    1  
ATOM   2623  C  CB   . SER A 1 168 ? 8.026   -9.739  18.131  1.00 5.62  ? 263 SER A CB   1  
ATOM   2624  O  OG   . SER A 1 168 ? 8.699   -10.973 18.267  1.00 6.18  ? 263 SER A OG   1  
ATOM   2625  H  H    . SER A 1 168 ? 7.076   -7.558  19.690  1.00 4.95  ? 263 SER A H    1  
ATOM   2626  H  HA   . SER A 1 168 ? 6.057   -10.211 18.868  1.00 5.01  ? 263 SER A HA   1  
ATOM   2627  H  HB2  . SER A 1 168 ? 7.613   -9.663  17.124  1.00 5.58  ? 263 SER A HB2  1  
ATOM   2628  H  HB3  . SER A 1 168 ? 8.755   -8.939  18.267  1.00 6.20  ? 263 SER A HB3  1  
ATOM   2629  H  HG   . SER A 1 168 ? 8.830   -11.383 17.382  1.00 6.48  ? 263 SER A HG   1  
ATOM   2630  N  N    . VAL A 1 169 ? 7.048   -10.980 21.262  1.00 6.45  ? 264 VAL A N    1  
ATOM   2631  C  CA   . VAL A 1 169 ? 6.230   -12.162 20.925  1.00 7.09  ? 264 VAL A CA   1  
ATOM   2632  C  C    . VAL A 1 169 ? 6.782   -12.847 19.666  1.00 7.74  ? 264 VAL A C    1  
ATOM   2633  O  O    . VAL A 1 169 ? 6.238   -12.675 18.580  1.00 8.33  ? 264 VAL A O    1  
ATOM   2634  C  CB   . VAL A 1 169 ? 4.711   -11.848 20.844  1.00 7.67  ? 264 VAL A CB   1  
ATOM   2635  C  CG1  . VAL A 1 169 ? 3.891   -13.149 20.781  1.00 8.43  ? 264 VAL A CG1  1  
ATOM   2636  C  CG2  . VAL A 1 169 ? 4.236   -11.039 22.068  1.00 8.47  ? 264 VAL A CG2  1  
ATOM   2637  H  H    . VAL A 1 169 ? 7.491   -11.006 22.177  1.00 6.96  ? 264 VAL A H    1  
ATOM   2638  H  HA   . VAL A 1 169 ? 6.358   -12.854 21.758  1.00 7.43  ? 264 VAL A HA   1  
ATOM   2639  H  HB   . VAL A 1 169 ? 4.500   -11.253 19.957  1.00 7.69  ? 264 VAL A HB   1  
ATOM   2640  H  HG11 . VAL A 1 169 ? 4.079   -13.754 21.669  1.00 8.80  ? 264 VAL A HG11 1  
ATOM   2641  H  HG12 . VAL A 1 169 ? 2.827   -12.915 20.728  1.00 8.89  ? 264 VAL A HG12 1  
ATOM   2642  H  HG13 . VAL A 1 169 ? 4.157   -13.727 19.896  1.00 8.70  ? 264 VAL A HG13 1  
ATOM   2643  H  HG21 . VAL A 1 169 ? 4.705   -10.055 22.076  1.00 8.66  ? 264 VAL A HG21 1  
ATOM   2644  H  HG22 . VAL A 1 169 ? 4.488   -11.566 22.990  1.00 8.93  ? 264 VAL A HG22 1  
ATOM   2645  H  HG23 . VAL A 1 169 ? 3.156   -10.895 22.023  1.00 8.93  ? 264 VAL A HG23 1  
ATOM   2646  N  N    . LEU A 1 170 ? 7.928   -13.536 19.732  1.00 8.17  ? 265 LEU A N    1  
ATOM   2647  C  CA   . LEU A 1 170 ? 8.612   -14.180 20.850  1.00 9.18  ? 265 LEU A CA   1  
ATOM   2648  C  C    . LEU A 1 170 ? 9.586   -13.198 21.505  1.00 10.22 ? 265 LEU A C    1  
ATOM   2649  O  O    . LEU A 1 170 ? 10.704  -12.965 21.048  1.00 10.98 ? 265 LEU A O    1  
ATOM   2650  C  CB   . LEU A 1 170 ? 9.327   -15.446 20.346  1.00 9.71  ? 265 LEU A CB   1  
ATOM   2651  C  CG   . LEU A 1 170 ? 8.428   -16.433 19.571  1.00 9.65  ? 265 LEU A CG   1  
ATOM   2652  C  CD1  . LEU A 1 170 ? 9.243   -17.695 19.281  1.00 10.74 ? 265 LEU A CD1  1  
ATOM   2653  C  CD2  . LEU A 1 170 ? 7.140   -16.814 20.320  1.00 9.69  ? 265 LEU A CD2  1  
ATOM   2654  H  H    . LEU A 1 170 ? 8.474   -13.495 18.901  1.00 8.15  ? 265 LEU A H    1  
ATOM   2655  H  HA   . LEU A 1 170 ? 7.890   -14.509 21.595  1.00 9.38  ? 265 LEU A HA   1  
ATOM   2656  H  HB2  . LEU A 1 170 ? 10.152  -15.154 19.693  1.00 10.59 ? 265 LEU A HB2  1  
ATOM   2657  H  HB3  . LEU A 1 170 ? 9.754   -15.957 21.211  1.00 9.85  ? 265 LEU A HB3  1  
ATOM   2658  H  HG   . LEU A 1 170 ? 8.147   -15.985 18.617  1.00 9.31  ? 265 LEU A HG   1  
ATOM   2659  H  HD11 . LEU A 1 170 ? 9.569   -18.136 20.222  1.00 11.23 ? 265 LEU A HD11 1  
ATOM   2660  H  HD12 . LEU A 1 170 ? 8.637   -18.413 18.729  1.00 11.11 ? 265 LEU A HD12 1  
ATOM   2661  H  HD13 . LEU A 1 170 ? 10.119  -17.435 18.686  1.00 11.06 ? 265 LEU A HD13 1  
ATOM   2662  H  HD21 . LEU A 1 170 ? 7.381   -17.278 21.276  1.00 10.06 ? 265 LEU A HD21 1  
ATOM   2663  H  HD22 . LEU A 1 170 ? 6.521   -15.933 20.490  1.00 9.38  ? 265 LEU A HD22 1  
ATOM   2664  H  HD23 . LEU A 1 170 ? 6.562   -17.506 19.710  1.00 10.17 ? 265 LEU A HD23 1  
ATOM   2665  N  N    . SER A 1 171 ? 9.078   -12.616 22.582  1.00 10.64 ? 266 SER A N    1  
ATOM   2666  C  CA   . SER A 1 171 ? 9.593   -11.433 23.301  1.00 11.87 ? 266 SER A CA   1  
ATOM   2667  C  C    . SER A 1 171 ? 11.019  -11.590 23.807  1.00 13.23 ? 266 SER A C    1  
ATOM   2668  O  O    . SER A 1 171 ? 11.330  -12.640 24.408  1.00 13.98 ? 266 SER A O    1  
ATOM   2669  C  CB   . SER A 1 171 ? 8.694   -11.064 24.485  1.00 11.97 ? 266 SER A CB   1  
ATOM   2670  O  OG   . SER A 1 171 ? 7.328   -11.270 24.160  1.00 12.01 ? 266 SER A OG   1  
ATOM   2671  O  OXT  . SER A 1 171 ? 11.800  -10.630 23.636  1.00 13.77 ? 266 SER A OXT  1  
ATOM   2672  H  H    . SER A 1 171 ? 8.144   -12.934 22.780  1.00 10.27 ? 266 SER A H    1  
ATOM   2673  H  HA   . SER A 1 171 ? 9.619   -10.593 22.608  1.00 12.14 ? 266 SER A HA   1  
ATOM   2674  H  HB2  . SER A 1 171 ? 8.953   -11.688 25.346  1.00 12.11 ? 266 SER A HB2  1  
ATOM   2675  H  HB3  . SER A 1 171 ? 8.875   -10.022 24.758  1.00 12.33 ? 266 SER A HB3  1  
ATOM   2676  H  HG   . SER A 1 171 ? 7.154   -12.221 24.365  1.00 12.24 ? 266 SER A HG   1  
HETATM 2677  CU CU   . CU1 B 2 .   ? -2.180  11.530  -4.329  1.00 2.30  ? 267 CU1 A CU   1  
ATOM   2678  N  N    . SER A 1 2   ? -24.390 -21.193 3.256   1.00 13.18 ? 97  SER A N    2  
ATOM   2679  C  CA   . SER A 1 2   ? -24.793 -20.220 2.224   1.00 13.58 ? 97  SER A CA   2  
ATOM   2680  C  C    . SER A 1 2   ? -25.603 -19.099 2.843   1.00 13.13 ? 97  SER A C    2  
ATOM   2681  O  O    . SER A 1 2   ? -26.460 -19.415 3.658   1.00 13.15 ? 97  SER A O    2  
ATOM   2682  C  CB   . SER A 1 2   ? -25.626 -20.893 1.136   1.00 14.65 ? 97  SER A CB   2  
ATOM   2683  O  OG   . SER A 1 2   ? -24.931 -22.033 0.689   1.00 15.03 ? 97  SER A OG   2  
ATOM   2684  H  H    . SER A 1 2   ? -23.765 -20.749 3.918   1.00 12.55 ? 97  SER A H    2  
ATOM   2685  H  HA   . SER A 1 2   ? -23.894 -19.807 1.772   1.00 13.79 ? 97  SER A HA   2  
ATOM   2686  H  HB2  . SER A 1 2   ? -26.594 -21.196 1.537   1.00 14.68 ? 97  SER A HB2  2  
ATOM   2687  H  HB3  . SER A 1 2   ? -25.780 -20.202 0.307   1.00 15.35 ? 97  SER A HB3  2  
ATOM   2688  H  HG   . SER A 1 2   ? -25.398 -22.393 -0.095  1.00 15.84 ? 97  SER A HG   2  
ATOM   2689  N  N    . PHE A 1 3   ? -25.345 -17.843 2.440   1.00 13.09 ? 98  PHE A N    2  
ATOM   2690  C  CA   . PHE A 1 3   ? -25.967 -16.561 2.856   1.00 13.00 ? 98  PHE A CA   2  
ATOM   2691  C  C    . PHE A 1 3   ? -24.963 -15.400 2.684   1.00 12.72 ? 98  PHE A C    2  
ATOM   2692  O  O    . PHE A 1 3   ? -23.750 -15.618 2.750   1.00 11.69 ? 98  PHE A O    2  
ATOM   2693  C  CB   . PHE A 1 3   ? -26.546 -16.597 4.291   1.00 12.72 ? 98  PHE A CB   2  
ATOM   2694  C  CG   . PHE A 1 3   ? -27.045 -15.266 4.826   1.00 13.26 ? 98  PHE A CG   2  
ATOM   2695  C  CD1  . PHE A 1 3   ? -28.224 -14.694 4.310   1.00 14.88 ? 98  PHE A CD1  2  
ATOM   2696  C  CD2  . PHE A 1 3   ? -26.317 -14.586 5.824   1.00 13.18 ? 98  PHE A CD2  2  
ATOM   2697  C  CE1  . PHE A 1 3   ? -28.667 -13.447 4.783   1.00 15.19 ? 98  PHE A CE1  2  
ATOM   2698  C  CE2  . PHE A 1 3   ? -26.762 -13.338 6.294   1.00 13.95 ? 98  PHE A CE2  2  
ATOM   2699  C  CZ   . PHE A 1 3   ? -27.938 -12.768 5.774   1.00 14.67 ? 98  PHE A CZ   2  
ATOM   2700  H  H    . PHE A 1 3   ? -24.606 -17.745 1.751   1.00 13.36 ? 98  PHE A H    2  
ATOM   2701  H  HA   . PHE A 1 3   ? -26.797 -16.362 2.176   1.00 13.85 ? 98  PHE A HA   2  
ATOM   2702  H  HB2  . PHE A 1 3   ? -27.398 -17.276 4.315   1.00 13.13 ? 98  PHE A HB2  2  
ATOM   2703  H  HB3  . PHE A 1 3   ? -25.787 -16.989 4.969   1.00 12.06 ? 98  PHE A HB3  2  
ATOM   2704  H  HD1  . PHE A 1 3   ? -28.791 -15.209 3.547   1.00 15.55 ? 98  PHE A HD1  2  
ATOM   2705  H  HD2  . PHE A 1 3   ? -25.413 -15.017 6.227   1.00 12.64 ? 98  PHE A HD2  2  
ATOM   2706  H  HE1  . PHE A 1 3   ? -29.574 -13.011 4.387   1.00 16.33 ? 98  PHE A HE1  2  
ATOM   2707  H  HE2  . PHE A 1 3   ? -26.202 -12.815 7.057   1.00 14.09 ? 98  PHE A HE2  2  
ATOM   2708  H  HZ   . PHE A 1 3   ? -28.285 -11.811 6.139   1.00 15.19 ? 98  PHE A HZ   2  
ATOM   2709  N  N    . THR A 1 4   ? -25.460 -14.167 2.503   1.00 13.15 ? 99  THR A N    2  
ATOM   2710  C  CA   . THR A 1 4   ? -24.674 -12.923 2.357   1.00 13.09 ? 99  THR A CA   2  
ATOM   2711  C  C    . THR A 1 4   ? -24.140 -12.434 3.717   1.00 11.91 ? 99  THR A C    2  
ATOM   2712  O  O    . THR A 1 4   ? -24.468 -11.335 4.163   1.00 12.63 ? 99  THR A O    2  
ATOM   2713  C  CB   . THR A 1 4   ? -25.506 -11.845 1.628   1.00 14.79 ? 99  THR A CB   2  
ATOM   2714  O  OG1  . THR A 1 4   ? -26.214 -12.424 0.551   1.00 15.43 ? 99  THR A OG1  2  
ATOM   2715  C  CG2  . THR A 1 4   ? -24.616 -10.743 1.047   1.00 15.31 ? 99  THR A CG2  2  
ATOM   2716  H  H    . THR A 1 4   ? -26.465 -14.069 2.444   1.00 13.80 ? 99  THR A H    2  
ATOM   2717  H  HA   . THR A 1 4   ? -23.808 -13.143 1.733   1.00 13.00 ? 99  THR A HA   2  
ATOM   2718  H  HB   . THR A 1 4   ? -26.226 -11.402 2.321   1.00 15.53 ? 99  THR A HB   2  
ATOM   2719  H  HG1  . THR A 1 4   ? -26.243 -11.775 -0.180  1.00 15.96 ? 99  THR A HG1  2  
ATOM   2720  H  HG21 . THR A 1 4   ? -23.969 -11.152 0.270   1.00 15.42 ? 99  THR A HG21 2  
ATOM   2721  H  HG22 . THR A 1 4   ? -25.241 -9.959  0.622   1.00 16.27 ? 99  THR A HG22 2  
ATOM   2722  H  HG23 . THR A 1 4   ? -23.998 -10.299 1.826   1.00 14.93 ? 99  THR A HG23 2  
ATOM   2723  N  N    . GLY A 1 5   ? -23.349 -13.266 4.407   1.00 10.44 ? 100 GLY A N    2  
ATOM   2724  C  CA   . GLY A 1 5   ? -22.879 -13.027 5.781   1.00 9.48  ? 100 GLY A CA   2  
ATOM   2725  C  C    . GLY A 1 5   ? -21.502 -13.614 6.097   1.00 8.15  ? 100 GLY A C    2  
ATOM   2726  O  O    . GLY A 1 5   ? -21.387 -14.547 6.890   1.00 7.85  ? 100 GLY A O    2  
ATOM   2727  H  H    . GLY A 1 5   ? -23.143 -14.163 3.979   1.00 10.28 ? 100 GLY A H    2  
ATOM   2728  H  HA2  . GLY A 1 5   ? -22.855 -11.955 5.985   1.00 9.92  ? 100 GLY A HA2  2  
ATOM   2729  H  HA3  . GLY A 1 5   ? -23.590 -13.469 6.478   1.00 9.72  ? 100 GLY A HA3  2  
ATOM   2730  N  N    . GLN A 1 6   ? -20.446 -13.049 5.510   1.00 7.64  ? 101 GLN A N    2  
ATOM   2731  C  CA   . GLN A 1 6   ? -19.051 -13.398 5.791   1.00 6.60  ? 101 GLN A CA   2  
ATOM   2732  C  C    . GLN A 1 6   ? -18.177 -12.179 5.472   1.00 5.94  ? 101 GLN A C    2  
ATOM   2733  O  O    . GLN A 1 6   ? -18.321 -11.583 4.407   1.00 7.13  ? 101 GLN A O    2  
ATOM   2734  C  CB   . GLN A 1 6   ? -18.645 -14.616 4.935   1.00 7.26  ? 101 GLN A CB   2  
ATOM   2735  C  CG   . GLN A 1 6   ? -17.191 -15.102 5.104   1.00 7.07  ? 101 GLN A CG   2  
ATOM   2736  C  CD   . GLN A 1 6   ? -16.962 -15.996 6.322   1.00 7.06  ? 101 GLN A CD   2  
ATOM   2737  O  OE1  . GLN A 1 6   ? -16.782 -17.202 6.210   1.00 7.51  ? 101 GLN A OE1  2  
ATOM   2738  N  NE2  . GLN A 1 6   ? -16.952 -15.480 7.534   1.00 7.07  ? 101 GLN A NE2  2  
ATOM   2739  H  H    . GLN A 1 6   ? -20.597 -12.292 4.858   1.00 8.21  ? 101 GLN A H    2  
ATOM   2740  H  HA   . GLN A 1 6   ? -18.947 -13.642 6.849   1.00 6.29  ? 101 GLN A HA   2  
ATOM   2741  H  HB2  . GLN A 1 6   ? -19.316 -15.450 5.147   1.00 7.88  ? 101 GLN A HB2  2  
ATOM   2742  H  HB3  . GLN A 1 6   ? -18.780 -14.347 3.885   1.00 7.80  ? 101 GLN A HB3  2  
ATOM   2743  H  HG2  . GLN A 1 6   ? -16.938 -15.693 4.224   1.00 7.72  ? 101 GLN A HG2  2  
ATOM   2744  H  HG3  . GLN A 1 6   ? -16.504 -14.257 5.138   1.00 6.79  ? 101 GLN A HG3  2  
ATOM   2745  H  HE21 . GLN A 1 6   ? -17.084 -14.497 7.713   1.00 7.09  ? 101 GLN A HE21 2  
ATOM   2746  H  HE22 . GLN A 1 6   ? -16.912 -16.155 8.286   1.00 7.45  ? 101 GLN A HE22 2  
ATOM   2747  N  N    . GLY A 1 7   ? -17.264 -11.810 6.378   1.00 4.57  ? 102 GLY A N    2  
ATOM   2748  C  CA   . GLY A 1 7   ? -16.321 -10.714 6.154   1.00 4.15  ? 102 GLY A CA   2  
ATOM   2749  C  C    . GLY A 1 7   ? -15.101 -11.171 5.360   1.00 3.41  ? 102 GLY A C    2  
ATOM   2750  O  O    . GLY A 1 7   ? -14.105 -11.580 5.954   1.00 3.82  ? 102 GLY A O    2  
ATOM   2751  H  H    . GLY A 1 7   ? -17.240 -12.270 7.281   1.00 4.40  ? 102 GLY A H    2  
ATOM   2752  H  HA2  . GLY A 1 7   ? -16.812 -9.914  5.596   1.00 4.64  ? 102 GLY A HA2  2  
ATOM   2753  H  HA3  . GLY A 1 7   ? -15.973 -10.326 7.111   1.00 4.40  ? 102 GLY A HA3  2  
ATOM   2754  N  N    . ASP A 1 8   ? -15.158 -11.056 4.034   1.00 3.08  ? 103 ASP A N    2  
ATOM   2755  C  CA   . ASP A 1 8   ? -14.027 -11.218 3.110   1.00 2.62  ? 103 ASP A CA   2  
ATOM   2756  C  C    . ASP A 1 8   ? -14.245 -10.476 1.780   1.00 2.54  ? 103 ASP A C    2  
ATOM   2757  O  O    . ASP A 1 8   ? -15.363 -10.089 1.437   1.00 3.04  ? 103 ASP A O    2  
ATOM   2758  C  CB   . ASP A 1 8   ? -13.666 -12.705 2.889   1.00 2.83  ? 103 ASP A CB   2  
ATOM   2759  C  CG   . ASP A 1 8   ? -14.678 -13.479 2.037   1.00 4.16  ? 103 ASP A CG   2  
ATOM   2760  O  OD1  . ASP A 1 8   ? -14.718 -13.270 0.802   1.00 4.99  ? 103 ASP A OD1  2  
ATOM   2761  O  OD2  . ASP A 1 8   ? -15.427 -14.299 2.605   1.00 5.05  ? 103 ASP A OD2  2  
ATOM   2762  H  H    . ASP A 1 8   ? -16.048 -10.785 3.627   1.00 3.71  ? 103 ASP A H    2  
ATOM   2763  H  HA   . ASP A 1 8   ? -13.161 -10.746 3.573   1.00 2.55  ? 103 ASP A HA   2  
ATOM   2764  H  HB2  . ASP A 1 8   ? -12.695 -12.754 2.395   1.00 2.70  ? 103 ASP A HB2  2  
ATOM   2765  H  HB3  . ASP A 1 8   ? -13.559 -13.198 3.855   1.00 3.26  ? 103 ASP A HB3  2  
ATOM   2766  N  N    . PHE A 1 9   ? -13.146 -10.292 1.043   1.00 2.10  ? 104 PHE A N    2  
ATOM   2767  C  CA   . PHE A 1 9   ? -13.066 -9.597  -0.239  1.00 1.91  ? 104 PHE A CA   2  
ATOM   2768  C  C    . PHE A 1 9   ? -12.063 -10.315 -1.157  1.00 6.56  ? 104 PHE A C    2  
ATOM   2769  O  O    . PHE A 1 9   ? -11.174 -11.035 -0.689  1.00 4.44  ? 104 PHE A O    2  
ATOM   2770  C  CB   . PHE A 1 9   ? -12.652 -8.133  0.001   1.00 2.09  ? 104 PHE A CB   2  
ATOM   2771  C  CG   . PHE A 1 9   ? -11.261 -7.945  0.585   1.00 2.11  ? 104 PHE A CG   2  
ATOM   2772  C  CD1  . PHE A 1 9   ? -11.076 -7.910  1.980   1.00 3.39  ? 104 PHE A CD1  2  
ATOM   2773  C  CD2  . PHE A 1 9   ? -10.150 -7.800  -0.269  1.00 2.51  ? 104 PHE A CD2  2  
ATOM   2774  C  CE1  . PHE A 1 9   ? -9.789  -7.730  2.517   1.00 4.44  ? 104 PHE A CE1  2  
ATOM   2775  C  CE2  . PHE A 1 9   ? -8.864  -7.617  0.268   1.00 2.80  ? 104 PHE A CE2  2  
ATOM   2776  C  CZ   . PHE A 1 9   ? -8.683  -7.580  1.661   1.00 2.17  ? 104 PHE A CZ   2  
ATOM   2777  H  H    . PHE A 1 9   ? -12.287 -10.704 1.369   1.00 1.99  ? 104 PHE A H    2  
ATOM   2778  H  HA   . PHE A 1 9   ? -14.046 -9.590  -0.723  1.00 2.01  ? 104 PHE A HA   2  
ATOM   2779  H  HB2  . PHE A 1 9   ? -12.705 -7.595  -0.946  1.00 2.04  ? 104 PHE A HB2  2  
ATOM   2780  H  HB3  . PHE A 1 9   ? -13.381 -7.667  0.667   1.00 2.33  ? 104 PHE A HB3  2  
ATOM   2781  H  HD1  . PHE A 1 9   ? -11.925 -8.009  2.642   1.00 5.70  ? 104 PHE A HD1  2  
ATOM   2782  H  HD2  . PHE A 1 9   ? -10.285 -7.825  -1.340  1.00 4.17  ? 104 PHE A HD2  2  
ATOM   2783  H  HE1  . PHE A 1 9   ? -9.651  -7.678  3.588   1.00 5.50  ? 104 PHE A HE1  2  
ATOM   2784  H  HE2  . PHE A 1 9   ? -8.018  -7.489  -0.390  1.00 3.52  ? 104 PHE A HE2  2  
ATOM   2785  H  HZ   . PHE A 1 9   ? -7.698  -7.416  2.076   1.00 2.44  ? 104 PHE A HZ   2  
ATOM   2786  N  N    . HIS A 1 10  ? -12.169 -10.078 -2.466  1.00 1.35  ? 105 HIS A N    2  
ATOM   2787  C  CA   . HIS A 1 10  ? -11.250 -10.606 -3.478  1.00 1.06  ? 105 HIS A CA   2  
ATOM   2788  C  C    . HIS A 1 10  ? -10.822 -9.501  -4.465  1.00 0.97  ? 105 HIS A C    2  
ATOM   2789  O  O    . HIS A 1 10  ? -11.640 -8.696  -4.916  1.00 1.21  ? 105 HIS A O    2  
ATOM   2790  C  CB   . HIS A 1 10  ? -11.910 -11.804 -4.196  1.00 1.18  ? 105 HIS A CB   2  
ATOM   2791  C  CG   . HIS A 1 10  ? -11.053 -13.041 -4.293  1.00 1.75  ? 105 HIS A CG   2  
ATOM   2792  N  ND1  . HIS A 1 10  ? -11.511 -14.343 -4.086  1.00 3.07  ? 105 HIS A ND1  2  
ATOM   2793  C  CD2  . HIS A 1 10  ? -9.727  -13.095 -4.617  1.00 2.23  ? 105 HIS A CD2  2  
ATOM   2794  C  CE1  . HIS A 1 10  ? -10.451 -15.145 -4.272  1.00 3.91  ? 105 HIS A CE1  2  
ATOM   2795  N  NE2  . HIS A 1 10  ? -9.364  -14.423 -4.589  1.00 3.42  ? 105 HIS A NE2  2  
ATOM   2796  H  H    . HIS A 1 10  ? -12.915 -9.479  -2.789  1.00 1.59  ? 105 HIS A H    2  
ATOM   2797  H  HA   . HIS A 1 10  ? -10.349 -10.962 -2.977  1.00 1.05  ? 105 HIS A HA   2  
ATOM   2798  H  HB2  . HIS A 1 10  ? -12.820 -12.090 -3.664  1.00 1.68  ? 105 HIS A HB2  2  
ATOM   2799  H  HB3  . HIS A 1 10  ? -12.211 -11.512 -5.202  1.00 1.82  ? 105 HIS A HB3  2  
ATOM   2800  H  HD2  . HIS A 1 10  ? -9.091  -12.260 -4.863  1.00 2.42  ? 105 HIS A HD2  2  
ATOM   2801  H  HE1  . HIS A 1 10  ? -10.474 -16.226 -4.193  1.00 5.09  ? 105 HIS A HE1  2  
ATOM   2802  H  HE2  . HIS A 1 10  ? -8.438  -14.798 -4.782  1.00 4.15  ? 105 HIS A HE2  2  
ATOM   2803  N  N    . LEU A 1 11  ? -9.531  -9.466  -4.793  1.00 0.85  ? 106 LEU A N    2  
ATOM   2804  C  CA   . LEU A 1 11  ? -8.880  -8.592  -5.767  1.00 0.80  ? 106 LEU A CA   2  
ATOM   2805  C  C    . LEU A 1 11  ? -7.969  -9.471  -6.638  1.00 0.91  ? 106 LEU A C    2  
ATOM   2806  O  O    . LEU A 1 11  ? -7.899  -10.684 -6.447  1.00 1.28  ? 106 LEU A O    2  
ATOM   2807  C  CB   . LEU A 1 11  ? -8.073  -7.508  -5.009  1.00 0.87  ? 106 LEU A CB   2  
ATOM   2808  C  CG   . LEU A 1 11  ? -8.925  -6.502  -4.202  1.00 1.12  ? 106 LEU A CG   2  
ATOM   2809  C  CD1  . LEU A 1 11  ? -8.025  -5.657  -3.290  1.00 2.22  ? 106 LEU A CD1  2  
ATOM   2810  C  CD2  . LEU A 1 11  ? -9.720  -5.570  -5.127  1.00 2.13  ? 106 LEU A CD2  2  
ATOM   2811  H  H    . LEU A 1 11  ? -8.921  -10.169 -4.390  1.00 0.98  ? 106 LEU A H    2  
ATOM   2812  H  HA   . LEU A 1 11  ? -9.618  -8.127  -6.422  1.00 0.77  ? 106 LEU A HA   2  
ATOM   2813  H  HB2  . LEU A 1 11  ? -7.386  -8.013  -4.327  1.00 1.15  ? 106 LEU A HB2  2  
ATOM   2814  H  HB3  . LEU A 1 11  ? -7.470  -6.943  -5.720  1.00 1.03  ? 106 LEU A HB3  2  
ATOM   2815  H  HG   . LEU A 1 11  ? -9.625  -7.044  -3.566  1.00 2.29  ? 106 LEU A HG   2  
ATOM   2816  H  HD11 . LEU A 1 11  ? -7.478  -6.304  -2.605  1.00 3.19  ? 106 LEU A HD11 2  
ATOM   2817  H  HD12 . LEU A 1 11  ? -7.318  -5.079  -3.884  1.00 3.11  ? 106 LEU A HD12 2  
ATOM   2818  H  HD13 . LEU A 1 11  ? -8.636  -4.971  -2.702  1.00 2.80  ? 106 LEU A HD13 2  
ATOM   2819  H  HD21 . LEU A 1 11  ? -10.312 -4.875  -4.531  1.00 2.55  ? 106 LEU A HD21 2  
ATOM   2820  H  HD22 . LEU A 1 11  ? -9.036  -5.004  -5.760  1.00 2.96  ? 106 LEU A HD22 2  
ATOM   2821  H  HD23 . LEU A 1 11  ? -10.396 -6.147  -5.756  1.00 3.15  ? 106 LEU A HD23 2  
ATOM   2822  N  N    . LEU A 1 12  ? -7.237  -8.875  -7.574  1.00 0.84  ? 107 LEU A N    2  
ATOM   2823  C  CA   . LEU A 1 12  ? -6.136  -9.545  -8.266  1.00 1.02  ? 107 LEU A CA   2  
ATOM   2824  C  C    . LEU A 1 12  ? -4.963  -8.588  -8.456  1.00 0.78  ? 107 LEU A C    2  
ATOM   2825  O  O    . LEU A 1 12  ? -5.139  -7.368  -8.427  1.00 0.76  ? 107 LEU A O    2  
ATOM   2826  C  CB   . LEU A 1 12  ? -6.603  -10.198 -9.581  1.00 1.60  ? 107 LEU A CB   2  
ATOM   2827  C  CG   . LEU A 1 12  ? -7.184  -9.202  -10.605 1.00 1.29  ? 107 LEU A CG   2  
ATOM   2828  C  CD1  . LEU A 1 12  ? -6.712  -9.571  -12.017 1.00 2.75  ? 107 LEU A CD1  2  
ATOM   2829  C  CD2  . LEU A 1 12  ? -8.719  -9.172  -10.562 1.00 2.04  ? 107 LEU A CD2  2  
ATOM   2830  H  H    . LEU A 1 12  ? -7.311  -7.877  -7.705  1.00 0.91  ? 107 LEU A H    2  
ATOM   2831  H  HA   . LEU A 1 12  ? -5.761  -10.344 -7.636  1.00 1.14  ? 107 LEU A HA   2  
ATOM   2832  H  HB2  . LEU A 1 12  ? -5.737  -10.700 -10.017 1.00 3.06  ? 107 LEU A HB2  2  
ATOM   2833  H  HB3  . LEU A 1 12  ? -7.341  -10.971 -9.363  1.00 2.61  ? 107 LEU A HB3  2  
ATOM   2834  H  HG   . LEU A 1 12  ? -6.818  -8.207  -10.371 1.00 2.49  ? 107 LEU A HG   2  
ATOM   2835  H  HD11 . LEU A 1 12  ? -7.111  -8.859  -12.739 1.00 3.34  ? 107 LEU A HD11 2  
ATOM   2836  H  HD12 . LEU A 1 12  ? -5.623  -9.535  -12.055 1.00 3.86  ? 107 LEU A HD12 2  
ATOM   2837  H  HD13 . LEU A 1 12  ? -7.047  -10.577 -12.272 1.00 3.25  ? 107 LEU A HD13 2  
ATOM   2838  H  HD21 . LEU A 1 12  ? -9.118  -10.157 -10.810 1.00 2.36  ? 107 LEU A HD21 2  
ATOM   2839  H  HD22 . LEU A 1 12  ? -9.063  -8.885  -9.570  1.00 3.19  ? 107 LEU A HD22 2  
ATOM   2840  H  HD23 . LEU A 1 12  ? -9.091  -8.445  -11.284 1.00 2.93  ? 107 LEU A HD23 2  
ATOM   2841  N  N    . ASP A 1 13  ? -3.776  -9.165  -8.612  1.00 0.76  ? 108 ASP A N    2  
ATOM   2842  C  CA   . ASP A 1 13  ? -2.562  -8.438  -8.977  1.00 0.69  ? 108 ASP A CA   2  
ATOM   2843  C  C    . ASP A 1 13  ? -2.400  -8.301  -10.500 1.00 0.93  ? 108 ASP A C    2  
ATOM   2844  O  O    . ASP A 1 13  ? -3.006  -9.018  -11.296 1.00 1.18  ? 108 ASP A O    2  
ATOM   2845  C  CB   . ASP A 1 13  ? -1.331  -9.074  -8.295  1.00 0.91  ? 108 ASP A CB   2  
ATOM   2846  C  CG   . ASP A 1 13  ? -1.065  -10.554 -8.608  1.00 1.51  ? 108 ASP A CG   2  
ATOM   2847  O  OD1  . ASP A 1 13  ? -1.216  -10.981 -9.775  1.00 2.79  ? 108 ASP A OD1  2  
ATOM   2848  O  OD2  . ASP A 1 13  ? -0.658  -11.277 -7.669  1.00 2.10  ? 108 ASP A OD2  2  
ATOM   2849  H  H    . ASP A 1 13  ? -3.737  -10.177 -8.647  1.00 0.90  ? 108 ASP A H    2  
ATOM   2850  H  HA   . ASP A 1 13  ? -2.640  -7.423  -8.588  1.00 0.76  ? 108 ASP A HA   2  
ATOM   2851  H  HB2  . ASP A 1 13  ? -0.444  -8.500  -8.566  1.00 1.97  ? 108 ASP A HB2  2  
ATOM   2852  H  HB3  . ASP A 1 13  ? -1.457  -8.969  -7.215  1.00 1.70  ? 108 ASP A HB3  2  
ATOM   2853  N  N    . HIS A 1 14  ? -1.519  -7.386  -10.903 1.00 1.06  ? 109 HIS A N    2  
ATOM   2854  C  CA   . HIS A 1 14  ? -1.067  -7.177  -12.286 1.00 1.43  ? 109 HIS A CA   2  
ATOM   2855  C  C    . HIS A 1 14  ? -0.562  -8.444  -13.019 1.00 1.68  ? 109 HIS A C    2  
ATOM   2856  O  O    . HIS A 1 14  ? -0.525  -8.466  -14.254 1.00 2.21  ? 109 HIS A O    2  
ATOM   2857  C  CB   . HIS A 1 14  ? 0.016   -6.079  -12.256 1.00 1.58  ? 109 HIS A CB   2  
ATOM   2858  C  CG   . HIS A 1 14  ? 1.094   -6.223  -11.199 1.00 1.19  ? 109 HIS A CG   2  
ATOM   2859  N  ND1  . HIS A 1 14  ? 1.471   -7.391  -10.528 1.00 2.39  ? 109 HIS A ND1  2  
ATOM   2860  C  CD2  . HIS A 1 14  ? 1.812   -5.185  -10.686 1.00 1.36  ? 109 HIS A CD2  2  
ATOM   2861  C  CE1  . HIS A 1 14  ? 2.389   -7.018  -9.621  1.00 1.53  ? 109 HIS A CE1  2  
ATOM   2862  N  NE2  . HIS A 1 14  ? 2.614   -5.695  -9.688  1.00 1.31  ? 109 HIS A NE2  2  
ATOM   2863  H  H    . HIS A 1 14  ? -1.078  -6.825  -10.186 1.00 1.08  ? 109 HIS A H    2  
ATOM   2864  H  HA   . HIS A 1 14  ? -1.913  -6.806  -12.865 1.00 1.60  ? 109 HIS A HA   2  
ATOM   2865  H  HB2  . HIS A 1 14  ? 0.493   -6.020  -13.234 1.00 2.03  ? 109 HIS A HB2  2  
ATOM   2866  H  HB3  . HIS A 1 14  ? -0.486  -5.126  -12.082 1.00 1.78  ? 109 HIS A HB3  2  
ATOM   2867  H  HD2  . HIS A 1 14  ? 1.740   -4.160  -11.000 1.00 2.57  ? 109 HIS A HD2  2  
ATOM   2868  H  HE1  . HIS A 1 14  ? 2.875   -7.689  -8.927  1.00 2.14  ? 109 HIS A HE1  2  
ATOM   2869  H  HE2  . HIS A 1 14  ? 3.261   -5.170  -9.104  1.00 2.26  ? 109 HIS A HE2  2  
ATOM   2870  N  N    . ARG A 1 15  ? -0.186  -9.499  -12.284 1.00 1.70  ? 110 ARG A N    2  
ATOM   2871  C  CA   . ARG A 1 15  ? 0.280   -10.787 -12.823 1.00 2.19  ? 110 ARG A CA   2  
ATOM   2872  C  C    . ARG A 1 15  ? -0.861  -11.807 -13.020 1.00 1.92  ? 110 ARG A C    2  
ATOM   2873  O  O    . ARG A 1 15  ? -0.635  -12.816 -13.692 1.00 2.26  ? 110 ARG A O    2  
ATOM   2874  C  CB   . ARG A 1 15  ? 1.392   -11.343 -11.913 1.00 3.05  ? 110 ARG A CB   2  
ATOM   2875  C  CG   . ARG A 1 15  ? 2.677   -10.487 -11.944 1.00 3.42  ? 110 ARG A CG   2  
ATOM   2876  C  CD   . ARG A 1 15  ? 3.622   -10.802 -13.116 1.00 3.63  ? 110 ARG A CD   2  
ATOM   2877  N  NE   . ARG A 1 15  ? 4.251   -12.135 -13.017 1.00 4.67  ? 110 ARG A NE   2  
ATOM   2878  C  CZ   . ARG A 1 15  ? 5.195   -12.514 -12.159 1.00 5.95  ? 110 ARG A CZ   2  
ATOM   2879  N  NH1  . ARG A 1 15  ? 5.693   -11.699 -11.252 1.00 6.62  ? 110 ARG A NH1  2  
ATOM   2880  N  NH2  . ARG A 1 15  ? 5.658   -13.741 -12.206 1.00 7.09  ? 110 ARG A NH2  2  
ATOM   2881  H  H    . ARG A 1 15  ? -0.288  -9.415  -11.278 1.00 1.66  ? 110 ARG A H    2  
ATOM   2882  H  HA   . ARG A 1 15  ? 0.712   -10.617 -13.809 1.00 2.61  ? 110 ARG A HA   2  
ATOM   2883  H  HB2  . ARG A 1 15  ? 1.027   -11.377 -10.887 1.00 3.90  ? 110 ARG A HB2  2  
ATOM   2884  H  HB3  . ARG A 1 15  ? 1.632   -12.365 -12.207 1.00 3.51  ? 110 ARG A HB3  2  
ATOM   2885  H  HG2  . ARG A 1 15  ? 2.414   -9.434  -12.006 1.00 3.58  ? 110 ARG A HG2  2  
ATOM   2886  H  HG3  . ARG A 1 15  ? 3.210   -10.614 -11.002 1.00 4.53  ? 110 ARG A HG3  2  
ATOM   2887  H  HD2  . ARG A 1 15  ? 3.060   -10.736 -14.048 1.00 3.66  ? 110 ARG A HD2  2  
ATOM   2888  H  HD3  . ARG A 1 15  ? 4.402   -10.040 -13.153 1.00 4.08  ? 110 ARG A HD3  2  
ATOM   2889  H  HE   . ARG A 1 15  ? 3.956   -12.820 -13.699 1.00 4.91  ? 110 ARG A HE   2  
ATOM   2890  H  HH11 . ARG A 1 15  ? 5.373   -10.749 -11.202 1.00 6.21  ? 110 ARG A HH11 2  
ATOM   2891  H  HH12 . ARG A 1 15  ? 6.415   -12.022 -10.613 1.00 7.88  ? 110 ARG A HH12 2  
ATOM   2892  H  HH21 . ARG A 1 15  ? 5.365   -14.366 -12.955 1.00 7.11  ? 110 ARG A HH21 2  
ATOM   2893  H  HH22 . ARG A 1 15  ? 6.357   -14.060 -11.549 1.00 8.19  ? 110 ARG A HH22 2  
ATOM   2894  N  N    . GLY A 1 16  ? -2.071  -11.546 -12.504 1.00 1.63  ? 111 GLY A N    2  
ATOM   2895  C  CA   . GLY A 1 16  ? -3.299  -12.328 -12.729 1.00 1.81  ? 111 GLY A CA   2  
ATOM   2896  C  C    . GLY A 1 16  ? -3.724  -13.236 -11.569 1.00 1.68  ? 111 GLY A C    2  
ATOM   2897  O  O    . GLY A 1 16  ? -4.714  -13.963 -11.700 1.00 2.13  ? 111 GLY A O    2  
ATOM   2898  H  H    . GLY A 1 16  ? -2.153  -10.722 -11.913 1.00 1.61  ? 111 GLY A H    2  
ATOM   2899  H  HA2  . GLY A 1 16  ? -4.120  -11.627 -12.889 1.00 2.14  ? 111 GLY A HA2  2  
ATOM   2900  H  HA3  . GLY A 1 16  ? -3.186  -12.953 -13.616 1.00 2.24  ? 111 GLY A HA3  2  
ATOM   2901  N  N    . ARG A 1 17  ? -3.017  -13.220 -10.431 1.00 1.48  ? 112 ARG A N    2  
ATOM   2902  C  CA   . ARG A 1 17  ? -3.370  -14.059 -9.277  1.00 1.57  ? 112 ARG A CA   2  
ATOM   2903  C  C    . ARG A 1 17  ? -4.389  -13.356 -8.383  1.00 1.40  ? 112 ARG A C    2  
ATOM   2904  O  O    . ARG A 1 17  ? -4.220  -12.195 -8.007  1.00 1.62  ? 112 ARG A O    2  
ATOM   2905  C  CB   . ARG A 1 17  ? -2.136  -14.493 -8.478  1.00 1.81  ? 112 ARG A CB   2  
ATOM   2906  C  CG   . ARG A 1 17  ? -1.212  -15.393 -9.312  1.00 2.07  ? 112 ARG A CG   2  
ATOM   2907  C  CD   . ARG A 1 17  ? -0.235  -16.136 -8.398  1.00 2.84  ? 112 ARG A CD   2  
ATOM   2908  N  NE   . ARG A 1 17  ? 0.770   -16.888 -9.163  1.00 3.36  ? 112 ARG A NE   2  
ATOM   2909  C  CZ   . ARG A 1 17  ? 0.677   -18.133 -9.613  1.00 3.71  ? 112 ARG A CZ   2  
ATOM   2910  N  NH1  . ARG A 1 17  ? -0.405  -18.871 -9.491  1.00 4.15  ? 112 ARG A NH1  2  
ATOM   2911  N  NH2  . ARG A 1 17  ? 1.703   -18.693 -10.201 1.00 4.53  ? 112 ARG A NH2  2  
ATOM   2912  H  H    . ARG A 1 17  ? -2.285  -12.520 -10.321 1.00 1.52  ? 112 ARG A H    2  
ATOM   2913  H  HA   . ARG A 1 17  ? -3.835  -14.972 -9.649  1.00 1.81  ? 112 ARG A HA   2  
ATOM   2914  H  HB2  . ARG A 1 17  ? -1.586  -13.619 -8.135  1.00 2.27  ? 112 ARG A HB2  2  
ATOM   2915  H  HB3  . ARG A 1 17  ? -2.478  -15.051 -7.605  1.00 2.41  ? 112 ARG A HB3  2  
ATOM   2916  H  HG2  . ARG A 1 17  ? -1.805  -16.126 -9.862  1.00 2.67  ? 112 ARG A HG2  2  
ATOM   2917  H  HG3  . ARG A 1 17  ? -0.657  -14.780 -10.025 1.00 2.55  ? 112 ARG A HG3  2  
ATOM   2918  H  HD2  . ARG A 1 17  ? 0.281   -15.407 -7.771  1.00 3.35  ? 112 ARG A HD2  2  
ATOM   2919  H  HD3  . ARG A 1 17  ? -0.790  -16.811 -7.744  1.00 3.43  ? 112 ARG A HD3  2  
ATOM   2920  H  HE   . ARG A 1 17  ? 1.686   -16.453 -9.218  1.00 4.20  ? 112 ARG A HE   2  
ATOM   2921  H  HH11 . ARG A 1 17  ? -1.280  -18.470 -9.170  1.00 4.29  ? 112 ARG A HH11 2  
ATOM   2922  H  HH12 . ARG A 1 17  ? -0.412  -19.798 -9.882  1.00 4.89  ? 112 ARG A HH12 2  
ATOM   2923  H  HH21 . ARG A 1 17  ? 2.528   -18.166 -10.465 1.00 5.17  ? 112 ARG A HH21 2  
ATOM   2924  H  HH22 . ARG A 1 17  ? 1.690   -19.687 -10.398 1.00 4.95  ? 112 ARG A HH22 2  
ATOM   2925  N  N    . ALA A 1 18  ? -5.453  -14.074 -8.024  1.00 1.36  ? 113 ALA A N    2  
ATOM   2926  C  CA   . ALA A 1 18  ? -6.591  -13.538 -7.287  1.00 1.35  ? 113 ALA A CA   2  
ATOM   2927  C  C    . ALA A 1 18  ? -6.289  -13.485 -5.777  1.00 1.35  ? 113 ALA A C    2  
ATOM   2928  O  O    . ALA A 1 18  ? -6.431  -14.480 -5.063  1.00 2.14  ? 113 ALA A O    2  
ATOM   2929  C  CB   . ALA A 1 18  ? -7.825  -14.371 -7.646  1.00 1.59  ? 113 ALA A CB   2  
ATOM   2930  H  H    . ALA A 1 18  ? -5.482  -15.051 -8.296  1.00 1.61  ? 113 ALA A H    2  
ATOM   2931  H  HA   . ALA A 1 18  ? -6.780  -12.519 -7.627  1.00 1.36  ? 113 ALA A HA   2  
ATOM   2932  H  HB1  . ALA A 1 18  ? -7.711  -15.393 -7.281  1.00 2.28  ? 113 ALA A HB1  2  
ATOM   2933  H  HB2  . ALA A 1 18  ? -8.714  -13.923 -7.202  1.00 2.11  ? 113 ALA A HB2  2  
ATOM   2934  H  HB3  . ALA A 1 18  ? -7.960  -14.390 -8.728  1.00 2.17  ? 113 ALA A HB3  2  
ATOM   2935  N  N    . ARG A 1 19  ? -5.844  -12.322 -5.301  1.00 0.93  ? 114 ARG A N    2  
ATOM   2936  C  CA   . ARG A 1 19  ? -5.458  -12.068 -3.909  1.00 0.97  ? 114 ARG A CA   2  
ATOM   2937  C  C    . ARG A 1 19  ? -6.700  -11.796 -3.041  1.00 0.98  ? 114 ARG A C    2  
ATOM   2938  O  O    . ARG A 1 19  ? -7.494  -10.901 -3.333  1.00 0.99  ? 114 ARG A O    2  
ATOM   2939  C  CB   . ARG A 1 19  ? -4.426  -10.920 -3.867  1.00 1.18  ? 114 ARG A CB   2  
ATOM   2940  C  CG   . ARG A 1 19  ? -2.968  -11.414 -3.762  1.00 1.28  ? 114 ARG A CG   2  
ATOM   2941  C  CD   . ARG A 1 19  ? -2.477  -12.377 -4.861  1.00 2.09  ? 114 ARG A CD   2  
ATOM   2942  N  NE   . ARG A 1 19  ? -1.508  -13.353 -4.318  1.00 2.58  ? 114 ARG A NE   2  
ATOM   2943  C  CZ   . ARG A 1 19  ? -0.290  -13.651 -4.763  1.00 3.16  ? 114 ARG A CZ   2  
ATOM   2944  N  NH1  . ARG A 1 19  ? 0.268   -13.061 -5.799  1.00 3.73  ? 114 ARG A NH1  2  
ATOM   2945  N  NH2  . ARG A 1 19  ? 0.412   -14.588 -4.163  1.00 3.93  ? 114 ARG A NH2  2  
ATOM   2946  H  H    . ARG A 1 19  ? -5.840  -11.537 -5.937  1.00 1.16  ? 114 ARG A H    2  
ATOM   2947  H  HA   . ARG A 1 19  ? -4.979  -12.966 -3.520  1.00 1.04  ? 114 ARG A HA   2  
ATOM   2948  H  HB2  . ARG A 1 19  ? -4.533  -10.281 -4.746  1.00 1.68  ? 114 ARG A HB2  2  
ATOM   2949  H  HB3  . ARG A 1 19  ? -4.621  -10.301 -2.989  1.00 1.48  ? 114 ARG A HB3  2  
ATOM   2950  H  HG2  . ARG A 1 19  ? -2.306  -10.547 -3.744  1.00 1.99  ? 114 ARG A HG2  2  
ATOM   2951  H  HG3  . ARG A 1 19  ? -2.869  -11.904 -2.799  1.00 1.92  ? 114 ARG A HG3  2  
ATOM   2952  H  HD2  . ARG A 1 19  ? -3.316  -12.942 -5.264  1.00 2.89  ? 114 ARG A HD2  2  
ATOM   2953  H  HD3  . ARG A 1 19  ? -2.047  -11.794 -5.675  1.00 2.84  ? 114 ARG A HD3  2  
ATOM   2954  H  HE   . ARG A 1 19  ? -1.825  -13.862 -3.491  1.00 3.14  ? 114 ARG A HE   2  
ATOM   2955  H  HH11 . ARG A 1 19  ? -0.231  -12.345 -6.336  1.00 3.85  ? 114 ARG A HH11 2  
ATOM   2956  H  HH12 . ARG A 1 19  ? 1.233   -13.238 -6.038  1.00 4.43  ? 114 ARG A HH12 2  
ATOM   2957  H  HH21 . ARG A 1 19  ? 0.048   -15.065 -3.342  1.00 4.34  ? 114 ARG A HH21 2  
ATOM   2958  H  HH22 . ARG A 1 19  ? 1.311   -14.872 -4.532  1.00 4.49  ? 114 ARG A HH22 2  
ATOM   2959  N  N    . CYS A 1 20  ? -6.872  -12.584 -1.982  1.00 1.17  ? 115 CYS A N    2  
ATOM   2960  C  CA   . CYS A 1 20  ? -7.981  -12.530 -1.020  1.00 1.28  ? 115 CYS A CA   2  
ATOM   2961  C  C    . CYS A 1 20  ? -7.468  -12.053 0.354   1.00 1.35  ? 115 CYS A C    2  
ATOM   2962  O  O    . CYS A 1 20  ? -6.261  -11.931 0.558   1.00 1.45  ? 115 CYS A O    2  
ATOM   2963  C  CB   . CYS A 1 20  ? -8.596  -13.943 -0.982  1.00 1.33  ? 115 CYS A CB   2  
ATOM   2964  S  SG   . CYS A 1 20  ? -10.154 -14.003 -0.047  1.00 2.93  ? 115 CYS A SG   2  
ATOM   2965  H  H    . CYS A 1 20  ? -6.119  -13.237 -1.770  1.00 1.27  ? 115 CYS A H    2  
ATOM   2966  H  HA   . CYS A 1 20  ? -8.739  -11.820 -1.356  1.00 1.41  ? 115 CYS A HA   2  
ATOM   2967  H  HB2  . CYS A 1 20  ? -8.800  -14.267 -2.003  1.00 2.47  ? 115 CYS A HB2  2  
ATOM   2968  H  HB3  . CYS A 1 20  ? -7.879  -14.649 -0.556  1.00 1.60  ? 115 CYS A HB3  2  
ATOM   2969  H  HG   . CYS A 1 20  ? -10.805 -13.023 -0.704  1.00 3.78  ? 115 CYS A HG   2  
ATOM   2970  N  N    . LYS A 1 21  ? -8.351  -11.831 1.335   1.00 1.49  ? 116 LYS A N    2  
ATOM   2971  C  CA   . LYS A 1 21  ? -7.963  -11.354 2.677   1.00 1.63  ? 116 LYS A CA   2  
ATOM   2972  C  C    . LYS A 1 21  ? -6.861  -12.193 3.371   1.00 1.52  ? 116 LYS A C    2  
ATOM   2973  O  O    . LYS A 1 21  ? -6.148  -11.681 4.230   1.00 1.67  ? 116 LYS A O    2  
ATOM   2974  C  CB   . LYS A 1 21  ? -9.209  -11.208 3.574   1.00 1.85  ? 116 LYS A CB   2  
ATOM   2975  C  CG   . LYS A 1 21  ? -9.817  -12.537 4.059   1.00 3.25  ? 116 LYS A CG   2  
ATOM   2976  C  CD   . LYS A 1 21  ? -10.807 -12.289 5.202   1.00 3.48  ? 116 LYS A CD   2  
ATOM   2977  C  CE   . LYS A 1 21  ? -11.334 -13.620 5.745   1.00 5.11  ? 116 LYS A CE   2  
ATOM   2978  N  NZ   . LYS A 1 21  ? -12.240 -13.411 6.894   1.00 5.05  ? 116 LYS A NZ   2  
ATOM   2979  H  H    . LYS A 1 21  ? -9.334  -11.942 1.119   1.00 1.59  ? 116 LYS A H    2  
ATOM   2980  H  HA   . LYS A 1 21  ? -7.553  -10.351 2.556   1.00 1.78  ? 116 LYS A HA   2  
ATOM   2981  H  HB2  . LYS A 1 21  ? -8.909  -10.625 4.446   1.00 1.82  ? 116 LYS A HB2  2  
ATOM   2982  H  HB3  . LYS A 1 21  ? -9.972  -10.637 3.043   1.00 2.75  ? 116 LYS A HB3  2  
ATOM   2983  H  HG2  . LYS A 1 21  ? -10.321 -13.035 3.230   1.00 4.51  ? 116 LYS A HG2  2  
ATOM   2984  H  HG3  . LYS A 1 21  ? -9.035  -13.192 4.440   1.00 3.86  ? 116 LYS A HG3  2  
ATOM   2985  H  HD2  . LYS A 1 21  ? -10.298 -11.754 6.007   1.00 3.09  ? 116 LYS A HD2  2  
ATOM   2986  H  HD3  . LYS A 1 21  ? -11.633 -11.677 4.845   1.00 3.89  ? 116 LYS A HD3  2  
ATOM   2987  H  HE2  . LYS A 1 21  ? -11.860 -14.157 4.950   1.00 6.26  ? 116 LYS A HE2  2  
ATOM   2988  H  HE3  . LYS A 1 21  ? -10.488 -14.234 6.068   1.00 5.80  ? 116 LYS A HE3  2  
ATOM   2989  H  HZ1  . LYS A 1 21  ? -12.420 -14.301 7.355   1.00 5.45  ? 116 LYS A HZ1  2  
ATOM   2990  H  HZ2  . LYS A 1 21  ? -11.801 -12.831 7.594   1.00 4.71  ? 116 LYS A HZ2  2  
ATOM   2991  H  HZ3  . LYS A 1 21  ? -13.107 -12.966 6.602   1.00 5.47  ? 116 LYS A HZ3  2  
ATOM   2992  N  N    . ALA A 1 22  ? -6.733  -13.476 3.014   1.00 1.42  ? 117 ALA A N    2  
ATOM   2993  C  CA   . ALA A 1 22  ? -5.726  -14.398 3.537   1.00 1.46  ? 117 ALA A CA   2  
ATOM   2994  C  C    . ALA A 1 22  ? -4.291  -14.139 3.034   1.00 1.54  ? 117 ALA A C    2  
ATOM   2995  O  O    . ALA A 1 22  ? -3.349  -14.445 3.761   1.00 1.66  ? 117 ALA A O    2  
ATOM   2996  C  CB   . ALA A 1 22  ? -6.181  -15.823 3.192   1.00 1.58  ? 117 ALA A CB   2  
ATOM   2997  H  H    . ALA A 1 22  ? -7.340  -13.813 2.286   1.00 1.47  ? 117 ALA A H    2  
ATOM   2998  H  HA   . ALA A 1 22  ? -5.690  -14.303 4.625   1.00 1.51  ? 117 ALA A HA   2  
ATOM   2999  H  HB1  . ALA A 1 22  ? -6.207  -15.958 2.109   1.00 2.53  ? 117 ALA A HB1  2  
ATOM   3000  H  HB2  . ALA A 1 22  ? -5.476  -16.541 3.617   1.00 1.96  ? 117 ALA A HB2  2  
ATOM   3001  H  HB3  . ALA A 1 22  ? -7.170  -16.017 3.610   1.00 2.15  ? 117 ALA A HB3  2  
ATOM   3002  N  N    . ASP A 1 23  ? -4.106  -13.574 1.834   1.00 1.63  ? 118 ASP A N    2  
ATOM   3003  C  CA   . ASP A 1 23  ? -2.788  -13.453 1.184   1.00 1.83  ? 118 ASP A CA   2  
ATOM   3004  C  C    . ASP A 1 23  ? -1.885  -12.460 1.930   1.00 1.73  ? 118 ASP A C    2  
ATOM   3005  O  O    . ASP A 1 23  ? -0.663  -12.583 1.945   1.00 2.00  ? 118 ASP A O    2  
ATOM   3006  C  CB   . ASP A 1 23  ? -2.967  -12.968 -0.265  1.00 2.13  ? 118 ASP A CB   2  
ATOM   3007  C  CG   . ASP A 1 23  ? -3.422  -14.055 -1.244  1.00 2.58  ? 118 ASP A CG   2  
ATOM   3008  O  OD1  . ASP A 1 23  ? -4.649  -14.265 -1.390  1.00 3.95  ? 118 ASP A OD1  2  
ATOM   3009  O  OD2  . ASP A 1 23  ? -2.541  -14.613 -1.941  1.00 2.72  ? 118 ASP A OD2  2  
ATOM   3010  H  H    . ASP A 1 23  ? -4.892  -13.141 1.363   1.00 1.65  ? 118 ASP A H    2  
ATOM   3011  H  HA   . ASP A 1 23  ? -2.284  -14.421 1.180   1.00 2.00  ? 118 ASP A HA   2  
ATOM   3012  H  HB2  . ASP A 1 23  ? -3.669  -12.134 -0.290  1.00 2.98  ? 118 ASP A HB2  2  
ATOM   3013  H  HB3  . ASP A 1 23  ? -2.007  -12.587 -0.618  1.00 2.19  ? 118 ASP A HB3  2  
ATOM   3014  N  N    . PHE A 1 24  ? -2.522  -11.483 2.574   1.00 1.54  ? 119 PHE A N    2  
ATOM   3015  C  CA   . PHE A 1 24  ? -1.894  -10.445 3.373   1.00 1.62  ? 119 PHE A CA   2  
ATOM   3016  C  C    . PHE A 1 24  ? -1.305  -10.973 4.694   1.00 6.49  ? 119 PHE A C    2  
ATOM   3017  O  O    . PHE A 1 24  ? -0.425  -10.328 5.265   1.00 4.84  ? 119 PHE A O    2  
ATOM   3018  C  CB   . PHE A 1 24  ? -2.966  -9.378  3.619   1.00 1.83  ? 119 PHE A CB   2  
ATOM   3019  C  CG   . PHE A 1 24  ? -3.573  -8.790  2.357   1.00 2.26  ? 119 PHE A CG   2  
ATOM   3020  C  CD1  . PHE A 1 24  ? -2.885  -7.811  1.617   1.00 3.23  ? 119 PHE A CD1  2  
ATOM   3021  C  CD2  . PHE A 1 24  ? -4.820  -9.253  1.901   1.00 3.41  ? 119 PHE A CD2  2  
ATOM   3022  C  CE1  . PHE A 1 24  ? -3.455  -7.286  0.444   1.00 6.37  ? 119 PHE A CE1  2  
ATOM   3023  C  CE2  . PHE A 1 24  ? -5.387  -8.736  0.726   1.00 4.24  ? 119 PHE A CE2  2  
ATOM   3024  C  CZ   . PHE A 1 24  ? -4.709  -7.743  0.002   1.00 3.60  ? 119 PHE A CZ   2  
ATOM   3025  H  H    . PHE A 1 24  ? -3.526  -11.463 2.490   1.00 1.48  ? 119 PHE A H    2  
ATOM   3026  H  HA   . PHE A 1 24  ? -1.076  -10.004 2.801   1.00 1.94  ? 119 PHE A HA   2  
ATOM   3027  H  HB2  . PHE A 1 24  ? -3.760  -9.803  4.236   1.00 1.99  ? 119 PHE A HB2  2  
ATOM   3028  H  HB3  . PHE A 1 24  ? -2.521  -8.574  4.184   1.00 1.91  ? 119 PHE A HB3  2  
ATOM   3029  H  HD1  . PHE A 1 24  ? -1.914  -7.466  1.945   1.00 4.05  ? 119 PHE A HD1  2  
ATOM   3030  H  HD2  . PHE A 1 24  ? -5.335  -10.023 2.449   1.00 4.88  ? 119 PHE A HD2  2  
ATOM   3031  H  HE1  . PHE A 1 24  ? -2.924  -6.539  -0.125  1.00 7.29  ? 119 PHE A HE1  2  
ATOM   3032  H  HE2  . PHE A 1 24  ? -6.336  -9.113  0.375   1.00 5.53  ? 119 PHE A HE2  2  
ATOM   3033  H  HZ   . PHE A 1 24  ? -5.150  -7.340  -0.898  1.00 4.49  ? 119 PHE A HZ   2  
ATOM   3034  N  N    . ARG A 1 25  ? -1.746  -12.143 5.182   1.00 1.18  ? 120 ARG A N    2  
ATOM   3035  C  CA   . ARG A 1 25  ? -1.314  -12.717 6.466   1.00 1.28  ? 120 ARG A CA   2  
ATOM   3036  C  C    . ARG A 1 25  ? 0.034   -13.458 6.337   1.00 1.68  ? 120 ARG A C    2  
ATOM   3037  O  O    . ARG A 1 25  ? 0.141   -14.654 6.620   1.00 2.62  ? 120 ARG A O    2  
ATOM   3038  C  CB   . ARG A 1 25  ? -2.456  -13.558 7.075   1.00 1.29  ? 120 ARG A CB   2  
ATOM   3039  C  CG   . ARG A 1 25  ? -2.202  -13.837 8.561   1.00 1.56  ? 120 ARG A CG   2  
ATOM   3040  C  CD   . ARG A 1 25  ? -3.395  -14.415 9.326   1.00 1.82  ? 120 ARG A CD   2  
ATOM   3041  N  NE   . ARG A 1 25  ? -3.773  -15.784 8.946   1.00 2.38  ? 120 ARG A NE   2  
ATOM   3042  C  CZ   . ARG A 1 25  ? -4.661  -16.524 9.607   1.00 2.91  ? 120 ARG A CZ   2  
ATOM   3043  N  NH1  . ARG A 1 25  ? -5.324  -16.068 10.653  1.00 3.12  ? 120 ARG A NH1  2  
ATOM   3044  N  NH2  . ARG A 1 25  ? -4.900  -17.756 9.220   1.00 4.19  ? 120 ARG A NH2  2  
ATOM   3045  H  H    . ARG A 1 25  ? -2.400  -12.678 4.620   1.00 1.18  ? 120 ARG A H    2  
ATOM   3046  H  HA   . ARG A 1 25  ? -1.143  -11.879 7.144   1.00 1.48  ? 120 ARG A HA   2  
ATOM   3047  H  HB2  . ARG A 1 25  ? -3.390  -12.999 6.985   1.00 1.46  ? 120 ARG A HB2  2  
ATOM   3048  H  HB3  . ARG A 1 25  ? -2.561  -14.500 6.548   1.00 1.47  ? 120 ARG A HB3  2  
ATOM   3049  H  HG2  . ARG A 1 25  ? -1.353  -14.508 8.679   1.00 2.07  ? 120 ARG A HG2  2  
ATOM   3050  H  HG3  . ARG A 1 25  ? -1.960  -12.885 9.029   1.00 2.23  ? 120 ARG A HG3  2  
ATOM   3051  H  HD2  . ARG A 1 25  ? -3.109  -14.437 10.376  1.00 2.63  ? 120 ARG A HD2  2  
ATOM   3052  H  HD3  . ARG A 1 25  ? -4.253  -13.750 9.204   1.00 2.80  ? 120 ARG A HD3  2  
ATOM   3053  H  HE   . ARG A 1 25  ? -3.294  -16.205 8.166   1.00 3.27  ? 120 ARG A HE   2  
ATOM   3054  H  HH11 . ARG A 1 25  ? -5.185  -15.124 10.990  1.00 3.36  ? 120 ARG A HH11 2  
ATOM   3055  H  HH12 . ARG A 1 25  ? -6.011  -16.666 11.113  1.00 3.80  ? 120 ARG A HH12 2  
ATOM   3056  H  HH21 . ARG A 1 25  ? -4.442  -18.154 8.406   1.00 5.08  ? 120 ARG A HH21 2  
ATOM   3057  H  HH22 . ARG A 1 25  ? -5.589  -18.315 9.704   1.00 4.68  ? 120 ARG A HH22 2  
ATOM   3058  N  N    . GLY A 1 26  ? 1.067   -12.741 5.878   1.00 1.83  ? 121 GLY A N    2  
ATOM   3059  C  CA   . GLY A 1 26  ? 2.431   -13.256 5.659   1.00 2.40  ? 121 GLY A CA   2  
ATOM   3060  C  C    . GLY A 1 26  ? 3.573   -12.374 6.179   1.00 1.89  ? 121 GLY A C    2  
ATOM   3061  O  O    . GLY A 1 26  ? 4.710   -12.841 6.211   1.00 2.50  ? 121 GLY A O    2  
ATOM   3062  H  H    . GLY A 1 26  ? 0.857   -11.788 5.604   1.00 2.19  ? 121 GLY A H    2  
ATOM   3063  H  HA2  . GLY A 1 26  ? 2.537   -14.246 6.104   1.00 3.15  ? 121 GLY A HA2  2  
ATOM   3064  H  HA3  . GLY A 1 26  ? 2.580   -13.352 4.583   1.00 2.96  ? 121 GLY A HA3  2  
ATOM   3065  N  N    . GLN A 1 27  ? 3.297   -11.128 6.585   1.00 1.34  ? 122 GLN A N    2  
ATOM   3066  C  CA   . GLN A 1 27  ? 4.265   -10.107 7.011   1.00 1.20  ? 122 GLN A CA   2  
ATOM   3067  C  C    . GLN A 1 27  ? 3.486   -8.908  7.599   1.00 1.09  ? 122 GLN A C    2  
ATOM   3068  O  O    . GLN A 1 27  ? 2.256   -8.907  7.578   1.00 1.88  ? 122 GLN A O    2  
ATOM   3069  C  CB   . GLN A 1 27  ? 5.176   -9.726  5.814   1.00 1.59  ? 122 GLN A CB   2  
ATOM   3070  C  CG   . GLN A 1 27  ? 6.347   -8.787  6.163   1.00 2.91  ? 122 GLN A CG   2  
ATOM   3071  C  CD   . GLN A 1 27  ? 7.589   -9.002  5.296   1.00 3.66  ? 122 GLN A CD   2  
ATOM   3072  O  OE1  . GLN A 1 27  ? 8.689   -9.172  5.800   1.00 4.67  ? 122 GLN A OE1  2  
ATOM   3073  N  NE2  . GLN A 1 27  ? 7.488   -9.036  3.984   1.00 3.73  ? 122 GLN A NE2  2  
ATOM   3074  H  H    . GLN A 1 27  ? 2.335   -10.815 6.575   1.00 1.58  ? 122 GLN A H    2  
ATOM   3075  H  HA   . GLN A 1 27  ? 4.890   -10.521 7.803   1.00 1.46  ? 122 GLN A HA   2  
ATOM   3076  H  HB2  . GLN A 1 27  ? 5.607   -10.638 5.403   1.00 2.33  ? 122 GLN A HB2  2  
ATOM   3077  H  HB3  . GLN A 1 27  ? 4.572   -9.265  5.031   1.00 1.61  ? 122 GLN A HB3  2  
ATOM   3078  H  HG2  . GLN A 1 27  ? 6.023   -7.752  6.053   1.00 3.31  ? 122 GLN A HG2  2  
ATOM   3079  H  HG3  . GLN A 1 27  ? 6.642   -8.951  7.200   1.00 3.75  ? 122 GLN A HG3  2  
ATOM   3080  H  HE21 . GLN A 1 27  ? 6.590   -8.995  3.518   1.00 3.55  ? 122 GLN A HE21 2  
ATOM   3081  H  HE22 . GLN A 1 27  ? 8.345   -9.190  3.465   1.00 4.35  ? 122 GLN A HE22 2  
ATOM   3082  N  N    . TRP A 1 28  ? 4.170   -7.873  8.105   1.00 1.18  ? 123 TRP A N    2  
ATOM   3083  C  CA   . TRP A 1 28  ? 3.548   -6.567  8.345   1.00 1.07  ? 123 TRP A CA   2  
ATOM   3084  C  C    . TRP A 1 28  ? 3.105   -5.946  7.005   1.00 1.09  ? 123 TRP A C    2  
ATOM   3085  O  O    . TRP A 1 28  ? 3.947   -5.662  6.145   1.00 1.29  ? 123 TRP A O    2  
ATOM   3086  C  CB   . TRP A 1 28  ? 4.535   -5.632  9.076   1.00 1.14  ? 123 TRP A CB   2  
ATOM   3087  C  CG   . TRP A 1 28  ? 4.281   -5.350  10.529  1.00 1.09  ? 123 TRP A CG   2  
ATOM   3088  C  CD1  . TRP A 1 28  ? 5.216   -5.380  11.505  1.00 1.74  ? 123 TRP A CD1  2  
ATOM   3089  C  CD2  . TRP A 1 28  ? 3.049   -4.897  11.181  1.00 2.00  ? 123 TRP A CD2  2  
ATOM   3090  N  NE1  . TRP A 1 28  ? 4.668   -4.928  12.691  1.00 1.47  ? 123 TRP A NE1  2  
ATOM   3091  C  CE2  . TRP A 1 28  ? 3.329   -4.652  12.558  1.00 1.48  ? 123 TRP A CE2  2  
ATOM   3092  C  CE3  . TRP A 1 28  ? 1.728   -4.651  10.753  1.00 3.78  ? 123 TRP A CE3  2  
ATOM   3093  C  CZ2  . TRP A 1 28  ? 2.360   -4.192  13.460  1.00 2.39  ? 123 TRP A CZ2  2  
ATOM   3094  C  CZ3  . TRP A 1 28  ? 0.734   -4.231  11.657  1.00 4.90  ? 123 TRP A CZ3  2  
ATOM   3095  C  CH2  . TRP A 1 28  ? 1.053   -3.982  13.002  1.00 4.17  ? 123 TRP A CH2  2  
ATOM   3096  H  H    . TRP A 1 28  ? 5.176   -7.914  8.137   1.00 1.92  ? 123 TRP A H    2  
ATOM   3097  H  HA   . TRP A 1 28  ? 2.665   -6.707  8.969   1.00 1.10  ? 123 TRP A HA   2  
ATOM   3098  H  HB2  . TRP A 1 28  ? 5.556   -6.001  8.954   1.00 1.35  ? 123 TRP A HB2  2  
ATOM   3099  H  HB3  . TRP A 1 28  ? 4.512   -4.659  8.586   1.00 1.28  ? 123 TRP A HB3  2  
ATOM   3100  H  HD1  . TRP A 1 28  ? 6.249   -5.665  11.351  1.00 2.94  ? 123 TRP A HD1  2  
ATOM   3101  H  HE1  . TRP A 1 28  ? 5.193   -4.740  13.533  1.00 2.29  ? 123 TRP A HE1  2  
ATOM   3102  H  HE3  . TRP A 1 28  ? 1.481   -4.781  9.713   1.00 4.35  ? 123 TRP A HE3  2  
ATOM   3103  H  HZ2  . TRP A 1 28  ? 2.618   -3.997  14.490  1.00 1.96  ? 123 TRP A HZ2  2  
ATOM   3104  H  HZ3  . TRP A 1 28  ? -0.277  -4.076  11.312  1.00 6.36  ? 123 TRP A HZ3  2  
ATOM   3105  H  HH2  . TRP A 1 28  ? 0.301   -3.611  13.680  1.00 5.03  ? 123 TRP A HH2  2  
ATOM   3106  N  N    . VAL A 1 29  ? 1.802   -5.711  6.838   1.00 1.20  ? 124 VAL A N    2  
ATOM   3107  C  CA   . VAL A 1 29  ? 1.218   -5.081  5.642   1.00 1.32  ? 124 VAL A CA   2  
ATOM   3108  C  C    . VAL A 1 29  ? 0.774   -3.647  5.956   1.00 1.30  ? 124 VAL A C    2  
ATOM   3109  O  O    . VAL A 1 29  ? 0.237   -3.368  7.026   1.00 1.32  ? 124 VAL A O    2  
ATOM   3110  C  CB   . VAL A 1 29  ? 0.056   -5.941  5.095   1.00 1.59  ? 124 VAL A CB   2  
ATOM   3111  C  CG1  . VAL A 1 29  ? -0.845  -5.211  4.084   1.00 2.10  ? 124 VAL A CG1  2  
ATOM   3112  C  CG2  . VAL A 1 29  ? 0.622   -7.202  4.416   1.00 1.67  ? 124 VAL A CG2  2  
ATOM   3113  H  H    . VAL A 1 29  ? 1.152   -6.012  7.567   1.00 1.35  ? 124 VAL A H    2  
ATOM   3114  H  HA   . VAL A 1 29  ? 1.977   -5.022  4.860   1.00 1.37  ? 124 VAL A HA   2  
ATOM   3115  H  HB   . VAL A 1 29  ? -0.569  -6.250  5.932   1.00 2.60  ? 124 VAL A HB   2  
ATOM   3116  H  HG11 . VAL A 1 29  ? -0.245  -4.819  3.264   1.00 2.18  ? 124 VAL A HG11 2  
ATOM   3117  H  HG12 . VAL A 1 29  ? -1.594  -5.896  3.688   1.00 3.02  ? 124 VAL A HG12 2  
ATOM   3118  H  HG13 . VAL A 1 29  ? -1.369  -4.390  4.573   1.00 3.04  ? 124 VAL A HG13 2  
ATOM   3119  H  HG21 . VAL A 1 29  ? 1.200   -7.788  5.131   1.00 2.69  ? 124 VAL A HG21 2  
ATOM   3120  H  HG22 . VAL A 1 29  ? -0.193  -7.820  4.040   1.00 2.20  ? 124 VAL A HG22 2  
ATOM   3121  H  HG23 . VAL A 1 29  ? 1.266   -6.922  3.582   1.00 2.27  ? 124 VAL A HG23 2  
ATOM   3122  N  N    . LEU A 1 30  ? 0.989   -2.751  4.992   1.00 1.31  ? 125 LEU A N    2  
ATOM   3123  C  CA   . LEU A 1 30  ? 0.593   -1.346  4.993   1.00 1.28  ? 125 LEU A CA   2  
ATOM   3124  C  C    . LEU A 1 30  ? -0.280  -1.088  3.756   1.00 1.17  ? 125 LEU A C    2  
ATOM   3125  O  O    . LEU A 1 30  ? 0.183   -1.207  2.621   1.00 1.09  ? 125 LEU A O    2  
ATOM   3126  C  CB   . LEU A 1 30  ? 1.890   -0.516  4.996   1.00 1.41  ? 125 LEU A CB   2  
ATOM   3127  C  CG   . LEU A 1 30  ? 1.728   1.012   4.942   1.00 1.36  ? 125 LEU A CG   2  
ATOM   3128  C  CD1  . LEU A 1 30  ? 1.048   1.541   6.212   1.00 3.15  ? 125 LEU A CD1  2  
ATOM   3129  C  CD2  . LEU A 1 30  ? 3.124   1.636   4.791   1.00 1.93  ? 125 LEU A CD2  2  
ATOM   3130  H  H    . LEU A 1 30  ? 1.486   -3.066  4.163   1.00 1.33  ? 125 LEU A H    2  
ATOM   3131  H  HA   . LEU A 1 30  ? 0.018   -1.121  5.891   1.00 1.29  ? 125 LEU A HA   2  
ATOM   3132  H  HB2  . LEU A 1 30  ? 2.446   -0.767  5.899   1.00 2.18  ? 125 LEU A HB2  2  
ATOM   3133  H  HB3  . LEU A 1 30  ? 2.495   -0.823  4.142   1.00 1.94  ? 125 LEU A HB3  2  
ATOM   3134  H  HG   . LEU A 1 30  ? 1.129   1.289   4.074   1.00 2.26  ? 125 LEU A HG   2  
ATOM   3135  H  HD11 . LEU A 1 30  ? 1.624   1.246   7.089   1.00 3.48  ? 125 LEU A HD11 2  
ATOM   3136  H  HD12 . LEU A 1 30  ? 0.997   2.627   6.184   1.00 3.80  ? 125 LEU A HD12 2  
ATOM   3137  H  HD13 . LEU A 1 30  ? 0.035   1.148   6.291   1.00 4.42  ? 125 LEU A HD13 2  
ATOM   3138  H  HD21 . LEU A 1 30  ? 3.049   2.719   4.728   1.00 2.42  ? 125 LEU A HD21 2  
ATOM   3139  H  HD22 . LEU A 1 30  ? 3.749   1.372   5.646   1.00 3.07  ? 125 LEU A HD22 2  
ATOM   3140  H  HD23 . LEU A 1 30  ? 3.597   1.270   3.878   1.00 2.89  ? 125 LEU A HD23 2  
ATOM   3141  N  N    . MET A 1 31  ? -1.557  -0.765  3.961   1.00 1.23  ? 126 MET A N    2  
ATOM   3142  C  CA   . MET A 1 31  ? -2.529  -0.575  2.876   1.00 1.15  ? 126 MET A CA   2  
ATOM   3143  C  C    . MET A 1 31  ? -2.694  0.909   2.539   1.00 1.11  ? 126 MET A C    2  
ATOM   3144  O  O    . MET A 1 31  ? -2.949  1.720   3.426   1.00 1.20  ? 126 MET A O    2  
ATOM   3145  C  CB   . MET A 1 31  ? -3.878  -1.209  3.254   1.00 1.25  ? 126 MET A CB   2  
ATOM   3146  C  CG   . MET A 1 31  ? -3.739  -2.720  3.492   1.00 2.16  ? 126 MET A CG   2  
ATOM   3147  S  SD   . MET A 1 31  ? -5.300  -3.578  3.816   1.00 2.24  ? 126 MET A SD   2  
ATOM   3148  C  CE   . MET A 1 31  ? -4.764  -5.275  3.482   1.00 3.78  ? 126 MET A CE   2  
ATOM   3149  H  H    . MET A 1 31  ? -1.880  -0.662  4.918   1.00 1.38  ? 126 MET A H    2  
ATOM   3150  H  HA   . MET A 1 31  ? -2.171  -1.077  1.976   1.00 1.13  ? 126 MET A HA   2  
ATOM   3151  H  HB2  . MET A 1 31  ? -4.271  -0.737  4.155   1.00 1.62  ? 126 MET A HB2  2  
ATOM   3152  H  HB3  . MET A 1 31  ? -4.588  -1.045  2.441   1.00 1.80  ? 126 MET A HB3  2  
ATOM   3153  H  HG2  . MET A 1 31  ? -3.268  -3.170  2.617   1.00 3.01  ? 126 MET A HG2  2  
ATOM   3154  H  HG3  . MET A 1 31  ? -3.085  -2.880  4.350   1.00 2.91  ? 126 MET A HG3  2  
ATOM   3155  H  HE1  . MET A 1 31  ? -4.428  -5.360  2.448   1.00 4.29  ? 126 MET A HE1  2  
ATOM   3156  H  HE2  . MET A 1 31  ? -3.947  -5.545  4.151   1.00 4.68  ? 126 MET A HE2  2  
ATOM   3157  H  HE3  . MET A 1 31  ? -5.594  -5.966  3.635   1.00 4.42  ? 126 MET A HE3  2  
ATOM   3158  N  N    . TYR A 1 32  ? -2.579  1.247   1.253   1.00 1.06  ? 127 TYR A N    2  
ATOM   3159  C  CA   . TYR A 1 32  ? -2.849  2.570   0.677   1.00 1.07  ? 127 TYR A CA   2  
ATOM   3160  C  C    . TYR A 1 32  ? -3.969  2.486   -0.377  1.00 1.09  ? 127 TYR A C    2  
ATOM   3161  O  O    . TYR A 1 32  ? -3.962  1.572   -1.204  1.00 1.12  ? 127 TYR A O    2  
ATOM   3162  C  CB   . TYR A 1 32  ? -1.551  3.099   0.043   1.00 1.08  ? 127 TYR A CB   2  
ATOM   3163  C  CG   . TYR A 1 32  ? -1.729  4.306   -0.863  1.00 1.23  ? 127 TYR A CG   2  
ATOM   3164  C  CD1  . TYR A 1 32  ? -2.105  5.555   -0.332  1.00 1.85  ? 127 TYR A CD1  2  
ATOM   3165  C  CD2  . TYR A 1 32  ? -1.546  4.164   -2.252  1.00 2.35  ? 127 TYR A CD2  2  
ATOM   3166  C  CE1  . TYR A 1 32  ? -2.293  6.660   -1.184  1.00 1.99  ? 127 TYR A CE1  2  
ATOM   3167  C  CE2  . TYR A 1 32  ? -1.741  5.262   -3.109  1.00 2.71  ? 127 TYR A CE2  2  
ATOM   3168  C  CZ   . TYR A 1 32  ? -2.115  6.516   -2.578  1.00 1.96  ? 127 TYR A CZ   2  
ATOM   3169  O  OH   . TYR A 1 32  ? -2.305  7.571   -3.414  1.00 2.40  ? 127 TYR A OH   2  
ATOM   3170  H  H    . TYR A 1 32  ? -2.300  0.529   0.597   1.00 1.08  ? 127 TYR A H    2  
ATOM   3171  H  HA   . TYR A 1 32  ? -3.171  3.262   1.457   1.00 1.11  ? 127 TYR A HA   2  
ATOM   3172  H  HB2  . TYR A 1 32  ? -0.843  3.351   0.833   1.00 1.08  ? 127 TYR A HB2  2  
ATOM   3173  H  HB3  . TYR A 1 32  ? -1.099  2.298   -0.543  1.00 1.20  ? 127 TYR A HB3  2  
ATOM   3174  H  HD1  . TYR A 1 32  ? -2.258  5.677   0.730   1.00 2.87  ? 127 TYR A HD1  2  
ATOM   3175  H  HD2  . TYR A 1 32  ? -1.255  3.209   -2.664  1.00 3.33  ? 127 TYR A HD2  2  
ATOM   3176  H  HE1  . TYR A 1 32  ? -2.578  7.619   -0.774  1.00 2.89  ? 127 TYR A HE1  2  
ATOM   3177  H  HE2  . TYR A 1 32  ? -1.598  5.157   -4.174  1.00 3.88  ? 127 TYR A HE2  2  
ATOM   3178  H  HH   . TYR A 1 32  ? -2.414  8.412   -2.934  1.00 2.33  ? 127 TYR A HH   2  
ATOM   3179  N  N    . PHE A 1 33  ? -4.899  3.451   -0.353  1.00 1.14  ? 128 PHE A N    2  
ATOM   3180  C  CA   . PHE A 1 33  ? -6.037  3.559   -1.273  1.00 1.23  ? 128 PHE A CA   2  
ATOM   3181  C  C    . PHE A 1 33  ? -5.870  4.796   -2.173  1.00 5.71  ? 128 PHE A C    2  
ATOM   3182  O  O    . PHE A 1 33  ? -6.161  5.919   -1.757  1.00 3.98  ? 128 PHE A O    2  
ATOM   3183  C  CB   . PHE A 1 33  ? -7.341  3.620   -0.460  1.00 1.42  ? 128 PHE A CB   2  
ATOM   3184  C  CG   . PHE A 1 33  ? -7.710  2.322   0.235   1.00 1.47  ? 128 PHE A CG   2  
ATOM   3185  C  CD1  . PHE A 1 33  ? -7.203  2.029   1.517   1.00 2.86  ? 128 PHE A CD1  2  
ATOM   3186  C  CD2  . PHE A 1 33  ? -8.585  1.413   -0.392  1.00 2.45  ? 128 PHE A CD2  2  
ATOM   3187  C  CE1  . PHE A 1 33  ? -7.576  0.841   2.170   1.00 7.07  ? 128 PHE A CE1  2  
ATOM   3188  C  CE2  . PHE A 1 33  ? -8.962  0.228   0.265   1.00 2.00  ? 128 PHE A CE2  2  
ATOM   3189  C  CZ   . PHE A 1 33  ? -8.459  -0.057  1.545   1.00 2.62  ? 128 PHE A CZ   2  
ATOM   3190  H  H    . PHE A 1 33  ? -4.797  4.190   0.328   1.00 1.18  ? 128 PHE A H    2  
ATOM   3191  H  HA   . PHE A 1 33  ? -6.087  2.678   -1.911  1.00 1.18  ? 128 PHE A HA   2  
ATOM   3192  H  HB2  . PHE A 1 33  ? -7.271  4.417   0.282   1.00 1.52  ? 128 PHE A HB2  2  
ATOM   3193  H  HB3  . PHE A 1 33  ? -8.155  3.885   -1.135  1.00 1.48  ? 128 PHE A HB3  2  
ATOM   3194  H  HD1  . PHE A 1 33  ? -6.534  2.722   2.006   1.00 3.07  ? 128 PHE A HD1  2  
ATOM   3195  H  HD2  . PHE A 1 33  ? -8.978  1.629   -1.376  1.00 3.10  ? 128 PHE A HD2  2  
ATOM   3196  H  HE1  . PHE A 1 33  ? -7.192  0.623   3.157   1.00 8.29  ? 128 PHE A HE1  2  
ATOM   3197  H  HE2  . PHE A 1 33  ? -9.640  -0.463  -0.215  1.00 2.86  ? 128 PHE A HE2  2  
ATOM   3198  H  HZ   . PHE A 1 33  ? -8.746  -0.971  2.045   1.00 4.68  ? 128 PHE A HZ   2  
ATOM   3199  N  N    . GLY A 1 34  ? -5.383  4.585   -3.401  1.00 1.20  ? 129 GLY A N    2  
ATOM   3200  C  CA   . GLY A 1 34  ? -4.965  5.658   -4.316  1.00 1.26  ? 129 GLY A CA   2  
ATOM   3201  C  C    . GLY A 1 34  ? -5.854  5.833   -5.544  1.00 1.24  ? 129 GLY A C    2  
ATOM   3202  O  O    . GLY A 1 34  ? -6.448  4.871   -6.037  1.00 1.19  ? 129 GLY A O    2  
ATOM   3203  H  H    . GLY A 1 34  ? -5.234  3.621   -3.687  1.00 1.23  ? 129 GLY A H    2  
ATOM   3204  H  HA2  . GLY A 1 34  ? -4.915  6.609   -3.782  1.00 1.43  ? 129 GLY A HA2  2  
ATOM   3205  H  HA3  . GLY A 1 34  ? -3.970  5.431   -4.692  1.00 1.28  ? 129 GLY A HA3  2  
ATOM   3206  N  N    . PHE A 1 35  ? -5.884  7.058   -6.076  1.00 1.54  ? 130 PHE A N    2  
ATOM   3207  C  CA   . PHE A 1 35  ? -6.488  7.393   -7.369  1.00 1.70  ? 130 PHE A CA   2  
ATOM   3208  C  C    . PHE A 1 35  ? -5.428  7.925   -8.345  1.00 5.14  ? 130 PHE A C    2  
ATOM   3209  O  O    . PHE A 1 35  ? -4.416  8.493   -7.926  1.00 3.90  ? 130 PHE A O    2  
ATOM   3210  C  CB   . PHE A 1 35  ? -7.644  8.394   -7.180  1.00 2.10  ? 130 PHE A CB   2  
ATOM   3211  C  CG   . PHE A 1 35  ? -7.288  9.873   -7.154  1.00 2.12  ? 130 PHE A CG   2  
ATOM   3212  C  CD1  . PHE A 1 35  ? -6.712  10.466  -6.012  1.00 3.90  ? 130 PHE A CD1  2  
ATOM   3213  C  CD2  . PHE A 1 35  ? -7.569  10.672  -8.280  1.00 3.15  ? 130 PHE A CD2  2  
ATOM   3214  C  CE1  . PHE A 1 35  ? -6.434  11.847  -6.000  1.00 4.36  ? 130 PHE A CE1  2  
ATOM   3215  C  CE2  . PHE A 1 35  ? -7.285  12.048  -8.268  1.00 5.11  ? 130 PHE A CE2  2  
ATOM   3216  C  CZ   . PHE A 1 35  ? -6.727  12.640  -7.124  1.00 3.28  ? 130 PHE A CZ   2  
ATOM   3217  H  H    . PHE A 1 35  ? -5.333  7.782   -5.636  1.00 1.75  ? 130 PHE A H    2  
ATOM   3218  H  HA   . PHE A 1 35  ? -6.912  6.487   -7.805  1.00 1.80  ? 130 PHE A HA   2  
ATOM   3219  H  HB2  . PHE A 1 35  ? -8.322  8.247   -8.016  1.00 2.47  ? 130 PHE A HB2  2  
ATOM   3220  H  HB3  . PHE A 1 35  ? -8.203  8.141   -6.278  1.00 2.83  ? 130 PHE A HB3  2  
ATOM   3221  H  HD1  . PHE A 1 35  ? -6.490  9.870   -5.140  1.00 5.27  ? 130 PHE A HD1  2  
ATOM   3222  H  HD2  . PHE A 1 35  ? -8.015  10.232  -9.161  1.00 3.23  ? 130 PHE A HD2  2  
ATOM   3223  H  HE1  . PHE A 1 35  ? -5.985  12.299  -5.125  1.00 5.81  ? 130 PHE A HE1  2  
ATOM   3224  H  HE2  . PHE A 1 35  ? -7.509  12.653  -9.134  1.00 5.48  ? 130 PHE A HE2  2  
ATOM   3225  H  HZ   . PHE A 1 35  ? -6.532  13.706  -7.110  1.00 4.36  ? 130 PHE A HZ   2  
ATOM   3226  N  N    . THR A 1 36  ? -5.644  7.765   -9.656  1.00 1.68  ? 131 THR A N    2  
ATOM   3227  C  CA   . THR A 1 36  ? -4.733  8.334   -10.666 1.00 1.93  ? 131 THR A CA   2  
ATOM   3228  C  C    . THR A 1 36  ? -4.991  9.835   -10.795 1.00 2.52  ? 131 THR A C    2  
ATOM   3229  O  O    . THR A 1 36  ? -6.129  10.206  -11.073 1.00 4.02  ? 131 THR A O    2  
ATOM   3230  C  CB   . THR A 1 36  ? -4.870  7.645   -12.025 1.00 1.92  ? 131 THR A CB   2  
ATOM   3231  O  OG1  . THR A 1 36  ? -6.206  7.725   -12.434 1.00 3.03  ? 131 THR A OG1  2  
ATOM   3232  C  CG2  . THR A 1 36  ? -4.460  6.174   -11.985 1.00 1.98  ? 131 THR A CG2  2  
ATOM   3233  H  H    . THR A 1 36  ? -6.501  7.315   -9.965  1.00 2.25  ? 131 THR A H    2  
ATOM   3234  H  HA   . THR A 1 36  ? -3.707  8.185   -10.331 1.00 2.08  ? 131 THR A HA   2  
ATOM   3235  H  HB   . THR A 1 36  ? -4.240  8.165   -12.751 1.00 2.24  ? 131 THR A HB   2  
ATOM   3236  H  HG1  . THR A 1 36  ? -6.552  8.571   -12.111 1.00 3.95  ? 131 THR A HG1  2  
ATOM   3237  H  HG21 . THR A 1 36  ? -4.588  5.737   -12.976 1.00 2.37  ? 131 THR A HG21 2  
ATOM   3238  H  HG22 . THR A 1 36  ? -3.414  6.090   -11.692 1.00 2.37  ? 131 THR A HG22 2  
ATOM   3239  H  HG23 . THR A 1 36  ? -5.078  5.628   -11.274 1.00 3.16  ? 131 THR A HG23 2  
ATOM   3240  N  N    . HIS A 1 37  ? -3.935  10.649  -10.623 1.00 1.81  ? 132 HIS A N    2  
ATOM   3241  C  CA   . HIS A 1 37  ? -3.835  12.116  -10.788 1.00 2.18  ? 132 HIS A CA   2  
ATOM   3242  C  C    . HIS A 1 37  ? -3.861  12.882  -9.447  1.00 2.05  ? 132 HIS A C    2  
ATOM   3243  O  O    . HIS A 1 37  ? -4.158  14.076  -9.458  1.00 2.85  ? 132 HIS A O    2  
ATOM   3244  C  CB   . HIS A 1 37  ? -4.824  12.734  -11.813 1.00 2.84  ? 132 HIS A CB   2  
ATOM   3245  C  CG   . HIS A 1 37  ? -4.858  12.114  -13.193 1.00 2.92  ? 132 HIS A CG   2  
ATOM   3246  N  ND1  . HIS A 1 37  ? -3.856  12.125  -14.153 1.00 3.25  ? 132 HIS A ND1  2  
ATOM   3247  C  CD2  . HIS A 1 37  ? -5.946  11.494  -13.741 1.00 4.28  ? 132 HIS A CD2  2  
ATOM   3248  C  CE1  . HIS A 1 37  ? -4.331  11.490  -15.247 1.00 4.52  ? 132 HIS A CE1  2  
ATOM   3249  N  NE2  . HIS A 1 37  ? -5.602  11.098  -15.013 1.00 5.08  ? 132 HIS A NE2  2  
ATOM   3250  H  H    . HIS A 1 37  ? -3.075  10.192  -10.362 1.00 1.79  ? 132 HIS A H    2  
ATOM   3251  H  HA   . HIS A 1 37  ? -2.835  12.300  -11.181 1.00 2.46  ? 132 HIS A HA   2  
ATOM   3252  H  HB2  . HIS A 1 37  ? -5.831  12.713  -11.389 1.00 4.04  ? 132 HIS A HB2  2  
ATOM   3253  H  HB3  . HIS A 1 37  ? -4.574  13.789  -11.943 1.00 3.28  ? 132 HIS A HB3  2  
ATOM   3254  H  HD1  . HIS A 1 37  ? -2.941  12.565  -14.070 1.00 3.46  ? 132 HIS A HD1  2  
ATOM   3255  H  HD2  . HIS A 1 37  ? -6.910  11.338  -13.269 1.00 5.18  ? 132 HIS A HD2  2  
ATOM   3256  H  HE1  . HIS A 1 37  ? -3.784  11.325  -16.167 1.00 5.52  ? 132 HIS A HE1  2  
ATOM   3257  H  HE2  . HIS A 1 37  ? -6.223  10.562  -15.639 1.00 6.39  ? 132 HIS A HE2  2  
ATOM   3258  N  N    . CYS A 1 38  ? -3.525  12.255  -8.309  1.00 2.14  ? 133 CYS A N    2  
ATOM   3259  C  CA   . CYS A 1 38  ? -3.169  13.008  -7.105  1.00 2.17  ? 133 CYS A CA   2  
ATOM   3260  C  C    . CYS A 1 38  ? -1.989  13.960  -7.412  1.00 2.31  ? 133 CYS A C    2  
ATOM   3261  O  O    . CYS A 1 38  ? -1.043  13.522  -8.084  1.00 2.61  ? 133 CYS A O    2  
ATOM   3262  C  CB   . CYS A 1 38  ? -2.839  12.081  -5.936  1.00 2.26  ? 133 CYS A CB   2  
ATOM   3263  S  SG   . CYS A 1 38  ? -2.512  13.048  -4.440  1.00 2.75  ? 133 CYS A SG   2  
ATOM   3264  H  H    . CYS A 1 38  ? -3.344  11.270  -8.301  1.00 2.83  ? 133 CYS A H    2  
ATOM   3265  H  HA   . CYS A 1 38  ? -4.055  13.567  -6.825  1.00 2.31  ? 133 CYS A HA   2  
ATOM   3266  H  HB2  . CYS A 1 38  ? -3.678  11.410  -5.748  1.00 2.61  ? 133 CYS A HB2  2  
ATOM   3267  H  HB3  . CYS A 1 38  ? -1.959  11.483  -6.178  1.00 2.61  ? 133 CYS A HB3  2  
ATOM   3268  N  N    . PRO A 1 39  ? -2.046  15.253  -7.027  1.00 2.23  ? 134 PRO A N    2  
ATOM   3269  C  CA   . PRO A 1 39  ? -1.236  16.279  -7.673  1.00 2.16  ? 134 PRO A CA   2  
ATOM   3270  C  C    . PRO A 1 39  ? -0.055  16.782  -6.832  1.00 2.11  ? 134 PRO A C    2  
ATOM   3271  O  O    . PRO A 1 39  ? 0.821   17.445  -7.383  1.00 2.82  ? 134 PRO A O    2  
ATOM   3272  C  CB   . PRO A 1 39  ? -2.239  17.408  -7.917  1.00 2.28  ? 134 PRO A CB   2  
ATOM   3273  C  CG   . PRO A 1 39  ? -3.197  17.325  -6.725  1.00 2.19  ? 134 PRO A CG   2  
ATOM   3274  C  CD   . PRO A 1 39  ? -3.069  15.896  -6.203  1.00 2.36  ? 134 PRO A CD   2  
ATOM   3275  H  HA   . PRO A 1 39  ? -0.851  15.930  -8.632  1.00 2.50  ? 134 PRO A HA   2  
ATOM   3276  H  HB2  . PRO A 1 39  ? -1.758  18.386  -7.982  1.00 2.50  ? 134 PRO A HB2  2  
ATOM   3277  H  HB3  . PRO A 1 39  ? -2.790  17.201  -8.835  1.00 2.67  ? 134 PRO A HB3  2  
ATOM   3278  H  HG2  . PRO A 1 39  ? -2.899  18.025  -5.946  1.00 2.41  ? 134 PRO A HG2  2  
ATOM   3279  H  HG3  . PRO A 1 39  ? -4.221  17.509  -7.049  1.00 2.43  ? 134 PRO A HG3  2  
ATOM   3280  H  HD2  . PRO A 1 39  ? -2.745  15.914  -5.162  1.00 2.62  ? 134 PRO A HD2  2  
ATOM   3281  H  HD3  . PRO A 1 39  ? -4.038  15.410  -6.250  1.00 2.88  ? 134 PRO A HD3  2  
ATOM   3282  N  N    . ASP A 1 40  ? -0.046  16.542  -5.512  1.00 2.35  ? 135 ASP A N    2  
ATOM   3283  C  CA   . ASP A 1 40  ? 0.755   17.354  -4.579  1.00 2.83  ? 135 ASP A CA   2  
ATOM   3284  C  C    . ASP A 1 40  ? 0.963   16.728  -3.180  1.00 2.63  ? 135 ASP A C    2  
ATOM   3285  O  O    . ASP A 1 40  ? 1.512   17.387  -2.294  1.00 2.99  ? 135 ASP A O    2  
ATOM   3286  C  CB   . ASP A 1 40  ? 0.097   18.750  -4.470  1.00 3.85  ? 135 ASP A CB   2  
ATOM   3287  C  CG   . ASP A 1 40  ? 1.100   19.859  -4.156  1.00 4.75  ? 135 ASP A CG   2  
ATOM   3288  O  OD1  . ASP A 1 40  ? 1.835   20.281  -5.077  1.00 4.54  ? 135 ASP A OD1  2  
ATOM   3289  O  OD2  . ASP A 1 40  ? 1.117   20.351  -3.003  1.00 6.29  ? 135 ASP A OD2  2  
ATOM   3290  H  H    . ASP A 1 40  ? -0.805  15.994  -5.131  1.00 2.97  ? 135 ASP A H    2  
ATOM   3291  H  HA   . ASP A 1 40  ? 1.748   17.479  -5.017  1.00 3.17  ? 135 ASP A HA   2  
ATOM   3292  H  HB2  . ASP A 1 40  ? -0.388  19.016  -5.411  1.00 3.87  ? 135 ASP A HB2  2  
ATOM   3293  H  HB3  . ASP A 1 40  ? -0.683  18.722  -3.707  1.00 4.61  ? 135 ASP A HB3  2  
ATOM   3294  N  N    . ILE A 1 41  ? 0.522   15.481  -2.940  1.00 2.29  ? 136 ILE A N    2  
ATOM   3295  C  CA   . ILE A 1 41  ? 0.526   14.877  -1.594  1.00 2.32  ? 136 ILE A CA   2  
ATOM   3296  C  C    . ILE A 1 41  ? 0.870   13.384  -1.618  1.00 2.20  ? 136 ILE A C    2  
ATOM   3297  O  O    . ILE A 1 41  ? 1.970   13.032  -1.187  1.00 2.03  ? 136 ILE A O    2  
ATOM   3298  C  CB   . ILE A 1 41  ? -0.768  15.254  -0.823  1.00 2.67  ? 136 ILE A CB   2  
ATOM   3299  C  CG1  . ILE A 1 41  ? -0.877  14.589  0.565   1.00 4.06  ? 136 ILE A CG1  2  
ATOM   3300  C  CG2  . ILE A 1 41  ? -2.077  14.975  -1.584  1.00 2.10  ? 136 ILE A CG2  2  
ATOM   3301  C  CD1  . ILE A 1 41  ? 0.276   14.940  1.512   1.00 5.03  ? 136 ILE A CD1  2  
ATOM   3302  H  H    . ILE A 1 41  ? 0.108   14.945  -3.693  1.00 2.23  ? 136 ILE A H    2  
ATOM   3303  H  HA   . ILE A 1 41  ? 1.355   15.316  -1.037  1.00 2.30  ? 136 ILE A HA   2  
ATOM   3304  H  HB   . ILE A 1 41  ? -0.734  16.333  -0.661  1.00 3.73  ? 136 ILE A HB   2  
ATOM   3305  H  HG12 . ILE A 1 41  ? -1.805  14.921  1.033   1.00 4.57  ? 136 ILE A HG12 2  
ATOM   3306  H  HG13 . ILE A 1 41  ? -0.933  13.506  0.449   1.00 4.81  ? 136 ILE A HG13 2  
ATOM   3307  H  HG21 . ILE A 1 41  ? -2.245  13.903  -1.677  1.00 2.38  ? 136 ILE A HG21 2  
ATOM   3308  H  HG22 . ILE A 1 41  ? -2.916  15.408  -1.040  1.00 3.20  ? 136 ILE A HG22 2  
ATOM   3309  H  HG23 . ILE A 1 41  ? -2.056  15.429  -2.575  1.00 2.61  ? 136 ILE A HG23 2  
ATOM   3310  H  HD11 . ILE A 1 41  ? 0.100   14.474  2.482   1.00 5.87  ? 136 ILE A HD11 2  
ATOM   3311  H  HD12 . ILE A 1 41  ? 1.223   14.574  1.117   1.00 5.44  ? 136 ILE A HD12 2  
ATOM   3312  H  HD13 . ILE A 1 41  ? 0.334   16.021  1.640   1.00 5.23  ? 136 ILE A HD13 2  
ATOM   3313  N  N    . CYS A 1 42  ? 0.017   12.512  -2.159  1.00 2.34  ? 137 CYS A N    2  
ATOM   3314  C  CA   . CYS A 1 42  ? 0.283   11.075  -2.210  1.00 2.42  ? 137 CYS A CA   2  
ATOM   3315  C  C    . CYS A 1 42  ? 1.636   10.688  -2.837  1.00 2.00  ? 137 CYS A C    2  
ATOM   3316  O  O    . CYS A 1 42  ? 2.333   9.891   -2.213  1.00 1.94  ? 137 CYS A O    2  
ATOM   3317  C  CB   . CYS A 1 42  ? -0.864  10.365  -2.917  1.00 2.80  ? 137 CYS A CB   2  
ATOM   3318  S  SG   . CYS A 1 42  ? -2.359  10.238  -1.910  1.00 3.50  ? 137 CYS A SG   2  
ATOM   3319  H  H    . CYS A 1 42  ? -0.888  12.817  -2.503  1.00 2.48  ? 137 CYS A H    2  
ATOM   3320  H  HA   . CYS A 1 42  ? 0.301   10.709  -1.182  1.00 2.64  ? 137 CYS A HA   2  
ATOM   3321  H  HB2  . CYS A 1 42  ? -1.098  10.875  -3.851  1.00 2.70  ? 137 CYS A HB2  2  
ATOM   3322  H  HB3  . CYS A 1 42  ? -0.523  9.367   -3.172  1.00 2.94  ? 137 CYS A HB3  2  
ATOM   3323  N  N    . PRO A 1 43  ? 2.064   11.203  -4.012  1.00 1.79  ? 138 PRO A N    2  
ATOM   3324  C  CA   . PRO A 1 43  ? 3.370   10.847  -4.571  1.00 1.54  ? 138 PRO A CA   2  
ATOM   3325  C  C    . PRO A 1 43  ? 4.548   11.305  -3.695  1.00 1.37  ? 138 PRO A C    2  
ATOM   3326  O  O    . PRO A 1 43  ? 5.587   10.642  -3.700  1.00 1.39  ? 138 PRO A O    2  
ATOM   3327  C  CB   . PRO A 1 43  ? 3.409   11.467  -5.972  1.00 1.64  ? 138 PRO A CB   2  
ATOM   3328  C  CG   . PRO A 1 43  ? 2.375   12.589  -5.915  1.00 1.79  ? 138 PRO A CG   2  
ATOM   3329  C  CD   . PRO A 1 43  ? 1.326   12.033  -4.958  1.00 1.91  ? 138 PRO A CD   2  
ATOM   3330  H  HA   . PRO A 1 43  ? 3.430   9.765   -4.674  1.00 1.54  ? 138 PRO A HA   2  
ATOM   3331  H  HB2  . PRO A 1 43  ? 4.400   11.847  -6.228  1.00 1.60  ? 138 PRO A HB2  2  
ATOM   3332  H  HB3  . PRO A 1 43  ? 3.092   10.722  -6.703  1.00 1.72  ? 138 PRO A HB3  2  
ATOM   3333  H  HG2  . PRO A 1 43  ? 2.827   13.484  -5.485  1.00 1.72  ? 138 PRO A HG2  2  
ATOM   3334  H  HG3  . PRO A 1 43  ? 1.952   12.802  -6.897  1.00 1.95  ? 138 PRO A HG3  2  
ATOM   3335  H  HD2  . PRO A 1 43  ? 0.800   12.856  -4.482  1.00 1.98  ? 138 PRO A HD2  2  
ATOM   3336  H  HD3  . PRO A 1 43  ? 0.623   11.405  -5.508  1.00 2.08  ? 138 PRO A HD3  2  
ATOM   3337  N  N    . ASP A 1 44  ? 4.392   12.382  -2.912  1.00 1.38  ? 139 ASP A N    2  
ATOM   3338  C  CA   . ASP A 1 44  ? 5.414   12.854  -1.978  1.00 1.32  ? 139 ASP A CA   2  
ATOM   3339  C  C    . ASP A 1 44  ? 5.534   11.889  -0.790  1.00 1.38  ? 139 ASP A C    2  
ATOM   3340  O  O    . ASP A 1 44  ? 6.634   11.413  -0.525  1.00 1.32  ? 139 ASP A O    2  
ATOM   3341  C  CB   . ASP A 1 44  ? 5.102   14.299  -1.535  1.00 1.52  ? 139 ASP A CB   2  
ATOM   3342  C  CG   . ASP A 1 44  ? 6.270   14.946  -0.786  1.00 1.71  ? 139 ASP A CG   2  
ATOM   3343  O  OD1  . ASP A 1 44  ? 7.367   15.046  -1.388  1.00 2.30  ? 139 ASP A OD1  2  
ATOM   3344  O  OD2  . ASP A 1 44  ? 6.117   15.304  0.407   1.00 2.53  ? 139 ASP A OD2  2  
ATOM   3345  H  H    . ASP A 1 44  ? 3.480   12.815  -2.838  1.00 1.47  ? 139 ASP A H    2  
ATOM   3346  H  HA   . ASP A 1 44  ? 6.374   12.852  -2.500  1.00 1.20  ? 139 ASP A HA   2  
ATOM   3347  H  HB2  . ASP A 1 44  ? 4.889   14.902  -2.419  1.00 1.56  ? 139 ASP A HB2  2  
ATOM   3348  H  HB3  . ASP A 1 44  ? 4.215   14.309  -0.900  1.00 1.71  ? 139 ASP A HB3  2  
ATOM   3349  N  N    . GLU A 1 45  ? 4.414   11.558  -0.131  1.00 1.56  ? 140 GLU A N    2  
ATOM   3350  C  CA   . GLU A 1 45  ? 4.286   10.537  0.923   1.00 1.66  ? 140 GLU A CA   2  
ATOM   3351  C  C    . GLU A 1 45  ? 4.694   9.124   0.458   1.00 1.50  ? 140 GLU A C    2  
ATOM   3352  O  O    . GLU A 1 45  ? 5.286   8.366   1.230   1.00 1.50  ? 140 GLU A O    2  
ATOM   3353  C  CB   . GLU A 1 45  ? 2.843   10.487  1.463   1.00 1.93  ? 140 GLU A CB   2  
ATOM   3354  C  CG   . GLU A 1 45  ? 2.350   11.765  2.164   1.00 2.22  ? 140 GLU A CG   2  
ATOM   3355  C  CD   . GLU A 1 45  ? 3.125   12.143  3.429   1.00 2.76  ? 140 GLU A CD   2  
ATOM   3356  O  OE1  . GLU A 1 45  ? 3.527   11.259  4.211   1.00 3.41  ? 140 GLU A OE1  2  
ATOM   3357  O  OE2  . GLU A 1 45  ? 3.360   13.355  3.632   1.00 3.52  ? 140 GLU A OE2  2  
ATOM   3358  H  H    . GLU A 1 45  ? 3.570   12.036  -0.414  1.00 1.62  ? 140 GLU A H    2  
ATOM   3359  H  HA   . GLU A 1 45  ? 4.936   10.812  1.746   1.00 1.73  ? 140 GLU A HA   2  
ATOM   3360  H  HB2  . GLU A 1 45  ? 2.170   10.273  0.633   1.00 1.90  ? 140 GLU A HB2  2  
ATOM   3361  H  HB3  . GLU A 1 45  ? 2.763   9.659   2.168   1.00 2.84  ? 140 GLU A HB3  2  
ATOM   3362  H  HG2  . GLU A 1 45  ? 2.402   12.592  1.458   1.00 2.82  ? 140 GLU A HG2  2  
ATOM   3363  H  HG3  . GLU A 1 45  ? 1.303   11.627  2.434   1.00 2.83  ? 140 GLU A HG3  2  
ATOM   3364  N  N    . LEU A 1 46  ? 4.430   8.757   -0.800  1.00 1.41  ? 141 LEU A N    2  
ATOM   3365  C  CA   . LEU A 1 46  ? 4.802   7.455   -1.355  1.00 1.30  ? 141 LEU A CA   2  
ATOM   3366  C  C    . LEU A 1 46  ? 6.315   7.343   -1.527  1.00 1.10  ? 141 LEU A C    2  
ATOM   3367  O  O    . LEU A 1 46  ? 6.894   6.400   -0.988  1.00 1.14  ? 141 LEU A O    2  
ATOM   3368  C  CB   . LEU A 1 46  ? 4.049   7.181   -2.670  1.00 1.41  ? 141 LEU A CB   2  
ATOM   3369  C  CG   . LEU A 1 46  ? 2.579   6.741   -2.482  1.00 2.31  ? 141 LEU A CG   2  
ATOM   3370  C  CD1  . LEU A 1 46  ? 1.853   6.809   -3.832  1.00 2.45  ? 141 LEU A CD1  2  
ATOM   3371  C  CD2  . LEU A 1 46  ? 2.473   5.308   -1.931  1.00 3.17  ? 141 LEU A CD2  2  
ATOM   3372  H  H    . LEU A 1 46  ? 3.883   9.391   -1.378  1.00 1.47  ? 141 LEU A H    2  
ATOM   3373  H  HA   . LEU A 1 46  ? 4.524   6.692   -0.632  1.00 1.39  ? 141 LEU A HA   2  
ATOM   3374  H  HB2  . LEU A 1 46  ? 4.085   8.081   -3.283  1.00 1.49  ? 141 LEU A HB2  2  
ATOM   3375  H  HB3  . LEU A 1 46  ? 4.566   6.391   -3.213  1.00 1.79  ? 141 LEU A HB3  2  
ATOM   3376  H  HG   . LEU A 1 46  ? 2.078   7.411   -1.783  1.00 3.50  ? 141 LEU A HG   2  
ATOM   3377  H  HD11 . LEU A 1 46  ? 1.885   7.828   -4.219  1.00 3.26  ? 141 LEU A HD11 2  
ATOM   3378  H  HD12 . LEU A 1 46  ? 2.330   6.137   -4.547  1.00 2.43  ? 141 LEU A HD12 2  
ATOM   3379  H  HD13 . LEU A 1 46  ? 0.809   6.521   -3.706  1.00 3.27  ? 141 LEU A HD13 2  
ATOM   3380  H  HD21 . LEU A 1 46  ? 1.423   5.028   -1.841  1.00 3.90  ? 141 LEU A HD21 2  
ATOM   3381  H  HD22 . LEU A 1 46  ? 2.972   4.609   -2.602  1.00 3.07  ? 141 LEU A HD22 2  
ATOM   3382  H  HD23 . LEU A 1 46  ? 2.928   5.245   -0.945  1.00 4.16  ? 141 LEU A HD23 2  
ATOM   3383  N  N    . GLU A 1 47  ? 6.989   8.280   -2.208  1.00 0.96  ? 142 GLU A N    2  
ATOM   3384  C  CA   . GLU A 1 47  ? 8.453   8.181   -2.338  1.00 1.01  ? 142 GLU A CA   2  
ATOM   3385  C  C    . GLU A 1 47  ? 9.148   8.335   -0.974  1.00 1.03  ? 142 GLU A C    2  
ATOM   3386  O  O    . GLU A 1 47  ? 10.163  7.694   -0.706  1.00 1.11  ? 142 GLU A O    2  
ATOM   3387  C  CB   . GLU A 1 47  ? 9.030   9.171   -3.367  1.00 1.19  ? 142 GLU A CB   2  
ATOM   3388  C  CG   . GLU A 1 47  ? 10.296  8.540   -3.977  1.00 2.06  ? 142 GLU A CG   2  
ATOM   3389  C  CD   . GLU A 1 47  ? 11.195  9.508   -4.739  1.00 2.64  ? 142 GLU A CD   2  
ATOM   3390  O  OE1  . GLU A 1 47  ? 10.700  10.317  -5.552  1.00 3.34  ? 142 GLU A OE1  2  
ATOM   3391  O  OE2  . GLU A 1 47  ? 12.437  9.420   -4.567  1.00 3.56  ? 142 GLU A OE2  2  
ATOM   3392  H  H    . GLU A 1 47  ? 6.490   9.066   -2.616  1.00 0.93  ? 142 GLU A H    2  
ATOM   3393  H  HA   . GLU A 1 47  ? 8.668   7.174   -2.696  1.00 1.21  ? 142 GLU A HA   2  
ATOM   3394  H  HB2  . GLU A 1 47  ? 8.304   9.355   -4.162  1.00 1.08  ? 142 GLU A HB2  2  
ATOM   3395  H  HB3  . GLU A 1 47  ? 9.271   10.117  -2.879  1.00 1.39  ? 142 GLU A HB3  2  
ATOM   3396  H  HG2  . GLU A 1 47  ? 10.893  8.088   -3.185  1.00 2.50  ? 142 GLU A HG2  2  
ATOM   3397  H  HG3  . GLU A 1 47  ? 9.986   7.745   -4.655  1.00 2.81  ? 142 GLU A HG3  2  
ATOM   3398  N  N    . LYS A 1 48  ? 8.568   9.129   -0.073  1.00 1.12  ? 143 LYS A N    2  
ATOM   3399  C  CA   . LYS A 1 48  ? 8.944   9.265   1.336   1.00 1.32  ? 143 LYS A CA   2  
ATOM   3400  C  C    . LYS A 1 48  ? 8.903   7.908   2.060   1.00 1.35  ? 143 LYS A C    2  
ATOM   3401  O  O    . LYS A 1 48  ? 9.949   7.428   2.511   1.00 1.61  ? 143 LYS A O    2  
ATOM   3402  C  CB   . LYS A 1 48  ? 7.989   10.335  1.879   1.00 1.49  ? 143 LYS A CB   2  
ATOM   3403  C  CG   . LYS A 1 48  ? 8.047   10.826  3.323   1.00 1.66  ? 143 LYS A CG   2  
ATOM   3404  C  CD   . LYS A 1 48  ? 6.899   11.820  3.601   1.00 1.73  ? 143 LYS A CD   2  
ATOM   3405  C  CE   . LYS A 1 48  ? 6.904   13.009  2.617   1.00 1.93  ? 143 LYS A CE   2  
ATOM   3406  N  NZ   . LYS A 1 48  ? 5.874   14.037  2.896   1.00 2.98  ? 143 LYS A NZ   2  
ATOM   3407  H  H    . LYS A 1 48  ? 7.747   9.649   -0.372  1.00 1.11  ? 143 LYS A H    2  
ATOM   3408  H  HA   . LYS A 1 48  ? 9.966   9.641   1.401   1.00 1.39  ? 143 LYS A HA   2  
ATOM   3409  H  HB2  . LYS A 1 48  ? 8.191   11.209  1.273   1.00 1.68  ? 143 LYS A HB2  2  
ATOM   3410  H  HB3  . LYS A 1 48  ? 6.974   10.018  1.686   1.00 1.44  ? 143 LYS A HB3  2  
ATOM   3411  H  HG2  . LYS A 1 48  ? 7.988   9.985   4.014   1.00 2.73  ? 143 LYS A HG2  2  
ATOM   3412  H  HG3  . LYS A 1 48  ? 8.984   11.351  3.444   1.00 2.27  ? 143 LYS A HG3  2  
ATOM   3413  H  HD2  . LYS A 1 48  ? 5.952   11.290  3.539   1.00 2.73  ? 143 LYS A HD2  2  
ATOM   3414  H  HD3  . LYS A 1 48  ? 6.988   12.184  4.617   1.00 2.79  ? 143 LYS A HD3  2  
ATOM   3415  H  HE2  . LYS A 1 48  ? 7.891   13.477  2.624   1.00 2.52  ? 143 LYS A HE2  2  
ATOM   3416  H  HE3  . LYS A 1 48  ? 6.732   12.625  1.609   1.00 2.90  ? 143 LYS A HE3  2  
ATOM   3417  H  HZ1  . LYS A 1 48  ? 6.041   14.525  3.768   1.00 3.93  ? 143 LYS A HZ1  2  
ATOM   3418  H  HZ2  . LYS A 1 48  ? 5.841   14.706  2.128   1.00 3.40  ? 143 LYS A HZ2  2  
ATOM   3419  H  HZ3  . LYS A 1 48  ? 4.943   13.632  2.983   1.00 3.59  ? 143 LYS A HZ3  2  
ATOM   3420  N  N    . LEU A 1 49  ? 7.754   7.219   2.110   1.00 1.28  ? 144 LEU A N    2  
ATOM   3421  C  CA   . LEU A 1 49  ? 7.677   5.894   2.740   1.00 1.37  ? 144 LEU A CA   2  
ATOM   3422  C  C    . LEU A 1 49  ? 8.497   4.842   1.977   1.00 1.19  ? 144 LEU A C    2  
ATOM   3423  O  O    . LEU A 1 49  ? 9.219   4.085   2.621   1.00 1.24  ? 144 LEU A O    2  
ATOM   3424  C  CB   . LEU A 1 49  ? 6.215   5.512   3.068   1.00 1.85  ? 144 LEU A CB   2  
ATOM   3425  C  CG   . LEU A 1 49  ? 5.300   5.051   1.912   1.00 1.43  ? 144 LEU A CG   2  
ATOM   3426  C  CD1  . LEU A 1 49  ? 5.430   3.547   1.615   1.00 2.31  ? 144 LEU A CD1  2  
ATOM   3427  C  CD2  . LEU A 1 49  ? 3.832   5.335   2.268   1.00 2.04  ? 144 LEU A CD2  2  
ATOM   3428  H  H    . LEU A 1 49  ? 6.908   7.638   1.724   1.00 1.33  ? 144 LEU A H    2  
ATOM   3429  H  HA   . LEU A 1 49  ? 8.171   5.984   3.709   1.00 1.53  ? 144 LEU A HA   2  
ATOM   3430  H  HB2  . LEU A 1 49  ? 6.228   4.726   3.826   1.00 3.10  ? 144 LEU A HB2  2  
ATOM   3431  H  HB3  . LEU A 1 49  ? 5.760   6.385   3.541   1.00 2.74  ? 144 LEU A HB3  2  
ATOM   3432  H  HG   . LEU A 1 49  ? 5.548   5.611   1.017   1.00 1.84  ? 144 LEU A HG   2  
ATOM   3433  H  HD11 . LEU A 1 49  ? 6.448   3.283   1.344   1.00 3.30  ? 144 LEU A HD11 2  
ATOM   3434  H  HD12 . LEU A 1 49  ? 5.141   2.965   2.492   1.00 2.93  ? 144 LEU A HD12 2  
ATOM   3435  H  HD13 . LEU A 1 49  ? 4.777   3.281   0.783   1.00 2.64  ? 144 LEU A HD13 2  
ATOM   3436  H  HD21 . LEU A 1 49  ? 3.559   4.807   3.181   1.00 2.69  ? 144 LEU A HD21 2  
ATOM   3437  H  HD22 . LEU A 1 49  ? 3.685   6.405   2.417   1.00 2.85  ? 144 LEU A HD22 2  
ATOM   3438  H  HD23 . LEU A 1 49  ? 3.180   5.007   1.457   1.00 2.70  ? 144 LEU A HD23 2  
ATOM   3439  N  N    . VAL A 1 50  ? 8.514   4.841   0.641   1.00 1.13  ? 145 VAL A N    2  
ATOM   3440  C  CA   . VAL A 1 50  ? 9.292   3.866   -0.153  1.00 1.27  ? 145 VAL A CA   2  
ATOM   3441  C  C    . VAL A 1 50  ? 10.804  4.018   0.085   1.00 1.29  ? 145 VAL A C    2  
ATOM   3442  O  O    . VAL A 1 50  ? 11.485  3.012   0.289   1.00 1.44  ? 145 VAL A O    2  
ATOM   3443  C  CB   . VAL A 1 50  ? 8.935   3.935   -1.660  1.00 1.52  ? 145 VAL A CB   2  
ATOM   3444  C  CG1  . VAL A 1 50  ? 9.909   3.151   -2.557  1.00 1.94  ? 145 VAL A CG1  2  
ATOM   3445  C  CG2  . VAL A 1 50  ? 7.522   3.362   -1.894  1.00 2.05  ? 145 VAL A CG2  2  
ATOM   3446  H  H    . VAL A 1 50  ? 7.889   5.485   0.144   1.00 1.13  ? 145 VAL A H    2  
ATOM   3447  H  HA   . VAL A 1 50  ? 9.014   2.872   0.199   1.00 1.40  ? 145 VAL A HA   2  
ATOM   3448  H  HB   . VAL A 1 50  ? 8.958   4.978   -1.975  1.00 1.53  ? 145 VAL A HB   2  
ATOM   3449  H  HG11 . VAL A 1 50  ? 9.980   2.115   -2.223  1.00 3.15  ? 145 VAL A HG11 2  
ATOM   3450  H  HG12 . VAL A 1 50  ? 9.560   3.169   -3.590  1.00 2.52  ? 145 VAL A HG12 2  
ATOM   3451  H  HG13 . VAL A 1 50  ? 10.900  3.606   -2.531  1.00 1.86  ? 145 VAL A HG13 2  
ATOM   3452  H  HG21 . VAL A 1 50  ? 7.508   2.296   -1.663  1.00 2.77  ? 145 VAL A HG21 2  
ATOM   3453  H  HG22 . VAL A 1 50  ? 6.790   3.860   -1.261  1.00 3.05  ? 145 VAL A HG22 2  
ATOM   3454  H  HG23 . VAL A 1 50  ? 7.232   3.503   -2.936  1.00 2.24  ? 145 VAL A HG23 2  
ATOM   3455  N  N    . GLN A 1 51  ? 11.350  5.243   0.129   1.00 1.31  ? 146 GLN A N    2  
ATOM   3456  C  CA   . GLN A 1 51  ? 12.770  5.421   0.456   1.00 1.70  ? 146 GLN A CA   2  
ATOM   3457  C  C    . GLN A 1 51  ? 13.068  5.123   1.935   1.00 1.44  ? 146 GLN A C    2  
ATOM   3458  O  O    . GLN A 1 51  ? 14.109  4.528   2.216   1.00 1.57  ? 146 GLN A O    2  
ATOM   3459  C  CB   . GLN A 1 51  ? 13.309  6.768   -0.055  1.00 2.38  ? 146 GLN A CB   2  
ATOM   3460  C  CG   . GLN A 1 51  ? 12.990  8.000   0.804   1.00 1.45  ? 146 GLN A CG   2  
ATOM   3461  C  CD   . GLN A 1 51  ? 13.233  9.283   0.014   1.00 1.99  ? 146 GLN A CD   2  
ATOM   3462  O  OE1  . GLN A 1 51  ? 14.291  9.892   0.072   1.00 2.87  ? 146 GLN A OE1  2  
ATOM   3463  N  NE2  . GLN A 1 51  ? 12.292  9.697   -0.804  1.00 2.32  ? 146 GLN A NE2  2  
ATOM   3464  H  H    . GLN A 1 51  ? 10.789  6.061   -0.100  1.00 1.22  ? 146 GLN A H    2  
ATOM   3465  H  HA   . GLN A 1 51  ? 13.317  4.661   -0.103  1.00 2.06  ? 146 GLN A HA   2  
ATOM   3466  H  HB2  . GLN A 1 51  ? 14.395  6.696   -0.134  1.00 3.64  ? 146 GLN A HB2  2  
ATOM   3467  H  HB3  . GLN A 1 51  ? 12.923  6.925   -1.064  1.00 3.69  ? 146 GLN A HB3  2  
ATOM   3468  H  HG2  . GLN A 1 51  ? 11.950  7.976   1.113   1.00 2.33  ? 146 GLN A HG2  2  
ATOM   3469  H  HG3  . GLN A 1 51  ? 13.615  7.999   1.698   1.00 2.15  ? 146 GLN A HG3  2  
ATOM   3470  H  HE21 . GLN A 1 51  ? 11.448  9.148   -0.908  1.00 2.53  ? 146 GLN A HE21 2  
ATOM   3471  H  HE22 . GLN A 1 51  ? 12.467  10.530  -1.344  1.00 2.83  ? 146 GLN A HE22 2  
ATOM   3472  N  N    . VAL A 1 52  ? 12.139  5.407   2.860   1.00 1.25  ? 147 VAL A N    2  
ATOM   3473  C  CA   . VAL A 1 52  ? 12.250  4.943   4.257   1.00 1.26  ? 147 VAL A CA   2  
ATOM   3474  C  C    . VAL A 1 52  ? 12.241  3.409   4.342   1.00 1.04  ? 147 VAL A C    2  
ATOM   3475  O  O    . VAL A 1 52  ? 13.059  2.862   5.068   1.00 1.09  ? 147 VAL A O    2  
ATOM   3476  C  CB   . VAL A 1 52  ? 11.172  5.571   5.172   1.00 1.45  ? 147 VAL A CB   2  
ATOM   3477  C  CG1  . VAL A 1 52  ? 11.106  4.924   6.566   1.00 1.78  ? 147 VAL A CG1  2  
ATOM   3478  C  CG2  . VAL A 1 52  ? 11.457  7.067   5.374   1.00 2.18  ? 147 VAL A CG2  2  
ATOM   3479  H  H    . VAL A 1 52  ? 11.322  5.960   2.598   1.00 1.21  ? 147 VAL A H    2  
ATOM   3480  H  HA   . VAL A 1 52  ? 13.221  5.278   4.628   1.00 1.48  ? 147 VAL A HA   2  
ATOM   3481  H  HB   . VAL A 1 52  ? 10.197  5.463   4.697   1.00 1.54  ? 147 VAL A HB   2  
ATOM   3482  H  HG11 . VAL A 1 52  ? 12.091  4.949   7.033   1.00 2.81  ? 147 VAL A HG11 2  
ATOM   3483  H  HG12 . VAL A 1 52  ? 10.410  5.467   7.201   1.00 1.96  ? 147 VAL A HG12 2  
ATOM   3484  H  HG13 . VAL A 1 52  ? 10.758  3.893   6.491   1.00 2.25  ? 147 VAL A HG13 2  
ATOM   3485  H  HG21 . VAL A 1 52  ? 12.362  7.199   5.970   1.00 2.97  ? 147 VAL A HG21 2  
ATOM   3486  H  HG22 . VAL A 1 52  ? 11.598  7.571   4.420   1.00 3.06  ? 147 VAL A HG22 2  
ATOM   3487  H  HG23 . VAL A 1 52  ? 10.617  7.526   5.891   1.00 2.18  ? 147 VAL A HG23 2  
ATOM   3488  N  N    . VAL A 1 53  ? 11.414  2.691   3.570   1.00 0.93  ? 148 VAL A N    2  
ATOM   3489  C  CA   . VAL A 1 53  ? 11.460  1.214   3.499   1.00 0.98  ? 148 VAL A CA   2  
ATOM   3490  C  C    . VAL A 1 53  ? 12.841  0.714   3.026   1.00 1.03  ? 148 VAL A C    2  
ATOM   3491  O  O    . VAL A 1 53  ? 13.336  -0.278  3.563   1.00 1.13  ? 148 VAL A O    2  
ATOM   3492  C  CB   . VAL A 1 53  ? 10.299  0.641   2.646   1.00 1.12  ? 148 VAL A CB   2  
ATOM   3493  C  CG1  . VAL A 1 53  ? 10.472  -0.847  2.286   1.00 1.80  ? 148 VAL A CG1  2  
ATOM   3494  C  CG2  . VAL A 1 53  ? 8.964   0.778   3.403   1.00 1.84  ? 148 VAL A CG2  2  
ATOM   3495  H  H    . VAL A 1 53  ? 10.685  3.186   3.051   1.00 0.91  ? 148 VAL A H    2  
ATOM   3496  H  HA   . VAL A 1 53  ? 11.319  0.843   4.513   1.00 1.06  ? 148 VAL A HA   2  
ATOM   3497  H  HB   . VAL A 1 53  ? 10.230  1.205   1.717   1.00 1.36  ? 148 VAL A HB   2  
ATOM   3498  H  HG11 . VAL A 1 53  ? 10.608  -1.441  3.192   1.00 2.79  ? 148 VAL A HG11 2  
ATOM   3499  H  HG12 . VAL A 1 53  ? 9.589   -1.207  1.755   1.00 2.22  ? 148 VAL A HG12 2  
ATOM   3500  H  HG13 . VAL A 1 53  ? 11.333  -0.982  1.633   1.00 2.36  ? 148 VAL A HG13 2  
ATOM   3501  H  HG21 . VAL A 1 53  ? 8.974   0.151   4.296   1.00 2.82  ? 148 VAL A HG21 2  
ATOM   3502  H  HG22 . VAL A 1 53  ? 8.796   1.809   3.706   1.00 2.66  ? 148 VAL A HG22 2  
ATOM   3503  H  HG23 . VAL A 1 53  ? 8.138   0.467   2.761   1.00 2.22  ? 148 VAL A HG23 2  
ATOM   3504  N  N    . ARG A 1 54  ? 13.521  1.429   2.110   1.00 1.06  ? 149 ARG A N    2  
ATOM   3505  C  CA   . ARG A 1 54  ? 14.903  1.151   1.726   1.00 1.20  ? 149 ARG A CA   2  
ATOM   3506  C  C    . ARG A 1 54  ? 15.868  1.276   2.915   1.00 1.23  ? 149 ARG A C    2  
ATOM   3507  O  O    . ARG A 1 54  ? 16.696  0.390   3.125   1.00 1.41  ? 149 ARG A O    2  
ATOM   3508  C  CB   . ARG A 1 54  ? 15.303  2.076   0.558   1.00 1.35  ? 149 ARG A CB   2  
ATOM   3509  C  CG   . ARG A 1 54  ? 16.291  1.331   -0.334  1.00 2.37  ? 149 ARG A CG   2  
ATOM   3510  C  CD   . ARG A 1 54  ? 16.695  2.053   -1.634  1.00 2.09  ? 149 ARG A CD   2  
ATOM   3511  N  NE   . ARG A 1 54  ? 17.887  2.917   -1.506  1.00 2.96  ? 149 ARG A NE   2  
ATOM   3512  C  CZ   . ARG A 1 54  ? 17.916  4.230   -1.307  1.00 3.82  ? 149 ARG A CZ   2  
ATOM   3513  N  NH1  . ARG A 1 54  ? 16.852  4.927   -0.984  1.00 4.49  ? 149 ARG A NH1  2  
ATOM   3514  N  NH2  . ARG A 1 54  ? 19.039  4.891   -1.455  1.00 5.07  ? 149 ARG A NH2  2  
ATOM   3515  H  H    . ARG A 1 54  ? 13.086  2.214   1.651   1.00 1.03  ? 149 ARG A H    2  
ATOM   3516  H  HA   . ARG A 1 54  ? 14.932  0.113   1.389   1.00 1.31  ? 149 ARG A HA   2  
ATOM   3517  H  HB2  . ARG A 1 54  ? 14.422  2.324   -0.037  1.00 2.13  ? 149 ARG A HB2  2  
ATOM   3518  H  HB3  . ARG A 1 54  ? 15.756  2.996   0.930   1.00 1.33  ? 149 ARG A HB3  2  
ATOM   3519  H  HG2  . ARG A 1 54  ? 17.165  1.086   0.260   1.00 3.66  ? 149 ARG A HG2  2  
ATOM   3520  H  HG3  . ARG A 1 54  ? 15.794  0.404   -0.612  1.00 3.42  ? 149 ARG A HG3  2  
ATOM   3521  H  HD2  . ARG A 1 54  ? 16.932  1.285   -2.373  1.00 2.79  ? 149 ARG A HD2  2  
ATOM   3522  H  HD3  . ARG A 1 54  ? 15.846  2.617   -2.025  1.00 2.16  ? 149 ARG A HD3  2  
ATOM   3523  H  HE   . ARG A 1 54  ? 18.773  2.502   -1.759  1.00 3.87  ? 149 ARG A HE   2  
ATOM   3524  H  HH11 . ARG A 1 54  ? 15.963  4.486   -0.862  1.00 4.19  ? 149 ARG A HH11 2  
ATOM   3525  H  HH12 . ARG A 1 54  ? 16.953  5.937   -0.917  1.00 5.84  ? 149 ARG A HH12 2  
ATOM   3526  H  HH21 . ARG A 1 54  ? 19.874  4.428   -1.804  1.00 5.39  ? 149 ARG A HH21 2  
ATOM   3527  H  HH22 . ARG A 1 54  ? 19.032  5.897   -1.351  1.00 6.07  ? 149 ARG A HH22 2  
ATOM   3528  N  N    . GLN A 1 55  ? 15.722  2.323   3.733   1.00 1.16  ? 150 GLN A N    2  
ATOM   3529  C  CA   . GLN A 1 55  ? 16.466  2.429   4.995   1.00 1.26  ? 150 GLN A CA   2  
ATOM   3530  C  C    . GLN A 1 55  ? 16.112  1.309   5.982   1.00 1.18  ? 150 GLN A C    2  
ATOM   3531  O  O    . GLN A 1 55  ? 17.021  0.759   6.582   1.00 1.31  ? 150 GLN A O    2  
ATOM   3532  C  CB   . GLN A 1 55  ? 16.279  3.788   5.690   1.00 1.38  ? 150 GLN A CB   2  
ATOM   3533  C  CG   . GLN A 1 55  ? 16.917  4.976   4.949   1.00 1.90  ? 150 GLN A CG   2  
ATOM   3534  C  CD   . GLN A 1 55  ? 17.260  6.143   5.886   1.00 2.31  ? 150 GLN A CD   2  
ATOM   3535  O  OE1  . GLN A 1 55  ? 16.896  6.188   7.055   1.00 2.64  ? 150 GLN A OE1  2  
ATOM   3536  N  NE2  . GLN A 1 55  ? 18.021  7.110   5.426   1.00 3.36  ? 150 GLN A NE2  2  
ATOM   3537  H  H    . GLN A 1 55  ? 15.031  3.024   3.493   1.00 1.10  ? 150 GLN A H    2  
ATOM   3538  H  HA   . GLN A 1 55  ? 17.531  2.306   4.781   1.00 1.42  ? 150 GLN A HA   2  
ATOM   3539  H  HB2  . GLN A 1 55  ? 15.223  3.993   5.862   1.00 1.64  ? 150 GLN A HB2  2  
ATOM   3540  H  HB3  . GLN A 1 55  ? 16.760  3.701   6.666   1.00 1.88  ? 150 GLN A HB3  2  
ATOM   3541  H  HG2  . GLN A 1 55  ? 17.844  4.647   4.480   1.00 2.66  ? 150 GLN A HG2  2  
ATOM   3542  H  HG3  . GLN A 1 55  ? 16.245  5.326   4.165   1.00 2.30  ? 150 GLN A HG3  2  
ATOM   3543  H  HE21 . GLN A 1 55  ? 18.343  7.120   4.466   1.00 4.07  ? 150 GLN A HE21 2  
ATOM   3544  H  HE22 . GLN A 1 55  ? 18.386  7.761   6.110   1.00 3.91  ? 150 GLN A HE22 2  
ATOM   3545  N  N    . LEU A 1 56  ? 14.839  0.939   6.153   1.00 1.07  ? 151 LEU A N    2  
ATOM   3546  C  CA   . LEU A 1 56  ? 14.409  -0.058  7.146   1.00 1.13  ? 151 LEU A CA   2  
ATOM   3547  C  C    . LEU A 1 56  ? 14.894  -1.479  6.842   1.00 1.31  ? 151 LEU A C    2  
ATOM   3548  O  O    . LEU A 1 56  ? 15.140  -2.241  7.776   1.00 1.53  ? 151 LEU A O    2  
ATOM   3549  C  CB   . LEU A 1 56  ? 12.876  0.002   7.293   1.00 1.06  ? 151 LEU A CB   2  
ATOM   3550  C  CG   . LEU A 1 56  ? 12.409  0.847   8.494   1.00 1.11  ? 151 LEU A CG   2  
ATOM   3551  C  CD1  . LEU A 1 56  ? 12.968  2.278   8.516   1.00 2.18  ? 151 LEU A CD1  2  
ATOM   3552  C  CD2  . LEU A 1 56  ? 10.877  0.906   8.501   1.00 1.58  ? 151 LEU A CD2  2  
ATOM   3553  H  H    . LEU A 1 56  ? 14.118  1.452   5.661   1.00 1.01  ? 151 LEU A H    2  
ATOM   3554  H  HA   . LEU A 1 56  ? 14.867  0.189   8.106   1.00 1.20  ? 151 LEU A HA   2  
ATOM   3555  H  HB2  . LEU A 1 56  ? 12.429  0.385   6.377   1.00 1.05  ? 151 LEU A HB2  2  
ATOM   3556  H  HB3  . LEU A 1 56  ? 12.496  -1.011  7.441   1.00 1.19  ? 151 LEU A HB3  2  
ATOM   3557  H  HG   . LEU A 1 56  ? 12.735  0.346   9.403   1.00 1.78  ? 151 LEU A HG   2  
ATOM   3558  H  HD11 . LEU A 1 56  ? 12.548  2.826   9.361   1.00 2.68  ? 151 LEU A HD11 2  
ATOM   3559  H  HD12 . LEU A 1 56  ? 14.053  2.263   8.621   1.00 3.21  ? 151 LEU A HD12 2  
ATOM   3560  H  HD13 . LEU A 1 56  ? 12.705  2.787   7.594   1.00 2.73  ? 151 LEU A HD13 2  
ATOM   3561  H  HD21 . LEU A 1 56  ? 10.534  1.452   9.377   1.00 2.32  ? 151 LEU A HD21 2  
ATOM   3562  H  HD22 . LEU A 1 56  ? 10.515  1.407   7.602   1.00 2.55  ? 151 LEU A HD22 2  
ATOM   3563  H  HD23 . LEU A 1 56  ? 10.467  -0.103  8.535   1.00 2.14  ? 151 LEU A HD23 2  
ATOM   3564  N  N    . GLU A 1 57  ? 15.107  -1.828  5.573   1.00 1.37  ? 152 GLU A N    2  
ATOM   3565  C  CA   . GLU A 1 57  ? 15.895  -3.010  5.205   1.00 1.68  ? 152 GLU A CA   2  
ATOM   3566  C  C    . GLU A 1 57  ? 17.345  -2.836  5.697   1.00 1.83  ? 152 GLU A C    2  
ATOM   3567  O  O    . GLU A 1 57  ? 17.782  -3.565  6.594   1.00 2.60  ? 152 GLU A O    2  
ATOM   3568  C  CB   . GLU A 1 57  ? 15.836  -3.235  3.682   1.00 1.82  ? 152 GLU A CB   2  
ATOM   3569  C  CG   . GLU A 1 57  ? 14.518  -3.870  3.214   1.00 2.19  ? 152 GLU A CG   2  
ATOM   3570  C  CD   . GLU A 1 57  ? 14.572  -5.399  3.263   1.00 3.71  ? 152 GLU A CD   2  
ATOM   3571  O  OE1  . GLU A 1 57  ? 14.449  -5.985  4.356   1.00 5.15  ? 152 GLU A OE1  2  
ATOM   3572  O  OE2  . GLU A 1 57  ? 14.749  -6.018  2.187   1.00 4.15  ? 152 GLU A OE2  2  
ATOM   3573  H  H    . GLU A 1 57  ? 14.829  -1.181  4.848   1.00 1.30  ? 152 GLU A H    2  
ATOM   3574  H  HA   . GLU A 1 57  ? 15.479  -3.892  5.698   1.00 1.82  ? 152 GLU A HA   2  
ATOM   3575  H  HB2  . GLU A 1 57  ? 15.961  -2.275  3.179   1.00 2.03  ? 152 GLU A HB2  2  
ATOM   3576  H  HB3  . GLU A 1 57  ? 16.662  -3.878  3.377   1.00 2.62  ? 152 GLU A HB3  2  
ATOM   3577  H  HG2  . GLU A 1 57  ? 13.686  -3.503  3.814   1.00 2.83  ? 152 GLU A HG2  2  
ATOM   3578  H  HG3  . GLU A 1 57  ? 14.341  -3.565  2.181   1.00 2.18  ? 152 GLU A HG3  2  
ATOM   3579  N  N    . ALA A 1 58  ? 18.062  -1.842  5.157   1.00 1.50  ? 153 ALA A N    2  
ATOM   3580  C  CA   . ALA A 1 58  ? 19.508  -1.658  5.313   1.00 1.66  ? 153 ALA A CA   2  
ATOM   3581  C  C    . ALA A 1 58  ? 19.981  -1.353  6.751   1.00 2.05  ? 153 ALA A C    2  
ATOM   3582  O  O    . ALA A 1 58  ? 21.025  -1.855  7.173   1.00 2.18  ? 153 ALA A O    2  
ATOM   3583  C  CB   . ALA A 1 58  ? 19.918  -0.538  4.345   1.00 1.92  ? 153 ALA A CB   2  
ATOM   3584  H  H    . ALA A 1 58  ? 17.596  -1.229  4.499   1.00 1.56  ? 153 ALA A H    2  
ATOM   3585  H  HA   . ALA A 1 58  ? 20.007  -2.579  5.006   1.00 1.82  ? 153 ALA A HA   2  
ATOM   3586  H  HB1  . ALA A 1 58  ? 19.658  -0.816  3.323   1.00 2.83  ? 153 ALA A HB1  2  
ATOM   3587  H  HB2  . ALA A 1 58  ? 19.407  0.392   4.603   1.00 1.91  ? 153 ALA A HB2  2  
ATOM   3588  H  HB3  . ALA A 1 58  ? 20.994  -0.375  4.394   1.00 2.75  ? 153 ALA A HB3  2  
ATOM   3589  N  N    . GLU A 1 59  ? 19.245  -0.539  7.507   1.00 2.58  ? 154 GLU A N    2  
ATOM   3590  C  CA   . GLU A 1 59  ? 19.456  -0.251  8.914   1.00 3.35  ? 154 GLU A CA   2  
ATOM   3591  C  C    . GLU A 1 59  ? 19.065  -1.508  9.714   1.00 3.10  ? 154 GLU A C    2  
ATOM   3592  O  O    . GLU A 1 59  ? 17.921  -1.963  9.597   1.00 3.23  ? 154 GLU A O    2  
ATOM   3593  C  CB   . GLU A 1 59  ? 18.603  0.979   9.265   1.00 4.26  ? 154 GLU A CB   2  
ATOM   3594  C  CG   . GLU A 1 59  ? 19.118  1.647   10.529  1.00 4.83  ? 154 GLU A CG   2  
ATOM   3595  C  CD   . GLU A 1 59  ? 18.376  2.951   10.822  1.00 5.73  ? 154 GLU A CD   2  
ATOM   3596  O  OE1  . GLU A 1 59  ? 18.498  3.930   10.048  1.00 6.70  ? 154 GLU A OE1  2  
ATOM   3597  O  OE2  . GLU A 1 59  ? 17.662  3.032   11.840  1.00 6.08  ? 154 GLU A OE2  2  
ATOM   3598  H  H    . GLU A 1 59  ? 18.386  -0.160  7.128   1.00 2.56  ? 154 GLU A H    2  
ATOM   3599  H  HA   . GLU A 1 59  ? 20.509  -0.008  9.056   1.00 3.76  ? 154 GLU A HA   2  
ATOM   3600  H  HB2  . GLU A 1 59  ? 18.675  1.705   8.454   1.00 5.07  ? 154 GLU A HB2  2  
ATOM   3601  H  HB3  . GLU A 1 59  ? 17.555  0.697   9.388   1.00 4.40  ? 154 GLU A HB3  2  
ATOM   3602  H  HG2  . GLU A 1 59  ? 19.003  0.948   11.355  1.00 4.62  ? 154 GLU A HG2  2  
ATOM   3603  H  HG3  . GLU A 1 59  ? 20.173  1.861   10.379  1.00 5.57  ? 154 GLU A HG3  2  
ATOM   3604  N  N    . PRO A 1 60  ? 20.000  -2.137  10.449  1.00 3.10  ? 155 PRO A N    2  
ATOM   3605  C  CA   . PRO A 1 60  ? 20.009  -3.588  10.622  1.00 3.00  ? 155 PRO A CA   2  
ATOM   3606  C  C    . PRO A 1 60  ? 18.779  -4.123  11.358  1.00 2.89  ? 155 PRO A C    2  
ATOM   3607  O  O    . PRO A 1 60  ? 17.928  -4.746  10.720  1.00 2.97  ? 155 PRO A O    2  
ATOM   3608  C  CB   . PRO A 1 60  ? 21.345  -3.923  11.297  1.00 3.36  ? 155 PRO A CB   2  
ATOM   3609  C  CG   . PRO A 1 60  ? 21.807  -2.600  11.907  1.00 3.74  ? 155 PRO A CG   2  
ATOM   3610  C  CD   . PRO A 1 60  ? 21.254  -1.574  10.921  1.00 3.51  ? 155 PRO A CD   2  
ATOM   3611  H  HA   . PRO A 1 60  ? 20.018  -4.049  9.633   1.00 3.06  ? 155 PRO A HA   2  
ATOM   3612  H  HB2  . PRO A 1 60  ? 21.254  -4.708  12.049  1.00 3.57  ? 155 PRO A HB2  2  
ATOM   3613  H  HB3  . PRO A 1 60  ? 22.053  -4.227  10.524  1.00 3.40  ? 155 PRO A HB3  2  
ATOM   3614  H  HG2  . PRO A 1 60  ? 21.341  -2.460  12.884  1.00 3.98  ? 155 PRO A HG2  2  
ATOM   3615  H  HG3  . PRO A 1 60  ? 22.892  -2.543  11.989  1.00 4.11  ? 155 PRO A HG3  2  
ATOM   3616  H  HD2  . PRO A 1 60  ? 21.102  -0.614  11.416  1.00 3.94  ? 155 PRO A HD2  2  
ATOM   3617  H  HD3  . PRO A 1 60  ? 21.940  -1.463  10.081  1.00 3.44  ? 155 PRO A HD3  2  
ATOM   3618  N  N    . GLY A 1 61  ? 18.655  -3.849  12.664  1.00 3.97  ? 156 GLY A N    2  
ATOM   3619  C  CA   . GLY A 1 61  ? 17.627  -4.446  13.530  1.00 4.04  ? 156 GLY A CA   2  
ATOM   3620  C  C    . GLY A 1 61  ? 16.194  -3.966  13.282  1.00 3.81  ? 156 GLY A C    2  
ATOM   3621  O  O    . GLY A 1 61  ? 15.268  -4.503  13.885  1.00 3.84  ? 156 GLY A O    2  
ATOM   3622  H  H    . GLY A 1 61  ? 19.394  -3.328  13.113  1.00 5.14  ? 156 GLY A H    2  
ATOM   3623  H  HA2  . GLY A 1 61  ? 17.628  -5.526  13.378  1.00 4.11  ? 156 GLY A HA2  2  
ATOM   3624  H  HA3  . GLY A 1 61  ? 17.870  -4.234  14.572  1.00 4.37  ? 156 GLY A HA3  2  
ATOM   3625  N  N    . LEU A 1 62  ? 15.982  -2.985  12.396  1.00 3.93  ? 157 LEU A N    2  
ATOM   3626  C  CA   . LEU A 1 62  ? 14.638  -2.579  11.981  1.00 3.69  ? 157 LEU A CA   2  
ATOM   3627  C  C    . LEU A 1 62  ? 14.033  -3.609  10.999  1.00 3.45  ? 157 LEU A C    2  
ATOM   3628  O  O    . LEU A 1 62  ? 14.758  -4.082  10.114  1.00 3.84  ? 157 LEU A O    2  
ATOM   3629  C  CB   . LEU A 1 62  ? 14.663  -1.172  11.354  1.00 3.90  ? 157 LEU A CB   2  
ATOM   3630  C  CG   . LEU A 1 62  ? 15.132  -0.022  12.270  1.00 4.83  ? 157 LEU A CG   2  
ATOM   3631  C  CD1  . LEU A 1 62  ? 14.897  1.311   11.545  1.00 5.85  ? 157 LEU A CD1  2  
ATOM   3632  C  CD2  . LEU A 1 62  ? 14.400  0.015   13.622  1.00 5.46  ? 157 LEU A CD2  2  
ATOM   3633  H  H    . LEU A 1 62  ? 16.777  -2.624  11.890  1.00 4.29  ? 157 LEU A H    2  
ATOM   3634  H  HA   . LEU A 1 62  ? 14.014  -2.545  12.873  1.00 3.73  ? 157 LEU A HA   2  
ATOM   3635  H  HB2  . LEU A 1 62  ? 15.298  -1.191  10.466  1.00 3.95  ? 157 LEU A HB2  2  
ATOM   3636  H  HB3  . LEU A 1 62  ? 13.650  -0.951  11.024  1.00 3.88  ? 157 LEU A HB3  2  
ATOM   3637  H  HG   . LEU A 1 62  ? 16.202  -0.130  12.459  1.00 5.26  ? 157 LEU A HG   2  
ATOM   3638  H  HD11 . LEU A 1 62  ? 13.836  1.446   11.340  1.00 6.09  ? 157 LEU A HD11 2  
ATOM   3639  H  HD12 . LEU A 1 62  ? 15.238  2.136   12.170  1.00 6.72  ? 157 LEU A HD12 2  
ATOM   3640  H  HD13 . LEU A 1 62  ? 15.453  1.326   10.608  1.00 6.25  ? 157 LEU A HD13 2  
ATOM   3641  H  HD21 . LEU A 1 62  ? 14.709  0.897   14.185  1.00 6.48  ? 157 LEU A HD21 2  
ATOM   3642  H  HD22 . LEU A 1 62  ? 13.321  0.052   13.464  1.00 5.74  ? 157 LEU A HD22 2  
ATOM   3643  H  HD23 . LEU A 1 62  ? 14.653  -0.865  14.212  1.00 5.50  ? 157 LEU A HD23 2  
ATOM   3644  N  N    . PRO A 1 63  ? 12.734  -3.950  11.123  1.00 3.00  ? 158 PRO A N    2  
ATOM   3645  C  CA   . PRO A 1 63  ? 12.038  -4.838  10.198  1.00 2.89  ? 158 PRO A CA   2  
ATOM   3646  C  C    . PRO A 1 63  ? 11.540  -4.078  8.953   1.00 2.57  ? 158 PRO A C    2  
ATOM   3647  O  O    . PRO A 1 63  ? 11.284  -2.874  9.039   1.00 2.53  ? 158 PRO A O    2  
ATOM   3648  C  CB   . PRO A 1 63  ? 10.859  -5.395  11.001  1.00 2.70  ? 158 PRO A CB   2  
ATOM   3649  C  CG   . PRO A 1 63  ? 10.488  -4.226  11.914  1.00 2.40  ? 158 PRO A CG   2  
ATOM   3650  C  CD   . PRO A 1 63  ? 11.843  -3.587  12.220  1.00 2.75  ? 158 PRO A CD   2  
ATOM   3651  H  HA   . PRO A 1 63  ? 12.695  -5.657  9.906   1.00 3.39  ? 158 PRO A HA   2  
ATOM   3652  H  HB2  . PRO A 1 63  ? 10.025  -5.692  10.363  1.00 2.55  ? 158 PRO A HB2  2  
ATOM   3653  H  HB3  . PRO A 1 63  ? 11.195  -6.238  11.607  1.00 3.20  ? 158 PRO A HB3  2  
ATOM   3654  H  HG2  . PRO A 1 63  ? 9.860   -3.518  11.372  1.00 2.10  ? 158 PRO A HG2  2  
ATOM   3655  H  HG3  . PRO A 1 63  ? 9.987   -4.564  12.822  1.00 2.54  ? 158 PRO A HG3  2  
ATOM   3656  H  HD2  . PRO A 1 63  ? 11.738  -2.504  12.299  1.00 2.73  ? 158 PRO A HD2  2  
ATOM   3657  H  HD3  . PRO A 1 63  ? 12.236  -4.001  13.149  1.00 3.07  ? 158 PRO A HD3  2  
ATOM   3658  N  N    . PRO A 1 64  ? 11.342  -4.768  7.813   1.00 2.49  ? 159 PRO A N    2  
ATOM   3659  C  CA   . PRO A 1 64  ? 10.630  -4.229  6.662   1.00 2.26  ? 159 PRO A CA   2  
ATOM   3660  C  C    . PRO A 1 64  ? 9.107   -4.270  6.878   1.00 2.04  ? 159 PRO A C    2  
ATOM   3661  O  O    . PRO A 1 64  ? 8.592   -5.030  7.697   1.00 2.69  ? 159 PRO A O    2  
ATOM   3662  C  CB   . PRO A 1 64  ? 11.055  -5.117  5.489   1.00 2.52  ? 159 PRO A CB   2  
ATOM   3663  C  CG   . PRO A 1 64  ? 11.244  -6.482  6.149   1.00 2.67  ? 159 PRO A CG   2  
ATOM   3664  C  CD   . PRO A 1 64  ? 11.792  -6.126  7.532   1.00 2.79  ? 159 PRO A CD   2  
ATOM   3665  H  HA   . PRO A 1 64  ? 10.943  -3.202  6.473   1.00 2.39  ? 159 PRO A HA   2  
ATOM   3666  H  HB2  . PRO A 1 64  ? 10.309  -5.150  4.694   1.00 2.49  ? 159 PRO A HB2  2  
ATOM   3667  H  HB3  . PRO A 1 64  ? 12.012  -4.767  5.099   1.00 2.85  ? 159 PRO A HB3  2  
ATOM   3668  H  HG2  . PRO A 1 64  ? 10.277  -6.976  6.254   1.00 2.56  ? 159 PRO A HG2  2  
ATOM   3669  H  HG3  . PRO A 1 64  ? 11.937  -7.110  5.589   1.00 3.01  ? 159 PRO A HG3  2  
ATOM   3670  H  HD2  . PRO A 1 64  ? 11.415  -6.830  8.274   1.00 2.96  ? 159 PRO A HD2  2  
ATOM   3671  H  HD3  . PRO A 1 64  ? 12.882  -6.146  7.506   1.00 3.13  ? 159 PRO A HD3  2  
ATOM   3672  N  N    . VAL A 1 65  ? 8.386   -3.469  6.091   1.00 1.56  ? 160 VAL A N    2  
ATOM   3673  C  CA   . VAL A 1 65  ? 6.914   -3.400  6.028   1.00 1.39  ? 160 VAL A CA   2  
ATOM   3674  C  C    . VAL A 1 65  ? 6.520   -3.325  4.548   1.00 1.48  ? 160 VAL A C    2  
ATOM   3675  O  O    . VAL A 1 65  ? 7.225   -2.691  3.762   1.00 1.77  ? 160 VAL A O    2  
ATOM   3676  C  CB   . VAL A 1 65  ? 6.379   -2.166  6.800   1.00 1.59  ? 160 VAL A CB   2  
ATOM   3677  C  CG1  . VAL A 1 65  ? 4.852   -2.018  6.674   1.00 2.68  ? 160 VAL A CG1  2  
ATOM   3678  C  CG2  . VAL A 1 65  ? 6.741   -2.217  8.296   1.00 2.94  ? 160 VAL A CG2  2  
ATOM   3679  H  H    . VAL A 1 65  ? 8.885   -2.887  5.433   1.00 1.73  ? 160 VAL A H    2  
ATOM   3680  H  HA   . VAL A 1 65  ? 6.487   -4.307  6.461   1.00 1.33  ? 160 VAL A HA   2  
ATOM   3681  H  HB   . VAL A 1 65  ? 6.835   -1.271  6.374   1.00 1.82  ? 160 VAL A HB   2  
ATOM   3682  H  HG11 . VAL A 1 65  ? 4.581   -1.818  5.637   1.00 3.33  ? 160 VAL A HG11 2  
ATOM   3683  H  HG12 . VAL A 1 65  ? 4.351   -2.927  7.007   1.00 3.41  ? 160 VAL A HG12 2  
ATOM   3684  H  HG13 . VAL A 1 65  ? 4.507   -1.178  7.279   1.00 3.53  ? 160 VAL A HG13 2  
ATOM   3685  H  HG21 . VAL A 1 65  ? 6.361   -3.135  8.745   1.00 3.92  ? 160 VAL A HG21 2  
ATOM   3686  H  HG22 . VAL A 1 65  ? 7.823   -2.177  8.425   1.00 3.49  ? 160 VAL A HG22 2  
ATOM   3687  H  HG23 . VAL A 1 65  ? 6.307   -1.361  8.812   1.00 3.60  ? 160 VAL A HG23 2  
ATOM   3688  N  N    . GLN A 1 66  ? 5.427   -3.983  4.149   1.00 1.40  ? 161 GLN A N    2  
ATOM   3689  C  CA   . GLN A 1 66  ? 4.989   -4.027  2.750   1.00 1.48  ? 161 GLN A CA   2  
ATOM   3690  C  C    . GLN A 1 66  ? 3.919   -2.972  2.426   1.00 1.28  ? 161 GLN A C    2  
ATOM   3691  O  O    . GLN A 1 66  ? 2.785   -3.143  2.870   1.00 1.16  ? 161 GLN A O    2  
ATOM   3692  C  CB   . GLN A 1 66  ? 4.401   -5.407  2.427   1.00 1.78  ? 161 GLN A CB   2  
ATOM   3693  C  CG   . GLN A 1 66  ? 5.473   -6.483  2.222   1.00 2.83  ? 161 GLN A CG   2  
ATOM   3694  C  CD   . GLN A 1 66  ? 4.878   -7.793  1.708   1.00 3.49  ? 161 GLN A CD   2  
ATOM   3695  O  OE1  . GLN A 1 66  ? 5.237   -8.872  2.158   1.00 4.32  ? 161 GLN A OE1  2  
ATOM   3696  N  NE2  . GLN A 1 66  ? 3.976   -7.750  0.746   1.00 3.69  ? 161 GLN A NE2  2  
ATOM   3697  H  H    . GLN A 1 66  ? 4.874   -4.483  4.844   1.00 1.42  ? 161 GLN A H    2  
ATOM   3698  H  HA   . GLN A 1 66  ? 5.845   -3.872  2.096   1.00 1.58  ? 161 GLN A HA   2  
ATOM   3699  H  HB2  . GLN A 1 66  ? 3.714   -5.717  3.217   1.00 2.77  ? 161 GLN A HB2  2  
ATOM   3700  H  HB3  . GLN A 1 66  ? 3.829   -5.304  1.504   1.00 1.64  ? 161 GLN A HB3  2  
ATOM   3701  H  HG2  . GLN A 1 66  ? 6.197   -6.131  1.487   1.00 3.05  ? 161 GLN A HG2  2  
ATOM   3702  H  HG3  . GLN A 1 66  ? 5.988   -6.664  3.165   1.00 4.10  ? 161 GLN A HG3  2  
ATOM   3703  H  HE21 . GLN A 1 66  ? 3.649   -6.868  0.392   1.00 3.26  ? 161 GLN A HE21 2  
ATOM   3704  H  HE22 . GLN A 1 66  ? 3.549   -8.608  0.453   1.00 4.61  ? 161 GLN A HE22 2  
ATOM   3705  N  N    . PRO A 1 67  ? 4.210   -1.954  1.591   1.00 1.27  ? 162 PRO A N    2  
ATOM   3706  C  CA   . PRO A 1 67  ? 3.185   -1.079  1.042   1.00 1.08  ? 162 PRO A CA   2  
ATOM   3707  C  C    . PRO A 1 67  ? 2.430   -1.799  -0.084  1.00 0.93  ? 162 PRO A C    2  
ATOM   3708  O  O    . PRO A 1 67  ? 3.025   -2.186  -1.091  1.00 0.99  ? 162 PRO A O    2  
ATOM   3709  C  CB   . PRO A 1 67  ? 3.931   0.167   0.556   1.00 1.24  ? 162 PRO A CB   2  
ATOM   3710  C  CG   . PRO A 1 67  ? 5.310   -0.366  0.166   1.00 1.47  ? 162 PRO A CG   2  
ATOM   3711  C  CD   . PRO A 1 67  ? 5.527   -1.554  1.108   1.00 1.48  ? 162 PRO A CD   2  
ATOM   3712  H  HA   . PRO A 1 67  ? 2.487   -0.781  1.822   1.00 1.03  ? 162 PRO A HA   2  
ATOM   3713  H  HB2  . PRO A 1 67  ? 3.427   0.647   -0.283  1.00 1.18  ? 162 PRO A HB2  2  
ATOM   3714  H  HB3  . PRO A 1 67  ? 4.035   0.866   1.386   1.00 1.34  ? 162 PRO A HB3  2  
ATOM   3715  H  HG2  . PRO A 1 67  ? 5.291   -0.716  -0.866  1.00 1.43  ? 162 PRO A HG2  2  
ATOM   3716  H  HG3  . PRO A 1 67  ? 6.083   0.393   0.293   1.00 1.69  ? 162 PRO A HG3  2  
ATOM   3717  H  HD2  . PRO A 1 67  ? 6.011   -2.365  0.564   1.00 1.54  ? 162 PRO A HD2  2  
ATOM   3718  H  HD3  . PRO A 1 67  ? 6.141   -1.248  1.953   1.00 1.63  ? 162 PRO A HD3  2  
ATOM   3719  N  N    . VAL A 1 68  ? 1.116   -1.959  0.087   1.00 0.98  ? 163 VAL A N    2  
ATOM   3720  C  CA   . VAL A 1 68  ? 0.183   -2.418  -0.959  1.00 1.02  ? 163 VAL A CA   2  
ATOM   3721  C  C    . VAL A 1 68  ? -0.486  -1.192  -1.584  1.00 0.91  ? 163 VAL A C    2  
ATOM   3722  O  O    . VAL A 1 68  ? -1.088  -0.391  -0.864  1.00 0.85  ? 163 VAL A O    2  
ATOM   3723  C  CB   . VAL A 1 68  ? -0.924  -3.346  -0.405  1.00 1.08  ? 163 VAL A CB   2  
ATOM   3724  C  CG1  . VAL A 1 68  ? -1.883  -3.823  -1.512  1.00 1.69  ? 163 VAL A CG1  2  
ATOM   3725  C  CG2  . VAL A 1 68  ? -0.321  -4.591  0.264   1.00 1.86  ? 163 VAL A CG2  2  
ATOM   3726  H  H    . VAL A 1 68  ? 0.721   -1.656  0.982   1.00 1.10  ? 163 VAL A H    2  
ATOM   3727  H  HA   . VAL A 1 68  ? 0.745   -2.983  -1.710  1.00 1.19  ? 163 VAL A HA   2  
ATOM   3728  H  HB   . VAL A 1 68  ? -1.518  -2.805  0.336   1.00 2.01  ? 163 VAL A HB   2  
ATOM   3729  H  HG11 . VAL A 1 68  ? -2.641  -4.478  -1.086  1.00 2.78  ? 163 VAL A HG11 2  
ATOM   3730  H  HG12 . VAL A 1 68  ? -2.396  -2.978  -1.969  1.00 2.58  ? 163 VAL A HG12 2  
ATOM   3731  H  HG13 . VAL A 1 68  ? -1.331  -4.364  -2.282  1.00 2.00  ? 163 VAL A HG13 2  
ATOM   3732  H  HG21 . VAL A 1 68  ? 0.238   -5.172  -0.469  1.00 2.70  ? 163 VAL A HG21 2  
ATOM   3733  H  HG22 . VAL A 1 68  ? 0.347   -4.299  1.074   1.00 2.63  ? 163 VAL A HG22 2  
ATOM   3734  H  HG23 . VAL A 1 68  ? -1.120  -5.205  0.679   1.00 2.58  ? 163 VAL A HG23 2  
ATOM   3735  N  N    . PHE A 1 69  ? -0.445  -1.075  -2.915  1.00 0.96  ? 164 PHE A N    2  
ATOM   3736  C  CA   . PHE A 1 69  ? -1.258  -0.116  -3.660  1.00 0.98  ? 164 PHE A CA   2  
ATOM   3737  C  C    . PHE A 1 69  ? -2.596  -0.762  -4.031  1.00 6.40  ? 164 PHE A C    2  
ATOM   3738  O  O    . PHE A 1 69  ? -2.690  -1.571  -4.956  1.00 4.98  ? 164 PHE A O    2  
ATOM   3739  C  CB   . PHE A 1 69  ? -0.491  0.389   -4.893  1.00 1.04  ? 164 PHE A CB   2  
ATOM   3740  C  CG   . PHE A 1 69  ? -1.299  1.188   -5.910  1.00 1.37  ? 164 PHE A CG   2  
ATOM   3741  C  CD1  . PHE A 1 69  ? -2.307  2.089   -5.504  1.00 2.55  ? 164 PHE A CD1  2  
ATOM   3742  C  CD2  . PHE A 1 69  ? -1.033  1.028   -7.285  1.00 2.59  ? 164 PHE A CD2  2  
ATOM   3743  C  CE1  . PHE A 1 69  ? -3.051  2.800   -6.462  1.00 3.50  ? 164 PHE A CE1  2  
ATOM   3744  C  CE2  . PHE A 1 69  ? -1.770  1.751   -8.242  1.00 3.18  ? 164 PHE A CE2  2  
ATOM   3745  C  CZ   . PHE A 1 69  ? -2.783  2.633   -7.830  1.00 2.40  ? 164 PHE A CZ   2  
ATOM   3746  H  H    . PHE A 1 69  ? 0.005   -1.812  -3.449  1.00 1.06  ? 164 PHE A H    2  
ATOM   3747  H  HA   . PHE A 1 69  ? -1.465  0.747   -3.026  1.00 0.91  ? 164 PHE A HA   2  
ATOM   3748  H  HB2  . PHE A 1 69  ? 0.329   1.017   -4.546  1.00 0.82  ? 164 PHE A HB2  2  
ATOM   3749  H  HB3  . PHE A 1 69  ? -0.060  -0.475  -5.401  1.00 1.26  ? 164 PHE A HB3  2  
ATOM   3750  H  HD1  . PHE A 1 69  ? -2.532  2.232   -4.458  1.00 4.18  ? 164 PHE A HD1  2  
ATOM   3751  H  HD2  . PHE A 1 69  ? -0.257  0.350   -7.610  1.00 4.34  ? 164 PHE A HD2  2  
ATOM   3752  H  HE1  . PHE A 1 69  ? -3.833  3.474   -6.143  1.00 4.59  ? 164 PHE A HE1  2  
ATOM   3753  H  HE2  . PHE A 1 69  ? -1.558  1.632   -9.294  1.00 4.36  ? 164 PHE A HE2  2  
ATOM   3754  H  HZ   . PHE A 1 69  ? -3.354  3.185   -8.563  1.00 3.33  ? 164 PHE A HZ   2  
ATOM   3755  N  N    . ILE A 1 70  ? -3.652  -0.364  -3.325  1.00 1.27  ? 165 ILE A N    2  
ATOM   3756  C  CA   . ILE A 1 70  ? -5.033  -0.636  -3.717  1.00 1.19  ? 165 ILE A CA   2  
ATOM   3757  C  C    . ILE A 1 70  ? -5.497  0.576   -4.534  1.00 1.18  ? 165 ILE A C    2  
ATOM   3758  O  O    . ILE A 1 70  ? -5.460  1.702   -4.030  1.00 1.29  ? 165 ILE A O    2  
ATOM   3759  C  CB   . ILE A 1 70  ? -5.929  -0.877  -2.474  1.00 1.20  ? 165 ILE A CB   2  
ATOM   3760  C  CG1  . ILE A 1 70  ? -5.283  -1.888  -1.495  1.00 1.46  ? 165 ILE A CG1  2  
ATOM   3761  C  CG2  . ILE A 1 70  ? -7.305  -1.378  -2.946  1.00 1.36  ? 165 ILE A CG2  2  
ATOM   3762  C  CD1  . ILE A 1 70  ? -6.096  -2.206  -0.236  1.00 1.61  ? 165 ILE A CD1  2  
ATOM   3763  H  H    . ILE A 1 70  ? -3.520  0.317   -2.580  1.00 1.38  ? 165 ILE A H    2  
ATOM   3764  H  HA   . ILE A 1 70  ? -5.062  -1.530  -4.343  1.00 1.18  ? 165 ILE A HA   2  
ATOM   3765  H  HB   . ILE A 1 70  ? -6.069  0.068   -1.944  1.00 1.25  ? 165 ILE A HB   2  
ATOM   3766  H  HG12 . ILE A 1 70  ? -5.090  -2.819  -2.029  1.00 2.21  ? 165 ILE A HG12 2  
ATOM   3767  H  HG13 . ILE A 1 70  ? -4.335  -1.482  -1.149  1.00 1.90  ? 165 ILE A HG13 2  
ATOM   3768  H  HG21 . ILE A 1 70  ? -7.741  -0.677  -3.655  1.00 1.48  ? 165 ILE A HG21 2  
ATOM   3769  H  HG22 . ILE A 1 70  ? -7.200  -2.355  -3.418  1.00 2.53  ? 165 ILE A HG22 2  
ATOM   3770  H  HG23 . ILE A 1 70  ? -7.986  -1.458  -2.099  1.00 2.13  ? 165 ILE A HG23 2  
ATOM   3771  H  HD11 . ILE A 1 70  ? -5.509  -2.852  0.419   1.00 2.56  ? 165 ILE A HD11 2  
ATOM   3772  H  HD12 . ILE A 1 70  ? -6.321  -1.282  0.294   1.00 2.44  ? 165 ILE A HD12 2  
ATOM   3773  H  HD13 . ILE A 1 70  ? -7.022  -2.724  -0.489  1.00 2.12  ? 165 ILE A HD13 2  
ATOM   3774  N  N    . THR A 1 71  ? -5.912  0.380   -5.790  1.00 1.11  ? 166 THR A N    2  
ATOM   3775  C  CA   . THR A 1 71  ? -6.538  1.469   -6.555  1.00 1.18  ? 166 THR A CA   2  
ATOM   3776  C  C    . THR A 1 71  ? -7.991  1.619   -6.124  1.00 1.19  ? 166 THR A C    2  
ATOM   3777  O  O    . THR A 1 71  ? -8.673  0.617   -5.921  1.00 1.42  ? 166 THR A O    2  
ATOM   3778  C  CB   . THR A 1 71  ? -6.364  1.292   -8.060  1.00 1.29  ? 166 THR A CB   2  
ATOM   3779  O  OG1  . THR A 1 71  ? -6.711  2.503   -8.678  1.00 2.00  ? 166 THR A OG1  2  
ATOM   3780  C  CG2  . THR A 1 71  ? -7.210  0.180   -8.676  1.00 2.17  ? 166 THR A CG2  2  
ATOM   3781  H  H    . THR A 1 71  ? -5.907  -0.554  -6.177  1.00 1.06  ? 166 THR A H    2  
ATOM   3782  H  HA   . THR A 1 71  ? -6.022  2.392   -6.296  1.00 1.36  ? 166 THR A HA   2  
ATOM   3783  H  HB   . THR A 1 71  ? -5.310  1.090   -8.263  1.00 2.29  ? 166 THR A HB   2  
ATOM   3784  H  HG1  . THR A 1 71  ? -6.421  2.438   -9.592  1.00 2.35  ? 166 THR A HG1  2  
ATOM   3785  H  HG21 . THR A 1 71  ? -8.271  0.342   -8.485  1.00 2.64  ? 166 THR A HG21 2  
ATOM   3786  H  HG22 . THR A 1 71  ? -7.056  0.147   -9.751  1.00 2.46  ? 166 THR A HG22 2  
ATOM   3787  H  HG23 . THR A 1 71  ? -6.899  -0.767  -8.247  1.00 3.48  ? 166 THR A HG23 2  
ATOM   3788  N  N    . VAL A 1 72  ? -8.443  2.863   -5.988  1.00 1.22  ? 167 VAL A N    2  
ATOM   3789  C  CA   . VAL A 1 72  ? -9.802  3.225   -5.539  1.00 1.31  ? 167 VAL A CA   2  
ATOM   3790  C  C    . VAL A 1 72  ? -10.493 4.225   -6.495  1.00 1.57  ? 167 VAL A C    2  
ATOM   3791  O  O    . VAL A 1 72  ? -11.565 4.735   -6.191  1.00 1.97  ? 167 VAL A O    2  
ATOM   3792  C  CB   . VAL A 1 72  ? -9.757  3.680   -4.055  1.00 1.92  ? 167 VAL A CB   2  
ATOM   3793  C  CG1  . VAL A 1 72  ? -9.327  5.143   -3.853  1.00 1.91  ? 167 VAL A CG1  2  
ATOM   3794  C  CG2  . VAL A 1 72  ? -11.066 3.388   -3.306  1.00 3.17  ? 167 VAL A CG2  2  
ATOM   3795  H  H    . VAL A 1 72  ? -7.761  3.609   -6.106  1.00 1.34  ? 167 VAL A H    2  
ATOM   3796  H  HA   . VAL A 1 72  ? -10.401 2.315   -5.578  1.00 1.23  ? 167 VAL A HA   2  
ATOM   3797  H  HB   . VAL A 1 72  ? -8.998  3.071   -3.557  1.00 3.32  ? 167 VAL A HB   2  
ATOM   3798  H  HG11 . VAL A 1 72  ? -10.077 5.826   -4.249  1.00 2.28  ? 167 VAL A HG11 2  
ATOM   3799  H  HG12 . VAL A 1 72  ? -9.199  5.343   -2.789  1.00 2.90  ? 167 VAL A HG12 2  
ATOM   3800  H  HG13 . VAL A 1 72  ? -8.377  5.321   -4.350  1.00 2.72  ? 167 VAL A HG13 2  
ATOM   3801  H  HG21 . VAL A 1 72  ? -11.889 3.971   -3.718  1.00 3.38  ? 167 VAL A HG21 2  
ATOM   3802  H  HG22 . VAL A 1 72  ? -11.298 2.325   -3.379  1.00 4.21  ? 167 VAL A HG22 2  
ATOM   3803  H  HG23 . VAL A 1 72  ? -10.945 3.639   -2.251  1.00 4.00  ? 167 VAL A HG23 2  
ATOM   3804  N  N    . ASP A 1 73  ? -9.886  4.450   -7.671  1.00 1.80  ? 168 ASP A N    2  
ATOM   3805  C  CA   . ASP A 1 73  ? -10.350 5.192   -8.846  1.00 2.25  ? 168 ASP A CA   2  
ATOM   3806  C  C    . ASP A 1 73  ? -9.170  5.215   -9.836  1.00 3.34  ? 168 ASP A C    2  
ATOM   3807  O  O    . ASP A 1 73  ? -8.421  6.197   -9.917  1.00 4.17  ? 168 ASP A O    2  
ATOM   3808  C  CB   . ASP A 1 73  ? -10.989 6.579   -8.629  1.00 2.64  ? 168 ASP A CB   2  
ATOM   3809  C  CG   . ASP A 1 73  ? -11.683 7.054   -9.918  1.00 2.96  ? 168 ASP A CG   2  
ATOM   3810  O  OD1  . ASP A 1 73  ? -11.454 6.496   -11.018 1.00 3.19  ? 168 ASP A OD1  2  
ATOM   3811  O  OD2  . ASP A 1 73  ? -12.583 7.924   -9.861  1.00 3.70  ? 168 ASP A OD2  2  
ATOM   3812  H  H    . ASP A 1 73  ? -9.094  3.855   -7.892  1.00 1.72  ? 168 ASP A H    2  
ATOM   3813  H  HA   . ASP A 1 73  ? -11.160 4.610   -9.275  1.00 2.12  ? 168 ASP A HA   2  
ATOM   3814  H  HB2  . ASP A 1 73  ? -11.749 6.525   -7.852  1.00 2.76  ? 168 ASP A HB2  2  
ATOM   3815  H  HB3  . ASP A 1 73  ? -10.242 7.304   -8.319  1.00 3.25  ? 168 ASP A HB3  2  
ATOM   3816  N  N    . PRO A 1 74  ? -8.967  4.101   -10.563 1.00 3.86  ? 169 PRO A N    2  
ATOM   3817  C  CA   . PRO A 1 74  ? -7.938  3.985   -11.589 1.00 5.05  ? 169 PRO A CA   2  
ATOM   3818  C  C    . PRO A 1 74  ? -8.247  4.799   -12.856 1.00 5.36  ? 169 PRO A C    2  
ATOM   3819  O  O    . PRO A 1 74  ? -7.463  4.703   -13.797 1.00 6.51  ? 169 PRO A O    2  
ATOM   3820  C  CB   . PRO A 1 74  ? -7.850  2.482   -11.896 1.00 5.68  ? 169 PRO A CB   2  
ATOM   3821  C  CG   . PRO A 1 74  ? -9.245  1.972   -11.559 1.00 5.08  ? 169 PRO A CG   2  
ATOM   3822  C  CD   . PRO A 1 74  ? -9.662  2.831   -10.384 1.00 3.91  ? 169 PRO A CD   2  
ATOM   3823  H  HA   . PRO A 1 74  ? -6.985  4.330   -11.191 1.00 5.49  ? 169 PRO A HA   2  
ATOM   3824  H  HB2  . PRO A 1 74  ? -7.601  2.272   -12.936 1.00 6.44  ? 169 PRO A HB2  2  
ATOM   3825  H  HB3  . PRO A 1 74  ? -7.123  2.009   -11.242 1.00 5.93  ? 169 PRO A HB3  2  
ATOM   3826  H  HG2  . PRO A 1 74  ? -9.912  2.198   -12.384 1.00 5.17  ? 169 PRO A HG2  2  
ATOM   3827  H  HG3  . PRO A 1 74  ? -9.254  0.908   -11.316 1.00 5.55  ? 169 PRO A HG3  2  
ATOM   3828  H  HD2  . PRO A 1 74  ? -10.745 2.945   -10.397 1.00 3.52  ? 169 PRO A HD2  2  
ATOM   3829  H  HD3  . PRO A 1 74  ? -9.343  2.361   -9.452  1.00 3.88  ? 169 PRO A HD3  2  
ATOM   3830  N  N    . GLU A 1 75  ? -9.377  5.532   -12.920 1.00 4.55  ? 170 GLU A N    2  
ATOM   3831  C  CA   . GLU A 1 75  ? -9.883  6.323   -14.036 1.00 4.71  ? 170 GLU A CA   2  
ATOM   3832  C  C    . GLU A 1 75  ? -10.326 5.448   -15.220 1.00 2.87  ? 170 GLU A C    2  
ATOM   3833  O  O    . GLU A 1 75  ? -11.499 5.450   -15.599 1.00 2.59  ? 170 GLU A O    2  
ATOM   3834  C  CB   . GLU A 1 75  ? -8.855  7.404   -14.396 1.00 6.42  ? 170 GLU A CB   2  
ATOM   3835  C  CG   . GLU A 1 75  ? -9.500  8.531   -15.186 1.00 7.47  ? 170 GLU A CG   2  
ATOM   3836  C  CD   . GLU A 1 75  ? -8.478  9.614   -15.546 1.00 9.39  ? 170 GLU A CD   2  
ATOM   3837  O  OE1  . GLU A 1 75  ? -7.402  9.287   -16.098 1.00 10.32 ? 170 GLU A OE1  2  
ATOM   3838  O  OE2  . GLU A 1 75  ? -8.713  10.798  -15.223 1.00 10.35 ? 170 GLU A OE2  2  
ATOM   3839  H  H    . GLU A 1 75  ? -9.911  5.701   -12.079 1.00 4.08  ? 170 GLU A H    2  
ATOM   3840  H  HA   . GLU A 1 75  ? -10.775 6.833   -13.672 1.00 5.48  ? 170 GLU A HA   2  
ATOM   3841  H  HB2  . GLU A 1 75  ? -8.477  7.841   -13.475 1.00 6.80  ? 170 GLU A HB2  2  
ATOM   3842  H  HB3  . GLU A 1 75  ? -8.031  6.971   -14.962 1.00 7.00  ? 170 GLU A HB3  2  
ATOM   3843  H  HG2  . GLU A 1 75  ? -9.946  8.099   -16.076 1.00 7.42  ? 170 GLU A HG2  2  
ATOM   3844  H  HG3  . GLU A 1 75  ? -10.293 8.953   -14.566 1.00 7.27  ? 170 GLU A HG3  2  
ATOM   3845  N  N    . ARG A 1 76  ? -9.393  4.663   -15.763 1.00 2.47  ? 171 ARG A N    2  
ATOM   3846  C  CA   . ARG A 1 76  ? -9.566  3.748   -16.887 1.00 2.27  ? 171 ARG A CA   2  
ATOM   3847  C  C    . ARG A 1 76  ? -9.709  2.270   -16.467 1.00 2.50  ? 171 ARG A C    2  
ATOM   3848  O  O    . ARG A 1 76  ? -10.052 1.464   -17.323 1.00 3.70  ? 171 ARG A O    2  
ATOM   3849  C  CB   . ARG A 1 76  ? -8.357  3.960   -17.820 1.00 3.91  ? 171 ARG A CB   2  
ATOM   3850  C  CG   . ARG A 1 76  ? -8.523  3.468   -19.266 1.00 5.24  ? 171 ARG A CG   2  
ATOM   3851  C  CD   . ARG A 1 76  ? -9.696  4.135   -20.002 1.00 5.67  ? 171 ARG A CD   2  
ATOM   3852  N  NE   . ARG A 1 76  ? -9.630  3.858   -21.445 1.00 6.64  ? 171 ARG A NE   2  
ATOM   3853  C  CZ   . ARG A 1 76  ? -8.890  4.494   -22.347 1.00 7.03  ? 171 ARG A CZ   2  
ATOM   3854  N  NH1  . ARG A 1 76  ? -8.244  5.609   -22.074 1.00 6.86  ? 171 ARG A NH1  2  
ATOM   3855  N  NH2  . ARG A 1 76  ? -8.776  3.997   -23.556 1.00 8.13  ? 171 ARG A NH2  2  
ATOM   3856  H  H    . ARG A 1 76  ? -8.467  4.729   -15.355 1.00 3.34  ? 171 ARG A H    2  
ATOM   3857  H  HA   . ARG A 1 76  ? -10.477 4.028   -17.414 1.00 2.37  ? 171 ARG A HA   2  
ATOM   3858  H  HB2  . ARG A 1 76  ? -8.140  5.030   -17.872 1.00 4.25  ? 171 ARG A HB2  2  
ATOM   3859  H  HB3  . ARG A 1 76  ? -7.483  3.473   -17.382 1.00 4.46  ? 171 ARG A HB3  2  
ATOM   3860  H  HG2  . ARG A 1 76  ? -7.599  3.699   -19.797 1.00 6.04  ? 171 ARG A HG2  2  
ATOM   3861  H  HG3  . ARG A 1 76  ? -8.652  2.387   -19.283 1.00 5.77  ? 171 ARG A HG3  2  
ATOM   3862  H  HD2  . ARG A 1 76  ? -10.635 3.738   -19.609 1.00 5.94  ? 171 ARG A HD2  2  
ATOM   3863  H  HD3  . ARG A 1 76  ? -9.682  5.212   -19.826 1.00 5.56  ? 171 ARG A HD3  2  
ATOM   3864  H  HE   . ARG A 1 76  ? -10.189 3.069   -21.761 1.00 7.40  ? 171 ARG A HE   2  
ATOM   3865  H  HH11 . ARG A 1 76  ? -8.354  6.045   -21.177 1.00 6.32  ? 171 ARG A HH11 2  
ATOM   3866  H  HH12 . ARG A 1 76  ? -7.739  6.101   -22.806 1.00 7.58  ? 171 ARG A HH12 2  
ATOM   3867  H  HH21 . ARG A 1 76  ? -9.277  3.151   -23.805 1.00 8.69  ? 171 ARG A HH21 2  
ATOM   3868  H  HH22 . ARG A 1 76  ? -8.150  4.424   -24.229 1.00 8.65  ? 171 ARG A HH22 2  
ATOM   3869  N  N    . ASP A 1 77  ? -9.453  1.914   -15.194 1.00 2.10  ? 172 ASP A N    2  
ATOM   3870  C  CA   . ASP A 1 77  ? -9.665  0.563   -14.635 1.00 3.11  ? 172 ASP A CA   2  
ATOM   3871  C  C    . ASP A 1 77  ? -9.189  -0.635  -15.493 1.00 2.71  ? 172 ASP A C    2  
ATOM   3872  O  O    . ASP A 1 77  ? -9.983  -1.428  -16.004 1.00 3.10  ? 172 ASP A O    2  
ATOM   3873  C  CB   . ASP A 1 77  ? -11.139 0.426   -14.200 1.00 4.64  ? 172 ASP A CB   2  
ATOM   3874  C  CG   . ASP A 1 77  ? -11.399 -0.813  -13.340 1.00 6.09  ? 172 ASP A CG   2  
ATOM   3875  O  OD1  . ASP A 1 77  ? -10.452 -1.342  -12.714 1.00 6.06  ? 172 ASP A OD1  2  
ATOM   3876  O  OD2  . ASP A 1 77  ? -12.564 -1.276  -13.316 1.00 7.71  ? 172 ASP A OD2  2  
ATOM   3877  H  H    . ASP A 1 77  ? -9.250  2.645   -14.515 1.00 1.69  ? 172 ASP A H    2  
ATOM   3878  H  HA   . ASP A 1 77  ? -9.034  0.510   -13.748 1.00 3.73  ? 172 ASP A HA   2  
ATOM   3879  H  HB2  . ASP A 1 77  ? -11.446 1.306   -13.635 1.00 4.59  ? 172 ASP A HB2  2  
ATOM   3880  H  HB3  . ASP A 1 77  ? -11.770 0.383   -15.090 1.00 5.45  ? 172 ASP A HB3  2  
ATOM   3881  N  N    . ASP A 1 78  ? -7.868  -0.800  -15.590 1.00 2.20  ? 173 ASP A N    2  
ATOM   3882  C  CA   . ASP A 1 78  ? -7.220  -1.920  -16.277 1.00 1.88  ? 173 ASP A CA   2  
ATOM   3883  C  C    . ASP A 1 78  ? -5.922  -2.315  -15.550 1.00 1.64  ? 173 ASP A C    2  
ATOM   3884  O  O    . ASP A 1 78  ? -5.254  -1.461  -14.967 1.00 1.72  ? 173 ASP A O    2  
ATOM   3885  C  CB   . ASP A 1 78  ? -6.953  -1.514  -17.738 1.00 1.79  ? 173 ASP A CB   2  
ATOM   3886  C  CG   . ASP A 1 78  ? -6.601  -2.703  -18.631 1.00 2.34  ? 173 ASP A CG   2  
ATOM   3887  O  OD1  . ASP A 1 78  ? -5.481  -3.246  -18.517 1.00 3.40  ? 173 ASP A OD1  2  
ATOM   3888  O  OD2  . ASP A 1 78  ? -7.428  -3.107  -19.477 1.00 2.70  ? 173 ASP A OD2  2  
ATOM   3889  H  H    . ASP A 1 78  ? -7.266  -0.138  -15.128 1.00 2.27  ? 173 ASP A H    2  
ATOM   3890  H  HA   . ASP A 1 78  ? -7.898  -2.776  -16.272 1.00 2.11  ? 173 ASP A HA   2  
ATOM   3891  H  HB2  . ASP A 1 78  ? -7.844  -1.032  -18.145 1.00 2.21  ? 173 ASP A HB2  2  
ATOM   3892  H  HB3  . ASP A 1 78  ? -6.138  -0.786  -17.768 1.00 1.62  ? 173 ASP A HB3  2  
ATOM   3893  N  N    . VAL A 1 79  ? -5.527  -3.592  -15.624 1.00 1.51  ? 174 VAL A N    2  
ATOM   3894  C  CA   . VAL A 1 79  ? -4.239  -4.092  -15.093 1.00 1.31  ? 174 VAL A CA   2  
ATOM   3895  C  C    . VAL A 1 79  ? -3.034  -3.304  -15.631 1.00 1.20  ? 174 VAL A C    2  
ATOM   3896  O  O    . VAL A 1 79  ? -2.054  -3.132  -14.907 1.00 1.22  ? 174 VAL A O    2  
ATOM   3897  C  CB   . VAL A 1 79  ? -4.019  -5.603  -15.369 1.00 1.40  ? 174 VAL A CB   2  
ATOM   3898  C  CG1  . VAL A 1 79  ? -4.965  -6.467  -14.521 1.00 2.44  ? 174 VAL A CG1  2  
ATOM   3899  C  CG2  . VAL A 1 79  ? -4.185  -5.984  -16.853 1.00 1.94  ? 174 VAL A CG2  2  
ATOM   3900  H  H    . VAL A 1 79  ? -6.099  -4.224  -16.163 1.00 1.65  ? 174 VAL A H    2  
ATOM   3901  H  HA   . VAL A 1 79  ? -4.257  -3.951  -14.013 1.00 1.37  ? 174 VAL A HA   2  
ATOM   3902  H  HB   . VAL A 1 79  ? -3.000  -5.856  -15.073 1.00 2.41  ? 174 VAL A HB   2  
ATOM   3903  H  HG11 . VAL A 1 79  ? -6.005  -6.218  -14.735 1.00 3.47  ? 174 VAL A HG11 2  
ATOM   3904  H  HG12 . VAL A 1 79  ? -4.800  -7.523  -14.738 1.00 2.82  ? 174 VAL A HG12 2  
ATOM   3905  H  HG13 . VAL A 1 79  ? -4.761  -6.304  -13.464 1.00 3.04  ? 174 VAL A HG13 2  
ATOM   3906  H  HG21 . VAL A 1 79  ? -3.490  -5.415  -17.470 1.00 2.78  ? 174 VAL A HG21 2  
ATOM   3907  H  HG22 . VAL A 1 79  ? -3.969  -7.044  -16.987 1.00 2.92  ? 174 VAL A HG22 2  
ATOM   3908  H  HG23 . VAL A 1 79  ? -5.205  -5.791  -17.187 1.00 2.42  ? 174 VAL A HG23 2  
ATOM   3909  N  N    . GLU A 1 80  ? -3.124  -2.763  -16.854 1.00 1.24  ? 175 GLU A N    2  
ATOM   3910  C  CA   . GLU A 1 80  ? -2.091  -1.916  -17.461 1.00 1.35  ? 175 GLU A CA   2  
ATOM   3911  C  C    . GLU A 1 80  ? -1.890  -0.585  -16.718 1.00 1.52  ? 175 GLU A C    2  
ATOM   3912  O  O    . GLU A 1 80  ? -0.765  -0.087  -16.679 1.00 1.61  ? 175 GLU A O    2  
ATOM   3913  C  CB   . GLU A 1 80  ? -2.443  -1.657  -18.935 1.00 1.52  ? 175 GLU A CB   2  
ATOM   3914  C  CG   . GLU A 1 80  ? -2.209  -2.907  -19.796 1.00 2.05  ? 175 GLU A CG   2  
ATOM   3915  C  CD   . GLU A 1 80  ? -2.851  -2.771  -21.170 1.00 2.74  ? 175 GLU A CD   2  
ATOM   3916  O  OE1  . GLU A 1 80  ? -2.492  -1.862  -21.952 1.00 3.07  ? 175 GLU A OE1  2  
ATOM   3917  O  OE2  . GLU A 1 80  ? -3.749  -3.576  -21.496 1.00 3.97  ? 175 GLU A OE2  2  
ATOM   3918  H  H    . GLU A 1 80  ? -3.960  -2.956  -17.404 1.00 1.28  ? 175 GLU A H    2  
ATOM   3919  H  HA   . GLU A 1 80  ? -1.141  -2.449  -17.431 1.00 1.31  ? 175 GLU A HA   2  
ATOM   3920  H  HB2  . GLU A 1 80  ? -3.486  -1.343  -19.008 1.00 2.07  ? 175 GLU A HB2  2  
ATOM   3921  H  HB3  . GLU A 1 80  ? -1.816  -0.853  -19.322 1.00 1.64  ? 175 GLU A HB3  2  
ATOM   3922  H  HG2  . GLU A 1 80  ? -1.136  -3.070  -19.911 1.00 2.20  ? 175 GLU A HG2  2  
ATOM   3923  H  HG3  . GLU A 1 80  ? -2.634  -3.780  -19.299 1.00 2.82  ? 175 GLU A HG3  2  
ATOM   3924  N  N    . ALA A 1 81  ? -2.926  -0.025  -16.079 1.00 1.69  ? 176 ALA A N    2  
ATOM   3925  C  CA   . ALA A 1 81  ? -2.805  1.202   -15.283 1.00 1.89  ? 176 ALA A CA   2  
ATOM   3926  C  C    . ALA A 1 81  ? -1.915  0.964   -14.053 1.00 1.62  ? 176 ALA A C    2  
ATOM   3927  O  O    . ALA A 1 81  ? -0.925  1.669   -13.844 1.00 1.61  ? 176 ALA A O    2  
ATOM   3928  C  CB   . ALA A 1 81  ? -4.212  1.695   -14.899 1.00 2.25  ? 176 ALA A CB   2  
ATOM   3929  H  H    . ALA A 1 81  ? -3.814  -0.517  -16.064 1.00 1.74  ? 176 ALA A H    2  
ATOM   3930  H  HA   . ALA A 1 81  ? -2.317  1.968   -15.887 1.00 2.08  ? 176 ALA A HA   2  
ATOM   3931  H  HB1  . ALA A 1 81  ? -4.128  2.634   -14.350 1.00 2.66  ? 176 ALA A HB1  2  
ATOM   3932  H  HB2  . ALA A 1 81  ? -4.809  1.863   -15.795 1.00 2.28  ? 176 ALA A HB2  2  
ATOM   3933  H  HB3  . ALA A 1 81  ? -4.730  0.970   -14.268 1.00 3.29  ? 176 ALA A HB3  2  
ATOM   3934  N  N    . MET A 1 82  ? -2.227  -0.083  -13.282 1.00 1.47  ? 177 MET A N    2  
ATOM   3935  C  CA   . MET A 1 82  ? -1.433  -0.498  -12.120 1.00 1.25  ? 177 MET A CA   2  
ATOM   3936  C  C    . MET A 1 82  ? -0.023  -0.908  -12.548 1.00 1.01  ? 177 MET A C    2  
ATOM   3937  O  O    . MET A 1 82  ? 0.944   -0.441  -11.952 1.00 0.96  ? 177 MET A O    2  
ATOM   3938  C  CB   . MET A 1 82  ? -2.146  -1.624  -11.347 1.00 1.32  ? 177 MET A CB   2  
ATOM   3939  C  CG   . MET A 1 82  ? -3.126  -1.079  -10.295 1.00 1.77  ? 177 MET A CG   2  
ATOM   3940  S  SD   . MET A 1 82  ? -4.285  0.206   -10.840 1.00 2.23  ? 177 MET A SD   2  
ATOM   3941  C  CE   . MET A 1 82  ? -5.398  -0.830  -11.811 1.00 3.89  ? 177 MET A CE   2  
ATOM   3942  H  H    . MET A 1 82  ? -3.064  -0.602  -13.512 1.00 1.53  ? 177 MET A H    2  
ATOM   3943  H  HA   . MET A 1 82  ? -1.322  0.358   -11.455 1.00 1.33  ? 177 MET A HA   2  
ATOM   3944  H  HB2  . MET A 1 82  ? -2.669  -2.282  -12.044 1.00 1.50  ? 177 MET A HB2  2  
ATOM   3945  H  HB3  . MET A 1 82  ? -1.403  -2.227  -10.822 1.00 1.45  ? 177 MET A HB3  2  
ATOM   3946  H  HG2  . MET A 1 82  ? -3.700  -1.914  -9.888  1.00 3.10  ? 177 MET A HG2  2  
ATOM   3947  H  HG3  . MET A 1 82  ? -2.547  -0.665  -9.468  1.00 2.57  ? 177 MET A HG3  2  
ATOM   3948  H  HE1  . MET A 1 82  ? -4.819  -1.520  -12.423 1.00 4.44  ? 177 MET A HE1  2  
ATOM   3949  H  HE2  . MET A 1 82  ? -6.038  -1.400  -11.141 1.00 4.59  ? 177 MET A HE2  2  
ATOM   3950  H  HE3  . MET A 1 82  ? -6.013  -0.209  -12.462 1.00 4.81  ? 177 MET A HE3  2  
ATOM   3951  N  N    . ALA A 1 83  ? 0.120   -1.715  -13.604 1.00 0.97  ? 178 ALA A N    2  
ATOM   3952  C  CA   . ALA A 1 83  ? 1.419   -2.152  -14.116 1.00 0.95  ? 178 ALA A CA   2  
ATOM   3953  C  C    . ALA A 1 83  ? 2.314   -0.979  -14.548 1.00 1.12  ? 178 ALA A C    2  
ATOM   3954  O  O    . ALA A 1 83  ? 3.514   -1.007  -14.261 1.00 1.17  ? 178 ALA A O    2  
ATOM   3955  C  CB   . ALA A 1 83  ? 1.188   -3.137  -15.269 1.00 1.04  ? 178 ALA A CB   2  
ATOM   3956  H  H    . ALA A 1 83  ? -0.715  -2.049  -14.073 1.00 1.05  ? 178 ALA A H    2  
ATOM   3957  H  HA   . ALA A 1 83  ? 1.948   -2.677  -13.319 1.00 0.86  ? 178 ALA A HA   2  
ATOM   3958  H  HB1  . ALA A 1 83  ? 0.681   -2.636  -16.093 1.00 2.23  ? 178 ALA A HB1  2  
ATOM   3959  H  HB2  . ALA A 1 83  ? 2.146   -3.519  -15.624 1.00 1.29  ? 178 ALA A HB2  2  
ATOM   3960  H  HB3  . ALA A 1 83  ? 0.580   -3.977  -14.929 1.00 1.95  ? 178 ALA A HB3  2  
ATOM   3961  N  N    . ARG A 1 84  ? 1.762   0.065   -15.185 1.00 1.29  ? 179 ARG A N    2  
ATOM   3962  C  CA   . ARG A 1 84  ? 2.539   1.254   -15.562 1.00 1.44  ? 179 ARG A CA   2  
ATOM   3963  C  C    . ARG A 1 84  ? 3.031   2.002   -14.314 1.00 1.30  ? 179 ARG A C    2  
ATOM   3964  O  O    . ARG A 1 84  ? 4.225   2.261   -14.189 1.00 1.34  ? 179 ARG A O    2  
ATOM   3965  C  CB   . ARG A 1 84  ? 1.716   2.138   -16.516 1.00 1.72  ? 179 ARG A CB   2  
ATOM   3966  C  CG   . ARG A 1 84  ? 2.566   3.248   -17.162 1.00 2.35  ? 179 ARG A CG   2  
ATOM   3967  C  CD   . ARG A 1 84  ? 1.806   3.949   -18.298 1.00 2.82  ? 179 ARG A CD   2  
ATOM   3968  N  NE   . ARG A 1 84  ? 2.636   4.981   -18.943 1.00 3.42  ? 179 ARG A NE   2  
ATOM   3969  C  CZ   . ARG A 1 84  ? 2.610   5.364   -20.215 1.00 3.85  ? 179 ARG A CZ   2  
ATOM   3970  N  NH1  . ARG A 1 84  ? 1.808   4.869   -21.132 1.00 4.11  ? 179 ARG A NH1  2  
ATOM   3971  N  NH2  . ARG A 1 84  ? 3.427   6.301   -20.616 1.00 4.62  ? 179 ARG A NH2  2  
ATOM   3972  H  H    . ARG A 1 84  ? 0.768   0.044   -15.413 1.00 1.33  ? 179 ARG A H    2  
ATOM   3973  H  HA   . ARG A 1 84  ? 3.421   0.913   -16.107 1.00 1.52  ? 179 ARG A HA   2  
ATOM   3974  H  HB2  . ARG A 1 84  ? 1.324   1.505   -17.314 1.00 1.64  ? 179 ARG A HB2  2  
ATOM   3975  H  HB3  . ARG A 1 84  ? 0.874   2.582   -15.983 1.00 2.69  ? 179 ARG A HB3  2  
ATOM   3976  H  HG2  . ARG A 1 84  ? 2.844   3.982   -16.404 1.00 3.43  ? 179 ARG A HG2  2  
ATOM   3977  H  HG3  . ARG A 1 84  ? 3.475   2.806   -17.575 1.00 2.54  ? 179 ARG A HG3  2  
ATOM   3978  H  HD2  . ARG A 1 84  ? 1.510   3.200   -19.034 1.00 2.85  ? 179 ARG A HD2  2  
ATOM   3979  H  HD3  . ARG A 1 84  ? 0.907   4.416   -17.891 1.00 3.38  ? 179 ARG A HD3  2  
ATOM   3980  H  HE   . ARG A 1 84  ? 3.285   5.482   -18.347 1.00 4.00  ? 179 ARG A HE   2  
ATOM   3981  H  HH11 . ARG A 1 84  ? 1.119   4.172   -20.921 1.00 4.02  ? 179 ARG A HH11 2  
ATOM   3982  H  HH12 . ARG A 1 84  ? 1.876   5.255   -22.070 1.00 4.82  ? 179 ARG A HH12 2  
ATOM   3983  H  HH21 . ARG A 1 84  ? 4.031   6.765   -19.952 1.00 5.05  ? 179 ARG A HH21 2  
ATOM   3984  H  HH22 . ARG A 1 84  ? 3.393   6.592   -21.589 1.00 5.11  ? 179 ARG A HH22 2  
ATOM   3985  N  N    . TYR A 1 85  ? 2.145   2.259   -13.345 1.00 1.20  ? 180 TYR A N    2  
ATOM   3986  C  CA   . TYR A 1 85  ? 2.492   2.945   -12.089 1.00 1.14  ? 180 TYR A CA   2  
ATOM   3987  C  C    . TYR A 1 85  ? 3.452   2.134   -11.196 1.00 1.01  ? 180 TYR A C    2  
ATOM   3988  O  O    . TYR A 1 85  ? 4.380   2.692   -10.617 1.00 1.06  ? 180 TYR A O    2  
ATOM   3989  C  CB   . TYR A 1 85  ? 1.185   3.278   -11.354 1.00 1.22  ? 180 TYR A CB   2  
ATOM   3990  C  CG   . TYR A 1 85  ? 1.330   4.268   -10.213 1.00 1.27  ? 180 TYR A CG   2  
ATOM   3991  C  CD1  . TYR A 1 85  ? 1.598   5.621   -10.497 1.00 1.88  ? 180 TYR A CD1  2  
ATOM   3992  C  CD2  . TYR A 1 85  ? 1.154   3.855   -8.876  1.00 2.16  ? 180 TYR A CD2  2  
ATOM   3993  C  CE1  . TYR A 1 85  ? 1.674   6.563   -9.455  1.00 2.16  ? 180 TYR A CE1  2  
ATOM   3994  C  CE2  . TYR A 1 85  ? 1.223   4.795   -7.828  1.00 2.55  ? 180 TYR A CE2  2  
ATOM   3995  C  CZ   . TYR A 1 85  ? 1.476   6.156   -8.118  1.00 2.14  ? 180 TYR A CZ   2  
ATOM   3996  O  OH   . TYR A 1 85  ? 1.523   7.082   -7.122  1.00 2.68  ? 180 TYR A OH   2  
ATOM   3997  H  H    . TYR A 1 85  ? 1.172   2.021   -13.508 1.00 1.25  ? 180 TYR A H    2  
ATOM   3998  H  HA   . TYR A 1 85  ? 3.006   3.878   -12.331 1.00 1.23  ? 180 TYR A HA   2  
ATOM   3999  H  HB2  . TYR A 1 85  ? 0.484   3.711   -12.070 1.00 1.48  ? 180 TYR A HB2  2  
ATOM   4000  H  HB3  . TYR A 1 85  ? 0.736   2.355   -10.984 1.00 1.39  ? 180 TYR A HB3  2  
ATOM   4001  H  HD1  . TYR A 1 85  ? 1.736   5.942   -11.520 1.00 2.72  ? 180 TYR A HD1  2  
ATOM   4002  H  HD2  . TYR A 1 85  ? 0.950   2.819   -8.650  1.00 3.00  ? 180 TYR A HD2  2  
ATOM   4003  H  HE1  . TYR A 1 85  ? 1.873   7.602   -9.671  1.00 2.99  ? 180 TYR A HE1  2  
ATOM   4004  H  HE2  . TYR A 1 85  ? 1.074   4.478   -6.807  1.00 3.56  ? 180 TYR A HE2  2  
ATOM   4005  H  HH   . TYR A 1 85  ? 1.359   6.707   -6.254  1.00 3.19  ? 180 TYR A HH   2  
ATOM   4006  N  N    . VAL A 1 86  ? 3.269   0.812   -11.133 1.00 0.94  ? 181 VAL A N    2  
ATOM   4007  C  CA   . VAL A 1 86  ? 4.142   -0.120  -10.399 1.00 0.94  ? 181 VAL A CA   2  
ATOM   4008  C  C    . VAL A 1 86  ? 5.572   -0.092  -10.941 1.00 1.00  ? 181 VAL A C    2  
ATOM   4009  O  O    . VAL A 1 86  ? 6.500   0.050   -10.153 1.00 1.08  ? 181 VAL A O    2  
ATOM   4010  C  CB   . VAL A 1 86  ? 3.568   -1.558  -10.418 1.00 0.98  ? 181 VAL A CB   2  
ATOM   4011  C  CG1  . VAL A 1 86  ? 4.622   -2.655  -10.175 1.00 1.30  ? 181 VAL A CG1  2  
ATOM   4012  C  CG2  . VAL A 1 86  ? 2.433   -1.661  -9.381  1.00 1.05  ? 181 VAL A CG2  2  
ATOM   4013  H  H    . VAL A 1 86  ? 2.433   0.440   -11.582 1.00 0.95  ? 181 VAL A H    2  
ATOM   4014  H  HA   . VAL A 1 86  ? 4.179   0.215   -9.361  1.00 0.94  ? 181 VAL A HA   2  
ATOM   4015  H  HB   . VAL A 1 86  ? 3.148   -1.747  -11.407 1.00 1.23  ? 181 VAL A HB   2  
ATOM   4016  H  HG11 . VAL A 1 86  ? 5.300   -2.719  -11.026 1.00 2.20  ? 181 VAL A HG11 2  
ATOM   4017  H  HG12 . VAL A 1 86  ? 5.195   -2.451  -9.274  1.00 1.83  ? 181 VAL A HG12 2  
ATOM   4018  H  HG13 . VAL A 1 86  ? 4.138   -3.621  -10.076 1.00 2.23  ? 181 VAL A HG13 2  
ATOM   4019  H  HG21 . VAL A 1 86  ? 2.832   -1.535  -8.379  1.00 1.82  ? 181 VAL A HG21 2  
ATOM   4020  H  HG22 . VAL A 1 86  ? 1.684   -0.888  -9.548  1.00 1.88  ? 181 VAL A HG22 2  
ATOM   4021  H  HG23 . VAL A 1 86  ? 1.949   -2.633  -9.442  1.00 1.70  ? 181 VAL A HG23 2  
ATOM   4022  N  N    . GLN A 1 87  ? 5.770   -0.211  -12.260 1.00 1.05  ? 182 GLN A N    2  
ATOM   4023  C  CA   . GLN A 1 87  ? 7.115   -0.199  -12.852 1.00 1.17  ? 182 GLN A CA   2  
ATOM   4024  C  C    . GLN A 1 87  ? 7.858   1.112   -12.591 1.00 1.18  ? 182 GLN A C    2  
ATOM   4025  O  O    . GLN A 1 87  ? 9.076   1.082   -12.422 1.00 1.31  ? 182 GLN A O    2  
ATOM   4026  C  CB   . GLN A 1 87  ? 7.011   -0.386  -14.369 1.00 1.46  ? 182 GLN A CB   2  
ATOM   4027  C  CG   . GLN A 1 87  ? 6.698   -1.821  -14.805 1.00 2.24  ? 182 GLN A CG   2  
ATOM   4028  C  CD   . GLN A 1 87  ? 6.366   -1.821  -16.291 1.00 2.82  ? 182 GLN A CD   2  
ATOM   4029  O  OE1  . GLN A 1 87  ? 7.216   -2.032  -17.147 1.00 3.04  ? 182 GLN A OE1  2  
ATOM   4030  N  NE2  . GLN A 1 87  ? 5.144   -1.496  -16.647 1.00 3.60  ? 182 GLN A NE2  2  
ATOM   4031  H  H    . GLN A 1 87  ? 4.970   -0.292  -12.878 1.00 1.06  ? 182 GLN A H    2  
ATOM   4032  H  HA   . GLN A 1 87  ? 7.727   -0.991  -12.420 1.00 1.28  ? 182 GLN A HA   2  
ATOM   4033  H  HB2  . GLN A 1 87  ? 6.246   0.292   -14.753 1.00 2.44  ? 182 GLN A HB2  2  
ATOM   4034  H  HB3  . GLN A 1 87  ? 7.961   -0.103  -14.827 1.00 1.63  ? 182 GLN A HB3  2  
ATOM   4035  H  HG2  . GLN A 1 87  ? 7.564   -2.459  -14.623 1.00 2.57  ? 182 GLN A HG2  2  
ATOM   4036  H  HG3  . GLN A 1 87  ? 5.850   -2.214  -14.244 1.00 3.02  ? 182 GLN A HG3  2  
ATOM   4037  H  HE21 . GLN A 1 87  ? 4.466   -1.267  -15.933 1.00 3.92  ? 182 GLN A HE21 2  
ATOM   4038  H  HE22 . GLN A 1 87  ? 4.974   -1.328  -17.634 1.00 4.06  ? 182 GLN A HE22 2  
ATOM   4039  N  N    . ASP A 1 88  ? 7.135   2.235   -12.584 1.00 1.21  ? 183 ASP A N    2  
ATOM   4040  C  CA   . ASP A 1 88  ? 7.708   3.571   -12.450 1.00 1.41  ? 183 ASP A CA   2  
ATOM   4041  C  C    . ASP A 1 88  ? 8.224   3.860   -11.032 1.00 1.39  ? 183 ASP A C    2  
ATOM   4042  O  O    . ASP A 1 88  ? 9.282   4.467   -10.881 1.00 1.52  ? 183 ASP A O    2  
ATOM   4043  C  CB   . ASP A 1 88  ? 6.665   4.605   -12.903 1.00 1.69  ? 183 ASP A CB   2  
ATOM   4044  C  CG   . ASP A 1 88  ? 7.254   6.005   -13.093 1.00 2.70  ? 183 ASP A CG   2  
ATOM   4045  O  OD1  . ASP A 1 88  ? 8.469   6.133   -13.362 1.00 3.23  ? 183 ASP A OD1  2  
ATOM   4046  O  OD2  . ASP A 1 88  ? 6.485   6.990   -13.041 1.00 3.83  ? 183 ASP A OD2  2  
ATOM   4047  H  H    . ASP A 1 88  ? 6.132   2.174   -12.698 1.00 1.15  ? 183 ASP A H    2  
ATOM   4048  H  HA   . ASP A 1 88  ? 8.561   3.627   -13.126 1.00 1.54  ? 183 ASP A HA   2  
ATOM   4049  H  HB2  . ASP A 1 88  ? 6.246   4.288   -13.860 1.00 1.45  ? 183 ASP A HB2  2  
ATOM   4050  H  HB3  . ASP A 1 88  ? 5.854   4.644   -12.174 1.00 2.20  ? 183 ASP A HB3  2  
ATOM   4051  N  N    . PHE A 1 89  ? 7.537   3.369   -9.994  1.00 1.36  ? 184 PHE A N    2  
ATOM   4052  C  CA   . PHE A 1 89  ? 8.062   3.379   -8.632  1.00 1.43  ? 184 PHE A CA   2  
ATOM   4053  C  C    . PHE A 1 89  ? 9.175   2.332   -8.516  1.00 6.22  ? 184 PHE A C    2  
ATOM   4054  O  O    . PHE A 1 89  ? 10.335  2.692   -8.317  1.00 4.52  ? 184 PHE A O    2  
ATOM   4055  C  CB   . PHE A 1 89  ? 6.917   3.167   -7.621  1.00 1.53  ? 184 PHE A CB   2  
ATOM   4056  C  CG   . PHE A 1 89  ? 6.427   4.464   -7.004  1.00 1.60  ? 184 PHE A CG   2  
ATOM   4057  C  CD1  . PHE A 1 89  ? 5.400   5.215   -7.612  1.00 2.46  ? 184 PHE A CD1  2  
ATOM   4058  C  CD2  . PHE A 1 89  ? 7.041   4.947   -5.833  1.00 3.12  ? 184 PHE A CD2  2  
ATOM   4059  C  CE1  . PHE A 1 89  ? 5.000   6.441   -7.050  1.00 2.28  ? 184 PHE A CE1  2  
ATOM   4060  C  CE2  . PHE A 1 89  ? 6.636   6.171   -5.273  1.00 5.88  ? 184 PHE A CE2  2  
ATOM   4061  C  CZ   . PHE A 1 89  ? 5.618   6.921   -5.881  1.00 2.12  ? 184 PHE A CZ   2  
ATOM   4062  H  H    . PHE A 1 89  ? 6.706   2.826   -10.178 1.00 1.36  ? 184 PHE A H    2  
ATOM   4063  H  HA   . PHE A 1 89  ? 8.521   4.351   -8.434  1.00 1.60  ? 184 PHE A HA   2  
ATOM   4064  H  HB2  . PHE A 1 89  ? 6.083   2.647   -8.097  1.00 1.64  ? 184 PHE A HB2  2  
ATOM   4065  H  HB3  . PHE A 1 89  ? 7.272   2.529   -6.811  1.00 1.55  ? 184 PHE A HB3  2  
ATOM   4066  H  HD1  . PHE A 1 89  ? 4.928   4.865   -8.517  1.00 3.66  ? 184 PHE A HD1  2  
ATOM   4067  H  HD2  . PHE A 1 89  ? 7.839   4.387   -5.368  1.00 4.32  ? 184 PHE A HD2  2  
ATOM   4068  H  HE1  . PHE A 1 89  ? 4.225   7.024   -7.526  1.00 3.15  ? 184 PHE A HE1  2  
ATOM   4069  H  HE2  . PHE A 1 89  ? 7.119   6.538   -4.381  1.00 6.71  ? 184 PHE A HE2  2  
ATOM   4070  H  HZ   . PHE A 1 89  ? 5.319   7.869   -5.456  1.00 3.65  ? 184 PHE A HZ   2  
ATOM   4071  N  N    . HIS A 1 90  ? 8.811   1.055   -8.696  1.00 1.16  ? 185 HIS A N    2  
ATOM   4072  C  CA   . HIS A 1 90  ? 9.674   -0.133  -8.687  1.00 1.23  ? 185 HIS A CA   2  
ATOM   4073  C  C    . HIS A 1 90  ? 8.855   -1.427  -8.924  1.00 1.26  ? 185 HIS A C    2  
ATOM   4074  O  O    . HIS A 1 90  ? 7.828   -1.593  -8.264  1.00 1.20  ? 185 HIS A O    2  
ATOM   4075  C  CB   . HIS A 1 90  ? 10.402  -0.249  -7.338  1.00 1.37  ? 185 HIS A CB   2  
ATOM   4076  C  CG   . HIS A 1 90  ? 11.405  -1.363  -7.348  1.00 1.61  ? 185 HIS A CG   2  
ATOM   4077  N  ND1  . HIS A 1 90  ? 11.174  -2.681  -6.949  1.00 2.24  ? 185 HIS A ND1  2  
ATOM   4078  C  CD2  . HIS A 1 90  ? 12.613  -1.292  -7.969  1.00 1.97  ? 185 HIS A CD2  2  
ATOM   4079  C  CE1  . HIS A 1 90  ? 12.271  -3.364  -7.318  1.00 2.44  ? 185 HIS A CE1  2  
ATOM   4080  N  NE2  . HIS A 1 90  ? 13.149  -2.556  -7.935  1.00 2.36  ? 185 HIS A NE2  2  
ATOM   4081  H  H    . HIS A 1 90  ? 7.839   0.902   -8.940  1.00 1.11  ? 185 HIS A H    2  
ATOM   4082  H  HA   . HIS A 1 90  ? 10.411  -0.009  -9.480  1.00 1.31  ? 185 HIS A HA   2  
ATOM   4083  H  HB2  . HIS A 1 90  ? 10.933  0.673   -7.114  1.00 1.43  ? 185 HIS A HB2  2  
ATOM   4084  H  HB3  . HIS A 1 90  ? 9.669   -0.415  -6.549  1.00 1.51  ? 185 HIS A HB3  2  
ATOM   4085  H  HD2  . HIS A 1 90  ? 13.006  -0.427  -8.479  1.00 2.35  ? 185 HIS A HD2  2  
ATOM   4086  H  HE1  . HIS A 1 90  ? 12.423  -4.425  -7.177  1.00 2.98  ? 185 HIS A HE1  2  
ATOM   4087  H  HE2  . HIS A 1 90  ? 14.016  -2.853  -8.380  1.00 2.89  ? 185 HIS A HE2  2  
ATOM   4088  N  N    . PRO A 1 91  ? 9.285   -2.394  -9.764  1.00 1.45  ? 186 PRO A N    2  
ATOM   4089  C  CA   . PRO A 1 91  ? 8.496   -3.591  -10.084 1.00 1.60  ? 186 PRO A CA   2  
ATOM   4090  C  C    . PRO A 1 91  ? 8.086   -4.502  -8.904  1.00 1.79  ? 186 PRO A C    2  
ATOM   4091  O  O    . PRO A 1 91  ? 7.179   -5.309  -9.090  1.00 2.55  ? 186 PRO A O    2  
ATOM   4092  C  CB   . PRO A 1 91  ? 9.295   -4.352  -11.150 1.00 1.79  ? 186 PRO A CB   2  
ATOM   4093  C  CG   . PRO A 1 91  ? 10.710  -3.787  -11.048 1.00 1.84  ? 186 PRO A CG   2  
ATOM   4094  C  CD   . PRO A 1 91  ? 10.464  -2.346  -10.616 1.00 1.65  ? 186 PRO A CD   2  
ATOM   4095  H  HA   . PRO A 1 91  ? 7.567   -3.256  -10.545 1.00 1.56  ? 186 PRO A HA   2  
ATOM   4096  H  HB2  . PRO A 1 91  ? 9.286   -5.430  -10.985 1.00 1.88  ? 186 PRO A HB2  2  
ATOM   4097  H  HB3  . PRO A 1 91  ? 8.887   -4.124  -12.137 1.00 1.87  ? 186 PRO A HB3  2  
ATOM   4098  H  HG2  . PRO A 1 91  ? 11.262  -4.315  -10.269 1.00 1.88  ? 186 PRO A HG2  2  
ATOM   4099  H  HG3  . PRO A 1 91  ? 11.238  -3.842  -12.000 1.00 2.01  ? 186 PRO A HG3  2  
ATOM   4100  H  HD2  . PRO A 1 91  ? 11.340  -1.962  -10.099 1.00 1.69  ? 186 PRO A HD2  2  
ATOM   4101  H  HD3  . PRO A 1 91  ? 10.252  -1.731  -11.491 1.00 1.71  ? 186 PRO A HD3  2  
ATOM   4102  N  N    . ARG A 1 92  ? 8.669   -4.373  -7.698  1.00 1.49  ? 187 ARG A N    2  
ATOM   4103  C  CA   . ARG A 1 92  ? 8.152   -5.043  -6.484  1.00 1.62  ? 187 ARG A CA   2  
ATOM   4104  C  C    . ARG A 1 92  ? 6.887   -4.388  -5.884  1.00 1.48  ? 187 ARG A C    2  
ATOM   4105  O  O    . ARG A 1 92  ? 6.318   -4.944  -4.943  1.00 1.63  ? 187 ARG A O    2  
ATOM   4106  C  CB   . ARG A 1 92  ? 9.243   -5.140  -5.398  1.00 1.86  ? 187 ARG A CB   2  
ATOM   4107  C  CG   . ARG A 1 92  ? 10.243  -6.290  -5.630  1.00 2.55  ? 187 ARG A CG   2  
ATOM   4108  C  CD   . ARG A 1 92  ? 11.250  -6.452  -4.475  1.00 2.51  ? 187 ARG A CD   2  
ATOM   4109  N  NE   . ARG A 1 92  ? 10.572  -6.638  -3.172  1.00 2.41  ? 187 ARG A NE   2  
ATOM   4110  C  CZ   . ARG A 1 92  ? 10.377  -7.772  -2.503  1.00 3.23  ? 187 ARG A CZ   2  
ATOM   4111  N  NH1  . ARG A 1 92  ? 10.944  -8.908  -2.830  1.00 4.05  ? 187 ARG A NH1  2  
ATOM   4112  N  NH2  . ARG A 1 92  ? 9.579   -7.774  -1.458  1.00 4.21  ? 187 ARG A NH2  2  
ATOM   4113  H  H    . ARG A 1 92  ? 9.437   -3.722  -7.588  1.00 1.56  ? 187 ARG A H    2  
ATOM   4114  H  HA   . ARG A 1 92  ? 7.862   -6.059  -6.755  1.00 1.74  ? 187 ARG A HA   2  
ATOM   4115  H  HB2  . ARG A 1 92  ? 9.772   -4.192  -5.310  1.00 1.92  ? 187 ARG A HB2  2  
ATOM   4116  H  HB3  . ARG A 1 92  ? 8.751   -5.323  -4.443  1.00 2.59  ? 187 ARG A HB3  2  
ATOM   4117  H  HG2  . ARG A 1 92  ? 9.689   -7.223  -5.739  1.00 3.48  ? 187 ARG A HG2  2  
ATOM   4118  H  HG3  . ARG A 1 92  ? 10.792  -6.109  -6.555  1.00 3.26  ? 187 ARG A HG3  2  
ATOM   4119  H  HD2  . ARG A 1 92  ? 11.904  -7.297  -4.694  1.00 3.47  ? 187 ARG A HD2  2  
ATOM   4120  H  HD3  . ARG A 1 92  ? 11.873  -5.556  -4.426  1.00 2.98  ? 187 ARG A HD3  2  
ATOM   4121  H  HE   . ARG A 1 92  ? 10.138  -5.814  -2.791  1.00 2.85  ? 187 ARG A HE   2  
ATOM   4122  H  HH11 . ARG A 1 92  ? 11.688  -8.944  -3.522  1.00 4.29  ? 187 ARG A HH11 2  
ATOM   4123  H  HH12 . ARG A 1 92  ? 10.768  -9.748  -2.298  1.00 4.96  ? 187 ARG A HH12 2  
ATOM   4124  H  HH21 . ARG A 1 92  ? 9.101   -6.944  -1.164  1.00 4.61  ? 187 ARG A HH21 2  
ATOM   4125  H  HH22 . ARG A 1 92  ? 9.427   -8.645  -0.950  1.00 5.03  ? 187 ARG A HH22 2  
ATOM   4126  N  N    . LEU A 1 93  ? 6.454   -3.212  -6.356  1.00 1.23  ? 188 LEU A N    2  
ATOM   4127  C  CA   . LEU A 1 93  ? 5.259   -2.513  -5.859  1.00 0.94  ? 188 LEU A CA   2  
ATOM   4128  C  C    . LEU A 1 93  ? 4.001   -3.354  -6.172  1.00 0.91  ? 188 LEU A C    2  
ATOM   4129  O  O    . LEU A 1 93  ? 3.788   -3.800  -7.302  1.00 1.30  ? 188 LEU A O    2  
ATOM   4130  C  CB   . LEU A 1 93  ? 5.243   -1.086  -6.461  1.00 0.84  ? 188 LEU A CB   2  
ATOM   4131  C  CG   . LEU A 1 93  ? 4.486   0.042   -5.734  1.00 1.59  ? 188 LEU A CG   2  
ATOM   4132  C  CD1  . LEU A 1 93  ? 3.012   -0.262  -5.441  1.00 2.47  ? 188 LEU A CD1  2  
ATOM   4133  C  CD2  . LEU A 1 93  ? 5.193   0.432   -4.426  1.00 2.29  ? 188 LEU A CD2  2  
ATOM   4134  H  H    . LEU A 1 93  ? 6.967   -2.786  -7.121  1.00 1.20  ? 188 LEU A H    2  
ATOM   4135  H  HA   . LEU A 1 93  ? 5.349   -2.431  -4.775  1.00 0.99  ? 188 LEU A HA   2  
ATOM   4136  H  HB2  . LEU A 1 93  ? 6.273   -0.738  -6.533  1.00 1.41  ? 188 LEU A HB2  2  
ATOM   4137  H  HB3  . LEU A 1 93  ? 4.871   -1.144  -7.480  1.00 1.73  ? 188 LEU A HB3  2  
ATOM   4138  H  HG   . LEU A 1 93  ? 4.517   0.909   -6.400  1.00 1.90  ? 188 LEU A HG   2  
ATOM   4139  H  HD11 . LEU A 1 93  ? 2.508   -0.605  -6.344  1.00 3.26  ? 188 LEU A HD11 2  
ATOM   4140  H  HD12 . LEU A 1 93  ? 2.922   -1.013  -4.658  1.00 3.21  ? 188 LEU A HD12 2  
ATOM   4141  H  HD13 . LEU A 1 93  ? 2.529   0.652   -5.099  1.00 2.76  ? 188 LEU A HD13 2  
ATOM   4142  H  HD21 . LEU A 1 93  ? 6.231   0.700   -4.629  1.00 2.09  ? 188 LEU A HD21 2  
ATOM   4143  H  HD22 . LEU A 1 93  ? 4.693   1.293   -3.981  1.00 3.20  ? 188 LEU A HD22 2  
ATOM   4144  H  HD23 . LEU A 1 93  ? 5.168   -0.396  -3.716  1.00 3.13  ? 188 LEU A HD23 2  
ATOM   4145  N  N    . LEU A 1 94  ? 3.179   -3.623  -5.152  1.00 0.97  ? 189 LEU A N    2  
ATOM   4146  C  CA   . LEU A 1 94  ? 2.050   -4.548  -5.246  1.00 1.19  ? 189 LEU A CA   2  
ATOM   4147  C  C    . LEU A 1 94  ? 0.771   -3.783  -5.633  1.00 1.15  ? 189 LEU A C    2  
ATOM   4148  O  O    . LEU A 1 94  ? 0.060   -3.275  -4.771  1.00 1.52  ? 189 LEU A O    2  
ATOM   4149  C  CB   . LEU A 1 94  ? 1.964   -5.338  -3.919  1.00 1.42  ? 189 LEU A CB   2  
ATOM   4150  C  CG   . LEU A 1 94  ? 1.396   -6.762  -4.059  1.00 1.52  ? 189 LEU A CG   2  
ATOM   4151  C  CD1  . LEU A 1 94  ? 1.505   -7.497  -2.715  1.00 2.42  ? 189 LEU A CD1  2  
ATOM   4152  C  CD2  . LEU A 1 94  ? -0.059  -6.794  -4.536  1.00 2.14  ? 189 LEU A CD2  2  
ATOM   4153  H  H    . LEU A 1 94  ? 3.382   -3.224  -4.247  1.00 1.24  ? 189 LEU A H    2  
ATOM   4154  H  HA   . LEU A 1 94  ? 2.258   -5.265  -6.043  1.00 1.43  ? 189 LEU A HA   2  
ATOM   4155  H  HB2  . LEU A 1 94  ? 2.973   -5.437  -3.513  1.00 2.00  ? 189 LEU A HB2  2  
ATOM   4156  H  HB3  . LEU A 1 94  ? 1.374   -4.790  -3.190  1.00 2.00  ? 189 LEU A HB3  2  
ATOM   4157  H  HG   . LEU A 1 94  ? 2.009   -7.292  -4.784  1.00 2.12  ? 189 LEU A HG   2  
ATOM   4158  H  HD11 . LEU A 1 94  ? 0.899   -6.993  -1.961  1.00 3.18  ? 189 LEU A HD11 2  
ATOM   4159  H  HD12 . LEU A 1 94  ? 1.154   -8.524  -2.825  1.00 3.08  ? 189 LEU A HD12 2  
ATOM   4160  H  HD13 . LEU A 1 94  ? 2.544   -7.518  -2.384  1.00 2.91  ? 189 LEU A HD13 2  
ATOM   4161  H  HD21 . LEU A 1 94  ? -0.146  -6.360  -5.532  1.00 2.74  ? 189 LEU A HD21 2  
ATOM   4162  H  HD22 . LEU A 1 94  ? -0.406  -7.826  -4.585  1.00 3.01  ? 189 LEU A HD22 2  
ATOM   4163  H  HD23 . LEU A 1 94  ? -0.682  -6.237  -3.838  1.00 2.82  ? 189 LEU A HD23 2  
ATOM   4164  N  N    . GLY A 1 95  ? 0.495   -3.691  -6.941  1.00 0.88  ? 190 GLY A N    2  
ATOM   4165  C  CA   . GLY A 1 95  ? -0.692  -3.029  -7.503  1.00 0.83  ? 190 GLY A CA   2  
ATOM   4166  C  C    . GLY A 1 95  ? -1.858  -4.002  -7.640  1.00 0.81  ? 190 GLY A C    2  
ATOM   4167  O  O    . GLY A 1 95  ? -1.834  -4.853  -8.528  1.00 0.90  ? 190 GLY A O    2  
ATOM   4168  H  H    . GLY A 1 95  ? 1.142   -4.119  -7.588  1.00 0.92  ? 190 GLY A H    2  
ATOM   4169  H  HA2  . GLY A 1 95  ? -1.015  -2.192  -6.885  1.00 0.78  ? 190 GLY A HA2  2  
ATOM   4170  H  HA3  . GLY A 1 95  ? -0.460  -2.660  -8.502  1.00 1.01  ? 190 GLY A HA3  2  
ATOM   4171  N  N    . LEU A 1 96  ? -2.886  -3.845  -6.800  1.00 0.93  ? 191 LEU A N    2  
ATOM   4172  C  CA   . LEU A 1 96  ? -4.129  -4.625  -6.852  1.00 0.94  ? 191 LEU A CA   2  
ATOM   4173  C  C    . LEU A 1 96  ? -5.237  -3.846  -7.569  1.00 0.94  ? 191 LEU A C    2  
ATOM   4174  O  O    . LEU A 1 96  ? -5.443  -2.660  -7.290  1.00 1.00  ? 191 LEU A O    2  
ATOM   4175  C  CB   . LEU A 1 96  ? -4.591  -4.987  -5.428  1.00 1.05  ? 191 LEU A CB   2  
ATOM   4176  C  CG   . LEU A 1 96  ? -3.635  -5.908  -4.649  1.00 1.38  ? 191 LEU A CG   2  
ATOM   4177  C  CD1  . LEU A 1 96  ? -4.193  -6.144  -3.241  1.00 2.22  ? 191 LEU A CD1  2  
ATOM   4178  C  CD2  . LEU A 1 96  ? -3.443  -7.267  -5.339  1.00 2.73  ? 191 LEU A CD2  2  
ATOM   4179  H  H    . LEU A 1 96  ? -2.820  -3.104  -6.106  1.00 1.12  ? 191 LEU A H    2  
ATOM   4180  H  HA   . LEU A 1 96  ? -3.952  -5.540  -7.415  1.00 1.05  ? 191 LEU A HA   2  
ATOM   4181  H  HB2  . LEU A 1 96  ? -4.727  -4.062  -4.862  1.00 1.60  ? 191 LEU A HB2  2  
ATOM   4182  H  HB3  . LEU A 1 96  ? -5.561  -5.480  -5.499  1.00 1.62  ? 191 LEU A HB3  2  
ATOM   4183  H  HG   . LEU A 1 96  ? -2.671  -5.411  -4.555  1.00 2.03  ? 191 LEU A HG   2  
ATOM   4184  H  HD11 . LEU A 1 96  ? -3.473  -6.718  -2.657  1.00 3.28  ? 191 LEU A HD11 2  
ATOM   4185  H  HD12 . LEU A 1 96  ? -4.366  -5.189  -2.744  1.00 2.83  ? 191 LEU A HD12 2  
ATOM   4186  H  HD13 . LEU A 1 96  ? -5.131  -6.695  -3.298  1.00 2.73  ? 191 LEU A HD13 2  
ATOM   4187  H  HD21 . LEU A 1 96  ? -2.897  -7.135  -6.270  1.00 3.58  ? 191 LEU A HD21 2  
ATOM   4188  H  HD22 . LEU A 1 96  ? -2.867  -7.933  -4.697  1.00 3.32  ? 191 LEU A HD22 2  
ATOM   4189  H  HD23 . LEU A 1 96  ? -4.411  -7.725  -5.545  1.00 3.47  ? 191 LEU A HD23 2  
ATOM   4190  N  N    . THR A 1 97  ? -5.981  -4.514  -8.462  1.00 0.98  ? 192 THR A N    2  
ATOM   4191  C  CA   . THR A 1 97  ? -7.039  -3.870  -9.258  1.00 1.06  ? 192 THR A CA   2  
ATOM   4192  C  C    . THR A 1 97  ? -8.384  -3.887  -8.529  1.00 1.24  ? 192 THR A C    2  
ATOM   4193  O  O    . THR A 1 97  ? -9.144  -4.862  -8.593  1.00 1.44  ? 192 THR A O    2  
ATOM   4194  C  CB   . THR A 1 97  ? -7.121  -4.435  -10.683 1.00 1.79  ? 192 THR A CB   2  
ATOM   4195  O  OG1  . THR A 1 97  ? -7.591  -5.753  -10.648 1.00 3.69  ? 192 THR A OG1  2  
ATOM   4196  C  CG2  . THR A 1 97  ? -5.766  -4.456  -11.388 1.00 2.04  ? 192 THR A CG2  2  
ATOM   4197  H  H    . THR A 1 97  ? -5.765  -5.490  -8.647  1.00 1.02  ? 192 THR A H    2  
ATOM   4198  H  HA   . THR A 1 97  ? -6.769  -2.824  -9.383  1.00 1.72  ? 192 THR A HA   2  
ATOM   4199  H  HB   . THR A 1 97  ? -7.811  -3.812  -11.259 1.00 2.38  ? 192 THR A HB   2  
ATOM   4200  H  HG1  . THR A 1 97  ? -8.420  -5.725  -10.155 1.00 4.43  ? 192 THR A HG1  2  
ATOM   4201  H  HG21 . THR A 1 97  ? -5.222  -3.534  -11.203 1.00 2.33  ? 192 THR A HG21 2  
ATOM   4202  H  HG22 . THR A 1 97  ? -5.166  -5.297  -11.033 1.00 3.07  ? 192 THR A HG22 2  
ATOM   4203  H  HG23 . THR A 1 97  ? -5.933  -4.561  -12.458 1.00 2.51  ? 192 THR A HG23 2  
ATOM   4204  N  N    . GLY A 1 98  ? -8.700  -2.769  -7.876  1.00 2.62  ? 193 GLY A N    2  
ATOM   4205  C  CA   . GLY A 1 98  ? -10.018 -2.440  -7.324  1.00 3.84  ? 193 GLY A CA   2  
ATOM   4206  C  C    . GLY A 1 98  ? -10.996 -2.038  -8.425  1.00 3.38  ? 193 GLY A C    2  
ATOM   4207  O  O    . GLY A 1 98  ? -11.497 -0.920  -8.443  1.00 3.93  ? 193 GLY A O    2  
ATOM   4208  H  H    . GLY A 1 98  ? -7.995  -2.050  -7.809  1.00 3.16  ? 193 GLY A H    2  
ATOM   4209  H  HA2  . GLY A 1 98  ? -10.435 -3.306  -6.811  1.00 4.58  ? 193 GLY A HA2  2  
ATOM   4210  H  HA3  . GLY A 1 98  ? -9.932  -1.605  -6.627  1.00 4.81  ? 193 GLY A HA3  2  
ATOM   4211  N  N    . SER A 1 99  ? -11.256 -2.946  -9.362  1.00 2.88  ? 194 SER A N    2  
ATOM   4212  C  CA   . SER A 1 99  ? -12.220 -2.720  -10.446 1.00 2.71  ? 194 SER A CA   2  
ATOM   4213  C  C    . SER A 1 99  ? -13.660 -2.645  -9.928  1.00 1.93  ? 194 SER A C    2  
ATOM   4214  O  O    . SER A 1 99  ? -13.944 -3.070  -8.801  1.00 1.57  ? 194 SER A O    2  
ATOM   4215  C  CB   . SER A 1 99  ? -12.066 -3.782  -11.544 1.00 3.49  ? 194 SER A CB   2  
ATOM   4216  O  OG   . SER A 1 99  ? -10.710 -3.865  -11.946 1.00 5.03  ? 194 SER A OG   2  
ATOM   4217  H  H    . SER A 1 99  ? -10.754 -3.822  -9.341  1.00 3.11  ? 194 SER A H    2  
ATOM   4218  H  HA   . SER A 1 99  ? -12.004 -1.747  -10.885 1.00 2.96  ? 194 SER A HA   2  
ATOM   4219  H  HB2  . SER A 1 99  ? -12.410 -4.745  -11.185 1.00 3.23  ? 194 SER A HB2  2  
ATOM   4220  H  HB3  . SER A 1 99  ? -12.684 -3.521  -12.403 1.00 3.83  ? 194 SER A HB3  2  
ATOM   4221  H  HG   . SER A 1 99  ? -10.479 -2.974  -12.304 1.00 5.61  ? 194 SER A HG   2  
ATOM   4222  N  N    . THR A 1 100 ? -14.562 -2.064  -10.730 1.00 1.95  ? 195 THR A N    2  
ATOM   4223  C  CA   . THR A 1 100 ? -15.831 -1.475  -10.257 1.00 1.80  ? 195 THR A CA   2  
ATOM   4224  C  C    . THR A 1 100 ? -16.667 -2.387  -9.355  1.00 1.79  ? 195 THR A C    2  
ATOM   4225  O  O    . THR A 1 100 ? -17.007 -1.982  -8.243  1.00 1.66  ? 195 THR A O    2  
ATOM   4226  C  CB   . THR A 1 100 ? -16.644 -0.893  -11.414 1.00 2.21  ? 195 THR A CB   2  
ATOM   4227  O  OG1  . THR A 1 100 ? -16.989 -1.916  -12.319 1.00 3.50  ? 195 THR A OG1  2  
ATOM   4228  C  CG2  . THR A 1 100 ? -15.855 0.183   -12.171 1.00 3.60  ? 195 THR A CG2  2  
ATOM   4229  H  H    . THR A 1 100 ? -14.259 -1.806  -11.664 1.00 2.32  ? 195 THR A H    2  
ATOM   4230  H  HA   . THR A 1 100 ? -15.582 -0.619  -9.636  1.00 1.63  ? 195 THR A HA   2  
ATOM   4231  H  HB   . THR A 1 100 ? -17.542 -0.437  -10.990 1.00 1.84  ? 195 THR A HB   2  
ATOM   4232  H  HG1  . THR A 1 100 ? -17.554 -1.536  -12.997 1.00 3.90  ? 195 THR A HG1  2  
ATOM   4233  H  HG21 . THR A 1 100 ? -16.500 0.665   -12.906 1.00 3.93  ? 195 THR A HG21 2  
ATOM   4234  H  HG22 . THR A 1 100 ? -15.493 0.940   -11.474 1.00 4.41  ? 195 THR A HG22 2  
ATOM   4235  H  HG23 . THR A 1 100 ? -14.996 -0.250  -12.686 1.00 4.50  ? 195 THR A HG23 2  
ATOM   4236  N  N    . LYS A 1 101 ? -16.939 -3.634  -9.754  1.00 2.08  ? 196 LYS A N    2  
ATOM   4237  C  CA   . LYS A 1 101 ? -17.686 -4.582  -8.907  1.00 2.21  ? 196 LYS A CA   2  
ATOM   4238  C  C    . LYS A 1 101 ? -16.911 -5.049  -7.655  1.00 1.93  ? 196 LYS A C    2  
ATOM   4239  O  O    . LYS A 1 101 ? -17.547 -5.409  -6.661  1.00 2.04  ? 196 LYS A O    2  
ATOM   4240  C  CB   . LYS A 1 101 ? -18.198 -5.779  -9.733  1.00 2.60  ? 196 LYS A CB   2  
ATOM   4241  C  CG   . LYS A 1 101 ? -19.356 -5.402  -10.677 1.00 3.41  ? 196 LYS A CG   2  
ATOM   4242  C  CD   . LYS A 1 101 ? -20.054 -6.656  -11.229 1.00 3.72  ? 196 LYS A CD   2  
ATOM   4243  C  CE   . LYS A 1 101 ? -21.185 -6.292  -12.205 1.00 5.02  ? 196 LYS A CE   2  
ATOM   4244  N  NZ   . LYS A 1 101 ? -21.899 -7.494  -12.698 1.00 5.43  ? 196 LYS A NZ   2  
ATOM   4245  H  H    . LYS A 1 101 ? -16.652 -3.906  -10.683 1.00 2.35  ? 196 LYS A H    2  
ATOM   4246  H  HA   . LYS A 1 101 ? -18.558 -4.060  -8.511  1.00 2.29  ? 196 LYS A HA   2  
ATOM   4247  H  HB2  . LYS A 1 101 ? -17.377 -6.215  -10.306 1.00 3.33  ? 196 LYS A HB2  2  
ATOM   4248  H  HB3  . LYS A 1 101 ? -18.564 -6.536  -9.037  1.00 2.38  ? 196 LYS A HB3  2  
ATOM   4249  H  HG2  . LYS A 1 101 ? -20.091 -4.811  -10.127 1.00 3.53  ? 196 LYS A HG2  2  
ATOM   4250  H  HG3  . LYS A 1 101 ? -18.970 -4.803  -11.502 1.00 4.40  ? 196 LYS A HG3  2  
ATOM   4251  H  HD2  . LYS A 1 101 ? -19.317 -7.273  -11.743 1.00 4.21  ? 196 LYS A HD2  2  
ATOM   4252  H  HD3  . LYS A 1 101 ? -20.472 -7.229  -10.397 1.00 3.19  ? 196 LYS A HD3  2  
ATOM   4253  H  HE2  . LYS A 1 101 ? -21.896 -5.629  -11.704 1.00 5.17  ? 196 LYS A HE2  2  
ATOM   4254  H  HE3  . LYS A 1 101 ? -20.759 -5.752  -13.056 1.00 6.09  ? 196 LYS A HE3  2  
ATOM   4255  H  HZ1  . LYS A 1 101 ? -21.243 -8.178  -13.063 1.00 6.01  ? 196 LYS A HZ1  2  
ATOM   4256  H  HZ2  . LYS A 1 101 ? -22.426 -7.939  -11.951 1.00 5.06  ? 196 LYS A HZ2  2  
ATOM   4257  H  HZ3  . LYS A 1 101 ? -22.548 -7.252  -13.448 1.00 6.06  ? 196 LYS A HZ3  2  
ATOM   4258  N  N    . GLN A 1 102 ? -15.573 -5.023  -7.644  1.00 1.71  ? 197 GLN A N    2  
ATOM   4259  C  CA   . GLN A 1 102 ? -14.798 -5.171  -6.405  1.00 1.51  ? 197 GLN A CA   2  
ATOM   4260  C  C    . GLN A 1 102 ? -14.931 -3.918  -5.536  1.00 1.30  ? 197 GLN A C    2  
ATOM   4261  O  O    . GLN A 1 102 ? -15.381 -4.034  -4.400  1.00 1.45  ? 197 GLN A O    2  
ATOM   4262  C  CB   . GLN A 1 102 ? -13.308 -5.491  -6.643  1.00 1.82  ? 197 GLN A CB   2  
ATOM   4263  C  CG   . GLN A 1 102 ? -13.042 -6.765  -7.458  1.00 2.05  ? 197 GLN A CG   2  
ATOM   4264  C  CD   . GLN A 1 102 ? -12.856 -6.471  -8.941  1.00 3.39  ? 197 GLN A CD   2  
ATOM   4265  O  OE1  . GLN A 1 102 ? -13.809 -6.361  -9.697  1.00 3.66  ? 197 GLN A OE1  2  
ATOM   4266  N  NE2  . GLN A 1 102 ? -11.633 -6.297  -9.405  1.00 5.04  ? 197 GLN A NE2  2  
ATOM   4267  H  H    . GLN A 1 102 ? -15.089 -4.709  -8.479  1.00 1.78  ? 197 GLN A H    2  
ATOM   4268  H  HA   . GLN A 1 102 ? -15.220 -5.994  -5.821  1.00 1.62  ? 197 GLN A HA   2  
ATOM   4269  H  HB2  . GLN A 1 102 ? -12.802 -4.647  -7.111  1.00 2.46  ? 197 GLN A HB2  2  
ATOM   4270  H  HB3  . GLN A 1 102 ? -12.855 -5.631  -5.660  1.00 2.02  ? 197 GLN A HB3  2  
ATOM   4271  H  HG2  . GLN A 1 102 ? -12.128 -7.228  -7.090  1.00 2.68  ? 197 GLN A HG2  2  
ATOM   4272  H  HG3  . GLN A 1 102 ? -13.853 -7.480  -7.322  1.00 2.05  ? 197 GLN A HG3  2  
ATOM   4273  H  HE21 . GLN A 1 102 ? -10.833 -6.267  -8.794  1.00 5.45  ? 197 GLN A HE21 2  
ATOM   4274  H  HE22 . GLN A 1 102 ? -11.542 -6.118  -10.393 1.00 6.14  ? 197 GLN A HE22 2  
ATOM   4275  N  N    . VAL A 1 103 ? -14.568 -2.733  -6.050  1.00 1.24  ? 198 VAL A N    2  
ATOM   4276  C  CA   . VAL A 1 103 ? -14.470 -1.512  -5.222  1.00 1.33  ? 198 VAL A CA   2  
ATOM   4277  C  C    . VAL A 1 103 ? -15.812 -1.102  -4.606  1.00 1.49  ? 198 VAL A C    2  
ATOM   4278  O  O    . VAL A 1 103 ? -15.828 -0.641  -3.470  1.00 1.73  ? 198 VAL A O    2  
ATOM   4279  C  CB   . VAL A 1 103 ? -13.768 -0.332  -5.940  1.00 1.43  ? 198 VAL A CB   2  
ATOM   4280  C  CG1  . VAL A 1 103 ? -14.461 0.085   -7.240  1.00 2.91  ? 198 VAL A CG1  2  
ATOM   4281  C  CG2  . VAL A 1 103 ? -13.628 0.912   -5.050  1.00 2.95  ? 198 VAL A CG2  2  
ATOM   4282  H  H    . VAL A 1 103 ? -14.268 -2.694  -7.029  1.00 1.30  ? 198 VAL A H    2  
ATOM   4283  H  HA   . VAL A 1 103 ? -13.815 -1.780  -4.398  1.00 1.48  ? 198 VAL A HA   2  
ATOM   4284  H  HB   . VAL A 1 103 ? -12.764 -0.674  -6.184  1.00 1.93  ? 198 VAL A HB   2  
ATOM   4285  H  HG11 . VAL A 1 103 ? -14.443 -0.756  -7.919  1.00 3.44  ? 198 VAL A HG11 2  
ATOM   4286  H  HG12 . VAL A 1 103 ? -15.492 0.386   -7.052  1.00 3.92  ? 198 VAL A HG12 2  
ATOM   4287  H  HG13 . VAL A 1 103 ? -13.923 0.912   -7.705  1.00 3.69  ? 198 VAL A HG13 2  
ATOM   4288  H  HG21 . VAL A 1 103 ? -12.989 1.642   -5.548  1.00 3.45  ? 198 VAL A HG21 2  
ATOM   4289  H  HG22 . VAL A 1 103 ? -14.605 1.366   -4.885  1.00 3.98  ? 198 VAL A HG22 2  
ATOM   4290  H  HG23 . VAL A 1 103 ? -13.182 0.639   -4.095  1.00 3.80  ? 198 VAL A HG23 2  
ATOM   4291  N  N    . ALA A 1 104 ? -16.942 -1.350  -5.282  1.00 1.56  ? 199 ALA A N    2  
ATOM   4292  C  CA   . ALA A 1 104 ? -18.272 -1.102  -4.719  1.00 1.93  ? 199 ALA A CA   2  
ATOM   4293  C  C    . ALA A 1 104 ? -18.560 -1.912  -3.436  1.00 2.04  ? 199 ALA A C    2  
ATOM   4294  O  O    . ALA A 1 104 ? -19.279 -1.433  -2.560  1.00 2.51  ? 199 ALA A O    2  
ATOM   4295  C  CB   . ALA A 1 104 ? -19.308 -1.394  -5.813  1.00 2.11  ? 199 ALA A CB   2  
ATOM   4296  H  H    . ALA A 1 104 ? -16.877 -1.691  -6.237  1.00 1.47  ? 199 ALA A H    2  
ATOM   4297  H  HA   . ALA A 1 104 ? -18.341 -0.046  -4.443  1.00 2.13  ? 199 ALA A HA   2  
ATOM   4298  H  HB1  . ALA A 1 104 ? -20.308 -1.180  -5.436  1.00 2.34  ? 199 ALA A HB1  2  
ATOM   4299  H  HB2  . ALA A 1 104 ? -19.113 -0.768  -6.684  1.00 3.00  ? 199 ALA A HB2  2  
ATOM   4300  H  HB3  . ALA A 1 104 ? -19.256 -2.443  -6.108  1.00 2.43  ? 199 ALA A HB3  2  
ATOM   4301  N  N    . GLN A 1 105 ? -18.042 -3.142  -3.330  1.00 1.78  ? 200 GLN A N    2  
ATOM   4302  C  CA   . GLN A 1 105 ? -18.029 -3.915  -2.082  1.00 1.82  ? 200 GLN A CA   2  
ATOM   4303  C  C    . GLN A 1 105 ? -16.909 -3.453  -1.131  1.00 1.85  ? 200 GLN A C    2  
ATOM   4304  O  O    . GLN A 1 105 ? -17.122 -3.333  0.077   1.00 2.03  ? 200 GLN A O    2  
ATOM   4305  C  CB   . GLN A 1 105 ? -17.919 -5.420  -2.397  1.00 1.83  ? 200 GLN A CB   2  
ATOM   4306  C  CG   . GLN A 1 105 ? -19.091 -5.958  -3.239  1.00 2.43  ? 200 GLN A CG   2  
ATOM   4307  C  CD   . GLN A 1 105 ? -18.834 -7.381  -3.735  1.00 2.84  ? 200 GLN A CD   2  
ATOM   4308  O  OE1  . GLN A 1 105 ? -19.183 -8.373  -3.107  1.00 3.23  ? 200 GLN A OE1  2  
ATOM   4309  N  NE2  . GLN A 1 105 ? -18.205 -7.555  -4.877  1.00 3.98  ? 200 GLN A NE2  2  
ATOM   4310  H  H    . GLN A 1 105 ? -17.422 -3.445  -4.071  1.00 1.59  ? 200 GLN A H    2  
ATOM   4311  H  HA   . GLN A 1 105 ? -18.967 -3.749  -1.547  1.00 1.95  ? 200 GLN A HA   2  
ATOM   4312  H  HB2  . GLN A 1 105 ? -16.982 -5.608  -2.920  1.00 2.28  ? 200 GLN A HB2  2  
ATOM   4313  H  HB3  . GLN A 1 105 ? -17.900 -5.966  -1.451  1.00 1.92  ? 200 GLN A HB3  2  
ATOM   4314  H  HG2  . GLN A 1 105 ? -20.002 -5.949  -2.640  1.00 2.89  ? 200 GLN A HG2  2  
ATOM   4315  H  HG3  . GLN A 1 105 ? -19.252 -5.324  -4.111  1.00 3.42  ? 200 GLN A HG3  2  
ATOM   4316  H  HE21 . GLN A 1 105 ? -17.974 -6.759  -5.461  1.00 4.60  ? 200 GLN A HE21 2  
ATOM   4317  H  HE22 . GLN A 1 105 ? -18.041 -8.506  -5.174  1.00 4.71  ? 200 GLN A HE22 2  
ATOM   4318  N  N    . ALA A 1 106 ? -15.701 -3.215  -1.656  1.00 1.73  ? 201 ALA A N    2  
ATOM   4319  C  CA   . ALA A 1 106 ? -14.521 -2.903  -0.854  1.00 1.68  ? 201 ALA A CA   2  
ATOM   4320  C  C    . ALA A 1 106 ? -14.609 -1.569  -0.096  1.00 1.68  ? 201 ALA A C    2  
ATOM   4321  O  O    . ALA A 1 106 ? -14.305 -1.566  1.089   1.00 1.72  ? 201 ALA A O    2  
ATOM   4322  C  CB   . ALA A 1 106 ? -13.272 -2.963  -1.742  1.00 1.61  ? 201 ALA A CB   2  
ATOM   4323  H  H    . ALA A 1 106 ? -15.555 -3.420  -2.640  1.00 1.63  ? 201 ALA A H    2  
ATOM   4324  H  HA   . ALA A 1 106 ? -14.425 -3.682  -0.096  1.00 1.74  ? 201 ALA A HA   2  
ATOM   4325  H  HB1  . ALA A 1 106 ? -12.381 -2.937  -1.115  1.00 1.71  ? 201 ALA A HB1  2  
ATOM   4326  H  HB2  . ALA A 1 106 ? -13.267 -3.883  -2.330  1.00 2.18  ? 201 ALA A HB2  2  
ATOM   4327  H  HB3  . ALA A 1 106 ? -13.248 -2.102  -2.406  1.00 2.57  ? 201 ALA A HB3  2  
ATOM   4328  N  N    . SER A 1 107 ? -15.016 -0.454  -0.709  1.00 1.71  ? 202 SER A N    2  
ATOM   4329  C  CA   . SER A 1 107 ? -15.162 0.836   -0.003  1.00 1.80  ? 202 SER A CA   2  
ATOM   4330  C  C    . SER A 1 107 ? -16.379 0.912   0.939   1.00 2.01  ? 202 SER A C    2  
ATOM   4331  O  O    . SER A 1 107 ? -16.405 1.723   1.863   1.00 2.22  ? 202 SER A O    2  
ATOM   4332  C  CB   . SER A 1 107 ? -15.147 2.013   -0.987  1.00 1.97  ? 202 SER A CB   2  
ATOM   4333  O  OG   . SER A 1 107 ? -16.219 1.969   -1.909  1.00 2.69  ? 202 SER A OG   2  
ATOM   4334  H  H    . SER A 1 107 ? -15.300 -0.490  -1.684  1.00 1.74  ? 202 SER A H    2  
ATOM   4335  H  HA   . SER A 1 107 ? -14.292 0.962   0.640   1.00 1.73  ? 202 SER A HA   2  
ATOM   4336  H  HB2  . SER A 1 107 ? -15.203 2.944   -0.420  1.00 2.58  ? 202 SER A HB2  2  
ATOM   4337  H  HB3  . SER A 1 107 ? -14.205 2.002   -1.537  1.00 2.92  ? 202 SER A HB3  2  
ATOM   4338  H  HG   . SER A 1 107 ? -16.204 2.793   -2.418  1.00 3.29  ? 202 SER A HG   2  
ATOM   4339  N  N    . HIS A 1 108 ? -17.378 0.046   0.754   1.00 2.01  ? 203 HIS A N    2  
ATOM   4340  C  CA   . HIS A 1 108 ? -18.417 -0.216  1.755   1.00 2.18  ? 203 HIS A CA   2  
ATOM   4341  C  C    . HIS A 1 108 ? -17.873 -1.028  2.956   1.00 2.13  ? 203 HIS A C    2  
ATOM   4342  O  O    . HIS A 1 108 ? -18.257 -0.796  4.102   1.00 2.25  ? 203 HIS A O    2  
ATOM   4343  C  CB   . HIS A 1 108 ? -19.576 -0.915  1.023   1.00 2.34  ? 203 HIS A CB   2  
ATOM   4344  C  CG   . HIS A 1 108 ? -20.643 -1.490  1.913   1.00 2.28  ? 203 HIS A CG   2  
ATOM   4345  N  ND1  . HIS A 1 108 ? -21.043 -2.823  1.896   1.00 2.60  ? 203 HIS A ND1  2  
ATOM   4346  C  CD2  . HIS A 1 108 ? -21.386 -0.815  2.839   1.00 2.71  ? 203 HIS A CD2  2  
ATOM   4347  C  CE1  . HIS A 1 108 ? -21.995 -2.931  2.832   1.00 3.42  ? 203 HIS A CE1  2  
ATOM   4348  N  NE2  . HIS A 1 108 ? -22.227 -1.742  3.418   1.00 3.51  ? 203 HIS A NE2  2  
ATOM   4349  H  H    . HIS A 1 108 ? -17.344 -0.547  -0.063  1.00 1.88  ? 203 HIS A H    2  
ATOM   4350  H  HA   . HIS A 1 108 ? -18.782 0.733   2.149   1.00 2.32  ? 203 HIS A HA   2  
ATOM   4351  H  HB2  . HIS A 1 108 ? -20.040 -0.204  0.340   1.00 3.13  ? 203 HIS A HB2  2  
ATOM   4352  H  HB3  . HIS A 1 108 ? -19.177 -1.733  0.424   1.00 2.58  ? 203 HIS A HB3  2  
ATOM   4353  H  HD2  . HIS A 1 108 ? -21.298 0.232   3.092   1.00 2.73  ? 203 HIS A HD2  2  
ATOM   4354  H  HE1  . HIS A 1 108 ? -22.499 -3.856  3.076   1.00 4.12  ? 203 HIS A HE1  2  
ATOM   4355  H  HE2  . HIS A 1 108 ? -22.906 -1.575  4.162   1.00 4.23  ? 203 HIS A HE2  2  
ATOM   4356  N  N    . SER A 1 109 ? -16.960 -1.968  2.705   1.00 2.04  ? 204 SER A N    2  
ATOM   4357  C  CA   . SER A 1 109 ? -16.318 -2.806  3.723   1.00 2.07  ? 204 SER A CA   2  
ATOM   4358  C  C    . SER A 1 109 ? -15.291 -2.005  4.538   1.00 2.03  ? 204 SER A C    2  
ATOM   4359  O  O    . SER A 1 109 ? -15.453 -1.807  5.745   1.00 2.30  ? 204 SER A O    2  
ATOM   4360  C  CB   . SER A 1 109 ? -15.665 -4.031  3.063   1.00 2.13  ? 204 SER A CB   2  
ATOM   4361  O  OG   . SER A 1 109 ? -16.608 -4.785  2.322   1.00 2.96  ? 204 SER A OG   2  
ATOM   4362  H  H    . SER A 1 109 ? -16.632 -2.045  1.753   1.00 1.99  ? 204 SER A H    2  
ATOM   4363  H  HA   . SER A 1 109 ? -17.077 -3.169  4.418   1.00 2.20  ? 204 SER A HA   2  
ATOM   4364  H  HB2  . SER A 1 109 ? -14.863 -3.714  2.397   1.00 2.45  ? 204 SER A HB2  2  
ATOM   4365  H  HB3  . SER A 1 109 ? -15.238 -4.665  3.840   1.00 2.19  ? 204 SER A HB3  2  
ATOM   4366  H  HG   . SER A 1 109 ? -16.896 -4.268  1.543   1.00 3.68  ? 204 SER A HG   2  
ATOM   4367  N  N    . TYR A 1 110 ? -14.251 -1.505  3.869   1.00 1.88  ? 205 TYR A N    2  
ATOM   4368  C  CA   . TYR A 1 110 ? -13.322 -0.497  4.363   1.00 2.02  ? 205 TYR A CA   2  
ATOM   4369  C  C    . TYR A 1 110 ? -13.921 0.895   4.111   1.00 2.03  ? 205 TYR A C    2  
ATOM   4370  O  O    . TYR A 1 110 ? -13.818 1.406   2.996   1.00 2.82  ? 205 TYR A O    2  
ATOM   4371  C  CB   . TYR A 1 110 ? -11.978 -0.582  3.607   1.00 2.42  ? 205 TYR A CB   2  
ATOM   4372  C  CG   . TYR A 1 110 ? -11.100 -1.805  3.782   1.00 2.40  ? 205 TYR A CG   2  
ATOM   4373  C  CD1  . TYR A 1 110 ? -11.393 -2.997  3.088   1.00 3.43  ? 205 TYR A CD1  2  
ATOM   4374  C  CD2  . TYR A 1 110 ? -9.888  -1.689  4.492   1.00 2.83  ? 205 TYR A CD2  2  
ATOM   4375  C  CE1  . TYR A 1 110 ? -10.474 -4.063  3.092   1.00 3.95  ? 205 TYR A CE1  2  
ATOM   4376  C  CE2  . TYR A 1 110 ? -8.955  -2.741  4.479   1.00 3.35  ? 205 TYR A CE2  2  
ATOM   4377  C  CZ   . TYR A 1 110 ? -9.242  -3.930  3.770   1.00 3.58  ? 205 TYR A CZ   2  
ATOM   4378  O  OH   . TYR A 1 110 ? -8.315  -4.924  3.710   1.00 4.39  ? 205 TYR A OH   2  
ATOM   4379  H  H    . TYR A 1 110 ? -14.219 -1.670  2.868   1.00 1.81  ? 205 TYR A H    2  
ATOM   4380  H  HA   . TYR A 1 110 ? -13.161 -0.644  5.427   1.00 2.14  ? 205 TYR A HA   2  
ATOM   4381  H  HB2  . TYR A 1 110 ? -12.170 -0.482  2.538   1.00 3.00  ? 205 TYR A HB2  2  
ATOM   4382  H  HB3  . TYR A 1 110 ? -11.388 0.289   3.893   1.00 2.82  ? 205 TYR A HB3  2  
ATOM   4383  H  HD1  . TYR A 1 110 ? -12.304 -3.073  2.512   1.00 4.37  ? 205 TYR A HD1  2  
ATOM   4384  H  HD2  . TYR A 1 110 ? -9.644  -0.767  5.000   1.00 3.56  ? 205 TYR A HD2  2  
ATOM   4385  H  HE1  . TYR A 1 110 ? -10.683 -4.965  2.537   1.00 5.11  ? 205 TYR A HE1  2  
ATOM   4386  H  HE2  . TYR A 1 110 ? -8.010  -2.625  4.989   1.00 4.24  ? 205 TYR A HE2  2  
ATOM   4387  H  HH   . TYR A 1 110 ? -7.473  -4.646  4.081   1.00 4.64  ? 205 TYR A HH   2  
ATOM   4388  N  N    . ARG A 1 111 ? -14.513 1.541   5.127   1.00 1.80  ? 206 ARG A N    2  
ATOM   4389  C  CA   . ARG A 1 111 ? -15.142 2.869   4.989   1.00 1.94  ? 206 ARG A CA   2  
ATOM   4390  C  C    . ARG A 1 111 ? -14.100 3.983   4.749   1.00 1.89  ? 206 ARG A C    2  
ATOM   4391  O  O    . ARG A 1 111 ? -13.793 4.761   5.646   1.00 2.25  ? 206 ARG A O    2  
ATOM   4392  C  CB   . ARG A 1 111 ? -16.068 3.185   6.185   1.00 2.39  ? 206 ARG A CB   2  
ATOM   4393  C  CG   . ARG A 1 111 ? -17.428 2.462   6.141   1.00 2.68  ? 206 ARG A CG   2  
ATOM   4394  C  CD   . ARG A 1 111 ? -17.416 1.000   6.598   1.00 3.15  ? 206 ARG A CD   2  
ATOM   4395  N  NE   . ARG A 1 111 ? -17.200 0.875   8.052   1.00 4.13  ? 206 ARG A NE   2  
ATOM   4396  C  CZ   . ARG A 1 111 ? -17.139 -0.263  8.729   1.00 5.51  ? 206 ARG A CZ   2  
ATOM   4397  N  NH1  . ARG A 1 111 ? -17.058 -1.433  8.138   1.00 6.39  ? 206 ARG A NH1  2  
ATOM   4398  N  NH2  . ARG A 1 111 ? -17.152 -0.225  10.039  1.00 6.52  ? 206 ARG A NH2  2  
ATOM   4399  H  H    . ARG A 1 111 ? -14.568 1.074   6.019   1.00 2.09  ? 206 ARG A H    2  
ATOM   4400  H  HA   . ARG A 1 111 ? -15.772 2.849   4.099   1.00 2.11  ? 206 ARG A HA   2  
ATOM   4401  H  HB2  . ARG A 1 111 ? -15.556 2.981   7.127   1.00 2.84  ? 206 ARG A HB2  2  
ATOM   4402  H  HB3  . ARG A 1 111 ? -16.291 4.253   6.160   1.00 2.85  ? 206 ARG A HB3  2  
ATOM   4403  H  HG2  . ARG A 1 111 ? -18.127 3.007   6.777   1.00 3.02  ? 206 ARG A HG2  2  
ATOM   4404  H  HG3  . ARG A 1 111 ? -17.817 2.506   5.123   1.00 3.34  ? 206 ARG A HG3  2  
ATOM   4405  H  HD2  . ARG A 1 111 ? -18.388 0.565   6.357   1.00 3.50  ? 206 ARG A HD2  2  
ATOM   4406  H  HD3  . ARG A 1 111 ? -16.661 0.444   6.046   1.00 3.49  ? 206 ARG A HD3  2  
ATOM   4407  H  HE   . ARG A 1 111 ? -17.234 1.721   8.614   1.00 4.22  ? 206 ARG A HE   2  
ATOM   4408  H  HH11 . ARG A 1 111 ? -16.901 -1.482  7.140   1.00 6.11  ? 206 ARG A HH11 2  
ATOM   4409  H  HH12 . ARG A 1 111 ? -16.880 -2.246  8.709   1.00 7.72  ? 206 ARG A HH12 2  
ATOM   4410  H  HH21 . ARG A 1 111 ? -17.163 0.676   10.507  1.00 6.41  ? 206 ARG A HH21 2  
ATOM   4411  H  HH22 . ARG A 1 111 ? -17.246 -1.076  10.589  1.00 7.62  ? 206 ARG A HH22 2  
ATOM   4412  N  N    . VAL A 1 112 ? -13.546 4.024   3.540   1.00 1.84  ? 207 VAL A N    2  
ATOM   4413  C  CA   . VAL A 1 112 ? -12.562 5.010   3.065   1.00 1.94  ? 207 VAL A CA   2  
ATOM   4414  C  C    . VAL A 1 112 ? -13.254 6.243   2.488   1.00 1.96  ? 207 VAL A C    2  
ATOM   4415  O  O    . VAL A 1 112 ? -14.326 6.154   1.892   1.00 2.15  ? 207 VAL A O    2  
ATOM   4416  C  CB   . VAL A 1 112 ? -11.571 4.437   2.023   1.00 2.18  ? 207 VAL A CB   2  
ATOM   4417  C  CG1  . VAL A 1 112 ? -10.642 3.404   2.674   1.00 2.57  ? 207 VAL A CG1  2  
ATOM   4418  C  CG2  . VAL A 1 112 ? -12.252 3.819   0.788   1.00 3.27  ? 207 VAL A CG2  2  
ATOM   4419  H  H    . VAL A 1 112 ? -13.841 3.284   2.907   1.00 1.97  ? 207 VAL A H    2  
ATOM   4420  H  HA   . VAL A 1 112 ? -11.973 5.333   3.925   1.00 2.08  ? 207 VAL A HA   2  
ATOM   4421  H  HB   . VAL A 1 112 ? -10.940 5.257   1.676   1.00 3.05  ? 207 VAL A HB   2  
ATOM   4422  H  HG11 . VAL A 1 112 ? -11.215 2.546   3.025   1.00 3.03  ? 207 VAL A HG11 2  
ATOM   4423  H  HG12 . VAL A 1 112 ? -9.908  3.070   1.943   1.00 3.39  ? 207 VAL A HG12 2  
ATOM   4424  H  HG13 . VAL A 1 112 ? -10.117 3.860   3.514   1.00 3.38  ? 207 VAL A HG13 2  
ATOM   4425  H  HG21 . VAL A 1 112 ? -12.845 4.572   0.273   1.00 3.89  ? 207 VAL A HG21 2  
ATOM   4426  H  HG22 . VAL A 1 112 ? -11.494 3.448   0.100   1.00 4.20  ? 207 VAL A HG22 2  
ATOM   4427  H  HG23 . VAL A 1 112 ? -12.898 2.992   1.077   1.00 3.71  ? 207 VAL A HG23 2  
ATOM   4428  N  N    . TYR A 1 113 ? -12.617 7.398   2.667   1.00 2.00  ? 208 TYR A N    2  
ATOM   4429  C  CA   . TYR A 1 113 ? -13.127 8.695   2.227   1.00 2.12  ? 208 TYR A CA   2  
ATOM   4430  C  C    . TYR A 1 113 ? -12.621 9.100   0.827   1.00 2.00  ? 208 TYR A C    2  
ATOM   4431  O  O    . TYR A 1 113 ? -11.420 9.050   0.541   1.00 2.20  ? 208 TYR A O    2  
ATOM   4432  C  CB   . TYR A 1 113 ? -12.753 9.727   3.298   1.00 2.52  ? 208 TYR A CB   2  
ATOM   4433  C  CG   . TYR A 1 113 ? -12.962 11.168  2.886   1.00 3.57  ? 208 TYR A CG   2  
ATOM   4434  C  CD1  . TYR A 1 113 ? -14.250 11.736  2.858   1.00 3.92  ? 208 TYR A CD1  2  
ATOM   4435  C  CD2  . TYR A 1 113 ? -11.848 11.937  2.508   1.00 5.17  ? 208 TYR A CD2  2  
ATOM   4436  C  CE1  . TYR A 1 113 ? -14.418 13.082  2.475   1.00 5.31  ? 208 TYR A CE1  2  
ATOM   4437  C  CE2  . TYR A 1 113 ? -12.011 13.270  2.106   1.00 6.58  ? 208 TYR A CE2  2  
ATOM   4438  C  CZ   . TYR A 1 113 ? -13.296 13.858  2.105   1.00 6.50  ? 208 TYR A CZ   2  
ATOM   4439  O  OH   . TYR A 1 113 ? -13.450 15.170  1.773   1.00 8.03  ? 208 TYR A OH   2  
ATOM   4440  H  H    . TYR A 1 113 ? -11.748 7.386   3.179   1.00 2.05  ? 208 TYR A H    2  
ATOM   4441  H  HA   . TYR A 1 113 ? -14.216 8.651   2.182   1.00 2.17  ? 208 TYR A HA   2  
ATOM   4442  H  HB2  . TYR A 1 113 ? -13.340 9.531   4.197   1.00 2.56  ? 208 TYR A HB2  2  
ATOM   4443  H  HB3  . TYR A 1 113 ? -11.703 9.594   3.562   1.00 3.06  ? 208 TYR A HB3  2  
ATOM   4444  H  HD1  . TYR A 1 113 ? -15.109 11.144  3.140   1.00 3.83  ? 208 TYR A HD1  2  
ATOM   4445  H  HD2  . TYR A 1 113 ? -10.859 11.507  2.534   1.00 5.67  ? 208 TYR A HD2  2  
ATOM   4446  H  HE1  . TYR A 1 113 ? -15.401 13.531  2.470   1.00 5.90  ? 208 TYR A HE1  2  
ATOM   4447  H  HE2  . TYR A 1 113 ? -11.144 13.841  1.817   1.00 8.00  ? 208 TYR A HE2  2  
ATOM   4448  H  HH   . TYR A 1 113 ? -12.592 15.608  1.646   1.00 8.99  ? 208 TYR A HH   2  
ATOM   4449  N  N    . TYR A 1 114 ? -13.549 9.565   -0.012  1.00 1.94  ? 209 TYR A N    2  
ATOM   4450  C  CA   . TYR A 1 114 ? -13.321 10.243  -1.292  1.00 1.97  ? 209 TYR A CA   2  
ATOM   4451  C  C    . TYR A 1 114 ? -14.539 11.116  -1.663  1.00 2.07  ? 209 TYR A C    2  
ATOM   4452  O  O    . TYR A 1 114 ? -15.678 10.730  -1.394  1.00 2.18  ? 209 TYR A O    2  
ATOM   4453  C  CB   . TYR A 1 114 ? -12.928 9.229   -2.385  1.00 2.20  ? 209 TYR A CB   2  
ATOM   4454  C  CG   . TYR A 1 114 ? -13.832 8.016   -2.549  1.00 1.94  ? 209 TYR A CG   2  
ATOM   4455  C  CD1  . TYR A 1 114 ? -15.056 8.126   -3.240  1.00 3.05  ? 209 TYR A CD1  2  
ATOM   4456  C  CD2  . TYR A 1 114 ? -13.428 6.761   -2.049  1.00 2.37  ? 209 TYR A CD2  2  
ATOM   4457  C  CE1  . TYR A 1 114 ? -15.875 6.994   -3.424  1.00 3.19  ? 209 TYR A CE1  2  
ATOM   4458  C  CE2  . TYR A 1 114 ? -14.235 5.623   -2.240  1.00 2.47  ? 209 TYR A CE2  2  
ATOM   4459  C  CZ   . TYR A 1 114 ? -15.465 5.736   -2.926  1.00 2.26  ? 209 TYR A CZ   2  
ATOM   4460  O  OH   . TYR A 1 114 ? -16.252 4.639   -3.112  1.00 2.69  ? 209 TYR A OH   2  
ATOM   4461  H  H    . TYR A 1 114 ? -14.515 9.521   0.284   1.00 2.05  ? 209 TYR A H    2  
ATOM   4462  H  HA   . TYR A 1 114 ? -12.480 10.921  -1.167  1.00 2.04  ? 209 TYR A HA   2  
ATOM   4463  H  HB2  . TYR A 1 114 ? -12.867 9.748   -3.338  1.00 2.61  ? 209 TYR A HB2  2  
ATOM   4464  H  HB3  . TYR A 1 114 ? -11.922 8.873   -2.165  1.00 2.64  ? 209 TYR A HB3  2  
ATOM   4465  H  HD1  . TYR A 1 114 ? -15.372 9.083   -3.628  1.00 4.31  ? 209 TYR A HD1  2  
ATOM   4466  H  HD2  . TYR A 1 114 ? -12.487 6.666   -1.526  1.00 3.50  ? 209 TYR A HD2  2  
ATOM   4467  H  HE1  . TYR A 1 114 ? -16.812 7.092   -3.950  1.00 4.51  ? 209 TYR A HE1  2  
ATOM   4468  H  HE2  . TYR A 1 114 ? -13.915 4.662   -1.869  1.00 3.59  ? 209 TYR A HE2  2  
ATOM   4469  H  HH   . TYR A 1 114 ? -17.050 4.863   -3.596  1.00 3.43  ? 209 TYR A HH   2  
ATOM   4470  N  N    . ASN A 1 115 ? -14.315 12.309  -2.223  1.00 2.25  ? 210 ASN A N    2  
ATOM   4471  C  CA   . ASN A 1 115 ? -15.317 13.384  -2.285  1.00 2.68  ? 210 ASN A CA   2  
ATOM   4472  C  C    . ASN A 1 115 ? -15.050 14.373  -3.439  1.00 2.96  ? 210 ASN A C    2  
ATOM   4473  O  O    . ASN A 1 115 ? -13.974 14.966  -3.499  1.00 3.32  ? 210 ASN A O    2  
ATOM   4474  C  CB   . ASN A 1 115 ? -15.279 14.104  -0.926  1.00 3.22  ? 210 ASN A CB   2  
ATOM   4475  C  CG   . ASN A 1 115 ? -16.205 15.307  -0.822  1.00 4.08  ? 210 ASN A CG   2  
ATOM   4476  O  OD1  . ASN A 1 115 ? -17.139 15.480  -1.593  1.00 4.35  ? 210 ASN A OD1  2  
ATOM   4477  N  ND2  . ASN A 1 115 ? -15.963 16.172  0.144   1.00 5.05  ? 210 ASN A ND2  2  
ATOM   4478  H  H    . ASN A 1 115 ? -13.348 12.590  -2.364  1.00 2.33  ? 210 ASN A H    2  
ATOM   4479  H  HA   . ASN A 1 115 ? -16.309 12.953  -2.423  1.00 2.84  ? 210 ASN A HA   2  
ATOM   4480  H  HB2  . ASN A 1 115 ? -15.547 13.401  -0.139  1.00 3.28  ? 210 ASN A HB2  2  
ATOM   4481  H  HB3  . ASN A 1 115 ? -14.257 14.442  -0.745  1.00 3.65  ? 210 ASN A HB3  2  
ATOM   4482  H  HD21 . ASN A 1 115 ? -15.178 16.025  0.764   1.00 5.30  ? 210 ASN A HD21 2  
ATOM   4483  H  HD22 . ASN A 1 115 ? -16.567 16.971  0.227   1.00 5.79  ? 210 ASN A HD22 2  
ATOM   4484  N  N    . ALA A 1 116 ? -16.025 14.576  -4.337  1.00 3.13  ? 211 ALA A N    2  
ATOM   4485  C  CA   . ALA A 1 116 ? -15.889 15.419  -5.531  1.00 3.53  ? 211 ALA A CA   2  
ATOM   4486  C  C    . ALA A 1 116 ? -17.238 15.954  -6.057  1.00 3.54  ? 211 ALA A C    2  
ATOM   4487  O  O    . ALA A 1 116 ? -18.284 15.315  -5.897  1.00 3.61  ? 211 ALA A O    2  
ATOM   4488  C  CB   . ALA A 1 116 ? -15.170 14.610  -6.620  1.00 3.92  ? 211 ALA A CB   2  
ATOM   4489  H  H    . ALA A 1 116 ? -16.925 14.147  -4.174  1.00 3.18  ? 211 ALA A H    2  
ATOM   4490  H  HA   . ALA A 1 116 ? -15.264 16.278  -5.279  1.00 4.10  ? 211 ALA A HA   2  
ATOM   4491  H  HB1  . ALA A 1 116 ? -15.797 13.780  -6.948  1.00 3.78  ? 211 ALA A HB1  2  
ATOM   4492  H  HB2  . ALA A 1 116 ? -14.939 15.251  -7.472  1.00 4.70  ? 211 ALA A HB2  2  
ATOM   4493  H  HB3  . ALA A 1 116 ? -14.236 14.215  -6.226  1.00 4.40  ? 211 ALA A HB3  2  
ATOM   4494  N  N    . GLY A 1 117 ? -17.194 17.102  -6.747  1.00 3.95  ? 212 GLY A N    2  
ATOM   4495  C  CA   . GLY A 1 117 ? -18.361 17.724  -7.393  1.00 4.38  ? 212 GLY A CA   2  
ATOM   4496  C  C    . GLY A 1 117 ? -18.079 19.126  -7.963  1.00 4.73  ? 212 GLY A C    2  
ATOM   4497  O  O    . GLY A 1 117 ? -17.878 20.042  -7.162  1.00 5.82  ? 212 GLY A O    2  
ATOM   4498  H  H    . GLY A 1 117 ? -16.293 17.551  -6.846  1.00 4.20  ? 212 GLY A H    2  
ATOM   4499  H  HA2  . GLY A 1 117 ? -18.736 17.052  -8.163  1.00 4.69  ? 212 GLY A HA2  2  
ATOM   4500  H  HA3  . GLY A 1 117 ? -19.163 17.813  -6.661  1.00 5.16  ? 212 GLY A HA3  2  
ATOM   4501  N  N    . PRO A 1 118 ? -18.073 19.320  -9.301  1.00 4.86  ? 213 PRO A N    2  
ATOM   4502  C  CA   . PRO A 1 118 ? -17.818 20.613  -9.938  1.00 5.80  ? 213 PRO A CA   2  
ATOM   4503  C  C    . PRO A 1 118 ? -19.048 21.528  -9.876  1.00 5.49  ? 213 PRO A C    2  
ATOM   4504  O  O    . PRO A 1 118 ? -20.182 21.055  -9.868  1.00 5.31  ? 213 PRO A O    2  
ATOM   4505  C  CB   . PRO A 1 118 ? -17.433 20.287  -11.384 1.00 6.82  ? 213 PRO A CB   2  
ATOM   4506  C  CG   . PRO A 1 118 ? -18.229 19.016  -11.671 1.00 6.42  ? 213 PRO A CG   2  
ATOM   4507  C  CD   . PRO A 1 118 ? -18.233 18.291  -10.324 1.00 5.35  ? 213 PRO A CD   2  
ATOM   4508  H  HA   . PRO A 1 118 ? -16.981 21.109  -9.452  1.00 6.86  ? 213 PRO A HA   2  
ATOM   4509  H  HB2  . PRO A 1 118 ? -17.693 21.090  -12.074 1.00 7.31  ? 213 PRO A HB2  2  
ATOM   4510  H  HB3  . PRO A 1 118 ? -16.365 20.069  -11.436 1.00 7.95  ? 213 PRO A HB3  2  
ATOM   4511  H  HG2  . PRO A 1 118 ? -19.251 19.278  -11.950 1.00 6.14  ? 213 PRO A HG2  2  
ATOM   4512  H  HG3  . PRO A 1 118 ? -17.763 18.415  -12.453 1.00 7.75  ? 213 PRO A HG3  2  
ATOM   4513  H  HD2  . PRO A 1 118 ? -19.175 17.754  -10.200 1.00 5.29  ? 213 PRO A HD2  2  
ATOM   4514  H  HD3  . PRO A 1 118 ? -17.392 17.598  -10.276 1.00 5.96  ? 213 PRO A HD3  2  
ATOM   4515  N  N    . LYS A 1 119 ? -18.820 22.846  -9.848  1.00 6.29  ? 214 LYS A N    2  
ATOM   4516  C  CA   . LYS A 1 119 ? -19.880 23.848  -9.660  1.00 6.68  ? 214 LYS A CA   2  
ATOM   4517  C  C    . LYS A 1 119 ? -20.317 24.590  -10.943 1.00 7.01  ? 214 LYS A C    2  
ATOM   4518  O  O    . LYS A 1 119 ? -19.740 24.470  -12.023 1.00 7.37  ? 214 LYS A O    2  
ATOM   4519  C  CB   . LYS A 1 119 ? -19.416 24.871  -8.605  1.00 8.19  ? 214 LYS A CB   2  
ATOM   4520  C  CG   . LYS A 1 119 ? -19.269 24.312  -7.181  1.00 8.96  ? 214 LYS A CG   2  
ATOM   4521  C  CD   . LYS A 1 119 ? -18.773 25.393  -6.206  1.00 10.81 ? 214 LYS A CD   2  
ATOM   4522  C  CE   . LYS A 1 119 ? -17.446 26.020  -6.656  1.00 11.10 ? 214 LYS A CE   2  
ATOM   4523  N  NZ   . LYS A 1 119 ? -17.004 27.109  -5.770  1.00 12.98 ? 214 LYS A NZ   2  
ATOM   4524  H  H    . LYS A 1 119 ? -17.862 23.166  -9.828  1.00 7.13  ? 214 LYS A H    2  
ATOM   4525  H  HA   . LYS A 1 119 ? -20.771 23.347  -9.281  1.00 6.30  ? 214 LYS A HA   2  
ATOM   4526  H  HB2  . LYS A 1 119 ? -18.472 25.274  -8.953  1.00 8.36  ? 214 LYS A HB2  2  
ATOM   4527  H  HB3  . LYS A 1 119 ? -20.121 25.699  -8.537  1.00 9.18  ? 214 LYS A HB3  2  
ATOM   4528  H  HG2  . LYS A 1 119 ? -20.240 23.952  -6.840  1.00 9.19  ? 214 LYS A HG2  2  
ATOM   4529  H  HG3  . LYS A 1 119 ? -18.582 23.471  -7.175  1.00 8.46  ? 214 LYS A HG3  2  
ATOM   4530  H  HD2  . LYS A 1 119 ? -19.530 26.174  -6.128  1.00 11.80 ? 214 LYS A HD2  2  
ATOM   4531  H  HD3  . LYS A 1 119 ? -18.638 24.935  -5.225  1.00 11.36 ? 214 LYS A HD3  2  
ATOM   4532  H  HE2  . LYS A 1 119 ? -16.679 25.251  -6.685  1.00 10.36 ? 214 LYS A HE2  2  
ATOM   4533  H  HE3  . LYS A 1 119 ? -17.540 26.402  -7.669  1.00 10.98 ? 214 LYS A HE3  2  
ATOM   4534  H  HZ1  . LYS A 1 119 ? -17.688 27.866  -5.726  1.00 13.60 ? 214 LYS A HZ1  2  
ATOM   4535  H  HZ2  . LYS A 1 119 ? -16.795 26.751  -4.845  1.00 13.66 ? 214 LYS A HZ2  2  
ATOM   4536  H  HZ3  . LYS A 1 119 ? -16.156 27.535  -6.120  1.00 13.35 ? 214 LYS A HZ3  2  
ATOM   4537  N  N    . ASP A 1 120 ? -21.328 25.432  -10.722 1.00 7.50  ? 215 ASP A N    2  
ATOM   4538  C  CA   . ASP A 1 120 ? -21.983 26.402  -11.607 1.00 8.20  ? 215 ASP A CA   2  
ATOM   4539  C  C    . ASP A 1 120 ? -21.440 27.836  -11.428 1.00 9.11  ? 215 ASP A C    2  
ATOM   4540  O  O    . ASP A 1 120 ? -21.483 28.615  -12.374 1.00 9.57  ? 215 ASP A O    2  
ATOM   4541  C  CB   . ASP A 1 120 ? -23.475 26.364  -11.229 1.00 8.61  ? 215 ASP A CB   2  
ATOM   4542  C  CG   . ASP A 1 120 ? -24.340 27.405  -11.943 1.00 9.86  ? 215 ASP A CG   2  
ATOM   4543  O  OD1  . ASP A 1 120 ? -24.761 27.140  -13.091 1.00 10.17 ? 215 ASP A OD1  2  
ATOM   4544  O  OD2  . ASP A 1 120 ? -24.694 28.429  -11.310 1.00 10.84 ? 215 ASP A OD2  2  
ATOM   4545  H  H    . ASP A 1 120 ? -21.661 25.416  -9.780  1.00 7.73  ? 215 ASP A H    2  
ATOM   4546  H  HA   . ASP A 1 120 ? -21.862 26.111  -12.652 1.00 8.26  ? 215 ASP A HA   2  
ATOM   4547  H  HB2  . ASP A 1 120 ? -23.867 25.371  -11.452 1.00 8.27  ? 215 ASP A HB2  2  
ATOM   4548  H  HB3  . ASP A 1 120 ? -23.570 26.519  -10.151 1.00 8.82  ? 215 ASP A HB3  2  
ATOM   4549  N  N    . GLU A 1 121 ? -20.922 28.173  -10.235 1.00 9.79  ? 216 GLU A N    2  
ATOM   4550  C  CA   . GLU A 1 121 ? -20.345 29.487  -9.895  1.00 11.08 ? 216 GLU A CA   2  
ATOM   4551  C  C    . GLU A 1 121 ? -19.260 29.906  -10.901 1.00 11.09 ? 216 GLU A C    2  
ATOM   4552  O  O    . GLU A 1 121 ? -19.220 31.054  -11.344 1.00 12.33 ? 216 GLU A O    2  
ATOM   4553  C  CB   . GLU A 1 121 ? -19.758 29.414  -8.471  1.00 11.48 ? 216 GLU A CB   2  
ATOM   4554  C  CG   . GLU A 1 121 ? -19.225 30.760  -7.942  1.00 12.97 ? 216 GLU A CG   2  
ATOM   4555  C  CD   . GLU A 1 121 ? -18.508 30.650  -6.590  1.00 13.82 ? 216 GLU A CD   2  
ATOM   4556  O  OE1  . GLU A 1 121 ? -18.202 29.523  -6.137  1.00 13.84 ? 216 GLU A OE1  2  
ATOM   4557  O  OE2  . GLU A 1 121 ? -18.171 31.707  -6.005  1.00 14.78 ? 216 GLU A OE2  2  
ATOM   4558  H  H    . GLU A 1 121 ? -20.981 27.495  -9.498  1.00 9.69  ? 216 GLU A H    2  
ATOM   4559  H  HA   . GLU A 1 121 ? -21.140 30.235  -9.915  1.00 12.15 ? 216 GLU A HA   2  
ATOM   4560  H  HB2  . GLU A 1 121 ? -20.533 29.060  -7.788  1.00 11.64 ? 216 GLU A HB2  2  
ATOM   4561  H  HB3  . GLU A 1 121 ? -18.948 28.682  -8.473  1.00 10.96 ? 216 GLU A HB3  2  
ATOM   4562  H  HG2  . GLU A 1 121 ? -18.514 31.175  -8.657  1.00 13.26 ? 216 GLU A HG2  2  
ATOM   4563  H  HG3  . GLU A 1 121 ? -20.058 31.456  -7.847  1.00 13.55 ? 216 GLU A HG3  2  
ATOM   4564  N  N    . ASP A 1 122 ? -18.409 28.957  -11.303 1.00 9.92  ? 217 ASP A N    2  
ATOM   4565  C  CA   . ASP A 1 122 ? -17.509 29.076  -12.448 1.00 9.81  ? 217 ASP A CA   2  
ATOM   4566  C  C    . ASP A 1 122 ? -17.127 27.648  -12.844 1.00 8.78  ? 217 ASP A C    2  
ATOM   4567  O  O    . ASP A 1 122 ? -17.441 27.181  -13.936 1.00 8.56  ? 217 ASP A O    2  
ATOM   4568  C  CB   . ASP A 1 122 ? -16.286 29.937  -12.068 1.00 10.53 ? 217 ASP A CB   2  
ATOM   4569  C  CG   . ASP A 1 122 ? -15.821 30.796  -13.238 1.00 10.97 ? 217 ASP A CG   2  
ATOM   4570  O  OD1  . ASP A 1 122 ? -16.458 31.854  -13.459 1.00 11.84 ? 217 ASP A OD1  2  
ATOM   4571  O  OD2  . ASP A 1 122 ? -14.811 30.443  -13.889 1.00 10.79 ? 217 ASP A OD2  2  
ATOM   4572  H  H    . ASP A 1 122 ? -18.497 28.028  -10.909 1.00 9.13  ? 217 ASP A H    2  
ATOM   4573  H  HA   . ASP A 1 122 ? -18.046 29.541  -13.279 1.00 10.29 ? 217 ASP A HA   2  
ATOM   4574  H  HB2  . ASP A 1 122 ? -16.546 30.605  -11.245 1.00 11.30 ? 217 ASP A HB2  2  
ATOM   4575  H  HB3  . ASP A 1 122 ? -15.468 29.307  -11.716 1.00 10.34 ? 217 ASP A HB3  2  
ATOM   4576  N  N    . GLN A 1 123 ? -16.600 26.927  -11.854 1.00 8.51  ? 218 GLN A N    2  
ATOM   4577  C  CA   . GLN A 1 123 ? -16.419 25.484  -11.773 1.00 7.81  ? 218 GLN A CA   2  
ATOM   4578  C  C    . GLN A 1 123 ? -15.969 25.167  -10.329 1.00 8.20  ? 218 GLN A C    2  
ATOM   4579  O  O    . GLN A 1 123 ? -16.157 25.997  -9.439  1.00 9.53  ? 218 GLN A O    2  
ATOM   4580  C  CB   . GLN A 1 123 ? -15.430 25.005  -12.853 1.00 8.01  ? 218 GLN A CB   2  
ATOM   4581  C  CG   . GLN A 1 123 ? -15.862 23.701  -13.542 1.00 7.65  ? 218 GLN A CG   2  
ATOM   4582  C  CD   . GLN A 1 123 ? -16.743 23.943  -14.772 1.00 8.30  ? 218 GLN A CD   2  
ATOM   4583  O  OE1  . GLN A 1 123 ? -16.240 24.141  -15.875 1.00 9.37  ? 218 GLN A OE1  2  
ATOM   4584  N  NE2  . GLN A 1 123 ? -18.055 23.936  -14.645 1.00 8.25  ? 218 GLN A NE2  2  
ATOM   4585  H  H    . GLN A 1 123 ? -16.381 27.419  -10.997 1.00 9.08  ? 218 GLN A H    2  
ATOM   4586  H  HA   . GLN A 1 123 ? -17.384 25.010  -11.938 1.00 7.47  ? 218 GLN A HA   2  
ATOM   4587  H  HB2  . GLN A 1 123 ? -15.316 25.768  -13.619 1.00 8.61  ? 218 GLN A HB2  2  
ATOM   4588  H  HB3  . GLN A 1 123 ? -14.454 24.866  -12.394 1.00 8.46  ? 218 GLN A HB3  2  
ATOM   4589  H  HG2  . GLN A 1 123 ? -14.966 23.179  -13.878 1.00 7.78  ? 218 GLN A HG2  2  
ATOM   4590  H  HG3  . GLN A 1 123 ? -16.378 23.052  -12.834 1.00 7.48  ? 218 GLN A HG3  2  
ATOM   4591  H  HE21 . GLN A 1 123 ? -18.513 23.881  -13.748 1.00 7.81  ? 218 GLN A HE21 2  
ATOM   4592  H  HE22 . GLN A 1 123 ? -18.610 23.960  -15.495 1.00 8.98  ? 218 GLN A HE22 2  
ATOM   4593  N  N    . ASP A 1 124 ? -15.357 24.006  -10.086 1.00 7.43  ? 219 ASP A N    2  
ATOM   4594  C  CA   . ASP A 1 124 ? -14.687 23.675  -8.811  1.00 8.02  ? 219 ASP A CA   2  
ATOM   4595  C  C    . ASP A 1 124 ? -13.375 22.871  -8.974  1.00 6.92  ? 219 ASP A C    2  
ATOM   4596  O  O    . ASP A 1 124 ? -13.029 22.424  -10.070 1.00 6.18  ? 219 ASP A O    2  
ATOM   4597  C  CB   . ASP A 1 124 ? -15.663 22.945  -7.862  1.00 8.88  ? 219 ASP A CB   2  
ATOM   4598  C  CG   . ASP A 1 124 ? -15.523 23.337  -6.382  1.00 10.49 ? 219 ASP A CG   2  
ATOM   4599  O  OD1  . ASP A 1 124 ? -14.546 24.031  -6.018  1.00 11.34 ? 219 ASP A OD1  2  
ATOM   4600  O  OD2  . ASP A 1 124 ? -16.446 23.030  -5.598  1.00 11.26 ? 219 ASP A OD2  2  
ATOM   4601  H  H    . ASP A 1 124 ? -15.180 23.410  -10.873 1.00 6.65  ? 219 ASP A H    2  
ATOM   4602  H  HA   . ASP A 1 124 ? -14.406 24.622  -8.346  1.00 9.29  ? 219 ASP A HA   2  
ATOM   4603  H  HB2  . ASP A 1 124 ? -16.679 23.176  -8.170  1.00 9.41  ? 219 ASP A HB2  2  
ATOM   4604  H  HB3  . ASP A 1 124 ? -15.525 21.867  -7.956  1.00 8.37  ? 219 ASP A HB3  2  
ATOM   4605  N  N    . TYR A 1 125 ? -12.664 22.703  -7.852  1.00 7.31  ? 220 TYR A N    2  
ATOM   4606  C  CA   . TYR A 1 125 ? -11.286 22.208  -7.694  1.00 7.02  ? 220 TYR A CA   2  
ATOM   4607  C  C    . TYR A 1 125 ? -10.925 20.877  -8.406  1.00 5.85  ? 220 TYR A C    2  
ATOM   4608  O  O    . TYR A 1 125 ? -10.326 20.910  -9.480  1.00 6.06  ? 220 TYR A O    2  
ATOM   4609  C  CB   . TYR A 1 125 ? -10.911 22.231  -6.190  1.00 8.20  ? 220 TYR A CB   2  
ATOM   4610  C  CG   . TYR A 1 125 ? -11.532 21.166  -5.286  1.00 8.10  ? 220 TYR A CG   2  
ATOM   4611  C  CD1  . TYR A 1 125 ? -12.931 21.040  -5.177  1.00 7.86  ? 220 TYR A CD1  2  
ATOM   4612  C  CD2  . TYR A 1 125 ? -10.710 20.258  -4.588  1.00 8.82  ? 220 TYR A CD2  2  
ATOM   4613  C  CE1  . TYR A 1 125 ? -13.512 20.017  -4.411  1.00 8.12  ? 220 TYR A CE1  2  
ATOM   4614  C  CE2  . TYR A 1 125 ? -11.280 19.224  -3.821  1.00 9.10  ? 220 TYR A CE2  2  
ATOM   4615  C  CZ   . TYR A 1 125 ? -12.684 19.094  -3.732  1.00 8.65  ? 220 TYR A CZ   2  
ATOM   4616  O  OH   . TYR A 1 125 ? -13.225 18.093  -2.987  1.00 9.29  ? 220 TYR A OH   2  
ATOM   4617  H  H    . TYR A 1 125 ? -13.071 23.130  -7.023  1.00 8.27  ? 220 TYR A H    2  
ATOM   4618  H  HA   . TYR A 1 125 ? -10.650 22.957  -8.169  1.00 7.39  ? 220 TYR A HA   2  
ATOM   4619  H  HB2  . TYR A 1 125 ? -9.826  22.150  -6.123  1.00 8.77  ? 220 TYR A HB2  2  
ATOM   4620  H  HB3  . TYR A 1 125 ? -11.173 23.208  -5.783  1.00 9.16  ? 220 TYR A HB3  2  
ATOM   4621  H  HD1  . TYR A 1 125 ? -13.577 21.737  -5.675  1.00 7.94  ? 220 TYR A HD1  2  
ATOM   4622  H  HD2  . TYR A 1 125 ? -9.634  20.354  -4.629  1.00 9.54  ? 220 TYR A HD2  2  
ATOM   4623  H  HE1  . TYR A 1 125 ? -14.591 19.962  -4.343  1.00 8.37  ? 220 TYR A HE1  2  
ATOM   4624  H  HE2  . TYR A 1 125 ? -10.650 18.527  -3.285  1.00 10.01 ? 220 TYR A HE2  2  
ATOM   4625  H  HH   . TYR A 1 125 ? -14.182 18.082  -2.998  1.00 9.24  ? 220 TYR A HH   2  
ATOM   4626  N  N    . ILE A 1 126 ? -11.210 19.710  -7.808  1.00 5.05  ? 221 ILE A N    2  
ATOM   4627  C  CA   . ILE A 1 126 ? -10.678 18.370  -8.158  1.00 4.28  ? 221 ILE A CA   2  
ATOM   4628  C  C    . ILE A 1 126 ? -11.404 17.285  -7.338  1.00 3.64  ? 221 ILE A C    2  
ATOM   4629  O  O    . ILE A 1 126 ? -12.575 17.040  -7.609  1.00 3.38  ? 221 ILE A O    2  
ATOM   4630  C  CB   . ILE A 1 126 ? -9.114  18.340  -8.194  1.00 4.51  ? 221 ILE A CB   2  
ATOM   4631  C  CG1  . ILE A 1 126 ? -8.552  16.951  -8.581  1.00 4.04  ? 221 ILE A CG1  2  
ATOM   4632  C  CG2  . ILE A 1 126 ? -8.439  18.883  -6.916  1.00 6.04  ? 221 ILE A CG2  2  
ATOM   4633  C  CD1  . ILE A 1 126 ? -7.142  16.999  -9.185  1.00 4.98  ? 221 ILE A CD1  2  
ATOM   4634  H  H    . ILE A 1 126 ? -11.775 19.766  -6.970  1.00 5.37  ? 221 ILE A H    2  
ATOM   4635  H  HA   . ILE A 1 126 ? -10.988 18.151  -9.180  1.00 4.40  ? 221 ILE A HA   2  
ATOM   4636  H  HB   . ILE A 1 126 ? -8.812  19.008  -9.000  1.00 4.95  ? 221 ILE A HB   2  
ATOM   4637  H  HG12 . ILE A 1 126 ? -8.511  16.313  -7.701  1.00 4.69  ? 221 ILE A HG12 2  
ATOM   4638  H  HG13 . ILE A 1 126 ? -9.213  16.491  -9.317  1.00 3.70  ? 221 ILE A HG13 2  
ATOM   4639  H  HG21 . ILE A 1 126 ? -8.699  18.291  -6.041  1.00 6.50  ? 221 ILE A HG21 2  
ATOM   4640  H  HG22 . ILE A 1 126 ? -7.356  18.875  -7.029  1.00 6.58  ? 221 ILE A HG22 2  
ATOM   4641  H  HG23 . ILE A 1 126 ? -8.737  19.917  -6.751  1.00 6.87  ? 221 ILE A HG23 2  
ATOM   4642  H  HD11 . ILE A 1 126 ? -7.136  17.633  -10.072 1.00 5.42  ? 221 ILE A HD11 2  
ATOM   4643  H  HD12 . ILE A 1 126 ? -6.425  17.379  -8.458  1.00 5.68  ? 221 ILE A HD12 2  
ATOM   4644  H  HD13 . ILE A 1 126 ? -6.840  15.991  -9.472  1.00 5.18  ? 221 ILE A HD13 2  
ATOM   4645  N  N    . VAL A 1 127 ? -10.754 16.652  -6.364  1.00 3.66  ? 222 VAL A N    2  
ATOM   4646  C  CA   . VAL A 1 127 ? -11.273 15.602  -5.476  1.00 3.15  ? 222 VAL A CA   2  
ATOM   4647  C  C    . VAL A 1 127 ? -10.425 15.616  -4.202  1.00 3.11  ? 222 VAL A C    2  
ATOM   4648  O  O    . VAL A 1 127 ? -9.208  15.777  -4.284  1.00 3.31  ? 222 VAL A O    2  
ATOM   4649  C  CB   . VAL A 1 127 ? -11.291 14.197  -6.151  1.00 2.91  ? 222 VAL A CB   2  
ATOM   4650  C  CG1  . VAL A 1 127 ? -9.998  13.838  -6.899  1.00 4.00  ? 222 VAL A CG1  2  
ATOM   4651  C  CG2  . VAL A 1 127 ? -11.619 13.035  -5.192  1.00 3.80  ? 222 VAL A CG2  2  
ATOM   4652  H  H    . VAL A 1 127 ? -9.806  16.936  -6.167  1.00 4.21  ? 222 VAL A H    2  
ATOM   4653  H  HA   . VAL A 1 127 ? -12.297 15.866  -5.211  1.00 3.27  ? 222 VAL A HA   2  
ATOM   4654  H  HB   . VAL A 1 127 ? -12.074 14.211  -6.907  1.00 3.19  ? 222 VAL A HB   2  
ATOM   4655  H  HG11 . VAL A 1 127 ? -9.871  14.501  -7.752  1.00 5.13  ? 222 VAL A HG11 2  
ATOM   4656  H  HG12 . VAL A 1 127 ? -9.140  13.915  -6.234  1.00 4.60  ? 222 VAL A HG12 2  
ATOM   4657  H  HG13 . VAL A 1 127 ? -10.063 12.818  -7.284  1.00 4.19  ? 222 VAL A HG13 2  
ATOM   4658  H  HG21 . VAL A 1 127 ? -12.552 13.226  -4.669  1.00 4.62  ? 222 VAL A HG21 2  
ATOM   4659  H  HG22 . VAL A 1 127 ? -11.733 12.108  -5.757  1.00 3.63  ? 222 VAL A HG22 2  
ATOM   4660  H  HG23 . VAL A 1 127 ? -10.817 12.901  -4.464  1.00 4.96  ? 222 VAL A HG23 2  
ATOM   4661  N  N    . ASP A 1 128 ? -11.068 15.472  -3.043  1.00 3.10  ? 223 ASP A N    2  
ATOM   4662  C  CA   . ASP A 1 128 ? -10.426 15.243  -1.743  1.00 3.16  ? 223 ASP A CA   2  
ATOM   4663  C  C    . ASP A 1 128 ? -10.614 13.771  -1.336  1.00 2.64  ? 223 ASP A C    2  
ATOM   4664  O  O    . ASP A 1 128 ? -11.650 13.173  -1.631  1.00 2.67  ? 223 ASP A O    2  
ATOM   4665  C  CB   . ASP A 1 128 ? -11.020 16.211  -0.704  1.00 3.86  ? 223 ASP A CB   2  
ATOM   4666  C  CG   . ASP A 1 128 ? -10.270 16.207  0.633   1.00 4.78  ? 223 ASP A CG   2  
ATOM   4667  O  OD1  . ASP A 1 128 ? -9.021  16.166  0.625   1.00 5.41  ? 223 ASP A OD1  2  
ATOM   4668  O  OD2  . ASP A 1 128 ? -10.933 16.275  1.697   1.00 5.69  ? 223 ASP A OD2  2  
ATOM   4669  H  H    . ASP A 1 128 ? -12.080 15.374  -3.077  1.00 3.19  ? 223 ASP A H    2  
ATOM   4670  H  HA   . ASP A 1 128 ? -9.356  15.445  -1.824  1.00 3.28  ? 223 ASP A HA   2  
ATOM   4671  H  HB2  . ASP A 1 128 ? -10.978 17.225  -1.105  1.00 4.30  ? 223 ASP A HB2  2  
ATOM   4672  H  HB3  . ASP A 1 128 ? -12.069 15.959  -0.540  1.00 3.90  ? 223 ASP A HB3  2  
ATOM   4673  N  N    . HIS A 1 129 ? -9.616  13.154  -0.695  1.00 2.60  ? 224 HIS A N    2  
ATOM   4674  C  CA   . HIS A 1 129 ? -9.613  11.706  -0.445  1.00 2.20  ? 224 HIS A CA   2  
ATOM   4675  C  C    . HIS A 1 129 ? -8.742  11.263  0.747   1.00 2.30  ? 224 HIS A C    2  
ATOM   4676  O  O    . HIS A 1 129 ? -8.037  12.056  1.366   1.00 2.90  ? 224 HIS A O    2  
ATOM   4677  C  CB   . HIS A 1 129 ? -9.243  10.950  -1.743  1.00 2.01  ? 224 HIS A CB   2  
ATOM   4678  C  CG   . HIS A 1 129 ? -7.756  10.833  -2.001  1.00 1.81  ? 224 HIS A CG   2  
ATOM   4679  N  ND1  . HIS A 1 129 ? -7.010  9.707   -1.797  1.00 2.21  ? 224 HIS A ND1  2  
ATOM   4680  C  CD2  . HIS A 1 129 ? -6.934  11.854  -2.390  1.00 2.18  ? 224 HIS A CD2  2  
ATOM   4681  C  CE1  . HIS A 1 129 ? -5.728  10.003  -2.010  1.00 2.22  ? 224 HIS A CE1  2  
ATOM   4682  N  NE2  . HIS A 1 129 ? -5.646  11.297  -2.378  1.00 2.06  ? 224 HIS A NE2  2  
ATOM   4683  H  H    . HIS A 1 129 ? -8.814  13.698  -0.395  1.00 3.16  ? 224 HIS A H    2  
ATOM   4684  H  HA   . HIS A 1 129 ? -10.633 11.425  -0.186  1.00 2.43  ? 224 HIS A HA   2  
ATOM   4685  H  HB2  . HIS A 1 129 ? -9.659  9.943   -1.687  1.00 2.34  ? 224 HIS A HB2  2  
ATOM   4686  H  HB3  . HIS A 1 129 ? -9.712  11.436  -2.600  1.00 2.22  ? 224 HIS A HB3  2  
ATOM   4687  H  HD1  . HIS A 1 129 ? -7.338  8.806   -1.476  1.00 2.86  ? 224 HIS A HD1  2  
ATOM   4688  H  HD2  . HIS A 1 129 ? -7.235  12.874  -2.595  1.00 3.02  ? 224 HIS A HD2  2  
ATOM   4689  H  HE1  . HIS A 1 129 ? -4.896  9.329   -1.845  1.00 2.82  ? 224 HIS A HE1  2  
ATOM   4690  N  N    . SER A 1 130 ? -8.780  9.964   1.058   1.00 2.51  ? 225 SER A N    2  
ATOM   4691  C  CA   . SER A 1 130 ? -7.917  9.282   2.032   1.00 3.31  ? 225 SER A CA   2  
ATOM   4692  C  C    . SER A 1 130 ? -6.410  9.384   1.699   1.00 2.96  ? 225 SER A C    2  
ATOM   4693  O  O    . SER A 1 130 ? -5.798  8.412   1.258   1.00 4.09  ? 225 SER A O    2  
ATOM   4694  C  CB   . SER A 1 130 ? -8.369  7.811   2.153   1.00 5.01  ? 225 SER A CB   2  
ATOM   4695  O  OG   . SER A 1 130 ? -7.536  7.057   3.021   1.00 6.36  ? 225 SER A OG   2  
ATOM   4696  H  H    . SER A 1 130 ? -9.515  9.417   0.618   1.00 2.67  ? 225 SER A H    2  
ATOM   4697  H  HA   . SER A 1 130 ? -8.056  9.743   3.010   1.00 3.79  ? 225 SER A HA   2  
ATOM   4698  H  HB2  . SER A 1 130 ? -9.393  7.783   2.530   1.00 5.23  ? 225 SER A HB2  2  
ATOM   4699  H  HB3  . SER A 1 130 ? -8.353  7.348   1.165   1.00 5.70  ? 225 SER A HB3  2  
ATOM   4700  H  HG   . SER A 1 130 ? -6.664  6.990   2.591   1.00 6.71  ? 225 SER A HG   2  
ATOM   4701  N  N    . ILE A 1 131 ? -5.787  10.533  1.983   1.00 2.50  ? 226 ILE A N    2  
ATOM   4702  C  CA   . ILE A 1 131 ? -4.322  10.748  2.054   1.00 3.23  ? 226 ILE A CA   2  
ATOM   4703  C  C    . ILE A 1 131 ? -3.708  10.053  3.291   1.00 2.71  ? 226 ILE A C    2  
ATOM   4704  O  O    . ILE A 1 131 ? -3.011  10.660  4.112   1.00 3.51  ? 226 ILE A O    2  
ATOM   4705  C  CB   . ILE A 1 131 ? -3.991  12.261  1.972   1.00 4.60  ? 226 ILE A CB   2  
ATOM   4706  C  CG1  . ILE A 1 131 ? -4.704  13.107  3.058   1.00 5.39  ? 226 ILE A CG1  2  
ATOM   4707  C  CG2  . ILE A 1 131 ? -4.332  12.781  0.564   1.00 5.44  ? 226 ILE A CG2  2  
ATOM   4708  C  CD1  . ILE A 1 131 ? -4.109  14.511  3.223   1.00 6.76  ? 226 ILE A CD1  2  
ATOM   4709  H  H    . ILE A 1 131 ? -6.379  11.338  2.169   1.00 2.52  ? 226 ILE A H    2  
ATOM   4710  H  HA   . ILE A 1 131 ? -3.859  10.268  1.187   1.00 4.00  ? 226 ILE A HA   2  
ATOM   4711  H  HB   . ILE A 1 131 ? -2.913  12.368  2.105   1.00 5.37  ? 226 ILE A HB   2  
ATOM   4712  H  HG12 . ILE A 1 131 ? -5.763  13.202  2.814   1.00 5.71  ? 226 ILE A HG12 2  
ATOM   4713  H  HG13 . ILE A 1 131 ? -4.631  12.607  4.022   1.00 5.35  ? 226 ILE A HG13 2  
ATOM   4714  H  HG21 . ILE A 1 131 ? -5.405  12.722  0.378   1.00 5.88  ? 226 ILE A HG21 2  
ATOM   4715  H  HG22 . ILE A 1 131 ? -4.013  13.815  0.453   1.00 6.35  ? 226 ILE A HG22 2  
ATOM   4716  H  HG23 . ILE A 1 131 ? -3.809  12.185  -0.183  1.00 5.54  ? 226 ILE A HG23 2  
ATOM   4717  H  HD11 . ILE A 1 131 ? -4.604  15.017  4.051   1.00 7.28  ? 226 ILE A HD11 2  
ATOM   4718  H  HD12 . ILE A 1 131 ? -3.042  14.441  3.441   1.00 7.13  ? 226 ILE A HD12 2  
ATOM   4719  H  HD13 . ILE A 1 131 ? -4.257  15.100  2.318   1.00 7.52  ? 226 ILE A HD13 2  
ATOM   4720  N  N    . ALA A 1 132 ? -4.047  8.775   3.461   1.00 1.95  ? 227 ALA A N    2  
ATOM   4721  C  CA   . ALA A 1 132 ? -3.891  7.998   4.684   1.00 1.93  ? 227 ALA A CA   2  
ATOM   4722  C  C    . ALA A 1 132 ? -3.749  6.495   4.402   1.00 1.53  ? 227 ALA A C    2  
ATOM   4723  O  O    . ALA A 1 132 ? -4.196  5.990   3.368   1.00 1.71  ? 227 ALA A O    2  
ATOM   4724  C  CB   . ALA A 1 132 ? -5.069  8.300   5.622   1.00 2.62  ? 227 ALA A CB   2  
ATOM   4725  H  H    . ALA A 1 132 ? -4.546  8.331   2.697   1.00 2.07  ? 227 ALA A H    2  
ATOM   4726  H  HA   . ALA A 1 132 ? -2.971  8.321   5.167   1.00 2.63  ? 227 ALA A HA   2  
ATOM   4727  H  HB1  . ALA A 1 132 ? -6.008  8.007   5.151   1.00 3.00  ? 227 ALA A HB1  2  
ATOM   4728  H  HB2  . ALA A 1 132 ? -4.956  7.742   6.553   1.00 3.37  ? 227 ALA A HB2  2  
ATOM   4729  H  HB3  . ALA A 1 132 ? -5.097  9.365   5.853   1.00 3.17  ? 227 ALA A HB3  2  
ATOM   4730  N  N    . ILE A 1 133 ? -3.098  5.795   5.333   1.00 1.41  ? 228 ILE A N    2  
ATOM   4731  C  CA   . ILE A 1 133 ? -2.558  4.435   5.178   1.00 1.31  ? 228 ILE A CA   2  
ATOM   4732  C  C    . ILE A 1 133 ? -2.695  3.629   6.477   1.00 1.29  ? 228 ILE A C    2  
ATOM   4733  O  O    . ILE A 1 133 ? -2.666  4.201   7.563   1.00 1.43  ? 228 ILE A O    2  
ATOM   4734  C  CB   . ILE A 1 133 ? -1.083  4.488   4.703   1.00 1.48  ? 228 ILE A CB   2  
ATOM   4735  C  CG1  . ILE A 1 133 ? -0.176  5.299   5.664   1.00 2.01  ? 228 ILE A CG1  2  
ATOM   4736  C  CG2  . ILE A 1 133 ? -1.008  5.029   3.267   1.00 2.11  ? 228 ILE A CG2  2  
ATOM   4737  C  CD1  . ILE A 1 133 ? 1.276   5.440   5.194   1.00 2.14  ? 228 ILE A CD1  2  
ATOM   4738  H  H    . ILE A 1 133 ? -2.866  6.280   6.195   1.00 1.62  ? 228 ILE A H    2  
ATOM   4739  H  HA   . ILE A 1 133 ? -3.150  3.915   4.426   1.00 1.37  ? 228 ILE A HA   2  
ATOM   4740  H  HB   . ILE A 1 133 ? -0.715  3.461   4.671   1.00 2.51  ? 228 ILE A HB   2  
ATOM   4741  H  HG12 . ILE A 1 133 ? -0.574  6.305   5.790   1.00 2.40  ? 228 ILE A HG12 2  
ATOM   4742  H  HG13 . ILE A 1 133 ? -0.170  4.811   6.639   1.00 3.02  ? 228 ILE A HG13 2  
ATOM   4743  H  HG21 . ILE A 1 133 ? -1.185  6.105   3.252   1.00 2.45  ? 228 ILE A HG21 2  
ATOM   4744  H  HG22 . ILE A 1 133 ? -0.030  4.822   2.834   1.00 2.82  ? 228 ILE A HG22 2  
ATOM   4745  H  HG23 . ILE A 1 133 ? -1.762  4.536   2.660   1.00 3.18  ? 228 ILE A HG23 2  
ATOM   4746  H  HD11 . ILE A 1 133 ? 1.330   6.115   4.339   1.00 2.18  ? 228 ILE A HD11 2  
ATOM   4747  H  HD12 . ILE A 1 133 ? 1.881   5.852   6.002   1.00 3.03  ? 228 ILE A HD12 2  
ATOM   4748  H  HD13 . ILE A 1 133 ? 1.669   4.468   4.907   1.00 2.70  ? 228 ILE A HD13 2  
ATOM   4749  N  N    . TYR A 1 134 ? -2.852  2.307   6.371   1.00 1.26  ? 229 TYR A N    2  
ATOM   4750  C  CA   . TYR A 1 134 ? -3.405  1.468   7.453   1.00 1.32  ? 229 TYR A CA   2  
ATOM   4751  C  C    . TYR A 1 134 ? -2.555  0.207   7.719   1.00 1.45  ? 229 TYR A C    2  
ATOM   4752  O  O    . TYR A 1 134 ? -2.206  -0.506  6.774   1.00 1.56  ? 229 TYR A O    2  
ATOM   4753  C  CB   . TYR A 1 134 ? -4.849  1.087   7.062   1.00 1.28  ? 229 TYR A CB   2  
ATOM   4754  C  CG   . TYR A 1 134 ? -5.722  2.271   6.665   1.00 1.75  ? 229 TYR A CG   2  
ATOM   4755  C  CD1  . TYR A 1 134 ? -5.765  2.709   5.324   1.00 3.18  ? 229 TYR A CD1  2  
ATOM   4756  C  CD2  . TYR A 1 134 ? -6.435  2.981   7.647   1.00 2.24  ? 229 TYR A CD2  2  
ATOM   4757  C  CE1  . TYR A 1 134 ? -6.469  3.879   4.975   1.00 4.43  ? 229 TYR A CE1  2  
ATOM   4758  C  CE2  . TYR A 1 134 ? -7.151  4.145   7.306   1.00 3.38  ? 229 TYR A CE2  2  
ATOM   4759  C  CZ   . TYR A 1 134 ? -7.159  4.608   5.970   1.00 4.37  ? 229 TYR A CZ   2  
ATOM   4760  O  OH   . TYR A 1 134 ? -7.822  5.754   5.648   1.00 5.77  ? 229 TYR A OH   2  
ATOM   4761  H  H    . TYR A 1 134 ? -2.845  1.913   5.437   1.00 1.29  ? 229 TYR A H    2  
ATOM   4762  H  HA   . TYR A 1 134 ? -3.450  2.045   8.378   1.00 1.42  ? 229 TYR A HA   2  
ATOM   4763  H  HB2  . TYR A 1 134 ? -4.817  0.387   6.225   1.00 1.90  ? 229 TYR A HB2  2  
ATOM   4764  H  HB3  . TYR A 1 134 ? -5.313  0.570   7.902   1.00 1.73  ? 229 TYR A HB3  2  
ATOM   4765  H  HD1  . TYR A 1 134 ? -5.220  2.170   4.563   1.00 3.71  ? 229 TYR A HD1  2  
ATOM   4766  H  HD2  . TYR A 1 134 ? -6.413  2.645   8.673   1.00 2.61  ? 229 TYR A HD2  2  
ATOM   4767  H  HE1  . TYR A 1 134 ? -6.464  4.233   3.955   1.00 5.71  ? 229 TYR A HE1  2  
ATOM   4768  H  HE2  . TYR A 1 134 ? -7.676  4.703   8.068   1.00 4.02  ? 229 TYR A HE2  2  
ATOM   4769  H  HH   . TYR A 1 134 ? -7.729  6.003   4.719   1.00 6.65  ? 229 TYR A HH   2  
ATOM   4770  N  N    . LEU A 1 135 ? -2.225  -0.091  8.986   1.00 1.45  ? 230 LEU A N    2  
ATOM   4771  C  CA   . LEU A 1 135 ? -1.379  -1.240  9.366   1.00 1.42  ? 230 LEU A CA   2  
ATOM   4772  C  C    . LEU A 1 135 ? -2.207  -2.508  9.645   1.00 1.45  ? 230 LEU A C    2  
ATOM   4773  O  O    . LEU A 1 135 ? -3.136  -2.479  10.452  1.00 1.52  ? 230 LEU A O    2  
ATOM   4774  C  CB   . LEU A 1 135 ? -0.489  -0.886  10.586  1.00 1.47  ? 230 LEU A CB   2  
ATOM   4775  C  CG   . LEU A 1 135 ? 0.855   -0.167  10.324  1.00 1.20  ? 230 LEU A CG   2  
ATOM   4776  C  CD1  . LEU A 1 135 ? 1.730   -0.887  9.283   1.00 1.90  ? 230 LEU A CD1  2  
ATOM   4777  C  CD2  . LEU A 1 135 ? 0.635   1.298   9.921   1.00 2.28  ? 230 LEU A CD2  2  
ATOM   4778  H  H    . LEU A 1 135 ? -2.570  0.508   9.731   1.00 1.42  ? 230 LEU A H    2  
ATOM   4779  H  HA   . LEU A 1 135 ? -0.731  -1.483  8.527   1.00 1.44  ? 230 LEU A HA   2  
ATOM   4780  H  HB2  . LEU A 1 135 ? -1.071  -0.303  11.302  1.00 2.19  ? 230 LEU A HB2  2  
ATOM   4781  H  HB3  . LEU A 1 135 ? -0.235  -1.811  11.095  1.00 1.85  ? 230 LEU A HB3  2  
ATOM   4782  H  HG   . LEU A 1 135 ? 1.425   -0.182  11.258  1.00 1.26  ? 230 LEU A HG   2  
ATOM   4783  H  HD11 . LEU A 1 135 ? 2.718   -0.427  9.257   1.00 2.51  ? 230 LEU A HD11 2  
ATOM   4784  H  HD12 . LEU A 1 135 ? 1.843   -1.936  9.555   1.00 2.65  ? 230 LEU A HD12 2  
ATOM   4785  H  HD13 . LEU A 1 135 ? 1.291   -0.819  8.289   1.00 2.61  ? 230 LEU A HD13 2  
ATOM   4786  H  HD21 . LEU A 1 135 ? 0.096   1.359   8.977   1.00 2.96  ? 230 LEU A HD21 2  
ATOM   4787  H  HD22 . LEU A 1 135 ? 0.057   1.809   10.691  1.00 3.31  ? 230 LEU A HD22 2  
ATOM   4788  H  HD23 . LEU A 1 135 ? 1.598   1.800   9.811   1.00 2.58  ? 230 LEU A HD23 2  
ATOM   4789  N  N    . LEU A 1 136 ? -1.818  -3.626  9.013   1.00 1.47  ? 231 LEU A N    2  
ATOM   4790  C  CA   . LEU A 1 136 ? -2.449  -4.955  9.057   1.00 1.51  ? 231 LEU A CA   2  
ATOM   4791  C  C    . LEU A 1 136 ? -1.400  -6.034  9.398   1.00 1.51  ? 231 LEU A C    2  
ATOM   4792  O  O    . LEU A 1 136 ? -0.344  -6.117  8.761   1.00 1.40  ? 231 LEU A O    2  
ATOM   4793  C  CB   . LEU A 1 136 ? -3.139  -5.177  7.691   1.00 1.51  ? 231 LEU A CB   2  
ATOM   4794  C  CG   . LEU A 1 136 ? -3.975  -6.459  7.465   1.00 1.84  ? 231 LEU A CG   2  
ATOM   4795  C  CD1  . LEU A 1 136 ? -3.123  -7.677  7.080   1.00 3.18  ? 231 LEU A CD1  2  
ATOM   4796  C  CD2  . LEU A 1 136 ? -4.879  -6.815  8.651   1.00 3.04  ? 231 LEU A CD2  2  
ATOM   4797  H  H    . LEU A 1 136 ? -1.021  -3.543  8.392   1.00 1.49  ? 231 LEU A H    2  
ATOM   4798  H  HA   . LEU A 1 136 ? -3.208  -4.964  9.838   1.00 1.60  ? 231 LEU A HA   2  
ATOM   4799  H  HB2  . LEU A 1 136 ? -3.818  -4.336  7.540   1.00 1.88  ? 231 LEU A HB2  2  
ATOM   4800  H  HB3  . LEU A 1 136 ? -2.391  -5.109  6.901   1.00 1.38  ? 231 LEU A HB3  2  
ATOM   4801  H  HG   . LEU A 1 136 ? -4.628  -6.256  6.613   1.00 2.43  ? 231 LEU A HG   2  
ATOM   4802  H  HD11 . LEU A 1 136 ? -2.474  -7.974  7.901   1.00 4.00  ? 231 LEU A HD11 2  
ATOM   4803  H  HD12 . LEU A 1 136 ? -3.773  -8.515  6.829   1.00 3.96  ? 231 LEU A HD12 2  
ATOM   4804  H  HD13 . LEU A 1 136 ? -2.513  -7.438  6.212   1.00 3.90  ? 231 LEU A HD13 2  
ATOM   4805  H  HD21 . LEU A 1 136 ? -4.281  -7.195  9.476   1.00 3.84  ? 231 LEU A HD21 2  
ATOM   4806  H  HD22 . LEU A 1 136 ? -5.434  -5.936  8.975   1.00 3.68  ? 231 LEU A HD22 2  
ATOM   4807  H  HD23 . LEU A 1 136 ? -5.589  -7.586  8.350   1.00 3.67  ? 231 LEU A HD23 2  
ATOM   4808  N  N    . ASN A 1 137 ? -1.685  -6.827  10.436  1.00 1.69  ? 232 ASN A N    2  
ATOM   4809  C  CA   . ASN A 1 137 ? -0.739  -7.711  11.133  1.00 1.62  ? 232 ASN A CA   2  
ATOM   4810  C  C    . ASN A 1 137 ? -0.770  -9.191  10.640  1.00 1.62  ? 232 ASN A C    2  
ATOM   4811  O  O    . ASN A 1 137 ? -1.694  -9.577  9.914   1.00 1.73  ? 232 ASN A O    2  
ATOM   4812  C  CB   . ASN A 1 137 ? -0.982  -7.526  12.657  1.00 1.68  ? 232 ASN A CB   2  
ATOM   4813  C  CG   . ASN A 1 137 ? -1.991  -8.473  13.319  1.00 2.88  ? 232 ASN A CG   2  
ATOM   4814  O  OD1  . ASN A 1 137 ? -2.651  -9.285  12.688  1.00 4.14  ? 232 ASN A OD1  2  
ATOM   4815  N  ND2  . ASN A 1 137 ? -2.104  -8.421  14.632  1.00 3.30  ? 232 ASN A ND2  2  
ATOM   4816  H  H    . ASN A 1 137 ? -2.596  -6.727  10.869  1.00 1.86  ? 232 ASN A H    2  
ATOM   4817  H  HA   . ASN A 1 137 ? 0.262   -7.330  10.927  1.00 1.57  ? 232 ASN A HA   2  
ATOM   4818  H  HB2  . ASN A 1 137 ? -0.033  -7.627  13.179  1.00 2.14  ? 232 ASN A HB2  2  
ATOM   4819  H  HB3  . ASN A 1 137 ? -1.304  -6.502  12.849  1.00 1.85  ? 232 ASN A HB3  2  
ATOM   4820  H  HD21 . ASN A 1 137 ? -1.577  -7.756  15.173  1.00 3.19  ? 232 ASN A HD21 2  
ATOM   4821  H  HD22 . ASN A 1 137 ? -2.703  -9.096  15.101  1.00 4.28  ? 232 ASN A HD22 2  
ATOM   4822  N  N    . PRO A 1 138 ? 0.185   -10.053 11.060  1.00 1.62  ? 233 PRO A N    2  
ATOM   4823  C  CA   . PRO A 1 138 ? 0.298   -11.441 10.597  1.00 1.68  ? 233 PRO A CA   2  
ATOM   4824  C  C    . PRO A 1 138 ? -0.641  -12.446 11.314  1.00 1.85  ? 233 PRO A C    2  
ATOM   4825  O  O    . PRO A 1 138 ? -0.472  -13.651 11.158  1.00 2.24  ? 233 PRO A O    2  
ATOM   4826  C  CB   . PRO A 1 138 ? 1.786   -11.774 10.767  1.00 1.61  ? 233 PRO A CB   2  
ATOM   4827  C  CG   . PRO A 1 138 ? 2.154   -11.014 12.034  1.00 1.70  ? 233 PRO A CG   2  
ATOM   4828  C  CD   . PRO A 1 138 ? 1.339   -9.728  11.897  1.00 1.69  ? 233 PRO A CD   2  
ATOM   4829  H  HA   . PRO A 1 138 ? 0.059   -11.481 9.534   1.00 1.76  ? 233 PRO A HA   2  
ATOM   4830  H  HB2  . PRO A 1 138 ? 1.983   -12.841 10.860  1.00 1.67  ? 233 PRO A HB2  2  
ATOM   4831  H  HB3  . PRO A 1 138 ? 2.355   -11.351 9.933   1.00 1.62  ? 233 PRO A HB3  2  
ATOM   4832  H  HG2  . PRO A 1 138 ? 1.821   -11.574 12.911  1.00 1.84  ? 233 PRO A HG2  2  
ATOM   4833  H  HG3  . PRO A 1 138 ? 3.223   -10.811 12.088  1.00 1.80  ? 233 PRO A HG3  2  
ATOM   4834  H  HD2  . PRO A 1 138 ? 1.036   -9.408  12.891  1.00 1.89  ? 233 PRO A HD2  2  
ATOM   4835  H  HD3  . PRO A 1 138 ? 1.943   -8.960  11.411  1.00 1.69  ? 233 PRO A HD3  2  
ATOM   4836  N  N    . ASP A 1 139 ? -1.656  -11.980 12.055  1.00 1.85  ? 234 ASP A N    2  
ATOM   4837  C  CA   . ASP A 1 139 ? -2.804  -12.762 12.561  1.00 2.01  ? 234 ASP A CA   2  
ATOM   4838  C  C    . ASP A 1 139 ? -4.084  -12.447 11.744  1.00 2.13  ? 234 ASP A C    2  
ATOM   4839  O  O    . ASP A 1 139 ? -5.050  -13.216 11.757  1.00 2.44  ? 234 ASP A O    2  
ATOM   4840  C  CB   . ASP A 1 139 ? -2.968  -12.458 14.064  1.00 2.08  ? 234 ASP A CB   2  
ATOM   4841  C  CG   . ASP A 1 139 ? -4.248  -12.993 14.725  1.00 2.78  ? 234 ASP A CG   2  
ATOM   4842  O  OD1  . ASP A 1 139 ? -4.591  -14.192 14.579  1.00 3.50  ? 234 ASP A OD1  2  
ATOM   4843  O  OD2  . ASP A 1 139 ? -4.909  -12.189 15.422  1.00 3.49  ? 234 ASP A OD2  2  
ATOM   4844  H  H    . ASP A 1 139 ? -1.763  -10.978 12.133  1.00 1.93  ? 234 ASP A H    2  
ATOM   4845  H  HA   . ASP A 1 139 ? -2.601  -13.829 12.463  1.00 2.31  ? 234 ASP A HA   2  
ATOM   4846  H  HB2  . ASP A 1 139 ? -2.108  -12.869 14.595  1.00 2.55  ? 234 ASP A HB2  2  
ATOM   4847  H  HB3  . ASP A 1 139 ? -2.945  -11.377 14.199  1.00 1.95  ? 234 ASP A HB3  2  
ATOM   4848  N  N    . GLY A 1 140 ? -4.050  -11.374 10.940  1.00 2.14  ? 235 GLY A N    2  
ATOM   4849  C  CA   . GLY A 1 140 ? -5.130  -10.922 10.057  1.00 2.58  ? 235 GLY A CA   2  
ATOM   4850  C  C    . GLY A 1 140 ? -5.913  -9.726  10.599  1.00 2.34  ? 235 GLY A C    2  
ATOM   4851  O  O    . GLY A 1 140 ? -6.985  -9.434  10.072  1.00 2.75  ? 235 GLY A O    2  
ATOM   4852  H  H    . GLY A 1 140 ? -3.200  -10.823 10.940  1.00 1.98  ? 235 GLY A H    2  
ATOM   4853  H  HA2  . GLY A 1 140 ? -4.688  -10.599 9.113   1.00 2.85  ? 235 GLY A HA2  2  
ATOM   4854  H  HA3  . GLY A 1 140 ? -5.838  -11.730 9.876   1.00 3.12  ? 235 GLY A HA3  2  
ATOM   4855  N  N    . LEU A 1 141 ? -5.410  -9.044  11.637  1.00 2.04  ? 236 LEU A N    2  
ATOM   4856  C  CA   . LEU A 1 141 ? -6.072  -7.908  12.284  1.00 2.03  ? 236 LEU A CA   2  
ATOM   4857  C  C    . LEU A 1 141 ? -5.292  -6.601  12.099  1.00 1.91  ? 236 LEU A C    2  
ATOM   4858  O  O    . LEU A 1 141 ? -4.062  -6.585  12.064  1.00 2.43  ? 236 LEU A O    2  
ATOM   4859  C  CB   . LEU A 1 141 ? -6.280  -8.206  13.779  1.00 2.41  ? 236 LEU A CB   2  
ATOM   4860  C  CG   . LEU A 1 141 ? -7.264  -9.358  14.053  1.00 3.44  ? 236 LEU A CG   2  
ATOM   4861  C  CD1  . LEU A 1 141 ? -7.348  -9.592  15.566  1.00 3.63  ? 236 LEU A CD1  2  
ATOM   4862  C  CD2  . LEU A 1 141 ? -8.676  -9.094  13.509  1.00 4.81  ? 236 LEU A CD2  2  
ATOM   4863  H  H    . LEU A 1 141 ? -4.500  -9.316  11.992  1.00 2.12  ? 236 LEU A H    2  
ATOM   4864  H  HA   . LEU A 1 141 ? -7.052  -7.767  11.833  1.00 2.32  ? 236 LEU A HA   2  
ATOM   4865  H  HB2  . LEU A 1 141 ? -5.313  -8.451  14.225  1.00 2.22  ? 236 LEU A HB2  2  
ATOM   4866  H  HB3  . LEU A 1 141 ? -6.655  -7.306  14.271  1.00 3.05  ? 236 LEU A HB3  2  
ATOM   4867  H  HG   . LEU A 1 141 ? -6.881  -10.257 13.573  1.00 4.51  ? 236 LEU A HG   2  
ATOM   4868  H  HD11 . LEU A 1 141 ? -8.017  -10.427 15.772  1.00 4.37  ? 236 LEU A HD11 2  
ATOM   4869  H  HD12 . LEU A 1 141 ? -6.359  -9.823  15.962  1.00 4.02  ? 236 LEU A HD12 2  
ATOM   4870  H  HD13 . LEU A 1 141 ? -7.730  -8.700  16.063  1.00 3.80  ? 236 LEU A HD13 2  
ATOM   4871  H  HD21 . LEU A 1 141 ? -9.053  -8.143  13.887  1.00 5.05  ? 236 LEU A HD21 2  
ATOM   4872  H  HD22 . LEU A 1 141 ? -8.665  -9.077  12.420  1.00 5.58  ? 236 LEU A HD22 2  
ATOM   4873  H  HD23 . LEU A 1 141 ? -9.346  -9.894  13.823  1.00 5.77  ? 236 LEU A HD23 2  
ATOM   4874  N  N    . PHE A 1 142 ? -6.019  -5.488  12.022  1.00 1.77  ? 237 PHE A N    2  
ATOM   4875  C  CA   . PHE A 1 142 ? -5.441  -4.144  11.986  1.00 1.72  ? 237 PHE A CA   2  
ATOM   4876  C  C    . PHE A 1 142 ? -4.967  -3.695  13.381  1.00 6.03  ? 237 PHE A C    2  
ATOM   4877  O  O    . PHE A 1 142 ? -5.183  -4.397  14.373  1.00 5.08  ? 237 PHE A O    2  
ATOM   4878  C  CB   . PHE A 1 142 ? -6.466  -3.172  11.374  1.00 1.98  ? 237 PHE A CB   2  
ATOM   4879  C  CG   . PHE A 1 142 ? -6.911  -3.554  9.974   1.00 3.16  ? 237 PHE A CG   2  
ATOM   4880  C  CD1  . PHE A 1 142 ? -6.183  -3.109  8.855   1.00 4.74  ? 237 PHE A CD1  2  
ATOM   4881  C  CD2  . PHE A 1 142 ? -8.035  -4.384  9.791   1.00 4.52  ? 237 PHE A CD2  2  
ATOM   4882  C  CE1  . PHE A 1 142 ? -6.562  -3.510  7.561   1.00 6.10  ? 237 PHE A CE1  2  
ATOM   4883  C  CE2  . PHE A 1 142 ? -8.408  -4.790  8.498   1.00 6.24  ? 237 PHE A CE2  2  
ATOM   4884  C  CZ   . PHE A 1 142 ? -7.668  -4.360  7.385   1.00 6.26  ? 237 PHE A CZ   2  
ATOM   4885  H  H    . PHE A 1 142 ? -7.022  -5.565  12.074  1.00 2.08  ? 237 PHE A H    2  
ATOM   4886  H  HA   . PHE A 1 142 ? -4.569  -4.167  11.338  1.00 1.80  ? 237 PHE A HA   2  
ATOM   4887  H  HB2  . PHE A 1 142 ? -7.340  -3.116  12.026  1.00 2.53  ? 237 PHE A HB2  2  
ATOM   4888  H  HB3  . PHE A 1 142 ? -6.032  -2.172  11.329  1.00 2.42  ? 237 PHE A HB3  2  
ATOM   4889  H  HD1  . PHE A 1 142 ? -5.323  -2.468  8.986   1.00 6.17  ? 237 PHE A HD1  2  
ATOM   4890  H  HD2  . PHE A 1 142 ? -8.607  -4.724  10.643  1.00 5.16  ? 237 PHE A HD2  2  
ATOM   4891  H  HE1  . PHE A 1 142 ? -5.996  -3.171  6.706   1.00 7.63  ? 237 PHE A HE1  2  
ATOM   4892  H  HE2  . PHE A 1 142 ? -9.265  -5.435  8.361   1.00 7.41  ? 237 PHE A HE2  2  
ATOM   4893  H  HZ   . PHE A 1 142 ? -7.956  -4.683  6.397   1.00 6.60  ? 237 PHE A HZ   2  
ATOM   4894  N  N    . THR A 1 143 ? -4.364  -2.501  13.470  1.00 1.75  ? 238 THR A N    2  
ATOM   4895  C  CA   . THR A 1 143 ? -4.173  -1.802  14.755  1.00 2.14  ? 238 THR A CA   2  
ATOM   4896  C  C    . THR A 1 143 ? -4.455  -0.312  14.690  1.00 2.24  ? 238 THR A C    2  
ATOM   4897  O  O    . THR A 1 143 ? -5.025  0.197   15.645  1.00 2.70  ? 238 THR A O    2  
ATOM   4898  C  CB   . THR A 1 143 ? -2.792  -2.072  15.369  1.00 2.46  ? 238 THR A CB   2  
ATOM   4899  O  OG1  . THR A 1 143 ? -2.784  -1.445  16.630  1.00 3.77  ? 238 THR A OG1  2  
ATOM   4900  C  CG2  . THR A 1 143 ? -1.606  -1.545  14.555  1.00 1.79  ? 238 THR A CG2  2  
ATOM   4901  H  H    . THR A 1 143 ? -4.164  -2.011  12.607  1.00 1.70  ? 238 THR A H    2  
ATOM   4902  H  HA   . THR A 1 143 ? -4.905  -2.194  15.464  1.00 2.45  ? 238 THR A HA   2  
ATOM   4903  H  HB   . THR A 1 143 ? -2.666  -3.148  15.501  1.00 3.83  ? 238 THR A HB   2  
ATOM   4904  H  HG1  . THR A 1 143 ? -3.359  -0.666  16.547  1.00 4.35  ? 238 THR A HG1  2  
ATOM   4905  H  HG21 . THR A 1 143 ? -0.680  -1.842  15.044  1.00 2.01  ? 238 THR A HG21 2  
ATOM   4906  H  HG22 . THR A 1 143 ? -1.625  -1.962  13.547  1.00 2.87  ? 238 THR A HG22 2  
ATOM   4907  H  HG23 . THR A 1 143 ? -1.627  -0.457  14.499  1.00 2.31  ? 238 THR A HG23 2  
ATOM   4908  N  N    . ASP A 1 144 ? -4.045  0.384   13.630  1.00 2.07  ? 239 ASP A N    2  
ATOM   4909  C  CA   . ASP A 1 144 ? -4.023  1.850   13.581  1.00 2.08  ? 239 ASP A CA   2  
ATOM   4910  C  C    . ASP A 1 144 ? -3.650  2.357   12.173  1.00 1.82  ? 239 ASP A C    2  
ATOM   4911  O  O    . ASP A 1 144 ? -3.397  1.565   11.255  1.00 1.87  ? 239 ASP A O    2  
ATOM   4912  C  CB   . ASP A 1 144 ? -3.097  2.431   14.684  1.00 2.37  ? 239 ASP A CB   2  
ATOM   4913  C  CG   . ASP A 1 144 ? -3.776  3.575   15.447  1.00 3.29  ? 239 ASP A CG   2  
ATOM   4914  O  OD1  . ASP A 1 144 ? -4.042  4.623   14.818  1.00 3.43  ? 239 ASP A OD1  2  
ATOM   4915  O  OD2  . ASP A 1 144 ? -4.067  3.417   16.658  1.00 4.57  ? 239 ASP A OD2  2  
ATOM   4916  H  H    . ASP A 1 144 ? -3.593  -0.083  12.862  1.00 2.08  ? 239 ASP A H    2  
ATOM   4917  H  HA   . ASP A 1 144 ? -5.037  2.199   13.785  1.00 2.22  ? 239 ASP A HA   2  
ATOM   4918  H  HB2  . ASP A 1 144 ? -2.811  1.659   15.400  1.00 2.51  ? 239 ASP A HB2  2  
ATOM   4919  H  HB3  . ASP A 1 144 ? -2.170  2.794   14.235  1.00 2.18  ? 239 ASP A HB3  2  
ATOM   4920  N  N    . TYR A 1 145 ? -3.629  3.681   12.009  1.00 1.67  ? 240 TYR A N    2  
ATOM   4921  C  CA   . TYR A 1 145 ? -3.476  4.376   10.729  1.00 1.51  ? 240 TYR A CA   2  
ATOM   4922  C  C    . TYR A 1 145 ? -2.469  5.538   10.786  1.00 1.59  ? 240 TYR A C    2  
ATOM   4923  O  O    . TYR A 1 145 ? -2.022  5.958   11.853  1.00 1.84  ? 240 TYR A O    2  
ATOM   4924  C  CB   . TYR A 1 145 ? -4.859  4.860   10.257  1.00 1.49  ? 240 TYR A CB   2  
ATOM   4925  C  CG   . TYR A 1 145 ? -5.496  5.934   11.122  1.00 1.67  ? 240 TYR A CG   2  
ATOM   4926  C  CD1  . TYR A 1 145 ? -6.195  5.569   12.288  1.00 2.77  ? 240 TYR A CD1  2  
ATOM   4927  C  CD2  . TYR A 1 145 ? -5.391  7.295   10.767  1.00 2.13  ? 240 TYR A CD2  2  
ATOM   4928  C  CE1  . TYR A 1 145 ? -6.770  6.553   13.111  1.00 3.12  ? 240 TYR A CE1  2  
ATOM   4929  C  CE2  . TYR A 1 145 ? -5.966  8.286   11.586  1.00 2.60  ? 240 TYR A CE2  2  
ATOM   4930  C  CZ   . TYR A 1 145 ? -6.648  7.919   12.769  1.00 2.65  ? 240 TYR A CZ   2  
ATOM   4931  O  OH   . TYR A 1 145 ? -7.172  8.876   13.585  1.00 3.25  ? 240 TYR A OH   2  
ATOM   4932  H  H    . TYR A 1 145 ? -3.774  4.261   12.835  1.00 1.76  ? 240 TYR A H    2  
ATOM   4933  H  HA   . TYR A 1 145 ? -3.099  3.672   9.988   1.00 1.54  ? 240 TYR A HA   2  
ATOM   4934  H  HB2  . TYR A 1 145 ? -4.774  5.231   9.234   1.00 1.58  ? 240 TYR A HB2  2  
ATOM   4935  H  HB3  . TYR A 1 145 ? -5.529  4.004   10.231  1.00 1.70  ? 240 TYR A HB3  2  
ATOM   4936  H  HD1  . TYR A 1 145 ? -6.272  4.529   12.567  1.00 3.75  ? 240 TYR A HD1  2  
ATOM   4937  H  HD2  . TYR A 1 145 ? -4.859  7.578   9.871   1.00 2.90  ? 240 TYR A HD2  2  
ATOM   4938  H  HE1  . TYR A 1 145 ? -7.289  6.259   14.010  1.00 4.20  ? 240 TYR A HE1  2  
ATOM   4939  H  HE2  . TYR A 1 145 ? -5.875  9.329   11.326  1.00 3.52  ? 240 TYR A HE2  2  
ATOM   4940  H  HH   . TYR A 1 145 ? -7.502  8.494   14.410  1.00 3.74  ? 240 TYR A HH   2  
ATOM   4941  N  N    . TYR A 1 146 ? -2.107  6.070   9.617   1.00 1.52  ? 241 TYR A N    2  
ATOM   4942  C  CA   . TYR A 1 146 ? -1.135  7.154   9.442   1.00 1.69  ? 241 TYR A CA   2  
ATOM   4943  C  C    . TYR A 1 146 ? -1.370  7.942   8.140   1.00 1.87  ? 241 TYR A C    2  
ATOM   4944  O  O    . TYR A 1 146 ? -2.293  7.635   7.387   1.00 2.20  ? 241 TYR A O    2  
ATOM   4945  C  CB   . TYR A 1 146 ? 0.288   6.567   9.508   1.00 2.23  ? 241 TYR A CB   2  
ATOM   4946  C  CG   . TYR A 1 146 ? 1.258   7.378   10.341  1.00 2.17  ? 241 TYR A CG   2  
ATOM   4947  C  CD1  . TYR A 1 146 ? 1.041   7.495   11.728  1.00 3.74  ? 241 TYR A CD1  2  
ATOM   4948  C  CD2  . TYR A 1 146 ? 2.409   7.947   9.762   1.00 2.36  ? 241 TYR A CD2  2  
ATOM   4949  C  CE1  . TYR A 1 146 ? 1.984   8.140   12.545  1.00 4.49  ? 241 TYR A CE1  2  
ATOM   4950  C  CE2  . TYR A 1 146 ? 3.362   8.591   10.575  1.00 3.37  ? 241 TYR A CE2  2  
ATOM   4951  C  CZ   . TYR A 1 146 ? 3.162   8.661   11.975  1.00 4.08  ? 241 TYR A CZ   2  
ATOM   4952  O  OH   . TYR A 1 146 ? 4.143   9.111   12.796  1.00 5.24  ? 241 TYR A OH   2  
ATOM   4953  H  H    . TYR A 1 146 ? -2.484  5.636   8.777   1.00 1.46  ? 241 TYR A H    2  
ATOM   4954  H  HA   . TYR A 1 146 ? -1.264  7.855   10.269  1.00 1.73  ? 241 TYR A HA   2  
ATOM   4955  H  HB2  . TYR A 1 146 ? 0.255   5.571   9.953   1.00 3.18  ? 241 TYR A HB2  2  
ATOM   4956  H  HB3  . TYR A 1 146 ? 0.679   6.437   8.498   1.00 2.73  ? 241 TYR A HB3  2  
ATOM   4957  H  HD1  . TYR A 1 146 ? 0.158   7.064   12.179  1.00 4.83  ? 241 TYR A HD1  2  
ATOM   4958  H  HD2  . TYR A 1 146 ? 2.585   7.855   8.698   1.00 2.94  ? 241 TYR A HD2  2  
ATOM   4959  H  HE1  . TYR A 1 146 ? 1.831   8.201   13.614  1.00 5.86  ? 241 TYR A HE1  2  
ATOM   4960  H  HE2  . TYR A 1 146 ? 4.268   8.985   10.139  1.00 4.32  ? 241 TYR A HE2  2  
ATOM   4961  H  HH   . TYR A 1 146 ? 4.991   9.206   12.338  1.00 5.41  ? 241 TYR A HH   2  
ATOM   4962  N  N    . GLY A 1 147 ? -0.535  8.951   7.862   1.00 2.33  ? 242 GLY A N    2  
ATOM   4963  C  CA   . GLY A 1 147 ? -0.666  9.872   6.721   1.00 2.90  ? 242 GLY A CA   2  
ATOM   4964  C  C    . GLY A 1 147 ? -0.956  11.294  7.195   1.00 2.53  ? 242 GLY A C    2  
ATOM   4965  O  O    . GLY A 1 147 ? -0.442  11.693  8.239   1.00 3.04  ? 242 GLY A O    2  
ATOM   4966  H  H    . GLY A 1 147 ? 0.176   9.171   8.544   1.00 2.56  ? 242 GLY A H    2  
ATOM   4967  H  HA2  . GLY A 1 147 ? 0.275   9.905   6.170   1.00 3.43  ? 242 GLY A HA2  2  
ATOM   4968  H  HA3  . GLY A 1 147 ? -1.457  9.555   6.044   1.00 3.49  ? 242 GLY A HA3  2  
ATOM   4969  N  N    . ARG A 1 148 ? -1.749  12.063  6.435   1.00 2.78  ? 243 ARG A N    2  
ATOM   4970  C  CA   . ARG A 1 148 ? -2.147  13.443  6.790   1.00 2.92  ? 243 ARG A CA   2  
ATOM   4971  C  C    . ARG A 1 148 ? -0.923  14.393  6.825   1.00 2.87  ? 243 ARG A C    2  
ATOM   4972  O  O    . ARG A 1 148 ? -0.755  15.160  7.774   1.00 3.05  ? 243 ARG A O    2  
ATOM   4973  C  CB   . ARG A 1 148 ? -2.961  13.424  8.112   1.00 3.42  ? 243 ARG A CB   2  
ATOM   4974  C  CG   . ARG A 1 148 ? -3.945  14.596  8.309   1.00 4.00  ? 243 ARG A CG   2  
ATOM   4975  C  CD   . ARG A 1 148 ? -4.568  14.500  9.714   1.00 4.85  ? 243 ARG A CD   2  
ATOM   4976  N  NE   . ARG A 1 148 ? -5.719  15.405  9.916   1.00 5.41  ? 243 ARG A NE   2  
ATOM   4977  C  CZ   . ARG A 1 148 ? -6.248  15.747  11.090  1.00 6.14  ? 243 ARG A CZ   2  
ATOM   4978  N  NH1  . ARG A 1 148 ? -5.712  15.398  12.239  1.00 6.57  ? 243 ARG A NH1  2  
ATOM   4979  N  NH2  . ARG A 1 148 ? -7.354  16.452  11.119  1.00 6.96  ? 243 ARG A NH2  2  
ATOM   4980  H  H    . ARG A 1 148 ? -2.156  11.648  5.599   1.00 3.53  ? 243 ARG A H    2  
ATOM   4981  H  HA   . ARG A 1 148 ? -2.806  13.795  5.997   1.00 3.42  ? 243 ARG A HA   2  
ATOM   4982  H  HB2  . ARG A 1 148 ? -3.550  12.506  8.139   1.00 3.96  ? 243 ARG A HB2  2  
ATOM   4983  H  HB3  . ARG A 1 148 ? -2.273  13.394  8.959   1.00 3.67  ? 243 ARG A HB3  2  
ATOM   4984  H  HG2  . ARG A 1 148 ? -3.425  15.549  8.207   1.00 4.03  ? 243 ARG A HG2  2  
ATOM   4985  H  HG3  . ARG A 1 148 ? -4.729  14.533  7.554   1.00 4.57  ? 243 ARG A HG3  2  
ATOM   4986  H  HD2  . ARG A 1 148 ? -4.909  13.477  9.879   1.00 5.47  ? 243 ARG A HD2  2  
ATOM   4987  H  HD3  . ARG A 1 148 ? -3.789  14.724  10.446  1.00 5.16  ? 243 ARG A HD3  2  
ATOM   4988  H  HE   . ARG A 1 148 ? -6.221  15.727  9.095   1.00 5.70  ? 243 ARG A HE   2  
ATOM   4989  H  HH11 . ARG A 1 148 ? -4.871  14.854  12.274  1.00 6.40  ? 243 ARG A HH11 2  
ATOM   4990  H  HH12 . ARG A 1 148 ? -6.100  15.755  13.110  1.00 7.36  ? 243 ARG A HH12 2  
ATOM   4991  H  HH21 . ARG A 1 148 ? -7.798  16.710  10.245  1.00 7.16  ? 243 ARG A HH21 2  
ATOM   4992  H  HH22 . ARG A 1 148 ? -7.814  16.644  12.009  1.00 7.69  ? 243 ARG A HH22 2  
ATOM   4993  N  N    . SER A 1 149 ? -0.037  14.257  5.830   1.00 3.65  ? 244 SER A N    2  
ATOM   4994  C  CA   . SER A 1 149 ? 1.132   15.118  5.534   1.00 4.34  ? 244 SER A CA   2  
ATOM   4995  C  C    . SER A 1 149 ? 2.248   15.023  6.588   1.00 3.76  ? 244 SER A C    2  
ATOM   4996  O  O    . SER A 1 149 ? 2.146   15.627  7.653   1.00 4.01  ? 244 SER A O    2  
ATOM   4997  C  CB   . SER A 1 149 ? 0.708   16.583  5.352   1.00 5.53  ? 244 SER A CB   2  
ATOM   4998  O  OG   . SER A 1 149 ? -0.266  16.693  4.330   1.00 6.74  ? 244 SER A OG   2  
ATOM   4999  H  H    . SER A 1 149 ? -0.285  13.601  5.110   1.00 4.34  ? 244 SER A H    2  
ATOM   5000  H  HA   . SER A 1 149 ? 1.563   14.804  4.583   1.00 4.85  ? 244 SER A HA   2  
ATOM   5001  H  HB2  . SER A 1 149 ? 0.305   16.980  6.284   1.00 5.15  ? 244 SER A HB2  2  
ATOM   5002  H  HB3  . SER A 1 149 ? 1.584   17.172  5.075   1.00 6.37  ? 244 SER A HB3  2  
ATOM   5003  H  HG   . SER A 1 149 ? -0.302  17.639  4.069   1.00 7.11  ? 244 SER A HG   2  
ATOM   5004  N  N    . ARG A 1 150 ? 3.321   14.268  6.318   1.00 3.42  ? 245 ARG A N    2  
ATOM   5005  C  CA   . ARG A 1 150 ? 4.359   13.883  7.273   1.00 2.86  ? 245 ARG A CA   2  
ATOM   5006  C  C    . ARG A 1 150 ? 5.734   14.048  6.609   1.00 2.61  ? 245 ARG A C    2  
ATOM   5007  O  O    . ARG A 1 150 ? 5.919   14.779  5.637   1.00 2.95  ? 245 ARG A O    2  
ATOM   5008  C  CB   . ARG A 1 150 ? 4.103   12.426  7.739   1.00 2.68  ? 245 ARG A CB   2  
ATOM   5009  C  CG   . ARG A 1 150 ? 2.796   12.200  8.515   1.00 3.18  ? 245 ARG A CG   2  
ATOM   5010  C  CD   . ARG A 1 150 ? 2.708   12.987  9.837   1.00 3.71  ? 245 ARG A CD   2  
ATOM   5011  N  NE   . ARG A 1 150 ? 1.618   13.966  9.795   1.00 5.41  ? 245 ARG A NE   2  
ATOM   5012  C  CZ   . ARG A 1 150 ? 1.279   14.857  10.713  1.00 6.45  ? 245 ARG A CZ   2  
ATOM   5013  N  NH1  . ARG A 1 150 ? 1.850   14.945  11.894  1.00 6.25  ? 245 ARG A NH1  2  
ATOM   5014  N  NH2  . ARG A 1 150 ? 0.332   15.718  10.431  1.00 8.17  ? 245 ARG A NH2  2  
ATOM   5015  H  H    . ARG A 1 150 ? 3.469   13.925  5.373   1.00 3.84  ? 245 ARG A H    2  
ATOM   5016  H  HA   . ARG A 1 150 ? 4.335   14.544  8.138   1.00 3.08  ? 245 ARG A HA   2  
ATOM   5017  H  HB2  . ARG A 1 150 ? 4.099   11.773  6.863   1.00 3.42  ? 245 ARG A HB2  2  
ATOM   5018  H  HB3  . ARG A 1 150 ? 4.911   12.097  8.390   1.00 2.48  ? 245 ARG A HB3  2  
ATOM   5019  H  HG2  . ARG A 1 150 ? 1.958   12.450  7.867   1.00 4.09  ? 245 ARG A HG2  2  
ATOM   5020  H  HG3  . ARG A 1 150 ? 2.722   11.137  8.748   1.00 3.32  ? 245 ARG A HG3  2  
ATOM   5021  H  HD2  . ARG A 1 150 ? 2.537   12.287  10.654  1.00 3.84  ? 245 ARG A HD2  2  
ATOM   5022  H  HD3  . ARG A 1 150 ? 3.648   13.506  10.024  1.00 3.70  ? 245 ARG A HD3  2  
ATOM   5023  H  HE   . ARG A 1 150 ? 1.188   14.114  8.891   1.00 6.23  ? 245 ARG A HE   2  
ATOM   5024  H  HH11 . ARG A 1 150 ? 2.679   14.403  12.117  1.00 5.37  ? 245 ARG A HH11 2  
ATOM   5025  H  HH12 . ARG A 1 150 ? 1.519   15.666  12.526  1.00 7.36  ? 245 ARG A HH12 2  
ATOM   5026  H  HH21 . ARG A 1 150 ? -0.051  15.746  9.490   1.00 8.80  ? 245 ARG A HH21 2  
ATOM   5027  H  HH22 . ARG A 1 150 ? 0.102   16.423  11.120  1.00 9.08  ? 245 ARG A HH22 2  
ATOM   5028  N  N    . SER A 1 151 ? 6.741   13.358  7.124   1.00 2.20  ? 246 SER A N    2  
ATOM   5029  C  CA   . SER A 1 151 ? 8.130   13.466  6.715   1.00 1.91  ? 246 SER A CA   2  
ATOM   5030  C  C    . SER A 1 151 ? 8.768   12.101  6.973   1.00 1.74  ? 246 SER A C    2  
ATOM   5031  O  O    . SER A 1 151 ? 8.306   11.374  7.858   1.00 1.75  ? 246 SER A O    2  
ATOM   5032  C  CB   . SER A 1 151 ? 8.760   14.605  7.524   1.00 1.72  ? 246 SER A CB   2  
ATOM   5033  O  OG   . SER A 1 151 ? 10.100  14.337  7.916   1.00 2.11  ? 246 SER A OG   2  
ATOM   5034  H  H    . SER A 1 151 ? 6.579   12.701  7.873   1.00 2.26  ? 246 SER A H    2  
ATOM   5035  H  HA   . SER A 1 151 ? 8.215   13.708  5.656   1.00 2.18  ? 246 SER A HA   2  
ATOM   5036  H  HB2  . SER A 1 151 ? 8.675   15.516  6.930   1.00 2.15  ? 246 SER A HB2  2  
ATOM   5037  H  HB3  . SER A 1 151 ? 8.157   14.751  8.421   1.00 1.75  ? 246 SER A HB3  2  
ATOM   5038  H  HG   . SER A 1 151 ? 10.729  14.791  7.308   1.00 2.52  ? 246 SER A HG   2  
ATOM   5039  N  N    . ALA A 1 152 ? 9.816   11.748  6.224   1.00 1.70  ? 247 ALA A N    2  
ATOM   5040  C  CA   . ALA A 1 152 ? 10.559  10.494  6.381   1.00 1.60  ? 247 ALA A CA   2  
ATOM   5041  C  C    . ALA A 1 152 ? 10.877  10.177  7.857   1.00 1.49  ? 247 ALA A C    2  
ATOM   5042  O  O    . ALA A 1 152 ? 10.729  9.040   8.306   1.00 1.45  ? 247 ALA A O    2  
ATOM   5043  C  CB   . ALA A 1 152 ? 11.835  10.614  5.538   1.00 1.63  ? 247 ALA A CB   2  
ATOM   5044  H  H    . ALA A 1 152 ? 10.113  12.387  5.490   1.00 1.80  ? 247 ALA A H    2  
ATOM   5045  H  HA   . ALA A 1 152 ? 9.953   9.674   5.996   1.00 1.69  ? 247 ALA A HA   2  
ATOM   5046  H  HB1  . ALA A 1 152 ? 12.438  9.712   5.645   1.00 1.93  ? 247 ALA A HB1  2  
ATOM   5047  H  HB2  . ALA A 1 152 ? 11.579  10.746  4.485   1.00 2.24  ? 247 ALA A HB2  2  
ATOM   5048  H  HB3  . ALA A 1 152 ? 12.431  11.467  5.870   1.00 2.14  ? 247 ALA A HB3  2  
ATOM   5049  N  N    . GLU A 1 153 ? 11.214  11.208  8.632   1.00 1.51  ? 248 GLU A N    2  
ATOM   5050  C  CA   . GLU A 1 153 ? 11.541  11.094  10.050  1.00 1.54  ? 248 GLU A CA   2  
ATOM   5051  C  C    . GLU A 1 153 ? 10.325  10.738  10.922  1.00 1.57  ? 248 GLU A C    2  
ATOM   5052  O  O    . GLU A 1 153 ? 10.450  9.980   11.885  1.00 1.53  ? 248 GLU A O    2  
ATOM   5053  C  CB   . GLU A 1 153 ? 12.227  12.404  10.487  1.00 1.74  ? 248 GLU A CB   2  
ATOM   5054  C  CG   . GLU A 1 153 ? 13.433  12.185  11.410  1.00 1.98  ? 248 GLU A CG   2  
ATOM   5055  C  CD   . GLU A 1 153 ? 14.453  13.303  11.205  1.00 2.93  ? 248 GLU A CD   2  
ATOM   5056  O  OE1  . GLU A 1 153 ? 14.313  14.369  11.845  1.00 3.28  ? 248 GLU A OE1  2  
ATOM   5057  O  OE2  . GLU A 1 153 ? 15.366  13.119  10.358  1.00 4.11  ? 248 GLU A OE2  2  
ATOM   5058  H  H    . GLU A 1 153 ? 11.261  12.124  8.206   1.00 1.55  ? 248 GLU A H    2  
ATOM   5059  H  HA   . GLU A 1 153 ? 12.241  10.270  10.133  1.00 1.51  ? 248 GLU A HA   2  
ATOM   5060  H  HB2  . GLU A 1 153 ? 12.586  12.922  9.596   1.00 2.36  ? 248 GLU A HB2  2  
ATOM   5061  H  HB3  . GLU A 1 153 ? 11.506  13.065  10.970  1.00 2.08  ? 248 GLU A HB3  2  
ATOM   5062  H  HG2  . GLU A 1 153 ? 13.100  12.157  12.449  1.00 2.13  ? 248 GLU A HG2  2  
ATOM   5063  H  HG3  . GLU A 1 153 ? 13.914  11.234  11.177  1.00 2.40  ? 248 GLU A HG3  2  
ATOM   5064  N  N    . GLN A 1 154 ? 9.133   11.229  10.575  1.00 1.76  ? 249 GLN A N    2  
ATOM   5065  C  CA   . GLN A 1 154 ? 7.880   10.819  11.207  1.00 1.95  ? 249 GLN A CA   2  
ATOM   5066  C  C    . GLN A 1 154 ? 7.362   9.438   10.745  1.00 1.89  ? 249 GLN A C    2  
ATOM   5067  O  O    . GLN A 1 154 ? 6.545   8.832   11.436  1.00 2.05  ? 249 GLN A O    2  
ATOM   5068  C  CB   . GLN A 1 154 ? 6.857   11.957  11.076  1.00 2.22  ? 249 GLN A CB   2  
ATOM   5069  C  CG   . GLN A 1 154 ? 5.667   11.763  12.030  1.00 2.95  ? 249 GLN A CG   2  
ATOM   5070  C  CD   . GLN A 1 154 ? 5.311   13.018  12.812  1.00 3.23  ? 249 GLN A CD   2  
ATOM   5071  O  OE1  . GLN A 1 154 ? 4.371   13.728  12.481  1.00 4.07  ? 249 GLN A OE1  2  
ATOM   5072  N  NE2  . GLN A 1 154 ? 6.047   13.325  13.859  1.00 3.42  ? 249 GLN A NE2  2  
ATOM   5073  H  H    . GLN A 1 154 ? 9.065   11.775  9.725   1.00 1.88  ? 249 GLN A H    2  
ATOM   5074  H  HA   . GLN A 1 154 ? 8.093   10.708  12.269  1.00 1.96  ? 249 GLN A HA   2  
ATOM   5075  H  HB2  . GLN A 1 154 ? 7.356   12.897  11.323  1.00 1.97  ? 249 GLN A HB2  2  
ATOM   5076  H  HB3  . GLN A 1 154 ? 6.504   12.022  10.048  1.00 3.16  ? 249 GLN A HB3  2  
ATOM   5077  H  HG2  . GLN A 1 154 ? 4.798   11.430  11.462  1.00 4.26  ? 249 GLN A HG2  2  
ATOM   5078  H  HG3  . GLN A 1 154 ? 5.907   11.004  12.770  1.00 3.20  ? 249 GLN A HG3  2  
ATOM   5079  H  HE21 . GLN A 1 154 ? 6.804   12.705  14.159  1.00 3.44  ? 249 GLN A HE21 2  
ATOM   5080  H  HE22 . GLN A 1 154 ? 5.802   14.147  14.380  1.00 4.07  ? 249 GLN A HE22 2  
ATOM   5081  N  N    . ILE A 1 155 ? 7.833   8.885   9.619   1.00 1.75  ? 250 ILE A N    2  
ATOM   5082  C  CA   . ILE A 1 155 ? 7.593   7.460   9.292   1.00 1.66  ? 250 ILE A CA   2  
ATOM   5083  C  C    . ILE A 1 155 ? 8.356   6.558   10.275  1.00 1.34  ? 250 ILE A C    2  
ATOM   5084  O  O    . ILE A 1 155 ? 7.809   5.560   10.746  1.00 1.42  ? 250 ILE A O    2  
ATOM   5085  C  CB   . ILE A 1 155 ? 7.946   7.138   7.818   1.00 1.78  ? 250 ILE A CB   2  
ATOM   5086  C  CG1  . ILE A 1 155 ? 7.323   8.104   6.780   1.00 2.31  ? 250 ILE A CG1  2  
ATOM   5087  C  CG2  . ILE A 1 155 ? 7.550   5.689   7.471   1.00 1.71  ? 250 ILE A CG2  2  
ATOM   5088  C  CD1  . ILE A 1 155 ? 5.796   8.241   6.824   1.00 1.28  ? 250 ILE A CD1  2  
ATOM   5089  H  H    . ILE A 1 155 ? 8.452   9.434   9.030   1.00 1.74  ? 250 ILE A H    2  
ATOM   5090  H  HA   . ILE A 1 155 ? 6.540   7.223   9.445   1.00 1.84  ? 250 ILE A HA   2  
ATOM   5091  H  HB   . ILE A 1 155 ? 9.026   7.216   7.709   1.00 1.71  ? 250 ILE A HB   2  
ATOM   5092  H  HG12 . ILE A 1 155 ? 7.755   9.092   6.917   1.00 3.20  ? 250 ILE A HG12 2  
ATOM   5093  H  HG13 . ILE A 1 155 ? 7.609   7.776   5.780   1.00 3.50  ? 250 ILE A HG13 2  
ATOM   5094  H  HG21 . ILE A 1 155 ? 8.126   4.986   8.074   1.00 2.10  ? 250 ILE A HG21 2  
ATOM   5095  H  HG22 . ILE A 1 155 ? 6.489   5.526   7.663   1.00 1.66  ? 250 ILE A HG22 2  
ATOM   5096  H  HG23 . ILE A 1 155 ? 7.760   5.485   6.422   1.00 2.57  ? 250 ILE A HG23 2  
ATOM   5097  H  HD11 . ILE A 1 155 ? 5.476   8.617   7.796   1.00 1.64  ? 250 ILE A HD11 2  
ATOM   5098  H  HD12 . ILE A 1 155 ? 5.479   8.949   6.056   1.00 1.95  ? 250 ILE A HD12 2  
ATOM   5099  H  HD13 . ILE A 1 155 ? 5.322   7.281   6.627   1.00 2.08  ? 250 ILE A HD13 2  
ATOM   5100  N  N    . SER A 1 156 ? 9.572   6.952   10.660  1.00 1.10  ? 251 SER A N    2  
ATOM   5101  C  CA   . SER A 1 156 ? 10.316  6.323   11.764  1.00 1.12  ? 251 SER A CA   2  
ATOM   5102  C  C    . SER A 1 156 ? 9.543   6.395   13.097  1.00 1.43  ? 251 SER A C    2  
ATOM   5103  O  O    . SER A 1 156 ? 9.444   5.370   13.774  1.00 1.55  ? 251 SER A O    2  
ATOM   5104  C  CB   . SER A 1 156 ? 11.741  6.917   11.833  1.00 1.37  ? 251 SER A CB   2  
ATOM   5105  O  OG   . SER A 1 156 ? 12.370  6.804   13.102  1.00 2.77  ? 251 SER A OG   2  
ATOM   5106  H  H    . SER A 1 156 ? 9.951   7.789   10.233  1.00 1.11  ? 251 SER A H    2  
ATOM   5107  H  HA   . SER A 1 156 ? 10.424  5.260   11.549  1.00 1.14  ? 251 SER A HA   2  
ATOM   5108  H  HB2  . SER A 1 156 ? 12.357  6.408   11.090  1.00 1.40  ? 251 SER A HB2  2  
ATOM   5109  H  HB3  . SER A 1 156 ? 11.715  7.974   11.564  1.00 2.31  ? 251 SER A HB3  2  
ATOM   5110  H  HG   . SER A 1 156 ? 12.068  7.568   13.645  1.00 3.67  ? 251 SER A HG   2  
ATOM   5111  N  N    . ASP A 1 157 ? 8.907   7.533   13.433  1.00 1.78  ? 252 ASP A N    2  
ATOM   5112  C  CA   . ASP A 1 157 ? 8.047   7.641   14.630  1.00 2.32  ? 252 ASP A CA   2  
ATOM   5113  C  C    . ASP A 1 157 ? 6.884   6.638   14.584  1.00 2.17  ? 252 ASP A C    2  
ATOM   5114  O  O    . ASP A 1 157 ? 6.490   6.101   15.616  1.00 2.40  ? 252 ASP A O    2  
ATOM   5115  C  CB   . ASP A 1 157 ? 7.418   9.041   14.784  1.00 3.06  ? 252 ASP A CB   2  
ATOM   5116  C  CG   . ASP A 1 157 ? 8.377   10.202  15.037  1.00 3.85  ? 252 ASP A CG   2  
ATOM   5117  O  OD1  . ASP A 1 157 ? 9.422   9.984   15.697  1.00 3.67  ? 252 ASP A OD1  2  
ATOM   5118  O  OD2  . ASP A 1 157 ? 8.035   11.324  14.602  1.00 5.29  ? 252 ASP A OD2  2  
ATOM   5119  H  H    . ASP A 1 157 ? 9.029   8.346   12.844  1.00 1.76  ? 252 ASP A H    2  
ATOM   5120  H  HA   . ASP A 1 157 ? 8.643   7.423   15.517  1.00 2.55  ? 252 ASP A HA   2  
ATOM   5121  H  HB2  . ASP A 1 157 ? 6.825   9.258   13.900  1.00 4.12  ? 252 ASP A HB2  2  
ATOM   5122  H  HB3  . ASP A 1 157 ? 6.727   9.010   15.628  1.00 2.75  ? 252 ASP A HB3  2  
ATOM   5123  N  N    . SER A 1 158 ? 6.324   6.392   13.397  1.00 2.03  ? 253 SER A N    2  
ATOM   5124  C  CA   . SER A 1 158 ? 5.266   5.398   13.196  1.00 2.20  ? 253 SER A CA   2  
ATOM   5125  C  C    . SER A 1 158 ? 5.801   3.968   13.314  1.00 1.71  ? 253 SER A C    2  
ATOM   5126  O  O    . SER A 1 158 ? 5.398   3.215   14.200  1.00 1.65  ? 253 SER A O    2  
ATOM   5127  C  CB   . SER A 1 158 ? 4.593   5.600   11.831  1.00 2.65  ? 253 SER A CB   2  
ATOM   5128  O  OG   . SER A 1 158 ? 3.223   5.239   11.884  1.00 3.03  ? 253 SER A OG   2  
ATOM   5129  H  H    . SER A 1 158 ? 6.692   6.902   12.600  1.00 1.96  ? 253 SER A H    2  
ATOM   5130  H  HA   . SER A 1 158 ? 4.513   5.527   13.972  1.00 2.58  ? 253 SER A HA   2  
ATOM   5131  H  HB2  . SER A 1 158 ? 4.685   6.642   11.541  1.00 2.89  ? 253 SER A HB2  2  
ATOM   5132  H  HB3  . SER A 1 158 ? 5.092   5.011   11.061  1.00 3.33  ? 253 SER A HB3  2  
ATOM   5133  H  HG   . SER A 1 158 ? 2.694   6.050   11.831  1.00 3.25  ? 253 SER A HG   2  
ATOM   5134  N  N    . VAL A 1 159 ? 6.718   3.573   12.428  1.00 1.51  ? 254 VAL A N    2  
ATOM   5135  C  CA   . VAL A 1 159 ? 7.080   2.158   12.267  1.00 1.37  ? 254 VAL A CA   2  
ATOM   5136  C  C    . VAL A 1 159 ? 7.886   1.640   13.468  1.00 1.35  ? 254 VAL A C    2  
ATOM   5137  O  O    . VAL A 1 159 ? 7.802   0.453   13.776  1.00 1.51  ? 254 VAL A O    2  
ATOM   5138  C  CB   . VAL A 1 159 ? 7.759   1.883   10.907  1.00 1.41  ? 254 VAL A CB   2  
ATOM   5139  C  CG1  . VAL A 1 159 ? 8.054   0.385   10.725  1.00 1.45  ? 254 VAL A CG1  2  
ATOM   5140  C  CG2  . VAL A 1 159 ? 6.837   2.311   9.747   1.00 1.53  ? 254 VAL A CG2  2  
ATOM   5141  H  H    . VAL A 1 159 ? 7.111   4.273   11.788  1.00 1.54  ? 254 VAL A H    2  
ATOM   5142  H  HA   . VAL A 1 159 ? 6.142   1.597   12.257  1.00 1.35  ? 254 VAL A HA   2  
ATOM   5143  H  HB   . VAL A 1 159 ? 8.692   2.446   10.851  1.00 1.52  ? 254 VAL A HB   2  
ATOM   5144  H  HG11 . VAL A 1 159 ? 8.862   0.077   11.386  1.00 1.72  ? 254 VAL A HG11 2  
ATOM   5145  H  HG12 . VAL A 1 159 ? 7.158   -0.200  10.944  1.00 2.15  ? 254 VAL A HG12 2  
ATOM   5146  H  HG13 . VAL A 1 159 ? 8.358   0.188   9.698   1.00 2.40  ? 254 VAL A HG13 2  
ATOM   5147  H  HG21 . VAL A 1 159 ? 6.624   3.378   9.793   1.00 1.88  ? 254 VAL A HG21 2  
ATOM   5148  H  HG22 . VAL A 1 159 ? 7.322   2.106   8.791   1.00 2.42  ? 254 VAL A HG22 2  
ATOM   5149  H  HG23 . VAL A 1 159 ? 5.896   1.761   9.796   1.00 1.79  ? 254 VAL A HG23 2  
ATOM   5150  N  N    . ARG A 1 160 ? 8.576   2.506   14.231  1.00 1.30  ? 255 ARG A N    2  
ATOM   5151  C  CA   . ARG A 1 160 ? 9.185   2.102   15.507  1.00 1.37  ? 255 ARG A CA   2  
ATOM   5152  C  C    . ARG A 1 160 ? 8.128   1.727   16.563  1.00 1.44  ? 255 ARG A C    2  
ATOM   5153  O  O    . ARG A 1 160 ? 8.365   0.793   17.333  1.00 1.46  ? 255 ARG A O    2  
ATOM   5154  C  CB   . ARG A 1 160 ? 10.141  3.201   16.003  1.00 1.54  ? 255 ARG A CB   2  
ATOM   5155  C  CG   . ARG A 1 160 ? 11.030  2.791   17.194  1.00 1.99  ? 255 ARG A CG   2  
ATOM   5156  C  CD   . ARG A 1 160 ? 11.853  1.517   16.928  1.00 2.50  ? 255 ARG A CD   2  
ATOM   5157  N  NE   . ARG A 1 160 ? 12.960  1.357   17.889  1.00 2.97  ? 255 ARG A NE   2  
ATOM   5158  C  CZ   . ARG A 1 160 ? 14.185  1.856   17.777  1.00 3.22  ? 255 ARG A CZ   2  
ATOM   5159  N  NH1  . ARG A 1 160 ? 14.530  2.676   16.808  1.00 3.54  ? 255 ARG A NH1  2  
ATOM   5160  N  NH2  . ARG A 1 160 ? 15.084  1.519   18.670  1.00 4.07  ? 255 ARG A NH2  2  
ATOM   5161  H  H    . ARG A 1 160 ? 8.626   3.485   13.957  1.00 1.31  ? 255 ARG A H    2  
ATOM   5162  H  HA   . ARG A 1 160 ? 9.776   1.209   15.303  1.00 1.42  ? 255 ARG A HA   2  
ATOM   5163  H  HB2  . ARG A 1 160 ? 10.801  3.483   15.180  1.00 1.67  ? 255 ARG A HB2  2  
ATOM   5164  H  HB3  . ARG A 1 160 ? 9.562   4.083   16.283  1.00 2.33  ? 255 ARG A HB3  2  
ATOM   5165  H  HG2  . ARG A 1 160 ? 11.710  3.618   17.399  1.00 2.95  ? 255 ARG A HG2  2  
ATOM   5166  H  HG3  . ARG A 1 160 ? 10.412  2.637   18.080  1.00 3.30  ? 255 ARG A HG3  2  
ATOM   5167  H  HD2  . ARG A 1 160 ? 11.197  0.648   16.999  1.00 3.77  ? 255 ARG A HD2  2  
ATOM   5168  H  HD3  . ARG A 1 160 ? 12.255  1.549   15.915  1.00 3.17  ? 255 ARG A HD3  2  
ATOM   5169  H  HE   . ARG A 1 160 ? 12.797  0.778   18.708  1.00 3.82  ? 255 ARG A HE   2  
ATOM   5170  H  HH11 . ARG A 1 160 ? 13.855  2.978   16.131  1.00 3.53  ? 255 ARG A HH11 2  
ATOM   5171  H  HH12 . ARG A 1 160 ? 15.448  3.115   16.831  1.00 4.30  ? 255 ARG A HH12 2  
ATOM   5172  H  HH21 . ARG A 1 160 ? 14.801  0.920   19.440  1.00 4.68  ? 255 ARG A HH21 2  
ATOM   5173  H  HH22 . ARG A 1 160 ? 16.050  1.810   18.605  1.00 4.55  ? 255 ARG A HH22 2  
ATOM   5174  N  N    . ARG A 1 161 ? 6.944   2.361   16.556  1.00 1.68  ? 256 ARG A N    2  
ATOM   5175  C  CA   . ARG A 1 161 ? 5.798   1.945   17.384  1.00 2.00  ? 256 ARG A CA   2  
ATOM   5176  C  C    . ARG A 1 161 ? 5.277   0.584   16.905  1.00 2.11  ? 256 ARG A C    2  
ATOM   5177  O  O    . ARG A 1 161 ? 5.229   -0.362  17.686  1.00 2.28  ? 256 ARG A O    2  
ATOM   5178  C  CB   . ARG A 1 161 ? 4.676   2.994   17.387  1.00 2.37  ? 256 ARG A CB   2  
ATOM   5179  C  CG   . ARG A 1 161 ? 5.120   4.342   17.978  1.00 2.62  ? 256 ARG A CG   2  
ATOM   5180  C  CD   . ARG A 1 161 ? 4.101   5.430   17.622  1.00 3.99  ? 256 ARG A CD   2  
ATOM   5181  N  NE   . ARG A 1 161 ? 4.648   6.786   17.822  1.00 4.55  ? 256 ARG A NE   2  
ATOM   5182  C  CZ   . ARG A 1 161 ? 4.007   7.863   18.267  1.00 5.33  ? 256 ARG A CZ   2  
ATOM   5183  N  NH1  . ARG A 1 161 ? 2.730   7.843   18.592  1.00 5.75  ? 256 ARG A NH1  2  
ATOM   5184  N  NH2  . ARG A 1 161 ? 4.633   9.011   18.397  1.00 6.03  ? 256 ARG A NH2  2  
ATOM   5185  H  H    . ARG A 1 161 ? 6.784   3.076   15.853  1.00 1.80  ? 256 ARG A H    2  
ATOM   5186  H  HA   . ARG A 1 161 ? 6.128   1.846   18.416  1.00 2.07  ? 256 ARG A HA   2  
ATOM   5187  H  HB2  . ARG A 1 161 ? 4.308   3.136   16.373  1.00 2.83  ? 256 ARG A HB2  2  
ATOM   5188  H  HB3  . ARG A 1 161 ? 3.843   2.616   17.983  1.00 2.42  ? 256 ARG A HB3  2  
ATOM   5189  H  HG2  . ARG A 1 161 ? 5.209   4.260   19.063  1.00 2.64  ? 256 ARG A HG2  2  
ATOM   5190  H  HG3  . ARG A 1 161 ? 6.094   4.617   17.579  1.00 2.77  ? 256 ARG A HG3  2  
ATOM   5191  H  HD2  . ARG A 1 161 ? 3.853   5.313   16.568  1.00 4.75  ? 256 ARG A HD2  2  
ATOM   5192  H  HD3  . ARG A 1 161 ? 3.202   5.271   18.217  1.00 4.49  ? 256 ARG A HD3  2  
ATOM   5193  H  HE   . ARG A 1 161 ? 5.594   6.918   17.483  1.00 4.70  ? 256 ARG A HE   2  
ATOM   5194  H  HH11 . ARG A 1 161 ? 2.175   7.015   18.480  1.00 5.58  ? 256 ARG A HH11 2  
ATOM   5195  H  HH12 . ARG A 1 161 ? 2.269   8.689   18.898  1.00 6.49  ? 256 ARG A HH12 2  
ATOM   5196  H  HH21 . ARG A 1 161 ? 5.613   9.141   18.175  1.00 6.06  ? 256 ARG A HH21 2  
ATOM   5197  H  HH22 . ARG A 1 161 ? 4.129   9.808   18.777  1.00 6.67  ? 256 ARG A HH22 2  
ATOM   5198  N  N    . HIS A 1 162 ? 4.983   0.436   15.610  1.00 2.14  ? 257 HIS A N    2  
ATOM   5199  C  CA   . HIS A 1 162 ? 4.454   -0.816  15.032  1.00 2.45  ? 257 HIS A CA   2  
ATOM   5200  C  C    . HIS A 1 162 ? 5.417   -2.020  15.183  1.00 2.41  ? 257 HIS A C    2  
ATOM   5201  O  O    . HIS A 1 162 ? 4.988   -3.165  15.332  1.00 2.83  ? 257 HIS A O    2  
ATOM   5202  C  CB   . HIS A 1 162 ? 4.084   -0.559  13.562  1.00 2.60  ? 257 HIS A CB   2  
ATOM   5203  C  CG   . HIS A 1 162 ? 3.098   0.569   13.382  1.00 2.82  ? 257 HIS A CG   2  
ATOM   5204  N  ND1  . HIS A 1 162 ? 1.908   0.722   14.095  1.00 3.21  ? 257 HIS A ND1  2  
ATOM   5205  C  CD2  . HIS A 1 162 ? 3.253   1.635   12.547  1.00 3.16  ? 257 HIS A CD2  2  
ATOM   5206  C  CE1  . HIS A 1 162 ? 1.384   1.887   13.680  1.00 3.49  ? 257 HIS A CE1  2  
ATOM   5207  N  NE2  . HIS A 1 162 ? 2.177   2.464   12.760  1.00 3.50  ? 257 HIS A NE2  2  
ATOM   5208  H  H    . HIS A 1 162 ? 5.020   1.260   15.015  1.00 2.02  ? 257 HIS A H    2  
ATOM   5209  H  HA   . HIS A 1 162 ? 3.537   -1.075  15.565  1.00 2.74  ? 257 HIS A HA   2  
ATOM   5210  H  HB2  . HIS A 1 162 ? 4.988   -0.336  12.995  1.00 2.69  ? 257 HIS A HB2  2  
ATOM   5211  H  HB3  . HIS A 1 162 ? 3.639   -1.464  13.146  1.00 2.75  ? 257 HIS A HB3  2  
ATOM   5212  H  HD2  . HIS A 1 162 ? 4.079   1.819   11.881  1.00 3.48  ? 257 HIS A HD2  2  
ATOM   5213  H  HE1  . HIS A 1 162 ? 0.457   2.308   14.048  1.00 3.94  ? 257 HIS A HE1  2  
ATOM   5214  H  HE2  . HIS A 1 162 ? 2.035   3.374   12.334  1.00 3.97  ? 257 HIS A HE2  2  
ATOM   5215  N  N    . MET A 1 163 ? 6.728   -1.757  15.214  1.00 1.99  ? 258 MET A N    2  
ATOM   5216  C  CA   . MET A 1 163 ? 7.786   -2.708  15.580  1.00 1.99  ? 258 MET A CA   2  
ATOM   5217  C  C    . MET A 1 163 ? 7.659   -3.163  17.039  1.00 1.92  ? 258 MET A C    2  
ATOM   5218  O  O    . MET A 1 163 ? 7.480   -4.354  17.287  1.00 2.07  ? 258 MET A O    2  
ATOM   5219  C  CB   . MET A 1 163 ? 9.145   -2.046  15.295  1.00 1.89  ? 258 MET A CB   2  
ATOM   5220  C  CG   . MET A 1 163 ? 10.336  -2.818  15.864  1.00 2.12  ? 258 MET A CG   2  
ATOM   5221  S  SD   . MET A 1 163 ? 11.921  -2.089  15.383  1.00 2.71  ? 258 MET A SD   2  
ATOM   5222  C  CE   . MET A 1 163 ? 13.050  -3.306  16.106  1.00 3.77  ? 258 MET A CE   2  
ATOM   5223  H  H    . MET A 1 163 ? 7.002   -0.809  14.990  1.00 1.74  ? 258 MET A H    2  
ATOM   5224  H  HA   . MET A 1 163 ? 7.699   -3.600  14.960  1.00 2.37  ? 258 MET A HA   2  
ATOM   5225  H  HB2  . MET A 1 163 ? 9.268   -1.953  14.214  1.00 2.25  ? 258 MET A HB2  2  
ATOM   5226  H  HB3  . MET A 1 163 ? 9.164   -1.044  15.721  1.00 1.91  ? 258 MET A HB3  2  
ATOM   5227  H  HG2  . MET A 1 163 ? 10.285  -2.819  16.954  1.00 2.16  ? 258 MET A HG2  2  
ATOM   5228  H  HG3  . MET A 1 163 ? 10.272  -3.851  15.527  1.00 2.48  ? 258 MET A HG3  2  
ATOM   5229  H  HE1  . MET A 1 163 ? 12.694  -3.619  17.088  1.00 4.18  ? 258 MET A HE1  2  
ATOM   5230  H  HE2  . MET A 1 163 ? 13.129  -4.177  15.454  1.00 4.05  ? 258 MET A HE2  2  
ATOM   5231  H  HE3  . MET A 1 163 ? 14.043  -2.867  16.215  1.00 4.80  ? 258 MET A HE3  2  
ATOM   5232  N  N    . ALA A 1 164 ? 7.732   -2.231  17.996  1.00 1.84  ? 259 ALA A N    2  
ATOM   5233  C  CA   . ALA A 1 164 ? 7.694   -2.533  19.430  1.00 1.95  ? 259 ALA A CA   2  
ATOM   5234  C  C    . ALA A 1 164 ? 6.344   -3.110  19.899  1.00 2.20  ? 259 ALA A C    2  
ATOM   5235  O  O    . ALA A 1 164 ? 6.302   -3.849  20.879  1.00 2.43  ? 259 ALA A O    2  
ATOM   5236  C  CB   . ALA A 1 164 ? 8.048   -1.245  20.184  1.00 1.96  ? 259 ALA A CB   2  
ATOM   5237  H  H    . ALA A 1 164 ? 7.851   -1.261  17.724  1.00 1.77  ? 259 ALA A H    2  
ATOM   5238  H  HA   . ALA A 1 164 ? 8.449   -3.289  19.656  1.00 1.96  ? 259 ALA A HA   2  
ATOM   5239  H  HB1  . ALA A 1 164 ? 7.304   -0.474  19.977  1.00 2.57  ? 259 ALA A HB1  2  
ATOM   5240  H  HB2  . ALA A 1 164 ? 8.065   -1.446  21.257  1.00 2.09  ? 259 ALA A HB2  2  
ATOM   5241  H  HB3  . ALA A 1 164 ? 9.032   -0.891  19.876  1.00 2.48  ? 259 ALA A HB3  2  
ATOM   5242  N  N    . ALA A 1 165 ? 5.258   -2.800  19.186  1.00 2.27  ? 260 ALA A N    2  
ATOM   5243  C  CA   . ALA A 1 165 ? 3.915   -3.325  19.451  1.00 2.62  ? 260 ALA A CA   2  
ATOM   5244  C  C    . ALA A 1 165 ? 3.737   -4.774  18.963  1.00 2.60  ? 260 ALA A C    2  
ATOM   5245  O  O    . ALA A 1 165 ? 3.018   -5.550  19.589  1.00 2.83  ? 260 ALA A O    2  
ATOM   5246  C  CB   . ALA A 1 165 ? 2.897   -2.385  18.790  1.00 3.02  ? 260 ALA A CB   2  
ATOM   5247  H  H    . ALA A 1 165 ? 5.377   -2.135  18.431  1.00 2.13  ? 260 ALA A H    2  
ATOM   5248  H  HA   . ALA A 1 165 ? 3.739   -3.330  20.529  1.00 2.77  ? 260 ALA A HA   2  
ATOM   5249  H  HB1  . ALA A 1 165 ? 3.013   -1.375  19.185  1.00 3.11  ? 260 ALA A HB1  2  
ATOM   5250  H  HB2  . ALA A 1 165 ? 3.044   -2.369  17.709  1.00 3.73  ? 260 ALA A HB2  2  
ATOM   5251  H  HB3  . ALA A 1 165 ? 1.886   -2.733  19.005  1.00 3.28  ? 260 ALA A HB3  2  
ATOM   5252  N  N    . PHE A 1 166 ? 4.404   -5.149  17.865  1.00 2.54  ? 261 PHE A N    2  
ATOM   5253  C  CA   . PHE A 1 166 ? 4.434   -6.525  17.368  1.00 2.65  ? 261 PHE A CA   2  
ATOM   5254  C  C    . PHE A 1 166 ? 5.346   -7.404  18.239  1.00 5.40  ? 261 PHE A C    2  
ATOM   5255  O  O    . PHE A 1 166 ? 4.948   -8.499  18.638  1.00 4.15  ? 261 PHE A O    2  
ATOM   5256  C  CB   . PHE A 1 166 ? 4.872   -6.489  15.894  1.00 2.62  ? 261 PHE A CB   2  
ATOM   5257  C  CG   . PHE A 1 166 ? 5.116   -7.834  15.232  1.00 2.99  ? 261 PHE A CG   2  
ATOM   5258  C  CD1  . PHE A 1 166 ? 4.199   -8.893  15.383  1.00 3.42  ? 261 PHE A CD1  2  
ATOM   5259  C  CD2  . PHE A 1 166 ? 6.264   -8.018  14.434  1.00 4.07  ? 261 PHE A CD2  2  
ATOM   5260  C  CE1  . PHE A 1 166 ? 4.433   -10.128 14.752  1.00 6.12  ? 261 PHE A CE1  2  
ATOM   5261  C  CE2  . PHE A 1 166 ? 6.490   -9.249  13.792  1.00 4.75  ? 261 PHE A CE2  2  
ATOM   5262  C  CZ   . PHE A 1 166 ? 5.575   -10.304 13.953  1.00 4.59  ? 261 PHE A CZ   2  
ATOM   5263  H  H    . PHE A 1 166 ? 4.962   -4.458  17.386  1.00 2.53  ? 261 PHE A H    2  
ATOM   5264  H  HA   . PHE A 1 166 ? 3.427   -6.943  17.427  1.00 2.82  ? 261 PHE A HA   2  
ATOM   5265  H  HB2  . PHE A 1 166 ? 4.099   -5.972  15.325  1.00 2.66  ? 261 PHE A HB2  2  
ATOM   5266  H  HB3  . PHE A 1 166 ? 5.785   -5.896  15.820  1.00 2.70  ? 261 PHE A HB3  2  
ATOM   5267  H  HD1  . PHE A 1 166 ? 3.312   -8.767  15.988  1.00 3.26  ? 261 PHE A HD1  2  
ATOM   5268  H  HD2  . PHE A 1 166 ? 6.972   -7.213  14.305  1.00 5.03  ? 261 PHE A HD2  2  
ATOM   5269  H  HE1  . PHE A 1 166 ? 3.735   -10.944 14.879  1.00 6.47  ? 261 PHE A HE1  2  
ATOM   5270  H  HE2  . PHE A 1 166 ? 7.370   -9.386  13.180  1.00 5.90  ? 261 PHE A HE2  2  
ATOM   5271  H  HZ   . PHE A 1 166 ? 5.753   -11.252 13.465  1.00 5.86  ? 261 PHE A HZ   2  
ATOM   5272  N  N    . ARG A 1 167 ? 6.560   -6.923  18.540  1.00 3.88  ? 262 ARG A N    2  
ATOM   5273  C  CA   . ARG A 1 167 ? 7.462   -7.412  19.601  1.00 4.67  ? 262 ARG A CA   2  
ATOM   5274  C  C    . ARG A 1 167 ? 8.020   -8.842  19.426  1.00 5.03  ? 262 ARG A C    2  
ATOM   5275  O  O    . ARG A 1 167 ? 8.812   -9.297  20.245  1.00 5.91  ? 262 ARG A O    2  
ATOM   5276  C  CB   . ARG A 1 167 ? 6.788   -7.230  20.975  1.00 4.89  ? 262 ARG A CB   2  
ATOM   5277  C  CG   . ARG A 1 167 ? 7.818   -6.825  22.038  1.00 6.12  ? 262 ARG A CG   2  
ATOM   5278  C  CD   . ARG A 1 167 ? 7.162   -6.573  23.393  1.00 6.34  ? 262 ARG A CD   2  
ATOM   5279  N  NE   . ARG A 1 167 ? 8.191   -6.294  24.406  1.00 7.76  ? 262 ARG A NE   2  
ATOM   5280  C  CZ   . ARG A 1 167 ? 8.125   -6.569  25.701  1.00 8.62  ? 262 ARG A CZ   2  
ATOM   5281  N  NH1  . ARG A 1 167 ? 7.047   -7.051  26.279  1.00 8.47  ? 262 ARG A NH1  2  
ATOM   5282  N  NH2  . ARG A 1 167 ? 9.184   -6.380  26.452  1.00 10.00 ? 262 ARG A NH2  2  
ATOM   5283  H  H    . ARG A 1 167 ? 6.807   -6.026  18.132  1.00 4.35  ? 262 ARG A H    2  
ATOM   5284  H  HA   . ARG A 1 167 ? 8.327   -6.749  19.572  1.00 5.36  ? 262 ARG A HA   2  
ATOM   5285  H  HB2  . ARG A 1 167 ? 6.037   -6.442  20.917  1.00 4.70  ? 262 ARG A HB2  2  
ATOM   5286  H  HB3  . ARG A 1 167 ? 6.287   -8.154  21.269  1.00 4.84  ? 262 ARG A HB3  2  
ATOM   5287  H  HG2  . ARG A 1 167 ? 8.560   -7.617  22.152  1.00 6.77  ? 262 ARG A HG2  2  
ATOM   5288  H  HG3  . ARG A 1 167 ? 8.323   -5.911  21.722  1.00 6.71  ? 262 ARG A HG3  2  
ATOM   5289  H  HD2  . ARG A 1 167 ? 6.483   -5.722  23.310  1.00 6.34  ? 262 ARG A HD2  2  
ATOM   5290  H  HD3  . ARG A 1 167 ? 6.593   -7.462  23.669  1.00 6.02  ? 262 ARG A HD3  2  
ATOM   5291  H  HE   . ARG A 1 167 ? 9.067   -5.922  24.066  1.00 8.36  ? 262 ARG A HE   2  
ATOM   5292  H  HH11 . ARG A 1 167 ? 6.221   -7.278  25.748  1.00 7.70  ? 262 ARG A HH11 2  
ATOM   5293  H  HH12 . ARG A 1 167 ? 7.109   -7.352  27.246  1.00 9.37  ? 262 ARG A HH12 2  
ATOM   5294  H  HH21 . ARG A 1 167 ? 10.076  -6.118  26.038  1.00 10.44 ? 262 ARG A HH21 2  
ATOM   5295  H  HH22 . ARG A 1 167 ? 9.174   -6.670  27.418  1.00 10.75 ? 262 ARG A HH22 2  
ATOM   5296  N  N    . SER A 1 168 ? 7.643   -9.555  18.364  1.00 5.08  ? 263 SER A N    2  
ATOM   5297  C  CA   . SER A 1 168 ? 8.140   -10.894 18.006  1.00 5.78  ? 263 SER A CA   2  
ATOM   5298  C  C    . SER A 1 168 ? 9.679   -10.979 18.058  1.00 7.33  ? 263 SER A C    2  
ATOM   5299  O  O    . SER A 1 168 ? 10.336  -10.479 17.148  1.00 8.45  ? 263 SER A O    2  
ATOM   5300  C  CB   . SER A 1 168 ? 7.635   -11.232 16.595  1.00 5.71  ? 263 SER A CB   2  
ATOM   5301  O  OG   . SER A 1 168 ? 8.328   -12.328 16.022  1.00 6.43  ? 263 SER A OG   2  
ATOM   5302  H  H    . SER A 1 168 ? 6.903   -9.162  17.805  1.00 5.08  ? 263 SER A H    2  
ATOM   5303  H  HA   . SER A 1 168 ? 7.726   -11.632 18.690  1.00 5.77  ? 263 SER A HA   2  
ATOM   5304  H  HB2  . SER A 1 168 ? 6.567   -11.450 16.636  1.00 5.30  ? 263 SER A HB2  2  
ATOM   5305  H  HB3  . SER A 1 168 ? 7.789   -10.364 15.951  1.00 6.12  ? 263 SER A HB3  2  
ATOM   5306  H  HG   . SER A 1 168 ? 9.264   -12.071 15.963  1.00 6.99  ? 263 SER A HG   2  
ATOM   5307  N  N    . VAL A 1 169 ? 10.245  -11.610 19.095  1.00 7.89  ? 264 VAL A N    2  
ATOM   5308  C  CA   . VAL A 1 169 ? 11.689  -11.687 19.417  1.00 9.55  ? 264 VAL A CA   2  
ATOM   5309  C  C    . VAL A 1 169 ? 12.429  -10.328 19.415  1.00 10.65 ? 264 VAL A C    2  
ATOM   5310  O  O    . VAL A 1 169 ? 13.639  -10.267 19.187  1.00 12.02 ? 264 VAL A O    2  
ATOM   5311  C  CB   . VAL A 1 169 ? 12.447  -12.797 18.637  1.00 10.75 ? 264 VAL A CB   2  
ATOM   5312  C  CG1  . VAL A 1 169 ? 11.801  -14.174 18.870  1.00 10.85 ? 264 VAL A CG1  2  
ATOM   5313  C  CG2  . VAL A 1 169 ? 12.598  -12.561 17.125  1.00 11.47 ? 264 VAL A CG2  2  
ATOM   5314  H  H    . VAL A 1 169 ? 9.610   -12.032 19.780  1.00 7.43  ? 264 VAL A H    2  
ATOM   5315  H  HA   . VAL A 1 169 ? 11.704  -12.002 20.461  1.00 9.57  ? 264 VAL A HA   2  
ATOM   5316  H  HB   . VAL A 1 169 ? 13.456  -12.855 19.054  1.00 11.66 ? 264 VAL A HB   2  
ATOM   5317  H  HG11 . VAL A 1 169 ? 10.804  -14.210 18.431  1.00 10.61 ? 264 VAL A HG11 2  
ATOM   5318  H  HG12 . VAL A 1 169 ? 12.415  -14.952 18.413  1.00 11.55 ? 264 VAL A HG12 2  
ATOM   5319  H  HG13 . VAL A 1 169 ? 11.729  -14.374 19.940  1.00 10.91 ? 264 VAL A HG13 2  
ATOM   5320  H  HG21 . VAL A 1 169 ? 12.988  -11.561 16.929  1.00 11.91 ? 264 VAL A HG21 2  
ATOM   5321  H  HG22 . VAL A 1 169 ? 13.300  -13.285 16.717  1.00 12.29 ? 264 VAL A HG22 2  
ATOM   5322  H  HG23 . VAL A 1 169 ? 11.639  -12.682 16.621  1.00 11.18 ? 264 VAL A HG23 2  
ATOM   5323  N  N    . LEU A 1 170 ? 11.711  -9.226  19.672  1.00 10.51 ? 265 LEU A N    2  
ATOM   5324  C  CA   . LEU A 1 170 ? 12.216  -7.851  19.612  1.00 12.02 ? 265 LEU A CA   2  
ATOM   5325  C  C    . LEU A 1 170 ? 11.944  -7.103  20.927  1.00 12.76 ? 265 LEU A C    2  
ATOM   5326  O  O    . LEU A 1 170 ? 10.940  -6.404  21.061  1.00 13.05 ? 265 LEU A O    2  
ATOM   5327  C  CB   . LEU A 1 170 ? 11.607  -7.137  18.393  1.00 12.34 ? 265 LEU A CB   2  
ATOM   5328  C  CG   . LEU A 1 170 ? 12.207  -7.596  17.047  1.00 12.81 ? 265 LEU A CG   2  
ATOM   5329  C  CD1  . LEU A 1 170 ? 11.386  -6.958  15.927  1.00 13.17 ? 265 LEU A CD1  2  
ATOM   5330  C  CD2  . LEU A 1 170 ? 13.684  -7.198  16.880  1.00 14.40 ? 265 LEU A CD2  2  
ATOM   5331  H  H    . LEU A 1 170 ? 10.723  -9.347  19.876  1.00 9.57  ? 265 LEU A H    2  
ATOM   5332  H  HA   . LEU A 1 170 ? 13.290  -7.851  19.464  1.00 12.87 ? 265 LEU A HA   2  
ATOM   5333  H  HB2  . LEU A 1 170 ? 10.530  -7.310  18.391  1.00 11.41 ? 265 LEU A HB2  2  
ATOM   5334  H  HB3  . LEU A 1 170 ? 11.772  -6.063  18.494  1.00 13.55 ? 265 LEU A HB3  2  
ATOM   5335  H  HG   . LEU A 1 170 ? 12.132  -8.679  16.955  1.00 12.11 ? 265 LEU A HG   2  
ATOM   5336  H  HD11 . LEU A 1 170 ? 10.349  -7.281  16.012  1.00 12.75 ? 265 LEU A HD11 2  
ATOM   5337  H  HD12 . LEU A 1 170 ? 11.439  -5.875  16.016  1.00 13.64 ? 265 LEU A HD12 2  
ATOM   5338  H  HD13 . LEU A 1 170 ? 11.778  -7.269  14.960  1.00 13.74 ? 265 LEU A HD13 2  
ATOM   5339  H  HD21 . LEU A 1 170 ? 14.019  -7.438  15.870  1.00 14.97 ? 265 LEU A HD21 2  
ATOM   5340  H  HD22 . LEU A 1 170 ? 13.810  -6.129  17.051  1.00 15.18 ? 265 LEU A HD22 2  
ATOM   5341  H  HD23 . LEU A 1 170 ? 14.310  -7.752  17.578  1.00 14.49 ? 265 LEU A HD23 2  
ATOM   5342  N  N    . SER A 1 171 ? 12.876  -7.233  21.881  1.00 13.48 ? 266 SER A N    2  
ATOM   5343  C  CA   . SER A 1 171 ? 12.906  -6.511  23.168  1.00 14.64 ? 266 SER A CA   2  
ATOM   5344  C  C    . SER A 1 171 ? 14.254  -6.605  23.876  1.00 15.97 ? 266 SER A C    2  
ATOM   5345  O  O    . SER A 1 171 ? 15.102  -7.439  23.470  1.00 16.53 ? 266 SER A O    2  
ATOM   5346  C  CB   . SER A 1 171 ? 11.795  -7.017  24.086  1.00 14.09 ? 266 SER A CB   2  
ATOM   5347  O  OG   . SER A 1 171 ? 11.706  -6.093  25.149  1.00 15.27 ? 266 SER A OG   2  
ATOM   5348  O  OXT  . SER A 1 171 ? 14.440  -5.858  24.859  1.00 16.64 ? 266 SER A OXT  2  
ATOM   5349  H  H    . SER A 1 171 ? 13.641  -7.872  21.715  1.00 13.45 ? 266 SER A H    2  
ATOM   5350  H  HA   . SER A 1 171 ? 12.728  -5.454  22.969  1.00 15.27 ? 266 SER A HA   2  
ATOM   5351  H  HB2  . SER A 1 171 ? 10.846  -7.062  23.550  1.00 13.31 ? 266 SER A HB2  2  
ATOM   5352  H  HB3  . SER A 1 171 ? 12.045  -8.013  24.462  1.00 13.93 ? 266 SER A HB3  2  
ATOM   5353  H  HG   . SER A 1 171 ? 12.632  -5.849  25.356  1.00 16.13 ? 266 SER A HG   2  
HETATM 5354  CU CU   . CU1 B 2 .   ? -3.684  12.148  -2.478  1.00 3.14  ? 267 CU1 A CU   2  
ATOM   5355  N  N    . SER A 1 2   ? -13.629 -26.178 18.051  1.00 15.88 ? 97  SER A N    3  
ATOM   5356  C  CA   . SER A 1 2   ? -12.519 -25.874 17.130  1.00 15.73 ? 97  SER A CA   3  
ATOM   5357  C  C    . SER A 1 2   ? -13.015 -25.250 15.824  1.00 14.38 ? 97  SER A C    3  
ATOM   5358  O  O    . SER A 1 2   ? -12.768 -25.784 14.744  1.00 14.16 ? 97  SER A O    3  
ATOM   5359  C  CB   . SER A 1 2   ? -11.673 -27.124 16.892  1.00 16.84 ? 97  SER A CB   3  
ATOM   5360  O  OG   . SER A 1 2   ? -11.390 -27.699 18.152  1.00 17.96 ? 97  SER A OG   3  
ATOM   5361  H  H    . SER A 1 2   ? -14.357 -26.688 17.567  1.00 15.58 ? 97  SER A H    3  
ATOM   5362  H  HA   . SER A 1 2   ? -11.881 -25.146 17.623  1.00 16.08 ? 97  SER A HA   3  
ATOM   5363  H  HB2  . SER A 1 2   ? -12.219 -27.844 16.281  1.00 16.71 ? 97  SER A HB2  3  
ATOM   5364  H  HB3  . SER A 1 2   ? -10.745 -26.847 16.389  1.00 17.14 ? 97  SER A HB3  3  
ATOM   5365  H  HG   . SER A 1 2   ? -10.559 -28.207 18.083  1.00 18.85 ? 97  SER A HG   3  
ATOM   5366  N  N    . PHE A 1 3   ? -13.703 -24.105 15.903  1.00 13.73 ? 98  PHE A N    3  
ATOM   5367  C  CA   . PHE A 1 3   ? -14.363 -23.431 14.777  1.00 12.52 ? 98  PHE A CA   3  
ATOM   5368  C  C    . PHE A 1 3   ? -14.652 -21.953 15.102  1.00 11.99 ? 98  PHE A C    3  
ATOM   5369  O  O    . PHE A 1 3   ? -14.826 -21.595 16.271  1.00 12.74 ? 98  PHE A O    3  
ATOM   5370  C  CB   . PHE A 1 3   ? -15.661 -24.191 14.436  1.00 12.58 ? 98  PHE A CB   3  
ATOM   5371  C  CG   . PHE A 1 3   ? -16.413 -23.669 13.226  1.00 11.85 ? 98  PHE A CG   3  
ATOM   5372  C  CD1  . PHE A 1 3   ? -17.392 -22.668 13.376  1.00 11.64 ? 98  PHE A CD1  3  
ATOM   5373  C  CD2  . PHE A 1 3   ? -16.119 -24.170 11.944  1.00 12.01 ? 98  PHE A CD2  3  
ATOM   5374  C  CE1  . PHE A 1 3   ? -18.053 -22.154 12.247  1.00 11.28 ? 98  PHE A CE1  3  
ATOM   5375  C  CE2  . PHE A 1 3   ? -16.798 -23.673 10.818  1.00 11.62 ? 98  PHE A CE2  3  
ATOM   5376  C  CZ   . PHE A 1 3   ? -17.763 -22.661 10.968  1.00 11.27 ? 98  PHE A CZ   3  
ATOM   5377  H  H    . PHE A 1 3   ? -13.831 -23.681 16.816  1.00 14.25 ? 98  PHE A H    3  
ATOM   5378  H  HA   . PHE A 1 3   ? -13.703 -23.468 13.909  1.00 12.41 ? 98  PHE A HA   3  
ATOM   5379  H  HB2  . PHE A 1 3   ? -15.420 -25.239 14.252  1.00 13.28 ? 98  PHE A HB2  3  
ATOM   5380  H  HB3  . PHE A 1 3   ? -16.325 -24.160 15.300  1.00 12.91 ? 98  PHE A HB3  3  
ATOM   5381  H  HD1  . PHE A 1 3   ? -17.624 -22.273 14.355  1.00 12.15 ? 98  PHE A HD1  3  
ATOM   5382  H  HD2  . PHE A 1 3   ? -15.369 -24.940 11.819  1.00 12.30 ? 98  PHE A HD2  3  
ATOM   5383  H  HE1  . PHE A 1 3   ? -18.778 -21.363 12.360  1.00 11.62 ? 98  PHE A HE1  3  
ATOM   5384  H  HE2  . PHE A 1 3   ? -16.573 -24.059 9.833   1.00 11.78 ? 98  PHE A HE2  3  
ATOM   5385  H  HZ   . PHE A 1 3   ? -18.274 -22.267 10.101  1.00 11.35 ? 98  PHE A HZ   3  
ATOM   5386  N  N    . THR A 1 4   ? -14.745 -21.111 14.064  1.00 10.68 ? 99  THR A N    3  
ATOM   5387  C  CA   . THR A 1 4   ? -15.135 -19.691 14.104  1.00 9.99  ? 99  THR A CA   3  
ATOM   5388  C  C    . THR A 1 4   ? -15.415 -19.214 12.677  1.00 8.74  ? 99  THR A C    3  
ATOM   5389  O  O    . THR A 1 4   ? -14.810 -19.726 11.736  1.00 8.61  ? 99  THR A O    3  
ATOM   5390  C  CB   . THR A 1 4   ? -14.097 -18.831 14.842  1.00 10.80 ? 99  THR A CB   3  
ATOM   5391  O  OG1  . THR A 1 4   ? -14.598 -17.525 14.921  1.00 10.86 ? 99  THR A OG1  3  
ATOM   5392  C  CG2  . THR A 1 4   ? -12.723 -18.782 14.172  1.00 10.91 ? 99  THR A CG2  3  
ATOM   5393  H  H    . THR A 1 4   ? -14.605 -21.486 13.133  1.00 10.45 ? 99  THR A H    3  
ATOM   5394  H  HA   . THR A 1 4   ? -16.070 -19.603 14.658  1.00 10.23 ? 99  THR A HA   3  
ATOM   5395  H  HB   . THR A 1 4   ? -13.977 -19.213 15.858  1.00 11.73 ? 99  THR A HB   3  
ATOM   5396  H  HG1  . THR A 1 4   ? -14.107 -17.049 15.611  1.00 11.74 ? 99  THR A HG1  3  
ATOM   5397  H  HG21 . THR A 1 4   ? -12.047 -18.173 14.776  1.00 11.58 ? 99  THR A HG21 3  
ATOM   5398  H  HG22 . THR A 1 4   ? -12.309 -19.786 14.091  1.00 11.19 ? 99  THR A HG22 3  
ATOM   5399  H  HG23 . THR A 1 4   ? -12.805 -18.344 13.178  1.00 10.49 ? 99  THR A HG23 3  
ATOM   5400  N  N    . GLY A 1 5   ? -16.358 -18.281 12.517  1.00 8.24  ? 100 GLY A N    3  
ATOM   5401  C  CA   . GLY A 1 5   ? -16.830 -17.760 11.226  1.00 7.34  ? 100 GLY A CA   3  
ATOM   5402  C  C    . GLY A 1 5   ? -16.668 -16.244 11.095  1.00 6.30  ? 100 GLY A C    3  
ATOM   5403  O  O    . GLY A 1 5   ? -16.946 -15.501 12.036  1.00 6.49  ? 100 GLY A O    3  
ATOM   5404  H  H    . GLY A 1 5   ? -16.769 -17.885 13.355  1.00 8.85  ? 100 GLY A H    3  
ATOM   5405  H  HA2  . GLY A 1 5   ? -16.306 -18.254 10.407  1.00 7.48  ? 100 GLY A HA2  3  
ATOM   5406  H  HA3  . GLY A 1 5   ? -17.894 -17.972 11.132  1.00 7.75  ? 100 GLY A HA3  3  
ATOM   5407  N  N    . GLN A 1 6   ? -16.268 -15.795 9.902   1.00 5.61  ? 101 GLN A N    3  
ATOM   5408  C  CA   . GLN A 1 6   ? -16.049 -14.397 9.498   1.00 4.90  ? 101 GLN A CA   3  
ATOM   5409  C  C    . GLN A 1 6   ? -15.809 -14.365 7.968   1.00 4.50  ? 101 GLN A C    3  
ATOM   5410  O  O    . GLN A 1 6   ? -15.603 -15.419 7.359   1.00 5.38  ? 101 GLN A O    3  
ATOM   5411  C  CB   . GLN A 1 6   ? -14.851 -13.797 10.275  1.00 5.21  ? 101 GLN A CB   3  
ATOM   5412  C  CG   . GLN A 1 6   ? -14.807 -12.258 10.359  1.00 5.93  ? 101 GLN A CG   3  
ATOM   5413  C  CD   . GLN A 1 6   ? -15.632 -11.686 11.515  1.00 7.31  ? 101 GLN A CD   3  
ATOM   5414  O  OE1  . GLN A 1 6   ? -15.113 -11.424 12.589  1.00 8.11  ? 101 GLN A OE1  3  
ATOM   5415  N  NE2  . GLN A 1 6   ? -16.913 -11.444 11.343  1.00 8.14  ? 101 GLN A NE2  3  
ATOM   5416  H  H    . GLN A 1 6   ? -16.099 -16.485 9.182   1.00 5.90  ? 101 GLN A H    3  
ATOM   5417  H  HA   . GLN A 1 6   ? -16.950 -13.826 9.726   1.00 5.20  ? 101 GLN A HA   3  
ATOM   5418  H  HB2  . GLN A 1 6   ? -14.834 -14.179 11.297  1.00 5.93  ? 101 GLN A HB2  3  
ATOM   5419  H  HB3  . GLN A 1 6   ? -13.935 -14.143 9.797   1.00 5.04  ? 101 GLN A HB3  3  
ATOM   5420  H  HG2  . GLN A 1 6   ? -13.770 -11.962 10.525  1.00 6.20  ? 101 GLN A HG2  3  
ATOM   5421  H  HG3  . GLN A 1 6   ? -15.126 -11.805 9.424   1.00 5.91  ? 101 GLN A HG3  3  
ATOM   5422  H  HE21 . GLN A 1 6   ? -17.349 -11.568 10.436  1.00 8.00  ? 101 GLN A HE21 3  
ATOM   5423  H  HE22 . GLN A 1 6   ? -17.432 -11.084 12.134  1.00 9.23  ? 101 GLN A HE22 3  
ATOM   5424  N  N    . GLY A 1 7   ? -15.832 -13.190 7.332   1.00 3.89  ? 102 GLY A N    3  
ATOM   5425  C  CA   . GLY A 1 7   ? -15.584 -12.997 5.893   1.00 3.94  ? 102 GLY A CA   3  
ATOM   5426  C  C    . GLY A 1 7   ? -14.183 -12.483 5.529   1.00 3.17  ? 102 GLY A C    3  
ATOM   5427  O  O    . GLY A 1 7   ? -13.346 -12.189 6.391   1.00 3.86  ? 102 GLY A O    3  
ATOM   5428  H  H    . GLY A 1 7   ? -16.126 -12.375 7.859   1.00 4.00  ? 102 GLY A H    3  
ATOM   5429  H  HA2  . GLY A 1 7   ? -15.743 -13.931 5.354   1.00 4.63  ? 102 GLY A HA2  3  
ATOM   5430  H  HA3  . GLY A 1 7   ? -16.294 -12.261 5.514   1.00 4.58  ? 102 GLY A HA3  3  
ATOM   5431  N  N    . ASP A 1 8   ? -13.959 -12.348 4.219   1.00 2.41  ? 103 ASP A N    3  
ATOM   5432  C  CA   . ASP A 1 8   ? -12.708 -11.937 3.575   1.00 1.84  ? 103 ASP A CA   3  
ATOM   5433  C  C    . ASP A 1 8   ? -12.939 -11.087 2.310   1.00 1.74  ? 103 ASP A C    3  
ATOM   5434  O  O    . ASP A 1 8   ? -14.002 -11.137 1.697   1.00 2.41  ? 103 ASP A O    3  
ATOM   5435  C  CB   . ASP A 1 8   ? -11.847 -13.182 3.272   1.00 2.07  ? 103 ASP A CB   3  
ATOM   5436  C  CG   . ASP A 1 8   ? -12.366 -14.107 2.167   1.00 3.04  ? 103 ASP A CG   3  
ATOM   5437  O  OD1  . ASP A 1 8   ? -13.541 -14.535 2.218   1.00 3.88  ? 103 ASP A OD1  3  
ATOM   5438  O  OD2  . ASP A 1 8   ? -11.551 -14.467 1.289   1.00 4.10  ? 103 ASP A OD2  3  
ATOM   5439  H  H    . ASP A 1 8   ? -14.690 -12.625 3.575   1.00 2.86  ? 103 ASP A H    3  
ATOM   5440  H  HA   . ASP A 1 8   ? -12.157 -11.311 4.274   1.00 1.94  ? 103 ASP A HA   3  
ATOM   5441  H  HB2  . ASP A 1 8   ? -10.846 -12.839 3.001   1.00 2.49  ? 103 ASP A HB2  3  
ATOM   5442  H  HB3  . ASP A 1 8   ? -11.760 -13.781 4.177   1.00 2.81  ? 103 ASP A HB3  3  
ATOM   5443  N  N    . PHE A 1 9   ? -11.932 -10.286 1.939   1.00 1.34  ? 104 PHE A N    3  
ATOM   5444  C  CA   . PHE A 1 9   ? -11.933 -9.440  0.740   1.00 1.24  ? 104 PHE A CA   3  
ATOM   5445  C  C    . PHE A 1 9   ? -11.394 -10.198 -0.483  1.00 1.70  ? 104 PHE A C    3  
ATOM   5446  O  O    . PHE A 1 9   ? -10.527 -11.060 -0.343  1.00 1.87  ? 104 PHE A O    3  
ATOM   5447  C  CB   . PHE A 1 9   ? -11.104 -8.171  1.010   1.00 1.35  ? 104 PHE A CB   3  
ATOM   5448  C  CG   . PHE A 1 9   ? -9.638  -8.385  1.373   1.00 1.42  ? 104 PHE A CG   3  
ATOM   5449  C  CD1  . PHE A 1 9   ? -8.679  -8.635  0.372   1.00 2.03  ? 104 PHE A CD1  3  
ATOM   5450  C  CD2  . PHE A 1 9   ? -9.220  -8.293  2.716   1.00 2.40  ? 104 PHE A CD2  3  
ATOM   5451  C  CE1  . PHE A 1 9   ? -7.321  -8.787  0.705   1.00 2.33  ? 104 PHE A CE1  3  
ATOM   5452  C  CE2  . PHE A 1 9   ? -7.861  -8.441  3.050   1.00 2.46  ? 104 PHE A CE2  3  
ATOM   5453  C  CZ   . PHE A 1 9   ? -6.910  -8.684  2.044   1.00 1.94  ? 104 PHE A CZ   3  
ATOM   5454  H  H    . PHE A 1 9   ? -11.073 -10.323 2.464   1.00 1.50  ? 104 PHE A H    3  
ATOM   5455  H  HA   . PHE A 1 9   ? -12.959 -9.134  0.518   1.00 1.33  ? 104 PHE A HA   3  
ATOM   5456  H  HB2  . PHE A 1 9   ? -11.145 -7.535  0.125   1.00 1.33  ? 104 PHE A HB2  3  
ATOM   5457  H  HB3  . PHE A 1 9   ? -11.588 -7.614  1.814   1.00 1.56  ? 104 PHE A HB3  3  
ATOM   5458  H  HD1  . PHE A 1 9   ? -8.981  -8.709  -0.662  1.00 3.05  ? 104 PHE A HD1  3  
ATOM   5459  H  HD2  . PHE A 1 9   ? -9.944  -8.086  3.494   1.00 3.52  ? 104 PHE A HD2  3  
ATOM   5460  H  HE1  . PHE A 1 9   ? -6.589  -8.967  -0.070  1.00 3.48  ? 104 PHE A HE1  3  
ATOM   5461  H  HE2  . PHE A 1 9   ? -7.545  -8.344  4.079   1.00 3.81  ? 104 PHE A HE2  3  
ATOM   5462  H  HZ   . PHE A 1 9   ? -5.861  -8.780  2.295   1.00 2.25  ? 104 PHE A HZ   3  
ATOM   5463  N  N    . HIS A 1 10  ? -11.838 -9.821  -1.687  1.00 1.13  ? 105 HIS A N    3  
ATOM   5464  C  CA   . HIS A 1 10  ? -11.427 -10.455 -2.949  1.00 1.14  ? 105 HIS A CA   3  
ATOM   5465  C  C    . HIS A 1 10  ? -10.897 -9.420  -3.961  1.00 1.03  ? 105 HIS A C    3  
ATOM   5466  O  O    . HIS A 1 10  ? -11.665 -8.631  -4.517  1.00 1.25  ? 105 HIS A O    3  
ATOM   5467  C  CB   . HIS A 1 10  ? -12.625 -11.246 -3.516  1.00 1.41  ? 105 HIS A CB   3  
ATOM   5468  C  CG   . HIS A 1 10  ? -13.168 -12.263 -2.547  1.00 2.63  ? 105 HIS A CG   3  
ATOM   5469  N  ND1  . HIS A 1 10  ? -14.485 -12.329 -2.081  1.00 3.88  ? 105 HIS A ND1  3  
ATOM   5470  C  CD2  . HIS A 1 10  ? -12.394 -13.121 -1.826  1.00 3.38  ? 105 HIS A CD2  3  
ATOM   5471  C  CE1  . HIS A 1 10  ? -14.454 -13.204 -1.060  1.00 5.29  ? 105 HIS A CE1  3  
ATOM   5472  N  NE2  . HIS A 1 10  ? -13.216 -13.697 -0.889  1.00 5.06  ? 105 HIS A NE2  3  
ATOM   5473  H  H    . HIS A 1 10  ? -12.576 -9.135  -1.729  1.00 1.31  ? 105 HIS A H    3  
ATOM   5474  H  HA   . HIS A 1 10  ? -10.618 -11.162 -2.755  1.00 1.22  ? 105 HIS A HA   3  
ATOM   5475  H  HB2  . HIS A 1 10  ? -13.429 -10.555 -3.773  1.00 2.30  ? 105 HIS A HB2  3  
ATOM   5476  H  HB3  . HIS A 1 10  ? -12.316 -11.765 -4.422  1.00 1.57  ? 105 HIS A HB3  3  
ATOM   5477  H  HD2  . HIS A 1 10  ? -11.317 -13.200 -1.887  1.00 3.02  ? 105 HIS A HD2  3  
ATOM   5478  H  HE1  . HIS A 1 10  ? -15.288 -13.427 -0.407  1.00 6.59  ? 105 HIS A HE1  3  
ATOM   5479  H  HE2  . HIS A 1 10  ? -12.912 -14.249 -0.088  1.00 6.11  ? 105 HIS A HE2  3  
ATOM   5480  N  N    . LEU A 1 11  ? -9.581  -9.420  -4.208  1.00 0.90  ? 106 LEU A N    3  
ATOM   5481  C  CA   . LEU A 1 11  ? -8.900  -8.535  -5.169  1.00 0.86  ? 106 LEU A CA   3  
ATOM   5482  C  C    . LEU A 1 11  ? -7.855  -9.311  -5.995  1.00 0.92  ? 106 LEU A C    3  
ATOM   5483  O  O    . LEU A 1 11  ? -7.695  -10.522 -5.827  1.00 1.10  ? 106 LEU A O    3  
ATOM   5484  C  CB   . LEU A 1 11  ? -8.286  -7.304  -4.449  1.00 0.90  ? 106 LEU A CB   3  
ATOM   5485  C  CG   . LEU A 1 11  ? -9.312  -6.259  -3.943  1.00 1.17  ? 106 LEU A CG   3  
ATOM   5486  C  CD1  . LEU A 1 11  ? -9.693  -6.476  -2.470  1.00 2.43  ? 106 LEU A CD1  3  
ATOM   5487  C  CD2  . LEU A 1 11  ? -8.746  -4.837  -4.086  1.00 2.00  ? 106 LEU A CD2  3  
ATOM   5488  H  H    . LEU A 1 11  ? -9.013  -10.122 -3.744  1.00 1.02  ? 106 LEU A H    3  
ATOM   5489  H  HA   . LEU A 1 11  ? -9.635  -8.181  -5.888  1.00 0.83  ? 106 LEU A HA   3  
ATOM   5490  H  HB2  . LEU A 1 11  ? -7.652  -7.635  -3.625  1.00 1.14  ? 106 LEU A HB2  3  
ATOM   5491  H  HB3  . LEU A 1 11  ? -7.637  -6.794  -5.159  1.00 1.02  ? 106 LEU A HB3  3  
ATOM   5492  H  HG   . LEU A 1 11  ? -10.213 -6.314  -4.554  1.00 2.21  ? 106 LEU A HG   3  
ATOM   5493  H  HD11 . LEU A 1 11  ? -8.812  -6.386  -1.835  1.00 3.11  ? 106 LEU A HD11 3  
ATOM   5494  H  HD12 . LEU A 1 11  ? -10.428 -5.729  -2.165  1.00 3.05  ? 106 LEU A HD12 3  
ATOM   5495  H  HD13 . LEU A 1 11  ? -10.132 -7.460  -2.329  1.00 3.29  ? 106 LEU A HD13 3  
ATOM   5496  H  HD21 . LEU A 1 11  ? -7.833  -4.732  -3.498  1.00 2.80  ? 106 LEU A HD21 3  
ATOM   5497  H  HD22 . LEU A 1 11  ? -8.527  -4.628  -5.134  1.00 2.88  ? 106 LEU A HD22 3  
ATOM   5498  H  HD23 . LEU A 1 11  ? -9.479  -4.109  -3.737  1.00 2.74  ? 106 LEU A HD23 3  
ATOM   5499  N  N    . LEU A 1 12  ? -7.141  -8.628  -6.895  1.00 1.03  ? 107 LEU A N    3  
ATOM   5500  C  CA   . LEU A 1 12  ? -6.124  -9.209  -7.774  1.00 1.12  ? 107 LEU A CA   3  
ATOM   5501  C  C    . LEU A 1 12  ? -5.056  -8.182  -8.180  1.00 0.68  ? 107 LEU A C    3  
ATOM   5502  O  O    . LEU A 1 12  ? -5.289  -6.979  -8.087  1.00 0.67  ? 107 LEU A O    3  
ATOM   5503  C  CB   . LEU A 1 12  ? -6.783  -9.863  -9.003  1.00 1.60  ? 107 LEU A CB   3  
ATOM   5504  C  CG   . LEU A 1 12  ? -7.598  -8.885  -9.883  1.00 1.34  ? 107 LEU A CG   3  
ATOM   5505  C  CD1  . LEU A 1 12  ? -7.349  -9.200  -11.362 1.00 2.18  ? 107 LEU A CD1  3  
ATOM   5506  C  CD2  . LEU A 1 12  ? -9.103  -8.970  -9.584  1.00 2.60  ? 107 LEU A CD2  3  
ATOM   5507  H  H    . LEU A 1 12  ? -7.299  -7.633  -6.996  1.00 1.16  ? 107 LEU A H    3  
ATOM   5508  H  HA   . LEU A 1 12  ? -5.605  -9.992  -7.230  1.00 1.38  ? 107 LEU A HA   3  
ATOM   5509  H  HB2  . LEU A 1 12  ? -5.987  -10.309 -9.600  1.00 2.77  ? 107 LEU A HB2  3  
ATOM   5510  H  HB3  . LEU A 1 12  ? -7.423  -10.684 -8.679  1.00 2.82  ? 107 LEU A HB3  3  
ATOM   5511  H  HG   . LEU A 1 12  ? -7.274  -7.860  -9.705  1.00 2.55  ? 107 LEU A HG   3  
ATOM   5512  H  HD11 . LEU A 1 12  ? -6.291  -9.048  -11.582 1.00 3.40  ? 107 LEU A HD11 3  
ATOM   5513  H  HD12 . LEU A 1 12  ? -7.621  -10.234 -11.576 1.00 2.73  ? 107 LEU A HD12 3  
ATOM   5514  H  HD13 . LEU A 1 12  ? -7.935  -8.529  -11.991 1.00 2.83  ? 107 LEU A HD13 3  
ATOM   5515  H  HD21 . LEU A 1 12  ? -9.644  -8.265  -10.215 1.00 3.18  ? 107 LEU A HD21 3  
ATOM   5516  H  HD22 . LEU A 1 12  ? -9.468  -9.979  -9.782  1.00 3.00  ? 107 LEU A HD22 3  
ATOM   5517  H  HD23 . LEU A 1 12  ? -9.295  -8.717  -8.542  1.00 3.83  ? 107 LEU A HD23 3  
ATOM   5518  N  N    . ASP A 1 13  ? -3.914  -8.688  -8.650  1.00 0.59  ? 108 ASP A N    3  
ATOM   5519  C  CA   . ASP A 1 13  ? -2.754  -7.904  -9.093  1.00 0.67  ? 108 ASP A CA   3  
ATOM   5520  C  C    . ASP A 1 13  ? -2.955  -7.263  -10.478 1.00 0.90  ? 108 ASP A C    3  
ATOM   5521  O  O    . ASP A 1 13  ? -3.664  -7.790  -11.338 1.00 1.11  ? 108 ASP A O    3  
ATOM   5522  C  CB   . ASP A 1 13  ? -1.514  -8.832  -9.220  1.00 1.17  ? 108 ASP A CB   3  
ATOM   5523  C  CG   . ASP A 1 13  ? -0.718  -9.094  -7.943  1.00 1.68  ? 108 ASP A CG   3  
ATOM   5524  O  OD1  . ASP A 1 13  ? -0.875  -8.368  -6.945  1.00 2.88  ? 108 ASP A OD1  3  
ATOM   5525  O  OD2  . ASP A 1 13  ? 0.081   -10.059 -7.945  1.00 2.64  ? 108 ASP A OD2  3  
ATOM   5526  H  H    . ASP A 1 13  ? -3.817  -9.694  -8.634  1.00 0.76  ? 108 ASP A H    3  
ATOM   5527  H  HA   . ASP A 1 13  ? -2.545  -7.111  -8.371  1.00 0.68  ? 108 ASP A HA   3  
ATOM   5528  H  HB2  . ASP A 1 13  ? -1.827  -9.784  -9.654  1.00 2.00  ? 108 ASP A HB2  3  
ATOM   5529  H  HB3  . ASP A 1 13  ? -0.803  -8.393  -9.922  1.00 2.40  ? 108 ASP A HB3  3  
ATOM   5530  N  N    . HIS A 1 14  ? -2.104  -6.271  -10.750 1.00 1.03  ? 109 HIS A N    3  
ATOM   5531  C  CA   . HIS A 1 14  ? -1.573  -5.790  -12.039 1.00 1.08  ? 109 HIS A CA   3  
ATOM   5532  C  C    . HIS A 1 14  ? -1.009  -6.887  -12.993 1.00 1.18  ? 109 HIS A C    3  
ATOM   5533  O  O    . HIS A 1 14  ? -0.271  -6.601  -13.943 1.00 1.33  ? 109 HIS A O    3  
ATOM   5534  C  CB   . HIS A 1 14  ? -0.485  -4.755  -11.689 1.00 1.09  ? 109 HIS A CB   3  
ATOM   5535  C  CG   . HIS A 1 14  ? 0.667   -5.345  -10.911 1.00 0.99  ? 109 HIS A CG   3  
ATOM   5536  N  ND1  . HIS A 1 14  ? 0.639   -5.655  -9.550  1.00 1.48  ? 109 HIS A ND1  3  
ATOM   5537  C  CD2  . HIS A 1 14  ? 1.872   -5.732  -11.424 1.00 1.12  ? 109 HIS A CD2  3  
ATOM   5538  C  CE1  . HIS A 1 14  ? 1.817   -6.229  -9.279  1.00 1.36  ? 109 HIS A CE1  3  
ATOM   5539  N  NE2  . HIS A 1 14  ? 2.585   -6.281  -10.378 1.00 1.16  ? 109 HIS A NE2  3  
ATOM   5540  H  H    . HIS A 1 14  ? -1.671  -5.852  -9.928  1.00 1.05  ? 109 HIS A H    3  
ATOM   5541  H  HA   . HIS A 1 14  ? -2.372  -5.276  -12.568 1.00 1.19  ? 109 HIS A HA   3  
ATOM   5542  H  HB2  . HIS A 1 14  ? -0.108  -4.303  -12.605 1.00 1.29  ? 109 HIS A HB2  3  
ATOM   5543  H  HB3  . HIS A 1 14  ? -0.933  -3.960  -11.089 1.00 1.22  ? 109 HIS A HB3  3  
ATOM   5544  H  HD2  . HIS A 1 14  ? 2.191   -5.636  -12.451 1.00 1.62  ? 109 HIS A HD2  3  
ATOM   5545  H  HE1  . HIS A 1 14  ? 2.113   -6.597  -8.307  1.00 1.79  ? 109 HIS A HE1  3  
ATOM   5546  H  HE2  . HIS A 1 14  ? 3.544   -6.614  -10.393 1.00 1.45  ? 109 HIS A HE2  3  
ATOM   5547  N  N    . ARG A 1 15  ? -1.303  -8.159  -12.706 1.00 1.46  ? 110 ARG A N    3  
ATOM   5548  C  CA   . ARG A 1 15  ? -0.850  -9.375  -13.374 1.00 1.64  ? 110 ARG A CA   3  
ATOM   5549  C  C    . ARG A 1 15  ? -1.864  -10.539 -13.281 1.00 1.51  ? 110 ARG A C    3  
ATOM   5550  O  O    . ARG A 1 15  ? -1.545  -11.655 -13.684 1.00 1.91  ? 110 ARG A O    3  
ATOM   5551  C  CB   . ARG A 1 15  ? 0.505   -9.757  -12.748 1.00 2.33  ? 110 ARG A CB   3  
ATOM   5552  C  CG   . ARG A 1 15  ? 1.496   -10.312 -13.770 1.00 2.69  ? 110 ARG A CG   3  
ATOM   5553  C  CD   . ARG A 1 15  ? 1.953   -9.262  -14.796 1.00 3.49  ? 110 ARG A CD   3  
ATOM   5554  N  NE   . ARG A 1 15  ? 1.260   -9.394  -16.091 1.00 4.58  ? 110 ARG A NE   3  
ATOM   5555  C  CZ   . ARG A 1 15  ? 0.935   -8.417  -16.929 1.00 5.91  ? 110 ARG A CZ   3  
ATOM   5556  N  NH1  . ARG A 1 15  ? 0.871   -7.149  -16.578 1.00 6.64  ? 110 ARG A NH1  3  
ATOM   5557  N  NH2  . ARG A 1 15  ? 0.675   -8.747  -18.169 1.00 7.05  ? 110 ARG A NH2  3  
ATOM   5558  H  H    . ARG A 1 15  ? -1.854  -8.291  -11.875 1.00 1.65  ? 110 ARG A H    3  
ATOM   5559  H  HA   . ARG A 1 15  ? -0.726  -9.139  -14.429 1.00 1.96  ? 110 ARG A HA   3  
ATOM   5560  H  HB2  . ARG A 1 15  ? 0.970   -8.887  -12.279 1.00 2.92  ? 110 ARG A HB2  3  
ATOM   5561  H  HB3  . ARG A 1 15  ? 0.347   -10.495 -11.959 1.00 2.83  ? 110 ARG A HB3  3  
ATOM   5562  H  HG2  . ARG A 1 15  ? 2.368   -10.642 -13.207 1.00 3.05  ? 110 ARG A HG2  3  
ATOM   5563  H  HG3  . ARG A 1 15  ? 1.059   -11.175 -14.271 1.00 3.51  ? 110 ARG A HG3  3  
ATOM   5564  H  HD2  . ARG A 1 15  ? 1.828   -8.261  -14.381 1.00 4.09  ? 110 ARG A HD2  3  
ATOM   5565  H  HD3  . ARG A 1 15  ? 3.020   -9.412  -14.977 1.00 3.77  ? 110 ARG A HD3  3  
ATOM   5566  H  HE   . ARG A 1 15  ? 1.218   -10.330 -16.489 1.00 4.82  ? 110 ARG A HE   3  
ATOM   5567  H  HH11 . ARG A 1 15  ? 0.826   -6.903  -15.598 1.00 6.28  ? 110 ARG A HH11 3  
ATOM   5568  H  HH12 . ARG A 1 15  ? 0.695   -6.432  -17.276 1.00 7.90  ? 110 ARG A HH12 3  
ATOM   5569  H  HH21 . ARG A 1 15  ? 0.740   -9.724  -18.433 1.00 7.02  ? 110 ARG A HH21 3  
ATOM   5570  H  HH22 . ARG A 1 15  ? 0.578   -8.048  -18.897 1.00 8.15  ? 110 ARG A HH22 3  
ATOM   5571  N  N    . GLY A 1 16  ? -3.067  -10.318 -12.725 1.00 1.42  ? 111 GLY A N    3  
ATOM   5572  C  CA   . GLY A 1 16  ? -4.163  -11.303 -12.660 1.00 1.87  ? 111 GLY A CA   3  
ATOM   5573  C  C    . GLY A 1 16  ? -4.112  -12.290 -11.484 1.00 1.61  ? 111 GLY A C    3  
ATOM   5574  O  O    . GLY A 1 16  ? -5.007  -13.126 -11.359 1.00 2.26  ? 111 GLY A O    3  
ATOM   5575  H  H    . GLY A 1 16  ? -3.282  -9.375  -12.410 1.00 1.40  ? 111 GLY A H    3  
ATOM   5576  H  HA2  . GLY A 1 16  ? -5.110  -10.769 -12.586 1.00 2.49  ? 111 GLY A HA2  3  
ATOM   5577  H  HA3  . GLY A 1 16  ? -4.160  -11.900 -13.574 1.00 2.25  ? 111 GLY A HA3  3  
ATOM   5578  N  N    . ARG A 1 17  ? -3.085  -12.208 -10.627 1.00 1.10  ? 112 ARG A N    3  
ATOM   5579  C  CA   . ARG A 1 17  ? -2.870  -13.104 -9.479  1.00 1.37  ? 112 ARG A CA   3  
ATOM   5580  C  C    . ARG A 1 17  ? -3.778  -12.690 -8.308  1.00 1.39  ? 112 ARG A C    3  
ATOM   5581  O  O    . ARG A 1 17  ? -3.847  -11.508 -7.978  1.00 1.61  ? 112 ARG A O    3  
ATOM   5582  C  CB   . ARG A 1 17  ? -1.367  -13.099 -9.116  1.00 1.79  ? 112 ARG A CB   3  
ATOM   5583  C  CG   . ARG A 1 17  ? -0.826  -14.494 -8.753  1.00 2.32  ? 112 ARG A CG   3  
ATOM   5584  C  CD   . ARG A 1 17  ? 0.716   -14.514 -8.811  1.00 3.13  ? 112 ARG A CD   3  
ATOM   5585  N  NE   . ARG A 1 17  ? 1.302   -15.842 -8.536  1.00 3.72  ? 112 ARG A NE   3  
ATOM   5586  C  CZ   . ARG A 1 17  ? 1.242   -16.936 -9.292  1.00 3.74  ? 112 ARG A CZ   3  
ATOM   5587  N  NH1  . ARG A 1 17  ? 0.586   -16.994 -10.431 1.00 3.88  ? 112 ARG A NH1  3  
ATOM   5588  N  NH2  . ARG A 1 17  ? 1.863   -18.034 -8.934  1.00 4.59  ? 112 ARG A NH2  3  
ATOM   5589  H  H    . ARG A 1 17  ? -2.421  -11.465 -10.770 1.00 1.04  ? 112 ARG A H    3  
ATOM   5590  H  HA   . ARG A 1 17  ? -3.150  -14.110 -9.794  1.00 1.68  ? 112 ARG A HA   3  
ATOM   5591  H  HB2  . ARG A 1 17  ? -0.799  -12.739 -9.977  1.00 2.07  ? 112 ARG A HB2  3  
ATOM   5592  H  HB3  . ARG A 1 17  ? -1.182  -12.409 -8.291  1.00 2.43  ? 112 ARG A HB3  3  
ATOM   5593  H  HG2  . ARG A 1 17  ? -1.164  -14.768 -7.752  1.00 3.00  ? 112 ARG A HG2  3  
ATOM   5594  H  HG3  . ARG A 1 17  ? -1.213  -15.218 -9.468  1.00 2.40  ? 112 ARG A HG3  3  
ATOM   5595  H  HD2  . ARG A 1 17  ? 1.050   -14.175 -9.793  1.00 3.25  ? 112 ARG A HD2  3  
ATOM   5596  H  HD3  . ARG A 1 17  ? 1.098   -13.805 -8.072  1.00 3.89  ? 112 ARG A HD3  3  
ATOM   5597  H  HE   . ARG A 1 17  ? 1.952   -15.883 -7.755  1.00 4.79  ? 112 ARG A HE   3  
ATOM   5598  H  HH11 . ARG A 1 17  ? 0.123   -16.185 -10.796 1.00 3.98  ? 112 ARG A HH11 3  
ATOM   5599  H  HH12 . ARG A 1 17  ? 0.619   -17.865 -10.954 1.00 4.57  ? 112 ARG A HH12 3  
ATOM   5600  H  HH21 . ARG A 1 17  ? 2.470   -18.060 -8.120  1.00 5.44  ? 112 ARG A HH21 3  
ATOM   5601  H  HH22 . ARG A 1 17  ? 1.817   -18.846 -9.535  1.00 4.81  ? 112 ARG A HH22 3  
ATOM   5602  N  N    . ALA A 1 18  ? -4.507  -13.635 -7.708  1.00 1.42  ? 113 ALA A N    3  
ATOM   5603  C  CA   . ALA A 1 18  ? -5.586  -13.361 -6.744  1.00 1.37  ? 113 ALA A CA   3  
ATOM   5604  C  C    . ALA A 1 18  ? -5.088  -13.034 -5.320  1.00 1.23  ? 113 ALA A C    3  
ATOM   5605  O  O    . ALA A 1 18  ? -4.005  -13.455 -4.910  1.00 1.77  ? 113 ALA A O    3  
ATOM   5606  C  CB   . ALA A 1 18  ? -6.544  -14.559 -6.746  1.00 2.00  ? 113 ALA A CB   3  
ATOM   5607  H  H    . ALA A 1 18  ? -4.393  -14.586 -8.016  1.00 1.57  ? 113 ALA A H    3  
ATOM   5608  H  HA   . ALA A 1 18  ? -6.146  -12.489 -7.093  1.00 1.26  ? 113 ALA A HA   3  
ATOM   5609  H  HB1  . ALA A 1 18  ? -6.918  -14.739 -7.754  1.00 2.03  ? 113 ALA A HB1  3  
ATOM   5610  H  HB2  . ALA A 1 18  ? -6.031  -15.452 -6.382  1.00 3.26  ? 113 ALA A HB2  3  
ATOM   5611  H  HB3  . ALA A 1 18  ? -7.395  -14.353 -6.094  1.00 2.43  ? 113 ALA A HB3  3  
ATOM   5612  N  N    . ARG A 1 19  ? -5.875  -12.248 -4.574  1.00 1.03  ? 114 ARG A N    3  
ATOM   5613  C  CA   . ARG A 1 19  ? -5.588  -11.768 -3.213  1.00 1.15  ? 114 ARG A CA   3  
ATOM   5614  C  C    . ARG A 1 19  ? -6.836  -11.852 -2.326  1.00 1.04  ? 114 ARG A C    3  
ATOM   5615  O  O    . ARG A 1 19  ? -7.907  -11.386 -2.714  1.00 1.06  ? 114 ARG A O    3  
ATOM   5616  C  CB   . ARG A 1 19  ? -5.102  -10.299 -3.229  1.00 1.62  ? 114 ARG A CB   3  
ATOM   5617  C  CG   . ARG A 1 19  ? -3.603  -10.127 -3.509  1.00 1.82  ? 114 ARG A CG   3  
ATOM   5618  C  CD   . ARG A 1 19  ? -3.246  -10.190 -5.001  1.00 2.63  ? 114 ARG A CD   3  
ATOM   5619  N  NE   . ARG A 1 19  ? -1.805  -10.294 -5.232  1.00 3.14  ? 114 ARG A NE   3  
ATOM   5620  C  CZ   . ARG A 1 19  ? -0.977  -11.287 -4.939  1.00 3.04  ? 114 ARG A CZ   3  
ATOM   5621  N  NH1  . ARG A 1 19  ? -1.353  -12.389 -4.325  1.00 3.21  ? 114 ARG A NH1  3  
ATOM   5622  N  NH2  . ARG A 1 19  ? 0.279   -11.170 -5.296  1.00 3.95  ? 114 ARG A NH2  3  
ATOM   5623  H  H    . ARG A 1 19  ? -6.736  -11.910 -4.993  1.00 1.23  ? 114 ARG A H    3  
ATOM   5624  H  HA   . ARG A 1 19  ? -4.817  -12.395 -2.761  1.00 1.43  ? 114 ARG A HA   3  
ATOM   5625  H  HB2  . ARG A 1 19  ? -5.688  -9.712  -3.939  1.00 2.21  ? 114 ARG A HB2  3  
ATOM   5626  H  HB3  . ARG A 1 19  ? -5.282  -9.874  -2.240  1.00 1.94  ? 114 ARG A HB3  3  
ATOM   5627  H  HG2  . ARG A 1 19  ? -3.289  -9.153  -3.132  1.00 2.77  ? 114 ARG A HG2  3  
ATOM   5628  H  HG3  . ARG A 1 19  ? -3.058  -10.886 -2.951  1.00 1.93  ? 114 ARG A HG3  3  
ATOM   5629  H  HD2  . ARG A 1 19  ? -3.724  -11.032 -5.481  1.00 2.91  ? 114 ARG A HD2  3  
ATOM   5630  H  HD3  . ARG A 1 19  ? -3.614  -9.288  -5.491  1.00 3.67  ? 114 ARG A HD3  3  
ATOM   5631  H  HE   . ARG A 1 19  ? -1.390  -9.502  -5.724  1.00 4.29  ? 114 ARG A HE   3  
ATOM   5632  H  HH11 . ARG A 1 19  ? -2.335  -12.603 -4.221  1.00 3.43  ? 114 ARG A HH11 3  
ATOM   5633  H  HH12 . ARG A 1 19  ? -0.657  -13.027 -3.943  1.00 3.89  ? 114 ARG A HH12 3  
ATOM   5634  H  HH21 . ARG A 1 19  ? 0.505   -10.451 -5.982  1.00 4.96  ? 114 ARG A HH21 3  
ATOM   5635  H  HH22 . ARG A 1 19  ? 0.940   -11.888 -5.062  1.00 4.13  ? 114 ARG A HH22 3  
ATOM   5636  N  N    . CYS A 1 20  ? -6.645  -12.357 -1.106  1.00 1.14  ? 115 CYS A N    3  
ATOM   5637  C  CA   . CYS A 1 20  ? -7.602  -12.330 0.002   1.00 1.15  ? 115 CYS A CA   3  
ATOM   5638  C  C    . CYS A 1 20  ? -6.853  -12.251 1.342   1.00 1.14  ? 115 CYS A C    3  
ATOM   5639  O  O    . CYS A 1 20  ? -5.622  -12.293 1.365   1.00 1.22  ? 115 CYS A O    3  
ATOM   5640  C  CB   . CYS A 1 20  ? -8.540  -13.546 -0.096  1.00 1.27  ? 115 CYS A CB   3  
ATOM   5641  S  SG   . CYS A 1 20  ? -7.651  -15.085 0.280   1.00 2.05  ? 115 CYS A SG   3  
ATOM   5642  H  H    . CYS A 1 20  ? -5.726  -12.710 -0.873  1.00 1.29  ? 115 CYS A H    3  
ATOM   5643  H  HA   . CYS A 1 20  ? -8.205  -11.426 -0.083  1.00 1.29  ? 115 CYS A HA   3  
ATOM   5644  H  HB2  . CYS A 1 20  ? -9.375  -13.428 0.600   1.00 2.30  ? 115 CYS A HB2  3  
ATOM   5645  H  HB3  . CYS A 1 20  ? -8.973  -13.602 -1.097  1.00 1.83  ? 115 CYS A HB3  3  
ATOM   5646  H  HG   . CYS A 1 20  ? -8.710  -15.901 0.118   1.00 2.44  ? 115 CYS A HG   3  
ATOM   5647  N  N    . LYS A 1 21  ? -7.568  -12.158 2.467   1.00 1.31  ? 116 LYS A N    3  
ATOM   5648  C  CA   . LYS A 1 21  ? -6.981  -11.848 3.786   1.00 1.42  ? 116 LYS A CA   3  
ATOM   5649  C  C    . LYS A 1 21  ? -5.888  -12.817 4.293   1.00 1.32  ? 116 LYS A C    3  
ATOM   5650  O  O    . LYS A 1 21  ? -5.139  -12.459 5.199   1.00 1.47  ? 116 LYS A O    3  
ATOM   5651  C  CB   . LYS A 1 21  ? -8.120  -11.719 4.820   1.00 1.75  ? 116 LYS A CB   3  
ATOM   5652  C  CG   . LYS A 1 21  ? -8.710  -13.081 5.235   1.00 3.00  ? 116 LYS A CG   3  
ATOM   5653  C  CD   . LYS A 1 21  ? -9.980  -12.955 6.082   1.00 3.42  ? 116 LYS A CD   3  
ATOM   5654  C  CE   . LYS A 1 21  ? -9.757  -12.357 7.468   1.00 3.76  ? 116 LYS A CE   3  
ATOM   5655  N  NZ   . LYS A 1 21  ? -11.028 -12.340 8.231   1.00 4.05  ? 116 LYS A NZ   3  
ATOM   5656  H  H    . LYS A 1 21  ? -8.574  -12.166 2.379   1.00 1.44  ? 116 LYS A H    3  
ATOM   5657  H  HA   . LYS A 1 21  ? -6.495  -10.877 3.709   1.00 1.46  ? 116 LYS A HA   3  
ATOM   5658  H  HB2  . LYS A 1 21  ? -7.728  -11.221 5.709   1.00 2.83  ? 116 LYS A HB2  3  
ATOM   5659  H  HB3  . LYS A 1 21  ? -8.909  -11.089 4.402   1.00 1.95  ? 116 LYS A HB3  3  
ATOM   5660  H  HG2  . LYS A 1 21  ? -8.961  -13.648 4.337   1.00 3.72  ? 116 LYS A HG2  3  
ATOM   5661  H  HG3  . LYS A 1 21  ? -7.972  -13.649 5.801   1.00 4.07  ? 116 LYS A HG3  3  
ATOM   5662  H  HD2  . LYS A 1 21  ? -10.691 -12.321 5.559   1.00 3.52  ? 116 LYS A HD2  3  
ATOM   5663  H  HD3  . LYS A 1 21  ? -10.415 -13.951 6.185   1.00 4.10  ? 116 LYS A HD3  3  
ATOM   5664  H  HE2  . LYS A 1 21  ? -9.016  -12.952 8.007   1.00 4.27  ? 116 LYS A HE2  3  
ATOM   5665  H  HE3  . LYS A 1 21  ? -9.376  -11.338 7.369   1.00 3.91  ? 116 LYS A HE3  3  
ATOM   5666  H  HZ1  . LYS A 1 21  ? -11.329 -13.295 8.419   1.00 4.47  ? 116 LYS A HZ1  3  
ATOM   5667  H  HZ2  . LYS A 1 21  ? -10.891 -11.836 9.101   1.00 4.25  ? 116 LYS A HZ2  3  
ATOM   5668  H  HZ3  . LYS A 1 21  ? -11.774 -11.918 7.685   1.00 4.30  ? 116 LYS A HZ3  3  
ATOM   5669  N  N    . ALA A 1 22  ? -5.830  -14.045 3.768   1.00 1.29  ? 117 ALA A N    3  
ATOM   5670  C  CA   . ALA A 1 22  ? -5.015  -15.131 4.316   1.00 1.36  ? 117 ALA A CA   3  
ATOM   5671  C  C    . ALA A 1 22  ? -3.501  -14.939 4.119   1.00 1.42  ? 117 ALA A C    3  
ATOM   5672  O  O    . ALA A 1 22  ? -2.746  -15.029 5.082   1.00 1.60  ? 117 ALA A O    3  
ATOM   5673  C  CB   . ALA A 1 22  ? -5.509  -16.444 3.693   1.00 1.59  ? 117 ALA A CB   3  
ATOM   5674  H  H    . ALA A 1 22  ? -6.444  -14.254 2.996   1.00 1.37  ? 117 ALA A H    3  
ATOM   5675  H  HA   . ALA A 1 22  ? -5.177  -15.184 5.394   1.00 1.44  ? 117 ALA A HA   3  
ATOM   5676  H  HB1  . ALA A 1 22  ? -6.566  -16.595 3.919   1.00 1.82  ? 117 ALA A HB1  3  
ATOM   5677  H  HB2  . ALA A 1 22  ? -5.373  -16.431 2.610   1.00 2.26  ? 117 ALA A HB2  3  
ATOM   5678  H  HB3  . ALA A 1 22  ? -4.942  -17.280 4.106   1.00 2.38  ? 117 ALA A HB3  3  
ATOM   5679  N  N    . ASP A 1 23  ? -3.052  -14.691 2.884   1.00 1.51  ? 118 ASP A N    3  
ATOM   5680  C  CA   . ASP A 1 23  ? -1.623  -14.745 2.517   1.00 1.78  ? 118 ASP A CA   3  
ATOM   5681  C  C    . ASP A 1 23  ? -0.814  -13.548 3.055   1.00 1.71  ? 118 ASP A C    3  
ATOM   5682  O  O    . ASP A 1 23  ? 0.412   -13.589 3.156   1.00 1.87  ? 118 ASP A O    3  
ATOM   5683  C  CB   . ASP A 1 23  ? -1.491  -14.901 0.994   1.00 2.09  ? 118 ASP A CB   3  
ATOM   5684  C  CG   . ASP A 1 23  ? -0.125  -15.472 0.602   1.00 3.01  ? 118 ASP A CG   3  
ATOM   5685  O  OD1  . ASP A 1 23  ? 0.172   -16.622 1.002   1.00 3.88  ? 118 ASP A OD1  3  
ATOM   5686  O  OD2  . ASP A 1 23  ? 0.634   -14.778 -0.117  1.00 3.63  ? 118 ASP A OD2  3  
ATOM   5687  H  H    . ASP A 1 23  ? -3.721  -14.460 2.168   1.00 1.51  ? 118 ASP A H    3  
ATOM   5688  H  HA   . ASP A 1 23  ? -1.208  -15.642 2.976   1.00 2.02  ? 118 ASP A HA   3  
ATOM   5689  H  HB2  . ASP A 1 23  ? -2.259  -15.591 0.637   1.00 2.44  ? 118 ASP A HB2  3  
ATOM   5690  H  HB3  . ASP A 1 23  ? -1.654  -13.936 0.511   1.00 2.00  ? 118 ASP A HB3  3  
ATOM   5691  N  N    . PHE A 1 24  ? -1.541  -12.494 3.429   1.00 1.61  ? 119 PHE A N    3  
ATOM   5692  C  CA   . PHE A 1 24  ? -1.071  -11.285 4.095   1.00 1.68  ? 119 PHE A CA   3  
ATOM   5693  C  C    . PHE A 1 24  ? -0.651  -11.545 5.556   1.00 2.49  ? 119 PHE A C    3  
ATOM   5694  O  O    . PHE A 1 24  ? 0.156   -10.799 6.107   1.00 2.82  ? 119 PHE A O    3  
ATOM   5695  C  CB   . PHE A 1 24  ? -2.236  -10.277 4.058   1.00 1.82  ? 119 PHE A CB   3  
ATOM   5696  C  CG   . PHE A 1 24  ? -2.523  -9.618  2.717   1.00 1.90  ? 119 PHE A CG   3  
ATOM   5697  C  CD1  . PHE A 1 24  ? -3.087  -10.358 1.660   1.00 2.57  ? 119 PHE A CD1  3  
ATOM   5698  C  CD2  . PHE A 1 24  ? -2.268  -8.244  2.535   1.00 2.82  ? 119 PHE A CD2  3  
ATOM   5699  C  CE1  . PHE A 1 24  ? -3.387  -9.739  0.435   1.00 2.92  ? 119 PHE A CE1  3  
ATOM   5700  C  CE2  . PHE A 1 24  ? -2.569  -7.623  1.307   1.00 2.84  ? 119 PHE A CE2  3  
ATOM   5701  C  CZ   . PHE A 1 24  ? -3.126  -8.370  0.256   1.00 2.58  ? 119 PHE A CZ   3  
ATOM   5702  H  H    . PHE A 1 24  ? -2.537  -12.578 3.303   1.00 1.63  ? 119 PHE A H    3  
ATOM   5703  H  HA   . PHE A 1 24  ? -0.211  -10.874 3.562   1.00 1.81  ? 119 PHE A HA   3  
ATOM   5704  H  HB2  . PHE A 1 24  ? -3.146  -10.768 4.405   1.00 2.01  ? 119 PHE A HB2  3  
ATOM   5705  H  HB3  . PHE A 1 24  ? -2.024  -9.499  4.781   1.00 1.99  ? 119 PHE A HB3  3  
ATOM   5706  H  HD1  . PHE A 1 24  ? -3.298  -11.408 1.785   1.00 3.49  ? 119 PHE A HD1  3  
ATOM   5707  H  HD2  . PHE A 1 24  ? -1.844  -7.659  3.338   1.00 3.57  ? 119 PHE A HD2  3  
ATOM   5708  H  HE1  . PHE A 1 24  ? -3.813  -10.321 -0.367  1.00 4.01  ? 119 PHE A HE1  3  
ATOM   5709  H  HE2  . PHE A 1 24  ? -2.369  -6.569  1.172   1.00 3.96  ? 119 PHE A HE2  3  
ATOM   5710  H  HZ   . PHE A 1 24  ? -3.350  -7.890  -0.686  1.00 2.99  ? 119 PHE A HZ   3  
ATOM   5711  N  N    . ARG A 1 25  ? -1.197  -12.588 6.197   1.00 1.62  ? 120 ARG A N    3  
ATOM   5712  C  CA   . ARG A 1 25  ? -1.134  -12.821 7.647   1.00 1.66  ? 120 ARG A CA   3  
ATOM   5713  C  C    . ARG A 1 25  ? 0.178   -13.498 8.090   1.00 1.94  ? 120 ARG A C    3  
ATOM   5714  O  O    . ARG A 1 25  ? 0.167   -14.477 8.834   1.00 2.90  ? 120 ARG A O    3  
ATOM   5715  C  CB   . ARG A 1 25  ? -2.399  -13.600 8.055   1.00 1.58  ? 120 ARG A CB   3  
ATOM   5716  C  CG   . ARG A 1 25  ? -2.807  -13.430 9.524   1.00 1.74  ? 120 ARG A CG   3  
ATOM   5717  C  CD   . ARG A 1 25  ? -2.517  -14.643 10.419  1.00 2.27  ? 120 ARG A CD   3  
ATOM   5718  N  NE   . ARG A 1 25  ? -3.247  -14.492 11.681  1.00 2.72  ? 120 ARG A NE   3  
ATOM   5719  C  CZ   . ARG A 1 25  ? -3.324  -15.330 12.699  1.00 3.16  ? 120 ARG A CZ   3  
ATOM   5720  N  NH1  . ARG A 1 25  ? -2.740  -16.508 12.689  1.00 3.44  ? 120 ARG A NH1  3  
ATOM   5721  N  NH2  . ARG A 1 25  ? -4.025  -14.959 13.746  1.00 4.15  ? 120 ARG A NH2  3  
ATOM   5722  H  H    . ARG A 1 25  ? -1.785  -13.214 5.655   1.00 1.63  ? 120 ARG A H    3  
ATOM   5723  H  HA   . ARG A 1 25  ? -1.173  -11.842 8.127   1.00 1.76  ? 120 ARG A HA   3  
ATOM   5724  H  HB2  . ARG A 1 25  ? -3.234  -13.235 7.452   1.00 1.58  ? 120 ARG A HB2  3  
ATOM   5725  H  HB3  . ARG A 1 25  ? -2.271  -14.654 7.832   1.00 1.70  ? 120 ARG A HB3  3  
ATOM   5726  H  HG2  . ARG A 1 25  ? -2.322  -12.551 9.942   1.00 2.00  ? 120 ARG A HG2  3  
ATOM   5727  H  HG3  . ARG A 1 25  ? -3.885  -13.261 9.540   1.00 2.07  ? 120 ARG A HG3  3  
ATOM   5728  H  HD2  . ARG A 1 25  ? -2.846  -15.553 9.915   1.00 2.71  ? 120 ARG A HD2  3  
ATOM   5729  H  HD3  . ARG A 1 25  ? -1.448  -14.705 10.622  1.00 3.25  ? 120 ARG A HD3  3  
ATOM   5730  H  HE   . ARG A 1 25  ? -3.748  -13.621 11.799  1.00 3.41  ? 120 ARG A HE   3  
ATOM   5731  H  HH11 . ARG A 1 25  ? -2.193  -16.795 11.897  1.00 3.67  ? 120 ARG A HH11 3  
ATOM   5732  H  HH12 . ARG A 1 25  ? -2.911  -17.155 13.454  1.00 3.94  ? 120 ARG A HH12 3  
ATOM   5733  H  HH21 . ARG A 1 25  ? -4.451  -14.042 13.753  1.00 4.87  ? 120 ARG A HH21 3  
ATOM   5734  H  HH22 . ARG A 1 25  ? -4.071  -15.539 14.577  1.00 4.55  ? 120 ARG A HH22 3  
ATOM   5735  N  N    . GLY A 1 26  ? 1.316   -13.002 7.596   1.00 1.75  ? 121 GLY A N    3  
ATOM   5736  C  CA   . GLY A 1 26  ? 2.636   -13.622 7.780   1.00 2.04  ? 121 GLY A CA   3  
ATOM   5737  C  C    . GLY A 1 26  ? 3.820   -12.724 7.437   1.00 1.99  ? 121 GLY A C    3  
ATOM   5738  O  O    . GLY A 1 26  ? 4.804   -13.230 6.908   1.00 2.64  ? 121 GLY A O    3  
ATOM   5739  H  H    . GLY A 1 26  ? 1.231   -12.207 6.971   1.00 2.02  ? 121 GLY A H    3  
ATOM   5740  H  HA2  . GLY A 1 26  ? 2.739   -13.952 8.814   1.00 2.37  ? 121 GLY A HA2  3  
ATOM   5741  H  HA3  . GLY A 1 26  ? 2.693   -14.513 7.152   1.00 2.22  ? 121 GLY A HA3  3  
ATOM   5742  N  N    . GLN A 1 27  ? 3.707   -11.415 7.703   1.00 1.66  ? 122 GLN A N    3  
ATOM   5743  C  CA   . GLN A 1 27  ? 4.668   -10.323 7.467   1.00 1.56  ? 122 GLN A CA   3  
ATOM   5744  C  C    . GLN A 1 27  ? 3.975   -8.982  7.802   1.00 1.27  ? 122 GLN A C    3  
ATOM   5745  O  O    . GLN A 1 27  ? 2.920   -8.990  8.440   1.00 2.02  ? 122 GLN A O    3  
ATOM   5746  C  CB   . GLN A 1 27  ? 5.277   -10.414 6.042   1.00 1.85  ? 122 GLN A CB   3  
ATOM   5747  C  CG   . GLN A 1 27  ? 6.700   -11.006 6.060   1.00 2.96  ? 122 GLN A CG   3  
ATOM   5748  C  CD   . GLN A 1 27  ? 7.017   -11.712 4.751   1.00 3.27  ? 122 GLN A CD   3  
ATOM   5749  O  OE1  . GLN A 1 27  ? 7.868   -11.316 3.969   1.00 3.34  ? 122 GLN A OE1  3  
ATOM   5750  N  NE2  . GLN A 1 27  ? 6.327   -12.789 4.454   1.00 4.12  ? 122 GLN A NE2  3  
ATOM   5751  H  H    . GLN A 1 27  ? 2.832   -11.101 8.104   1.00 1.84  ? 122 GLN A H    3  
ATOM   5752  H  HA   . GLN A 1 27  ? 5.483   -10.416 8.189   1.00 1.75  ? 122 GLN A HA   3  
ATOM   5753  H  HB2  . GLN A 1 27  ? 4.616   -11.014 5.415   1.00 2.01  ? 122 GLN A HB2  3  
ATOM   5754  H  HB3  . GLN A 1 27  ? 5.339   -9.451  5.545   1.00 1.95  ? 122 GLN A HB3  3  
ATOM   5755  H  HG2  . GLN A 1 27  ? 7.421   -10.209 6.231   1.00 3.42  ? 122 GLN A HG2  3  
ATOM   5756  H  HG3  . GLN A 1 27  ? 6.807   -11.728 6.868   1.00 3.64  ? 122 GLN A HG3  3  
ATOM   5757  H  HE21 . GLN A 1 27  ? 5.673   -13.159 5.135   1.00 4.75  ? 122 GLN A HE21 3  
ATOM   5758  H  HE22 . GLN A 1 27  ? 6.428   -13.165 3.533   1.00 4.38  ? 122 GLN A HE22 3  
ATOM   5759  N  N    . TRP A 1 28  ? 4.558   -7.840  7.418   1.00 1.20  ? 123 TRP A N    3  
ATOM   5760  C  CA   . TRP A 1 28  ? 3.936   -6.511  7.517   1.00 0.98  ? 123 TRP A CA   3  
ATOM   5761  C  C    . TRP A 1 28  ? 3.567   -5.981  6.119   1.00 1.05  ? 123 TRP A C    3  
ATOM   5762  O  O    . TRP A 1 28  ? 4.360   -6.085  5.184   1.00 1.35  ? 123 TRP A O    3  
ATOM   5763  C  CB   . TRP A 1 28  ? 4.899   -5.532  8.221   1.00 1.00  ? 123 TRP A CB   3  
ATOM   5764  C  CG   . TRP A 1 28  ? 4.754   -5.394  9.711   1.00 0.92  ? 123 TRP A CG   3  
ATOM   5765  C  CD1  . TRP A 1 28  ? 4.340   -6.354  10.566  1.00 1.42  ? 123 TRP A CD1  3  
ATOM   5766  C  CD2  . TRP A 1 28  ? 5.001   -4.218  10.545  1.00 1.35  ? 123 TRP A CD2  3  
ATOM   5767  N  NE1  . TRP A 1 28  ? 4.225   -5.829  11.841  1.00 1.34  ? 123 TRP A NE1  3  
ATOM   5768  C  CE2  . TRP A 1 28  ? 4.682   -4.535  11.899  1.00 1.08  ? 123 TRP A CE2  3  
ATOM   5769  C  CE3  . TRP A 1 28  ? 5.451   -2.908  10.295  1.00 2.45  ? 123 TRP A CE3  3  
ATOM   5770  C  CZ2  . TRP A 1 28  ? 4.828   -3.618  12.951  1.00 1.53  ? 123 TRP A CZ2  3  
ATOM   5771  C  CZ3  . TRP A 1 28  ? 5.593   -1.974  11.336  1.00 3.10  ? 123 TRP A CZ3  3  
ATOM   5772  C  CH2  . TRP A 1 28  ? 5.304   -2.328  12.662  1.00 2.58  ? 123 TRP A CH2  3  
ATOM   5773  H  H    . TRP A 1 28  ? 5.414   -7.884  6.881   1.00 1.94  ? 123 TRP A H    3  
ATOM   5774  H  HA   . TRP A 1 28  ? 3.016   -6.574  8.102   1.00 0.98  ? 123 TRP A HA   3  
ATOM   5775  H  HB2  . TRP A 1 28  ? 5.931   -5.797  7.983   1.00 1.31  ? 123 TRP A HB2  3  
ATOM   5776  H  HB3  . TRP A 1 28  ? 4.733   -4.538  7.805   1.00 1.09  ? 123 TRP A HB3  3  
ATOM   5777  H  HD1  . TRP A 1 28  ? 4.098   -7.363  10.273  1.00 2.18  ? 123 TRP A HD1  3  
ATOM   5778  H  HE1  . TRP A 1 28  ? 3.799   -6.314  12.616  1.00 1.94  ? 123 TRP A HE1  3  
ATOM   5779  H  HE3  . TRP A 1 28  ? 5.687   -2.618  9.289   1.00 2.90  ? 123 TRP A HE3  3  
ATOM   5780  H  HZ2  . TRP A 1 28  ? 4.587   -3.901  13.965  1.00 1.39  ? 123 TRP A HZ2  3  
ATOM   5781  H  HZ3  . TRP A 1 28  ? 5.937   -0.980  11.109  1.00 4.05  ? 123 TRP A HZ3  3  
ATOM   5782  H  HH2  . TRP A 1 28  ? 5.448   -1.609  13.451  1.00 3.10  ? 123 TRP A HH2  3  
ATOM   5783  N  N    . VAL A 1 29  ? 2.386   -5.370  5.987   1.00 0.94  ? 124 VAL A N    3  
ATOM   5784  C  CA   . VAL A 1 29  ? 1.926   -4.739  4.736   1.00 1.03  ? 124 VAL A CA   3  
ATOM   5785  C  C    . VAL A 1 29  ? 1.471   -3.300  5.005   1.00 0.94  ? 124 VAL A C    3  
ATOM   5786  O  O    . VAL A 1 29  ? 0.874   -3.010  6.041   1.00 0.94  ? 124 VAL A O    3  
ATOM   5787  C  CB   . VAL A 1 29  ? 0.825   -5.588  4.052   1.00 1.22  ? 124 VAL A CB   3  
ATOM   5788  C  CG1  . VAL A 1 29  ? 0.074   -4.856  2.923   1.00 1.71  ? 124 VAL A CG1  3  
ATOM   5789  C  CG2  . VAL A 1 29  ? 1.417   -6.889  3.482   1.00 2.02  ? 124 VAL A CG2  3  
ATOM   5790  H  H    . VAL A 1 29  ? 1.761   -5.337  6.795   1.00 0.93  ? 124 VAL A H    3  
ATOM   5791  H  HA   . VAL A 1 29  ? 2.767   -4.678  4.046   1.00 1.16  ? 124 VAL A HA   3  
ATOM   5792  H  HB   . VAL A 1 29  ? 0.092   -5.871  4.805   1.00 1.95  ? 124 VAL A HB   3  
ATOM   5793  H  HG11 . VAL A 1 29  ? -0.485  -4.010  3.325   1.00 2.46  ? 124 VAL A HG11 3  
ATOM   5794  H  HG12 . VAL A 1 29  ? 0.777   -4.501  2.171   1.00 2.49  ? 124 VAL A HG12 3  
ATOM   5795  H  HG13 . VAL A 1 29  ? -0.638  -5.531  2.451   1.00 2.28  ? 124 VAL A HG13 3  
ATOM   5796  H  HG21 . VAL A 1 29  ? 2.167   -6.658  2.724   1.00 3.05  ? 124 VAL A HG21 3  
ATOM   5797  H  HG22 . VAL A 1 29  ? 1.878   -7.477  4.276   1.00 2.63  ? 124 VAL A HG22 3  
ATOM   5798  H  HG23 . VAL A 1 29  ? 0.630   -7.491  3.028   1.00 2.52  ? 124 VAL A HG23 3  
ATOM   5799  N  N    . LEU A 1 30  ? 1.762   -2.399  4.063   1.00 0.94  ? 125 LEU A N    3  
ATOM   5800  C  CA   . LEU A 1 30  ? 1.391   -0.984  4.076   1.00 0.92  ? 125 LEU A CA   3  
ATOM   5801  C  C    . LEU A 1 30  ? 0.394   -0.717  2.940   1.00 0.85  ? 125 LEU A C    3  
ATOM   5802  O  O    . LEU A 1 30  ? 0.694   -0.950  1.769   1.00 0.86  ? 125 LEU A O    3  
ATOM   5803  C  CB   . LEU A 1 30  ? 2.694   -0.166  3.982   1.00 1.08  ? 125 LEU A CB   3  
ATOM   5804  C  CG   . LEU A 1 30  ? 2.507   1.366   4.027   1.00 1.40  ? 125 LEU A CG   3  
ATOM   5805  C  CD1  . LEU A 1 30  ? 3.744   2.022   4.658   1.00 1.87  ? 125 LEU A CD1  3  
ATOM   5806  C  CD2  . LEU A 1 30  ? 2.289   1.968   2.628   1.00 2.64  ? 125 LEU A CD2  3  
ATOM   5807  H  H    . LEU A 1 30  ? 2.251   -2.736  3.236   1.00 0.99  ? 125 LEU A H    3  
ATOM   5808  H  HA   . LEU A 1 30  ? 0.901   -0.743  5.021   1.00 0.93  ? 125 LEU A HA   3  
ATOM   5809  H  HB2  . LEU A 1 30  ? 3.313   -0.465  4.830   1.00 1.51  ? 125 LEU A HB2  3  
ATOM   5810  H  HB3  . LEU A 1 30  ? 3.239   -0.441  3.077   1.00 1.92  ? 125 LEU A HB3  3  
ATOM   5811  H  HG   . LEU A 1 30  ? 1.649   1.599   4.658   1.00 1.82  ? 125 LEU A HG   3  
ATOM   5812  H  HD11 . LEU A 1 30  ? 4.628   1.825   4.051   1.00 2.68  ? 125 LEU A HD11 3  
ATOM   5813  H  HD12 . LEU A 1 30  ? 3.589   3.097   4.736   1.00 2.68  ? 125 LEU A HD12 3  
ATOM   5814  H  HD13 . LEU A 1 30  ? 3.903   1.628   5.663   1.00 2.19  ? 125 LEU A HD13 3  
ATOM   5815  H  HD21 . LEU A 1 30  ? 2.270   3.056   2.688   1.00 3.08  ? 125 LEU A HD21 3  
ATOM   5816  H  HD22 . LEU A 1 30  ? 3.097   1.672   1.958   1.00 3.31  ? 125 LEU A HD22 3  
ATOM   5817  H  HD23 . LEU A 1 30  ? 1.339   1.640   2.210   1.00 3.63  ? 125 LEU A HD23 3  
ATOM   5818  N  N    . MET A 1 31  ? -0.800  -0.236  3.286   1.00 0.85  ? 126 MET A N    3  
ATOM   5819  C  CA   . MET A 1 31  ? -1.921  -0.058  2.353   1.00 0.82  ? 126 MET A CA   3  
ATOM   5820  C  C    . MET A 1 31  ? -2.184  1.418   2.058   1.00 0.72  ? 126 MET A C    3  
ATOM   5821  O  O    . MET A 1 31  ? -2.472  2.180   2.977   1.00 0.82  ? 126 MET A O    3  
ATOM   5822  C  CB   . MET A 1 31  ? -3.151  -0.756  2.956   1.00 0.98  ? 126 MET A CB   3  
ATOM   5823  C  CG   . MET A 1 31  ? -4.397  -0.671  2.068   1.00 1.87  ? 126 MET A CG   3  
ATOM   5824  S  SD   . MET A 1 31  ? -5.789  -1.660  2.673   1.00 1.90  ? 126 MET A SD   3  
ATOM   5825  C  CE   . MET A 1 31  ? -6.262  -0.709  4.139   1.00 2.94  ? 126 MET A CE   3  
ATOM   5826  H  H    . MET A 1 31  ? -0.973  -0.044  4.267   1.00 0.90  ? 126 MET A H    3  
ATOM   5827  H  HA   . MET A 1 31  ? -1.687  -0.542  1.407   1.00 0.84  ? 126 MET A HA   3  
ATOM   5828  H  HB2  . MET A 1 31  ? -2.911  -1.809  3.112   1.00 2.12  ? 126 MET A HB2  3  
ATOM   5829  H  HB3  . MET A 1 31  ? -3.376  -0.312  3.926   1.00 1.85  ? 126 MET A HB3  3  
ATOM   5830  H  HG2  . MET A 1 31  ? -4.716  0.369   1.978   1.00 2.88  ? 126 MET A HG2  3  
ATOM   5831  H  HG3  . MET A 1 31  ? -4.140  -1.027  1.070   1.00 2.97  ? 126 MET A HG3  3  
ATOM   5832  H  HE1  . MET A 1 31  ? -5.871  0.304   4.075   1.00 3.88  ? 126 MET A HE1  3  
ATOM   5833  H  HE2  . MET A 1 31  ? -7.350  -0.669  4.210   1.00 3.70  ? 126 MET A HE2  3  
ATOM   5834  H  HE3  . MET A 1 31  ? -5.866  -1.194  5.032   1.00 3.46  ? 126 MET A HE3  3  
ATOM   5835  N  N    . TYR A 1 32  ? -2.126  1.800   0.780   1.00 0.69  ? 127 TYR A N    3  
ATOM   5836  C  CA   . TYR A 1 32  ? -2.408  3.145   0.251   1.00 0.65  ? 127 TYR A CA   3  
ATOM   5837  C  C    . TYR A 1 32  ? -3.481  3.102   -0.856  1.00 0.64  ? 127 TYR A C    3  
ATOM   5838  O  O    . TYR A 1 32  ? -3.524  2.171   -1.666  1.00 0.68  ? 127 TYR A O    3  
ATOM   5839  C  CB   . TYR A 1 32  ? -1.096  3.747   -0.286  1.00 0.71  ? 127 TYR A CB   3  
ATOM   5840  C  CG   . TYR A 1 32  ? -1.258  4.933   -1.227  1.00 0.89  ? 127 TYR A CG   3  
ATOM   5841  C  CD1  . TYR A 1 32  ? -1.520  6.232   -0.740  1.00 1.51  ? 127 TYR A CD1  3  
ATOM   5842  C  CD2  . TYR A 1 32  ? -1.179  4.717   -2.617  1.00 2.26  ? 127 TYR A CD2  3  
ATOM   5843  C  CE1  . TYR A 1 32  ? -1.684  7.312   -1.636  1.00 1.64  ? 127 TYR A CE1  3  
ATOM   5844  C  CE2  . TYR A 1 32  ? -1.350  5.787   -3.509  1.00 2.65  ? 127 TYR A CE2  3  
ATOM   5845  C  CZ   . TYR A 1 32  ? -1.600  7.088   -3.030  1.00 1.76  ? 127 TYR A CZ   3  
ATOM   5846  O  OH   . TYR A 1 32  ? -1.757  8.090   -3.938  1.00 2.29  ? 127 TYR A OH   3  
ATOM   5847  H  H    . TYR A 1 32  ? -1.861  1.103   0.092   1.00 0.76  ? 127 TYR A H    3  
ATOM   5848  H  HA   . TYR A 1 32  ? -2.779  3.787   1.054   1.00 0.71  ? 127 TYR A HA   3  
ATOM   5849  H  HB2  . TYR A 1 32  ? -0.467  4.038   0.553   1.00 0.86  ? 127 TYR A HB2  3  
ATOM   5850  H  HB3  . TYR A 1 32  ? -0.557  2.966   -0.826  1.00 0.86  ? 127 TYR A HB3  3  
ATOM   5851  H  HD1  . TYR A 1 32  ? -1.598  6.406   0.323   1.00 2.62  ? 127 TYR A HD1  3  
ATOM   5852  H  HD2  . TYR A 1 32  ? -0.993  3.724   -3.001  1.00 3.29  ? 127 TYR A HD2  3  
ATOM   5853  H  HE1  . TYR A 1 32  ? -1.879  8.308   -1.265  1.00 2.55  ? 127 TYR A HE1  3  
ATOM   5854  H  HE2  . TYR A 1 32  ? -1.293  5.626   -4.571  1.00 3.90  ? 127 TYR A HE2  3  
ATOM   5855  H  HH   . TYR A 1 32  ? -1.858  8.984   -3.579  1.00 2.15  ? 127 TYR A HH   3  
ATOM   5856  N  N    . PHE A 1 33  ? -4.322  4.139   -0.913  1.00 0.70  ? 128 PHE A N    3  
ATOM   5857  C  CA   . PHE A 1 33  ? -5.405  4.298   -1.887  1.00 0.75  ? 128 PHE A CA   3  
ATOM   5858  C  C    . PHE A 1 33  ? -5.065  5.411   -2.892  1.00 1.94  ? 128 PHE A C    3  
ATOM   5859  O  O    . PHE A 1 33  ? -4.948  6.574   -2.510  1.00 2.28  ? 128 PHE A O    3  
ATOM   5860  C  CB   . PHE A 1 33  ? -6.696  4.594   -1.112  1.00 0.83  ? 128 PHE A CB   3  
ATOM   5861  C  CG   . PHE A 1 33  ? -7.191  3.411   -0.303  1.00 0.86  ? 128 PHE A CG   3  
ATOM   5862  C  CD1  . PHE A 1 33  ? -8.046  2.461   -0.894  1.00 2.05  ? 128 PHE A CD1  3  
ATOM   5863  C  CD2  . PHE A 1 33  ? -6.768  3.235   1.029   1.00 2.33  ? 128 PHE A CD2  3  
ATOM   5864  C  CE1  . PHE A 1 33  ? -8.476  1.343   -0.159  1.00 2.15  ? 128 PHE A CE1  3  
ATOM   5865  C  CE2  . PHE A 1 33  ? -7.190  2.110   1.759   1.00 2.22  ? 128 PHE A CE2  3  
ATOM   5866  C  CZ   . PHE A 1 33  ? -8.043  1.164   1.167   1.00 1.20  ? 128 PHE A CZ   3  
ATOM   5867  H  H    . PHE A 1 33  ? -4.198  4.886   -0.246  1.00 0.77  ? 128 PHE A H    3  
ATOM   5868  H  HA   . PHE A 1 33  ? -5.551  3.372   -2.445  1.00 0.72  ? 128 PHE A HA   3  
ATOM   5869  H  HB2  . PHE A 1 33  ? -6.541  5.448   -0.449  1.00 0.89  ? 128 PHE A HB2  3  
ATOM   5870  H  HB3  . PHE A 1 33  ? -7.471  4.882   -1.818  1.00 0.90  ? 128 PHE A HB3  3  
ATOM   5871  H  HD1  . PHE A 1 33  ? -8.370  2.584   -1.917  1.00 3.37  ? 128 PHE A HD1  3  
ATOM   5872  H  HD2  . PHE A 1 33  ? -6.111  3.958   1.490   1.00 3.49  ? 128 PHE A HD2  3  
ATOM   5873  H  HE1  . PHE A 1 33  ? -9.138  0.620   -0.613  1.00 3.41  ? 128 PHE A HE1  3  
ATOM   5874  H  HE2  . PHE A 1 33  ? -6.865  1.976   2.779   1.00 3.81  ? 128 PHE A HE2  3  
ATOM   5875  H  HZ   . PHE A 1 33  ? -8.371  0.301   1.731   1.00 1.45  ? 128 PHE A HZ   3  
ATOM   5876  N  N    . GLY A 1 34  ? -4.909  5.045   -4.169  1.00 0.96  ? 129 GLY A N    3  
ATOM   5877  C  CA   . GLY A 1 34  ? -4.355  5.885   -5.238  1.00 1.16  ? 129 GLY A CA   3  
ATOM   5878  C  C    . GLY A 1 34  ? -5.256  6.046   -6.466  1.00 1.09  ? 129 GLY A C    3  
ATOM   5879  O  O    . GLY A 1 34  ? -6.291  5.389   -6.600  1.00 1.04  ? 129 GLY A O    3  
ATOM   5880  H  H    . GLY A 1 34  ? -5.139  4.086   -4.417  1.00 0.94  ? 129 GLY A H    3  
ATOM   5881  H  HA2  . GLY A 1 34  ? -4.093  6.871   -4.858  1.00 1.41  ? 129 GLY A HA2  3  
ATOM   5882  H  HA3  . GLY A 1 34  ? -3.440  5.417   -5.589  1.00 1.34  ? 129 GLY A HA3  3  
ATOM   5883  N  N    . PHE A 1 35  ? -4.827  6.913   -7.384  1.00 1.34  ? 130 PHE A N    3  
ATOM   5884  C  CA   . PHE A 1 35  ? -5.536  7.293   -8.610  1.00 1.45  ? 130 PHE A CA   3  
ATOM   5885  C  C    . PHE A 1 35  ? -4.561  7.356   -9.801  1.00 1.90  ? 130 PHE A C    3  
ATOM   5886  O  O    . PHE A 1 35  ? -3.359  7.565   -9.626  1.00 2.81  ? 130 PHE A O    3  
ATOM   5887  C  CB   . PHE A 1 35  ? -6.221  8.640   -8.331  1.00 1.94  ? 130 PHE A CB   3  
ATOM   5888  C  CG   . PHE A 1 35  ? -7.018  9.251   -9.468  1.00 1.67  ? 130 PHE A CG   3  
ATOM   5889  C  CD1  . PHE A 1 35  ? -8.301  8.760   -9.780  1.00 2.73  ? 130 PHE A CD1  3  
ATOM   5890  C  CD2  . PHE A 1 35  ? -6.508  10.365  -10.161 1.00 2.66  ? 130 PHE A CD2  3  
ATOM   5891  C  CE1  . PHE A 1 35  ? -9.080  9.399   -10.763 1.00 3.38  ? 130 PHE A CE1  3  
ATOM   5892  C  CE2  . PHE A 1 35  ? -7.287  11.002  -11.143 1.00 3.05  ? 130 PHE A CE2  3  
ATOM   5893  C  CZ   . PHE A 1 35  ? -8.580  10.530  -11.433 1.00 3.07  ? 130 PHE A CZ   3  
ATOM   5894  H  H    . PHE A 1 35  ? -3.963  7.409   -7.206  1.00 1.57  ? 130 PHE A H    3  
ATOM   5895  H  HA   . PHE A 1 35  ? -6.306  6.553   -8.837  1.00 1.62  ? 130 PHE A HA   3  
ATOM   5896  H  HB2  . PHE A 1 35  ? -6.898  8.510   -7.488  1.00 2.62  ? 130 PHE A HB2  3  
ATOM   5897  H  HB3  . PHE A 1 35  ? -5.460  9.359   -8.017  1.00 3.01  ? 130 PHE A HB3  3  
ATOM   5898  H  HD1  . PHE A 1 35  ? -8.708  7.916   -9.242  1.00 3.48  ? 130 PHE A HD1  3  
ATOM   5899  H  HD2  . PHE A 1 35  ? -5.532  10.759  -9.911  1.00 3.73  ? 130 PHE A HD2  3  
ATOM   5900  H  HE1  . PHE A 1 35  ? -10.076 9.033   -10.980 1.00 4.76  ? 130 PHE A HE1  3  
ATOM   5901  H  HE2  . PHE A 1 35  ? -6.898  11.873  -11.651 1.00 3.87  ? 130 PHE A HE2  3  
ATOM   5902  H  HZ   . PHE A 1 35  ? -9.193  11.051  -12.155 1.00 3.85  ? 130 PHE A HZ   3  
ATOM   5903  N  N    . THR A 1 36  ? -5.049  7.139   -11.030 1.00 1.54  ? 131 THR A N    3  
ATOM   5904  C  CA   . THR A 1 36  ? -4.205  7.029   -12.239 1.00 1.74  ? 131 THR A CA   3  
ATOM   5905  C  C    . THR A 1 36  ? -4.047  8.383   -12.940 1.00 2.11  ? 131 THR A C    3  
ATOM   5906  O  O    . THR A 1 36  ? -4.550  8.558   -14.051 1.00 3.13  ? 131 THR A O    3  
ATOM   5907  C  CB   . THR A 1 36  ? -4.709  5.927   -13.180 1.00 1.87  ? 131 THR A CB   3  
ATOM   5908  O  OG1  . THR A 1 36  ? -6.017  6.244   -13.558 1.00 2.74  ? 131 THR A OG1  3  
ATOM   5909  C  CG2  . THR A 1 36  ? -4.709  4.548   -12.527 1.00 2.41  ? 131 THR A CG2  3  
ATOM   5910  H  H    . THR A 1 36  ? -6.042  6.979   -11.141 1.00 2.26  ? 131 THR A H    3  
ATOM   5911  H  HA   . THR A 1 36  ? -3.203  6.725   -11.936 1.00 1.86  ? 131 THR A HA   3  
ATOM   5912  H  HB   . THR A 1 36  ? -4.073  5.893   -14.066 1.00 2.45  ? 131 THR A HB   3  
ATOM   5913  H  HG1  . THR A 1 36  ? -5.937  7.069   -14.058 1.00 3.27  ? 131 THR A HG1  3  
ATOM   5914  H  HG21 . THR A 1 36  ? -3.708  4.314   -12.168 1.00 2.74  ? 131 THR A HG21 3  
ATOM   5915  H  HG22 . THR A 1 36  ? -5.410  4.524   -11.696 1.00 3.13  ? 131 THR A HG22 3  
ATOM   5916  H  HG23 . THR A 1 36  ? -5.009  3.797   -13.260 1.00 3.18  ? 131 THR A HG23 3  
ATOM   5917  N  N    . HIS A 1 37  ? -3.354  9.312   -12.259 1.00 1.82  ? 132 HIS A N    3  
ATOM   5918  C  CA   . HIS A 1 37  ? -2.781  10.597  -12.706 1.00 2.25  ? 132 HIS A CA   3  
ATOM   5919  C  C    . HIS A 1 37  ? -3.237  11.737  -11.793 1.00 2.00  ? 132 HIS A C    3  
ATOM   5920  O  O    . HIS A 1 37  ? -4.270  12.363  -12.038 1.00 2.49  ? 132 HIS A O    3  
ATOM   5921  C  CB   . HIS A 1 37  ? -3.002  10.939  -14.199 1.00 3.06  ? 132 HIS A CB   3  
ATOM   5922  C  CG   . HIS A 1 37  ? -2.348  12.239  -14.603 1.00 3.41  ? 132 HIS A CG   3  
ATOM   5923  N  ND1  . HIS A 1 37  ? -2.778  13.507  -14.249 1.00 3.41  ? 132 HIS A ND1  3  
ATOM   5924  C  CD2  . HIS A 1 37  ? -1.161  12.376  -15.267 1.00 4.63  ? 132 HIS A CD2  3  
ATOM   5925  C  CE1  . HIS A 1 37  ? -1.859  14.396  -14.668 1.00 4.33  ? 132 HIS A CE1  3  
ATOM   5926  N  NE2  . HIS A 1 37  ? -0.876  13.730  -15.309 1.00 5.01  ? 132 HIS A NE2  3  
ATOM   5927  H  H    . HIS A 1 37  ? -3.107  9.044   -11.313 1.00 1.83  ? 132 HIS A H    3  
ATOM   5928  H  HA   . HIS A 1 37  ? -1.701  10.509  -12.577 1.00 2.53  ? 132 HIS A HA   3  
ATOM   5929  H  HB2  . HIS A 1 37  ? -2.598  10.135  -14.819 1.00 3.79  ? 132 HIS A HB2  3  
ATOM   5930  H  HB3  . HIS A 1 37  ? -4.073  11.020  -14.398 1.00 3.30  ? 132 HIS A HB3  3  
ATOM   5931  H  HD1  . HIS A 1 37  ? -3.575  13.698  -13.647 1.00 3.37  ? 132 HIS A HD1  3  
ATOM   5932  H  HD2  . HIS A 1 37  ? -0.525  11.569  -15.615 1.00 5.52  ? 132 HIS A HD2  3  
ATOM   5933  H  HE1  . HIS A 1 37  ? -1.861  15.458  -14.450 1.00 4.90  ? 132 HIS A HE1  3  
ATOM   5934  H  HE2  . HIS A 1 37  ? 0.004   14.142  -15.632 1.00 6.02  ? 132 HIS A HE2  3  
ATOM   5935  N  N    . CYS A 1 38  ? -2.376  12.091  -10.849 1.00 2.00  ? 133 CYS A N    3  
ATOM   5936  C  CA   . CYS A 1 38  ? -2.497  13.190  -9.914  1.00 1.85  ? 133 CYS A CA   3  
ATOM   5937  C  C    . CYS A 1 38  ? -1.551  14.326  -10.347 1.00 2.08  ? 133 CYS A C    3  
ATOM   5938  O  O    . CYS A 1 38  ? -0.766  14.156  -11.296 1.00 2.34  ? 133 CYS A O    3  
ATOM   5939  C  CB   . CYS A 1 38  ? -2.108  12.595  -8.550  1.00 1.71  ? 133 CYS A CB   3  
ATOM   5940  S  SG   . CYS A 1 38  ? -3.079  11.135  -8.092  1.00 3.12  ? 133 CYS A SG   3  
ATOM   5941  H  H    . CYS A 1 38  ? -1.517  11.591  -10.741 1.00 2.51  ? 133 CYS A H    3  
ATOM   5942  H  HA   . CYS A 1 38  ? -3.520  13.563  -9.872  1.00 1.97  ? 133 CYS A HA   3  
ATOM   5943  H  HB2  . CYS A 1 38  ? -1.053  12.315  -8.567  1.00 2.44  ? 133 CYS A HB2  3  
ATOM   5944  H  HB3  . CYS A 1 38  ? -2.229  13.333  -7.759  1.00 1.83  ? 133 CYS A HB3  3  
ATOM   5945  N  N    . PRO A 1 39  ? -1.573  15.473  -9.657  1.00 2.14  ? 134 PRO A N    3  
ATOM   5946  C  CA   . PRO A 1 39  ? -0.429  16.368  -9.626  1.00 2.38  ? 134 PRO A CA   3  
ATOM   5947  C  C    . PRO A 1 39  ? 0.672   15.771  -8.731  1.00 2.29  ? 134 PRO A C    3  
ATOM   5948  O  O    . PRO A 1 39  ? 0.588   14.627  -8.293  1.00 3.26  ? 134 PRO A O    3  
ATOM   5949  C  CB   . PRO A 1 39  ? -1.014  17.680  -9.118  1.00 2.66  ? 134 PRO A CB   3  
ATOM   5950  C  CG   . PRO A 1 39  ? -2.083  17.221  -8.130  1.00 2.45  ? 134 PRO A CG   3  
ATOM   5951  C  CD   . PRO A 1 39  ? -2.640  15.965  -8.793  1.00 2.17  ? 134 PRO A CD   3  
ATOM   5952  H  HA   . PRO A 1 39  ? -0.024  16.522  -10.627 1.00 2.67  ? 134 PRO A HA   3  
ATOM   5953  H  HB2  . PRO A 1 39  ? -0.269  18.321  -8.654  1.00 2.90  ? 134 PRO A HB2  3  
ATOM   5954  H  HB3  . PRO A 1 39  ? -1.496  18.174  -9.961  1.00 2.93  ? 134 PRO A HB3  3  
ATOM   5955  H  HG2  . PRO A 1 39  ? -1.611  16.957  -7.184  1.00 2.53  ? 134 PRO A HG2  3  
ATOM   5956  H  HG3  . PRO A 1 39  ? -2.855  17.976  -7.983  1.00 2.65  ? 134 PRO A HG3  3  
ATOM   5957  H  HD2  . PRO A 1 39  ? -2.929  15.244  -8.032  1.00 2.08  ? 134 PRO A HD2  3  
ATOM   5958  H  HD3  . PRO A 1 39  ? -3.506  16.226  -9.401  1.00 2.35  ? 134 PRO A HD3  3  
ATOM   5959  N  N    . ASP A 1 40  ? 1.720   16.540  -8.440  1.00 2.31  ? 135 ASP A N    3  
ATOM   5960  C  CA   . ASP A 1 40  ? 2.901   16.111  -7.678  1.00 2.29  ? 135 ASP A CA   3  
ATOM   5961  C  C    . ASP A 1 40  ? 2.679   16.042  -6.149  1.00 2.03  ? 135 ASP A C    3  
ATOM   5962  O  O    . ASP A 1 40  ? 3.557   16.407  -5.368  1.00 2.18  ? 135 ASP A O    3  
ATOM   5963  C  CB   . ASP A 1 40  ? 4.121   16.958  -8.087  1.00 3.14  ? 135 ASP A CB   3  
ATOM   5964  C  CG   . ASP A 1 40  ? 4.087   18.389  -7.548  1.00 2.94  ? 135 ASP A CG   3  
ATOM   5965  O  OD1  . ASP A 1 40  ? 3.137   19.128  -7.880  1.00 3.50  ? 135 ASP A OD1  3  
ATOM   5966  O  OD2  . ASP A 1 40  ? 5.032   18.760  -6.806  1.00 3.66  ? 135 ASP A OD2  3  
ATOM   5967  H  H    . ASP A 1 40  ? 1.685   17.513  -8.716  1.00 3.10  ? 135 ASP A H    3  
ATOM   5968  H  HA   . ASP A 1 40  ? 3.122   15.094  -7.993  1.00 2.16  ? 135 ASP A HA   3  
ATOM   5969  H  HB2  . ASP A 1 40  ? 5.023   16.462  -7.725  1.00 4.06  ? 135 ASP A HB2  3  
ATOM   5970  H  HB3  . ASP A 1 40  ? 4.184   16.991  -9.175  1.00 4.34  ? 135 ASP A HB3  3  
ATOM   5971  N  N    . ILE A 1 41  ? 1.503   15.585  -5.712  1.00 1.83  ? 136 ILE A N    3  
ATOM   5972  C  CA   . ILE A 1 41  ? 1.182   15.303  -4.301  1.00 1.82  ? 136 ILE A CA   3  
ATOM   5973  C  C    . ILE A 1 41  ? 1.445   13.823  -3.994  1.00 1.62  ? 136 ILE A C    3  
ATOM   5974  O  O    . ILE A 1 41  ? 2.527   13.486  -3.518  1.00 1.76  ? 136 ILE A O    3  
ATOM   5975  C  CB   . ILE A 1 41  ? -0.230  15.842  -3.941  1.00 2.11  ? 136 ILE A CB   3  
ATOM   5976  C  CG1  . ILE A 1 41  ? -0.596  15.651  -2.454  1.00 2.14  ? 136 ILE A CG1  3  
ATOM   5977  C  CG2  . ILE A 1 41  ? -1.389  15.291  -4.802  1.00 3.31  ? 136 ILE A CG2  3  
ATOM   5978  C  CD1  . ILE A 1 41  ? 0.390   16.307  -1.477  1.00 3.20  ? 136 ILE A CD1  3  
ATOM   5979  H  H    . ILE A 1 41  ? 0.857   15.259  -6.427  1.00 1.85  ? 136 ILE A H    3  
ATOM   5980  H  HA   . ILE A 1 41  ? 1.897   15.839  -3.679  1.00 1.91  ? 136 ILE A HA   3  
ATOM   5981  H  HB   . ILE A 1 41  ? -0.199  16.917  -4.126  1.00 3.12  ? 136 ILE A HB   3  
ATOM   5982  H  HG12 . ILE A 1 41  ? -1.579  16.093  -2.281  1.00 2.29  ? 136 ILE A HG12 3  
ATOM   5983  H  HG13 . ILE A 1 41  ? -0.662  14.588  -2.223  1.00 3.01  ? 136 ILE A HG13 3  
ATOM   5984  H  HG21 . ILE A 1 41  ? -1.093  15.192  -5.844  1.00 4.62  ? 136 ILE A HG21 3  
ATOM   5985  H  HG22 . ILE A 1 41  ? -1.722  14.320  -4.437  1.00 3.41  ? 136 ILE A HG22 3  
ATOM   5986  H  HG23 . ILE A 1 41  ? -2.237  15.974  -4.744  1.00 4.02  ? 136 ILE A HG23 3  
ATOM   5987  H  HD11 . ILE A 1 41  ? 1.353   15.797  -1.508  1.00 4.08  ? 136 ILE A HD11 3  
ATOM   5988  H  HD12 . ILE A 1 41  ? 0.521   17.359  -1.729  1.00 3.44  ? 136 ILE A HD12 3  
ATOM   5989  H  HD13 . ILE A 1 41  ? -0.007  16.233  -0.464  1.00 3.85  ? 136 ILE A HD13 3  
ATOM   5990  N  N    . CYS A 1 42  ? 0.522   12.940  -4.365  1.00 1.41  ? 137 CYS A N    3  
ATOM   5991  C  CA   . CYS A 1 42  ? 0.623   11.488  -4.307  1.00 1.34  ? 137 CYS A CA   3  
ATOM   5992  C  C    . CYS A 1 42  ? 1.991   10.910  -4.752  1.00 1.12  ? 137 CYS A C    3  
ATOM   5993  O  O    . CYS A 1 42  ? 2.570   10.140  -3.983  1.00 1.21  ? 137 CYS A O    3  
ATOM   5994  C  CB   . CYS A 1 42  ? -0.568  10.969  -5.122  1.00 1.41  ? 137 CYS A CB   3  
ATOM   5995  S  SG   . CYS A 1 42  ? -2.158  11.240  -4.285  1.00 2.05  ? 137 CYS A SG   3  
ATOM   5996  H  H    . CYS A 1 42  ? -0.369  13.278  -4.694  1.00 1.40  ? 137 CYS A H    3  
ATOM   5997  H  HA   . CYS A 1 42  ? 0.473   11.183  -3.271  1.00 1.60  ? 137 CYS A HA   3  
ATOM   5998  H  HB2  . CYS A 1 42  ? -0.607  11.472  -6.092  1.00 1.33  ? 137 CYS A HB2  3  
ATOM   5999  H  HB3  . CYS A 1 42  ? -0.440  9.906   -5.310  1.00 1.54  ? 137 CYS A HB3  3  
ATOM   6000  N  N    . PRO A 1 43  ? 2.570   11.269  -5.919  1.00 1.01  ? 138 PRO A N    3  
ATOM   6001  C  CA   . PRO A 1 43  ? 3.869   10.747  -6.346  1.00 1.10  ? 138 PRO A CA   3  
ATOM   6002  C  C    . PRO A 1 43  ? 5.078   11.434  -5.687  1.00 1.40  ? 138 PRO A C    3  
ATOM   6003  O  O    . PRO A 1 43  ? 6.198   10.989  -5.918  1.00 1.70  ? 138 PRO A O    3  
ATOM   6004  C  CB   . PRO A 1 43  ? 3.880   10.913  -7.868  1.00 1.30  ? 138 PRO A CB   3  
ATOM   6005  C  CG   . PRO A 1 43  ? 3.065   12.183  -8.067  1.00 1.25  ? 138 PRO A CG   3  
ATOM   6006  C  CD   . PRO A 1 43  ? 1.981   12.052  -6.997  1.00 1.00  ? 138 PRO A CD   3  
ATOM   6007  H  HA   . PRO A 1 43  ? 3.928   9.684   -6.114  1.00 1.06  ? 138 PRO A HA   3  
ATOM   6008  H  HB2  . PRO A 1 43  ? 4.887   11.007  -8.276  1.00 1.62  ? 138 PRO A HB2  3  
ATOM   6009  H  HB3  . PRO A 1 43  ? 3.361   10.073  -8.331  1.00 1.35  ? 138 PRO A HB3  3  
ATOM   6010  H  HG2  . PRO A 1 43  ? 3.697   13.045  -7.852  1.00 1.47  ? 138 PRO A HG2  3  
ATOM   6011  H  HG3  . PRO A 1 43  ? 2.641   12.250  -9.069  1.00 1.37  ? 138 PRO A HG3  3  
ATOM   6012  H  HD2  . PRO A 1 43  ? 1.680   13.039  -6.658  1.00 1.10  ? 138 PRO A HD2  3  
ATOM   6013  H  HD3  . PRO A 1 43  ? 1.128   11.517  -7.415  1.00 0.99  ? 138 PRO A HD3  3  
ATOM   6014  N  N    . ASP A 1 44  ? 4.929   12.536  -4.937  1.00 1.51  ? 139 ASP A N    3  
ATOM   6015  C  CA   . ASP A 1 44  ? 5.923   12.946  -3.941  1.00 1.69  ? 139 ASP A CA   3  
ATOM   6016  C  C    . ASP A 1 44  ? 5.780   12.190  -2.625  1.00 1.52  ? 139 ASP A C    3  
ATOM   6017  O  O    . ASP A 1 44  ? 6.788   11.720  -2.117  1.00 1.42  ? 139 ASP A O    3  
ATOM   6018  C  CB   . ASP A 1 44  ? 5.928   14.467  -3.728  1.00 2.19  ? 139 ASP A CB   3  
ATOM   6019  C  CG   . ASP A 1 44  ? 6.886   15.204  -4.669  1.00 3.69  ? 139 ASP A CG   3  
ATOM   6020  O  OD1  . ASP A 1 44  ? 7.675   14.575  -5.411  1.00 4.99  ? 139 ASP A OD1  3  
ATOM   6021  O  OD2  . ASP A 1 44  ? 6.926   16.453  -4.617  1.00 4.23  ? 139 ASP A OD2  3  
ATOM   6022  H  H    . ASP A 1 44  ? 3.991   12.841  -4.702  1.00 1.40  ? 139 ASP A H    3  
ATOM   6023  H  HA   . ASP A 1 44  ? 6.912   12.664  -4.295  1.00 1.72  ? 139 ASP A HA   3  
ATOM   6024  H  HB2  . ASP A 1 44  ? 4.918   14.861  -3.827  1.00 1.44  ? 139 ASP A HB2  3  
ATOM   6025  H  HB3  . ASP A 1 44  ? 6.260   14.674  -2.709  1.00 2.98  ? 139 ASP A HB3  3  
ATOM   6026  N  N    . GLU A 1 45  ? 4.578   12.051  -2.060  1.00 1.57  ? 140 GLU A N    3  
ATOM   6027  C  CA   . GLU A 1 45  ? 4.438   11.390  -0.762  1.00 1.67  ? 140 GLU A CA   3  
ATOM   6028  C  C    . GLU A 1 45  ? 4.668   9.866   -0.848  1.00 1.31  ? 140 GLU A C    3  
ATOM   6029  O  O    . GLU A 1 45  ? 5.217   9.273   0.077   1.00 1.40  ? 140 GLU A O    3  
ATOM   6030  C  CB   . GLU A 1 45  ? 3.146   11.810  -0.047  1.00 2.08  ? 140 GLU A CB   3  
ATOM   6031  C  CG   . GLU A 1 45  ? 3.235   11.652  1.487   1.00 2.36  ? 140 GLU A CG   3  
ATOM   6032  C  CD   . GLU A 1 45  ? 4.308   12.509  2.191   1.00 3.30  ? 140 GLU A CD   3  
ATOM   6033  O  OE1  . GLU A 1 45  ? 4.903   13.428  1.574   1.00 4.46  ? 140 GLU A OE1  3  
ATOM   6034  O  OE2  . GLU A 1 45  ? 4.569   12.257  3.389   1.00 3.55  ? 140 GLU A OE2  3  
ATOM   6035  H  H    . GLU A 1 45  ? 3.770   12.505  -2.470  1.00 1.64  ? 140 GLU A H    3  
ATOM   6036  H  HA   . GLU A 1 45  ? 5.241   11.795  -0.161  1.00 2.02  ? 140 GLU A HA   3  
ATOM   6037  H  HB2  . GLU A 1 45  ? 2.934   12.857  -0.268  1.00 2.71  ? 140 GLU A HB2  3  
ATOM   6038  H  HB3  . GLU A 1 45  ? 2.317   11.210  -0.427  1.00 2.25  ? 140 GLU A HB3  3  
ATOM   6039  H  HG2  . GLU A 1 45  ? 2.264   11.917  1.908   1.00 2.45  ? 140 GLU A HG2  3  
ATOM   6040  H  HG3  . GLU A 1 45  ? 3.416   10.603  1.723   1.00 2.70  ? 140 GLU A HG3  3  
ATOM   6041  N  N    . LEU A 1 46  ? 4.367   9.210   -1.978  1.00 1.01  ? 141 LEU A N    3  
ATOM   6042  C  CA   . LEU A 1 46  ? 4.780   7.814   -2.199  1.00 0.92  ? 141 LEU A CA   3  
ATOM   6043  C  C    . LEU A 1 46  ? 6.304   7.692   -2.432  1.00 0.85  ? 141 LEU A C    3  
ATOM   6044  O  O    . LEU A 1 46  ? 6.920   6.730   -1.964  1.00 0.90  ? 141 LEU A O    3  
ATOM   6045  C  CB   . LEU A 1 46  ? 3.846   7.123   -3.224  1.00 1.11  ? 141 LEU A CB   3  
ATOM   6046  C  CG   . LEU A 1 46  ? 4.361   6.893   -4.660  1.00 1.77  ? 141 LEU A CG   3  
ATOM   6047  C  CD1  . LEU A 1 46  ? 5.164   5.583   -4.753  1.00 2.86  ? 141 LEU A CD1  3  
ATOM   6048  C  CD2  . LEU A 1 46  ? 3.171   6.791   -5.629  1.00 2.51  ? 141 LEU A CD2  3  
ATOM   6049  H  H    . LEU A 1 46  ? 3.846   9.692   -2.705  1.00 0.97  ? 141 LEU A H    3  
ATOM   6050  H  HA   . LEU A 1 46  ? 4.586   7.300   -1.262  1.00 1.17  ? 141 LEU A HA   3  
ATOM   6051  H  HB2  . LEU A 1 46  ? 3.565   6.154   -2.810  1.00 2.37  ? 141 LEU A HB2  3  
ATOM   6052  H  HB3  . LEU A 1 46  ? 2.914   7.688   -3.270  1.00 2.62  ? 141 LEU A HB3  3  
ATOM   6053  H  HG   . LEU A 1 46  ? 4.981   7.734   -4.970  1.00 3.10  ? 141 LEU A HG   3  
ATOM   6054  H  HD11 . LEU A 1 46  ? 4.584   4.751   -4.356  1.00 3.17  ? 141 LEU A HD11 3  
ATOM   6055  H  HD12 . LEU A 1 46  ? 5.400   5.364   -5.793  1.00 3.60  ? 141 LEU A HD12 3  
ATOM   6056  H  HD13 . LEU A 1 46  ? 6.099   5.664   -4.202  1.00 4.01  ? 141 LEU A HD13 3  
ATOM   6057  H  HD21 . LEU A 1 46  ? 2.596   7.718   -5.614  1.00 3.46  ? 141 LEU A HD21 3  
ATOM   6058  H  HD22 . LEU A 1 46  ? 3.538   6.624   -6.642  1.00 3.32  ? 141 LEU A HD22 3  
ATOM   6059  H  HD23 . LEU A 1 46  ? 2.521   5.964   -5.341  1.00 2.58  ? 141 LEU A HD23 3  
ATOM   6060  N  N    . GLU A 1 47  ? 6.933   8.700   -3.052  1.00 0.85  ? 142 GLU A N    3  
ATOM   6061  C  CA   . GLU A 1 47  ? 8.398   8.822   -3.182  1.00 1.04  ? 142 GLU A CA   3  
ATOM   6062  C  C    . GLU A 1 47  ? 9.042   8.971   -1.793  1.00 1.14  ? 142 GLU A C    3  
ATOM   6063  O  O    . GLU A 1 47  ? 9.923   8.203   -1.423  1.00 1.22  ? 142 GLU A O    3  
ATOM   6064  C  CB   . GLU A 1 47  ? 8.741   9.980   -4.144  1.00 1.22  ? 142 GLU A CB   3  
ATOM   6065  C  CG   . GLU A 1 47  ? 10.230  10.259  -4.393  1.00 1.57  ? 142 GLU A CG   3  
ATOM   6066  C  CD   . GLU A 1 47  ? 10.423  11.430  -5.371  1.00 2.77  ? 142 GLU A CD   3  
ATOM   6067  O  OE1  . GLU A 1 47  ? 9.651   11.540  -6.356  1.00 4.05  ? 142 GLU A OE1  3  
ATOM   6068  O  OE2  . GLU A 1 47  ? 11.358  12.242  -5.197  1.00 3.33  ? 142 GLU A OE2  3  
ATOM   6069  H  H    . GLU A 1 47  ? 6.369   9.495   -3.314  1.00 0.80  ? 142 GLU A H    3  
ATOM   6070  H  HA   . GLU A 1 47  ? 8.782   7.915   -3.639  1.00 1.15  ? 142 GLU A HA   3  
ATOM   6071  H  HB2  . GLU A 1 47  ? 8.282   9.739   -5.102  1.00 1.25  ? 142 GLU A HB2  3  
ATOM   6072  H  HB3  . GLU A 1 47  ? 8.304   10.901  -3.779  1.00 1.31  ? 142 GLU A HB3  3  
ATOM   6073  H  HG2  . GLU A 1 47  ? 10.715  10.500  -3.447  1.00 1.67  ? 142 GLU A HG2  3  
ATOM   6074  H  HG3  . GLU A 1 47  ? 10.699  9.366   -4.809  1.00 1.91  ? 142 GLU A HG3  3  
ATOM   6075  N  N    . LYS A 1 48  ? 8.520   9.874   -0.967  1.00 1.27  ? 143 LYS A N    3  
ATOM   6076  C  CA   . LYS A 1 48  ? 8.819   10.062  0.456   1.00 1.42  ? 143 LYS A CA   3  
ATOM   6077  C  C    . LYS A 1 48  ? 8.633   8.772   1.282   1.00 1.34  ? 143 LYS A C    3  
ATOM   6078  O  O    . LYS A 1 48  ? 9.467   8.456   2.142   1.00 1.37  ? 143 LYS A O    3  
ATOM   6079  C  CB   . LYS A 1 48  ? 7.900   11.208  0.905   1.00 1.64  ? 143 LYS A CB   3  
ATOM   6080  C  CG   . LYS A 1 48  ? 7.750   11.450  2.414   1.00 1.49  ? 143 LYS A CG   3  
ATOM   6081  C  CD   . LYS A 1 48  ? 9.024   11.761  3.209   1.00 2.37  ? 143 LYS A CD   3  
ATOM   6082  C  CE   . LYS A 1 48  ? 9.396   13.252  3.209   1.00 3.13  ? 143 LYS A CE   3  
ATOM   6083  N  NZ   . LYS A 1 48  ? 9.782   13.761  1.875   1.00 4.12  ? 143 LYS A NZ   3  
ATOM   6084  H  H    . LYS A 1 48  ? 7.796   10.475  -1.348  1.00 1.30  ? 143 LYS A H    3  
ATOM   6085  H  HA   . LYS A 1 48  ? 9.851   10.382  0.565   1.00 1.51  ? 143 LYS A HA   3  
ATOM   6086  H  HB2  . LYS A 1 48  ? 8.183   12.121  0.380   1.00 1.85  ? 143 LYS A HB2  3  
ATOM   6087  H  HB3  . LYS A 1 48  ? 6.907   10.975  0.552   1.00 1.87  ? 143 LYS A HB3  3  
ATOM   6088  H  HG2  . LYS A 1 48  ? 7.060   12.275  2.560   1.00 2.11  ? 143 LYS A HG2  3  
ATOM   6089  H  HG3  . LYS A 1 48  ? 7.264   10.569  2.833   1.00 1.58  ? 143 LYS A HG3  3  
ATOM   6090  H  HD2  . LYS A 1 48  ? 8.831   11.482  4.244   1.00 2.79  ? 143 LYS A HD2  3  
ATOM   6091  H  HD3  . LYS A 1 48  ? 9.859   11.155  2.857   1.00 3.12  ? 143 LYS A HD3  3  
ATOM   6092  H  HE2  . LYS A 1 48  ? 8.544   13.831  3.585   1.00 2.96  ? 143 LYS A HE2  3  
ATOM   6093  H  HE3  . LYS A 1 48  ? 10.231  13.393  3.899   1.00 3.93  ? 143 LYS A HE3  3  
ATOM   6094  H  HZ1  . LYS A 1 48  ? 10.487  13.160  1.460   1.00 5.01  ? 143 LYS A HZ1  3  
ATOM   6095  H  HZ2  . LYS A 1 48  ? 8.956   13.819  1.281   1.00 3.91  ? 143 LYS A HZ2  3  
ATOM   6096  H  HZ3  . LYS A 1 48  ? 10.155  14.703  1.962   1.00 4.85  ? 143 LYS A HZ3  3  
ATOM   6097  N  N    . LEU A 1 49  ? 7.602   7.972   0.987   1.00 1.28  ? 144 LEU A N    3  
ATOM   6098  C  CA   . LEU A 1 49  ? 7.403   6.647   1.579   1.00 1.23  ? 144 LEU A CA   3  
ATOM   6099  C  C    . LEU A 1 49  ? 8.515   5.690   1.137   1.00 1.08  ? 144 LEU A C    3  
ATOM   6100  O  O    . LEU A 1 49  ? 9.223   5.191   2.009   1.00 1.17  ? 144 LEU A O    3  
ATOM   6101  C  CB   . LEU A 1 49  ? 5.985   6.131   1.276   1.00 1.39  ? 144 LEU A CB   3  
ATOM   6102  C  CG   . LEU A 1 49  ? 4.863   6.533   2.272   1.00 1.90  ? 144 LEU A CG   3  
ATOM   6103  C  CD1  . LEU A 1 49  ? 4.595   5.376   3.247   1.00 2.84  ? 144 LEU A CD1  3  
ATOM   6104  C  CD2  . LEU A 1 49  ? 5.093   7.804   3.113   1.00 3.56  ? 144 LEU A CD2  3  
ATOM   6105  H  H    . LEU A 1 49  ? 6.915   8.313   0.322   1.00 1.30  ? 144 LEU A H    3  
ATOM   6106  H  HA   . LEU A 1 49  ? 7.501   6.726   2.658   1.00 1.29  ? 144 LEU A HA   3  
ATOM   6107  H  HB2  . LEU A 1 49  ? 5.698   6.478   0.290   1.00 2.48  ? 144 LEU A HB2  3  
ATOM   6108  H  HB3  . LEU A 1 49  ? 6.019   5.042   1.207   1.00 1.87  ? 144 LEU A HB3  3  
ATOM   6109  H  HG   . LEU A 1 49  ? 3.959   6.688   1.681   1.00 2.23  ? 144 LEU A HG   3  
ATOM   6110  H  HD11 . LEU A 1 49  ? 5.485   5.171   3.843   1.00 3.82  ? 144 LEU A HD11 3  
ATOM   6111  H  HD12 . LEU A 1 49  ? 3.769   5.633   3.911   1.00 3.84  ? 144 LEU A HD12 3  
ATOM   6112  H  HD13 . LEU A 1 49  ? 4.322   4.480   2.692   1.00 2.71  ? 144 LEU A HD13 3  
ATOM   6113  H  HD21 . LEU A 1 49  ? 4.182   8.045   3.661   1.00 4.17  ? 144 LEU A HD21 3  
ATOM   6114  H  HD22 . LEU A 1 49  ? 5.899   7.655   3.830   1.00 4.19  ? 144 LEU A HD22 3  
ATOM   6115  H  HD23 . LEU A 1 49  ? 5.333   8.650   2.477   1.00 4.48  ? 144 LEU A HD23 3  
ATOM   6116  N  N    . VAL A 1 50  ? 8.768   5.492   -0.164  1.00 0.96  ? 145 VAL A N    3  
ATOM   6117  C  CA   . VAL A 1 50  ? 9.874   4.593   -0.574  1.00 0.94  ? 145 VAL A CA   3  
ATOM   6118  C  C    . VAL A 1 50  ? 11.261  5.107   -0.136  1.00 0.96  ? 145 VAL A C    3  
ATOM   6119  O  O    . VAL A 1 50  ? 12.159  4.307   0.109   1.00 1.06  ? 145 VAL A O    3  
ATOM   6120  C  CB   . VAL A 1 50  ? 9.864   4.189   -2.067  1.00 1.15  ? 145 VAL A CB   3  
ATOM   6121  C  CG1  . VAL A 1 50  ? 8.579   3.421   -2.425  1.00 2.72  ? 145 VAL A CG1  3  
ATOM   6122  C  CG2  . VAL A 1 50  ? 10.064  5.353   -3.041  1.00 2.36  ? 145 VAL A CG2  3  
ATOM   6123  H  H    . VAL A 1 50  ? 8.176   5.949   -0.867  1.00 0.97  ? 145 VAL A H    3  
ATOM   6124  H  HA   . VAL A 1 50  ? 9.707   3.665   -0.031  1.00 1.07  ? 145 VAL A HA   3  
ATOM   6125  H  HB   . VAL A 1 50  ? 10.698  3.505   -2.214  1.00 2.73  ? 145 VAL A HB   3  
ATOM   6126  H  HG11 . VAL A 1 50  ? 7.707   4.067   -2.323  1.00 3.88  ? 145 VAL A HG11 3  
ATOM   6127  H  HG12 . VAL A 1 50  ? 8.638   3.064   -3.454  1.00 3.19  ? 145 VAL A HG12 3  
ATOM   6128  H  HG13 . VAL A 1 50  ? 8.467   2.561   -1.764  1.00 3.69  ? 145 VAL A HG13 3  
ATOM   6129  H  HG21 . VAL A 1 50  ? 10.969  5.907   -2.795  1.00 3.68  ? 145 VAL A HG21 3  
ATOM   6130  H  HG22 . VAL A 1 50  ? 10.153  4.970   -4.058  1.00 2.93  ? 145 VAL A HG22 3  
ATOM   6131  H  HG23 . VAL A 1 50  ? 9.203   6.008   -2.988  1.00 2.97  ? 145 VAL A HG23 3  
ATOM   6132  N  N    . GLN A 1 51  ? 11.421  6.419   0.064   1.00 0.99  ? 146 GLN A N    3  
ATOM   6133  C  CA   . GLN A 1 51  ? 12.583  7.070   0.670   1.00 1.18  ? 146 GLN A CA   3  
ATOM   6134  C  C    . GLN A 1 51  ? 12.732  6.627   2.136   1.00 1.25  ? 146 GLN A C    3  
ATOM   6135  O  O    . GLN A 1 51  ? 13.765  6.049   2.475   1.00 1.27  ? 146 GLN A O    3  
ATOM   6136  C  CB   . GLN A 1 51  ? 12.401  8.589   0.451   1.00 1.48  ? 146 GLN A CB   3  
ATOM   6137  C  CG   . GLN A 1 51  ? 13.269  9.587   1.228   1.00 1.39  ? 146 GLN A CG   3  
ATOM   6138  C  CD   . GLN A 1 51  ? 12.870  11.022  0.844   1.00 1.84  ? 146 GLN A CD   3  
ATOM   6139  O  OE1  . GLN A 1 51  ? 11.895  11.589  1.326   1.00 2.97  ? 146 GLN A OE1  3  
ATOM   6140  N  NE2  . GLN A 1 51  ? 13.546  11.637  -0.103  1.00 2.21  ? 146 GLN A NE2  3  
ATOM   6141  H  H    . GLN A 1 51  ? 10.665  7.035   -0.230  1.00 0.95  ? 146 GLN A H    3  
ATOM   6142  H  HA   . GLN A 1 51  ? 13.488  6.751   0.154   1.00 1.22  ? 146 GLN A HA   3  
ATOM   6143  H  HB2  . GLN A 1 51  ? 12.537  8.784   -0.615  1.00 2.53  ? 146 GLN A HB2  3  
ATOM   6144  H  HB3  . GLN A 1 51  ? 11.377  8.839   0.684   1.00 2.30  ? 146 GLN A HB3  3  
ATOM   6145  H  HG2  . GLN A 1 51  ? 13.121  9.456   2.301   1.00 2.04  ? 146 GLN A HG2  3  
ATOM   6146  H  HG3  . GLN A 1 51  ? 14.319  9.417   0.992   1.00 2.24  ? 146 GLN A HG3  3  
ATOM   6147  H  HE21 . GLN A 1 51  ? 14.360  11.218  -0.513  1.00 2.89  ? 146 GLN A HE21 3  
ATOM   6148  H  HE22 . GLN A 1 51  ? 13.235  12.555  -0.372  1.00 2.55  ? 146 GLN A HE22 3  
ATOM   6149  N  N    . VAL A 1 52  ? 11.710  6.788   2.989   1.00 1.38  ? 147 VAL A N    3  
ATOM   6150  C  CA   . VAL A 1 52  ? 11.804  6.307   4.384   1.00 1.59  ? 147 VAL A CA   3  
ATOM   6151  C  C    . VAL A 1 52  ? 11.863  4.769   4.480   1.00 1.48  ? 147 VAL A C    3  
ATOM   6152  O  O    . VAL A 1 52  ? 12.563  4.260   5.346   1.00 1.58  ? 147 VAL A O    3  
ATOM   6153  C  CB   . VAL A 1 52  ? 10.740  6.928   5.322   1.00 1.97  ? 147 VAL A CB   3  
ATOM   6154  C  CG1  . VAL A 1 52  ? 9.319   6.387   5.124   1.00 2.57  ? 147 VAL A CG1  3  
ATOM   6155  C  CG2  . VAL A 1 52  ? 11.133  6.756   6.797   1.00 2.04  ? 147 VAL A CG2  3  
ATOM   6156  H  H    . VAL A 1 52  ? 10.869  7.280   2.678   1.00 1.42  ? 147 VAL A H    3  
ATOM   6157  H  HA   . VAL A 1 52  ? 12.764  6.677   4.748   1.00 1.72  ? 147 VAL A HA   3  
ATOM   6158  H  HB   . VAL A 1 52  ? 10.712  7.999   5.120   1.00 3.31  ? 147 VAL A HB   3  
ATOM   6159  H  HG11 . VAL A 1 52  ? 9.282   5.313   5.305   1.00 2.43  ? 147 VAL A HG11 3  
ATOM   6160  H  HG12 . VAL A 1 52  ? 8.635   6.886   5.811   1.00 3.19  ? 147 VAL A HG12 3  
ATOM   6161  H  HG13 . VAL A 1 52  ? 8.999   6.600   4.112   1.00 3.78  ? 147 VAL A HG13 3  
ATOM   6162  H  HG21 . VAL A 1 52  ? 11.115  5.705   7.078   1.00 2.58  ? 147 VAL A HG21 3  
ATOM   6163  H  HG22 . VAL A 1 52  ? 12.133  7.158   6.970   1.00 3.11  ? 147 VAL A HG22 3  
ATOM   6164  H  HG23 . VAL A 1 52  ? 10.425  7.291   7.428   1.00 2.44  ? 147 VAL A HG23 3  
ATOM   6165  N  N    . VAL A 1 53  ? 11.234  4.014   3.569   1.00 1.35  ? 148 VAL A N    3  
ATOM   6166  C  CA   . VAL A 1 53  ? 11.352  2.539   3.523   1.00 1.37  ? 148 VAL A CA   3  
ATOM   6167  C  C    . VAL A 1 53  ? 12.794  2.089   3.213   1.00 1.33  ? 148 VAL A C    3  
ATOM   6168  O  O    . VAL A 1 53  ? 13.277  1.139   3.829   1.00 1.48  ? 148 VAL A O    3  
ATOM   6169  C  CB   . VAL A 1 53  ? 10.341  1.916   2.528   1.00 1.32  ? 148 VAL A CB   3  
ATOM   6170  C  CG1  . VAL A 1 53  ? 10.594  0.424   2.248   1.00 1.61  ? 148 VAL A CG1  3  
ATOM   6171  C  CG2  . VAL A 1 53  ? 8.905   2.062   3.064   1.00 1.94  ? 148 VAL A CG2  3  
ATOM   6172  H  H    . VAL A 1 53  ? 10.609  4.477   2.903   1.00 1.28  ? 148 VAL A H    3  
ATOM   6173  H  HA   . VAL A 1 53  ? 11.100  2.164   4.515   1.00 1.54  ? 148 VAL A HA   3  
ATOM   6174  H  HB   . VAL A 1 53  ? 10.424  2.451   1.585   1.00 1.70  ? 148 VAL A HB   3  
ATOM   6175  H  HG11 . VAL A 1 53  ? 11.536  0.291   1.715   1.00 2.37  ? 148 VAL A HG11 3  
ATOM   6176  H  HG12 . VAL A 1 53  ? 10.628  -0.134  3.186   1.00 2.57  ? 148 VAL A HG12 3  
ATOM   6177  H  HG13 . VAL A 1 53  ? 9.796   0.022   1.623   1.00 2.12  ? 148 VAL A HG13 3  
ATOM   6178  H  HG21 . VAL A 1 53  ? 8.191   1.711   2.317   1.00 1.90  ? 148 VAL A HG21 3  
ATOM   6179  H  HG22 . VAL A 1 53  ? 8.787   1.477   3.974   1.00 2.75  ? 148 VAL A HG22 3  
ATOM   6180  H  HG23 . VAL A 1 53  ? 8.678   3.100   3.297   1.00 3.18  ? 148 VAL A HG23 3  
ATOM   6181  N  N    . ARG A 1 54  ? 13.523  2.807   2.343   1.00 1.21  ? 149 ARG A N    3  
ATOM   6182  C  CA   . ARG A 1 54  ? 14.958  2.562   2.112   1.00 1.29  ? 149 ARG A CA   3  
ATOM   6183  C  C    . ARG A 1 54  ? 15.784  2.857   3.365   1.00 1.51  ? 149 ARG A C    3  
ATOM   6184  O  O    . ARG A 1 54  ? 16.693  2.103   3.704   1.00 1.73  ? 149 ARG A O    3  
ATOM   6185  C  CB   . ARG A 1 54  ? 15.470  3.381   0.919   1.00 1.19  ? 149 ARG A CB   3  
ATOM   6186  C  CG   . ARG A 1 54  ? 14.933  2.810   -0.399  1.00 1.26  ? 149 ARG A CG   3  
ATOM   6187  C  CD   . ARG A 1 54  ? 15.745  1.613   -0.930  1.00 1.85  ? 149 ARG A CD   3  
ATOM   6188  N  NE   . ARG A 1 54  ? 16.740  2.020   -1.942  1.00 2.21  ? 149 ARG A NE   3  
ATOM   6189  C  CZ   . ARG A 1 54  ? 16.522  2.190   -3.241  1.00 2.73  ? 149 ARG A CZ   3  
ATOM   6190  N  NH1  . ARG A 1 54  ? 15.331  2.033   -3.783  1.00 3.40  ? 149 ARG A NH1  3  
ATOM   6191  N  NH2  . ARG A 1 54  ? 17.524  2.528   -4.019  1.00 3.78  ? 149 ARG A NH2  3  
ATOM   6192  H  H    . ARG A 1 54  ? 13.080  3.574   1.851   1.00 1.10  ? 149 ARG A H    3  
ATOM   6193  H  HA   . ARG A 1 54  ? 15.093  1.510   1.870   1.00 1.39  ? 149 ARG A HA   3  
ATOM   6194  H  HB2  . ARG A 1 54  ? 15.143  4.415   1.021   1.00 1.37  ? 149 ARG A HB2  3  
ATOM   6195  H  HB3  . ARG A 1 54  ? 16.561  3.370   0.896   1.00 1.38  ? 149 ARG A HB3  3  
ATOM   6196  H  HG2  . ARG A 1 54  ? 13.906  2.487   -0.239  1.00 1.84  ? 149 ARG A HG2  3  
ATOM   6197  H  HG3  . ARG A 1 54  ? 14.916  3.615   -1.131  1.00 1.81  ? 149 ARG A HG3  3  
ATOM   6198  H  HD2  . ARG A 1 54  ? 16.251  1.116   -0.101  1.00 2.85  ? 149 ARG A HD2  3  
ATOM   6199  H  HD3  . ARG A 1 54  ? 15.060  0.884   -1.367  1.00 2.55  ? 149 ARG A HD3  3  
ATOM   6200  H  HE   . ARG A 1 54  ? 17.693  2.146   -1.623  1.00 3.16  ? 149 ARG A HE   3  
ATOM   6201  H  HH11 . ARG A 1 54  ? 14.558  1.767   -3.196  1.00 3.45  ? 149 ARG A HH11 3  
ATOM   6202  H  HH12 . ARG A 1 54  ? 15.198  2.156   -4.771  1.00 4.47  ? 149 ARG A HH12 3  
ATOM   6203  H  HH21 . ARG A 1 54  ? 18.446  2.638   -3.601  1.00 4.28  ? 149 ARG A HH21 3  
ATOM   6204  H  HH22 . ARG A 1 54  ? 17.412  2.671   -5.005  1.00 4.55  ? 149 ARG A HH22 3  
ATOM   6205  N  N    . GLN A 1 55  ? 15.426  3.912   4.097   1.00 1.54  ? 150 GLN A N    3  
ATOM   6206  C  CA   . GLN A 1 55  ? 16.018  4.178   5.419   1.00 1.78  ? 150 GLN A CA   3  
ATOM   6207  C  C    . GLN A 1 55  ? 15.688  3.095   6.468   1.00 1.91  ? 150 GLN A C    3  
ATOM   6208  O  O    . GLN A 1 55  ? 16.500  2.884   7.361   1.00 2.34  ? 150 GLN A O    3  
ATOM   6209  C  CB   . GLN A 1 55  ? 15.645  5.575   5.948   1.00 1.91  ? 150 GLN A CB   3  
ATOM   6210  C  CG   . GLN A 1 55  ? 16.156  6.714   5.047   1.00 2.41  ? 150 GLN A CG   3  
ATOM   6211  C  CD   . GLN A 1 55  ? 16.069  8.115   5.664   1.00 2.76  ? 150 GLN A CD   3  
ATOM   6212  O  OE1  . GLN A 1 55  ? 16.722  9.037   5.195   1.00 3.89  ? 150 GLN A OE1  3  
ATOM   6213  N  NE2  . GLN A 1 55  ? 15.296  8.352   6.702   1.00 2.70  ? 150 GLN A NE2  3  
ATOM   6214  H  H    . GLN A 1 55  ? 14.710  4.515   3.702   1.00 1.44  ? 150 GLN A H    3  
ATOM   6215  H  HA   . GLN A 1 55  ? 17.106  4.142   5.316   1.00 1.87  ? 150 GLN A HA   3  
ATOM   6216  H  HB2  . GLN A 1 55  ? 14.566  5.656   6.064   1.00 2.14  ? 150 GLN A HB2  3  
ATOM   6217  H  HB3  . GLN A 1 55  ? 16.101  5.687   6.934   1.00 2.24  ? 150 GLN A HB3  3  
ATOM   6218  H  HG2  . GLN A 1 55  ? 17.201  6.525   4.803   1.00 2.83  ? 150 GLN A HG2  3  
ATOM   6219  H  HG3  . GLN A 1 55  ? 15.586  6.720   4.120   1.00 2.92  ? 150 GLN A HG3  3  
ATOM   6220  H  HE21 . GLN A 1 55  ? 14.748  7.625   7.119   1.00 3.05  ? 150 GLN A HE21 3  
ATOM   6221  H  HE22 . GLN A 1 55  ? 15.341  9.284   7.113   1.00 3.10  ? 150 GLN A HE22 3  
ATOM   6222  N  N    . LEU A 1 56  ? 14.553  2.387   6.369   1.00 1.64  ? 151 LEU A N    3  
ATOM   6223  C  CA   . LEU A 1 56  ? 14.227  1.247   7.241   1.00 1.71  ? 151 LEU A CA   3  
ATOM   6224  C  C    . LEU A 1 56  ? 15.088  0.013   6.930   1.00 1.93  ? 151 LEU A C    3  
ATOM   6225  O  O    . LEU A 1 56  ? 15.702  -0.532  7.844   1.00 2.31  ? 151 LEU A O    3  
ATOM   6226  C  CB   . LEU A 1 56  ? 12.709  0.950   7.187   1.00 1.45  ? 151 LEU A CB   3  
ATOM   6227  C  CG   . LEU A 1 56  ? 11.920  1.537   8.375   1.00 1.35  ? 151 LEU A CG   3  
ATOM   6228  C  CD1  . LEU A 1 56  ? 12.061  3.059   8.529   1.00 2.33  ? 151 LEU A CD1  3  
ATOM   6229  C  CD2  . LEU A 1 56  ? 10.432  1.196   8.234   1.00 1.88  ? 151 LEU A CD2  3  
ATOM   6230  H  H    . LEU A 1 56  ? 13.876  2.652   5.665   1.00 1.39  ? 151 LEU A H    3  
ATOM   6231  H  HA   . LEU A 1 56  ? 14.495  1.513   8.264   1.00 1.90  ? 151 LEU A HA   3  
ATOM   6232  H  HB2  . LEU A 1 56  ? 12.279  1.316   6.255   1.00 1.48  ? 151 LEU A HB2  3  
ATOM   6233  H  HB3  . LEU A 1 56  ? 12.558  -0.133  7.200   1.00 1.49  ? 151 LEU A HB3  3  
ATOM   6234  H  HG   . LEU A 1 56  ? 12.283  1.070   9.289   1.00 1.73  ? 151 LEU A HG   3  
ATOM   6235  H  HD11 . LEU A 1 56  ? 11.666  3.551   7.645   1.00 2.68  ? 151 LEU A HD11 3  
ATOM   6236  H  HD12 . LEU A 1 56  ? 11.497  3.396   9.400   1.00 3.16  ? 151 LEU A HD12 3  
ATOM   6237  H  HD13 . LEU A 1 56  ? 13.105  3.338   8.668   1.00 3.15  ? 151 LEU A HD13 3  
ATOM   6238  H  HD21 . LEU A 1 56  ? 9.888   1.603   9.086   1.00 2.60  ? 151 LEU A HD21 3  
ATOM   6239  H  HD22 . LEU A 1 56  ? 10.032  1.630   7.316   1.00 2.90  ? 151 LEU A HD22 3  
ATOM   6240  H  HD23 . LEU A 1 56  ? 10.298  0.113   8.212   1.00 2.23  ? 151 LEU A HD23 3  
ATOM   6241  N  N    . GLU A 1 57  ? 15.191  -0.414  5.665   1.00 1.77  ? 152 GLU A N    3  
ATOM   6242  C  CA   . GLU A 1 57  ? 16.018  -1.584  5.313   1.00 2.03  ? 152 GLU A CA   3  
ATOM   6243  C  C    . GLU A 1 57  ? 17.527  -1.361  5.524   1.00 2.23  ? 152 GLU A C    3  
ATOM   6244  O  O    . GLU A 1 57  ? 18.290  -2.324  5.534   1.00 2.49  ? 152 GLU A O    3  
ATOM   6245  C  CB   . GLU A 1 57  ? 15.742  -2.091  3.889   1.00 1.88  ? 152 GLU A CB   3  
ATOM   6246  C  CG   . GLU A 1 57  ? 16.191  -1.118  2.789   1.00 3.01  ? 152 GLU A CG   3  
ATOM   6247  C  CD   . GLU A 1 57  ? 16.416  -1.809  1.449   1.00 3.18  ? 152 GLU A CD   3  
ATOM   6248  O  OE1  . GLU A 1 57  ? 17.169  -2.814  1.399   1.00 3.66  ? 152 GLU A OE1  3  
ATOM   6249  O  OE2  . GLU A 1 57  ? 15.891  -1.321  0.422   1.00 3.81  ? 152 GLU A OE2  3  
ATOM   6250  H  H    . GLU A 1 57  ? 14.670  0.064   4.941   1.00 1.52  ? 152 GLU A H    3  
ATOM   6251  H  HA   . GLU A 1 57  ? 15.736  -2.392  5.991   1.00 2.33  ? 152 GLU A HA   3  
ATOM   6252  H  HB2  . GLU A 1 57  ? 16.272  -3.037  3.775   1.00 2.59  ? 152 GLU A HB2  3  
ATOM   6253  H  HB3  . GLU A 1 57  ? 14.677  -2.293  3.773   1.00 2.44  ? 152 GLU A HB3  3  
ATOM   6254  H  HG2  . GLU A 1 57  ? 15.422  -0.358  2.688   1.00 3.76  ? 152 GLU A HG2  3  
ATOM   6255  H  HG3  . GLU A 1 57  ? 17.126  -0.631  3.062   1.00 4.16  ? 152 GLU A HG3  3  
ATOM   6256  N  N    . ALA A 1 58  ? 17.972  -0.116  5.733   1.00 2.24  ? 153 ALA A N    3  
ATOM   6257  C  CA   . ALA A 1 58  ? 19.352  0.187   6.108   1.00 2.53  ? 153 ALA A CA   3  
ATOM   6258  C  C    . ALA A 1 58  ? 19.755  -0.421  7.468   1.00 2.62  ? 153 ALA A C    3  
ATOM   6259  O  O    . ALA A 1 58  ? 20.952  -0.563  7.725   1.00 2.97  ? 153 ALA A O    3  
ATOM   6260  C  CB   . ALA A 1 58  ? 19.538  1.710   6.080   1.00 2.65  ? 153 ALA A CB   3  
ATOM   6261  H  H    . ALA A 1 58  ? 17.317  0.650   5.664   1.00 2.12  ? 153 ALA A H    3  
ATOM   6262  H  HA   . ALA A 1 58  ? 20.008  -0.260  5.360   1.00 2.71  ? 153 ALA A HA   3  
ATOM   6263  H  HB1  . ALA A 1 58  ? 20.587  1.955   6.248   1.00 3.02  ? 153 ALA A HB1  3  
ATOM   6264  H  HB2  . ALA A 1 58  ? 19.233  2.104   5.110   1.00 2.74  ? 153 ALA A HB2  3  
ATOM   6265  H  HB3  . ALA A 1 58  ? 18.937  2.172   6.865   1.00 3.23  ? 153 ALA A HB3  3  
ATOM   6266  N  N    . GLU A 1 59  ? 18.790  -0.800  8.318   1.00 2.42  ? 154 GLU A N    3  
ATOM   6267  C  CA   . GLU A 1 59  ? 18.997  -1.608  9.520   1.00 2.55  ? 154 GLU A CA   3  
ATOM   6268  C  C    . GLU A 1 59  ? 17.961  -2.759  9.529   1.00 2.17  ? 154 GLU A C    3  
ATOM   6269  O  O    . GLU A 1 59  ? 16.944  -2.685  10.228  1.00 3.01  ? 154 GLU A O    3  
ATOM   6270  C  CB   . GLU A 1 59  ? 18.979  -0.709  10.771  1.00 3.65  ? 154 GLU A CB   3  
ATOM   6271  C  CG   . GLU A 1 59  ? 20.207  0.224   10.748  1.00 4.68  ? 154 GLU A CG   3  
ATOM   6272  C  CD   . GLU A 1 59  ? 20.516  0.976   12.040  1.00 5.67  ? 154 GLU A CD   3  
ATOM   6273  O  OE1  . GLU A 1 59  ? 19.995  0.663   13.126  1.00 5.90  ? 154 GLU A OE1  3  
ATOM   6274  O  OE2  . GLU A 1 59  ? 21.403  1.866   11.988  1.00 6.67  ? 154 GLU A OE2  3  
ATOM   6275  H  H    . GLU A 1 59  ? 17.827  -0.610  8.071   1.00 2.28  ? 154 GLU A H    3  
ATOM   6276  H  HA   . GLU A 1 59  ? 19.987  -2.061  9.482   1.00 2.79  ? 154 GLU A HA   3  
ATOM   6277  H  HB2  . GLU A 1 59  ? 18.060  -0.121  10.809  1.00 4.10  ? 154 GLU A HB2  3  
ATOM   6278  H  HB3  . GLU A 1 59  ? 19.024  -1.354  11.643  1.00 3.87  ? 154 GLU A HB3  3  
ATOM   6279  H  HG2  . GLU A 1 59  ? 21.091  -0.369  10.510  1.00 4.97  ? 154 GLU A HG2  3  
ATOM   6280  H  HG3  . GLU A 1 59  ? 20.073  0.963   9.957   1.00 5.06  ? 154 GLU A HG3  3  
ATOM   6281  N  N    . PRO A 1 60  ? 18.195  -3.829  8.735   1.00 2.44  ? 155 PRO A N    3  
ATOM   6282  C  CA   . PRO A 1 60  ? 17.197  -4.819  8.316   1.00 3.41  ? 155 PRO A CA   3  
ATOM   6283  C  C    . PRO A 1 60  ? 16.858  -5.877  9.388   1.00 2.99  ? 155 PRO A C    3  
ATOM   6284  O  O    . PRO A 1 60  ? 16.549  -7.025  9.064   1.00 4.18  ? 155 PRO A O    3  
ATOM   6285  C  CB   . PRO A 1 60  ? 17.764  -5.421  7.022   1.00 5.07  ? 155 PRO A CB   3  
ATOM   6286  C  CG   . PRO A 1 60  ? 19.268  -5.403  7.280   1.00 5.01  ? 155 PRO A CG   3  
ATOM   6287  C  CD   . PRO A 1 60  ? 19.454  -4.096  8.049   1.00 3.42  ? 155 PRO A CD   3  
ATOM   6288  H  HA   . PRO A 1 60  ? 16.269  -4.296  8.077   1.00 4.04  ? 155 PRO A HA   3  
ATOM   6289  H  HB2  . PRO A 1 60  ? 17.402  -6.424  6.807   1.00 6.01  ? 155 PRO A HB2  3  
ATOM   6290  H  HB3  . PRO A 1 60  ? 17.531  -4.763  6.183   1.00 5.75  ? 155 PRO A HB3  3  
ATOM   6291  H  HG2  . PRO A 1 60  ? 19.544  -6.244  7.916   1.00 5.37  ? 155 PRO A HG2  3  
ATOM   6292  H  HG3  . PRO A 1 60  ? 19.839  -5.411  6.351   1.00 6.11  ? 155 PRO A HG3  3  
ATOM   6293  H  HD2  . PRO A 1 60  ? 20.260  -4.199  8.772   1.00 3.68  ? 155 PRO A HD2  3  
ATOM   6294  H  HD3  . PRO A 1 60  ? 19.679  -3.292  7.348   1.00 3.55  ? 155 PRO A HD3  3  
ATOM   6295  N  N    . GLY A 1 61  ? 16.889  -5.486  10.669  1.00 2.54  ? 156 GLY A N    3  
ATOM   6296  C  CA   . GLY A 1 61  ? 16.127  -6.151  11.734  1.00 2.60  ? 156 GLY A CA   3  
ATOM   6297  C  C    . GLY A 1 61  ? 14.713  -5.571  11.877  1.00 2.46  ? 156 GLY A C    3  
ATOM   6298  O  O    . GLY A 1 61  ? 13.857  -6.193  12.503  1.00 2.85  ? 156 GLY A O    3  
ATOM   6299  H  H    . GLY A 1 61  ? 17.175  -4.529  10.844  1.00 3.28  ? 156 GLY A H    3  
ATOM   6300  H  HA2  . GLY A 1 61  ? 16.030  -7.215  11.520  1.00 2.77  ? 156 GLY A HA2  3  
ATOM   6301  H  HA3  . GLY A 1 61  ? 16.640  -6.004  12.684  1.00 2.89  ? 156 GLY A HA3  3  
ATOM   6302  N  N    . LEU A 1 62  ? 14.466  -4.390  11.294  1.00 2.51  ? 157 LEU A N    3  
ATOM   6303  C  CA   . LEU A 1 62  ? 13.152  -3.749  11.184  1.00 2.54  ? 157 LEU A CA   3  
ATOM   6304  C  C    . LEU A 1 62  ? 12.240  -4.517  10.194  1.00 2.33  ? 157 LEU A C    3  
ATOM   6305  O  O    . LEU A 1 62  ? 12.755  -5.181  9.291   1.00 2.43  ? 157 LEU A O    3  
ATOM   6306  C  CB   . LEU A 1 62  ? 13.383  -2.278  10.770  1.00 2.92  ? 157 LEU A CB   3  
ATOM   6307  C  CG   . LEU A 1 62  ? 14.110  -1.423  11.834  1.00 3.63  ? 157 LEU A CG   3  
ATOM   6308  C  CD1  . LEU A 1 62  ? 14.387  -0.014  11.290  1.00 4.79  ? 157 LEU A CD1  3  
ATOM   6309  C  CD2  . LEU A 1 62  ? 13.299  -1.295  13.134  1.00 4.58  ? 157 LEU A CD2  3  
ATOM   6310  H  H    . LEU A 1 62  ? 15.230  -3.948  10.797  1.00 2.89  ? 157 LEU A H    3  
ATOM   6311  H  HA   . LEU A 1 62  ? 12.671  -3.787  12.162  1.00 2.69  ? 157 LEU A HA   3  
ATOM   6312  H  HB2  . LEU A 1 62  ? 13.976  -2.269  9.851   1.00 2.98  ? 157 LEU A HB2  3  
ATOM   6313  H  HB3  . LEU A 1 62  ? 12.431  -1.812  10.535  1.00 3.39  ? 157 LEU A HB3  3  
ATOM   6314  H  HG   . LEU A 1 62  ? 15.070  -1.880  12.072  1.00 3.81  ? 157 LEU A HG   3  
ATOM   6315  H  HD11 . LEU A 1 62  ? 13.451  0.514   11.123  1.00 5.45  ? 157 LEU A HD11 3  
ATOM   6316  H  HD12 . LEU A 1 62  ? 14.989  0.546   12.008  1.00 5.43  ? 157 LEU A HD12 3  
ATOM   6317  H  HD13 . LEU A 1 62  ? 14.943  -0.081  10.356  1.00 5.18  ? 157 LEU A HD13 3  
ATOM   6318  H  HD21 . LEU A 1 62  ? 13.795  -0.600  13.814  1.00 5.42  ? 157 LEU A HD21 3  
ATOM   6319  H  HD22 . LEU A 1 62  ? 12.294  -0.927  12.920  1.00 5.26  ? 157 LEU A HD22 3  
ATOM   6320  H  HD23 . LEU A 1 62  ? 13.234  -2.260  13.631  1.00 4.73  ? 157 LEU A HD23 3  
ATOM   6321  N  N    . PRO A 1 63  ? 10.899  -4.466  10.348  1.00 2.16  ? 158 PRO A N    3  
ATOM   6322  C  CA   . PRO A 1 63  ? 9.983   -5.322  9.598   1.00 1.83  ? 158 PRO A CA   3  
ATOM   6323  C  C    . PRO A 1 63  ? 9.959   -4.987  8.095   1.00 1.52  ? 158 PRO A C    3  
ATOM   6324  O  O    . PRO A 1 63  ? 9.935   -3.805  7.736   1.00 1.67  ? 158 PRO A O    3  
ATOM   6325  C  CB   . PRO A 1 63  ? 8.602   -5.131  10.235  1.00 1.93  ? 158 PRO A CB   3  
ATOM   6326  C  CG   . PRO A 1 63  ? 8.697   -3.751  10.883  1.00 2.21  ? 158 PRO A CG   3  
ATOM   6327  C  CD   . PRO A 1 63  ? 10.150  -3.711  11.343  1.00 2.34  ? 158 PRO A CD   3  
ATOM   6328  H  HA   . PRO A 1 63  ? 10.295  -6.354  9.750   1.00 1.88  ? 158 PRO A HA   3  
ATOM   6329  H  HB2  . PRO A 1 63  ? 7.796   -5.175  9.503   1.00 1.79  ? 158 PRO A HB2  3  
ATOM   6330  H  HB3  . PRO A 1 63  ? 8.449   -5.884  11.010  1.00 2.10  ? 158 PRO A HB3  3  
ATOM   6331  H  HG2  . PRO A 1 63  ? 8.522   -2.974  10.138  1.00 2.17  ? 158 PRO A HG2  3  
ATOM   6332  H  HG3  . PRO A 1 63  ? 8.009   -3.647  11.723  1.00 2.45  ? 158 PRO A HG3  3  
ATOM   6333  H  HD2  . PRO A 1 63  ? 10.490  -2.679  11.424  1.00 2.48  ? 158 PRO A HD2  3  
ATOM   6334  H  HD3  . PRO A 1 63  ? 10.220  -4.220  12.302  1.00 2.52  ? 158 PRO A HD3  3  
ATOM   6335  N  N    . PRO A 1 64  ? 9.915   -6.003  7.207   1.00 1.29  ? 159 PRO A N    3  
ATOM   6336  C  CA   . PRO A 1 64  ? 9.822   -5.806  5.767   1.00 1.23  ? 159 PRO A CA   3  
ATOM   6337  C  C    . PRO A 1 64  ? 8.405   -5.347  5.399   1.00 1.26  ? 159 PRO A C    3  
ATOM   6338  O  O    . PRO A 1 64  ? 7.499   -6.153  5.203   1.00 1.74  ? 159 PRO A O    3  
ATOM   6339  C  CB   . PRO A 1 64  ? 10.216  -7.147  5.141   1.00 1.40  ? 159 PRO A CB   3  
ATOM   6340  C  CG   . PRO A 1 64  ? 9.768   -8.163  6.191   1.00 1.49  ? 159 PRO A CG   3  
ATOM   6341  C  CD   . PRO A 1 64  ? 10.005  -7.427  7.510   1.00 1.42  ? 159 PRO A CD   3  
ATOM   6342  H  HA   . PRO A 1 64  ? 10.540  -5.049  5.448   1.00 1.35  ? 159 PRO A HA   3  
ATOM   6343  H  HB2  . PRO A 1 64  ? 9.734   -7.317  4.178   1.00 1.59  ? 159 PRO A HB2  3  
ATOM   6344  H  HB3  . PRO A 1 64  ? 11.301  -7.193  5.034   1.00 1.49  ? 159 PRO A HB3  3  
ATOM   6345  H  HG2  . PRO A 1 64  ? 8.704   -8.362  6.071   1.00 1.58  ? 159 PRO A HG2  3  
ATOM   6346  H  HG3  . PRO A 1 64  ? 10.342  -9.089  6.134   1.00 1.73  ? 159 PRO A HG3  3  
ATOM   6347  H  HD2  . PRO A 1 64  ? 9.252   -7.723  8.241   1.00 1.60  ? 159 PRO A HD2  3  
ATOM   6348  H  HD3  . PRO A 1 64  ? 11.006  -7.652  7.881   1.00 1.53  ? 159 PRO A HD3  3  
ATOM   6349  N  N    . VAL A 1 65  ? 8.235   -4.029  5.312   1.00 1.14  ? 160 VAL A N    3  
ATOM   6350  C  CA   . VAL A 1 65  ? 6.978   -3.357  4.951   1.00 1.16  ? 160 VAL A CA   3  
ATOM   6351  C  C    . VAL A 1 65  ? 6.741   -3.425  3.438   1.00 1.18  ? 160 VAL A C    3  
ATOM   6352  O  O    . VAL A 1 65  ? 7.357   -2.689  2.669   1.00 1.60  ? 160 VAL A O    3  
ATOM   6353  C  CB   . VAL A 1 65  ? 6.954   -1.884  5.440   1.00 1.31  ? 160 VAL A CB   3  
ATOM   6354  C  CG1  . VAL A 1 65  ? 6.493   -1.834  6.901   1.00 1.98  ? 160 VAL A CG1  3  
ATOM   6355  C  CG2  . VAL A 1 65  ? 8.302   -1.141  5.331   1.00 2.57  ? 160 VAL A CG2  3  
ATOM   6356  H  H    . VAL A 1 65  ? 9.013   -3.453  5.608   1.00 1.40  ? 160 VAL A H    3  
ATOM   6357  H  HA   . VAL A 1 65  ? 6.156   -3.886  5.440   1.00 1.18  ? 160 VAL A HA   3  
ATOM   6358  H  HB   . VAL A 1 65  ? 6.223   -1.327  4.855   1.00 2.06  ? 160 VAL A HB   3  
ATOM   6359  H  HG11 . VAL A 1 65  ? 7.188   -2.390  7.531   1.00 2.85  ? 160 VAL A HG11 3  
ATOM   6360  H  HG12 . VAL A 1 65  ? 6.445   -0.800  7.244   1.00 2.75  ? 160 VAL A HG12 3  
ATOM   6361  H  HG13 . VAL A 1 65  ? 5.496   -2.270  6.983   1.00 2.71  ? 160 VAL A HG13 3  
ATOM   6362  H  HG21 . VAL A 1 65  ? 8.663   -1.159  4.304   1.00 3.56  ? 160 VAL A HG21 3  
ATOM   6363  H  HG22 . VAL A 1 65  ? 8.170   -0.103  5.635   1.00 3.14  ? 160 VAL A HG22 3  
ATOM   6364  H  HG23 . VAL A 1 65  ? 9.050   -1.594  5.982   1.00 3.22  ? 160 VAL A HG23 3  
ATOM   6365  N  N    . GLN A 1 66  ? 5.832   -4.305  3.003   1.00 1.08  ? 161 GLN A N    3  
ATOM   6366  C  CA   . GLN A 1 66  ? 5.424   -4.392  1.595   1.00 1.24  ? 161 GLN A CA   3  
ATOM   6367  C  C    . GLN A 1 66  ? 4.325   -3.361  1.277   1.00 1.10  ? 161 GLN A C    3  
ATOM   6368  O  O    . GLN A 1 66  ? 3.257   -3.433  1.885   1.00 1.01  ? 161 GLN A O    3  
ATOM   6369  C  CB   . GLN A 1 66  ? 4.916   -5.811  1.262   1.00 1.45  ? 161 GLN A CB   3  
ATOM   6370  C  CG   . GLN A 1 66  ? 6.006   -6.722  0.674   1.00 2.43  ? 161 GLN A CG   3  
ATOM   6371  C  CD   . GLN A 1 66  ? 6.600   -6.207  -0.643  1.00 2.62  ? 161 GLN A CD   3  
ATOM   6372  O  OE1  . GLN A 1 66  ? 7.807   -6.123  -0.793  1.00 3.56  ? 161 GLN A OE1  3  
ATOM   6373  N  NE2  . GLN A 1 66  ? 5.804   -5.822  -1.623  1.00 2.61  ? 161 GLN A NE2  3  
ATOM   6374  H  H    . GLN A 1 66  ? 5.380   -4.910  3.684   1.00 1.19  ? 161 GLN A H    3  
ATOM   6375  H  HA   . GLN A 1 66  ? 6.295   -4.184  0.978   1.00 1.45  ? 161 GLN A HA   3  
ATOM   6376  H  HB2  . GLN A 1 66  ? 4.509   -6.274  2.163   1.00 1.92  ? 161 GLN A HB2  3  
ATOM   6377  H  HB3  . GLN A 1 66  ? 4.103   -5.745  0.539   1.00 1.90  ? 161 GLN A HB3  3  
ATOM   6378  H  HG2  . GLN A 1 66  ? 6.806   -6.836  1.407   1.00 3.51  ? 161 GLN A HG2  3  
ATOM   6379  H  HG3  . GLN A 1 66  ? 5.570   -7.703  0.490   1.00 3.31  ? 161 GLN A HG3  3  
ATOM   6380  H  HE21 . GLN A 1 66  ? 4.805   -5.852  -1.526  1.00 2.41  ? 161 GLN A HE21 3  
ATOM   6381  H  HE22 . GLN A 1 66  ? 6.230   -5.478  -2.478  1.00 3.32  ? 161 GLN A HE22 3  
ATOM   6382  N  N    . PRO A 1 67  ? 4.530   -2.433  0.320   1.00 1.16  ? 162 PRO A N    3  
ATOM   6383  C  CA   . PRO A 1 67  ? 3.500   -1.485  -0.085  1.00 1.04  ? 162 PRO A CA   3  
ATOM   6384  C  C    . PRO A 1 67  ? 2.501   -2.124  -1.062  1.00 0.92  ? 162 PRO A C    3  
ATOM   6385  O  O    . PRO A 1 67  ? 2.909   -2.739  -2.048  1.00 1.02  ? 162 PRO A O    3  
ATOM   6386  C  CB   . PRO A 1 67  ? 4.261   -0.324  -0.734  1.00 1.25  ? 162 PRO A CB   3  
ATOM   6387  C  CG   . PRO A 1 67  ? 5.491   -1.003  -1.338  1.00 1.42  ? 162 PRO A CG   3  
ATOM   6388  C  CD   . PRO A 1 67  ? 5.786   -2.139  -0.360  1.00 1.39  ? 162 PRO A CD   3  
ATOM   6389  H  HA   . PRO A 1 67  ? 2.971   -1.111  0.790   1.00 0.99  ? 162 PRO A HA   3  
ATOM   6390  H  HB2  . PRO A 1 67  ? 3.666   0.189   -1.491  1.00 1.25  ? 162 PRO A HB2  3  
ATOM   6391  H  HB3  . PRO A 1 67  ? 4.578   0.378   0.040   1.00 1.35  ? 162 PRO A HB3  3  
ATOM   6392  H  HG2  . PRO A 1 67  ? 5.245   -1.424  -2.312  1.00 1.40  ? 162 PRO A HG2  3  
ATOM   6393  H  HG3  . PRO A 1 67  ? 6.333   -0.314  -1.423  1.00 1.62  ? 162 PRO A HG3  3  
ATOM   6394  H  HD2  . PRO A 1 67  ? 6.157   -3.009  -0.904  1.00 1.46  ? 162 PRO A HD2  3  
ATOM   6395  H  HD3  . PRO A 1 67  ? 6.524   -1.805  0.370   1.00 1.52  ? 162 PRO A HD3  3  
ATOM   6396  N  N    . VAL A 1 68  ? 1.201   -1.909  -0.821  1.00 0.80  ? 163 VAL A N    3  
ATOM   6397  C  CA   . VAL A 1 68  ? 0.129   -2.107  -1.818  1.00 0.70  ? 163 VAL A CA   3  
ATOM   6398  C  C    . VAL A 1 68  ? -0.518  -0.769  -2.198  1.00 0.62  ? 163 VAL A C    3  
ATOM   6399  O  O    . VAL A 1 68  ? -0.866  0.037   -1.333  1.00 0.66  ? 163 VAL A O    3  
ATOM   6400  C  CB   . VAL A 1 68  ? -0.956  -3.131  -1.397  1.00 0.77  ? 163 VAL A CB   3  
ATOM   6401  C  CG1  . VAL A 1 68  ? -0.359  -4.525  -1.156  1.00 1.72  ? 163 VAL A CG1  3  
ATOM   6402  C  CG2  . VAL A 1 68  ? -1.785  -2.752  -0.158  1.00 1.48  ? 163 VAL A CG2  3  
ATOM   6403  H  H    . VAL A 1 68  ? 0.952   -1.464  0.066   1.00 0.81  ? 163 VAL A H    3  
ATOM   6404  H  HA   . VAL A 1 68  ? 0.587   -2.506  -2.722  1.00 0.74  ? 163 VAL A HA   3  
ATOM   6405  H  HB   . VAL A 1 68  ? -1.658  -3.220  -2.231  1.00 1.71  ? 163 VAL A HB   3  
ATOM   6406  H  HG11 . VAL A 1 68  ? 0.263   -4.522  -0.262  1.00 2.71  ? 163 VAL A HG11 3  
ATOM   6407  H  HG12 . VAL A 1 68  ? -1.165  -5.250  -1.037  1.00 2.29  ? 163 VAL A HG12 3  
ATOM   6408  H  HG13 . VAL A 1 68  ? 0.249   -4.817  -2.007  1.00 2.36  ? 163 VAL A HG13 3  
ATOM   6409  H  HG21 . VAL A 1 68  ? -2.512  -3.537  0.055   1.00 2.22  ? 163 VAL A HG21 3  
ATOM   6410  H  HG22 . VAL A 1 68  ? -1.135  -2.634  0.709   1.00 1.96  ? 163 VAL A HG22 3  
ATOM   6411  H  HG23 . VAL A 1 68  ? -2.337  -1.832  -0.342  1.00 2.78  ? 163 VAL A HG23 3  
ATOM   6412  N  N    . PHE A 1 69  ? -0.690  -0.558  -3.505  1.00 0.60  ? 164 PHE A N    3  
ATOM   6413  C  CA   . PHE A 1 69  ? -1.439  0.540   -4.114  1.00 0.58  ? 164 PHE A CA   3  
ATOM   6414  C  C    . PHE A 1 69  ? -2.814  0.008   -4.532  1.00 1.33  ? 164 PHE A C    3  
ATOM   6415  O  O    . PHE A 1 69  ? -2.892  -0.929  -5.323  1.00 1.73  ? 164 PHE A O    3  
ATOM   6416  C  CB   . PHE A 1 69  ? -0.633  1.045   -5.330  1.00 0.65  ? 164 PHE A CB   3  
ATOM   6417  C  CG   . PHE A 1 69  ? -1.183  2.245   -6.096  1.00 0.79  ? 164 PHE A CG   3  
ATOM   6418  C  CD1  . PHE A 1 69  ? -2.372  2.149   -6.852  1.00 1.90  ? 164 PHE A CD1  3  
ATOM   6419  C  CD2  . PHE A 1 69  ? -0.444  3.446   -6.137  1.00 2.01  ? 164 PHE A CD2  3  
ATOM   6420  C  CE1  . PHE A 1 69  ? -2.823  3.241   -7.614  1.00 2.09  ? 164 PHE A CE1  3  
ATOM   6421  C  CE2  . PHE A 1 69  ? -0.886  4.529   -6.919  1.00 1.98  ? 164 PHE A CE2  3  
ATOM   6422  C  CZ   . PHE A 1 69  ? -2.075  4.427   -7.659  1.00 1.28  ? 164 PHE A CZ   3  
ATOM   6423  H  H    . PHE A 1 69  ? -0.341  -1.274  -4.137  1.00 0.66  ? 164 PHE A H    3  
ATOM   6424  H  HA   . PHE A 1 69  ? -1.566  1.355   -3.401  1.00 0.58  ? 164 PHE A HA   3  
ATOM   6425  H  HB2  . PHE A 1 69  ? 0.372   1.291   -4.983  1.00 0.69  ? 164 PHE A HB2  3  
ATOM   6426  H  HB3  . PHE A 1 69  ? -0.520  0.223   -6.039  1.00 0.68  ? 164 PHE A HB3  3  
ATOM   6427  H  HD1  . PHE A 1 69  ? -2.936  1.230   -6.877  1.00 3.13  ? 164 PHE A HD1  3  
ATOM   6428  H  HD2  . PHE A 1 69  ? 0.476   3.535   -5.578  1.00 3.24  ? 164 PHE A HD2  3  
ATOM   6429  H  HE1  . PHE A 1 69  ? -3.732  3.154   -8.193  1.00 3.36  ? 164 PHE A HE1  3  
ATOM   6430  H  HE2  . PHE A 1 69  ? -0.315  5.447   -6.946  1.00 3.50  ? 164 PHE A HE2  3  
ATOM   6431  H  HZ   . PHE A 1 69  ? -2.411  5.261   -8.263  1.00 1.55  ? 164 PHE A HZ   3  
ATOM   6432  N  N    . ILE A 1 70  ? -3.905  0.594   -4.042  1.00 0.66  ? 165 ILE A N    3  
ATOM   6433  C  CA   . ILE A 1 70  ? -5.275  0.245   -4.460  1.00 0.74  ? 165 ILE A CA   3  
ATOM   6434  C  C    . ILE A 1 70  ? -5.815  1.352   -5.377  1.00 0.79  ? 165 ILE A C    3  
ATOM   6435  O  O    . ILE A 1 70  ? -5.881  2.505   -4.950  1.00 0.86  ? 165 ILE A O    3  
ATOM   6436  C  CB   . ILE A 1 70  ? -6.172  0.023   -3.217  1.00 0.83  ? 165 ILE A CB   3  
ATOM   6437  C  CG1  . ILE A 1 70  ? -5.639  -1.161  -2.371  1.00 1.10  ? 165 ILE A CG1  3  
ATOM   6438  C  CG2  . ILE A 1 70  ? -7.626  -0.251  -3.654  1.00 1.12  ? 165 ILE A CG2  3  
ATOM   6439  C  CD1  . ILE A 1 70  ? -6.297  -1.306  -0.995  1.00 1.30  ? 165 ILE A CD1  3  
ATOM   6440  H  H    . ILE A 1 70  ? -3.788  1.330   -3.349  1.00 0.68  ? 165 ILE A H    3  
ATOM   6441  H  HA   . ILE A 1 70  ? -5.258  -0.687  -5.030  1.00 0.78  ? 165 ILE A HA   3  
ATOM   6442  H  HB   . ILE A 1 70  ? -6.155  0.928   -2.607  1.00 0.98  ? 165 ILE A HB   3  
ATOM   6443  H  HG12 . ILE A 1 70  ? -5.789  -2.087  -2.923  1.00 1.99  ? 165 ILE A HG12 3  
ATOM   6444  H  HG13 . ILE A 1 70  ? -4.570  -1.042  -2.194  1.00 1.73  ? 165 ILE A HG13 3  
ATOM   6445  H  HG21 . ILE A 1 70  ? -8.263  -0.405  -2.785  1.00 1.53  ? 165 ILE A HG21 3  
ATOM   6446  H  HG22 . ILE A 1 70  ? -8.029  0.600   -4.201  1.00 2.09  ? 165 ILE A HG22 3  
ATOM   6447  H  HG23 . ILE A 1 70  ? -7.664  -1.138  -4.289  1.00 1.92  ? 165 ILE A HG23 3  
ATOM   6448  H  HD11 . ILE A 1 70  ? -6.164  -0.385  -0.427  1.00 2.27  ? 165 ILE A HD11 3  
ATOM   6449  H  HD12 . ILE A 1 70  ? -7.357  -1.531  -1.091  1.00 2.21  ? 165 ILE A HD12 3  
ATOM   6450  H  HD13 . ILE A 1 70  ? -5.819  -2.124  -0.456  1.00 1.53  ? 165 ILE A HD13 3  
ATOM   6451  N  N    . THR A 1 71  ? -6.196  1.019   -6.616  1.00 0.86  ? 166 THR A N    3  
ATOM   6452  C  CA   . THR A 1 71  ? -6.678  1.980   -7.625  1.00 1.05  ? 166 THR A CA   3  
ATOM   6453  C  C    . THR A 1 71  ? -8.144  2.332   -7.388  1.00 1.14  ? 166 THR A C    3  
ATOM   6454  O  O    . THR A 1 71  ? -9.014  1.496   -7.615  1.00 1.55  ? 166 THR A O    3  
ATOM   6455  C  CB   . THR A 1 71  ? -6.487  1.409   -9.034  1.00 1.30  ? 166 THR A CB   3  
ATOM   6456  O  OG1  . THR A 1 71  ? -5.125  1.091   -9.200  1.00 2.10  ? 166 THR A OG1  3  
ATOM   6457  C  CG2  . THR A 1 71  ? -6.869  2.417   -10.118 1.00 1.84  ? 166 THR A CG2  3  
ATOM   6458  H  H    . THR A 1 71  ? -6.067  0.058   -6.918  1.00 0.89  ? 166 THR A H    3  
ATOM   6459  H  HA   . THR A 1 71  ? -6.084  2.890   -7.547  1.00 1.15  ? 166 THR A HA   3  
ATOM   6460  H  HB   . THR A 1 71  ? -7.086  0.505   -9.156  1.00 1.65  ? 166 THR A HB   3  
ATOM   6461  H  HG1  . THR A 1 71  ? -4.945  1.018   -10.144 1.00 2.52  ? 166 THR A HG1  3  
ATOM   6462  H  HG21 . THR A 1 71  ? -6.360  3.363   -9.941  1.00 2.77  ? 166 THR A HG21 3  
ATOM   6463  H  HG22 . THR A 1 71  ? -6.599  2.030   -11.101 1.00 2.55  ? 166 THR A HG22 3  
ATOM   6464  H  HG23 . THR A 1 71  ? -7.947  2.584   -10.105 1.00 2.13  ? 166 THR A HG23 3  
ATOM   6465  N  N    . VAL A 1 72  ? -8.417  3.574   -6.987  1.00 1.13  ? 167 VAL A N    3  
ATOM   6466  C  CA   . VAL A 1 72  ? -9.768  4.089   -6.668  1.00 1.27  ? 167 VAL A CA   3  
ATOM   6467  C  C    . VAL A 1 72  ? -10.403 4.827   -7.866  1.00 1.72  ? 167 VAL A C    3  
ATOM   6468  O  O    . VAL A 1 72  ? -10.850 5.965   -7.748  1.00 2.68  ? 167 VAL A O    3  
ATOM   6469  C  CB   . VAL A 1 72  ? -9.779  4.942   -5.370  1.00 1.27  ? 167 VAL A CB   3  
ATOM   6470  C  CG1  . VAL A 1 72  ? -11.203 5.102   -4.799  1.00 1.97  ? 167 VAL A CG1  3  
ATOM   6471  C  CG2  . VAL A 1 72  ? -8.935  4.310   -4.250  1.00 2.41  ? 167 VAL A CG2  3  
ATOM   6472  H  H    . VAL A 1 72  ? -7.625  4.181   -6.791  1.00 1.27  ? 167 VAL A H    3  
ATOM   6473  H  HA   . VAL A 1 72  ? -10.395 3.218   -6.468  1.00 1.39  ? 167 VAL A HA   3  
ATOM   6474  H  HB   . VAL A 1 72  ? -9.357  5.929   -5.574  1.00 2.53  ? 167 VAL A HB   3  
ATOM   6475  H  HG11 . VAL A 1 72  ? -11.861 5.605   -5.506  1.00 3.10  ? 167 VAL A HG11 3  
ATOM   6476  H  HG12 . VAL A 1 72  ? -11.625 4.123   -4.563  1.00 2.87  ? 167 VAL A HG12 3  
ATOM   6477  H  HG13 . VAL A 1 72  ? -11.168 5.699   -3.890  1.00 2.43  ? 167 VAL A HG13 3  
ATOM   6478  H  HG21 . VAL A 1 72  ? -9.234  3.272   -4.092  1.00 3.38  ? 167 VAL A HG21 3  
ATOM   6479  H  HG22 . VAL A 1 72  ? -7.876  4.348   -4.502  1.00 3.44  ? 167 VAL A HG22 3  
ATOM   6480  H  HG23 . VAL A 1 72  ? -9.080  4.867   -3.325  1.00 2.84  ? 167 VAL A HG23 3  
ATOM   6481  N  N    . ASP A 1 73  ? -10.449 4.161   -9.026  1.00 1.34  ? 168 ASP A N    3  
ATOM   6482  C  CA   . ASP A 1 73  ? -11.288 4.509   -10.189 1.00 1.52  ? 168 ASP A CA   3  
ATOM   6483  C  C    . ASP A 1 73  ? -11.272 3.342   -11.202 1.00 1.30  ? 168 ASP A C    3  
ATOM   6484  O  O    . ASP A 1 73  ? -10.216 3.062   -11.776 1.00 1.79  ? 168 ASP A O    3  
ATOM   6485  C  CB   . ASP A 1 73  ? -10.874 5.832   -10.874 1.00 2.26  ? 168 ASP A CB   3  
ATOM   6486  C  CG   . ASP A 1 73  ? -11.890 6.317   -11.926 1.00 2.71  ? 168 ASP A CG   3  
ATOM   6487  O  OD1  . ASP A 1 73  ? -12.729 5.519   -12.412 1.00 3.27  ? 168 ASP A OD1  3  
ATOM   6488  O  OD2  . ASP A 1 73  ? -11.844 7.519   -12.279 1.00 3.39  ? 168 ASP A OD2  3  
ATOM   6489  H  H    . ASP A 1 73  ? -10.021 3.242   -9.038  1.00 1.20  ? 168 ASP A H    3  
ATOM   6490  H  HA   . ASP A 1 73  ? -12.296 4.668   -9.814  1.00 1.66  ? 168 ASP A HA   3  
ATOM   6491  H  HB2  . ASP A 1 73  ? -10.779 6.620   -10.130 1.00 2.65  ? 168 ASP A HB2  3  
ATOM   6492  H  HB3  . ASP A 1 73  ? -9.897  5.709   -11.344 1.00 2.55  ? 168 ASP A HB3  3  
ATOM   6493  N  N    . PRO A 1 74  ? -12.407 2.651   -11.434 1.00 1.33  ? 169 PRO A N    3  
ATOM   6494  C  CA   . PRO A 1 74  ? -12.468 1.494   -12.321 1.00 1.66  ? 169 PRO A CA   3  
ATOM   6495  C  C    . PRO A 1 74  ? -12.524 1.850   -13.816 1.00 1.77  ? 169 PRO A C    3  
ATOM   6496  O  O    . PRO A 1 74  ? -12.418 0.937   -14.633 1.00 2.39  ? 169 PRO A O    3  
ATOM   6497  C  CB   . PRO A 1 74  ? -13.725 0.731   -11.879 1.00 2.27  ? 169 PRO A CB   3  
ATOM   6498  C  CG   . PRO A 1 74  ? -14.652 1.834   -11.378 1.00 2.37  ? 169 PRO A CG   3  
ATOM   6499  C  CD   . PRO A 1 74  ? -13.683 2.829   -10.748 1.00 1.85  ? 169 PRO A CD   3  
ATOM   6500  H  HA   . PRO A 1 74  ? -11.595 0.861   -12.159 1.00 1.90  ? 169 PRO A HA   3  
ATOM   6501  H  HB2  . PRO A 1 74  ? -14.176 0.157   -12.690 1.00 2.63  ? 169 PRO A HB2  3  
ATOM   6502  H  HB3  . PRO A 1 74  ? -13.474 0.074   -11.047 1.00 2.58  ? 169 PRO A HB3  3  
ATOM   6503  H  HG2  . PRO A 1 74  ? -15.164 2.300   -12.220 1.00 2.47  ? 169 PRO A HG2  3  
ATOM   6504  H  HG3  . PRO A 1 74  ? -15.371 1.457   -10.649 1.00 2.94  ? 169 PRO A HG3  3  
ATOM   6505  H  HD2  . PRO A 1 74  ? -14.061 3.845   -10.874 1.00 2.11  ? 169 PRO A HD2  3  
ATOM   6506  H  HD3  . PRO A 1 74  ? -13.557 2.602   -9.689  1.00 2.03  ? 169 PRO A HD3  3  
ATOM   6507  N  N    . GLU A 1 75  ? -12.708 3.126   -14.202 1.00 1.78  ? 170 GLU A N    3  
ATOM   6508  C  CA   . GLU A 1 75  ? -12.909 3.528   -15.609 1.00 1.99  ? 170 GLU A CA   3  
ATOM   6509  C  C    . GLU A 1 75  ? -11.985 4.697   -16.016 1.00 1.77  ? 170 GLU A C    3  
ATOM   6510  O  O    . GLU A 1 75  ? -12.407 5.650   -16.684 1.00 2.32  ? 170 GLU A O    3  
ATOM   6511  C  CB   . GLU A 1 75  ? -14.407 3.789   -15.906 1.00 2.89  ? 170 GLU A CB   3  
ATOM   6512  C  CG   . GLU A 1 75  ? -15.320 2.625   -15.474 1.00 3.71  ? 170 GLU A CG   3  
ATOM   6513  C  CD   . GLU A 1 75  ? -16.545 2.438   -16.366 1.00 4.90  ? 170 GLU A CD   3  
ATOM   6514  O  OE1  . GLU A 1 75  ? -17.578 3.114   -16.182 1.00 5.22  ? 170 GLU A OE1  3  
ATOM   6515  O  OE2  . GLU A 1 75  ? -16.502 1.532   -17.237 1.00 6.14  ? 170 GLU A OE2  3  
ATOM   6516  H  H    . GLU A 1 75  ? -12.758 3.860   -13.494 1.00 2.04  ? 170 GLU A H    3  
ATOM   6517  H  HA   . GLU A 1 75  ? -12.609 2.695   -16.246 1.00 2.41  ? 170 GLU A HA   3  
ATOM   6518  H  HB2  . GLU A 1 75  ? -14.732 4.700   -15.402 1.00 3.04  ? 170 GLU A HB2  3  
ATOM   6519  H  HB3  . GLU A 1 75  ? -14.513 3.936   -16.982 1.00 3.51  ? 170 GLU A HB3  3  
ATOM   6520  H  HG2  . GLU A 1 75  ? -14.759 1.692   -15.510 1.00 4.08  ? 170 GLU A HG2  3  
ATOM   6521  H  HG3  . GLU A 1 75  ? -15.643 2.784   -14.445 1.00 3.79  ? 170 GLU A HG3  3  
ATOM   6522  N  N    . ARG A 1 76  ? -10.711 4.627   -15.602 1.00 1.82  ? 171 ARG A N    3  
ATOM   6523  C  CA   . ARG A 1 76  ? -9.700  5.685   -15.776 1.00 2.45  ? 171 ARG A CA   3  
ATOM   6524  C  C    . ARG A 1 76  ? -8.533  5.245   -16.678 1.00 2.60  ? 171 ARG A C    3  
ATOM   6525  O  O    . ARG A 1 76  ? -8.490  5.629   -17.851 1.00 3.12  ? 171 ARG A O    3  
ATOM   6526  C  CB   . ARG A 1 76  ? -9.257  6.140   -14.374 1.00 3.15  ? 171 ARG A CB   3  
ATOM   6527  C  CG   . ARG A 1 76  ? -8.695  7.566   -14.297 1.00 4.35  ? 171 ARG A CG   3  
ATOM   6528  C  CD   . ARG A 1 76  ? -9.754  8.644   -14.566 1.00 4.71  ? 171 ARG A CD   3  
ATOM   6529  N  NE   . ARG A 1 76  ? -9.581  9.267   -15.892 1.00 4.97  ? 171 ARG A NE   3  
ATOM   6530  C  CZ   . ARG A 1 76  ? -10.470 9.326   -16.875 1.00 5.14  ? 171 ARG A CZ   3  
ATOM   6531  N  NH1  . ARG A 1 76  ? -11.637 8.721   -16.808 1.00 5.34  ? 171 ARG A NH1  3  
ATOM   6532  N  NH2  . ARG A 1 76  ? -10.174 10.006  -17.961 1.00 5.72  ? 171 ARG A NH2  3  
ATOM   6533  H  H    . ARG A 1 76  ? -10.454 3.820   -15.049 1.00 1.98  ? 171 ARG A H    3  
ATOM   6534  H  HA   . ARG A 1 76  ? -10.174 6.529   -16.270 1.00 3.26  ? 171 ARG A HA   3  
ATOM   6535  H  HB2  . ARG A 1 76  ? -10.120 6.103   -13.721 1.00 3.29  ? 171 ARG A HB2  3  
ATOM   6536  H  HB3  . ARG A 1 76  ? -8.535  5.440   -13.953 1.00 3.48  ? 171 ARG A HB3  3  
ATOM   6537  H  HG2  . ARG A 1 76  ? -8.323  7.719   -13.282 1.00 5.35  ? 171 ARG A HG2  3  
ATOM   6538  H  HG3  . ARG A 1 76  ? -7.856  7.677   -14.985 1.00 4.69  ? 171 ARG A HG3  3  
ATOM   6539  H  HD2  . ARG A 1 76  ? -10.752 8.219   -14.447 1.00 4.70  ? 171 ARG A HD2  3  
ATOM   6540  H  HD3  . ARG A 1 76  ? -9.650  9.420   -13.809 1.00 5.46  ? 171 ARG A HD3  3  
ATOM   6541  H  HE   . ARG A 1 76  ? -8.696  9.718   -16.058 1.00 5.49  ? 171 ARG A HE   3  
ATOM   6542  H  HH11 . ARG A 1 76  ? -11.848 8.118   -16.026 1.00 5.32  ? 171 ARG A HH11 3  
ATOM   6543  H  HH12 . ARG A 1 76  ? -12.191 8.607   -17.647 1.00 5.80  ? 171 ARG A HH12 3  
ATOM   6544  H  HH21 . ARG A 1 76  ? -9.243  10.373  -18.123 1.00 6.16  ? 171 ARG A HH21 3  
ATOM   6545  H  HH22 . ARG A 1 76  ? -10.866 10.152  -18.688 1.00 6.04  ? 171 ARG A HH22 3  
ATOM   6546  N  N    . ASP A 1 77  ? -7.614  4.432   -16.148 1.00 2.82  ? 172 ASP A N    3  
ATOM   6547  C  CA   . ASP A 1 77  ? -6.504  3.780   -16.857 1.00 3.53  ? 172 ASP A CA   3  
ATOM   6548  C  C    . ASP A 1 77  ? -6.405  2.317   -16.385 1.00 2.75  ? 172 ASP A C    3  
ATOM   6549  O  O    . ASP A 1 77  ? -6.784  1.997   -15.259 1.00 3.05  ? 172 ASP A O    3  
ATOM   6550  C  CB   . ASP A 1 77  ? -5.188  4.557   -16.638 1.00 5.41  ? 172 ASP A CB   3  
ATOM   6551  C  CG   . ASP A 1 77  ? -4.198  4.448   -17.808 1.00 7.04  ? 172 ASP A CG   3  
ATOM   6552  O  OD1  . ASP A 1 77  ? -4.426  3.648   -18.744 1.00 7.65  ? 172 ASP A OD1  3  
ATOM   6553  O  OD2  . ASP A 1 77  ? -3.235  5.256   -17.848 1.00 8.26  ? 172 ASP A OD2  3  
ATOM   6554  H  H    . ASP A 1 77  ? -7.738  4.142   -15.187 1.00 2.80  ? 172 ASP A H    3  
ATOM   6555  H  HA   . ASP A 1 77  ? -6.721  3.767   -17.925 1.00 3.83  ? 172 ASP A HA   3  
ATOM   6556  H  HB2  . ASP A 1 77  ? -5.423  5.615   -16.510 1.00 6.07  ? 172 ASP A HB2  3  
ATOM   6557  H  HB3  . ASP A 1 77  ? -4.706  4.208   -15.725 1.00 5.46  ? 172 ASP A HB3  3  
ATOM   6558  N  N    . ASP A 1 78  ? -5.975  1.417   -17.270 1.00 2.57  ? 173 ASP A N    3  
ATOM   6559  C  CA   . ASP A 1 78  ? -6.268  -0.019  -17.143 1.00 1.86  ? 173 ASP A CA   3  
ATOM   6560  C  C    . ASP A 1 78  ? -5.302  -0.781  -16.206 1.00 1.43  ? 173 ASP A C    3  
ATOM   6561  O  O    . ASP A 1 78  ? -4.175  -0.358  -15.954 1.00 1.36  ? 173 ASP A O    3  
ATOM   6562  C  CB   . ASP A 1 78  ? -6.314  -0.638  -18.556 1.00 1.78  ? 173 ASP A CB   3  
ATOM   6563  C  CG   . ASP A 1 78  ? -7.052  -1.980  -18.655 1.00 2.18  ? 173 ASP A CG   3  
ATOM   6564  O  OD1  . ASP A 1 78  ? -7.600  -2.467  -17.640 1.00 3.34  ? 173 ASP A OD1  3  
ATOM   6565  O  OD2  . ASP A 1 78  ? -7.049  -2.564  -19.762 1.00 2.66  ? 173 ASP A OD2  3  
ATOM   6566  H  H    . ASP A 1 78  ? -5.581  1.766   -18.136 1.00 3.43  ? 173 ASP A H    3  
ATOM   6567  H  HA   . ASP A 1 78  ? -7.270  -0.104  -16.714 1.00 2.23  ? 173 ASP A HA   3  
ATOM   6568  H  HB2  . ASP A 1 78  ? -6.821  0.060   -19.227 1.00 2.32  ? 173 ASP A HB2  3  
ATOM   6569  H  HB3  . ASP A 1 78  ? -5.291  -0.763  -18.918 1.00 1.88  ? 173 ASP A HB3  3  
ATOM   6570  N  N    . VAL A 1 79  ? -5.696  -1.983  -15.779 1.00 1.56  ? 174 VAL A N    3  
ATOM   6571  C  CA   . VAL A 1 79  ? -4.845  -2.935  -15.033 1.00 1.66  ? 174 VAL A CA   3  
ATOM   6572  C  C    . VAL A 1 79  ? -3.554  -3.294  -15.802 1.00 1.45  ? 174 VAL A C    3  
ATOM   6573  O  O    . VAL A 1 79  ? -2.530  -3.613  -15.197 1.00 1.51  ? 174 VAL A O    3  
ATOM   6574  C  CB   . VAL A 1 79  ? -5.655  -4.195  -14.640 1.00 2.50  ? 174 VAL A CB   3  
ATOM   6575  C  CG1  . VAL A 1 79  ? -5.963  -5.120  -15.832 1.00 3.04  ? 174 VAL A CG1  3  
ATOM   6576  C  CG2  . VAL A 1 79  ? -4.955  -5.014  -13.545 1.00 2.80  ? 174 VAL A CG2  3  
ATOM   6577  H  H    . VAL A 1 79  ? -6.633  -2.277  -16.074 1.00 1.85  ? 174 VAL A H    3  
ATOM   6578  H  HA   . VAL A 1 79  ? -4.554  -2.429  -14.111 1.00 1.70  ? 174 VAL A HA   3  
ATOM   6579  H  HB   . VAL A 1 79  ? -6.608  -3.856  -14.232 1.00 4.18  ? 174 VAL A HB   3  
ATOM   6580  H  HG11 . VAL A 1 79  ? -6.457  -4.564  -16.626 1.00 4.14  ? 174 VAL A HG11 3  
ATOM   6581  H  HG12 . VAL A 1 79  ? -5.046  -5.559  -16.227 1.00 2.81  ? 174 VAL A HG12 3  
ATOM   6582  H  HG13 . VAL A 1 79  ? -6.625  -5.925  -15.510 1.00 3.90  ? 174 VAL A HG13 3  
ATOM   6583  H  HG21 . VAL A 1 79  ? -4.062  -5.492  -13.947 1.00 2.92  ? 174 VAL A HG21 3  
ATOM   6584  H  HG22 . VAL A 1 79  ? -4.683  -4.368  -12.710 1.00 3.74  ? 174 VAL A HG22 3  
ATOM   6585  H  HG23 . VAL A 1 79  ? -5.629  -5.791  -13.179 1.00 3.53  ? 174 VAL A HG23 3  
ATOM   6586  N  N    . GLU A 1 80  ? -3.577  -3.172  -17.137 1.00 1.52  ? 175 GLU A N    3  
ATOM   6587  C  CA   . GLU A 1 80  ? -2.393  -3.287  -17.994 1.00 1.88  ? 175 GLU A CA   3  
ATOM   6588  C  C    . GLU A 1 80  ? -1.430  -2.100  -17.814 1.00 1.78  ? 175 GLU A C    3  
ATOM   6589  O  O    . GLU A 1 80  ? -0.214  -2.308  -17.771 1.00 2.21  ? 175 GLU A O    3  
ATOM   6590  C  CB   . GLU A 1 80  ? -2.807  -3.378  -19.475 1.00 2.22  ? 175 GLU A CB   3  
ATOM   6591  C  CG   . GLU A 1 80  ? -3.704  -4.583  -19.778 1.00 3.69  ? 175 GLU A CG   3  
ATOM   6592  C  CD   . GLU A 1 80  ? -3.884  -4.783  -21.282 1.00 4.16  ? 175 GLU A CD   3  
ATOM   6593  O  OE1  . GLU A 1 80  ? -4.412  -3.879  -21.965 1.00 4.52  ? 175 GLU A OE1  3  
ATOM   6594  O  OE2  . GLU A 1 80  ? -3.526  -5.872  -21.783 1.00 4.90  ? 175 GLU A OE2  3  
ATOM   6595  H  H    . GLU A 1 80  ? -4.455  -2.918  -17.562 1.00 1.50  ? 175 GLU A H    3  
ATOM   6596  H  HA   . GLU A 1 80  ? -1.859  -4.198  -17.728 1.00 2.23  ? 175 GLU A HA   3  
ATOM   6597  H  HB2  . GLU A 1 80  ? -3.326  -2.464  -19.766 1.00 1.80  ? 175 GLU A HB2  3  
ATOM   6598  H  HB3  . GLU A 1 80  ? -1.899  -3.462  -20.076 1.00 2.73  ? 175 GLU A HB3  3  
ATOM   6599  H  HG2  . GLU A 1 80  ? -3.252  -5.480  -19.350 1.00 4.46  ? 175 GLU A HG2  3  
ATOM   6600  H  HG3  . GLU A 1 80  ? -4.683  -4.437  -19.321 1.00 4.34  ? 175 GLU A HG3  3  
ATOM   6601  N  N    . ALA A 1 81  ? -1.963  -0.876  -17.695 1.00 1.54  ? 176 ALA A N    3  
ATOM   6602  C  CA   . ALA A 1 81  ? -1.223  0.368   -17.474 1.00 1.87  ? 176 ALA A CA   3  
ATOM   6603  C  C    . ALA A 1 81  ? -0.643  0.456   -16.051 1.00 1.61  ? 176 ALA A C    3  
ATOM   6604  O  O    . ALA A 1 81  ? 0.483   0.934   -15.875 1.00 1.80  ? 176 ALA A O    3  
ATOM   6605  C  CB   . ALA A 1 81  ? -2.169  1.544   -17.784 1.00 2.19  ? 176 ALA A CB   3  
ATOM   6606  H  H    . ALA A 1 81  ? -2.972  -0.801  -17.639 1.00 1.30  ? 176 ALA A H    3  
ATOM   6607  H  HA   . ALA A 1 81  ? -0.385  0.403   -18.173 1.00 2.33  ? 176 ALA A HA   3  
ATOM   6608  H  HB1  . ALA A 1 81  ? -3.010  1.576   -17.090 1.00 1.93  ? 176 ALA A HB1  3  
ATOM   6609  H  HB2  . ALA A 1 81  ? -1.638  2.490   -17.705 1.00 2.76  ? 176 ALA A HB2  3  
ATOM   6610  H  HB3  . ALA A 1 81  ? -2.565  1.460   -18.798 1.00 3.38  ? 176 ALA A HB3  3  
ATOM   6611  N  N    . MET A 1 82  ? -1.374  -0.059  -15.053 1.00 1.25  ? 177 MET A N    3  
ATOM   6612  C  CA   . MET A 1 82  ? -0.936  -0.166  -13.650 1.00 1.11  ? 177 MET A CA   3  
ATOM   6613  C  C    . MET A 1 82  ? 0.394   -0.909  -13.493 1.00 0.89  ? 177 MET A C    3  
ATOM   6614  O  O    . MET A 1 82  ? 1.231   -0.513  -12.679 1.00 0.89  ? 177 MET A O    3  
ATOM   6615  C  CB   . MET A 1 82  ? -2.021  -0.880  -12.821 1.00 1.11  ? 177 MET A CB   3  
ATOM   6616  C  CG   . MET A 1 82  ? -3.224  0.019   -12.511 1.00 1.82  ? 177 MET A CG   3  
ATOM   6617  S  SD   . MET A 1 82  ? -2.857  1.559   -11.620 1.00 2.39  ? 177 MET A SD   3  
ATOM   6618  C  CE   . MET A 1 82  ? -1.900  0.944   -10.210 1.00 2.23  ? 177 MET A CE   3  
ATOM   6619  H  H    . MET A 1 82  ? -2.325  -0.340  -15.277 1.00 1.18  ? 177 MET A H    3  
ATOM   6620  H  HA   . MET A 1 82  ? -0.781  0.836   -13.249 1.00 1.33  ? 177 MET A HA   3  
ATOM   6621  H  HB2  . MET A 1 82  ? -2.366  -1.767  -13.348 1.00 1.27  ? 177 MET A HB2  3  
ATOM   6622  H  HB3  . MET A 1 82  ? -1.593  -1.216  -11.876 1.00 1.24  ? 177 MET A HB3  3  
ATOM   6623  H  HG2  . MET A 1 82  ? -3.718  0.283   -13.450 1.00 2.54  ? 177 MET A HG2  3  
ATOM   6624  H  HG3  . MET A 1 82  ? -3.945  -0.558  -11.928 1.00 2.16  ? 177 MET A HG3  3  
ATOM   6625  H  HE1  . MET A 1 82  ? -1.684  1.774   -9.538  1.00 2.98  ? 177 MET A HE1  3  
ATOM   6626  H  HE2  . MET A 1 82  ? -2.475  0.190   -9.670  1.00 2.50  ? 177 MET A HE2  3  
ATOM   6627  H  HE3  . MET A 1 82  ? -0.954  0.521   -10.548 1.00 3.14  ? 177 MET A HE3  3  
ATOM   6628  N  N    . ALA A 1 83  ? 0.632   -1.949  -14.300 1.00 0.82  ? 178 ALA A N    3  
ATOM   6629  C  CA   . ALA A 1 83  ? 1.874   -2.725  -14.265 1.00 0.88  ? 178 ALA A CA   3  
ATOM   6630  C  C    . ALA A 1 83  ? 3.122   -1.867  -14.548 1.00 1.07  ? 178 ALA A C    3  
ATOM   6631  O  O    . ALA A 1 83  ? 4.164   -2.094  -13.934 1.00 1.23  ? 178 ALA A O    3  
ATOM   6632  C  CB   . ALA A 1 83  ? 1.745   -3.878  -15.263 1.00 0.96  ? 178 ALA A CB   3  
ATOM   6633  H  H    . ALA A 1 83  ? -0.089  -2.216  -14.958 1.00 0.85  ? 178 ALA A H    3  
ATOM   6634  H  HA   . ALA A 1 83  ? 1.995   -3.140  -13.263 1.00 0.93  ? 178 ALA A HA   3  
ATOM   6635  H  HB1  . ALA A 1 83  ? 1.705   -3.484  -16.278 1.00 1.60  ? 178 ALA A HB1  3  
ATOM   6636  H  HB2  . ALA A 1 83  ? 2.608   -4.538  -15.174 1.00 1.80  ? 178 ALA A HB2  3  
ATOM   6637  H  HB3  . ALA A 1 83  ? 0.835   -4.446  -15.063 1.00 1.94  ? 178 ALA A HB3  3  
ATOM   6638  N  N    . ARG A 1 84  ? 3.013   -0.850  -15.417 1.00 1.18  ? 179 ARG A N    3  
ATOM   6639  C  CA   . ARG A 1 84  ? 4.094   0.119   -15.640 1.00 1.44  ? 179 ARG A CA   3  
ATOM   6640  C  C    . ARG A 1 84  ? 4.276   1.040   -14.432 1.00 1.31  ? 179 ARG A C    3  
ATOM   6641  O  O    . ARG A 1 84  ? 5.398   1.215   -13.974 1.00 1.37  ? 179 ARG A O    3  
ATOM   6642  C  CB   . ARG A 1 84  ? 3.848   0.952   -16.906 1.00 1.76  ? 179 ARG A CB   3  
ATOM   6643  C  CG   . ARG A 1 84  ? 3.691   0.133   -18.198 1.00 2.41  ? 179 ARG A CG   3  
ATOM   6644  C  CD   . ARG A 1 84  ? 4.865   -0.823  -18.450 1.00 4.18  ? 179 ARG A CD   3  
ATOM   6645  N  NE   . ARG A 1 84  ? 4.826   -1.338  -19.829 1.00 5.06  ? 179 ARG A NE   3  
ATOM   6646  C  CZ   . ARG A 1 84  ? 5.559   -0.915  -20.853 1.00 5.51  ? 179 ARG A CZ   3  
ATOM   6647  N  NH1  . ARG A 1 84  ? 6.532   -0.037  -20.719 1.00 5.66  ? 179 ARG A NH1  3  
ATOM   6648  N  NH2  . ARG A 1 84  ? 5.310   -1.380  -22.053 1.00 6.53  ? 179 ARG A NH2  3  
ATOM   6649  H  H    . ARG A 1 84  ? 2.114   -0.678  -15.849 1.00 1.13  ? 179 ARG A H    3  
ATOM   6650  H  HA   . ARG A 1 84  ? 5.030   -0.427  -15.766 1.00 1.59  ? 179 ARG A HA   3  
ATOM   6651  H  HB2  . ARG A 1 84  ? 2.954   1.556   -16.770 1.00 1.56  ? 179 ARG A HB2  3  
ATOM   6652  H  HB3  . ARG A 1 84  ? 4.690   1.634   -17.036 1.00 2.64  ? 179 ARG A HB3  3  
ATOM   6653  H  HG2  . ARG A 1 84  ? 2.765   -0.440  -18.160 1.00 3.41  ? 179 ARG A HG2  3  
ATOM   6654  H  HG3  . ARG A 1 84  ? 3.620   0.836   -19.030 1.00 2.44  ? 179 ARG A HG3  3  
ATOM   6655  H  HD2  . ARG A 1 84  ? 5.805   -0.301  -18.260 1.00 4.49  ? 179 ARG A HD2  3  
ATOM   6656  H  HD3  . ARG A 1 84  ? 4.801   -1.661  -17.754 1.00 5.53  ? 179 ARG A HD3  3  
ATOM   6657  H  HE   . ARG A 1 84  ? 4.129   -2.035  -20.035 1.00 5.81  ? 179 ARG A HE   3  
ATOM   6658  H  HH11 . ARG A 1 84  ? 6.785   0.319   -19.818 1.00 5.68  ? 179 ARG A HH11 3  
ATOM   6659  H  HH12 . ARG A 1 84  ? 7.055   0.272   -21.535 1.00 6.29  ? 179 ARG A HH12 3  
ATOM   6660  H  HH21 . ARG A 1 84  ? 4.551   -2.029  -22.236 1.00 7.21  ? 179 ARG A HH21 3  
ATOM   6661  H  HH22 . ARG A 1 84  ? 5.866   -1.067  -22.838 1.00 6.96  ? 179 ARG A HH22 3  
ATOM   6662  N  N    . TYR A 1 85  ? 3.184   1.575   -13.867 1.00 1.19  ? 180 TYR A N    3  
ATOM   6663  C  CA   . TYR A 1 85  ? 3.255   2.441   -12.678 1.00 1.16  ? 180 TYR A CA   3  
ATOM   6664  C  C    . TYR A 1 85  ? 3.833   1.709   -11.450 1.00 1.02  ? 180 TYR A C    3  
ATOM   6665  O  O    . TYR A 1 85  ? 4.581   2.301   -10.679 1.00 1.10  ? 180 TYR A O    3  
ATOM   6666  C  CB   . TYR A 1 85  ? 1.869   3.034   -12.385 1.00 1.25  ? 180 TYR A CB   3  
ATOM   6667  C  CG   . TYR A 1 85  ? 1.923   4.238   -11.459 1.00 1.24  ? 180 TYR A CG   3  
ATOM   6668  C  CD1  . TYR A 1 85  ? 2.149   5.521   -11.998 1.00 2.18  ? 180 TYR A CD1  3  
ATOM   6669  C  CD2  . TYR A 1 85  ? 1.791   4.079   -10.065 1.00 1.77  ? 180 TYR A CD2  3  
ATOM   6670  C  CE1  . TYR A 1 85  ? 2.245   6.640   -11.150 1.00 2.44  ? 180 TYR A CE1  3  
ATOM   6671  C  CE2  . TYR A 1 85  ? 1.886   5.196   -9.211  1.00 2.06  ? 180 TYR A CE2  3  
ATOM   6672  C  CZ   . TYR A 1 85  ? 2.112   6.481   -9.754  1.00 1.96  ? 180 TYR A CZ   3  
ATOM   6673  O  OH   . TYR A 1 85  ? 2.202   7.567   -8.939  1.00 2.46  ? 180 TYR A OH   3  
ATOM   6674  H  H    . TYR A 1 85  ? 2.280   1.396   -14.284 1.00 1.22  ? 180 TYR A H    3  
ATOM   6675  H  HA   . TYR A 1 85  ? 3.935   3.265   -12.899 1.00 1.33  ? 180 TYR A HA   3  
ATOM   6676  H  HB2  . TYR A 1 85  ? 1.412   3.351   -13.324 1.00 1.55  ? 180 TYR A HB2  3  
ATOM   6677  H  HB3  . TYR A 1 85  ? 1.225   2.267   -11.950 1.00 1.43  ? 180 TYR A HB3  3  
ATOM   6678  H  HD1  . TYR A 1 85  ? 2.256   5.646   -13.066 1.00 3.09  ? 180 TYR A HD1  3  
ATOM   6679  H  HD2  . TYR A 1 85  ? 1.630   3.098   -9.641  1.00 2.60  ? 180 TYR A HD2  3  
ATOM   6680  H  HE1  . TYR A 1 85  ? 2.429   7.622   -11.560 1.00 3.42  ? 180 TYR A HE1  3  
ATOM   6681  H  HE2  . TYR A 1 85  ? 1.797   5.064   -8.144  1.00 2.94  ? 180 TYR A HE2  3  
ATOM   6682  H  HH   . TYR A 1 85  ? 2.070   7.342   -8.016  1.00 2.69  ? 180 TYR A HH   3  
ATOM   6683  N  N    . VAL A 1 86  ? 3.546   0.409   -11.321 1.00 0.94  ? 181 VAL A N    3  
ATOM   6684  C  CA   . VAL A 1 86  ? 4.245   -0.519  -10.417 1.00 1.01  ? 181 VAL A CA   3  
ATOM   6685  C  C    . VAL A 1 86  ? 5.746   -0.581  -10.754 1.00 1.11  ? 181 VAL A C    3  
ATOM   6686  O  O    . VAL A 1 86  ? 6.564   -0.163  -9.941  1.00 1.13  ? 181 VAL A O    3  
ATOM   6687  C  CB   . VAL A 1 86  ? 3.566   -1.915  -10.450 1.00 1.06  ? 181 VAL A CB   3  
ATOM   6688  C  CG1  . VAL A 1 86  ? 4.446   -3.068  -9.935  1.00 1.45  ? 181 VAL A CG1  3  
ATOM   6689  C  CG2  . VAL A 1 86  ? 2.256   -1.881  -9.643  1.00 1.11  ? 181 VAL A CG2  3  
ATOM   6690  H  H    . VAL A 1 86  ? 2.812   0.045   -11.925 1.00 0.91  ? 181 VAL A H    3  
ATOM   6691  H  HA   . VAL A 1 86  ? 4.153   -0.129  -9.402  1.00 1.04  ? 181 VAL A HA   3  
ATOM   6692  H  HB   . VAL A 1 86  ? 3.307   -2.145  -11.482 1.00 1.22  ? 181 VAL A HB   3  
ATOM   6693  H  HG11 . VAL A 1 86  ? 5.258   -3.272  -10.632 1.00 2.12  ? 181 VAL A HG11 3  
ATOM   6694  H  HG12 . VAL A 1 86  ? 4.863   -2.819  -8.967  1.00 1.88  ? 181 VAL A HG12 3  
ATOM   6695  H  HG13 . VAL A 1 86  ? 3.852   -3.973  -9.840  1.00 2.55  ? 181 VAL A HG13 3  
ATOM   6696  H  HG21 . VAL A 1 86  ? 1.606   -1.084  -10.006 1.00 1.90  ? 181 VAL A HG21 3  
ATOM   6697  H  HG22 . VAL A 1 86  ? 1.730   -2.829  -9.753  1.00 2.02  ? 181 VAL A HG22 3  
ATOM   6698  H  HG23 . VAL A 1 86  ? 2.468   -1.711  -8.588  1.00 1.64  ? 181 VAL A HG23 3  
ATOM   6699  N  N    . GLN A 1 87  ? 6.114   -1.080  -11.943 1.00 1.29  ? 182 GLN A N    3  
ATOM   6700  C  CA   . GLN A 1 87  ? 7.496   -1.384  -12.341 1.00 1.54  ? 182 GLN A CA   3  
ATOM   6701  C  C    . GLN A 1 87  ? 8.450   -0.195  -12.245 1.00 1.71  ? 182 GLN A C    3  
ATOM   6702  O  O    . GLN A 1 87  ? 9.533   -0.347  -11.684 1.00 2.08  ? 182 GLN A O    3  
ATOM   6703  C  CB   . GLN A 1 87  ? 7.454   -1.922  -13.788 1.00 1.51  ? 182 GLN A CB   3  
ATOM   6704  C  CG   . GLN A 1 87  ? 8.829   -2.258  -14.394 1.00 2.14  ? 182 GLN A CG   3  
ATOM   6705  C  CD   . GLN A 1 87  ? 8.747   -2.534  -15.896 1.00 2.51  ? 182 GLN A CD   3  
ATOM   6706  O  OE1  . GLN A 1 87  ? 8.692   -3.676  -16.342 1.00 2.73  ? 182 GLN A OE1  3  
ATOM   6707  N  NE2  . GLN A 1 87  ? 8.734   -1.509  -16.725 1.00 3.09  ? 182 GLN A NE2  3  
ATOM   6708  H  H    . GLN A 1 87  ? 5.385   -1.344  -12.598 1.00 1.36  ? 182 GLN A H    3  
ATOM   6709  H  HA   . GLN A 1 87  ? 7.925   -2.131  -11.671 1.00 1.72  ? 182 GLN A HA   3  
ATOM   6710  H  HB2  . GLN A 1 87  ? 6.836   -2.820  -13.817 1.00 2.43  ? 182 GLN A HB2  3  
ATOM   6711  H  HB3  . GLN A 1 87  ? 6.979   -1.169  -14.420 1.00 1.64  ? 182 GLN A HB3  3  
ATOM   6712  H  HG2  . GLN A 1 87  ? 9.517   -1.424  -14.255 1.00 2.55  ? 182 GLN A HG2  3  
ATOM   6713  H  HG3  . GLN A 1 87  ? 9.244   -3.131  -13.888 1.00 3.13  ? 182 GLN A HG3  3  
ATOM   6714  H  HE21 . GLN A 1 87  ? 8.777   -0.552  -16.366 1.00 3.38  ? 182 GLN A HE21 3  
ATOM   6715  H  HE22 . GLN A 1 87  ? 8.876   -1.686  -17.711 1.00 3.57  ? 182 GLN A HE22 3  
ATOM   6716  N  N    . ASP A 1 88  ? 8.097   0.930   -12.861 1.00 1.65  ? 183 ASP A N    3  
ATOM   6717  C  CA   . ASP A 1 88  ? 8.968   2.096   -13.018 1.00 1.92  ? 183 ASP A CA   3  
ATOM   6718  C  C    . ASP A 1 88  ? 9.124   2.962   -11.752 1.00 1.55  ? 183 ASP A C    3  
ATOM   6719  O  O    . ASP A 1 88  ? 9.986   3.841   -11.716 1.00 1.55  ? 183 ASP A O    3  
ATOM   6720  C  CB   . ASP A 1 88  ? 8.562   2.856   -14.289 1.00 2.45  ? 183 ASP A CB   3  
ATOM   6721  C  CG   . ASP A 1 88  ? 9.259   2.253   -15.518 1.00 3.85  ? 183 ASP A CG   3  
ATOM   6722  O  OD1  . ASP A 1 88  ? 8.766   1.276   -16.129 1.00 4.97  ? 183 ASP A OD1  3  
ATOM   6723  O  OD2  . ASP A 1 88  ? 10.333  2.787   -15.883 1.00 4.44  ? 183 ASP A OD2  3  
ATOM   6724  H  H    . ASP A 1 88  ? 7.151   1.009   -13.225 1.00 1.52  ? 183 ASP A H    3  
ATOM   6725  H  HA   . ASP A 1 88  ? 9.977   1.717   -13.196 1.00 2.34  ? 183 ASP A HA   3  
ATOM   6726  H  HB2  . ASP A 1 88  ? 7.480   2.842   -14.419 1.00 2.07  ? 183 ASP A HB2  3  
ATOM   6727  H  HB3  . ASP A 1 88  ? 8.870   3.899   -14.195 1.00 2.84  ? 183 ASP A HB3  3  
ATOM   6728  N  N    . PHE A 1 89  ? 8.336   2.693   -10.701 1.00 1.34  ? 184 PHE A N    3  
ATOM   6729  C  CA   . PHE A 1 89  ? 8.708   3.049   -9.329  1.00 1.28  ? 184 PHE A CA   3  
ATOM   6730  C  C    . PHE A 1 89  ? 9.655   1.981   -8.763  1.00 1.99  ? 184 PHE A C    3  
ATOM   6731  O  O    . PHE A 1 89  ? 10.794  2.289   -8.419  1.00 2.19  ? 184 PHE A O    3  
ATOM   6732  C  CB   . PHE A 1 89  ? 7.451   3.243   -8.457  1.00 1.21  ? 184 PHE A CB   3  
ATOM   6733  C  CG   . PHE A 1 89  ? 7.256   4.682   -8.019  1.00 1.13  ? 184 PHE A CG   3  
ATOM   6734  C  CD1  . PHE A 1 89  ? 8.087   5.222   -7.019  1.00 2.06  ? 184 PHE A CD1  3  
ATOM   6735  C  CD2  . PHE A 1 89  ? 6.268   5.487   -8.618  1.00 2.26  ? 184 PHE A CD2  3  
ATOM   6736  C  CE1  . PHE A 1 89  ? 7.927   6.559   -6.613  1.00 1.93  ? 184 PHE A CE1  3  
ATOM   6737  C  CE2  . PHE A 1 89  ? 6.107   6.824   -8.210  1.00 2.33  ? 184 PHE A CE2  3  
ATOM   6738  C  CZ   . PHE A 1 89  ? 6.932   7.360   -7.203  1.00 1.29  ? 184 PHE A CZ   3  
ATOM   6739  H  H    . PHE A 1 89  ? 7.629   1.981   -10.824 1.00 1.37  ? 184 PHE A H    3  
ATOM   6740  H  HA   . PHE A 1 89  ? 9.266   3.986   -9.341  1.00 1.38  ? 184 PHE A HA   3  
ATOM   6741  H  HB2  . PHE A 1 89  ? 6.565   2.900   -8.992  1.00 1.29  ? 184 PHE A HB2  3  
ATOM   6742  H  HB3  . PHE A 1 89  ? 7.532   2.632   -7.557  1.00 1.28  ? 184 PHE A HB3  3  
ATOM   6743  H  HD1  . PHE A 1 89  ? 8.853   4.611   -6.564  1.00 3.10  ? 184 PHE A HD1  3  
ATOM   6744  H  HD2  . PHE A 1 89  ? 5.633   5.078   -9.392  1.00 3.60  ? 184 PHE A HD2  3  
ATOM   6745  H  HE1  . PHE A 1 89  ? 8.566   6.968   -5.845  1.00 3.36  ? 184 PHE A HE1  3  
ATOM   6746  H  HE2  . PHE A 1 89  ? 5.346   7.434   -8.675  1.00 3.71  ? 184 PHE A HE2  3  
ATOM   6747  H  HZ   . PHE A 1 89  ? 6.805   8.381   -6.871  1.00 1.50  ? 184 PHE A HZ   3  
ATOM   6748  N  N    . HIS A 1 90  ? 9.196   0.723   -8.729  1.00 1.24  ? 185 HIS A N    3  
ATOM   6749  C  CA   . HIS A 1 90  ? 10.013  -0.484  -8.548  1.00 1.33  ? 185 HIS A CA   3  
ATOM   6750  C  C    . HIS A 1 90  ? 9.191   -1.765  -8.802  1.00 1.30  ? 185 HIS A C    3  
ATOM   6751  O  O    . HIS A 1 90  ? 8.077   -1.856  -8.285  1.00 1.26  ? 185 HIS A O    3  
ATOM   6752  C  CB   . HIS A 1 90  ? 10.609  -0.540  -7.129  1.00 1.52  ? 185 HIS A CB   3  
ATOM   6753  C  CG   . HIS A 1 90  ? 11.786  -1.461  -7.058  1.00 1.59  ? 185 HIS A CG   3  
ATOM   6754  N  ND1  . HIS A 1 90  ? 11.790  -2.756  -6.545  1.00 2.12  ? 185 HIS A ND1  3  
ATOM   6755  C  CD2  . HIS A 1 90  ? 13.007  -1.180  -7.582  1.00 1.86  ? 185 HIS A CD2  3  
ATOM   6756  C  CE1  . HIS A 1 90  ? 13.048  -3.202  -6.721  1.00 2.14  ? 185 HIS A CE1  3  
ATOM   6757  N  NE2  . HIS A 1 90  ? 13.804  -2.274  -7.336  1.00 2.10  ? 185 HIS A NE2  3  
ATOM   6758  H  H    . HIS A 1 90  ? 8.243   0.576   -9.043  1.00 1.17  ? 185 HIS A H    3  
ATOM   6759  H  HA   . HIS A 1 90  ? 10.825  -0.423  -9.273  1.00 1.38  ? 185 HIS A HA   3  
ATOM   6760  H  HB2  . HIS A 1 90  ? 10.948  0.443   -6.809  1.00 1.58  ? 185 HIS A HB2  3  
ATOM   6761  H  HB3  . HIS A 1 90  ? 9.857   -0.875  -6.417  1.00 1.80  ? 185 HIS A HB3  3  
ATOM   6762  H  HD2  . HIS A 1 90  ? 13.252  -0.275  -8.116  1.00 2.28  ? 185 HIS A HD2  3  
ATOM   6763  H  HE1  . HIS A 1 90  ? 13.407  -4.171  -6.400  1.00 2.55  ? 185 HIS A HE1  3  
ATOM   6764  H  HE2  . HIS A 1 90  ? 14.801  -2.356  -7.537  1.00 2.58  ? 185 HIS A HE2  3  
ATOM   6765  N  N    . PRO A 1 91  ? 9.712   -2.820  -9.465  1.00 1.42  ? 186 PRO A N    3  
ATOM   6766  C  CA   . PRO A 1 91  ? 8.972   -4.073  -9.670  1.00 1.47  ? 186 PRO A CA   3  
ATOM   6767  C  C    . PRO A 1 91  ? 8.520   -4.783  -8.378  1.00 1.54  ? 186 PRO A C    3  
ATOM   6768  O  O    . PRO A 1 91  ? 7.658   -5.655  -8.458  1.00 2.18  ? 186 PRO A O    3  
ATOM   6769  C  CB   . PRO A 1 91  ? 9.884   -4.958  -10.529 1.00 1.67  ? 186 PRO A CB   3  
ATOM   6770  C  CG   . PRO A 1 91  ? 11.282  -4.394  -10.285 1.00 1.74  ? 186 PRO A CG   3  
ATOM   6771  C  CD   . PRO A 1 91  ? 11.012  -2.902  -10.115 1.00 1.60  ? 186 PRO A CD   3  
ATOM   6772  H  HA   . PRO A 1 91  ? 8.068   -3.856  -10.239 1.00 1.44  ? 186 PRO A HA   3  
ATOM   6773  H  HB2  . PRO A 1 91  ? 9.823   -6.012  -10.252 1.00 1.75  ? 186 PRO A HB2  3  
ATOM   6774  H  HB3  . PRO A 1 91  ? 9.623   -4.831  -11.581 1.00 1.75  ? 186 PRO A HB3  3  
ATOM   6775  H  HG2  . PRO A 1 91  ? 11.687  -4.801  -9.356  1.00 1.77  ? 186 PRO A HG2  3  
ATOM   6776  H  HG3  . PRO A 1 91  ? 11.953  -4.592  -11.121 1.00 1.92  ? 186 PRO A HG3  3  
ATOM   6777  H  HD2  . PRO A 1 91  ? 11.803  -2.448  -9.527  1.00 1.63  ? 186 PRO A HD2  3  
ATOM   6778  H  HD3  . PRO A 1 91  ? 10.958  -2.425  -11.094 1.00 1.68  ? 186 PRO A HD3  3  
ATOM   6779  N  N    . ARG A 1 92  ? 9.038   -4.400  -7.199  1.00 1.31  ? 187 ARG A N    3  
ATOM   6780  C  CA   . ARG A 1 92  ? 8.579   -4.889  -5.890  1.00 1.31  ? 187 ARG A CA   3  
ATOM   6781  C  C    . ARG A 1 92  ? 7.265   -4.236  -5.384  1.00 1.19  ? 187 ARG A C    3  
ATOM   6782  O  O    . ARG A 1 92  ? 6.690   -4.720  -4.404  1.00 1.29  ? 187 ARG A O    3  
ATOM   6783  C  CB   . ARG A 1 92  ? 9.744   -4.712  -4.896  1.00 1.49  ? 187 ARG A CB   3  
ATOM   6784  C  CG   . ARG A 1 92  ? 9.625   -5.486  -3.576  1.00 1.87  ? 187 ARG A CG   3  
ATOM   6785  C  CD   . ARG A 1 92  ? 9.529   -7.004  -3.779  1.00 2.86  ? 187 ARG A CD   3  
ATOM   6786  N  NE   . ARG A 1 92  ? 9.433   -7.686  -2.487  1.00 3.23  ? 187 ARG A NE   3  
ATOM   6787  C  CZ   . ARG A 1 92  ? 9.336   -8.988  -2.274  1.00 4.23  ? 187 ARG A CZ   3  
ATOM   6788  N  NH1  . ARG A 1 92  ? 9.352   -9.883  -3.239  1.00 5.24  ? 187 ARG A NH1  3  
ATOM   6789  N  NH2  . ARG A 1 92  ? 9.235   -9.432  -1.046  1.00 4.90  ? 187 ARG A NH2  3  
ATOM   6790  H  H    . ARG A 1 92  ? 9.784   -3.716  -7.194  1.00 1.55  ? 187 ARG A H    3  
ATOM   6791  H  HA   . ARG A 1 92  ? 8.378   -5.952  -6.007  1.00 1.41  ? 187 ARG A HA   3  
ATOM   6792  H  HB2  . ARG A 1 92  ? 10.665  -5.043  -5.378  1.00 2.01  ? 187 ARG A HB2  3  
ATOM   6793  H  HB3  . ARG A 1 92  ? 9.851   -3.651  -4.665  1.00 1.63  ? 187 ARG A HB3  3  
ATOM   6794  H  HG2  . ARG A 1 92  ? 10.509  -5.272  -2.975  1.00 2.39  ? 187 ARG A HG2  3  
ATOM   6795  H  HG3  . ARG A 1 92  ? 8.757   -5.133  -3.024  1.00 2.88  ? 187 ARG A HG3  3  
ATOM   6796  H  HD2  . ARG A 1 92  ? 8.642   -7.244  -4.365  1.00 4.17  ? 187 ARG A HD2  3  
ATOM   6797  H  HD3  . ARG A 1 92  ? 10.418  -7.349  -4.312  1.00 3.40  ? 187 ARG A HD3  3  
ATOM   6798  H  HE   . ARG A 1 92  ? 9.294   -7.086  -1.675  1.00 3.45  ? 187 ARG A HE   3  
ATOM   6799  H  HH11 . ARG A 1 92  ? 9.491   -9.614  -4.210  1.00 5.40  ? 187 ARG A HH11 3  
ATOM   6800  H  HH12 . ARG A 1 92  ? 9.238   -10.860 -2.977  1.00 6.22  ? 187 ARG A HH12 3  
ATOM   6801  H  HH21 . ARG A 1 92  ? 9.468   -8.802  -0.287  1.00 4.87  ? 187 ARG A HH21 3  
ATOM   6802  H  HH22 . ARG A 1 92  ? 9.197   -10.434 -0.894  1.00 5.72  ? 187 ARG A HH22 3  
ATOM   6803  N  N    . LEU A 1 93  ? 6.773   -3.168  -6.032  1.00 1.06  ? 188 LEU A N    3  
ATOM   6804  C  CA   . LEU A 1 93  ? 5.423   -2.613  -5.812  1.00 0.95  ? 188 LEU A CA   3  
ATOM   6805  C  C    . LEU A 1 93  ? 4.342   -3.639  -6.193  1.00 0.90  ? 188 LEU A C    3  
ATOM   6806  O  O    . LEU A 1 93  ? 4.575   -4.561  -6.983  1.00 1.04  ? 188 LEU A O    3  
ATOM   6807  C  CB   . LEU A 1 93  ? 5.231   -1.310  -6.633  1.00 1.01  ? 188 LEU A CB   3  
ATOM   6808  C  CG   . LEU A 1 93  ? 5.608   0.037   -5.985  1.00 1.11  ? 188 LEU A CG   3  
ATOM   6809  C  CD1  . LEU A 1 93  ? 4.548   0.460   -4.957  1.00 1.74  ? 188 LEU A CD1  3  
ATOM   6810  C  CD2  . LEU A 1 93  ? 6.999   0.031   -5.340  1.00 1.64  ? 188 LEU A CD2  3  
ATOM   6811  H  H    . LEU A 1 93  ? 7.291   -2.817  -6.829  1.00 1.09  ? 188 LEU A H    3  
ATOM   6812  H  HA   . LEU A 1 93  ? 5.294   -2.396  -4.751  1.00 0.99  ? 188 LEU A HA   3  
ATOM   6813  H  HB2  . LEU A 1 93  ? 5.786   -1.391  -7.563  1.00 1.58  ? 188 LEU A HB2  3  
ATOM   6814  H  HB3  . LEU A 1 93  ? 4.183   -1.230  -6.929  1.00 1.60  ? 188 LEU A HB3  3  
ATOM   6815  H  HG   . LEU A 1 93  ? 5.616   0.784   -6.784  1.00 1.41  ? 188 LEU A HG   3  
ATOM   6816  H  HD11 . LEU A 1 93  ? 4.817   1.424   -4.522  1.00 2.40  ? 188 LEU A HD11 3  
ATOM   6817  H  HD12 . LEU A 1 93  ? 3.577   0.557   -5.445  1.00 2.27  ? 188 LEU A HD12 3  
ATOM   6818  H  HD13 . LEU A 1 93  ? 4.469   -0.281  -4.162  1.00 2.64  ? 188 LEU A HD13 3  
ATOM   6819  H  HD21 . LEU A 1 93  ? 7.240   1.031   -4.976  1.00 1.86  ? 188 LEU A HD21 3  
ATOM   6820  H  HD22 . LEU A 1 93  ? 7.035   -0.668  -4.506  1.00 2.67  ? 188 LEU A HD22 3  
ATOM   6821  H  HD23 . LEU A 1 93  ? 7.735   -0.252  -6.088  1.00 2.41  ? 188 LEU A HD23 3  
ATOM   6822  N  N    . LEU A 1 94  ? 3.134   -3.450  -5.663  1.00 0.85  ? 189 LEU A N    3  
ATOM   6823  C  CA   . LEU A 1 94  ? 1.963   -4.267  -5.933  1.00 0.88  ? 189 LEU A CA   3  
ATOM   6824  C  C    . LEU A 1 94  ? 0.768   -3.339  -6.191  1.00 0.78  ? 189 LEU A C    3  
ATOM   6825  O  O    . LEU A 1 94  ? 0.466   -2.481  -5.365  1.00 0.78  ? 189 LEU A O    3  
ATOM   6826  C  CB   . LEU A 1 94  ? 1.805   -5.188  -4.709  1.00 1.06  ? 189 LEU A CB   3  
ATOM   6827  C  CG   . LEU A 1 94  ? 0.857   -6.372  -4.931  1.00 1.40  ? 189 LEU A CG   3  
ATOM   6828  C  CD1  . LEU A 1 94  ? 1.131   -7.470  -3.892  1.00 1.99  ? 189 LEU A CD1  3  
ATOM   6829  C  CD2  . LEU A 1 94  ? -0.622  -5.975  -4.860  1.00 2.48  ? 189 LEU A CD2  3  
ATOM   6830  H  H    . LEU A 1 94  ? 3.001   -2.730  -4.972  1.00 0.88  ? 189 LEU A H    3  
ATOM   6831  H  HA   . LEU A 1 94  ? 2.134   -4.871  -6.823  1.00 1.00  ? 189 LEU A HA   3  
ATOM   6832  H  HB2  . LEU A 1 94  ? 2.789   -5.597  -4.473  1.00 1.77  ? 189 LEU A HB2  3  
ATOM   6833  H  HB3  . LEU A 1 94  ? 1.482   -4.605  -3.850  1.00 1.66  ? 189 LEU A HB3  3  
ATOM   6834  H  HG   . LEU A 1 94  ? 1.081   -6.761  -5.919  1.00 2.02  ? 189 LEU A HG   3  
ATOM   6835  H  HD11 . LEU A 1 94  ? 2.168   -7.800  -3.962  1.00 2.27  ? 189 LEU A HD11 3  
ATOM   6836  H  HD12 . LEU A 1 94  ? 0.944   -7.092  -2.886  1.00 2.75  ? 189 LEU A HD12 3  
ATOM   6837  H  HD13 . LEU A 1 94  ? 0.484   -8.328  -4.079  1.00 2.99  ? 189 LEU A HD13 3  
ATOM   6838  H  HD21 . LEU A 1 94  ? -0.904  -5.410  -5.745  1.00 3.33  ? 189 LEU A HD21 3  
ATOM   6839  H  HD22 . LEU A 1 94  ? -1.238  -6.871  -4.825  1.00 3.21  ? 189 LEU A HD22 3  
ATOM   6840  H  HD23 . LEU A 1 94  ? -0.813  -5.380  -3.969  1.00 3.05  ? 189 LEU A HD23 3  
ATOM   6841  N  N    . GLY A 1 95  ? 0.115   -3.489  -7.347  1.00 0.77  ? 190 GLY A N    3  
ATOM   6842  C  CA   . GLY A 1 95  ? -1.067  -2.712  -7.734  1.00 0.71  ? 190 GLY A CA   3  
ATOM   6843  C  C    . GLY A 1 95  ? -2.315  -3.586  -7.713  1.00 0.69  ? 190 GLY A C    3  
ATOM   6844  O  O    . GLY A 1 95  ? -2.370  -4.580  -8.430  1.00 0.91  ? 190 GLY A O    3  
ATOM   6845  H  H    . GLY A 1 95  ? 0.397   -4.235  -7.970  1.00 0.86  ? 190 GLY A H    3  
ATOM   6846  H  HA2  . GLY A 1 95  ? -1.209  -1.860  -7.070  1.00 0.71  ? 190 GLY A HA2  3  
ATOM   6847  H  HA3  . GLY A 1 95  ? -0.946  -2.354  -8.756  1.00 0.84  ? 190 GLY A HA3  3  
ATOM   6848  N  N    . LEU A 1 96  ? -3.318  -3.200  -6.924  1.00 0.64  ? 191 LEU A N    3  
ATOM   6849  C  CA   . LEU A 1 96  ? -4.624  -3.855  -6.828  1.00 0.78  ? 191 LEU A CA   3  
ATOM   6850  C  C    . LEU A 1 96  ? -5.692  -3.021  -7.547  1.00 0.78  ? 191 LEU A C    3  
ATOM   6851  O  O    . LEU A 1 96  ? -5.725  -1.794  -7.418  1.00 0.90  ? 191 LEU A O    3  
ATOM   6852  C  CB   . LEU A 1 96  ? -4.998  -4.042  -5.343  1.00 1.11  ? 191 LEU A CB   3  
ATOM   6853  C  CG   . LEU A 1 96  ? -4.066  -4.969  -4.537  1.00 1.02  ? 191 LEU A CG   3  
ATOM   6854  C  CD1  . LEU A 1 96  ? -4.467  -4.968  -3.055  1.00 2.30  ? 191 LEU A CD1  3  
ATOM   6855  C  CD2  . LEU A 1 96  ? -4.096  -6.412  -5.063  1.00 2.23  ? 191 LEU A CD2  3  
ATOM   6856  H  H    . LEU A 1 96  ? -3.183  -2.356  -6.378  1.00 0.69  ? 191 LEU A H    3  
ATOM   6857  H  HA   . LEU A 1 96  ? -4.575  -4.828  -7.314  1.00 0.92  ? 191 LEU A HA   3  
ATOM   6858  H  HB2  . LEU A 1 96  ? -5.001  -3.060  -4.871  1.00 1.87  ? 191 LEU A HB2  3  
ATOM   6859  H  HB3  . LEU A 1 96  ? -6.012  -4.440  -5.289  1.00 1.78  ? 191 LEU A HB3  3  
ATOM   6860  H  HG   . LEU A 1 96  ? -3.047  -4.590  -4.602  1.00 1.81  ? 191 LEU A HG   3  
ATOM   6861  H  HD11 . LEU A 1 96  ? -3.796  -5.616  -2.489  1.00 3.16  ? 191 LEU A HD11 3  
ATOM   6862  H  HD12 . LEU A 1 96  ? -4.387  -3.960  -2.652  1.00 3.27  ? 191 LEU A HD12 3  
ATOM   6863  H  HD13 . LEU A 1 96  ? -5.491  -5.326  -2.940  1.00 2.77  ? 191 LEU A HD13 3  
ATOM   6864  H  HD21 . LEU A 1 96  ? -3.537  -7.062  -4.389  1.00 3.00  ? 191 LEU A HD21 3  
ATOM   6865  H  HD22 . LEU A 1 96  ? -5.123  -6.771  -5.128  1.00 3.21  ? 191 LEU A HD22 3  
ATOM   6866  H  HD23 . LEU A 1 96  ? -3.627  -6.459  -6.045  1.00 2.93  ? 191 LEU A HD23 3  
ATOM   6867  N  N    . THR A 1 97  ? -6.596  -3.681  -8.279  1.00 0.84  ? 192 THR A N    3  
ATOM   6868  C  CA   . THR A 1 97  ? -7.691  -3.042  -9.038  1.00 0.96  ? 192 THR A CA   3  
ATOM   6869  C  C    . THR A 1 97  ? -8.914  -3.963  -9.041  1.00 1.08  ? 192 THR A C    3  
ATOM   6870  O  O    . THR A 1 97  ? -8.779  -5.171  -8.836  1.00 1.17  ? 192 THR A O    3  
ATOM   6871  C  CB   . THR A 1 97  ? -7.216  -2.692  -10.464 1.00 1.03  ? 192 THR A CB   3  
ATOM   6872  O  OG1  . THR A 1 97  ? -6.014  -1.960  -10.401 1.00 2.38  ? 192 THR A OG1  3  
ATOM   6873  C  CG2  . THR A 1 97  ? -8.202  -1.820  -11.246 1.00 2.62  ? 192 THR A CG2  3  
ATOM   6874  H  H    . THR A 1 97  ? -6.516  -4.690  -8.344  1.00 0.89  ? 192 THR A H    3  
ATOM   6875  H  HA   . THR A 1 97  ? -7.982  -2.119  -8.537  1.00 1.07  ? 192 THR A HA   3  
ATOM   6876  H  HB   . THR A 1 97  ? -7.036  -3.612  -11.025 1.00 1.89  ? 192 THR A HB   3  
ATOM   6877  H  HG1  . THR A 1 97  ? -5.955  -1.555  -9.527  1.00 2.95  ? 192 THR A HG1  3  
ATOM   6878  H  HG21 . THR A 1 97  ? -9.088  -2.396  -11.512 1.00 3.46  ? 192 THR A HG21 3  
ATOM   6879  H  HG22 . THR A 1 97  ? -8.493  -0.950  -10.654 1.00 3.83  ? 192 THR A HG22 3  
ATOM   6880  H  HG23 . THR A 1 97  ? -7.733  -1.478  -12.170 1.00 2.95  ? 192 THR A HG23 3  
ATOM   6881  N  N    . GLY A 1 98  ? -10.108 -3.396  -9.241  1.00 1.39  ? 193 GLY A N    3  
ATOM   6882  C  CA   . GLY A 1 98  ? -11.380 -4.126  -9.285  1.00 1.71  ? 193 GLY A CA   3  
ATOM   6883  C  C    . GLY A 1 98  ? -12.511 -3.362  -9.977  1.00 1.65  ? 193 GLY A C    3  
ATOM   6884  O  O    . GLY A 1 98  ? -12.385 -2.178  -10.273 1.00 2.26  ? 193 GLY A O    3  
ATOM   6885  H  H    . GLY A 1 98  ? -10.151 -2.401  -9.409  1.00 1.58  ? 193 GLY A H    3  
ATOM   6886  H  HA2  . GLY A 1 98  ? -11.238 -5.086  -9.784  1.00 1.93  ? 193 GLY A HA2  3  
ATOM   6887  H  HA3  . GLY A 1 98  ? -11.697 -4.340  -8.264  1.00 2.08  ? 193 GLY A HA3  3  
ATOM   6888  N  N    . SER A 1 99  ? -13.629 -4.038  -10.233 1.00 1.43  ? 194 SER A N    3  
ATOM   6889  C  CA   . SER A 1 99  ? -14.827 -3.437  -10.854 1.00 1.50  ? 194 SER A CA   3  
ATOM   6890  C  C    . SER A 1 99  ? -15.676 -2.614  -9.861  1.00 1.49  ? 194 SER A C    3  
ATOM   6891  O  O    . SER A 1 99  ? -15.578 -2.809  -8.646  1.00 1.54  ? 194 SER A O    3  
ATOM   6892  C  CB   . SER A 1 99  ? -15.696 -4.547  -11.471 1.00 1.88  ? 194 SER A CB   3  
ATOM   6893  O  OG   . SER A 1 99  ? -15.019 -5.232  -12.510 1.00 2.32  ? 194 SER A OG   3  
ATOM   6894  H  H    . SER A 1 99  ? -13.652 -5.018  -9.963  1.00 1.67  ? 194 SER A H    3  
ATOM   6895  H  HA   . SER A 1 99  ? -14.516 -2.760  -11.653 1.00 1.62  ? 194 SER A HA   3  
ATOM   6896  H  HB2  . SER A 1 99  ? -15.964 -5.261  -10.691 1.00 2.52  ? 194 SER A HB2  3  
ATOM   6897  H  HB3  . SER A 1 99  ? -16.616 -4.117  -11.871 1.00 2.51  ? 194 SER A HB3  3  
ATOM   6898  H  HG   . SER A 1 99  ? -14.906 -4.639  -13.262 1.00 2.69  ? 194 SER A HG   3  
ATOM   6899  N  N    . THR A 1 100 ? -16.572 -1.739  -10.355 1.00 1.57  ? 195 THR A N    3  
ATOM   6900  C  CA   . THR A 1 100 ? -17.388 -0.849  -9.495  1.00 1.66  ? 195 THR A CA   3  
ATOM   6901  C  C    . THR A 1 100 ? -18.150 -1.605  -8.401  1.00 1.70  ? 195 THR A C    3  
ATOM   6902  O  O    . THR A 1 100 ? -17.989 -1.294  -7.225  1.00 1.65  ? 195 THR A O    3  
ATOM   6903  C  CB   . THR A 1 100 ? -18.266 0.100   -10.330 1.00 1.92  ? 195 THR A CB   3  
ATOM   6904  O  OG1  . THR A 1 100 ? -18.857 1.029   -9.452  1.00 3.03  ? 195 THR A OG1  3  
ATOM   6905  C  CG2  . THR A 1 100 ? -19.379 -0.580  -11.129 1.00 2.39  ? 195 THR A CG2  3  
ATOM   6906  H  H    . THR A 1 100 ? -16.643 -1.634  -11.366 1.00 1.63  ? 195 THR A H    3  
ATOM   6907  H  HA   . THR A 1 100 ? -16.697 -0.205  -8.950  1.00 1.59  ? 195 THR A HA   3  
ATOM   6908  H  HB   . THR A 1 100 ? -17.619 0.639   -11.026 1.00 2.25  ? 195 THR A HB   3  
ATOM   6909  H  HG1  . THR A 1 100 ? -19.154 1.809   -9.948  1.00 3.44  ? 195 THR A HG1  3  
ATOM   6910  H  HG21 . THR A 1 100 ? -19.869 0.163   -11.761 1.00 3.22  ? 195 THR A HG21 3  
ATOM   6911  H  HG22 . THR A 1 100 ? -18.963 -1.356  -11.772 1.00 2.83  ? 195 THR A HG22 3  
ATOM   6912  H  HG23 . THR A 1 100 ? -20.121 -1.011  -10.459 1.00 3.12  ? 195 THR A HG23 3  
ATOM   6913  N  N    . LYS A 1 101 ? -18.850 -2.699  -8.733  1.00 1.83  ? 196 LYS A N    3  
ATOM   6914  C  CA   . LYS A 1 101 ? -19.538 -3.548  -7.739  1.00 1.94  ? 196 LYS A CA   3  
ATOM   6915  C  C    . LYS A 1 101 ? -18.596 -4.102  -6.641  1.00 1.85  ? 196 LYS A C    3  
ATOM   6916  O  O    . LYS A 1 101 ? -18.971 -4.212  -5.475  1.00 1.97  ? 196 LYS A O    3  
ATOM   6917  C  CB   . LYS A 1 101 ? -20.313 -4.679  -8.460  1.00 2.13  ? 196 LYS A CB   3  
ATOM   6918  C  CG   . LYS A 1 101 ? -19.444 -5.648  -9.292  1.00 2.49  ? 196 LYS A CG   3  
ATOM   6919  C  CD   . LYS A 1 101 ? -20.178 -6.922  -9.737  1.00 2.80  ? 196 LYS A CD   3  
ATOM   6920  C  CE   . LYS A 1 101 ? -21.266 -6.672  -10.786 1.00 3.95  ? 196 LYS A CE   3  
ATOM   6921  N  NZ   . LYS A 1 101 ? -21.948 -7.936  -11.155 1.00 4.40  ? 196 LYS A NZ   3  
ATOM   6922  H  H    . LYS A 1 101 ? -18.961 -2.910  -9.713  1.00 1.91  ? 196 LYS A H    3  
ATOM   6923  H  HA   . LYS A 1 101 ? -20.269 -2.928  -7.212  1.00 2.03  ? 196 LYS A HA   3  
ATOM   6924  H  HB2  . LYS A 1 101 ? -20.848 -5.251  -7.700  1.00 2.75  ? 196 LYS A HB2  3  
ATOM   6925  H  HB3  . LYS A 1 101 ? -21.062 -4.227  -9.113  1.00 3.49  ? 196 LYS A HB3  3  
ATOM   6926  H  HG2  . LYS A 1 101 ? -19.054 -5.130  -10.170 1.00 3.69  ? 196 LYS A HG2  3  
ATOM   6927  H  HG3  . LYS A 1 101 ? -18.597 -5.979  -8.693  1.00 3.15  ? 196 LYS A HG3  3  
ATOM   6928  H  HD2  . LYS A 1 101 ? -19.443 -7.612  -10.157 1.00 3.47  ? 196 LYS A HD2  3  
ATOM   6929  H  HD3  . LYS A 1 101 ? -20.623 -7.400  -8.860  1.00 2.56  ? 196 LYS A HD3  3  
ATOM   6930  H  HE2  . LYS A 1 101 ? -22.002 -5.975  -10.377 1.00 4.18  ? 196 LYS A HE2  3  
ATOM   6931  H  HE3  . LYS A 1 101 ? -20.819 -6.221  -11.676 1.00 4.99  ? 196 LYS A HE3  3  
ATOM   6932  H  HZ1  . LYS A 1 101 ? -22.656 -7.780  -11.867 1.00 4.83  ? 196 LYS A HZ1  3  
ATOM   6933  H  HZ2  . LYS A 1 101 ? -21.303 -8.629  -11.522 1.00 5.20  ? 196 LYS A HZ2  3  
ATOM   6934  H  HZ3  . LYS A 1 101 ? -22.414 -8.335  -10.343 1.00 4.22  ? 196 LYS A HZ3  3  
ATOM   6935  N  N    . GLN A 1 102 ? -17.366 -4.450  -7.022  1.00 1.72  ? 197 GLN A N    3  
ATOM   6936  C  CA   . GLN A 1 102 ? -16.329 -5.019  -6.163  1.00 1.64  ? 197 GLN A CA   3  
ATOM   6937  C  C    . GLN A 1 102 ? -15.753 -3.945  -5.235  1.00 1.42  ? 197 GLN A C    3  
ATOM   6938  O  O    . GLN A 1 102 ? -15.749 -4.143  -4.022  1.00 1.45  ? 197 GLN A O    3  
ATOM   6939  C  CB   . GLN A 1 102 ? -15.281 -5.651  -7.093  1.00 1.85  ? 197 GLN A CB   3  
ATOM   6940  C  CG   . GLN A 1 102 ? -14.117 -6.405  -6.441  1.00 1.86  ? 197 GLN A CG   3  
ATOM   6941  C  CD   . GLN A 1 102 ? -13.120 -6.872  -7.509  1.00 2.66  ? 197 GLN A CD   3  
ATOM   6942  O  OE1  . GLN A 1 102 ? -13.220 -6.547  -8.685  1.00 3.39  ? 197 GLN A OE1  3  
ATOM   6943  N  NE2  . GLN A 1 102 ? -12.117 -7.640  -7.155  1.00 3.60  ? 197 GLN A NE2  3  
ATOM   6944  H  H    . GLN A 1 102 ? -17.093 -4.183  -7.956  1.00 1.71  ? 197 GLN A H    3  
ATOM   6945  H  HA   . GLN A 1 102 ? -16.759 -5.797  -5.527  1.00 1.75  ? 197 GLN A HA   3  
ATOM   6946  H  HB2  . GLN A 1 102 ? -15.793 -6.344  -7.764  1.00 2.48  ? 197 GLN A HB2  3  
ATOM   6947  H  HB3  . GLN A 1 102 ? -14.843 -4.867  -7.700  1.00 2.93  ? 197 GLN A HB3  3  
ATOM   6948  H  HG2  . GLN A 1 102 ? -13.597 -5.751  -5.740  1.00 3.07  ? 197 GLN A HG2  3  
ATOM   6949  H  HG3  . GLN A 1 102 ? -14.497 -7.270  -5.897  1.00 2.11  ? 197 GLN A HG3  3  
ATOM   6950  H  HE21 . GLN A 1 102 ? -12.022 -7.949  -6.192  1.00 3.59  ? 197 GLN A HE21 3  
ATOM   6951  H  HE22 . GLN A 1 102 ? -11.487 -7.914  -7.888  1.00 4.66  ? 197 GLN A HE22 3  
ATOM   6952  N  N    . VAL A 1 103 ? -15.340 -2.797  -5.788  1.00 1.33  ? 198 VAL A N    3  
ATOM   6953  C  CA   . VAL A 1 103 ? -14.826 -1.651  -5.013  1.00 1.35  ? 198 VAL A CA   3  
ATOM   6954  C  C    . VAL A 1 103 ? -15.896 -1.122  -4.039  1.00 1.38  ? 198 VAL A C    3  
ATOM   6955  O  O    . VAL A 1 103 ? -15.574 -0.771  -2.902  1.00 1.44  ? 198 VAL A O    3  
ATOM   6956  C  CB   . VAL A 1 103 ? -14.308 -0.530  -5.955  1.00 1.46  ? 198 VAL A CB   3  
ATOM   6957  C  CG1  . VAL A 1 103 ? -13.868 0.733   -5.194  1.00 2.82  ? 198 VAL A CG1  3  
ATOM   6958  C  CG2  . VAL A 1 103 ? -13.118 -1.031  -6.795  1.00 1.63  ? 198 VAL A CG2  3  
ATOM   6959  H  H    . VAL A 1 103 ? -15.385 -2.702  -6.805  1.00 1.37  ? 198 VAL A H    3  
ATOM   6960  H  HA   . VAL A 1 103 ? -13.982 -2.008  -4.420  1.00 1.41  ? 198 VAL A HA   3  
ATOM   6961  H  HB   . VAL A 1 103 ? -15.107 -0.249  -6.644  1.00 2.34  ? 198 VAL A HB   3  
ATOM   6962  H  HG11 . VAL A 1 103 ? -14.722 1.197   -4.701  1.00 4.03  ? 198 VAL A HG11 3  
ATOM   6963  H  HG12 . VAL A 1 103 ? -13.113 0.479   -4.449  1.00 3.14  ? 198 VAL A HG12 3  
ATOM   6964  H  HG13 . VAL A 1 103 ? -13.450 1.460   -5.893  1.00 3.47  ? 198 VAL A HG13 3  
ATOM   6965  H  HG21 . VAL A 1 103 ? -13.405 -1.897  -7.392  1.00 2.45  ? 198 VAL A HG21 3  
ATOM   6966  H  HG22 . VAL A 1 103 ? -12.787 -0.246  -7.477  1.00 2.30  ? 198 VAL A HG22 3  
ATOM   6967  H  HG23 . VAL A 1 103 ? -12.288 -1.310  -6.145  1.00 2.69  ? 198 VAL A HG23 3  
ATOM   6968  N  N    . ALA A 1 104 ? -17.174 -1.129  -4.446  1.00 1.43  ? 199 ALA A N    3  
ATOM   6969  C  CA   . ALA A 1 104 ? -18.299 -0.752  -3.595  1.00 1.60  ? 199 ALA A CA   3  
ATOM   6970  C  C    . ALA A 1 104 ? -18.493 -1.722  -2.419  1.00 1.66  ? 199 ALA A C    3  
ATOM   6971  O  O    . ALA A 1 104 ? -18.595 -1.266  -1.284  1.00 1.68  ? 199 ALA A O    3  
ATOM   6972  C  CB   . ALA A 1 104 ? -19.558 -0.649  -4.465  1.00 1.78  ? 199 ALA A CB   3  
ATOM   6973  H  H    . ALA A 1 104 ? -17.379 -1.393  -5.404  1.00 1.43  ? 199 ALA A H    3  
ATOM   6974  H  HA   . ALA A 1 104 ? -18.098 0.231   -3.164  1.00 1.66  ? 199 ALA A HA   3  
ATOM   6975  H  HB1  . ALA A 1 104 ? -20.402 -0.329  -3.852  1.00 2.54  ? 199 ALA A HB1  3  
ATOM   6976  H  HB2  . ALA A 1 104 ? -19.403 0.083   -5.259  1.00 2.45  ? 199 ALA A HB2  3  
ATOM   6977  H  HB3  . ALA A 1 104 ? -19.792 -1.616  -4.913  1.00 1.93  ? 199 ALA A HB3  3  
ATOM   6978  N  N    . GLN A 1 105 ? -18.513 -3.043  -2.649  1.00 1.77  ? 200 GLN A N    3  
ATOM   6979  C  CA   . GLN A 1 105 ? -18.713 -4.004  -1.558  1.00 1.94  ? 200 GLN A CA   3  
ATOM   6980  C  C    . GLN A 1 105 ? -17.522 -4.096  -0.600  1.00 1.84  ? 200 GLN A C    3  
ATOM   6981  O  O    . GLN A 1 105 ? -17.751 -4.251  0.599   1.00 1.99  ? 200 GLN A O    3  
ATOM   6982  C  CB   . GLN A 1 105 ? -19.080 -5.400  -2.089  1.00 2.23  ? 200 GLN A CB   3  
ATOM   6983  C  CG   . GLN A 1 105 ? -20.601 -5.603  -2.175  1.00 3.22  ? 200 GLN A CG   3  
ATOM   6984  C  CD   . GLN A 1 105 ? -21.289 -5.881  -0.826  1.00 4.03  ? 200 GLN A CD   3  
ATOM   6985  O  OE1  . GLN A 1 105 ? -22.434 -6.317  -0.786  1.00 4.98  ? 200 GLN A OE1  3  
ATOM   6986  N  NE2  . GLN A 1 105 ? -20.666 -5.661  0.316   1.00 4.65  ? 200 GLN A NE2  3  
ATOM   6987  H  H    . GLN A 1 105 ? -18.419 -3.382  -3.600  1.00 1.84  ? 200 GLN A H    3  
ATOM   6988  H  HA   . GLN A 1 105 ? -19.540 -3.635  -0.949  1.00 2.03  ? 200 GLN A HA   3  
ATOM   6989  H  HB2  . GLN A 1 105 ? -18.631 -5.553  -3.070  1.00 2.80  ? 200 GLN A HB2  3  
ATOM   6990  H  HB3  . GLN A 1 105 ? -18.686 -6.166  -1.416  1.00 2.09  ? 200 GLN A HB3  3  
ATOM   6991  H  HG2  . GLN A 1 105 ? -21.056 -4.723  -2.630  1.00 3.75  ? 200 GLN A HG2  3  
ATOM   6992  H  HG3  . GLN A 1 105 ? -20.786 -6.451  -2.834  1.00 3.83  ? 200 GLN A HG3  3  
ATOM   6993  H  HE21 . GLN A 1 105 ? -19.701 -5.362  0.368   1.00 4.58  ? 200 GLN A HE21 3  
ATOM   6994  H  HE22 . GLN A 1 105 ? -21.200 -5.747  1.167   1.00 5.73  ? 200 GLN A HE22 3  
ATOM   6995  N  N    . ALA A 1 106 ? -16.282 -3.965  -1.084  1.00 1.69  ? 201 ALA A N    3  
ATOM   6996  C  CA   . ALA A 1 106 ? -15.109 -3.849  -0.219  1.00 1.70  ? 201 ALA A CA   3  
ATOM   6997  C  C    . ALA A 1 106 ? -15.206 -2.617  0.701   1.00 1.62  ? 201 ALA A C    3  
ATOM   6998  O  O    . ALA A 1 106 ? -14.965 -2.724  1.900   1.00 1.75  ? 201 ALA A O    3  
ATOM   6999  C  CB   . ALA A 1 106 ? -13.861 -3.808  -1.109  1.00 1.68  ? 201 ALA A CB   3  
ATOM   7000  H  H    . ALA A 1 106 ? -16.134 -3.938  -2.089  1.00 1.63  ? 201 ALA A H    3  
ATOM   7001  H  HA   . ALA A 1 106 ? -15.059 -4.726  0.427   1.00 1.89  ? 201 ALA A HA   3  
ATOM   7002  H  HB1  . ALA A 1 106 ? -13.805 -4.716  -1.711  1.00 2.52  ? 201 ALA A HB1  3  
ATOM   7003  H  HB2  . ALA A 1 106 ? -13.899 -2.943  -1.774  1.00 2.12  ? 201 ALA A HB2  3  
ATOM   7004  H  HB3  . ALA A 1 106 ? -12.969 -3.737  -0.486  1.00 1.84  ? 201 ALA A HB3  3  
ATOM   7005  N  N    . SER A 1 107 ? -15.616 -1.470  0.158   1.00 1.52  ? 202 SER A N    3  
ATOM   7006  C  CA   . SER A 1 107 ? -15.785 -0.222  0.920   1.00 1.57  ? 202 SER A CA   3  
ATOM   7007  C  C    . SER A 1 107 ? -16.979 -0.257  1.890   1.00 1.69  ? 202 SER A C    3  
ATOM   7008  O  O    . SER A 1 107 ? -16.956 0.374   2.945   1.00 1.84  ? 202 SER A O    3  
ATOM   7009  C  CB   . SER A 1 107 ? -15.951 0.955   -0.047  1.00 1.60  ? 202 SER A CB   3  
ATOM   7010  O  OG   . SER A 1 107 ? -14.824 1.075   -0.896  1.00 2.23  ? 202 SER A OG   3  
ATOM   7011  H  H    . SER A 1 107 ? -15.810 -1.458  -0.834  1.00 1.48  ? 202 SER A H    3  
ATOM   7012  H  HA   . SER A 1 107 ? -14.889 -0.042  1.511   1.00 1.65  ? 202 SER A HA   3  
ATOM   7013  H  HB2  . SER A 1 107 ? -16.852 0.818   -0.648  1.00 2.07  ? 202 SER A HB2  3  
ATOM   7014  H  HB3  . SER A 1 107 ? -16.057 1.872   0.534   1.00 2.16  ? 202 SER A HB3  3  
ATOM   7015  H  HG   . SER A 1 107 ? -14.964 0.530   -1.685  1.00 2.85  ? 202 SER A HG   3  
ATOM   7016  N  N    . HIS A 1 108 ? -18.028 -1.015  1.561   1.00 1.75  ? 203 HIS A N    3  
ATOM   7017  C  CA   . HIS A 1 108 ? -19.164 -1.286  2.442   1.00 1.97  ? 203 HIS A CA   3  
ATOM   7018  C  C    . HIS A 1 108 ? -18.740 -2.109  3.678   1.00 2.01  ? 203 HIS A C    3  
ATOM   7019  O  O    . HIS A 1 108 ? -19.104 -1.760  4.805   1.00 2.09  ? 203 HIS A O    3  
ATOM   7020  C  CB   . HIS A 1 108 ? -20.226 -1.982  1.582   1.00 2.10  ? 203 HIS A CB   3  
ATOM   7021  C  CG   . HIS A 1 108 ? -21.453 -2.468  2.299   1.00 2.53  ? 203 HIS A CG   3  
ATOM   7022  N  ND1  . HIS A 1 108 ? -21.746 -3.810  2.532   1.00 3.00  ? 203 HIS A ND1  3  
ATOM   7023  C  CD2  . HIS A 1 108 ? -22.522 -1.706  2.669   1.00 3.09  ? 203 HIS A CD2  3  
ATOM   7024  C  CE1  . HIS A 1 108 ? -22.985 -3.828  3.040   1.00 3.85  ? 203 HIS A CE1  3  
ATOM   7025  N  NE2  . HIS A 1 108 ? -23.480 -2.580  3.137   1.00 3.87  ? 203 HIS A NE2  3  
ATOM   7026  H  H    . HIS A 1 108 ? -18.030 -1.449  0.644   1.00 1.69  ? 203 HIS A H    3  
ATOM   7027  H  HA   . HIS A 1 108 ? -19.569 -0.338  2.802   1.00 2.09  ? 203 HIS A HA   3  
ATOM   7028  H  HB2  . HIS A 1 108 ? -20.540 -1.300  0.790   1.00 2.72  ? 203 HIS A HB2  3  
ATOM   7029  H  HB3  . HIS A 1 108 ? -19.775 -2.848  1.109   1.00 2.11  ? 203 HIS A HB3  3  
ATOM   7030  H  HD2  . HIS A 1 108 ? -22.616 -0.637  2.560   1.00 3.18  ? 203 HIS A HD2  3  
ATOM   7031  H  HE1  . HIS A 1 108 ? -23.511 -4.735  3.296   1.00 4.56  ? 203 HIS A HE1  3  
ATOM   7032  H  HE2  . HIS A 1 108 ? -24.419 -2.330  3.440   1.00 4.51  ? 203 HIS A HE2  3  
ATOM   7033  N  N    . SER A 1 109 ? -17.920 -3.148  3.500   1.00 2.04  ? 204 SER A N    3  
ATOM   7034  C  CA   . SER A 1 109 ? -17.359 -3.927  4.612   1.00 2.18  ? 204 SER A CA   3  
ATOM   7035  C  C    . SER A 1 109 ? -16.290 -3.158  5.404   1.00 2.13  ? 204 SER A C    3  
ATOM   7036  O  O    . SER A 1 109 ? -16.263 -3.264  6.633   1.00 2.32  ? 204 SER A O    3  
ATOM   7037  C  CB   . SER A 1 109 ? -16.790 -5.259  4.104   1.00 2.37  ? 204 SER A CB   3  
ATOM   7038  O  OG   . SER A 1 109 ? -17.831 -6.194  3.872   1.00 3.17  ? 204 SER A OG   3  
ATOM   7039  H  H    . SER A 1 109 ? -17.624 -3.374  2.556   1.00 2.04  ? 204 SER A H    3  
ATOM   7040  H  HA   . SER A 1 109 ? -18.158 -4.160  5.317   1.00 2.31  ? 204 SER A HA   3  
ATOM   7041  H  HB2  . SER A 1 109 ? -16.233 -5.088  3.180   1.00 2.29  ? 204 SER A HB2  3  
ATOM   7042  H  HB3  . SER A 1 109 ? -16.111 -5.672  4.850   1.00 2.71  ? 204 SER A HB3  3  
ATOM   7043  H  HG   . SER A 1 109 ? -18.065 -6.636  4.710   1.00 3.87  ? 204 SER A HG   3  
ATOM   7044  N  N    . TYR A 1 110 ? -15.439 -2.368  4.739   1.00 1.97  ? 205 TYR A N    3  
ATOM   7045  C  CA   . TYR A 1 110 ? -14.409 -1.536  5.369   1.00 2.00  ? 205 TYR A CA   3  
ATOM   7046  C  C    . TYR A 1 110 ? -14.355 -0.131  4.743   1.00 1.93  ? 205 TYR A C    3  
ATOM   7047  O  O    . TYR A 1 110 ? -13.812 0.073   3.656   1.00 2.64  ? 205 TYR A O    3  
ATOM   7048  C  CB   . TYR A 1 110 ? -13.050 -2.253  5.296   1.00 2.44  ? 205 TYR A CB   3  
ATOM   7049  C  CG   . TYR A 1 110 ? -11.918 -1.509  5.985   1.00 2.17  ? 205 TYR A CG   3  
ATOM   7050  C  CD1  . TYR A 1 110 ? -11.735 -1.633  7.376   1.00 3.30  ? 205 TYR A CD1  3  
ATOM   7051  C  CD2  . TYR A 1 110 ? -11.057 -0.680  5.240   1.00 2.89  ? 205 TYR A CD2  3  
ATOM   7052  C  CE1  . TYR A 1 110 ? -10.699 -0.929  8.023   1.00 4.52  ? 205 TYR A CE1  3  
ATOM   7053  C  CE2  . TYR A 1 110 ? -10.024 0.033   5.881   1.00 4.33  ? 205 TYR A CE2  3  
ATOM   7054  C  CZ   . TYR A 1 110 ? -9.844  -0.088  7.276   1.00 4.97  ? 205 TYR A CZ   3  
ATOM   7055  O  OH   . TYR A 1 110 ? -8.854  0.606   7.903   1.00 6.69  ? 205 TYR A OH   3  
ATOM   7056  H  H    . TYR A 1 110 ? -15.477 -2.360  3.722   1.00 1.90  ? 205 TYR A H    3  
ATOM   7057  H  HA   . TYR A 1 110 ? -14.670 -1.421  6.419   1.00 2.15  ? 205 TYR A HA   3  
ATOM   7058  H  HB2  . TYR A 1 110 ? -13.149 -3.236  5.760   1.00 3.72  ? 205 TYR A HB2  3  
ATOM   7059  H  HB3  . TYR A 1 110 ? -12.788 -2.414  4.248   1.00 3.31  ? 205 TYR A HB3  3  
ATOM   7060  H  HD1  . TYR A 1 110 ? -12.397 -2.266  7.951   1.00 3.98  ? 205 TYR A HD1  3  
ATOM   7061  H  HD2  . TYR A 1 110 ? -11.199 -0.573  4.173   1.00 3.28  ? 205 TYR A HD2  3  
ATOM   7062  H  HE1  . TYR A 1 110 ? -10.561 -1.015  9.090   1.00 5.67  ? 205 TYR A HE1  3  
ATOM   7063  H  HE2  . TYR A 1 110 ? -9.377  0.681   5.306   1.00 5.45  ? 205 TYR A HE2  3  
ATOM   7064  H  HH   . TYR A 1 110 ? -8.388  1.202   7.312   1.00 7.29  ? 205 TYR A HH   3  
ATOM   7065  N  N    . ARG A 1 111 ? -14.929 0.853   5.444   1.00 1.78  ? 206 ARG A N    3  
ATOM   7066  C  CA   . ARG A 1 111 ? -15.093 2.219   4.936   1.00 1.94  ? 206 ARG A CA   3  
ATOM   7067  C  C    . ARG A 1 111 ? -13.757 2.975   4.918   1.00 2.02  ? 206 ARG A C    3  
ATOM   7068  O  O    . ARG A 1 111 ? -13.076 3.047   5.935   1.00 2.72  ? 206 ARG A O    3  
ATOM   7069  C  CB   . ARG A 1 111 ? -16.151 2.984   5.757   1.00 2.41  ? 206 ARG A CB   3  
ATOM   7070  C  CG   . ARG A 1 111 ? -17.610 2.625   5.410   1.00 2.83  ? 206 ARG A CG   3  
ATOM   7071  C  CD   . ARG A 1 111 ? -18.114 1.256   5.898   1.00 3.03  ? 206 ARG A CD   3  
ATOM   7072  N  NE   . ARG A 1 111 ? -18.242 1.206   7.367   1.00 3.67  ? 206 ARG A NE   3  
ATOM   7073  C  CZ   . ARG A 1 111 ? -18.545 0.132   8.087   1.00 4.78  ? 206 ARG A CZ   3  
ATOM   7074  N  NH1  . ARG A 1 111 ? -18.735 -1.055  7.559   1.00 5.57  ? 206 ARG A NH1  3  
ATOM   7075  N  NH2  . ARG A 1 111 ? -18.683 0.227   9.387   1.00 5.69  ? 206 ARG A NH2  3  
ATOM   7076  H  H    . ARG A 1 111 ? -15.305 0.634   6.351   1.00 2.10  ? 206 ARG A H    3  
ATOM   7077  H  HA   . ARG A 1 111 ? -15.451 2.160   3.907   1.00 2.16  ? 206 ARG A HA   3  
ATOM   7078  H  HB2  . ARG A 1 111 ? -15.969 2.843   6.824   1.00 2.75  ? 206 ARG A HB2  3  
ATOM   7079  H  HB3  . ARG A 1 111 ? -16.029 4.048   5.545   1.00 2.91  ? 206 ARG A HB3  3  
ATOM   7080  H  HG2  . ARG A 1 111 ? -18.259 3.391   5.839   1.00 3.18  ? 206 ARG A HG2  3  
ATOM   7081  H  HG3  . ARG A 1 111 ? -17.730 2.673   4.328   1.00 3.60  ? 206 ARG A HG3  3  
ATOM   7082  H  HD2  . ARG A 1 111 ? -19.096 1.080   5.456   1.00 3.42  ? 206 ARG A HD2  3  
ATOM   7083  H  HD3  . ARG A 1 111 ? -17.452 0.467   5.542   1.00 3.33  ? 206 ARG A HD3  3  
ATOM   7084  H  HE   . ARG A 1 111 ? -18.146 2.071   7.877   1.00 3.86  ? 206 ARG A HE   3  
ATOM   7085  H  HH11 . ARG A 1 111 ? -18.719 -1.203  6.555   1.00 5.39  ? 206 ARG A HH11 3  
ATOM   7086  H  HH12 . ARG A 1 111 ? -18.966 -1.820  8.184   1.00 6.67  ? 206 ARG A HH12 3  
ATOM   7087  H  HH21 . ARG A 1 111 ? -18.631 1.124   9.867   1.00 5.71  ? 206 ARG A HH21 3  
ATOM   7088  H  HH22 . ARG A 1 111 ? -18.917 -0.611  9.908   1.00 6.67  ? 206 ARG A HH22 3  
ATOM   7089  N  N    . VAL A 1 112 ? -13.445 3.586   3.776   1.00 1.80  ? 207 VAL A N    3  
ATOM   7090  C  CA   . VAL A 1 112 ? -12.330 4.525   3.548   1.00 1.93  ? 207 VAL A CA   3  
ATOM   7091  C  C    . VAL A 1 112 ? -12.837 5.732   2.748   1.00 2.06  ? 207 VAL A C    3  
ATOM   7092  O  O    . VAL A 1 112 ? -13.919 5.671   2.163   1.00 2.18  ? 207 VAL A O    3  
ATOM   7093  C  CB   . VAL A 1 112 ? -11.133 3.863   2.823   1.00 2.20  ? 207 VAL A CB   3  
ATOM   7094  C  CG1  . VAL A 1 112 ? -10.514 2.756   3.688   1.00 3.14  ? 207 VAL A CG1  3  
ATOM   7095  C  CG2  . VAL A 1 112 ? -11.508 3.303   1.438   1.00 3.05  ? 207 VAL A CG2  3  
ATOM   7096  H  H    . VAL A 1 112 ? -14.082 3.457   3.005   1.00 1.93  ? 207 VAL A H    3  
ATOM   7097  H  HA   . VAL A 1 112 ? -11.981 4.894   4.513   1.00 1.99  ? 207 VAL A HA   3  
ATOM   7098  H  HB   . VAL A 1 112 ? -10.367 4.625   2.677   1.00 2.84  ? 207 VAL A HB   3  
ATOM   7099  H  HG11 . VAL A 1 112 ? -9.600  2.390   3.223   1.00 3.83  ? 207 VAL A HG11 3  
ATOM   7100  H  HG12 . VAL A 1 112 ? -10.269 3.150   4.674   1.00 3.82  ? 207 VAL A HG12 3  
ATOM   7101  H  HG13 . VAL A 1 112 ? -11.211 1.926   3.794   1.00 3.80  ? 207 VAL A HG13 3  
ATOM   7102  H  HG21 . VAL A 1 112 ? -10.624 2.877   0.965   1.00 3.89  ? 207 VAL A HG21 3  
ATOM   7103  H  HG22 . VAL A 1 112 ? -12.267 2.526   1.530   1.00 3.98  ? 207 VAL A HG22 3  
ATOM   7104  H  HG23 . VAL A 1 112 ? -11.884 4.099   0.796   1.00 3.33  ? 207 VAL A HG23 3  
ATOM   7105  N  N    . TYR A 1 113 ? -12.084 6.836   2.737   1.00 2.25  ? 208 TYR A N    3  
ATOM   7106  C  CA   . TYR A 1 113 ? -12.551 8.116   2.196   1.00 2.39  ? 208 TYR A CA   3  
ATOM   7107  C  C    . TYR A 1 113 ? -12.274 8.265   0.688   1.00 2.25  ? 208 TYR A C    3  
ATOM   7108  O  O    . TYR A 1 113 ? -11.124 8.346   0.252   1.00 2.54  ? 208 TYR A O    3  
ATOM   7109  C  CB   . TYR A 1 113 ? -11.927 9.271   2.993   1.00 3.00  ? 208 TYR A CB   3  
ATOM   7110  C  CG   . TYR A 1 113 ? -12.218 9.275   4.483   1.00 3.61  ? 208 TYR A CG   3  
ATOM   7111  C  CD1  . TYR A 1 113 ? -11.377 8.575   5.371   1.00 5.23  ? 208 TYR A CD1  3  
ATOM   7112  C  CD2  . TYR A 1 113 ? -13.310 10.008  4.986   1.00 3.54  ? 208 TYR A CD2  3  
ATOM   7113  C  CE1  . TYR A 1 113 ? -11.638 8.586   6.755   1.00 6.40  ? 208 TYR A CE1  3  
ATOM   7114  C  CE2  . TYR A 1 113 ? -13.568 10.036  6.370   1.00 4.62  ? 208 TYR A CE2  3  
ATOM   7115  C  CZ   . TYR A 1 113 ? -12.735 9.321   7.258   1.00 5.95  ? 208 TYR A CZ   3  
ATOM   7116  O  OH   . TYR A 1 113 ? -12.992 9.340   8.596   1.00 7.28  ? 208 TYR A OH   3  
ATOM   7117  H  H    . TYR A 1 113 ? -11.168 6.816   3.175   1.00 2.36  ? 208 TYR A H    3  
ATOM   7118  H  HA   . TYR A 1 113 ? -13.631 8.179   2.342   1.00 2.35  ? 208 TYR A HA   3  
ATOM   7119  H  HB2  . TYR A 1 113 ? -10.848 9.255   2.851   1.00 3.86  ? 208 TYR A HB2  3  
ATOM   7120  H  HB3  . TYR A 1 113 ? -12.303 10.205  2.578   1.00 2.89  ? 208 TYR A HB3  3  
ATOM   7121  H  HD1  . TYR A 1 113 ? -10.532 8.018   4.990   1.00 5.93  ? 208 TYR A HD1  3  
ATOM   7122  H  HD2  . TYR A 1 113 ? -13.957 10.548  4.308   1.00 3.48  ? 208 TYR A HD2  3  
ATOM   7123  H  HE1  . TYR A 1 113 ? -10.995 8.034   7.424   1.00 7.89  ? 208 TYR A HE1  3  
ATOM   7124  H  HE2  . TYR A 1 113 ? -14.410 10.592  6.759   1.00 4.94  ? 208 TYR A HE2  3  
ATOM   7125  H  HH   . TYR A 1 113 ? -12.401 8.764   9.085   1.00 8.34  ? 208 TYR A HH   3  
ATOM   7126  N  N    . TYR A 1 114 ? -13.340 8.334   -0.110  1.00 2.05  ? 209 TYR A N    3  
ATOM   7127  C  CA   . TYR A 1 114 ? -13.332 8.679   -1.540  1.00 2.03  ? 209 TYR A CA   3  
ATOM   7128  C  C    . TYR A 1 114 ? -14.719 9.183   -1.981  1.00 2.12  ? 209 TYR A C    3  
ATOM   7129  O  O    . TYR A 1 114 ? -15.719 8.908   -1.310  1.00 2.21  ? 209 TYR A O    3  
ATOM   7130  C  CB   . TYR A 1 114 ? -12.857 7.484   -2.387  1.00 2.26  ? 209 TYR A CB   3  
ATOM   7131  C  CG   . TYR A 1 114 ? -13.854 6.350   -2.543  1.00 2.00  ? 209 TYR A CG   3  
ATOM   7132  C  CD1  . TYR A 1 114 ? -14.064 5.437   -1.492  1.00 2.68  ? 209 TYR A CD1  3  
ATOM   7133  C  CD2  . TYR A 1 114 ? -14.560 6.196   -3.754  1.00 2.78  ? 209 TYR A CD2  3  
ATOM   7134  C  CE1  . TYR A 1 114 ? -14.977 4.378   -1.645  1.00 2.85  ? 209 TYR A CE1  3  
ATOM   7135  C  CE2  . TYR A 1 114 ? -15.468 5.134   -3.916  1.00 2.89  ? 209 TYR A CE2  3  
ATOM   7136  C  CZ   . TYR A 1 114 ? -15.679 4.218   -2.860  1.00 2.36  ? 209 TYR A CZ   3  
ATOM   7137  O  OH   . TYR A 1 114 ? -16.554 3.185   -3.015  1.00 2.82  ? 209 TYR A OH   3  
ATOM   7138  H  H    . TYR A 1 114 ? -14.254 8.203   0.302   1.00 2.06  ? 209 TYR A H    3  
ATOM   7139  H  HA   . TYR A 1 114 ? -12.625 9.497   -1.693  1.00 2.08  ? 209 TYR A HA   3  
ATOM   7140  H  HB2  . TYR A 1 114 ? -12.605 7.851   -3.380  1.00 2.64  ? 209 TYR A HB2  3  
ATOM   7141  H  HB3  . TYR A 1 114 ? -11.935 7.084   -1.963  1.00 2.73  ? 209 TYR A HB3  3  
ATOM   7142  H  HD1  . TYR A 1 114 ? -13.518 5.546   -0.566  1.00 3.78  ? 209 TYR A HD1  3  
ATOM   7143  H  HD2  . TYR A 1 114 ? -14.391 6.890   -4.566  1.00 3.93  ? 209 TYR A HD2  3  
ATOM   7144  H  HE1  . TYR A 1 114 ? -15.131 3.679   -0.840  1.00 4.02  ? 209 TYR A HE1  3  
ATOM   7145  H  HE2  . TYR A 1 114 ? -15.998 5.018   -4.849  1.00 4.05  ? 209 TYR A HE2  3  
ATOM   7146  H  HH   . TYR A 1 114 ? -16.947 3.181   -3.888  1.00 3.26  ? 209 TYR A HH   3  
ATOM   7147  N  N    . ASN A 1 115 ? -14.798 9.915   -3.096  1.00 2.41  ? 210 ASN A N    3  
ATOM   7148  C  CA   . ASN A 1 115 ? -16.062 10.408  -3.654  1.00 2.76  ? 210 ASN A CA   3  
ATOM   7149  C  C    . ASN A 1 115 ? -15.948 10.718  -5.162  1.00 3.07  ? 210 ASN A C    3  
ATOM   7150  O  O    . ASN A 1 115 ? -14.852 10.808  -5.712  1.00 3.42  ? 210 ASN A O    3  
ATOM   7151  C  CB   . ASN A 1 115 ? -16.558 11.627  -2.835  1.00 3.00  ? 210 ASN A CB   3  
ATOM   7152  C  CG   . ASN A 1 115 ? -18.077 11.804  -2.851  1.00 3.80  ? 210 ASN A CG   3  
ATOM   7153  O  OD1  . ASN A 1 115 ? -18.800 11.169  -3.609  1.00 4.55  ? 210 ASN A OD1  3  
ATOM   7154  N  ND2  . ASN A 1 115 ? -18.622 12.646  -1.992  1.00 4.26  ? 210 ASN A ND2  3  
ATOM   7155  H  H    . ASN A 1 115 ? -13.948 10.094  -3.628  1.00 2.61  ? 210 ASN A H    3  
ATOM   7156  H  HA   . ASN A 1 115 ? -16.795 9.607   -3.546  1.00 2.99  ? 210 ASN A HA   3  
ATOM   7157  H  HB2  . ASN A 1 115 ? -16.262 11.513  -1.792  1.00 3.11  ? 210 ASN A HB2  3  
ATOM   7158  H  HB3  . ASN A 1 115 ? -16.087 12.537  -3.210  1.00 3.16  ? 210 ASN A HB3  3  
ATOM   7159  H  HD21 . ASN A 1 115 ? -18.068 13.153  -1.308  1.00 4.20  ? 210 ASN A HD21 3  
ATOM   7160  H  HD22 . ASN A 1 115 ? -19.619 12.768  -2.024  1.00 5.03  ? 210 ASN A HD22 3  
ATOM   7161  N  N    . ALA A 1 116 ? -17.076 10.932  -5.839  1.00 3.27  ? 211 ALA A N    3  
ATOM   7162  C  CA   . ALA A 1 116 ? -17.092 11.529  -7.173  1.00 3.55  ? 211 ALA A CA   3  
ATOM   7163  C  C    . ALA A 1 116 ? -16.908 13.051  -7.063  1.00 3.36  ? 211 ALA A C    3  
ATOM   7164  O  O    . ALA A 1 116 ? -17.351 13.666  -6.092  1.00 3.44  ? 211 ALA A O    3  
ATOM   7165  C  CB   . ALA A 1 116 ? -18.423 11.184  -7.848  1.00 4.13  ? 211 ALA A CB   3  
ATOM   7166  H  H    . ALA A 1 116 ? -17.947 10.916  -5.317  1.00 3.32  ? 211 ALA A H    3  
ATOM   7167  H  HA   . ALA A 1 116 ? -16.274 11.123  -7.770  1.00 4.04  ? 211 ALA A HA   3  
ATOM   7168  H  HB1  . ALA A 1 116 ? -18.511 10.104  -7.967  1.00 4.60  ? 211 ALA A HB1  3  
ATOM   7169  H  HB2  . ALA A 1 116 ? -19.252 11.556  -7.245  1.00 4.58  ? 211 ALA A HB2  3  
ATOM   7170  H  HB3  . ALA A 1 116 ? -18.468 11.658  -8.828  1.00 4.60  ? 211 ALA A HB3  3  
ATOM   7171  N  N    . GLY A 1 117 ? -16.304 13.677  -8.078  1.00 3.64  ? 212 GLY A N    3  
ATOM   7172  C  CA   . GLY A 1 117 ? -16.157 15.132  -8.133  1.00 3.96  ? 212 GLY A CA   3  
ATOM   7173  C  C    . GLY A 1 117 ? -17.535 15.801  -8.250  1.00 3.75  ? 212 GLY A C    3  
ATOM   7174  O  O    . GLY A 1 117 ? -18.212 15.545  -9.253  1.00 4.09  ? 212 GLY A O    3  
ATOM   7175  H  H    . GLY A 1 117 ? -15.939 13.136  -8.852  1.00 3.89  ? 212 GLY A H    3  
ATOM   7176  H  HA2  . GLY A 1 117 ? -15.629 15.468  -7.243  1.00 4.43  ? 212 GLY A HA2  3  
ATOM   7177  H  HA3  . GLY A 1 117 ? -15.575 15.402  -9.009  1.00 4.61  ? 212 GLY A HA3  3  
ATOM   7178  N  N    . PRO A 1 118 ? -17.956 16.651  -7.285  1.00 4.09  ? 213 PRO A N    3  
ATOM   7179  C  CA   . PRO A 1 118 ? -19.288 17.258  -7.244  1.00 4.75  ? 213 PRO A CA   3  
ATOM   7180  C  C    . PRO A 1 118 ? -19.349 18.486  -8.167  1.00 4.49  ? 213 PRO A C    3  
ATOM   7181  O  O    . PRO A 1 118 ? -19.396 19.633  -7.721  1.00 4.97  ? 213 PRO A O    3  
ATOM   7182  C  CB   . PRO A 1 118 ? -19.521 17.581  -5.763  1.00 5.94  ? 213 PRO A CB   3  
ATOM   7183  C  CG   . PRO A 1 118 ? -18.118 17.930  -5.265  1.00 5.88  ? 213 PRO A CG   3  
ATOM   7184  C  CD   . PRO A 1 118 ? -17.229 16.977  -6.060  1.00 4.81  ? 213 PRO A CD   3  
ATOM   7185  H  HA   . PRO A 1 118 ? -20.039 16.538  -7.573  1.00 5.14  ? 213 PRO A HA   3  
ATOM   7186  H  HB2  . PRO A 1 118 ? -20.228 18.398  -5.611  1.00 6.62  ? 213 PRO A HB2  3  
ATOM   7187  H  HB3  . PRO A 1 118 ? -19.873 16.685  -5.249  1.00 6.47  ? 213 PRO A HB3  3  
ATOM   7188  H  HG2  . PRO A 1 118 ? -17.876 18.960  -5.525  1.00 5.91  ? 213 PRO A HG2  3  
ATOM   7189  H  HG3  . PRO A 1 118 ? -18.019 17.772  -4.190  1.00 6.85  ? 213 PRO A HG3  3  
ATOM   7190  H  HD2  . PRO A 1 118 ? -16.270 17.450  -6.280  1.00 4.80  ? 213 PRO A HD2  3  
ATOM   7191  H  HD3  . PRO A 1 118 ? -17.069 16.070  -5.475  1.00 5.15  ? 213 PRO A HD3  3  
ATOM   7192  N  N    . LYS A 1 119 ? -19.236 18.242  -9.474  1.00 4.25  ? 214 LYS A N    3  
ATOM   7193  C  CA   . LYS A 1 119 ? -19.081 19.261  -10.517 1.00 4.17  ? 214 LYS A CA   3  
ATOM   7194  C  C    . LYS A 1 119 ? -20.360 19.467  -11.351 1.00 4.52  ? 214 LYS A C    3  
ATOM   7195  O  O    . LYS A 1 119 ? -21.179 18.563  -11.498 1.00 5.00  ? 214 LYS A O    3  
ATOM   7196  C  CB   . LYS A 1 119 ? -17.903 18.862  -11.433 1.00 4.36  ? 214 LYS A CB   3  
ATOM   7197  C  CG   . LYS A 1 119 ? -16.543 18.643  -10.738 1.00 5.30  ? 214 LYS A CG   3  
ATOM   7198  C  CD   . LYS A 1 119 ? -16.029 19.857  -9.949  1.00 6.50  ? 214 LYS A CD   3  
ATOM   7199  C  CE   . LYS A 1 119 ? -16.184 19.713  -8.435  1.00 7.39  ? 214 LYS A CE   3  
ATOM   7200  N  NZ   . LYS A 1 119 ? -16.075 21.021  -7.744  1.00 8.92  ? 214 LYS A NZ   3  
ATOM   7201  H  H    . LYS A 1 119 ? -19.231 17.273  -9.774  1.00 4.50  ? 214 LYS A H    3  
ATOM   7202  H  HA   . LYS A 1 119 ? -18.853 20.222  -10.057 1.00 4.27  ? 214 LYS A HA   3  
ATOM   7203  H  HB2  . LYS A 1 119 ? -18.167 17.939  -11.953 1.00 4.73  ? 214 LYS A HB2  3  
ATOM   7204  H  HB3  . LYS A 1 119 ? -17.777 19.636  -12.192 1.00 4.54  ? 214 LYS A HB3  3  
ATOM   7205  H  HG2  . LYS A 1 119 ? -16.598 17.772  -10.086 1.00 5.70  ? 214 LYS A HG2  3  
ATOM   7206  H  HG3  . LYS A 1 119 ? -15.816 18.416  -11.520 1.00 5.67  ? 214 LYS A HG3  3  
ATOM   7207  H  HD2  . LYS A 1 119 ? -14.971 20.000  -10.165 1.00 7.23  ? 214 LYS A HD2  3  
ATOM   7208  H  HD3  . LYS A 1 119 ? -16.574 20.736  -10.284 1.00 6.71  ? 214 LYS A HD3  3  
ATOM   7209  H  HE2  . LYS A 1 119 ? -17.169 19.298  -8.243  1.00 7.16  ? 214 LYS A HE2  3  
ATOM   7210  H  HE3  . LYS A 1 119 ? -15.428 19.014  -8.069  1.00 7.71  ? 214 LYS A HE3  3  
ATOM   7211  H  HZ1  . LYS A 1 119 ? -16.389 20.978  -6.781  1.00 9.60  ? 214 LYS A HZ1  3  
ATOM   7212  H  HZ2  . LYS A 1 119 ? -15.136 21.404  -7.772  1.00 9.62  ? 214 LYS A HZ2  3  
ATOM   7213  H  HZ3  . LYS A 1 119 ? -16.674 21.706  -8.199  1.00 9.07  ? 214 LYS A HZ3  3  
ATOM   7214  N  N    . ASP A 1 120 ? -20.457 20.647  -11.965 1.00 4.72  ? 215 ASP A N    3  
ATOM   7215  C  CA   . ASP A 1 120 ? -21.461 21.054  -12.963 1.00 5.38  ? 215 ASP A CA   3  
ATOM   7216  C  C    . ASP A 1 120 ? -21.657 20.036  -14.101 1.00 5.69  ? 215 ASP A C    3  
ATOM   7217  O  O    . ASP A 1 120 ? -22.792 19.745  -14.481 1.00 6.36  ? 215 ASP A O    3  
ATOM   7218  C  CB   . ASP A 1 120 ? -21.005 22.412  -13.543 1.00 6.13  ? 215 ASP A CB   3  
ATOM   7219  C  CG   . ASP A 1 120 ? -19.502 22.434  -13.868 1.00 7.21  ? 215 ASP A CG   3  
ATOM   7220  O  OD1  . ASP A 1 120 ? -18.728 22.703  -12.921 1.00 7.70  ? 215 ASP A OD1  3  
ATOM   7221  O  OD2  . ASP A 1 120 ? -19.114 22.043  -14.995 1.00 8.14  ? 215 ASP A OD2  3  
ATOM   7222  H  H    . ASP A 1 120 ? -19.716 21.321  -11.807 1.00 4.72  ? 215 ASP A H    3  
ATOM   7223  H  HA   . ASP A 1 120 ? -22.426 21.188  -12.473 1.00 5.92  ? 215 ASP A HA   3  
ATOM   7224  H  HB2  . ASP A 1 120 ? -21.584 22.641  -14.440 1.00 6.74  ? 215 ASP A HB2  3  
ATOM   7225  H  HB3  . ASP A 1 120 ? -21.213 23.189  -12.807 1.00 6.26  ? 215 ASP A HB3  3  
ATOM   7226  N  N    . GLU A 1 121 ? -20.540 19.509  -14.614 1.00 5.87  ? 216 GLU A N    3  
ATOM   7227  C  CA   . GLU A 1 121 ? -20.393 18.565  -15.729 1.00 6.88  ? 216 GLU A CA   3  
ATOM   7228  C  C    . GLU A 1 121 ? -18.922 18.427  -16.170 1.00 6.92  ? 216 GLU A C    3  
ATOM   7229  O  O    . GLU A 1 121 ? -18.525 17.338  -16.578 1.00 7.90  ? 216 GLU A O    3  
ATOM   7230  C  CB   . GLU A 1 121 ? -21.291 18.908  -16.939 1.00 7.68  ? 216 GLU A CB   3  
ATOM   7231  C  CG   . GLU A 1 121 ? -21.253 20.389  -17.366 1.00 7.85  ? 216 GLU A CG   3  
ATOM   7232  C  CD   . GLU A 1 121 ? -21.066 20.620  -18.860 1.00 9.03  ? 216 GLU A CD   3  
ATOM   7233  O  OE1  . GLU A 1 121 ? -20.344 19.879  -19.559 1.00 9.95  ? 216 GLU A OE1  3  
ATOM   7234  O  OE2  . GLU A 1 121 ? -21.465 21.682  -19.382 1.00 9.40  ? 216 GLU A OE2  3  
ATOM   7235  H  H    . GLU A 1 121 ? -19.683 19.893  -14.248 1.00 5.69  ? 216 GLU A H    3  
ATOM   7236  H  HA   . GLU A 1 121 ? -20.704 17.584  -15.369 1.00 7.65  ? 216 GLU A HA   3  
ATOM   7237  H  HB2  . GLU A 1 121 ? -20.996 18.266  -17.766 1.00 8.47  ? 216 GLU A HB2  3  
ATOM   7238  H  HB3  . GLU A 1 121 ? -22.320 18.646  -16.706 1.00 8.05  ? 216 GLU A HB3  3  
ATOM   7239  H  HG2  . GLU A 1 121 ? -22.176 20.873  -17.042 1.00 7.97  ? 216 GLU A HG2  3  
ATOM   7240  H  HG3  . GLU A 1 121 ? -20.430 20.892  -16.869 1.00 7.64  ? 216 GLU A HG3  3  
ATOM   7241  N  N    . ASP A 1 122 ? -18.096 19.480  -16.058 1.00 6.22  ? 217 ASP A N    3  
ATOM   7242  C  CA   . ASP A 1 122 ? -16.695 19.530  -16.511 1.00 6.45  ? 217 ASP A CA   3  
ATOM   7243  C  C    . ASP A 1 122 ? -16.033 20.817  -15.984 1.00 5.73  ? 217 ASP A C    3  
ATOM   7244  O  O    . ASP A 1 122 ? -16.037 21.854  -16.646 1.00 6.10  ? 217 ASP A O    3  
ATOM   7245  C  CB   . ASP A 1 122 ? -16.587 19.426  -18.052 1.00 7.62  ? 217 ASP A CB   3  
ATOM   7246  C  CG   . ASP A 1 122 ? -16.342 18.000  -18.542 1.00 8.92  ? 217 ASP A CG   3  
ATOM   7247  O  OD1  . ASP A 1 122 ? -15.363 17.378  -18.077 1.00 9.36  ? 217 ASP A OD1  3  
ATOM   7248  O  OD2  . ASP A 1 122 ? -17.114 17.518  -19.407 1.00 9.95  ? 217 ASP A OD2  3  
ATOM   7249  H  H    . ASP A 1 122 ? -18.471 20.358  -15.702 1.00 5.79  ? 217 ASP A H    3  
ATOM   7250  H  HA   . ASP A 1 122 ? -16.158 18.686  -16.075 1.00 7.04  ? 217 ASP A HA   3  
ATOM   7251  H  HB2  . ASP A 1 122 ? -17.481 19.842  -18.521 1.00 7.88  ? 217 ASP A HB2  3  
ATOM   7252  H  HB3  . ASP A 1 122 ? -15.734 20.017  -18.395 1.00 7.85  ? 217 ASP A HB3  3  
ATOM   7253  N  N    . GLN A 1 123 ? -15.496 20.750  -14.764 1.00 5.47  ? 218 GLN A N    3  
ATOM   7254  C  CA   . GLN A 1 123 ? -14.881 21.890  -14.074 1.00 5.76  ? 218 GLN A CA   3  
ATOM   7255  C  C    . GLN A 1 123 ? -13.350 21.793  -14.115 1.00 5.90  ? 218 GLN A C    3  
ATOM   7256  O  O    . GLN A 1 123 ? -12.707 22.656  -14.706 1.00 6.97  ? 218 GLN A O    3  
ATOM   7257  C  CB   . GLN A 1 123 ? -15.415 21.929  -12.636 1.00 6.42  ? 218 GLN A CB   3  
ATOM   7258  C  CG   . GLN A 1 123 ? -15.212 23.275  -11.922 1.00 7.65  ? 218 GLN A CG   3  
ATOM   7259  C  CD   . GLN A 1 123 ? -15.956 23.300  -10.584 1.00 8.22  ? 218 GLN A CD   3  
ATOM   7260  O  OE1  . GLN A 1 123 ? -15.383 23.187  -9.506  1.00 9.26  ? 218 GLN A OE1  3  
ATOM   7261  N  NE2  . GLN A 1 123 ? -17.272 23.329  -10.599 1.00 7.94  ? 218 GLN A NE2  3  
ATOM   7262  H  H    . GLN A 1 123 ? -15.555 19.871  -14.278 1.00 5.67  ? 218 GLN A H    3  
ATOM   7263  H  HA   . GLN A 1 123 ? -15.171 22.819  -14.563 1.00 6.23  ? 218 GLN A HA   3  
ATOM   7264  H  HB2  . GLN A 1 123 ? -16.479 21.711  -12.667 1.00 6.49  ? 218 GLN A HB2  3  
ATOM   7265  H  HB3  . GLN A 1 123 ? -14.933 21.147  -12.057 1.00 6.62  ? 218 GLN A HB3  3  
ATOM   7266  H  HG2  . GLN A 1 123 ? -14.149 23.444  -11.749 1.00 8.29  ? 218 GLN A HG2  3  
ATOM   7267  H  HG3  . GLN A 1 123 ? -15.598 24.079  -12.549 1.00 8.09  ? 218 GLN A HG3  3  
ATOM   7268  H  HE21 . GLN A 1 123 ? -17.775 23.325  -11.491 1.00 7.46  ? 218 GLN A HE21 3  
ATOM   7269  H  HE22 . GLN A 1 123 ? -17.775 23.289  -9.721  1.00 8.47  ? 218 GLN A HE22 3  
ATOM   7270  N  N    . ASP A 1 124 ? -12.814 20.717  -13.517 1.00 5.34  ? 219 ASP A N    3  
ATOM   7271  C  CA   . ASP A 1 124 ? -11.396 20.350  -13.336 1.00 5.58  ? 219 ASP A CA   3  
ATOM   7272  C  C    . ASP A 1 124 ? -11.236 19.141  -12.382 1.00 4.76  ? 219 ASP A C    3  
ATOM   7273  O  O    . ASP A 1 124 ? -10.496 18.199  -12.661 1.00 5.14  ? 219 ASP A O    3  
ATOM   7274  C  CB   . ASP A 1 124 ? -10.530 21.538  -12.855 1.00 6.70  ? 219 ASP A CB   3  
ATOM   7275  C  CG   . ASP A 1 124 ? -10.707 21.968  -11.392 1.00 7.36  ? 219 ASP A CG   3  
ATOM   7276  O  OD1  . ASP A 1 124 ? -11.840 21.947  -10.849 1.00 7.53  ? 219 ASP A OD1  3  
ATOM   7277  O  OD2  . ASP A 1 124 ? -9.666  22.286  -10.765 1.00 8.31  ? 219 ASP A OD2  3  
ATOM   7278  H  H    . ASP A 1 124 ? -13.471 20.087  -13.102 1.00 5.11  ? 219 ASP A H    3  
ATOM   7279  H  HA   . ASP A 1 124 ? -11.013 20.049  -14.312 1.00 6.03  ? 219 ASP A HA   3  
ATOM   7280  H  HB2  . ASP A 1 124 ? -9.499  21.222  -12.982 1.00 7.50  ? 219 ASP A HB2  3  
ATOM   7281  H  HB3  . ASP A 1 124 ? -10.646 22.406  -13.498 1.00 7.05  ? 219 ASP A HB3  3  
ATOM   7282  N  N    . TYR A 1 125 ? -11.949 19.163  -11.253 1.00 4.35  ? 220 TYR A N    3  
ATOM   7283  C  CA   . TYR A 1 125 ? -11.884 18.209  -10.136 1.00 3.97  ? 220 TYR A CA   3  
ATOM   7284  C  C    . TYR A 1 125 ? -12.851 17.030  -10.359 1.00 3.14  ? 220 TYR A C    3  
ATOM   7285  O  O    . TYR A 1 125 ? -13.990 17.046  -9.898  1.00 4.10  ? 220 TYR A O    3  
ATOM   7286  C  CB   . TYR A 1 125 ? -12.161 19.034  -8.861  1.00 5.00  ? 220 TYR A CB   3  
ATOM   7287  C  CG   . TYR A 1 125 ? -12.418 18.350  -7.523  1.00 5.50  ? 220 TYR A CG   3  
ATOM   7288  C  CD1  . TYR A 1 125 ? -11.910 17.074  -7.196  1.00 5.93  ? 220 TYR A CD1  3  
ATOM   7289  C  CD2  . TYR A 1 125 ? -13.144 19.071  -6.553  1.00 6.34  ? 220 TYR A CD2  3  
ATOM   7290  C  CE1  . TYR A 1 125 ? -12.110 16.543  -5.905  1.00 6.98  ? 220 TYR A CE1  3  
ATOM   7291  C  CE2  . TYR A 1 125 ? -13.371 18.535  -5.275  1.00 7.26  ? 220 TYR A CE2  3  
ATOM   7292  C  CZ   . TYR A 1 125 ? -12.843 17.272  -4.939  1.00 7.52  ? 220 TYR A CZ   3  
ATOM   7293  O  OH   . TYR A 1 125 ? -13.021 16.804  -3.675  1.00 8.77  ? 220 TYR A OH   3  
ATOM   7294  H  H    . TYR A 1 125 ? -12.404 20.052  -11.060 1.00 4.94  ? 220 TYR A H    3  
ATOM   7295  H  HA   . TYR A 1 125 ? -10.872 17.809  -10.062 1.00 4.53  ? 220 TYR A HA   3  
ATOM   7296  H  HB2  . TYR A 1 125 ? -11.312 19.705  -8.717  1.00 5.87  ? 220 TYR A HB2  3  
ATOM   7297  H  HB3  . TYR A 1 125 ? -13.023 19.670  -9.059  1.00 5.30  ? 220 TYR A HB3  3  
ATOM   7298  H  HD1  . TYR A 1 125 ? -11.349 16.499  -7.914  1.00 5.95  ? 220 TYR A HD1  3  
ATOM   7299  H  HD2  . TYR A 1 125 ? -13.501 20.064  -6.780  1.00 6.71  ? 220 TYR A HD2  3  
ATOM   7300  H  HE1  . TYR A 1 125 ? -11.693 15.578  -5.648  1.00 7.74  ? 220 TYR A HE1  3  
ATOM   7301  H  HE2  . TYR A 1 125 ? -13.911 19.100  -4.530  1.00 8.16  ? 220 TYR A HE2  3  
ATOM   7302  H  HH   . TYR A 1 125 ? -12.493 16.013  -3.470  1.00 9.24  ? 220 TYR A HH   3  
ATOM   7303  N  N    . ILE A 1 126 ? -12.406 16.015  -11.116 1.00 2.97  ? 221 ILE A N    3  
ATOM   7304  C  CA   . ILE A 1 126 ? -13.270 14.923  -11.635 1.00 3.72  ? 221 ILE A CA   3  
ATOM   7305  C  C    . ILE A 1 126 ? -13.674 13.875  -10.581 1.00 3.61  ? 221 ILE A C    3  
ATOM   7306  O  O    . ILE A 1 126 ? -14.793 13.365  -10.626 1.00 4.18  ? 221 ILE A O    3  
ATOM   7307  C  CB   . ILE A 1 126 ? -12.622 14.215  -12.862 1.00 5.17  ? 221 ILE A CB   3  
ATOM   7308  C  CG1  . ILE A 1 126 ? -11.865 15.154  -13.837 1.00 5.63  ? 221 ILE A CG1  3  
ATOM   7309  C  CG2  . ILE A 1 126 ? -13.701 13.470  -13.668 1.00 6.92  ? 221 ILE A CG2  3  
ATOM   7310  C  CD1  . ILE A 1 126 ? -10.355 15.167  -13.566 1.00 5.63  ? 221 ILE A CD1  3  
ATOM   7311  H  H    . ILE A 1 126 ? -11.502 16.156  -11.551 1.00 3.67  ? 221 ILE A H    3  
ATOM   7312  H  HA   . ILE A 1 126 ? -14.207 15.366  -11.973 1.00 4.27  ? 221 ILE A HA   3  
ATOM   7313  H  HB   . ILE A 1 126 ? -11.918 13.463  -12.498 1.00 5.40  ? 221 ILE A HB   3  
ATOM   7314  H  HG12 . ILE A 1 126 ? -11.995 14.816  -14.866 1.00 6.52  ? 221 ILE A HG12 3  
ATOM   7315  H  HG13 . ILE A 1 126 ? -12.264 16.167  -13.778 1.00 5.88  ? 221 ILE A HG13 3  
ATOM   7316  H  HG21 . ILE A 1 126 ? -14.434 14.177  -14.060 1.00 7.66  ? 221 ILE A HG21 3  
ATOM   7317  H  HG22 . ILE A 1 126 ? -13.238 12.939  -14.500 1.00 7.62  ? 221 ILE A HG22 3  
ATOM   7318  H  HG23 . ILE A 1 126 ? -14.209 12.732  -13.049 1.00 7.34  ? 221 ILE A HG23 3  
ATOM   7319  H  HD11 . ILE A 1 126 ? -10.145 15.469  -12.542 1.00 5.30  ? 221 ILE A HD11 3  
ATOM   7320  H  HD12 . ILE A 1 126 ? -9.947  14.169  -13.735 1.00 6.32  ? 221 ILE A HD12 3  
ATOM   7321  H  HD13 . ILE A 1 126 ? -9.873  15.864  -14.252 1.00 6.16  ? 221 ILE A HD13 3  
ATOM   7322  N  N    . VAL A 1 127 ? -12.782 13.536  -9.653  1.00 3.18  ? 222 VAL A N    3  
ATOM   7323  C  CA   . VAL A 1 127 ? -12.885 12.431  -8.680  1.00 3.23  ? 222 VAL A CA   3  
ATOM   7324  C  C    . VAL A 1 127 ? -12.080 12.834  -7.439  1.00 3.17  ? 222 VAL A C    3  
ATOM   7325  O  O    . VAL A 1 127 ? -11.119 13.596  -7.565  1.00 3.17  ? 222 VAL A O    3  
ATOM   7326  C  CB   . VAL A 1 127 ? -12.327 11.099  -9.267  1.00 3.39  ? 222 VAL A CB   3  
ATOM   7327  C  CG1  . VAL A 1 127 ? -12.370 9.922   -8.277  1.00 3.71  ? 222 VAL A CG1  3  
ATOM   7328  C  CG2  . VAL A 1 127 ? -13.089 10.661  -10.534 1.00 3.85  ? 222 VAL A CG2  3  
ATOM   7329  H  H    . VAL A 1 127 ? -11.922 14.060  -9.611  1.00 3.13  ? 222 VAL A H    3  
ATOM   7330  H  HA   . VAL A 1 127 ? -13.930 12.290  -8.401  1.00 3.51  ? 222 VAL A HA   3  
ATOM   7331  H  HB   . VAL A 1 127 ? -11.287 11.266  -9.553  1.00 3.53  ? 222 VAL A HB   3  
ATOM   7332  H  HG11 . VAL A 1 127 ? -12.048 9.003   -8.769  1.00 4.61  ? 222 VAL A HG11 3  
ATOM   7333  H  HG12 . VAL A 1 127 ? -11.691 10.099  -7.444  1.00 3.46  ? 222 VAL A HG12 3  
ATOM   7334  H  HG13 . VAL A 1 127 ? -13.385 9.785   -7.901  1.00 4.01  ? 222 VAL A HG13 3  
ATOM   7335  H  HG21 . VAL A 1 127 ? -12.721 9.693   -10.875 1.00 4.52  ? 222 VAL A HG21 3  
ATOM   7336  H  HG22 . VAL A 1 127 ? -14.156 10.582  -10.321 1.00 4.03  ? 222 VAL A HG22 3  
ATOM   7337  H  HG23 . VAL A 1 127 ? -12.926 11.373  -11.341 1.00 4.18  ? 222 VAL A HG23 3  
ATOM   7338  N  N    . ASP A 1 128 ? -12.467 12.341  -6.260  1.00 3.43  ? 223 ASP A N    3  
ATOM   7339  C  CA   . ASP A 1 128 ? -11.730 12.479  -5.001  1.00 3.53  ? 223 ASP A CA   3  
ATOM   7340  C  C    . ASP A 1 128 ? -11.323 11.104  -4.448  1.00 3.56  ? 223 ASP A C    3  
ATOM   7341  O  O    . ASP A 1 128 ? -12.145 10.190  -4.393  1.00 4.19  ? 223 ASP A O    3  
ATOM   7342  C  CB   . ASP A 1 128 ? -12.615 13.197  -3.973  1.00 3.94  ? 223 ASP A CB   3  
ATOM   7343  C  CG   . ASP A 1 128 ? -11.786 13.641  -2.769  1.00 4.30  ? 223 ASP A CG   3  
ATOM   7344  O  OD1  . ASP A 1 128 ? -11.519 12.799  -1.881  1.00 5.36  ? 223 ASP A OD1  3  
ATOM   7345  O  OD2  . ASP A 1 128 ? -11.379 14.827  -2.772  1.00 4.26  ? 223 ASP A OD2  3  
ATOM   7346  H  H    . ASP A 1 128 ? -13.263 11.706  -6.231  1.00 3.77  ? 223 ASP A H    3  
ATOM   7347  H  HA   . ASP A 1 128 ? -10.830 13.076  -5.162  1.00 3.48  ? 223 ASP A HA   3  
ATOM   7348  H  HB2  . ASP A 1 128 ? -13.072 14.072  -4.436  1.00 3.90  ? 223 ASP A HB2  3  
ATOM   7349  H  HB3  . ASP A 1 128 ? -13.420 12.538  -3.645  1.00 4.58  ? 223 ASP A HB3  3  
ATOM   7350  N  N    . HIS A 1 129 ? -10.077 10.969  -3.976  1.00 3.01  ? 224 HIS A N    3  
ATOM   7351  C  CA   . HIS A 1 129 ? -9.634  9.779   -3.243  1.00 2.97  ? 224 HIS A CA   3  
ATOM   7352  C  C    . HIS A 1 129 ? -8.901  10.142  -1.932  1.00 2.94  ? 224 HIS A C    3  
ATOM   7353  O  O    . HIS A 1 129 ? -7.818  9.631   -1.668  1.00 3.68  ? 224 HIS A O    3  
ATOM   7354  C  CB   . HIS A 1 129 ? -8.832  8.865   -4.201  1.00 3.00  ? 224 HIS A CB   3  
ATOM   7355  C  CG   . HIS A 1 129 ? -7.406  9.280   -4.521  1.00 2.74  ? 224 HIS A CG   3  
ATOM   7356  N  ND1  . HIS A 1 129 ? -6.298  8.652   -4.031  1.00 3.21  ? 224 HIS A ND1  3  
ATOM   7357  C  CD2  . HIS A 1 129 ? -7.007  10.337  -5.295  1.00 2.27  ? 224 HIS A CD2  3  
ATOM   7358  C  CE1  . HIS A 1 129 ? -5.214  9.306   -4.441  1.00 2.80  ? 224 HIS A CE1  3  
ATOM   7359  N  NE2  . HIS A 1 129 ? -5.604  10.322  -5.228  1.00 2.16  ? 224 HIS A NE2  3  
ATOM   7360  H  H    . HIS A 1 129 ? -9.452  11.759  -4.029  1.00 2.72  ? 224 HIS A H    3  
ATOM   7361  H  HA   . HIS A 1 129 ? -10.514 9.215   -2.935  1.00 3.16  ? 224 HIS A HA   3  
ATOM   7362  H  HB2  . HIS A 1 129 ? -8.795  7.872   -3.752  1.00 3.23  ? 224 HIS A HB2  3  
ATOM   7363  H  HB3  . HIS A 1 129 ? -9.384  8.763   -5.138  1.00 3.20  ? 224 HIS A HB3  3  
ATOM   7364  H  HD1  . HIS A 1 129 ? -6.281  7.907   -3.344  1.00 3.78  ? 224 HIS A HD1  3  
ATOM   7365  H  HD2  . HIS A 1 129 ? -7.652  11.036  -5.809  1.00 2.38  ? 224 HIS A HD2  3  
ATOM   7366  H  HE1  . HIS A 1 129 ? -4.197  9.094   -4.139  1.00 3.11  ? 224 HIS A HE1  3  
ATOM   7367  N  N    . SER A 1 130 ? -9.528  10.985  -1.098  1.00 2.78  ? 225 SER A N    3  
ATOM   7368  C  CA   . SER A 1 130 ? -9.072  11.494  0.215   1.00 3.00  ? 225 SER A CA   3  
ATOM   7369  C  C    . SER A 1 130 ? -8.083  10.572  0.963   1.00 2.83  ? 225 SER A C    3  
ATOM   7370  O  O    . SER A 1 130 ? -8.478  9.694   1.738   1.00 3.37  ? 225 SER A O    3  
ATOM   7371  C  CB   . SER A 1 130 ? -10.314 11.809  1.071   1.00 3.77  ? 225 SER A CB   3  
ATOM   7372  O  OG   . SER A 1 130 ? -10.010 11.962  2.453   1.00 3.94  ? 225 SER A OG   3  
ATOM   7373  H  H    . SER A 1 130 ? -10.386 11.414  -1.454  1.00 3.09  ? 225 SER A H    3  
ATOM   7374  H  HA   . SER A 1 130 ? -8.563  12.442  0.053   1.00 3.23  ? 225 SER A HA   3  
ATOM   7375  H  HB2  . SER A 1 130 ? -10.787 12.720  0.698   1.00 4.33  ? 225 SER A HB2  3  
ATOM   7376  H  HB3  . SER A 1 130 ? -11.023 10.991  0.956   1.00 4.52  ? 225 SER A HB3  3  
ATOM   7377  H  HG   . SER A 1 130 ? -9.490  11.174  2.694   1.00 4.15  ? 225 SER A HG   3  
ATOM   7378  N  N    . ILE A 1 131 ? -6.783  10.784  0.725   1.00 2.89  ? 226 ILE A N    3  
ATOM   7379  C  CA   . ILE A 1 131 ? -5.742  9.787   0.995   1.00 3.27  ? 226 ILE A CA   3  
ATOM   7380  C  C    . ILE A 1 131 ? -5.507  9.500   2.480   1.00 2.41  ? 226 ILE A C    3  
ATOM   7381  O  O    . ILE A 1 131 ? -5.459  10.396  3.319   1.00 2.89  ? 226 ILE A O    3  
ATOM   7382  C  CB   . ILE A 1 131 ? -4.405  10.114  0.278   1.00 4.58  ? 226 ILE A CB   3  
ATOM   7383  C  CG1  . ILE A 1 131 ? -3.633  11.360  0.778   1.00 5.47  ? 226 ILE A CG1  3  
ATOM   7384  C  CG2  . ILE A 1 131 ? -4.596  10.145  -1.245  1.00 5.68  ? 226 ILE A CG2  3  
ATOM   7385  C  CD1  . ILE A 1 131 ? -4.324  12.724  0.632   1.00 6.47  ? 226 ILE A CD1  3  
ATOM   7386  H  H    . ILE A 1 131 ? -6.530  11.526  0.093   1.00 3.26  ? 226 ILE A H    3  
ATOM   7387  H  HA   . ILE A 1 131 ? -6.110  8.854   0.562   1.00 3.95  ? 226 ILE A HA   3  
ATOM   7388  H  HB   . ILE A 1 131 ? -3.744  9.268   0.472   1.00 5.01  ? 226 ILE A HB   3  
ATOM   7389  H  HG12 . ILE A 1 131 ? -3.377  11.220  1.829   1.00 5.56  ? 226 ILE A HG12 3  
ATOM   7390  H  HG13 . ILE A 1 131 ? -2.690  11.410  0.232   1.00 6.24  ? 226 ILE A HG13 3  
ATOM   7391  H  HG21 . ILE A 1 131 ? -3.633  10.289  -1.735  1.00 6.47  ? 226 ILE A HG21 3  
ATOM   7392  H  HG22 . ILE A 1 131 ? -5.012  9.193   -1.571  1.00 6.11  ? 226 ILE A HG22 3  
ATOM   7393  H  HG23 . ILE A 1 131 ? -5.268  10.949  -1.545  1.00 5.97  ? 226 ILE A HG23 3  
ATOM   7394  H  HD11 . ILE A 1 131 ? -3.621  13.508  0.908   1.00 6.96  ? 226 ILE A HD11 3  
ATOM   7395  H  HD12 . ILE A 1 131 ? -4.639  12.886  -0.398  1.00 7.21  ? 226 ILE A HD12 3  
ATOM   7396  H  HD13 . ILE A 1 131 ? -5.182  12.787  1.301   1.00 6.60  ? 226 ILE A HD13 3  
ATOM   7397  N  N    . ALA A 1 132 ? -5.254  8.225   2.764   1.00 1.95  ? 227 ALA A N    3  
ATOM   7398  C  CA   . ALA A 1 132 ? -4.756  7.715   4.032   1.00 1.80  ? 227 ALA A CA   3  
ATOM   7399  C  C    . ALA A 1 132 ? -3.875  6.486   3.763   1.00 1.54  ? 227 ALA A C    3  
ATOM   7400  O  O    . ALA A 1 132 ? -3.898  5.915   2.667   1.00 1.89  ? 227 ALA A O    3  
ATOM   7401  C  CB   . ALA A 1 132 ? -5.948  7.402   4.946   1.00 2.70  ? 227 ALA A CB   3  
ATOM   7402  H  H    . ALA A 1 132 ? -5.316  7.549   2.018   1.00 2.42  ? 227 ALA A H    3  
ATOM   7403  H  HA   . ALA A 1 132 ? -4.141  8.482   4.509   1.00 2.21  ? 227 ALA A HA   3  
ATOM   7404  H  HB1  . ALA A 1 132 ? -6.514  8.315   5.135   1.00 3.13  ? 227 ALA A HB1  3  
ATOM   7405  H  HB2  . ALA A 1 132 ? -6.600  6.680   4.459   1.00 3.54  ? 227 ALA A HB2  3  
ATOM   7406  H  HB3  . ALA A 1 132 ? -5.603  6.996   5.898   1.00 3.31  ? 227 ALA A HB3  3  
ATOM   7407  N  N    . ILE A 1 133 ? -3.087  6.085   4.760   1.00 1.24  ? 228 ILE A N    3  
ATOM   7408  C  CA   . ILE A 1 133 ? -2.198  4.915   4.704   1.00 1.09  ? 228 ILE A CA   3  
ATOM   7409  C  C    . ILE A 1 133 ? -2.370  4.123   6.001   1.00 1.03  ? 228 ILE A C    3  
ATOM   7410  O  O    . ILE A 1 133 ? -2.470  4.727   7.066   1.00 1.13  ? 228 ILE A O    3  
ATOM   7411  C  CB   . ILE A 1 133 ? -0.727  5.338   4.453   1.00 1.18  ? 228 ILE A CB   3  
ATOM   7412  C  CG1  . ILE A 1 133 ? -0.588  6.061   3.094   1.00 2.22  ? 228 ILE A CG1  3  
ATOM   7413  C  CG2  . ILE A 1 133 ? 0.222   4.127   4.537   1.00 2.59  ? 228 ILE A CG2  3  
ATOM   7414  C  CD1  . ILE A 1 133 ? 0.835   6.507   2.731   1.00 2.30  ? 228 ILE A CD1  3  
ATOM   7415  H  H    . ILE A 1 133 ? -3.196  6.530   5.659   1.00 1.42  ? 228 ILE A H    3  
ATOM   7416  H  HA   . ILE A 1 133 ? -2.517  4.279   3.884   1.00 1.24  ? 228 ILE A HA   3  
ATOM   7417  H  HB   . ILE A 1 133 ? -0.436  6.039   5.228   1.00 2.21  ? 228 ILE A HB   3  
ATOM   7418  H  HG12 . ILE A 1 133 ? -0.960  5.404   2.309   1.00 3.22  ? 228 ILE A HG12 3  
ATOM   7419  H  HG13 . ILE A 1 133 ? -1.205  6.958   3.104   1.00 3.38  ? 228 ILE A HG13 3  
ATOM   7420  H  HG21 . ILE A 1 133 ? 1.256   4.445   4.416   1.00 3.21  ? 228 ILE A HG21 3  
ATOM   7421  H  HG22 . ILE A 1 133 ? 0.156   3.648   5.513   1.00 3.53  ? 228 ILE A HG22 3  
ATOM   7422  H  HG23 . ILE A 1 133 ? -0.035  3.402   3.763   1.00 3.40  ? 228 ILE A HG23 3  
ATOM   7423  H  HD11 . ILE A 1 133 ? 1.461   5.643   2.504   1.00 2.63  ? 228 ILE A HD11 3  
ATOM   7424  H  HD12 . ILE A 1 133 ? 0.796   7.141   1.844   1.00 3.44  ? 228 ILE A HD12 3  
ATOM   7425  H  HD13 . ILE A 1 133 ? 1.270   7.074   3.553   1.00 2.38  ? 228 ILE A HD13 3  
ATOM   7426  N  N    . TYR A 1 134 ? -2.410  2.793   5.913   1.00 1.03  ? 229 TYR A N    3  
ATOM   7427  C  CA   . TYR A 1 134 ? -2.749  1.892   7.025   1.00 1.03  ? 229 TYR A CA   3  
ATOM   7428  C  C    . TYR A 1 134 ? -1.725  0.747   7.176   1.00 0.96  ? 229 TYR A C    3  
ATOM   7429  O  O    . TYR A 1 134 ? -1.243  0.212   6.171   1.00 0.97  ? 229 TYR A O    3  
ATOM   7430  C  CB   . TYR A 1 134 ? -4.155  1.312   6.782   1.00 1.14  ? 229 TYR A CB   3  
ATOM   7431  C  CG   . TYR A 1 134 ? -5.265  2.325   6.536   1.00 1.78  ? 229 TYR A CG   3  
ATOM   7432  C  CD1  . TYR A 1 134 ? -5.473  2.858   5.245   1.00 3.26  ? 229 TYR A CD1  3  
ATOM   7433  C  CD2  . TYR A 1 134 ? -6.115  2.717   7.590   1.00 2.10  ? 229 TYR A CD2  3  
ATOM   7434  C  CE1  . TYR A 1 134 ? -6.508  3.784   5.009   1.00 4.39  ? 229 TYR A CE1  3  
ATOM   7435  C  CE2  . TYR A 1 134 ? -7.158  3.636   7.357   1.00 3.15  ? 229 TYR A CE2  3  
ATOM   7436  C  CZ   . TYR A 1 134 ? -7.358  4.177   6.067   1.00 4.16  ? 229 TYR A CZ   3  
ATOM   7437  O  OH   . TYR A 1 134 ? -8.363  5.072   5.853   1.00 5.39  ? 229 TYR A OH   3  
ATOM   7438  H  H    . TYR A 1 134 ? -2.316  2.382   4.990   1.00 1.14  ? 229 TYR A H    3  
ATOM   7439  H  HA   . TYR A 1 134 ? -2.769  2.455   7.959   1.00 1.08  ? 229 TYR A HA   3  
ATOM   7440  H  HB2  . TYR A 1 134 ? -4.111  0.645   5.921   1.00 1.88  ? 229 TYR A HB2  3  
ATOM   7441  H  HB3  . TYR A 1 134 ? -4.425  0.700   7.645   1.00 1.35  ? 229 TYR A HB3  3  
ATOM   7442  H  HD1  . TYR A 1 134 ? -4.824  2.564   4.430   1.00 3.85  ? 229 TYR A HD1  3  
ATOM   7443  H  HD2  . TYR A 1 134 ? -5.964  2.313   8.580   1.00 2.41  ? 229 TYR A HD2  3  
ATOM   7444  H  HE1  . TYR A 1 134 ? -6.652  4.197   4.021   1.00 5.66  ? 229 TYR A HE1  3  
ATOM   7445  H  HE2  . TYR A 1 134 ? -7.807  3.940   8.166   1.00 3.68  ? 229 TYR A HE2  3  
ATOM   7446  H  HH   . TYR A 1 134 ? -8.399  5.404   4.950   1.00 6.29  ? 229 TYR A HH   3  
ATOM   7447  N  N    . LEU A 1 135 ? -1.412  0.340   8.415   1.00 0.95  ? 230 LEU A N    3  
ATOM   7448  C  CA   . LEU A 1 135 ? -0.533  -0.808  8.711   1.00 0.90  ? 230 LEU A CA   3  
ATOM   7449  C  C    . LEU A 1 135 ? -1.376  -2.083  8.888   1.00 0.97  ? 230 LEU A C    3  
ATOM   7450  O  O    . LEU A 1 135 ? -2.199  -2.146  9.800   1.00 1.07  ? 230 LEU A O    3  
ATOM   7451  C  CB   . LEU A 1 135 ? 0.316   -0.496  9.973   1.00 0.92  ? 230 LEU A CB   3  
ATOM   7452  C  CG   . LEU A 1 135 ? 1.714   -1.137  10.075  1.00 1.42  ? 230 LEU A CG   3  
ATOM   7453  C  CD1  . LEU A 1 135 ? 1.623   -2.666  10.162  1.00 2.67  ? 230 LEU A CD1  3  
ATOM   7454  C  CD2  . LEU A 1 135 ? 2.636   -0.714  8.921   1.00 2.42  ? 230 LEU A CD2  3  
ATOM   7455  H  H    . LEU A 1 135 ? -1.838  0.827   9.199   1.00 1.00  ? 230 LEU A H    3  
ATOM   7456  H  HA   . LEU A 1 135 ? 0.134   -0.958  7.863   1.00 0.93  ? 230 LEU A HA   3  
ATOM   7457  H  HB2  . LEU A 1 135 ? 0.462   0.580   10.048  1.00 1.39  ? 230 LEU A HB2  3  
ATOM   7458  H  HB3  . LEU A 1 135 ? -0.233  -0.809  10.860  1.00 1.37  ? 230 LEU A HB3  3  
ATOM   7459  H  HG   . LEU A 1 135 ? 2.160   -0.770  11.006  1.00 1.22  ? 230 LEU A HG   3  
ATOM   7460  H  HD11 . LEU A 1 135 ? 2.591   -3.070  10.445  1.00 3.40  ? 230 LEU A HD11 3  
ATOM   7461  H  HD12 . LEU A 1 135 ? 0.893   -2.959  10.916  1.00 3.43  ? 230 LEU A HD12 3  
ATOM   7462  H  HD13 . LEU A 1 135 ? 1.342   -3.086  9.197   1.00 3.06  ? 230 LEU A HD13 3  
ATOM   7463  H  HD21 . LEU A 1 135 ? 2.649   0.374   8.836   1.00 2.54  ? 230 LEU A HD21 3  
ATOM   7464  H  HD22 . LEU A 1 135 ? 3.650   -1.058  9.119   1.00 3.44  ? 230 LEU A HD22 3  
ATOM   7465  H  HD23 . LEU A 1 135 ? 2.302   -1.144  7.976   1.00 3.34  ? 230 LEU A HD23 3  
ATOM   7466  N  N    . LEU A 1 136 ? -1.157  -3.094  8.041   1.00 1.02  ? 231 LEU A N    3  
ATOM   7467  C  CA   . LEU A 1 136 ? -1.781  -4.424  8.082   1.00 1.16  ? 231 LEU A CA   3  
ATOM   7468  C  C    . LEU A 1 136 ? -0.747  -5.450  8.590   1.00 1.14  ? 231 LEU A C    3  
ATOM   7469  O  O    . LEU A 1 136 ? 0.401   -5.469  8.130   1.00 1.01  ? 231 LEU A O    3  
ATOM   7470  C  CB   . LEU A 1 136 ? -2.301  -4.750  6.663   1.00 1.34  ? 231 LEU A CB   3  
ATOM   7471  C  CG   . LEU A 1 136 ? -3.463  -5.755  6.503   1.00 1.62  ? 231 LEU A CG   3  
ATOM   7472  C  CD1  . LEU A 1 136 ? -3.173  -7.149  7.075   1.00 2.84  ? 231 LEU A CD1  3  
ATOM   7473  C  CD2  . LEU A 1 136 ? -4.776  -5.197  7.072   1.00 2.14  ? 231 LEU A CD2  3  
ATOM   7474  H  H    . LEU A 1 136 ? -0.444  -2.958  7.335   1.00 1.04  ? 231 LEU A H    3  
ATOM   7475  H  HA   . LEU A 1 136 ? -2.619  -4.402  8.779   1.00 1.24  ? 231 LEU A HA   3  
ATOM   7476  H  HB2  . LEU A 1 136 ? -2.628  -3.820  6.194   1.00 1.51  ? 231 LEU A HB2  3  
ATOM   7477  H  HB3  . LEU A 1 136 ? -1.463  -5.116  6.079   1.00 1.54  ? 231 LEU A HB3  3  
ATOM   7478  H  HG   . LEU A 1 136 ? -3.611  -5.883  5.430   1.00 2.78  ? 231 LEU A HG   3  
ATOM   7479  H  HD11 . LEU A 1 136 ? -2.191  -7.492  6.748   1.00 3.92  ? 231 LEU A HD11 3  
ATOM   7480  H  HD12 . LEU A 1 136 ? -3.213  -7.135  8.162   1.00 3.21  ? 231 LEU A HD12 3  
ATOM   7481  H  HD13 . LEU A 1 136 ? -3.926  -7.853  6.717   1.00 3.55  ? 231 LEU A HD13 3  
ATOM   7482  H  HD21 . LEU A 1 136 ? -5.015  -4.251  6.585   1.00 2.98  ? 231 LEU A HD21 3  
ATOM   7483  H  HD22 . LEU A 1 136 ? -5.587  -5.900  6.884   1.00 2.95  ? 231 LEU A HD22 3  
ATOM   7484  H  HD23 . LEU A 1 136 ? -4.693  -5.031  8.143   1.00 2.97  ? 231 LEU A HD23 3  
ATOM   7485  N  N    . ASN A 1 137 ? -1.155  -6.266  9.563   1.00 1.37  ? 232 ASN A N    3  
ATOM   7486  C  CA   . ASN A 1 137 ? -0.275  -7.007  10.472  1.00 1.18  ? 232 ASN A CA   3  
ATOM   7487  C  C    . ASN A 1 137 ? -0.424  -8.558  10.386  1.00 1.15  ? 232 ASN A C    3  
ATOM   7488  O  O    . ASN A 1 137 ? -1.401  -9.056  9.813   1.00 1.36  ? 232 ASN A O    3  
ATOM   7489  C  CB   . ASN A 1 137 ? -0.529  -6.418  11.880  1.00 1.23  ? 232 ASN A CB   3  
ATOM   7490  C  CG   . ASN A 1 137 ? -1.833  -6.846  12.558  1.00 1.96  ? 232 ASN A CG   3  
ATOM   7491  O  OD1  . ASN A 1 137 ? -2.346  -7.939  12.355  1.00 3.30  ? 232 ASN A OD1  3  
ATOM   7492  N  ND2  . ASN A 1 137 ? -2.378  -5.999  13.408  1.00 2.19  ? 232 ASN A ND2  3  
ATOM   7493  H  H    . ASN A 1 137 ? -2.137  -6.232  9.819   1.00 1.62  ? 232 ASN A H    3  
ATOM   7494  H  HA   . ASN A 1 137 ? 0.756   -6.770  10.206  1.00 1.27  ? 232 ASN A HA   3  
ATOM   7495  H  HB2  . ASN A 1 137 ? 0.288   -6.651  12.554  1.00 1.90  ? 232 ASN A HB2  3  
ATOM   7496  H  HB3  . ASN A 1 137 ? -0.532  -5.333  11.787  1.00 2.03  ? 232 ASN A HB3  3  
ATOM   7497  H  HD21 . ASN A 1 137 ? -1.974  -5.080  13.554  1.00 2.27  ? 232 ASN A HD21 3  
ATOM   7498  H  HD22 . ASN A 1 137 ? -3.238  -6.253  13.861  1.00 3.04  ? 232 ASN A HD22 3  
ATOM   7499  N  N    . PRO A 1 138 ? 0.504   -9.341  10.983  1.00 1.13  ? 233 PRO A N    3  
ATOM   7500  C  CA   . PRO A 1 138 ? 0.527   -10.805 10.889  1.00 1.37  ? 233 PRO A CA   3  
ATOM   7501  C  C    . PRO A 1 138 ? -0.409  -11.522 11.885  1.00 1.60  ? 233 PRO A C    3  
ATOM   7502  O  O    . PRO A 1 138 ? -0.292  -12.735 12.060  1.00 2.00  ? 233 PRO A O    3  
ATOM   7503  C  CB   . PRO A 1 138 ? 2.000   -11.182 11.091  1.00 1.38  ? 233 PRO A CB   3  
ATOM   7504  C  CG   . PRO A 1 138 ? 2.487   -10.131 12.080  1.00 1.30  ? 233 PRO A CG   3  
ATOM   7505  C  CD   . PRO A 1 138 ? 1.711   -8.883  11.665  1.00 1.16  ? 233 PRO A CD   3  
ATOM   7506  H  HA   . PRO A 1 138 ? 0.228   -11.102 9.886   1.00 1.61  ? 233 PRO A HA   3  
ATOM   7507  H  HB2  . PRO A 1 138 ? 2.139   -12.193 11.471  1.00 1.53  ? 233 PRO A HB2  3  
ATOM   7508  H  HB3  . PRO A 1 138 ? 2.535   -11.065 10.151  1.00 1.53  ? 233 PRO A HB3  3  
ATOM   7509  H  HG2  . PRO A 1 138 ? 2.203   -10.421 13.092  1.00 1.45  ? 233 PRO A HG2  3  
ATOM   7510  H  HG3  . PRO A 1 138 ? 3.565   -9.978  12.011  1.00 1.47  ? 233 PRO A HG3  3  
ATOM   7511  H  HD2  . PRO A 1 138 ? 1.477   -8.310  12.559  1.00 1.27  ? 233 PRO A HD2  3  
ATOM   7512  H  HD3  . PRO A 1 138 ? 2.305   -8.284  10.976  1.00 1.24  ? 233 PRO A HD3  3  
ATOM   7513  N  N    . ASP A 1 139 ? -1.348  -10.806 12.521  1.00 1.73  ? 234 ASP A N    3  
ATOM   7514  C  CA   . ASP A 1 139 ? -2.486  -11.397 13.238  1.00 2.04  ? 234 ASP A CA   3  
ATOM   7515  C  C    . ASP A 1 139 ? -3.740  -11.434 12.346  1.00 1.92  ? 234 ASP A C    3  
ATOM   7516  O  O    . ASP A 1 139 ? -4.661  -12.203 12.631  1.00 2.22  ? 234 ASP A O    3  
ATOM   7517  C  CB   . ASP A 1 139 ? -2.795  -10.612 14.523  1.00 2.41  ? 234 ASP A CB   3  
ATOM   7518  C  CG   . ASP A 1 139 ? -1.745  -10.776 15.622  1.00 3.73  ? 234 ASP A CG   3  
ATOM   7519  O  OD1  . ASP A 1 139 ? -1.343  -11.929 15.911  1.00 4.38  ? 234 ASP A OD1  3  
ATOM   7520  O  OD2  . ASP A 1 139 ? -1.397  -9.756  16.255  1.00 4.94  ? 234 ASP A OD2  3  
ATOM   7521  H  H    . ASP A 1 139 ? -1.436  -9.819  12.319  1.00 1.78  ? 234 ASP A H    3  
ATOM   7522  H  HA   . ASP A 1 139 ? -2.250  -12.424 13.520  1.00 2.62  ? 234 ASP A HA   3  
ATOM   7523  H  HB2  . ASP A 1 139 ? -2.921  -9.555  14.288  1.00 3.22  ? 234 ASP A HB2  3  
ATOM   7524  H  HB3  . ASP A 1 139 ? -3.744  -10.969 14.928  1.00 2.47  ? 234 ASP A HB3  3  
ATOM   7525  N  N    . GLY A 1 140 ? -3.756  -10.682 11.233  1.00 1.88  ? 235 GLY A N    3  
ATOM   7526  C  CA   . GLY A 1 140 ? -4.876  -10.605 10.287  1.00 2.43  ? 235 GLY A CA   3  
ATOM   7527  C  C    . GLY A 1 140 ? -5.748  -9.370  10.501  1.00 2.15  ? 235 GLY A C    3  
ATOM   7528  O  O    . GLY A 1 140 ? -6.943  -9.415  10.195  1.00 2.74  ? 235 GLY A O    3  
ATOM   7529  H  H    . GLY A 1 140 ? -2.942  -10.107 11.037  1.00 1.70  ? 235 GLY A H    3  
ATOM   7530  H  HA2  . GLY A 1 140 ? -4.472  -10.536 9.278   1.00 2.83  ? 235 GLY A HA2  3  
ATOM   7531  H  HA3  . GLY A 1 140 ? -5.511  -11.487 10.376  1.00 2.98  ? 235 GLY A HA3  3  
ATOM   7532  N  N    . LEU A 1 141 ? -5.163  -8.293  11.038  1.00 1.68  ? 236 LEU A N    3  
ATOM   7533  C  CA   . LEU A 1 141 ? -5.841  -7.048  11.396  1.00 1.71  ? 236 LEU A CA   3  
ATOM   7534  C  C    . LEU A 1 141 ? -5.013  -5.815  10.993  1.00 1.62  ? 236 LEU A C    3  
ATOM   7535  O  O    . LEU A 1 141 ? -3.905  -5.930  10.465  1.00 2.04  ? 236 LEU A O    3  
ATOM   7536  C  CB   . LEU A 1 141 ? -6.120  -7.067  12.919  1.00 1.97  ? 236 LEU A CB   3  
ATOM   7537  C  CG   . LEU A 1 141 ? -7.518  -6.535  13.293  1.00 2.96  ? 236 LEU A CG   3  
ATOM   7538  C  CD1  . LEU A 1 141 ? -8.604  -7.557  12.924  1.00 3.38  ? 236 LEU A CD1  3  
ATOM   7539  C  CD2  . LEU A 1 141 ? -7.579  -6.231  14.793  1.00 3.85  ? 236 LEU A CD2  3  
ATOM   7540  H  H    . LEU A 1 141 ? -4.173  -8.343  11.252  1.00 1.73  ? 236 LEU A H    3  
ATOM   7541  H  HA   . LEU A 1 141 ? -6.780  -6.988  10.847  1.00 2.21  ? 236 LEU A HA   3  
ATOM   7542  H  HB2  . LEU A 1 141 ? -6.031  -8.085  13.310  1.00 2.10  ? 236 LEU A HB2  3  
ATOM   7543  H  HB3  . LEU A 1 141 ? -5.358  -6.472  13.427  1.00 2.25  ? 236 LEU A HB3  3  
ATOM   7544  H  HG   . LEU A 1 141 ? -7.711  -5.606  12.754  1.00 3.49  ? 236 LEU A HG   3  
ATOM   7545  H  HD11 . LEU A 1 141 ? -9.583  -7.177  13.214  1.00 3.94  ? 236 LEU A HD11 3  
ATOM   7546  H  HD12 . LEU A 1 141 ? -8.604  -7.741  11.851  1.00 4.02  ? 236 LEU A HD12 3  
ATOM   7547  H  HD13 . LEU A 1 141 ? -8.417  -8.499  13.443  1.00 3.42  ? 236 LEU A HD13 3  
ATOM   7548  H  HD21 . LEU A 1 141 ? -6.868  -5.440  15.032  1.00 4.27  ? 236 LEU A HD21 3  
ATOM   7549  H  HD22 . LEU A 1 141 ? -8.579  -5.889  15.064  1.00 4.84  ? 236 LEU A HD22 3  
ATOM   7550  H  HD23 . LEU A 1 141 ? -7.334  -7.124  15.371  1.00 4.01  ? 236 LEU A HD23 3  
ATOM   7551  N  N    . PHE A 1 142 ? -5.553  -4.629  11.265  1.00 1.58  ? 237 PHE A N    3  
ATOM   7552  C  CA   . PHE A 1 142 ? -4.818  -3.366  11.241  1.00 1.57  ? 237 PHE A CA   3  
ATOM   7553  C  C    . PHE A 1 142 ? -4.068  -3.139  12.567  1.00 2.00  ? 237 PHE A C    3  
ATOM   7554  O  O    . PHE A 1 142 ? -4.458  -3.688  13.601  1.00 2.26  ? 237 PHE A O    3  
ATOM   7555  C  CB   . PHE A 1 142 ? -5.804  -2.220  10.942  1.00 1.97  ? 237 PHE A CB   3  
ATOM   7556  C  CG   . PHE A 1 142 ? -7.040  -2.210  11.828  1.00 2.03  ? 237 PHE A CG   3  
ATOM   7557  C  CD1  . PHE A 1 142 ? -6.969  -1.715  13.144  1.00 3.44  ? 237 PHE A CD1  3  
ATOM   7558  C  CD2  . PHE A 1 142 ? -8.252  -2.750  11.352  1.00 3.10  ? 237 PHE A CD2  3  
ATOM   7559  C  CE1  . PHE A 1 142 ? -8.095  -1.780  13.984  1.00 4.41  ? 237 PHE A CE1  3  
ATOM   7560  C  CE2  . PHE A 1 142 ? -9.379  -2.810  12.192  1.00 4.10  ? 237 PHE A CE2  3  
ATOM   7561  C  CZ   . PHE A 1 142 ? -9.298  -2.329  13.510  1.00 4.47  ? 237 PHE A CZ   3  
ATOM   7562  H  H    . PHE A 1 142 ? -6.450  -4.613  11.727  1.00 1.81  ? 237 PHE A H    3  
ATOM   7563  H  HA   . PHE A 1 142 ? -4.086  -3.407  10.438  1.00 1.65  ? 237 PHE A HA   3  
ATOM   7564  H  HB2  . PHE A 1 142 ? -5.286  -1.265  11.042  1.00 2.60  ? 237 PHE A HB2  3  
ATOM   7565  H  HB3  . PHE A 1 142 ? -6.118  -2.302  9.900   1.00 2.94  ? 237 PHE A HB3  3  
ATOM   7566  H  HD1  . PHE A 1 142 ? -6.044  -1.303  13.523  1.00 4.04  ? 237 PHE A HD1  3  
ATOM   7567  H  HD2  . PHE A 1 142 ? -8.317  -3.129  10.341  1.00 4.00  ? 237 PHE A HD2  3  
ATOM   7568  H  HE1  . PHE A 1 142 ? -8.029  -1.413  14.999  1.00 5.65  ? 237 PHE A HE1  3  
ATOM   7569  H  HE2  . PHE A 1 142 ? -10.305 -3.229  11.823  1.00 5.33  ? 237 PHE A HE2  3  
ATOM   7570  H  HZ   . PHE A 1 142 ? -10.157 -2.383  14.163  1.00 5.60  ? 237 PHE A HZ   3  
ATOM   7571  N  N    . THR A 1 143 ? -3.031  -2.291  12.545  1.00 1.52  ? 238 THR A N    3  
ATOM   7572  C  CA   . THR A 1 143 ? -2.358  -1.761  13.750  1.00 1.52  ? 238 THR A CA   3  
ATOM   7573  C  C    . THR A 1 143 ? -2.596  -0.262  13.903  1.00 1.58  ? 238 THR A C    3  
ATOM   7574  O  O    . THR A 1 143 ? -3.002  0.171   14.979  1.00 2.12  ? 238 THR A O    3  
ATOM   7575  C  CB   . THR A 1 143 ? -0.858  -2.075  13.736  1.00 1.49  ? 238 THR A CB   3  
ATOM   7576  O  OG1  . THR A 1 143 ? -0.676  -3.470  13.646  1.00 1.93  ? 238 THR A OG1  3  
ATOM   7577  C  CG2  . THR A 1 143 ? -0.152  -1.623  15.015  1.00 1.60  ? 238 THR A CG2  3  
ATOM   7578  H  H    . THR A 1 143 ? -2.728  -1.958  11.637  1.00 1.71  ? 238 THR A H    3  
ATOM   7579  H  HA   . THR A 1 143 ? -2.784  -2.229  14.638  1.00 1.70  ? 238 THR A HA   3  
ATOM   7580  H  HB   . THR A 1 143 ? -0.385  -1.592  12.882  1.00 1.69  ? 238 THR A HB   3  
ATOM   7581  H  HG1  . THR A 1 143 ? 0.253   -3.637  13.826  1.00 3.01  ? 238 THR A HG1  3  
ATOM   7582  H  HG21 . THR A 1 143 ? -0.634  -2.067  15.887  1.00 2.25  ? 238 THR A HG21 3  
ATOM   7583  H  HG22 . THR A 1 143 ? 0.896   -1.921  14.990  1.00 2.45  ? 238 THR A HG22 3  
ATOM   7584  H  HG23 . THR A 1 143 ? -0.192  -0.539  15.101  1.00 1.91  ? 238 THR A HG23 3  
ATOM   7585  N  N    . ASP A 1 144 ? -2.382  0.528   12.845  1.00 1.43  ? 239 ASP A N    3  
ATOM   7586  C  CA   . ASP A 1 144 ? -2.537  1.989   12.877  1.00 1.50  ? 239 ASP A CA   3  
ATOM   7587  C  C    . ASP A 1 144 ? -2.802  2.627   11.499  1.00 1.36  ? 239 ASP A C    3  
ATOM   7588  O  O    . ASP A 1 144 ? -2.871  1.937   10.476  1.00 1.46  ? 239 ASP A O    3  
ATOM   7589  C  CB   . ASP A 1 144 ? -1.371  2.650   13.654  1.00 1.73  ? 239 ASP A CB   3  
ATOM   7590  C  CG   . ASP A 1 144 ? -0.140  3.120   12.864  1.00 3.41  ? 239 ASP A CG   3  
ATOM   7591  O  OD1  . ASP A 1 144 ? 0.079   2.754   11.691  1.00 4.86  ? 239 ASP A OD1  3  
ATOM   7592  O  OD2  . ASP A 1 144 ? 0.624   3.926   13.443  1.00 4.07  ? 239 ASP A OD2  3  
ATOM   7593  H  H    . ASP A 1 144 ? -2.079  0.125   11.973  1.00 1.59  ? 239 ASP A H    3  
ATOM   7594  H  HA   . ASP A 1 144 ? -3.435  2.188   13.462  1.00 1.66  ? 239 ASP A HA   3  
ATOM   7595  H  HB2  . ASP A 1 144 ? -1.780  3.532   14.143  1.00 2.01  ? 239 ASP A HB2  3  
ATOM   7596  H  HB3  . ASP A 1 144 ? -1.037  1.988   14.452  1.00 2.17  ? 239 ASP A HB3  3  
ATOM   7597  N  N    . TYR A 1 145 ? -2.963  3.956   11.497  1.00 1.32  ? 240 TYR A N    3  
ATOM   7598  C  CA   . TYR A 1 145 ? -3.234  4.782   10.318  1.00 1.23  ? 240 TYR A CA   3  
ATOM   7599  C  C    . TYR A 1 145 ? -2.432  6.099   10.323  1.00 1.26  ? 240 TYR A C    3  
ATOM   7600  O  O    . TYR A 1 145 ? -2.050  6.628   11.368  1.00 1.42  ? 240 TYR A O    3  
ATOM   7601  C  CB   . TYR A 1 145 ? -4.746  5.048   10.199  1.00 1.38  ? 240 TYR A CB   3  
ATOM   7602  C  CG   . TYR A 1 145 ? -5.358  5.924   11.284  1.00 1.66  ? 240 TYR A CG   3  
ATOM   7603  C  CD1  . TYR A 1 145 ? -5.688  5.372   12.539  1.00 2.92  ? 240 TYR A CD1  3  
ATOM   7604  C  CD2  . TYR A 1 145 ? -5.629  7.284   11.033  1.00 2.35  ? 240 TYR A CD2  3  
ATOM   7605  C  CE1  . TYR A 1 145 ? -6.274  6.174   13.538  1.00 3.37  ? 240 TYR A CE1  3  
ATOM   7606  C  CE2  . TYR A 1 145 ? -6.224  8.091   12.025  1.00 2.78  ? 240 TYR A CE2  3  
ATOM   7607  C  CZ   . TYR A 1 145 ? -6.549  7.537   13.284  1.00 2.78  ? 240 TYR A CZ   3  
ATOM   7608  O  OH   . TYR A 1 145 ? -7.133  8.298   14.251  1.00 3.42  ? 240 TYR A OH   3  
ATOM   7609  H  H    . TYR A 1 145 ? -2.848  4.451   12.370  1.00 1.47  ? 240 TYR A H    3  
ATOM   7610  H  HA   . TYR A 1 145 ? -2.929  4.222   9.437   1.00 1.21  ? 240 TYR A HA   3  
ATOM   7611  H  HB2  . TYR A 1 145 ? -4.934  5.510   9.229   1.00 1.53  ? 240 TYR A HB2  3  
ATOM   7612  H  HB3  . TYR A 1 145 ? -5.266  4.090   10.196  1.00 1.60  ? 240 TYR A HB3  3  
ATOM   7613  H  HD1  . TYR A 1 145 ? -5.495  4.327   12.732  1.00 4.02  ? 240 TYR A HD1  3  
ATOM   7614  H  HD2  . TYR A 1 145 ? -5.386  7.712   10.070  1.00 3.35  ? 240 TYR A HD2  3  
ATOM   7615  H  HE1  . TYR A 1 145 ? -6.529  5.746   14.497  1.00 4.64  ? 240 TYR A HE1  3  
ATOM   7616  H  HE2  . TYR A 1 145 ? -6.430  9.132   11.820  1.00 3.83  ? 240 TYR A HE2  3  
ATOM   7617  H  HH   . TYR A 1 145 ? -7.343  9.198   13.961  1.00 3.62  ? 240 TYR A HH   3  
ATOM   7618  N  N    . TYR A 1 146 ? -2.163  6.635   9.132   1.00 1.28  ? 241 TYR A N    3  
ATOM   7619  C  CA   . TYR A 1 146 ? -1.463  7.904   8.913   1.00 1.47  ? 241 TYR A CA   3  
ATOM   7620  C  C    . TYR A 1 146 ? -2.409  9.118   9.023   1.00 2.06  ? 241 TYR A C    3  
ATOM   7621  O  O    . TYR A 1 146 ? -3.595  9.030   8.711   1.00 2.88  ? 241 TYR A O    3  
ATOM   7622  C  CB   . TYR A 1 146 ? -0.786  7.887   7.531   1.00 2.28  ? 241 TYR A CB   3  
ATOM   7623  C  CG   . TYR A 1 146 ? 0.525   7.118   7.416   1.00 2.59  ? 241 TYR A CG   3  
ATOM   7624  C  CD1  . TYR A 1 146 ? 0.637   5.775   7.838   1.00 3.64  ? 241 TYR A CD1  3  
ATOM   7625  C  CD2  . TYR A 1 146 ? 1.636   7.742   6.816   1.00 3.50  ? 241 TYR A CD2  3  
ATOM   7626  C  CE1  . TYR A 1 146 ? 1.856   5.084   7.713   1.00 4.63  ? 241 TYR A CE1  3  
ATOM   7627  C  CE2  . TYR A 1 146 ? 2.845   7.040   6.646   1.00 4.49  ? 241 TYR A CE2  3  
ATOM   7628  C  CZ   . TYR A 1 146 ? 2.961   5.711   7.100   1.00 4.78  ? 241 TYR A CZ   3  
ATOM   7629  O  OH   . TYR A 1 146 ? 4.125   5.025   6.940   1.00 6.08  ? 241 TYR A OH   3  
ATOM   7630  H  H    . TYR A 1 146 ? -2.480  6.119   8.316   1.00 1.29  ? 241 TYR A H    3  
ATOM   7631  H  HA   . TYR A 1 146 ? -0.693  8.021   9.677   1.00 1.54  ? 241 TYR A HA   3  
ATOM   7632  H  HB2  . TYR A 1 146 ? -1.491  7.495   6.798   1.00 3.18  ? 241 TYR A HB2  3  
ATOM   7633  H  HB3  . TYR A 1 146 ? -0.587  8.920   7.245   1.00 2.77  ? 241 TYR A HB3  3  
ATOM   7634  H  HD1  . TYR A 1 146 ? -0.223  5.254   8.235   1.00 4.41  ? 241 TYR A HD1  3  
ATOM   7635  H  HD2  . TYR A 1 146 ? 1.558   8.756   6.446   1.00 4.25  ? 241 TYR A HD2  3  
ATOM   7636  H  HE1  . TYR A 1 146 ? 1.952   4.062   8.053   1.00 5.84  ? 241 TYR A HE1  3  
ATOM   7637  H  HE2  . TYR A 1 146 ? 3.675   7.519   6.152   1.00 5.62  ? 241 TYR A HE2  3  
ATOM   7638  H  HH   . TYR A 1 146 ? 4.785   5.517   6.449   1.00 6.62  ? 241 TYR A HH   3  
ATOM   7639  N  N    . GLY A 1 147 ? -1.856  10.275  9.406   1.00 2.29  ? 242 GLY A N    3  
ATOM   7640  C  CA   . GLY A 1 147 ? -2.565  11.558  9.473   1.00 3.19  ? 242 GLY A CA   3  
ATOM   7641  C  C    . GLY A 1 147 ? -1.626  12.758  9.603   1.00 2.97  ? 242 GLY A C    3  
ATOM   7642  O  O    . GLY A 1 147 ? -0.403  12.601  9.590   1.00 3.43  ? 242 GLY A O    3  
ATOM   7643  H  H    . GLY A 1 147 ? -0.871  10.292  9.621   1.00 2.22  ? 242 GLY A H    3  
ATOM   7644  H  HA2  . GLY A 1 147 ? -3.187  11.680  8.584   1.00 3.70  ? 242 GLY A HA2  3  
ATOM   7645  H  HA3  . GLY A 1 147 ? -3.236  11.544  10.332  1.00 4.05  ? 242 GLY A HA3  3  
ATOM   7646  N  N    . ARG A 1 148 ? -2.211  13.956  9.742   1.00 3.15  ? 243 ARG A N    3  
ATOM   7647  C  CA   . ARG A 1 148 ? -1.505  15.233  9.941   1.00 3.29  ? 243 ARG A CA   3  
ATOM   7648  C  C    . ARG A 1 148 ? -0.475  15.109  11.074  1.00 3.55  ? 243 ARG A C    3  
ATOM   7649  O  O    . ARG A 1 148 ? -0.828  14.685  12.167  1.00 4.75  ? 243 ARG A O    3  
ATOM   7650  C  CB   . ARG A 1 148 ? -2.558  16.325  10.230  1.00 3.88  ? 243 ARG A CB   3  
ATOM   7651  C  CG   . ARG A 1 148 ? -2.105  17.789  10.095  1.00 4.72  ? 243 ARG A CG   3  
ATOM   7652  C  CD   . ARG A 1 148 ? -1.149  18.290  11.187  1.00 5.82  ? 243 ARG A CD   3  
ATOM   7653  N  NE   . ARG A 1 148 ? -1.050  19.759  11.182  1.00 6.76  ? 243 ARG A NE   3  
ATOM   7654  C  CZ   . ARG A 1 148 ? -0.234  20.497  11.930  1.00 7.86  ? 243 ARG A CZ   3  
ATOM   7655  N  NH1  . ARG A 1 148 ? 0.654   19.961  12.741  1.00 8.37  ? 243 ARG A NH1  3  
ATOM   7656  N  NH2  . ARG A 1 148 ? -0.318  21.807  11.877  1.00 8.89  ? 243 ARG A NH2  3  
ATOM   7657  H  H    . ARG A 1 148 ? -3.219  13.982  9.745   1.00 3.78  ? 243 ARG A H    3  
ATOM   7658  H  HA   . ARG A 1 148 ? -0.992  15.483  9.012   1.00 3.41  ? 243 ARG A HA   3  
ATOM   7659  H  HB2  . ARG A 1 148 ? -3.374  16.194  9.517   1.00 4.06  ? 243 ARG A HB2  3  
ATOM   7660  H  HB3  . ARG A 1 148 ? -2.977  16.172  11.226  1.00 4.34  ? 243 ARG A HB3  3  
ATOM   7661  H  HG2  . ARG A 1 148 ? -1.643  17.938  9.118   1.00 4.67  ? 243 ARG A HG2  3  
ATOM   7662  H  HG3  . ARG A 1 148 ? -3.008  18.399  10.138  1.00 5.43  ? 243 ARG A HG3  3  
ATOM   7663  H  HD2  . ARG A 1 148 ? -1.512  17.962  12.163  1.00 6.30  ? 243 ARG A HD2  3  
ATOM   7664  H  HD3  . ARG A 1 148 ? -0.160  17.871  11.011  1.00 6.15  ? 243 ARG A HD3  3  
ATOM   7665  H  HE   . ARG A 1 148 ? -1.699  20.252  10.571  1.00 6.92  ? 243 ARG A HE   3  
ATOM   7666  H  HH11 . ARG A 1 148 ? 0.739   18.954  12.809  1.00 7.95  ? 243 ARG A HH11 3  
ATOM   7667  H  HH12 . ARG A 1 148 ? 1.255   20.549  13.309  1.00 9.45  ? 243 ARG A HH12 3  
ATOM   7668  H  HH21 . ARG A 1 148 ? -1.054  22.242  11.327  1.00 8.93  ? 243 ARG A HH21 3  
ATOM   7669  H  HH22 . ARG A 1 148 ? 0.175   22.394  12.534  1.00 9.83  ? 243 ARG A HH22 3  
ATOM   7670  N  N    . SER A 1 149 ? 0.782   15.446  10.778  1.00 3.18  ? 244 SER A N    3  
ATOM   7671  C  CA   . SER A 1 149 ? 1.962   15.442  11.677  1.00 3.68  ? 244 SER A CA   3  
ATOM   7672  C  C    . SER A 1 149 ? 2.773   14.128  11.621  1.00 3.04  ? 244 SER A C    3  
ATOM   7673  O  O    . SER A 1 149 ? 3.856   14.058  12.203  1.00 3.51  ? 244 SER A O    3  
ATOM   7674  C  CB   . SER A 1 149 ? 1.649   15.831  13.139  1.00 4.85  ? 244 SER A CB   3  
ATOM   7675  O  OG   . SER A 1 149 ? 0.953   17.071  13.222  1.00 5.35  ? 244 SER A OG   3  
ATOM   7676  H  H    . SER A 1 149 ? 0.950   15.722  9.821   1.00 3.20  ? 244 SER A H    3  
ATOM   7677  H  HA   . SER A 1 149 ? 2.650   16.206  11.313  1.00 4.11  ? 244 SER A HA   3  
ATOM   7678  H  HB2  . SER A 1 149 ? 1.064   15.045  13.618  1.00 5.31  ? 244 SER A HB2  3  
ATOM   7679  H  HB3  . SER A 1 149 ? 2.587   15.922  13.690  1.00 5.46  ? 244 SER A HB3  3  
ATOM   7680  H  HG   . SER A 1 149 ? 0.520   17.100  14.109  1.00 6.34  ? 244 SER A HG   3  
ATOM   7681  N  N    . ARG A 1 150 ? 2.318   13.100  10.885  1.00 2.98  ? 245 ARG A N    3  
ATOM   7682  C  CA   . ARG A 1 150 ? 3.190   12.008  10.437  1.00 2.74  ? 245 ARG A CA   3  
ATOM   7683  C  C    . ARG A 1 150 ? 4.159   12.546  9.362   1.00 2.50  ? 245 ARG A C    3  
ATOM   7684  O  O    . ARG A 1 150 ? 3.815   13.441  8.600   1.00 2.76  ? 245 ARG A O    3  
ATOM   7685  C  CB   . ARG A 1 150 ? 2.341   10.817  9.940   1.00 2.78  ? 245 ARG A CB   3  
ATOM   7686  C  CG   . ARG A 1 150 ? 3.135   9.495   9.907   1.00 3.41  ? 245 ARG A CG   3  
ATOM   7687  C  CD   . ARG A 1 150 ? 2.870   8.522   11.073  1.00 4.70  ? 245 ARG A CD   3  
ATOM   7688  N  NE   . ARG A 1 150 ? 2.173   7.300   10.618  1.00 6.01  ? 245 ARG A NE   3  
ATOM   7689  C  CZ   . ARG A 1 150 ? 1.730   6.301   11.379  1.00 7.26  ? 245 ARG A CZ   3  
ATOM   7690  N  NH1  . ARG A 1 150 ? 1.894   6.249   12.678  1.00 7.74  ? 245 ARG A NH1  3  
ATOM   7691  N  NH2  . ARG A 1 150 ? 1.110   5.285   10.828  1.00 8.44  ? 245 ARG A NH2  3  
ATOM   7692  H  H    . ARG A 1 150 ? 1.422   13.185  10.421  1.00 3.70  ? 245 ARG A H    3  
ATOM   7693  H  HA   . ARG A 1 150 ? 3.767   11.676  11.297  1.00 3.22  ? 245 ARG A HA   3  
ATOM   7694  H  HB2  . ARG A 1 150 ? 1.467   10.693  10.583  1.00 3.40  ? 245 ARG A HB2  3  
ATOM   7695  H  HB3  . ARG A 1 150 ? 1.981   11.045  8.935   1.00 3.08  ? 245 ARG A HB3  3  
ATOM   7696  H  HG2  . ARG A 1 150 ? 2.934   8.993   8.961   1.00 4.13  ? 245 ARG A HG2  3  
ATOM   7697  H  HG3  . ARG A 1 150 ? 4.193   9.734   9.921   1.00 3.37  ? 245 ARG A HG3  3  
ATOM   7698  H  HD2  . ARG A 1 150 ? 3.830   8.234   11.504  1.00 5.05  ? 245 ARG A HD2  3  
ATOM   7699  H  HD3  . ARG A 1 150 ? 2.296   9.019   11.854  1.00 4.84  ? 245 ARG A HD3  3  
ATOM   7700  H  HE   . ARG A 1 150 ? 2.025   7.200   9.625   1.00 6.27  ? 245 ARG A HE   3  
ATOM   7701  H  HH11 . ARG A 1 150 ? 2.541   6.846   13.171  1.00 7.32  ? 245 ARG A HH11 3  
ATOM   7702  H  HH12 . ARG A 1 150 ? 1.475   5.453   13.165  1.00 8.87  ? 245 ARG A HH12 3  
ATOM   7703  H  HH21 . ARG A 1 150 ? 0.956   5.229   9.840   1.00 8.57  ? 245 ARG A HH21 3  
ATOM   7704  H  HH22 . ARG A 1 150 ? 0.803   4.496   11.407  1.00 9.43  ? 245 ARG A HH22 3  
ATOM   7705  N  N    . SER A 1 151 ? 5.370   12.003  9.307   1.00 2.27  ? 246 SER A N    3  
ATOM   7706  C  CA   . SER A 1 151 ? 6.519   12.424  8.486   1.00 2.00  ? 246 SER A CA   3  
ATOM   7707  C  C    . SER A 1 151 ? 7.625   11.365  8.700   1.00 1.59  ? 246 SER A C    3  
ATOM   7708  O  O    . SER A 1 151 ? 7.481   10.554  9.617   1.00 1.56  ? 246 SER A O    3  
ATOM   7709  C  CB   . SER A 1 151 ? 6.952   13.842  8.896   1.00 2.32  ? 246 SER A CB   3  
ATOM   7710  O  OG   . SER A 1 151 ? 8.235   14.165  8.402   1.00 2.41  ? 246 SER A OG   3  
ATOM   7711  H  H    . SER A 1 151 ? 5.595   11.264  9.955   1.00 2.41  ? 246 SER A H    3  
ATOM   7712  H  HA   . SER A 1 151 ? 6.247   12.445  7.427   1.00 2.05  ? 246 SER A HA   3  
ATOM   7713  H  HB2  . SER A 1 151 ? 6.229   14.567  8.519   1.00 2.77  ? 246 SER A HB2  3  
ATOM   7714  H  HB3  . SER A 1 151 ? 6.968   13.909  9.986   1.00 2.55  ? 246 SER A HB3  3  
ATOM   7715  H  HG   . SER A 1 151 ? 8.788   14.403  9.197   1.00 2.86  ? 246 SER A HG   3  
ATOM   7716  N  N    . ALA A 1 152 ? 8.703   11.309  7.904   1.00 1.43  ? 247 ALA A N    3  
ATOM   7717  C  CA   . ALA A 1 152 ? 9.658   10.183  7.897   1.00 1.21  ? 247 ALA A CA   3  
ATOM   7718  C  C    . ALA A 1 152 ? 10.179  9.799   9.300   1.00 1.18  ? 247 ALA A C    3  
ATOM   7719  O  O    . ALA A 1 152 ? 10.095  8.637   9.703   1.00 1.13  ? 247 ALA A O    3  
ATOM   7720  C  CB   . ALA A 1 152 ? 10.794  10.502  6.911   1.00 1.31  ? 247 ALA A CB   3  
ATOM   7721  H  H    . ALA A 1 152 ? 8.861   12.073  7.257   1.00 1.57  ? 247 ALA A H    3  
ATOM   7722  H  HA   . ALA A 1 152 ? 9.143   9.301   7.521   1.00 1.13  ? 247 ALA A HA   3  
ATOM   7723  H  HB1  . ALA A 1 152 ? 11.510  9.681   6.889   1.00 1.70  ? 247 ALA A HB1  3  
ATOM   7724  H  HB2  . ALA A 1 152 ? 10.396  10.626  5.901   1.00 1.79  ? 247 ALA A HB2  3  
ATOM   7725  H  HB3  . ALA A 1 152 ? 11.316  11.412  7.207   1.00 2.11  ? 247 ALA A HB3  3  
ATOM   7726  N  N    . GLU A 1 153 ? 10.620  10.778  10.089  1.00 1.28  ? 248 GLU A N    3  
ATOM   7727  C  CA   . GLU A 1 153 ? 11.033  10.588  11.482  1.00 1.37  ? 248 GLU A CA   3  
ATOM   7728  C  C    . GLU A 1 153 ? 9.894   10.128  12.414  1.00 1.35  ? 248 GLU A C    3  
ATOM   7729  O  O    . GLU A 1 153 ? 10.113  9.284   13.281  1.00 1.39  ? 248 GLU A O    3  
ATOM   7730  C  CB   . GLU A 1 153 ? 11.742  11.855  12.011  1.00 1.58  ? 248 GLU A CB   3  
ATOM   7731  C  CG   . GLU A 1 153 ? 10.947  13.181  12.009  1.00 2.91  ? 248 GLU A CG   3  
ATOM   7732  C  CD   . GLU A 1 153 ? 10.648  13.763  10.622  1.00 3.98  ? 248 GLU A CD   3  
ATOM   7733  O  OE1  . GLU A 1 153 ? 11.357  13.423  9.644   1.00 4.38  ? 248 GLU A OE1  3  
ATOM   7734  O  OE2  . GLU A 1 153 ? 9.651   14.503  10.485  1.00 5.33  ? 248 GLU A OE2  3  
ATOM   7735  H  H    . GLU A 1 153 ? 10.739  11.702  9.677   1.00 1.31  ? 248 GLU A H    3  
ATOM   7736  H  HA   . GLU A 1 153 ? 11.765  9.784   11.490  1.00 1.41  ? 248 GLU A HA   3  
ATOM   7737  H  HB2  . GLU A 1 153 ? 12.042  11.655  13.041  1.00 2.84  ? 248 GLU A HB2  3  
ATOM   7738  H  HB3  . GLU A 1 153 ? 12.661  11.999  11.444  1.00 2.02  ? 248 GLU A HB3  3  
ATOM   7739  H  HG2  . GLU A 1 153 ? 10.010  13.037  12.548  1.00 3.69  ? 248 GLU A HG2  3  
ATOM   7740  H  HG3  . GLU A 1 153 ? 11.528  13.922  12.559  1.00 3.75  ? 248 GLU A HG3  3  
ATOM   7741  N  N    . GLN A 1 154 ? 8.667   10.619  12.214  1.00 1.38  ? 249 GLN A N    3  
ATOM   7742  C  CA   . GLN A 1 154 ? 7.489   10.198  12.978  1.00 1.44  ? 249 GLN A CA   3  
ATOM   7743  C  C    . GLN A 1 154 ? 7.042   8.773   12.592  1.00 1.35  ? 249 GLN A C    3  
ATOM   7744  O  O    . GLN A 1 154 ? 6.501   8.047   13.421  1.00 1.45  ? 249 GLN A O    3  
ATOM   7745  C  CB   . GLN A 1 154 ? 6.355   11.215  12.737  1.00 1.68  ? 249 GLN A CB   3  
ATOM   7746  C  CG   . GLN A 1 154 ? 5.403   11.385  13.938  1.00 2.75  ? 249 GLN A CG   3  
ATOM   7747  C  CD   . GLN A 1 154 ? 5.802   12.551  14.849  1.00 2.81  ? 249 GLN A CD   3  
ATOM   7748  O  OE1  . GLN A 1 154 ? 6.354   12.380  15.924  1.00 3.59  ? 249 GLN A OE1  3  
ATOM   7749  N  NE2  . GLN A 1 154 ? 5.536   13.780  14.466  1.00 3.58  ? 249 GLN A NE2  3  
ATOM   7750  H  H    . GLN A 1 154 ? 8.518   11.218  11.415  1.00 1.43  ? 249 GLN A H    3  
ATOM   7751  H  HA   . GLN A 1 154 ? 7.751   10.184  14.038  1.00 1.51  ? 249 GLN A HA   3  
ATOM   7752  H  HB2  . GLN A 1 154 ? 6.771   12.191  12.481  1.00 1.73  ? 249 GLN A HB2  3  
ATOM   7753  H  HB3  . GLN A 1 154 ? 5.775   10.875  11.880  1.00 1.97  ? 249 GLN A HB3  3  
ATOM   7754  H  HG2  . GLN A 1 154 ? 4.401   11.590  13.561  1.00 3.72  ? 249 GLN A HG2  3  
ATOM   7755  H  HG3  . GLN A 1 154 ? 5.358   10.464  14.517  1.00 3.69  ? 249 GLN A HG3  3  
ATOM   7756  H  HE21 . GLN A 1 154 ? 5.032   13.952  13.598  1.00 4.39  ? 249 GLN A HE21 3  
ATOM   7757  H  HE22 . GLN A 1 154 ? 5.815   14.537  15.064  1.00 4.10  ? 249 GLN A HE22 3  
ATOM   7758  N  N    . ILE A 1 155 ? 7.260   8.355   11.338  1.00 1.25  ? 250 ILE A N    3  
ATOM   7759  C  CA   . ILE A 1 155 ? 7.034   6.978   10.859  1.00 1.19  ? 250 ILE A CA   3  
ATOM   7760  C  C    . ILE A 1 155 ? 8.036   6.038   11.521  1.00 1.07  ? 250 ILE A C    3  
ATOM   7761  O  O    . ILE A 1 155 ? 7.627   5.010   12.055  1.00 1.13  ? 250 ILE A O    3  
ATOM   7762  C  CB   . ILE A 1 155 ? 7.110   6.908   9.310   1.00 1.18  ? 250 ILE A CB   3  
ATOM   7763  C  CG1  . ILE A 1 155 ? 5.974   7.739   8.675   1.00 1.50  ? 250 ILE A CG1  3  
ATOM   7764  C  CG2  . ILE A 1 155 ? 7.035   5.455   8.801   1.00 1.24  ? 250 ILE A CG2  3  
ATOM   7765  C  CD1  . ILE A 1 155 ? 6.181   8.084   7.197   1.00 1.31  ? 250 ILE A CD1  3  
ATOM   7766  H  H    . ILE A 1 155 ? 7.677   9.023   10.691  1.00 1.24  ? 250 ILE A H    3  
ATOM   7767  H  HA   . ILE A 1 155 ? 6.049   6.635   11.176  1.00 1.32  ? 250 ILE A HA   3  
ATOM   7768  H  HB   . ILE A 1 155 ? 8.064   7.324   8.987   1.00 1.09  ? 250 ILE A HB   3  
ATOM   7769  H  HG12 . ILE A 1 155 ? 5.024   7.219   8.799   1.00 2.43  ? 250 ILE A HG12 3  
ATOM   7770  H  HG13 . ILE A 1 155 ? 5.900   8.684   9.196   1.00 2.21  ? 250 ILE A HG13 3  
ATOM   7771  H  HG21 . ILE A 1 155 ? 6.116   4.981   9.146   1.00 1.67  ? 250 ILE A HG21 3  
ATOM   7772  H  HG22 . ILE A 1 155 ? 7.064   5.430   7.712   1.00 1.75  ? 250 ILE A HG22 3  
ATOM   7773  H  HG23 . ILE A 1 155 ? 7.889   4.880   9.161   1.00 2.20  ? 250 ILE A HG23 3  
ATOM   7774  H  HD11 . ILE A 1 155 ? 5.416   8.799   6.891   1.00 1.62  ? 250 ILE A HD11 3  
ATOM   7775  H  HD12 . ILE A 1 155 ? 7.154   8.551   7.057   1.00 2.18  ? 250 ILE A HD12 3  
ATOM   7776  H  HD13 . ILE A 1 155 ? 6.114   7.192   6.578   1.00 2.24  ? 250 ILE A HD13 3  
ATOM   7777  N  N    . SER A 1 156 ? 9.318   6.404   11.549  1.00 1.00  ? 251 SER A N    3  
ATOM   7778  C  CA   . SER A 1 156 ? 10.354  5.629   12.240  1.00 1.06  ? 251 SER A CA   3  
ATOM   7779  C  C    . SER A 1 156 ? 9.971   5.348   13.700  1.00 1.13  ? 251 SER A C    3  
ATOM   7780  O  O    . SER A 1 156 ? 9.904   4.180   14.082  1.00 1.17  ? 251 SER A O    3  
ATOM   7781  C  CB   . SER A 1 156 ? 11.705  6.357   12.151  1.00 1.28  ? 251 SER A CB   3  
ATOM   7782  O  OG   . SER A 1 156 ? 12.749  5.638   12.795  1.00 2.47  ? 251 SER A OG   3  
ATOM   7783  H  H    . SER A 1 156 ? 9.577   7.277   11.097  1.00 1.02  ? 251 SER A H    3  
ATOM   7784  H  HA   . SER A 1 156 ? 10.450  4.659   11.753  1.00 1.09  ? 251 SER A HA   3  
ATOM   7785  H  HB2  . SER A 1 156 ? 11.964  6.510   11.103  1.00 1.33  ? 251 SER A HB2  3  
ATOM   7786  H  HB3  . SER A 1 156 ? 11.610  7.332   12.623  1.00 2.12  ? 251 SER A HB3  3  
ATOM   7787  H  HG   . SER A 1 156 ? 13.212  5.108   12.135  1.00 2.88  ? 251 SER A HG   3  
ATOM   7788  N  N    . ASP A 1 157 ? 9.656   6.376   14.499  1.00 1.25  ? 252 ASP A N    3  
ATOM   7789  C  CA   . ASP A 1 157 ? 9.259   6.175   15.900  1.00 1.42  ? 252 ASP A CA   3  
ATOM   7790  C  C    . ASP A 1 157 ? 7.902   5.453   16.034  1.00 1.35  ? 252 ASP A C    3  
ATOM   7791  O  O    . ASP A 1 157 ? 7.693   4.720   16.998  1.00 1.41  ? 252 ASP A O    3  
ATOM   7792  C  CB   . ASP A 1 157 ? 9.284   7.513   16.659  1.00 1.72  ? 252 ASP A CB   3  
ATOM   7793  C  CG   . ASP A 1 157 ? 9.267   7.320   18.183  1.00 2.38  ? 252 ASP A CG   3  
ATOM   7794  O  OD1  . ASP A 1 157 ? 10.139  6.585   18.701  1.00 2.96  ? 252 ASP A OD1  3  
ATOM   7795  O  OD2  . ASP A 1 157 ? 8.393   7.914   18.856  1.00 3.11  ? 252 ASP A OD2  3  
ATOM   7796  H  H    . ASP A 1 157 ? 9.718   7.327   14.144  1.00 1.29  ? 252 ASP A H    3  
ATOM   7797  H  HA   . ASP A 1 157 ? 10.009  5.535   16.363  1.00 1.50  ? 252 ASP A HA   3  
ATOM   7798  H  HB2  . ASP A 1 157 ? 10.198  8.051   16.398  1.00 1.96  ? 252 ASP A HB2  3  
ATOM   7799  H  HB3  . ASP A 1 157 ? 8.432   8.122   16.345  1.00 1.76  ? 252 ASP A HB3  3  
ATOM   7800  N  N    . SER A 1 158 ? 6.999   5.565   15.049  1.00 1.31  ? 253 SER A N    3  
ATOM   7801  C  CA   . SER A 1 158 ? 5.773   4.753   15.023  1.00 1.41  ? 253 SER A CA   3  
ATOM   7802  C  C    . SER A 1 158 ? 6.096   3.265   14.818  1.00 1.31  ? 253 SER A C    3  
ATOM   7803  O  O    . SER A 1 158 ? 5.656   2.425   15.603  1.00 1.39  ? 253 SER A O    3  
ATOM   7804  C  CB   . SER A 1 158 ? 4.800   5.232   13.933  1.00 1.63  ? 253 SER A CB   3  
ATOM   7805  O  OG   . SER A 1 158 ? 4.428   6.595   14.084  1.00 1.69  ? 253 SER A OG   3  
ATOM   7806  H  H    . SER A 1 158 ? 7.219   6.153   14.250  1.00 1.31  ? 253 SER A H    3  
ATOM   7807  H  HA   . SER A 1 158 ? 5.266   4.838   15.985  1.00 1.54  ? 253 SER A HA   3  
ATOM   7808  H  HB2  . SER A 1 158 ? 5.252   5.093   12.951  1.00 2.47  ? 253 SER A HB2  3  
ATOM   7809  H  HB3  . SER A 1 158 ? 3.900   4.615   13.978  1.00 2.53  ? 253 SER A HB3  3  
ATOM   7810  H  HG   . SER A 1 158 ? 5.240   7.143   13.986  1.00 2.56  ? 253 SER A HG   3  
ATOM   7811  N  N    . VAL A 1 159 ? 6.907   2.932   13.806  1.00 1.21  ? 254 VAL A N    3  
ATOM   7812  C  CA   . VAL A 1 159 ? 7.306   1.549   13.484  1.00 1.24  ? 254 VAL A CA   3  
ATOM   7813  C  C    . VAL A 1 159 ? 8.084   0.927   14.657  1.00 1.25  ? 254 VAL A C    3  
ATOM   7814  O  O    . VAL A 1 159 ? 7.800   -0.205  15.046  1.00 1.36  ? 254 VAL A O    3  
ATOM   7815  C  CB   . VAL A 1 159 ? 8.133   1.511   12.175  1.00 1.27  ? 254 VAL A CB   3  
ATOM   7816  C  CG1  . VAL A 1 159 ? 8.807   0.149   11.926  1.00 1.42  ? 254 VAL A CG1  3  
ATOM   7817  C  CG2  . VAL A 1 159 ? 7.234   1.857   10.972  1.00 1.37  ? 254 VAL A CG2  3  
ATOM   7818  H  H    . VAL A 1 159 ? 7.295   3.693   13.238  1.00 1.19  ? 254 VAL A H    3  
ATOM   7819  H  HA   . VAL A 1 159 ? 6.393   0.963   13.326  1.00 1.34  ? 254 VAL A HA   3  
ATOM   7820  H  HB   . VAL A 1 159 ? 8.922   2.263   12.236  1.00 1.30  ? 254 VAL A HB   3  
ATOM   7821  H  HG11 . VAL A 1 159 ? 8.073   -0.654  11.979  1.00 1.96  ? 254 VAL A HG11 3  
ATOM   7822  H  HG12 . VAL A 1 159 ? 9.278   0.136   10.942  1.00 1.94  ? 254 VAL A HG12 3  
ATOM   7823  H  HG13 . VAL A 1 159 ? 9.585   -0.030  12.670  1.00 2.26  ? 254 VAL A HG13 3  
ATOM   7824  H  HG21 . VAL A 1 159 ? 6.767   2.829   11.102  1.00 1.68  ? 254 VAL A HG21 3  
ATOM   7825  H  HG22 . VAL A 1 159 ? 7.824   1.883   10.056  1.00 2.11  ? 254 VAL A HG22 3  
ATOM   7826  H  HG23 . VAL A 1 159 ? 6.444   1.117   10.862  1.00 1.95  ? 254 VAL A HG23 3  
ATOM   7827  N  N    . ARG A 1 160 ? 9.016   1.680   15.260  1.00 1.19  ? 255 ARG A N    3  
ATOM   7828  C  CA   . ARG A 1 160 ? 9.780   1.284   16.450  1.00 1.28  ? 255 ARG A CA   3  
ATOM   7829  C  C    . ARG A 1 160 ? 8.867   0.963   17.641  1.00 1.35  ? 255 ARG A C    3  
ATOM   7830  O  O    . ARG A 1 160 ? 9.005   -0.115  18.221  1.00 1.46  ? 255 ARG A O    3  
ATOM   7831  C  CB   . ARG A 1 160 ? 10.791  2.396   16.794  1.00 1.32  ? 255 ARG A CB   3  
ATOM   7832  C  CG   . ARG A 1 160 ? 12.062  2.292   15.928  1.00 1.83  ? 255 ARG A CG   3  
ATOM   7833  C  CD   . ARG A 1 160 ? 12.751  3.632   15.632  1.00 2.49  ? 255 ARG A CD   3  
ATOM   7834  N  NE   . ARG A 1 160 ? 12.992  4.457   16.824  1.00 3.31  ? 255 ARG A NE   3  
ATOM   7835  C  CZ   . ARG A 1 160 ? 13.176  5.774   16.827  1.00 4.51  ? 255 ARG A CZ   3  
ATOM   7836  N  NH1  . ARG A 1 160 ? 13.187  6.506   15.732  1.00 5.09  ? 255 ARG A NH1  3  
ATOM   7837  N  NH2  . ARG A 1 160 ? 13.366  6.408   17.958  1.00 5.83  ? 255 ARG A NH2  3  
ATOM   7838  H  H    . ARG A 1 160 ? 9.207   2.597   14.868  1.00 1.14  ? 255 ARG A H    3  
ATOM   7839  H  HA   . ARG A 1 160 ? 10.335  0.373   16.220  1.00 1.39  ? 255 ARG A HA   3  
ATOM   7840  H  HB2  . ARG A 1 160 ? 10.315  3.366   16.659  1.00 1.68  ? 255 ARG A HB2  3  
ATOM   7841  H  HB3  . ARG A 1 160 ? 11.087  2.313   17.841  1.00 1.96  ? 255 ARG A HB3  3  
ATOM   7842  H  HG2  . ARG A 1 160 ? 12.770  1.629   16.426  1.00 2.52  ? 255 ARG A HG2  3  
ATOM   7843  H  HG3  . ARG A 1 160 ? 11.812  1.844   14.964  1.00 2.29  ? 255 ARG A HG3  3  
ATOM   7844  H  HD2  . ARG A 1 160 ? 13.703  3.431   15.139  1.00 2.66  ? 255 ARG A HD2  3  
ATOM   7845  H  HD3  . ARG A 1 160 ? 12.129  4.190   14.938  1.00 3.57  ? 255 ARG A HD3  3  
ATOM   7846  H  HE   . ARG A 1 160 ? 13.091  3.978   17.718  1.00 3.74  ? 255 ARG A HE   3  
ATOM   7847  H  HH11 . ARG A 1 160 ? 12.999  6.098   14.827  1.00 4.88  ? 255 ARG A HH11 3  
ATOM   7848  H  HH12 . ARG A 1 160 ? 13.348  7.501   15.831  1.00 6.18  ? 255 ARG A HH12 3  
ATOM   7849  H  HH21 . ARG A 1 160 ? 13.186  5.931   18.835  1.00 6.25  ? 255 ARG A HH21 3  
ATOM   7850  H  HH22 . ARG A 1 160 ? 13.507  7.409   17.934  1.00 6.84  ? 255 ARG A HH22 3  
ATOM   7851  N  N    . ARG A 1 161 ? 7.897   1.829   17.968  1.00 1.36  ? 256 ARG A N    3  
ATOM   7852  C  CA   . ARG A 1 161 ? 6.906   1.572   19.030  1.00 1.53  ? 256 ARG A CA   3  
ATOM   7853  C  C    . ARG A 1 161 ? 6.104   0.296   18.756  1.00 1.63  ? 256 ARG A C    3  
ATOM   7854  O  O    . ARG A 1 161 ? 6.095   -0.614  19.583  1.00 1.81  ? 256 ARG A O    3  
ATOM   7855  C  CB   . ARG A 1 161 ? 5.954   2.765   19.172  1.00 1.62  ? 256 ARG A CB   3  
ATOM   7856  C  CG   . ARG A 1 161 ? 6.616   3.948   19.887  1.00 1.75  ? 256 ARG A CG   3  
ATOM   7857  C  CD   . ARG A 1 161 ? 5.751   5.195   19.699  1.00 2.47  ? 256 ARG A CD   3  
ATOM   7858  N  NE   . ARG A 1 161 ? 6.456   6.402   20.140  1.00 3.14  ? 256 ARG A NE   3  
ATOM   7859  C  CZ   . ARG A 1 161 ? 6.284   7.114   21.242  1.00 3.69  ? 256 ARG A CZ   3  
ATOM   7860  N  NH1  . ARG A 1 161 ? 5.437   6.769   22.190  1.00 3.83  ? 256 ARG A NH1  3  
ATOM   7861  N  NH2  . ARG A 1 161 ? 7.000   8.206   21.361  1.00 4.58  ? 256 ARG A NH2  3  
ATOM   7862  H  H    . ARG A 1 161 ? 7.828   2.696   17.446  1.00 1.31  ? 256 ARG A H    3  
ATOM   7863  H  HA   . ARG A 1 161 ? 7.430   1.437   19.976  1.00 1.60  ? 256 ARG A HA   3  
ATOM   7864  H  HB2  . ARG A 1 161 ? 5.611   3.067   18.182  1.00 1.74  ? 256 ARG A HB2  3  
ATOM   7865  H  HB3  . ARG A 1 161 ? 5.081   2.462   19.753  1.00 2.02  ? 256 ARG A HB3  3  
ATOM   7866  H  HG2  . ARG A 1 161 ? 6.722   3.728   20.949  1.00 2.29  ? 256 ARG A HG2  3  
ATOM   7867  H  HG3  . ARG A 1 161 ? 7.607   4.131   19.471  1.00 2.29  ? 256 ARG A HG3  3  
ATOM   7868  H  HD2  . ARG A 1 161 ? 5.535   5.306   18.635  1.00 3.08  ? 256 ARG A HD2  3  
ATOM   7869  H  HD3  . ARG A 1 161 ? 4.807   5.075   20.230  1.00 3.15  ? 256 ARG A HD3  3  
ATOM   7870  H  HE   . ARG A 1 161 ? 7.166   6.766   19.504  1.00 3.59  ? 256 ARG A HE   3  
ATOM   7871  H  HH11 . ARG A 1 161 ? 4.922   5.913   22.116  1.00 3.60  ? 256 ARG A HH11 3  
ATOM   7872  H  HH12 . ARG A 1 161 ? 5.292   7.344   23.021  1.00 4.47  ? 256 ARG A HH12 3  
ATOM   7873  H  HH21 . ARG A 1 161 ? 7.639   8.428   20.595  1.00 4.91  ? 256 ARG A HH21 3  
ATOM   7874  H  HH22 . ARG A 1 161 ? 6.912   8.800   22.166  1.00 5.12  ? 256 ARG A HH22 3  
ATOM   7875  N  N    . HIS A 1 162 ? 5.477   0.192   17.584  1.00 1.55  ? 257 HIS A N    3  
ATOM   7876  C  CA   . HIS A 1 162 ? 4.648   -0.964  17.219  1.00 1.68  ? 257 HIS A CA   3  
ATOM   7877  C  C    . HIS A 1 162 ? 5.432   -2.290  17.202  1.00 1.72  ? 257 HIS A C    3  
ATOM   7878  O  O    . HIS A 1 162 ? 4.896   -3.331  17.576  1.00 1.91  ? 257 HIS A O    3  
ATOM   7879  C  CB   . HIS A 1 162 ? 4.008   -0.683  15.855  1.00 1.68  ? 257 HIS A CB   3  
ATOM   7880  C  CG   . HIS A 1 162 ? 2.985   0.416   15.875  1.00 1.94  ? 257 HIS A CG   3  
ATOM   7881  N  ND1  . HIS A 1 162 ? 2.044   0.633   16.882  1.00 2.51  ? 257 HIS A ND1  3  
ATOM   7882  C  CD2  . HIS A 1 162 ? 2.805   1.337   14.887  1.00 2.27  ? 257 HIS A CD2  3  
ATOM   7883  C  CE1  . HIS A 1 162 ? 1.326   1.693   16.479  1.00 2.88  ? 257 HIS A CE1  3  
ATOM   7884  N  NE2  . HIS A 1 162 ? 1.767   2.140   15.290  1.00 2.78  ? 257 HIS A NE2  3  
ATOM   7885  H  H    . HIS A 1 162 ? 5.515   0.975   16.936  1.00 1.46  ? 257 HIS A H    3  
ATOM   7886  H  HA   . HIS A 1 162 ? 3.851   -1.076  17.958  1.00 1.83  ? 257 HIS A HA   3  
ATOM   7887  H  HB2  . HIS A 1 162 ? 4.792   -0.409  15.149  1.00 1.77  ? 257 HIS A HB2  3  
ATOM   7888  H  HB3  . HIS A 1 162 ? 3.517   -1.589  15.498  1.00 1.84  ? 257 HIS A HB3  3  
ATOM   7889  H  HD2  . HIS A 1 162 ? 3.375   1.419   13.974  1.00 2.50  ? 257 HIS A HD2  3  
ATOM   7890  H  HE1  . HIS A 1 162 ? 0.493   2.116   17.022  1.00 3.45  ? 257 HIS A HE1  3  
ATOM   7891  H  HE2  . HIS A 1 162 ? 1.364   2.908   14.755  1.00 3.26  ? 257 HIS A HE2  3  
ATOM   7892  N  N    . MET A 1 163 ? 6.712   -2.248  16.817  1.00 1.61  ? 258 MET A N    3  
ATOM   7893  C  CA   . MET A 1 163 ? 7.631   -3.389  16.877  1.00 1.72  ? 258 MET A CA   3  
ATOM   7894  C  C    . MET A 1 163 ? 7.981   -3.771  18.324  1.00 1.85  ? 258 MET A C    3  
ATOM   7895  O  O    . MET A 1 163 ? 7.852   -4.939  18.689  1.00 1.98  ? 258 MET A O    3  
ATOM   7896  C  CB   . MET A 1 163 ? 8.880   -3.061  16.042  1.00 1.68  ? 258 MET A CB   3  
ATOM   7897  C  CG   . MET A 1 163 ? 9.893   -4.204  16.104  1.00 1.92  ? 258 MET A CG   3  
ATOM   7898  S  SD   . MET A 1 163 ? 11.232  -4.096  14.896  1.00 2.03  ? 258 MET A SD   3  
ATOM   7899  C  CE   . MET A 1 163 ? 12.349  -5.349  15.578  1.00 3.58  ? 258 MET A CE   3  
ATOM   7900  H  H    . MET A 1 163 ? 7.067   -1.365  16.469  1.00 1.49  ? 258 MET A H    3  
ATOM   7901  H  HA   . MET A 1 163 ? 7.142   -4.257  16.432  1.00 1.83  ? 258 MET A HA   3  
ATOM   7902  H  HB2  . MET A 1 163 ? 8.581   -2.910  15.004  1.00 1.75  ? 258 MET A HB2  3  
ATOM   7903  H  HB3  . MET A 1 163 ? 9.354   -2.147  16.404  1.00 1.82  ? 258 MET A HB3  3  
ATOM   7904  H  HG2  . MET A 1 163 ? 10.333  -4.226  17.100  1.00 2.21  ? 258 MET A HG2  3  
ATOM   7905  H  HG3  . MET A 1 163 ? 9.357   -5.136  15.943  1.00 2.13  ? 258 MET A HG3  3  
ATOM   7906  H  HE1  . MET A 1 163 ? 11.834  -5.977  16.307  1.00 4.10  ? 258 MET A HE1  3  
ATOM   7907  H  HE2  . MET A 1 163 ? 12.729  -5.977  14.772  1.00 4.32  ? 258 MET A HE2  3  
ATOM   7908  H  HE3  . MET A 1 163 ? 13.193  -4.857  16.063  1.00 4.29  ? 258 MET A HE3  3  
ATOM   7909  N  N    . ALA A 1 164 ? 8.401   -2.812  19.155  1.00 1.91  ? 259 ALA A N    3  
ATOM   7910  C  CA   . ALA A 1 164 ? 8.793   -3.057  20.547  1.00 2.14  ? 259 ALA A CA   3  
ATOM   7911  C  C    . ALA A 1 164 ? 7.625   -3.517  21.441  1.00 2.29  ? 259 ALA A C    3  
ATOM   7912  O  O    . ALA A 1 164 ? 7.848   -4.206  22.437  1.00 2.55  ? 259 ALA A O    3  
ATOM   7913  C  CB   . ALA A 1 164 ? 9.436   -1.773  21.087  1.00 2.23  ? 259 ALA A CB   3  
ATOM   7914  H  H    . ALA A 1 164 ? 8.490   -1.865  18.800  1.00 1.85  ? 259 ALA A H    3  
ATOM   7915  H  HA   . ALA A 1 164 ? 9.536   -3.857  20.568  1.00 2.21  ? 259 ALA A HA   3  
ATOM   7916  H  HB1  . ALA A 1 164 ? 9.773   -1.933  22.112  1.00 3.02  ? 259 ALA A HB1  3  
ATOM   7917  H  HB2  . ALA A 1 164 ? 10.292  -1.494  20.469  1.00 2.97  ? 259 ALA A HB2  3  
ATOM   7918  H  HB3  . ALA A 1 164 ? 8.709   -0.958  21.076  1.00 2.13  ? 259 ALA A HB3  3  
ATOM   7919  N  N    . ALA A 1 165 ? 6.392   -3.152  21.087  1.00 2.21  ? 260 ALA A N    3  
ATOM   7920  C  CA   . ALA A 1 165 ? 5.172   -3.510  21.815  1.00 2.43  ? 260 ALA A CA   3  
ATOM   7921  C  C    . ALA A 1 165 ? 4.536   -4.843  21.369  1.00 2.36  ? 260 ALA A C    3  
ATOM   7922  O  O    . ALA A 1 165 ? 3.520   -5.243  21.941  1.00 2.49  ? 260 ALA A O    3  
ATOM   7923  C  CB   . ALA A 1 165 ? 4.188   -2.343  21.649  1.00 2.54  ? 260 ALA A CB   3  
ATOM   7924  H  H    . ALA A 1 165 ? 6.300   -2.530  20.291  1.00 2.06  ? 260 ALA A H    3  
ATOM   7925  H  HA   . ALA A 1 165 ? 5.406   -3.614  22.876  1.00 2.67  ? 260 ALA A HA   3  
ATOM   7926  H  HB1  . ALA A 1 165 ? 4.644   -1.416  21.997  1.00 3.18  ? 260 ALA A HB1  3  
ATOM   7927  H  HB2  . ALA A 1 165 ? 3.910   -2.233  20.599  1.00 2.50  ? 260 ALA A HB2  3  
ATOM   7928  H  HB3  . ALA A 1 165 ? 3.287   -2.534  22.235  1.00 2.97  ? 260 ALA A HB3  3  
ATOM   7929  N  N    . PHE A 1 166 ? 5.066   -5.522  20.341  1.00 2.34  ? 261 PHE A N    3  
ATOM   7930  C  CA   . PHE A 1 166 ? 4.335   -6.610  19.692  1.00 2.24  ? 261 PHE A CA   3  
ATOM   7931  C  C    . PHE A 1 166 ? 4.260   -7.900  20.533  1.00 2.95  ? 261 PHE A C    3  
ATOM   7932  O  O    . PHE A 1 166 ? 5.183   -8.720  20.565  1.00 3.63  ? 261 PHE A O    3  
ATOM   7933  C  CB   . PHE A 1 166 ? 4.860   -6.867  18.273  1.00 2.20  ? 261 PHE A CB   3  
ATOM   7934  C  CG   . PHE A 1 166 ? 3.912   -7.743  17.472  1.00 2.11  ? 261 PHE A CG   3  
ATOM   7935  C  CD1  . PHE A 1 166 ? 2.687   -7.217  17.017  1.00 2.57  ? 261 PHE A CD1  3  
ATOM   7936  C  CD2  . PHE A 1 166 ? 4.212   -9.099  17.242  1.00 3.28  ? 261 PHE A CD2  3  
ATOM   7937  C  CE1  . PHE A 1 166 ? 1.764   -8.039  16.348  1.00 3.11  ? 261 PHE A CE1  3  
ATOM   7938  C  CE2  . PHE A 1 166 ? 3.292   -9.921  16.563  1.00 3.18  ? 261 PHE A CE2  3  
ATOM   7939  C  CZ   . PHE A 1 166 ? 2.065   -9.393  16.123  1.00 2.72  ? 261 PHE A CZ   3  
ATOM   7940  H  H    . PHE A 1 166 ? 5.909   -5.181  19.901  1.00 2.47  ? 261 PHE A H    3  
ATOM   7941  H  HA   . PHE A 1 166 ? 3.310   -6.256  19.569  1.00 2.29  ? 261 PHE A HA   3  
ATOM   7942  H  HB2  . PHE A 1 166 ? 4.967   -5.917  17.751  1.00 2.32  ? 261 PHE A HB2  3  
ATOM   7943  H  HB3  . PHE A 1 166 ? 5.849   -7.328  18.325  1.00 2.47  ? 261 PHE A HB3  3  
ATOM   7944  H  HD1  . PHE A 1 166 ? 2.445   -6.178  17.200  1.00 3.40  ? 261 PHE A HD1  3  
ATOM   7945  H  HD2  . PHE A 1 166 ? 5.141   -9.519  17.602  1.00 4.38  ? 261 PHE A HD2  3  
ATOM   7946  H  HE1  . PHE A 1 166 ? 0.814   -7.640  16.021  1.00 4.20  ? 261 PHE A HE1  3  
ATOM   7947  H  HE2  . PHE A 1 166 ? 3.523   -10.963 16.398  1.00 4.30  ? 261 PHE A HE2  3  
ATOM   7948  H  HZ   . PHE A 1 166 ? 1.346   -10.032 15.626  1.00 3.18  ? 261 PHE A HZ   3  
ATOM   7949  N  N    . ARG A 1 167 ? 3.093   -8.103  21.151  1.00 3.15  ? 262 ARG A N    3  
ATOM   7950  C  CA   . ARG A 1 167 ? 2.569   -9.420  21.533  1.00 4.00  ? 262 ARG A CA   3  
ATOM   7951  C  C    . ARG A 1 167 ? 1.615   -9.912  20.447  1.00 4.72  ? 262 ARG A C    3  
ATOM   7952  O  O    . ARG A 1 167 ? 1.929   -10.876 19.752  1.00 4.97  ? 262 ARG A O    3  
ATOM   7953  C  CB   . ARG A 1 167 ? 1.922   -9.350  22.928  1.00 4.52  ? 262 ARG A CB   3  
ATOM   7954  C  CG   . ARG A 1 167 ? 3.046   -9.511  23.956  1.00 4.96  ? 262 ARG A CG   3  
ATOM   7955  C  CD   . ARG A 1 167 ? 2.645   -9.255  25.412  1.00 5.67  ? 262 ARG A CD   3  
ATOM   7956  N  NE   . ARG A 1 167 ? 3.824   -9.443  26.275  1.00 6.17  ? 262 ARG A NE   3  
ATOM   7957  C  CZ   . ARG A 1 167 ? 3.861   -9.661  27.582  1.00 7.27  ? 262 ARG A CZ   3  
ATOM   7958  N  NH1  . ARG A 1 167 ? 2.790   -9.621  28.348  1.00 8.00  ? 262 ARG A NH1  3  
ATOM   7959  N  NH2  . ARG A 1 167 ? 5.017   -9.937  28.145  1.00 8.08  ? 262 ARG A NH2  3  
ATOM   7960  H  H    . ARG A 1 167 ? 2.467   -7.310  21.212  1.00 3.68  ? 262 ARG A H    3  
ATOM   7961  H  HA   . ARG A 1 167 ? 3.387   -10.140 21.572  1.00 4.43  ? 262 ARG A HA   3  
ATOM   7962  H  HB2  . ARG A 1 167 ? 1.409   -8.397  23.066  1.00 4.55  ? 262 ARG A HB2  3  
ATOM   7963  H  HB3  . ARG A 1 167 ? 1.209   -10.167 23.054  1.00 5.10  ? 262 ARG A HB3  3  
ATOM   7964  H  HG2  . ARG A 1 167 ? 3.418   -10.533 23.865  1.00 5.47  ? 262 ARG A HG2  3  
ATOM   7965  H  HG3  . ARG A 1 167 ? 3.852   -8.823  23.698  1.00 4.92  ? 262 ARG A HG3  3  
ATOM   7966  H  HD2  . ARG A 1 167 ? 2.278   -8.232  25.506  1.00 5.95  ? 262 ARG A HD2  3  
ATOM   7967  H  HD3  . ARG A 1 167 ? 1.854   -9.950  25.697  1.00 6.26  ? 262 ARG A HD3  3  
ATOM   7968  H  HE   . ARG A 1 167 ? 4.721   -9.480  25.794  1.00 6.07  ? 262 ARG A HE   3  
ATOM   7969  H  HH11 . ARG A 1 167 ? 1.885   -9.345  27.975  1.00 7.89  ? 262 ARG A HH11 3  
ATOM   7970  H  HH12 . ARG A 1 167 ? 2.879   -9.786  29.334  1.00 8.96  ? 262 ARG A HH12 3  
ATOM   7971  H  HH21 . ARG A 1 167 ? 5.865   -9.952  27.595  1.00 8.00  ? 262 ARG A HH21 3  
ATOM   7972  H  HH22 . ARG A 1 167 ? 5.078   -10.162 29.133  1.00 9.04  ? 262 ARG A HH22 3  
ATOM   7973  N  N    . SER A 1 168 ? 0.505   -9.204  20.250  1.00 5.82  ? 263 SER A N    3  
ATOM   7974  C  CA   . SER A 1 168 ? -0.526  -9.482  19.240  1.00 7.22  ? 263 SER A CA   3  
ATOM   7975  C  C    . SER A 1 168 ? -1.680  -8.466  19.346  1.00 9.16  ? 263 SER A C    3  
ATOM   7976  O  O    . SER A 1 168 ? -1.851  -7.836  20.390  1.00 9.70  ? 263 SER A O    3  
ATOM   7977  C  CB   . SER A 1 168 ? -1.042  -10.931 19.337  1.00 7.99  ? 263 SER A CB   3  
ATOM   7978  O  OG   . SER A 1 168 ? -1.376  -11.320 20.661  1.00 8.95  ? 263 SER A OG   3  
ATOM   7979  H  H    . SER A 1 168 ? 0.283   -8.470  20.907  1.00 6.12  ? 263 SER A H    3  
ATOM   7980  H  HA   . SER A 1 168 ? -0.077  -9.364  18.253  1.00 6.88  ? 263 SER A HA   3  
ATOM   7981  H  HB2  . SER A 1 168 ? -1.920  -11.031 18.713  1.00 8.51  ? 263 SER A HB2  3  
ATOM   7982  H  HB3  . SER A 1 168 ? -0.284  -11.610 18.946  1.00 7.89  ? 263 SER A HB3  3  
ATOM   7983  H  HG   . SER A 1 168 ? -1.608  -12.253 20.645  1.00 9.39  ? 263 SER A HG   3  
ATOM   7984  N  N    . VAL A 1 169 ? -2.463  -8.287  18.277  1.00 10.52 ? 264 VAL A N    3  
ATOM   7985  C  CA   . VAL A 1 169 ? -3.629  -7.389  18.213  1.00 12.65 ? 264 VAL A CA   3  
ATOM   7986  C  C    . VAL A 1 169 ? -4.900  -8.243  18.144  1.00 13.88 ? 264 VAL A C    3  
ATOM   7987  O  O    . VAL A 1 169 ? -5.175  -8.881  17.130  1.00 14.35 ? 264 VAL A O    3  
ATOM   7988  C  CB   . VAL A 1 169 ? -3.545  -6.415  17.011  1.00 13.64 ? 264 VAL A CB   3  
ATOM   7989  C  CG1  . VAL A 1 169 ? -4.696  -5.395  17.074  1.00 15.45 ? 264 VAL A CG1  3  
ATOM   7990  C  CG2  . VAL A 1 169 ? -2.213  -5.642  16.989  1.00 13.66 ? 264 VAL A CG2  3  
ATOM   7991  H  H    . VAL A 1 169 ? -2.234  -8.821  17.433  1.00 10.21 ? 264 VAL A H    3  
ATOM   7992  H  HA   . VAL A 1 169 ? -3.673  -6.787  19.124  1.00 13.01 ? 264 VAL A HA   3  
ATOM   7993  H  HB   . VAL A 1 169 ? -3.622  -6.975  16.078  1.00 13.45 ? 264 VAL A HB   3  
ATOM   7994  H  HG11 . VAL A 1 169 ? -5.657  -5.908  17.063  1.00 16.01 ? 264 VAL A HG11 3  
ATOM   7995  H  HG12 . VAL A 1 169 ? -4.623  -4.803  17.986  1.00 15.77 ? 264 VAL A HG12 3  
ATOM   7996  H  HG13 . VAL A 1 169 ? -4.648  -4.731  16.212  1.00 16.14 ? 264 VAL A HG13 3  
ATOM   7997  H  HG21 . VAL A 1 169 ? -2.065  -5.120  17.936  1.00 13.54 ? 264 VAL A HG21 3  
ATOM   7998  H  HG22 . VAL A 1 169 ? -1.380  -6.326  16.823  1.00 13.34 ? 264 VAL A HG22 3  
ATOM   7999  H  HG23 . VAL A 1 169 ? -2.218  -4.913  16.177  1.00 14.45 ? 264 VAL A HG23 3  
ATOM   8000  N  N    . LEU A 1 170 ? -5.653  -8.251  19.248  1.00 14.69 ? 265 LEU A N    3  
ATOM   8001  C  CA   . LEU A 1 170 ? -6.844  -9.048  19.532  1.00 16.13 ? 265 LEU A CA   3  
ATOM   8002  C  C    . LEU A 1 170 ? -7.646  -8.308  20.615  1.00 17.40 ? 265 LEU A C    3  
ATOM   8003  O  O    . LEU A 1 170 ? -7.143  -8.076  21.714  1.00 17.39 ? 265 LEU A O    3  
ATOM   8004  C  CB   . LEU A 1 170 ? -6.462  -10.457 20.019  1.00 15.54 ? 265 LEU A CB   3  
ATOM   8005  C  CG   . LEU A 1 170 ? -5.902  -11.413 18.946  1.00 15.10 ? 265 LEU A CG   3  
ATOM   8006  C  CD1  . LEU A 1 170 ? -5.610  -12.749 19.626  1.00 14.60 ? 265 LEU A CD1  3  
ATOM   8007  C  CD2  . LEU A 1 170 ? -6.875  -11.664 17.780  1.00 16.63 ? 265 LEU A CD2  3  
ATOM   8008  H  H    . LEU A 1 170 ? -5.378  -7.643  20.002  1.00 14.48 ? 265 LEU A H    3  
ATOM   8009  H  HA   . LEU A 1 170 ? -7.455  -9.161  18.640  1.00 17.02 ? 265 LEU A HA   3  
ATOM   8010  H  HB2  . LEU A 1 170 ? -5.731  -10.358 20.824  1.00 14.65 ? 265 LEU A HB2  3  
ATOM   8011  H  HB3  . LEU A 1 170 ? -7.357  -10.914 20.444  1.00 16.63 ? 265 LEU A HB3  3  
ATOM   8012  H  HG   . LEU A 1 170 ? -4.963  -11.024 18.556  1.00 14.33 ? 265 LEU A HG   3  
ATOM   8013  H  HD11 . LEU A 1 170 ? -5.182  -13.443 18.904  1.00 14.38 ? 265 LEU A HD11 3  
ATOM   8014  H  HD12 . LEU A 1 170 ? -4.904  -12.592 20.440  1.00 13.97 ? 265 LEU A HD12 3  
ATOM   8015  H  HD13 . LEU A 1 170 ? -6.540  -13.156 20.022  1.00 15.42 ? 265 LEU A HD13 3  
ATOM   8016  H  HD21 . LEU A 1 170 ? -7.832  -12.025 18.160  1.00 17.48 ? 265 LEU A HD21 3  
ATOM   8017  H  HD22 . LEU A 1 170 ? -7.039  -10.751 17.210  1.00 17.27 ? 265 LEU A HD22 3  
ATOM   8018  H  HD23 . LEU A 1 170 ? -6.455  -12.410 17.103  1.00 16.51 ? 265 LEU A HD23 3  
ATOM   8019  N  N    . SER A 1 171 ? -8.885  -7.945  20.285  1.00 18.71 ? 266 SER A N    3  
ATOM   8020  C  CA   . SER A 1 171 ? -9.882  -7.265  21.138  1.00 20.21 ? 266 SER A CA   3  
ATOM   8021  C  C    . SER A 1 171 ? -11.301 -7.388  20.569  1.00 22.17 ? 266 SER A C    3  
ATOM   8022  O  O    . SER A 1 171 ? -12.232 -6.826  21.198  1.00 23.57 ? 266 SER A O    3  
ATOM   8023  C  CB   . SER A 1 171 ? -9.477  -5.800  21.342  1.00 20.04 ? 266 SER A CB   3  
ATOM   8024  O  OG   . SER A 1 171 ? -10.424 -5.220  22.216  1.00 21.17 ? 266 SER A OG   3  
ATOM   8025  O  OXT  . SER A 1 171 ? -11.473 -8.045  19.525  1.00 22.46 ? 266 SER A OXT  3  
ATOM   8026  H  H    . SER A 1 171 ? -9.176  -8.158  19.345  1.00 18.80 ? 266 SER A H    3  
ATOM   8027  H  HA   . SER A 1 171 ? -9.892  -7.752  22.112  1.00 20.27 ? 266 SER A HA   3  
ATOM   8028  H  HB2  . SER A 1 171 ? -8.477  -5.742  21.779  1.00 19.04 ? 266 SER A HB2  3  
ATOM   8029  H  HB3  . SER A 1 171 ? -9.481  -5.281  20.382  1.00 20.29 ? 266 SER A HB3  3  
ATOM   8030  H  HG   . SER A 1 171 ? -11.231 -5.764  22.072  1.00 21.83 ? 266 SER A HG   3  
HETATM 8031  CU CU   . CU1 B 2 .   ? -4.007  11.586  -5.884  1.00 1.76  ? 267 CU1 A CU   3  
ATOM   8032  N  N    . SER A 1 2   ? -17.374 -28.974 3.030   1.00 14.22 ? 97  SER A N    4  
ATOM   8033  C  CA   . SER A 1 2   ? -17.853 -29.145 4.413   1.00 13.57 ? 97  SER A CA   4  
ATOM   8034  C  C    . SER A 1 2   ? -18.294 -27.821 5.012   1.00 12.32 ? 97  SER A C    4  
ATOM   8035  O  O    . SER A 1 2   ? -19.463 -27.696 5.374   1.00 12.24 ? 97  SER A O    4  
ATOM   8036  C  CB   . SER A 1 2   ? -16.812 -29.843 5.294   1.00 14.09 ? 97  SER A CB   4  
ATOM   8037  O  OG   . SER A 1 2   ? -16.387 -31.011 4.627   1.00 15.21 ? 97  SER A OG   4  
ATOM   8038  H  H    . SER A 1 2   ? -16.533 -28.414 2.994   1.00 14.03 ? 97  SER A H    4  
ATOM   8039  H  HA   . SER A 1 2   ? -18.729 -29.790 4.377   1.00 14.08 ? 97  SER A HA   4  
ATOM   8040  H  HB2  . SER A 1 2   ? -15.958 -29.191 5.469   1.00 13.82 ? 97  SER A HB2  4  
ATOM   8041  H  HB3  . SER A 1 2   ? -17.259 -30.107 6.252   1.00 14.28 ? 97  SER A HB3  4  
ATOM   8042  H  HG   . SER A 1 2   ? -15.670 -31.434 5.137   1.00 15.76 ? 97  SER A HG   4  
ATOM   8043  N  N    . PHE A 1 3   ? -17.397 -26.830 5.129   1.00 11.63 ? 98  PHE A N    4  
ATOM   8044  C  CA   . PHE A 1 3   ? -17.692 -25.540 5.768   1.00 10.57 ? 98  PHE A CA   4  
ATOM   8045  C  C    . PHE A 1 3   ? -16.757 -24.415 5.291   1.00 10.21 ? 98  PHE A C    4  
ATOM   8046  O  O    . PHE A 1 3   ? -15.570 -24.651 5.058   1.00 10.84 ? 98  PHE A O    4  
ATOM   8047  C  CB   . PHE A 1 3   ? -17.610 -25.699 7.299   1.00 10.72 ? 98  PHE A CB   4  
ATOM   8048  C  CG   . PHE A 1 3   ? -17.742 -24.389 8.056   1.00 10.31 ? 98  PHE A CG   4  
ATOM   8049  C  CD1  . PHE A 1 3   ? -18.995 -23.754 8.152   1.00 10.46 ? 98  PHE A CD1  4  
ATOM   8050  C  CD2  . PHE A 1 3   ? -16.599 -23.763 8.593   1.00 10.37 ? 98  PHE A CD2  4  
ATOM   8051  C  CE1  . PHE A 1 3   ? -19.105 -22.501 8.779   1.00 10.42 ? 98  PHE A CE1  4  
ATOM   8052  C  CE2  . PHE A 1 3   ? -16.710 -22.510 9.221   1.00 10.40 ? 98  PHE A CE2  4  
ATOM   8053  C  CZ   . PHE A 1 3   ? -17.963 -21.877 9.313   1.00 10.46 ? 98  PHE A CZ   4  
ATOM   8054  H  H    . PHE A 1 3   ? -16.450 -26.967 4.796   1.00 12.05 ? 98  PHE A H    4  
ATOM   8055  H  HA   . PHE A 1 3   ? -18.713 -25.251 5.512   1.00 10.50 ? 98  PHE A HA   4  
ATOM   8056  H  HB2  . PHE A 1 3   ? -18.399 -26.374 7.633   1.00 11.27 ? 98  PHE A HB2  4  
ATOM   8057  H  HB3  . PHE A 1 3   ? -16.654 -26.158 7.557   1.00 11.10 ? 98  PHE A HB3  4  
ATOM   8058  H  HD1  . PHE A 1 3   ? -19.876 -24.222 7.738   1.00 10.55 ? 98  PHE A HD1  4  
ATOM   8059  H  HD2  . PHE A 1 3   ? -15.630 -24.234 8.516   1.00 10.80 ? 98  PHE A HD2  4  
ATOM   8060  H  HE1  . PHE A 1 3   ? -20.068 -22.015 8.852   1.00 10.58 ? 98  PHE A HE1  4  
ATOM   8061  H  HE2  . PHE A 1 3   ? -15.833 -22.032 9.636   1.00 10.97 ? 98  PHE A HE2  4  
ATOM   8062  H  HZ   . PHE A 1 3   ? -18.050 -20.913 9.796   1.00 10.85 ? 98  PHE A HZ   4  
ATOM   8063  N  N    . THR A 1 4   ? -17.307 -23.195 5.226   1.00 9.35  ? 99  THR A N    4  
ATOM   8064  C  CA   . THR A 1 4   ? -16.679 -21.885 4.971   1.00 8.90  ? 99  THR A CA   4  
ATOM   8065  C  C    . THR A 1 4   ? -17.766 -20.804 5.041   1.00 8.28  ? 99  THR A C    4  
ATOM   8066  O  O    . THR A 1 4   ? -18.955 -21.134 5.041   1.00 8.92  ? 99  THR A O    4  
ATOM   8067  C  CB   . THR A 1 4   ? -15.861 -21.859 3.666   1.00 9.81  ? 99  THR A CB   4  
ATOM   8068  O  OG1  . THR A 1 4   ? -15.117 -20.666 3.634   1.00 9.72  ? 99  THR A OG1  4  
ATOM   8069  C  CG2  . THR A 1 4   ? -16.719 -21.938 2.401   1.00 10.66 ? 99  THR A CG2  4  
ATOM   8070  H  H    . THR A 1 4   ? -18.292 -23.134 5.455   1.00 9.34  ? 99  THR A H    4  
ATOM   8071  H  HA   . THR A 1 4   ? -15.984 -21.683 5.786   1.00 8.84  ? 99  THR A HA   4  
ATOM   8072  H  HB   . THR A 1 4   ? -15.155 -22.691 3.660   1.00 10.47 ? 99  THR A HB   4  
ATOM   8073  H  HG1  . THR A 1 4   ? -14.527 -20.693 2.856   1.00 10.30 ? 99  THR A HG1  4  
ATOM   8074  H  HG21 . THR A 1 4   ? -16.070 -21.973 1.527   1.00 11.34 ? 99  THR A HG21 4  
ATOM   8075  H  HG22 . THR A 1 4   ? -17.326 -22.843 2.421   1.00 11.06 ? 99  THR A HG22 4  
ATOM   8076  H  HG23 . THR A 1 4   ? -17.372 -21.068 2.334   1.00 10.68 ? 99  THR A HG23 4  
ATOM   8077  N  N    . GLY A 1 5   ? -17.380 -19.528 5.093   1.00 7.53  ? 100 GLY A N    4  
ATOM   8078  C  CA   . GLY A 1 5   ? -18.284 -18.372 5.190   1.00 7.20  ? 100 GLY A CA   4  
ATOM   8079  C  C    . GLY A 1 5   ? -17.777 -17.316 6.170   1.00 6.21  ? 100 GLY A C    4  
ATOM   8080  O  O    . GLY A 1 5   ? -17.982 -17.435 7.378   1.00 6.21  ? 100 GLY A O    4  
ATOM   8081  H  H    . GLY A 1 5   ? -16.385 -19.358 5.018   1.00 7.55  ? 100 GLY A H    4  
ATOM   8082  H  HA2  . GLY A 1 5   ? -18.375 -17.914 4.206   1.00 7.55  ? 100 GLY A HA2  4  
ATOM   8083  H  HA3  . GLY A 1 5   ? -19.280 -18.686 5.506   1.00 7.79  ? 100 GLY A HA3  4  
ATOM   8084  N  N    . GLN A 1 6   ? -17.129 -16.279 5.633   1.00 5.71  ? 101 GLN A N    4  
ATOM   8085  C  CA   . GLN A 1 6   ? -16.474 -15.186 6.351   1.00 4.97  ? 101 GLN A CA   4  
ATOM   8086  C  C    . GLN A 1 6   ? -16.163 -14.058 5.343   1.00 4.74  ? 101 GLN A C    4  
ATOM   8087  O  O    . GLN A 1 6   ? -16.128 -14.301 4.134   1.00 5.93  ? 101 GLN A O    4  
ATOM   8088  C  CB   . GLN A 1 6   ? -15.216 -15.726 7.069   1.00 4.84  ? 101 GLN A CB   4  
ATOM   8089  C  CG   . GLN A 1 6   ? -14.588 -14.744 8.071   1.00 4.96  ? 101 GLN A CG   4  
ATOM   8090  C  CD   . GLN A 1 6   ? -13.572 -15.431 8.990   1.00 5.21  ? 101 GLN A CD   4  
ATOM   8091  O  OE1  . GLN A 1 6   ? -12.697 -16.173 8.566   1.00 5.50  ? 101 GLN A OE1  4  
ATOM   8092  N  NE2  . GLN A 1 6   ? -13.657 -15.230 10.288  1.00 5.87  ? 101 GLN A NE2  4  
ATOM   8093  H  H    . GLN A 1 6   ? -17.072 -16.217 4.627   1.00 6.11  ? 101 GLN A H    4  
ATOM   8094  H  HA   . GLN A 1 6   ? -17.172 -14.796 7.095   1.00 5.23  ? 101 GLN A HA   4  
ATOM   8095  H  HB2  . GLN A 1 6   ? -15.489 -16.624 7.625   1.00 5.37  ? 101 GLN A HB2  4  
ATOM   8096  H  HB3  . GLN A 1 6   ? -14.468 -16.008 6.326   1.00 4.88  ? 101 GLN A HB3  4  
ATOM   8097  H  HG2  . GLN A 1 6   ? -14.083 -13.939 7.537   1.00 5.14  ? 101 GLN A HG2  4  
ATOM   8098  H  HG3  . GLN A 1 6   ? -15.379 -14.311 8.683   1.00 5.53  ? 101 GLN A HG3  4  
ATOM   8099  H  HE21 . GLN A 1 6   ? -14.390 -14.669 10.681  1.00 6.22  ? 101 GLN A HE21 4  
ATOM   8100  H  HE22 . GLN A 1 6   ? -12.987 -15.720 10.873  1.00 6.41  ? 101 GLN A HE22 4  
ATOM   8101  N  N    . GLY A 1 7   ? -15.981 -12.820 5.822   1.00 3.82  ? 102 GLY A N    4  
ATOM   8102  C  CA   . GLY A 1 7   ? -15.850 -11.631 4.971   1.00 3.86  ? 102 GLY A CA   4  
ATOM   8103  C  C    . GLY A 1 7   ? -14.417 -11.122 4.808   1.00 3.01  ? 102 GLY A C    4  
ATOM   8104  O  O    . GLY A 1 7   ? -13.828 -10.614 5.764   1.00 3.66  ? 102 GLY A O    4  
ATOM   8105  H  H    . GLY A 1 7   ? -16.013 -12.671 6.820   1.00 3.70  ? 102 GLY A H    4  
ATOM   8106  H  HA2  . GLY A 1 7   ? -16.264 -11.826 3.982   1.00 4.37  ? 102 GLY A HA2  4  
ATOM   8107  H  HA3  . GLY A 1 7   ? -16.420 -10.816 5.415   1.00 4.53  ? 102 GLY A HA3  4  
ATOM   8108  N  N    . ASP A 1 8   ? -13.917 -11.152 3.575   1.00 2.38  ? 103 ASP A N    4  
ATOM   8109  C  CA   . ASP A 1 8   ? -12.739 -10.424 3.085   1.00 2.08  ? 103 ASP A CA   4  
ATOM   8110  C  C    . ASP A 1 8   ? -12.979 -9.838  1.676   1.00 1.95  ? 103 ASP A C    4  
ATOM   8111  O  O    . ASP A 1 8   ? -14.006 -10.097 1.042   1.00 2.42  ? 103 ASP A O    4  
ATOM   8112  C  CB   . ASP A 1 8   ? -11.464 -11.269 3.198   1.00 2.37  ? 103 ASP A CB   4  
ATOM   8113  C  CG   . ASP A 1 8   ? -11.308 -12.544 2.373   1.00 2.84  ? 103 ASP A CG   4  
ATOM   8114  O  OD1  . ASP A 1 8   ? -12.233 -12.940 1.632   1.00 3.80  ? 103 ASP A OD1  4  
ATOM   8115  O  OD2  . ASP A 1 8   ? -10.181 -13.086 2.478   1.00 3.56  ? 103 ASP A OD2  4  
ATOM   8116  H  H    . ASP A 1 8   ? -14.430 -11.659 2.868   1.00 2.91  ? 103 ASP A H    4  
ATOM   8117  H  HA   . ASP A 1 8   ? -12.528 -9.571  3.735   1.00 2.62  ? 103 ASP A HA   4  
ATOM   8118  H  HB2  . ASP A 1 8   ? -10.656 -10.617 2.889   1.00 3.36  ? 103 ASP A HB2  4  
ATOM   8119  H  HB3  . ASP A 1 8   ? -11.313 -11.520 4.250   1.00 2.88  ? 103 ASP A HB3  4  
ATOM   8120  N  N    . PHE A 1 9   ? -12.054 -8.983  1.226   1.00 1.89  ? 104 PHE A N    4  
ATOM   8121  C  CA   . PHE A 1 9   ? -12.065 -8.344  -0.095  1.00 1.73  ? 104 PHE A CA   4  
ATOM   8122  C  C    . PHE A 1 9   ? -11.409 -9.238  -1.155  1.00 2.00  ? 104 PHE A C    4  
ATOM   8123  O  O    . PHE A 1 9   ? -10.537 -10.034 -0.823  1.00 2.11  ? 104 PHE A O    4  
ATOM   8124  C  CB   . PHE A 1 9   ? -11.347 -6.987  0.001   1.00 1.77  ? 104 PHE A CB   4  
ATOM   8125  C  CG   . PHE A 1 9   ? -9.928  -7.030  0.557   1.00 1.70  ? 104 PHE A CG   4  
ATOM   8126  C  CD1  . PHE A 1 9   ? -8.854  -7.486  -0.234  1.00 2.49  ? 104 PHE A CD1  4  
ATOM   8127  C  CD2  . PHE A 1 9   ? -9.678  -6.608  1.877   1.00 2.66  ? 104 PHE A CD2  4  
ATOM   8128  C  CE1  . PHE A 1 9   ? -7.548  -7.528  0.288   1.00 2.37  ? 104 PHE A CE1  4  
ATOM   8129  C  CE2  . PHE A 1 9   ? -8.373  -6.650  2.397   1.00 2.83  ? 104 PHE A CE2  4  
ATOM   8130  C  CZ   . PHE A 1 9   ? -7.306  -7.109  1.607   1.00 1.83  ? 104 PHE A CZ   4  
ATOM   8131  H  H    . PHE A 1 9   ? -11.232 -8.839  1.787   1.00 2.26  ? 104 PHE A H    4  
ATOM   8132  H  HA   . PHE A 1 9   ? -13.099 -8.176  -0.399  1.00 1.82  ? 104 PHE A HA   4  
ATOM   8133  H  HB2  . PHE A 1 9   ? -11.317 -6.533  -0.991  1.00 1.69  ? 104 PHE A HB2  4  
ATOM   8134  H  HB3  . PHE A 1 9   ? -11.950 -6.333  0.633   1.00 2.01  ? 104 PHE A HB3  4  
ATOM   8135  H  HD1  . PHE A 1 9   ? -9.028  -7.816  -1.247  1.00 3.56  ? 104 PHE A HD1  4  
ATOM   8136  H  HD2  . PHE A 1 9   ? -10.490 -6.251  2.496   1.00 3.78  ? 104 PHE A HD2  4  
ATOM   8137  H  HE1  . PHE A 1 9   ? -6.732  -7.881  -0.328  1.00 3.66  ? 104 PHE A HE1  4  
ATOM   8138  H  HE2  . PHE A 1 9   ? -8.196  -6.337  3.414   1.00 3.93  ? 104 PHE A HE2  4  
ATOM   8139  H  HZ   . PHE A 1 9   ? -6.302  -7.140  2.008   1.00 2.03  ? 104 PHE A HZ   4  
ATOM   8140  N  N    . HIS A 1 10  ? -11.763 -9.057  -2.432  1.00 1.42  ? 105 HIS A N    4  
ATOM   8141  C  CA   . HIS A 1 10  ? -11.245 -9.859  -3.553  1.00 1.25  ? 105 HIS A CA   4  
ATOM   8142  C  C    . HIS A 1 10  ? -10.675 -8.967  -4.672  1.00 1.09  ? 105 HIS A C    4  
ATOM   8143  O  O    . HIS A 1 10  ? -11.417 -8.219  -5.311  1.00 1.39  ? 105 HIS A O    4  
ATOM   8144  C  CB   . HIS A 1 10  ? -12.375 -10.776 -4.063  1.00 1.49  ? 105 HIS A CB   4  
ATOM   8145  C  CG   . HIS A 1 10  ? -12.960 -11.630 -2.969  1.00 2.45  ? 105 HIS A CG   4  
ATOM   8146  N  ND1  . HIS A 1 10  ? -14.300 -11.655 -2.579  1.00 3.69  ? 105 HIS A ND1  4  
ATOM   8147  C  CD2  . HIS A 1 10  ? -12.216 -12.300 -2.048  1.00 3.30  ? 105 HIS A CD2  4  
ATOM   8148  C  CE1  . HIS A 1 10  ? -14.318 -12.321 -1.411  1.00 5.18  ? 105 HIS A CE1  4  
ATOM   8149  N  NE2  . HIS A 1 10  ? -13.079 -12.707 -1.056  1.00 5.04  ? 105 HIS A NE2  4  
ATOM   8150  H  H    . HIS A 1 10  ? -12.491 -8.390  -2.642  1.00 1.56  ? 105 HIS A H    4  
ATOM   8151  H  HA   . HIS A 1 10  ? -10.432 -10.495 -3.202  1.00 1.22  ? 105 HIS A HA   4  
ATOM   8152  H  HB2  . HIS A 1 10  ? -13.173 -10.169 -4.491  1.00 2.64  ? 105 HIS A HB2  4  
ATOM   8153  H  HB3  . HIS A 1 10  ? -11.984 -11.429 -4.843  1.00 1.63  ? 105 HIS A HB3  4  
ATOM   8154  H  HD2  . HIS A 1 10  ? -11.139 -12.332 -2.031  1.00 2.99  ? 105 HIS A HD2  4  
ATOM   8155  H  HE1  . HIS A 1 10  ? -15.197 -12.463 -0.799  1.00 6.48  ? 105 HIS A HE1  4  
ATOM   8156  H  HE2  . HIS A 1 10  ? -12.810 -13.056 -0.133  1.00 6.22  ? 105 HIS A HE2  4  
ATOM   8157  N  N    . LEU A 1 11  ? -9.353  -9.027  -4.882  1.00 0.80  ? 106 LEU A N    4  
ATOM   8158  C  CA   . LEU A 1 11  ? -8.624  -8.234  -5.881  1.00 0.74  ? 106 LEU A CA   4  
ATOM   8159  C  C    . LEU A 1 11  ? -7.579  -9.097  -6.618  1.00 0.71  ? 106 LEU A C    4  
ATOM   8160  O  O    . LEU A 1 11  ? -7.216  -10.177 -6.148  1.00 0.80  ? 106 LEU A O    4  
ATOM   8161  C  CB   . LEU A 1 11  ? -7.963  -6.995  -5.223  1.00 0.81  ? 106 LEU A CB   4  
ATOM   8162  C  CG   . LEU A 1 11  ? -8.919  -5.835  -4.847  1.00 1.22  ? 106 LEU A CG   4  
ATOM   8163  C  CD1  . LEU A 1 11  ? -9.492  -5.949  -3.424  1.00 1.84  ? 106 LEU A CD1  4  
ATOM   8164  C  CD2  . LEU A 1 11  ? -8.182  -4.488  -4.904  1.00 2.52  ? 106 LEU A CD2  4  
ATOM   8165  H  H    . LEU A 1 11  ? -8.806  -9.687  -4.334  1.00 0.83  ? 106 LEU A H    4  
ATOM   8166  H  HA   . LEU A 1 11  ? -9.334  -7.898  -6.637  1.00 0.84  ? 106 LEU A HA   4  
ATOM   8167  H  HB2  . LEU A 1 11  ? -7.399  -7.307  -4.344  1.00 0.90  ? 106 LEU A HB2  4  
ATOM   8168  H  HB3  . LEU A 1 11  ? -7.240  -6.601  -5.940  1.00 1.07  ? 106 LEU A HB3  4  
ATOM   8169  H  HG   . LEU A 1 11  ? -9.740  -5.801  -5.565  1.00 2.36  ? 106 LEU A HG   4  
ATOM   8170  H  HD11 . LEU A 1 11  ? -10.172 -5.119  -3.233  1.00 2.52  ? 106 LEU A HD11 4  
ATOM   8171  H  HD12 . LEU A 1 11  ? -10.043 -6.874  -3.297  1.00 2.80  ? 106 LEU A HD12 4  
ATOM   8172  H  HD13 . LEU A 1 11  ? -8.682  -5.917  -2.696  1.00 2.64  ? 106 LEU A HD13 4  
ATOM   8173  H  HD21 . LEU A 1 11  ? -8.877  -3.672  -4.703  1.00 2.92  ? 106 LEU A HD21 4  
ATOM   8174  H  HD22 . LEU A 1 11  ? -7.382  -4.464  -4.164  1.00 3.30  ? 106 LEU A HD22 4  
ATOM   8175  H  HD23 . LEU A 1 11  ? -7.757  -4.337  -5.892  1.00 3.61  ? 106 LEU A HD23 4  
ATOM   8176  N  N    . LEU A 1 12  ? -7.098  -8.630  -7.774  1.00 0.78  ? 107 LEU A N    4  
ATOM   8177  C  CA   . LEU A 1 12  ? -6.036  -9.265  -8.566  1.00 0.86  ? 107 LEU A CA   4  
ATOM   8178  C  C    . LEU A 1 12  ? -4.772  -8.393  -8.587  1.00 0.74  ? 107 LEU A C    4  
ATOM   8179  O  O    . LEU A 1 12  ? -4.853  -7.170  -8.707  1.00 0.78  ? 107 LEU A O    4  
ATOM   8180  C  CB   . LEU A 1 12  ? -6.520  -9.528  -10.009 1.00 1.16  ? 107 LEU A CB   4  
ATOM   8181  C  CG   . LEU A 1 12  ? -7.255  -10.867 -10.227 1.00 1.86  ? 107 LEU A CG   4  
ATOM   8182  C  CD1  . LEU A 1 12  ? -8.598  -10.960 -9.486  1.00 2.73  ? 107 LEU A CD1  4  
ATOM   8183  C  CD2  . LEU A 1 12  ? -7.499  -11.067 -11.730 1.00 2.35  ? 107 LEU A CD2  4  
ATOM   8184  H  H    . LEU A 1 12  ? -7.426  -7.723  -8.095  1.00 0.86  ? 107 LEU A H    4  
ATOM   8185  H  HA   . LEU A 1 12  ? -5.756  -10.214 -8.111  1.00 0.94  ? 107 LEU A HA   4  
ATOM   8186  H  HB2  . LEU A 1 12  ? -7.148  -8.699  -10.341 1.00 1.56  ? 107 LEU A HB2  4  
ATOM   8187  H  HB3  . LEU A 1 12  ? -5.638  -9.541  -10.654 1.00 1.74  ? 107 LEU A HB3  4  
ATOM   8188  H  HG   . LEU A 1 12  ? -6.614  -11.679 -9.880  1.00 3.01  ? 107 LEU A HG   4  
ATOM   8189  H  HD11 . LEU A 1 12  ? -9.219  -10.096 -9.722  1.00 2.77  ? 107 LEU A HD11 4  
ATOM   8190  H  HD12 . LEU A 1 12  ? -9.123  -11.869 -9.783  1.00 3.64  ? 107 LEU A HD12 4  
ATOM   8191  H  HD13 . LEU A 1 12  ? -8.431  -11.009 -8.412  1.00 3.82  ? 107 LEU A HD13 4  
ATOM   8192  H  HD21 . LEU A 1 12  ? -8.139  -10.272 -12.116 1.00 2.45  ? 107 LEU A HD21 4  
ATOM   8193  H  HD22 . LEU A 1 12  ? -6.548  -11.053 -12.266 1.00 3.22  ? 107 LEU A HD22 4  
ATOM   8194  H  HD23 . LEU A 1 12  ? -7.979  -12.030 -11.905 1.00 3.18  ? 107 LEU A HD23 4  
ATOM   8195  N  N    . ASP A 1 13  ? -3.616  -9.054  -8.526  1.00 0.80  ? 108 ASP A N    4  
ATOM   8196  C  CA   . ASP A 1 13  ? -2.275  -8.457  -8.523  1.00 0.88  ? 108 ASP A CA   4  
ATOM   8197  C  C    . ASP A 1 13  ? -1.833  -8.021  -9.926  1.00 1.00  ? 108 ASP A C    4  
ATOM   8198  O  O    . ASP A 1 13  ? -2.254  -8.583  -10.937 1.00 1.16  ? 108 ASP A O    4  
ATOM   8199  C  CB   . ASP A 1 13  ? -1.268  -9.498  -7.988  1.00 1.13  ? 108 ASP A CB   4  
ATOM   8200  C  CG   . ASP A 1 13  ? -1.613  -10.066 -6.603  1.00 2.07  ? 108 ASP A CG   4  
ATOM   8201  O  OD1  . ASP A 1 13  ? -1.787  -9.271  -5.656  1.00 3.48  ? 108 ASP A OD1  4  
ATOM   8202  O  OD2  . ASP A 1 13  ? -1.647  -11.315 -6.488  1.00 2.65  ? 108 ASP A OD2  4  
ATOM   8203  H  H    . ASP A 1 13  ? -3.671  -10.063 -8.447  1.00 0.96  ? 108 ASP A H    4  
ATOM   8204  H  HA   . ASP A 1 13  ? -2.230  -7.577  -7.882  1.00 0.88  ? 108 ASP A HA   4  
ATOM   8205  H  HB2  . ASP A 1 13  ? -1.205  -10.320 -8.705  1.00 1.96  ? 108 ASP A HB2  4  
ATOM   8206  H  HB3  . ASP A 1 13  ? -0.282  -9.036  -7.933  1.00 1.71  ? 108 ASP A HB3  4  
ATOM   8207  N  N    . HIS A 1 14  ? -0.860  -7.107  -9.998  1.00 1.12  ? 109 HIS A N    4  
ATOM   8208  C  CA   . HIS A 1 14  ? -0.199  -6.677  -11.242 1.00 1.36  ? 109 HIS A CA   4  
ATOM   8209  C  C    . HIS A 1 14  ? 0.564   -7.804  -11.999 1.00 1.78  ? 109 HIS A C    4  
ATOM   8210  O  O    . HIS A 1 14  ? 1.214   -7.554  -13.016 1.00 2.11  ? 109 HIS A O    4  
ATOM   8211  C  CB   . HIS A 1 14  ? 0.699   -5.470  -10.910 1.00 1.33  ? 109 HIS A CB   4  
ATOM   8212  C  CG   . HIS A 1 14  ? 1.946   -5.808  -10.131 1.00 1.29  ? 109 HIS A CG   4  
ATOM   8213  N  ND1  . HIS A 1 14  ? 2.167   -5.586  -8.773  1.00 1.54  ? 109 HIS A ND1  4  
ATOM   8214  C  CD2  . HIS A 1 14  ? 3.060   -6.375  -10.668 1.00 1.55  ? 109 HIS A CD2  4  
ATOM   8215  C  CE1  . HIS A 1 14  ? 3.415   -6.025  -8.535  1.00 1.43  ? 109 HIS A CE1  4  
ATOM   8216  N  NE2  . HIS A 1 14  ? 3.982   -6.495  -9.656  1.00 1.50  ? 109 HIS A NE2  4  
ATOM   8217  H  H    . HIS A 1 14  ? -0.619  -6.607  -9.144  1.00 1.10  ? 109 HIS A H    4  
ATOM   8218  H  HA   . HIS A 1 14  ? -0.982  -6.328  -11.916 1.00 1.43  ? 109 HIS A HA   4  
ATOM   8219  H  HB2  . HIS A 1 14  ? 1.002   -4.998  -11.844 1.00 1.51  ? 109 HIS A HB2  4  
ATOM   8220  H  HB3  . HIS A 1 14  ? 0.123   -4.734  -10.350 1.00 1.35  ? 109 HIS A HB3  4  
ATOM   8221  H  HD2  . HIS A 1 14  ? 3.165   -6.671  -11.692 1.00 2.03  ? 109 HIS A HD2  4  
ATOM   8222  H  HE1  . HIS A 1 14  ? 3.916   -5.985  -7.577  1.00 1.65  ? 109 HIS A HE1  4  
ATOM   8223  H  HE2  . HIS A 1 14  ? 4.930   -6.839  -9.729  1.00 1.81  ? 109 HIS A HE2  4  
ATOM   8224  N  N    . ARG A 1 15  ? 0.511   -9.045  -11.491 1.00 1.99  ? 110 ARG A N    4  
ATOM   8225  C  CA   . ARG A 1 15  ? 0.997   -10.285 -12.123 1.00 2.50  ? 110 ARG A CA   4  
ATOM   8226  C  C    . ARG A 1 15  ? -0.113  -11.331 -12.376 1.00 2.15  ? 110 ARG A C    4  
ATOM   8227  O  O    . ARG A 1 15  ? 0.195   -12.459 -12.753 1.00 2.58  ? 110 ARG A O    4  
ATOM   8228  C  CB   . ARG A 1 15  ? 2.123   -10.897 -11.263 1.00 3.43  ? 110 ARG A CB   4  
ATOM   8229  C  CG   . ARG A 1 15  ? 3.419   -10.071 -11.219 1.00 4.13  ? 110 ARG A CG   4  
ATOM   8230  C  CD   . ARG A 1 15  ? 4.014   -9.829  -12.615 1.00 3.95  ? 110 ARG A CD   4  
ATOM   8231  N  NE   . ARG A 1 15  ? 5.427   -9.429  -12.530 1.00 5.25  ? 110 ARG A NE   4  
ATOM   8232  C  CZ   . ARG A 1 15  ? 6.006   -8.337  -13.019 1.00 6.13  ? 110 ARG A CZ   4  
ATOM   8233  N  NH1  . ARG A 1 15  ? 5.343   -7.374  -13.624 1.00 6.27  ? 110 ARG A NH1  4  
ATOM   8234  N  NH2  . ARG A 1 15  ? 7.300   -8.195  -12.895 1.00 7.46  ? 110 ARG A NH2  4  
ATOM   8235  H  H    . ARG A 1 15  ? -0.028  -9.133  -10.640 1.00 1.88  ? 110 ARG A H    4  
ATOM   8236  H  HA   . ARG A 1 15  ? 1.397   -10.046 -13.109 1.00 2.86  ? 110 ARG A HA   4  
ATOM   8237  H  HB2  . ARG A 1 15  ? 1.759   -11.036 -10.243 1.00 4.21  ? 110 ARG A HB2  4  
ATOM   8238  H  HB3  . ARG A 1 15  ? 2.385   -11.881 -11.656 1.00 3.69  ? 110 ARG A HB3  4  
ATOM   8239  H  HG2  . ARG A 1 15  ? 3.232   -9.116  -10.731 1.00 4.71  ? 110 ARG A HG2  4  
ATOM   8240  H  HG3  . ARG A 1 15  ? 4.141   -10.623 -10.616 1.00 5.18  ? 110 ARG A HG3  4  
ATOM   8241  H  HD2  . ARG A 1 15  ? 3.959   -10.757 -13.188 1.00 4.01  ? 110 ARG A HD2  4  
ATOM   8242  H  HD3  . ARG A 1 15  ? 3.422   -9.074  -13.133 1.00 3.97  ? 110 ARG A HD3  4  
ATOM   8243  H  HE   . ARG A 1 15  ? 6.032   -10.079 -12.034 1.00 5.96  ? 110 ARG A HE   4  
ATOM   8244  H  HH11 . ARG A 1 15  ? 4.353   -7.449  -13.774 1.00 5.66  ? 110 ARG A HH11 4  
ATOM   8245  H  HH12 . ARG A 1 15  ? 5.866   -6.588  -14.001 1.00 7.34  ? 110 ARG A HH12 4  
ATOM   8246  H  HH21 . ARG A 1 15  ? 7.869   -8.944  -12.508 1.00 7.86  ? 110 ARG A HH21 4  
ATOM   8247  H  HH22 . ARG A 1 15  ? 7.759   -7.325  -13.132 1.00 8.36  ? 110 ARG A HH22 4  
ATOM   8248  N  N    . GLY A 1 16  ? -1.392  -10.999 -12.154 1.00 1.68  ? 111 GLY A N    4  
ATOM   8249  C  CA   . GLY A 1 16  ? -2.538  -11.867 -12.468 1.00 1.76  ? 111 GLY A CA   4  
ATOM   8250  C  C    . GLY A 1 16  ? -2.788  -13.003 -11.468 1.00 1.73  ? 111 GLY A C    4  
ATOM   8251  O  O    . GLY A 1 16  ? -3.533  -13.927 -11.790 1.00 2.03  ? 111 GLY A O    4  
ATOM   8252  H  H    . GLY A 1 16  ? -1.600  -10.060 -11.835 1.00 1.52  ? 111 GLY A H    4  
ATOM   8253  H  HA2  . GLY A 1 16  ? -3.440  -11.253 -12.481 1.00 2.14  ? 111 GLY A HA2  4  
ATOM   8254  H  HA3  . GLY A 1 16  ? -2.397  -12.313 -13.452 1.00 2.01  ? 111 GLY A HA3  4  
ATOM   8255  N  N    . ARG A 1 17  ? -2.185  -12.952 -10.273 1.00 1.69  ? 112 ARG A N    4  
ATOM   8256  C  CA   . ARG A 1 17  ? -2.564  -13.799 -9.130  1.00 1.79  ? 112 ARG A CA   4  
ATOM   8257  C  C    . ARG A 1 17  ? -3.738  -13.163 -8.364  1.00 1.48  ? 112 ARG A C    4  
ATOM   8258  O  O    . ARG A 1 17  ? -4.007  -11.969 -8.507  1.00 1.34  ? 112 ARG A O    4  
ATOM   8259  C  CB   . ARG A 1 17  ? -1.344  -14.064 -8.222  1.00 2.08  ? 112 ARG A CB   4  
ATOM   8260  C  CG   . ARG A 1 17  ? -0.438  -15.166 -8.803  1.00 2.51  ? 112 ARG A CG   4  
ATOM   8261  C  CD   . ARG A 1 17  ? 0.740   -15.520 -7.879  1.00 3.33  ? 112 ARG A CD   4  
ATOM   8262  N  NE   . ARG A 1 17  ? 1.404   -16.762 -8.327  1.00 3.85  ? 112 ARG A NE   4  
ATOM   8263  C  CZ   . ARG A 1 17  ? 2.710   -17.020 -8.405  1.00 4.65  ? 112 ARG A CZ   4  
ATOM   8264  N  NH1  . ARG A 1 17  ? 3.649   -16.180 -8.024  1.00 5.45  ? 112 ARG A NH1  4  
ATOM   8265  N  NH2  . ARG A 1 17  ? 3.123   -18.171 -8.885  1.00 5.23  ? 112 ARG A NH2  4  
ATOM   8266  H  H    . ARG A 1 17  ? -1.630  -12.135 -10.070 1.00 1.74  ? 112 ARG A H    4  
ATOM   8267  H  HA   . ARG A 1 17  ? -2.917  -14.762 -9.502  1.00 2.07  ? 112 ARG A HA   4  
ATOM   8268  H  HB2  . ARG A 1 17  ? -0.770  -13.146 -8.092  1.00 2.49  ? 112 ARG A HB2  4  
ATOM   8269  H  HB3  . ARG A 1 17  ? -1.696  -14.392 -7.242  1.00 2.41  ? 112 ARG A HB3  4  
ATOM   8270  H  HG2  . ARG A 1 17  ? -1.041  -16.060 -8.953  1.00 2.84  ? 112 ARG A HG2  4  
ATOM   8271  H  HG3  . ARG A 1 17  ? -0.048  -14.846 -9.770  1.00 2.90  ? 112 ARG A HG3  4  
ATOM   8272  H  HD2  . ARG A 1 17  ? 1.442   -14.684 -7.867  1.00 3.76  ? 112 ARG A HD2  4  
ATOM   8273  H  HD3  . ARG A 1 17  ? 0.363   -15.673 -6.866  1.00 3.73  ? 112 ARG A HD3  4  
ATOM   8274  H  HE   . ARG A 1 17  ? 0.786   -17.500 -8.630  1.00 4.06  ? 112 ARG A HE   4  
ATOM   8275  H  HH11 . ARG A 1 17  ? 3.441   -15.323 -7.535  1.00 5.52  ? 112 ARG A HH11 4  
ATOM   8276  H  HH12 . ARG A 1 17  ? 4.615   -16.453 -8.112  1.00 6.35  ? 112 ARG A HH12 4  
ATOM   8277  H  HH21 . ARG A 1 17  ? 2.488   -18.917 -9.144  1.00 5.30  ? 112 ARG A HH21 4  
ATOM   8278  H  HH22 . ARG A 1 17  ? 4.119   -18.336 -9.021  1.00 5.97  ? 112 ARG A HH22 4  
ATOM   8279  N  N    . ALA A 1 18  ? -4.472  -13.973 -7.599  1.00 1.59  ? 113 ALA A N    4  
ATOM   8280  C  CA   . ALA A 1 18  ? -5.617  -13.537 -6.793  1.00 1.41  ? 113 ALA A CA   4  
ATOM   8281  C  C    . ALA A 1 18  ? -5.210  -13.264 -5.334  1.00 1.21  ? 113 ALA A C    4  
ATOM   8282  O  O    . ALA A 1 18  ? -4.473  -14.049 -4.728  1.00 1.59  ? 113 ALA A O    4  
ATOM   8283  C  CB   . ALA A 1 18  ? -6.710  -14.610 -6.884  1.00 1.89  ? 113 ALA A CB   4  
ATOM   8284  H  H    . ALA A 1 18  ? -4.212  -14.952 -7.558  1.00 1.94  ? 113 ALA A H    4  
ATOM   8285  H  HA   . ALA A 1 18  ? -6.018  -12.607 -7.206  1.00 1.30  ? 113 ALA A HA   4  
ATOM   8286  H  HB1  . ALA A 1 18  ? -6.994  -14.761 -7.927  1.00 2.01  ? 113 ALA A HB1  4  
ATOM   8287  H  HB2  . ALA A 1 18  ? -6.348  -15.553 -6.469  1.00 3.11  ? 113 ALA A HB2  4  
ATOM   8288  H  HB3  . ALA A 1 18  ? -7.588  -14.289 -6.321  1.00 2.26  ? 113 ALA A HB3  4  
ATOM   8289  N  N    . ARG A 1 19  ? -5.730  -12.176 -4.761  1.00 0.94  ? 114 ARG A N    4  
ATOM   8290  C  CA   . ARG A 1 19  ? -5.430  -11.700 -3.408  1.00 1.09  ? 114 ARG A CA   4  
ATOM   8291  C  C    . ARG A 1 19  ? -6.716  -11.410 -2.621  1.00 1.09  ? 114 ARG A C    4  
ATOM   8292  O  O    . ARG A 1 19  ? -7.686  -10.870 -3.158  1.00 1.00  ? 114 ARG A O    4  
ATOM   8293  C  CB   . ARG A 1 19  ? -4.553  -10.429 -3.500  1.00 1.33  ? 114 ARG A CB   4  
ATOM   8294  C  CG   . ARG A 1 19  ? -3.249  -10.554 -2.704  1.00 1.69  ? 114 ARG A CG   4  
ATOM   8295  C  CD   . ARG A 1 19  ? -2.219  -11.502 -3.338  1.00 1.71  ? 114 ARG A CD   4  
ATOM   8296  N  NE   . ARG A 1 19  ? -1.509  -12.270 -2.298  1.00 2.63  ? 114 ARG A NE   4  
ATOM   8297  C  CZ   . ARG A 1 19  ? -1.786  -13.514 -1.921  1.00 3.77  ? 114 ARG A CZ   4  
ATOM   8298  N  NH1  . ARG A 1 19  ? -2.617  -14.279 -2.591  1.00 4.67  ? 114 ARG A NH1  4  
ATOM   8299  N  NH2  . ARG A 1 19  ? -1.243  -14.007 -0.830  1.00 4.89  ? 114 ARG A NH2  4  
ATOM   8300  H  H    . ARG A 1 19  ? -6.339  -11.585 -5.319  1.00 0.95  ? 114 ARG A H    4  
ATOM   8301  H  HA   . ARG A 1 19  ? -4.883  -12.476 -2.872  1.00 1.35  ? 114 ARG A HA   4  
ATOM   8302  H  HB2  . ARG A 1 19  ? -4.310  -10.196 -4.538  1.00 1.60  ? 114 ARG A HB2  4  
ATOM   8303  H  HB3  . ARG A 1 19  ? -5.112  -9.583  -3.095  1.00 1.96  ? 114 ARG A HB3  4  
ATOM   8304  H  HG2  . ARG A 1 19  ? -2.792  -9.568  -2.634  1.00 2.54  ? 114 ARG A HG2  4  
ATOM   8305  H  HG3  . ARG A 1 19  ? -3.495  -10.886 -1.693  1.00 2.54  ? 114 ARG A HG3  4  
ATOM   8306  H  HD2  . ARG A 1 19  ? -2.705  -12.164 -4.057  1.00 2.19  ? 114 ARG A HD2  4  
ATOM   8307  H  HD3  . ARG A 1 19  ? -1.491  -10.910 -3.892  1.00 2.39  ? 114 ARG A HD3  4  
ATOM   8308  H  HE   . ARG A 1 19  ? -0.825  -11.762 -1.767  1.00 3.31  ? 114 ARG A HE   4  
ATOM   8309  H  HH11 . ARG A 1 19  ? -3.067  -13.961 -3.442  1.00 4.41  ? 114 ARG A HH11 4  
ATOM   8310  H  HH12 . ARG A 1 19  ? -2.908  -15.177 -2.205  1.00 6.09  ? 114 ARG A HH12 4  
ATOM   8311  H  HH21 . ARG A 1 19  ? -0.638  -13.461 -0.246  1.00 5.04  ? 114 ARG A HH21 4  
ATOM   8312  H  HH22 . ARG A 1 19  ? -1.547  -14.923 -0.492  1.00 6.04  ? 114 ARG A HH22 4  
ATOM   8313  N  N    . CYS A 1 20  ? -6.694  -11.716 -1.323  1.00 1.40  ? 115 CYS A N    4  
ATOM   8314  C  CA   . CYS A 1 20  ? -7.780  -11.450 -0.376  1.00 1.58  ? 115 CYS A CA   4  
ATOM   8315  C  C    . CYS A 1 20  ? -7.239  -11.214 1.041   1.00 1.55  ? 115 CYS A C    4  
ATOM   8316  O  O    . CYS A 1 20  ? -6.050  -11.432 1.283   1.00 1.56  ? 115 CYS A O    4  
ATOM   8317  C  CB   . CYS A 1 20  ? -8.799  -12.598 -0.456  1.00 1.89  ? 115 CYS A CB   4  
ATOM   8318  S  SG   . CYS A 1 20  ? -8.176  -14.092 0.361   1.00 2.12  ? 115 CYS A SG   4  
ATOM   8319  H  H    . CYS A 1 20  ? -5.872  -12.160 -0.945  1.00 1.60  ? 115 CYS A H    4  
ATOM   8320  H  HA   . CYS A 1 20  ? -8.269  -10.525 -0.678  1.00 1.71  ? 115 CYS A HA   4  
ATOM   8321  H  HB2  . CYS A 1 20  ? -9.732  -12.299 0.030   1.00 2.96  ? 115 CYS A HB2  4  
ATOM   8322  H  HB3  . CYS A 1 20  ? -9.028  -12.821 -1.499  1.00 2.38  ? 115 CYS A HB3  4  
ATOM   8323  H  HG   . CYS A 1 20  ? -9.147  -14.117 1.300   1.00 3.07  ? 115 CYS A HG   4  
ATOM   8324  N  N    . LYS A 1 21  ? -8.071  -10.756 1.988   1.00 1.71  ? 116 LYS A N    4  
ATOM   8325  C  CA   . LYS A 1 21  ? -7.576  -10.411 3.332   1.00 1.77  ? 116 LYS A CA   4  
ATOM   8326  C  C    . LYS A 1 21  ? -7.006  -11.625 4.088   1.00 1.82  ? 116 LYS A C    4  
ATOM   8327  O  O    . LYS A 1 21  ? -5.980  -11.493 4.757   1.00 1.66  ? 116 LYS A O    4  
ATOM   8328  C  CB   . LYS A 1 21  ? -8.619  -9.663  4.179   1.00 2.25  ? 116 LYS A CB   4  
ATOM   8329  C  CG   . LYS A 1 21  ? -7.928  -8.852  5.283   1.00 2.83  ? 116 LYS A CG   4  
ATOM   8330  C  CD   . LYS A 1 21  ? -8.941  -8.186  6.217   1.00 3.56  ? 116 LYS A CD   4  
ATOM   8331  C  CE   . LYS A 1 21  ? -8.168  -7.541  7.370   1.00 4.41  ? 116 LYS A CE   4  
ATOM   8332  N  NZ   . LYS A 1 21  ? -9.036  -7.282  8.537   1.00 4.83  ? 116 LYS A NZ   4  
ATOM   8333  H  H    . LYS A 1 21  ? -9.053  -10.660 1.767   1.00 1.84  ? 116 LYS A H    4  
ATOM   8334  H  HA   . LYS A 1 21  ? -6.767  -9.709  3.183   1.00 1.59  ? 116 LYS A HA   4  
ATOM   8335  H  HB2  . LYS A 1 21  ? -9.195  -8.986  3.549   1.00 2.46  ? 116 LYS A HB2  4  
ATOM   8336  H  HB3  . LYS A 1 21  ? -9.289  -10.386 4.646   1.00 2.50  ? 116 LYS A HB3  4  
ATOM   8337  H  HG2  . LYS A 1 21  ? -7.303  -9.517  5.878   1.00 2.99  ? 116 LYS A HG2  4  
ATOM   8338  H  HG3  . LYS A 1 21  ? -7.290  -8.088  4.836   1.00 3.19  ? 116 LYS A HG3  4  
ATOM   8339  H  HD2  . LYS A 1 21  ? -9.522  -7.432  5.682   1.00 4.12  ? 116 LYS A HD2  4  
ATOM   8340  H  HD3  . LYS A 1 21  ? -9.614  -8.952  6.608   1.00 3.55  ? 116 LYS A HD3  4  
ATOM   8341  H  HE2  . LYS A 1 21  ? -7.376  -8.227  7.680   1.00 4.45  ? 116 LYS A HE2  4  
ATOM   8342  H  HE3  . LYS A 1 21  ? -7.697  -6.614  7.029   1.00 5.16  ? 116 LYS A HE3  4  
ATOM   8343  H  HZ1  . LYS A 1 21  ? -9.598  -8.104  8.754   1.00 4.35  ? 116 LYS A HZ1  4  
ATOM   8344  H  HZ2  . LYS A 1 21  ? -8.464  -7.086  9.348   1.00 5.47  ? 116 LYS A HZ2  4  
ATOM   8345  H  HZ3  . LYS A 1 21  ? -9.678  -6.514  8.362   1.00 5.45  ? 116 LYS A HZ3  4  
ATOM   8346  N  N    . ALA A 1 22  ? -7.646  -12.795 3.979   1.00 2.19  ? 117 ALA A N    4  
ATOM   8347  C  CA   . ALA A 1 22  ? -7.206  -14.016 4.660   1.00 2.46  ? 117 ALA A CA   4  
ATOM   8348  C  C    . ALA A 1 22  ? -5.835  -14.507 4.161   1.00 2.36  ? 117 ALA A C    4  
ATOM   8349  O  O    . ALA A 1 22  ? -4.979  -14.867 4.968   1.00 2.46  ? 117 ALA A O    4  
ATOM   8350  C  CB   . ALA A 1 22  ? -8.295  -15.080 4.475   1.00 2.96  ? 117 ALA A CB   4  
ATOM   8351  H  H    . ALA A 1 22  ? -8.492  -12.843 3.409   1.00 2.37  ? 117 ALA A H    4  
ATOM   8352  H  HA   . ALA A 1 22  ? -7.096  -13.810 5.726   1.00 2.50  ? 117 ALA A HA   4  
ATOM   8353  H  HB1  . ALA A 1 22  ? -9.243  -14.719 4.876   1.00 4.01  ? 117 ALA A HB1  4  
ATOM   8354  H  HB2  . ALA A 1 22  ? -8.426  -15.308 3.416   1.00 3.08  ? 117 ALA A HB2  4  
ATOM   8355  H  HB3  . ALA A 1 22  ? -8.012  -15.993 5.002   1.00 2.95  ? 117 ALA A HB3  4  
ATOM   8356  N  N    . ASP A 1 23  ? -5.610  -14.471 2.844   1.00 2.31  ? 118 ASP A N    4  
ATOM   8357  C  CA   . ASP A 1 23  ? -4.363  -14.901 2.200   1.00 2.44  ? 118 ASP A CA   4  
ATOM   8358  C  C    . ASP A 1 23  ? -3.203  -13.916 2.489   1.00 2.19  ? 118 ASP A C    4  
ATOM   8359  O  O    . ASP A 1 23  ? -2.037  -14.312 2.559   1.00 2.34  ? 118 ASP A O    4  
ATOM   8360  C  CB   . ASP A 1 23  ? -4.681  -15.060 0.698   1.00 2.71  ? 118 ASP A CB   4  
ATOM   8361  C  CG   . ASP A 1 23  ? -3.713  -15.919 -0.123  1.00 2.73  ? 118 ASP A CG   4  
ATOM   8362  O  OD1  . ASP A 1 23  ? -2.573  -16.178 0.322   1.00 3.17  ? 118 ASP A OD1  4  
ATOM   8363  O  OD2  . ASP A 1 23  ? -4.059  -16.217 -1.288  1.00 3.31  ? 118 ASP A OD2  4  
ATOM   8364  H  H    . ASP A 1 23  ? -6.350  -14.140 2.238   1.00 2.28  ? 118 ASP A H    4  
ATOM   8365  H  HA   . ASP A 1 23  ? -4.084  -15.878 2.598   1.00 2.72  ? 118 ASP A HA   4  
ATOM   8366  H  HB2  . ASP A 1 23  ? -5.660  -15.534 0.608   1.00 3.24  ? 118 ASP A HB2  4  
ATOM   8367  H  HB3  . ASP A 1 23  ? -4.750  -14.069 0.242   1.00 2.94  ? 118 ASP A HB3  4  
ATOM   8368  N  N    . PHE A 1 24  ? -3.516  -12.633 2.725   1.00 1.91  ? 119 PHE A N    4  
ATOM   8369  C  CA   . PHE A 1 24  ? -2.537  -11.592 3.060   1.00 1.77  ? 119 PHE A CA   4  
ATOM   8370  C  C    . PHE A 1 24  ? -1.923  -11.710 4.469   1.00 2.23  ? 119 PHE A C    4  
ATOM   8371  O  O    . PHE A 1 24  ? -0.792  -11.255 4.651   1.00 2.51  ? 119 PHE A O    4  
ATOM   8372  C  CB   . PHE A 1 24  ? -3.180  -10.199 2.879   1.00 1.66  ? 119 PHE A CB   4  
ATOM   8373  C  CG   . PHE A 1 24  ? -2.387  -9.290  1.961   1.00 1.57  ? 119 PHE A CG   4  
ATOM   8374  C  CD1  . PHE A 1 24  ? -1.137  -8.789  2.374   1.00 2.86  ? 119 PHE A CD1  4  
ATOM   8375  C  CD2  . PHE A 1 24  ? -2.884  -8.962  0.683   1.00 2.20  ? 119 PHE A CD2  4  
ATOM   8376  C  CE1  . PHE A 1 24  ? -0.370  -8.002  1.498   1.00 3.31  ? 119 PHE A CE1  4  
ATOM   8377  C  CE2  . PHE A 1 24  ? -2.124  -8.151  -0.180  1.00 2.51  ? 119 PHE A CE2  4  
ATOM   8378  C  CZ   . PHE A 1 24  ? -0.860  -7.690  0.221   1.00 2.75  ? 119 PHE A CZ   4  
ATOM   8379  H  H    . PHE A 1 24  ? -4.488  -12.364 2.635   1.00 1.90  ? 119 PHE A H    4  
ATOM   8380  H  HA   . PHE A 1 24  ? -1.712  -11.683 2.353   1.00 2.05  ? 119 PHE A HA   4  
ATOM   8381  H  HB2  . PHE A 1 24  ? -4.188  -10.297 2.483   1.00 1.81  ? 119 PHE A HB2  4  
ATOM   8382  H  HB3  . PHE A 1 24  ? -3.280  -9.710  3.849   1.00 2.03  ? 119 PHE A HB3  4  
ATOM   8383  H  HD1  . PHE A 1 24  ? -0.762  -9.012  3.362   1.00 3.42  ? 119 PHE A HD1  4  
ATOM   8384  H  HD2  . PHE A 1 24  ? -3.848  -9.333  0.365   1.00 3.27  ? 119 PHE A HD2  4  
ATOM   8385  H  HE1  . PHE A 1 24  ? 0.594   -7.628  1.807   1.00 4.57  ? 119 PHE A HE1  4  
ATOM   8386  H  HE2  . PHE A 1 24  ? -2.509  -7.881  -1.152  1.00 3.18  ? 119 PHE A HE2  4  
ATOM   8387  H  HZ   . PHE A 1 24  ? -0.265  -7.087  -0.449  1.00 3.44  ? 119 PHE A HZ   4  
ATOM   8388  N  N    . ARG A 1 25  ? -2.661  -12.278 5.440   1.00 1.54  ? 120 ARG A N    4  
ATOM   8389  C  CA   . ARG A 1 25  ? -2.456  -12.170 6.905   1.00 1.62  ? 120 ARG A CA   4  
ATOM   8390  C  C    . ARG A 1 25  ? -0.988  -12.002 7.343   1.00 1.89  ? 120 ARG A C    4  
ATOM   8391  O  O    . ARG A 1 25  ? -0.575  -10.913 7.735   1.00 3.37  ? 120 ARG A O    4  
ATOM   8392  C  CB   . ARG A 1 25  ? -3.130  -13.379 7.592   1.00 1.54  ? 120 ARG A CB   4  
ATOM   8393  C  CG   . ARG A 1 25  ? -3.236  -13.291 9.124   1.00 1.69  ? 120 ARG A CG   4  
ATOM   8394  C  CD   . ARG A 1 25  ? -3.665  -14.637 9.735   1.00 1.96  ? 120 ARG A CD   4  
ATOM   8395  N  NE   . ARG A 1 25  ? -3.975  -14.522 11.172  1.00 2.59  ? 120 ARG A NE   4  
ATOM   8396  C  CZ   . ARG A 1 25  ? -4.207  -15.515 12.025  1.00 2.87  ? 120 ARG A CZ   4  
ATOM   8397  N  NH1  . ARG A 1 25  ? -4.097  -16.787 11.702  1.00 2.89  ? 120 ARG A NH1  4  
ATOM   8398  N  NH2  . ARG A 1 25  ? -4.574  -15.245 13.254  1.00 3.95  ? 120 ARG A NH2  4  
ATOM   8399  H  H    . ARG A 1 25  ? -3.548  -12.669 5.143   1.00 1.77  ? 120 ARG A H    4  
ATOM   8400  H  HA   . ARG A 1 25  ? -2.984  -11.274 7.233   1.00 1.90  ? 120 ARG A HA   4  
ATOM   8401  H  HB2  . ARG A 1 25  ? -4.147  -13.464 7.213   1.00 1.70  ? 120 ARG A HB2  4  
ATOM   8402  H  HB3  . ARG A 1 25  ? -2.586  -14.284 7.333   1.00 1.53  ? 120 ARG A HB3  4  
ATOM   8403  H  HG2  . ARG A 1 25  ? -2.278  -13.000 9.550   1.00 1.71  ? 120 ARG A HG2  4  
ATOM   8404  H  HG3  . ARG A 1 25  ? -3.980  -12.535 9.361   1.00 2.09  ? 120 ARG A HG3  4  
ATOM   8405  H  HD2  . ARG A 1 25  ? -4.554  -14.996 9.212   1.00 2.62  ? 120 ARG A HD2  4  
ATOM   8406  H  HD3  . ARG A 1 25  ? -2.860  -15.359 9.590   1.00 2.35  ? 120 ARG A HD3  4  
ATOM   8407  H  HE   . ARG A 1 25  ? -4.144  -13.585 11.524  1.00 3.44  ? 120 ARG A HE   4  
ATOM   8408  H  HH11 . ARG A 1 25  ? -3.633  -17.054 10.851  1.00 3.03  ? 120 ARG A HH11 4  
ATOM   8409  H  HH12 . ARG A 1 25  ? -4.366  -17.491 12.380  1.00 3.41  ? 120 ARG A HH12 4  
ATOM   8410  H  HH21 . ARG A 1 25  ? -4.537  -14.287 13.601  1.00 4.75  ? 120 ARG A HH21 4  
ATOM   8411  H  HH22 . ARG A 1 25  ? -4.773  -15.992 13.901  1.00 4.22  ? 120 ARG A HH22 4  
ATOM   8412  N  N    . GLY A 1 26  ? -0.195  -13.076 7.287   1.00 1.79  ? 121 GLY A N    4  
ATOM   8413  C  CA   . GLY A 1 26  ? 1.144   -13.145 7.886   1.00 2.05  ? 121 GLY A CA   4  
ATOM   8414  C  C    . GLY A 1 26  ? 2.230   -12.514 7.020   1.00 1.86  ? 121 GLY A C    4  
ATOM   8415  O  O    . GLY A 1 26  ? 3.062   -13.238 6.482   1.00 2.60  ? 121 GLY A O    4  
ATOM   8416  H  H    . GLY A 1 26  ? -0.573  -13.913 6.873   1.00 2.67  ? 121 GLY A H    4  
ATOM   8417  H  HA2  . GLY A 1 26  ? 1.141   -12.622 8.843   1.00 2.35  ? 121 GLY A HA2  4  
ATOM   8418  H  HA3  . GLY A 1 26  ? 1.418   -14.187 8.052   1.00 2.60  ? 121 GLY A HA3  4  
ATOM   8419  N  N    . GLN A 1 27  ? 2.242   -11.182 6.904   1.00 1.50  ? 122 GLN A N    4  
ATOM   8420  C  CA   . GLN A 1 27  ? 3.337   -10.447 6.251   1.00 1.55  ? 122 GLN A CA   4  
ATOM   8421  C  C    . GLN A 1 27  ? 3.833   -9.234  7.048   1.00 1.26  ? 122 GLN A C    4  
ATOM   8422  O  O    . GLN A 1 27  ? 5.039   -9.167  7.259   1.00 2.81  ? 122 GLN A O    4  
ATOM   8423  C  CB   . GLN A 1 27  ? 2.959   -10.051 4.817   1.00 2.06  ? 122 GLN A CB   4  
ATOM   8424  C  CG   . GLN A 1 27  ? 3.000   -11.268 3.878   1.00 3.41  ? 122 GLN A CG   4  
ATOM   8425  C  CD   . GLN A 1 27  ? 3.011   -10.839 2.419   1.00 3.73  ? 122 GLN A CD   4  
ATOM   8426  O  OE1  . GLN A 1 27  ? 4.008   -10.928 1.713   1.00 3.79  ? 122 GLN A OE1  4  
ATOM   8427  N  NE2  . GLN A 1 27  ? 1.915   -10.316 1.918   1.00 4.45  ? 122 GLN A NE2  4  
ATOM   8428  H  H    . GLN A 1 27  ? 1.470   -10.670 7.313   1.00 1.70  ? 122 GLN A H    4  
ATOM   8429  H  HA   . GLN A 1 27  ? 4.208   -11.097 6.164   1.00 2.13  ? 122 GLN A HA   4  
ATOM   8430  H  HB2  . GLN A 1 27  ? 1.971   -9.586  4.798   1.00 2.76  ? 122 GLN A HB2  4  
ATOM   8431  H  HB3  . GLN A 1 27  ? 3.693   -9.324  4.461   1.00 1.85  ? 122 GLN A HB3  4  
ATOM   8432  H  HG2  . GLN A 1 27  ? 3.904   -11.849 4.064   1.00 3.82  ? 122 GLN A HG2  4  
ATOM   8433  H  HG3  . GLN A 1 27  ? 2.133   -11.903 4.061   1.00 4.47  ? 122 GLN A HG3  4  
ATOM   8434  H  HE21 . GLN A 1 27  ? 1.089   -10.215 2.484   1.00 4.85  ? 122 GLN A HE21 4  
ATOM   8435  H  HE22 . GLN A 1 27  ? 1.991   -9.942  0.995   1.00 4.80  ? 122 GLN A HE22 4  
ATOM   8436  N  N    . TRP A 1 28  ? 2.943   -8.315  7.475   1.00 1.56  ? 123 TRP A N    4  
ATOM   8437  C  CA   . TRP A 1 28  ? 3.201   -7.024  8.123   1.00 1.25  ? 123 TRP A CA   4  
ATOM   8438  C  C    . TRP A 1 28  ? 3.357   -5.978  7.005   1.00 1.13  ? 123 TRP A C    4  
ATOM   8439  O  O    . TRP A 1 28  ? 4.384   -5.976  6.342   1.00 1.52  ? 123 TRP A O    4  
ATOM   8440  C  CB   . TRP A 1 28  ? 4.407   -7.078  9.093   1.00 2.02  ? 123 TRP A CB   4  
ATOM   8441  C  CG   . TRP A 1 28  ? 4.258   -6.309  10.358  1.00 1.54  ? 123 TRP A CG   4  
ATOM   8442  C  CD1  . TRP A 1 28  ? 3.620   -5.132  10.486  1.00 1.50  ? 123 TRP A CD1  4  
ATOM   8443  C  CD2  . TRP A 1 28  ? 4.721   -6.660  11.699  1.00 2.94  ? 123 TRP A CD2  4  
ATOM   8444  N  NE1  . TRP A 1 28  ? 3.512   -4.815  11.818  1.00 1.32  ? 123 TRP A NE1  4  
ATOM   8445  C  CE2  . TRP A 1 28  ? 4.208   -5.695  12.614  1.00 1.85  ? 123 TRP A CE2  4  
ATOM   8446  C  CE3  . TRP A 1 28  ? 5.513   -7.699  12.235  1.00 5.29  ? 123 TRP A CE3  4  
ATOM   8447  C  CZ2  . TRP A 1 28  ? 4.441   -5.770  13.993  1.00 2.88  ? 123 TRP A CZ2  4  
ATOM   8448  C  CZ3  . TRP A 1 28  ? 5.788   -7.761  13.615  1.00 6.42  ? 123 TRP A CZ3  4  
ATOM   8449  C  CH2  . TRP A 1 28  ? 5.255   -6.798  14.489  1.00 5.19  ? 123 TRP A CH2  4  
ATOM   8450  H  H    . TRP A 1 28  ? 1.991   -8.409  7.183   1.00 3.02  ? 123 TRP A H    4  
ATOM   8451  H  HA   . TRP A 1 28  ? 2.315   -6.770  8.705   1.00 1.07  ? 123 TRP A HA   4  
ATOM   8452  H  HB2  . TRP A 1 28  ? 4.551   -8.108  9.412   1.00 2.91  ? 123 TRP A HB2  4  
ATOM   8453  H  HB3  . TRP A 1 28  ? 5.321   -6.768  8.584   1.00 2.66  ? 123 TRP A HB3  4  
ATOM   8454  H  HD1  . TRP A 1 28  ? 3.199   -4.575  9.667   1.00 2.93  ? 123 TRP A HD1  4  
ATOM   8455  H  HE1  . TRP A 1 28  ? 2.942   -4.052  12.149  1.00 2.35  ? 123 TRP A HE1  4  
ATOM   8456  H  HE3  . TRP A 1 28  ? 5.916   -8.451  11.573  1.00 6.28  ? 123 TRP A HE3  4  
ATOM   8457  H  HZ2  . TRP A 1 28  ? 4.011   -5.043  14.666  1.00 2.07  ? 123 TRP A HZ2  4  
ATOM   8458  H  HZ3  . TRP A 1 28  ? 6.397   -8.563  14.004  1.00 8.27  ? 123 TRP A HZ3  4  
ATOM   8459  H  HH2  . TRP A 1 28  ? 5.459   -6.847  15.546  1.00 6.07  ? 123 TRP A HH2  4  
ATOM   8460  N  N    . VAL A 1 29  ? 2.338   -5.148  6.724   1.00 0.98  ? 124 VAL A N    4  
ATOM   8461  C  CA   . VAL A 1 29  ? 2.289   -4.322  5.497   1.00 1.24  ? 124 VAL A CA   4  
ATOM   8462  C  C    . VAL A 1 29  ? 1.454   -3.042  5.659   1.00 0.95  ? 124 VAL A C    4  
ATOM   8463  O  O    . VAL A 1 29  ? 0.621   -2.946  6.558   1.00 0.88  ? 124 VAL A O    4  
ATOM   8464  C  CB   . VAL A 1 29  ? 1.746   -5.120  4.282   1.00 1.65  ? 124 VAL A CB   4  
ATOM   8465  C  CG1  . VAL A 1 29  ? 2.731   -6.169  3.744   1.00 3.13  ? 124 VAL A CG1  4  
ATOM   8466  C  CG2  . VAL A 1 29  ? 0.384   -5.779  4.559   1.00 1.47  ? 124 VAL A CG2  4  
ATOM   8467  H  H    . VAL A 1 29  ? 1.477   -5.194  7.264   1.00 0.86  ? 124 VAL A H    4  
ATOM   8468  H  HA   . VAL A 1 29  ? 3.305   -4.005  5.255   1.00 1.69  ? 124 VAL A HA   4  
ATOM   8469  H  HB   . VAL A 1 29  ? 1.579   -4.409  3.485   1.00 2.68  ? 124 VAL A HB   4  
ATOM   8470  H  HG11 . VAL A 1 29  ? 3.712   -5.716  3.597   1.00 4.21  ? 124 VAL A HG11 4  
ATOM   8471  H  HG12 . VAL A 1 29  ? 2.813   -7.005  4.438   1.00 4.01  ? 124 VAL A HG12 4  
ATOM   8472  H  HG13 . VAL A 1 29  ? 2.380   -6.546  2.784   1.00 3.33  ? 124 VAL A HG13 4  
ATOM   8473  H  HG21 . VAL A 1 29  ? 0.035   -6.293  3.667   1.00 1.93  ? 124 VAL A HG21 4  
ATOM   8474  H  HG22 . VAL A 1 29  ? 0.452   -6.496  5.379   1.00 2.20  ? 124 VAL A HG22 4  
ATOM   8475  H  HG23 . VAL A 1 29  ? -0.341  -5.006  4.801   1.00 2.53  ? 124 VAL A HG23 4  
ATOM   8476  N  N    . LEU A 1 30  ? 1.661   -2.072  4.759   1.00 0.94  ? 125 LEU A N    4  
ATOM   8477  C  CA   . LEU A 1 30  ? 0.838   -0.868  4.597   1.00 0.86  ? 125 LEU A CA   4  
ATOM   8478  C  C    . LEU A 1 30  ? -0.105  -1.011  3.392   1.00 0.94  ? 125 LEU A C    4  
ATOM   8479  O  O    . LEU A 1 30  ? 0.260   -1.563  2.353   1.00 1.18  ? 125 LEU A O    4  
ATOM   8480  C  CB   . LEU A 1 30  ? 1.747   0.368   4.413   1.00 1.08  ? 125 LEU A CB   4  
ATOM   8481  C  CG   . LEU A 1 30  ? 2.344   0.938   5.714   1.00 1.39  ? 125 LEU A CG   4  
ATOM   8482  C  CD1  . LEU A 1 30  ? 3.478   1.917   5.377   1.00 1.72  ? 125 LEU A CD1  4  
ATOM   8483  C  CD2  . LEU A 1 30  ? 1.293   1.668   6.565   1.00 3.04  ? 125 LEU A CD2  4  
ATOM   8484  H  H    . LEU A 1 30  ? 2.343   -2.261  4.026   1.00 1.07  ? 125 LEU A H    4  
ATOM   8485  H  HA   . LEU A 1 30  ? 0.218   -0.730  5.480   1.00 0.89  ? 125 LEU A HA   4  
ATOM   8486  H  HB2  . LEU A 1 30  ? 2.561   0.095   3.741   1.00 1.56  ? 125 LEU A HB2  4  
ATOM   8487  H  HB3  . LEU A 1 30  ? 1.178   1.161   3.926   1.00 2.01  ? 125 LEU A HB3  4  
ATOM   8488  H  HG   . LEU A 1 30  ? 2.756   0.124   6.303   1.00 2.16  ? 125 LEU A HG   4  
ATOM   8489  H  HD11 . LEU A 1 30  ? 3.090   2.755   4.800   1.00 2.70  ? 125 LEU A HD11 4  
ATOM   8490  H  HD12 . LEU A 1 30  ? 3.926   2.294   6.297   1.00 2.52  ? 125 LEU A HD12 4  
ATOM   8491  H  HD13 . LEU A 1 30  ? 4.249   1.408   4.799   1.00 2.33  ? 125 LEU A HD13 4  
ATOM   8492  H  HD21 . LEU A 1 30  ? 1.770   2.117   7.437   1.00 4.01  ? 125 LEU A HD21 4  
ATOM   8493  H  HD22 . LEU A 1 30  ? 0.808   2.451   5.981   1.00 3.26  ? 125 LEU A HD22 4  
ATOM   8494  H  HD23 . LEU A 1 30  ? 0.546   0.963   6.915   1.00 3.99  ? 125 LEU A HD23 4  
ATOM   8495  N  N    . MET A 1 31  ? -1.304  -0.440  3.496   1.00 0.86  ? 126 MET A N    4  
ATOM   8496  C  CA   . MET A 1 31  ? -2.218  -0.242  2.365   1.00 0.83  ? 126 MET A CA   4  
ATOM   8497  C  C    . MET A 1 31  ? -2.337  1.249   2.054   1.00 0.77  ? 126 MET A C    4  
ATOM   8498  O  O    . MET A 1 31  ? -2.428  2.052   2.982   1.00 0.87  ? 126 MET A O    4  
ATOM   8499  C  CB   . MET A 1 31  ? -3.599  -0.847  2.672   1.00 1.02  ? 126 MET A CB   4  
ATOM   8500  C  CG   . MET A 1 31  ? -3.515  -2.340  3.026   1.00 1.90  ? 126 MET A CG   4  
ATOM   8501  S  SD   . MET A 1 31  ? -5.118  -3.180  3.138   1.00 1.99  ? 126 MET A SD   4  
ATOM   8502  C  CE   . MET A 1 31  ? -5.260  -3.736  1.421   1.00 3.09  ? 126 MET A CE   4  
ATOM   8503  H  H    . MET A 1 31  ? -1.546  0.003   4.376   1.00 0.83  ? 126 MET A H    4  
ATOM   8504  H  HA   . MET A 1 31  ? -1.821  -0.726  1.477   1.00 0.85  ? 126 MET A HA   4  
ATOM   8505  H  HB2  . MET A 1 31  ? -4.058  -0.307  3.501   1.00 1.38  ? 126 MET A HB2  4  
ATOM   8506  H  HB3  . MET A 1 31  ? -4.233  -0.727  1.792   1.00 1.90  ? 126 MET A HB3  4  
ATOM   8507  H  HG2  . MET A 1 31  ? -2.905  -2.846  2.277   1.00 2.92  ? 126 MET A HG2  4  
ATOM   8508  H  HG3  . MET A 1 31  ? -3.007  -2.444  3.985   1.00 2.57  ? 126 MET A HG3  4  
ATOM   8509  H  HE1  . MET A 1 31  ? -6.263  -4.123  1.236   1.00 3.78  ? 126 MET A HE1  4  
ATOM   8510  H  HE2  . MET A 1 31  ? -5.074  -2.898  0.748   1.00 3.60  ? 126 MET A HE2  4  
ATOM   8511  H  HE3  . MET A 1 31  ? -4.529  -4.520  1.223   1.00 3.93  ? 126 MET A HE3  4  
ATOM   8512  N  N    . TYR A 1 32  ? -2.352  1.608   0.768   1.00 0.73  ? 127 TYR A N    4  
ATOM   8513  C  CA   . TYR A 1 32  ? -2.547  2.974   0.267   1.00 0.70  ? 127 TYR A CA   4  
ATOM   8514  C  C    . TYR A 1 32  ? -3.632  3.027   -0.821  1.00 0.63  ? 127 TYR A C    4  
ATOM   8515  O  O    . TYR A 1 32  ? -3.691  2.143   -1.681  1.00 0.67  ? 127 TYR A O    4  
ATOM   8516  C  CB   . TYR A 1 32  ? -1.226  3.526   -0.297  1.00 0.74  ? 127 TYR A CB   4  
ATOM   8517  C  CG   . TYR A 1 32  ? -1.228  5.041   -0.403  1.00 0.99  ? 127 TYR A CG   4  
ATOM   8518  C  CD1  . TYR A 1 32  ? -0.805  5.791   0.706   1.00 2.34  ? 127 TYR A CD1  4  
ATOM   8519  C  CD2  . TYR A 1 32  ? -1.701  5.704   -1.554  1.00 1.74  ? 127 TYR A CD2  4  
ATOM   8520  C  CE1  . TYR A 1 32  ? -0.862  7.195   0.688   1.00 2.92  ? 127 TYR A CE1  4  
ATOM   8521  C  CE2  . TYR A 1 32  ? -1.752  7.114   -1.585  1.00 2.04  ? 127 TYR A CE2  4  
ATOM   8522  C  CZ   . TYR A 1 32  ? -1.331  7.865   -0.462  1.00 2.26  ? 127 TYR A CZ   4  
ATOM   8523  O  OH   . TYR A 1 32  ? -1.384  9.226   -0.486  1.00 2.96  ? 127 TYR A OH   4  
ATOM   8524  H  H    . TYR A 1 32  ? -2.215  0.891   0.065   1.00 0.80  ? 127 TYR A H    4  
ATOM   8525  H  HA   . TYR A 1 32  ? -2.857  3.613   1.093   1.00 0.77  ? 127 TYR A HA   4  
ATOM   8526  H  HB2  . TYR A 1 32  ? -0.409  3.230   0.362   1.00 1.02  ? 127 TYR A HB2  4  
ATOM   8527  H  HB3  . TYR A 1 32  ? -1.030  3.089   -1.278  1.00 0.81  ? 127 TYR A HB3  4  
ATOM   8528  H  HD1  . TYR A 1 32  ? -0.445  5.275   1.581   1.00 3.31  ? 127 TYR A HD1  4  
ATOM   8529  H  HD2  . TYR A 1 32  ? -2.038  5.138   -2.409  1.00 2.81  ? 127 TYR A HD2  4  
ATOM   8530  H  HE1  . TYR A 1 32  ? -0.553  7.765   1.552   1.00 4.20  ? 127 TYR A HE1  4  
ATOM   8531  H  HE2  . TYR A 1 32  ? -2.115  7.632   -2.462  1.00 2.93  ? 127 TYR A HE2  4  
ATOM   8532  H  HH   . TYR A 1 32  ? -1.015  9.643   0.318   1.00 3.73  ? 127 TYR A HH   4  
ATOM   8533  N  N    . PHE A 1 33  ? -4.459  4.075   -0.797  1.00 0.65  ? 128 PHE A N    4  
ATOM   8534  C  CA   . PHE A 1 33  ? -5.593  4.269   -1.703  1.00 0.69  ? 128 PHE A CA   4  
ATOM   8535  C  C    . PHE A 1 33  ? -5.452  5.599   -2.466  1.00 1.85  ? 128 PHE A C    4  
ATOM   8536  O  O    . PHE A 1 33  ? -5.489  6.668   -1.851  1.00 2.20  ? 128 PHE A O    4  
ATOM   8537  C  CB   . PHE A 1 33  ? -6.882  4.205   -0.868  1.00 0.88  ? 128 PHE A CB   4  
ATOM   8538  C  CG   . PHE A 1 33  ? -7.133  2.852   -0.222  1.00 1.04  ? 128 PHE A CG   4  
ATOM   8539  C  CD1  . PHE A 1 33  ? -6.627  2.569   1.064   1.00 1.88  ? 128 PHE A CD1  4  
ATOM   8540  C  CD2  . PHE A 1 33  ? -7.857  1.863   -0.913  1.00 2.30  ? 128 PHE A CD2  4  
ATOM   8541  C  CE1  . PHE A 1 33  ? -6.841  1.308   1.650   1.00 2.14  ? 128 PHE A CE1  4  
ATOM   8542  C  CE2  . PHE A 1 33  ? -8.077  0.604   -0.325  1.00 2.37  ? 128 PHE A CE2  4  
ATOM   8543  C  CZ   . PHE A 1 33  ? -7.567  0.325   0.957   1.00 1.73  ? 128 PHE A CZ   4  
ATOM   8544  H  H    . PHE A 1 33  ? -4.333  4.758   -0.059  1.00 0.74  ? 128 PHE A H    4  
ATOM   8545  H  HA   . PHE A 1 33  ? -5.630  3.460   -2.432  1.00 0.68  ? 128 PHE A HA   4  
ATOM   8546  H  HB2  . PHE A 1 33  ? -6.844  4.974   -0.097  1.00 0.97  ? 128 PHE A HB2  4  
ATOM   8547  H  HB3  . PHE A 1 33  ? -7.727  4.440   -1.511  1.00 0.96  ? 128 PHE A HB3  4  
ATOM   8548  H  HD1  . PHE A 1 33  ? -6.063  3.317   1.599   1.00 2.90  ? 128 PHE A HD1  4  
ATOM   8549  H  HD2  . PHE A 1 33  ? -8.243  2.066   -1.903  1.00 3.35  ? 128 PHE A HD2  4  
ATOM   8550  H  HE1  . PHE A 1 33  ? -6.446  1.097   2.633   1.00 3.11  ? 128 PHE A HE1  4  
ATOM   8551  H  HE2  . PHE A 1 33  ? -8.637  -0.149  -0.863  1.00 3.78  ? 128 PHE A HE2  4  
ATOM   8552  H  HZ   . PHE A 1 33  ? -7.733  -0.643  1.406   1.00 2.09  ? 128 PHE A HZ   4  
ATOM   8553  N  N    . GLY A 1 34  ? -5.275  5.520   -3.794  1.00 0.83  ? 129 GLY A N    4  
ATOM   8554  C  CA   . GLY A 1 34  ? -4.935  6.652   -4.674  1.00 1.01  ? 129 GLY A CA   4  
ATOM   8555  C  C    . GLY A 1 34  ? -5.766  6.769   -5.961  1.00 1.11  ? 129 GLY A C    4  
ATOM   8556  O  O    . GLY A 1 34  ? -6.620  5.935   -6.258  1.00 1.18  ? 129 GLY A O    4  
ATOM   8557  H  H    . GLY A 1 34  ? -5.299  4.593   -4.217  1.00 0.84  ? 129 GLY A H    4  
ATOM   8558  H  HA2  . GLY A 1 34  ? -5.006  7.594   -4.129  1.00 1.15  ? 129 GLY A HA2  4  
ATOM   8559  H  HA3  . GLY A 1 34  ? -3.895  6.547   -4.977  1.00 1.09  ? 129 GLY A HA3  4  
ATOM   8560  N  N    . PHE A 1 35  ? -5.502  7.829   -6.730  1.00 1.30  ? 130 PHE A N    4  
ATOM   8561  C  CA   . PHE A 1 35  ? -6.301  8.282   -7.885  1.00 1.70  ? 130 PHE A CA   4  
ATOM   8562  C  C    . PHE A 1 35  ? -5.641  8.011   -9.263  1.00 1.65  ? 130 PHE A C    4  
ATOM   8563  O  O    . PHE A 1 35  ? -6.086  8.553   -10.273 1.00 2.54  ? 130 PHE A O    4  
ATOM   8564  C  CB   . PHE A 1 35  ? -6.596  9.777   -7.629  1.00 2.42  ? 130 PHE A CB   4  
ATOM   8565  C  CG   . PHE A 1 35  ? -7.429  10.519  -8.662  1.00 1.77  ? 130 PHE A CG   4  
ATOM   8566  C  CD1  . PHE A 1 35  ? -8.778  10.178  -8.872  1.00 2.17  ? 130 PHE A CD1  4  
ATOM   8567  C  CD2  . PHE A 1 35  ? -6.850  11.555  -9.420  1.00 2.84  ? 130 PHE A CD2  4  
ATOM   8568  C  CE1  . PHE A 1 35  ? -9.530  10.848  -9.852  1.00 2.64  ? 130 PHE A CE1  4  
ATOM   8569  C  CE2  . PHE A 1 35  ? -7.596  12.208  -10.419 1.00 3.00  ? 130 PHE A CE2  4  
ATOM   8570  C  CZ   . PHE A 1 35  ? -8.936  11.847  -10.644 1.00 2.51  ? 130 PHE A CZ   4  
ATOM   8571  H  H    . PHE A 1 35  ? -4.788  8.474   -6.394  1.00 1.36  ? 130 PHE A H    4  
ATOM   8572  H  HA   . PHE A 1 35  ? -7.252  7.747   -7.894  1.00 2.29  ? 130 PHE A HA   4  
ATOM   8573  H  HB2  . PHE A 1 35  ? -7.135  9.843   -6.687  1.00 3.48  ? 130 PHE A HB2  4  
ATOM   8574  H  HB3  . PHE A 1 35  ? -5.651  10.307  -7.496  1.00 3.37  ? 130 PHE A HB3  4  
ATOM   8575  H  HD1  . PHE A 1 35  ? -9.237  9.395   -8.283  1.00 3.15  ? 130 PHE A HD1  4  
ATOM   8576  H  HD2  . PHE A 1 35  ? -5.823  11.843  -9.245  1.00 4.06  ? 130 PHE A HD2  4  
ATOM   8577  H  HE1  . PHE A 1 35  ? -10.566 10.586  -9.999  1.00 4.11  ? 130 PHE A HE1  4  
ATOM   8578  H  HE2  . PHE A 1 35  ? -7.123  12.974  -11.017 1.00 3.94  ? 130 PHE A HE2  4  
ATOM   8579  H  HZ   . PHE A 1 35  ? -9.506  12.332  -11.424 1.00 3.25  ? 130 PHE A HZ   4  
ATOM   8580  N  N    . THR A 1 36  ? -4.543  7.233   -9.318  1.00 1.55  ? 131 THR A N    4  
ATOM   8581  C  CA   . THR A 1 36  ? -3.731  6.900   -10.524 1.00 1.65  ? 131 THR A CA   4  
ATOM   8582  C  C    . THR A 1 36  ? -2.871  8.086   -10.978 1.00 2.07  ? 131 THR A C    4  
ATOM   8583  O  O    . THR A 1 36  ? -1.706  7.884   -11.315 1.00 3.38  ? 131 THR A O    4  
ATOM   8584  C  CB   . THR A 1 36  ? -4.589  6.368   -11.689 1.00 1.69  ? 131 THR A CB   4  
ATOM   8585  O  OG1  . THR A 1 36  ? -5.346  5.271   -11.241 1.00 2.66  ? 131 THR A OG1  4  
ATOM   8586  C  CG2  . THR A 1 36  ? -3.740  5.854   -12.854 1.00 1.54  ? 131 THR A CG2  4  
ATOM   8587  H  H    . THR A 1 36  ? -4.260  6.817   -8.444  1.00 2.55  ? 131 THR A H    4  
ATOM   8588  H  HA   . THR A 1 36  ? -3.040  6.091   -10.282 1.00 1.94  ? 131 THR A HA   4  
ATOM   8589  H  HB   . THR A 1 36  ? -5.260  7.144   -12.062 1.00 2.22  ? 131 THR A HB   4  
ATOM   8590  H  HG1  . THR A 1 36  ? -6.046  5.135   -11.932 1.00 2.73  ? 131 THR A HG1  4  
ATOM   8591  H  HG21 . THR A 1 36  ? -4.389  5.401   -13.604 1.00 2.40  ? 131 THR A HG21 4  
ATOM   8592  H  HG22 . THR A 1 36  ? -3.197  6.677   -13.316 1.00 2.30  ? 131 THR A HG22 4  
ATOM   8593  H  HG23 . THR A 1 36  ? -3.030  5.106   -12.497 1.00 2.32  ? 131 THR A HG23 4  
ATOM   8594  N  N    . HIS A 1 37  ? -3.391  9.324   -10.953 1.00 1.53  ? 132 HIS A N    4  
ATOM   8595  C  CA   . HIS A 1 37  ? -2.646  10.540  -11.288 1.00 1.96  ? 132 HIS A CA   4  
ATOM   8596  C  C    . HIS A 1 37  ? -3.287  11.790  -10.671 1.00 1.50  ? 132 HIS A C    4  
ATOM   8597  O  O    . HIS A 1 37  ? -4.124  12.439  -11.295 1.00 2.09  ? 132 HIS A O    4  
ATOM   8598  C  CB   . HIS A 1 37  ? -2.482  10.665  -12.818 1.00 2.88  ? 132 HIS A CB   4  
ATOM   8599  C  CG   . HIS A 1 37  ? -1.887  11.987  -13.254 1.00 3.34  ? 132 HIS A CG   4  
ATOM   8600  N  ND1  . HIS A 1 37  ? -2.516  12.933  -14.045 1.00 3.38  ? 132 HIS A ND1  4  
ATOM   8601  C  CD2  . HIS A 1 37  ? -0.685  12.514  -12.859 1.00 4.70  ? 132 HIS A CD2  4  
ATOM   8602  C  CE1  . HIS A 1 37  ? -1.712  14.005  -14.135 1.00 4.25  ? 132 HIS A CE1  4  
ATOM   8603  N  NE2  . HIS A 1 37  ? -0.592  13.775  -13.424 1.00 5.08  ? 132 HIS A NE2  4  
ATOM   8604  H  H    . HIS A 1 37  ? -4.365  9.420   -10.692 1.00 1.53  ? 132 HIS A H    4  
ATOM   8605  H  HA   . HIS A 1 37  ? -1.647  10.450  -10.861 1.00 2.53  ? 132 HIS A HA   4  
ATOM   8606  H  HB2  . HIS A 1 37  ? -1.848  9.856   -13.183 1.00 3.75  ? 132 HIS A HB2  4  
ATOM   8607  H  HB3  . HIS A 1 37  ? -3.464  10.559  -13.284 1.00 3.09  ? 132 HIS A HB3  4  
ATOM   8608  H  HD1  . HIS A 1 37  ? -3.417  12.838  -14.506 1.00 3.56  ? 132 HIS A HD1  4  
ATOM   8609  H  HD2  . HIS A 1 37  ? 0.035   12.053  -12.192 1.00 5.71  ? 132 HIS A HD2  4  
ATOM   8610  H  HE1  . HIS A 1 37  ? -1.928  14.901  -14.705 1.00 4.76  ? 132 HIS A HE1  4  
ATOM   8611  H  HE2  . HIS A 1 37  ? 0.191   14.430  -13.351 1.00 6.18  ? 132 HIS A HE2  4  
ATOM   8612  N  N    . CYS A 1 38  ? -2.766  12.176  -9.509  1.00 1.53  ? 133 CYS A N    4  
ATOM   8613  C  CA   . CYS A 1 38  ? -2.717  13.546  -9.036  1.00 1.37  ? 133 CYS A CA   4  
ATOM   8614  C  C    . CYS A 1 38  ? -1.415  14.183  -9.555  1.00 1.77  ? 133 CYS A C    4  
ATOM   8615  O  O    . CYS A 1 38  ? -0.468  13.454  -9.878  1.00 2.13  ? 133 CYS A O    4  
ATOM   8616  C  CB   . CYS A 1 38  ? -2.757  13.528  -7.504  1.00 1.55  ? 133 CYS A CB   4  
ATOM   8617  S  SG   . CYS A 1 38  ? -4.424  13.322  -6.853  1.00 2.40  ? 133 CYS A SG   4  
ATOM   8618  H  H    . CYS A 1 38  ? -2.053  11.607  -9.103  1.00 2.27  ? 133 CYS A H    4  
ATOM   8619  H  HA   . CYS A 1 38  ? -3.578  14.100  -9.411  1.00 1.72  ? 133 CYS A HA   4  
ATOM   8620  H  HB2  . CYS A 1 38  ? -2.126  12.726  -7.124  1.00 1.76  ? 133 CYS A HB2  4  
ATOM   8621  H  HB3  . CYS A 1 38  ? -2.375  14.474  -7.121  1.00 2.46  ? 133 CYS A HB3  4  
ATOM   8622  N  N    . PRO A 1 39  ? -1.341  15.522  -9.625  1.00 2.22  ? 134 PRO A N    4  
ATOM   8623  C  CA   . PRO A 1 39  ? -0.182  16.221  -10.170 1.00 2.81  ? 134 PRO A CA   4  
ATOM   8624  C  C    . PRO A 1 39  ? 1.050   16.150  -9.260  1.00 2.62  ? 134 PRO A C    4  
ATOM   8625  O  O    . PRO A 1 39  ? 2.162   16.075  -9.778  1.00 3.73  ? 134 PRO A O    4  
ATOM   8626  C  CB   . PRO A 1 39  ? -0.671  17.653  -10.375 1.00 3.49  ? 134 PRO A CB   4  
ATOM   8627  C  CG   . PRO A 1 39  ? -1.738  17.827  -9.294  1.00 3.26  ? 134 PRO A CG   4  
ATOM   8628  C  CD   . PRO A 1 39  ? -2.402  16.458  -9.283  1.00 2.60  ? 134 PRO A CD   4  
ATOM   8629  H  HA   . PRO A 1 39  ? 0.085   15.796  -11.139 1.00 3.15  ? 134 PRO A HA   4  
ATOM   8630  H  HB2  . PRO A 1 39  ? 0.135   18.379  -10.281 1.00 3.94  ? 134 PRO A HB2  4  
ATOM   8631  H  HB3  . PRO A 1 39  ? -1.145  17.710  -11.353 1.00 3.86  ? 134 PRO A HB3  4  
ATOM   8632  H  HG2  . PRO A 1 39  ? -1.267  18.003  -8.328  1.00 3.32  ? 134 PRO A HG2  4  
ATOM   8633  H  HG3  . PRO A 1 39  ? -2.448  18.614  -9.541  1.00 3.68  ? 134 PRO A HG3  4  
ATOM   8634  H  HD2  . PRO A 1 39  ? -2.829  16.257  -8.300  1.00 2.42  ? 134 PRO A HD2  4  
ATOM   8635  H  HD3  . PRO A 1 39  ? -3.181  16.419  -10.046 1.00 2.87  ? 134 PRO A HD3  4  
ATOM   8636  N  N    . ASP A 1 40  ? 0.861   16.139  -7.931  1.00 1.72  ? 135 ASP A N    4  
ATOM   8637  C  CA   . ASP A 1 40  ? 1.930   16.048  -6.922  1.00 1.58  ? 135 ASP A CA   4  
ATOM   8638  C  C    . ASP A 1 40  ? 1.409   15.660  -5.515  1.00 1.40  ? 135 ASP A C    4  
ATOM   8639  O  O    . ASP A 1 40  ? 1.962   16.090  -4.500  1.00 1.54  ? 135 ASP A O    4  
ATOM   8640  C  CB   . ASP A 1 40  ? 2.816   17.316  -6.930  1.00 2.04  ? 135 ASP A CB   4  
ATOM   8641  C  CG   . ASP A 1 40  ? 2.146   18.570  -6.367  1.00 2.86  ? 135 ASP A CG   4  
ATOM   8642  O  OD1  . ASP A 1 40  ? 1.410   19.263  -7.108  1.00 3.86  ? 135 ASP A OD1  4  
ATOM   8643  O  OD2  . ASP A 1 40  ? 2.426   18.894  -5.188  1.00 3.95  ? 135 ASP A OD2  4  
ATOM   8644  H  H    . ASP A 1 40  ? -0.070  16.330  -7.593  1.00 1.83  ? 135 ASP A H    4  
ATOM   8645  H  HA   . ASP A 1 40  ? 2.576   15.224  -7.232  1.00 1.69  ? 135 ASP A HA   4  
ATOM   8646  H  HB2  . ASP A 1 40  ? 3.712   17.106  -6.340  1.00 2.96  ? 135 ASP A HB2  4  
ATOM   8647  H  HB3  . ASP A 1 40  ? 3.162   17.528  -7.941  1.00 3.04  ? 135 ASP A HB3  4  
ATOM   8648  N  N    . ILE A 1 41  ? 0.329   14.865  -5.453  1.00 1.43  ? 136 ILE A N    4  
ATOM   8649  C  CA   . ILE A 1 41  ? -0.251  14.325  -4.202  1.00 1.61  ? 136 ILE A CA   4  
ATOM   8650  C  C    . ILE A 1 41  ? 0.076   12.826  -4.106  1.00 1.50  ? 136 ILE A C    4  
ATOM   8651  O  O    . ILE A 1 41  ? 1.142   12.500  -3.584  1.00 1.51  ? 136 ILE A O    4  
ATOM   8652  C  CB   . ILE A 1 41  ? -1.762  14.665  -4.060  1.00 2.05  ? 136 ILE A CB   4  
ATOM   8653  C  CG1  . ILE A 1 41  ? -2.017  16.180  -4.265  1.00 2.73  ? 136 ILE A CG1  4  
ATOM   8654  C  CG2  . ILE A 1 41  ? -2.261  14.209  -2.672  1.00 2.11  ? 136 ILE A CG2  4  
ATOM   8655  C  CD1  . ILE A 1 41  ? -3.490  16.597  -4.176  1.00 4.13  ? 136 ILE A CD1  4  
ATOM   8656  H  H    . ILE A 1 41  ? -0.027  14.510  -6.328  1.00 1.55  ? 136 ILE A H    4  
ATOM   8657  H  HA   . ILE A 1 41  ? 0.258   14.778  -3.350  1.00 1.68  ? 136 ILE A HA   4  
ATOM   8658  H  HB   . ILE A 1 41  ? -2.331  14.124  -4.816  1.00 2.67  ? 136 ILE A HB   4  
ATOM   8659  H  HG12 . ILE A 1 41  ? -1.446  16.747  -3.527  1.00 2.48  ? 136 ILE A HG12 4  
ATOM   8660  H  HG13 . ILE A 1 41  ? -1.669  16.472  -5.256  1.00 3.63  ? 136 ILE A HG13 4  
ATOM   8661  H  HG21 . ILE A 1 41  ? -3.341  14.335  -2.599  1.00 2.88  ? 136 ILE A HG21 4  
ATOM   8662  H  HG22 . ILE A 1 41  ? -2.050  13.151  -2.513  1.00 2.87  ? 136 ILE A HG22 4  
ATOM   8663  H  HG23 . ILE A 1 41  ? -1.777  14.789  -1.888  1.00 2.26  ? 136 ILE A HG23 4  
ATOM   8664  H  HD11 . ILE A 1 41  ? -3.858  16.488  -3.157  1.00 4.31  ? 136 ILE A HD11 4  
ATOM   8665  H  HD12 . ILE A 1 41  ? -3.586  17.645  -4.466  1.00 4.67  ? 136 ILE A HD12 4  
ATOM   8666  H  HD13 . ILE A 1 41  ? -4.091  15.986  -4.853  1.00 5.24  ? 136 ILE A HD13 4  
ATOM   8667  N  N    . CYS A 1 42  ? -0.759  11.946  -4.682  1.00 1.50  ? 137 CYS A N    4  
ATOM   8668  C  CA   . CYS A 1 42  ? -0.526  10.502  -4.813  1.00 1.55  ? 137 CYS A CA   4  
ATOM   8669  C  C    . CYS A 1 42  ? 0.955   10.107  -5.059  1.00 1.44  ? 137 CYS A C    4  
ATOM   8670  O  O    . CYS A 1 42  ? 1.487   9.310   -4.283  1.00 1.46  ? 137 CYS A O    4  
ATOM   8671  C  CB   . CYS A 1 42  ? -1.444  9.958   -5.927  1.00 1.66  ? 137 CYS A CB   4  
ATOM   8672  S  SG   . CYS A 1 42  ? -3.191  9.699   -5.506  1.00 1.95  ? 137 CYS A SG   4  
ATOM   8673  H  H    . CYS A 1 42  ? -1.662  12.264  -5.005  1.00 1.56  ? 137 CYS A H    4  
ATOM   8674  H  HA   . CYS A 1 42  ? -0.828  10.028  -3.878  1.00 1.69  ? 137 CYS A HA   4  
ATOM   8675  H  HB2  . CYS A 1 42  ? -1.401  10.617  -6.791  1.00 1.64  ? 137 CYS A HB2  4  
ATOM   8676  H  HB3  . CYS A 1 42  ? -1.048  8.990   -6.234  1.00 1.82  ? 137 CYS A HB3  4  
ATOM   8677  N  N    . PRO A 1 43  ? 1.658   10.637  -6.089  1.00 1.40  ? 138 PRO A N    4  
ATOM   8678  C  CA   . PRO A 1 43  ? 3.037   10.241  -6.372  1.00 1.46  ? 138 PRO A CA   4  
ATOM   8679  C  C    . PRO A 1 43  ? 4.071   10.827  -5.395  1.00 1.44  ? 138 PRO A C    4  
ATOM   8680  O  O    . PRO A 1 43  ? 5.163   10.276  -5.289  1.00 1.53  ? 138 PRO A O    4  
ATOM   8681  C  CB   . PRO A 1 43  ? 3.310   10.719  -7.803  1.00 1.54  ? 138 PRO A CB   4  
ATOM   8682  C  CG   . PRO A 1 43  ? 2.414   11.948  -7.936  1.00 1.45  ? 138 PRO A CG   4  
ATOM   8683  C  CD   . PRO A 1 43  ? 1.180   11.533  -7.140  1.00 1.40  ? 138 PRO A CD   4  
ATOM   8684  H  HA   . PRO A 1 43  ? 3.117   9.156   -6.348  1.00 1.53  ? 138 PRO A HA   4  
ATOM   8685  H  HB2  . PRO A 1 43  ? 4.361   10.963  -7.967  1.00 1.62  ? 138 PRO A HB2  4  
ATOM   8686  H  HB3  . PRO A 1 43  ? 2.985   9.953   -8.509  1.00 1.64  ? 138 PRO A HB3  4  
ATOM   8687  H  HG2  . PRO A 1 43  ? 2.891   12.806  -7.460  1.00 1.42  ? 138 PRO A HG2  4  
ATOM   8688  H  HG3  . PRO A 1 43  ? 2.172   12.168  -8.976  1.00 1.52  ? 138 PRO A HG3  4  
ATOM   8689  H  HD2  . PRO A 1 43  ? 0.694   12.419  -6.739  1.00 1.37  ? 138 PRO A HD2  4  
ATOM   8690  H  HD3  . PRO A 1 43  ? 0.498   10.992  -7.798  1.00 1.47  ? 138 PRO A HD3  4  
ATOM   8691  N  N    . ASP A 1 44  ? 3.771   11.929  -4.693  1.00 1.40  ? 139 ASP A N    4  
ATOM   8692  C  CA   . ASP A 1 44  ? 4.705   12.553  -3.757  1.00 1.44  ? 139 ASP A CA   4  
ATOM   8693  C  C    . ASP A 1 44  ? 4.755   11.704  -2.489  1.00 1.29  ? 139 ASP A C    4  
ATOM   8694  O  O    . ASP A 1 44  ? 5.844   11.327  -2.067  1.00 1.23  ? 139 ASP A O    4  
ATOM   8695  C  CB   . ASP A 1 44  ? 4.297   14.013  -3.500  1.00 1.64  ? 139 ASP A CB   4  
ATOM   8696  C  CG   . ASP A 1 44  ? 5.392   14.895  -2.881  1.00 1.90  ? 139 ASP A CG   4  
ATOM   8697  O  OD1  . ASP A 1 44  ? 6.331   14.393  -2.219  1.00 2.31  ? 139 ASP A OD1  4  
ATOM   8698  O  OD2  . ASP A 1 44  ? 5.294   16.136  -3.059  1.00 2.81  ? 139 ASP A OD2  4  
ATOM   8699  H  H    . ASP A 1 44  ? 2.798   12.163  -4.543  1.00 1.36  ? 139 ASP A H    4  
ATOM   8700  H  HA   . ASP A 1 44  ? 5.700   12.554  -4.203  1.00 1.56  ? 139 ASP A HA   4  
ATOM   8701  H  HB2  . ASP A 1 44  ? 4.032   14.454  -4.462  1.00 1.87  ? 139 ASP A HB2  4  
ATOM   8702  H  HB3  . ASP A 1 44  ? 3.412   14.040  -2.862  1.00 1.61  ? 139 ASP A HB3  4  
ATOM   8703  N  N    . GLU A 1 45  ? 3.582   11.325  -1.954  1.00 1.31  ? 140 GLU A N    4  
ATOM   8704  C  CA   . GLU A 1 45  ? 3.416   10.332  -0.901  1.00 1.32  ? 140 GLU A CA   4  
ATOM   8705  C  C    . GLU A 1 45  ? 3.851   8.914   -1.326  1.00 1.29  ? 140 GLU A C    4  
ATOM   8706  O  O    . GLU A 1 45  ? 4.371   8.174   -0.492  1.00 1.34  ? 140 GLU A O    4  
ATOM   8707  C  CB   . GLU A 1 45  ? 1.997   10.366  -0.309  1.00 1.33  ? 140 GLU A CB   4  
ATOM   8708  C  CG   . GLU A 1 45  ? 1.935   9.555   1.003   1.00 1.92  ? 140 GLU A CG   4  
ATOM   8709  C  CD   . GLU A 1 45  ? 0.937   10.126  2.011   1.00 2.59  ? 140 GLU A CD   4  
ATOM   8710  O  OE1  . GLU A 1 45  ? -0.225  10.388  1.633   1.00 3.67  ? 140 GLU A OE1  4  
ATOM   8711  O  OE2  . GLU A 1 45  ? 1.340   10.365  3.175   1.00 3.02  ? 140 GLU A OE2  4  
ATOM   8712  H  H    . GLU A 1 45  ? 2.740   11.738  -2.319  1.00 1.40  ? 140 GLU A H    4  
ATOM   8713  H  HA   . GLU A 1 45  ? 4.051   10.660  -0.096  1.00 1.41  ? 140 GLU A HA   4  
ATOM   8714  H  HB2  . GLU A 1 45  ? 1.747   11.405  -0.092  1.00 1.56  ? 140 GLU A HB2  4  
ATOM   8715  H  HB3  . GLU A 1 45  ? 1.277   9.975   -1.029  1.00 1.98  ? 140 GLU A HB3  4  
ATOM   8716  H  HG2  . GLU A 1 45  ? 1.678   8.520   0.776   1.00 3.02  ? 140 GLU A HG2  4  
ATOM   8717  H  HG3  . GLU A 1 45  ? 2.917   9.554   1.478   1.00 2.45  ? 140 GLU A HG3  4  
ATOM   8718  N  N    . LEU A 1 46  ? 3.756   8.530   -2.606  1.00 1.26  ? 141 LEU A N    4  
ATOM   8719  C  CA   . LEU A 1 46  ? 4.336   7.263   -3.076  1.00 1.28  ? 141 LEU A CA   4  
ATOM   8720  C  C    . LEU A 1 46  ? 5.870   7.293   -3.020  1.00 1.26  ? 141 LEU A C    4  
ATOM   8721  O  O    . LEU A 1 46  ? 6.479   6.353   -2.508  1.00 1.30  ? 141 LEU A O    4  
ATOM   8722  C  CB   . LEU A 1 46  ? 3.799   6.917   -4.476  1.00 1.31  ? 141 LEU A CB   4  
ATOM   8723  C  CG   . LEU A 1 46  ? 4.188   5.515   -4.990  1.00 1.90  ? 141 LEU A CG   4  
ATOM   8724  C  CD1  . LEU A 1 46  ? 3.731   4.389   -4.048  1.00 2.48  ? 141 LEU A CD1  4  
ATOM   8725  C  CD2  . LEU A 1 46  ? 3.560   5.293   -6.373  1.00 2.64  ? 141 LEU A CD2  4  
ATOM   8726  H  H    . LEU A 1 46  ? 3.230   9.103   -3.259  1.00 1.26  ? 141 LEU A H    4  
ATOM   8727  H  HA   . LEU A 1 46  ? 4.011   6.489   -2.382  1.00 1.32  ? 141 LEU A HA   4  
ATOM   8728  H  HB2  . LEU A 1 46  ? 2.710   6.984   -4.456  1.00 1.90  ? 141 LEU A HB2  4  
ATOM   8729  H  HB3  . LEU A 1 46  ? 4.175   7.657   -5.183  1.00 1.85  ? 141 LEU A HB3  4  
ATOM   8730  H  HG   . LEU A 1 46  ? 5.272   5.461   -5.096  1.00 3.14  ? 141 LEU A HG   4  
ATOM   8731  H  HD11 . LEU A 1 46  ? 2.667   4.494   -3.827  1.00 2.90  ? 141 LEU A HD11 4  
ATOM   8732  H  HD12 . LEU A 1 46  ? 3.898   3.421   -4.521  1.00 3.41  ? 141 LEU A HD12 4  
ATOM   8733  H  HD13 . LEU A 1 46  ? 4.299   4.418   -3.120  1.00 3.18  ? 141 LEU A HD13 4  
ATOM   8734  H  HD21 . LEU A 1 46  ? 3.849   6.097   -7.048  1.00 3.53  ? 141 LEU A HD21 4  
ATOM   8735  H  HD22 . LEU A 1 46  ? 3.903   4.344   -6.790  1.00 3.27  ? 141 LEU A HD22 4  
ATOM   8736  H  HD23 . LEU A 1 46  ? 2.473   5.274   -6.288  1.00 2.98  ? 141 LEU A HD23 4  
ATOM   8737  N  N    . GLU A 1 47  ? 6.510   8.388   -3.448  1.00 1.22  ? 142 GLU A N    4  
ATOM   8738  C  CA   . GLU A 1 47  ? 7.945   8.597   -3.211  1.00 1.18  ? 142 GLU A CA   4  
ATOM   8739  C  C    . GLU A 1 47  ? 8.250   8.662   -1.706  1.00 1.20  ? 142 GLU A C    4  
ATOM   8740  O  O    . GLU A 1 47  ? 9.241   8.107   -1.242  1.00 1.21  ? 142 GLU A O    4  
ATOM   8741  C  CB   . GLU A 1 47  ? 8.437   9.861   -3.930  1.00 1.16  ? 142 GLU A CB   4  
ATOM   8742  C  CG   . GLU A 1 47  ? 9.954   10.033  -3.787  1.00 1.28  ? 142 GLU A CG   4  
ATOM   8743  C  CD   . GLU A 1 47  ? 10.465  11.170  -4.659  1.00 2.29  ? 142 GLU A CD   4  
ATOM   8744  O  OE1  . GLU A 1 47  ? 10.085  12.339  -4.408  1.00 3.17  ? 142 GLU A OE1  4  
ATOM   8745  O  OE2  . GLU A 1 47  ? 11.265  10.900  -5.588  1.00 3.31  ? 142 GLU A OE2  4  
ATOM   8746  H  H    . GLU A 1 47  ? 5.966   9.132   -3.873  1.00 1.24  ? 142 GLU A H    4  
ATOM   8747  H  HA   . GLU A 1 47  ? 8.486   7.748   -3.626  1.00 1.24  ? 142 GLU A HA   4  
ATOM   8748  H  HB2  . GLU A 1 47  ? 8.200   9.777   -4.990  1.00 1.20  ? 142 GLU A HB2  4  
ATOM   8749  H  HB3  . GLU A 1 47  ? 7.934   10.741  -3.528  1.00 1.26  ? 142 GLU A HB3  4  
ATOM   8750  H  HG2  . GLU A 1 47  ? 10.205  10.253  -2.748  1.00 1.58  ? 142 GLU A HG2  4  
ATOM   8751  H  HG3  . GLU A 1 47  ? 10.451  9.105   -4.076  1.00 1.70  ? 142 GLU A HG3  4  
ATOM   8752  N  N    . LYS A 1 48  ? 7.362   9.266   -0.919  1.00 1.28  ? 143 LYS A N    4  
ATOM   8753  C  CA   . LYS A 1 48  ? 7.456   9.374   0.538   1.00 1.33  ? 143 LYS A CA   4  
ATOM   8754  C  C    . LYS A 1 48  ? 7.471   7.985   1.204   1.00 1.38  ? 143 LYS A C    4  
ATOM   8755  O  O    . LYS A 1 48  ? 8.345   7.701   2.026   1.00 1.46  ? 143 LYS A O    4  
ATOM   8756  C  CB   . LYS A 1 48  ? 6.308   10.303  0.983   1.00 1.37  ? 143 LYS A CB   4  
ATOM   8757  C  CG   . LYS A 1 48  ? 6.535   11.227  2.171   1.00 1.44  ? 143 LYS A CG   4  
ATOM   8758  C  CD   . LYS A 1 48  ? 7.751   12.168  2.049   1.00 1.98  ? 143 LYS A CD   4  
ATOM   8759  C  CE   . LYS A 1 48  ? 7.696   13.153  0.861   1.00 2.87  ? 143 LYS A CE   4  
ATOM   8760  N  NZ   . LYS A 1 48  ? 8.033   12.567  -0.464  1.00 3.94  ? 143 LYS A NZ   4  
ATOM   8761  H  H    . LYS A 1 48  ? 6.552   9.683   -1.369  1.00 1.32  ? 143 LYS A H    4  
ATOM   8762  H  HA   . LYS A 1 48  ? 8.406   9.832   0.778   1.00 1.33  ? 143 LYS A HA   4  
ATOM   8763  H  HB2  . LYS A 1 48  ? 6.082   10.989  0.187   1.00 1.59  ? 143 LYS A HB2  4  
ATOM   8764  H  HB3  . LYS A 1 48  ? 5.398   9.728   1.131   1.00 1.35  ? 143 LYS A HB3  4  
ATOM   8765  H  HG2  . LYS A 1 48  ? 5.643   11.843  2.294   1.00 2.04  ? 143 LYS A HG2  4  
ATOM   8766  H  HG3  . LYS A 1 48  ? 6.608   10.605  3.048   1.00 1.65  ? 143 LYS A HG3  4  
ATOM   8767  H  HD2  . LYS A 1 48  ? 7.777   12.769  2.959   1.00 2.32  ? 143 LYS A HD2  4  
ATOM   8768  H  HD3  . LYS A 1 48  ? 8.679   11.598  2.024   1.00 2.56  ? 143 LYS A HD3  4  
ATOM   8769  H  HE2  . LYS A 1 48  ? 6.696   13.593  0.820   1.00 3.16  ? 143 LYS A HE2  4  
ATOM   8770  H  HE3  . LYS A 1 48  ? 8.396   13.968  1.065   1.00 3.30  ? 143 LYS A HE3  4  
ATOM   8771  H  HZ1  . LYS A 1 48  ? 7.296   11.954  -0.798  1.00 4.32  ? 143 LYS A HZ1  4  
ATOM   8772  H  HZ2  . LYS A 1 48  ? 8.116   13.302  -1.161  1.00 4.56  ? 143 LYS A HZ2  4  
ATOM   8773  H  HZ3  . LYS A 1 48  ? 8.910   12.052  -0.429  1.00 4.55  ? 143 LYS A HZ3  4  
ATOM   8774  N  N    . LEU A 1 49  ? 6.604   7.071   0.756   1.00 1.40  ? 144 LEU A N    4  
ATOM   8775  C  CA   . LEU A 1 49  ? 6.661   5.643   1.071   1.00 1.50  ? 144 LEU A CA   4  
ATOM   8776  C  C    . LEU A 1 49  ? 7.967   5.021   0.564   1.00 1.35  ? 144 LEU A C    4  
ATOM   8777  O  O    . LEU A 1 49  ? 8.693   4.437   1.360   1.00 1.37  ? 144 LEU A O    4  
ATOM   8778  C  CB   . LEU A 1 49  ? 5.426   4.933   0.481   1.00 1.80  ? 144 LEU A CB   4  
ATOM   8779  C  CG   . LEU A 1 49  ? 4.097   5.254   1.192   1.00 1.62  ? 144 LEU A CG   4  
ATOM   8780  C  CD1  . LEU A 1 49  ? 2.921   4.739   0.350   1.00 2.70  ? 144 LEU A CD1  4  
ATOM   8781  C  CD2  . LEU A 1 49  ? 4.046   4.611   2.587   1.00 2.09  ? 144 LEU A CD2  4  
ATOM   8782  H  H    . LEU A 1 49  ? 5.886   7.392   0.111   1.00 1.38  ? 144 LEU A H    4  
ATOM   8783  H  HA   . LEU A 1 49  ? 6.668   5.519   2.155   1.00 1.60  ? 144 LEU A HA   4  
ATOM   8784  H  HB2  . LEU A 1 49  ? 5.333   5.202   -0.571  1.00 2.79  ? 144 LEU A HB2  4  
ATOM   8785  H  HB3  . LEU A 1 49  ? 5.589   3.856   0.526   1.00 2.57  ? 144 LEU A HB3  4  
ATOM   8786  H  HG   . LEU A 1 49  ? 3.989   6.332   1.301   1.00 2.08  ? 144 LEU A HG   4  
ATOM   8787  H  HD11 . LEU A 1 49  ? 2.911   5.242   -0.619  1.00 3.53  ? 144 LEU A HD11 4  
ATOM   8788  H  HD12 . LEU A 1 49  ? 3.007   3.664   0.193   1.00 3.00  ? 144 LEU A HD12 4  
ATOM   8789  H  HD13 . LEU A 1 49  ? 1.981   4.954   0.858   1.00 3.40  ? 144 LEU A HD13 4  
ATOM   8790  H  HD21 . LEU A 1 49  ? 3.074   4.798   3.037   1.00 2.78  ? 144 LEU A HD21 4  
ATOM   8791  H  HD22 . LEU A 1 49  ? 4.201   3.534   2.513   1.00 2.95  ? 144 LEU A HD22 4  
ATOM   8792  H  HD23 . LEU A 1 49  ? 4.809   5.043   3.233   1.00 2.65  ? 144 LEU A HD23 4  
ATOM   8793  N  N    . VAL A 1 50  ? 8.312   5.177   -0.717  1.00 1.28  ? 145 VAL A N    4  
ATOM   8794  C  CA   . VAL A 1 50  ? 9.503   4.545   -1.321  1.00 1.28  ? 145 VAL A CA   4  
ATOM   8795  C  C    . VAL A 1 50  ? 10.823  4.976   -0.651  1.00 1.22  ? 145 VAL A C    4  
ATOM   8796  O  O    . VAL A 1 50  ? 11.687  4.122   -0.449  1.00 1.26  ? 145 VAL A O    4  
ATOM   8797  C  CB   . VAL A 1 50  ? 9.532   4.761   -2.854  1.00 1.34  ? 145 VAL A CB   4  
ATOM   8798  C  CG1  . VAL A 1 50  ? 10.881  4.413   -3.517  1.00 1.53  ? 145 VAL A CG1  4  
ATOM   8799  C  CG2  . VAL A 1 50  ? 8.450   3.892   -3.526  1.00 1.64  ? 145 VAL A CG2  4  
ATOM   8800  H  H    . VAL A 1 50  ? 7.661   5.681   -1.326  1.00 1.28  ? 145 VAL A H    4  
ATOM   8801  H  HA   . VAL A 1 50  ? 9.404   3.472   -1.153  1.00 1.39  ? 145 VAL A HA   4  
ATOM   8802  H  HB   . VAL A 1 50  ? 9.322   5.808   -3.062  1.00 1.54  ? 145 VAL A HB   4  
ATOM   8803  H  HG11 . VAL A 1 50  ? 10.799  4.515   -4.599  1.00 2.65  ? 145 VAL A HG11 4  
ATOM   8804  H  HG12 . VAL A 1 50  ? 11.658  5.095   -3.173  1.00 1.95  ? 145 VAL A HG12 4  
ATOM   8805  H  HG13 . VAL A 1 50  ? 11.165  3.389   -3.275  1.00 2.00  ? 145 VAL A HG13 4  
ATOM   8806  H  HG21 . VAL A 1 50  ? 7.475   4.068   -3.075  1.00 2.01  ? 145 VAL A HG21 4  
ATOM   8807  H  HG22 . VAL A 1 50  ? 8.390   4.132   -4.588  1.00 2.50  ? 145 VAL A HG22 4  
ATOM   8808  H  HG23 . VAL A 1 50  ? 8.695   2.836   -3.413  1.00 2.21  ? 145 VAL A HG23 4  
ATOM   8809  N  N    . GLN A 1 51  ? 10.993  6.244   -0.242  1.00 1.17  ? 146 GLN A N    4  
ATOM   8810  C  CA   . GLN A 1 51  ? 12.207  6.680   0.447   1.00 1.24  ? 146 GLN A CA   4  
ATOM   8811  C  C    . GLN A 1 51  ? 12.244  6.071   1.856   1.00 1.21  ? 146 GLN A C    4  
ATOM   8812  O  O    . GLN A 1 51  ? 13.246  5.450   2.206   1.00 1.27  ? 146 GLN A O    4  
ATOM   8813  C  CB   . GLN A 1 51  ? 12.391  8.216   0.361   1.00 1.47  ? 146 GLN A CB   4  
ATOM   8814  C  CG   . GLN A 1 51  ? 11.397  9.091   1.146   1.00 2.04  ? 146 GLN A CG   4  
ATOM   8815  C  CD   . GLN A 1 51  ? 11.333  10.542  0.641   1.00 2.38  ? 146 GLN A CD   4  
ATOM   8816  O  OE1  . GLN A 1 51  ? 10.345  10.993  0.077   1.00 4.09  ? 146 GLN A OE1  4  
ATOM   8817  N  NE2  . GLN A 1 51  ? 12.346  11.359  0.824   1.00 1.93  ? 146 GLN A NE2  4  
ATOM   8818  H  H    . GLN A 1 51  ? 10.262  6.935   -0.400  1.00 1.10  ? 146 GLN A H    4  
ATOM   8819  H  HA   . GLN A 1 51  ? 13.058  6.244   -0.078  1.00 1.29  ? 146 GLN A HA   4  
ATOM   8820  H  HB2  . GLN A 1 51  ? 13.400  8.461   0.700   1.00 2.23  ? 146 GLN A HB2  4  
ATOM   8821  H  HB3  . GLN A 1 51  ? 12.328  8.493   -0.694  1.00 3.07  ? 146 GLN A HB3  4  
ATOM   8822  H  HG2  . GLN A 1 51  ? 10.406  8.665   1.045   1.00 3.45  ? 146 GLN A HG2  4  
ATOM   8823  H  HG3  . GLN A 1 51  ? 11.669  9.088   2.201   1.00 2.80  ? 146 GLN A HG3  4  
ATOM   8824  H  HE21 . GLN A 1 51  ? 13.167  11.101  1.359   1.00 2.59  ? 146 GLN A HE21 4  
ATOM   8825  H  HE22 . GLN A 1 51  ? 12.241  12.292  0.466   1.00 2.34  ? 146 GLN A HE22 4  
ATOM   8826  N  N    . VAL A 1 52  ? 11.124  6.098   2.592   1.00 1.23  ? 147 VAL A N    4  
ATOM   8827  C  CA   . VAL A 1 52  ? 11.004  5.458   3.914   1.00 1.28  ? 147 VAL A CA   4  
ATOM   8828  C  C    . VAL A 1 52  ? 11.191  3.934   3.837   1.00 1.19  ? 147 VAL A C    4  
ATOM   8829  O  O    . VAL A 1 52  ? 11.842  3.372   4.710   1.00 1.23  ? 147 VAL A O    4  
ATOM   8830  C  CB   . VAL A 1 52  ? 9.670   5.839   4.596   1.00 1.47  ? 147 VAL A CB   4  
ATOM   8831  C  CG1  . VAL A 1 52  ? 9.393   5.050   5.886   1.00 1.49  ? 147 VAL A CG1  4  
ATOM   8832  C  CG2  . VAL A 1 52  ? 9.682   7.335   4.956   1.00 1.99  ? 147 VAL A CG2  4  
ATOM   8833  H  H    . VAL A 1 52  ? 10.312  6.602   2.239   1.00 1.25  ? 147 VAL A H    4  
ATOM   8834  H  HA   . VAL A 1 52  ? 11.810  5.852   4.534   1.00 1.32  ? 147 VAL A HA   4  
ATOM   8835  H  HB   . VAL A 1 52  ? 8.853   5.651   3.899   1.00 1.86  ? 147 VAL A HB   4  
ATOM   8836  H  HG11 . VAL A 1 52  ? 9.202   4.005   5.651   1.00 2.09  ? 147 VAL A HG11 4  
ATOM   8837  H  HG12 . VAL A 1 52  ? 10.243  5.124   6.566   1.00 1.80  ? 147 VAL A HG12 4  
ATOM   8838  H  HG13 . VAL A 1 52  ? 8.508   5.452   6.380   1.00 2.37  ? 147 VAL A HG13 4  
ATOM   8839  H  HG21 . VAL A 1 52  ? 10.439  7.516   5.717   1.00 2.15  ? 147 VAL A HG21 4  
ATOM   8840  H  HG22 . VAL A 1 52  ? 9.914   7.946   4.085   1.00 2.99  ? 147 VAL A HG22 4  
ATOM   8841  H  HG23 . VAL A 1 52  ? 8.707   7.631   5.336   1.00 2.51  ? 147 VAL A HG23 4  
ATOM   8842  N  N    . VAL A 1 53  ? 10.718  3.264   2.779   1.00 1.13  ? 148 VAL A N    4  
ATOM   8843  C  CA   . VAL A 1 53  ? 10.985  1.835   2.530   1.00 1.10  ? 148 VAL A CA   4  
ATOM   8844  C  C    . VAL A 1 53  ? 12.488  1.571   2.402   1.00 1.02  ? 148 VAL A C    4  
ATOM   8845  O  O    . VAL A 1 53  ? 12.976  0.651   3.054   1.00 1.09  ? 148 VAL A O    4  
ATOM   8846  C  CB   . VAL A 1 53  ? 10.209  1.304   1.299   1.00 1.21  ? 148 VAL A CB   4  
ATOM   8847  C  CG1  . VAL A 1 53  ? 10.792  0.019   0.677   1.00 1.82  ? 148 VAL A CG1  4  
ATOM   8848  C  CG2  . VAL A 1 53  ? 8.759   1.000   1.700   1.00 1.49  ? 148 VAL A CG2  4  
ATOM   8849  H  H    . VAL A 1 53  ? 10.108  3.765   2.133   1.00 1.15  ? 148 VAL A H    4  
ATOM   8850  H  HA   . VAL A 1 53  ? 10.638  1.282   3.405   1.00 1.20  ? 148 VAL A HA   4  
ATOM   8851  H  HB   . VAL A 1 53  ? 10.207  2.073   0.529   1.00 1.78  ? 148 VAL A HB   4  
ATOM   8852  H  HG11 . VAL A 1 53  ? 10.879  -0.761  1.435   1.00 2.09  ? 148 VAL A HG11 4  
ATOM   8853  H  HG12 . VAL A 1 53  ? 10.143  -0.333  -0.124  1.00 2.53  ? 148 VAL A HG12 4  
ATOM   8854  H  HG13 . VAL A 1 53  ? 11.775  0.217   0.247   1.00 2.80  ? 148 VAL A HG13 4  
ATOM   8855  H  HG21 . VAL A 1 53  ? 8.298   1.876   2.156   1.00 1.93  ? 148 VAL A HG21 4  
ATOM   8856  H  HG22 . VAL A 1 53  ? 8.186   0.720   0.816   1.00 2.47  ? 148 VAL A HG22 4  
ATOM   8857  H  HG23 . VAL A 1 53  ? 8.742   0.174   2.413   1.00 2.08  ? 148 VAL A HG23 4  
ATOM   8858  N  N    . ARG A 1 54  ? 13.247  2.379   1.644   1.00 0.98  ? 149 ARG A N    4  
ATOM   8859  C  CA   . ARG A 1 54  ? 14.708  2.201   1.567   1.00 1.01  ? 149 ARG A CA   4  
ATOM   8860  C  C    . ARG A 1 54  ? 15.392  2.508   2.904   1.00 1.21  ? 149 ARG A C    4  
ATOM   8861  O  O    . ARG A 1 54  ? 16.317  1.792   3.287   1.00 1.41  ? 149 ARG A O    4  
ATOM   8862  C  CB   . ARG A 1 54  ? 15.334  3.028   0.431   1.00 1.08  ? 149 ARG A CB   4  
ATOM   8863  C  CG   . ARG A 1 54  ? 14.809  2.610   -0.955  1.00 1.29  ? 149 ARG A CG   4  
ATOM   8864  C  CD   . ARG A 1 54  ? 15.886  2.607   -2.053  1.00 1.74  ? 149 ARG A CD   4  
ATOM   8865  N  NE   . ARG A 1 54  ? 16.855  1.514   -1.843  1.00 2.41  ? 149 ARG A NE   4  
ATOM   8866  C  CZ   . ARG A 1 54  ? 18.142  1.489   -2.165  1.00 3.27  ? 149 ARG A CZ   4  
ATOM   8867  N  NH1  . ARG A 1 54  ? 18.718  2.412   -2.905  1.00 3.75  ? 149 ARG A NH1  4  
ATOM   8868  N  NH2  . ARG A 1 54  ? 18.869  0.492   -1.712  1.00 4.60  ? 149 ARG A NH2  4  
ATOM   8869  H  H    . ARG A 1 54  ? 12.811  3.147   1.145   1.00 0.99  ? 149 ARG A H    4  
ATOM   8870  H  HA   . ARG A 1 54  ? 14.905  1.150   1.348   1.00 1.05  ? 149 ARG A HA   4  
ATOM   8871  H  HB2  . ARG A 1 54  ? 15.138  4.091   0.589   1.00 1.28  ? 149 ARG A HB2  4  
ATOM   8872  H  HB3  . ARG A 1 54  ? 16.414  2.878   0.470   1.00 1.34  ? 149 ARG A HB3  4  
ATOM   8873  H  HG2  . ARG A 1 54  ? 14.372  1.611   -0.896  1.00 1.97  ? 149 ARG A HG2  4  
ATOM   8874  H  HG3  . ARG A 1 54  ? 14.018  3.305   -1.232  1.00 1.90  ? 149 ARG A HG3  4  
ATOM   8875  H  HD2  . ARG A 1 54  ? 15.402  2.470   -3.022  1.00 2.59  ? 149 ARG A HD2  4  
ATOM   8876  H  HD3  . ARG A 1 54  ? 16.393  3.575   -2.058  1.00 2.69  ? 149 ARG A HD3  4  
ATOM   8877  H  HE   . ARG A 1 54  ? 16.513  0.681   -1.371  1.00 3.22  ? 149 ARG A HE   4  
ATOM   8878  H  HH11 . ARG A 1 54  ? 18.166  3.127   -3.380  1.00 3.80  ? 149 ARG A HH11 4  
ATOM   8879  H  HH12 . ARG A 1 54  ? 19.706  2.335   -3.127  1.00 4.68  ? 149 ARG A HH12 4  
ATOM   8880  H  HH21 . ARG A 1 54  ? 18.398  -0.244  -1.196  1.00 5.19  ? 149 ARG A HH21 4  
ATOM   8881  H  HH22 . ARG A 1 54  ? 19.874  0.446   -1.852  1.00 5.39  ? 149 ARG A HH22 4  
ATOM   8882  N  N    . GLN A 1 55  ? 14.923  3.517   3.641   1.00 1.31  ? 150 GLN A N    4  
ATOM   8883  C  CA   . GLN A 1 55  ? 15.442  3.839   4.980   1.00 1.60  ? 150 GLN A CA   4  
ATOM   8884  C  C    . GLN A 1 55  ? 15.221  2.693   5.982   1.00 1.60  ? 150 GLN A C    4  
ATOM   8885  O  O    . GLN A 1 55  ? 16.161  2.311   6.673   1.00 1.78  ? 150 GLN A O    4  
ATOM   8886  C  CB   . GLN A 1 55  ? 14.822  5.146   5.501   1.00 1.84  ? 150 GLN A CB   4  
ATOM   8887  C  CG   . GLN A 1 55  ? 15.301  6.372   4.712   1.00 2.50  ? 150 GLN A CG   4  
ATOM   8888  C  CD   . GLN A 1 55  ? 14.718  7.669   5.267   1.00 2.92  ? 150 GLN A CD   4  
ATOM   8889  O  OE1  . GLN A 1 55  ? 13.581  8.029   5.010   1.00 4.36  ? 150 GLN A OE1  4  
ATOM   8890  N  NE2  . GLN A 1 55  ? 15.470  8.406   6.052   1.00 2.65  ? 150 GLN A NE2  4  
ATOM   8891  H  H    . GLN A 1 55  ? 14.188  4.091   3.233   1.00 1.27  ? 150 GLN A H    4  
ATOM   8892  H  HA   . GLN A 1 55  ? 16.523  3.976   4.918   1.00 1.78  ? 150 GLN A HA   4  
ATOM   8893  H  HB2  . GLN A 1 55  ? 13.735  5.085   5.460   1.00 2.21  ? 150 GLN A HB2  4  
ATOM   8894  H  HB3  . GLN A 1 55  ? 15.113  5.277   6.545   1.00 1.98  ? 150 GLN A HB3  4  
ATOM   8895  H  HG2  . GLN A 1 55  ? 16.387  6.415   4.758   1.00 2.78  ? 150 GLN A HG2  4  
ATOM   8896  H  HG3  . GLN A 1 55  ? 15.025  6.290   3.665   1.00 3.08  ? 150 GLN A HG3  4  
ATOM   8897  H  HE21 . GLN A 1 55  ? 16.446  8.175   6.188   1.00 3.08  ? 150 GLN A HE21 4  
ATOM   8898  H  HE22 . GLN A 1 55  ? 15.097  9.298   6.322   1.00 3.06  ? 150 GLN A HE22 4  
ATOM   8899  N  N    . LEU A 1 56  ? 14.023  2.100   6.030   1.00 1.46  ? 151 LEU A N    4  
ATOM   8900  C  CA   . LEU A 1 56  ? 13.705  0.941   6.873   1.00 1.49  ? 151 LEU A CA   4  
ATOM   8901  C  C    . LEU A 1 56  ? 14.461  -0.313  6.418   1.00 1.55  ? 151 LEU A C    4  
ATOM   8902  O  O    . LEU A 1 56  ? 15.055  -1.021  7.233   1.00 1.73  ? 151 LEU A O    4  
ATOM   8903  C  CB   . LEU A 1 56  ? 12.182  0.705   6.830   1.00 1.36  ? 151 LEU A CB   4  
ATOM   8904  C  CG   . LEU A 1 56  ? 11.341  1.746   7.599   1.00 1.74  ? 151 LEU A CG   4  
ATOM   8905  C  CD1  . LEU A 1 56  ? 9.859   1.537   7.253   1.00 2.85  ? 151 LEU A CD1  4  
ATOM   8906  C  CD2  . LEU A 1 56  ? 11.544  1.630   9.118   1.00 1.81  ? 151 LEU A CD2  4  
ATOM   8907  H  H    . LEU A 1 56  ? 13.275  2.485   5.464   1.00 1.36  ? 151 LEU A H    4  
ATOM   8908  H  HA   . LEU A 1 56  ? 14.025  1.138   7.897   1.00 1.66  ? 151 LEU A HA   4  
ATOM   8909  H  HB2  . LEU A 1 56  ? 11.864  0.691   5.786   1.00 1.18  ? 151 LEU A HB2  4  
ATOM   8910  H  HB3  . LEU A 1 56  ? 11.966  -0.279  7.244   1.00 1.45  ? 151 LEU A HB3  4  
ATOM   8911  H  HG   . LEU A 1 56  ? 11.624  2.750   7.289   1.00 2.95  ? 151 LEU A HG   4  
ATOM   8912  H  HD11 . LEU A 1 56  ? 9.707   1.685   6.183   1.00 3.49  ? 151 LEU A HD11 4  
ATOM   8913  H  HD12 . LEU A 1 56  ? 9.549   0.525   7.514   1.00 3.63  ? 151 LEU A HD12 4  
ATOM   8914  H  HD13 . LEU A 1 56  ? 9.246   2.258   7.795   1.00 3.62  ? 151 LEU A HD13 4  
ATOM   8915  H  HD21 . LEU A 1 56  ? 12.567  1.894   9.384   1.00 2.73  ? 151 LEU A HD21 4  
ATOM   8916  H  HD22 . LEU A 1 56  ? 10.871  2.317   9.633   1.00 2.78  ? 151 LEU A HD22 4  
ATOM   8917  H  HD23 . LEU A 1 56  ? 11.338  0.612   9.450   1.00 1.95  ? 151 LEU A HD23 4  
ATOM   8918  N  N    . GLU A 1 57  ? 14.491  -0.587  5.114   1.00 1.49  ? 152 GLU A N    4  
ATOM   8919  C  CA   . GLU A 1 57  ? 15.241  -1.712  4.560   1.00 1.61  ? 152 GLU A CA   4  
ATOM   8920  C  C    . GLU A 1 57  ? 16.742  -1.611  4.885   1.00 1.80  ? 152 GLU A C    4  
ATOM   8921  O  O    . GLU A 1 57  ? 17.341  -2.628  5.236   1.00 2.06  ? 152 GLU A O    4  
ATOM   8922  C  CB   . GLU A 1 57  ? 14.942  -1.872  3.061   1.00 1.57  ? 152 GLU A CB   4  
ATOM   8923  C  CG   . GLU A 1 57  ? 15.410  -3.240  2.560   1.00 1.86  ? 152 GLU A CG   4  
ATOM   8924  C  CD   . GLU A 1 57  ? 14.814  -3.581  1.199   1.00 2.26  ? 152 GLU A CD   4  
ATOM   8925  O  OE1  . GLU A 1 57  ? 15.158  -2.921  0.194   1.00 2.93  ? 152 GLU A OE1  4  
ATOM   8926  O  OE2  . GLU A 1 57  ? 14.008  -4.531  1.125   1.00 3.02  ? 152 GLU A OE2  4  
ATOM   8927  H  H    . GLU A 1 57  ? 13.921  -0.032  4.488   1.00 1.39  ? 152 GLU A H    4  
ATOM   8928  H  HA   . GLU A 1 57  ? 14.869  -2.605  5.064   1.00 1.70  ? 152 GLU A HA   4  
ATOM   8929  H  HB2  . GLU A 1 57  ? 13.863  -1.814  2.914   1.00 2.14  ? 152 GLU A HB2  4  
ATOM   8930  H  HB3  . GLU A 1 57  ? 15.423  -1.075  2.492   1.00 2.41  ? 152 GLU A HB3  4  
ATOM   8931  H  HG2  . GLU A 1 57  ? 16.497  -3.254  2.495   1.00 2.93  ? 152 GLU A HG2  4  
ATOM   8932  H  HG3  . GLU A 1 57  ? 15.087  -3.999  3.272   1.00 2.69  ? 152 GLU A HG3  4  
ATOM   8933  N  N    . ALA A 1 58  ? 17.314  -0.403  4.965   1.00 1.84  ? 153 ALA A N    4  
ATOM   8934  C  CA   . ALA A 1 58  ? 18.623  -0.158  5.575   1.00 2.14  ? 153 ALA A CA   4  
ATOM   8935  C  C    . ALA A 1 58  ? 18.609  -0.362  7.108   1.00 2.55  ? 153 ALA A C    4  
ATOM   8936  O  O    . ALA A 1 58  ? 19.108  -1.381  7.584   1.00 2.58  ? 153 ALA A O    4  
ATOM   8937  C  CB   . ALA A 1 58  ? 19.118  1.233   5.151   1.00 2.16  ? 153 ALA A CB   4  
ATOM   8938  H  H    . ALA A 1 58  ? 16.797  0.404   4.625   1.00 1.81  ? 153 ALA A H    4  
ATOM   8939  H  HA   . ALA A 1 58  ? 19.326  -0.893  5.174   1.00 2.16  ? 153 ALA A HA   4  
ATOM   8940  H  HB1  . ALA A 1 58  ? 20.106  1.419   5.574   1.00 2.37  ? 153 ALA A HB1  4  
ATOM   8941  H  HB2  . ALA A 1 58  ? 19.185  1.285   4.064   1.00 2.40  ? 153 ALA A HB2  4  
ATOM   8942  H  HB3  . ALA A 1 58  ? 18.436  2.010   5.497   1.00 2.89  ? 153 ALA A HB3  4  
ATOM   8943  N  N    . GLU A 1 59  ? 17.994  0.535   7.885   1.00 3.19  ? 154 GLU A N    4  
ATOM   8944  C  CA   . GLU A 1 59  ? 18.115  0.612   9.356   1.00 3.85  ? 154 GLU A CA   4  
ATOM   8945  C  C    . GLU A 1 59  ? 17.628  -0.650  10.120  1.00 3.79  ? 154 GLU A C    4  
ATOM   8946  O  O    . GLU A 1 59  ? 16.840  -1.421  9.570   1.00 3.67  ? 154 GLU A O    4  
ATOM   8947  C  CB   . GLU A 1 59  ? 17.417  1.886   9.872   1.00 4.85  ? 154 GLU A CB   4  
ATOM   8948  C  CG   . GLU A 1 59  ? 18.166  3.162   9.439   1.00 5.69  ? 154 GLU A CG   4  
ATOM   8949  C  CD   . GLU A 1 59  ? 18.062  4.301   10.456  1.00 6.64  ? 154 GLU A CD   4  
ATOM   8950  O  OE1  . GLU A 1 59  ? 18.204  4.060   11.680  1.00 6.70  ? 154 GLU A OE1  4  
ATOM   8951  O  OE2  . GLU A 1 59  ? 17.952  5.485   10.068  1.00 7.73  ? 154 GLU A OE2  4  
ATOM   8952  H  H    . GLU A 1 59  ? 17.453  1.261   7.420   1.00 3.44  ? 154 GLU A H    4  
ATOM   8953  H  HA   . GLU A 1 59  ? 19.178  0.712   9.568   1.00 4.00  ? 154 GLU A HA   4  
ATOM   8954  H  HB2  . GLU A 1 59  ? 16.388  1.921   9.512   1.00 4.98  ? 154 GLU A HB2  4  
ATOM   8955  H  HB3  . GLU A 1 59  ? 17.380  1.835   10.957  1.00 5.28  ? 154 GLU A HB3  4  
ATOM   8956  H  HG2  . GLU A 1 59  ? 19.226  2.940   9.313   1.00 5.76  ? 154 GLU A HG2  4  
ATOM   8957  H  HG3  . GLU A 1 59  ? 17.784  3.496   8.475   1.00 6.04  ? 154 GLU A HG3  4  
ATOM   8958  N  N    . PRO A 1 60  ? 18.112  -0.930  11.351  1.00 4.16  ? 155 PRO A N    4  
ATOM   8959  C  CA   . PRO A 1 60  ? 17.946  -2.234  11.999  1.00 4.31  ? 155 PRO A CA   4  
ATOM   8960  C  C    . PRO A 1 60  ? 16.711  -2.326  12.910  1.00 4.71  ? 155 PRO A C    4  
ATOM   8961  O  O    . PRO A 1 60  ? 16.182  -1.316  13.378  1.00 5.67  ? 155 PRO A O    4  
ATOM   8962  C  CB   . PRO A 1 60  ? 19.227  -2.421  12.816  1.00 4.70  ? 155 PRO A CB   4  
ATOM   8963  C  CG   . PRO A 1 60  ? 19.535  -0.998  13.276  1.00 5.02  ? 155 PRO A CG   4  
ATOM   8964  C  CD   . PRO A 1 60  ? 19.100  -0.146  12.083  1.00 4.62  ? 155 PRO A CD   4  
ATOM   8965  H  HA   . PRO A 1 60  ? 17.888  -3.023  11.249  1.00 4.10  ? 155 PRO A HA   4  
ATOM   8966  H  HB2  . PRO A 1 60  ? 19.095  -3.100  13.659  1.00 5.04  ? 155 PRO A HB2  4  
ATOM   8967  H  HB3  . PRO A 1 60  ? 20.028  -2.773  12.165  1.00 4.60  ? 155 PRO A HB3  4  
ATOM   8968  H  HG2  . PRO A 1 60  ? 18.929  -0.750  14.150  1.00 5.38  ? 155 PRO A HG2  4  
ATOM   8969  H  HG3  . PRO A 1 60  ? 20.595  -0.874  13.497  1.00 5.31  ? 155 PRO A HG3  4  
ATOM   8970  H  HD2  . PRO A 1 60  ? 18.680  0.797   12.433  1.00 4.95  ? 155 PRO A HD2  4  
ATOM   8971  H  HD3  . PRO A 1 60  ? 19.955  0.037   11.439  1.00 4.52  ? 155 PRO A HD3  4  
ATOM   8972  N  N    . GLY A 1 61  ? 16.307  -3.567  13.219  1.00 4.29  ? 156 GLY A N    4  
ATOM   8973  C  CA   . GLY A 1 61  ? 15.357  -3.883  14.297  1.00 4.68  ? 156 GLY A CA   4  
ATOM   8974  C  C    . GLY A 1 61  ? 13.879  -3.699  13.940  1.00 4.27  ? 156 GLY A C    4  
ATOM   8975  O  O    . GLY A 1 61  ? 13.098  -3.359  14.829  1.00 5.10  ? 156 GLY A O    4  
ATOM   8976  H  H    . GLY A 1 61  ? 16.802  -4.341  12.800  1.00 3.97  ? 156 GLY A H    4  
ATOM   8977  H  HA2  . GLY A 1 61  ? 15.490  -4.923  14.594  1.00 4.91  ? 156 GLY A HA2  4  
ATOM   8978  H  HA3  . GLY A 1 61  ? 15.566  -3.235  15.149  1.00 5.26  ? 156 GLY A HA3  4  
ATOM   8979  N  N    . LEU A 1 62  ? 13.513  -3.888  12.666  1.00 3.29  ? 157 LEU A N    4  
ATOM   8980  C  CA   . LEU A 1 62  ? 12.266  -3.411  12.053  1.00 3.10  ? 157 LEU A CA   4  
ATOM   8981  C  C    . LEU A 1 62  ? 11.462  -4.516  11.308  1.00 2.63  ? 157 LEU A C    4  
ATOM   8982  O  O    . LEU A 1 62  ? 12.063  -5.478  10.825  1.00 2.57  ? 157 LEU A O    4  
ATOM   8983  C  CB   . LEU A 1 62  ? 12.631  -2.185  11.174  1.00 3.18  ? 157 LEU A CB   4  
ATOM   8984  C  CG   . LEU A 1 62  ? 13.317  -2.382  9.800   1.00 3.42  ? 157 LEU A CG   4  
ATOM   8985  C  CD1  . LEU A 1 62  ? 14.486  -3.379  9.800   1.00 3.60  ? 157 LEU A CD1  4  
ATOM   8986  C  CD2  . LEU A 1 62  ? 12.338  -2.761  8.681   1.00 4.61  ? 157 LEU A CD2  4  
ATOM   8987  H  H    . LEU A 1 62  ? 14.215  -4.235  12.030  1.00 3.01  ? 157 LEU A H    4  
ATOM   8988  H  HA   . LEU A 1 62  ? 11.635  -3.048  12.865  1.00 3.54  ? 157 LEU A HA   4  
ATOM   8989  H  HB2  . LEU A 1 62  ? 11.738  -1.585  11.014  1.00 4.09  ? 157 LEU A HB2  4  
ATOM   8990  H  HB3  . LEU A 1 62  ? 13.291  -1.549  11.768  1.00 3.57  ? 157 LEU A HB3  4  
ATOM   8991  H  HG   . LEU A 1 62  ? 13.727  -1.407  9.531   1.00 4.28  ? 157 LEU A HG   4  
ATOM   8992  H  HD11 . LEU A 1 62  ? 14.982  -3.350  8.834   1.00 4.15  ? 157 LEU A HD11 4  
ATOM   8993  H  HD12 . LEU A 1 62  ? 15.198  -3.111  10.577  1.00 3.93  ? 157 LEU A HD12 4  
ATOM   8994  H  HD13 . LEU A 1 62  ? 14.138  -4.396  9.967   1.00 4.08  ? 157 LEU A HD13 4  
ATOM   8995  H  HD21 . LEU A 1 62  ? 12.827  -2.651  7.714   1.00 5.49  ? 157 LEU A HD21 4  
ATOM   8996  H  HD22 . LEU A 1 62  ? 12.019  -3.796  8.783   1.00 5.01  ? 157 LEU A HD22 4  
ATOM   8997  H  HD23 . LEU A 1 62  ? 11.469  -2.105  8.710   1.00 5.17  ? 157 LEU A HD23 4  
ATOM   8998  N  N    . PRO A 1 63  ? 10.119  -4.401  11.200  1.00 2.47  ? 158 PRO A N    4  
ATOM   8999  C  CA   . PRO A 1 63  ? 9.254   -5.321  10.457  1.00 2.10  ? 158 PRO A CA   4  
ATOM   9000  C  C    . PRO A 1 63  ? 9.280   -4.995  8.947   1.00 1.72  ? 158 PRO A C    4  
ATOM   9001  O  O    . PRO A 1 63  ? 9.377   -3.819  8.592   1.00 1.68  ? 158 PRO A O    4  
ATOM   9002  C  CB   . PRO A 1 63  ? 7.865   -5.153  11.067  1.00 2.18  ? 158 PRO A CB   4  
ATOM   9003  C  CG   . PRO A 1 63  ? 7.850   -3.696  11.515  1.00 2.52  ? 158 PRO A CG   4  
ATOM   9004  C  CD   . PRO A 1 63  ? 9.312   -3.369  11.825  1.00 2.82  ? 158 PRO A CD   4  
ATOM   9005  H  HA   . PRO A 1 63  ? 9.553   -6.350  10.623  1.00 2.19  ? 158 PRO A HA   4  
ATOM   9006  H  HB2  . PRO A 1 63  ? 7.071   -5.372  10.355  1.00 1.94  ? 158 PRO A HB2  4  
ATOM   9007  H  HB3  . PRO A 1 63  ? 7.777   -5.797  11.944  1.00 2.42  ? 158 PRO A HB3  4  
ATOM   9008  H  HG2  . PRO A 1 63  ? 7.499   -3.074  10.696  1.00 2.46  ? 158 PRO A HG2  4  
ATOM   9009  H  HG3  . PRO A 1 63  ? 7.224   -3.565  12.393  1.00 2.75  ? 158 PRO A HG3  4  
ATOM   9010  H  HD2  . PRO A 1 63  ? 9.573   -2.399  11.415  1.00 2.98  ? 158 PRO A HD2  4  
ATOM   9011  H  HD3  . PRO A 1 63  ? 9.472   -3.369  12.900  1.00 3.28  ? 158 PRO A HD3  4  
ATOM   9012  N  N    . PRO A 1 64  ? 9.174   -5.996  8.049   1.00 1.64  ? 159 PRO A N    4  
ATOM   9013  C  CA   . PRO A 1 64  ? 9.413   -5.858  6.606   1.00 1.33  ? 159 PRO A CA   4  
ATOM   9014  C  C    . PRO A 1 64  ? 8.205   -5.240  5.871   1.00 1.22  ? 159 PRO A C    4  
ATOM   9015  O  O    . PRO A 1 64  ? 7.681   -5.800  4.911   1.00 1.91  ? 159 PRO A O    4  
ATOM   9016  C  CB   . PRO A 1 64  ? 9.748   -7.283  6.141   1.00 1.73  ? 159 PRO A CB   4  
ATOM   9017  C  CG   . PRO A 1 64  ? 8.846   -8.136  7.032   1.00 2.10  ? 159 PRO A CG   4  
ATOM   9018  C  CD   . PRO A 1 64  ? 8.925   -7.398  8.369   1.00 2.10  ? 159 PRO A CD   4  
ATOM   9019  H  HA   . PRO A 1 64  ? 10.278  -5.211  6.434   1.00 1.26  ? 159 PRO A HA   4  
ATOM   9020  H  HB2  . PRO A 1 64  ? 9.558   -7.450  5.081   1.00 1.77  ? 159 PRO A HB2  4  
ATOM   9021  H  HB3  . PRO A 1 64  ? 10.793  -7.502  6.369   1.00 1.98  ? 159 PRO A HB3  4  
ATOM   9022  H  HG2  . PRO A 1 64  ? 7.821   -8.114  6.656   1.00 2.11  ? 159 PRO A HG2  4  
ATOM   9023  H  HG3  . PRO A 1 64  ? 9.207   -9.162  7.114   1.00 2.52  ? 159 PRO A HG3  4  
ATOM   9024  H  HD2  . PRO A 1 64  ? 7.989   -7.517  8.918   1.00 2.37  ? 159 PRO A HD2  4  
ATOM   9025  H  HD3  . PRO A 1 64  ? 9.759   -7.794  8.948   1.00 2.32  ? 159 PRO A HD3  4  
ATOM   9026  N  N    . VAL A 1 65  ? 7.767   -4.071  6.336   1.00 1.49  ? 160 VAL A N    4  
ATOM   9027  C  CA   . VAL A 1 65  ? 6.509   -3.427  5.945   1.00 1.43  ? 160 VAL A CA   4  
ATOM   9028  C  C    . VAL A 1 65  ? 6.669   -2.783  4.563   1.00 1.71  ? 160 VAL A C    4  
ATOM   9029  O  O    . VAL A 1 65  ? 7.247   -1.706  4.420   1.00 2.64  ? 160 VAL A O    4  
ATOM   9030  C  CB   . VAL A 1 65  ? 6.083   -2.398  7.020   1.00 1.82  ? 160 VAL A CB   4  
ATOM   9031  C  CG1  . VAL A 1 65  ? 4.853   -1.564  6.635   1.00 2.72  ? 160 VAL A CG1  4  
ATOM   9032  C  CG2  . VAL A 1 65  ? 5.747   -3.109  8.345   1.00 3.45  ? 160 VAL A CG2  4  
ATOM   9033  H  H    . VAL A 1 65  ? 8.289   -3.664  7.108   1.00 2.25  ? 160 VAL A H    4  
ATOM   9034  H  HA   . VAL A 1 65  ? 5.728   -4.189  5.886   1.00 1.21  ? 160 VAL A HA   4  
ATOM   9035  H  HB   . VAL A 1 65  ? 6.917   -1.719  7.208   1.00 2.06  ? 160 VAL A HB   4  
ATOM   9036  H  HG11 . VAL A 1 65  ? 5.030   -1.009  5.714   1.00 3.13  ? 160 VAL A HG11 4  
ATOM   9037  H  HG12 . VAL A 1 65  ? 3.991   -2.215  6.503   1.00 3.47  ? 160 VAL A HG12 4  
ATOM   9038  H  HG13 . VAL A 1 65  ? 4.638   -0.848  7.427   1.00 3.58  ? 160 VAL A HG13 4  
ATOM   9039  H  HG21 . VAL A 1 65  ? 6.588   -3.714  8.675   1.00 4.10  ? 160 VAL A HG21 4  
ATOM   9040  H  HG22 . VAL A 1 65  ? 5.523   -2.374  9.120   1.00 4.28  ? 160 VAL A HG22 4  
ATOM   9041  H  HG23 . VAL A 1 65  ? 4.884   -3.759  8.211   1.00 4.23  ? 160 VAL A HG23 4  
ATOM   9042  N  N    . GLN A 1 66  ? 6.132   -3.453  3.541   1.00 1.33  ? 161 GLN A N    4  
ATOM   9043  C  CA   . GLN A 1 66  ? 5.937   -2.882  2.206   1.00 1.77  ? 161 GLN A CA   4  
ATOM   9044  C  C    . GLN A 1 66  ? 4.537   -2.255  2.085   1.00 1.33  ? 161 GLN A C    4  
ATOM   9045  O  O    . GLN A 1 66  ? 3.597   -2.753  2.707   1.00 1.15  ? 161 GLN A O    4  
ATOM   9046  C  CB   . GLN A 1 66  ? 6.101   -3.950  1.105   1.00 2.34  ? 161 GLN A CB   4  
ATOM   9047  C  CG   . GLN A 1 66  ? 7.560   -4.144  0.649   1.00 3.63  ? 161 GLN A CG   4  
ATOM   9048  C  CD   . GLN A 1 66  ? 7.682   -4.866  -0.699  1.00 3.63  ? 161 GLN A CD   4  
ATOM   9049  O  OE1  . GLN A 1 66  ? 8.381   -5.862  -0.844  1.00 4.02  ? 161 GLN A OE1  4  
ATOM   9050  N  NE2  . GLN A 1 66  ? 7.031   -4.386  -1.743  1.00 3.65  ? 161 GLN A NE2  4  
ATOM   9051  H  H    . GLN A 1 66  ? 5.701   -4.347  3.751   1.00 1.22  ? 161 GLN A H    4  
ATOM   9052  H  HA   . GLN A 1 66  ? 6.679   -2.097  2.054   1.00 2.31  ? 161 GLN A HA   4  
ATOM   9053  H  HB2  . GLN A 1 66  ? 5.688   -4.904  1.441   1.00 2.05  ? 161 GLN A HB2  4  
ATOM   9054  H  HB3  . GLN A 1 66  ? 5.515   -3.629  0.243   1.00 3.11  ? 161 GLN A HB3  4  
ATOM   9055  H  HG2  . GLN A 1 66  ? 8.029   -3.165  0.536   1.00 4.77  ? 161 GLN A HG2  4  
ATOM   9056  H  HG3  . GLN A 1 66  ? 8.105   -4.699  1.413   1.00 4.34  ? 161 GLN A HG3  4  
ATOM   9057  H  HE21 . GLN A 1 66  ? 6.427   -3.589  -1.656  1.00 3.50  ? 161 GLN A HE21 4  
ATOM   9058  H  HE22 . GLN A 1 66  ? 7.152   -4.842  -2.633  1.00 4.05  ? 161 GLN A HE22 4  
ATOM   9059  N  N    . PRO A 1 67  ? 4.367   -1.217  1.245   1.00 1.33  ? 162 PRO A N    4  
ATOM   9060  C  CA   . PRO A 1 67  ? 3.062   -0.740  0.822   1.00 1.06  ? 162 PRO A CA   4  
ATOM   9061  C  C    . PRO A 1 67  ? 2.509   -1.586  -0.336  1.00 0.82  ? 162 PRO A C    4  
ATOM   9062  O  O    . PRO A 1 67  ? 3.252   -1.960  -1.244  1.00 1.03  ? 162 PRO A O    4  
ATOM   9063  C  CB   . PRO A 1 67  ? 3.291   0.709   0.392   1.00 1.51  ? 162 PRO A CB   4  
ATOM   9064  C  CG   . PRO A 1 67  ? 4.706   0.673   -0.187  1.00 1.83  ? 162 PRO A CG   4  
ATOM   9065  C  CD   . PRO A 1 67  ? 5.414   -0.374  0.677   1.00 1.78  ? 162 PRO A CD   4  
ATOM   9066  H  HA   . PRO A 1 67  ? 2.370   -0.756  1.658   1.00 0.98  ? 162 PRO A HA   4  
ATOM   9067  H  HB2  . PRO A 1 67  ? 2.558   1.044   -0.344  1.00 1.53  ? 162 PRO A HB2  4  
ATOM   9068  H  HB3  . PRO A 1 67  ? 3.271   1.355   1.270   1.00 1.72  ? 162 PRO A HB3  4  
ATOM   9069  H  HG2  . PRO A 1 67  ? 4.674   0.337   -1.223  1.00 1.78  ? 162 PRO A HG2  4  
ATOM   9070  H  HG3  . PRO A 1 67  ? 5.195   1.644   -0.121  1.00 2.23  ? 162 PRO A HG3  4  
ATOM   9071  H  HD2  . PRO A 1 67  ? 6.104   -0.956  0.067   1.00 1.95  ? 162 PRO A HD2  4  
ATOM   9072  H  HD3  . PRO A 1 67  ? 5.947   0.123   1.488   1.00 2.01  ? 162 PRO A HD3  4  
ATOM   9073  N  N    . VAL A 1 68  ? 1.190   -1.810  -0.334  1.00 0.73  ? 163 VAL A N    4  
ATOM   9074  C  CA   . VAL A 1 68  ? 0.392   -2.027  -1.561  1.00 0.66  ? 163 VAL A CA   4  
ATOM   9075  C  C    . VAL A 1 68  ? -0.336  -0.743  -1.962  1.00 0.62  ? 163 VAL A C    4  
ATOM   9076  O  O    . VAL A 1 68  ? -0.890  -0.056  -1.103  1.00 0.65  ? 163 VAL A O    4  
ATOM   9077  C  CB   . VAL A 1 68  ? -0.666  -3.150  -1.447  1.00 0.81  ? 163 VAL A CB   4  
ATOM   9078  C  CG1  . VAL A 1 68  ? -0.043  -4.529  -1.658  1.00 1.80  ? 163 VAL A CG1  4  
ATOM   9079  C  CG2  . VAL A 1 68  ? -1.468  -3.168  -0.139  1.00 1.23  ? 163 VAL A CG2  4  
ATOM   9080  H  H    . VAL A 1 68  ? 0.690   -1.606  0.532   1.00 0.89  ? 163 VAL A H    4  
ATOM   9081  H  HA   . VAL A 1 68  ? 1.068   -2.290  -2.377  1.00 0.74  ? 163 VAL A HA   4  
ATOM   9082  H  HB   . VAL A 1 68  ? -1.383  -3.003  -2.255  1.00 1.66  ? 163 VAL A HB   4  
ATOM   9083  H  HG11 . VAL A 1 68  ? -0.829  -5.282  -1.668  1.00 2.39  ? 163 VAL A HG11 4  
ATOM   9084  H  HG12 . VAL A 1 68  ? 0.451   -4.547  -2.625  1.00 2.71  ? 163 VAL A HG12 4  
ATOM   9085  H  HG13 . VAL A 1 68  ? 0.679   -4.748  -0.870  1.00 2.76  ? 163 VAL A HG13 4  
ATOM   9086  H  HG21 . VAL A 1 68  ? -2.003  -2.229  -0.023  1.00 2.32  ? 163 VAL A HG21 4  
ATOM   9087  H  HG22 . VAL A 1 68  ? -2.203  -3.974  -0.170  1.00 2.15  ? 163 VAL A HG22 4  
ATOM   9088  H  HG23 . VAL A 1 68  ? -0.803  -3.335  0.709   1.00 2.00  ? 163 VAL A HG23 4  
ATOM   9089  N  N    . PHE A 1 69  ? -0.377  -0.455  -3.267  1.00 0.61  ? 164 PHE A N    4  
ATOM   9090  C  CA   . PHE A 1 69  ? -1.166  0.629   -3.854  1.00 0.61  ? 164 PHE A CA   4  
ATOM   9091  C  C    . PHE A 1 69  ? -2.446  0.080   -4.507  1.00 1.35  ? 164 PHE A C    4  
ATOM   9092  O  O    . PHE A 1 69  ? -2.399  -0.819  -5.347  1.00 1.76  ? 164 PHE A O    4  
ATOM   9093  C  CB   . PHE A 1 69  ? -0.300  1.382   -4.876  1.00 0.76  ? 164 PHE A CB   4  
ATOM   9094  C  CG   . PHE A 1 69  ? -0.949  2.635   -5.442  1.00 0.93  ? 164 PHE A CG   4  
ATOM   9095  C  CD1  . PHE A 1 69  ? -1.791  2.554   -6.569  1.00 1.58  ? 164 PHE A CD1  4  
ATOM   9096  C  CD2  . PHE A 1 69  ? -0.703  3.888   -4.845  1.00 2.40  ? 164 PHE A CD2  4  
ATOM   9097  C  CE1  . PHE A 1 69  ? -2.380  3.718   -7.096  1.00 1.81  ? 164 PHE A CE1  4  
ATOM   9098  C  CE2  . PHE A 1 69  ? -1.287  5.052   -5.376  1.00 2.40  ? 164 PHE A CE2  4  
ATOM   9099  C  CZ   . PHE A 1 69  ? -2.122  4.966   -6.504  1.00 1.47  ? 164 PHE A CZ   4  
ATOM   9100  H  H    . PHE A 1 69  ? 0.125   -1.063  -3.908  1.00 0.65  ? 164 PHE A H    4  
ATOM   9101  H  HA   . PHE A 1 69  ? -1.453  1.334   -3.074  1.00 0.59  ? 164 PHE A HA   4  
ATOM   9102  H  HB2  . PHE A 1 69  ? 0.638   1.666   -4.396  1.00 0.82  ? 164 PHE A HB2  4  
ATOM   9103  H  HB3  . PHE A 1 69  ? -0.051  0.709   -5.698  1.00 0.83  ? 164 PHE A HB3  4  
ATOM   9104  H  HD1  . PHE A 1 69  ? -1.986  1.598   -7.033  1.00 2.74  ? 164 PHE A HD1  4  
ATOM   9105  H  HD2  . PHE A 1 69  ? -0.057  3.962   -3.981  1.00 3.60  ? 164 PHE A HD2  4  
ATOM   9106  H  HE1  . PHE A 1 69  ? -3.022  3.651   -7.963  1.00 2.93  ? 164 PHE A HE1  4  
ATOM   9107  H  HE2  . PHE A 1 69  ? -1.084  6.014   -4.926  1.00 3.85  ? 164 PHE A HE2  4  
ATOM   9108  H  HZ   . PHE A 1 69  ? -2.558  5.865   -6.919  1.00 1.78  ? 164 PHE A HZ   4  
ATOM   9109  N  N    . ILE A 1 70  ? -3.596  0.649   -4.150  1.00 0.76  ? 165 ILE A N    4  
ATOM   9110  C  CA   . ILE A 1 70  ? -4.905  0.365   -4.761  1.00 0.98  ? 165 ILE A CA   4  
ATOM   9111  C  C    . ILE A 1 70  ? -5.429  1.667   -5.383  1.00 0.97  ? 165 ILE A C    4  
ATOM   9112  O  O    . ILE A 1 70  ? -5.360  2.720   -4.742  1.00 1.02  ? 165 ILE A O    4  
ATOM   9113  C  CB   . ILE A 1 70  ? -5.868  -0.208  -3.690  1.00 1.13  ? 165 ILE A CB   4  
ATOM   9114  C  CG1  . ILE A 1 70  ? -5.336  -1.569  -3.175  1.00 1.65  ? 165 ILE A CG1  4  
ATOM   9115  C  CG2  . ILE A 1 70  ? -7.289  -0.379  -4.261  1.00 1.47  ? 165 ILE A CG2  4  
ATOM   9116  C  CD1  . ILE A 1 70  ? -6.118  -2.176  -2.002  1.00 1.48  ? 165 ILE A CD1  4  
ATOM   9117  H  H    . ILE A 1 70  ? -3.575  1.380   -3.442  1.00 0.73  ? 165 ILE A H    4  
ATOM   9118  H  HA   . ILE A 1 70  ? -4.795  -0.380  -5.554  1.00 1.21  ? 165 ILE A HA   4  
ATOM   9119  H  HB   . ILE A 1 70  ? -5.915  0.493   -2.853  1.00 1.12  ? 165 ILE A HB   4  
ATOM   9120  H  HG12 . ILE A 1 70  ? -5.339  -2.281  -4.000  1.00 2.54  ? 165 ILE A HG12 4  
ATOM   9121  H  HG13 . ILE A 1 70  ? -4.308  -1.453  -2.834  1.00 2.18  ? 165 ILE A HG13 4  
ATOM   9122  H  HG21 . ILE A 1 70  ? -7.690  0.583   -4.580  1.00 2.33  ? 165 ILE A HG21 4  
ATOM   9123  H  HG22 . ILE A 1 70  ? -7.270  -1.065  -5.107  1.00 2.53  ? 165 ILE A HG22 4  
ATOM   9124  H  HG23 . ILE A 1 70  ? -7.963  -0.767  -3.499  1.00 1.55  ? 165 ILE A HG23 4  
ATOM   9125  H  HD11 . ILE A 1 70  ? -7.127  -2.449  -2.309  1.00 2.55  ? 165 ILE A HD11 4  
ATOM   9126  H  HD12 . ILE A 1 70  ? -5.607  -3.079  -1.665  1.00 2.15  ? 165 ILE A HD12 4  
ATOM   9127  H  HD13 . ILE A 1 70  ? -6.160  -1.464  -1.179  1.00 1.67  ? 165 ILE A HD13 4  
ATOM   9128  N  N    . THR A 1 71  ? -5.953  1.608   -6.616  1.00 1.11  ? 166 THR A N    4  
ATOM   9129  C  CA   . THR A 1 71  ? -6.608  2.755   -7.266  1.00 1.26  ? 166 THR A CA   4  
ATOM   9130  C  C    . THR A 1 71  ? -8.112  2.730   -7.014  1.00 1.11  ? 166 THR A C    4  
ATOM   9131  O  O    . THR A 1 71  ? -8.707  1.656   -6.980  1.00 1.27  ? 166 THR A O    4  
ATOM   9132  C  CB   . THR A 1 71  ? -6.252  2.860   -8.748  1.00 1.93  ? 166 THR A CB   4  
ATOM   9133  O  OG1  . THR A 1 71  ? -6.755  4.101   -9.175  1.00 3.05  ? 166 THR A OG1  4  
ATOM   9134  C  CG2  . THR A 1 71  ? -6.831  1.753   -9.630  1.00 1.55  ? 166 THR A CG2  4  
ATOM   9135  H  H    . THR A 1 71  ? -6.043  0.705   -7.059  1.00 1.16  ? 166 THR A H    4  
ATOM   9136  H  HA   . THR A 1 71  ? -6.218  3.655   -6.799  1.00 1.28  ? 166 THR A HA   4  
ATOM   9137  H  HB   . THR A 1 71  ? -5.167  2.863   -8.850  1.00 3.21  ? 166 THR A HB   4  
ATOM   9138  H  HG1  . THR A 1 71  ? -6.285  4.360   -9.987  1.00 3.62  ? 166 THR A HG1  4  
ATOM   9139  H  HG21 . THR A 1 71  ? -6.479  1.882   -10.653 1.00 2.50  ? 166 THR A HG21 4  
ATOM   9140  H  HG22 . THR A 1 71  ? -6.504  0.779   -9.268  1.00 2.41  ? 166 THR A HG22 4  
ATOM   9141  H  HG23 . THR A 1 71  ? -7.921  1.791   -9.623  1.00 1.85  ? 166 THR A HG23 4  
ATOM   9142  N  N    . VAL A 1 72  ? -8.706  3.906   -6.810  1.00 1.12  ? 167 VAL A N    4  
ATOM   9143  C  CA   . VAL A 1 72  ? -10.072 4.056   -6.260  1.00 1.06  ? 167 VAL A CA   4  
ATOM   9144  C  C    . VAL A 1 72  ? -11.146 4.504   -7.268  1.00 1.27  ? 167 VAL A C    4  
ATOM   9145  O  O    . VAL A 1 72  ? -12.287 4.704   -6.855  1.00 1.74  ? 167 VAL A O    4  
ATOM   9146  C  CB   . VAL A 1 72  ? -10.097 5.001   -5.029  1.00 1.17  ? 167 VAL A CB   4  
ATOM   9147  C  CG1  . VAL A 1 72  ? -9.078  4.571   -3.961  1.00 2.03  ? 167 VAL A CG1  4  
ATOM   9148  C  CG2  . VAL A 1 72  ? -9.893  6.491   -5.377  1.00 2.19  ? 167 VAL A CG2  4  
ATOM   9149  H  H    . VAL A 1 72  ? -8.097  4.720   -6.858  1.00 1.35  ? 167 VAL A H    4  
ATOM   9150  H  HA   . VAL A 1 72  ? -10.386 3.076   -5.898  1.00 1.15  ? 167 VAL A HA   4  
ATOM   9151  H  HB   . VAL A 1 72  ? -11.077 4.917   -4.557  1.00 2.00  ? 167 VAL A HB   4  
ATOM   9152  H  HG11 . VAL A 1 72  ? -9.232  3.523   -3.706  1.00 2.77  ? 167 VAL A HG11 4  
ATOM   9153  H  HG12 . VAL A 1 72  ? -8.057  4.708   -4.318  1.00 3.09  ? 167 VAL A HG12 4  
ATOM   9154  H  HG13 . VAL A 1 72  ? -9.222  5.176   -3.066  1.00 2.53  ? 167 VAL A HG13 4  
ATOM   9155  H  HG21 . VAL A 1 72  ? -10.751 6.866   -5.932  1.00 2.81  ? 167 VAL A HG21 4  
ATOM   9156  H  HG22 . VAL A 1 72  ? -9.801  7.079   -4.464  1.00 2.96  ? 167 VAL A HG22 4  
ATOM   9157  H  HG23 . VAL A 1 72  ? -9.000  6.630   -5.981  1.00 3.00  ? 167 VAL A HG23 4  
ATOM   9158  N  N    . ASP A 1 73  ? -10.830 4.708   -8.558  1.00 1.37  ? 168 ASP A N    4  
ATOM   9159  C  CA   . ASP A 1 73  ? -11.717 5.475   -9.452  1.00 1.81  ? 168 ASP A CA   4  
ATOM   9160  C  C    . ASP A 1 73  ? -11.640 5.007   -10.922 1.00 1.98  ? 168 ASP A C    4  
ATOM   9161  O  O    . ASP A 1 73  ? -11.257 5.790   -11.798 1.00 2.78  ? 168 ASP A O    4  
ATOM   9162  C  CB   . ASP A 1 73  ? -11.422 6.979   -9.268  1.00 2.53  ? 168 ASP A CB   4  
ATOM   9163  C  CG   . ASP A 1 73  ? -12.464 7.854   -9.964  1.00 3.34  ? 168 ASP A CG   4  
ATOM   9164  O  OD1  . ASP A 1 73  ? -13.679 7.625   -9.788  1.00 4.06  ? 168 ASP A OD1  4  
ATOM   9165  O  OD2  . ASP A 1 73  ? -12.096 8.785   -10.716 1.00 3.99  ? 168 ASP A OD2  4  
ATOM   9166  H  H    . ASP A 1 73  ? -9.942  4.390   -8.933  1.00 1.46  ? 168 ASP A H    4  
ATOM   9167  H  HA   . ASP A 1 73  ? -12.748 5.310   -9.139  1.00 1.90  ? 168 ASP A HA   4  
ATOM   9168  H  HB2  . ASP A 1 73  ? -11.439 7.224   -8.204  1.00 2.81  ? 168 ASP A HB2  4  
ATOM   9169  H  HB3  . ASP A 1 73  ? -10.424 7.208   -9.649  1.00 2.63  ? 168 ASP A HB3  4  
ATOM   9170  N  N    . PRO A 1 74  ? -11.974 3.727   -11.198 1.00 1.71  ? 169 PRO A N    4  
ATOM   9171  C  CA   . PRO A 1 74  ? -11.721 3.085   -12.481 1.00 2.13  ? 169 PRO A CA   4  
ATOM   9172  C  C    . PRO A 1 74  ? -12.577 3.681   -13.603 1.00 2.23  ? 169 PRO A C    4  
ATOM   9173  O  O    . PRO A 1 74  ? -13.798 3.514   -13.639 1.00 3.02  ? 169 PRO A O    4  
ATOM   9174  C  CB   . PRO A 1 74  ? -11.979 1.589   -12.264 1.00 2.44  ? 169 PRO A CB   4  
ATOM   9175  C  CG   . PRO A 1 74  ? -12.980 1.567   -11.111 1.00 2.21  ? 169 PRO A CG   4  
ATOM   9176  C  CD   . PRO A 1 74  ? -12.540 2.758   -10.264 1.00 1.78  ? 169 PRO A CD   4  
ATOM   9177  H  HA   . PRO A 1 74  ? -10.669 3.210   -12.730 1.00 2.59  ? 169 PRO A HA   4  
ATOM   9178  H  HB2  . PRO A 1 74  ? -12.374 1.102   -13.156 1.00 2.75  ? 169 PRO A HB2  4  
ATOM   9179  H  HB3  . PRO A 1 74  ? -11.054 1.105   -11.949 1.00 2.86  ? 169 PRO A HB3  4  
ATOM   9180  H  HG2  . PRO A 1 74  ? -13.985 1.741   -11.495 1.00 2.20  ? 169 PRO A HG2  4  
ATOM   9181  H  HG3  . PRO A 1 74  ? -12.934 0.632   -10.551 1.00 2.72  ? 169 PRO A HG3  4  
ATOM   9182  H  HD2  . PRO A 1 74  ? -13.392 3.171   -9.724  1.00 1.88  ? 169 PRO A HD2  4  
ATOM   9183  H  HD3  . PRO A 1 74  ? -11.771 2.435   -9.562  1.00 2.06  ? 169 PRO A HD3  4  
ATOM   9184  N  N    . GLU A 1 75  ? -11.895 4.349   -14.534 1.00 2.38  ? 170 GLU A N    4  
ATOM   9185  C  CA   . GLU A 1 75  ? -12.433 4.906   -15.787 1.00 2.48  ? 170 GLU A CA   4  
ATOM   9186  C  C    . GLU A 1 75  ? -11.638 4.422   -17.009 1.00 2.14  ? 170 GLU A C    4  
ATOM   9187  O  O    . GLU A 1 75  ? -12.217 4.215   -18.081 1.00 2.44  ? 170 GLU A O    4  
ATOM   9188  C  CB   . GLU A 1 75  ? -12.305 6.433   -15.745 1.00 3.65  ? 170 GLU A CB   4  
ATOM   9189  C  CG   . GLU A 1 75  ? -13.312 7.114   -14.807 1.00 4.39  ? 170 GLU A CG   4  
ATOM   9190  C  CD   . GLU A 1 75  ? -12.841 8.497   -14.370 1.00 6.08  ? 170 GLU A CD   4  
ATOM   9191  O  OE1  . GLU A 1 75  ? -11.818 9.026   -14.857 1.00 7.09  ? 170 GLU A OE1  4  
ATOM   9192  O  OE2  . GLU A 1 75  ? -13.361 9.020   -13.362 1.00 6.99  ? 170 GLU A OE2  4  
ATOM   9193  H  H    . GLU A 1 75  ? -10.911 4.527   -14.320 1.00 2.95  ? 170 GLU A H    4  
ATOM   9194  H  HA   . GLU A 1 75  ? -13.480 4.628   -15.918 1.00 2.73  ? 170 GLU A HA   4  
ATOM   9195  H  HB2  . GLU A 1 75  ? -11.285 6.667   -15.430 1.00 4.19  ? 170 GLU A HB2  4  
ATOM   9196  H  HB3  . GLU A 1 75  ? -12.450 6.842   -16.746 1.00 4.08  ? 170 GLU A HB3  4  
ATOM   9197  H  HG2  . GLU A 1 75  ? -14.277 7.195   -15.310 1.00 4.74  ? 170 GLU A HG2  4  
ATOM   9198  H  HG3  . GLU A 1 75  ? -13.444 6.507   -13.910 1.00 4.12  ? 170 GLU A HG3  4  
ATOM   9199  N  N    . ARG A 1 76  ? -10.315 4.273   -16.840 1.00 2.31  ? 171 ARG A N    4  
ATOM   9200  C  CA   . ARG A 1 76  ? -9.335  3.847   -17.854 1.00 2.82  ? 171 ARG A CA   4  
ATOM   9201  C  C    . ARG A 1 76  ? -8.214  2.968   -17.258 1.00 2.47  ? 171 ARG A C    4  
ATOM   9202  O  O    . ARG A 1 76  ? -7.259  2.637   -17.959 1.00 2.80  ? 171 ARG A O    4  
ATOM   9203  C  CB   . ARG A 1 76  ? -8.711  5.094   -18.516 1.00 3.97  ? 171 ARG A CB   4  
ATOM   9204  C  CG   . ARG A 1 76  ? -9.686  5.889   -19.398 1.00 4.48  ? 171 ARG A CG   4  
ATOM   9205  C  CD   . ARG A 1 76  ? -8.946  7.017   -20.137 1.00 5.15  ? 171 ARG A CD   4  
ATOM   9206  N  NE   . ARG A 1 76  ? -9.806  7.694   -21.123 1.00 5.50  ? 171 ARG A NE   4  
ATOM   9207  C  CZ   . ARG A 1 76  ? -10.162 7.223   -22.312 1.00 6.16  ? 171 ARG A CZ   4  
ATOM   9208  N  NH1  . ARG A 1 76  ? -9.762  6.065   -22.788 1.00 6.87  ? 171 ARG A NH1  4  
ATOM   9209  N  NH2  . ARG A 1 76  ? -10.945 7.926   -23.088 1.00 6.65  ? 171 ARG A NH2  4  
ATOM   9210  H  H    . ARG A 1 76  ? -9.943  4.520   -15.926 1.00 2.57  ? 171 ARG A H    4  
ATOM   9211  H  HA   . ARG A 1 76  ? -9.844  3.254   -18.613 1.00 3.11  ? 171 ARG A HA   4  
ATOM   9212  H  HB2  . ARG A 1 76  ? -8.305  5.749   -17.744 1.00 4.04  ? 171 ARG A HB2  4  
ATOM   9213  H  HB3  . ARG A 1 76  ? -7.885  4.773   -19.152 1.00 5.10  ? 171 ARG A HB3  4  
ATOM   9214  H  HG2  . ARG A 1 76  ? -10.135 5.211   -20.125 1.00 5.62  ? 171 ARG A HG2  4  
ATOM   9215  H  HG3  . ARG A 1 76  ? -10.475 6.327   -18.787 1.00 4.18  ? 171 ARG A HG3  4  
ATOM   9216  H  HD2  . ARG A 1 76  ? -8.600  7.747   -19.403 1.00 5.21  ? 171 ARG A HD2  4  
ATOM   9217  H  HD3  . ARG A 1 76  ? -8.070  6.608   -20.642 1.00 6.02  ? 171 ARG A HD3  4  
ATOM   9218  H  HE   . ARG A 1 76  ? -10.161 8.606   -20.875 1.00 5.65  ? 171 ARG A HE   4  
ATOM   9219  H  HH11 . ARG A 1 76  ? -9.091  5.490   -22.289 1.00 6.96  ? 171 ARG A HH11 4  
ATOM   9220  H  HH12 . ARG A 1 76  ? -10.094 5.786   -23.701 1.00 7.63  ? 171 ARG A HH12 4  
ATOM   9221  H  HH21 . ARG A 1 76  ? -11.198 8.885   -22.852 1.00 6.75  ? 171 ARG A HH21 4  
ATOM   9222  H  HH22 . ARG A 1 76  ? -11.173 7.559   -24.002 1.00 7.27  ? 171 ARG A HH22 4  
ATOM   9223  N  N    . ASP A 1 77  ? -8.292  2.644   -15.965 1.00 2.04  ? 172 ASP A N    4  
ATOM   9224  C  CA   . ASP A 1 77  ? -7.197  2.203   -15.100 1.00 1.86  ? 172 ASP A CA   4  
ATOM   9225  C  C    . ASP A 1 77  ? -6.869  0.702   -15.260 1.00 1.72  ? 172 ASP A C    4  
ATOM   9226  O  O    . ASP A 1 77  ? -7.035  -0.103  -14.344 1.00 2.60  ? 172 ASP A O    4  
ATOM   9227  C  CB   . ASP A 1 77  ? -7.582  2.617   -13.665 1.00 2.37  ? 172 ASP A CB   4  
ATOM   9228  C  CG   . ASP A 1 77  ? -7.967  4.104   -13.580 1.00 3.93  ? 172 ASP A CG   4  
ATOM   9229  O  OD1  . ASP A 1 77  ? -9.059  4.459   -14.099 1.00 5.05  ? 172 ASP A OD1  4  
ATOM   9230  O  OD2  . ASP A 1 77  ? -7.142  4.879   -13.048 1.00 4.86  ? 172 ASP A OD2  4  
ATOM   9231  H  H    . ASP A 1 77  ? -9.067  3.029   -15.428 1.00 2.05  ? 172 ASP A H    4  
ATOM   9232  H  HA   . ASP A 1 77  ? -6.298  2.759   -15.371 1.00 2.03  ? 172 ASP A HA   4  
ATOM   9233  H  HB2  . ASP A 1 77  ? -8.430  2.018   -13.329 1.00 2.56  ? 172 ASP A HB2  4  
ATOM   9234  H  HB3  . ASP A 1 77  ? -6.738  2.418   -13.003 1.00 2.85  ? 172 ASP A HB3  4  
ATOM   9235  N  N    . ASP A 1 78  ? -6.450  0.326   -16.473 1.00 1.67  ? 173 ASP A N    4  
ATOM   9236  C  CA   . ASP A 1 78  ? -6.219  -1.059  -16.885 1.00 1.50  ? 173 ASP A CA   4  
ATOM   9237  C  C    . ASP A 1 78  ? -4.987  -1.720  -16.229 1.00 1.22  ? 173 ASP A C    4  
ATOM   9238  O  O    . ASP A 1 78  ? -4.116  -1.069  -15.655 1.00 1.16  ? 173 ASP A O    4  
ATOM   9239  C  CB   . ASP A 1 78  ? -6.213  -1.153  -18.429 1.00 1.77  ? 173 ASP A CB   4  
ATOM   9240  C  CG   . ASP A 1 78  ? -4.826  -1.350  -19.051 1.00 2.82  ? 173 ASP A CG   4  
ATOM   9241  O  OD1  . ASP A 1 78  ? -4.103  -0.354  -19.273 1.00 4.00  ? 173 ASP A OD1  4  
ATOM   9242  O  OD2  . ASP A 1 78  ? -4.478  -2.528  -19.306 1.00 3.40  ? 173 ASP A OD2  4  
ATOM   9243  H  H    . ASP A 1 78  ? -6.390  1.050   -17.181 1.00 2.49  ? 173 ASP A H    4  
ATOM   9244  H  HA   . ASP A 1 78  ? -7.089  -1.621  -16.542 1.00 1.60  ? 173 ASP A HA   4  
ATOM   9245  H  HB2  . ASP A 1 78  ? -6.830  -2.010  -18.708 1.00 2.73  ? 173 ASP A HB2  4  
ATOM   9246  H  HB3  . ASP A 1 78  ? -6.686  -0.271  -18.865 1.00 1.99  ? 173 ASP A HB3  4  
ATOM   9247  N  N    . VAL A 1 79  ? -4.894  -3.046  -16.360 1.00 1.21  ? 174 VAL A N    4  
ATOM   9248  C  CA   . VAL A 1 79  ? -3.819  -3.851  -15.760 1.00 1.09  ? 174 VAL A CA   4  
ATOM   9249  C  C    . VAL A 1 79  ? -2.424  -3.490  -16.294 1.00 1.02  ? 174 VAL A C    4  
ATOM   9250  O  O    . VAL A 1 79  ? -1.471  -3.541  -15.519 1.00 1.01  ? 174 VAL A O    4  
ATOM   9251  C  CB   . VAL A 1 79  ? -4.066  -5.374  -15.882 1.00 1.29  ? 174 VAL A CB   4  
ATOM   9252  C  CG1  . VAL A 1 79  ? -5.337  -5.774  -15.112 1.00 2.48  ? 174 VAL A CG1  4  
ATOM   9253  C  CG2  . VAL A 1 79  ? -4.179  -5.872  -17.335 1.00 2.23  ? 174 VAL A CG2  4  
ATOM   9254  H  H    . VAL A 1 79  ? -5.602  -3.505  -16.910 1.00 1.39  ? 174 VAL A H    4  
ATOM   9255  H  HA   . VAL A 1 79  ? -3.816  -3.620  -14.694 1.00 1.08  ? 174 VAL A HA   4  
ATOM   9256  H  HB   . VAL A 1 79  ? -3.227  -5.892  -15.419 1.00 2.22  ? 174 VAL A HB   4  
ATOM   9257  H  HG11 . VAL A 1 79  ? -6.219  -5.324  -15.569 1.00 3.60  ? 174 VAL A HG11 4  
ATOM   9258  H  HG12 . VAL A 1 79  ? -5.448  -6.859  -15.123 1.00 2.91  ? 174 VAL A HG12 4  
ATOM   9259  H  HG13 . VAL A 1 79  ? -5.261  -5.444  -14.075 1.00 3.09  ? 174 VAL A HG13 4  
ATOM   9260  H  HG21 . VAL A 1 79  ? -3.253  -5.671  -17.875 1.00 3.07  ? 174 VAL A HG21 4  
ATOM   9261  H  HG22 . VAL A 1 79  ? -4.346  -6.951  -17.339 1.00 3.00  ? 174 VAL A HG22 4  
ATOM   9262  H  HG23 . VAL A 1 79  ? -5.009  -5.382  -17.845 1.00 2.80  ? 174 VAL A HG23 4  
ATOM   9263  N  N    . GLU A 1 80  ? -2.278  -3.101  -17.571 1.00 1.11  ? 175 GLU A N    4  
ATOM   9264  C  CA   . GLU A 1 80  ? -1.008  -2.573  -18.084 1.00 1.18  ? 175 GLU A CA   4  
ATOM   9265  C  C    . GLU A 1 80  ? -0.723  -1.139  -17.608 1.00 1.06  ? 175 GLU A C    4  
ATOM   9266  O  O    . GLU A 1 80  ? 0.416   -0.869  -17.227 1.00 1.10  ? 175 GLU A O    4  
ATOM   9267  C  CB   . GLU A 1 80  ? -0.865  -2.749  -19.605 1.00 1.69  ? 175 GLU A CB   4  
ATOM   9268  C  CG   . GLU A 1 80  ? -0.834  -4.243  -19.991 1.00 2.57  ? 175 GLU A CG   4  
ATOM   9269  C  CD   . GLU A 1 80  ? 0.101   -4.549  -21.166 1.00 3.45  ? 175 GLU A CD   4  
ATOM   9270  O  OE1  . GLU A 1 80  ? -0.031  -3.904  -22.234 1.00 3.48  ? 175 GLU A OE1  4  
ATOM   9271  O  OE2  . GLU A 1 80  ? 0.942   -5.468  -21.028 1.00 4.85  ? 175 GLU A OE2  4  
ATOM   9272  H  H    . GLU A 1 80  ? -3.100  -3.025  -18.169 1.00 1.17  ? 175 GLU A H    4  
ATOM   9273  H  HA   . GLU A 1 80  ? -0.214  -3.178  -17.648 1.00 1.21  ? 175 GLU A HA   4  
ATOM   9274  H  HB2  . GLU A 1 80  ? -1.677  -2.243  -20.128 1.00 1.66  ? 175 GLU A HB2  4  
ATOM   9275  H  HB3  . GLU A 1 80  ? 0.078   -2.291  -19.903 1.00 2.44  ? 175 GLU A HB3  4  
ATOM   9276  H  HG2  . GLU A 1 80  ? -0.497  -4.833  -19.137 1.00 3.36  ? 175 GLU A HG2  4  
ATOM   9277  H  HG3  . GLU A 1 80  ? -1.844  -4.570  -20.238 1.00 2.93  ? 175 GLU A HG3  4  
ATOM   9278  N  N    . ALA A 1 81  ? -1.718  -0.242  -17.525 1.00 1.14  ? 176 ALA A N    4  
ATOM   9279  C  CA   . ALA A 1 81  ? -1.544  1.077   -16.896 1.00 1.17  ? 176 ALA A CA   4  
ATOM   9280  C  C    . ALA A 1 81  ? -1.063  0.971   -15.439 1.00 1.03  ? 176 ALA A C    4  
ATOM   9281  O  O    . ALA A 1 81  ? -0.166  1.716   -15.037 1.00 1.04  ? 176 ALA A O    4  
ATOM   9282  C  CB   . ALA A 1 81  ? -2.859  1.872   -16.971 1.00 1.39  ? 176 ALA A CB   4  
ATOM   9283  H  H    . ALA A 1 81  ? -2.632  -0.472  -17.908 1.00 1.35  ? 176 ALA A H    4  
ATOM   9284  H  HA   . ALA A 1 81  ? -0.774  1.617   -17.447 1.00 1.23  ? 176 ALA A HA   4  
ATOM   9285  H  HB1  . ALA A 1 81  ? -2.725  2.851   -16.504 1.00 1.64  ? 176 ALA A HB1  4  
ATOM   9286  H  HB2  . ALA A 1 81  ? -3.162  1.998   -18.011 1.00 2.45  ? 176 ALA A HB2  4  
ATOM   9287  H  HB3  . ALA A 1 81  ? -3.650  1.350   -16.432 1.00 2.05  ? 176 ALA A HB3  4  
ATOM   9288  N  N    . MET A 1 82  ? -1.619  0.029   -14.668 1.00 0.99  ? 177 MET A N    4  
ATOM   9289  C  CA   . MET A 1 82  ? -1.181  -0.311  -13.306 1.00 0.94  ? 177 MET A CA   4  
ATOM   9290  C  C    . MET A 1 82  ? 0.219   -0.935  -13.290 1.00 0.83  ? 177 MET A C    4  
ATOM   9291  O  O    . MET A 1 82  ? 1.072   -0.507  -12.511 1.00 0.87  ? 177 MET A O    4  
ATOM   9292  C  CB   . MET A 1 82  ? -2.213  -1.253  -12.664 1.00 1.03  ? 177 MET A CB   4  
ATOM   9293  C  CG   . MET A 1 82  ? -3.480  -0.510  -12.215 1.00 1.61  ? 177 MET A CG   4  
ATOM   9294  S  SD   . MET A 1 82  ? -3.284  0.415   -10.664 1.00 1.65  ? 177 MET A SD   4  
ATOM   9295  C  CE   . MET A 1 82  ? -3.137  2.111   -11.282 1.00 2.90  ? 177 MET A CE   4  
ATOM   9296  H  H    . MET A 1 82  ? -2.406  -0.480  -15.062 1.00 1.06  ? 177 MET A H    4  
ATOM   9297  H  HA   . MET A 1 82  ? -1.122  0.598   -12.708 1.00 1.01  ? 177 MET A HA   4  
ATOM   9298  H  HB2  . MET A 1 82  ? -2.488  -2.032  -13.376 1.00 1.34  ? 177 MET A HB2  4  
ATOM   9299  H  HB3  . MET A 1 82  ? -1.774  -1.736  -11.788 1.00 1.15  ? 177 MET A HB3  4  
ATOM   9300  H  HG2  . MET A 1 82  ? -3.827  0.151   -13.012 1.00 2.28  ? 177 MET A HG2  4  
ATOM   9301  H  HG3  . MET A 1 82  ? -4.267  -1.248  -12.060 1.00 2.27  ? 177 MET A HG3  4  
ATOM   9302  H  HE1  . MET A 1 82  ? -2.766  2.115   -12.306 1.00 3.92  ? 177 MET A HE1  4  
ATOM   9303  H  HE2  . MET A 1 82  ? -4.112  2.598   -11.256 1.00 3.83  ? 177 MET A HE2  4  
ATOM   9304  H  HE3  . MET A 1 82  ? -2.444  2.664   -10.646 1.00 3.25  ? 177 MET A HE3  4  
ATOM   9305  N  N    . ALA A 1 83  ? 0.508   -1.900  -14.170 1.00 0.78  ? 178 ALA A N    4  
ATOM   9306  C  CA   . ALA A 1 83  ? 1.829   -2.530  -14.262 1.00 0.80  ? 178 ALA A CA   4  
ATOM   9307  C  C    . ALA A 1 83  ? 2.931   -1.533  -14.663 1.00 0.89  ? 178 ALA A C    4  
ATOM   9308  O  O    . ALA A 1 83  ? 4.059   -1.666  -14.184 1.00 0.99  ? 178 ALA A O    4  
ATOM   9309  C  CB   . ALA A 1 83  ? 1.757   -3.717  -15.229 1.00 0.88  ? 178 ALA A CB   4  
ATOM   9310  H  H    . ALA A 1 83  ? -0.222  -2.217  -14.798 1.00 0.79  ? 178 ALA A H    4  
ATOM   9311  H  HA   . ALA A 1 83  ? 2.094   -2.910  -13.273 1.00 0.83  ? 178 ALA A HA   4  
ATOM   9312  H  HB1  . ALA A 1 83  ? 0.994   -4.422  -14.898 1.00 2.03  ? 178 ALA A HB1  4  
ATOM   9313  H  HB2  . ALA A 1 83  ? 1.515   -3.366  -16.232 1.00 1.47  ? 178 ALA A HB2  4  
ATOM   9314  H  HB3  . ALA A 1 83  ? 2.719   -4.229  -15.255 1.00 1.82  ? 178 ALA A HB3  4  
ATOM   9315  N  N    . ARG A 1 84  ? 2.613   -0.520  -15.478 1.00 0.95  ? 179 ARG A N    4  
ATOM   9316  C  CA   . ARG A 1 84  ? 3.476   0.646   -15.688 1.00 1.04  ? 179 ARG A CA   4  
ATOM   9317  C  C    . ARG A 1 84  ? 3.603   1.465   -14.405 1.00 1.04  ? 179 ARG A C    4  
ATOM   9318  O  O    . ARG A 1 84  ? 4.704   1.604   -13.891 1.00 1.15  ? 179 ARG A O    4  
ATOM   9319  C  CB   . ARG A 1 84  ? 2.957   1.525   -16.832 1.00 1.19  ? 179 ARG A CB   4  
ATOM   9320  C  CG   . ARG A 1 84  ? 3.250   0.923   -18.217 1.00 1.88  ? 179 ARG A CG   4  
ATOM   9321  C  CD   . ARG A 1 84  ? 3.515   2.021   -19.253 1.00 2.03  ? 179 ARG A CD   4  
ATOM   9322  N  NE   . ARG A 1 84  ? 4.791   2.696   -18.966 1.00 2.68  ? 179 ARG A NE   4  
ATOM   9323  C  CZ   . ARG A 1 84  ? 5.384   3.634   -19.684 1.00 3.37  ? 179 ARG A CZ   4  
ATOM   9324  N  NH1  . ARG A 1 84  ? 4.826   4.133   -20.763 1.00 3.70  ? 179 ARG A NH1  4  
ATOM   9325  N  NH2  . ARG A 1 84  ? 6.567   4.063   -19.313 1.00 4.43  ? 179 ARG A NH2  4  
ATOM   9326  H  H    . ARG A 1 84  ? 1.692   -0.516  -15.905 1.00 0.97  ? 179 ARG A H    4  
ATOM   9327  H  HA   . ARG A 1 84  ? 4.480   0.305   -15.946 1.00 1.06  ? 179 ARG A HA   4  
ATOM   9328  H  HB2  . ARG A 1 84  ? 1.883   1.682   -16.734 1.00 1.35  ? 179 ARG A HB2  4  
ATOM   9329  H  HB3  . ARG A 1 84  ? 3.443   2.497   -16.745 1.00 1.67  ? 179 ARG A HB3  4  
ATOM   9330  H  HG2  . ARG A 1 84  ? 4.129   0.280   -18.171 1.00 2.78  ? 179 ARG A HG2  4  
ATOM   9331  H  HG3  . ARG A 1 84  ? 2.402   0.323   -18.540 1.00 2.61  ? 179 ARG A HG3  4  
ATOM   9332  H  HD2  . ARG A 1 84  ? 3.563   1.563   -20.243 1.00 2.62  ? 179 ARG A HD2  4  
ATOM   9333  H  HD3  . ARG A 1 84  ? 2.695   2.742   -19.235 1.00 2.31  ? 179 ARG A HD3  4  
ATOM   9334  H  HE   . ARG A 1 84  ? 5.280   2.417   -18.114 1.00 3.31  ? 179 ARG A HE   4  
ATOM   9335  H  HH11 . ARG A 1 84  ? 3.946   3.768   -21.078 1.00 3.59  ? 179 ARG A HH11 4  
ATOM   9336  H  HH12 . ARG A 1 84  ? 5.377   4.693   -21.402 1.00 4.53  ? 179 ARG A HH12 4  
ATOM   9337  H  HH21 . ARG A 1 84  ? 6.996   3.666   -18.480 1.00 4.88  ? 179 ARG A HH21 4  
ATOM   9338  H  HH22 . ARG A 1 84  ? 7.041   4.790   -19.831 1.00 5.09  ? 179 ARG A HH22 4  
ATOM   9339  N  N    . TYR A 1 85  ? 2.495   1.924   -13.815 1.00 1.04  ? 180 TYR A N    4  
ATOM   9340  C  CA   . TYR A 1 85  ? 2.504   2.748   -12.594 1.00 1.14  ? 180 TYR A CA   4  
ATOM   9341  C  C    . TYR A 1 85  ? 3.317   2.124   -11.441 1.00 1.07  ? 180 TYR A C    4  
ATOM   9342  O  O    . TYR A 1 85  ? 4.055   2.824   -10.755 1.00 1.20  ? 180 TYR A O    4  
ATOM   9343  C  CB   . TYR A 1 85  ? 1.052   3.016   -12.172 1.00 1.28  ? 180 TYR A CB   4  
ATOM   9344  C  CG   . TYR A 1 85  ? 0.935   4.015   -11.041 1.00 1.23  ? 180 TYR A CG   4  
ATOM   9345  C  CD1  . TYR A 1 85  ? 0.989   5.391   -11.327 1.00 1.96  ? 180 TYR A CD1  4  
ATOM   9346  C  CD2  . TYR A 1 85  ? 0.809   3.576   -9.710  1.00 2.74  ? 180 TYR A CD2  4  
ATOM   9347  C  CE1  . TYR A 1 85  ? 0.919   6.333   -10.286 1.00 1.98  ? 180 TYR A CE1  4  
ATOM   9348  C  CE2  . TYR A 1 85  ? 0.736   4.514   -8.664  1.00 3.07  ? 180 TYR A CE2  4  
ATOM   9349  C  CZ   . TYR A 1 85  ? 0.783   5.897   -8.947  1.00 1.86  ? 180 TYR A CZ   4  
ATOM   9350  O  OH   . TYR A 1 85  ? 0.698   6.808   -7.942  1.00 2.35  ? 180 TYR A OH   4  
ATOM   9351  H  H    . TYR A 1 85  ? 1.604   1.762   -14.270 1.00 1.06  ? 180 TYR A H    4  
ATOM   9352  H  HA   . TYR A 1 85  ? 2.975   3.702   -12.829 1.00 1.25  ? 180 TYR A HA   4  
ATOM   9353  H  HB2  . TYR A 1 85  ? 0.502   3.409   -13.028 1.00 1.45  ? 180 TYR A HB2  4  
ATOM   9354  H  HB3  . TYR A 1 85  ? 0.578   2.081   -11.875 1.00 1.59  ? 180 TYR A HB3  4  
ATOM   9355  H  HD1  . TYR A 1 85  ? 1.085   5.728   -12.350 1.00 3.36  ? 180 TYR A HD1  4  
ATOM   9356  H  HD2  . TYR A 1 85  ? 0.777   2.519   -9.485  1.00 4.07  ? 180 TYR A HD2  4  
ATOM   9357  H  HE1  . TYR A 1 85  ? 0.961   7.384   -10.517 1.00 3.19  ? 180 TYR A HE1  4  
ATOM   9358  H  HE2  . TYR A 1 85  ? 0.650   4.180   -7.642  1.00 4.59  ? 180 TYR A HE2  4  
ATOM   9359  H  HH   . TYR A 1 85  ? 0.732   7.708   -8.268  1.00 2.27  ? 180 TYR A HH   4  
ATOM   9360  N  N    . VAL A 1 86  ? 3.239   0.800   -11.294 1.00 0.95  ? 181 VAL A N    4  
ATOM   9361  C  CA   . VAL A 1 86  ? 4.129   -0.023  -10.459 1.00 0.95  ? 181 VAL A CA   4  
ATOM   9362  C  C    . VAL A 1 86  ? 5.595   0.087   -10.931 1.00 0.99  ? 181 VAL A C    4  
ATOM   9363  O  O    . VAL A 1 86  ? 6.437   0.623   -10.212 1.00 1.15  ? 181 VAL A O    4  
ATOM   9364  C  CB   . VAL A 1 86  ? 3.628   -1.491  -10.450 1.00 0.95  ? 181 VAL A CB   4  
ATOM   9365  C  CG1  . VAL A 1 86  ? 4.624   -2.512  -9.878  1.00 1.28  ? 181 VAL A CG1  4  
ATOM   9366  C  CG2  . VAL A 1 86  ? 2.328   -1.606  -9.634  1.00 1.06  ? 181 VAL A CG2  4  
ATOM   9367  H  H    . VAL A 1 86  ? 2.514   0.335   -11.842 1.00 0.91  ? 181 VAL A H    4  
ATOM   9368  H  HA   . VAL A 1 86  ? 4.079   0.356   -9.437  1.00 0.98  ? 181 VAL A HA   4  
ATOM   9369  H  HB   . VAL A 1 86  ? 3.415   -1.787  -11.480 1.00 1.11  ? 181 VAL A HB   4  
ATOM   9370  H  HG11 . VAL A 1 86  ? 5.550   -2.535  -10.448 1.00 1.93  ? 181 VAL A HG11 4  
ATOM   9371  H  HG12 . VAL A 1 86  ? 4.850   -2.259  -8.850  1.00 2.04  ? 181 VAL A HG12 4  
ATOM   9372  H  HG13 . VAL A 1 86  ? 4.188   -3.510  -9.911  1.00 2.19  ? 181 VAL A HG13 4  
ATOM   9373  H  HG21 . VAL A 1 86  ? 1.927   -2.617  -9.718  1.00 1.95  ? 181 VAL A HG21 4  
ATOM   9374  H  HG22 . VAL A 1 86  ? 2.527   -1.385  -8.585  1.00 1.78  ? 181 VAL A HG22 4  
ATOM   9375  H  HG23 . VAL A 1 86  ? 1.577   -0.908  -9.997  1.00 2.07  ? 181 VAL A HG23 4  
ATOM   9376  N  N    . GLN A 1 87  ? 5.921   -0.465  -12.106 1.00 1.01  ? 182 GLN A N    4  
ATOM   9377  C  CA   . GLN A 1 87  ? 7.306   -0.732  -12.515 1.00 1.18  ? 182 GLN A CA   4  
ATOM   9378  C  C    . GLN A 1 87  ? 8.112   0.518   -12.895 1.00 1.23  ? 182 GLN A C    4  
ATOM   9379  O  O    . GLN A 1 87  ? 9.321   0.519   -12.664 1.00 1.36  ? 182 GLN A O    4  
ATOM   9380  C  CB   . GLN A 1 87  ? 7.315   -1.768  -13.654 1.00 1.48  ? 182 GLN A CB   4  
ATOM   9381  C  CG   . GLN A 1 87  ? 6.748   -3.144  -13.232 1.00 2.90  ? 182 GLN A CG   4  
ATOM   9382  C  CD   . GLN A 1 87  ? 6.534   -4.096  -14.407 1.00 3.65  ? 182 GLN A CD   4  
ATOM   9383  O  OE1  . GLN A 1 87  ? 7.063   -5.202  -14.465 1.00 4.10  ? 182 GLN A OE1  4  
ATOM   9384  N  NE2  . GLN A 1 87  ? 5.717   -3.734  -15.369 1.00 4.14  ? 182 GLN A NE2  4  
ATOM   9385  H  H    . GLN A 1 87  ? 5.179   -0.764  -12.730 1.00 1.05  ? 182 GLN A H    4  
ATOM   9386  H  HA   . GLN A 1 87  ? 7.841   -1.149  -11.663 1.00 1.24  ? 182 GLN A HA   4  
ATOM   9387  H  HB2  . GLN A 1 87  ? 6.741   -1.366  -14.489 1.00 1.70  ? 182 GLN A HB2  4  
ATOM   9388  H  HB3  . GLN A 1 87  ? 8.343   -1.912  -13.994 1.00 1.96  ? 182 GLN A HB3  4  
ATOM   9389  H  HG2  . GLN A 1 87  ? 7.424   -3.613  -12.518 1.00 3.54  ? 182 GLN A HG2  4  
ATOM   9390  H  HG3  . GLN A 1 87  ? 5.783   -3.012  -12.745 1.00 3.48  ? 182 GLN A HG3  4  
ATOM   9391  H  HE21 . GLN A 1 87  ? 5.235   -2.845  -15.283 1.00 4.09  ? 182 GLN A HE21 4  
ATOM   9392  H  HE22 . GLN A 1 87  ? 5.621   -4.325  -16.175 1.00 4.72  ? 182 GLN A HE22 4  
ATOM   9393  N  N    . ASP A 1 88  ? 7.481   1.563   -13.443 1.00 1.30  ? 183 ASP A N    4  
ATOM   9394  C  CA   . ASP A 1 88  ? 8.133   2.828   -13.817 1.00 1.54  ? 183 ASP A CA   4  
ATOM   9395  C  C    . ASP A 1 88  ? 8.516   3.685   -12.596 1.00 1.46  ? 183 ASP A C    4  
ATOM   9396  O  O    . ASP A 1 88  ? 9.359   4.579   -12.720 1.00 1.62  ? 183 ASP A O    4  
ATOM   9397  C  CB   . ASP A 1 88  ? 7.230   3.625   -14.776 1.00 1.86  ? 183 ASP A CB   4  
ATOM   9398  C  CG   . ASP A 1 88  ? 7.276   3.104   -16.217 1.00 3.22  ? 183 ASP A CG   4  
ATOM   9399  O  OD1  . ASP A 1 88  ? 8.225   3.485   -16.946 1.00 3.79  ? 183 ASP A OD1  4  
ATOM   9400  O  OD2  . ASP A 1 88  ? 6.339   2.413   -16.666 1.00 4.45  ? 183 ASP A OD2  4  
ATOM   9401  H  H    . ASP A 1 88  ? 6.466   1.533   -13.533 1.00 1.23  ? 183 ASP A H    4  
ATOM   9402  H  HA   . ASP A 1 88  ? 9.063   2.596   -14.340 1.00 1.68  ? 183 ASP A HA   4  
ATOM   9403  H  HB2  . ASP A 1 88  ? 6.205   3.636   -14.407 1.00 1.52  ? 183 ASP A HB2  4  
ATOM   9404  H  HB3  . ASP A 1 88  ? 7.569   4.662   -14.794 1.00 2.31  ? 183 ASP A HB3  4  
ATOM   9405  N  N    . PHE A 1 89  ? 7.918   3.403   -11.430 1.00 1.33  ? 184 PHE A N    4  
ATOM   9406  C  CA   . PHE A 1 89  ? 8.368   3.893   -10.126 1.00 1.36  ? 184 PHE A CA   4  
ATOM   9407  C  C    . PHE A 1 89  ? 9.534   3.033   -9.621  1.00 1.90  ? 184 PHE A C    4  
ATOM   9408  O  O    . PHE A 1 89  ? 10.600  3.559   -9.300  1.00 2.04  ? 184 PHE A O    4  
ATOM   9409  C  CB   . PHE A 1 89  ? 7.181   3.894   -9.139  1.00 1.39  ? 184 PHE A CB   4  
ATOM   9410  C  CG   . PHE A 1 89  ? 6.925   5.250   -8.517  1.00 1.30  ? 184 PHE A CG   4  
ATOM   9411  C  CD1  . PHE A 1 89  ? 7.593   5.627   -7.336  1.00 1.68  ? 184 PHE A CD1  4  
ATOM   9412  C  CD2  . PHE A 1 89  ? 6.044   6.152   -9.141  1.00 2.66  ? 184 PHE A CD2  4  
ATOM   9413  C  CE1  . PHE A 1 89  ? 7.380   6.901   -6.783  1.00 1.55  ? 184 PHE A CE1  4  
ATOM   9414  C  CE2  . PHE A 1 89  ? 5.835   7.428   -8.591  1.00 2.68  ? 184 PHE A CE2  4  
ATOM   9415  C  CZ   . PHE A 1 89  ? 6.503   7.804   -7.412  1.00 1.34  ? 184 PHE A CZ   4  
ATOM   9416  H  H    . PHE A 1 89  ? 7.214   2.678   -11.440 1.00 1.26  ? 184 PHE A H    4  
ATOM   9417  H  HA   . PHE A 1 89  ? 8.734   4.915   -10.239 1.00 1.55  ? 184 PHE A HA   4  
ATOM   9418  H  HB2  . PHE A 1 89  ? 6.271   3.575   -9.646  1.00 1.50  ? 184 PHE A HB2  4  
ATOM   9419  H  HB3  . PHE A 1 89  ? 7.356   3.172   -8.341  1.00 1.47  ? 184 PHE A HB3  4  
ATOM   9420  H  HD1  . PHE A 1 89  ? 8.278   4.940   -6.861  1.00 2.69  ? 184 PHE A HD1  4  
ATOM   9421  H  HD2  . PHE A 1 89  ? 5.529   5.865   -10.048 1.00 4.07  ? 184 PHE A HD2  4  
ATOM   9422  H  HE1  . PHE A 1 89  ? 7.896   7.192   -5.881  1.00 3.04  ? 184 PHE A HE1  4  
ATOM   9423  H  HE2  . PHE A 1 89  ? 5.162   8.119   -9.076  1.00 4.11  ? 184 PHE A HE2  4  
ATOM   9424  H  HZ   . PHE A 1 89  ? 6.350   8.787   -6.994  1.00 1.50  ? 184 PHE A HZ   4  
ATOM   9425  N  N    . HIS A 1 90  ? 9.338   1.709   -9.605  1.00 1.22  ? 185 HIS A N    4  
ATOM   9426  C  CA   . HIS A 1 90  ? 10.361  0.661   -9.470  1.00 1.39  ? 185 HIS A CA   4  
ATOM   9427  C  C    . HIS A 1 90  ? 9.752   -0.748  -9.685  1.00 1.45  ? 185 HIS A C    4  
ATOM   9428  O  O    . HIS A 1 90  ? 8.666   -1.011  -9.158  1.00 1.43  ? 185 HIS A O    4  
ATOM   9429  C  CB   . HIS A 1 90  ? 11.060  0.724   -8.096  1.00 1.50  ? 185 HIS A CB   4  
ATOM   9430  C  CG   . HIS A 1 90  ? 12.224  -0.217  -8.005  1.00 1.77  ? 185 HIS A CG   4  
ATOM   9431  N  ND1  . HIS A 1 90  ? 12.198  -1.499  -7.455  1.00 2.01  ? 185 HIS A ND1  4  
ATOM   9432  C  CD2  . HIS A 1 90  ? 13.419  -0.017  -8.616  1.00 2.42  ? 185 HIS A CD2  4  
ATOM   9433  C  CE1  . HIS A 1 90  ? 13.402  -2.028  -7.728  1.00 2.33  ? 185 HIS A CE1  4  
ATOM   9434  N  NE2  . HIS A 1 90  ? 14.157  -1.161  -8.426  1.00 2.64  ? 185 HIS A NE2  4  
ATOM   9435  H  H    . HIS A 1 90  ? 8.408   1.396   -9.864  1.00 1.22  ? 185 HIS A H    4  
ATOM   9436  H  HA   . HIS A 1 90  ? 11.102  0.853   -10.246 1.00 1.52  ? 185 HIS A HA   4  
ATOM   9437  H  HB2  . HIS A 1 90  ? 11.438  1.725   -7.901  1.00 1.55  ? 185 HIS A HB2  4  
ATOM   9438  H  HB3  . HIS A 1 90  ? 10.357  0.471   -7.307  1.00 1.53  ? 185 HIS A HB3  4  
ATOM   9439  H  HD2  . HIS A 1 90  ? 13.678  0.844   -9.212  1.00 2.96  ? 185 HIS A HD2  4  
ATOM   9440  H  HE1  . HIS A 1 90  ? 13.712  -3.027  -7.456  1.00 2.67  ? 185 HIS A HE1  4  
ATOM   9441  H  HE2  . HIS A 1 90  ? 15.072  -1.354  -8.823  1.00 3.24  ? 185 HIS A HE2  4  
ATOM   9442  N  N    . PRO A 1 91  ? 10.433  -1.701  -10.359 1.00 1.58  ? 186 PRO A N    4  
ATOM   9443  C  CA   . PRO A 1 91  ? 9.938   -3.068  -10.564 1.00 1.66  ? 186 PRO A CA   4  
ATOM   9444  C  C    . PRO A 1 91  ? 9.535   -3.877  -9.313  1.00 1.67  ? 186 PRO A C    4  
ATOM   9445  O  O    . PRO A 1 91  ? 8.899   -4.917  -9.490  1.00 2.08  ? 186 PRO A O    4  
ATOM   9446  C  CB   . PRO A 1 91  ? 11.016  -3.792  -11.387 1.00 1.77  ? 186 PRO A CB   4  
ATOM   9447  C  CG   . PRO A 1 91  ? 12.242  -2.889  -11.324 1.00 1.88  ? 186 PRO A CG   4  
ATOM   9448  C  CD   . PRO A 1 91  ? 11.626  -1.506  -11.174 1.00 1.79  ? 186 PRO A CD   4  
ATOM   9449  H  HA   . PRO A 1 91  ? 9.045   -2.997  -11.181 1.00 1.78  ? 186 PRO A HA   4  
ATOM   9450  H  HB2  . PRO A 1 91  ? 11.254  -4.777  -10.986 1.00 1.85  ? 186 PRO A HB2  4  
ATOM   9451  H  HB3  . PRO A 1 91  ? 10.682  -3.879  -12.422 1.00 1.85  ? 186 PRO A HB3  4  
ATOM   9452  H  HG2  . PRO A 1 91  ? 12.832  -3.130  -10.439 1.00 1.97  ? 186 PRO A HG2  4  
ATOM   9453  H  HG3  . PRO A 1 91  ? 12.847  -2.971  -12.225 1.00 2.01  ? 186 PRO A HG3  4  
ATOM   9454  H  HD2  . PRO A 1 91  ? 12.346  -0.827  -10.727 1.00 1.97  ? 186 PRO A HD2  4  
ATOM   9455  H  HD3  . PRO A 1 91  ? 11.333  -1.129  -12.154 1.00 1.82  ? 186 PRO A HD3  4  
ATOM   9456  N  N    . ARG A 1 92  ? 9.863   -3.436  -8.086  1.00 1.61  ? 187 ARG A N    4  
ATOM   9457  C  CA   . ARG A 1 92  ? 9.479   -4.079  -6.814  1.00 1.65  ? 187 ARG A CA   4  
ATOM   9458  C  C    . ARG A 1 92  ? 8.265   -3.425  -6.103  1.00 1.51  ? 187 ARG A C    4  
ATOM   9459  O  O    . ARG A 1 92  ? 7.893   -3.866  -5.011  1.00 1.60  ? 187 ARG A O    4  
ATOM   9460  C  CB   . ARG A 1 92  ? 10.733  -4.136  -5.917  1.00 1.95  ? 187 ARG A CB   4  
ATOM   9461  C  CG   . ARG A 1 92  ? 10.619  -5.054  -4.685  1.00 1.86  ? 187 ARG A CG   4  
ATOM   9462  C  CD   . ARG A 1 92  ? 11.986  -5.247  -4.024  1.00 2.44  ? 187 ARG A CD   4  
ATOM   9463  N  NE   . ARG A 1 92  ? 11.849  -5.806  -2.668  1.00 2.55  ? 187 ARG A NE   4  
ATOM   9464  C  CZ   . ARG A 1 92  ? 12.502  -5.409  -1.583  1.00 3.56  ? 187 ARG A CZ   4  
ATOM   9465  N  NH1  . ARG A 1 92  ? 13.403  -4.450  -1.596  1.00 4.50  ? 187 ARG A NH1  4  
ATOM   9466  N  NH2  . ARG A 1 92  ? 12.257  -5.976  -0.430  1.00 4.38  ? 187 ARG A NH2  4  
ATOM   9467  H  H    . ARG A 1 92  ? 10.427  -2.597  -8.016  1.00 1.83  ? 187 ARG A H    4  
ATOM   9468  H  HA   . ARG A 1 92  ? 9.189   -5.107  -7.032  1.00 1.70  ? 187 ARG A HA   4  
ATOM   9469  H  HB2  . ARG A 1 92  ? 11.564  -4.502  -6.525  1.00 2.43  ? 187 ARG A HB2  4  
ATOM   9470  H  HB3  . ARG A 1 92  ? 10.978  -3.128  -5.580  1.00 2.41  ? 187 ARG A HB3  4  
ATOM   9471  H  HG2  . ARG A 1 92  ? 9.957   -4.596  -3.951  1.00 2.16  ? 187 ARG A HG2  4  
ATOM   9472  H  HG3  . ARG A 1 92  ? 10.219  -6.026  -4.976  1.00 2.35  ? 187 ARG A HG3  4  
ATOM   9473  H  HD2  . ARG A 1 92  ? 12.591  -5.918  -4.637  1.00 3.16  ? 187 ARG A HD2  4  
ATOM   9474  H  HD3  . ARG A 1 92  ? 12.481  -4.277  -3.980  1.00 3.26  ? 187 ARG A HD3  4  
ATOM   9475  H  HE   . ARG A 1 92  ? 11.160  -6.537  -2.528  1.00 2.77  ? 187 ARG A HE   4  
ATOM   9476  H  HH11 . ARG A 1 92  ? 13.636  -3.950  -2.427  1.00 4.50  ? 187 ARG A HH11 4  
ATOM   9477  H  HH12 . ARG A 1 92  ? 13.848  -4.187  -0.707  1.00 5.59  ? 187 ARG A HH12 4  
ATOM   9478  H  HH21 . ARG A 1 92  ? 11.565  -6.704  -0.345  1.00 4.36  ? 187 ARG A HH21 4  
ATOM   9479  H  HH22 . ARG A 1 92  ? 12.783  -5.623  0.378   1.00 5.39  ? 187 ARG A HH22 4  
ATOM   9480  N  N    . LEU A 1 93  ? 7.629   -2.391  -6.674  1.00 1.36  ? 188 LEU A N    4  
ATOM   9481  C  CA   . LEU A 1 93  ? 6.323   -1.906  -6.181  1.00 1.21  ? 188 LEU A CA   4  
ATOM   9482  C  C    . LEU A 1 93  ? 5.244   -3.005  -6.294  1.00 1.02  ? 188 LEU A C    4  
ATOM   9483  O  O    . LEU A 1 93  ? 5.440   -4.019  -6.965  1.00 1.04  ? 188 LEU A O    4  
ATOM   9484  C  CB   . LEU A 1 93  ? 5.893   -0.615  -6.927  1.00 1.12  ? 188 LEU A CB   4  
ATOM   9485  C  CG   . LEU A 1 93  ? 6.265   0.740   -6.294  1.00 1.32  ? 188 LEU A CG   4  
ATOM   9486  C  CD1  . LEU A 1 93  ? 5.629   0.937   -4.908  1.00 2.05  ? 188 LEU A CD1  4  
ATOM   9487  C  CD2  . LEU A 1 93  ? 7.778   0.940   -6.213  1.00 2.02  ? 188 LEU A CD2  4  
ATOM   9488  H  H    . LEU A 1 93  ? 7.961   -2.047  -7.566  1.00 1.38  ? 188 LEU A H    4  
ATOM   9489  H  HA   . LEU A 1 93  ? 6.416   -1.692  -5.117  1.00 1.43  ? 188 LEU A HA   4  
ATOM   9490  H  HB2  . LEU A 1 93  ? 6.292   -0.643  -7.939  1.00 1.75  ? 188 LEU A HB2  4  
ATOM   9491  H  HB3  . LEU A 1 93  ? 4.807   -0.610  -7.035  1.00 1.41  ? 188 LEU A HB3  4  
ATOM   9492  H  HG   . LEU A 1 93  ? 5.870   1.517   -6.951  1.00 1.58  ? 188 LEU A HG   4  
ATOM   9493  H  HD11 . LEU A 1 93  ? 5.830   1.950   -4.558  1.00 2.96  ? 188 LEU A HD11 4  
ATOM   9494  H  HD12 . LEU A 1 93  ? 4.550   0.795   -4.972  1.00 2.18  ? 188 LEU A HD12 4  
ATOM   9495  H  HD13 . LEU A 1 93  ? 6.044   0.235   -4.186  1.00 2.99  ? 188 LEU A HD13 4  
ATOM   9496  H  HD21 . LEU A 1 93  ? 8.190   0.846   -7.213  1.00 2.83  ? 188 LEU A HD21 4  
ATOM   9497  H  HD22 . LEU A 1 93  ? 8.001   1.939   -5.837  1.00 2.62  ? 188 LEU A HD22 4  
ATOM   9498  H  HD23 . LEU A 1 93  ? 8.232   0.197   -5.555  1.00 2.38  ? 188 LEU A HD23 4  
ATOM   9499  N  N    . LEU A 1 94  ? 4.091   -2.790  -5.650  1.00 1.05  ? 189 LEU A N    4  
ATOM   9500  C  CA   . LEU A 1 94  ? 2.951   -3.700  -5.694  1.00 1.05  ? 189 LEU A CA   4  
ATOM   9501  C  C    . LEU A 1 94  ? 1.650   -2.917  -5.916  1.00 0.92  ? 189 LEU A C    4  
ATOM   9502  O  O    . LEU A 1 94  ? 1.328   -2.012  -5.148  1.00 0.94  ? 189 LEU A O    4  
ATOM   9503  C  CB   . LEU A 1 94  ? 2.949   -4.548  -4.404  1.00 1.50  ? 189 LEU A CB   4  
ATOM   9504  C  CG   . LEU A 1 94  ? 2.532   -6.012  -4.623  1.00 1.35  ? 189 LEU A CG   4  
ATOM   9505  C  CD1  . LEU A 1 94  ? 2.685   -6.801  -3.313  1.00 2.05  ? 189 LEU A CD1  4  
ATOM   9506  C  CD2  . LEU A 1 94  ? 1.113   -6.201  -5.184  1.00 1.87  ? 189 LEU A CD2  4  
ATOM   9507  H  H    . LEU A 1 94  ? 3.975   -1.953  -5.104  1.00 1.21  ? 189 LEU A H    4  
ATOM   9508  H  HA   . LEU A 1 94  ? 3.074   -4.362  -6.546  1.00 1.04  ? 189 LEU A HA   4  
ATOM   9509  H  HB2  . LEU A 1 94  ? 3.959   -4.563  -3.990  1.00 2.31  ? 189 LEU A HB2  4  
ATOM   9510  H  HB3  . LEU A 1 94  ? 2.310   -4.082  -3.660  1.00 2.02  ? 189 LEU A HB3  4  
ATOM   9511  H  HG   . LEU A 1 94  ? 3.237   -6.420  -5.341  1.00 2.20  ? 189 LEU A HG   4  
ATOM   9512  H  HD11 . LEU A 1 94  ? 2.464   -7.854  -3.489  1.00 2.42  ? 189 LEU A HD11 4  
ATOM   9513  H  HD12 . LEU A 1 94  ? 3.709   -6.716  -2.946  1.00 3.10  ? 189 LEU A HD12 4  
ATOM   9514  H  HD13 . LEU A 1 94  ? 2.002   -6.415  -2.558  1.00 2.77  ? 189 LEU A HD13 4  
ATOM   9515  H  HD21 . LEU A 1 94  ? 0.382   -5.678  -4.571  1.00 2.48  ? 189 LEU A HD21 4  
ATOM   9516  H  HD22 . LEU A 1 94  ? 1.060   -5.827  -6.204  1.00 2.84  ? 189 LEU A HD22 4  
ATOM   9517  H  HD23 . LEU A 1 94  ? 0.862   -7.262  -5.209  1.00 2.52  ? 189 LEU A HD23 4  
ATOM   9518  N  N    . GLY A 1 95  ? 0.928   -3.272  -6.980  1.00 0.90  ? 190 GLY A N    4  
ATOM   9519  C  CA   . GLY A 1 95  ? -0.388  -2.740  -7.338  1.00 0.87  ? 190 GLY A CA   4  
ATOM   9520  C  C    . GLY A 1 95  ? -1.412  -3.865  -7.456  1.00 0.98  ? 190 GLY A C    4  
ATOM   9521  O  O    . GLY A 1 95  ? -1.080  -4.950  -7.940  1.00 1.28  ? 190 GLY A O    4  
ATOM   9522  H  H    . GLY A 1 95  ? 1.267   -4.040  -7.546  1.00 1.00  ? 190 GLY A H    4  
ATOM   9523  H  HA2  . GLY A 1 95  ? -0.723  -2.000  -6.616  1.00 0.83  ? 190 GLY A HA2  4  
ATOM   9524  H  HA3  . GLY A 1 95  ? -0.328  -2.263  -8.317  1.00 0.94  ? 190 GLY A HA3  4  
ATOM   9525  N  N    . LEU A 1 96  ? -2.663  -3.598  -7.075  1.00 0.89  ? 191 LEU A N    4  
ATOM   9526  C  CA   . LEU A 1 96  ? -3.784  -4.536  -7.214  1.00 1.08  ? 191 LEU A CA   4  
ATOM   9527  C  C    . LEU A 1 96  ? -5.121  -3.803  -7.409  1.00 0.98  ? 191 LEU A C    4  
ATOM   9528  O  O    . LEU A 1 96  ? -5.282  -2.665  -6.959  1.00 1.12  ? 191 LEU A O    4  
ATOM   9529  C  CB   . LEU A 1 96  ? -3.793  -5.588  -6.076  1.00 1.76  ? 191 LEU A CB   4  
ATOM   9530  C  CG   . LEU A 1 96  ? -4.165  -5.133  -4.652  1.00 1.02  ? 191 LEU A CG   4  
ATOM   9531  C  CD1  . LEU A 1 96  ? -4.321  -6.374  -3.756  1.00 2.11  ? 191 LEU A CD1  4  
ATOM   9532  C  CD2  . LEU A 1 96  ? -3.122  -4.211  -4.011  1.00 2.31  ? 191 LEU A CD2  4  
ATOM   9533  H  H    . LEU A 1 96  ? -2.861  -2.687  -6.673  1.00 0.85  ? 191 LEU A H    4  
ATOM   9534  H  HA   . LEU A 1 96  ? -3.614  -5.092  -8.138  1.00 1.16  ? 191 LEU A HA   4  
ATOM   9535  H  HB2  . LEU A 1 96  ? -4.512  -6.355  -6.358  1.00 3.10  ? 191 LEU A HB2  4  
ATOM   9536  H  HB3  . LEU A 1 96  ? -2.818  -6.078  -6.044  1.00 3.01  ? 191 LEU A HB3  4  
ATOM   9537  H  HG   . LEU A 1 96  ? -5.120  -4.615  -4.684  1.00 2.08  ? 191 LEU A HG   4  
ATOM   9538  H  HD11 . LEU A 1 96  ? -4.654  -6.076  -2.761  1.00 2.99  ? 191 LEU A HD11 4  
ATOM   9539  H  HD12 . LEU A 1 96  ? -5.061  -7.051  -4.183  1.00 2.96  ? 191 LEU A HD12 4  
ATOM   9540  H  HD13 . LEU A 1 96  ? -3.369  -6.901  -3.675  1.00 2.93  ? 191 LEU A HD13 4  
ATOM   9541  H  HD21 . LEU A 1 96  ? -3.386  -4.030  -2.968  1.00 3.13  ? 191 LEU A HD21 4  
ATOM   9542  H  HD22 . LEU A 1 96  ? -2.134  -4.669  -4.060  1.00 2.89  ? 191 LEU A HD22 4  
ATOM   9543  H  HD23 . LEU A 1 96  ? -3.102  -3.252  -4.523  1.00 3.34  ? 191 LEU A HD23 4  
ATOM   9544  N  N    . THR A 1 97  ? -6.061  -4.448  -8.114  1.00 0.93  ? 192 THR A N    4  
ATOM   9545  C  CA   . THR A 1 97  ? -7.308  -3.846  -8.636  1.00 1.01  ? 192 THR A CA   4  
ATOM   9546  C  C    . THR A 1 97  ? -8.390  -4.917  -8.858  1.00 1.08  ? 192 THR A C    4  
ATOM   9547  O  O    . THR A 1 97  ? -8.166  -6.092  -8.571  1.00 1.27  ? 192 THR A O    4  
ATOM   9548  C  CB   . THR A 1 97  ? -6.985  -2.982  -9.873  1.00 1.07  ? 192 THR A CB   4  
ATOM   9549  O  OG1  . THR A 1 97  ? -8.125  -2.259  -10.268 1.00 1.91  ? 192 THR A OG1  4  
ATOM   9550  C  CG2  . THR A 1 97  ? -6.496  -3.798  -11.074 1.00 1.54  ? 192 THR A CG2  4  
ATOM   9551  H  H    . THR A 1 97  ? -5.858  -5.404  -8.395  1.00 0.92  ? 192 THR A H    4  
ATOM   9552  H  HA   . THR A 1 97  ? -7.702  -3.161  -7.885  1.00 1.25  ? 192 THR A HA   4  
ATOM   9553  H  HB   . THR A 1 97  ? -6.213  -2.253  -9.605  1.00 1.61  ? 192 THR A HB   4  
ATOM   9554  H  HG1  . THR A 1 97  ? -7.874  -1.665  -10.984 1.00 2.03  ? 192 THR A HG1  4  
ATOM   9555  H  HG21 . THR A 1 97  ? -5.588  -4.340  -10.812 1.00 2.36  ? 192 THR A HG21 4  
ATOM   9556  H  HG22 . THR A 1 97  ? -7.262  -4.508  -11.387 1.00 2.26  ? 192 THR A HG22 4  
ATOM   9557  H  HG23 . THR A 1 97  ? -6.272  -3.126  -11.905 1.00 1.99  ? 192 THR A HG23 4  
ATOM   9558  N  N    . GLY A 1 98  ? -9.576  -4.526  -9.332  1.00 1.23  ? 193 GLY A N    4  
ATOM   9559  C  CA   . GLY A 1 98  ? -10.723 -5.412  -9.589  1.00 1.51  ? 193 GLY A CA   4  
ATOM   9560  C  C    . GLY A 1 98  ? -11.985 -4.663  -10.024 1.00 1.37  ? 193 GLY A C    4  
ATOM   9561  O  O    . GLY A 1 98  ? -11.981 -3.442  -10.158 1.00 1.86  ? 193 GLY A O    4  
ATOM   9562  H  H    . GLY A 1 98  ? -9.675  -3.547  -9.576  1.00 1.32  ? 193 GLY A H    4  
ATOM   9563  H  HA2  . GLY A 1 98  ? -10.453 -6.129  -10.364 1.00 1.78  ? 193 GLY A HA2  4  
ATOM   9564  H  HA3  . GLY A 1 98  ? -10.943 -5.985  -8.689  1.00 1.87  ? 193 GLY A HA3  4  
ATOM   9565  N  N    . SER A 1 99  ? -13.083 -5.387  -10.256 1.00 1.42  ? 194 SER A N    4  
ATOM   9566  C  CA   . SER A 1 99  ? -14.366 -4.772  -10.645 1.00 1.45  ? 194 SER A CA   4  
ATOM   9567  C  C    . SER A 1 99  ? -14.870 -3.741  -9.612  1.00 1.13  ? 194 SER A C    4  
ATOM   9568  O  O    . SER A 1 99  ? -14.857 -3.993  -8.400  1.00 1.09  ? 194 SER A O    4  
ATOM   9569  C  CB   . SER A 1 99  ? -15.451 -5.839  -10.885 1.00 2.05  ? 194 SER A CB   4  
ATOM   9570  O  OG   . SER A 1 99  ? -15.187 -6.627  -12.037 1.00 2.78  ? 194 SER A OG   4  
ATOM   9571  H  H    . SER A 1 99  ? -13.008 -6.396  -10.233 1.00 1.90  ? 194 SER A H    4  
ATOM   9572  H  HA   . SER A 1 99  ? -14.205 -4.238  -11.580 1.00 1.68  ? 194 SER A HA   4  
ATOM   9573  H  HB2  . SER A 1 99  ? -15.523 -6.484  -10.008 1.00 2.90  ? 194 SER A HB2  4  
ATOM   9574  H  HB3  . SER A 1 99  ? -16.411 -5.338  -11.026 1.00 2.23  ? 194 SER A HB3  4  
ATOM   9575  H  HG   . SER A 1 99  ? -15.934 -7.272  -12.133 1.00 3.59  ? 194 SER A HG   4  
ATOM   9576  N  N    . THR A 1 100 ? -15.352 -2.583  -10.092 1.00 1.28  ? 195 THR A N    4  
ATOM   9577  C  CA   . THR A 1 100 ? -15.617 -1.385  -9.272  1.00 1.73  ? 195 THR A CA   4  
ATOM   9578  C  C    . THR A 1 100 ? -16.587 -1.622  -8.120  1.00 1.74  ? 195 THR A C    4  
ATOM   9579  O  O    . THR A 1 100 ? -16.408 -1.043  -7.054  1.00 1.87  ? 195 THR A O    4  
ATOM   9580  C  CB   . THR A 1 100 ? -16.057 -0.217  -10.164 1.00 2.42  ? 195 THR A CB   4  
ATOM   9581  O  OG1  . THR A 1 100 ? -15.917 0.972   -9.428  1.00 3.80  ? 195 THR A OG1  4  
ATOM   9582  C  CG2  . THR A 1 100 ? -17.495 -0.306  -10.677 1.00 2.24  ? 195 THR A CG2  4  
ATOM   9583  H  H    . THR A 1 100 ? -15.401 -2.481  -11.104 1.00 1.39  ? 195 THR A H    4  
ATOM   9584  H  HA   . THR A 1 100 ? -14.667 -1.093  -8.818  1.00 1.95  ? 195 THR A HA   4  
ATOM   9585  H  HB   . THR A 1 100 ? -15.388 -0.163  -11.026 1.00 3.10  ? 195 THR A HB   4  
ATOM   9586  H  HG1  . THR A 1 100 ? -16.224 0.815   -8.529  1.00 4.13  ? 195 THR A HG1  4  
ATOM   9587  H  HG21 . THR A 1 100 ? -17.637 -1.229  -11.236 1.00 2.46  ? 195 THR A HG21 4  
ATOM   9588  H  HG22 . THR A 1 100 ? -18.207 -0.259  -9.853  1.00 2.85  ? 195 THR A HG22 4  
ATOM   9589  H  HG23 . THR A 1 100 ? -17.687 0.535   -11.343 1.00 2.91  ? 195 THR A HG23 4  
ATOM   9590  N  N    . LYS A 1 101 ? -17.572 -2.513  -8.286  1.00 1.84  ? 196 LYS A N    4  
ATOM   9591  C  CA   . LYS A 1 101 ? -18.486 -2.920  -7.210  1.00 2.18  ? 196 LYS A CA   4  
ATOM   9592  C  C    . LYS A 1 101 ? -17.725 -3.523  -6.012  1.00 2.08  ? 196 LYS A C    4  
ATOM   9593  O  O    . LYS A 1 101 ? -18.018 -3.201  -4.861  1.00 2.53  ? 196 LYS A O    4  
ATOM   9594  C  CB   . LYS A 1 101 ? -19.512 -3.909  -7.798  1.00 2.45  ? 196 LYS A CB   4  
ATOM   9595  C  CG   . LYS A 1 101 ? -20.642 -4.230  -6.808  1.00 2.98  ? 196 LYS A CG   4  
ATOM   9596  C  CD   . LYS A 1 101 ? -21.574 -5.326  -7.345  1.00 3.00  ? 196 LYS A CD   4  
ATOM   9597  C  CE   . LYS A 1 101 ? -22.740 -5.581  -6.378  1.00 3.79  ? 196 LYS A CE   4  
ATOM   9598  N  NZ   . LYS A 1 101 ? -23.791 -4.542  -6.472  1.00 4.93  ? 196 LYS A NZ   4  
ATOM   9599  H  H    . LYS A 1 101 ? -17.682 -2.930  -9.198  1.00 1.79  ? 196 LYS A H    4  
ATOM   9600  H  HA   . LYS A 1 101 ? -19.013 -2.036  -6.844  1.00 2.44  ? 196 LYS A HA   4  
ATOM   9601  H  HB2  . LYS A 1 101 ? -19.956 -3.475  -8.697  1.00 3.11  ? 196 LYS A HB2  4  
ATOM   9602  H  HB3  . LYS A 1 101 ? -19.003 -4.835  -8.077  1.00 2.48  ? 196 LYS A HB3  4  
ATOM   9603  H  HG2  . LYS A 1 101 ? -20.213 -4.580  -5.869  1.00 3.35  ? 196 LYS A HG2  4  
ATOM   9604  H  HG3  . LYS A 1 101 ? -21.213 -3.320  -6.614  1.00 3.81  ? 196 LYS A HG3  4  
ATOM   9605  H  HD2  . LYS A 1 101 ? -21.955 -5.051  -8.330  1.00 3.19  ? 196 LYS A HD2  4  
ATOM   9606  H  HD3  . LYS A 1 101 ? -20.999 -6.247  -7.445  1.00 2.90  ? 196 LYS A HD3  4  
ATOM   9607  H  HE2  . LYS A 1 101 ? -23.180 -6.557  -6.603  1.00 3.72  ? 196 LYS A HE2  4  
ATOM   9608  H  HE3  . LYS A 1 101 ? -22.345 -5.621  -5.357  1.00 4.49  ? 196 LYS A HE3  4  
ATOM   9609  H  HZ1  . LYS A 1 101 ? -24.263 -4.577  -7.369  1.00 5.02  ? 196 LYS A HZ1  4  
ATOM   9610  H  HZ2  . LYS A 1 101 ? -24.488 -4.670  -5.743  1.00 5.61  ? 196 LYS A HZ2  4  
ATOM   9611  H  HZ3  . LYS A 1 101 ? -23.411 -3.607  -6.363  1.00 5.67  ? 196 LYS A HZ3  4  
ATOM   9612  N  N    . GLN A 1 102 ? -16.710 -4.345  -6.293  1.00 1.65  ? 197 GLN A N    4  
ATOM   9613  C  CA   . GLN A 1 102 ? -15.869 -4.975  -5.278  1.00 1.58  ? 197 GLN A CA   4  
ATOM   9614  C  C    . GLN A 1 102 ? -14.992 -3.919  -4.603  1.00 1.31  ? 197 GLN A C    4  
ATOM   9615  O  O    . GLN A 1 102 ? -14.984 -3.864  -3.380  1.00 1.46  ? 197 GLN A O    4  
ATOM   9616  C  CB   . GLN A 1 102 ? -15.018 -6.114  -5.880  1.00 1.74  ? 197 GLN A CB   4  
ATOM   9617  C  CG   . GLN A 1 102 ? -15.753 -7.121  -6.792  1.00 2.25  ? 197 GLN A CG   4  
ATOM   9618  C  CD   . GLN A 1 102 ? -16.883 -7.913  -6.128  1.00 3.44  ? 197 GLN A CD   4  
ATOM   9619  O  OE1  . GLN A 1 102 ? -17.602 -7.435  -5.264  1.00 4.78  ? 197 GLN A OE1  4  
ATOM   9620  N  NE2  . GLN A 1 102 ? -17.106 -9.142  -6.534  1.00 3.79  ? 197 GLN A NE2  4  
ATOM   9621  H  H    . GLN A 1 102 ? -16.433 -4.447  -7.261  1.00 1.44  ? 197 GLN A H    4  
ATOM   9622  H  HA   . GLN A 1 102 ? -16.510 -5.398  -4.498  1.00 1.93  ? 197 GLN A HA   4  
ATOM   9623  H  HB2  . GLN A 1 102 ? -14.204 -5.677  -6.461  1.00 1.87  ? 197 GLN A HB2  4  
ATOM   9624  H  HB3  . GLN A 1 102 ? -14.558 -6.668  -5.058  1.00 2.34  ? 197 GLN A HB3  4  
ATOM   9625  H  HG2  . GLN A 1 102 ? -16.158 -6.605  -7.662  1.00 3.30  ? 197 GLN A HG2  4  
ATOM   9626  H  HG3  . GLN A 1 102 ? -15.011 -7.830  -7.163  1.00 2.16  ? 197 GLN A HG3  4  
ATOM   9627  H  HE21 . GLN A 1 102 ? -16.544 -9.570  -7.266  1.00 3.58  ? 197 GLN A HE21 4  
ATOM   9628  H  HE22 . GLN A 1 102 ? -17.854 -9.659  -6.088  1.00 4.83  ? 197 GLN A HE22 4  
ATOM   9629  N  N    . VAL A 1 103 ? -14.338 -3.031  -5.368  1.00 1.14  ? 198 VAL A N    4  
ATOM   9630  C  CA   . VAL A 1 103 ? -13.509 -1.937  -4.810  1.00 1.28  ? 198 VAL A CA   4  
ATOM   9631  C  C    . VAL A 1 103 ? -14.328 -1.038  -3.864  1.00 1.51  ? 198 VAL A C    4  
ATOM   9632  O  O    . VAL A 1 103 ? -13.874 -0.713  -2.764  1.00 1.63  ? 198 VAL A O    4  
ATOM   9633  C  CB   . VAL A 1 103 ? -12.835 -1.079  -5.917  1.00 1.40  ? 198 VAL A CB   4  
ATOM   9634  C  CG1  . VAL A 1 103 ? -11.886 -0.028  -5.314  1.00 2.51  ? 198 VAL A CG1  4  
ATOM   9635  C  CG2  . VAL A 1 103 ? -12.038 -1.954  -6.902  1.00 2.46  ? 198 VAL A CG2  4  
ATOM   9636  H  H    . VAL A 1 103 ? -14.364 -3.156  -6.378  1.00 1.10  ? 198 VAL A H    4  
ATOM   9637  H  HA   . VAL A 1 103 ? -12.715 -2.406  -4.226  1.00 1.35  ? 198 VAL A HA   4  
ATOM   9638  H  HB   . VAL A 1 103 ? -13.605 -0.556  -6.484  1.00 1.76  ? 198 VAL A HB   4  
ATOM   9639  H  HG11 . VAL A 1 103 ? -11.126 -0.514  -4.701  1.00 3.54  ? 198 VAL A HG11 4  
ATOM   9640  H  HG12 . VAL A 1 103 ? -11.397 0.531   -6.113  1.00 2.95  ? 198 VAL A HG12 4  
ATOM   9641  H  HG13 . VAL A 1 103 ? -12.442 0.681   -4.701  1.00 3.23  ? 198 VAL A HG13 4  
ATOM   9642  H  HG21 . VAL A 1 103 ? -12.701 -2.645  -7.418  1.00 2.96  ? 198 VAL A HG21 4  
ATOM   9643  H  HG22 . VAL A 1 103 ? -11.560 -1.322  -7.652  1.00 2.96  ? 198 VAL A HG22 4  
ATOM   9644  H  HG23 . VAL A 1 103 ? -11.272 -2.520  -6.369  1.00 3.71  ? 198 VAL A HG23 4  
ATOM   9645  N  N    . ALA A 1 104 ? -15.559 -0.679  -4.254  1.00 1.75  ? 199 ALA A N    4  
ATOM   9646  C  CA   . ALA A 1 104 ? -16.469 0.133   -3.446  1.00 2.22  ? 199 ALA A CA   4  
ATOM   9647  C  C    . ALA A 1 104 ? -16.914 -0.577  -2.153  1.00 2.20  ? 199 ALA A C    4  
ATOM   9648  O  O    . ALA A 1 104 ? -16.816 0.012   -1.071  1.00 2.39  ? 199 ALA A O    4  
ATOM   9649  C  CB   . ALA A 1 104 ? -17.665 0.525   -4.323  1.00 2.65  ? 199 ALA A CB   4  
ATOM   9650  H  H    . ALA A 1 104 ? -15.859 -0.937  -5.190  1.00 1.72  ? 199 ALA A H    4  
ATOM   9651  H  HA   . ALA A 1 104 ? -15.949 1.048   -3.148  1.00 2.43  ? 199 ALA A HA   4  
ATOM   9652  H  HB1  . ALA A 1 104 ? -18.203 -0.364  -4.657  1.00 2.33  ? 199 ALA A HB1  4  
ATOM   9653  H  HB2  . ALA A 1 104 ? -18.343 1.164   -3.756  1.00 3.25  ? 199 ALA A HB2  4  
ATOM   9654  H  HB3  . ALA A 1 104 ? -17.316 1.077   -5.198  1.00 3.46  ? 199 ALA A HB3  4  
ATOM   9655  N  N    . GLN A 1 105 ? -17.376 -1.831  -2.236  1.00 2.12  ? 200 GLN A N    4  
ATOM   9656  C  CA   . GLN A 1 105 ? -17.820 -2.578  -1.052  1.00 2.31  ? 200 GLN A CA   4  
ATOM   9657  C  C    . GLN A 1 105 ? -16.647 -2.963  -0.135  1.00 1.82  ? 200 GLN A C    4  
ATOM   9658  O  O    . GLN A 1 105 ? -16.813 -2.932  1.082   1.00 1.98  ? 200 GLN A O    4  
ATOM   9659  C  CB   . GLN A 1 105 ? -18.656 -3.814  -1.440  1.00 2.74  ? 200 GLN A CB   4  
ATOM   9660  C  CG   . GLN A 1 105 ? -20.023 -3.453  -2.055  1.00 3.97  ? 200 GLN A CG   4  
ATOM   9661  C  CD   . GLN A 1 105 ? -20.899 -4.679  -2.346  1.00 4.14  ? 200 GLN A CD   4  
ATOM   9662  O  OE1  . GLN A 1 105 ? -21.254 -4.963  -3.481  1.00 4.72  ? 200 GLN A OE1  4  
ATOM   9663  N  NE2  . GLN A 1 105 ? -21.292 -5.439  -1.343  1.00 4.47  ? 200 GLN A NE2  4  
ATOM   9664  H  H    . GLN A 1 105 ? -17.414 -2.282  -3.145  1.00 2.07  ? 200 GLN A H    4  
ATOM   9665  H  HA   . GLN A 1 105 ? -18.455 -1.925  -0.451  1.00 2.68  ? 200 GLN A HA   4  
ATOM   9666  H  HB2  . GLN A 1 105 ? -18.092 -4.438  -2.134  1.00 2.72  ? 200 GLN A HB2  4  
ATOM   9667  H  HB3  . GLN A 1 105 ? -18.838 -4.386  -0.527  1.00 2.90  ? 200 GLN A HB3  4  
ATOM   9668  H  HG2  . GLN A 1 105 ? -20.564 -2.810  -1.359  1.00 4.68  ? 200 GLN A HG2  4  
ATOM   9669  H  HG3  . GLN A 1 105 ? -19.874 -2.902  -2.981  1.00 4.75  ? 200 GLN A HG3  4  
ATOM   9670  H  HE21 . GLN A 1 105 ? -21.057 -5.209  -0.398  1.00 4.86  ? 200 GLN A HE21 4  
ATOM   9671  H  HE22 . GLN A 1 105 ? -21.876 -6.242  -1.556  1.00 4.84  ? 200 GLN A HE22 4  
ATOM   9672  N  N    . ALA A 1 106 ? -15.455 -3.252  -0.669  1.00 1.38  ? 201 ALA A N    4  
ATOM   9673  C  CA   . ALA A 1 106 ? -14.244 -3.471  0.127   1.00 1.23  ? 201 ALA A CA   4  
ATOM   9674  C  C    . ALA A 1 106 ? -13.850 -2.214  0.917   1.00 1.34  ? 201 ALA A C    4  
ATOM   9675  O  O    . ALA A 1 106 ? -13.549 -2.293  2.106   1.00 1.47  ? 201 ALA A O    4  
ATOM   9676  C  CB   . ALA A 1 106 ? -13.118 -3.913  -0.817  1.00 1.38  ? 201 ALA A CB   4  
ATOM   9677  H  H    . ALA A 1 106 ? -15.367 -3.322  -1.681  1.00 1.33  ? 201 ALA A H    4  
ATOM   9678  H  HA   . ALA A 1 106 ? -14.433 -4.266  0.850   1.00 1.42  ? 201 ALA A HA   4  
ATOM   9679  H  HB1  . ALA A 1 106 ? -12.197 -4.057  -0.249  1.00 1.95  ? 201 ALA A HB1  4  
ATOM   9680  H  HB2  . ALA A 1 106 ? -13.390 -4.848  -1.307  1.00 2.42  ? 201 ALA A HB2  4  
ATOM   9681  H  HB3  . ALA A 1 106 ? -12.942 -3.154  -1.581  1.00 1.78  ? 201 ALA A HB3  4  
ATOM   9682  N  N    . SER A 1 107 ? -13.908 -1.044  0.283   1.00 1.60  ? 202 SER A N    4  
ATOM   9683  C  CA   . SER A 1 107 ? -13.605 0.241   0.927   1.00 2.16  ? 202 SER A CA   4  
ATOM   9684  C  C    . SER A 1 107 ? -14.619 0.591   2.032   1.00 2.42  ? 202 SER A C    4  
ATOM   9685  O  O    . SER A 1 107 ? -14.235 1.035   3.117   1.00 2.80  ? 202 SER A O    4  
ATOM   9686  C  CB   . SER A 1 107 ? -13.546 1.342   -0.137  1.00 2.54  ? 202 SER A CB   4  
ATOM   9687  O  OG   . SER A 1 107 ? -12.504 1.084   -1.062  1.00 3.55  ? 202 SER A OG   4  
ATOM   9688  H  H    . SER A 1 107 ? -14.141 -1.051  -0.701  1.00 1.56  ? 202 SER A H    4  
ATOM   9689  H  HA   . SER A 1 107 ? -12.622 0.186   1.400   1.00 2.31  ? 202 SER A HA   4  
ATOM   9690  H  HB2  . SER A 1 107 ? -14.497 1.400   -0.668  1.00 2.07  ? 202 SER A HB2  4  
ATOM   9691  H  HB3  . SER A 1 107 ? -13.353 2.299   0.346   1.00 3.38  ? 202 SER A HB3  4  
ATOM   9692  H  HG   . SER A 1 107 ? -12.838 0.533   -1.787  1.00 3.78  ? 202 SER A HG   4  
ATOM   9693  N  N    . HIS A 1 108 ? -15.913 0.322   1.816   1.00 2.43  ? 203 HIS A N    4  
ATOM   9694  C  CA   . HIS A 1 108 ? -16.956 0.426   2.848   1.00 2.81  ? 203 HIS A CA   4  
ATOM   9695  C  C    . HIS A 1 108 ? -16.820 -0.646  3.959   1.00 2.41  ? 203 HIS A C    4  
ATOM   9696  O  O    . HIS A 1 108 ? -17.102 -0.370  5.128   1.00 2.65  ? 203 HIS A O    4  
ATOM   9697  C  CB   . HIS A 1 108 ? -18.323 0.355   2.149   1.00 3.27  ? 203 HIS A CB   4  
ATOM   9698  C  CG   . HIS A 1 108 ? -19.488 0.249   3.097   1.00 3.60  ? 203 HIS A CG   4  
ATOM   9699  N  ND1  . HIS A 1 108 ? -20.139 -0.943  3.414   1.00 3.99  ? 203 HIS A ND1  4  
ATOM   9700  C  CD2  . HIS A 1 108 ? -20.048 1.267   3.816   1.00 4.06  ? 203 HIS A CD2  4  
ATOM   9701  C  CE1  . HIS A 1 108 ? -21.072 -0.616  4.320   1.00 4.81  ? 203 HIS A CE1  4  
ATOM   9702  N  NE2  . HIS A 1 108 ? -21.044 0.703   4.588   1.00 4.82  ? 203 HIS A NE2  4  
ATOM   9703  H  H    . HIS A 1 108 ? -16.182 -0.041  0.906   1.00 2.29  ? 203 HIS A H    4  
ATOM   9704  H  HA   . HIS A 1 108 ? -16.876 1.400   3.334   1.00 3.26  ? 203 HIS A HA   4  
ATOM   9705  H  HB2  . HIS A 1 108 ? -18.455 1.240   1.525   1.00 4.13  ? 203 HIS A HB2  4  
ATOM   9706  H  HB3  . HIS A 1 108 ? -18.343 -0.521  1.500   1.00 3.13  ? 203 HIS A HB3  4  
ATOM   9707  H  HD2  . HIS A 1 108 ? -19.751 2.305   3.794   1.00 4.06  ? 203 HIS A HD2  4  
ATOM   9708  H  HE1  . HIS A 1 108 ? -21.744 -1.328  4.773   1.00 5.51  ? 203 HIS A HE1  4  
ATOM   9709  H  HE2  . HIS A 1 108 ? -21.636 1.181   5.266   1.00 5.46  ? 203 HIS A HE2  4  
ATOM   9710  N  N    . SER A 1 109 ? -16.335 -1.845  3.629   1.00 1.96  ? 204 SER A N    4  
ATOM   9711  C  CA   . SER A 1 109 ? -16.061 -2.919  4.583   1.00 1.81  ? 204 SER A CA   4  
ATOM   9712  C  C    . SER A 1 109 ? -14.827 -2.638  5.444   1.00 1.77  ? 204 SER A C    4  
ATOM   9713  O  O    . SER A 1 109 ? -14.742 -3.166  6.551   1.00 2.11  ? 204 SER A O    4  
ATOM   9714  C  CB   . SER A 1 109 ? -15.884 -4.263  3.869   1.00 1.87  ? 204 SER A CB   4  
ATOM   9715  O  OG   . SER A 1 109 ? -15.704 -5.293  4.831   1.00 2.17  ? 204 SER A OG   4  
ATOM   9716  H  H    . SER A 1 109 ? -16.103 -2.015  2.658   1.00 1.82  ? 204 SER A H    4  
ATOM   9717  H  HA   . SER A 1 109 ? -16.912 -3.011  5.260   1.00 2.06  ? 204 SER A HA   4  
ATOM   9718  H  HB2  . SER A 1 109 ? -16.766 -4.478  3.267   1.00 2.56  ? 204 SER A HB2  4  
ATOM   9719  H  HB3  . SER A 1 109 ? -15.011 -4.217  3.217   1.00 2.43  ? 204 SER A HB3  4  
ATOM   9720  H  HG   . SER A 1 109 ? -15.129 -4.944  5.531   1.00 3.11  ? 204 SER A HG   4  
ATOM   9721  N  N    . TYR A 1 110 ? -13.874 -1.827  4.976   1.00 1.70  ? 205 TYR A N    4  
ATOM   9722  C  CA   . TYR A 1 110 ? -12.826 -1.258  5.828   1.00 1.94  ? 205 TYR A CA   4  
ATOM   9723  C  C    . TYR A 1 110 ? -13.282 0.018   6.562   1.00 2.35  ? 205 TYR A C    4  
ATOM   9724  O  O    . TYR A 1 110 ? -12.735 0.334   7.618   1.00 3.82  ? 205 TYR A O    4  
ATOM   9725  C  CB   . TYR A 1 110 ? -11.554 -0.977  5.008   1.00 2.01  ? 205 TYR A CB   4  
ATOM   9726  C  CG   . TYR A 1 110 ? -10.483 -2.052  5.058   1.00 2.21  ? 205 TYR A CG   4  
ATOM   9727  C  CD1  . TYR A 1 110 ? -9.968  -2.475  6.302   1.00 2.95  ? 205 TYR A CD1  4  
ATOM   9728  C  CD2  . TYR A 1 110 ? -9.918  -2.549  3.867   1.00 2.97  ? 205 TYR A CD2  4  
ATOM   9729  C  CE1  . TYR A 1 110 ? -8.907  -3.399  6.356   1.00 3.57  ? 205 TYR A CE1  4  
ATOM   9730  C  CE2  . TYR A 1 110 ? -8.838  -3.449  3.913   1.00 3.57  ? 205 TYR A CE2  4  
ATOM   9731  C  CZ   . TYR A 1 110 ? -8.329  -3.881  5.161   1.00 3.59  ? 205 TYR A CZ   4  
ATOM   9732  O  OH   . TYR A 1 110 ? -7.268  -4.732  5.219   1.00 4.43  ? 205 TYR A OH   4  
ATOM   9733  H  H    . TYR A 1 110 ? -13.896 -1.562  3.995   1.00 1.63  ? 205 TYR A H    4  
ATOM   9734  H  HA   . TYR A 1 110 ? -12.600 -1.994  6.590   1.00 2.39  ? 205 TYR A HA   4  
ATOM   9735  H  HB2  . TYR A 1 110 ? -11.824 -0.763  3.972   1.00 2.36  ? 205 TYR A HB2  4  
ATOM   9736  H  HB3  . TYR A 1 110 ? -11.083 -0.076  5.402   1.00 2.42  ? 205 TYR A HB3  4  
ATOM   9737  H  HD1  . TYR A 1 110 ? -10.361 -2.060  7.219   1.00 3.66  ? 205 TYR A HD1  4  
ATOM   9738  H  HD2  . TYR A 1 110 ? -10.294 -2.210  2.910   1.00 3.68  ? 205 TYR A HD2  4  
ATOM   9739  H  HE1  . TYR A 1 110 ? -8.495  -3.702  7.309   1.00 4.53  ? 205 TYR A HE1  4  
ATOM   9740  H  HE2  . TYR A 1 110 ? -8.389  -3.798  2.994   1.00 4.52  ? 205 TYR A HE2  4  
ATOM   9741  H  HH   . TYR A 1 110 ? -6.830  -4.811  4.367   1.00 4.86  ? 205 TYR A HH   4  
ATOM   9742  N  N    . ARG A 1 111 ? -14.269 0.727   5.992   1.00 1.90  ? 206 ARG A N    4  
ATOM   9743  C  CA   . ARG A 1 111 ? -14.878 1.992   6.445   1.00 2.26  ? 206 ARG A CA   4  
ATOM   9744  C  C    . ARG A 1 111 ? -14.052 3.221   5.994   1.00 2.03  ? 206 ARG A C    4  
ATOM   9745  O  O    . ARG A 1 111 ? -13.932 4.204   6.718   1.00 2.30  ? 206 ARG A O    4  
ATOM   9746  C  CB   . ARG A 1 111 ? -15.232 1.933   7.950   1.00 3.08  ? 206 ARG A CB   4  
ATOM   9747  C  CG   . ARG A 1 111 ? -16.209 3.029   8.410   1.00 3.55  ? 206 ARG A CG   4  
ATOM   9748  C  CD   . ARG A 1 111 ? -17.161 2.560   9.522   1.00 4.48  ? 206 ARG A CD   4  
ATOM   9749  N  NE   . ARG A 1 111 ? -16.470 1.988   10.696  1.00 5.64  ? 206 ARG A NE   4  
ATOM   9750  C  CZ   . ARG A 1 111 ? -16.658 0.766   11.193  1.00 6.60  ? 206 ARG A CZ   4  
ATOM   9751  N  NH1  . ARG A 1 111 ? -17.370 -0.148  10.576  1.00 6.67  ? 206 ARG A NH1  4  
ATOM   9752  N  NH2  . ARG A 1 111 ? -16.138 0.412   12.347  1.00 7.96  ? 206 ARG A NH2  4  
ATOM   9753  H  H    . ARG A 1 111 ? -14.627 0.349   5.124   1.00 2.24  ? 206 ARG A H    4  
ATOM   9754  H  HA   . ARG A 1 111 ? -15.824 2.064   5.907   1.00 2.46  ? 206 ARG A HA   4  
ATOM   9755  H  HB2  . ARG A 1 111 ? -15.692 0.961   8.138   1.00 3.30  ? 206 ARG A HB2  4  
ATOM   9756  H  HB3  . ARG A 1 111 ? -14.329 2.007   8.557   1.00 3.98  ? 206 ARG A HB3  4  
ATOM   9757  H  HG2  . ARG A 1 111 ? -15.643 3.891   8.763   1.00 4.10  ? 206 ARG A HG2  4  
ATOM   9758  H  HG3  . ARG A 1 111 ? -16.822 3.348   7.566   1.00 3.59  ? 206 ARG A HG3  4  
ATOM   9759  H  HD2  . ARG A 1 111 ? -17.750 3.419   9.850   1.00 5.24  ? 206 ARG A HD2  4  
ATOM   9760  H  HD3  . ARG A 1 111 ? -17.857 1.839   9.093   1.00 4.23  ? 206 ARG A HD3  4  
ATOM   9761  H  HE   . ARG A 1 111 ? -15.862 2.602   11.213  1.00 6.15  ? 206 ARG A HE   4  
ATOM   9762  H  HH11 . ARG A 1 111 ? -17.690 -0.027  9.623   1.00 5.95  ? 206 ARG A HH11 4  
ATOM   9763  H  HH12 . ARG A 1 111 ? -17.444 -1.070  10.988  1.00 7.77  ? 206 ARG A HH12 4  
ATOM   9764  H  HH21 . ARG A 1 111 ? -15.550 1.026   12.886  1.00 8.31  ? 206 ARG A HH21 4  
ATOM   9765  H  HH22 . ARG A 1 111 ? -16.324 -0.521  12.694  1.00 8.84  ? 206 ARG A HH22 4  
ATOM   9766  N  N    . VAL A 1 112 ? -13.480 3.143   4.790   1.00 1.94  ? 207 VAL A N    4  
ATOM   9767  C  CA   . VAL A 1 112 ? -12.716 4.205   4.111   1.00 1.90  ? 207 VAL A CA   4  
ATOM   9768  C  C    . VAL A 1 112 ? -13.684 5.236   3.511   1.00 1.94  ? 207 VAL A C    4  
ATOM   9769  O  O    . VAL A 1 112 ? -14.770 4.873   3.061   1.00 2.19  ? 207 VAL A O    4  
ATOM   9770  C  CB   . VAL A 1 112 ? -11.807 3.609   3.002   1.00 2.08  ? 207 VAL A CB   4  
ATOM   9771  C  CG1  . VAL A 1 112 ? -10.982 4.674   2.257   1.00 2.43  ? 207 VAL A CG1  4  
ATOM   9772  C  CG2  . VAL A 1 112 ? -10.834 2.572   3.587   1.00 3.40  ? 207 VAL A CG2  4  
ATOM   9773  H  H    . VAL A 1 112 ? -13.719 2.326   4.231   1.00 2.11  ? 207 VAL A H    4  
ATOM   9774  H  HA   . VAL A 1 112 ? -12.081 4.701   4.847   1.00 2.01  ? 207 VAL A HA   4  
ATOM   9775  H  HB   . VAL A 1 112 ? -12.440 3.098   2.276   1.00 2.77  ? 207 VAL A HB   4  
ATOM   9776  H  HG11 . VAL A 1 112 ? -11.639 5.310   1.664   1.00 2.91  ? 207 VAL A HG11 4  
ATOM   9777  H  HG12 . VAL A 1 112 ? -10.429 5.285   2.971   1.00 3.13  ? 207 VAL A HG12 4  
ATOM   9778  H  HG13 . VAL A 1 112 ? -10.279 4.195   1.574   1.00 3.11  ? 207 VAL A HG13 4  
ATOM   9779  H  HG21 . VAL A 1 112 ? -10.208 3.032   4.354   1.00 4.06  ? 207 VAL A HG21 4  
ATOM   9780  H  HG22 . VAL A 1 112 ? -11.390 1.746   4.025   1.00 4.36  ? 207 VAL A HG22 4  
ATOM   9781  H  HG23 . VAL A 1 112 ? -10.196 2.168   2.799   1.00 3.80  ? 207 VAL A HG23 4  
ATOM   9782  N  N    . TYR A 1 113 ? -13.288 6.514   3.491   1.00 1.90  ? 208 TYR A N    4  
ATOM   9783  C  CA   . TYR A 1 113 ? -14.062 7.604   2.892   1.00 2.02  ? 208 TYR A CA   4  
ATOM   9784  C  C    . TYR A 1 113 ? -13.624 7.876   1.446   1.00 1.94  ? 208 TYR A C    4  
ATOM   9785  O  O    . TYR A 1 113 ? -12.432 7.903   1.134   1.00 2.14  ? 208 TYR A O    4  
ATOM   9786  C  CB   . TYR A 1 113 ? -13.925 8.873   3.750   1.00 2.30  ? 208 TYR A CB   4  
ATOM   9787  C  CG   . TYR A 1 113 ? -14.947 8.988   4.868   1.00 2.87  ? 208 TYR A CG   4  
ATOM   9788  C  CD1  . TYR A 1 113 ? -14.892 8.133   5.987   1.00 4.17  ? 208 TYR A CD1  4  
ATOM   9789  C  CD2  . TYR A 1 113 ? -15.974 9.951   4.779   1.00 3.27  ? 208 TYR A CD2  4  
ATOM   9790  C  CE1  . TYR A 1 113 ? -15.855 8.235   7.011   1.00 5.13  ? 208 TYR A CE1  4  
ATOM   9791  C  CE2  . TYR A 1 113 ? -16.940 10.059  5.796   1.00 4.08  ? 208 TYR A CE2  4  
ATOM   9792  C  CZ   . TYR A 1 113 ? -16.886 9.198   6.916   1.00 4.81  ? 208 TYR A CZ   4  
ATOM   9793  O  OH   . TYR A 1 113 ? -17.830 9.303   7.892   1.00 5.89  ? 208 TYR A OH   4  
ATOM   9794  H  H    . TYR A 1 113 ? -12.344 6.739   3.767   1.00 1.93  ? 208 TYR A H    4  
ATOM   9795  H  HA   . TYR A 1 113 ? -15.118 7.328   2.868   1.00 2.16  ? 208 TYR A HA   4  
ATOM   9796  H  HB2  . TYR A 1 113 ? -12.920 8.927   4.173   1.00 2.58  ? 208 TYR A HB2  4  
ATOM   9797  H  HB3  . TYR A 1 113 ? -14.038 9.743   3.102   1.00 2.60  ? 208 TYR A HB3  4  
ATOM   9798  H  HD1  . TYR A 1 113 ? -14.114 7.384   6.056   1.00 4.89  ? 208 TYR A HD1  4  
ATOM   9799  H  HD2  . TYR A 1 113 ? -16.027 10.608  3.923   1.00 3.73  ? 208 TYR A HD2  4  
ATOM   9800  H  HE1  . TYR A 1 113 ? -15.809 7.568   7.859   1.00 6.45  ? 208 TYR A HE1  4  
ATOM   9801  H  HE2  . TYR A 1 113 ? -17.726 10.793  5.719   1.00 4.75  ? 208 TYR A HE2  4  
ATOM   9802  H  HH   . TYR A 1 113 ? -17.680 8.688   8.615   1.00 6.73  ? 208 TYR A HH   4  
ATOM   9803  N  N    . TYR A 1 114 ? -14.604 8.128   0.577   1.00 1.88  ? 209 TYR A N    4  
ATOM   9804  C  CA   . TYR A 1 114 ? -14.436 8.501   -0.831  1.00 1.92  ? 209 TYR A CA   4  
ATOM   9805  C  C    . TYR A 1 114 ? -15.688 9.250   -1.320  1.00 2.05  ? 209 TYR A C    4  
ATOM   9806  O  O    . TYR A 1 114 ? -16.805 8.859   -0.983  1.00 2.29  ? 209 TYR A O    4  
ATOM   9807  C  CB   . TYR A 1 114 ? -14.131 7.251   -1.678  1.00 2.20  ? 209 TYR A CB   4  
ATOM   9808  C  CG   . TYR A 1 114 ? -15.101 6.083   -1.537  1.00 2.29  ? 209 TYR A CG   4  
ATOM   9809  C  CD1  . TYR A 1 114 ? -14.892 5.103   -0.543  1.00 3.10  ? 209 TYR A CD1  4  
ATOM   9810  C  CD2  . TYR A 1 114 ? -16.199 5.958   -2.411  1.00 2.73  ? 209 TYR A CD2  4  
ATOM   9811  C  CE1  . TYR A 1 114 ? -15.768 4.005   -0.426  1.00 3.56  ? 209 TYR A CE1  4  
ATOM   9812  C  CE2  . TYR A 1 114 ? -17.074 4.859   -2.307  1.00 3.10  ? 209 TYR A CE2  4  
ATOM   9813  C  CZ   . TYR A 1 114 ? -16.852 3.870   -1.323  1.00 3.23  ? 209 TYR A CZ   4  
ATOM   9814  O  OH   . TYR A 1 114 ? -17.674 2.785   -1.253  1.00 3.86  ? 209 TYR A OH   4  
ATOM   9815  H  H    . TYR A 1 114 ? -15.557 8.053   0.900   1.00 1.98  ? 209 TYR A H    4  
ATOM   9816  H  HA   . TYR A 1 114 ? -13.587 9.180   -0.914  1.00 1.92  ? 209 TYR A HA   4  
ATOM   9817  H  HB2  . TYR A 1 114 ? -14.087 7.546   -2.728  1.00 2.53  ? 209 TYR A HB2  4  
ATOM   9818  H  HB3  . TYR A 1 114 ? -13.133 6.895   -1.414  1.00 2.56  ? 209 TYR A HB3  4  
ATOM   9819  H  HD1  . TYR A 1 114 ? -14.054 5.195   0.133   1.00 3.84  ? 209 TYR A HD1  4  
ATOM   9820  H  HD2  . TYR A 1 114 ? -16.364 6.704   -3.176  1.00 3.41  ? 209 TYR A HD2  4  
ATOM   9821  H  HE1  . TYR A 1 114 ? -15.610 3.274   0.351   1.00 4.58  ? 209 TYR A HE1  4  
ATOM   9822  H  HE2  . TYR A 1 114 ? -17.901 4.759   -2.992  1.00 3.84  ? 209 TYR A HE2  4  
ATOM   9823  H  HH   . TYR A 1 114 ? -17.320 2.086   -0.692  1.00 4.33  ? 209 TYR A HH   4  
ATOM   9824  N  N    . ASN A 1 115 ? -15.518 10.339  -2.079  1.00 2.08  ? 210 ASN A N    4  
ATOM   9825  C  CA   . ASN A 1 115 ? -16.622 11.129  -2.638  1.00 2.36  ? 210 ASN A CA   4  
ATOM   9826  C  C    . ASN A 1 115 ? -16.163 11.944  -3.865  1.00 2.27  ? 210 ASN A C    4  
ATOM   9827  O  O    . ASN A 1 115 ? -14.965 12.017  -4.141  1.00 2.37  ? 210 ASN A O    4  
ATOM   9828  C  CB   . ASN A 1 115 ? -17.237 12.034  -1.541  1.00 2.88  ? 210 ASN A CB   4  
ATOM   9829  C  CG   . ASN A 1 115 ? -18.664 12.482  -1.856  1.00 3.68  ? 210 ASN A CG   4  
ATOM   9830  O  OD1  . ASN A 1 115 ? -19.297 12.003  -2.786  1.00 4.23  ? 210 ASN A OD1  4  
ATOM   9831  N  ND2  . ASN A 1 115 ? -19.208 13.412  -1.098  1.00 4.38  ? 210 ASN A ND2  4  
ATOM   9832  H  H    . ASN A 1 115 ? -14.587 10.627  -2.352  1.00 2.05  ? 210 ASN A H    4  
ATOM   9833  H  HA   . ASN A 1 115 ? -17.388 10.428  -2.977  1.00 2.60  ? 210 ASN A HA   4  
ATOM   9834  H  HB2  . ASN A 1 115 ? -17.275 11.492  -0.596  1.00 3.31  ? 210 ASN A HB2  4  
ATOM   9835  H  HB3  . ASN A 1 115 ? -16.603 12.909  -1.397  1.00 2.87  ? 210 ASN A HB3  4  
ATOM   9836  H  HD21 . ASN A 1 115 ? -18.684 13.882  -0.374  1.00 4.48  ? 210 ASN A HD21 4  
ATOM   9837  H  HD22 . ASN A 1 115 ? -20.173 13.661  -1.271  1.00 5.12  ? 210 ASN A HD22 4  
ATOM   9838  N  N    . ALA A 1 116 ? -17.105 12.576  -4.570  1.00 2.55  ? 211 ALA A N    4  
ATOM   9839  C  CA   . ALA A 1 116 ? -16.867 13.504  -5.674  1.00 2.81  ? 211 ALA A CA   4  
ATOM   9840  C  C    . ALA A 1 116 ? -17.842 14.687  -5.581  1.00 3.31  ? 211 ALA A C    4  
ATOM   9841  O  O    . ALA A 1 116 ? -19.014 14.505  -5.242  1.00 3.72  ? 211 ALA A O    4  
ATOM   9842  C  CB   . ALA A 1 116 ? -17.067 12.746  -6.996  1.00 3.17  ? 211 ALA A CB   4  
ATOM   9843  H  H    . ALA A 1 116 ? -18.070 12.476  -4.264  1.00 2.88  ? 211 ALA A H    4  
ATOM   9844  H  HA   . ALA A 1 116 ? -15.841 13.889  -5.639  1.00 2.82  ? 211 ALA A HA   4  
ATOM   9845  H  HB1  . ALA A 1 116 ? -18.098 12.400  -7.077  1.00 3.77  ? 211 ALA A HB1  4  
ATOM   9846  H  HB2  . ALA A 1 116 ? -16.846 13.410  -7.834  1.00 3.65  ? 211 ALA A HB2  4  
ATOM   9847  H  HB3  . ALA A 1 116 ? -16.397 11.886  -7.039  1.00 3.35  ? 211 ALA A HB3  4  
ATOM   9848  N  N    . GLY A 1 117 ? -17.383 15.887  -5.936  1.00 3.60  ? 212 GLY A N    4  
ATOM   9849  C  CA   . GLY A 1 117 ? -18.217 17.085  -6.066  1.00 4.26  ? 212 GLY A CA   4  
ATOM   9850  C  C    . GLY A 1 117 ? -19.167 17.026  -7.275  1.00 4.23  ? 212 GLY A C    4  
ATOM   9851  O  O    . GLY A 1 117 ? -19.098 16.086  -8.076  1.00 4.31  ? 212 GLY A O    4  
ATOM   9852  H  H    . GLY A 1 117 ? -16.391 15.975  -6.139  1.00 3.52  ? 212 GLY A H    4  
ATOM   9853  H  HA2  . GLY A 1 117 ? -18.823 17.195  -5.166  1.00 4.83  ? 212 GLY A HA2  4  
ATOM   9854  H  HA3  . GLY A 1 117 ? -17.573 17.959  -6.175  1.00 4.62  ? 212 GLY A HA3  4  
ATOM   9855  N  N    . PRO A 1 118 ? -20.082 18.005  -7.409  1.00 4.69  ? 213 PRO A N    4  
ATOM   9856  C  CA   . PRO A 1 118 ? -21.025 18.071  -8.521  1.00 5.06  ? 213 PRO A CA   4  
ATOM   9857  C  C    . PRO A 1 118 ? -20.303 18.397  -9.834  1.00 4.41  ? 213 PRO A C    4  
ATOM   9858  O  O    . PRO A 1 118 ? -19.262 19.056  -9.831  1.00 4.38  ? 213 PRO A O    4  
ATOM   9859  C  CB   . PRO A 1 118 ? -22.031 19.160  -8.131  1.00 6.11  ? 213 PRO A CB   4  
ATOM   9860  C  CG   . PRO A 1 118 ? -21.209 20.097  -7.247  1.00 6.09  ? 213 PRO A CG   4  
ATOM   9861  C  CD   . PRO A 1 118 ? -20.269 19.139  -6.515  1.00 5.42  ? 213 PRO A CD   4  
ATOM   9862  H  HA   . PRO A 1 118 ? -21.549 17.120  -8.628  1.00 5.54  ? 213 PRO A HA   4  
ATOM   9863  H  HB2  . PRO A 1 118 ? -22.442 19.677  -8.999  1.00 6.32  ? 213 PRO A HB2  4  
ATOM   9864  H  HB3  . PRO A 1 118 ? -22.833 18.717  -7.538  1.00 6.93  ? 213 PRO A HB3  4  
ATOM   9865  H  HG2  . PRO A 1 118 ? -20.628 20.776  -7.872  1.00 5.75  ? 213 PRO A HG2  4  
ATOM   9866  H  HG3  . PRO A 1 118 ? -21.839 20.654  -6.553  1.00 7.12  ? 213 PRO A HG3  4  
ATOM   9867  H  HD2  . PRO A 1 118 ? -19.323 19.637  -6.297  1.00 5.21  ? 213 PRO A HD2  4  
ATOM   9868  H  HD3  . PRO A 1 118 ? -20.738 18.797  -5.590  1.00 6.10  ? 213 PRO A HD3  4  
ATOM   9869  N  N    . LYS A 1 119 ? -20.874 17.955  -10.962 1.00 4.57  ? 214 LYS A N    4  
ATOM   9870  C  CA   . LYS A 1 119 ? -20.381 18.296  -12.303 1.00 4.51  ? 214 LYS A CA   4  
ATOM   9871  C  C    . LYS A 1 119 ? -21.390 19.105  -13.120 1.00 4.91  ? 214 LYS A C    4  
ATOM   9872  O  O    . LYS A 1 119 ? -22.604 18.948  -12.981 1.00 5.51  ? 214 LYS A O    4  
ATOM   9873  C  CB   . LYS A 1 119 ? -19.981 17.047  -13.105 1.00 5.18  ? 214 LYS A CB   4  
ATOM   9874  C  CG   . LYS A 1 119 ? -18.848 16.239  -12.468 1.00 5.53  ? 214 LYS A CG   4  
ATOM   9875  C  CD   . LYS A 1 119 ? -18.602 14.966  -13.290 1.00 6.87  ? 214 LYS A CD   4  
ATOM   9876  C  CE   . LYS A 1 119 ? -17.147 14.543  -13.128 1.00 7.54  ? 214 LYS A CE   4  
ATOM   9877  N  NZ   . LYS A 1 119 ? -16.786 13.400  -14.005 1.00 9.04  ? 214 LYS A NZ   4  
ATOM   9878  H  H    . LYS A 1 119 ? -21.743 17.443  -10.898 1.00 5.19  ? 214 LYS A H    4  
ATOM   9879  H  HA   . LYS A 1 119 ? -19.499 18.916  -12.199 1.00 4.34  ? 214 LYS A HA   4  
ATOM   9880  H  HB2  . LYS A 1 119 ? -20.849 16.415  -13.261 1.00 6.13  ? 214 LYS A HB2  4  
ATOM   9881  H  HB3  . LYS A 1 119 ? -19.648 17.367  -14.093 1.00 5.43  ? 214 LYS A HB3  4  
ATOM   9882  H  HG2  . LYS A 1 119 ? -17.951 16.859  -12.458 1.00 5.35  ? 214 LYS A HG2  4  
ATOM   9883  H  HG3  . LYS A 1 119 ? -19.095 15.960  -11.443 1.00 5.92  ? 214 LYS A HG3  4  
ATOM   9884  H  HD2  . LYS A 1 119 ? -19.273 14.173  -12.952 1.00 7.58  ? 214 LYS A HD2  4  
ATOM   9885  H  HD3  . LYS A 1 119 ? -18.797 15.161  -14.340 1.00 7.19  ? 214 LYS A HD3  4  
ATOM   9886  H  HE2  . LYS A 1 119 ? -16.507 15.386  -13.398 1.00 7.27  ? 214 LYS A HE2  4  
ATOM   9887  H  HE3  . LYS A 1 119 ? -16.969 14.329  -12.077 1.00 7.61  ? 214 LYS A HE3  4  
ATOM   9888  H  HZ1  . LYS A 1 119 ? -15.810 13.159  -13.846 1.00 9.58  ? 214 LYS A HZ1  4  
ATOM   9889  H  HZ2  . LYS A 1 119 ? -17.364 12.581  -13.844 1.00 9.65  ? 214 LYS A HZ2  4  
ATOM   9890  H  HZ3  . LYS A 1 119 ? -16.884 13.650  -14.989 1.00 9.31  ? 214 LYS A HZ3  4  
ATOM   9891  N  N    . ASP A 1 120 ? -20.859 19.907  -14.041 1.00 5.07  ? 215 ASP A N    4  
ATOM   9892  C  CA   . ASP A 1 120 ? -21.642 20.625  -15.053 1.00 5.84  ? 215 ASP A CA   4  
ATOM   9893  C  C    . ASP A 1 120 ? -22.198 19.636  -16.102 1.00 6.37  ? 215 ASP A C    4  
ATOM   9894  O  O    . ASP A 1 120 ? -23.406 19.413  -16.161 1.00 6.97  ? 215 ASP A O    4  
ATOM   9895  C  CB   . ASP A 1 120 ? -20.770 21.750  -15.644 1.00 6.75  ? 215 ASP A CB   4  
ATOM   9896  C  CG   . ASP A 1 120 ? -21.507 22.725  -16.574 1.00 8.10  ? 215 ASP A CG   4  
ATOM   9897  O  OD1  . ASP A 1 120 ? -22.716 22.533  -16.843 1.00 8.69  ? 215 ASP A OD1  4  
ATOM   9898  O  OD2  . ASP A 1 120 ? -20.831 23.649  -17.090 1.00 8.96  ? 215 ASP A OD2  4  
ATOM   9899  H  H    . ASP A 1 120 ? -19.852 20.035  -13.995 1.00 4.96  ? 215 ASP A H    4  
ATOM   9900  H  HA   . ASP A 1 120 ? -22.498 21.092  -14.562 1.00 6.14  ? 215 ASP A HA   4  
ATOM   9901  H  HB2  . ASP A 1 120 ? -20.356 22.331  -14.819 1.00 6.80  ? 215 ASP A HB2  4  
ATOM   9902  H  HB3  . ASP A 1 120 ? -19.930 21.309  -16.184 1.00 7.11  ? 215 ASP A HB3  4  
ATOM   9903  N  N    . GLU A 1 121 ? -21.332 18.987  -16.888 1.00 6.75  ? 216 GLU A N    4  
ATOM   9904  C  CA   . GLU A 1 121 ? -21.697 17.942  -17.866 1.00 7.94  ? 216 GLU A CA   4  
ATOM   9905  C  C    . GLU A 1 121 ? -20.791 16.707  -17.761 1.00 8.47  ? 216 GLU A C    4  
ATOM   9906  O  O    . GLU A 1 121 ? -21.288 15.584  -17.780 1.00 9.49  ? 216 GLU A O    4  
ATOM   9907  C  CB   . GLU A 1 121 ? -21.716 18.509  -19.300 1.00 8.84  ? 216 GLU A CB   4  
ATOM   9908  C  CG   . GLU A 1 121 ? -20.378 18.967  -19.906 1.00 9.37  ? 216 GLU A CG   4  
ATOM   9909  C  CD   . GLU A 1 121 ? -19.656 19.990  -19.037 1.00 9.25  ? 216 GLU A CD   4  
ATOM   9910  O  OE1  . GLU A 1 121 ? -20.013 21.192  -19.079 1.00 9.28  ? 216 GLU A OE1  4  
ATOM   9911  O  OE2  . GLU A 1 121 ? -18.769 19.584  -18.245 1.00 9.56  ? 216 GLU A OE2  4  
ATOM   9912  H  H    . GLU A 1 121 ? -20.355 19.248  -16.827 1.00 6.62  ? 216 GLU A H    4  
ATOM   9913  H  HA   . GLU A 1 121 ? -22.708 17.596  -17.646 1.00 8.34  ? 216 GLU A HA   4  
ATOM   9914  H  HB2  . GLU A 1 121 ? -22.129 17.746  -19.959 1.00 9.86  ? 216 GLU A HB2  4  
ATOM   9915  H  HB3  . GLU A 1 121 ? -22.408 19.347  -19.324 1.00 8.67  ? 216 GLU A HB3  4  
ATOM   9916  H  HG2  . GLU A 1 121 ? -19.732 18.100  -20.060 1.00 9.85  ? 216 GLU A HG2  4  
ATOM   9917  H  HG3  . GLU A 1 121 ? -20.571 19.408  -20.885 1.00 9.93  ? 216 GLU A HG3  4  
ATOM   9918  N  N    . ASP A 1 122 ? -19.484 16.909  -17.591 1.00 8.10  ? 217 ASP A N    4  
ATOM   9919  C  CA   . ASP A 1 122 ? -18.518 15.878  -17.176 1.00 8.74  ? 217 ASP A CA   4  
ATOM   9920  C  C    . ASP A 1 122 ? -17.251 16.486  -16.541 1.00 7.61  ? 217 ASP A C    4  
ATOM   9921  O  O    . ASP A 1 122 ? -16.618 15.851  -15.702 1.00 8.04  ? 217 ASP A O    4  
ATOM   9922  C  CB   . ASP A 1 122 ? -18.171 14.915  -18.329 1.00 10.52 ? 217 ASP A CB   4  
ATOM   9923  C  CG   . ASP A 1 122 ? -18.018 13.473  -17.822 1.00 12.01 ? 217 ASP A CG   4  
ATOM   9924  O  OD1  . ASP A 1 122 ? -17.311 13.248  -16.811 1.00 12.17 ? 217 ASP A OD1  4  
ATOM   9925  O  OD2  . ASP A 1 122 ? -18.648 12.564  -18.412 1.00 13.35 ? 217 ASP A OD2  4  
ATOM   9926  H  H    . ASP A 1 122 ? -19.155 17.861  -17.703 1.00 7.56  ? 217 ASP A H    4  
ATOM   9927  H  HA   . ASP A 1 122 ? -19.018 15.284  -16.414 1.00 9.27  ? 217 ASP A HA   4  
ATOM   9928  H  HB2  . ASP A 1 122 ? -18.963 14.935  -19.081 1.00 11.07 ? 217 ASP A HB2  4  
ATOM   9929  H  HB3  . ASP A 1 122 ? -17.247 15.236  -18.814 1.00 10.58 ? 217 ASP A HB3  4  
ATOM   9930  N  N    . GLN A 1 123 ? -16.928 17.747  -16.862 1.00 6.78  ? 218 GLN A N    4  
ATOM   9931  C  CA   . GLN A 1 123 ? -16.092 18.672  -16.084 1.00 6.13  ? 218 GLN A CA   4  
ATOM   9932  C  C    . GLN A 1 123 ? -14.569 18.428  -16.154 1.00 6.09  ? 218 GLN A C    4  
ATOM   9933  O  O    . GLN A 1 123 ? -13.810 19.390  -16.275 1.00 6.51  ? 218 GLN A O    4  
ATOM   9934  C  CB   . GLN A 1 123 ? -16.610 18.717  -14.643 1.00 6.09  ? 218 GLN A CB   4  
ATOM   9935  C  CG   . GLN A 1 123 ? -16.230 20.008  -13.912 1.00 6.41  ? 218 GLN A CG   4  
ATOM   9936  C  CD   . GLN A 1 123 ? -17.209 20.212  -12.768 1.00 6.83  ? 218 GLN A CD   4  
ATOM   9937  O  OE1  . GLN A 1 123 ? -18.260 20.806  -12.944 1.00 7.51  ? 218 GLN A OE1  4  
ATOM   9938  N  NE2  . GLN A 1 123 ? -16.982 19.613  -11.620 1.00 6.96  ? 218 GLN A NE2  4  
ATOM   9939  H  H    . GLN A 1 123 ? -17.510 18.198  -17.555 1.00 7.11  ? 218 GLN A H    4  
ATOM   9940  H  HA   . GLN A 1 123 ? -16.280 19.657  -16.497 1.00 6.44  ? 218 GLN A HA   4  
ATOM   9941  H  HB2  . GLN A 1 123 ? -17.701 18.670  -14.682 1.00 6.38  ? 218 GLN A HB2  4  
ATOM   9942  H  HB3  . GLN A 1 123 ? -16.256 17.855  -14.079 1.00 6.36  ? 218 GLN A HB3  4  
ATOM   9943  H  HG2  . GLN A 1 123 ? -15.208 19.949  -13.540 1.00 6.75  ? 218 GLN A HG2  4  
ATOM   9944  H  HG3  . GLN A 1 123 ? -16.312 20.861  -14.586 1.00 6.81  ? 218 GLN A HG3  4  
ATOM   9945  H  HE21 . GLN A 1 123 ? -16.151 19.069  -11.471 1.00 6.93  ? 218 GLN A HE21 4  
ATOM   9946  H  HE22 . GLN A 1 123 ? -17.716 19.662  -10.921 1.00 7.45  ? 218 GLN A HE22 4  
ATOM   9947  N  N    . ASP A 1 124 ? -14.146 17.162  -16.054 1.00 6.17  ? 219 ASP A N    4  
ATOM   9948  C  CA   . ASP A 1 124 ? -12.776 16.606  -16.087 1.00 6.43  ? 219 ASP A CA   4  
ATOM   9949  C  C    . ASP A 1 124 ? -11.733 17.284  -15.169 1.00 5.60  ? 219 ASP A C    4  
ATOM   9950  O  O    . ASP A 1 124 ? -10.526 17.205  -15.393 1.00 6.21  ? 219 ASP A O    4  
ATOM   9951  C  CB   . ASP A 1 124 ? -12.294 16.401  -17.539 1.00 8.02  ? 219 ASP A CB   4  
ATOM   9952  C  CG   . ASP A 1 124 ? -11.180 15.345  -17.661 1.00 8.98  ? 219 ASP A CG   4  
ATOM   9953  O  OD1  . ASP A 1 124 ? -11.190 14.350  -16.894 1.00 9.14  ? 219 ASP A OD1  4  
ATOM   9954  O  OD2  . ASP A 1 124 ? -10.326 15.480  -18.572 1.00 10.02 ? 219 ASP A OD2  4  
ATOM   9955  H  H    . ASP A 1 124 ? -14.887 16.470  -15.986 1.00 6.50  ? 219 ASP A H    4  
ATOM   9956  H  HA   . ASP A 1 124 ? -12.892 15.610  -15.663 1.00 6.59  ? 219 ASP A HA   4  
ATOM   9957  H  HB2  . ASP A 1 124 ? -13.136 16.063  -18.146 1.00 8.78  ? 219 ASP A HB2  4  
ATOM   9958  H  HB3  . ASP A 1 124 ? -11.950 17.355  -17.942 1.00 8.22  ? 219 ASP A HB3  4  
ATOM   9959  N  N    . TYR A 1 125 ? -12.197 17.947  -14.107 1.00 4.86  ? 220 TYR A N    4  
ATOM   9960  C  CA   . TYR A 1 125 ? -11.358 18.692  -13.162 1.00 4.82  ? 220 TYR A CA   4  
ATOM   9961  C  C    . TYR A 1 125 ? -10.296 17.832  -12.446 1.00 4.29  ? 220 TYR A C    4  
ATOM   9962  O  O    . TYR A 1 125 ? -9.184  18.315  -12.254 1.00 4.99  ? 220 TYR A O    4  
ATOM   9963  C  CB   . TYR A 1 125 ? -12.261 19.422  -12.151 1.00 5.14  ? 220 TYR A CB   4  
ATOM   9964  C  CG   . TYR A 1 125 ? -13.033 18.549  -11.167 1.00 4.88  ? 220 TYR A CG   4  
ATOM   9965  C  CD1  . TYR A 1 125 ? -14.139 17.787  -11.596 1.00 5.23  ? 220 TYR A CD1  4  
ATOM   9966  C  CD2  . TYR A 1 125 ? -12.656 18.513  -9.808  1.00 5.18  ? 220 TYR A CD2  4  
ATOM   9967  C  CE1  . TYR A 1 125 ? -14.869 17.007  -10.678 1.00 5.60  ? 220 TYR A CE1  4  
ATOM   9968  C  CE2  . TYR A 1 125 ? -13.383 17.737  -8.884  1.00 5.63  ? 220 TYR A CE2  4  
ATOM   9969  C  CZ   . TYR A 1 125 ? -14.495 16.982  -9.316  1.00 5.71  ? 220 TYR A CZ   4  
ATOM   9970  O  OH   . TYR A 1 125 ? -15.222 16.247  -8.432  1.00 6.57  ? 220 TYR A OH   4  
ATOM   9971  H  H    . TYR A 1 125 ? -13.198 18.050  -14.052 1.00 5.00  ? 220 TYR A H    4  
ATOM   9972  H  HA   . TYR A 1 125 ? -10.817 19.448  -13.734 1.00 5.66  ? 220 TYR A HA   4  
ATOM   9973  H  HB2  . TYR A 1 125 ? -11.635 20.112  -11.585 1.00 5.78  ? 220 TYR A HB2  4  
ATOM   9974  H  HB3  . TYR A 1 125 ? -12.976 20.034  -12.704 1.00 5.73  ? 220 TYR A HB3  4  
ATOM   9975  H  HD1  . TYR A 1 125 ? -14.428 17.785  -12.634 1.00 5.77  ? 220 TYR A HD1  4  
ATOM   9976  H  HD2  . TYR A 1 125 ? -11.807 19.091  -9.466  1.00 5.62  ? 220 TYR A HD2  4  
ATOM   9977  H  HE1  . TYR A 1 125 ? -15.710 16.413  -11.004 1.00 6.30  ? 220 TYR A HE1  4  
ATOM   9978  H  HE2  . TYR A 1 125 ? -13.092 17.717  -7.842  1.00 6.38  ? 220 TYR A HE2  4  
ATOM   9979  H  HH   . TYR A 1 125 ? -14.917 16.345  -7.513  1.00 6.97  ? 220 TYR A HH   4  
ATOM   9980  N  N    . ILE A 1 126 ? -10.680 16.601  -12.079 1.00 3.73  ? 221 ILE A N    4  
ATOM   9981  C  CA   . ILE A 1 126 ? -10.066 15.472  -11.332 1.00 3.38  ? 221 ILE A CA   4  
ATOM   9982  C  C    . ILE A 1 126 ? -11.245 14.720  -10.663 1.00 3.17  ? 221 ILE A C    4  
ATOM   9983  O  O    . ILE A 1 126 ? -12.343 14.722  -11.220 1.00 3.77  ? 221 ILE A O    4  
ATOM   9984  C  CB   . ILE A 1 126 ? -8.889  15.820  -10.358 1.00 3.53  ? 221 ILE A CB   4  
ATOM   9985  C  CG1  . ILE A 1 126 ? -9.243  16.901  -9.309  1.00 3.60  ? 221 ILE A CG1  4  
ATOM   9986  C  CG2  . ILE A 1 126 ? -7.540  16.056  -11.068 1.00 4.87  ? 221 ILE A CG2  4  
ATOM   9987  C  CD1  . ILE A 1 126 ? -8.220  16.989  -8.169  1.00 4.84  ? 221 ILE A CD1  4  
ATOM   9988  H  H    . ILE A 1 126 ? -11.640 16.403  -12.337 1.00 4.06  ? 221 ILE A H    4  
ATOM   9989  H  HA   . ILE A 1 126 ? -9.669  14.772  -12.069 1.00 3.81  ? 221 ILE A HA   4  
ATOM   9990  H  HB   . ILE A 1 126 ? -8.687  14.911  -9.792  1.00 3.93  ? 221 ILE A HB   4  
ATOM   9991  H  HG12 . ILE A 1 126 ? -9.313  17.880  -9.780  1.00 3.95  ? 221 ILE A HG12 4  
ATOM   9992  H  HG13 . ILE A 1 126 ? -10.213 16.676  -8.870  1.00 3.69  ? 221 ILE A HG13 4  
ATOM   9993  H  HG21 . ILE A 1 126 ? -7.376  17.107  -11.287 1.00 5.48  ? 221 ILE A HG21 4  
ATOM   9994  H  HG22 . ILE A 1 126 ? -6.728  15.733  -10.414 1.00 5.47  ? 221 ILE A HG22 4  
ATOM   9995  H  HG23 . ILE A 1 126 ? -7.484  15.475  -11.988 1.00 5.43  ? 221 ILE A HG23 4  
ATOM   9996  H  HD11 . ILE A 1 126 ? -7.250  17.306  -8.553  1.00 5.57  ? 221 ILE A HD11 4  
ATOM   9997  H  HD12 . ILE A 1 126 ? -8.561  17.718  -7.434  1.00 5.35  ? 221 ILE A HD12 4  
ATOM   9998  H  HD13 . ILE A 1 126 ? -8.119  16.018  -7.682  1.00 5.25  ? 221 ILE A HD13 4  
ATOM   9999  N  N    . VAL A 1 127 ? -11.055 14.116  -9.489  1.00 2.73  ? 222 VAL A N    4  
ATOM   10000 C  CA   . VAL A 1 127 ? -12.070 13.940  -8.440  1.00 2.67  ? 222 VAL A CA   4  
ATOM   10001 C  C    . VAL A 1 127 ? -11.419 14.452  -7.150  1.00 2.70  ? 222 VAL A C    4  
ATOM   10002 O  O    . VAL A 1 127 ? -10.231 14.218  -6.931  1.00 2.58  ? 222 VAL A O    4  
ATOM   10003 C  CB   . VAL A 1 127 ? -12.503 12.463  -8.281  1.00 2.52  ? 222 VAL A CB   4  
ATOM   10004 C  CG1  . VAL A 1 127 ? -13.430 12.264  -7.072  1.00 2.95  ? 222 VAL A CG1  4  
ATOM   10005 C  CG2  . VAL A 1 127 ? -13.231 11.953  -9.538  1.00 2.99  ? 222 VAL A CG2  4  
ATOM   10006 H  H    . VAL A 1 127 ? -10.110 14.035  -9.145  1.00 2.72  ? 222 VAL A H    4  
ATOM   10007 H  HA   . VAL A 1 127 ? -12.953 14.546  -8.654  1.00 3.15  ? 222 VAL A HA   4  
ATOM   10008 H  HB   . VAL A 1 127 ? -11.615 11.850  -8.121  1.00 2.50  ? 222 VAL A HB   4  
ATOM   10009 H  HG11 . VAL A 1 127 ? -13.825 11.247  -7.059  1.00 3.40  ? 222 VAL A HG11 4  
ATOM   10010 H  HG12 . VAL A 1 127 ? -12.881 12.421  -6.144  1.00 2.96  ? 222 VAL A HG12 4  
ATOM   10011 H  HG13 . VAL A 1 127 ? -14.253 12.975  -7.125  1.00 3.77  ? 222 VAL A HG13 4  
ATOM   10012 H  HG21 . VAL A 1 127 ? -13.541 10.917  -9.394  1.00 3.36  ? 222 VAL A HG21 4  
ATOM   10013 H  HG22 . VAL A 1 127 ? -14.114 12.564  -9.731  1.00 3.55  ? 222 VAL A HG22 4  
ATOM   10014 H  HG23 . VAL A 1 127 ? -12.569 11.996  -10.403 1.00 3.43  ? 222 VAL A HG23 4  
ATOM   10015 N  N    . ASP A 1 128 ? -12.181 15.155  -6.312  1.00 3.23  ? 223 ASP A N    4  
ATOM   10016 C  CA   . ASP A 1 128 ? -11.767 15.694  -5.010  1.00 3.55  ? 223 ASP A CA   4  
ATOM   10017 C  C    . ASP A 1 128 ? -11.769 14.603  -3.918  1.00 3.37  ? 223 ASP A C    4  
ATOM   10018 O  O    . ASP A 1 128 ? -12.486 14.675  -2.917  1.00 3.74  ? 223 ASP A O    4  
ATOM   10019 C  CB   . ASP A 1 128 ? -12.598 16.949  -4.663  1.00 4.35  ? 223 ASP A CB   4  
ATOM   10020 C  CG   . ASP A 1 128 ? -14.126 16.804  -4.756  1.00 5.50  ? 223 ASP A CG   4  
ATOM   10021 O  OD1  . ASP A 1 128 ? -14.620 16.368  -5.824  1.00 7.00  ? 223 ASP A OD1  4  
ATOM   10022 O  OD2  . ASP A 1 128 ? -14.821 17.210  -3.791  1.00 5.70  ? 223 ASP A OD2  4  
ATOM   10023 H  H    . ASP A 1 128 ? -13.157 15.304  -6.555  1.00 3.63  ? 223 ASP A H    4  
ATOM   10024 H  HA   . ASP A 1 128 ? -10.731 16.024  -5.099  1.00 3.52  ? 223 ASP A HA   4  
ATOM   10025 H  HB2  . ASP A 1 128 ? -12.331 17.270  -3.655  1.00 3.88  ? 223 ASP A HB2  4  
ATOM   10026 H  HB3  . ASP A 1 128 ? -12.300 17.747  -5.344  1.00 5.62  ? 223 ASP A HB3  4  
ATOM   10027 N  N    . HIS A 1 129 ? -10.955 13.569  -4.149  1.00 3.19  ? 224 HIS A N    4  
ATOM   10028 C  CA   . HIS A 1 129 ? -10.880 12.357  -3.337  1.00 3.18  ? 224 HIS A CA   4  
ATOM   10029 C  C    . HIS A 1 129 ? -10.048 12.530  -2.052  1.00 3.14  ? 224 HIS A C    4  
ATOM   10030 O  O    . HIS A 1 129 ? -9.068  13.273  -2.008  1.00 3.40  ? 224 HIS A O    4  
ATOM   10031 C  CB   . HIS A 1 129 ? -10.342 11.193  -4.201  1.00 3.11  ? 224 HIS A CB   4  
ATOM   10032 C  CG   . HIS A 1 129 ? -8.841  10.974  -4.172  1.00 2.61  ? 224 HIS A CG   4  
ATOM   10033 N  ND1  . HIS A 1 129 ? -8.226  9.958   -3.504  1.00 2.98  ? 224 HIS A ND1  4  
ATOM   10034 C  CD2  . HIS A 1 129 ? -7.889  11.729  -4.805  1.00 2.24  ? 224 HIS A CD2  4  
ATOM   10035 C  CE1  . HIS A 1 129 ? -6.911  10.040  -3.712  1.00 2.70  ? 224 HIS A CE1  4  
ATOM   10036 N  NE2  . HIS A 1 129 ? -6.666  11.115  -4.486  1.00 2.01  ? 224 HIS A NE2  4  
ATOM   10037 H  H    . HIS A 1 129 ? -10.393 13.610  -4.990  1.00 3.38  ? 224 HIS A H    4  
ATOM   10038 H  HA   . HIS A 1 129 ? -11.900 12.104  -3.048  1.00 3.50  ? 224 HIS A HA   4  
ATOM   10039 H  HB2  . HIS A 1 129 ? -10.812 10.275  -3.846  1.00 3.57  ? 224 HIS A HB2  4  
ATOM   10040 H  HB3  . HIS A 1 129 ? -10.660 11.325  -5.236  1.00 3.26  ? 224 HIS A HB3  4  
ATOM   10041 H  HD1  . HIS A 1 129 ? -8.663  9.318   -2.849  1.00 3.56  ? 224 HIS A HD1  4  
ATOM   10042 H  HD2  . HIS A 1 129 ? -8.063  12.601  -5.420  1.00 2.61  ? 224 HIS A HD2  4  
ATOM   10043 H  HE1  . HIS A 1 129 ? -6.177  9.361   -3.304  1.00 3.24  ? 224 HIS A HE1  4  
ATOM   10044 N  N    . SER A 1 130 ? -10.374 11.760  -1.016  1.00 3.11  ? 225 SER A N    4  
ATOM   10045 C  CA   . SER A 1 130 ? -9.466  11.483  0.095   1.00 3.21  ? 225 SER A CA   4  
ATOM   10046 C  C    . SER A 1 130 ? -8.470  10.380  -0.295  1.00 3.69  ? 225 SER A C    4  
ATOM   10047 O  O    . SER A 1 130 ? -8.870  9.319   -0.777  1.00 4.78  ? 225 SER A O    4  
ATOM   10048 C  CB   . SER A 1 130 ? -10.279 11.071  1.337   1.00 3.69  ? 225 SER A CB   4  
ATOM   10049 O  OG   . SER A 1 130 ? -11.520 10.453  1.004   1.00 5.16  ? 225 SER A OG   4  
ATOM   10050 H  H    . SER A 1 130 ? -11.210 11.193  -1.025  1.00 3.20  ? 225 SER A H    4  
ATOM   10051 H  HA   . SER A 1 130 ? -8.901  12.382  0.343   1.00 3.19  ? 225 SER A HA   4  
ATOM   10052 H  HB2  . SER A 1 130 ? -9.686  10.413  1.972   1.00 3.73  ? 225 SER A HB2  4  
ATOM   10053 H  HB3  . SER A 1 130 ? -10.505 11.976  1.903   1.00 4.00  ? 225 SER A HB3  4  
ATOM   10054 H  HG   . SER A 1 130 ? -11.423 9.482   1.012   1.00 5.67  ? 225 SER A HG   4  
ATOM   10055 N  N    . ILE A 1 131 ? -7.172  10.607  -0.066  1.00 3.45  ? 226 ILE A N    4  
ATOM   10056 C  CA   . ILE A 1 131 ? -6.200  9.515   0.106   1.00 3.90  ? 226 ILE A CA   4  
ATOM   10057 C  C    . ILE A 1 131 ? -6.466  8.800   1.438   1.00 3.33  ? 226 ILE A C    4  
ATOM   10058 O  O    . ILE A 1 131 ? -6.996  9.402   2.375   1.00 3.75  ? 226 ILE A O    4  
ATOM   10059 C  CB   . ILE A 1 131 ? -4.726  10.001  0.018   1.00 4.68  ? 226 ILE A CB   4  
ATOM   10060 C  CG1  . ILE A 1 131 ? -4.220  10.866  1.200   1.00 5.07  ? 226 ILE A CG1  4  
ATOM   10061 C  CG2  . ILE A 1 131 ? -4.420  10.679  -1.331  1.00 5.77  ? 226 ILE A CG2  4  
ATOM   10062 C  CD1  . ILE A 1 131 ? -4.912  12.219  1.418   1.00 5.97  ? 226 ILE A CD1  4  
ATOM   10063 H  H    . ILE A 1 131 ? -6.889  11.514  0.271   1.00 3.17  ? 226 ILE A H    4  
ATOM   10064 H  HA   . ILE A 1 131 ? -6.358  8.779   -0.685  1.00 4.78  ? 226 ILE A HA   4  
ATOM   10065 H  HB   . ILE A 1 131 ? -4.109  9.100   0.038   1.00 5.15  ? 226 ILE A HB   4  
ATOM   10066 H  HG12 . ILE A 1 131 ? -4.296  10.291  2.122   1.00 5.15  ? 226 ILE A HG12 4  
ATOM   10067 H  HG13 . ILE A 1 131 ? -3.158  11.061  1.043   1.00 5.63  ? 226 ILE A HG13 4  
ATOM   10068 H  HG21 . ILE A 1 131 ? -5.101  11.507  -1.522  1.00 6.37  ? 226 ILE A HG21 4  
ATOM   10069 H  HG22 . ILE A 1 131 ? -3.397  11.058  -1.333  1.00 6.20  ? 226 ILE A HG22 4  
ATOM   10070 H  HG23 . ILE A 1 131 ? -4.499  9.946   -2.131  1.00 6.35  ? 226 ILE A HG23 4  
ATOM   10071 H  HD11 . ILE A 1 131 ? -4.365  12.777  2.180   1.00 6.22  ? 226 ILE A HD11 4  
ATOM   10072 H  HD12 . ILE A 1 131 ? -4.917  12.800  0.496   1.00 6.74  ? 226 ILE A HD12 4  
ATOM   10073 H  HD13 . ILE A 1 131 ? -5.931  12.071  1.772   1.00 6.29  ? 226 ILE A HD13 4  
ATOM   10074 N  N    . ALA A 1 132 ? -6.056  7.537   1.553   1.00 3.09  ? 227 ALA A N    4  
ATOM   10075 C  CA   . ALA A 1 132 ? -6.122  6.786   2.807   1.00 3.04  ? 227 ALA A CA   4  
ATOM   10076 C  C    . ALA A 1 132 ? -4.931  5.828   2.934   1.00 2.32  ? 227 ALA A C    4  
ATOM   10077 O  O    . ALA A 1 132 ? -4.414  5.337   1.932   1.00 2.34  ? 227 ALA A O    4  
ATOM   10078 C  CB   . ALA A 1 132 ? -7.470  6.056   2.898   1.00 4.43  ? 227 ALA A CB   4  
ATOM   10079 H  H    . ALA A 1 132 ? -5.613  7.093   0.760   1.00 3.40  ? 227 ALA A H    4  
ATOM   10080 H  HA   . ALA A 1 132 ? -6.057  7.495   3.636   1.00 3.16  ? 227 ALA A HA   4  
ATOM   10081 H  HB1  . ALA A 1 132 ? -7.569  5.339   2.084   1.00 5.36  ? 227 ALA A HB1  4  
ATOM   10082 H  HB2  . ALA A 1 132 ? -7.547  5.528   3.848   1.00 4.63  ? 227 ALA A HB2  4  
ATOM   10083 H  HB3  . ALA A 1 132 ? -8.283  6.782   2.830   1.00 4.96  ? 227 ALA A HB3  4  
ATOM   10084 N  N    . ILE A 1 133 ? -4.497  5.573   4.171   1.00 2.16  ? 228 ILE A N    4  
ATOM   10085 C  CA   . ILE A 1 133 ? -3.252  4.858   4.479   1.00 1.44  ? 228 ILE A CA   4  
ATOM   10086 C  C    . ILE A 1 133 ? -3.303  4.211   5.876   1.00 1.29  ? 228 ILE A C    4  
ATOM   10087 O  O    . ILE A 1 133 ? -3.690  4.851   6.856   1.00 1.68  ? 228 ILE A O    4  
ATOM   10088 C  CB   . ILE A 1 133 ? -2.022  5.769   4.228   1.00 1.61  ? 228 ILE A CB   4  
ATOM   10089 C  CG1  . ILE A 1 133 ? -0.717  5.026   4.613   1.00 1.81  ? 228 ILE A CG1  4  
ATOM   10090 C  CG2  . ILE A 1 133 ? -2.207  7.161   4.869   1.00 3.01  ? 228 ILE A CG2  4  
ATOM   10091 C  CD1  . ILE A 1 133 ? 0.591   5.787   4.356   1.00 1.82  ? 228 ILE A CD1  4  
ATOM   10092 H  H    . ILE A 1 133 ? -4.980  5.993   4.953   1.00 2.74  ? 228 ILE A H    4  
ATOM   10093 H  HA   . ILE A 1 133 ? -3.180  4.044   3.766   1.00 1.36  ? 228 ILE A HA   4  
ATOM   10094 H  HB   . ILE A 1 133 ? -1.975  5.944   3.155   1.00 2.64  ? 228 ILE A HB   4  
ATOM   10095 H  HG12 . ILE A 1 133 ? -0.740  4.753   5.667   1.00 2.66  ? 228 ILE A HG12 4  
ATOM   10096 H  HG13 . ILE A 1 133 ? -0.675  4.097   4.040   1.00 2.90  ? 228 ILE A HG13 4  
ATOM   10097 H  HG21 . ILE A 1 133 ? -1.293  7.749   4.798   1.00 3.21  ? 228 ILE A HG21 4  
ATOM   10098 H  HG22 . ILE A 1 133 ? -2.980  7.714   4.337   1.00 4.13  ? 228 ILE A HG22 4  
ATOM   10099 H  HG23 . ILE A 1 133 ? -2.513  7.063   5.908   1.00 3.95  ? 228 ILE A HG23 4  
ATOM   10100 H  HD11 . ILE A 1 133 ? 0.651   6.684   4.968   1.00 2.58  ? 228 ILE A HD11 4  
ATOM   10101 H  HD12 . ILE A 1 133 ? 1.429   5.141   4.620   1.00 2.27  ? 228 ILE A HD12 4  
ATOM   10102 H  HD13 . ILE A 1 133 ? 0.673   6.070   3.309   1.00 2.14  ? 228 ILE A HD13 4  
ATOM   10103 N  N    . TYR A 1 134 ? -2.935  2.927   5.953   1.00 0.98  ? 229 TYR A N    4  
ATOM   10104 C  CA   . TYR A 1 134 ? -3.311  2.012   7.046   1.00 1.04  ? 229 TYR A CA   4  
ATOM   10105 C  C    . TYR A 1 134 ? -2.322  0.841   7.223   1.00 0.99  ? 229 TYR A C    4  
ATOM   10106 O  O    . TYR A 1 134 ? -1.912  0.227   6.236   1.00 0.98  ? 229 TYR A O    4  
ATOM   10107 C  CB   . TYR A 1 134 ? -4.720  1.482   6.711   1.00 1.17  ? 229 TYR A CB   4  
ATOM   10108 C  CG   . TYR A 1 134 ? -5.109  0.171   7.370   1.00 2.41  ? 229 TYR A CG   4  
ATOM   10109 C  CD1  . TYR A 1 134 ? -5.267  0.097   8.765   1.00 3.45  ? 229 TYR A CD1  4  
ATOM   10110 C  CD2  . TYR A 1 134 ? -5.287  -0.986  6.584   1.00 4.18  ? 229 TYR A CD2  4  
ATOM   10111 C  CE1  . TYR A 1 134 ? -5.623  -1.121  9.372   1.00 5.21  ? 229 TYR A CE1  4  
ATOM   10112 C  CE2  . TYR A 1 134 ? -5.624  -2.210  7.189   1.00 5.85  ? 229 TYR A CE2  4  
ATOM   10113 C  CZ   . TYR A 1 134 ? -5.792  -2.284  8.585   1.00 6.15  ? 229 TYR A CZ   4  
ATOM   10114 O  OH   . TYR A 1 134 ? -6.111  -3.474  9.166   1.00 8.04  ? 229 TYR A OH   4  
ATOM   10115 H  H    . TYR A 1 134 ? -2.599  2.495   5.098   1.00 1.01  ? 229 TYR A H    4  
ATOM   10116 H  HA   . TYR A 1 134 ? -3.357  2.560   7.987   1.00 1.15  ? 229 TYR A HA   4  
ATOM   10117 H  HB2  . TYR A 1 134 ? -5.452  2.243   6.978   1.00 1.78  ? 229 TYR A HB2  4  
ATOM   10118 H  HB3  . TYR A 1 134 ? -4.792  1.341   5.631   1.00 2.29  ? 229 TYR A HB3  4  
ATOM   10119 H  HD1  . TYR A 1 134 ? -5.104  0.974   9.375   1.00 3.78  ? 229 TYR A HD1  4  
ATOM   10120 H  HD2  . TYR A 1 134 ? -5.159  -0.941  5.512   1.00 4.82  ? 229 TYR A HD2  4  
ATOM   10121 H  HE1  . TYR A 1 134 ? -5.752  -1.157  10.437  1.00 6.32  ? 229 TYR A HE1  4  
ATOM   10122 H  HE2  . TYR A 1 134 ? -5.746  -3.096  6.586   1.00 7.34  ? 229 TYR A HE2  4  
ATOM   10123 H  HH   . TYR A 1 134 ? -6.101  -3.423  10.122  1.00 8.51  ? 229 TYR A HH   4  
ATOM   10124 N  N    . LEU A 1 135 ? -1.975  0.493   8.473   1.00 0.99  ? 230 LEU A N    4  
ATOM   10125 C  CA   . LEU A 1 135 ? -1.115  -0.649  8.823   1.00 0.91  ? 230 LEU A CA   4  
ATOM   10126 C  C    . LEU A 1 135 ? -1.947  -1.924  9.061   1.00 0.93  ? 230 LEU A C    4  
ATOM   10127 O  O    . LEU A 1 135 ? -2.677  -2.026  10.052  1.00 1.01  ? 230 LEU A O    4  
ATOM   10128 C  CB   . LEU A 1 135 ? -0.274  -0.263  10.062  1.00 1.00  ? 230 LEU A CB   4  
ATOM   10129 C  CG   . LEU A 1 135 ? 1.029   -1.040  10.344  1.00 1.45  ? 230 LEU A CG   4  
ATOM   10130 C  CD1  . LEU A 1 135 ? 0.815   -2.549  10.516  1.00 2.85  ? 230 LEU A CD1  4  
ATOM   10131 C  CD2  . LEU A 1 135 ? 2.097   -0.790  9.269   1.00 2.25  ? 230 LEU A CD2  4  
ATOM   10132 H  H    . LEU A 1 135 ? -2.326  1.055   9.243   1.00 1.02  ? 230 LEU A H    4  
ATOM   10133 H  HA   . LEU A 1 135 ? -0.435  -0.840  7.993   1.00 0.91  ? 230 LEU A HA   4  
ATOM   10134 H  HB2  . LEU A 1 135 ? 0.011   0.782   9.970   1.00 1.41  ? 230 LEU A HB2  4  
ATOM   10135 H  HB3  . LEU A 1 135 ? -0.905  -0.335  10.946  1.00 1.73  ? 230 LEU A HB3  4  
ATOM   10136 H  HG   . LEU A 1 135 ? 1.426   -0.659  11.287  1.00 1.41  ? 230 LEU A HG   4  
ATOM   10137 H  HD11 . LEU A 1 135 ? 1.707   -2.983  10.963  1.00 3.49  ? 230 LEU A HD11 4  
ATOM   10138 H  HD12 . LEU A 1 135 ? -0.032  -2.739  11.174  1.00 3.75  ? 230 LEU A HD12 4  
ATOM   10139 H  HD13 . LEU A 1 135 ? 0.644   -3.016  9.549   1.00 3.22  ? 230 LEU A HD13 4  
ATOM   10140 H  HD21 . LEU A 1 135 ? 2.299   0.279   9.193   1.00 2.39  ? 230 LEU A HD21 4  
ATOM   10141 H  HD22 . LEU A 1 135 ? 3.021   -1.299  9.543   1.00 3.27  ? 230 LEU A HD22 4  
ATOM   10142 H  HD23 . LEU A 1 135 ? 1.765   -1.163  8.302   1.00 3.21  ? 230 LEU A HD23 4  
ATOM   10143 N  N    . LEU A 1 136 ? -1.780  -2.913  8.177   1.00 1.00  ? 231 LEU A N    4  
ATOM   10144 C  CA   . LEU A 1 136 ? -2.288  -4.279  8.322   1.00 1.05  ? 231 LEU A CA   4  
ATOM   10145 C  C    . LEU A 1 136 ? -1.206  -5.164  8.966   1.00 0.96  ? 231 LEU A C    4  
ATOM   10146 O  O    . LEU A 1 136 ? -0.106  -5.353  8.426   1.00 0.90  ? 231 LEU A O    4  
ATOM   10147 C  CB   . LEU A 1 136 ? -2.734  -4.783  6.936   1.00 1.20  ? 231 LEU A CB   4  
ATOM   10148 C  CG   . LEU A 1 136 ? -3.275  -6.228  6.890   1.00 1.72  ? 231 LEU A CG   4  
ATOM   10149 C  CD1  . LEU A 1 136 ? -4.562  -6.396  7.714   1.00 2.16  ? 231 LEU A CD1  4  
ATOM   10150 C  CD2  . LEU A 1 136 ? -3.561  -6.622  5.433   1.00 2.70  ? 231 LEU A CD2  4  
ATOM   10151 H  H    . LEU A 1 136 ? -1.127  -2.755  7.420   1.00 1.06  ? 231 LEU A H    4  
ATOM   10152 H  HA   . LEU A 1 136 ? -3.160  -4.263  8.981   1.00 1.18  ? 231 LEU A HA   4  
ATOM   10153 H  HB2  . LEU A 1 136 ? -3.500  -4.110  6.550   1.00 1.54  ? 231 LEU A HB2  4  
ATOM   10154 H  HB3  . LEU A 1 136 ? -1.879  -4.717  6.268   1.00 1.30  ? 231 LEU A HB3  4  
ATOM   10155 H  HG   . LEU A 1 136 ? -2.519  -6.909  7.282   1.00 2.62  ? 231 LEU A HG   4  
ATOM   10156 H  HD11 . LEU A 1 136 ? -4.944  -7.410  7.599   1.00 3.07  ? 231 LEU A HD11 4  
ATOM   10157 H  HD12 . LEU A 1 136 ? -4.353  -6.226  8.769   1.00 2.76  ? 231 LEU A HD12 4  
ATOM   10158 H  HD13 . LEU A 1 136 ? -5.319  -5.687  7.377   1.00 2.62  ? 231 LEU A HD13 4  
ATOM   10159 H  HD21 . LEU A 1 136 ? -4.315  -5.961  5.004   1.00 3.12  ? 231 LEU A HD21 4  
ATOM   10160 H  HD22 . LEU A 1 136 ? -2.647  -6.549  4.842   1.00 3.67  ? 231 LEU A HD22 4  
ATOM   10161 H  HD23 . LEU A 1 136 ? -3.920  -7.652  5.391   1.00 3.32  ? 231 LEU A HD23 4  
ATOM   10162 N  N    . ASN A 1 137 ? -1.531  -5.685  10.148  1.00 1.10  ? 232 ASN A N    4  
ATOM   10163 C  CA   . ASN A 1 137 ? -0.630  -6.439  11.021  1.00 1.07  ? 232 ASN A CA   4  
ATOM   10164 C  C    . ASN A 1 137 ? -0.544  -7.943  10.621  1.00 1.01  ? 232 ASN A C    4  
ATOM   10165 O  O    . ASN A 1 137 ? -1.374  -8.405  9.830   1.00 1.12  ? 232 ASN A O    4  
ATOM   10166 C  CB   . ASN A 1 137 ? -1.050  -6.132  12.483  1.00 1.28  ? 232 ASN A CB   4  
ATOM   10167 C  CG   . ASN A 1 137 ? -2.150  -7.004  13.088  1.00 2.10  ? 232 ASN A CG   4  
ATOM   10168 O  OD1  . ASN A 1 137 ? -2.485  -8.072  12.598  1.00 3.38  ? 232 ASN A OD1  4  
ATOM   10169 N  ND2  . ASN A 1 137 ? -2.732  -6.585  14.194  1.00 2.44  ? 232 ASN A ND2  4  
ATOM   10170 H  H    . ASN A 1 137 ? -2.470  -5.521  10.493  1.00 1.26  ? 232 ASN A H    4  
ATOM   10171 H  HA   . ASN A 1 137 ? 0.367   -6.018  10.888  1.00 1.11  ? 232 ASN A HA   4  
ATOM   10172 H  HB2  . ASN A 1 137 ? -0.180  -6.191  13.134  1.00 1.82  ? 232 ASN A HB2  4  
ATOM   10173 H  HB3  . ASN A 1 137 ? -1.376  -5.094  12.534  1.00 2.18  ? 232 ASN A HB3  4  
ATOM   10174 H  HD21 . ASN A 1 137 ? -2.545  -5.661  14.554  1.00 2.44  ? 232 ASN A HD21 4  
ATOM   10175 H  HD22 . ASN A 1 137 ? -3.382  -7.193  14.668  1.00 3.34  ? 232 ASN A HD22 4  
ATOM   10176 N  N    . PRO A 1 138 ? 0.421   -8.729  11.153  1.00 1.09  ? 233 PRO A N    4  
ATOM   10177 C  CA   . PRO A 1 138 ? 0.673   -10.116 10.737  1.00 1.17  ? 233 PRO A CA   4  
ATOM   10178 C  C    . PRO A 1 138 ? -0.344  -11.152 11.269  1.00 1.26  ? 233 PRO A C    4  
ATOM   10179 O  O    . PRO A 1 138 ? -0.166  -12.351 11.068  1.00 1.61  ? 233 PRO A O    4  
ATOM   10180 C  CB   . PRO A 1 138 ? 2.105   -10.410 11.203  1.00 1.36  ? 233 PRO A CB   4  
ATOM   10181 C  CG   . PRO A 1 138 ? 2.232   -9.565  12.465  1.00 1.50  ? 233 PRO A CG   4  
ATOM   10182 C  CD   . PRO A 1 138 ? 1.431   -8.312  12.119  1.00 1.35  ? 233 PRO A CD   4  
ATOM   10183 H  HA   . PRO A 1 138 ? 0.657   -10.162 9.652   1.00 1.26  ? 233 PRO A HA   4  
ATOM   10184 H  HB2  . PRO A 1 138 ? 2.279   -11.468 11.403  1.00 1.44  ? 233 PRO A HB2  4  
ATOM   10185 H  HB3  . PRO A 1 138 ? 2.813   -10.048 10.452  1.00 1.56  ? 233 PRO A HB3  4  
ATOM   10186 H  HG2  . PRO A 1 138 ? 1.757   -10.085 13.301  1.00 1.60  ? 233 PRO A HG2  4  
ATOM   10187 H  HG3  . PRO A 1 138 ? 3.271   -9.336  12.701  1.00 1.81  ? 233 PRO A HG3  4  
ATOM   10188 H  HD2  . PRO A 1 138 ? 0.981   -7.924  13.030  1.00 1.53  ? 233 PRO A HD2  4  
ATOM   10189 H  HD3  . PRO A 1 138 ? 2.078   -7.562  11.666  1.00 1.48  ? 233 PRO A HD3  4  
ATOM   10190 N  N    . ASP A 1 139 ? -1.408  -10.704 11.940  1.00 1.39  ? 234 ASP A N    4  
ATOM   10191 C  CA   . ASP A 1 139 ? -2.535  -11.476 12.480  1.00 1.59  ? 234 ASP A CA   4  
ATOM   10192 C  C    . ASP A 1 139 ? -3.840  -11.148 11.714  1.00 1.65  ? 234 ASP A C    4  
ATOM   10193 O  O    . ASP A 1 139 ? -4.842  -11.844 11.874  1.00 1.92  ? 234 ASP A O    4  
ATOM   10194 C  CB   . ASP A 1 139 ? -2.622  -11.150 13.988  1.00 1.95  ? 234 ASP A CB   4  
ATOM   10195 C  CG   . ASP A 1 139 ? -3.878  -11.638 14.719  1.00 2.74  ? 234 ASP A CG   4  
ATOM   10196 O  OD1  . ASP A 1 139 ? -4.218  -12.843 14.638  1.00 2.98  ? 234 ASP A OD1  4  
ATOM   10197 O  OD2  . ASP A 1 139 ? -4.479  -10.815 15.449  1.00 4.10  ? 234 ASP A OD2  4  
ATOM   10198 H  H    . ASP A 1 139 ? -1.526  -9.706  12.012  1.00 1.61  ? 234 ASP A H    4  
ATOM   10199 H  HA   . ASP A 1 139 ? -2.341  -12.544 12.372  1.00 1.87  ? 234 ASP A HA   4  
ATOM   10200 H  HB2  . ASP A 1 139 ? -1.751  -11.584 14.481  1.00 2.25  ? 234 ASP A HB2  4  
ATOM   10201 H  HB3  . ASP A 1 139 ? -2.558  -10.071 14.123  1.00 2.20  ? 234 ASP A HB3  4  
ATOM   10202 N  N    . GLY A 1 140 ? -3.812  -10.147 10.819  1.00 1.69  ? 235 GLY A N    4  
ATOM   10203 C  CA   . GLY A 1 140 ? -4.937  -9.704  9.984   1.00 2.17  ? 235 GLY A CA   4  
ATOM   10204 C  C    . GLY A 1 140 ? -5.709  -8.509  10.555  1.00 1.88  ? 235 GLY A C    4  
ATOM   10205 O  O    . GLY A 1 140 ? -6.719  -8.105  9.976   1.00 2.31  ? 235 GLY A O    4  
ATOM   10206 H  H    . GLY A 1 140 ? -2.931  -9.658  10.700  1.00 1.57  ? 235 GLY A H    4  
ATOM   10207 H  HA2  . GLY A 1 140 ? -4.543  -9.394  9.016   1.00 2.54  ? 235 GLY A HA2  4  
ATOM   10208 H  HA3  . GLY A 1 140 ? -5.645  -10.523 9.852   1.00 2.69  ? 235 GLY A HA3  4  
ATOM   10209 N  N    . LEU A 1 141 ? -5.262  -7.944  11.678  1.00 1.62  ? 236 LEU A N    4  
ATOM   10210 C  CA   . LEU A 1 141 ? -5.881  -6.803  12.360  1.00 1.66  ? 236 LEU A CA   4  
ATOM   10211 C  C    . LEU A 1 141 ? -5.115  -5.493  12.079  1.00 1.49  ? 236 LEU A C    4  
ATOM   10212 O  O    . LEU A 1 141 ? -4.208  -5.438  11.249  1.00 1.78  ? 236 LEU A O    4  
ATOM   10213 C  CB   . LEU A 1 141 ? -6.026  -7.157  13.864  1.00 2.09  ? 236 LEU A CB   4  
ATOM   10214 C  CG   . LEU A 1 141 ? -7.409  -7.732  14.239  1.00 2.85  ? 236 LEU A CG   4  
ATOM   10215 C  CD1  . LEU A 1 141 ? -7.734  -9.051  13.522  1.00 3.04  ? 236 LEU A CD1  4  
ATOM   10216 C  CD2  . LEU A 1 141 ? -7.495  -7.955  15.756  1.00 3.90  ? 236 LEU A CD2  4  
ATOM   10217 H  H    . LEU A 1 141 ? -4.389  -8.293  12.057  1.00 1.81  ? 236 LEU A H    4  
ATOM   10218 H  HA   . LEU A 1 141 ? -6.881  -6.640  11.958  1.00 2.05  ? 236 LEU A HA   4  
ATOM   10219 H  HB2  . LEU A 1 141 ? -5.257  -7.880  14.141  1.00 2.09  ? 236 LEU A HB2  4  
ATOM   10220 H  HB3  . LEU A 1 141 ? -5.860  -6.268  14.474  1.00 2.69  ? 236 LEU A HB3  4  
ATOM   10221 H  HG   . LEU A 1 141 ? -8.170  -6.998  13.968  1.00 3.39  ? 236 LEU A HG   4  
ATOM   10222 H  HD11 . LEU A 1 141 ? -7.820  -8.887  12.449  1.00 3.41  ? 236 LEU A HD11 4  
ATOM   10223 H  HD12 . LEU A 1 141 ? -6.951  -9.788  13.715  1.00 3.30  ? 236 LEU A HD12 4  
ATOM   10224 H  HD13 . LEU A 1 141 ? -8.688  -9.438  13.879  1.00 3.70  ? 236 LEU A HD13 4  
ATOM   10225 H  HD21 . LEU A 1 141 ? -7.256  -7.030  16.284  1.00 4.19  ? 236 LEU A HD21 4  
ATOM   10226 H  HD22 . LEU A 1 141 ? -8.505  -8.258  16.029  1.00 4.92  ? 236 LEU A HD22 4  
ATOM   10227 H  HD23 . LEU A 1 141 ? -6.797  -8.733  16.062  1.00 4.28  ? 236 LEU A HD23 4  
ATOM   10228 N  N    . PHE A 1 142 ? -5.531  -4.406  12.727  1.00 1.53  ? 237 PHE A N    4  
ATOM   10229 C  CA   . PHE A 1 142 ? -4.955  -3.067  12.583  1.00 1.50  ? 237 PHE A CA   4  
ATOM   10230 C  C    . PHE A 1 142 ? -3.652  -2.886  13.382  1.00 2.13  ? 237 PHE A C    4  
ATOM   10231 O  O    . PHE A 1 142 ? -3.258  -3.737  14.184  1.00 2.71  ? 237 PHE A O    4  
ATOM   10232 C  CB   . PHE A 1 142 ? -6.025  -2.043  13.019  1.00 2.18  ? 237 PHE A CB   4  
ATOM   10233 C  CG   . PHE A 1 142 ? -6.409  -2.113  14.490  1.00 3.46  ? 237 PHE A CG   4  
ATOM   10234 C  CD1  . PHE A 1 142 ? -7.404  -3.013  14.924  1.00 4.11  ? 237 PHE A CD1  4  
ATOM   10235 C  CD2  . PHE A 1 142 ? -5.760  -1.290  15.432  1.00 5.31  ? 237 PHE A CD2  4  
ATOM   10236 C  CE1  . PHE A 1 142 ? -7.726  -3.109  16.290  1.00 5.71  ? 237 PHE A CE1  4  
ATOM   10237 C  CE2  . PHE A 1 142 ? -6.085  -1.384  16.796  1.00 6.75  ? 237 PHE A CE2  4  
ATOM   10238 C  CZ   . PHE A 1 142 ? -7.064  -2.296  17.227  1.00 6.82  ? 237 PHE A CZ   4  
ATOM   10239 H  H    . PHE A 1 142 ? -6.226  -4.528  13.446  1.00 1.87  ? 237 PHE A H    4  
ATOM   10240 H  HA   . PHE A 1 142 ? -4.706  -2.897  11.535  1.00 1.43  ? 237 PHE A HA   4  
ATOM   10241 H  HB2  . PHE A 1 142 ? -5.666  -1.034  12.806  1.00 2.64  ? 237 PHE A HB2  4  
ATOM   10242 H  HB3  . PHE A 1 142 ? -6.924  -2.187  12.417  1.00 2.55  ? 237 PHE A HB3  4  
ATOM   10243 H  HD1  . PHE A 1 142 ? -7.924  -3.638  14.212  1.00 4.19  ? 237 PHE A HD1  4  
ATOM   10244 H  HD2  . PHE A 1 142 ? -5.006  -0.586  15.115  1.00 5.56  ? 237 PHE A HD2  4  
ATOM   10245 H  HE1  . PHE A 1 142 ? -8.477  -3.810  16.624  1.00 6.71  ? 237 PHE A HE1  4  
ATOM   10246 H  HE2  . PHE A 1 142 ? -5.580  -0.757  17.518  1.00 7.98  ? 237 PHE A HE2  4  
ATOM   10247 H  HZ   . PHE A 1 142 ? -7.304  -2.372  18.279  1.00 8.19  ? 237 PHE A HZ   4  
ATOM   10248 N  N    . THR A 1 143 ? -3.015  -1.723  13.230  1.00 1.32  ? 238 THR A N    4  
ATOM   10249 C  CA   . THR A 1 143 ? -2.103  -1.170  14.244  1.00 1.43  ? 238 THR A CA   4  
ATOM   10250 C  C    . THR A 1 143 ? -2.289  0.333   14.331  1.00 1.55  ? 238 THR A C    4  
ATOM   10251 O  O    . THR A 1 143 ? -2.672  0.824   15.389  1.00 2.20  ? 238 THR A O    4  
ATOM   10252 C  CB   . THR A 1 143 ? -0.648  -1.560  13.973  1.00 1.41  ? 238 THR A CB   4  
ATOM   10253 O  OG1  . THR A 1 143 ? -0.562  -2.964  14.016  1.00 1.77  ? 238 THR A OG1  4  
ATOM   10254 C  CG2  . THR A 1 143 ? 0.286   -1.012  15.044  1.00 1.74  ? 238 THR A CG2  4  
ATOM   10255 H  H    . THR A 1 143 ? -3.312  -1.113  12.480  1.00 1.34  ? 238 THR A H    4  
ATOM   10256 H  HA   . THR A 1 143 ? -2.375  -1.559  15.227  1.00 1.62  ? 238 THR A HA   4  
ATOM   10257 H  HB   . THR A 1 143 ? -0.330  -1.198  12.996  1.00 1.59  ? 238 THR A HB   4  
ATOM   10258 H  HG1  . THR A 1 143 ? -1.465  -3.295  14.128  1.00 2.10  ? 238 THR A HG1  4  
ATOM   10259 H  HG21 . THR A 1 143 ? 1.256   -1.476  14.918  1.00 2.63  ? 238 THR A HG21 4  
ATOM   10260 H  HG22 . THR A 1 143 ? 0.396   0.067   14.930  1.00 2.41  ? 238 THR A HG22 4  
ATOM   10261 H  HG23 . THR A 1 143 ? -0.096  -1.243  16.039  1.00 2.11  ? 238 THR A HG23 4  
ATOM   10262 N  N    . ASP A 1 144 ? -2.105  1.050   13.225  1.00 1.25  ? 239 ASP A N    4  
ATOM   10263 C  CA   . ASP A 1 144 ? -2.216  2.508   13.165  1.00 1.35  ? 239 ASP A CA   4  
ATOM   10264 C  C    . ASP A 1 144 ? -2.472  3.051   11.743  1.00 1.13  ? 239 ASP A C    4  
ATOM   10265 O  O    . ASP A 1 144 ? -2.495  2.314   10.752  1.00 1.14  ? 239 ASP A O    4  
ATOM   10266 C  CB   . ASP A 1 144 ? -1.007  3.167   13.870  1.00 1.68  ? 239 ASP A CB   4  
ATOM   10267 C  CG   . ASP A 1 144 ? 0.374   2.957   13.231  1.00 3.60  ? 239 ASP A CG   4  
ATOM   10268 O  OD1  . ASP A 1 144 ? 0.542   2.091   12.344  1.00 5.16  ? 239 ASP A OD1  4  
ATOM   10269 O  OD2  . ASP A 1 144 ? 1.285   3.725   13.626  1.00 4.28  ? 239 ASP A OD2  4  
ATOM   10270 H  H    . ASP A 1 144 ? -1.712  0.607   12.408  1.00 1.37  ? 239 ASP A H    4  
ATOM   10271 H  HA   . ASP A 1 144 ? -3.097  2.784   13.744  1.00 1.52  ? 239 ASP A HA   4  
ATOM   10272 H  HB2  . ASP A 1 144 ? -1.196  4.241   13.927  1.00 2.47  ? 239 ASP A HB2  4  
ATOM   10273 H  HB3  . ASP A 1 144 ? -0.959  2.809   14.899  1.00 2.02  ? 239 ASP A HB3  4  
ATOM   10274 N  N    . TYR A 1 145 ? -2.731  4.359   11.675  1.00 1.17  ? 240 TYR A N    4  
ATOM   10275 C  CA   . TYR A 1 145 ? -3.141  5.103   10.476  1.00 1.09  ? 240 TYR A CA   4  
ATOM   10276 C  C    . TYR A 1 145 ? -2.258  6.344   10.256  1.00 1.17  ? 240 TYR A C    4  
ATOM   10277 O  O    . TYR A 1 145 ? -1.586  6.825   11.177  1.00 1.40  ? 240 TYR A O    4  
ATOM   10278 C  CB   . TYR A 1 145 ? -4.619  5.503   10.607  1.00 1.27  ? 240 TYR A CB   4  
ATOM   10279 C  CG   . TYR A 1 145 ? -5.591  4.333   10.593  1.00 2.73  ? 240 TYR A CG   4  
ATOM   10280 C  CD1  . TYR A 1 145 ? -5.907  3.654   11.786  1.00 4.04  ? 240 TYR A CD1  4  
ATOM   10281 C  CD2  . TYR A 1 145 ? -6.183  3.927   9.380   1.00 4.26  ? 240 TYR A CD2  4  
ATOM   10282 C  CE1  . TYR A 1 145 ? -6.799  2.566   11.769  1.00 5.98  ? 240 TYR A CE1  4  
ATOM   10283 C  CE2  . TYR A 1 145 ? -7.094  2.854   9.359   1.00 6.28  ? 240 TYR A CE2  4  
ATOM   10284 C  CZ   . TYR A 1 145 ? -7.397  2.162   10.555  1.00 6.95  ? 240 TYR A CZ   4  
ATOM   10285 O  OH   . TYR A 1 145 ? -8.245  1.099   10.536  1.00 9.06  ? 240 TYR A OH   4  
ATOM   10286 H  H    . TYR A 1 145 ? -2.661  4.890   12.529  1.00 1.37  ? 240 TYR A H    4  
ATOM   10287 H  HA   . TYR A 1 145 ? -3.041  4.466   9.596   1.00 1.13  ? 240 TYR A HA   4  
ATOM   10288 H  HB2  . TYR A 1 145 ? -4.757  6.069   11.530  1.00 2.61  ? 240 TYR A HB2  4  
ATOM   10289 H  HB3  . TYR A 1 145 ? -4.876  6.166   9.780   1.00 1.96  ? 240 TYR A HB3  4  
ATOM   10290 H  HD1  . TYR A 1 145 ? -5.453  3.962   12.717  1.00 4.23  ? 240 TYR A HD1  4  
ATOM   10291 H  HD2  . TYR A 1 145 ? -5.936  4.443   8.462   1.00 4.45  ? 240 TYR A HD2  4  
ATOM   10292 H  HE1  . TYR A 1 145 ? -7.034  2.037   12.681  1.00 7.13  ? 240 TYR A HE1  4  
ATOM   10293 H  HE2  . TYR A 1 145 ? -7.546  2.550   8.426   1.00 7.66  ? 240 TYR A HE2  4  
ATOM   10294 H  HH   . TYR A 1 145 ? -8.591  0.926   9.658   1.00 9.84  ? 240 TYR A HH   4  
ATOM   10295 N  N    . TYR A 1 146 ? -2.220  6.847   9.020   1.00 1.29  ? 241 TYR A N    4  
ATOM   10296 C  CA   . TYR A 1 146 ? -1.211  7.817   8.565   1.00 1.46  ? 241 TYR A CA   4  
ATOM   10297 C  C    . TYR A 1 146 ? -1.823  9.047   7.858   1.00 1.62  ? 241 TYR A C    4  
ATOM   10298 O  O    . TYR A 1 146 ? -3.040  9.232   7.843   1.00 2.29  ? 241 TYR A O    4  
ATOM   10299 C  CB   . TYR A 1 146 ? -0.141  7.067   7.740   1.00 2.02  ? 241 TYR A CB   4  
ATOM   10300 C  CG   . TYR A 1 146 ? 0.632   6.005   8.504   1.00 2.49  ? 241 TYR A CG   4  
ATOM   10301 C  CD1  . TYR A 1 146 ? 0.033   4.768   8.805   1.00 3.75  ? 241 TYR A CD1  4  
ATOM   10302 C  CD2  . TYR A 1 146 ? 1.943   6.266   8.947   1.00 3.02  ? 241 TYR A CD2  4  
ATOM   10303 C  CE1  . TYR A 1 146 ? 0.685   3.848   9.643   1.00 4.74  ? 241 TYR A CE1  4  
ATOM   10304 C  CE2  . TYR A 1 146 ? 2.624   5.320   9.736   1.00 4.03  ? 241 TYR A CE2  4  
ATOM   10305 C  CZ   . TYR A 1 146 ? 1.986   4.121   10.115  1.00 4.68  ? 241 TYR A CZ   4  
ATOM   10306 O  OH   . TYR A 1 146 ? 2.614   3.257   10.955  1.00 5.91  ? 241 TYR A OH   4  
ATOM   10307 H  H    . TYR A 1 146 ? -2.821  6.430   8.317   1.00 1.45  ? 241 TYR A H    4  
ATOM   10308 H  HA   . TYR A 1 146 ? -0.707  8.223   9.438   1.00 1.53  ? 241 TYR A HA   4  
ATOM   10309 H  HB2  . TYR A 1 146 ? -0.633  6.575   6.916   1.00 2.74  ? 241 TYR A HB2  4  
ATOM   10310 H  HB3  . TYR A 1 146 ? 0.569   7.781   7.323   1.00 2.31  ? 241 TYR A HB3  4  
ATOM   10311 H  HD1  . TYR A 1 146 ? -0.954  4.534   8.430   1.00 4.44  ? 241 TYR A HD1  4  
ATOM   10312 H  HD2  . TYR A 1 146 ? 2.425   7.194   8.687   1.00 3.45  ? 241 TYR A HD2  4  
ATOM   10313 H  HE1  . TYR A 1 146 ? 0.189   2.935   9.930   1.00 5.94  ? 241 TYR A HE1  4  
ATOM   10314 H  HE2  . TYR A 1 146 ? 3.619   5.514   10.096  1.00 4.84  ? 241 TYR A HE2  4  
ATOM   10315 H  HH   . TYR A 1 146 ? 1.983   2.644   11.372  1.00 6.60  ? 241 TYR A HH   4  
ATOM   10316 N  N    . GLY A 1 147 ? -0.967  9.957   7.369   1.00 2.09  ? 242 GLY A N    4  
ATOM   10317 C  CA   . GLY A 1 147 ? -1.350  11.320  6.973   1.00 2.39  ? 242 GLY A CA   4  
ATOM   10318 C  C    . GLY A 1 147 ? -1.458  12.265  8.181   1.00 2.24  ? 242 GLY A C    4  
ATOM   10319 O  O    . GLY A 1 147 ? -1.117  11.892  9.305   1.00 3.22  ? 242 GLY A O    4  
ATOM   10320 H  H    . GLY A 1 147 ? 0.011   9.716   7.331   1.00 2.78  ? 242 GLY A H    4  
ATOM   10321 H  HA2  . GLY A 1 147 ? -0.606  11.723  6.283   1.00 2.93  ? 242 GLY A HA2  4  
ATOM   10322 H  HA3  . GLY A 1 147 ? -2.318  11.296  6.470   1.00 2.83  ? 242 GLY A HA3  4  
ATOM   10323 N  N    . ARG A 1 148 ? -1.891  13.510  7.945   1.00 2.28  ? 243 ARG A N    4  
ATOM   10324 C  CA   . ARG A 1 148 ? -2.227  14.569  8.930   1.00 2.74  ? 243 ARG A CA   4  
ATOM   10325 C  C    . ARG A 1 148 ? -1.037  15.148  9.727   1.00 2.74  ? 243 ARG A C    4  
ATOM   10326 O  O    . ARG A 1 148 ? -0.985  16.350  9.963   1.00 3.57  ? 243 ARG A O    4  
ATOM   10327 C  CB   . ARG A 1 148 ? -3.355  14.106  9.884   1.00 3.56  ? 243 ARG A CB   4  
ATOM   10328 C  CG   . ARG A 1 148 ? -4.160  15.299  10.433  1.00 4.43  ? 243 ARG A CG   4  
ATOM   10329 C  CD   . ARG A 1 148 ? -5.319  14.887  11.360  1.00 5.51  ? 243 ARG A CD   4  
ATOM   10330 N  NE   . ARG A 1 148 ? -6.331  15.956  11.438  1.00 6.00  ? 243 ARG A NE   4  
ATOM   10331 C  CZ   . ARG A 1 148 ? -6.910  16.489  12.511  1.00 6.82  ? 243 ARG A CZ   4  
ATOM   10332 N  NH1  . ARG A 1 148 ? -6.630  16.127  13.746  1.00 7.42  ? 243 ARG A NH1  4  
ATOM   10333 N  NH2  . ARG A 1 148 ? -7.813  17.434  12.373  1.00 7.49  ? 243 ARG A NH2  4  
ATOM   10334 H  H    . ARG A 1 148 ? -2.090  13.733  6.979   1.00 2.89  ? 243 ARG A H    4  
ATOM   10335 H  HA   . ARG A 1 148 ? -2.627  15.397  8.341   1.00 3.25  ? 243 ARG A HA   4  
ATOM   10336 H  HB2  . ARG A 1 148 ? -4.045  13.463  9.333   1.00 3.81  ? 243 ARG A HB2  4  
ATOM   10337 H  HB3  . ARG A 1 148 ? -2.934  13.530  10.710  1.00 4.09  ? 243 ARG A HB3  4  
ATOM   10338 H  HG2  . ARG A 1 148 ? -3.500  15.971  10.985  1.00 4.85  ? 243 ARG A HG2  4  
ATOM   10339 H  HG3  . ARG A 1 148 ? -4.569  15.846  9.584   1.00 4.60  ? 243 ARG A HG3  4  
ATOM   10340 H  HD2  . ARG A 1 148 ? -5.800  13.995  10.954  1.00 5.84  ? 243 ARG A HD2  4  
ATOM   10341 H  HD3  . ARG A 1 148 ? -4.920  14.644  12.346  1.00 6.21  ? 243 ARG A HD3  4  
ATOM   10342 H  HE   . ARG A 1 148 ? -6.663  16.296  10.539  1.00 6.08  ? 243 ARG A HE   4  
ATOM   10343 H  HH11 . ARG A 1 148 ? -5.989  15.376  13.931  1.00 7.38  ? 243 ARG A HH11 4  
ATOM   10344 H  HH12 . ARG A 1 148 ? -7.119  16.582  14.505  1.00 8.22  ? 243 ARG A HH12 4  
ATOM   10345 H  HH21 . ARG A 1 148 ? -8.112  17.770  11.462  1.00 7.55  ? 243 ARG A HH21 4  
ATOM   10346 H  HH22 . ARG A 1 148 ? -8.240  17.825  13.205  1.00 8.22  ? 243 ARG A HH22 4  
ATOM   10347 N  N    . SER A 1 149 ? -0.078  14.332  10.160  1.00 2.72  ? 244 SER A N    4  
ATOM   10348 C  CA   . SER A 1 149 ? 1.098   14.718  10.976  1.00 3.17  ? 244 SER A CA   4  
ATOM   10349 C  C    . SER A 1 149 ? 2.202   13.635  10.946  1.00 2.69  ? 244 SER A C    4  
ATOM   10350 O  O    . SER A 1 149 ? 2.938   13.429  11.914  1.00 3.14  ? 244 SER A O    4  
ATOM   10351 C  CB   . SER A 1 149 ? 0.671   15.075  12.415  1.00 4.40  ? 244 SER A CB   4  
ATOM   10352 O  OG   . SER A 1 149 ? -0.039  16.305  12.462  1.00 4.91  ? 244 SER A OG   4  
ATOM   10353 H  H    . SER A 1 149 ? -0.247  13.342  10.014  1.00 3.10  ? 244 SER A H    4  
ATOM   10354 H  HA   . SER A 1 149 ? 1.550   15.613  10.544  1.00 3.42  ? 244 SER A HA   4  
ATOM   10355 H  HB2  . SER A 1 149 ? 0.050   14.276  12.822  1.00 4.97  ? 244 SER A HB2  4  
ATOM   10356 H  HB3  . SER A 1 149 ? 1.555   15.179  13.048  1.00 4.94  ? 244 SER A HB3  4  
ATOM   10357 H  HG   . SER A 1 149 ? -0.455  16.477  11.595  1.00 4.91  ? 244 SER A HG   4  
ATOM   10358 N  N    . ARG A 1 150 ? 2.307   12.911  9.823   1.00 2.56  ? 245 ARG A N    4  
ATOM   10359 C  CA   . ARG A 1 150 ? 3.345   11.907  9.564   1.00 2.53  ? 245 ARG A CA   4  
ATOM   10360 C  C    . ARG A 1 150 ? 4.427   12.484  8.638   1.00 2.23  ? 245 ARG A C    4  
ATOM   10361 O  O    . ARG A 1 150 ? 4.230   13.506  7.994   1.00 2.34  ? 245 ARG A O    4  
ATOM   10362 C  CB   . ARG A 1 150 ? 2.722   10.641  8.952   1.00 2.74  ? 245 ARG A CB   4  
ATOM   10363 C  CG   . ARG A 1 150 ? 1.753   9.888   9.880   1.00 3.62  ? 245 ARG A CG   4  
ATOM   10364 C  CD   . ARG A 1 150 ? 2.394   9.178   11.085  1.00 4.35  ? 245 ARG A CD   4  
ATOM   10365 N  NE   . ARG A 1 150 ? 1.448   8.196   11.647  1.00 5.51  ? 245 ARG A NE   4  
ATOM   10366 C  CZ   . ARG A 1 150 ? 1.726   7.164   12.435  1.00 6.62  ? 245 ARG A CZ   4  
ATOM   10367 N  NH1  . ARG A 1 150 ? 2.903   6.957   12.980  1.00 7.14  ? 245 ARG A NH1  4  
ATOM   10368 N  NH2  . ARG A 1 150 ? 0.782   6.287   12.674  1.00 7.67  ? 245 ARG A NH2  4  
ATOM   10369 H  H    . ARG A 1 150 ? 1.769   13.210  9.026   1.00 2.95  ? 245 ARG A H    4  
ATOM   10370 H  HA   . ARG A 1 150 ? 3.816   11.631  10.504  1.00 3.06  ? 245 ARG A HA   4  
ATOM   10371 H  HB2  . ARG A 1 150 ? 2.185   10.923  8.046   1.00 3.01  ? 245 ARG A HB2  4  
ATOM   10372 H  HB3  . ARG A 1 150 ? 3.516   9.951   8.661   1.00 2.87  ? 245 ARG A HB3  4  
ATOM   10373 H  HG2  . ARG A 1 150 ? 0.977   10.564  10.240  1.00 3.71  ? 245 ARG A HG2  4  
ATOM   10374 H  HG3  . ARG A 1 150 ? 1.272   9.134   9.264   1.00 4.52  ? 245 ARG A HG3  4  
ATOM   10375 H  HD2  . ARG A 1 150 ? 3.298   8.657   10.758  1.00 4.79  ? 245 ARG A HD2  4  
ATOM   10376 H  HD3  . ARG A 1 150 ? 2.663   9.914   11.845  1.00 4.16  ? 245 ARG A HD3  4  
ATOM   10377 H  HE   . ARG A 1 150 ? 0.488   8.253   11.343  1.00 5.84  ? 245 ARG A HE   4  
ATOM   10378 H  HH11 . ARG A 1 150 ? 3.699   7.567   12.824  1.00 6.69  ? 245 ARG A HH11 4  
ATOM   10379 H  HH12 . ARG A 1 150 ? 3.036   6.167   13.604  1.00 8.26  ? 245 ARG A HH12 4  
ATOM   10380 H  HH21 . ARG A 1 150 ? -0.118  6.368   12.218  1.00 7.75  ? 245 ARG A HH21 4  
ATOM   10381 H  HH22 . ARG A 1 150 ? 1.016   5.418   13.153  1.00 8.64  ? 245 ARG A HH22 4  
ATOM   10382 N  N    . SER A 1 151 ? 5.564   11.805  8.577   1.00 2.22  ? 246 SER A N    4  
ATOM   10383 C  CA   . SER A 1 151 ? 6.819   12.152  7.901   1.00 1.87  ? 246 SER A CA   4  
ATOM   10384 C  C    . SER A 1 151 ? 7.804   11.008  8.233   1.00 1.57  ? 246 SER A C    4  
ATOM   10385 O  O    . SER A 1 151 ? 7.431   10.112  8.999   1.00 1.74  ? 246 SER A O    4  
ATOM   10386 C  CB   . SER A 1 151 ? 7.305   13.545  8.339   1.00 2.07  ? 246 SER A CB   4  
ATOM   10387 O  OG   . SER A 1 151 ? 8.559   13.870  7.771   1.00 2.21  ? 246 SER A OG   4  
ATOM   10388 H  H    . SER A 1 151 ? 5.644   10.954  9.119   1.00 2.61  ? 246 SER A H    4  
ATOM   10389 H  HA   . SER A 1 151 ? 6.670   12.173  6.820   1.00 1.90  ? 246 SER A HA   4  
ATOM   10390 H  HB2  . SER A 1 151 ? 6.584   14.294  8.010   1.00 2.50  ? 246 SER A HB2  4  
ATOM   10391 H  HB3  . SER A 1 151 ? 7.365   13.583  9.427   1.00 2.24  ? 246 SER A HB3  4  
ATOM   10392 H  HG   . SER A 1 151 ? 8.681   14.840  7.863   1.00 2.51  ? 246 SER A HG   4  
ATOM   10393 N  N    . ALA A 1 152 ? 9.021   10.977  7.679   1.00 1.33  ? 247 ALA A N    4  
ATOM   10394 C  CA   . ALA A 1 152 ? 9.873   9.779   7.716   1.00 1.19  ? 247 ALA A CA   4  
ATOM   10395 C  C    . ALA A 1 152 ? 10.138  9.263   9.150   1.00 1.30  ? 247 ALA A C    4  
ATOM   10396 O  O    . ALA A 1 152 ? 9.840   8.101   9.433   1.00 1.34  ? 247 ALA A O    4  
ATOM   10397 C  CB   . ALA A 1 152 ? 11.140  10.031  6.883   1.00 1.23  ? 247 ALA A CB   4  
ATOM   10398 H  H    . ALA A 1 152 ? 9.335   11.786  7.156   1.00 1.39  ? 247 ALA A H    4  
ATOM   10399 H  HA   . ALA A 1 152 ? 9.324   8.974   7.227   1.00 1.15  ? 247 ALA A HA   4  
ATOM   10400 H  HB1  . ALA A 1 152 ? 10.873  10.207  5.836   1.00 1.84  ? 247 ALA A HB1  4  
ATOM   10401 H  HB2  . ALA A 1 152 ? 11.699  10.881  7.273   1.00 2.10  ? 247 ALA A HB2  4  
ATOM   10402 H  HB3  . ALA A 1 152 ? 11.777  9.144   6.902   1.00 2.32  ? 247 ALA A HB3  4  
ATOM   10403 N  N    . GLU A 1 153 ? 10.565  10.118  10.090  1.00 1.50  ? 248 GLU A N    4  
ATOM   10404 C  CA   . GLU A 1 153 ? 10.701  9.730   11.503  1.00 1.80  ? 248 GLU A CA   4  
ATOM   10405 C  C    . GLU A 1 153 ? 9.370   9.347   12.171  1.00 1.80  ? 248 GLU A C    4  
ATOM   10406 O  O    . GLU A 1 153 ? 9.327   8.390   12.944  1.00 1.94  ? 248 GLU A O    4  
ATOM   10407 C  CB   . GLU A 1 153 ? 11.354  10.854  12.329  1.00 2.17  ? 248 GLU A CB   4  
ATOM   10408 C  CG   . GLU A 1 153 ? 12.852  11.055  12.063  1.00 2.14  ? 248 GLU A CG   4  
ATOM   10409 C  CD   . GLU A 1 153 ? 13.198  11.809  10.780  1.00 3.08  ? 248 GLU A CD   4  
ATOM   10410 O  OE1  . GLU A 1 153 ? 12.296  12.384  10.124  1.00 3.96  ? 248 GLU A OE1  4  
ATOM   10411 O  OE2  . GLU A 1 153 ? 14.410  11.863  10.472  1.00 3.92  ? 248 GLU A OE2  4  
ATOM   10412 H  H    . GLU A 1 153 ? 10.904  11.039  9.811   1.00 1.53  ? 248 GLU A H    4  
ATOM   10413 H  HA   . GLU A 1 153 ? 11.334  8.848   11.549  1.00 1.94  ? 248 GLU A HA   4  
ATOM   10414 H  HB2  . GLU A 1 153 ? 10.812  11.790  12.186  1.00 2.67  ? 248 GLU A HB2  4  
ATOM   10415 H  HB3  . GLU A 1 153 ? 11.257  10.584  13.382  1.00 3.08  ? 248 GLU A HB3  4  
ATOM   10416 H  HG2  . GLU A 1 153 ? 13.265  11.624  12.897  1.00 2.22  ? 248 GLU A HG2  4  
ATOM   10417 H  HG3  . GLU A 1 153 ? 13.347  10.082  12.053  1.00 2.77  ? 248 GLU A HG3  4  
ATOM   10418 N  N    . GLN A 1 154 ? 8.282   10.061  11.863  1.00 1.72  ? 249 GLN A N    4  
ATOM   10419 C  CA   . GLN A 1 154 ? 6.957   9.830   12.456  1.00 1.82  ? 249 GLN A CA   4  
ATOM   10420 C  C    . GLN A 1 154 ? 6.359   8.485   12.005  1.00 1.76  ? 249 GLN A C    4  
ATOM   10421 O  O    . GLN A 1 154 ? 5.492   7.941   12.681  1.00 1.95  ? 249 GLN A O    4  
ATOM   10422 C  CB   . GLN A 1 154 ? 5.975   10.940  12.034  1.00 2.09  ? 249 GLN A CB   4  
ATOM   10423 C  CG   . GLN A 1 154 ? 6.375   12.402  12.300  1.00 2.45  ? 249 GLN A CG   4  
ATOM   10424 C  CD   . GLN A 1 154 ? 6.131   12.843  13.741  1.00 2.61  ? 249 GLN A CD   4  
ATOM   10425 O  OE1  . GLN A 1 154 ? 7.013   12.761  14.576  1.00 3.07  ? 249 GLN A OE1  4  
ATOM   10426 N  NE2  . GLN A 1 154 ? 4.945   13.321  14.063  1.00 3.88  ? 249 GLN A NE2  4  
ATOM   10427 H  H    . GLN A 1 154 ? 8.375   10.771  11.154  1.00 1.64  ? 249 GLN A H    4  
ATOM   10428 H  HA   . GLN A 1 154 ? 7.044   9.808   13.545  1.00 1.96  ? 249 GLN A HA   4  
ATOM   10429 H  HB2  . GLN A 1 154 ? 5.826   10.832  10.966  1.00 2.81  ? 249 GLN A HB2  4  
ATOM   10430 H  HB3  . GLN A 1 154 ? 5.011   10.754  12.512  1.00 2.19  ? 249 GLN A HB3  4  
ATOM   10431 H  HG2  . GLN A 1 154 ? 7.422   12.566  12.046  1.00 3.07  ? 249 GLN A HG2  4  
ATOM   10432 H  HG3  . GLN A 1 154 ? 5.779   13.041  11.649  1.00 3.52  ? 249 GLN A HG3  4  
ATOM   10433 H  HE21 . GLN A 1 154 ? 4.204   13.397  13.374  1.00 4.89  ? 249 GLN A HE21 4  
ATOM   10434 H  HE22 . GLN A 1 154 ? 4.808   13.672  15.004  1.00 4.38  ? 249 GLN A HE22 4  
ATOM   10435 N  N    . ILE A 1 155 ? 6.750   7.974   10.832  1.00 1.61  ? 250 ILE A N    4  
ATOM   10436 C  CA   . ILE A 1 155 ? 6.518   6.580   10.418  1.00 1.53  ? 250 ILE A CA   4  
ATOM   10437 C  C    . ILE A 1 155 ? 7.478   5.629   11.142  1.00 1.38  ? 250 ILE A C    4  
ATOM   10438 O  O    . ILE A 1 155 ? 7.054   4.640   11.744  1.00 1.40  ? 250 ILE A O    4  
ATOM   10439 C  CB   . ILE A 1 155 ? 6.624   6.457   8.876   1.00 1.54  ? 250 ILE A CB   4  
ATOM   10440 C  CG1  . ILE A 1 155 ? 5.560   7.323   8.156   1.00 1.85  ? 250 ILE A CG1  4  
ATOM   10441 C  CG2  . ILE A 1 155 ? 6.465   4.984   8.443   1.00 1.54  ? 250 ILE A CG2  4  
ATOM   10442 C  CD1  . ILE A 1 155 ? 5.938   7.674   6.712   1.00 1.65  ? 250 ILE A CD1  4  
ATOM   10443 H  H    . ILE A 1 155 ? 7.390   8.533   10.272  1.00 1.55  ? 250 ILE A H    4  
ATOM   10444 H  HA   . ILE A 1 155 ? 5.522   6.276   10.732  1.00 1.65  ? 250 ILE A HA   4  
ATOM   10445 H  HB   . ILE A 1 155 ? 7.613   6.800   8.569   1.00 1.44  ? 250 ILE A HB   4  
ATOM   10446 H  HG12 . ILE A 1 155 ? 4.611   6.795   8.150   1.00 2.92  ? 250 ILE A HG12 4  
ATOM   10447 H  HG13 . ILE A 1 155 ? 5.412   8.264   8.685   1.00 2.32  ? 250 ILE A HG13 4  
ATOM   10448 H  HG21 . ILE A 1 155 ? 7.313   4.394   8.793   1.00 1.91  ? 250 ILE A HG21 4  
ATOM   10449 H  HG22 . ILE A 1 155 ? 5.546   4.565   8.852   1.00 2.22  ? 250 ILE A HG22 4  
ATOM   10450 H  HG23 . ILE A 1 155 ? 6.431   4.902   7.357   1.00 2.04  ? 250 ILE A HG23 4  
ATOM   10451 H  HD11 . ILE A 1 155 ? 6.865   8.249   6.705   1.00 2.30  ? 250 ILE A HD11 4  
ATOM   10452 H  HD12 . ILE A 1 155 ? 6.066   6.772   6.115   1.00 2.84  ? 250 ILE A HD12 4  
ATOM   10453 H  HD13 . ILE A 1 155 ? 5.146   8.278   6.269   1.00 1.85  ? 250 ILE A HD13 4  
ATOM   10454 N  N    . SER A 1 156 ? 8.776   5.912   11.058  1.00 1.31  ? 251 SER A N    4  
ATOM   10455 C  CA   . SER A 1 156 ? 9.824   4.959   11.424  1.00 1.35  ? 251 SER A CA   4  
ATOM   10456 C  C    . SER A 1 156 ? 9.782   4.525   12.892  1.00 1.55  ? 251 SER A C    4  
ATOM   10457 O  O    . SER A 1 156 ? 9.993   3.340   13.153  1.00 1.70  ? 251 SER A O    4  
ATOM   10458 C  CB   . SER A 1 156 ? 11.205  5.536   11.099  1.00 1.37  ? 251 SER A CB   4  
ATOM   10459 O  OG   . SER A 1 156 ? 12.207  4.550   11.288  1.00 2.30  ? 251 SER A OG   4  
ATOM   10460 H  H    . SER A 1 156 ? 9.058   6.767   10.589  1.00 1.34  ? 251 SER A H    4  
ATOM   10461 H  HA   . SER A 1 156 ? 9.691   4.057   10.826  1.00 1.36  ? 251 SER A HA   4  
ATOM   10462 H  HB2  . SER A 1 156 ? 11.227  5.867   10.060  1.00 2.01  ? 251 SER A HB2  4  
ATOM   10463 H  HB3  . SER A 1 156 ? 11.403  6.392   11.747  1.00 1.64  ? 251 SER A HB3  4  
ATOM   10464 H  HG   . SER A 1 156 ? 12.042  4.093   12.123  1.00 3.28  ? 251 SER A HG   4  
ATOM   10465 N  N    . ASP A 1 157 ? 9.533   5.429   13.850  1.00 1.68  ? 252 ASP A N    4  
ATOM   10466 C  CA   . ASP A 1 157 ? 9.398   4.998   15.249  1.00 2.04  ? 252 ASP A CA   4  
ATOM   10467 C  C    . ASP A 1 157 ? 8.079   4.264   15.523  1.00 2.05  ? 252 ASP A C    4  
ATOM   10468 O  O    . ASP A 1 157 ? 8.071   3.361   16.347  1.00 2.22  ? 252 ASP A O    4  
ATOM   10469 C  CB   . ASP A 1 157 ? 9.652   6.127   16.257  1.00 2.40  ? 252 ASP A CB   4  
ATOM   10470 C  CG   . ASP A 1 157 ? 10.028  5.523   17.622  1.00 3.28  ? 252 ASP A CG   4  
ATOM   10471 O  OD1  . ASP A 1 157 ? 11.090  4.859   17.704  1.00 4.08  ? 252 ASP A OD1  4  
ATOM   10472 O  OD2  . ASP A 1 157 ? 9.268   5.683   18.605  1.00 3.80  ? 252 ASP A OD2  4  
ATOM   10473 H  H    . ASP A 1 157 ? 9.393   6.408   13.610  1.00 1.66  ? 252 ASP A H    4  
ATOM   10474 H  HA   . ASP A 1 157 ? 10.190  4.269   15.421  1.00 2.26  ? 252 ASP A HA   4  
ATOM   10475 H  HB2  . ASP A 1 157 ? 10.484  6.742   15.909  1.00 2.51  ? 252 ASP A HB2  4  
ATOM   10476 H  HB3  . ASP A 1 157 ? 8.765   6.756   16.342  1.00 2.37  ? 252 ASP A HB3  4  
ATOM   10477 N  N    . SER A 1 158 ? 6.990   4.548   14.797  1.00 1.98  ? 253 SER A N    4  
ATOM   10478 C  CA   . SER A 1 158 ? 5.761   3.726   14.851  1.00 2.13  ? 253 SER A CA   4  
ATOM   10479 C  C    . SER A 1 158 ? 6.072   2.287   14.418  1.00 2.04  ? 253 SER A C    4  
ATOM   10480 O  O    . SER A 1 158 ? 5.776   1.324   15.129  1.00 2.24  ? 253 SER A O    4  
ATOM   10481 C  CB   . SER A 1 158 ? 4.664   4.304   13.932  1.00 2.29  ? 253 SER A CB   4  
ATOM   10482 O  OG   . SER A 1 158 ? 3.499   4.655   14.659  1.00 2.54  ? 253 SER A OG   4  
ATOM   10483 H  H    . SER A 1 158 ? 7.067   5.270   14.091  1.00 1.92  ? 253 SER A H    4  
ATOM   10484 H  HA   . SER A 1 158 ? 5.385   3.691   15.874  1.00 2.31  ? 253 SER A HA   4  
ATOM   10485 H  HB2  . SER A 1 158 ? 5.044   5.191   13.424  1.00 2.26  ? 253 SER A HB2  4  
ATOM   10486 H  HB3  . SER A 1 158 ? 4.390   3.573   13.168  1.00 3.13  ? 253 SER A HB3  4  
ATOM   10487 H  HG   . SER A 1 158 ? 2.732   4.128   14.317  1.00 3.41  ? 253 SER A HG   4  
ATOM   10488 N  N    . VAL A 1 159 ? 6.759   2.169   13.280  1.00 1.77  ? 254 VAL A N    4  
ATOM   10489 C  CA   . VAL A 1 159 ? 7.183   0.899   12.676  1.00 1.75  ? 254 VAL A CA   4  
ATOM   10490 C  C    . VAL A 1 159 ? 8.113   0.107   13.615  1.00 1.92  ? 254 VAL A C    4  
ATOM   10491 O  O    . VAL A 1 159 ? 8.001   -1.116  13.719  1.00 2.23  ? 254 VAL A O    4  
ATOM   10492 C  CB   . VAL A 1 159 ? 7.795   1.166   11.280  1.00 1.50  ? 254 VAL A CB   4  
ATOM   10493 C  CG1  . VAL A 1 159 ? 8.551   -0.042  10.719  1.00 1.67  ? 254 VAL A CG1  4  
ATOM   10494 C  CG2  . VAL A 1 159 ? 6.681   1.533   10.283  1.00 1.53  ? 254 VAL A CG2  4  
ATOM   10495 H  H    . VAL A 1 159 ? 6.989   3.043   12.802  1.00 1.62  ? 254 VAL A H    4  
ATOM   10496 H  HA   . VAL A 1 159 ? 6.288   0.302   12.528  1.00 1.90  ? 254 VAL A HA   4  
ATOM   10497 H  HB   . VAL A 1 159 ? 8.493   2.000   11.345  1.00 1.41  ? 254 VAL A HB   4  
ATOM   10498 H  HG11 . VAL A 1 159 ? 9.440   -0.233  11.318  1.00 2.11  ? 254 VAL A HG11 4  
ATOM   10499 H  HG12 . VAL A 1 159 ? 7.896   -0.911  10.725  1.00 2.27  ? 254 VAL A HG12 4  
ATOM   10500 H  HG13 . VAL A 1 159 ? 8.865   0.153   9.695   1.00 2.48  ? 254 VAL A HG13 4  
ATOM   10501 H  HG21 . VAL A 1 159 ? 7.116   1.777   9.314   1.00 2.32  ? 254 VAL A HG21 4  
ATOM   10502 H  HG22 . VAL A 1 159 ? 5.995   0.693   10.163  1.00 2.53  ? 254 VAL A HG22 4  
ATOM   10503 H  HG23 . VAL A 1 159 ? 6.118   2.395   10.636  1.00 1.45  ? 254 VAL A HG23 4  
ATOM   10504 N  N    . ARG A 1 160 ? 8.984   0.803   14.356  1.00 1.81  ? 255 ARG A N    4  
ATOM   10505 C  CA   . ARG A 1 160 ? 9.817   0.239   15.420  1.00 1.97  ? 255 ARG A CA   4  
ATOM   10506 C  C    . ARG A 1 160 ? 8.979   -0.178  16.645  1.00 2.17  ? 255 ARG A C    4  
ATOM   10507 O  O    . ARG A 1 160 ? 9.150   -1.290  17.149  1.00 2.36  ? 255 ARG A O    4  
ATOM   10508 C  CB   . ARG A 1 160 ? 10.890  1.288   15.766  1.00 1.91  ? 255 ARG A CB   4  
ATOM   10509 C  CG   . ARG A 1 160 ? 12.060  0.729   16.582  1.00 2.22  ? 255 ARG A CG   4  
ATOM   10510 C  CD   . ARG A 1 160 ? 13.149  1.804   16.722  1.00 2.29  ? 255 ARG A CD   4  
ATOM   10511 N  NE   . ARG A 1 160 ? 14.343  1.283   17.412  1.00 2.96  ? 255 ARG A NE   4  
ATOM   10512 C  CZ   . ARG A 1 160 ? 14.505  1.183   18.725  1.00 3.71  ? 255 ARG A CZ   4  
ATOM   10513 N  NH1  . ARG A 1 160 ? 13.595  1.600   19.578  1.00 4.19  ? 255 ARG A NH1  4  
ATOM   10514 N  NH2  . ARG A 1 160 ? 15.599  0.658   19.232  1.00 4.58  ? 255 ARG A NH2  4  
ATOM   10515 H  H    . ARG A 1 160 ? 9.065   1.797   14.180  1.00 1.65  ? 255 ARG A H    4  
ATOM   10516 H  HA   . ARG A 1 160 ? 10.315  -0.649  15.029  1.00 2.04  ? 255 ARG A HA   4  
ATOM   10517 H  HB2  . ARG A 1 160 ? 11.296  1.681   14.833  1.00 2.38  ? 255 ARG A HB2  4  
ATOM   10518 H  HB3  . ARG A 1 160 ? 10.435  2.115   16.314  1.00 1.92  ? 255 ARG A HB3  4  
ATOM   10519 H  HG2  . ARG A 1 160 ? 11.709  0.427   17.570  1.00 2.52  ? 255 ARG A HG2  4  
ATOM   10520 H  HG3  . ARG A 1 160 ? 12.476  -0.139  16.068  1.00 2.94  ? 255 ARG A HG3  4  
ATOM   10521 H  HD2  . ARG A 1 160 ? 13.445  2.136   15.726  1.00 2.57  ? 255 ARG A HD2  4  
ATOM   10522 H  HD3  . ARG A 1 160 ? 12.746  2.668   17.255  1.00 2.45  ? 255 ARG A HD3  4  
ATOM   10523 H  HE   . ARG A 1 160 ? 15.108  0.975   16.817  1.00 3.39  ? 255 ARG A HE   4  
ATOM   10524 H  HH11 . ARG A 1 160 ? 12.770  2.097   19.269  1.00 3.87  ? 255 ARG A HH11 4  
ATOM   10525 H  HH12 . ARG A 1 160 ? 13.772  1.497   20.572  1.00 5.17  ? 255 ARG A HH12 4  
ATOM   10526 H  HH21 . ARG A 1 160 ? 16.356  0.344   18.630  1.00 4.74  ? 255 ARG A HH21 4  
ATOM   10527 H  HH22 . ARG A 1 160 ? 15.708  0.618   20.231  1.00 5.36  ? 255 ARG A HH22 4  
ATOM   10528 N  N    . ARG A 1 161 ? 8.039   0.664   17.091  1.00 2.19  ? 256 ARG A N    4  
ATOM   10529 C  CA   . ARG A 1 161 ? 7.199   0.475   18.285  1.00 2.32  ? 256 ARG A CA   4  
ATOM   10530 C  C    . ARG A 1 161 ? 6.375   -0.809  18.206  1.00 2.45  ? 256 ARG A C    4  
ATOM   10531 O  O    . ARG A 1 161 ? 6.418   -1.625  19.129  1.00 2.58  ? 256 ARG A O    4  
ATOM   10532 C  CB   . ARG A 1 161 ? 6.319   1.729   18.491  1.00 2.36  ? 256 ARG A CB   4  
ATOM   10533 C  CG   . ARG A 1 161 ? 5.733   1.881   19.899  1.00 3.11  ? 256 ARG A CG   4  
ATOM   10534 C  CD   . ARG A 1 161 ? 4.457   1.075   20.186  1.00 4.82  ? 256 ARG A CD   4  
ATOM   10535 N  NE   . ARG A 1 161 ? 4.388   0.678   21.603  1.00 6.24  ? 256 ARG A NE   4  
ATOM   10536 C  CZ   . ARG A 1 161 ? 3.383   0.833   22.457  1.00 7.02  ? 256 ARG A CZ   4  
ATOM   10537 N  NH1  . ARG A 1 161 ? 2.288   1.514   22.201  1.00 6.60  ? 256 ARG A NH1  4  
ATOM   10538 N  NH2  . ARG A 1 161 ? 3.460   0.286   23.647  1.00 8.57  ? 256 ARG A NH2  4  
ATOM   10539 H  H    . ARG A 1 161 ? 7.937   1.545   16.599  1.00 2.08  ? 256 ARG A H    4  
ATOM   10540 H  HA   . ARG A 1 161 ? 7.860   0.392   19.148  1.00 2.35  ? 256 ARG A HA   4  
ATOM   10541 H  HB2  . ARG A 1 161 ? 6.952   2.603   18.356  1.00 2.37  ? 256 ARG A HB2  4  
ATOM   10542 H  HB3  . ARG A 1 161 ? 5.522   1.771   17.747  1.00 2.72  ? 256 ARG A HB3  4  
ATOM   10543 H  HG2  . ARG A 1 161 ? 6.514   1.625   20.613  1.00 3.46  ? 256 ARG A HG2  4  
ATOM   10544 H  HG3  . ARG A 1 161 ? 5.491   2.936   20.039  1.00 2.90  ? 256 ARG A HG3  4  
ATOM   10545 H  HD2  . ARG A 1 161 ? 3.595   1.674   19.896  1.00 4.82  ? 256 ARG A HD2  4  
ATOM   10546 H  HD3  . ARG A 1 161 ? 4.443   0.168   19.583  1.00 5.57  ? 256 ARG A HD3  4  
ATOM   10547 H  HE   . ARG A 1 161 ? 5.235   0.266   21.982  1.00 6.92  ? 256 ARG A HE   4  
ATOM   10548 H  HH11 . ARG A 1 161 ? 2.159   2.025   21.331  1.00 5.73  ? 256 ARG A HH11 4  
ATOM   10549 H  HH12 . ARG A 1 161 ? 1.600   1.606   22.934  1.00 7.36  ? 256 ARG A HH12 4  
ATOM   10550 H  HH21 . ARG A 1 161 ? 4.223   -0.335  23.881  1.00 9.33  ? 256 ARG A HH21 4  
ATOM   10551 H  HH22 . ARG A 1 161 ? 2.702   0.440   24.304  1.00 9.20  ? 256 ARG A HH22 4  
ATOM   10552 N  N    . HIS A 1 162 ? 5.647   -1.044  17.110  1.00 2.45  ? 257 HIS A N    4  
ATOM   10553 C  CA   . HIS A 1 162 ? 4.827   -2.259  17.000  1.00 2.62  ? 257 HIS A CA   4  
ATOM   10554 C  C    . HIS A 1 162 ? 5.648   -3.559  16.869  1.00 2.64  ? 257 HIS A C    4  
ATOM   10555 O  O    . HIS A 1 162 ? 5.186   -4.620  17.287  1.00 2.85  ? 257 HIS A O    4  
ATOM   10556 C  CB   . HIS A 1 162 ? 3.732   -2.087  15.938  1.00 2.66  ? 257 HIS A CB   4  
ATOM   10557 C  CG   . HIS A 1 162 ? 4.136   -1.788  14.518  1.00 3.77  ? 257 HIS A CG   4  
ATOM   10558 N  ND1  . HIS A 1 162 ? 3.526   -0.817  13.730  1.00 4.34  ? 257 HIS A ND1  4  
ATOM   10559 C  CD2  . HIS A 1 162 ? 5.018   -2.484  13.744  1.00 5.41  ? 257 HIS A CD2  4  
ATOM   10560 C  CE1  . HIS A 1 162 ? 4.066   -0.928  12.512  1.00 5.99  ? 257 HIS A CE1  4  
ATOM   10561 N  NE2  . HIS A 1 162 ? 4.966   -1.923  12.486  1.00 6.56  ? 257 HIS A NE2  4  
ATOM   10562 H  H    . HIS A 1 162 ? 5.613   -0.341  16.372  1.00 2.41  ? 257 HIS A H    4  
ATOM   10563 H  HA   . HIS A 1 162 ? 4.290   -2.364  17.942  1.00 2.83  ? 257 HIS A HA   4  
ATOM   10564 H  HB2  . HIS A 1 162 ? 3.116   -2.985  15.928  1.00 3.96  ? 257 HIS A HB2  4  
ATOM   10565 H  HB3  . HIS A 1 162 ? 3.095   -1.266  16.272  1.00 1.93  ? 257 HIS A HB3  4  
ATOM   10566 H  HD2  . HIS A 1 162 ? 5.619   -3.326  14.044  1.00 6.10  ? 257 HIS A HD2  4  
ATOM   10567 H  HE1  . HIS A 1 162 ? 3.831   -0.278  11.683  1.00 7.06  ? 257 HIS A HE1  4  
ATOM   10568 H  HE2  . HIS A 1 162 ? 5.529   -2.185  11.689  1.00 7.91  ? 257 HIS A HE2  4  
ATOM   10569 N  N    . MET A 1 163 ? 6.890   -3.484  16.373  1.00 2.47  ? 258 MET A N    4  
ATOM   10570 C  CA   . MET A 1 163 ? 7.855   -4.590  16.454  1.00 2.52  ? 258 MET A CA   4  
ATOM   10571 C  C    . MET A 1 163 ? 8.399   -4.799  17.877  1.00 2.57  ? 258 MET A C    4  
ATOM   10572 O  O    . MET A 1 163 ? 8.482   -5.940  18.328  1.00 2.74  ? 258 MET A O    4  
ATOM   10573 C  CB   . MET A 1 163 ? 8.953   -4.388  15.405  1.00 2.52  ? 258 MET A CB   4  
ATOM   10574 C  CG   . MET A 1 163 ? 10.152  -5.323  15.613  1.00 2.68  ? 258 MET A CG   4  
ATOM   10575 S  SD   . MET A 1 163 ? 10.852  -6.035  14.111  1.00 3.30  ? 258 MET A SD   4  
ATOM   10576 C  CE   . MET A 1 163 ? 9.659   -7.367  13.832  1.00 4.88  ? 258 MET A CE   4  
ATOM   10577 H  H    . MET A 1 163 ? 7.212   -2.583  16.044  1.00 2.32  ? 258 MET A H    4  
ATOM   10578 H  HA   . MET A 1 163 ? 7.340   -5.517  16.199  1.00 2.66  ? 258 MET A HA   4  
ATOM   10579 H  HB2  . MET A 1 163 ? 8.508   -4.588  14.431  1.00 2.81  ? 258 MET A HB2  4  
ATOM   10580 H  HB3  . MET A 1 163 ? 9.310   -3.356  15.418  1.00 2.46  ? 258 MET A HB3  4  
ATOM   10581 H  HG2  . MET A 1 163 ? 10.926  -4.748  16.126  1.00 2.77  ? 258 MET A HG2  4  
ATOM   10582 H  HG3  . MET A 1 163 ? 9.872   -6.159  16.253  1.00 2.95  ? 258 MET A HG3  4  
ATOM   10583 H  HE1  . MET A 1 163 ? 9.807   -8.151  14.577  1.00 5.53  ? 258 MET A HE1  4  
ATOM   10584 H  HE2  . MET A 1 163 ? 8.642   -6.984  13.903  1.00 5.07  ? 258 MET A HE2  4  
ATOM   10585 H  HE3  . MET A 1 163 ? 9.815   -7.788  12.838  1.00 5.88  ? 258 MET A HE3  4  
ATOM   10586 N  N    . ALA A 1 164 ? 8.734   -3.736  18.610  1.00 2.54  ? 259 ALA A N    4  
ATOM   10587 C  CA   . ALA A 1 164 ? 9.210   -3.836  19.993  1.00 2.71  ? 259 ALA A CA   4  
ATOM   10588 C  C    . ALA A 1 164 ? 8.180   -4.506  20.922  1.00 2.98  ? 259 ALA A C    4  
ATOM   10589 O  O    . ALA A 1 164 ? 8.553   -5.331  21.759  1.00 3.42  ? 259 ALA A O    4  
ATOM   10590 C  CB   . ALA A 1 164 ? 9.578   -2.427  20.464  1.00 2.61  ? 259 ALA A CB   4  
ATOM   10591 H  H    . ALA A 1 164 ? 8.697   -2.815  18.183  1.00 2.47  ? 259 ALA A H    4  
ATOM   10592 H  HA   . ALA A 1 164 ? 10.112  -4.452  20.012  1.00 2.81  ? 259 ALA A HA   4  
ATOM   10593 H  HB1  . ALA A 1 164 ? 8.695   -1.788  20.465  1.00 2.43  ? 259 ALA A HB1  4  
ATOM   10594 H  HB2  . ALA A 1 164 ? 9.977   -2.476  21.476  1.00 2.99  ? 259 ALA A HB2  4  
ATOM   10595 H  HB3  . ALA A 1 164 ? 10.333  -1.993  19.808  1.00 3.28  ? 259 ALA A HB3  4  
ATOM   10596 N  N    . ALA A 1 165 ? 6.890   -4.223  20.717  1.00 2.85  ? 260 ALA A N    4  
ATOM   10597 C  CA   . ALA A 1 165 ? 5.761   -4.854  21.412  1.00 3.17  ? 260 ALA A CA   4  
ATOM   10598 C  C    . ALA A 1 165 ? 5.521   -6.344  21.058  1.00 3.43  ? 260 ALA A C    4  
ATOM   10599 O  O    . ALA A 1 165 ? 4.666   -6.991  21.672  1.00 3.61  ? 260 ALA A O    4  
ATOM   10600 C  CB   . ALA A 1 165 ? 4.519   -4.001  21.112  1.00 3.24  ? 260 ALA A CB   4  
ATOM   10601 H  H    . ALA A 1 165 ? 6.684   -3.490  20.046  1.00 2.57  ? 260 ALA A H    4  
ATOM   10602 H  HA   . ALA A 1 165 ? 5.956   -4.819  22.485  1.00 3.28  ? 260 ALA A HA   4  
ATOM   10603 H  HB1  . ALA A 1 165 ? 4.687   -2.971  21.430  1.00 3.33  ? 260 ALA A HB1  4  
ATOM   10604 H  HB2  . ALA A 1 165 ? 4.300   -4.021  20.044  1.00 3.54  ? 260 ALA A HB2  4  
ATOM   10605 H  HB3  . ALA A 1 165 ? 3.660   -4.398  21.655  1.00 3.71  ? 260 ALA A HB3  4  
ATOM   10606 N  N    . PHE A 1 166 ? 6.261   -6.883  20.079  1.00 3.60  ? 261 PHE A N    4  
ATOM   10607 C  CA   . PHE A 1 166 ? 6.123   -8.234  19.526  1.00 3.94  ? 261 PHE A CA   4  
ATOM   10608 C  C    . PHE A 1 166 ? 7.379   -9.100  19.750  1.00 4.86  ? 261 PHE A C    4  
ATOM   10609 O  O    . PHE A 1 166 ? 7.252   -10.298 19.988  1.00 5.28  ? 261 PHE A O    4  
ATOM   10610 C  CB   . PHE A 1 166 ? 5.822   -8.048  18.029  1.00 3.24  ? 261 PHE A CB   4  
ATOM   10611 C  CG   . PHE A 1 166 ? 5.650   -9.306  17.201  1.00 3.58  ? 261 PHE A CG   4  
ATOM   10612 C  CD1  . PHE A 1 166 ? 4.370   -9.868  17.033  1.00 3.22  ? 261 PHE A CD1  4  
ATOM   10613 C  CD2  . PHE A 1 166 ? 6.750   -9.854  16.512  1.00 4.98  ? 261 PHE A CD2  4  
ATOM   10614 C  CE1  . PHE A 1 166 ? 4.190   -10.966 16.175  1.00 3.58  ? 261 PHE A CE1  4  
ATOM   10615 C  CE2  . PHE A 1 166 ? 6.567   -10.953 15.654  1.00 5.28  ? 261 PHE A CE2  4  
ATOM   10616 C  CZ   . PHE A 1 166 ? 5.287   -11.508 15.482  1.00 4.26  ? 261 PHE A CZ   4  
ATOM   10617 H  H    . PHE A 1 166 ? 6.920   -6.273  19.615  1.00 3.54  ? 261 PHE A H    4  
ATOM   10618 H  HA   . PHE A 1 166 ? 5.278   -8.744  19.989  1.00 4.52  ? 261 PHE A HA   4  
ATOM   10619 H  HB2  . PHE A 1 166 ? 4.910   -7.455  17.937  1.00 3.14  ? 261 PHE A HB2  4  
ATOM   10620 H  HB3  . PHE A 1 166 ? 6.621   -7.463  17.577  1.00 2.82  ? 261 PHE A HB3  4  
ATOM   10621 H  HD1  . PHE A 1 166 ? 3.518   -9.440  17.541  1.00 3.45  ? 261 PHE A HD1  4  
ATOM   10622 H  HD2  . PHE A 1 166 ? 7.730   -9.412  16.616  1.00 5.95  ? 261 PHE A HD2  4  
ATOM   10623 H  HE1  . PHE A 1 166 ? 3.202   -11.378 16.031  1.00 3.92  ? 261 PHE A HE1  4  
ATOM   10624 H  HE2  . PHE A 1 166 ? 7.407   -11.354 15.104  1.00 6.61  ? 261 PHE A HE2  4  
ATOM   10625 H  HZ   . PHE A 1 166 ? 5.140   -12.339 14.807  1.00 4.57  ? 261 PHE A HZ   4  
ATOM   10626 N  N    . ARG A 1 167 ? 8.587   -8.513  19.674  1.00 5.33  ? 262 ARG A N    4  
ATOM   10627 C  CA   . ARG A 1 167 ? 9.929   -9.107  19.898  1.00 6.48  ? 262 ARG A CA   4  
ATOM   10628 C  C    . ARG A 1 167 ? 10.366  -10.132 18.837  1.00 6.98  ? 262 ARG A C    4  
ATOM   10629 O  O    . ARG A 1 167 ? 11.481  -10.016 18.332  1.00 8.20  ? 262 ARG A O    4  
ATOM   10630 C  CB   . ARG A 1 167 ? 10.083  -9.696  21.311  1.00 7.26  ? 262 ARG A CB   4  
ATOM   10631 C  CG   . ARG A 1 167 ? 10.176  -8.577  22.357  1.00 7.51  ? 262 ARG A CG   4  
ATOM   10632 C  CD   . ARG A 1 167 ? 10.158  -9.170  23.771  1.00 7.97  ? 262 ARG A CD   4  
ATOM   10633 N  NE   . ARG A 1 167 ? 10.293  -8.149  24.826  1.00 8.77  ? 262 ARG A NE   4  
ATOM   10634 C  CZ   . ARG A 1 167 ? 9.414   -7.205  25.149  1.00 9.15  ? 262 ARG A CZ   4  
ATOM   10635 N  NH1  . ARG A 1 167 ? 8.308   -6.990  24.472  1.00 8.86  ? 262 ARG A NH1  4  
ATOM   10636 N  NH2  . ARG A 1 167 ? 9.629   -6.425  26.181  1.00 10.22 ? 262 ARG A NH2  4  
ATOM   10637 H  H    . ARG A 1 167 ? 8.582   -7.530  19.422  1.00 5.42  ? 262 ARG A H    4  
ATOM   10638 H  HA   . ARG A 1 167 ? 10.644  -8.288  19.839  1.00 6.83  ? 262 ARG A HA   4  
ATOM   10639 H  HB2  . ARG A 1 167 ? 9.253   -10.362 21.544  1.00 7.04  ? 262 ARG A HB2  4  
ATOM   10640 H  HB3  . ARG A 1 167 ? 11.006  -10.279 21.357  1.00 8.43  ? 262 ARG A HB3  4  
ATOM   10641 H  HG2  . ARG A 1 167 ? 11.099  -8.014  22.209  1.00 8.59  ? 262 ARG A HG2  4  
ATOM   10642 H  HG3  . ARG A 1 167 ? 9.329   -7.905  22.233  1.00 6.81  ? 262 ARG A HG3  4  
ATOM   10643 H  HD2  . ARG A 1 167 ? 9.222   -9.712  23.900  1.00 7.24  ? 262 ARG A HD2  4  
ATOM   10644 H  HD3  . ARG A 1 167 ? 10.981  -9.880  23.864  1.00 8.93  ? 262 ARG A HD3  4  
ATOM   10645 H  HE   . ARG A 1 167 ? 11.125  -8.204  25.395  1.00 9.39  ? 262 ARG A HE   4  
ATOM   10646 H  HH11 . ARG A 1 167 ? 8.104   -7.516  23.644  1.00 8.29  ? 262 ARG A HH11 4  
ATOM   10647 H  HH12 . ARG A 1 167 ? 7.706   -6.228  24.758  1.00 9.53  ? 262 ARG A HH12 4  
ATOM   10648 H  HH21 . ARG A 1 167 ? 10.445  -6.541  26.773  1.00 10.68 ? 262 ARG A HH21 4  
ATOM   10649 H  HH22 . ARG A 1 167 ? 8.938   -5.725  26.403  1.00 10.74 ? 262 ARG A HH22 4  
ATOM   10650 N  N    . SER A 1 168 ? 9.490   -11.083 18.500  1.00 6.44  ? 263 SER A N    4  
ATOM   10651 C  CA   . SER A 1 168 ? 9.578   -12.118 17.448  1.00 7.00  ? 263 SER A CA   4  
ATOM   10652 C  C    . SER A 1 168 ? 10.120  -13.469 17.954  1.00 7.98  ? 263 SER A C    4  
ATOM   10653 O  O    . SER A 1 168 ? 11.004  -13.509 18.806  1.00 8.74  ? 263 SER A O    4  
ATOM   10654 C  CB   . SER A 1 168 ? 10.397  -11.671 16.226  1.00 7.47  ? 263 SER A CB   4  
ATOM   10655 O  OG   . SER A 1 168 ? 10.044  -12.449 15.096  1.00 7.74  ? 263 SER A OG   4  
ATOM   10656 H  H    . SER A 1 168 ? 8.639   -11.086 19.053  1.00 5.91  ? 263 SER A H    4  
ATOM   10657 H  HA   . SER A 1 168 ? 8.565   -12.301 17.096  1.00 6.77  ? 263 SER A HA   4  
ATOM   10658 H  HB2  . SER A 1 168 ? 10.183  -10.625 16.007  1.00 7.38  ? 263 SER A HB2  4  
ATOM   10659 H  HB3  . SER A 1 168 ? 11.461  -11.781 16.437  1.00 8.08  ? 263 SER A HB3  4  
ATOM   10660 H  HG   . SER A 1 168 ? 10.701  -12.315 14.405  1.00 8.45  ? 263 SER A HG   4  
ATOM   10661 N  N    . VAL A 1 169 ? 9.622   -14.574 17.387  1.00 8.34  ? 264 VAL A N    4  
ATOM   10662 C  CA   . VAL A 1 169 ? 10.114  -15.946 17.583  1.00 9.62  ? 264 VAL A CA   4  
ATOM   10663 C  C    . VAL A 1 169 ? 10.386  -16.566 16.210  1.00 10.61 ? 264 VAL A C    4  
ATOM   10664 O  O    . VAL A 1 169 ? 9.486   -16.647 15.374  1.00 10.92 ? 264 VAL A O    4  
ATOM   10665 C  CB   . VAL A 1 169 ? 9.090   -16.812 18.363  1.00 9.75  ? 264 VAL A CB   4  
ATOM   10666 C  CG1  . VAL A 1 169 ? 9.602   -18.253 18.553  1.00 10.97 ? 264 VAL A CG1  4  
ATOM   10667 C  CG2  . VAL A 1 169 ? 8.781   -16.217 19.748  1.00 9.59  ? 264 VAL A CG2  4  
ATOM   10668 H  H    . VAL A 1 169 ? 8.830   -14.460 16.747  1.00 7.93  ? 264 VAL A H    4  
ATOM   10669 H  HA   . VAL A 1 169 ? 11.048  -15.936 18.145  1.00 10.19 ? 264 VAL A HA   4  
ATOM   10670 H  HB   . VAL A 1 169 ? 8.158   -16.853 17.795  1.00 9.56  ? 264 VAL A HB   4  
ATOM   10671 H  HG11 . VAL A 1 169 ? 8.886   -18.827 19.142  1.00 11.08 ? 264 VAL A HG11 4  
ATOM   10672 H  HG12 . VAL A 1 169 ? 9.716   -18.748 17.588  1.00 11.58 ? 264 VAL A HG12 4  
ATOM   10673 H  HG13 . VAL A 1 169 ? 10.564  -18.246 19.067  1.00 11.50 ? 264 VAL A HG13 4  
ATOM   10674 H  HG21 . VAL A 1 169 ? 9.699   -16.125 20.331  1.00 10.06 ? 264 VAL A HG21 4  
ATOM   10675 H  HG22 . VAL A 1 169 ? 8.321   -15.234 19.645  1.00 9.34  ? 264 VAL A HG22 4  
ATOM   10676 H  HG23 . VAL A 1 169 ? 8.083   -16.863 20.283  1.00 9.83  ? 264 VAL A HG23 4  
ATOM   10677 N  N    . LEU A 1 170 ? 11.626  -17.017 15.997  1.00 11.47 ? 265 LEU A N    4  
ATOM   10678 C  CA   . LEU A 1 170 ? 12.021  -17.853 14.854  1.00 12.76 ? 265 LEU A CA   4  
ATOM   10679 C  C    . LEU A 1 170 ? 11.716  -19.327 15.174  1.00 13.71 ? 265 LEU A C    4  
ATOM   10680 O  O    . LEU A 1 170 ? 10.583  -19.747 14.941  1.00 13.74 ? 265 LEU A O    4  
ATOM   10681 C  CB   . LEU A 1 170 ? 13.482  -17.563 14.456  1.00 13.68 ? 265 LEU A CB   4  
ATOM   10682 C  CG   . LEU A 1 170 ? 13.758  -16.100 14.044  1.00 13.53 ? 265 LEU A CG   4  
ATOM   10683 C  CD1  . LEU A 1 170 ? 15.190  -16.013 13.507  1.00 14.91 ? 265 LEU A CD1  4  
ATOM   10684 C  CD2  . LEU A 1 170 ? 12.783  -15.555 12.989  1.00 13.72 ? 265 LEU A CD2  4  
ATOM   10685 H  H    . LEU A 1 170 ? 12.304  -16.846 16.723  1.00 11.41 ? 265 LEU A H    4  
ATOM   10686 H  HA   . LEU A 1 170 ? 11.403  -17.608 13.989  1.00 12.75 ? 265 LEU A HA   4  
ATOM   10687 H  HB2  . LEU A 1 170 ? 14.144  -17.813 15.287  1.00 13.79 ? 265 LEU A HB2  4  
ATOM   10688 H  HB3  . LEU A 1 170 ? 13.735  -18.214 13.617  1.00 14.80 ? 265 LEU A HB3  4  
ATOM   10689 H  HG   . LEU A 1 170 ? 13.688  -15.467 14.930  1.00 12.77 ? 265 LEU A HG   4  
ATOM   10690 H  HD11 . LEU A 1 170 ? 15.277  -16.615 12.602  1.00 15.55 ? 265 LEU A HD11 4  
ATOM   10691 H  HD12 . LEU A 1 170 ? 15.434  -14.975 13.277  1.00 15.07 ? 265 LEU A HD12 4  
ATOM   10692 H  HD13 . LEU A 1 170 ? 15.890  -16.385 14.256  1.00 15.40 ? 265 LEU A HD13 4  
ATOM   10693 H  HD21 . LEU A 1 170 ? 11.782  -15.460 13.411  1.00 13.24 ? 265 LEU A HD21 4  
ATOM   10694 H  HD22 . LEU A 1 170 ? 13.106  -14.567 12.659  1.00 14.12 ? 265 LEU A HD22 4  
ATOM   10695 H  HD23 . LEU A 1 170 ? 12.749  -16.223 12.129  1.00 14.34 ? 265 LEU A HD23 4  
ATOM   10696 N  N    . SER A 1 171 ? 12.698  -20.055 15.735  1.00 14.76 ? 266 SER A N    4  
ATOM   10697 C  CA   . SER A 1 171 ? 12.658  -21.362 16.445  1.00 15.94 ? 266 SER A CA   4  
ATOM   10698 C  C    . SER A 1 171 ? 13.647  -22.394 15.887  1.00 17.58 ? 266 SER A C    4  
ATOM   10699 O  O    . SER A 1 171 ? 14.327  -22.138 14.870  1.00 18.25 ? 266 SER A O    4  
ATOM   10700 C  CB   . SER A 1 171 ? 11.240  -21.937 16.597  1.00 15.83 ? 266 SER A CB   4  
ATOM   10701 O  OG   . SER A 1 171 ? 11.325  -23.082 17.422  1.00 16.68 ? 266 SER A OG   4  
ATOM   10702 O  OXT  . SER A 1 171 ? 13.724  -23.476 16.514  1.00 18.40 ? 266 SER A OXT  4  
ATOM   10703 H  H    . SER A 1 171 ? 13.609  -19.621 15.721  1.00 14.93 ? 266 SER A H    4  
ATOM   10704 H  HA   . SER A 1 171 ? 13.013  -21.170 17.457  1.00 16.01 ? 266 SER A HA   4  
ATOM   10705 H  HB2  . SER A 1 171 ? 10.586  -21.192 17.060  1.00 14.96 ? 266 SER A HB2  4  
ATOM   10706 H  HB3  . SER A 1 171 ? 10.846  -22.207 15.614  1.00 16.26 ? 266 SER A HB3  4  
ATOM   10707 H  HG   . SER A 1 171 ? 12.228  -23.435 17.235  1.00 17.34 ? 266 SER A HG   4  
HETATM 10708 CU CU   . CU1 B 2 .   ? -4.636  11.647  -5.100  1.00 1.78  ? 267 CU1 A CU   4  
ATOM   10709 N  N    . SER A 1 2   ? -15.201 -28.679 -1.408  1.00 16.73 ? 97  SER A N    5  
ATOM   10710 C  CA   . SER A 1 2   ? -16.537 -28.367 -0.881  1.00 15.68 ? 97  SER A CA   5  
ATOM   10711 C  C    . SER A 1 2   ? -16.429 -27.279 0.183   1.00 14.14 ? 97  SER A C    5  
ATOM   10712 O  O    . SER A 1 2   ? -16.328 -27.591 1.368   1.00 13.68 ? 97  SER A O    5  
ATOM   10713 C  CB   . SER A 1 2   ? -17.193 -29.641 -0.332  1.00 16.07 ? 97  SER A CB   5  
ATOM   10714 O  OG   . SER A 1 2   ? -18.409 -29.363 0.337   1.00 15.77 ? 97  SER A OG   5  
ATOM   10715 H  H    . SER A 1 2   ? -14.749 -27.832 -1.727  1.00 16.62 ? 97  SER A H    5  
ATOM   10716 H  HA   . SER A 1 2   ? -17.153 -27.982 -1.693  1.00 16.04 ? 97  SER A HA   5  
ATOM   10717 H  HB2  . SER A 1 2   ? -17.388 -30.326 -1.159  1.00 16.76 ? 97  SER A HB2  5  
ATOM   10718 H  HB3  . SER A 1 2   ? -16.515 -30.128 0.369   1.00 16.21 ? 97  SER A HB3  5  
ATOM   10719 H  HG   . SER A 1 2   ? -18.179 -28.951 1.183   1.00 15.41 ? 97  SER A HG   5  
ATOM   10720 N  N    . PHE A 1 3   ? -16.448 -26.004 -0.220  1.00 13.58 ? 98  PHE A N    5  
ATOM   10721 C  CA   . PHE A 1 3   ? -16.268 -24.842 0.659   1.00 12.22 ? 98  PHE A CA   5  
ATOM   10722 C  C    . PHE A 1 3   ? -16.930 -23.574 0.082   1.00 12.12 ? 98  PHE A C    5  
ATOM   10723 O  O    . PHE A 1 3   ? -17.240 -23.509 -1.109  1.00 13.19 ? 98  PHE A O    5  
ATOM   10724 C  CB   . PHE A 1 3   ? -14.761 -24.640 0.900   1.00 12.45 ? 98  PHE A CB   5  
ATOM   10725 C  CG   . PHE A 1 3   ? -14.394 -23.686 2.023   1.00 11.81 ? 98  PHE A CG   5  
ATOM   10726 C  CD1  . PHE A 1 3   ? -14.740 -24.000 3.351   1.00 11.44 ? 98  PHE A CD1  5  
ATOM   10727 C  CD2  . PHE A 1 3   ? -13.664 -22.512 1.754   1.00 12.15 ? 98  PHE A CD2  5  
ATOM   10728 C  CE1  . PHE A 1 3   ? -14.361 -23.146 4.403   1.00 11.29 ? 98  PHE A CE1  5  
ATOM   10729 C  CE2  . PHE A 1 3   ? -13.271 -21.667 2.807   1.00 11.97 ? 98  PHE A CE2  5  
ATOM   10730 C  CZ   . PHE A 1 3   ? -13.620 -21.982 4.132   1.00 11.58 ? 98  PHE A CZ   5  
ATOM   10731 H  H    . PHE A 1 3   ? -16.556 -25.809 -1.213  1.00 14.30 ? 98  PHE A H    5  
ATOM   10732 H  HA   . PHE A 1 3   ? -16.746 -25.060 1.615   1.00 11.61 ? 98  PHE A HA   5  
ATOM   10733 H  HB2  . PHE A 1 3   ? -14.309 -25.602 1.146   1.00 13.09 ? 98  PHE A HB2  5  
ATOM   10734 H  HB3  . PHE A 1 3   ? -14.303 -24.298 -0.030  1.00 12.99 ? 98  PHE A HB3  5  
ATOM   10735 H  HD1  . PHE A 1 3   ? -15.280 -24.910 3.570   1.00 11.70 ? 98  PHE A HD1  5  
ATOM   10736 H  HD2  . PHE A 1 3   ? -13.384 -22.265 0.741   1.00 12.60 ? 98  PHE A HD2  5  
ATOM   10737 H  HE1  . PHE A 1 3   ? -14.621 -23.393 5.422   1.00 11.55 ? 98  PHE A HE1  5  
ATOM   10738 H  HE2  . PHE A 1 3   ? -12.687 -20.782 2.601   1.00 12.34 ? 98  PHE A HE2  5  
ATOM   10739 H  HZ   . PHE A 1 3   ? -13.308 -21.336 4.941   1.00 11.83 ? 98  PHE A HZ   5  
ATOM   10740 N  N    . THR A 1 4   ? -17.137 -22.559 0.933   1.00 10.99 ? 99  THR A N    5  
ATOM   10741 C  CA   . THR A 1 4   ? -17.788 -21.267 0.636   1.00 10.94 ? 99  THR A CA   5  
ATOM   10742 C  C    . THR A 1 4   ? -17.499 -20.285 1.781   1.00 9.58  ? 99  THR A C    5  
ATOM   10743 O  O    . THR A 1 4   ? -16.666 -20.578 2.636   1.00 9.23  ? 99  THR A O    5  
ATOM   10744 C  CB   . THR A 1 4   ? -19.289 -21.459 0.319   1.00 11.84 ? 99  THR A CB   5  
ATOM   10745 O  OG1  . THR A 1 4   ? -19.790 -20.271 -0.255  1.00 12.19 ? 99  THR A OG1  5  
ATOM   10746 C  CG2  . THR A 1 4   ? -20.141 -21.826 1.536   1.00 11.71 ? 99  THR A CG2  5  
ATOM   10747 H  H    . THR A 1 4   ? -16.765 -22.656 1.869   1.00 10.43 ? 99  THR A H    5  
ATOM   10748 H  HA   . THR A 1 4   ? -17.317 -20.850 -0.254  1.00 11.70 ? 99  THR A HA   5  
ATOM   10749 H  HB   . THR A 1 4   ? -19.395 -22.256 -0.420  1.00 12.82 ? 99  THR A HB   5  
ATOM   10750 H  HG1  . THR A 1 4   ? -20.763 -20.259 -0.178  1.00 12.39 ? 99  THR A HG1  5  
ATOM   10751 H  HG21 . THR A 1 4   ? -21.167 -22.013 1.218   1.00 12.50 ? 99  THR A HG21 5  
ATOM   10752 H  HG22 . THR A 1 4   ? -19.752 -22.731 2.001   1.00 11.69 ? 99  THR A HG22 5  
ATOM   10753 H  HG23 . THR A 1 4   ? -20.141 -21.018 2.268   1.00 11.29 ? 99  THR A HG23 5  
ATOM   10754 N  N    . GLY A 1 5   ? -18.144 -19.116 1.810   1.00 9.14  ? 100 GLY A N    5  
ATOM   10755 C  CA   . GLY A 1 5   ? -18.073 -18.172 2.935   1.00 8.06  ? 100 GLY A CA   5  
ATOM   10756 C  C    . GLY A 1 5   ? -16.660 -17.625 3.161   1.00 7.38  ? 100 GLY A C    5  
ATOM   10757 O  O    . GLY A 1 5   ? -16.037 -17.142 2.219   1.00 8.21  ? 100 GLY A O    5  
ATOM   10758 H  H    . GLY A 1 5   ? -18.801 -18.934 1.064   1.00 9.83  ? 100 GLY A H    5  
ATOM   10759 H  HA2  . GLY A 1 5   ? -18.740 -17.330 2.751   1.00 8.16  ? 100 GLY A HA2  5  
ATOM   10760 H  HA3  . GLY A 1 5   ? -18.395 -18.685 3.839   1.00 8.08  ? 100 GLY A HA3  5  
ATOM   10761 N  N    . GLN A 1 6   ? -16.184 -17.680 4.411   1.00 6.48  ? 101 GLN A N    5  
ATOM   10762 C  CA   . GLN A 1 6   ? -14.844 -17.295 4.906   1.00 5.97  ? 101 GLN A CA   5  
ATOM   10763 C  C    . GLN A 1 6   ? -14.661 -15.776 5.074   1.00 5.03  ? 101 GLN A C    5  
ATOM   10764 O  O    . GLN A 1 6   ? -13.993 -15.357 6.022   1.00 4.92  ? 101 GLN A O    5  
ATOM   10765 C  CB   . GLN A 1 6   ? -13.720 -17.914 4.044   1.00 6.68  ? 101 GLN A CB   5  
ATOM   10766 C  CG   . GLN A 1 6   ? -12.292 -17.708 4.581   1.00 6.67  ? 101 GLN A CG   5  
ATOM   10767 C  CD   . GLN A 1 6   ? -12.051 -18.299 5.966   1.00 6.71  ? 101 GLN A CD   5  
ATOM   10768 O  OE1  . GLN A 1 6   ? -11.604 -19.425 6.121   1.00 7.43  ? 101 GLN A OE1  5  
ATOM   10769 N  NE2  . GLN A 1 6   ? -12.368 -17.577 7.019   1.00 6.47  ? 101 GLN A NE2  5  
ATOM   10770 H  H    . GLN A 1 6   ? -16.799 -18.097 5.093   1.00 6.67  ? 101 GLN A H    5  
ATOM   10771 H  HA   . GLN A 1 6   ? -14.749 -17.712 5.909   1.00 6.24  ? 101 GLN A HA   5  
ATOM   10772 H  HB2  . GLN A 1 6   ? -13.900 -18.984 3.948   1.00 7.51  ? 101 GLN A HB2  5  
ATOM   10773 H  HB3  . GLN A 1 6   ? -13.739 -17.470 3.051   1.00 6.89  ? 101 GLN A HB3  5  
ATOM   10774 H  HG2  . GLN A 1 6   ? -11.594 -18.174 3.887   1.00 7.39  ? 101 GLN A HG2  5  
ATOM   10775 H  HG3  . GLN A 1 6   ? -12.072 -16.644 4.610   1.00 6.42  ? 101 GLN A HG3  5  
ATOM   10776 H  HE21 . GLN A 1 6   ? -12.750 -16.645 6.889   1.00 6.28  ? 101 GLN A HE21 5  
ATOM   10777 H  HE22 . GLN A 1 6   ? -12.156 -17.965 7.921   1.00 6.86  ? 101 GLN A HE22 5  
ATOM   10778 N  N    . GLY A 1 7   ? -15.270 -14.966 4.200   1.00 4.82  ? 102 GLY A N    5  
ATOM   10779 C  CA   . GLY A 1 7   ? -15.237 -13.502 4.256   1.00 4.27  ? 102 GLY A CA   5  
ATOM   10780 C  C    . GLY A 1 7   ? -14.055 -12.948 3.470   1.00 3.55  ? 102 GLY A C    5  
ATOM   10781 O  O    . GLY A 1 7   ? -14.146 -12.778 2.258   1.00 4.73  ? 102 GLY A O    5  
ATOM   10782 H  H    . GLY A 1 7   ? -15.716 -15.388 3.394   1.00 5.43  ? 102 GLY A H    5  
ATOM   10783 H  HA2  . GLY A 1 7   ? -16.143 -13.096 3.809   1.00 4.64  ? 102 GLY A HA2  5  
ATOM   10784 H  HA3  . GLY A 1 7   ? -15.160 -13.167 5.291   1.00 4.45  ? 102 GLY A HA3  5  
ATOM   10785 N  N    . ASP A 1 8   ? -12.966 -12.659 4.181   1.00 2.30  ? 103 ASP A N    5  
ATOM   10786 C  CA   . ASP A 1 8   ? -11.704 -12.139 3.645   1.00 1.84  ? 103 ASP A CA   5  
ATOM   10787 C  C    . ASP A 1 8   ? -11.893 -10.812 2.866   1.00 1.75  ? 103 ASP A C    5  
ATOM   10788 O  O    . ASP A 1 8   ? -12.423 -9.846  3.415   1.00 2.62  ? 103 ASP A O    5  
ATOM   10789 C  CB   . ASP A 1 8   ? -10.948 -13.253 2.872   1.00 2.28  ? 103 ASP A CB   5  
ATOM   10790 C  CG   . ASP A 1 8   ? -10.459 -14.407 3.755   1.00 3.10  ? 103 ASP A CG   5  
ATOM   10791 O  OD1  . ASP A 1 8   ? -10.242 -14.199 4.973   1.00 3.71  ? 103 ASP A OD1  5  
ATOM   10792 O  OD2  . ASP A 1 8   ? -10.235 -15.517 3.220   1.00 4.03  ? 103 ASP A OD2  5  
ATOM   10793 H  H    . ASP A 1 8   ? -12.994 -12.883 5.163   1.00 2.62  ? 103 ASP A H    5  
ATOM   10794 H  HA   . ASP A 1 8   ? -11.089 -11.876 4.502   1.00 2.05  ? 103 ASP A HA   5  
ATOM   10795 H  HB2  . ASP A 1 8   ? -11.586 -13.648 2.081   1.00 2.72  ? 103 ASP A HB2  5  
ATOM   10796 H  HB3  . ASP A 1 8   ? -10.067 -12.823 2.395   1.00 2.98  ? 103 ASP A HB3  5  
ATOM   10797 N  N    . PHE A 1 9   ? -11.413 -10.762 1.620   1.00 1.35  ? 104 PHE A N    5  
ATOM   10798 C  CA   . PHE A 1 9   ? -11.631 -9.740  0.592   1.00 1.22  ? 104 PHE A CA   5  
ATOM   10799 C  C    . PHE A 1 9   ? -11.356 -10.374 -0.783  1.00 1.70  ? 104 PHE A C    5  
ATOM   10800 O  O    . PHE A 1 9   ? -10.909 -11.517 -0.867  1.00 2.13  ? 104 PHE A O    5  
ATOM   10801 C  CB   . PHE A 1 9   ? -10.787 -8.476  0.868   1.00 1.41  ? 104 PHE A CB   5  
ATOM   10802 C  CG   . PHE A 1 9   ? -9.268  -8.609  0.930   1.00 1.47  ? 104 PHE A CG   5  
ATOM   10803 C  CD1  . PHE A 1 9   ? -8.514  -8.916  -0.223  1.00 2.60  ? 104 PHE A CD1  5  
ATOM   10804 C  CD2  . PHE A 1 9   ? -8.589  -8.292  2.123   1.00 2.34  ? 104 PHE A CD2  5  
ATOM   10805 C  CE1  . PHE A 1 9   ? -7.109  -8.900  -0.186  1.00 2.87  ? 104 PHE A CE1  5  
ATOM   10806 C  CE2  . PHE A 1 9   ? -7.181  -8.269  2.160   1.00 2.43  ? 104 PHE A CE2  5  
ATOM   10807 C  CZ   . PHE A 1 9   ? -6.440  -8.569  1.004   1.00 1.98  ? 104 PHE A CZ   5  
ATOM   10808 H  H    . PHE A 1 9   ? -11.011 -11.622 1.270   1.00 1.69  ? 104 PHE A H    5  
ATOM   10809 H  HA   . PHE A 1 9   ? -12.683 -9.435  0.600   1.00 1.35  ? 104 PHE A HA   5  
ATOM   10810 H  HB2  . PHE A 1 9   ? -11.020 -7.735  0.104   1.00 1.37  ? 104 PHE A HB2  5  
ATOM   10811 H  HB3  . PHE A 1 9   ? -11.135 -8.051  1.811   1.00 1.74  ? 104 PHE A HB3  5  
ATOM   10812 H  HD1  . PHE A 1 9   ? -9.005  -9.125  -1.160  1.00 3.55  ? 104 PHE A HD1  5  
ATOM   10813 H  HD2  . PHE A 1 9   ? -9.149  -8.029  3.009   1.00 3.52  ? 104 PHE A HD2  5  
ATOM   10814 H  HE1  . PHE A 1 9   ? -6.548  -9.105  -1.085  1.00 4.29  ? 104 PHE A HE1  5  
ATOM   10815 H  HE2  . PHE A 1 9   ? -6.672  -7.993  3.072   1.00 3.41  ? 104 PHE A HE2  5  
ATOM   10816 H  HZ   . PHE A 1 9   ? -5.359  -8.527  1.026   1.00 2.29  ? 104 PHE A HZ   5  
ATOM   10817 N  N    . HIS A 1 10  ? -11.548 -9.627  -1.873  1.00 1.04  ? 105 HIS A N    5  
ATOM   10818 C  CA   . HIS A 1 10  ? -11.134 -10.056 -3.217  1.00 1.06  ? 105 HIS A CA   5  
ATOM   10819 C  C    . HIS A 1 10  ? -10.776 -8.856  -4.110  1.00 1.12  ? 105 HIS A C    5  
ATOM   10820 O  O    . HIS A 1 10  ? -11.635 -8.021  -4.404  1.00 1.54  ? 105 HIS A O    5  
ATOM   10821 C  CB   . HIS A 1 10  ? -12.238 -10.936 -3.829  1.00 1.29  ? 105 HIS A CB   5  
ATOM   10822 C  CG   . HIS A 1 10  ? -12.035 -11.220 -5.292  1.00 2.25  ? 105 HIS A CG   5  
ATOM   10823 N  ND1  . HIS A 1 10  ? -12.789 -10.664 -6.327  1.00 3.64  ? 105 HIS A ND1  5  
ATOM   10824 C  CD2  . HIS A 1 10  ? -11.066 -12.019 -5.823  1.00 2.73  ? 105 HIS A CD2  5  
ATOM   10825 C  CE1  . HIS A 1 10  ? -12.262 -11.159 -7.458  1.00 4.80  ? 105 HIS A CE1  5  
ATOM   10826 N  NE2  . HIS A 1 10  ? -11.227 -11.976 -7.188  1.00 4.32  ? 105 HIS A NE2  5  
ATOM   10827 H  H    . HIS A 1 10  ? -11.912 -8.693  -1.763  1.00 1.31  ? 105 HIS A H    5  
ATOM   10828 H  HA   . HIS A 1 10  ? -10.238 -10.673 -3.132  1.00 1.04  ? 105 HIS A HA   5  
ATOM   10829 H  HB2  . HIS A 1 10  ? -12.278 -11.884 -3.292  1.00 1.53  ? 105 HIS A HB2  5  
ATOM   10830 H  HB3  . HIS A 1 10  ? -13.203 -10.448 -3.709  1.00 2.19  ? 105 HIS A HB3  5  
ATOM   10831 H  HD2  . HIS A 1 10  ? -10.322 -12.578 -5.274  1.00 2.30  ? 105 HIS A HD2  5  
ATOM   10832 H  HE1  . HIS A 1 10  ? -12.620 -10.931 -8.453  1.00 6.09  ? 105 HIS A HE1  5  
ATOM   10833 H  HE2  . HIS A 1 10  ? -10.667 -12.468 -7.873  1.00 5.15  ? 105 HIS A HE2  5  
ATOM   10834 N  N    . LEU A 1 11  ? -9.503  -8.781  -4.511  1.00 0.86  ? 106 LEU A N    5  
ATOM   10835 C  CA   . LEU A 1 11  ? -8.956  -7.831  -5.488  1.00 0.83  ? 106 LEU A CA   5  
ATOM   10836 C  C    . LEU A 1 11  ? -8.104  -8.614  -6.509  1.00 0.84  ? 106 LEU A C    5  
ATOM   10837 O  O    . LEU A 1 11  ? -7.615  -9.700  -6.198  1.00 0.91  ? 106 LEU A O    5  
ATOM   10838 C  CB   . LEU A 1 11  ? -8.087  -6.757  -4.790  1.00 0.77  ? 106 LEU A CB   5  
ATOM   10839 C  CG   . LEU A 1 11  ? -8.740  -5.668  -3.907  1.00 1.20  ? 106 LEU A CG   5  
ATOM   10840 C  CD1  . LEU A 1 11  ? -9.892  -4.924  -4.596  1.00 2.12  ? 106 LEU A CD1  5  
ATOM   10841 C  CD2  . LEU A 1 11  ? -9.175  -6.174  -2.522  1.00 2.46  ? 106 LEU A CD2  5  
ATOM   10842 H  H    . LEU A 1 11  ? -8.872  -9.515  -4.207  1.00 0.83  ? 106 LEU A H    5  
ATOM   10843 H  HA   . LEU A 1 11  ? -9.762  -7.344  -6.040  1.00 0.96  ? 106 LEU A HA   5  
ATOM   10844 H  HB2  . LEU A 1 11  ? -7.323  -7.263  -4.197  1.00 0.91  ? 106 LEU A HB2  5  
ATOM   10845 H  HB3  . LEU A 1 11  ? -7.564  -6.220  -5.584  1.00 0.95  ? 106 LEU A HB3  5  
ATOM   10846 H  HG   . LEU A 1 11  ? -7.960  -4.927  -3.719  1.00 2.37  ? 106 LEU A HG   5  
ATOM   10847 H  HD11 . LEU A 1 11  ? -10.263 -4.134  -3.943  1.00 2.81  ? 106 LEU A HD11 5  
ATOM   10848 H  HD12 . LEU A 1 11  ? -9.534  -4.466  -5.516  1.00 2.94  ? 106 LEU A HD12 5  
ATOM   10849 H  HD13 . LEU A 1 11  ? -10.710 -5.604  -4.824  1.00 2.90  ? 106 LEU A HD13 5  
ATOM   10850 H  HD21 . LEU A 1 11  ? -8.356  -6.722  -2.058  1.00 3.44  ? 106 LEU A HD21 5  
ATOM   10851 H  HD22 . LEU A 1 11  ? -9.425  -5.323  -1.888  1.00 3.35  ? 106 LEU A HD22 5  
ATOM   10852 H  HD23 . LEU A 1 11  ? -10.050 -6.814  -2.595  1.00 3.08  ? 106 LEU A HD23 5  
ATOM   10853 N  N    . LEU A 1 12  ? -7.923  -8.064  -7.710  1.00 0.92  ? 107 LEU A N    5  
ATOM   10854 C  CA   . LEU A 1 12  ? -7.091  -8.609  -8.788  1.00 1.06  ? 107 LEU A CA   5  
ATOM   10855 C  C    . LEU A 1 12  ? -5.703  -7.964  -8.801  1.00 0.85  ? 107 LEU A C    5  
ATOM   10856 O  O    . LEU A 1 12  ? -5.570  -6.762  -8.576  1.00 0.72  ? 107 LEU A O    5  
ATOM   10857 C  CB   . LEU A 1 12  ? -7.784  -8.409  -10.152 1.00 1.37  ? 107 LEU A CB   5  
ATOM   10858 C  CG   . LEU A 1 12  ? -8.731  -9.554  -10.560 1.00 1.42  ? 107 LEU A CG   5  
ATOM   10859 C  CD1  . LEU A 1 12  ? -9.897  -9.759  -9.582  1.00 2.72  ? 107 LEU A CD1  5  
ATOM   10860 C  CD2  . LEU A 1 12  ? -9.285  -9.277  -11.963 1.00 2.34  ? 107 LEU A CD2  5  
ATOM   10861 H  H    . LEU A 1 12  ? -8.317  -7.144  -7.862  1.00 0.95  ? 107 LEU A H    5  
ATOM   10862 H  HA   . LEU A 1 12  ? -6.949  -9.677  -8.633  1.00 1.25  ? 107 LEU A HA   5  
ATOM   10863 H  HB2  . LEU A 1 12  ? -8.316  -7.456  -10.159 1.00 2.18  ? 107 LEU A HB2  5  
ATOM   10864 H  HB3  . LEU A 1 12  ? -7.007  -8.349  -10.920 1.00 1.80  ? 107 LEU A HB3  5  
ATOM   10865 H  HG   . LEU A 1 12  ? -8.157  -10.480 -10.603 1.00 2.08  ? 107 LEU A HG   5  
ATOM   10866 H  HD11 . LEU A 1 12  ? -10.572 -10.523 -9.971  1.00 3.39  ? 107 LEU A HD11 5  
ATOM   10867 H  HD12 . LEU A 1 12  ? -9.519  -10.098 -8.618  1.00 3.49  ? 107 LEU A HD12 5  
ATOM   10868 H  HD13 . LEU A 1 12  ? -10.447 -8.827  -9.449  1.00 3.54  ? 107 LEU A HD13 5  
ATOM   10869 H  HD21 . LEU A 1 12  ? -9.871  -8.357  -11.962 1.00 3.17  ? 107 LEU A HD21 5  
ATOM   10870 H  HD22 . LEU A 1 12  ? -8.461  -9.176  -12.671 1.00 2.89  ? 107 LEU A HD22 5  
ATOM   10871 H  HD23 . LEU A 1 12  ? -9.917  -10.107 -12.282 1.00 3.06  ? 107 LEU A HD23 5  
ATOM   10872 N  N    . ASP A 1 13  ? -4.698  -8.777  -9.123  1.00 0.99  ? 108 ASP A N    5  
ATOM   10873 C  CA   . ASP A 1 13  ? -3.287  -8.427  -9.298  1.00 1.01  ? 108 ASP A CA   5  
ATOM   10874 C  C    . ASP A 1 13  ? -3.051  -7.786  -10.677 1.00 0.97  ? 108 ASP A C    5  
ATOM   10875 O  O    . ASP A 1 13  ? -3.663  -8.173  -11.677 1.00 1.14  ? 108 ASP A O    5  
ATOM   10876 C  CB   . ASP A 1 13  ? -2.414  -9.703  -9.226  1.00 1.52  ? 108 ASP A CB   5  
ATOM   10877 C  CG   . ASP A 1 13  ? -2.345  -10.473 -7.892  1.00 1.76  ? 108 ASP A CG   5  
ATOM   10878 O  OD1  . ASP A 1 13  ? -3.355  -10.593 -7.171  1.00 3.09  ? 108 ASP A OD1  5  
ATOM   10879 O  OD2  . ASP A 1 13  ? -1.261  -11.055 -7.638  1.00 2.04  ? 108 ASP A OD2  5  
ATOM   10880 H  H    . ASP A 1 13  ? -4.950  -9.735  -9.332  1.00 1.23  ? 108 ASP A H    5  
ATOM   10881 H  HA   . ASP A 1 13  ? -2.970  -7.721  -8.529  1.00 0.93  ? 108 ASP A HA   5  
ATOM   10882 H  HB2  . ASP A 1 13  ? -2.755  -10.394 -9.998  1.00 2.76  ? 108 ASP A HB2  5  
ATOM   10883 H  HB3  . ASP A 1 13  ? -1.394  -9.419  -9.492  1.00 1.93  ? 108 ASP A HB3  5  
ATOM   10884 N  N    . HIS A 1 14  ? -2.051  -6.904  -10.769 1.00 0.94  ? 109 HIS A N    5  
ATOM   10885 C  CA   . HIS A 1 14  ? -1.600  -6.204  -11.983 1.00 1.01  ? 109 HIS A CA   5  
ATOM   10886 C  C    . HIS A 1 14  ? -1.013  -7.094  -13.121 1.00 1.19  ? 109 HIS A C    5  
ATOM   10887 O  O    . HIS A 1 14  ? -0.292  -6.608  -13.994 1.00 1.33  ? 109 HIS A O    5  
ATOM   10888 C  CB   . HIS A 1 14  ? -0.652  -5.074  -11.541 1.00 1.09  ? 109 HIS A CB   5  
ATOM   10889 C  CG   . HIS A 1 14  ? 0.625   -5.542  -10.890 1.00 1.00  ? 109 HIS A CG   5  
ATOM   10890 N  ND1  . HIS A 1 14  ? 0.845   -5.677  -9.516  1.00 1.37  ? 109 HIS A ND1  5  
ATOM   10891 C  CD2  . HIS A 1 14  ? 1.766   -5.874  -11.554 1.00 1.17  ? 109 HIS A CD2  5  
ATOM   10892 C  CE1  . HIS A 1 14  ? 2.121   -6.073  -9.392  1.00 1.15  ? 109 HIS A CE1  5  
ATOM   10893 N  NE2  . HIS A 1 14  ? 2.702   -6.197  -10.599 1.00 1.14  ? 109 HIS A NE2  5  
ATOM   10894 H  H    . HIS A 1 14  ? -1.652  -6.575  -9.894  1.00 0.98  ? 109 HIS A H    5  
ATOM   10895 H  HA   . HIS A 1 14  ? -2.483  -5.726  -12.412 1.00 1.12  ? 109 HIS A HA   5  
ATOM   10896 H  HB2  . HIS A 1 14  ? -0.395  -4.468  -12.410 1.00 1.32  ? 109 HIS A HB2  5  
ATOM   10897 H  HB3  . HIS A 1 14  ? -1.179  -4.426  -10.841 1.00 1.25  ? 109 HIS A HB3  5  
ATOM   10898 H  HD2  . HIS A 1 14  ? 1.894   -5.865  -12.625 1.00 1.66  ? 109 HIS A HD2  5  
ATOM   10899 H  HE1  . HIS A 1 14  ? 2.626   -6.249  -8.451  1.00 1.41  ? 109 HIS A HE1  5  
ATOM   10900 H  HE2  . HIS A 1 14  ? 3.668   -6.448  -10.760 1.00 1.48  ? 109 HIS A HE2  5  
ATOM   10901 N  N    . ARG A 1 15  ? -1.321  -8.400  -13.127 1.00 1.58  ? 110 ARG A N    5  
ATOM   10902 C  CA   . ARG A 1 15  ? -1.171  -9.329  -14.262 1.00 2.01  ? 110 ARG A CA   5  
ATOM   10903 C  C    . ARG A 1 15  ? -2.174  -10.505 -14.178 1.00 1.83  ? 110 ARG A C    5  
ATOM   10904 O  O    . ARG A 1 15  ? -1.819  -11.669 -14.378 1.00 2.07  ? 110 ARG A O    5  
ATOM   10905 C  CB   . ARG A 1 15  ? 0.302   -9.766  -14.464 1.00 2.69  ? 110 ARG A CB   5  
ATOM   10906 C  CG   . ARG A 1 15  ? 0.541   -10.263 -15.907 1.00 3.60  ? 110 ARG A CG   5  
ATOM   10907 C  CD   . ARG A 1 15  ? 1.957   -10.804 -16.172 1.00 3.87  ? 110 ARG A CD   5  
ATOM   10908 N  NE   . ARG A 1 15  ? 2.934   -9.730  -16.437 1.00 4.33  ? 110 ARG A NE   5  
ATOM   10909 C  CZ   . ARG A 1 15  ? 4.074   -9.872  -17.111 1.00 5.06  ? 110 ARG A CZ   5  
ATOM   10910 N  NH1  . ARG A 1 15  ? 4.484   -11.042 -17.547 1.00 5.48  ? 110 ARG A NH1  5  
ATOM   10911 N  NH2  . ARG A 1 15  ? 4.827   -8.821  -17.366 1.00 6.11  ? 110 ARG A NH2  5  
ATOM   10912 H  H    . ARG A 1 15  ? -1.919  -8.688  -12.362 1.00 1.83  ? 110 ARG A H    5  
ATOM   10913 H  HA   . ARG A 1 15  ? -1.458  -8.760  -15.151 1.00 2.48  ? 110 ARG A HA   5  
ATOM   10914 H  HB2  . ARG A 1 15  ? 0.965   -8.921  -14.283 1.00 3.27  ? 110 ARG A HB2  5  
ATOM   10915 H  HB3  . ARG A 1 15  ? 0.551   -10.555 -13.752 1.00 2.79  ? 110 ARG A HB3  5  
ATOM   10916 H  HG2  . ARG A 1 15  ? -0.155  -11.071 -16.128 1.00 4.05  ? 110 ARG A HG2  5  
ATOM   10917 H  HG3  . ARG A 1 15  ? 0.332   -9.452  -16.607 1.00 4.52  ? 110 ARG A HG3  5  
ATOM   10918 H  HD2  . ARG A 1 15  ? 2.282   -11.416 -15.329 1.00 4.03  ? 110 ARG A HD2  5  
ATOM   10919 H  HD3  . ARG A 1 15  ? 1.895   -11.450 -17.051 1.00 4.68  ? 110 ARG A HD3  5  
ATOM   10920 H  HE   . ARG A 1 15  ? 2.674   -8.801  -16.147 1.00 4.78  ? 110 ARG A HE   5  
ATOM   10921 H  HH11 . ARG A 1 15  ? 3.959   -11.891 -17.348 1.00 5.45  ? 110 ARG A HH11 5  
ATOM   10922 H  HH12 . ARG A 1 15  ? 5.310   -11.146 -18.126 1.00 6.30  ? 110 ARG A HH12 5  
ATOM   10923 H  HH21 . ARG A 1 15  ? 4.559   -7.904  -17.059 1.00 6.58  ? 110 ARG A HH21 5  
ATOM   10924 H  HH22 . ARG A 1 15  ? 5.704   -8.935  -17.874 1.00 6.79  ? 110 ARG A HH22 5  
ATOM   10925 N  N    . GLY A 1 16  ? -3.437  -10.226 -13.829 1.00 1.86  ? 111 GLY A N    5  
ATOM   10926 C  CA   . GLY A 1 16  ? -4.579  -11.138 -14.038 1.00 2.28  ? 111 GLY A CA   5  
ATOM   10927 C  C    . GLY A 1 16  ? -4.760  -12.266 -13.014 1.00 2.00  ? 111 GLY A C    5  
ATOM   10928 O  O    . GLY A 1 16  ? -5.677  -13.071 -13.183 1.00 2.46  ? 111 GLY A O    5  
ATOM   10929 H  H    . GLY A 1 16  ? -3.653  -9.277  -13.544 1.00 1.95  ? 111 GLY A H    5  
ATOM   10930 H  HA2  . GLY A 1 16  ? -5.496  -10.549 -14.021 1.00 2.77  ? 111 GLY A HA2  5  
ATOM   10931 H  HA3  . GLY A 1 16  ? -4.479  -11.612 -15.016 1.00 2.71  ? 111 GLY A HA3  5  
ATOM   10932 N  N    . ARG A 1 17  ? -3.920  -12.326 -11.972 1.00 1.54  ? 112 ARG A N    5  
ATOM   10933 C  CA   . ARG A 1 17  ? -4.135  -13.157 -10.772 1.00 1.41  ? 112 ARG A CA   5  
ATOM   10934 C  C    . ARG A 1 17  ? -5.041  -12.409 -9.766  1.00 1.32  ? 112 ARG A C    5  
ATOM   10935 O  O    . ARG A 1 17  ? -5.514  -11.316 -10.079 1.00 1.87  ? 112 ARG A O    5  
ATOM   10936 C  CB   . ARG A 1 17  ? -2.776  -13.588 -10.172 1.00 1.57  ? 112 ARG A CB   5  
ATOM   10937 C  CG   . ARG A 1 17  ? -1.986  -14.536 -11.102 1.00 2.39  ? 112 ARG A CG   5  
ATOM   10938 C  CD   . ARG A 1 17  ? -0.749  -13.906 -11.763 1.00 3.68  ? 112 ARG A CD   5  
ATOM   10939 N  NE   . ARG A 1 17  ? 0.369   -13.755 -10.810 1.00 4.13  ? 112 ARG A NE   5  
ATOM   10940 C  CZ   . ARG A 1 17  ? 1.485   -14.477 -10.743 1.00 4.69  ? 112 ARG A CZ   5  
ATOM   10941 N  NH1  . ARG A 1 17  ? 1.840   -15.390 -11.621 1.00 4.95  ? 112 ARG A NH1  5  
ATOM   10942 N  NH2  . ARG A 1 17  ? 2.307   -14.270 -9.743  1.00 5.82  ? 112 ARG A NH2  5  
ATOM   10943 H  H    . ARG A 1 17  ? -3.244  -11.583 -11.899 1.00 1.52  ? 112 ARG A H    5  
ATOM   10944 H  HA   . ARG A 1 17  ? -4.666  -14.066 -11.055 1.00 1.53  ? 112 ARG A HA   5  
ATOM   10945 H  HB2  . ARG A 1 17  ? -2.178  -12.709 -9.929  1.00 1.89  ? 112 ARG A HB2  5  
ATOM   10946 H  HB3  . ARG A 1 17  ? -2.961  -14.126 -9.242  1.00 1.89  ? 112 ARG A HB3  5  
ATOM   10947 H  HG2  . ARG A 1 17  ? -1.662  -15.405 -10.526 1.00 2.70  ? 112 ARG A HG2  5  
ATOM   10948 H  HG3  . ARG A 1 17  ? -2.644  -14.905 -11.889 1.00 2.92  ? 112 ARG A HG3  5  
ATOM   10949 H  HD2  . ARG A 1 17  ? -0.447  -14.545 -12.592 1.00 4.06  ? 112 ARG A HD2  5  
ATOM   10950 H  HD3  . ARG A 1 17  ? -1.015  -12.933 -12.177 1.00 4.97  ? 112 ARG A HD3  5  
ATOM   10951 H  HE   . ARG A 1 17  ? 0.263   -13.061 -10.078 1.00 4.73  ? 112 ARG A HE   5  
ATOM   10952 H  HH11 . ARG A 1 17  ? 1.347   -15.500 -12.504 1.00 5.20  ? 112 ARG A HH11 5  
ATOM   10953 H  HH12 . ARG A 1 17  ? 2.693   -15.906 -11.465 1.00 5.57  ? 112 ARG A HH12 5  
ATOM   10954 H  HH21 . ARG A 1 17  ? 2.087   -13.547 -9.069  1.00 6.51  ? 112 ARG A HH21 5  
ATOM   10955 H  HH22 . ARG A 1 17  ? 3.170   -14.808 -9.696  1.00 6.42  ? 112 ARG A HH22 5  
ATOM   10956 N  N    . ALA A 1 18  ? -5.271  -12.949 -8.567  1.00 1.09  ? 113 ALA A N    5  
ATOM   10957 C  CA   . ALA A 1 18  ? -6.083  -12.308 -7.528  1.00 1.13  ? 113 ALA A CA   5  
ATOM   10958 C  C    . ALA A 1 18  ? -5.607  -12.657 -6.110  1.00 1.04  ? 113 ALA A C    5  
ATOM   10959 O  O    . ALA A 1 18  ? -4.943  -13.675 -5.906  1.00 1.23  ? 113 ALA A O    5  
ATOM   10960 C  CB   . ALA A 1 18  ? -7.555  -12.687 -7.752  1.00 1.51  ? 113 ALA A CB   5  
ATOM   10961 H  H    . ALA A 1 18  ? -4.850  -13.834 -8.330  1.00 1.36  ? 113 ALA A H    5  
ATOM   10962 H  HA   . ALA A 1 18  ? -5.977  -11.225 -7.620  1.00 1.14  ? 113 ALA A HA   5  
ATOM   10963 H  HB1  . ALA A 1 18  ? -7.681  -13.766 -7.655  1.00 1.58  ? 113 ALA A HB1  5  
ATOM   10964 H  HB2  . ALA A 1 18  ? -8.184  -12.185 -7.016  1.00 2.38  ? 113 ALA A HB2  5  
ATOM   10965 H  HB3  . ALA A 1 18  ? -7.870  -12.380 -8.751  1.00 2.37  ? 113 ALA A HB3  5  
ATOM   10966 N  N    . ARG A 1 19  ? -5.977  -11.815 -5.136  1.00 0.97  ? 114 ARG A N    5  
ATOM   10967 C  CA   . ARG A 1 19  ? -5.569  -11.892 -3.729  1.00 1.00  ? 114 ARG A CA   5  
ATOM   10968 C  C    . ARG A 1 19  ? -6.771  -11.785 -2.777  1.00 0.94  ? 114 ARG A C    5  
ATOM   10969 O  O    . ARG A 1 19  ? -7.617  -10.899 -2.920  1.00 0.95  ? 114 ARG A O    5  
ATOM   10970 C  CB   . ARG A 1 19  ? -4.542  -10.776 -3.432  1.00 1.18  ? 114 ARG A CB   5  
ATOM   10971 C  CG   . ARG A 1 19  ? -3.169  -11.325 -3.025  1.00 1.36  ? 114 ARG A CG   5  
ATOM   10972 C  CD   . ARG A 1 19  ? -2.396  -11.933 -4.201  1.00 1.69  ? 114 ARG A CD   5  
ATOM   10973 N  NE   . ARG A 1 19  ? -1.188  -12.627 -3.727  1.00 2.24  ? 114 ARG A NE   5  
ATOM   10974 C  CZ   . ARG A 1 19  ? -0.182  -13.060 -4.469  1.00 2.86  ? 114 ARG A CZ   5  
ATOM   10975 N  NH1  . ARG A 1 19  ? -0.093  -12.802 -5.758  1.00 3.57  ? 114 ARG A NH1  5  
ATOM   10976 N  NH2  . ARG A 1 19  ? 0.749   -13.771 -3.879  1.00 3.59  ? 114 ARG A NH2  5  
ATOM   10977 H  H    . ARG A 1 19  ? -6.539  -11.016 -5.414  1.00 1.04  ? 114 ARG A H    5  
ATOM   10978 H  HA   . ARG A 1 19  ? -5.098  -12.862 -3.560  1.00 1.07  ? 114 ARG A HA   5  
ATOM   10979 H  HB2  . ARG A 1 19  ? -4.422  -10.125 -4.300  1.00 1.57  ? 114 ARG A HB2  5  
ATOM   10980 H  HB3  . ARG A 1 19  ? -4.908  -10.153 -2.614  1.00 1.60  ? 114 ARG A HB3  5  
ATOM   10981 H  HG2  . ARG A 1 19  ? -2.579  -10.504 -2.620  1.00 2.12  ? 114 ARG A HG2  5  
ATOM   10982 H  HG3  . ARG A 1 19  ? -3.300  -12.072 -2.241  1.00 2.23  ? 114 ARG A HG3  5  
ATOM   10983 H  HD2  . ARG A 1 19  ? -3.026  -12.650 -4.725  1.00 2.48  ? 114 ARG A HD2  5  
ATOM   10984 H  HD3  . ARG A 1 19  ? -2.128  -11.136 -4.898  1.00 2.38  ? 114 ARG A HD3  5  
ATOM   10985 H  HE   . ARG A 1 19  ? -1.144  -12.891 -2.744  1.00 2.90  ? 114 ARG A HE   5  
ATOM   10986 H  HH11 . ARG A 1 19  ? -0.787  -12.208 -6.212  1.00 3.67  ? 114 ARG A HH11 5  
ATOM   10987 H  HH12 . ARG A 1 19  ? 0.686   -13.137 -6.295  1.00 4.43  ? 114 ARG A HH12 5  
ATOM   10988 H  HH21 . ARG A 1 19  ? 0.631   -13.963 -2.882  1.00 3.95  ? 114 ARG A HH21 5  
ATOM   10989 H  HH22 . ARG A 1 19  ? 1.535   -14.182 -4.366  1.00 4.20  ? 114 ARG A HH22 5  
ATOM   10990 N  N    . CYS A 1 20  ? -6.785  -12.659 -1.760  1.00 1.05  ? 115 CYS A N    5  
ATOM   10991 C  CA   . CYS A 1 20  ? -7.870  -12.826 -0.780  1.00 1.15  ? 115 CYS A CA   5  
ATOM   10992 C  C    . CYS A 1 20  ? -7.358  -12.950 0.671   1.00 1.42  ? 115 CYS A C    5  
ATOM   10993 O  O    . CYS A 1 20  ? -7.538  -13.977 1.316   1.00 2.95  ? 115 CYS A O    5  
ATOM   10994 C  CB   . CYS A 1 20  ? -8.717  -14.046 -1.194  1.00 1.45  ? 115 CYS A CB   5  
ATOM   10995 S  SG   . CYS A 1 20  ? -9.591  -13.714 -2.749  1.00 3.45  ? 115 CYS A SG   5  
ATOM   10996 H  H    . CYS A 1 20  ? -6.068  -13.366 -1.769  1.00 1.23  ? 115 CYS A H    5