data_2RQR
# 
_entry.id   2RQR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2RQR         
RCSB  RCSB150173   
WWPDB D_1000150173 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2RQR 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-21 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yokoyama, S.'                                           1 
'Tochio, N.'                                             2 
'Koshiba, S.'                                            3 
'Kigawa, T.'                                             4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            109 
_citation.page_first                3305 
_citation.page_last                 3310 
_citation.year                      2012 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22331897 
_citation.pdbx_database_id_DOI      10.1073/pnas.1113512109 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hanawa-Suetsugu, K.'   1  ? 
primary 'Kukimoto-Niino, M.'    2  ? 
primary 'Mishima-Tsumagari, C.' 3  ? 
primary 'Akasaka, R.'           4  ? 
primary 'Ohsawa, N.'            5  ? 
primary 'Sekine, S.'            6  ? 
primary 'Ito, T.'               7  ? 
primary 'Tochio, N.'            8  ? 
primary 'Koshiba, S.'           9  ? 
primary 'Kigawa, T.'            10 ? 
primary 'Terada, T.'            11 ? 
primary 'Shirouzu, M.'          12 ? 
primary 'Nishikimi, A.'         13 ? 
primary 'Uruno, T.'             14 ? 
primary 'Katakai, T.'           15 ? 
primary 'Kinashi, T.'           16 ? 
primary 'Kohda, D.'             17 ? 
primary 'Fukui, Y.'             18 ? 
primary 'Yokoyama, S.'          19 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Engulfment and cell motility protein 1,Dedicator of cytokinesis protein 2' 
_entity.formula_weight             12635.978 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein ced-12 homolog' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRLLDLENIQIPDAPPPIPKEPSNYDFSGPSSGIEGRGSSGSSGSSGSSGDKERHGVAIYNFQGSGAPQLSLQI
GDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRLLDLENIQIPDAPPPIPKEPSNYDFSGPSSGIEGRGSSGSSGSSGSSGDKERHGVAIYNFQGSGAPQLSLQI
GDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   LEU n 
1 10  LEU n 
1 11  ASP n 
1 12  LEU n 
1 13  GLU n 
1 14  ASN n 
1 15  ILE n 
1 16  GLN n 
1 17  ILE n 
1 18  PRO n 
1 19  ASP n 
1 20  ALA n 
1 21  PRO n 
1 22  PRO n 
1 23  PRO n 
1 24  ILE n 
1 25  PRO n 
1 26  LYS n 
1 27  GLU n 
1 28  PRO n 
1 29  SER n 
1 30  ASN n 
1 31  TYR n 
1 32  ASP n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  PRO n 
1 37  SER n 
1 38  SER n 
1 39  GLY n 
1 40  ILE n 
1 41  GLU n 
1 42  GLY n 
1 43  ARG n 
1 44  GLY n 
1 45  SER n 
1 46  SER n 
1 47  GLY n 
1 48  SER n 
1 49  SER n 
1 50  GLY n 
1 51  SER n 
1 52  SER n 
1 53  GLY n 
1 54  SER n 
1 55  SER n 
1 56  GLY n 
1 57  ASP n 
1 58  LYS n 
1 59  GLU n 
1 60  ARG n 
1 61  HIS n 
1 62  GLY n 
1 63  VAL n 
1 64  ALA n 
1 65  ILE n 
1 66  TYR n 
1 67  ASN n 
1 68  PHE n 
1 69  GLN n 
1 70  GLY n 
1 71  SER n 
1 72  GLY n 
1 73  ALA n 
1 74  PRO n 
1 75  GLN n 
1 76  LEU n 
1 77  SER n 
1 78  LEU n 
1 79  GLN n 
1 80  ILE n 
1 81  GLY n 
1 82  ASP n 
1 83  VAL n 
1 84  VAL n 
1 85  ARG n 
1 86  ILE n 
1 87  GLN n 
1 88  GLU n 
1 89  THR n 
1 90  CYS n 
1 91  GLY n 
1 92  ASP n 
1 93  TRP n 
1 94  TYR n 
1 95  ARG n 
1 96  GLY n 
1 97  TYR n 
1 98  LEU n 
1 99  ILE n 
1 100 LYS n 
1 101 HIS n 
1 102 LYS n 
1 103 MET n 
1 104 LEU n 
1 105 GLN n 
1 106 GLY n 
1 107 ILE n 
1 108 PHE n 
1 109 PRO n 
1 110 LYS n 
1 111 SER n 
1 112 PHE n 
1 113 ILE n 
1 114 HIS n 
1 115 ILE n 
1 116 LYS n 
1 117 GLU n 
1 118 VAL n 
1 119 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  33  Human ? 'ELMO1, KIAA0281' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Cell-free synthesis' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? P070313-06 ? ? 
1 2 sample 'Biological sequence' 34 119 Human ? 'DOCK2, KIAA0209' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Cell-free synthesis' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? P070313-06 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ELMO1_HUMAN Q92556 ? 1 RLLDLENIQIPDAPPPIPKEPSNYDF                                      697 
2 UNP DOCK2_HUMAN Q92608 ? 1 DKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT 8   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2RQR A 8  ? 33  ? Q92556 697 ? 722 ? 8  33  
2 2 2RQR A 57 ? 119 ? Q92608 8   ? 70  ? 57 119 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2RQR GLY A 1  ? UNP Q92556 ? ? 'expression tag' 1  1  
1 2RQR SER A 2  ? UNP Q92556 ? ? 'expression tag' 2  2  
1 2RQR SER A 3  ? UNP Q92556 ? ? 'expression tag' 3  3  
1 2RQR GLY A 4  ? UNP Q92556 ? ? 'expression tag' 4  4  
1 2RQR SER A 5  ? UNP Q92556 ? ? 'expression tag' 5  5  
1 2RQR SER A 6  ? UNP Q92556 ? ? 'expression tag' 6  6  
1 2RQR GLY A 7  ? UNP Q92556 ? ? 'expression tag' 7  7  
1 2RQR SER A 34 ? UNP Q92556 ? ? linker           34 8  
1 2RQR GLY A 35 ? UNP Q92556 ? ? linker           35 9  
1 2RQR PRO A 36 ? UNP Q92556 ? ? linker           36 10 
1 2RQR SER A 37 ? UNP Q92556 ? ? linker           37 11 
1 2RQR SER A 38 ? UNP Q92556 ? ? linker           38 12 
1 2RQR GLY A 39 ? UNP Q92556 ? ? linker           39 13 
1 2RQR ILE A 40 ? UNP Q92556 ? ? linker           40 14 
1 2RQR GLU A 41 ? UNP Q92556 ? ? linker           41 15 
1 2RQR GLY A 42 ? UNP Q92556 ? ? linker           42 16 
1 2RQR ARG A 43 ? UNP Q92556 ? ? linker           43 17 
1 2RQR GLY A 44 ? UNP Q92556 ? ? linker           44 18 
1 2RQR SER A 45 ? UNP Q92556 ? ? linker           45 19 
1 2RQR SER A 46 ? UNP Q92556 ? ? linker           46 20 
1 2RQR GLY A 47 ? UNP Q92556 ? ? linker           47 21 
1 2RQR SER A 48 ? UNP Q92556 ? ? linker           48 22 
1 2RQR SER A 49 ? UNP Q92556 ? ? linker           49 23 
1 2RQR GLY A 50 ? UNP Q92556 ? ? linker           50 24 
1 2RQR SER A 51 ? UNP Q92556 ? ? linker           51 25 
1 2RQR SER A 52 ? UNP Q92556 ? ? linker           52 26 
1 2RQR GLY A 53 ? UNP Q92556 ? ? linker           53 27 
1 2RQR SER A 54 ? UNP Q92556 ? ? linker           54 28 
1 2RQR SER A 55 ? UNP Q92556 ? ? linker           55 29 
1 2RQR GLY A 56 ? UNP Q92556 ? ? linker           56 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-15N NOESY' 
1 2 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;1mM [U-100% 13C; U-100% 15N] protein, 20mM [U-2H] TRIS-2, 100mM sodium chloride-3, 0.02% sodium azide-4, 1mM [U-2H] DTT-5, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2RQR 
_pdbx_nmr_refine.method             'distance geometry' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2RQR 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2RQR 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                 collection           XwinNMR ? 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer, Bax' processing           NMRPipe ? 2 
'Johnson, One Moon Scientific'                   'data analysis'      NMRView ? 3 
Kobayashi                                        'data analysis'      KUJIRA  ? 4 
'Guntert, Mumenthaler, Wuthrich'                 'structure solution' CYANA   ? 5 
'Guntert, Mumenthaler, Wuthrich'                 refinement           CYANA   ? 6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2RQR 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2RQR 
_struct.title                     'The solution structure of human DOCK2 SH3 domain - ELMO1 peptide chimera complex' 
_struct.pdbx_descriptor           'Engulfment and cell motility protein 1, linker, Dedicator of cytokinesis protein 2' 
_struct.pdbx_model_details        'fewest violations, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RQR 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;KIAA0209, KIAA0281, Apoptosis, Membrane, Phagocytosis, Phosphoprotein, SH3-binding, Cytoskeleton, Guanine-nucleotide releasing factor, SH3 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        111 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ILE 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        113 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         111 
_struct_conf.end_auth_comp_id        ILE 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         113 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 1  0.01  
2  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 2  -0.02 
3  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 3  0.02  
4  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 4  -0.04 
5  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 5  -0.01 
6  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 6  0.08  
7  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 7  -0.01 
8  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 8  0.01  
9  ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 9  0.00  
10 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 10 -0.04 
11 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 11 0.03  
12 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 12 0.01  
13 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 13 0.02  
14 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 14 0.10  
15 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 15 -0.03 
16 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 16 0.03  
17 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 17 -0.01 
18 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 18 0.07  
19 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 19 -0.04 
20 ALA 73 A . ? ALA 73 A PRO 74 A ? PRO 74 A 20 0.08  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 60  ? VAL A 63  ? ARG A 60  VAL A 63  
A 2 VAL A 83  ? CYS A 90  ? VAL A 83  CYS A 90  
A 3 TRP A 93  ? LEU A 98  ? TRP A 93  LEU A 98  
A 4 GLN A 105 ? PRO A 109 ? GLN A 105 PRO A 109 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 60 ? N ARG A 60 O ILE A 86  ? O ILE A 86  
A 2 3 N CYS A 90 ? N CYS A 90 O TRP A 93  ? O TRP A 93  
A 3 4 N TYR A 94 ? N TYR A 94 O PHE A 108 ? O PHE A 108 
# 
_atom_sites.entry_id                    2RQR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 27.508  2.310   -31.523 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 26.451  2.749   -30.632 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 26.683  4.151   -30.104 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 27.784  4.690   -30.217 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 27.282  1.903   -32.386 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 25.513  2.727   -31.165 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 26.395  2.067   -29.795 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 25.643  4.744   -29.527 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 25.736  6.095   -28.985 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 25.100  6.170   -27.601 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 24.007  5.648   -27.379 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 25.058  7.093   -29.926 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 25.635  8.381   -29.804 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 24.791  4.263   -29.467 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 26.783  6.347   -28.902 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 25.170  6.756   -30.945 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 24.007  7.157   -29.681 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 26.590  8.313   -29.874 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 25.792  6.824   -26.673 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 25.297  6.965   -25.309 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 25.596  8.358   -24.764 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 26.654  8.927   -25.030 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 25.928  5.905   -24.403 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 25.266  5.845   -23.151 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 26.657  7.218   -26.912 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 24.227  6.820   -25.327 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 25.857  4.940   -24.880 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 26.967  6.150   -24.237 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 24.338  5.643   -23.289 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 24.654  8.903   -24.000 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 24.834  10.225  -23.429 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 25.508  10.184  -22.072 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 26.257  9.255   -21.771 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 23.830  8.402   -23.822 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 25.437  10.816  -24.102 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 23.866  10.693  -23.323 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 25.243  11.195  -21.251 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 25.834  11.274  -19.920 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 24.950  10.577  -18.891 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 23.815  10.202  -19.184 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 26.048  12.735  -19.520 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 27.095  12.857  -18.573 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 24.638  11.906  -21.549 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 26.791  10.775  -19.953 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 26.302  13.312  -20.395 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 25.138  13.123  -19.085 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 27.763  13.457  -18.909 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 25.480  10.406  -17.684 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 24.742  9.750   -16.611 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 24.701  10.628  -15.364 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 25.364  11.663  -15.298 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 25.378  8.400   -16.277 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 24.905  7.384   -17.145 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 26.390  10.727  -17.512 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 23.732  9.587   -16.955 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 26.450  8.474   -16.380 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 25.132  8.131   -15.260 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 25.630  7.062   -17.686 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 23.917  10.207  -14.376 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 23.804  10.965  -13.144 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 23.088  10.195  -12.052 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 22.303  10.764  -11.294 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 23.412  9.374   -14.485 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 24.794  11.222  -12.799 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 23.256  11.875  -13.344 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? 23.358  8.896   -11.973 1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? 22.732  8.045   -10.968 1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? 23.775  7.194   -10.250 1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? 23.577  5.997   -10.038 1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? 21.681  7.142   -11.617 1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? 20.346  7.832   -11.848 1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? 19.287  6.849   -12.323 1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? 19.063  5.777   -11.357 1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? 19.785  4.663   -11.315 1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? 20.773  4.476   -12.180 1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? 19.521  3.733   -10.406 1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? 23.993  8.499   -12.606 1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? 22.248  8.686   -10.246 1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? 22.055  6.801   -12.570 1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? 21.514  6.288   -10.978 1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? 20.017  8.279   -10.922 1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? 20.474  8.600   -12.597 1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? 18.361  7.383   -12.474 1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? 19.609  6.417   -13.258 1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? 18.338  5.894   -10.709 1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? 20.975  5.175   -12.865 1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? 21.316  3.637   -12.146 1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? 18.777  3.870   -9.753  1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? 20.065  2.895   -10.376 1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . LEU A 1 9   ? 24.886  7.820   -9.877  1.00 0.00 ? 9   LEU A N    1  
ATOM 91    C CA   . LEU A 1 9   ? 25.962  7.120   -9.183  1.00 0.00 ? 9   LEU A CA   1  
ATOM 92    C C    . LEU A 1 9   ? 26.167  7.690   -7.783  1.00 0.00 ? 9   LEU A C    1  
ATOM 93    O O    . LEU A 1 9   ? 26.802  8.731   -7.612  1.00 0.00 ? 9   LEU A O    1  
ATOM 94    C CB   . LEU A 1 9   ? 27.262  7.221   -9.982  1.00 0.00 ? 9   LEU A CB   1  
ATOM 95    C CG   . LEU A 1 9   ? 28.470  6.491   -9.394  1.00 0.00 ? 9   LEU A CG   1  
ATOM 96    C CD1  . LEU A 1 9   ? 28.248  4.987   -9.418  1.00 0.00 ? 9   LEU A CD1  1  
ATOM 97    C CD2  . LEU A 1 9   ? 29.737  6.857   -10.154 1.00 0.00 ? 9   LEU A CD2  1  
ATOM 98    H H    . LEU A 1 9   ? 24.987  8.774   -10.073 1.00 0.00 ? 9   LEU A H    1  
ATOM 99    H HA   . LEU A 1 9   ? 25.681  6.081   -9.098  1.00 0.00 ? 9   LEU A HA   1  
ATOM 100   H HB2  . LEU A 1 9   ? 27.078  6.816   -10.965 1.00 0.00 ? 9   LEU A HB2  1  
ATOM 101   H HB3  . LEU A 1 9   ? 27.516  8.268   -10.068 1.00 0.00 ? 9   LEU A HB3  1  
ATOM 102   H HG   . LEU A 1 9   ? 28.598  6.793   -8.363  1.00 0.00 ? 9   LEU A HG   1  
ATOM 103   H HD11 . LEU A 1 9   ? 28.296  4.632   -10.436 1.00 0.00 ? 9   LEU A HD11 1  
ATOM 104   H HD12 . LEU A 1 9   ? 27.278  4.759   -9.002  1.00 0.00 ? 9   LEU A HD12 1  
ATOM 105   H HD13 . LEU A 1 9   ? 29.013  4.501   -8.830  1.00 0.00 ? 9   LEU A HD13 1  
ATOM 106   H HD21 . LEU A 1 9   ? 30.580  6.832   -9.481  1.00 0.00 ? 9   LEU A HD21 1  
ATOM 107   H HD22 . LEU A 1 9   ? 29.634  7.850   -10.566 1.00 0.00 ? 9   LEU A HD22 1  
ATOM 108   H HD23 . LEU A 1 9   ? 29.893  6.149   -10.955 1.00 0.00 ? 9   LEU A HD23 1  
ATOM 109   N N    . LEU A 1 10  ? 25.627  7.000   -6.784  1.00 0.00 ? 10  LEU A N    1  
ATOM 110   C CA   . LEU A 1 10  ? 25.753  7.436   -5.398  1.00 0.00 ? 10  LEU A CA   1  
ATOM 111   C C    . LEU A 1 10  ? 26.283  6.308   -4.518  1.00 0.00 ? 10  LEU A C    1  
ATOM 112   O O    . LEU A 1 10  ? 26.490  5.188   -4.985  1.00 0.00 ? 10  LEU A O    1  
ATOM 113   C CB   . LEU A 1 10  ? 24.400  7.917   -4.869  1.00 0.00 ? 10  LEU A CB   1  
ATOM 114   C CG   . LEU A 1 10  ? 23.166  7.268   -5.496  1.00 0.00 ? 10  LEU A CG   1  
ATOM 115   C CD1  . LEU A 1 10  ? 23.062  7.631   -6.969  1.00 0.00 ? 10  LEU A CD1  1  
ATOM 116   C CD2  . LEU A 1 10  ? 23.208  5.758   -5.319  1.00 0.00 ? 10  LEU A CD2  1  
ATOM 117   H H    . LEU A 1 10  ? 25.133  6.178   -6.983  1.00 0.00 ? 10  LEU A H    1  
ATOM 118   H HA   . LEU A 1 10  ? 26.453  8.257   -5.371  1.00 0.00 ? 10  LEU A HA   1  
ATOM 119   H HB2  . LEU A 1 10  ? 24.372  7.723   -3.808  1.00 0.00 ? 10  LEU A HB2  1  
ATOM 120   H HB3  . LEU A 1 10  ? 24.339  8.982   -5.041  1.00 0.00 ? 10  LEU A HB3  1  
ATOM 121   H HG   . LEU A 1 10  ? 22.280  7.639   -4.999  1.00 0.00 ? 10  LEU A HG   1  
ATOM 122   H HD11 . LEU A 1 10  ? 22.032  7.838   -7.218  1.00 0.00 ? 10  LEU A HD11 1  
ATOM 123   H HD12 . LEU A 1 10  ? 23.419  6.807   -7.569  1.00 0.00 ? 10  LEU A HD12 1  
ATOM 124   H HD13 . LEU A 1 10  ? 23.664  8.506   -7.167  1.00 0.00 ? 10  LEU A HD13 1  
ATOM 125   H HD21 . LEU A 1 10  ? 24.236  5.433   -5.245  1.00 0.00 ? 10  LEU A HD21 1  
ATOM 126   H HD22 . LEU A 1 10  ? 22.741  5.283   -6.169  1.00 0.00 ? 10  LEU A HD22 1  
ATOM 127   H HD23 . LEU A 1 10  ? 22.678  5.486   -4.418  1.00 0.00 ? 10  LEU A HD23 1  
ATOM 128   N N    . ASP A 1 11  ? 26.500  6.611   -3.243  1.00 0.00 ? 11  ASP A N    1  
ATOM 129   C CA   . ASP A 1 11  ? 27.004  5.622   -2.297  1.00 0.00 ? 11  ASP A CA   1  
ATOM 130   C C    . ASP A 1 11  ? 25.919  5.220   -1.303  1.00 0.00 ? 11  ASP A C    1  
ATOM 131   O O    . ASP A 1 11  ? 26.125  4.341   -0.465  1.00 0.00 ? 11  ASP A O    1  
ATOM 132   C CB   . ASP A 1 11  ? 28.219  6.172   -1.550  1.00 0.00 ? 11  ASP A CB   1  
ATOM 133   C CG   . ASP A 1 11  ? 29.507  5.996   -2.330  1.00 0.00 ? 11  ASP A CG   1  
ATOM 134   O OD1  . ASP A 1 11  ? 29.881  4.836   -2.602  1.00 0.00 ? 11  ASP A OD1  1  
ATOM 135   O OD2  . ASP A 1 11  ? 30.141  7.018   -2.668  1.00 0.00 ? 11  ASP A OD2  1  
ATOM 136   H H    . ASP A 1 11  ? 26.317  7.522   -2.931  1.00 0.00 ? 11  ASP A H    1  
ATOM 137   H HA   . ASP A 1 11  ? 27.302  4.749   -2.857  1.00 0.00 ? 11  ASP A HA   1  
ATOM 138   H HB2  . ASP A 1 11  ? 28.074  7.227   -1.366  1.00 0.00 ? 11  ASP A HB2  1  
ATOM 139   H HB3  . ASP A 1 11  ? 28.317  5.657   -0.606  1.00 0.00 ? 11  ASP A HB3  1  
ATOM 140   N N    . LEU A 1 12  ? 24.764  5.870   -1.400  1.00 0.00 ? 12  LEU A N    1  
ATOM 141   C CA   . LEU A 1 12  ? 23.647  5.581   -0.508  1.00 0.00 ? 12  LEU A CA   1  
ATOM 142   C C    . LEU A 1 12  ? 22.350  5.421   -1.295  1.00 0.00 ? 12  LEU A C    1  
ATOM 143   O O    . LEU A 1 12  ? 21.502  6.313   -1.301  1.00 0.00 ? 12  LEU A O    1  
ATOM 144   C CB   . LEU A 1 12  ? 23.493  6.697   0.527   1.00 0.00 ? 12  LEU A CB   1  
ATOM 145   C CG   . LEU A 1 12  ? 22.949  6.275   1.893   1.00 0.00 ? 12  LEU A CG   1  
ATOM 146   C CD1  . LEU A 1 12  ? 21.735  5.374   1.728   1.00 0.00 ? 12  LEU A CD1  1  
ATOM 147   C CD2  . LEU A 1 12  ? 24.029  5.574   2.704   1.00 0.00 ? 12  LEU A CD2  1  
ATOM 148   H H    . LEU A 1 12  ? 24.660  6.560   -2.087  1.00 0.00 ? 12  LEU A H    1  
ATOM 149   H HA   . LEU A 1 12  ? 23.861  4.654   0.002   1.00 0.00 ? 12  LEU A HA   1  
ATOM 150   H HB2  . LEU A 1 12  ? 24.465  7.140   0.682   1.00 0.00 ? 12  LEU A HB2  1  
ATOM 151   H HB3  . LEU A 1 12  ? 22.822  7.438   0.117   1.00 0.00 ? 12  LEU A HB3  1  
ATOM 152   H HG   . LEU A 1 12  ? 22.639  7.156   2.437   1.00 0.00 ? 12  LEU A HG   1  
ATOM 153   H HD11 . LEU A 1 12  ? 20.859  5.980   1.550   1.00 0.00 ? 12  LEU A HD11 1  
ATOM 154   H HD12 . LEU A 1 12  ? 21.593  4.793   2.627   1.00 0.00 ? 12  LEU A HD12 1  
ATOM 155   H HD13 . LEU A 1 12  ? 21.890  4.710   0.891   1.00 0.00 ? 12  LEU A HD13 1  
ATOM 156   H HD21 . LEU A 1 12  ? 23.635  5.308   3.674   1.00 0.00 ? 12  LEU A HD21 1  
ATOM 157   H HD22 . LEU A 1 12  ? 24.873  6.237   2.827   1.00 0.00 ? 12  LEU A HD22 1  
ATOM 158   H HD23 . LEU A 1 12  ? 24.346  4.681   2.186   1.00 0.00 ? 12  LEU A HD23 1  
ATOM 159   N N    . GLU A 1 13  ? 22.202  4.277   -1.956  1.00 0.00 ? 13  GLU A N    1  
ATOM 160   C CA   . GLU A 1 13  ? 21.008  4.000   -2.745  1.00 0.00 ? 13  GLU A CA   1  
ATOM 161   C C    . GLU A 1 13  ? 19.752  4.100   -1.884  1.00 0.00 ? 13  GLU A C    1  
ATOM 162   O O    . GLU A 1 13  ? 19.697  3.556   -0.782  1.00 0.00 ? 13  GLU A O    1  
ATOM 163   C CB   . GLU A 1 13  ? 21.097  2.608   -3.375  1.00 0.00 ? 13  GLU A CB   1  
ATOM 164   C CG   . GLU A 1 13  ? 21.998  2.551   -4.598  1.00 0.00 ? 13  GLU A CG   1  
ATOM 165   C CD   . GLU A 1 13  ? 23.449  2.295   -4.241  1.00 0.00 ? 13  GLU A CD   1  
ATOM 166   O OE1  . GLU A 1 13  ? 23.849  2.629   -3.106  1.00 0.00 ? 13  GLU A OE1  1  
ATOM 167   O OE2  . GLU A 1 13  ? 24.185  1.760   -5.097  1.00 0.00 ? 13  GLU A OE2  1  
ATOM 168   H H    . GLU A 1 13  ? 22.914  3.604   -1.913  1.00 0.00 ? 13  GLU A H    1  
ATOM 169   H HA   . GLU A 1 13  ? 20.951  4.737   -3.531  1.00 0.00 ? 13  GLU A HA   1  
ATOM 170   H HB2  . GLU A 1 13  ? 21.479  1.916   -2.639  1.00 0.00 ? 13  GLU A HB2  1  
ATOM 171   H HB3  . GLU A 1 13  ? 20.106  2.296   -3.669  1.00 0.00 ? 13  GLU A HB3  1  
ATOM 172   H HG2  . GLU A 1 13  ? 21.656  1.756   -5.243  1.00 0.00 ? 13  GLU A HG2  1  
ATOM 173   H HG3  . GLU A 1 13  ? 21.932  3.493   -5.122  1.00 0.00 ? 13  GLU A HG3  1  
ATOM 174   N N    . ASN A 1 14  ? 18.745  4.801   -2.395  1.00 0.00 ? 14  ASN A N    1  
ATOM 175   C CA   . ASN A 1 14  ? 17.490  4.975   -1.673  1.00 0.00 ? 14  ASN A CA   1  
ATOM 176   C C    . ASN A 1 14  ? 16.398  5.500   -2.600  1.00 0.00 ? 14  ASN A C    1  
ATOM 177   O O    . ASN A 1 14  ? 16.494  6.612   -3.121  1.00 0.00 ? 14  ASN A O    1  
ATOM 178   C CB   . ASN A 1 14  ? 17.682  5.935   -0.498  1.00 0.00 ? 14  ASN A CB   1  
ATOM 179   C CG   . ASN A 1 14  ? 18.114  7.318   -0.945  1.00 0.00 ? 14  ASN A CG   1  
ATOM 180   O OD1  . ASN A 1 14  ? 19.048  7.464   -1.734  1.00 0.00 ? 14  ASN A OD1  1  
ATOM 181   N ND2  . ASN A 1 14  ? 17.435  8.341   -0.441  1.00 0.00 ? 14  ASN A ND2  1  
ATOM 182   H H    . ASN A 1 14  ? 18.849  5.212   -3.279  1.00 0.00 ? 14  ASN A H    1  
ATOM 183   H HA   . ASN A 1 14  ? 17.190  4.010   -1.293  1.00 0.00 ? 14  ASN A HA   1  
ATOM 184   H HB2  . ASN A 1 14  ? 16.750  6.026   0.040   1.00 0.00 ? 14  ASN A HB2  1  
ATOM 185   H HB3  . ASN A 1 14  ? 18.437  5.538   0.164   1.00 0.00 ? 14  ASN A HB3  1  
ATOM 186   H HD21 . ASN A 1 14  ? 16.703  8.150   0.182   1.00 0.00 ? 14  ASN A HD21 1  
ATOM 187   H HD22 . ASN A 1 14  ? 17.692  9.247   -0.714  1.00 0.00 ? 14  ASN A HD22 1  
ATOM 188   N N    . ILE A 1 15  ? 15.360  4.694   -2.799  1.00 0.00 ? 15  ILE A N    1  
ATOM 189   C CA   . ILE A 1 15  ? 14.250  5.078   -3.661  1.00 0.00 ? 15  ILE A CA   1  
ATOM 190   C C    . ILE A 1 15  ? 13.784  6.499   -3.358  1.00 0.00 ? 15  ILE A C    1  
ATOM 191   O O    . ILE A 1 15  ? 13.825  6.944   -2.211  1.00 0.00 ? 15  ILE A O    1  
ATOM 192   C CB   . ILE A 1 15  ? 13.057  4.116   -3.506  1.00 0.00 ? 15  ILE A CB   1  
ATOM 193   C CG1  . ILE A 1 15  ? 13.501  2.674   -3.764  1.00 0.00 ? 15  ILE A CG1  1  
ATOM 194   C CG2  . ILE A 1 15  ? 11.933  4.508   -4.453  1.00 0.00 ? 15  ILE A CG2  1  
ATOM 195   C CD1  . ILE A 1 15  ? 13.980  1.958   -2.521  1.00 0.00 ? 15  ILE A CD1  1  
ATOM 196   H H    . ILE A 1 15  ? 15.341  3.821   -2.356  1.00 0.00 ? 15  ILE A H    1  
ATOM 197   H HA   . ILE A 1 15  ? 14.592  5.034   -4.685  1.00 0.00 ? 15  ILE A HA   1  
ATOM 198   H HB   . ILE A 1 15  ? 12.688  4.196   -2.495  1.00 0.00 ? 15  ILE A HB   1  
ATOM 199   H HG12 . ILE A 1 15  ? 12.672  2.116   -4.170  1.00 0.00 ? 15  ILE A HG12 1  
ATOM 200   H HG13 . ILE A 1 15  ? 14.311  2.678   -4.479  1.00 0.00 ? 15  ILE A HG13 1  
ATOM 201   H HG21 . ILE A 1 15  ? 12.331  5.119   -5.250  1.00 0.00 ? 15  ILE A HG21 1  
ATOM 202   H HG22 . ILE A 1 15  ? 11.489  3.617   -4.872  1.00 0.00 ? 15  ILE A HG22 1  
ATOM 203   H HG23 . ILE A 1 15  ? 11.183  5.064   -3.912  1.00 0.00 ? 15  ILE A HG23 1  
ATOM 204   H HD11 . ILE A 1 15  ? 15.031  1.730   -2.620  1.00 0.00 ? 15  ILE A HD11 1  
ATOM 205   H HD12 . ILE A 1 15  ? 13.829  2.591   -1.659  1.00 0.00 ? 15  ILE A HD12 1  
ATOM 206   H HD13 . ILE A 1 15  ? 13.424  1.040   -2.397  1.00 0.00 ? 15  ILE A HD13 1  
ATOM 207   N N    . GLN A 1 16  ? 13.341  7.204   -4.394  1.00 0.00 ? 16  GLN A N    1  
ATOM 208   C CA   . GLN A 1 16  ? 12.867  8.574   -4.237  1.00 0.00 ? 16  GLN A CA   1  
ATOM 209   C C    . GLN A 1 16  ? 11.494  8.603   -3.573  1.00 0.00 ? 16  GLN A C    1  
ATOM 210   O O    . GLN A 1 16  ? 10.488  8.898   -4.219  1.00 0.00 ? 16  GLN A O    1  
ATOM 211   C CB   . GLN A 1 16  ? 12.804  9.273   -5.597  1.00 0.00 ? 16  GLN A CB   1  
ATOM 212   C CG   . GLN A 1 16  ? 14.136  9.301   -6.328  1.00 0.00 ? 16  GLN A CG   1  
ATOM 213   C CD   . GLN A 1 16  ? 15.105  10.306  -5.737  1.00 0.00 ? 16  GLN A CD   1  
ATOM 214   O OE1  . GLN A 1 16  ? 16.025  9.942   -5.004  1.00 0.00 ? 16  GLN A OE1  1  
ATOM 215   N NE2  . GLN A 1 16  ? 14.904  11.580  -6.054  1.00 0.00 ? 16  GLN A NE2  1  
ATOM 216   H H    . GLN A 1 16  ? 13.333  6.794   -5.283  1.00 0.00 ? 16  GLN A H    1  
ATOM 217   H HA   . GLN A 1 16  ? 13.569  9.098   -3.606  1.00 0.00 ? 16  GLN A HA   1  
ATOM 218   H HB2  . GLN A 1 16  ? 12.086  8.759   -6.219  1.00 0.00 ? 16  GLN A HB2  1  
ATOM 219   H HB3  . GLN A 1 16  ? 12.477  10.291  -5.450  1.00 0.00 ? 16  GLN A HB3  1  
ATOM 220   H HG2  . GLN A 1 16  ? 14.583  8.320   -6.275  1.00 0.00 ? 16  GLN A HG2  1  
ATOM 221   H HG3  . GLN A 1 16  ? 13.958  9.559   -7.362  1.00 0.00 ? 16  GLN A HG3  1  
ATOM 222   H HE21 . GLN A 1 16  ? 14.150  11.797  -6.642  1.00 0.00 ? 16  GLN A HE21 1  
ATOM 223   H HE22 . GLN A 1 16  ? 15.515  12.250  -5.685  1.00 0.00 ? 16  GLN A HE22 1  
ATOM 224   N N    . ILE A 1 17  ? 11.461  8.293   -2.282  1.00 0.00 ? 17  ILE A N    1  
ATOM 225   C CA   . ILE A 1 17  ? 10.211  8.284   -1.531  1.00 0.00 ? 17  ILE A CA   1  
ATOM 226   C C    . ILE A 1 17  ? 10.051  9.563   -0.716  1.00 0.00 ? 17  ILE A C    1  
ATOM 227   O O    . ILE A 1 17  ? 10.996  10.063  -0.107  1.00 0.00 ? 17  ILE A O    1  
ATOM 228   C CB   . ILE A 1 17  ? 10.132  7.072   -0.584  1.00 0.00 ? 17  ILE A CB   1  
ATOM 229   C CG1  . ILE A 1 17  ? 10.208  5.768   -1.381  1.00 0.00 ? 17  ILE A CG1  1  
ATOM 230   C CG2  . ILE A 1 17  ? 8.852   7.124   0.237   1.00 0.00 ? 17  ILE A CG2  1  
ATOM 231   C CD1  . ILE A 1 17  ? 10.369  4.539   -0.515  1.00 0.00 ? 17  ILE A CD1  1  
ATOM 232   H H    . ILE A 1 17  ? 12.296  8.066   -1.822  1.00 0.00 ? 17  ILE A H    1  
ATOM 233   H HA   . ILE A 1 17  ? 9.398   8.216   -2.239  1.00 0.00 ? 17  ILE A HA   1  
ATOM 234   H HB   . ILE A 1 17  ? 10.969  7.119   0.096   1.00 0.00 ? 17  ILE A HB   1  
ATOM 235   H HG12 . ILE A 1 17  ? 9.303   5.652   -1.956  1.00 0.00 ? 17  ILE A HG12 1  
ATOM 236   H HG13 . ILE A 1 17  ? 11.053  5.815   -2.053  1.00 0.00 ? 17  ILE A HG13 1  
ATOM 237   H HG21 . ILE A 1 17  ? 8.653   8.144   0.528   1.00 0.00 ? 17  ILE A HG21 1  
ATOM 238   H HG22 . ILE A 1 17  ? 8.030   6.752   -0.356  1.00 0.00 ? 17  ILE A HG22 1  
ATOM 239   H HG23 . ILE A 1 17  ? 8.965   6.512   1.119   1.00 0.00 ? 17  ILE A HG23 1  
ATOM 240   H HD11 . ILE A 1 17  ? 11.325  4.576   -0.011  1.00 0.00 ? 17  ILE A HD11 1  
ATOM 241   H HD12 . ILE A 1 17  ? 9.578   4.509   0.219   1.00 0.00 ? 17  ILE A HD12 1  
ATOM 242   H HD13 . ILE A 1 17  ? 10.323  3.654   -1.133  1.00 0.00 ? 17  ILE A HD13 1  
ATOM 243   N N    . PRO A 1 18  ? 8.824   10.105  -0.702  1.00 0.00 ? 18  PRO A N    1  
ATOM 244   C CA   . PRO A 1 18  ? 8.509   11.332  0.037   1.00 0.00 ? 18  PRO A CA   1  
ATOM 245   C C    . PRO A 1 18  ? 8.541   11.123  1.547   1.00 0.00 ? 18  PRO A C    1  
ATOM 246   O O    . PRO A 1 18  ? 8.424   9.997   2.030   1.00 0.00 ? 18  PRO A O    1  
ATOM 247   C CB   . PRO A 1 18  ? 7.090   11.670  -0.426  1.00 0.00 ? 18  PRO A CB   1  
ATOM 248   C CG   . PRO A 1 18  ? 6.507   10.365  -0.847  1.00 0.00 ? 18  PRO A CG   1  
ATOM 249   C CD   . PRO A 1 18  ? 7.650   9.562   -1.405  1.00 0.00 ? 18  PRO A CD   1  
ATOM 250   H HA   . PRO A 1 18  ? 9.178   12.137  -0.229  1.00 0.00 ? 18  PRO A HA   1  
ATOM 251   H HB2  . PRO A 1 18  ? 6.535   12.105  0.393   1.00 0.00 ? 18  PRO A HB2  1  
ATOM 252   H HB3  . PRO A 1 18  ? 7.132   12.367  -1.250  1.00 0.00 ? 18  PRO A HB3  1  
ATOM 253   H HG2  . PRO A 1 18  ? 6.077   9.862   0.006   1.00 0.00 ? 18  PRO A HG2  1  
ATOM 254   H HG3  . PRO A 1 18  ? 5.757   10.526  -1.607  1.00 0.00 ? 18  PRO A HG3  1  
ATOM 255   H HD2  . PRO A 1 18  ? 7.518   8.513   -1.184  1.00 0.00 ? 18  PRO A HD2  1  
ATOM 256   H HD3  . PRO A 1 18  ? 7.734   9.717   -2.471  1.00 0.00 ? 18  PRO A HD3  1  
ATOM 257   N N    . ASP A 1 19  ? 8.699   12.215  2.287   1.00 0.00 ? 19  ASP A N    1  
ATOM 258   C CA   . ASP A 1 19  ? 8.745   12.152  3.743   1.00 0.00 ? 19  ASP A CA   1  
ATOM 259   C C    . ASP A 1 19  ? 7.557   11.366  4.290   1.00 0.00 ? 19  ASP A C    1  
ATOM 260   O O    . ASP A 1 19  ? 7.698   10.582  5.228   1.00 0.00 ? 19  ASP A O    1  
ATOM 261   C CB   . ASP A 1 19  ? 8.756   13.562  4.336   1.00 0.00 ? 19  ASP A CB   1  
ATOM 262   C CG   . ASP A 1 19  ? 8.380   13.575  5.804   1.00 0.00 ? 19  ASP A CG   1  
ATOM 263   O OD1  . ASP A 1 19  ? 9.037   12.863  6.591   1.00 0.00 ? 19  ASP A OD1  1  
ATOM 264   O OD2  . ASP A 1 19  ? 7.427   14.298  6.167   1.00 0.00 ? 19  ASP A OD2  1  
ATOM 265   H H    . ASP A 1 19  ? 8.786   13.085  1.843   1.00 0.00 ? 19  ASP A H    1  
ATOM 266   H HA   . ASP A 1 19  ? 9.655   11.646  4.025   1.00 0.00 ? 19  ASP A HA   1  
ATOM 267   H HB2  . ASP A 1 19  ? 9.747   13.981  4.233   1.00 0.00 ? 19  ASP A HB2  1  
ATOM 268   H HB3  . ASP A 1 19  ? 8.052   14.178  3.796   1.00 0.00 ? 19  ASP A HB3  1  
ATOM 269   N N    . ALA A 1 20  ? 6.387   11.584  3.699   1.00 0.00 ? 20  ALA A N    1  
ATOM 270   C CA   . ALA A 1 20  ? 5.175   10.895  4.127   1.00 0.00 ? 20  ALA A CA   1  
ATOM 271   C C    . ALA A 1 20  ? 4.306   10.521  2.931   1.00 0.00 ? 20  ALA A C    1  
ATOM 272   O O    . ALA A 1 20  ? 4.306   11.191  1.899   1.00 0.00 ? 20  ALA A O    1  
ATOM 273   C CB   . ALA A 1 20  ? 4.391   11.763  5.101   1.00 0.00 ? 20  ALA A CB   1  
ATOM 274   H H    . ALA A 1 20  ? 6.338   12.221  2.957   1.00 0.00 ? 20  ALA A H    1  
ATOM 275   H HA   . ALA A 1 20  ? 5.469   9.993   4.643   1.00 0.00 ? 20  ALA A HA   1  
ATOM 276   H HB1  . ALA A 1 20  ? 3.376   11.872  4.747   1.00 0.00 ? 20  ALA A HB1  1  
ATOM 277   H HB2  . ALA A 1 20  ? 4.386   11.295  6.074   1.00 0.00 ? 20  ALA A HB2  1  
ATOM 278   H HB3  . ALA A 1 20  ? 4.856   12.735  5.170   1.00 0.00 ? 20  ALA A HB3  1  
ATOM 279   N N    . PRO A 1 21  ? 3.547   9.424   3.071   1.00 0.00 ? 21  PRO A N    1  
ATOM 280   C CA   . PRO A 1 21  ? 2.659   8.935   2.012   1.00 0.00 ? 21  PRO A CA   1  
ATOM 281   C C    . PRO A 1 21  ? 1.462   9.853   1.790   1.00 0.00 ? 21  PRO A C    1  
ATOM 282   O O    . PRO A 1 21  ? 0.924   10.450  2.723   1.00 0.00 ? 21  PRO A O    1  
ATOM 283   C CB   . PRO A 1 21  ? 2.197   7.573   2.537   1.00 0.00 ? 21  PRO A CB   1  
ATOM 284   C CG   . PRO A 1 21  ? 2.320   7.676   4.018   1.00 0.00 ? 21  PRO A CG   1  
ATOM 285   C CD   . PRO A 1 21  ? 3.497   8.576   4.274   1.00 0.00 ? 21  PRO A CD   1  
ATOM 286   H HA   . PRO A 1 21  ? 3.188   8.803   1.080   1.00 0.00 ? 21  PRO A HA   1  
ATOM 287   H HB2  . PRO A 1 21  ? 1.174   7.396   2.236   1.00 0.00 ? 21  PRO A HB2  1  
ATOM 288   H HB3  . PRO A 1 21  ? 2.834   6.796   2.141   1.00 0.00 ? 21  PRO A HB3  1  
ATOM 289   H HG2  . PRO A 1 21  ? 1.421   8.107   4.432   1.00 0.00 ? 21  PRO A HG2  1  
ATOM 290   H HG3  . PRO A 1 21  ? 2.497   6.698   4.440   1.00 0.00 ? 21  PRO A HG3  1  
ATOM 291   H HD2  . PRO A 1 21  ? 3.331   9.172   5.159   1.00 0.00 ? 21  PRO A HD2  1  
ATOM 292   H HD3  . PRO A 1 21  ? 4.402   7.994   4.373   1.00 0.00 ? 21  PRO A HD3  1  
ATOM 293   N N    . PRO A 1 22  ? 1.033   9.972   0.524   1.00 0.00 ? 22  PRO A N    1  
ATOM 294   C CA   . PRO A 1 22  ? -0.105  10.816  0.150   1.00 0.00 ? 22  PRO A CA   1  
ATOM 295   C C    . PRO A 1 22  ? -1.432  10.255  0.650   1.00 0.00 ? 22  PRO A C    1  
ATOM 296   O O    . PRO A 1 22  ? -1.520  9.111   1.099   1.00 0.00 ? 22  PRO A O    1  
ATOM 297   C CB   . PRO A 1 22  ? -0.065  10.808  -1.380  1.00 0.00 ? 22  PRO A CB   1  
ATOM 298   C CG   . PRO A 1 22  ? 0.627   9.537   -1.734  1.00 0.00 ? 22  PRO A CG   1  
ATOM 299   C CD   . PRO A 1 22  ? 1.627   9.291   -0.639  1.00 0.00 ? 22  PRO A CD   1  
ATOM 300   H HA   . PRO A 1 22  ? 0.015   11.827  0.510   1.00 0.00 ? 22  PRO A HA   1  
ATOM 301   H HB2  . PRO A 1 22  ? -1.073  10.832  -1.770  1.00 0.00 ? 22  PRO A HB2  1  
ATOM 302   H HB3  . PRO A 1 22  ? 0.484   11.668  -1.734  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 303   H HG2  . PRO A 1 22  ? -0.088  8.730   -1.779  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 304   H HG3  . PRO A 1 22  ? 1.131   9.646   -2.683  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 305   H HD2  . PRO A 1 22  ? 1.731   8.232   -0.454  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 306   H HD3  . PRO A 1 22  ? 2.582   9.726   -0.894  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 307   N N    . PRO A 1 23  ? -2.490  11.076  0.573   1.00 0.00 ? 23  PRO A N    1  
ATOM 308   C CA   . PRO A 1 23  ? -3.831  10.682  1.013   1.00 0.00 ? 23  PRO A CA   1  
ATOM 309   C C    . PRO A 1 23  ? -4.456  9.632   0.100   1.00 0.00 ? 23  PRO A C    1  
ATOM 310   O O    . PRO A 1 23  ? -4.811  9.922   -1.043  1.00 0.00 ? 23  PRO A O    1  
ATOM 311   C CB   . PRO A 1 23  ? -4.625  11.989  0.945   1.00 0.00 ? 23  PRO A CB   1  
ATOM 312   C CG   . PRO A 1 23  ? -3.912  12.813  -0.071  1.00 0.00 ? 23  PRO A CG   1  
ATOM 313   C CD   . PRO A 1 23  ? -2.457  12.452  0.049   1.00 0.00 ? 23  PRO A CD   1  
ATOM 314   H HA   . PRO A 1 23  ? -3.824  10.315  2.029   1.00 0.00 ? 23  PRO A HA   1  
ATOM 315   H HB2  . PRO A 1 23  ? -5.642  11.781  0.643   1.00 0.00 ? 23  PRO A HB2  1  
ATOM 316   H HB3  . PRO A 1 23  ? -4.621  12.467  1.913   1.00 0.00 ? 23  PRO A HB3  1  
ATOM 317   H HG2  . PRO A 1 23  ? -4.277  12.575  -1.059  1.00 0.00 ? 23  PRO A HG2  1  
ATOM 318   H HG3  . PRO A 1 23  ? -4.056  13.862  0.140   1.00 0.00 ? 23  PRO A HG3  1  
ATOM 319   H HD2  . PRO A 1 23  ? -1.979  12.485  -0.918  1.00 0.00 ? 23  PRO A HD2  1  
ATOM 320   H HD3  . PRO A 1 23  ? -1.960  13.115  0.742   1.00 0.00 ? 23  PRO A HD3  1  
ATOM 321   N N    . ILE A 1 24  ? -4.587  8.413   0.611   1.00 0.00 ? 24  ILE A N    1  
ATOM 322   C CA   . ILE A 1 24  ? -5.170  7.321   -0.158  1.00 0.00 ? 24  ILE A CA   1  
ATOM 323   C C    . ILE A 1 24  ? -6.272  7.827   -1.082  1.00 0.00 ? 24  ILE A C    1  
ATOM 324   O O    . ILE A 1 24  ? -7.089  8.670   -0.711  1.00 0.00 ? 24  ILE A O    1  
ATOM 325   C CB   . ILE A 1 24  ? -5.748  6.230   0.762   1.00 0.00 ? 24  ILE A CB   1  
ATOM 326   C CG1  . ILE A 1 24  ? -4.644  5.634   1.639   1.00 0.00 ? 24  ILE A CG1  1  
ATOM 327   C CG2  . ILE A 1 24  ? -6.420  5.143   -0.063  1.00 0.00 ? 24  ILE A CG2  1  
ATOM 328   C CD1  . ILE A 1 24  ? -5.168  4.772   2.767   1.00 0.00 ? 24  ILE A CD1  1  
ATOM 329   H H    . ILE A 1 24  ? -4.285  8.244   1.528   1.00 0.00 ? 24  ILE A H    1  
ATOM 330   H HA   . ILE A 1 24  ? -4.386  6.880   -0.758  1.00 0.00 ? 24  ILE A HA   1  
ATOM 331   H HB   . ILE A 1 24  ? -6.496  6.682   1.395   1.00 0.00 ? 24  ILE A HB   1  
ATOM 332   H HG12 . ILE A 1 24  ? -3.998  5.024   1.029   1.00 0.00 ? 24  ILE A HG12 1  
ATOM 333   H HG13 . ILE A 1 24  ? -4.069  6.438   2.074   1.00 0.00 ? 24  ILE A HG13 1  
ATOM 334   H HG21 . ILE A 1 24  ? -5.670  4.469   -0.451  1.00 0.00 ? 24  ILE A HG21 1  
ATOM 335   H HG22 . ILE A 1 24  ? -7.109  4.592   0.560   1.00 0.00 ? 24  ILE A HG22 1  
ATOM 336   H HG23 . ILE A 1 24  ? -6.958  5.593   -0.883  1.00 0.00 ? 24  ILE A HG23 1  
ATOM 337   H HD11 . ILE A 1 24  ? -5.940  4.117   2.390   1.00 0.00 ? 24  ILE A HD11 1  
ATOM 338   H HD12 . ILE A 1 24  ? -4.361  4.180   3.172   1.00 0.00 ? 24  ILE A HD12 1  
ATOM 339   H HD13 . ILE A 1 24  ? -5.578  5.402   3.542   1.00 0.00 ? 24  ILE A HD13 1  
ATOM 340   N N    . PRO A 1 25  ? -6.299  7.300   -2.316  1.00 0.00 ? 25  PRO A N    1  
ATOM 341   C CA   . PRO A 1 25  ? -7.298  7.682   -3.318  1.00 0.00 ? 25  PRO A CA   1  
ATOM 342   C C    . PRO A 1 25  ? -8.694  7.179   -2.967  1.00 0.00 ? 25  PRO A C    1  
ATOM 343   O O    . PRO A 1 25  ? -8.882  6.487   -1.966  1.00 0.00 ? 25  PRO A O    1  
ATOM 344   C CB   . PRO A 1 25  ? -6.793  7.009   -4.597  1.00 0.00 ? 25  PRO A CB   1  
ATOM 345   C CG   . PRO A 1 25  ? -5.982  5.853   -4.121  1.00 0.00 ? 25  PRO A CG   1  
ATOM 346   C CD   . PRO A 1 25  ? -5.356  6.291   -2.826  1.00 0.00 ? 25  PRO A CD   1  
ATOM 347   H HA   . PRO A 1 25  ? -7.328  8.753   -3.461  1.00 0.00 ? 25  PRO A HA   1  
ATOM 348   H HB2  . PRO A 1 25  ? -7.634  6.684   -5.192  1.00 0.00 ? 25  PRO A HB2  1  
ATOM 349   H HB3  . PRO A 1 25  ? -6.192  7.706   -5.162  1.00 0.00 ? 25  PRO A HB3  1  
ATOM 350   H HG2  . PRO A 1 25  ? -6.621  4.999   -3.959  1.00 0.00 ? 25  PRO A HG2  1  
ATOM 351   H HG3  . PRO A 1 25  ? -5.217  5.619   -4.847  1.00 0.00 ? 25  PRO A HG3  1  
ATOM 352   H HD2  . PRO A 1 25  ? -5.277  5.457   -2.144  1.00 0.00 ? 25  PRO A HD2  1  
ATOM 353   H HD3  . PRO A 1 25  ? -4.385  6.728   -3.005  1.00 0.00 ? 25  PRO A HD3  1  
ATOM 354   N N    . LYS A 1 26  ? -9.670  7.529   -3.797  1.00 0.00 ? 26  LYS A N    1  
ATOM 355   C CA   . LYS A 1 26  ? -11.050 7.111   -3.576  1.00 0.00 ? 26  LYS A CA   1  
ATOM 356   C C    . LYS A 1 26  ? -11.308 5.739   -4.190  1.00 0.00 ? 26  LYS A C    1  
ATOM 357   O O    . LYS A 1 26  ? -10.800 5.425   -5.266  1.00 0.00 ? 26  LYS A O    1  
ATOM 358   C CB   . LYS A 1 26  ? -12.016 8.137   -4.171  1.00 0.00 ? 26  LYS A CB   1  
ATOM 359   C CG   . LYS A 1 26  ? -12.312 7.913   -5.644  1.00 0.00 ? 26  LYS A CG   1  
ATOM 360   C CD   . LYS A 1 26  ? -11.077 8.139   -6.500  1.00 0.00 ? 26  LYS A CD   1  
ATOM 361   C CE   . LYS A 1 26  ? -11.448 8.428   -7.947  1.00 0.00 ? 26  LYS A CE   1  
ATOM 362   N NZ   . LYS A 1 26  ? -12.280 9.657   -8.071  1.00 0.00 ? 26  LYS A NZ   1  
ATOM 363   H H    . LYS A 1 26  ? -9.458  8.081   -4.579  1.00 0.00 ? 26  LYS A H    1  
ATOM 364   H HA   . LYS A 1 26  ? -11.211 7.052   -2.510  1.00 0.00 ? 26  LYS A HA   1  
ATOM 365   H HB2  . LYS A 1 26  ? -12.949 8.093   -3.627  1.00 0.00 ? 26  LYS A HB2  1  
ATOM 366   H HB3  . LYS A 1 26  ? -11.590 9.124   -4.057  1.00 0.00 ? 26  LYS A HB3  1  
ATOM 367   H HG2  . LYS A 1 26  ? -12.652 6.898   -5.783  1.00 0.00 ? 26  LYS A HG2  1  
ATOM 368   H HG3  . LYS A 1 26  ? -13.086 8.600   -5.955  1.00 0.00 ? 26  LYS A HG3  1  
ATOM 369   H HD2  . LYS A 1 26  ? -10.525 8.980   -6.107  1.00 0.00 ? 26  LYS A HD2  1  
ATOM 370   H HD3  . LYS A 1 26  ? -10.459 7.253   -6.467  1.00 0.00 ? 26  LYS A HD3  1  
ATOM 371   H HE2  . LYS A 1 26  ? -10.542 8.558   -8.518  1.00 0.00 ? 26  LYS A HE2  1  
ATOM 372   H HE3  . LYS A 1 26  ? -12.002 7.588   -8.337  1.00 0.00 ? 26  LYS A HE3  1  
ATOM 373   H HZ1  . LYS A 1 26  ? -12.314 10.159  -7.161  1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 374   H HZ2  . LYS A 1 26  ? -13.249 9.406   -8.353  1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 375   H HZ3  . LYS A 1 26  ? -11.876 10.291  -8.789  1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 376   N N    . GLU A 1 27  ? -12.100 4.926   -3.499  1.00 0.00 ? 27  GLU A N    1  
ATOM 377   C CA   . GLU A 1 27  ? -12.426 3.587   -3.978  1.00 0.00 ? 27  GLU A CA   1  
ATOM 378   C C    . GLU A 1 27  ? -12.956 3.635   -5.408  1.00 0.00 ? 27  GLU A C    1  
ATOM 379   O O    . GLU A 1 27  ? -13.612 4.591   -5.822  1.00 0.00 ? 27  GLU A O    1  
ATOM 380   C CB   . GLU A 1 27  ? -13.459 2.930   -3.061  1.00 0.00 ? 27  GLU A CB   1  
ATOM 381   C CG   . GLU A 1 27  ? -12.880 2.437   -1.746  1.00 0.00 ? 27  GLU A CG   1  
ATOM 382   C CD   . GLU A 1 27  ? -13.948 2.158   -0.706  1.00 0.00 ? 27  GLU A CD   1  
ATOM 383   O OE1  . GLU A 1 27  ? -14.882 1.386   -1.007  1.00 0.00 ? 27  GLU A OE1  1  
ATOM 384   O OE2  . GLU A 1 27  ? -13.848 2.711   0.409   1.00 0.00 ? 27  GLU A OE2  1  
ATOM 385   H H    . GLU A 1 27  ? -12.475 5.233   -2.647  1.00 0.00 ? 27  GLU A H    1  
ATOM 386   H HA   . GLU A 1 27  ? -11.520 3.000   -3.962  1.00 0.00 ? 27  GLU A HA   1  
ATOM 387   H HB2  . GLU A 1 27  ? -14.236 3.648   -2.842  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 388   H HB3  . GLU A 1 27  ? -13.896 2.088   -3.577  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 389   H HG2  . GLU A 1 27  ? -12.331 1.525   -1.929  1.00 0.00 ? 27  GLU A HG2  1  
ATOM 390   H HG3  . GLU A 1 27  ? -12.208 3.188   -1.358  1.00 0.00 ? 27  GLU A HG3  1  
ATOM 391   N N    . PRO A 1 28  ? -12.663 2.580   -6.182  1.00 0.00 ? 28  PRO A N    1  
ATOM 392   C CA   . PRO A 1 28  ? -13.100 2.477   -7.578  1.00 0.00 ? 28  PRO A CA   1  
ATOM 393   C C    . PRO A 1 28  ? -14.607 2.274   -7.700  1.00 0.00 ? 28  PRO A C    1  
ATOM 394   O O    . PRO A 1 28  ? -15.258 1.808   -6.765  1.00 0.00 ? 28  PRO A O    1  
ATOM 395   C CB   . PRO A 1 28  ? -12.351 1.246   -8.094  1.00 0.00 ? 28  PRO A CB   1  
ATOM 396   C CG   . PRO A 1 28  ? -12.086 0.426   -6.879  1.00 0.00 ? 28  PRO A CG   1  
ATOM 397   C CD   . PRO A 1 28  ? -11.885 1.405   -5.755  1.00 0.00 ? 28  PRO A CD   1  
ATOM 398   H HA   . PRO A 1 28  ? -12.808 3.345   -8.150  1.00 0.00 ? 28  PRO A HA   1  
ATOM 399   H HB2  . PRO A 1 28  ? -12.972 0.715   -8.802  1.00 0.00 ? 28  PRO A HB2  1  
ATOM 400   H HB3  . PRO A 1 28  ? -11.433 1.553   -8.571  1.00 0.00 ? 28  PRO A HB3  1  
ATOM 401   H HG2  . PRO A 1 28  ? -12.933 -0.211  -6.673  1.00 0.00 ? 28  PRO A HG2  1  
ATOM 402   H HG3  . PRO A 1 28  ? -11.195 -0.166  -7.023  1.00 0.00 ? 28  PRO A HG3  1  
ATOM 403   H HD2  . PRO A 1 28  ? -12.270 1.003   -4.830  1.00 0.00 ? 28  PRO A HD2  1  
ATOM 404   H HD3  . PRO A 1 28  ? -10.838 1.653   -5.654  1.00 0.00 ? 28  PRO A HD3  1  
ATOM 405   N N    . SER A 1 29  ? -15.155 2.627   -8.859  1.00 0.00 ? 29  SER A N    1  
ATOM 406   C CA   . SER A 1 29  ? -16.586 2.486   -9.102  1.00 0.00 ? 29  SER A CA   1  
ATOM 407   C C    . SER A 1 29  ? -17.031 1.040   -8.905  1.00 0.00 ? 29  SER A C    1  
ATOM 408   O O    . SER A 1 29  ? -16.209 0.150   -8.693  1.00 0.00 ? 29  SER A O    1  
ATOM 409   C CB   . SER A 1 29  ? -16.932 2.950   -10.518 1.00 0.00 ? 29  SER A CB   1  
ATOM 410   O OG   . SER A 1 29  ? -16.141 2.277   -11.483 1.00 0.00 ? 29  SER A OG   1  
ATOM 411   H H    . SER A 1 29  ? -14.583 2.992   -9.566  1.00 0.00 ? 29  SER A H    1  
ATOM 412   H HA   . SER A 1 29  ? -17.106 3.110   -8.391  1.00 0.00 ? 29  SER A HA   1  
ATOM 413   H HB2  . SER A 1 29  ? -17.973 2.745   -10.717 1.00 0.00 ? 29  SER A HB2  1  
ATOM 414   H HB3  . SER A 1 29  ? -16.752 4.012   -10.600 1.00 0.00 ? 29  SER A HB3  1  
ATOM 415   H HG   . SER A 1 29  ? -15.871 1.423   -11.136 1.00 0.00 ? 29  SER A HG   1  
ATOM 416   N N    . ASN A 1 30  ? -18.339 0.815   -8.977  1.00 0.00 ? 30  ASN A N    1  
ATOM 417   C CA   . ASN A 1 30  ? -18.895 -0.522  -8.806  1.00 0.00 ? 30  ASN A CA   1  
ATOM 418   C C    . ASN A 1 30  ? -18.054 -1.559  -9.545  1.00 0.00 ? 30  ASN A C    1  
ATOM 419   O O    . ASN A 1 30  ? -18.097 -1.647  -10.772 1.00 0.00 ? 30  ASN A O    1  
ATOM 420   C CB   . ASN A 1 30  ? -20.338 -0.565  -9.311  1.00 0.00 ? 30  ASN A CB   1  
ATOM 421   C CG   . ASN A 1 30  ? -21.321 -0.010  -8.298  1.00 0.00 ? 30  ASN A CG   1  
ATOM 422   O OD1  . ASN A 1 30  ? -21.964 -0.761  -7.564  1.00 0.00 ? 30  ASN A OD1  1  
ATOM 423   N ND2  . ASN A 1 30  ? -21.443 1.312   -8.255  1.00 0.00 ? 30  ASN A ND2  1  
ATOM 424   H H    . ASN A 1 30  ? -18.944 1.566   -9.148  1.00 0.00 ? 30  ASN A H    1  
ATOM 425   H HA   . ASN A 1 30  ? -18.884 -0.753  -7.751  1.00 0.00 ? 30  ASN A HA   1  
ATOM 426   H HB2  . ASN A 1 30  ? -20.414 0.020   -10.216 1.00 0.00 ? 30  ASN A HB2  1  
ATOM 427   H HB3  . ASN A 1 30  ? -20.609 -1.588  -9.524  1.00 0.00 ? 30  ASN A HB3  1  
ATOM 428   H HD21 . ASN A 1 30  ? -20.899 1.847   -8.870  1.00 0.00 ? 30  ASN A HD21 1  
ATOM 429   H HD22 . ASN A 1 30  ? -22.071 1.698   -7.610  1.00 0.00 ? 30  ASN A HD22 1  
ATOM 430   N N    . TYR A 1 31  ? -17.292 -2.342  -8.790  1.00 0.00 ? 31  TYR A N    1  
ATOM 431   C CA   . TYR A 1 31  ? -16.441 -3.372  -9.373  1.00 0.00 ? 31  TYR A CA   1  
ATOM 432   C C    . TYR A 1 31  ? -17.181 -4.136  -10.467 1.00 0.00 ? 31  TYR A C    1  
ATOM 433   O O    . TYR A 1 31  ? -18.404 -4.266  -10.429 1.00 0.00 ? 31  TYR A O    1  
ATOM 434   C CB   . TYR A 1 31  ? -15.964 -4.343  -8.291  1.00 0.00 ? 31  TYR A CB   1  
ATOM 435   C CG   . TYR A 1 31  ? -15.467 -3.657  -7.039  1.00 0.00 ? 31  TYR A CG   1  
ATOM 436   C CD1  . TYR A 1 31  ? -14.200 -3.086  -6.993  1.00 0.00 ? 31  TYR A CD1  1  
ATOM 437   C CD2  . TYR A 1 31  ? -16.261 -3.580  -5.902  1.00 0.00 ? 31  TYR A CD2  1  
ATOM 438   C CE1  . TYR A 1 31  ? -13.741 -2.458  -5.851  1.00 0.00 ? 31  TYR A CE1  1  
ATOM 439   C CE2  . TYR A 1 31  ? -15.811 -2.953  -4.756  1.00 0.00 ? 31  TYR A CE2  1  
ATOM 440   C CZ   . TYR A 1 31  ? -14.550 -2.394  -4.736  1.00 0.00 ? 31  TYR A CZ   1  
ATOM 441   O OH   . TYR A 1 31  ? -14.097 -1.770  -3.596  1.00 0.00 ? 31  TYR A OH   1  
ATOM 442   H H    . TYR A 1 31  ? -17.301 -2.224  -7.817  1.00 0.00 ? 31  TYR A H    1  
ATOM 443   H HA   . TYR A 1 31  ? -15.581 -2.884  -9.809  1.00 0.00 ? 31  TYR A HA   1  
ATOM 444   H HB2  . TYR A 1 31  ? -16.782 -4.989  -8.011  1.00 0.00 ? 31  TYR A HB2  1  
ATOM 445   H HB3  . TYR A 1 31  ? -15.157 -4.942  -8.685  1.00 0.00 ? 31  TYR A HB3  1  
ATOM 446   H HD1  . TYR A 1 31  ? -13.569 -3.137  -7.868  1.00 0.00 ? 31  TYR A HD1  1  
ATOM 447   H HD2  . TYR A 1 31  ? -17.248 -4.019  -5.921  1.00 0.00 ? 31  TYR A HD2  1  
ATOM 448   H HE1  . TYR A 1 31  ? -12.754 -2.020  -5.834  1.00 0.00 ? 31  TYR A HE1  1  
ATOM 449   H HE2  . TYR A 1 31  ? -16.444 -2.903  -3.883  1.00 0.00 ? 31  TYR A HE2  1  
ATOM 450   H HH   . TYR A 1 31  ? -14.829 -1.644  -2.988  1.00 0.00 ? 31  TYR A HH   1  
ATOM 451   N N    . ASP A 1 32  ? -16.429 -4.640  -11.439 1.00 0.00 ? 32  ASP A N    1  
ATOM 452   C CA   . ASP A 1 32  ? -17.011 -5.393  -12.544 1.00 0.00 ? 32  ASP A CA   1  
ATOM 453   C C    . ASP A 1 32  ? -16.597 -6.859  -12.480 1.00 0.00 ? 32  ASP A C    1  
ATOM 454   O O    . ASP A 1 32  ? -16.192 -7.445  -13.484 1.00 0.00 ? 32  ASP A O    1  
ATOM 455   C CB   . ASP A 1 32  ? -16.586 -4.787  -13.883 1.00 0.00 ? 32  ASP A CB   1  
ATOM 456   C CG   . ASP A 1 32  ? -17.494 -3.655  -14.321 1.00 0.00 ? 32  ASP A CG   1  
ATOM 457   O OD1  . ASP A 1 32  ? -17.455 -2.582  -13.684 1.00 0.00 ? 32  ASP A OD1  1  
ATOM 458   O OD2  . ASP A 1 32  ? -18.243 -3.843  -15.303 1.00 0.00 ? 32  ASP A OD2  1  
ATOM 459   H H    . ASP A 1 32  ? -15.459 -4.502  -11.414 1.00 0.00 ? 32  ASP A H    1  
ATOM 460   H HA   . ASP A 1 32  ? -18.086 -5.331  -12.457 1.00 0.00 ? 32  ASP A HA   1  
ATOM 461   H HB2  . ASP A 1 32  ? -15.580 -4.403  -13.793 1.00 0.00 ? 32  ASP A HB2  1  
ATOM 462   H HB3  . ASP A 1 32  ? -16.606 -5.556  -14.641 1.00 0.00 ? 32  ASP A HB3  1  
ATOM 463   N N    . PHE A 1 33  ? -16.701 -7.447  -11.293 1.00 0.00 ? 33  PHE A N    1  
ATOM 464   C CA   . PHE A 1 33  ? -16.335 -8.845  -11.097 1.00 0.00 ? 33  PHE A CA   1  
ATOM 465   C C    . PHE A 1 33  ? -17.300 -9.768  -11.835 1.00 0.00 ? 33  PHE A C    1  
ATOM 466   O O    . PHE A 1 33  ? -18.291 -9.317  -12.409 1.00 0.00 ? 33  PHE A O    1  
ATOM 467   C CB   . PHE A 1 33  ? -16.324 -9.187  -9.606  1.00 0.00 ? 33  PHE A CB   1  
ATOM 468   C CG   . PHE A 1 33  ? -15.023 -8.867  -8.927  1.00 0.00 ? 33  PHE A CG   1  
ATOM 469   C CD1  . PHE A 1 33  ? -13.998 -9.798  -8.889  1.00 0.00 ? 33  PHE A CD1  1  
ATOM 470   C CD2  . PHE A 1 33  ? -14.825 -7.634  -8.327  1.00 0.00 ? 33  PHE A CD2  1  
ATOM 471   C CE1  . PHE A 1 33  ? -12.800 -9.507  -8.265  1.00 0.00 ? 33  PHE A CE1  1  
ATOM 472   C CE2  . PHE A 1 33  ? -13.629 -7.336  -7.702  1.00 0.00 ? 33  PHE A CE2  1  
ATOM 473   C CZ   . PHE A 1 33  ? -12.615 -8.274  -7.670  1.00 0.00 ? 33  PHE A CZ   1  
ATOM 474   H H    . PHE A 1 33  ? -17.031 -6.928  -10.530 1.00 0.00 ? 33  PHE A H    1  
ATOM 475   H HA   . PHE A 1 33  ? -15.343 -8.986  -11.498 1.00 0.00 ? 33  PHE A HA   1  
ATOM 476   H HB2  . PHE A 1 33  ? -17.103 -8.628  -9.110  1.00 0.00 ? 33  PHE A HB2  1  
ATOM 477   H HB3  . PHE A 1 33  ? -16.511 -10.244 -9.485  1.00 0.00 ? 33  PHE A HB3  1  
ATOM 478   H HD1  . PHE A 1 33  ? -14.142 -10.764 -9.354  1.00 0.00 ? 33  PHE A HD1  1  
ATOM 479   H HD2  . PHE A 1 33  ? -15.617 -6.899  -8.350  1.00 0.00 ? 33  PHE A HD2  1  
ATOM 480   H HE1  . PHE A 1 33  ? -12.010 -10.242 -8.242  1.00 0.00 ? 33  PHE A HE1  1  
ATOM 481   H HE2  . PHE A 1 33  ? -13.487 -6.372  -7.237  1.00 0.00 ? 33  PHE A HE2  1  
ATOM 482   H HZ   . PHE A 1 33  ? -11.680 -8.044  -7.183  1.00 0.00 ? 33  PHE A HZ   1  
ATOM 483   N N    . SER A 1 34  ? -17.002 -11.063 -11.816 1.00 0.00 ? 34  SER A N    1  
ATOM 484   C CA   . SER A 1 34  ? -17.840 -12.051 -12.487 1.00 0.00 ? 34  SER A CA   1  
ATOM 485   C C    . SER A 1 34  ? -17.642 -13.435 -11.877 1.00 0.00 ? 34  SER A C    1  
ATOM 486   O O    . SER A 1 34  ? -16.532 -13.964 -11.856 1.00 0.00 ? 34  SER A O    1  
ATOM 487   C CB   . SER A 1 34  ? -17.521 -12.090 -13.982 1.00 0.00 ? 34  SER A CB   1  
ATOM 488   O OG   . SER A 1 34  ? -17.774 -10.835 -14.590 1.00 0.00 ? 34  SER A OG   1  
ATOM 489   H H    . SER A 1 34  ? -16.198 -11.361 -11.341 1.00 0.00 ? 34  SER A H    1  
ATOM 490   H HA   . SER A 1 34  ? -18.870 -11.756 -12.354 1.00 0.00 ? 34  SER A HA   1  
ATOM 491   H HB2  . SER A 1 34  ? -16.480 -12.340 -14.120 1.00 0.00 ? 34  SER A HB2  1  
ATOM 492   H HB3  . SER A 1 34  ? -18.137 -12.838 -14.459 1.00 0.00 ? 34  SER A HB3  1  
ATOM 493   H HG   . SER A 1 34  ? -16.996 -10.552 -15.077 1.00 0.00 ? 34  SER A HG   1  
ATOM 494   N N    . GLY A 1 35  ? -18.730 -14.017 -11.380 1.00 0.00 ? 35  GLY A N    1  
ATOM 495   C CA   . GLY A 1 35  ? -18.656 -15.334 -10.776 1.00 0.00 ? 35  GLY A CA   1  
ATOM 496   C C    . GLY A 1 35  ? -19.911 -15.689 -10.003 1.00 0.00 ? 35  GLY A C    1  
ATOM 497   O O    . GLY A 1 35  ? -20.971 -15.092 -10.192 1.00 0.00 ? 35  GLY A O    1  
ATOM 498   H H    . GLY A 1 35  ? -19.589 -13.548 -11.424 1.00 0.00 ? 35  GLY A H    1  
ATOM 499   H HA2  . GLY A 1 35  ? -18.505 -16.067 -11.554 1.00 0.00 ? 35  GLY A HA2  1  
ATOM 500   H HA3  . GLY A 1 35  ? -17.813 -15.362 -10.101 1.00 0.00 ? 35  GLY A HA3  1  
ATOM 501   N N    . PRO A 1 36  ? -19.800 -16.685 -9.112  1.00 0.00 ? 36  PRO A N    1  
ATOM 502   C CA   . PRO A 1 36  ? -20.926 -17.142 -8.291  1.00 0.00 ? 36  PRO A CA   1  
ATOM 503   C C    . PRO A 1 36  ? -21.332 -16.114 -7.240  1.00 0.00 ? 36  PRO A C    1  
ATOM 504   O O    . PRO A 1 36  ? -20.486 -15.575 -6.527  1.00 0.00 ? 36  PRO A O    1  
ATOM 505   C CB   . PRO A 1 36  ? -20.385 -18.407 -7.621  1.00 0.00 ? 36  PRO A CB   1  
ATOM 506   C CG   . PRO A 1 36  ? -18.908 -18.221 -7.595  1.00 0.00 ? 36  PRO A CG   1  
ATOM 507   C CD   . PRO A 1 36  ? -18.567 -17.441 -8.835  1.00 0.00 ? 36  PRO A CD   1  
ATOM 508   H HA   . PRO A 1 36  ? -21.783 -17.392 -8.898  1.00 0.00 ? 36  PRO A HA   1  
ATOM 509   H HB2  . PRO A 1 36  ? -20.791 -18.490 -6.622  1.00 0.00 ? 36  PRO A HB2  1  
ATOM 510   H HB3  . PRO A 1 36  ? -20.664 -19.274 -8.202  1.00 0.00 ? 36  PRO A HB3  1  
ATOM 511   H HG2  . PRO A 1 36  ? -18.622 -17.668 -6.714  1.00 0.00 ? 36  PRO A HG2  1  
ATOM 512   H HG3  . PRO A 1 36  ? -18.416 -19.183 -7.612  1.00 0.00 ? 36  PRO A HG3  1  
ATOM 513   H HD2  . PRO A 1 36  ? -17.740 -16.773 -8.645  1.00 0.00 ? 36  PRO A HD2  1  
ATOM 514   H HD3  . PRO A 1 36  ? -18.335 -18.110 -9.650  1.00 0.00 ? 36  PRO A HD3  1  
ATOM 515   N N    . SER A 1 37  ? -22.631 -15.849 -7.150  1.00 0.00 ? 37  SER A N    1  
ATOM 516   C CA   . SER A 1 37  ? -23.149 -14.883 -6.188  1.00 0.00 ? 37  SER A CA   1  
ATOM 517   C C    . SER A 1 37  ? -22.532 -15.104 -4.810  1.00 0.00 ? 37  SER A C    1  
ATOM 518   O O    . SER A 1 37  ? -22.631 -16.192 -4.241  1.00 0.00 ? 37  SER A O    1  
ATOM 519   C CB   . SER A 1 37  ? -24.673 -14.986 -6.100  1.00 0.00 ? 37  SER A CB   1  
ATOM 520   O OG   . SER A 1 37  ? -25.184 -14.131 -5.092  1.00 0.00 ? 37  SER A OG   1  
ATOM 521   H H    . SER A 1 37  ? -23.256 -16.312 -7.747  1.00 0.00 ? 37  SER A H    1  
ATOM 522   H HA   . SER A 1 37  ? -22.883 -13.895 -6.534  1.00 0.00 ? 37  SER A HA   1  
ATOM 523   H HB2  . SER A 1 37  ? -25.106 -14.705 -7.047  1.00 0.00 ? 37  SER A HB2  1  
ATOM 524   H HB3  . SER A 1 37  ? -24.949 -16.004 -5.866  1.00 0.00 ? 37  SER A HB3  1  
ATOM 525   H HG   . SER A 1 37  ? -25.439 -13.292 -5.483  1.00 0.00 ? 37  SER A HG   1  
ATOM 526   N N    . SER A 1 38  ? -21.896 -14.065 -4.280  1.00 0.00 ? 38  SER A N    1  
ATOM 527   C CA   . SER A 1 38  ? -21.259 -14.146 -2.971  1.00 0.00 ? 38  SER A CA   1  
ATOM 528   C C    . SER A 1 38  ? -22.254 -13.818 -1.861  1.00 0.00 ? 38  SER A C    1  
ATOM 529   O O    . SER A 1 38  ? -23.056 -12.894 -1.984  1.00 0.00 ? 38  SER A O    1  
ATOM 530   C CB   . SER A 1 38  ? -20.066 -13.190 -2.900  1.00 0.00 ? 38  SER A CB   1  
ATOM 531   O OG   . SER A 1 38  ? -18.980 -13.672 -3.671  1.00 0.00 ? 38  SER A OG   1  
ATOM 532   H H    . SER A 1 38  ? -21.851 -13.225 -4.783  1.00 0.00 ? 38  SER A H    1  
ATOM 533   H HA   . SER A 1 38  ? -20.906 -15.157 -2.835  1.00 0.00 ? 38  SER A HA   1  
ATOM 534   H HB2  . SER A 1 38  ? -20.360 -12.223 -3.280  1.00 0.00 ? 38  SER A HB2  1  
ATOM 535   H HB3  . SER A 1 38  ? -19.748 -13.091 -1.873  1.00 0.00 ? 38  SER A HB3  1  
ATOM 536   H HG   . SER A 1 38  ? -18.846 -13.099 -4.431  1.00 0.00 ? 38  SER A HG   1  
ATOM 537   N N    . GLY A 1 39  ? -22.195 -14.585 -0.777  1.00 0.00 ? 39  GLY A N    1  
ATOM 538   C CA   . GLY A 1 39  ? -23.095 -14.362 0.339   1.00 0.00 ? 39  GLY A CA   1  
ATOM 539   C C    . GLY A 1 39  ? -23.021 -15.467 1.374   1.00 0.00 ? 39  GLY A C    1  
ATOM 540   O O    . GLY A 1 39  ? -23.222 -15.226 2.565   1.00 0.00 ? 39  GLY A O    1  
ATOM 541   H H    . GLY A 1 39  ? -21.534 -15.308 -0.734  1.00 0.00 ? 39  GLY A H    1  
ATOM 542   H HA2  . GLY A 1 39  ? -22.842 -13.424 0.810   1.00 0.00 ? 39  GLY A HA2  1  
ATOM 543   H HA3  . GLY A 1 39  ? -24.107 -14.303 -0.036  1.00 0.00 ? 39  GLY A HA3  1  
ATOM 544   N N    . ILE A 1 40  ? -22.733 -16.683 0.920   1.00 0.00 ? 40  ILE A N    1  
ATOM 545   C CA   . ILE A 1 40  ? -22.634 -17.828 1.815   1.00 0.00 ? 40  ILE A CA   1  
ATOM 546   C C    . ILE A 1 40  ? -21.210 -18.000 2.333   1.00 0.00 ? 40  ILE A C    1  
ATOM 547   O O    . ILE A 1 40  ? -20.803 -19.099 2.707   1.00 0.00 ? 40  ILE A O    1  
ATOM 548   C CB   . ILE A 1 40  ? -23.074 -19.129 1.117   1.00 0.00 ? 40  ILE A CB   1  
ATOM 549   C CG1  . ILE A 1 40  ? -22.138 -19.448 -0.051  1.00 0.00 ? 40  ILE A CG1  1  
ATOM 550   C CG2  . ILE A 1 40  ? -24.511 -19.010 0.633   1.00 0.00 ? 40  ILE A CG2  1  
ATOM 551   C CD1  . ILE A 1 40  ? -20.946 -20.292 0.343   1.00 0.00 ? 40  ILE A CD1  1  
ATOM 552   H H    . ILE A 1 40  ? -22.583 -16.811 -0.040  1.00 0.00 ? 40  ILE A H    1  
ATOM 553   H HA   . ILE A 1 40  ? -23.292 -17.653 2.654   1.00 0.00 ? 40  ILE A HA   1  
ATOM 554   H HB   . ILE A 1 40  ? -23.027 -19.931 1.836   1.00 0.00 ? 40  ILE A HB   1  
ATOM 555   H HG12 . ILE A 1 40  ? -22.687 -19.984 -0.808  1.00 0.00 ? 40  ILE A HG12 1  
ATOM 556   H HG13 . ILE A 1 40  ? -21.767 -18.523 -0.468  1.00 0.00 ? 40  ILE A HG13 1  
ATOM 557   H HG21 . ILE A 1 40  ? -24.582 -19.380 -0.379  1.00 0.00 ? 40  ILE A HG21 1  
ATOM 558   H HG22 . ILE A 1 40  ? -25.156 -19.592 1.274   1.00 0.00 ? 40  ILE A HG22 1  
ATOM 559   H HG23 . ILE A 1 40  ? -24.816 -17.974 0.660   1.00 0.00 ? 40  ILE A HG23 1  
ATOM 560   H HD11 . ILE A 1 40  ? -20.680 -20.944 -0.477  1.00 0.00 ? 40  ILE A HD11 1  
ATOM 561   H HD12 . ILE A 1 40  ? -20.110 -19.649 0.576   1.00 0.00 ? 40  ILE A HD12 1  
ATOM 562   H HD13 . ILE A 1 40  ? -21.196 -20.887 1.209   1.00 0.00 ? 40  ILE A HD13 1  
ATOM 563   N N    . GLU A 1 41  ? -20.457 -16.904 2.353   1.00 0.00 ? 41  GLU A N    1  
ATOM 564   C CA   . GLU A 1 41  ? -19.079 -16.933 2.827   1.00 0.00 ? 41  GLU A CA   1  
ATOM 565   C C    . GLU A 1 41  ? -19.011 -17.405 4.277   1.00 0.00 ? 41  GLU A C    1  
ATOM 566   O O    . GLU A 1 41  ? -18.152 -18.206 4.641   1.00 0.00 ? 41  GLU A O    1  
ATOM 567   C CB   . GLU A 1 41  ? -18.442 -15.547 2.699   1.00 0.00 ? 41  GLU A CB   1  
ATOM 568   C CG   . GLU A 1 41  ? -17.859 -15.270 1.324   1.00 0.00 ? 41  GLU A CG   1  
ATOM 569   C CD   . GLU A 1 41  ? -18.909 -14.832 0.322   1.00 0.00 ? 41  GLU A CD   1  
ATOM 570   O OE1  . GLU A 1 41  ? -19.380 -13.680 0.421   1.00 0.00 ? 41  GLU A OE1  1  
ATOM 571   O OE2  . GLU A 1 41  ? -19.260 -15.642 -0.561  1.00 0.00 ? 41  GLU A OE2  1  
ATOM 572   H H    . GLU A 1 41  ? -20.838 -16.056 2.042   1.00 0.00 ? 41  GLU A H    1  
ATOM 573   H HA   . GLU A 1 41  ? -18.531 -17.629 2.209   1.00 0.00 ? 41  GLU A HA   1  
ATOM 574   H HB2  . GLU A 1 41  ? -19.193 -14.799 2.907   1.00 0.00 ? 41  GLU A HB2  1  
ATOM 575   H HB3  . GLU A 1 41  ? -17.650 -15.461 3.428   1.00 0.00 ? 41  GLU A HB3  1  
ATOM 576   H HG2  . GLU A 1 41  ? -17.119 -14.488 1.412   1.00 0.00 ? 41  GLU A HG2  1  
ATOM 577   H HG3  . GLU A 1 41  ? -17.387 -16.170 0.959   1.00 0.00 ? 41  GLU A HG3  1  
ATOM 578   N N    . GLY A 1 42  ? -19.925 -16.900 5.100   1.00 0.00 ? 42  GLY A N    1  
ATOM 579   C CA   . GLY A 1 42  ? -19.952 -17.280 6.501   1.00 0.00 ? 42  GLY A CA   1  
ATOM 580   C C    . GLY A 1 42  ? -20.250 -18.753 6.696   1.00 0.00 ? 42  GLY A C    1  
ATOM 581   O O    . GLY A 1 42  ? -19.607 -19.421 7.507   1.00 0.00 ? 42  GLY A O    1  
ATOM 582   H H    . GLY A 1 42  ? -20.586 -16.264 4.754   1.00 0.00 ? 42  GLY A H    1  
ATOM 583   H HA2  . GLY A 1 42  ? -18.992 -17.055 6.942   1.00 0.00 ? 42  GLY A HA2  1  
ATOM 584   H HA3  . GLY A 1 42  ? -20.712 -16.701 7.004   1.00 0.00 ? 42  GLY A HA3  1  
ATOM 585   N N    . ARG A 1 43  ? -21.228 -19.261 5.953   1.00 0.00 ? 43  ARG A N    1  
ATOM 586   C CA   . ARG A 1 43  ? -21.611 -20.664 6.051   1.00 0.00 ? 43  ARG A CA   1  
ATOM 587   C C    . ARG A 1 43  ? -20.430 -21.574 5.729   1.00 0.00 ? 43  ARG A C    1  
ATOM 588   O O    . ARG A 1 43  ? -20.149 -22.525 6.458   1.00 0.00 ? 43  ARG A O    1  
ATOM 589   C CB   . ARG A 1 43  ? -22.774 -20.964 5.103   1.00 0.00 ? 43  ARG A CB   1  
ATOM 590   C CG   . ARG A 1 43  ? -23.993 -20.087 5.337   1.00 0.00 ? 43  ARG A CG   1  
ATOM 591   C CD   . ARG A 1 43  ? -24.915 -20.684 6.389   1.00 0.00 ? 43  ARG A CD   1  
ATOM 592   N NE   . ARG A 1 43  ? -24.528 -20.293 7.742   1.00 0.00 ? 43  ARG A NE   1  
ATOM 593   C CZ   . ARG A 1 43  ? -25.247 -20.576 8.822   1.00 0.00 ? 43  ARG A CZ   1  
ATOM 594   N NH1  . ARG A 1 43  ? -26.385 -21.248 8.708   1.00 0.00 ? 43  ARG A NH1  1  
ATOM 595   N NH2  . ARG A 1 43  ? -24.829 -20.187 10.020  1.00 0.00 ? 43  ARG A NH2  1  
ATOM 596   H H    . ARG A 1 43  ? -21.703 -18.678 5.325   1.00 0.00 ? 43  ARG A H    1  
ATOM 597   H HA   . ARG A 1 43  ? -21.929 -20.851 7.066   1.00 0.00 ? 43  ARG A HA   1  
ATOM 598   H HB2  . ARG A 1 43  ? -22.441 -20.816 4.086   1.00 0.00 ? 43  ARG A HB2  1  
ATOM 599   H HB3  . ARG A 1 43  ? -23.069 -21.995 5.231   1.00 0.00 ? 43  ARG A HB3  1  
ATOM 600   H HG2  . ARG A 1 43  ? -23.665 -19.114 5.673   1.00 0.00 ? 43  ARG A HG2  1  
ATOM 601   H HG3  . ARG A 1 43  ? -24.535 -19.986 4.409   1.00 0.00 ? 43  ARG A HG3  1  
ATOM 602   H HD2  . ARG A 1 43  ? -25.922 -20.343 6.200   1.00 0.00 ? 43  ARG A HD2  1  
ATOM 603   H HD3  . ARG A 1 43  ? -24.879 -21.760 6.310   1.00 0.00 ? 43  ARG A HD3  1  
ATOM 604   H HE   . ARG A 1 43  ? -23.691 -19.796 7.849   1.00 0.00 ? 43  ARG A HE   1  
ATOM 605   H HH11 . ARG A 1 43  ? -26.702 -21.543 7.808   1.00 0.00 ? 43  ARG A HH11 1  
ATOM 606   H HH12 . ARG A 1 43  ? -26.924 -21.460 9.524   1.00 0.00 ? 43  ARG A HH12 1  
ATOM 607   H HH21 . ARG A 1 43  ? -23.972 -19.680 10.109  1.00 0.00 ? 43  ARG A HH21 1  
ATOM 608   H HH22 . ARG A 1 43  ? -25.371 -20.400 10.832  1.00 0.00 ? 43  ARG A HH22 1  
ATOM 609   N N    . GLY A 1 44  ? -19.741 -21.276 4.631   1.00 0.00 ? 44  GLY A N    1  
ATOM 610   C CA   . GLY A 1 44  ? -18.599 -22.077 4.232   1.00 0.00 ? 44  GLY A CA   1  
ATOM 611   C C    . GLY A 1 44  ? -18.956 -23.113 3.184   1.00 0.00 ? 44  GLY A C    1  
ATOM 612   O O    . GLY A 1 44  ? -19.903 -23.881 3.357   1.00 0.00 ? 44  GLY A O    1  
ATOM 613   H H    . GLY A 1 44  ? -20.011 -20.506 4.089   1.00 0.00 ? 44  GLY A H    1  
ATOM 614   H HA2  . GLY A 1 44  ? -17.837 -21.425 3.833   1.00 0.00 ? 44  GLY A HA2  1  
ATOM 615   H HA3  . GLY A 1 44  ? -18.207 -22.583 5.102   1.00 0.00 ? 44  GLY A HA3  1  
ATOM 616   N N    . SER A 1 45  ? -18.197 -23.135 2.093   1.00 0.00 ? 45  SER A N    1  
ATOM 617   C CA   . SER A 1 45  ? -18.442 -24.080 1.010   1.00 0.00 ? 45  SER A CA   1  
ATOM 618   C C    . SER A 1 45  ? -17.177 -24.302 0.186   1.00 0.00 ? 45  SER A C    1  
ATOM 619   O O    . SER A 1 45  ? -16.550 -23.349 -0.277  1.00 0.00 ? 45  SER A O    1  
ATOM 620   C CB   . SER A 1 45  ? -19.569 -23.575 0.108   1.00 0.00 ? 45  SER A CB   1  
ATOM 621   O OG   . SER A 1 45  ? -20.837 -23.821 0.691   1.00 0.00 ? 45  SER A OG   1  
ATOM 622   H H    . SER A 1 45  ? -17.457 -22.497 2.013   1.00 0.00 ? 45  SER A H    1  
ATOM 623   H HA   . SER A 1 45  ? -18.739 -25.020 1.452   1.00 0.00 ? 45  SER A HA   1  
ATOM 624   H HB2  . SER A 1 45  ? -19.456 -22.513 -0.044  1.00 0.00 ? 45  SER A HB2  1  
ATOM 625   H HB3  . SER A 1 45  ? -19.520 -24.083 -0.844  1.00 0.00 ? 45  SER A HB3  1  
ATOM 626   H HG   . SER A 1 45  ? -21.096 -24.730 0.524   1.00 0.00 ? 45  SER A HG   1  
ATOM 627   N N    . SER A 1 46  ? -16.808 -25.566 0.009   1.00 0.00 ? 46  SER A N    1  
ATOM 628   C CA   . SER A 1 46  ? -15.616 -25.915 -0.756  1.00 0.00 ? 46  SER A CA   1  
ATOM 629   C C    . SER A 1 46  ? -15.839 -25.680 -2.247  1.00 0.00 ? 46  SER A C    1  
ATOM 630   O O    . SER A 1 46  ? -16.974 -25.656 -2.720  1.00 0.00 ? 46  SER A O    1  
ATOM 631   C CB   . SER A 1 46  ? -15.235 -27.375 -0.509  1.00 0.00 ? 46  SER A CB   1  
ATOM 632   O OG   . SER A 1 46  ? -13.849 -27.583 -0.718  1.00 0.00 ? 46  SER A OG   1  
ATOM 633   H H    . SER A 1 46  ? -17.349 -26.282 0.403   1.00 0.00 ? 46  SER A H    1  
ATOM 634   H HA   . SER A 1 46  ? -14.810 -25.279 -0.420  1.00 0.00 ? 46  SER A HA   1  
ATOM 635   H HB2  . SER A 1 46  ? -15.476 -27.641 0.509   1.00 0.00 ? 46  SER A HB2  1  
ATOM 636   H HB3  . SER A 1 46  ? -15.788 -28.008 -1.187  1.00 0.00 ? 46  SER A HB3  1  
ATOM 637   H HG   . SER A 1 46  ? -13.681 -28.519 -0.851  1.00 0.00 ? 46  SER A HG   1  
ATOM 638   N N    . GLY A 1 47  ? -14.745 -25.508 -2.983  1.00 0.00 ? 47  GLY A N    1  
ATOM 639   C CA   . GLY A 1 47  ? -14.841 -25.277 -4.412  1.00 0.00 ? 47  GLY A CA   1  
ATOM 640   C C    . GLY A 1 47  ? -14.014 -24.091 -4.865  1.00 0.00 ? 47  GLY A C    1  
ATOM 641   O O    . GLY A 1 47  ? -14.547 -23.005 -5.095  1.00 0.00 ? 47  GLY A O    1  
ATOM 642   H H    . GLY A 1 47  ? -13.865 -25.537 -2.551  1.00 0.00 ? 47  GLY A H    1  
ATOM 643   H HA2  . GLY A 1 47  ? -14.500 -26.160 -4.932  1.00 0.00 ? 47  GLY A HA2  1  
ATOM 644   H HA3  . GLY A 1 47  ? -15.875 -25.099 -4.667  1.00 0.00 ? 47  GLY A HA3  1  
ATOM 645   N N    . SER A 1 48  ? -12.707 -24.296 -4.992  1.00 0.00 ? 48  SER A N    1  
ATOM 646   C CA   . SER A 1 48  ? -11.804 -23.232 -5.415  1.00 0.00 ? 48  SER A CA   1  
ATOM 647   C C    . SER A 1 48  ? -11.134 -23.583 -6.740  1.00 0.00 ? 48  SER A C    1  
ATOM 648   O O    . SER A 1 48  ? -9.938  -23.356 -6.924  1.00 0.00 ? 48  SER A O    1  
ATOM 649   C CB   . SER A 1 48  ? -10.740 -22.982 -4.344  1.00 0.00 ? 48  SER A CB   1  
ATOM 650   O OG   . SER A 1 48  ? -9.724  -23.969 -4.393  1.00 0.00 ? 48  SER A OG   1  
ATOM 651   H H    . SER A 1 48  ? -12.341 -25.184 -4.793  1.00 0.00 ? 48  SER A H    1  
ATOM 652   H HA   . SER A 1 48  ? -12.388 -22.334 -5.547  1.00 0.00 ? 48  SER A HA   1  
ATOM 653   H HB2  . SER A 1 48  ? -10.292 -22.013 -4.505  1.00 0.00 ? 48  SER A HB2  1  
ATOM 654   H HB3  . SER A 1 48  ? -11.203 -23.007 -3.368  1.00 0.00 ? 48  SER A HB3  1  
ATOM 655   H HG   . SER A 1 48  ? -8.960  -23.667 -3.896  1.00 0.00 ? 48  SER A HG   1  
ATOM 656   N N    . SER A 1 49  ? -11.915 -24.139 -7.661  1.00 0.00 ? 49  SER A N    1  
ATOM 657   C CA   . SER A 1 49  ? -11.398 -24.526 -8.969  1.00 0.00 ? 49  SER A CA   1  
ATOM 658   C C    . SER A 1 49  ? -11.622 -23.416 -9.991  1.00 0.00 ? 49  SER A C    1  
ATOM 659   O O    . SER A 1 49  ? -12.647 -22.735 -9.971  1.00 0.00 ? 49  SER A O    1  
ATOM 660   C CB   . SER A 1 49  ? -12.069 -25.816 -9.445  1.00 0.00 ? 49  SER A CB   1  
ATOM 661   O OG   . SER A 1 49  ? -11.626 -26.172 -10.743 1.00 0.00 ? 49  SER A OG   1  
ATOM 662   H H    . SER A 1 49  ? -12.860 -24.295 -7.455  1.00 0.00 ? 49  SER A H    1  
ATOM 663   H HA   . SER A 1 49  ? -10.337 -24.698 -8.868  1.00 0.00 ? 49  SER A HA   1  
ATOM 664   H HB2  . SER A 1 49  ? -11.828 -26.617 -8.763  1.00 0.00 ? 49  SER A HB2  1  
ATOM 665   H HB3  . SER A 1 49  ? -13.140 -25.673 -9.469  1.00 0.00 ? 49  SER A HB3  1  
ATOM 666   H HG   . SER A 1 49  ? -12.384 -26.385 -11.292 1.00 0.00 ? 49  SER A HG   1  
ATOM 667   N N    . GLY A 1 50  ? -10.654 -23.239 -10.886 1.00 0.00 ? 50  GLY A N    1  
ATOM 668   C CA   . GLY A 1 50  ? -10.763 -22.211 -11.904 1.00 0.00 ? 50  GLY A CA   1  
ATOM 669   C C    . GLY A 1 50  ? -9.925  -22.517 -13.129 1.00 0.00 ? 50  GLY A C    1  
ATOM 670   O O    . GLY A 1 50  ? -10.204 -23.468 -13.859 1.00 0.00 ? 50  GLY A O    1  
ATOM 671   H H    . GLY A 1 50  ? -9.859  -23.812 -10.854 1.00 0.00 ? 50  GLY A H    1  
ATOM 672   H HA2  . GLY A 1 50  ? -11.798 -22.122 -12.201 1.00 0.00 ? 50  GLY A HA2  1  
ATOM 673   H HA3  . GLY A 1 50  ? -10.438 -21.270 -11.485 1.00 0.00 ? 50  GLY A HA3  1  
ATOM 674   N N    . SER A 1 51  ? -8.895  -21.708 -13.356 1.00 0.00 ? 51  SER A N    1  
ATOM 675   C CA   . SER A 1 51  ? -8.016  -21.894 -14.505 1.00 0.00 ? 51  SER A CA   1  
ATOM 676   C C    . SER A 1 51  ? -7.489  -23.324 -14.560 1.00 0.00 ? 51  SER A C    1  
ATOM 677   O O    . SER A 1 51  ? -6.752  -23.760 -13.675 1.00 0.00 ? 51  SER A O    1  
ATOM 678   C CB   . SER A 1 51  ? -6.847  -20.909 -14.445 1.00 0.00 ? 51  SER A CB   1  
ATOM 679   O OG   . SER A 1 51  ? -6.153  -21.017 -13.214 1.00 0.00 ? 51  SER A OG   1  
ATOM 680   H H    . SER A 1 51  ? -8.724  -20.967 -12.738 1.00 0.00 ? 51  SER A H    1  
ATOM 681   H HA   . SER A 1 51  ? -8.592  -21.701 -15.398 1.00 0.00 ? 51  SER A HA   1  
ATOM 682   H HB2  . SER A 1 51  ? -6.161  -21.118 -15.251 1.00 0.00 ? 51  SER A HB2  1  
ATOM 683   H HB3  . SER A 1 51  ? -7.224  -19.901 -14.545 1.00 0.00 ? 51  SER A HB3  1  
ATOM 684   H HG   . SER A 1 51  ? -6.756  -20.839 -12.489 1.00 0.00 ? 51  SER A HG   1  
ATOM 685   N N    . SER A 1 52  ? -7.871  -24.050 -15.606 1.00 0.00 ? 52  SER A N    1  
ATOM 686   C CA   . SER A 1 52  ? -7.440  -25.433 -15.775 1.00 0.00 ? 52  SER A CA   1  
ATOM 687   C C    . SER A 1 52  ? -6.111  -25.500 -16.521 1.00 0.00 ? 52  SER A C    1  
ATOM 688   O O    . SER A 1 52  ? -5.139  -26.073 -16.030 1.00 0.00 ? 52  SER A O    1  
ATOM 689   C CB   . SER A 1 52  ? -8.504  -26.231 -16.532 1.00 0.00 ? 52  SER A CB   1  
ATOM 690   O OG   . SER A 1 52  ? -9.661  -26.422 -15.737 1.00 0.00 ? 52  SER A OG   1  
ATOM 691   H H    . SER A 1 52  ? -8.459  -23.646 -16.278 1.00 0.00 ? 52  SER A H    1  
ATOM 692   H HA   . SER A 1 52  ? -7.311  -25.862 -14.793 1.00 0.00 ? 52  SER A HA   1  
ATOM 693   H HB2  . SER A 1 52  ? -8.782  -25.697 -17.428 1.00 0.00 ? 52  SER A HB2  1  
ATOM 694   H HB3  . SER A 1 52  ? -8.102  -27.197 -16.800 1.00 0.00 ? 52  SER A HB3  1  
ATOM 695   H HG   . SER A 1 52  ? -9.732  -25.708 -15.098 1.00 0.00 ? 52  SER A HG   1  
ATOM 696   N N    . GLY A 1 53  ? -6.077  -24.910 -17.712 1.00 0.00 ? 53  GLY A N    1  
ATOM 697   C CA   . GLY A 1 53  ? -4.863  -24.913 -18.507 1.00 0.00 ? 53  GLY A CA   1  
ATOM 698   C C    . GLY A 1 53  ? -3.979  -23.716 -18.222 1.00 0.00 ? 53  GLY A C    1  
ATOM 699   O O    . GLY A 1 53  ? -3.817  -23.316 -17.069 1.00 0.00 ? 53  GLY A O    1  
ATOM 700   H H    . GLY A 1 53  ? -6.883  -24.468 -18.053 1.00 0.00 ? 53  GLY A H    1  
ATOM 701   H HA2  . GLY A 1 53  ? -4.309  -25.816 -18.295 1.00 0.00 ? 53  GLY A HA2  1  
ATOM 702   H HA3  . GLY A 1 53  ? -5.132  -24.906 -19.553 1.00 0.00 ? 53  GLY A HA3  1  
ATOM 703   N N    . SER A 1 54  ? -3.404  -23.142 -19.274 1.00 0.00 ? 54  SER A N    1  
ATOM 704   C CA   . SER A 1 54  ? -2.526  -21.987 -19.130 1.00 0.00 ? 54  SER A CA   1  
ATOM 705   C C    . SER A 1 54  ? -3.176  -20.735 -19.714 1.00 0.00 ? 54  SER A C    1  
ATOM 706   O O    . SER A 1 54  ? -2.920  -20.367 -20.860 1.00 0.00 ? 54  SER A O    1  
ATOM 707   C CB   . SER A 1 54  ? -1.186  -22.248 -19.820 1.00 0.00 ? 54  SER A CB   1  
ATOM 708   O OG   . SER A 1 54  ? -0.555  -23.400 -19.287 1.00 0.00 ? 54  SER A OG   1  
ATOM 709   H H    . SER A 1 54  ? -3.572  -23.507 -20.168 1.00 0.00 ? 54  SER A H    1  
ATOM 710   H HA   . SER A 1 54  ? -2.355  -21.830 -18.076 1.00 0.00 ? 54  SER A HA   1  
ATOM 711   H HB2  . SER A 1 54  ? -1.351  -22.398 -20.876 1.00 0.00 ? 54  SER A HB2  1  
ATOM 712   H HB3  . SER A 1 54  ? -0.537  -21.396 -19.674 1.00 0.00 ? 54  SER A HB3  1  
ATOM 713   H HG   . SER A 1 54  ? -0.811  -24.171 -19.799 1.00 0.00 ? 54  SER A HG   1  
ATOM 714   N N    . SER A 1 55  ? -4.018  -20.087 -18.916 1.00 0.00 ? 55  SER A N    1  
ATOM 715   C CA   . SER A 1 55  ? -4.709  -18.879 -19.354 1.00 0.00 ? 55  SER A CA   1  
ATOM 716   C C    . SER A 1 55  ? -3.754  -17.689 -19.386 1.00 0.00 ? 55  SER A C    1  
ATOM 717   O O    . SER A 1 55  ? -3.701  -16.949 -20.367 1.00 0.00 ? 55  SER A O    1  
ATOM 718   C CB   . SER A 1 55  ? -5.888  -18.576 -18.427 1.00 0.00 ? 55  SER A CB   1  
ATOM 719   O OG   . SER A 1 55  ? -5.472  -18.519 -17.074 1.00 0.00 ? 55  SER A OG   1  
ATOM 720   H H    . SER A 1 55  ? -4.181  -20.430 -18.013 1.00 0.00 ? 55  SER A H    1  
ATOM 721   H HA   . SER A 1 55  ? -5.082  -19.054 -20.352 1.00 0.00 ? 55  SER A HA   1  
ATOM 722   H HB2  . SER A 1 55  ? -6.320  -17.625 -18.698 1.00 0.00 ? 55  SER A HB2  1  
ATOM 723   H HB3  . SER A 1 55  ? -6.632  -19.353 -18.531 1.00 0.00 ? 55  SER A HB3  1  
ATOM 724   H HG   . SER A 1 55  ? -6.097  -17.995 -16.568 1.00 0.00 ? 55  SER A HG   1  
ATOM 725   N N    . GLY A 1 56  ? -3.001  -17.513 -18.304 1.00 0.00 ? 56  GLY A N    1  
ATOM 726   C CA   . GLY A 1 56  ? -2.058  -16.412 -18.228 1.00 0.00 ? 56  GLY A CA   1  
ATOM 727   C C    . GLY A 1 56  ? -1.310  -16.380 -16.911 1.00 0.00 ? 56  GLY A C    1  
ATOM 728   O O    . GLY A 1 56  ? -1.704  -15.673 -15.983 1.00 0.00 ? 56  GLY A O    1  
ATOM 729   H H    . GLY A 1 56  ? -3.086  -18.136 -17.552 1.00 0.00 ? 56  GLY A H    1  
ATOM 730   H HA2  . GLY A 1 56  ? -1.345  -16.507 -19.033 1.00 0.00 ? 56  GLY A HA2  1  
ATOM 731   H HA3  . GLY A 1 56  ? -2.597  -15.483 -18.346 1.00 0.00 ? 56  GLY A HA3  1  
ATOM 732   N N    . ASP A 1 57  ? -0.229  -17.148 -16.827 1.00 0.00 ? 57  ASP A N    1  
ATOM 733   C CA   . ASP A 1 57  ? 0.576   -17.205 -15.612 1.00 0.00 ? 57  ASP A CA   1  
ATOM 734   C C    . ASP A 1 57  ? 1.609   -16.083 -15.592 1.00 0.00 ? 57  ASP A C    1  
ATOM 735   O O    . ASP A 1 57  ? 2.792   -16.318 -15.343 1.00 0.00 ? 57  ASP A O    1  
ATOM 736   C CB   . ASP A 1 57  ? 1.274   -18.561 -15.501 1.00 0.00 ? 57  ASP A CB   1  
ATOM 737   C CG   . ASP A 1 57  ? 0.389   -19.619 -14.873 1.00 0.00 ? 57  ASP A CG   1  
ATOM 738   O OD1  . ASP A 1 57  ? -0.275  -19.313 -13.860 1.00 0.00 ? 57  ASP A OD1  1  
ATOM 739   O OD2  . ASP A 1 57  ? 0.358   -20.753 -15.395 1.00 0.00 ? 57  ASP A OD2  1  
ATOM 740   H H    . ASP A 1 57  ? 0.034   -17.689 -17.601 1.00 0.00 ? 57  ASP A H    1  
ATOM 741   H HA   . ASP A 1 57  ? -0.087  -17.082 -14.769 1.00 0.00 ? 57  ASP A HA   1  
ATOM 742   H HB2  . ASP A 1 57  ? 1.557   -18.895 -16.489 1.00 0.00 ? 57  ASP A HB2  1  
ATOM 743   H HB3  . ASP A 1 57  ? 2.162   -18.453 -14.895 1.00 0.00 ? 57  ASP A HB3  1  
ATOM 744   N N    . LYS A 1 58  ? 1.156   -14.863 -15.857 1.00 0.00 ? 58  LYS A N    1  
ATOM 745   C CA   . LYS A 1 58  ? 2.040   -13.704 -15.870 1.00 0.00 ? 58  LYS A CA   1  
ATOM 746   C C    . LYS A 1 58  ? 1.540   -12.628 -14.910 1.00 0.00 ? 58  LYS A C    1  
ATOM 747   O O    . LYS A 1 58  ? 0.909   -11.658 -15.326 1.00 0.00 ? 58  LYS A O    1  
ATOM 748   C CB   . LYS A 1 58  ? 2.143   -13.131 -17.285 1.00 0.00 ? 58  LYS A CB   1  
ATOM 749   C CG   . LYS A 1 58  ? 3.271   -13.734 -18.104 1.00 0.00 ? 58  LYS A CG   1  
ATOM 750   C CD   . LYS A 1 58  ? 3.827   -12.737 -19.107 1.00 0.00 ? 58  LYS A CD   1  
ATOM 751   C CE   . LYS A 1 58  ? 4.972   -11.929 -18.514 1.00 0.00 ? 58  LYS A CE   1  
ATOM 752   N NZ   . LYS A 1 58  ? 6.266   -12.661 -18.596 1.00 0.00 ? 58  LYS A NZ   1  
ATOM 753   H H    . LYS A 1 58  ? 0.202   -14.739 -16.048 1.00 0.00 ? 58  LYS A H    1  
ATOM 754   H HA   . LYS A 1 58  ? 3.018   -14.029 -15.550 1.00 0.00 ? 58  LYS A HA   1  
ATOM 755   H HB2  . LYS A 1 58  ? 1.213   -13.312 -17.803 1.00 0.00 ? 58  LYS A HB2  1  
ATOM 756   H HB3  . LYS A 1 58  ? 2.306   -12.065 -17.218 1.00 0.00 ? 58  LYS A HB3  1  
ATOM 757   H HG2  . LYS A 1 58  ? 4.065   -14.038 -17.439 1.00 0.00 ? 58  LYS A HG2  1  
ATOM 758   H HG3  . LYS A 1 58  ? 2.895   -14.596 -18.638 1.00 0.00 ? 58  LYS A HG3  1  
ATOM 759   H HD2  . LYS A 1 58  ? 4.189   -13.272 -19.972 1.00 0.00 ? 58  LYS A HD2  1  
ATOM 760   H HD3  . LYS A 1 58  ? 3.038   -12.061 -19.405 1.00 0.00 ? 58  LYS A HD3  1  
ATOM 761   H HE2  . LYS A 1 58  ? 5.058   -11.000 -19.056 1.00 0.00 ? 58  LYS A HE2  1  
ATOM 762   H HE3  . LYS A 1 58  ? 4.750   -11.722 -17.478 1.00 0.00 ? 58  LYS A HE3  1  
ATOM 763   H HZ1  . LYS A 1 58  ? 6.474   -12.911 -19.583 1.00 0.00 ? 58  LYS A HZ1  1  
ATOM 764   H HZ2  . LYS A 1 58  ? 6.220   -13.533 -18.031 1.00 0.00 ? 58  LYS A HZ2  1  
ATOM 765   H HZ3  . LYS A 1 58  ? 7.037   -12.065 -18.231 1.00 0.00 ? 58  LYS A HZ3  1  
ATOM 766   N N    . GLU A 1 59  ? 1.830   -12.808 -13.625 1.00 0.00 ? 59  GLU A N    1  
ATOM 767   C CA   . GLU A 1 59  ? 1.410   -11.852 -12.607 1.00 0.00 ? 59  GLU A CA   1  
ATOM 768   C C    . GLU A 1 59  ? 2.478   -10.784 -12.390 1.00 0.00 ? 59  GLU A C    1  
ATOM 769   O O    . GLU A 1 59  ? 3.583   -10.878 -12.926 1.00 0.00 ? 59  GLU A O    1  
ATOM 770   C CB   . GLU A 1 59  ? 1.117   -12.571 -11.289 1.00 0.00 ? 59  GLU A CB   1  
ATOM 771   C CG   . GLU A 1 59  ? 0.053   -13.650 -11.408 1.00 0.00 ? 59  GLU A CG   1  
ATOM 772   C CD   . GLU A 1 59  ? 0.500   -14.818 -12.264 1.00 0.00 ? 59  GLU A CD   1  
ATOM 773   O OE1  . GLU A 1 59  ? 1.652   -15.271 -12.095 1.00 0.00 ? 59  GLU A OE1  1  
ATOM 774   O OE2  . GLU A 1 59  ? -0.301  -15.280 -13.104 1.00 0.00 ? 59  GLU A OE2  1  
ATOM 775   H H    . GLU A 1 59  ? 2.336   -13.602 -13.355 1.00 0.00 ? 59  GLU A H    1  
ATOM 776   H HA   . GLU A 1 59  ? 0.506   -11.374 -12.954 1.00 0.00 ? 59  GLU A HA   1  
ATOM 777   H HB2  . GLU A 1 59  ? 2.028   -13.030 -10.933 1.00 0.00 ? 59  GLU A HB2  1  
ATOM 778   H HB3  . GLU A 1 59  ? 0.783   -11.845 -10.563 1.00 0.00 ? 59  GLU A HB3  1  
ATOM 779   H HG2  . GLU A 1 59  ? -0.181  -14.016 -10.420 1.00 0.00 ? 59  GLU A HG2  1  
ATOM 780   H HG3  . GLU A 1 59  ? -0.833  -13.217 -11.849 1.00 0.00 ? 59  GLU A HG3  1  
ATOM 781   N N    . ARG A 1 60  ? 2.140   -9.769  -11.602 1.00 0.00 ? 60  ARG A N    1  
ATOM 782   C CA   . ARG A 1 60  ? 3.069   -8.682  -11.315 1.00 0.00 ? 60  ARG A CA   1  
ATOM 783   C C    . ARG A 1 60  ? 3.574   -8.764  -9.877  1.00 0.00 ? 60  ARG A C    1  
ATOM 784   O O    . ARG A 1 60  ? 2.809   -9.045  -8.954  1.00 0.00 ? 60  ARG A O    1  
ATOM 785   C CB   . ARG A 1 60  ? 2.395   -7.330  -11.553 1.00 0.00 ? 60  ARG A CB   1  
ATOM 786   C CG   . ARG A 1 60  ? 3.362   -6.230  -11.960 1.00 0.00 ? 60  ARG A CG   1  
ATOM 787   C CD   . ARG A 1 60  ? 2.636   -4.922  -12.230 1.00 0.00 ? 60  ARG A CD   1  
ATOM 788   N NE   . ARG A 1 60  ? 2.132   -4.848  -13.599 1.00 0.00 ? 60  ARG A NE   1  
ATOM 789   C CZ   . ARG A 1 60  ? 2.915   -4.714  -14.664 1.00 0.00 ? 60  ARG A CZ   1  
ATOM 790   N NH1  . ARG A 1 60  ? 4.231   -4.641  -14.519 1.00 0.00 ? 60  ARG A NH1  1  
ATOM 791   N NH2  . ARG A 1 60  ? 2.381   -4.655  -15.878 1.00 0.00 ? 60  ARG A NH2  1  
ATOM 792   H H    . ARG A 1 60  ? 1.245   -9.750  -11.204 1.00 0.00 ? 60  ARG A H    1  
ATOM 793   H HA   . ARG A 1 60  ? 3.910   -8.779  -11.985 1.00 0.00 ? 60  ARG A HA   1  
ATOM 794   H HB2  . ARG A 1 60  ? 1.660   -7.441  -12.337 1.00 0.00 ? 60  ARG A HB2  1  
ATOM 795   H HB3  . ARG A 1 60  ? 1.897   -7.024  -10.645 1.00 0.00 ? 60  ARG A HB3  1  
ATOM 796   H HG2  . ARG A 1 60  ? 4.073   -6.076  -11.162 1.00 0.00 ? 60  ARG A HG2  1  
ATOM 797   H HG3  . ARG A 1 60  ? 3.883   -6.535  -12.856 1.00 0.00 ? 60  ARG A HG3  1  
ATOM 798   H HD2  . ARG A 1 60  ? 1.805   -4.839  -11.546 1.00 0.00 ? 60  ARG A HD2  1  
ATOM 799   H HD3  . ARG A 1 60  ? 3.322   -4.104  -12.064 1.00 0.00 ? 60  ARG A HD3  1  
ATOM 800   H HE   . ARG A 1 60  ? 1.163   -4.900  -13.729 1.00 0.00 ? 60  ARG A HE   1  
ATOM 801   H HH11 . ARG A 1 60  ? 4.635   -4.686  -13.606 1.00 0.00 ? 60  ARG A HH11 1  
ATOM 802   H HH12 . ARG A 1 60  ? 4.818   -4.541  -15.323 1.00 0.00 ? 60  ARG A HH12 1  
ATOM 803   H HH21 . ARG A 1 60  ? 1.390   -4.710  -15.991 1.00 0.00 ? 60  ARG A HH21 1  
ATOM 804   H HH22 . ARG A 1 60  ? 2.971   -4.554  -16.678 1.00 0.00 ? 60  ARG A HH22 1  
ATOM 805   N N    . HIS A 1 61  ? 4.868   -8.517  -9.695  1.00 0.00 ? 61  HIS A N    1  
ATOM 806   C CA   . HIS A 1 61  ? 5.475   -8.563  -8.370  1.00 0.00 ? 61  HIS A CA   1  
ATOM 807   C C    . HIS A 1 61  ? 5.531   -7.170  -7.750  1.00 0.00 ? 61  HIS A C    1  
ATOM 808   O O    . HIS A 1 61  ? 6.181   -6.270  -8.279  1.00 0.00 ? 61  HIS A O    1  
ATOM 809   C CB   . HIS A 1 61  ? 6.883   -9.155  -8.451  1.00 0.00 ? 61  HIS A CB   1  
ATOM 810   C CG   . HIS A 1 61  ? 7.295   -9.892  -7.214  1.00 0.00 ? 61  HIS A CG   1  
ATOM 811   N ND1  . HIS A 1 61  ? 8.386   -9.531  -6.452  1.00 0.00 ? 61  HIS A ND1  1  
ATOM 812   C CD2  . HIS A 1 61  ? 6.755   -10.974 -6.607  1.00 0.00 ? 61  HIS A CD2  1  
ATOM 813   C CE1  . HIS A 1 61  ? 8.500   -10.361 -5.430  1.00 0.00 ? 61  HIS A CE1  1  
ATOM 814   N NE2  . HIS A 1 61  ? 7.522   -11.246 -5.501  1.00 0.00 ? 61  HIS A NE2  1  
ATOM 815   H H    . HIS A 1 61  ? 5.426   -8.299  -10.470 1.00 0.00 ? 61  HIS A H    1  
ATOM 816   H HA   . HIS A 1 61  ? 4.863   -9.197  -7.746  1.00 0.00 ? 61  HIS A HA   1  
ATOM 817   H HB2  . HIS A 1 61  ? 6.928   -9.846  -9.279  1.00 0.00 ? 61  HIS A HB2  1  
ATOM 818   H HB3  . HIS A 1 61  ? 7.593   -8.357  -8.616  1.00 0.00 ? 61  HIS A HB3  1  
ATOM 819   H HD1  . HIS A 1 61  ? 8.988   -8.780  -6.633  1.00 0.00 ? 61  HIS A HD1  1  
ATOM 820   H HD2  . HIS A 1 61  ? 5.883   -11.524 -6.933  1.00 0.00 ? 61  HIS A HD2  1  
ATOM 821   H HE1  . HIS A 1 61  ? 9.262   -10.322 -4.666  1.00 0.00 ? 61  HIS A HE1  1  
ATOM 822   H HE2  . HIS A 1 61  ? 7.423   -12.025 -4.916  1.00 0.00 ? 61  HIS A HE2  1  
ATOM 823   N N    . GLY A 1 62  ? 4.845   -7.001  -6.623  1.00 0.00 ? 62  GLY A N    1  
ATOM 824   C CA   . GLY A 1 62  ? 4.829   -5.715  -5.950  1.00 0.00 ? 62  GLY A CA   1  
ATOM 825   C C    . GLY A 1 62  ? 5.294   -5.809  -4.511  1.00 0.00 ? 62  GLY A C    1  
ATOM 826   O O    . GLY A 1 62  ? 5.453   -6.904  -3.972  1.00 0.00 ? 62  GLY A O    1  
ATOM 827   H H    . GLY A 1 62  ? 4.345   -7.755  -6.247  1.00 0.00 ? 62  GLY A H    1  
ATOM 828   H HA2  . GLY A 1 62  ? 5.476   -5.034  -6.483  1.00 0.00 ? 62  GLY A HA2  1  
ATOM 829   H HA3  . GLY A 1 62  ? 3.822   -5.326  -5.966  1.00 0.00 ? 62  GLY A HA3  1  
ATOM 830   N N    . VAL A 1 63  ? 5.514   -4.657  -3.885  1.00 0.00 ? 63  VAL A N    1  
ATOM 831   C CA   . VAL A 1 63  ? 5.964   -4.613  -2.499  1.00 0.00 ? 63  VAL A CA   1  
ATOM 832   C C    . VAL A 1 63  ? 5.360   -3.423  -1.763  1.00 0.00 ? 63  VAL A C    1  
ATOM 833   O O    . VAL A 1 63  ? 5.405   -2.292  -2.247  1.00 0.00 ? 63  VAL A O    1  
ATOM 834   C CB   . VAL A 1 63  ? 7.500   -4.532  -2.410  1.00 0.00 ? 63  VAL A CB   1  
ATOM 835   C CG1  . VAL A 1 63  ? 7.930   -4.036  -1.038  1.00 0.00 ? 63  VAL A CG1  1  
ATOM 836   C CG2  . VAL A 1 63  ? 8.123   -5.885  -2.716  1.00 0.00 ? 63  VAL A CG2  1  
ATOM 837   H H    . VAL A 1 63  ? 5.369   -3.816  -4.368  1.00 0.00 ? 63  VAL A H    1  
ATOM 838   H HA   . VAL A 1 63  ? 5.644   -5.524  -2.015  1.00 0.00 ? 63  VAL A HA   1  
ATOM 839   H HB   . VAL A 1 63  ? 7.846   -3.824  -3.149  1.00 0.00 ? 63  VAL A HB   1  
ATOM 840   H HG11 . VAL A 1 63  ? 7.691   -2.987  -0.944  1.00 0.00 ? 63  VAL A HG11 1  
ATOM 841   H HG12 . VAL A 1 63  ? 7.411   -4.595  -0.274  1.00 0.00 ? 63  VAL A HG12 1  
ATOM 842   H HG13 . VAL A 1 63  ? 8.995   -4.173  -0.924  1.00 0.00 ? 63  VAL A HG13 1  
ATOM 843   H HG21 . VAL A 1 63  ? 7.961   -6.553  -1.884  1.00 0.00 ? 63  VAL A HG21 1  
ATOM 844   H HG22 . VAL A 1 63  ? 7.667   -6.298  -3.604  1.00 0.00 ? 63  VAL A HG22 1  
ATOM 845   H HG23 . VAL A 1 63  ? 9.184   -5.765  -2.880  1.00 0.00 ? 63  VAL A HG23 1  
ATOM 846   N N    . ALA A 1 64  ? 4.795   -3.685  -0.589  1.00 0.00 ? 64  ALA A N    1  
ATOM 847   C CA   . ALA A 1 64  ? 4.184   -2.636  0.217   1.00 0.00 ? 64  ALA A CA   1  
ATOM 848   C C    . ALA A 1 64  ? 5.239   -1.686  0.773   1.00 0.00 ? 64  ALA A C    1  
ATOM 849   O O    . ALA A 1 64  ? 6.200   -2.116  1.411   1.00 0.00 ? 64  ALA A O    1  
ATOM 850   C CB   . ALA A 1 64  ? 3.370   -3.245  1.349   1.00 0.00 ? 64  ALA A CB   1  
ATOM 851   H H    . ALA A 1 64  ? 4.791   -4.607  -0.256  1.00 0.00 ? 64  ALA A H    1  
ATOM 852   H HA   . ALA A 1 64  ? 3.510   -2.077  -0.417  1.00 0.00 ? 64  ALA A HA   1  
ATOM 853   H HB1  . ALA A 1 64  ? 3.099   -2.472  2.053   1.00 0.00 ? 64  ALA A HB1  1  
ATOM 854   H HB2  . ALA A 1 64  ? 2.476   -3.697  0.947   1.00 0.00 ? 64  ALA A HB2  1  
ATOM 855   H HB3  . ALA A 1 64  ? 3.960   -3.998  1.851   1.00 0.00 ? 64  ALA A HB3  1  
ATOM 856   N N    . ILE A 1 65  ? 5.054   -0.393  0.527   1.00 0.00 ? 65  ILE A N    1  
ATOM 857   C CA   . ILE A 1 65  ? 5.990   0.617   1.004   1.00 0.00 ? 65  ILE A CA   1  
ATOM 858   C C    . ILE A 1 65  ? 5.415   1.383   2.190   1.00 0.00 ? 65  ILE A C    1  
ATOM 859   O O    . ILE A 1 65  ? 6.156   1.914   3.018   1.00 0.00 ? 65  ILE A O    1  
ATOM 860   C CB   . ILE A 1 65  ? 6.356   1.616   -0.110  1.00 0.00 ? 65  ILE A CB   1  
ATOM 861   C CG1  . ILE A 1 65  ? 5.091   2.129   -0.800  1.00 0.00 ? 65  ILE A CG1  1  
ATOM 862   C CG2  . ILE A 1 65  ? 7.290   0.966   -1.119  1.00 0.00 ? 65  ILE A CG2  1  
ATOM 863   C CD1  . ILE A 1 65  ? 5.350   3.254   -1.778  1.00 0.00 ? 65  ILE A CD1  1  
ATOM 864   H H    . ILE A 1 65  ? 4.269   -0.112  0.013   1.00 0.00 ? 65  ILE A H    1  
ATOM 865   H HA   . ILE A 1 65  ? 6.893   0.112   1.318   1.00 0.00 ? 65  ILE A HA   1  
ATOM 866   H HB   . ILE A 1 65  ? 6.875   2.448   0.341   1.00 0.00 ? 65  ILE A HB   1  
ATOM 867   H HG12 . ILE A 1 65  ? 4.630   1.319   -1.342  1.00 0.00 ? 65  ILE A HG12 1  
ATOM 868   H HG13 . ILE A 1 65  ? 4.403   2.492   -0.050  1.00 0.00 ? 65  ILE A HG13 1  
ATOM 869   H HG21 . ILE A 1 65  ? 7.043   -0.081  -1.216  1.00 0.00 ? 65  ILE A HG21 1  
ATOM 870   H HG22 . ILE A 1 65  ? 7.178   1.451   -2.077  1.00 0.00 ? 65  ILE A HG22 1  
ATOM 871   H HG23 . ILE A 1 65  ? 8.311   1.065   -0.781  1.00 0.00 ? 65  ILE A HG23 1  
ATOM 872   H HD11 . ILE A 1 65  ? 5.480   2.845   -2.770  1.00 0.00 ? 65  ILE A HD11 1  
ATOM 873   H HD12 . ILE A 1 65  ? 4.510   3.933   -1.777  1.00 0.00 ? 65  ILE A HD12 1  
ATOM 874   H HD13 . ILE A 1 65  ? 6.244   3.785   -1.488  1.00 0.00 ? 65  ILE A HD13 1  
ATOM 875   N N    . TYR A 1 66  ? 4.090   1.435   2.268   1.00 0.00 ? 66  TYR A N    1  
ATOM 876   C CA   . TYR A 1 66  ? 3.415   2.136   3.353   1.00 0.00 ? 66  TYR A CA   1  
ATOM 877   C C    . TYR A 1 66  ? 2.474   1.200   4.105   1.00 0.00 ? 66  TYR A C    1  
ATOM 878   O O    . TYR A 1 66  ? 1.755   0.407   3.500   1.00 0.00 ? 66  TYR A O    1  
ATOM 879   C CB   . TYR A 1 66  ? 2.632   3.332   2.807   1.00 0.00 ? 66  TYR A CB   1  
ATOM 880   C CG   . TYR A 1 66  ? 3.513   4.450   2.296   1.00 0.00 ? 66  TYR A CG   1  
ATOM 881   C CD1  . TYR A 1 66  ? 4.405   5.099   3.140   1.00 0.00 ? 66  TYR A CD1  1  
ATOM 882   C CD2  . TYR A 1 66  ? 3.454   4.856   0.968   1.00 0.00 ? 66  TYR A CD2  1  
ATOM 883   C CE1  . TYR A 1 66  ? 5.211   6.121   2.678   1.00 0.00 ? 66  TYR A CE1  1  
ATOM 884   C CE2  . TYR A 1 66  ? 4.257   5.876   0.497   1.00 0.00 ? 66  TYR A CE2  1  
ATOM 885   C CZ   . TYR A 1 66  ? 5.134   6.506   1.356   1.00 0.00 ? 66  TYR A CZ   1  
ATOM 886   O OH   . TYR A 1 66  ? 5.936   7.523   0.891   1.00 0.00 ? 66  TYR A OH   1  
ATOM 887   H H    . TYR A 1 66  ? 3.553   0.992   1.578   1.00 0.00 ? 66  TYR A H    1  
ATOM 888   H HA   . TYR A 1 66  ? 4.170   2.495   4.037   1.00 0.00 ? 66  TYR A HA   1  
ATOM 889   H HB2  . TYR A 1 66  ? 2.009   3.002   1.990   1.00 0.00 ? 66  TYR A HB2  1  
ATOM 890   H HB3  . TYR A 1 66  ? 2.008   3.733   3.591   1.00 0.00 ? 66  TYR A HB3  1  
ATOM 891   H HD1  . TYR A 1 66  ? 4.463   4.795   4.175   1.00 0.00 ? 66  TYR A HD1  1  
ATOM 892   H HD2  . TYR A 1 66  ? 2.766   4.360   0.298   1.00 0.00 ? 66  TYR A HD2  1  
ATOM 893   H HE1  . TYR A 1 66  ? 5.898   6.614   3.350   1.00 0.00 ? 66  TYR A HE1  1  
ATOM 894   H HE2  . TYR A 1 66  ? 4.197   6.178   -0.538  1.00 0.00 ? 66  TYR A HE2  1  
ATOM 895   H HH   . TYR A 1 66  ? 5.633   8.360   1.253   1.00 0.00 ? 66  TYR A HH   1  
ATOM 896   N N    . ASN A 1 67  ? 2.486   1.299   5.431   1.00 0.00 ? 67  ASN A N    1  
ATOM 897   C CA   . ASN A 1 67  ? 1.635   0.462   6.268   1.00 0.00 ? 67  ASN A CA   1  
ATOM 898   C C    . ASN A 1 67  ? 0.164   0.821   6.079   1.00 0.00 ? 67  ASN A C    1  
ATOM 899   O O    . ASN A 1 67  ? -0.278  1.899   6.476   1.00 0.00 ? 67  ASN A O    1  
ATOM 900   C CB   . ASN A 1 67  ? 2.024   0.613   7.740   1.00 0.00 ? 67  ASN A CB   1  
ATOM 901   C CG   . ASN A 1 67  ? 1.758   2.009   8.267   1.00 0.00 ? 67  ASN A CG   1  
ATOM 902   O OD1  . ASN A 1 67  ? 0.728   2.263   8.893   1.00 0.00 ? 67  ASN A OD1  1  
ATOM 903   N ND2  . ASN A 1 67  ? 2.688   2.923   8.017   1.00 0.00 ? 67  ASN A ND2  1  
ATOM 904   H H    . ASN A 1 67  ? 3.082   1.951   5.856   1.00 0.00 ? 67  ASN A H    1  
ATOM 905   H HA   . ASN A 1 67  ? 1.784   -0.565  5.969   1.00 0.00 ? 67  ASN A HA   1  
ATOM 906   H HB2  . ASN A 1 67  ? 1.453   -0.089  8.330   1.00 0.00 ? 67  ASN A HB2  1  
ATOM 907   H HB3  . ASN A 1 67  ? 3.076   0.399   7.852   1.00 0.00 ? 67  ASN A HB3  1  
ATOM 908   H HD21 . ASN A 1 67  ? 3.483   2.650   7.513   1.00 0.00 ? 67  ASN A HD21 1  
ATOM 909   H HD22 . ASN A 1 67  ? 2.542   3.834   8.347   1.00 0.00 ? 67  ASN A HD22 1  
ATOM 910   N N    . PHE A 1 68  ? -0.589  -0.090  5.472   1.00 0.00 ? 68  PHE A N    1  
ATOM 911   C CA   . PHE A 1 68  ? -2.010  0.131   5.230   1.00 0.00 ? 68  PHE A CA   1  
ATOM 912   C C    . PHE A 1 68  ? -2.857  -0.578  6.283   1.00 0.00 ? 68  PHE A C    1  
ATOM 913   O O    . PHE A 1 68  ? -2.600  -1.732  6.626   1.00 0.00 ? 68  PHE A O    1  
ATOM 914   C CB   . PHE A 1 68  ? -2.394  -0.362  3.833   1.00 0.00 ? 68  PHE A CB   1  
ATOM 915   C CG   . PHE A 1 68  ? -3.849  -0.177  3.512   1.00 0.00 ? 68  PHE A CG   1  
ATOM 916   C CD1  . PHE A 1 68  ? -4.409  1.090   3.476   1.00 0.00 ? 68  PHE A CD1  1  
ATOM 917   C CD2  . PHE A 1 68  ? -4.658  -1.270  3.245   1.00 0.00 ? 68  PHE A CD2  1  
ATOM 918   C CE1  . PHE A 1 68  ? -5.748  1.263   3.181   1.00 0.00 ? 68  PHE A CE1  1  
ATOM 919   C CE2  . PHE A 1 68  ? -5.998  -1.103  2.949   1.00 0.00 ? 68  PHE A CE2  1  
ATOM 920   C CZ   . PHE A 1 68  ? -6.543  0.165   2.916   1.00 0.00 ? 68  PHE A CZ   1  
ATOM 921   H H    . PHE A 1 68  ? -0.178  -0.930  5.178   1.00 0.00 ? 68  PHE A H    1  
ATOM 922   H HA   . PHE A 1 68  ? -2.195  1.192   5.292   1.00 0.00 ? 68  PHE A HA   1  
ATOM 923   H HB2  . PHE A 1 68  ? -1.821  0.181   3.097   1.00 0.00 ? 68  PHE A HB2  1  
ATOM 924   H HB3  . PHE A 1 68  ? -2.167  -1.415  3.756   1.00 0.00 ? 68  PHE A HB3  1  
ATOM 925   H HD1  . PHE A 1 68  ? -3.788  1.950   3.682   1.00 0.00 ? 68  PHE A HD1  1  
ATOM 926   H HD2  . PHE A 1 68  ? -4.232  -2.263  3.270   1.00 0.00 ? 68  PHE A HD2  1  
ATOM 927   H HE1  . PHE A 1 68  ? -6.172  2.256   3.155   1.00 0.00 ? 68  PHE A HE1  1  
ATOM 928   H HE2  . PHE A 1 68  ? -6.616  -1.964  2.742   1.00 0.00 ? 68  PHE A HE2  1  
ATOM 929   H HZ   . PHE A 1 68  ? -7.590  0.297   2.686   1.00 0.00 ? 68  PHE A HZ   1  
ATOM 930   N N    . GLN A 1 69  ? -3.867  0.121   6.791   1.00 0.00 ? 69  GLN A N    1  
ATOM 931   C CA   . GLN A 1 69  ? -4.751  -0.440  7.805   1.00 0.00 ? 69  GLN A CA   1  
ATOM 932   C C    . GLN A 1 69  ? -6.192  -0.481  7.308   1.00 0.00 ? 69  GLN A C    1  
ATOM 933   O O    . GLN A 1 69  ? -6.829  0.557   7.136   1.00 0.00 ? 69  GLN A O    1  
ATOM 934   C CB   . GLN A 1 69  ? -4.666  0.377   9.095   1.00 0.00 ? 69  GLN A CB   1  
ATOM 935   C CG   . GLN A 1 69  ? -5.015  1.845   8.909   1.00 0.00 ? 69  GLN A CG   1  
ATOM 936   C CD   . GLN A 1 69  ? -4.522  2.712   10.050  1.00 0.00 ? 69  GLN A CD   1  
ATOM 937   O OE1  . GLN A 1 69  ? -5.197  2.861   11.069  1.00 0.00 ? 69  GLN A OE1  1  
ATOM 938   N NE2  . GLN A 1 69  ? -3.337  3.288   9.887   1.00 0.00 ? 69  GLN A NE2  1  
ATOM 939   H H    . GLN A 1 69  ? -4.020  1.036   6.476   1.00 0.00 ? 69  GLN A H    1  
ATOM 940   H HA   . GLN A 1 69  ? -4.424  -1.449  8.007   1.00 0.00 ? 69  GLN A HA   1  
ATOM 941   H HB2  . GLN A 1 69  ? -5.347  -0.044  9.819   1.00 0.00 ? 69  GLN A HB2  1  
ATOM 942   H HB3  . GLN A 1 69  ? -3.659  0.316   9.481   1.00 0.00 ? 69  GLN A HB3  1  
ATOM 943   H HG2  . GLN A 1 69  ? -4.566  2.195   7.991   1.00 0.00 ? 69  GLN A HG2  1  
ATOM 944   H HG3  . GLN A 1 69  ? -6.089  1.940   8.842   1.00 0.00 ? 69  GLN A HG3  1  
ATOM 945   H HE21 . GLN A 1 69  ? -2.855  3.125   9.048   1.00 0.00 ? 69  GLN A HE21 1  
ATOM 946   H HE22 . GLN A 1 69  ? -2.994  3.854   10.608  1.00 0.00 ? 69  GLN A HE22 1  
ATOM 947   N N    . GLY A 1 70  ? -6.700  -1.689  7.080   1.00 0.00 ? 70  GLY A N    1  
ATOM 948   C CA   . GLY A 1 70  ? -8.063  -1.842  6.605   1.00 0.00 ? 70  GLY A CA   1  
ATOM 949   C C    . GLY A 1 70  ? -9.004  -2.326  7.690   1.00 0.00 ? 70  GLY A C    1  
ATOM 950   O O    . GLY A 1 70  ? -8.605  -2.482  8.844   1.00 0.00 ? 70  GLY A O    1  
ATOM 951   H H    . GLY A 1 70  ? -6.145  -2.482  7.235   1.00 0.00 ? 70  GLY A H    1  
ATOM 952   H HA2  . GLY A 1 70  ? -8.414  -0.890  6.237   1.00 0.00 ? 70  GLY A HA2  1  
ATOM 953   H HA3  . GLY A 1 70  ? -8.071  -2.555  5.794   1.00 0.00 ? 70  GLY A HA3  1  
ATOM 954   N N    . SER A 1 71  ? -10.259 -2.563  7.321   1.00 0.00 ? 71  SER A N    1  
ATOM 955   C CA   . SER A 1 71  ? -11.262 -3.026  8.273   1.00 0.00 ? 71  SER A CA   1  
ATOM 956   C C    . SER A 1 71  ? -11.807 -4.392  7.865   1.00 0.00 ? 71  SER A C    1  
ATOM 957   O O    . SER A 1 71  ? -12.006 -5.269  8.705   1.00 0.00 ? 71  SER A O    1  
ATOM 958   C CB   . SER A 1 71  ? -12.406 -2.016  8.373   1.00 0.00 ? 71  SER A CB   1  
ATOM 959   O OG   . SER A 1 71  ? -12.118 -1.013  9.331   1.00 0.00 ? 71  SER A OG   1  
ATOM 960   H H    . SER A 1 71  ? -10.517 -2.420  6.386   1.00 0.00 ? 71  SER A H    1  
ATOM 961   H HA   . SER A 1 71  ? -10.786 -3.115  9.238   1.00 0.00 ? 71  SER A HA   1  
ATOM 962   H HB2  . SER A 1 71  ? -12.554 -1.548  7.412   1.00 0.00 ? 71  SER A HB2  1  
ATOM 963   H HB3  . SER A 1 71  ? -13.311 -2.529  8.667   1.00 0.00 ? 71  SER A HB3  1  
ATOM 964   H HG   . SER A 1 71  ? -12.310 -1.345  10.211  1.00 0.00 ? 71  SER A HG   1  
ATOM 965   N N    . GLY A 1 72  ? -12.048 -4.563  6.569   1.00 0.00 ? 72  GLY A N    1  
ATOM 966   C CA   . GLY A 1 72  ? -12.568 -5.823  6.071   1.00 0.00 ? 72  GLY A CA   1  
ATOM 967   C C    . GLY A 1 72  ? -12.797 -5.805  4.573   1.00 0.00 ? 72  GLY A C    1  
ATOM 968   O O    . GLY A 1 72  ? -13.002 -4.745  3.983   1.00 0.00 ? 72  GLY A O    1  
ATOM 969   H H    . GLY A 1 72  ? -11.870 -3.828  5.945   1.00 0.00 ? 72  GLY A H    1  
ATOM 970   H HA2  . GLY A 1 72  ? -11.867 -6.609  6.309   1.00 0.00 ? 72  GLY A HA2  1  
ATOM 971   H HA3  . GLY A 1 72  ? -13.507 -6.031  6.564   1.00 0.00 ? 72  GLY A HA3  1  
ATOM 972   N N    . ALA A 1 73  ? -12.760 -6.981  3.956   1.00 0.00 ? 73  ALA A N    1  
ATOM 973   C CA   . ALA A 1 73  ? -12.965 -7.096  2.517   1.00 0.00 ? 73  ALA A CA   1  
ATOM 974   C C    . ALA A 1 73  ? -14.076 -6.164  2.045   1.00 0.00 ? 73  ALA A C    1  
ATOM 975   O O    . ALA A 1 73  ? -14.979 -5.803  2.800   1.00 0.00 ? 73  ALA A O    1  
ATOM 976   C CB   . ALA A 1 73  ? -13.287 -8.535  2.143   1.00 0.00 ? 73  ALA A CB   1  
ATOM 977   H H    . ALA A 1 73  ? -12.592 -7.791  4.481   1.00 0.00 ? 73  ALA A H    1  
ATOM 978   H HA   . ALA A 1 73  ? -12.043 -6.820  2.026   1.00 0.00 ? 73  ALA A HA   1  
ATOM 979   H HB1  . ALA A 1 73  ? -13.925 -8.546  1.271   1.00 0.00 ? 73  ALA A HB1  1  
ATOM 980   H HB2  . ALA A 1 73  ? -12.371 -9.064  1.926   1.00 0.00 ? 73  ALA A HB2  1  
ATOM 981   H HB3  . ALA A 1 73  ? -13.794 -9.016  2.966   1.00 0.00 ? 73  ALA A HB3  1  
ATOM 982   N N    . PRO A 1 74  ? -14.009 -5.763  0.767   1.00 0.00 ? 74  PRO A N    1  
ATOM 983   C CA   . PRO A 1 74  ? -12.938 -6.185  -0.140  1.00 0.00 ? 74  PRO A CA   1  
ATOM 984   C C    . PRO A 1 74  ? -11.592 -5.570  0.226   1.00 0.00 ? 74  PRO A C    1  
ATOM 985   O O    . PRO A 1 74  ? -10.575 -5.860  -0.405  1.00 0.00 ? 74  PRO A O    1  
ATOM 986   C CB   . PRO A 1 74  ? -13.407 -5.674  -1.505  1.00 0.00 ? 74  PRO A CB   1  
ATOM 987   C CG   . PRO A 1 74  ? -14.301 -4.524  -1.192  1.00 0.00 ? 74  PRO A CG   1  
ATOM 988   C CD   . PRO A 1 74  ? -14.974 -4.865  0.109   1.00 0.00 ? 74  PRO A CD   1  
ATOM 989   H HA   . PRO A 1 74  ? -12.844 -7.261  -0.170  1.00 0.00 ? 74  PRO A HA   1  
ATOM 990   H HB2  . PRO A 1 74  ? -12.552 -5.362  -2.089  1.00 0.00 ? 74  PRO A HB2  1  
ATOM 991   H HB3  . PRO A 1 74  ? -13.938 -6.457  -2.024  1.00 0.00 ? 74  PRO A HB3  1  
ATOM 992   H HG2  . PRO A 1 74  ? -13.717 -3.622  -1.087  1.00 0.00 ? 74  PRO A HG2  1  
ATOM 993   H HG3  . PRO A 1 74  ? -15.036 -4.408  -1.974  1.00 0.00 ? 74  PRO A HG3  1  
ATOM 994   H HD2  . PRO A 1 74  ? -15.133 -3.973  0.697   1.00 0.00 ? 74  PRO A HD2  1  
ATOM 995   H HD3  . PRO A 1 74  ? -15.910 -5.373  -0.072  1.00 0.00 ? 74  PRO A HD3  1  
ATOM 996   N N    . GLN A 1 75  ? -11.593 -4.720  1.247   1.00 0.00 ? 75  GLN A N    1  
ATOM 997   C CA   . GLN A 1 75  ? -10.371 -4.064  1.696   1.00 0.00 ? 75  GLN A CA   1  
ATOM 998   C C    . GLN A 1 75  ? -9.437  -5.059  2.378   1.00 0.00 ? 75  GLN A C    1  
ATOM 999   O O    . GLN A 1 75  ? -9.864  -5.849  3.220   1.00 0.00 ? 75  GLN A O    1  
ATOM 1000  C CB   . GLN A 1 75  ? -10.703 -2.920  2.655   1.00 0.00 ? 75  GLN A CB   1  
ATOM 1001  C CG   . GLN A 1 75  ? -11.000 -1.604  1.954   1.00 0.00 ? 75  GLN A CG   1  
ATOM 1002  C CD   . GLN A 1 75  ? -11.277 -0.474  2.925   1.00 0.00 ? 75  GLN A CD   1  
ATOM 1003  O OE1  . GLN A 1 75  ? -10.475 -0.196  3.817   1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1004  N NE2  . GLN A 1 75  ? -12.417 0.186   2.757   1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1005  H H    . GLN A 1 75  ? -12.435 -4.529  1.710   1.00 0.00 ? 75  GLN A H    1  
ATOM 1006  H HA   . GLN A 1 75  ? -9.873  -3.660  0.828   1.00 0.00 ? 75  GLN A HA   1  
ATOM 1007  H HB2  . GLN A 1 75  ? -11.569 -3.195  3.239   1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1008  H HB3  . GLN A 1 75  ? -9.865  -2.767  3.319   1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1009  H HG2  . GLN A 1 75  ? -10.149 -1.335  1.346   1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1010  H HG3  . GLN A 1 75  ? -11.866 -1.736  1.321   1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1011  H HE21 . GLN A 1 75  ? -13.008 -0.092  2.026   1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1012  H HE22 . GLN A 1 75  ? -12.622 0.920   3.371   1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1013  N N    . LEU A 1 76  ? -8.162  -5.015  2.007   1.00 0.00 ? 76  LEU A N    1  
ATOM 1014  C CA   . LEU A 1 76  ? -7.167  -5.914  2.583   1.00 0.00 ? 76  LEU A CA   1  
ATOM 1015  C C    . LEU A 1 76  ? -6.034  -5.127  3.233   1.00 0.00 ? 76  LEU A C    1  
ATOM 1016  O O    . LEU A 1 76  ? -5.588  -4.109  2.703   1.00 0.00 ? 76  LEU A O    1  
ATOM 1017  C CB   . LEU A 1 76  ? -6.605  -6.842  1.504   1.00 0.00 ? 76  LEU A CB   1  
ATOM 1018  C CG   . LEU A 1 76  ? -5.296  -7.553  1.847   1.00 0.00 ? 76  LEU A CG   1  
ATOM 1019  C CD1  . LEU A 1 76  ? -5.568  -8.815  2.651   1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1020  C CD2  . LEU A 1 76  ? -4.521  -7.884  0.579   1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1021  H H    . LEU A 1 76  ? -7.882  -4.364  1.331   1.00 0.00 ? 76  LEU A H    1  
ATOM 1022  H HA   . LEU A 1 76  ? -7.656  -6.509  3.339   1.00 0.00 ? 76  LEU A HA   1  
ATOM 1023  H HB2  . LEU A 1 76  ? -7.348  -7.598  1.299   1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1024  H HB3  . LEU A 1 76  ? -6.439  -6.251  0.614   1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1025  H HG   . LEU A 1 76  ? -4.685  -6.898  2.452   1.00 0.00 ? 76  LEU A HG   1  
ATOM 1026  H HD11 . LEU A 1 76  ? -6.089  -8.556  3.560   1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1027  H HD12 . LEU A 1 76  ? -4.632  -9.295  2.896   1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1028  H HD13 . LEU A 1 76  ? -6.176  -9.490  2.067   1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1029  H HD21 . LEU A 1 76  ? -4.470  -7.008  -0.050  1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1030  H HD22 . LEU A 1 76  ? -5.022  -8.680  0.049   1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1031  H HD23 . LEU A 1 76  ? -3.521  -8.199  0.841   1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1032  N N    . SER A 1 77  ? -5.571  -5.606  4.383   1.00 0.00 ? 77  SER A N    1  
ATOM 1033  C CA   . SER A 1 77  ? -4.491  -4.947  5.107   1.00 0.00 ? 77  SER A CA   1  
ATOM 1034  C C    . SER A 1 77  ? -3.139  -5.274  4.480   1.00 0.00 ? 77  SER A C    1  
ATOM 1035  O O    . SER A 1 77  ? -2.982  -6.295  3.809   1.00 0.00 ? 77  SER A O    1  
ATOM 1036  C CB   . SER A 1 77  ? -4.500  -5.370  6.577   1.00 0.00 ? 77  SER A CB   1  
ATOM 1037  O OG   . SER A 1 77  ? -4.110  -6.725  6.720   1.00 0.00 ? 77  SER A OG   1  
ATOM 1038  H H    . SER A 1 77  ? -5.968  -6.422  4.755   1.00 0.00 ? 77  SER A H    1  
ATOM 1039  H HA   . SER A 1 77  ? -4.654  -3.881  5.047   1.00 0.00 ? 77  SER A HA   1  
ATOM 1040  H HB2  . SER A 1 77  ? -3.813  -4.750  7.132   1.00 0.00 ? 77  SER A HB2  1  
ATOM 1041  H HB3  . SER A 1 77  ? -5.497  -5.251  6.977   1.00 0.00 ? 77  SER A HB3  1  
ATOM 1042  H HG   . SER A 1 77  ? -3.154  -6.779  6.776   1.00 0.00 ? 77  SER A HG   1  
ATOM 1043  N N    . LEU A 1 78  ? -2.163  -4.400  4.704   1.00 0.00 ? 78  LEU A N    1  
ATOM 1044  C CA   . LEU A 1 78  ? -0.823  -4.593  4.163   1.00 0.00 ? 78  LEU A CA   1  
ATOM 1045  C C    . LEU A 1 78  ? 0.234   -4.042  5.114   1.00 0.00 ? 78  LEU A C    1  
ATOM 1046  O O    . LEU A 1 78  ? -0.032  -3.119  5.883   1.00 0.00 ? 78  LEU A O    1  
ATOM 1047  C CB   . LEU A 1 78  ? -0.700  -3.915  2.797   1.00 0.00 ? 78  LEU A CB   1  
ATOM 1048  C CG   . LEU A 1 78  ? -1.312  -4.669  1.616   1.00 0.00 ? 78  LEU A CG   1  
ATOM 1049  C CD1  . LEU A 1 78  ? -1.094  -3.901  0.322   1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1050  C CD2  . LEU A 1 78  ? -0.722  -6.068  1.513   1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1051  H H    . LEU A 1 78  ? -2.348  -3.605  5.247   1.00 0.00 ? 78  LEU A H    1  
ATOM 1052  H HA   . LEU A 1 78  ? -0.664  -5.655  4.044   1.00 0.00 ? 78  LEU A HA   1  
ATOM 1053  H HB2  . LEU A 1 78  ? -1.185  -2.953  2.861   1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1054  H HB3  . LEU A 1 78  ? 0.352   -3.774  2.592   1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1055  H HG   . LEU A 1 78  ? -2.377  -4.765  1.771   1.00 0.00 ? 78  LEU A HG   1  
ATOM 1056  H HD11 . LEU A 1 78  ? -0.346  -4.403  -0.274  1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1057  H HD12 . LEU A 1 78  ? -0.759  -2.900  0.549   1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1058  H HD13 . LEU A 1 78  ? -2.022  -3.854  -0.229  1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1059  H HD21 . LEU A 1 78  ? -1.377  -6.772  2.004   1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1060  H HD22 . LEU A 1 78  ? 0.248   -6.085  1.990   1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1061  H HD23 . LEU A 1 78  ? -0.616  -6.339  0.473   1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1062  N N    . GLN A 1 79  ? 1.433   -4.612  5.053   1.00 0.00 ? 79  GLN A N    1  
ATOM 1063  C CA   . GLN A 1 79  ? 2.530   -4.176  5.909   1.00 0.00 ? 79  GLN A CA   1  
ATOM 1064  C C    . GLN A 1 79  ? 3.788   -3.910  5.088   1.00 0.00 ? 79  GLN A C    1  
ATOM 1065  O O    . GLN A 1 79  ? 4.162   -4.711  4.231   1.00 0.00 ? 79  GLN A O    1  
ATOM 1066  C CB   . GLN A 1 79  ? 2.819   -5.228  6.980   1.00 0.00 ? 79  GLN A CB   1  
ATOM 1067  C CG   . GLN A 1 79  ? 1.902   -5.134  8.189   1.00 0.00 ? 79  GLN A CG   1  
ATOM 1068  C CD   . GLN A 1 79  ? 2.031   -6.328  9.114   1.00 0.00 ? 79  GLN A CD   1  
ATOM 1069  O OE1  . GLN A 1 79  ? 1.377   -7.352  8.920   1.00 0.00 ? 79  GLN A OE1  1  
ATOM 1070  N NE2  . GLN A 1 79  ? 2.879   -6.202  10.129  1.00 0.00 ? 79  GLN A NE2  1  
ATOM 1071  H H    . GLN A 1 79  ? 1.583   -5.343  4.419   1.00 0.00 ? 79  GLN A H    1  
ATOM 1072  H HA   . GLN A 1 79  ? 2.229   -3.258  6.391   1.00 0.00 ? 79  GLN A HA   1  
ATOM 1073  H HB2  . GLN A 1 79  ? 2.705   -6.209  6.544   1.00 0.00 ? 79  GLN A HB2  1  
ATOM 1074  H HB3  . GLN A 1 79  ? 3.838   -5.110  7.319   1.00 0.00 ? 79  GLN A HB3  1  
ATOM 1075  H HG2  . GLN A 1 79  ? 2.149   -4.241  8.744   1.00 0.00 ? 79  GLN A HG2  1  
ATOM 1076  H HG3  . GLN A 1 79  ? 0.880   -5.072  7.846   1.00 0.00 ? 79  GLN A HG3  1  
ATOM 1077  H HE21 . GLN A 1 79  ? 3.366   -5.356  10.222  1.00 0.00 ? 79  GLN A HE21 1  
ATOM 1078  H HE22 . GLN A 1 79  ? 2.982   -6.958  10.743  1.00 0.00 ? 79  GLN A HE22 1  
ATOM 1079  N N    . ILE A 1 80  ? 4.435   -2.780  5.356   1.00 0.00 ? 80  ILE A N    1  
ATOM 1080  C CA   . ILE A 1 80  ? 5.651   -2.410  4.642   1.00 0.00 ? 80  ILE A CA   1  
ATOM 1081  C C    . ILE A 1 80  ? 6.627   -3.579  4.576   1.00 0.00 ? 80  ILE A C    1  
ATOM 1082  O O    . ILE A 1 80  ? 6.900   -4.232  5.583   1.00 0.00 ? 80  ILE A O    1  
ATOM 1083  C CB   . ILE A 1 80  ? 6.349   -1.209  5.306   1.00 0.00 ? 80  ILE A CB   1  
ATOM 1084  C CG1  . ILE A 1 80  ? 5.422   0.008   5.316   1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1085  C CG2  . ILE A 1 80  ? 7.648   -0.886  4.584   1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1086  C CD1  . ILE A 1 80  ? 5.966   1.177   6.106   1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1087  H H    . ILE A 1 80  ? 4.087   -2.183  6.050   1.00 0.00 ? 80  ILE A H    1  
ATOM 1088  H HA   . ILE A 1 80  ? 5.374   -2.129  3.636   1.00 0.00 ? 80  ILE A HA   1  
ATOM 1089  H HB   . ILE A 1 80  ? 6.589   -1.478  6.324   1.00 0.00 ? 80  ILE A HB   1  
ATOM 1090  H HG12 . ILE A 1 80  ? 5.262   0.339   4.302   1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1091  H HG13 . ILE A 1 80  ? 4.474   -0.275  5.751   1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1092  H HG21 . ILE A 1 80  ? 8.486   -1.183  5.198   1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1093  H HG22 . ILE A 1 80  ? 7.682   -1.423  3.647   1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1094  H HG23 . ILE A 1 80  ? 7.700   0.176   4.393   1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1095  H HD11 . ILE A 1 80  ? 7.005   0.998   6.344   1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1096  H HD12 . ILE A 1 80  ? 5.884   2.079   5.518   1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1097  H HD13 . ILE A 1 80  ? 5.402   1.289   7.019   1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1098  N N    . GLY A 1 81  ? 7.154   -3.837  3.383   1.00 0.00 ? 81  GLY A N    1  
ATOM 1099  C CA   . GLY A 1 81  ? 8.096   -4.927  3.207   1.00 0.00 ? 81  GLY A CA   1  
ATOM 1100  C C    . GLY A 1 81  ? 7.411   -6.238  2.878   1.00 0.00 ? 81  GLY A C    1  
ATOM 1101  O O    . GLY A 1 81  ? 8.019   -7.305  2.973   1.00 0.00 ? 81  GLY A O    1  
ATOM 1102  H H    . GLY A 1 81  ? 6.900   -3.283  2.615   1.00 0.00 ? 81  GLY A H    1  
ATOM 1103  H HA2  . GLY A 1 81  ? 8.775   -4.676  2.406   1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1104  H HA3  . GLY A 1 81  ? 8.661   -5.049  4.120   1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1105  N N    . ASP A 1 82  ? 6.143   -6.160  2.490   1.00 0.00 ? 82  ASP A N    1  
ATOM 1106  C CA   . ASP A 1 82  ? 5.374   -7.351  2.146   1.00 0.00 ? 82  ASP A CA   1  
ATOM 1107  C C    . ASP A 1 82  ? 5.101   -7.406  0.646   1.00 0.00 ? 82  ASP A C    1  
ATOM 1108  O O    . ASP A 1 82  ? 4.812   -6.387  0.019   1.00 0.00 ? 82  ASP A O    1  
ATOM 1109  C CB   . ASP A 1 82  ? 4.054   -7.373  2.919   1.00 0.00 ? 82  ASP A CB   1  
ATOM 1110  C CG   . ASP A 1 82  ? 4.259   -7.569  4.408   1.00 0.00 ? 82  ASP A CG   1  
ATOM 1111  O OD1  . ASP A 1 82  ? 5.219   -6.989  4.957   1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1112  O OD2  . ASP A 1 82  ? 3.459   -8.304  5.026   1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1113  H H    . ASP A 1 82  ? 5.713   -5.281  2.434   1.00 0.00 ? 82  ASP A H    1  
ATOM 1114  H HA   . ASP A 1 82  ? 5.958   -8.215  2.425   1.00 0.00 ? 82  ASP A HA   1  
ATOM 1115  H HB2  . ASP A 1 82  ? 3.539   -6.436  2.766   1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1116  H HB3  . ASP A 1 82  ? 3.441   -8.181  2.548   1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1117  N N    . VAL A 1 83  ? 5.195   -8.604  0.077   1.00 0.00 ? 83  VAL A N    1  
ATOM 1118  C CA   . VAL A 1 83  ? 4.957   -8.793  -1.349  1.00 0.00 ? 83  VAL A CA   1  
ATOM 1119  C C    . VAL A 1 83  ? 3.607   -9.456  -1.599  1.00 0.00 ? 83  VAL A C    1  
ATOM 1120  O O    . VAL A 1 83  ? 3.224   -10.392 -0.898  1.00 0.00 ? 83  VAL A O    1  
ATOM 1121  C CB   . VAL A 1 83  ? 6.064   -9.648  -1.994  1.00 0.00 ? 83  VAL A CB   1  
ATOM 1122  C CG1  . VAL A 1 83  ? 5.772   -9.877  -3.469  1.00 0.00 ? 83  VAL A CG1  1  
ATOM 1123  C CG2  . VAL A 1 83  ? 7.423   -8.990  -1.807  1.00 0.00 ? 83  VAL A CG2  1  
ATOM 1124  H H    . VAL A 1 83  ? 5.428   -9.379  0.629   1.00 0.00 ? 83  VAL A H    1  
ATOM 1125  H HA   . VAL A 1 83  ? 4.963   -7.820  -1.820  1.00 0.00 ? 83  VAL A HA   1  
ATOM 1126  H HB   . VAL A 1 83  ? 6.082   -10.609 -1.500  1.00 0.00 ? 83  VAL A HB   1  
ATOM 1127  H HG11 . VAL A 1 83  ? 4.712   -9.769  -3.646  1.00 0.00 ? 83  VAL A HG11 1  
ATOM 1128  H HG12 . VAL A 1 83  ? 6.312   -9.152  -4.060  1.00 0.00 ? 83  VAL A HG12 1  
ATOM 1129  H HG13 . VAL A 1 83  ? 6.083   -10.873 -3.747  1.00 0.00 ? 83  VAL A HG13 1  
ATOM 1130  H HG21 . VAL A 1 83  ? 7.714   -8.497  -2.723  1.00 0.00 ? 83  VAL A HG21 1  
ATOM 1131  H HG22 . VAL A 1 83  ? 7.363   -8.264  -1.010  1.00 0.00 ? 83  VAL A HG22 1  
ATOM 1132  H HG23 . VAL A 1 83  ? 8.156   -9.742  -1.555  1.00 0.00 ? 83  VAL A HG23 1  
ATOM 1133  N N    . VAL A 1 84  ? 2.890   -8.964  -2.604  1.00 0.00 ? 84  VAL A N    1  
ATOM 1134  C CA   . VAL A 1 84  ? 1.582   -9.510  -2.948  1.00 0.00 ? 84  VAL A CA   1  
ATOM 1135  C C    . VAL A 1 84  ? 1.531   -9.932  -4.412  1.00 0.00 ? 84  VAL A C    1  
ATOM 1136  O O    . VAL A 1 84  ? 2.137   -9.296  -5.274  1.00 0.00 ? 84  VAL A O    1  
ATOM 1137  C CB   . VAL A 1 84  ? 0.460   -8.489  -2.680  1.00 0.00 ? 84  VAL A CB   1  
ATOM 1138  C CG1  . VAL A 1 84  ? 0.442   -8.087  -1.213  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1139  C CG2  . VAL A 1 84  ? 0.626   -7.269  -3.574  1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1140  H H    . VAL A 1 84  ? 3.248   -8.217  -3.127  1.00 0.00 ? 84  VAL A H    1  
ATOM 1141  H HA   . VAL A 1 84  ? 1.408   -10.376 -2.327  1.00 0.00 ? 84  VAL A HA   1  
ATOM 1142  H HB   . VAL A 1 84  ? -0.486  -8.955  -2.915  1.00 0.00 ? 84  VAL A HB   1  
ATOM 1143  H HG11 . VAL A 1 84  ? -0.407  -8.545  -0.726  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1144  H HG12 . VAL A 1 84  ? 1.353   -8.419  -0.738  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1145  H HG13 . VAL A 1 84  ? 0.365   -7.013  -1.136  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1146  H HG21 . VAL A 1 84  ? 0.108   -6.428  -3.136  1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1147  H HG22 . VAL A 1 84  ? 1.675   -7.035  -3.671  1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1148  H HG23 . VAL A 1 84  ? 0.211   -7.478  -4.549  1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1149  N N    . ARG A 1 85  ? 0.803   -11.010 -4.686  1.00 0.00 ? 85  ARG A N    1  
ATOM 1150  C CA   . ARG A 1 85  ? 0.673   -11.519 -6.046  1.00 0.00 ? 85  ARG A CA   1  
ATOM 1151  C C    . ARG A 1 85  ? -0.417  -10.769 -6.805  1.00 0.00 ? 85  ARG A C    1  
ATOM 1152  O O    . ARG A 1 85  ? -1.606  -11.041 -6.634  1.00 0.00 ? 85  ARG A O    1  
ATOM 1153  C CB   . ARG A 1 85  ? 0.357   -13.016 -6.025  1.00 0.00 ? 85  ARG A CB   1  
ATOM 1154  C CG   . ARG A 1 85  ? 0.876   -13.764 -7.242  1.00 0.00 ? 85  ARG A CG   1  
ATOM 1155  C CD   . ARG A 1 85  ? 2.386   -13.933 -7.190  1.00 0.00 ? 85  ARG A CD   1  
ATOM 1156  N NE   . ARG A 1 85  ? 2.779   -15.124 -6.441  1.00 0.00 ? 85  ARG A NE   1  
ATOM 1157  C CZ   . ARG A 1 85  ? 2.682   -16.359 -6.920  1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1158  N NH1  . ARG A 1 85  ? 2.208   -16.565 -8.141  1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1159  N NH2  . ARG A 1 85  ? 3.059   -17.391 -6.177  1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1160  H H    . ARG A 1 85  ? 0.343   -11.475 -3.956  1.00 0.00 ? 85  ARG A H    1  
ATOM 1161  H HA   . ARG A 1 85  ? 1.616   -11.366 -6.549  1.00 0.00 ? 85  ARG A HA   1  
ATOM 1162  H HB2  . ARG A 1 85  ? 0.803   -13.454 -5.144  1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1163  H HB3  . ARG A 1 85  ? -0.713  -13.145 -5.979  1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1164  H HG2  . ARG A 1 85  ? 0.417   -14.741 -7.275  1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1165  H HG3  . ARG A 1 85  ? 0.614   -13.211 -8.132  1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1166  H HD2  . ARG A 1 85  ? 2.761   -14.016 -8.200  1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1167  H HD3  . ARG A 1 85  ? 2.816   -13.063 -6.717  1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1168  H HE   . ARG A 1 85  ? 3.131   -14.995 -5.536  1.00 0.00 ? 85  ARG A HE   1  
ATOM 1169  H HH11 . ARG A 1 85  ? 1.924   -15.788 -8.703  1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1170  H HH12 . ARG A 1 85  ? 2.137   -17.496 -8.500  1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1171  H HH21 . ARG A 1 85  ? 3.417   -17.240 -5.256  1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1172  H HH22 . ARG A 1 85  ? 2.986   -18.320 -6.538  1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1173  N N    . ILE A 1 86  ? -0.004  -9.823  -7.643  1.00 0.00 ? 86  ILE A N    1  
ATOM 1174  C CA   . ILE A 1 86  ? -0.946  -9.035  -8.428  1.00 0.00 ? 86  ILE A CA   1  
ATOM 1175  C C    . ILE A 1 86  ? -1.541  -9.860  -9.563  1.00 0.00 ? 86  ILE A C    1  
ATOM 1176  O O    . ILE A 1 86  ? -0.821  -10.338 -10.439 1.00 0.00 ? 86  ILE A O    1  
ATOM 1177  C CB   . ILE A 1 86  ? -0.274  -7.780  -9.018  1.00 0.00 ? 86  ILE A CB   1  
ATOM 1178  C CG1  . ILE A 1 86  ? 0.340   -6.932  -7.902  1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1179  C CG2  . ILE A 1 86  ? -1.282  -6.967  -9.816  1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1180  C CD1  . ILE A 1 86  ? 1.389   -5.958  -8.392  1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1181  H H    . ILE A 1 86  ? 0.956   -9.653  -7.735  1.00 0.00 ? 86  ILE A H    1  
ATOM 1182  H HA   . ILE A 1 86  ? -1.743  -8.717  -7.771  1.00 0.00 ? 86  ILE A HA   1  
ATOM 1183  H HB   . ILE A 1 86  ? 0.508   -8.100  -9.689  1.00 0.00 ? 86  ILE A HB   1  
ATOM 1184  H HG12 . ILE A 1 86  ? -0.440  -6.363  -7.420  1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1185  H HG13 . ILE A 1 86  ? 0.804   -7.585  -7.178  1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1186  H HG21 . ILE A 1 86  ? -1.733  -6.224  -9.176  1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1187  H HG22 . ILE A 1 86  ? -0.778  -6.476  -10.636 1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1188  H HG23 . ILE A 1 86  ? -2.047  -7.622  -10.204 1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1189  H HD11 . ILE A 1 86  ? 1.452   -5.124  -7.708  1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1190  H HD12 . ILE A 1 86  ? 2.347   -6.455  -8.440  1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1191  H HD13 . ILE A 1 86  ? 1.118   -5.599  -9.373  1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1192  N N    . GLN A 1 87  ? -2.860  -10.021 -9.541  1.00 0.00 ? 87  GLN A N    1  
ATOM 1193  C CA   . GLN A 1 87  ? -3.553  -10.788 -10.570 1.00 0.00 ? 87  GLN A CA   1  
ATOM 1194  C C    . GLN A 1 87  ? -4.276  -9.864  -11.544 1.00 0.00 ? 87  GLN A C    1  
ATOM 1195  O O    . GLN A 1 87  ? -4.250  -10.081 -12.755 1.00 0.00 ? 87  GLN A O    1  
ATOM 1196  C CB   . GLN A 1 87  ? -4.551  -11.755 -9.930  1.00 0.00 ? 87  GLN A CB   1  
ATOM 1197  C CG   . GLN A 1 87  ? -3.923  -12.690 -8.909  1.00 0.00 ? 87  GLN A CG   1  
ATOM 1198  C CD   . GLN A 1 87  ? -3.408  -13.973 -9.531  1.00 0.00 ? 87  GLN A CD   1  
ATOM 1199  O OE1  . GLN A 1 87  ? -2.937  -13.980 -10.668 1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1200  N NE2  . GLN A 1 87  ? -3.496  -15.069 -8.786  1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1201  H H    . GLN A 1 87  ? -3.380  -9.616  -8.817  1.00 0.00 ? 87  GLN A H    1  
ATOM 1202  H HA   . GLN A 1 87  ? -2.814  -11.356 -11.114 1.00 0.00 ? 87  GLN A HA   1  
ATOM 1203  H HB2  . GLN A 1 87  ? -5.322  -11.183 -9.437  1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1204  H HB3  . GLN A 1 87  ? -5.000  -12.356 -10.707 1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1205  H HG2  . GLN A 1 87  ? -3.096  -12.181 -8.435  1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1206  H HG3  . GLN A 1 87  ? -4.665  -12.939 -8.165  1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1207  H HE21 . GLN A 1 87  ? -3.884  -14.988 -7.889  1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1208  H HE22 . GLN A 1 87  ? -3.172  -15.912 -9.163  1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1209  N N    . GLU A 1 88  ? -4.921  -8.833  -11.006 1.00 0.00 ? 88  GLU A N    1  
ATOM 1210  C CA   . GLU A 1 88  ? -5.651  -7.877  -11.829 1.00 0.00 ? 88  GLU A CA   1  
ATOM 1211  C C    . GLU A 1 88  ? -5.369  -6.445  -11.381 1.00 0.00 ? 88  GLU A C    1  
ATOM 1212  O O    . GLU A 1 88  ? -4.736  -6.219  -10.349 1.00 0.00 ? 88  GLU A O    1  
ATOM 1213  C CB   . GLU A 1 88  ? -7.154  -8.157  -11.763 1.00 0.00 ? 88  GLU A CB   1  
ATOM 1214  C CG   . GLU A 1 88  ? -7.558  -9.468  -12.416 1.00 0.00 ? 88  GLU A CG   1  
ATOM 1215  C CD   . GLU A 1 88  ? -9.002  -9.468  -12.880 1.00 0.00 ? 88  GLU A CD   1  
ATOM 1216  O OE1  . GLU A 1 88  ? -9.490  -8.397  -13.298 1.00 0.00 ? 88  GLU A OE1  1  
ATOM 1217  O OE2  . GLU A 1 88  ? -9.643  -10.538 -12.825 1.00 0.00 ? 88  GLU A OE2  1  
ATOM 1218  H H    . GLU A 1 88  ? -4.905  -8.713  -10.034 1.00 0.00 ? 88  GLU A H    1  
ATOM 1219  H HA   . GLU A 1 88  ? -5.318  -7.994  -12.849 1.00 0.00 ? 88  GLU A HA   1  
ATOM 1220  H HB2  . GLU A 1 88  ? -7.458  -8.186  -10.727 1.00 0.00 ? 88  GLU A HB2  1  
ATOM 1221  H HB3  . GLU A 1 88  ? -7.680  -7.355  -12.260 1.00 0.00 ? 88  GLU A HB3  1  
ATOM 1222  H HG2  . GLU A 1 88  ? -6.922  -9.641  -13.271 1.00 0.00 ? 88  GLU A HG2  1  
ATOM 1223  H HG3  . GLU A 1 88  ? -7.425  -10.267 -11.702 1.00 0.00 ? 88  GLU A HG3  1  
ATOM 1224  N N    . THR A 1 89  ? -5.844  -5.482  -12.164 1.00 0.00 ? 89  THR A N    1  
ATOM 1225  C CA   . THR A 1 89  ? -5.642  -4.073  -11.850 1.00 0.00 ? 89  THR A CA   1  
ATOM 1226  C C    . THR A 1 89  ? -6.843  -3.237  -12.277 1.00 0.00 ? 89  THR A C    1  
ATOM 1227  O O    . THR A 1 89  ? -7.125  -3.103  -13.469 1.00 0.00 ? 89  THR A O    1  
ATOM 1228  C CB   . THR A 1 89  ? -4.377  -3.520  -12.533 1.00 0.00 ? 89  THR A CB   1  
ATOM 1229  O OG1  . THR A 1 89  ? -3.235  -4.294  -12.148 1.00 0.00 ? 89  THR A OG1  1  
ATOM 1230  C CG2  . THR A 1 89  ? -4.156  -2.062  -12.163 1.00 0.00 ? 89  THR A CG2  1  
ATOM 1231  H H    . THR A 1 89  ? -6.341  -5.726  -12.972 1.00 0.00 ? 89  THR A H    1  
ATOM 1232  H HA   . THR A 1 89  ? -5.517  -3.984  -10.780 1.00 0.00 ? 89  THR A HA   1  
ATOM 1233  H HB   . THR A 1 89  ? -4.505  -3.590  -13.603 1.00 0.00 ? 89  THR A HB   1  
ATOM 1234  H HG1  . THR A 1 89  ? -3.333  -5.192  -12.473 1.00 0.00 ? 89  THR A HG1  1  
ATOM 1235  H HG21 . THR A 1 89  ? -5.069  -1.650  -11.762 1.00 0.00 ? 89  THR A HG21 1  
ATOM 1236  H HG22 . THR A 1 89  ? -3.867  -1.507  -13.043 1.00 0.00 ? 89  THR A HG22 1  
ATOM 1237  H HG23 . THR A 1 89  ? -3.374  -1.993  -11.421 1.00 0.00 ? 89  THR A HG23 1  
ATOM 1238  N N    . CYS A 1 90  ? -7.546  -2.676  -11.300 1.00 0.00 ? 90  CYS A N    1  
ATOM 1239  C CA   . CYS A 1 90  ? -8.718  -1.852  -11.576 1.00 0.00 ? 90  CYS A CA   1  
ATOM 1240  C C    . CYS A 1 90  ? -8.517  -0.432  -11.058 1.00 0.00 ? 90  CYS A C    1  
ATOM 1241  O O    . CYS A 1 90  ? -8.067  -0.228  -9.932  1.00 0.00 ? 90  CYS A O    1  
ATOM 1242  C CB   . CYS A 1 90  ? -9.963  -2.469  -10.937 1.00 0.00 ? 90  CYS A CB   1  
ATOM 1243  S SG   . CYS A 1 90  ? -11.486 -1.545  -11.246 1.00 0.00 ? 90  CYS A SG   1  
ATOM 1244  H H    . CYS A 1 90  ? -7.272  -2.820  -10.370 1.00 0.00 ? 90  CYS A H    1  
ATOM 1245  H HA   . CYS A 1 90  ? -8.852  -1.817  -12.646 1.00 0.00 ? 90  CYS A HA   1  
ATOM 1246  H HB2  . CYS A 1 90  ? -10.101 -3.468  -11.327 1.00 0.00 ? 90  CYS A HB2  1  
ATOM 1247  H HB3  . CYS A 1 90  ? -9.821  -2.524  -9.868  1.00 0.00 ? 90  CYS A HB3  1  
ATOM 1248  H HG   . CYS A 1 90  ? -11.300 -0.801  -12.326 1.00 0.00 ? 90  CYS A HG   1  
ATOM 1249  N N    . GLY A 1 91  ? -8.853  0.549   -11.891 1.00 0.00 ? 91  GLY A N    1  
ATOM 1250  C CA   . GLY A 1 91  ? -8.701  1.939   -11.501 1.00 0.00 ? 91  GLY A CA   1  
ATOM 1251  C C    . GLY A 1 91  ? -7.393  2.199   -10.781 1.00 0.00 ? 91  GLY A C    1  
ATOM 1252  O O    . GLY A 1 91  ? -6.327  1.806   -11.255 1.00 0.00 ? 91  GLY A O    1  
ATOM 1253  H H    . GLY A 1 91  ? -9.207  0.327   -12.778 1.00 0.00 ? 91  GLY A H    1  
ATOM 1254  H HA2  . GLY A 1 91  ? -8.742  2.556   -12.386 1.00 0.00 ? 91  GLY A HA2  1  
ATOM 1255  H HA3  . GLY A 1 91  ? -9.518  2.208   -10.848 1.00 0.00 ? 91  GLY A HA3  1  
ATOM 1256  N N    . ASP A 1 92  ? -7.474  2.863   -9.633  1.00 0.00 ? 92  ASP A N    1  
ATOM 1257  C CA   . ASP A 1 92  ? -6.287  3.176   -8.846  1.00 0.00 ? 92  ASP A CA   1  
ATOM 1258  C C    . ASP A 1 92  ? -6.131  2.199   -7.685  1.00 0.00 ? 92  ASP A C    1  
ATOM 1259  O O    . ASP A 1 92  ? -5.696  2.577   -6.597  1.00 0.00 ? 92  ASP A O    1  
ATOM 1260  C CB   . ASP A 1 92  ? -6.363  4.609   -8.317  1.00 0.00 ? 92  ASP A CB   1  
ATOM 1261  C CG   . ASP A 1 92  ? -6.560  5.626   -9.424  1.00 0.00 ? 92  ASP A CG   1  
ATOM 1262  O OD1  . ASP A 1 92  ? -5.766  5.616   -10.388 1.00 0.00 ? 92  ASP A OD1  1  
ATOM 1263  O OD2  . ASP A 1 92  ? -7.511  6.430   -9.328  1.00 0.00 ? 92  ASP A OD2  1  
ATOM 1264  H H    . ASP A 1 92  ? -8.353  3.149   -9.307  1.00 0.00 ? 92  ASP A H    1  
ATOM 1265  H HA   . ASP A 1 92  ? -5.427  3.086   -9.493  1.00 0.00 ? 92  ASP A HA   1  
ATOM 1266  H HB2  . ASP A 1 92  ? -7.192  4.688   -7.629  1.00 0.00 ? 92  ASP A HB2  1  
ATOM 1267  H HB3  . ASP A 1 92  ? -5.445  4.843   -7.797  1.00 0.00 ? 92  ASP A HB3  1  
ATOM 1268  N N    . TRP A 1 93  ? -6.492  0.943   -7.923  1.00 0.00 ? 93  TRP A N    1  
ATOM 1269  C CA   . TRP A 1 93  ? -6.393  -0.088  -6.896  1.00 0.00 ? 93  TRP A CA   1  
ATOM 1270  C C    . TRP A 1 93  ? -6.020  -1.433  -7.509  1.00 0.00 ? 93  TRP A C    1  
ATOM 1271  O O    . TRP A 1 93  ? -6.487  -1.782  -8.593  1.00 0.00 ? 93  TRP A O    1  
ATOM 1272  C CB   . TRP A 1 93  ? -7.716  -0.208  -6.137  1.00 0.00 ? 93  TRP A CB   1  
ATOM 1273  C CG   . TRP A 1 93  ? -8.076  1.028   -5.370  1.00 0.00 ? 93  TRP A CG   1  
ATOM 1274  C CD1  . TRP A 1 93  ? -8.427  2.241   -5.889  1.00 0.00 ? 93  TRP A CD1  1  
ATOM 1275  C CD2  . TRP A 1 93  ? -8.117  1.171   -3.946  1.00 0.00 ? 93  TRP A CD2  1  
ATOM 1276  N NE1  . TRP A 1 93  ? -8.684  3.130   -4.874  1.00 0.00 ? 93  TRP A NE1  1  
ATOM 1277  C CE2  . TRP A 1 93  ? -8.502  2.498   -3.672  1.00 0.00 ? 93  TRP A CE2  1  
ATOM 1278  C CE3  . TRP A 1 93  ? -7.869  0.307   -2.876  1.00 0.00 ? 93  TRP A CE3  1  
ATOM 1279  C CZ2  . TRP A 1 93  ? -8.642  2.979   -2.373  1.00 0.00 ? 93  TRP A CZ2  1  
ATOM 1280  C CZ3  . TRP A 1 93  ? -8.008  0.786   -1.588  1.00 0.00 ? 93  TRP A CZ3  1  
ATOM 1281  C CH2  . TRP A 1 93  ? -8.393  2.111   -1.344  1.00 0.00 ? 93  TRP A CH2  1  
ATOM 1282  H H    . TRP A 1 93  ? -6.832  0.703   -8.811  1.00 0.00 ? 93  TRP A H    1  
ATOM 1283  H HA   . TRP A 1 93  ? -5.618  0.208   -6.205  1.00 0.00 ? 93  TRP A HA   1  
ATOM 1284  H HB2  . TRP A 1 93  ? -8.511  -0.407  -6.841  1.00 0.00 ? 93  TRP A HB2  1  
ATOM 1285  H HB3  . TRP A 1 93  ? -7.647  -1.028  -5.437  1.00 0.00 ? 93  TRP A HB3  1  
ATOM 1286  H HD1  . TRP A 1 93  ? -8.488  2.457   -6.945  1.00 0.00 ? 93  TRP A HD1  1  
ATOM 1287  H HE1  . TRP A 1 93  ? -8.956  4.065   -4.991  1.00 0.00 ? 93  TRP A HE1  1  
ATOM 1288  H HE3  . TRP A 1 93  ? -7.571  -0.717  -3.043  1.00 0.00 ? 93  TRP A HE3  1  
ATOM 1289  H HZ2  . TRP A 1 93  ? -8.939  3.998   -2.169  1.00 0.00 ? 93  TRP A HZ2  1  
ATOM 1290  H HZ3  . TRP A 1 93  ? -7.819  0.133   -0.748  1.00 0.00 ? 93  TRP A HZ3  1  
ATOM 1291  H HH2  . TRP A 1 93  ? -8.489  2.442   -0.322  1.00 0.00 ? 93  TRP A HH2  1  
ATOM 1292  N N    . TYR A 1 94  ? -5.176  -2.183  -6.809  1.00 0.00 ? 94  TYR A N    1  
ATOM 1293  C CA   . TYR A 1 94  ? -4.739  -3.489  -7.287  1.00 0.00 ? 94  TYR A CA   1  
ATOM 1294  C C    . TYR A 1 94  ? -5.616  -4.600  -6.715  1.00 0.00 ? 94  TYR A C    1  
ATOM 1295  O O    . TYR A 1 94  ? -6.309  -4.407  -5.717  1.00 0.00 ? 94  TYR A O    1  
ATOM 1296  C CB   . TYR A 1 94  ? -3.278  -3.732  -6.906  1.00 0.00 ? 94  TYR A CB   1  
ATOM 1297  C CG   . TYR A 1 94  ? -2.293  -2.994  -7.784  1.00 0.00 ? 94  TYR A CG   1  
ATOM 1298  C CD1  . TYR A 1 94  ? -2.215  -3.255  -9.147  1.00 0.00 ? 94  TYR A CD1  1  
ATOM 1299  C CD2  . TYR A 1 94  ? -1.440  -2.035  -7.251  1.00 0.00 ? 94  TYR A CD2  1  
ATOM 1300  C CE1  . TYR A 1 94  ? -1.316  -2.583  -9.952  1.00 0.00 ? 94  TYR A CE1  1  
ATOM 1301  C CE2  . TYR A 1 94  ? -0.539  -1.357  -8.050  1.00 0.00 ? 94  TYR A CE2  1  
ATOM 1302  C CZ   . TYR A 1 94  ? -0.480  -1.636  -9.400  1.00 0.00 ? 94  TYR A CZ   1  
ATOM 1303  O OH   . TYR A 1 94  ? 0.415   -0.964  -10.199 1.00 0.00 ? 94  TYR A OH   1  
ATOM 1304  H H    . TYR A 1 94  ? -4.838  -1.850  -5.952  1.00 0.00 ? 94  TYR A H    1  
ATOM 1305  H HA   . TYR A 1 94  ? -4.826  -3.495  -8.363  1.00 0.00 ? 94  TYR A HA   1  
ATOM 1306  H HB2  . TYR A 1 94  ? -3.119  -3.409  -5.888  1.00 0.00 ? 94  TYR A HB2  1  
ATOM 1307  H HB3  . TYR A 1 94  ? -3.063  -4.788  -6.981  1.00 0.00 ? 94  TYR A HB3  1  
ATOM 1308  H HD1  . TYR A 1 94  ? -2.872  -3.997  -9.576  1.00 0.00 ? 94  TYR A HD1  1  
ATOM 1309  H HD2  . TYR A 1 94  ? -1.488  -1.819  -6.194  1.00 0.00 ? 94  TYR A HD2  1  
ATOM 1310  H HE1  . TYR A 1 94  ? -1.271  -2.801  -11.009 1.00 0.00 ? 94  TYR A HE1  1  
ATOM 1311  H HE2  . TYR A 1 94  ? 0.116   -0.615  -7.618  1.00 0.00 ? 94  TYR A HE2  1  
ATOM 1312  H HH   . TYR A 1 94  ? 0.801   -1.575  -10.832 1.00 0.00 ? 94  TYR A HH   1  
ATOM 1313  N N    . ARG A 1 95  ? -5.579  -5.763  -7.357  1.00 0.00 ? 95  ARG A N    1  
ATOM 1314  C CA   . ARG A 1 95  ? -6.370  -6.905  -6.915  1.00 0.00 ? 95  ARG A CA   1  
ATOM 1315  C C    . ARG A 1 95  ? -5.496  -8.147  -6.767  1.00 0.00 ? 95  ARG A C    1  
ATOM 1316  O O    . ARG A 1 95  ? -4.893  -8.613  -7.733  1.00 0.00 ? 95  ARG A O    1  
ATOM 1317  C CB   . ARG A 1 95  ? -7.504  -7.181  -7.904  1.00 0.00 ? 95  ARG A CB   1  
ATOM 1318  C CG   . ARG A 1 95  ? -8.719  -7.838  -7.270  1.00 0.00 ? 95  ARG A CG   1  
ATOM 1319  C CD   . ARG A 1 95  ? -8.440  -9.286  -6.900  1.00 0.00 ? 95  ARG A CD   1  
ATOM 1320  N NE   . ARG A 1 95  ? -9.637  -9.967  -6.415  1.00 0.00 ? 95  ARG A NE   1  
ATOM 1321  C CZ   . ARG A 1 95  ? -9.606  -11.070 -5.674  1.00 0.00 ? 95  ARG A CZ   1  
ATOM 1322  N NH1  . ARG A 1 95  ? -8.445  -11.613 -5.336  1.00 0.00 ? 95  ARG A NH1  1  
ATOM 1323  N NH2  . ARG A 1 95  ? -10.739 -11.632 -5.271  1.00 0.00 ? 95  ARG A NH2  1  
ATOM 1324  H H    . ARG A 1 95  ? -5.007  -5.855  -8.148  1.00 0.00 ? 95  ARG A H    1  
ATOM 1325  H HA   . ARG A 1 95  ? -6.795  -6.662  -5.953  1.00 0.00 ? 95  ARG A HA   1  
ATOM 1326  H HB2  . ARG A 1 95  ? -7.817  -6.246  -8.345  1.00 0.00 ? 95  ARG A HB2  1  
ATOM 1327  H HB3  . ARG A 1 95  ? -7.136  -7.832  -8.683  1.00 0.00 ? 95  ARG A HB3  1  
ATOM 1328  H HG2  . ARG A 1 95  ? -8.984  -7.294  -6.375  1.00 0.00 ? 95  ARG A HG2  1  
ATOM 1329  H HG3  . ARG A 1 95  ? -9.540  -7.805  -7.970  1.00 0.00 ? 95  ARG A HG3  1  
ATOM 1330  H HD2  . ARG A 1 95  ? -8.074  -9.803  -7.775  1.00 0.00 ? 95  ARG A HD2  1  
ATOM 1331  H HD3  . ARG A 1 95  ? -7.686  -9.308  -6.127  1.00 0.00 ? 95  ARG A HD3  1  
ATOM 1332  H HE   . ARG A 1 95  ? -10.506 -9.583  -6.653  1.00 0.00 ? 95  ARG A HE   1  
ATOM 1333  H HH11 . ARG A 1 95  ? -7.590  -11.191 -5.638  1.00 0.00 ? 95  ARG A HH11 1  
ATOM 1334  H HH12 . ARG A 1 95  ? -8.424  -12.442 -4.778  1.00 0.00 ? 95  ARG A HH12 1  
ATOM 1335  H HH21 . ARG A 1 95  ? -11.616 -11.225 -5.524  1.00 0.00 ? 95  ARG A HH21 1  
ATOM 1336  H HH22 . ARG A 1 95  ? -10.714 -12.461 -4.714  1.00 0.00 ? 95  ARG A HH22 1  
ATOM 1337  N N    . GLY A 1 96  ? -5.432  -8.678  -5.550  1.00 0.00 ? 96  GLY A N    1  
ATOM 1338  C CA   . GLY A 1 96  ? -4.629  -9.860  -5.297  1.00 0.00 ? 96  GLY A CA   1  
ATOM 1339  C C    . GLY A 1 96  ? -4.697  -10.310 -3.851  1.00 0.00 ? 96  GLY A C    1  
ATOM 1340  O O    . GLY A 1 96  ? -5.737  -10.186 -3.204  1.00 0.00 ? 96  GLY A O    1  
ATOM 1341  H H    . GLY A 1 96  ? -5.934  -8.264  -4.817  1.00 0.00 ? 96  GLY A H    1  
ATOM 1342  H HA2  . GLY A 1 96  ? -4.980  -10.662 -5.930  1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1343  H HA3  . GLY A 1 96  ? -3.601  -9.643  -5.546  1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1344  N N    . TYR A 1 97  ? -3.588  -10.835 -3.344  1.00 0.00 ? 97  TYR A N    1  
ATOM 1345  C CA   . TYR A 1 97  ? -3.527  -11.308 -1.966  1.00 0.00 ? 97  TYR A CA   1  
ATOM 1346  C C    . TYR A 1 97  ? -2.086  -11.349 -1.467  1.00 0.00 ? 97  TYR A C    1  
ATOM 1347  O O    . TYR A 1 97  ? -1.142  -11.215 -2.247  1.00 0.00 ? 97  TYR A O    1  
ATOM 1348  C CB   . TYR A 1 97  ? -4.157  -12.698 -1.854  1.00 0.00 ? 97  TYR A CB   1  
ATOM 1349  C CG   . TYR A 1 97  ? -3.405  -13.767 -2.615  1.00 0.00 ? 97  TYR A CG   1  
ATOM 1350  C CD1  . TYR A 1 97  ? -2.122  -14.144 -2.236  1.00 0.00 ? 97  TYR A CD1  1  
ATOM 1351  C CD2  . TYR A 1 97  ? -3.977  -14.399 -3.712  1.00 0.00 ? 97  TYR A CD2  1  
ATOM 1352  C CE1  . TYR A 1 97  ? -1.431  -15.120 -2.928  1.00 0.00 ? 97  TYR A CE1  1  
ATOM 1353  C CE2  . TYR A 1 97  ? -3.294  -15.376 -4.409  1.00 0.00 ? 97  TYR A CE2  1  
ATOM 1354  C CZ   . TYR A 1 97  ? -2.021  -15.733 -4.014  1.00 0.00 ? 97  TYR A CZ   1  
ATOM 1355  O OH   . TYR A 1 97  ? -1.337  -16.705 -4.706  1.00 0.00 ? 97  TYR A OH   1  
ATOM 1356  H H    . TYR A 1 97  ? -2.791  -10.907 -3.909  1.00 0.00 ? 97  TYR A H    1  
ATOM 1357  H HA   . TYR A 1 97  ? -4.088  -10.619 -1.353  1.00 0.00 ? 97  TYR A HA   1  
ATOM 1358  H HB2  . TYR A 1 97  ? -4.187  -12.989 -0.816  1.00 0.00 ? 97  TYR A HB2  1  
ATOM 1359  H HB3  . TYR A 1 97  ? -5.165  -12.661 -2.242  1.00 0.00 ? 97  TYR A HB3  1  
ATOM 1360  H HD1  . TYR A 1 97  ? -1.663  -13.661 -1.386  1.00 0.00 ? 97  TYR A HD1  1  
ATOM 1361  H HD2  . TYR A 1 97  ? -4.973  -14.116 -4.019  1.00 0.00 ? 97  TYR A HD2  1  
ATOM 1362  H HE1  . TYR A 1 97  ? -0.435  -15.400 -2.619  1.00 0.00 ? 97  TYR A HE1  1  
ATOM 1363  H HE2  . TYR A 1 97  ? -3.755  -15.856 -5.259  1.00 0.00 ? 97  TYR A HE2  1  
ATOM 1364  H HH   . TYR A 1 97  ? -1.946  -17.178 -5.279  1.00 0.00 ? 97  TYR A HH   1  
ATOM 1365  N N    . LEU A 1 98  ? -1.924  -11.537 -0.162  1.00 0.00 ? 98  LEU A N    1  
ATOM 1366  C CA   . LEU A 1 98  ? -0.598  -11.597 0.443   1.00 0.00 ? 98  LEU A CA   1  
ATOM 1367  C C    . LEU A 1 98  ? 0.056   -12.951 0.188   1.00 0.00 ? 98  LEU A C    1  
ATOM 1368  O O    . LEU A 1 98  ? -0.397  -13.976 0.698   1.00 0.00 ? 98  LEU A O    1  
ATOM 1369  C CB   . LEU A 1 98  ? -0.690  -11.338 1.948   1.00 0.00 ? 98  LEU A CB   1  
ATOM 1370  C CG   . LEU A 1 98  ? 0.528   -10.674 2.591   1.00 0.00 ? 98  LEU A CG   1  
ATOM 1371  C CD1  . LEU A 1 98  ? 0.774   -9.304  1.979   1.00 0.00 ? 98  LEU A CD1  1  
ATOM 1372  C CD2  . LEU A 1 98  ? 0.341   -10.562 4.097   1.00 0.00 ? 98  LEU A CD2  1  
ATOM 1373  H H    . LEU A 1 98  ? -2.713  -11.638 0.408   1.00 0.00 ? 98  LEU A H    1  
ATOM 1374  H HA   . LEU A 1 98  ? 0.008   -10.827 -0.010  1.00 0.00 ? 98  LEU A HA   1  
ATOM 1375  H HB2  . LEU A 1 98  ? -1.544  -10.701 2.122   1.00 0.00 ? 98  LEU A HB2  1  
ATOM 1376  H HB3  . LEU A 1 98  ? -0.847  -12.289 2.437   1.00 0.00 ? 98  LEU A HB3  1  
ATOM 1377  H HG   . LEU A 1 98  ? 1.402   -11.283 2.406   1.00 0.00 ? 98  LEU A HG   1  
ATOM 1378  H HD11 . LEU A 1 98  ? 1.332   -9.414  1.062   1.00 0.00 ? 98  LEU A HD11 1  
ATOM 1379  H HD12 . LEU A 1 98  ? 1.336   -8.696  2.672   1.00 0.00 ? 98  LEU A HD12 1  
ATOM 1380  H HD13 . LEU A 1 98  ? -0.173  -8.828  1.771   1.00 0.00 ? 98  LEU A HD13 1  
ATOM 1381  H HD21 . LEU A 1 98  ? 0.777   -11.425 4.579   1.00 0.00 ? 98  LEU A HD21 1  
ATOM 1382  H HD22 . LEU A 1 98  ? -0.713  -10.517 4.326   1.00 0.00 ? 98  LEU A HD22 1  
ATOM 1383  H HD23 . LEU A 1 98  ? 0.826   -9.665  4.454   1.00 0.00 ? 98  LEU A HD23 1  
ATOM 1384  N N    . ILE A 1 99  ? 1.125   -12.947 -0.602  1.00 0.00 ? 99  ILE A N    1  
ATOM 1385  C CA   . ILE A 1 99  ? 1.843   -14.174 -0.921  1.00 0.00 ? 99  ILE A CA   1  
ATOM 1386  C C    . ILE A 1 99  ? 2.284   -14.899 0.346   1.00 0.00 ? 99  ILE A C    1  
ATOM 1387  O O    . ILE A 1 99  ? 2.168   -16.121 0.448   1.00 0.00 ? 99  ILE A O    1  
ATOM 1388  C CB   . ILE A 1 99  ? 3.080   -13.892 -1.794  1.00 0.00 ? 99  ILE A CB   1  
ATOM 1389  C CG1  . ILE A 1 99  ? 2.679   -13.113 -3.049  1.00 0.00 ? 99  ILE A CG1  1  
ATOM 1390  C CG2  . ILE A 1 99  ? 3.771   -15.194 -2.170  1.00 0.00 ? 99  ILE A CG2  1  
ATOM 1391  C CD1  . ILE A 1 99  ? 3.829   -12.368 -3.691  1.00 0.00 ? 99  ILE A CD1  1  
ATOM 1392  H H    . ILE A 1 99  ? 1.438   -12.098 -0.978  1.00 0.00 ? 99  ILE A H    1  
ATOM 1393  H HA   . ILE A 1 99  ? 1.175   -14.816 -1.477  1.00 0.00 ? 99  ILE A HA   1  
ATOM 1394  H HB   . ILE A 1 99  ? 3.773   -13.299 -1.217  1.00 0.00 ? 99  ILE A HB   1  
ATOM 1395  H HG12 . ILE A 1 99  ? 2.281   -13.800 -3.779  1.00 0.00 ? 99  ILE A HG12 1  
ATOM 1396  H HG13 . ILE A 1 99  ? 1.919   -12.391 -2.787  1.00 0.00 ? 99  ILE A HG13 1  
ATOM 1397  H HG21 . ILE A 1 99  ? 4.481   -15.460 -1.401  1.00 0.00 ? 99  ILE A HG21 1  
ATOM 1398  H HG22 . ILE A 1 99  ? 3.035   -15.977 -2.266  1.00 0.00 ? 99  ILE A HG22 1  
ATOM 1399  H HG23 . ILE A 1 99  ? 4.288   -15.069 -3.110  1.00 0.00 ? 99  ILE A HG23 1  
ATOM 1400  H HD11 . ILE A 1 99  ? 4.182   -12.923 -4.549  1.00 0.00 ? 99  ILE A HD11 1  
ATOM 1401  H HD12 . ILE A 1 99  ? 3.493   -11.392 -4.008  1.00 0.00 ? 99  ILE A HD12 1  
ATOM 1402  H HD13 . ILE A 1 99  ? 4.632   -12.261 -2.977  1.00 0.00 ? 99  ILE A HD13 1  
ATOM 1403  N N    . LYS A 1 100 ? 2.788   -14.138 1.311   1.00 0.00 ? 100 LYS A N    1  
ATOM 1404  C CA   . LYS A 1 100 ? 3.244   -14.706 2.574   1.00 0.00 ? 100 LYS A CA   1  
ATOM 1405  C C    . LYS A 1 100 ? 2.068   -15.238 3.387   1.00 0.00 ? 100 LYS A C    1  
ATOM 1406  O O    . LYS A 1 100 ? 2.189   -16.243 4.088   1.00 0.00 ? 100 LYS A O    1  
ATOM 1407  C CB   . LYS A 1 100 ? 4.004   -13.654 3.385   1.00 0.00 ? 100 LYS A CB   1  
ATOM 1408  C CG   . LYS A 1 100 ? 3.288   -12.317 3.469   1.00 0.00 ? 100 LYS A CG   1  
ATOM 1409  C CD   . LYS A 1 100 ? 3.938   -11.400 4.492   1.00 0.00 ? 100 LYS A CD   1  
ATOM 1410  C CE   . LYS A 1 100 ? 5.159   -10.699 3.917   1.00 0.00 ? 100 LYS A CE   1  
ATOM 1411  N NZ   . LYS A 1 100 ? 5.971   -10.041 4.977   1.00 0.00 ? 100 LYS A NZ   1  
ATOM 1412  H H    . LYS A 1 100 ? 2.855   -13.170 1.170   1.00 0.00 ? 100 LYS A H    1  
ATOM 1413  H HA   . LYS A 1 100 ? 3.910   -15.525 2.349   1.00 0.00 ? 100 LYS A HA   1  
ATOM 1414  H HB2  . LYS A 1 100 ? 4.148   -14.025 4.389   1.00 0.00 ? 100 LYS A HB2  1  
ATOM 1415  H HB3  . LYS A 1 100 ? 4.970   -13.493 2.928   1.00 0.00 ? 100 LYS A HB3  1  
ATOM 1416  H HG2  . LYS A 1 100 ? 3.322   -11.839 2.501   1.00 0.00 ? 100 LYS A HG2  1  
ATOM 1417  H HG3  . LYS A 1 100 ? 2.259   -12.487 3.753   1.00 0.00 ? 100 LYS A HG3  1  
ATOM 1418  H HD2  . LYS A 1 100 ? 3.221   -10.653 4.800   1.00 0.00 ? 100 LYS A HD2  1  
ATOM 1419  H HD3  . LYS A 1 100 ? 4.240   -11.987 5.348   1.00 0.00 ? 100 LYS A HD3  1  
ATOM 1420  H HE2  . LYS A 1 100 ? 5.770   -11.429 3.408   1.00 0.00 ? 100 LYS A HE2  1  
ATOM 1421  H HE3  . LYS A 1 100 ? 4.829   -9.951  3.211   1.00 0.00 ? 100 LYS A HE3  1  
ATOM 1422  H HZ1  . LYS A 1 100 ? 6.940   -10.418 4.971   1.00 0.00 ? 100 LYS A HZ1  1  
ATOM 1423  H HZ2  . LYS A 1 100 ? 5.548   -10.215 5.911   1.00 0.00 ? 100 LYS A HZ2  1  
ATOM 1424  H HZ3  . LYS A 1 100 ? 6.010   -9.015  4.812   1.00 0.00 ? 100 LYS A HZ3  1  
ATOM 1425  N N    . HIS A 1 101 ? 0.930   -14.558 3.288   1.00 0.00 ? 101 HIS A N    1  
ATOM 1426  C CA   . HIS A 1 101 ? -0.269  -14.964 4.013   1.00 0.00 ? 101 HIS A CA   1  
ATOM 1427  C C    . HIS A 1 101 ? -1.495  -14.913 3.107   1.00 0.00 ? 101 HIS A C    1  
ATOM 1428  O O    . HIS A 1 101 ? -2.219  -13.918 3.080   1.00 0.00 ? 101 HIS A O    1  
ATOM 1429  C CB   . HIS A 1 101 ? -0.483  -14.065 5.232   1.00 0.00 ? 101 HIS A CB   1  
ATOM 1430  C CG   . HIS A 1 101 ? 0.627   -14.141 6.234   1.00 0.00 ? 101 HIS A CG   1  
ATOM 1431  N ND1  . HIS A 1 101 ? 0.843   -15.242 7.036   1.00 0.00 ? 101 HIS A ND1  1  
ATOM 1432  C CD2  . HIS A 1 101 ? 1.588   -13.245 6.561   1.00 0.00 ? 101 HIS A CD2  1  
ATOM 1433  C CE1  . HIS A 1 101 ? 1.887   -15.019 7.815   1.00 0.00 ? 101 HIS A CE1  1  
ATOM 1434  N NE2  . HIS A 1 101 ? 2.357   -13.814 7.546   1.00 0.00 ? 101 HIS A NE2  1  
ATOM 1435  H H    . HIS A 1 101 ? 0.896   -13.765 2.714   1.00 0.00 ? 101 HIS A H    1  
ATOM 1436  H HA   . HIS A 1 101 ? -0.126  -15.980 4.348   1.00 0.00 ? 101 HIS A HA   1  
ATOM 1437  H HB2  . HIS A 1 101 ? -0.563  -13.039 4.904   1.00 0.00 ? 101 HIS A HB2  1  
ATOM 1438  H HB3  . HIS A 1 101 ? -1.399  -14.353 5.727   1.00 0.00 ? 101 HIS A HB3  1  
ATOM 1439  H HD1  . HIS A 1 101 ? 0.310   -16.063 7.036   1.00 0.00 ? 101 HIS A HD1  1  
ATOM 1440  H HD2  . HIS A 1 101 ? 1.724   -12.263 6.129   1.00 0.00 ? 101 HIS A HD2  1  
ATOM 1441  H HE1  . HIS A 1 101 ? 2.288   -15.704 8.546   1.00 0.00 ? 101 HIS A HE1  1  
ATOM 1442  H HE2  . HIS A 1 101 ? 3.075   -13.366 8.039   1.00 0.00 ? 101 HIS A HE2  1  
ATOM 1443  N N    . LYS A 1 102 ? -1.721  -15.992 2.365   1.00 0.00 ? 102 LYS A N    1  
ATOM 1444  C CA   . LYS A 1 102 ? -2.860  -16.072 1.458   1.00 0.00 ? 102 LYS A CA   1  
ATOM 1445  C C    . LYS A 1 102 ? -4.175  -16.037 2.230   1.00 0.00 ? 102 LYS A C    1  
ATOM 1446  O O    . LYS A 1 102 ? -5.218  -15.682 1.682   1.00 0.00 ? 102 LYS A O    1  
ATOM 1447  C CB   . LYS A 1 102 ? -2.782  -17.350 0.619   1.00 0.00 ? 102 LYS A CB   1  
ATOM 1448  C CG   . LYS A 1 102 ? -1.550  -17.422 -0.266  1.00 0.00 ? 102 LYS A CG   1  
ATOM 1449  C CD   . LYS A 1 102 ? -0.310  -17.788 0.532   1.00 0.00 ? 102 LYS A CD   1  
ATOM 1450  C CE   . LYS A 1 102 ? 0.696   -18.548 -0.319  1.00 0.00 ? 102 LYS A CE   1  
ATOM 1451  N NZ   . LYS A 1 102 ? 0.159   -19.860 -0.774  1.00 0.00 ? 102 LYS A NZ   1  
ATOM 1452  H H    . LYS A 1 102 ? -1.108  -16.754 2.430   1.00 0.00 ? 102 LYS A H    1  
ATOM 1453  H HA   . LYS A 1 102 ? -2.820  -15.217 0.800   1.00 0.00 ? 102 LYS A HA   1  
ATOM 1454  H HB2  . LYS A 1 102 ? -2.772  -18.201 1.284   1.00 0.00 ? 102 LYS A HB2  1  
ATOM 1455  H HB3  . LYS A 1 102 ? -3.657  -17.406 -0.012  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 1456  H HG2  . LYS A 1 102 ? -1.709  -18.170 -1.028  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 1457  H HG3  . LYS A 1 102 ? -1.396  -16.459 -0.732  1.00 0.00 ? 102 LYS A HG3  1  
ATOM 1458  H HD2  . LYS A 1 102 ? 0.154   -16.883 0.895   1.00 0.00 ? 102 LYS A HD2  1  
ATOM 1459  H HD3  . LYS A 1 102 ? -0.601  -18.407 1.369   1.00 0.00 ? 102 LYS A HD3  1  
ATOM 1460  H HE2  . LYS A 1 102 ? 0.941   -17.950 -1.183  1.00 0.00 ? 102 LYS A HE2  1  
ATOM 1461  H HE3  . LYS A 1 102 ? 1.588   -18.717 0.266   1.00 0.00 ? 102 LYS A HE3  1  
ATOM 1462  H HZ1  . LYS A 1 102 ? 0.830   -20.621 -0.544  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 1463  H HZ2  . LYS A 1 102 ? 0.005   -19.846 -1.802  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 1464  H HZ3  . LYS A 1 102 ? -0.747  -20.058 -0.302  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 1465  N N    . MET A 1 103 ? -4.117  -16.407 3.505   1.00 0.00 ? 103 MET A N    1  
ATOM 1466  C CA   . MET A 1 103 ? -5.303  -16.415 4.353   1.00 0.00 ? 103 MET A CA   1  
ATOM 1467  C C    . MET A 1 103 ? -6.074  -15.105 4.223   1.00 0.00 ? 103 MET A C    1  
ATOM 1468  O O    . MET A 1 103 ? -7.261  -15.036 4.544   1.00 0.00 ? 103 MET A O    1  
ATOM 1469  C CB   . MET A 1 103 ? -4.912  -16.647 5.813   1.00 0.00 ? 103 MET A CB   1  
ATOM 1470  C CG   . MET A 1 103 ? -3.786  -15.744 6.291   1.00 0.00 ? 103 MET A CG   1  
ATOM 1471  S SD   . MET A 1 103 ? -2.824  -16.481 7.627   1.00 0.00 ? 103 MET A SD   1  
ATOM 1472  C CE   . MET A 1 103 ? -4.123  -16.912 8.782   1.00 0.00 ? 103 MET A CE   1  
ATOM 1473  H H    . MET A 1 103 ? -3.256  -16.680 3.886   1.00 0.00 ? 103 MET A H    1  
ATOM 1474  H HA   . MET A 1 103 ? -5.938  -17.226 4.026   1.00 0.00 ? 103 MET A HA   1  
ATOM 1475  H HB2  . MET A 1 103 ? -5.775  -16.472 6.437   1.00 0.00 ? 103 MET A HB2  1  
ATOM 1476  H HB3  . MET A 1 103 ? -4.595  -17.673 5.930   1.00 0.00 ? 103 MET A HB3  1  
ATOM 1477  H HG2  . MET A 1 103 ? -3.126  -15.542 5.461   1.00 0.00 ? 103 MET A HG2  1  
ATOM 1478  H HG3  . MET A 1 103 ? -4.213  -14.816 6.642   1.00 0.00 ? 103 MET A HG3  1  
ATOM 1479  H HE1  . MET A 1 103 ? -4.410  -16.035 9.344   1.00 0.00 ? 103 MET A HE1  1  
ATOM 1480  H HE2  . MET A 1 103 ? -4.978  -17.287 8.239   1.00 0.00 ? 103 MET A HE2  1  
ATOM 1481  H HE3  . MET A 1 103 ? -3.765  -17.673 9.458   1.00 0.00 ? 103 MET A HE3  1  
ATOM 1482  N N    . LEU A 1 104 ? -5.392  -14.067 3.750   1.00 0.00 ? 104 LEU A N    1  
ATOM 1483  C CA   . LEU A 1 104 ? -6.012  -12.758 3.578   1.00 0.00 ? 104 LEU A CA   1  
ATOM 1484  C C    . LEU A 1 104 ? -5.951  -12.314 2.120   1.00 0.00 ? 104 LEU A C    1  
ATOM 1485  O O    . LEU A 1 104 ? -4.878  -12.277 1.518   1.00 0.00 ? 104 LEU A O    1  
ATOM 1486  C CB   . LEU A 1 104 ? -5.321  -11.724 4.468   1.00 0.00 ? 104 LEU A CB   1  
ATOM 1487  C CG   . LEU A 1 104 ? -4.713  -12.254 5.766   1.00 0.00 ? 104 LEU A CG   1  
ATOM 1488  C CD1  . LEU A 1 104 ? -3.266  -12.669 5.548   1.00 0.00 ? 104 LEU A CD1  1  
ATOM 1489  C CD2  . LEU A 1 104 ? -4.809  -11.208 6.867   1.00 0.00 ? 104 LEU A CD2  1  
ATOM 1490  H H    . LEU A 1 104 ? -4.449  -14.183 3.511   1.00 0.00 ? 104 LEU A H    1  
ATOM 1491  H HA   . LEU A 1 104 ? -7.047  -12.841 3.874   1.00 0.00 ? 104 LEU A HA   1  
ATOM 1492  H HB2  . LEU A 1 104 ? -4.528  -11.270 3.893   1.00 0.00 ? 104 LEU A HB2  1  
ATOM 1493  H HB3  . LEU A 1 104 ? -6.052  -10.970 4.727   1.00 0.00 ? 104 LEU A HB3  1  
ATOM 1494  H HG   . LEU A 1 104 ? -5.265  -13.127 6.085   1.00 0.00 ? 104 LEU A HG   1  
ATOM 1495  H HD11 . LEU A 1 104 ? -2.754  -11.906 4.982   1.00 0.00 ? 104 LEU A HD11 1  
ATOM 1496  H HD12 . LEU A 1 104 ? -3.237  -13.601 5.003   1.00 0.00 ? 104 LEU A HD12 1  
ATOM 1497  H HD13 . LEU A 1 104 ? -2.780  -12.796 6.504   1.00 0.00 ? 104 LEU A HD13 1  
ATOM 1498  H HD21 . LEU A 1 104 ? -5.542  -11.519 7.596   1.00 0.00 ? 104 LEU A HD21 1  
ATOM 1499  H HD22 . LEU A 1 104 ? -5.106  -10.262 6.438   1.00 0.00 ? 104 LEU A HD22 1  
ATOM 1500  H HD23 . LEU A 1 104 ? -3.846  -11.099 7.346   1.00 0.00 ? 104 LEU A HD23 1  
ATOM 1501  N N    . GLN A 1 105 ? -7.108  -11.977 1.560   1.00 0.00 ? 105 GLN A N    1  
ATOM 1502  C CA   . GLN A 1 105 ? -7.185  -11.534 0.174   1.00 0.00 ? 105 GLN A CA   1  
ATOM 1503  C C    . GLN A 1 105 ? -8.077  -10.303 0.044   1.00 0.00 ? 105 GLN A C    1  
ATOM 1504  O O    . GLN A 1 105 ? -8.988  -10.098 0.844   1.00 0.00 ? 105 GLN A O    1  
ATOM 1505  C CB   . GLN A 1 105 ? -7.717  -12.660 -0.715  1.00 0.00 ? 105 GLN A CB   1  
ATOM 1506  C CG   . GLN A 1 105 ? -7.003  -13.986 -0.509  1.00 0.00 ? 105 GLN A CG   1  
ATOM 1507  C CD   . GLN A 1 105 ? -7.639  -15.119 -1.291  1.00 0.00 ? 105 GLN A CD   1  
ATOM 1508  O OE1  . GLN A 1 105 ? -8.835  -15.092 -1.582  1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1509  N NE2  . GLN A 1 105 ? -6.841  -16.122 -1.635  1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1510  H H    . GLN A 1 105 ? -7.929  -12.028 2.092   1.00 0.00 ? 105 GLN A H    1  
ATOM 1511  H HA   . GLN A 1 105 ? -6.188  -11.276 -0.147  1.00 0.00 ? 105 GLN A HA   1  
ATOM 1512  H HB2  . GLN A 1 105 ? -8.766  -12.804 -0.504  1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1513  H HB3  . GLN A 1 105 ? -7.602  -12.371 -1.749  1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1514  H HG2  . GLN A 1 105 ? -5.977  -13.881 -0.829  1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1515  H HG3  . GLN A 1 105 ? -7.028  -14.234 0.541   1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1516  H HE21 . GLN A 1 105 ? -5.898  -16.076 -1.368  1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1517  H HE22 . GLN A 1 105 ? -7.225  -16.868 -2.140  1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1518  N N    . GLY A 1 106 ? -7.807  -9.487  -0.971  1.00 0.00 ? 106 GLY A N    1  
ATOM 1519  C CA   . GLY A 1 106 ? -8.594  -8.287  -1.186  1.00 0.00 ? 106 GLY A CA   1  
ATOM 1520  C C    . GLY A 1 106 ? -7.938  -7.332  -2.164  1.00 0.00 ? 106 GLY A C    1  
ATOM 1521  O O    . GLY A 1 106 ? -7.274  -7.760  -3.109  1.00 0.00 ? 106 GLY A O    1  
ATOM 1522  H H    . GLY A 1 106 ? -7.068  -9.702  -1.578  1.00 0.00 ? 106 GLY A H    1  
ATOM 1523  H HA2  . GLY A 1 106 ? -9.563  -8.569  -1.569  1.00 0.00 ? 106 GLY A HA2  1  
ATOM 1524  H HA3  . GLY A 1 106 ? -8.724  -7.782  -0.241  1.00 0.00 ? 106 GLY A HA3  1  
ATOM 1525  N N    . ILE A 1 107 ? -8.125  -6.036  -1.939  1.00 0.00 ? 107 ILE A N    1  
ATOM 1526  C CA   . ILE A 1 107 ? -7.547  -5.019  -2.808  1.00 0.00 ? 107 ILE A CA   1  
ATOM 1527  C C    . ILE A 1 107 ? -6.757  -3.993  -2.003  1.00 0.00 ? 107 ILE A C    1  
ATOM 1528  O O    . ILE A 1 107 ? -6.848  -3.946  -0.776  1.00 0.00 ? 107 ILE A O    1  
ATOM 1529  C CB   . ILE A 1 107 ? -8.633  -4.290  -3.622  1.00 0.00 ? 107 ILE A CB   1  
ATOM 1530  C CG1  . ILE A 1 107 ? -9.702  -3.718  -2.689  1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1531  C CG2  . ILE A 1 107 ? -9.259  -5.236  -4.636  1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1532  C CD1  . ILE A 1 107 ? -10.705 -2.829  -3.392  1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1533  H H    . ILE A 1 107 ? -8.664  -5.757  -1.170  1.00 0.00 ? 107 ILE A H    1  
ATOM 1534  H HA   . ILE A 1 107 ? -6.878  -5.512  -3.499  1.00 0.00 ? 107 ILE A HA   1  
ATOM 1535  H HB   . ILE A 1 107 ? -8.165  -3.481  -4.161  1.00 0.00 ? 107 ILE A HB   1  
ATOM 1536  H HG12 . ILE A 1 107 ? -10.244 -4.530  -2.231  1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1537  H HG13 . ILE A 1 107 ? -9.221  -3.132  -1.919  1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1538  H HG21 . ILE A 1 107 ? -8.551  -6.011  -4.890  1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1539  H HG22 . ILE A 1 107 ? -10.145 -5.684  -4.211  1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1540  H HG23 . ILE A 1 107 ? -9.525  -4.686  -5.526  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1541  H HD11 . ILE A 1 107 ? -10.252 -1.870  -3.599  1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1542  H HD12 . ILE A 1 107 ? -11.008 -3.292  -4.320  1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1543  H HD13 . ILE A 1 107 ? -11.569 -2.690  -2.759  1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1544  N N    . PHE A 1 108 ? -5.982  -3.170  -2.702  1.00 0.00 ? 108 PHE A N    1  
ATOM 1545  C CA   . PHE A 1 108 ? -5.175  -2.143  -2.053  1.00 0.00 ? 108 PHE A CA   1  
ATOM 1546  C C    . PHE A 1 108 ? -4.793  -1.046  -3.042  1.00 0.00 ? 108 PHE A C    1  
ATOM 1547  O O    . PHE A 1 108 ? -4.838  -1.229  -4.259  1.00 0.00 ? 108 PHE A O    1  
ATOM 1548  C CB   . PHE A 1 108 ? -3.914  -2.762  -1.448  1.00 0.00 ? 108 PHE A CB   1  
ATOM 1549  C CG   . PHE A 1 108 ? -3.422  -3.970  -2.193  1.00 0.00 ? 108 PHE A CG   1  
ATOM 1550  C CD1  . PHE A 1 108 ? -3.921  -5.230  -1.903  1.00 0.00 ? 108 PHE A CD1  1  
ATOM 1551  C CD2  . PHE A 1 108 ? -2.461  -3.846  -3.184  1.00 0.00 ? 108 PHE A CD2  1  
ATOM 1552  C CE1  . PHE A 1 108 ? -3.470  -6.343  -2.587  1.00 0.00 ? 108 PHE A CE1  1  
ATOM 1553  C CE2  . PHE A 1 108 ? -2.007  -4.956  -3.872  1.00 0.00 ? 108 PHE A CE2  1  
ATOM 1554  C CZ   . PHE A 1 108 ? -2.512  -6.206  -3.573  1.00 0.00 ? 108 PHE A CZ   1  
ATOM 1555  H H    . PHE A 1 108 ? -5.951  -3.257  -3.678  1.00 0.00 ? 108 PHE A H    1  
ATOM 1556  H HA   . PHE A 1 108 ? -5.767  -1.709  -1.263  1.00 0.00 ? 108 PHE A HA   1  
ATOM 1557  H HB2  . PHE A 1 108 ? -3.123  -2.027  -1.452  1.00 0.00 ? 108 PHE A HB2  1  
ATOM 1558  H HB3  . PHE A 1 108 ? -4.119  -3.059  -0.431  1.00 0.00 ? 108 PHE A HB3  1  
ATOM 1559  H HD1  . PHE A 1 108 ? -4.671  -5.339  -1.133  1.00 0.00 ? 108 PHE A HD1  1  
ATOM 1560  H HD2  . PHE A 1 108 ? -2.065  -2.868  -3.419  1.00 0.00 ? 108 PHE A HD2  1  
ATOM 1561  H HE1  . PHE A 1 108 ? -3.867  -7.319  -2.352  1.00 0.00 ? 108 PHE A HE1  1  
ATOM 1562  H HE2  . PHE A 1 108 ? -1.258  -4.844  -4.642  1.00 0.00 ? 108 PHE A HE2  1  
ATOM 1563  H HZ   . PHE A 1 108 ? -2.158  -7.074  -4.108  1.00 0.00 ? 108 PHE A HZ   1  
ATOM 1564  N N    . PRO A 1 109 ? -4.409  0.123   -2.509  1.00 0.00 ? 109 PRO A N    1  
ATOM 1565  C CA   . PRO A 1 109 ? -4.012  1.274   -3.326  1.00 0.00 ? 109 PRO A CA   1  
ATOM 1566  C C    . PRO A 1 109 ? -2.681  1.048   -4.036  1.00 0.00 ? 109 PRO A C    1  
ATOM 1567  O O    . PRO A 1 109 ? -1.711  0.593   -3.430  1.00 0.00 ? 109 PRO A O    1  
ATOM 1568  C CB   . PRO A 1 109 ? -3.888  2.408   -2.305  1.00 0.00 ? 109 PRO A CB   1  
ATOM 1569  C CG   . PRO A 1 109 ? -3.601  1.724   -1.013  1.00 0.00 ? 109 PRO A CG   1  
ATOM 1570  C CD   . PRO A 1 109 ? -4.332  0.412   -1.067  1.00 0.00 ? 109 PRO A CD   1  
ATOM 1571  H HA   . PRO A 1 109 ? -4.769  1.524   -4.054  1.00 0.00 ? 109 PRO A HA   1  
ATOM 1572  H HB2  . PRO A 1 109 ? -3.081  3.067   -2.592  1.00 0.00 ? 109 PRO A HB2  1  
ATOM 1573  H HB3  . PRO A 1 109 ? -4.814  2.961   -2.262  1.00 0.00 ? 109 PRO A HB3  1  
ATOM 1574  H HG2  . PRO A 1 109 ? -2.539  1.558   -0.913  1.00 0.00 ? 109 PRO A HG2  1  
ATOM 1575  H HG3  . PRO A 1 109 ? -3.967  2.323   -0.192  1.00 0.00 ? 109 PRO A HG3  1  
ATOM 1576  H HD2  . PRO A 1 109 ? -3.773  -0.354  -0.550  1.00 0.00 ? 109 PRO A HD2  1  
ATOM 1577  H HD3  . PRO A 1 109 ? -5.320  0.513   -0.642  1.00 0.00 ? 109 PRO A HD3  1  
ATOM 1578  N N    . LYS A 1 110 ? -2.642  1.370   -5.325  1.00 0.00 ? 110 LYS A N    1  
ATOM 1579  C CA   . LYS A 1 110 ? -1.430  1.205   -6.118  1.00 0.00 ? 110 LYS A CA   1  
ATOM 1580  C C    . LYS A 1 110 ? -0.318  2.118   -5.610  1.00 0.00 ? 110 LYS A C    1  
ATOM 1581  O O    . LYS A 1 110 ? 0.865   1.819   -5.771  1.00 0.00 ? 110 LYS A O    1  
ATOM 1582  C CB   . LYS A 1 110 ? -1.716  1.504   -7.592  1.00 0.00 ? 110 LYS A CB   1  
ATOM 1583  C CG   . LYS A 1 110 ? -2.921  0.760   -8.140  1.00 0.00 ? 110 LYS A CG   1  
ATOM 1584  C CD   . LYS A 1 110 ? -3.460  1.421   -9.398  1.00 0.00 ? 110 LYS A CD   1  
ATOM 1585  C CE   . LYS A 1 110 ? -2.693  0.976   -10.634 1.00 0.00 ? 110 LYS A CE   1  
ATOM 1586  N NZ   . LYS A 1 110 ? -3.067  1.773   -11.835 1.00 0.00 ? 110 LYS A NZ   1  
ATOM 1587  H H    . LYS A 1 110 ? -3.448  1.729   -5.752  1.00 0.00 ? 110 LYS A H    1  
ATOM 1588  H HA   . LYS A 1 110 ? -1.109  0.179   -6.023  1.00 0.00 ? 110 LYS A HA   1  
ATOM 1589  H HB2  . LYS A 1 110 ? -1.891  2.563   -7.705  1.00 0.00 ? 110 LYS A HB2  1  
ATOM 1590  H HB3  . LYS A 1 110 ? -0.851  1.226   -8.177  1.00 0.00 ? 110 LYS A HB3  1  
ATOM 1591  H HG2  . LYS A 1 110 ? -2.631  -0.254  -8.376  1.00 0.00 ? 110 LYS A HG2  1  
ATOM 1592  H HG3  . LYS A 1 110 ? -3.698  0.748   -7.389  1.00 0.00 ? 110 LYS A HG3  1  
ATOM 1593  H HD2  . LYS A 1 110 ? -4.499  1.154   -9.518  1.00 0.00 ? 110 LYS A HD2  1  
ATOM 1594  H HD3  . LYS A 1 110 ? -3.371  2.494   -9.296  1.00 0.00 ? 110 LYS A HD3  1  
ATOM 1595  H HE2  . LYS A 1 110 ? -1.637  1.095   -10.448 1.00 0.00 ? 110 LYS A HE2  1  
ATOM 1596  H HE3  . LYS A 1 110 ? -2.911  -0.065  -10.821 1.00 0.00 ? 110 LYS A HE3  1  
ATOM 1597  H HZ1  . LYS A 1 110 ? -3.867  1.325   -12.326 1.00 0.00 ? 110 LYS A HZ1  1  
ATOM 1598  H HZ2  . LYS A 1 110 ? -2.261  1.831   -12.490 1.00 0.00 ? 110 LYS A HZ2  1  
ATOM 1599  H HZ3  . LYS A 1 110 ? -3.341  2.736   -11.554 1.00 0.00 ? 110 LYS A HZ3  1  
ATOM 1600  N N    . SER A 1 111 ? -0.707  3.230   -4.995  1.00 0.00 ? 111 SER A N    1  
ATOM 1601  C CA   . SER A 1 111 ? 0.258   4.187   -4.465  1.00 0.00 ? 111 SER A CA   1  
ATOM 1602  C C    . SER A 1 111 ? 1.040   3.583   -3.304  1.00 0.00 ? 111 SER A C    1  
ATOM 1603  O O    . SER A 1 111 ? 2.056   4.130   -2.873  1.00 0.00 ? 111 SER A O    1  
ATOM 1604  C CB   . SER A 1 111 ? -0.455  5.461   -4.007  1.00 0.00 ? 111 SER A CB   1  
ATOM 1605  O OG   . SER A 1 111 ? -0.656  6.351   -5.092  1.00 0.00 ? 111 SER A OG   1  
ATOM 1606  H H    . SER A 1 111 ? -1.665  3.412   -4.898  1.00 0.00 ? 111 SER A H    1  
ATOM 1607  H HA   . SER A 1 111 ? 0.947   4.436   -5.258  1.00 0.00 ? 111 SER A HA   1  
ATOM 1608  H HB2  . SER A 1 111 ? -1.415  5.202   -3.588  1.00 0.00 ? 111 SER A HB2  1  
ATOM 1609  H HB3  . SER A 1 111 ? 0.144   5.955   -3.257  1.00 0.00 ? 111 SER A HB3  1  
ATOM 1610  H HG   . SER A 1 111 ? -1.574  6.318   -5.368  1.00 0.00 ? 111 SER A HG   1  
ATOM 1611  N N    . PHE A 1 112 ? 0.560   2.451   -2.800  1.00 0.00 ? 112 PHE A N    1  
ATOM 1612  C CA   . PHE A 1 112 ? 1.213   1.772   -1.687  1.00 0.00 ? 112 PHE A CA   1  
ATOM 1613  C C    . PHE A 1 112 ? 1.990   0.552   -2.175  1.00 0.00 ? 112 PHE A C    1  
ATOM 1614  O O    . PHE A 1 112 ? 2.818   0.000   -1.450  1.00 0.00 ? 112 PHE A O    1  
ATOM 1615  C CB   . PHE A 1 112 ? 0.178   1.347   -0.643  1.00 0.00 ? 112 PHE A CB   1  
ATOM 1616  C CG   . PHE A 1 112 ? -0.351  2.490   0.175   1.00 0.00 ? 112 PHE A CG   1  
ATOM 1617  C CD1  . PHE A 1 112 ? -0.927  3.591   -0.439  1.00 0.00 ? 112 PHE A CD1  1  
ATOM 1618  C CD2  . PHE A 1 112 ? -0.273  2.464   1.558   1.00 0.00 ? 112 PHE A CD2  1  
ATOM 1619  C CE1  . PHE A 1 112 ? -1.414  4.644   0.312   1.00 0.00 ? 112 PHE A CE1  1  
ATOM 1620  C CE2  . PHE A 1 112 ? -0.759  3.514   2.314   1.00 0.00 ? 112 PHE A CE2  1  
ATOM 1621  C CZ   . PHE A 1 112 ? -1.331  4.605   1.690   1.00 0.00 ? 112 PHE A CZ   1  
ATOM 1622  H H    . PHE A 1 112 ? -0.254  2.063   -3.186  1.00 0.00 ? 112 PHE A H    1  
ATOM 1623  H HA   . PHE A 1 112 ? 1.904   2.467   -1.235  1.00 0.00 ? 112 PHE A HA   1  
ATOM 1624  H HB2  . PHE A 1 112 ? -0.658  0.883   -1.143  1.00 0.00 ? 112 PHE A HB2  1  
ATOM 1625  H HB3  . PHE A 1 112 ? 0.630   0.635   0.032   1.00 0.00 ? 112 PHE A HB3  1  
ATOM 1626  H HD1  . PHE A 1 112 ? -0.994  3.622   -1.516  1.00 0.00 ? 112 PHE A HD1  1  
ATOM 1627  H HD2  . PHE A 1 112 ? 0.174   1.610   2.048   1.00 0.00 ? 112 PHE A HD2  1  
ATOM 1628  H HE1  . PHE A 1 112 ? -1.861  5.496   -0.178  1.00 0.00 ? 112 PHE A HE1  1  
ATOM 1629  H HE2  . PHE A 1 112 ? -0.693  3.480   3.392   1.00 0.00 ? 112 PHE A HE2  1  
ATOM 1630  H HZ   . PHE A 1 112 ? -1.711  5.427   2.279   1.00 0.00 ? 112 PHE A HZ   1  
ATOM 1631  N N    . ILE A 1 113 ? 1.715   0.137   -3.407  1.00 0.00 ? 113 ILE A N    1  
ATOM 1632  C CA   . ILE A 1 113 ? 2.388   -1.016  -3.991  1.00 0.00 ? 113 ILE A CA   1  
ATOM 1633  C C    . ILE A 1 113 ? 3.532   -0.582  -4.902  1.00 0.00 ? 113 ILE A C    1  
ATOM 1634  O O    . ILE A 1 113 ? 3.336   0.201   -5.832  1.00 0.00 ? 113 ILE A O    1  
ATOM 1635  C CB   . ILE A 1 113 ? 1.409   -1.890  -4.797  1.00 0.00 ? 113 ILE A CB   1  
ATOM 1636  C CG1  . ILE A 1 113 ? 0.260   -2.363  -3.904  1.00 0.00 ? 113 ILE A CG1  1  
ATOM 1637  C CG2  . ILE A 1 113 ? 2.138   -3.079  -5.406  1.00 0.00 ? 113 ILE A CG2  1  
ATOM 1638  C CD1  . ILE A 1 113 ? 0.723   -3.022  -2.623  1.00 0.00 ? 113 ILE A CD1  1  
ATOM 1639  H H    . ILE A 1 113 ? 1.045   0.618   -3.935  1.00 0.00 ? 113 ILE A H    1  
ATOM 1640  H HA   . ILE A 1 113 ? 2.791   -1.611  -3.184  1.00 0.00 ? 113 ILE A HA   1  
ATOM 1641  H HB   . ILE A 1 113 ? 1.008   -1.294  -5.602  1.00 0.00 ? 113 ILE A HB   1  
ATOM 1642  H HG12 . ILE A 1 113 ? -0.353  -1.517  -3.638  1.00 0.00 ? 113 ILE A HG12 1  
ATOM 1643  H HG13 . ILE A 1 113 ? -0.338  -3.079  -4.449  1.00 0.00 ? 113 ILE A HG13 1  
ATOM 1644  H HG21 . ILE A 1 113 ? 3.203   -2.900  -5.380  1.00 0.00 ? 113 ILE A HG21 1  
ATOM 1645  H HG22 . ILE A 1 113 ? 1.910   -3.969  -4.839  1.00 0.00 ? 113 ILE A HG22 1  
ATOM 1646  H HG23 . ILE A 1 113 ? 1.820   -3.211  -6.429  1.00 0.00 ? 113 ILE A HG23 1  
ATOM 1647  H HD11 . ILE A 1 113 ? 0.716   -2.296  -1.823  1.00 0.00 ? 113 ILE A HD11 1  
ATOM 1648  H HD12 . ILE A 1 113 ? 0.056   -3.835  -2.375  1.00 0.00 ? 113 ILE A HD12 1  
ATOM 1649  H HD13 . ILE A 1 113 ? 1.724   -3.403  -2.755  1.00 0.00 ? 113 ILE A HD13 1  
ATOM 1650  N N    . HIS A 1 114 ? 4.727   -1.097  -4.629  1.00 0.00 ? 114 HIS A N    1  
ATOM 1651  C CA   . HIS A 1 114 ? 5.903   -0.765  -5.425  1.00 0.00 ? 114 HIS A CA   1  
ATOM 1652  C C    . HIS A 1 114 ? 6.188   -1.855  -6.454  1.00 0.00 ? 114 HIS A C    1  
ATOM 1653  O O    . HIS A 1 114 ? 6.790   -2.880  -6.135  1.00 0.00 ? 114 HIS A O    1  
ATOM 1654  C CB   . HIS A 1 114 ? 7.119   -0.571  -4.520  1.00 0.00 ? 114 HIS A CB   1  
ATOM 1655  C CG   . HIS A 1 114 ? 8.370   -0.217  -5.265  1.00 0.00 ? 114 HIS A CG   1  
ATOM 1656  N ND1  . HIS A 1 114 ? 8.519   0.958   -5.970  1.00 0.00 ? 114 HIS A ND1  1  
ATOM 1657  C CD2  . HIS A 1 114 ? 9.534   -0.892  -5.411  1.00 0.00 ? 114 HIS A CD2  1  
ATOM 1658  C CE1  . HIS A 1 114 ? 9.720   0.991   -6.519  1.00 0.00 ? 114 HIS A CE1  1  
ATOM 1659  N NE2  . HIS A 1 114 ? 10.356  -0.121  -6.195  1.00 0.00 ? 114 HIS A NE2  1  
ATOM 1660  H H    . HIS A 1 114 ? 4.819   -1.715  -3.875  1.00 0.00 ? 114 HIS A H    1  
ATOM 1661  H HA   . HIS A 1 114 ? 5.700   0.159   -5.945  1.00 0.00 ? 114 HIS A HA   1  
ATOM 1662  H HB2  . HIS A 1 114 ? 6.915   0.226   -3.820  1.00 0.00 ? 114 HIS A HB2  1  
ATOM 1663  H HB3  . HIS A 1 114 ? 7.304   -1.485  -3.975  1.00 0.00 ? 114 HIS A HB3  1  
ATOM 1664  H HD1  . HIS A 1 114 ? 7.844   1.663   -6.057  1.00 0.00 ? 114 HIS A HD1  1  
ATOM 1665  H HD2  . HIS A 1 114 ? 9.772   -1.859  -4.990  1.00 0.00 ? 114 HIS A HD2  1  
ATOM 1666  H HE1  . HIS A 1 114 ? 10.116  1.789   -7.128  1.00 0.00 ? 114 HIS A HE1  1  
ATOM 1667  H HE2  . HIS A 1 114 ? 11.232  -0.391  -6.540  1.00 0.00 ? 114 HIS A HE2  1  
ATOM 1668  N N    . ILE A 1 115 ? 5.751   -1.626  -7.688  1.00 0.00 ? 115 ILE A N    1  
ATOM 1669  C CA   . ILE A 1 115 ? 5.960   -2.588  -8.763  1.00 0.00 ? 115 ILE A CA   1  
ATOM 1670  C C    . ILE A 1 115 ? 7.438   -2.704  -9.117  1.00 0.00 ? 115 ILE A C    1  
ATOM 1671  O O    . ILE A 1 115 ? 8.033   -1.773  -9.661  1.00 0.00 ? 115 ILE A O    1  
ATOM 1672  C CB   . ILE A 1 115 ? 5.169   -2.201  -10.027 1.00 0.00 ? 115 ILE A CB   1  
ATOM 1673  C CG1  . ILE A 1 115 ? 3.684   -2.041  -9.697  1.00 0.00 ? 115 ILE A CG1  1  
ATOM 1674  C CG2  . ILE A 1 115 ? 5.366   -3.245  -11.115 1.00 0.00 ? 115 ILE A CG2  1  
ATOM 1675  C CD1  . ILE A 1 115 ? 3.088   -3.241  -8.994  1.00 0.00 ? 115 ILE A CD1  1  
ATOM 1676  H H    . ILE A 1 115 ? 5.277   -0.790  -7.880  1.00 0.00 ? 115 ILE A H    1  
ATOM 1677  H HA   . ILE A 1 115 ? 5.605   -3.550  -8.422  1.00 0.00 ? 115 ILE A HA   1  
ATOM 1678  H HB   . ILE A 1 115 ? 5.553   -1.260  -10.390 1.00 0.00 ? 115 ILE A HB   1  
ATOM 1679  H HG12 . ILE A 1 115 ? 3.554   -1.184  -9.055  1.00 0.00 ? 115 ILE A HG12 1  
ATOM 1680  H HG13 . ILE A 1 115 ? 3.134   -1.886  -10.614 1.00 0.00 ? 115 ILE A HG13 1  
ATOM 1681  H HG21 . ILE A 1 115 ? 4.925   -2.893  -12.036 1.00 0.00 ? 115 ILE A HG21 1  
ATOM 1682  H HG22 . ILE A 1 115 ? 6.422   -3.414  -11.265 1.00 0.00 ? 115 ILE A HG22 1  
ATOM 1683  H HG23 . ILE A 1 115 ? 4.893   -4.169  -10.818 1.00 0.00 ? 115 ILE A HG23 1  
ATOM 1684  H HD11 . ILE A 1 115 ? 2.028   -3.087  -8.855  1.00 0.00 ? 115 ILE A HD11 1  
ATOM 1685  H HD12 . ILE A 1 115 ? 3.246   -4.125  -9.595  1.00 0.00 ? 115 ILE A HD12 1  
ATOM 1686  H HD13 . ILE A 1 115 ? 3.562   -3.368  -8.033  1.00 0.00 ? 115 ILE A HD13 1  
ATOM 1687  N N    . LYS A 1 116 ? 8.027   -3.855  -8.807  1.00 0.00 ? 116 LYS A N    1  
ATOM 1688  C CA   . LYS A 1 116 ? 9.435   -4.096  -9.095  1.00 0.00 ? 116 LYS A CA   1  
ATOM 1689  C C    . LYS A 1 116 ? 9.621   -4.595  -10.524 1.00 0.00 ? 116 LYS A C    1  
ATOM 1690  O O    . LYS A 1 116 ? 8.968   -5.547  -10.948 1.00 0.00 ? 116 LYS A O    1  
ATOM 1691  C CB   . LYS A 1 116 ? 10.011  -5.115  -8.109  1.00 0.00 ? 116 LYS A CB   1  
ATOM 1692  C CG   . LYS A 1 116 ? 9.773   -4.754  -6.653  1.00 0.00 ? 116 LYS A CG   1  
ATOM 1693  C CD   . LYS A 1 116 ? 9.766   -5.988  -5.766  1.00 0.00 ? 116 LYS A CD   1  
ATOM 1694  C CE   . LYS A 1 116 ? 11.162  -6.324  -5.266  1.00 0.00 ? 116 LYS A CE   1  
ATOM 1695  N NZ   . LYS A 1 116 ? 11.146  -7.446  -4.287  1.00 0.00 ? 116 LYS A NZ   1  
ATOM 1696  H H    . LYS A 1 116 ? 7.500   -4.559  -8.374  1.00 0.00 ? 116 LYS A H    1  
ATOM 1697  H HA   . LYS A 1 116 ? 9.962   -3.160  -8.981  1.00 0.00 ? 116 LYS A HA   1  
ATOM 1698  H HB2  . LYS A 1 116 ? 9.558   -6.077  -8.298  1.00 0.00 ? 116 LYS A HB2  1  
ATOM 1699  H HB3  . LYS A 1 116 ? 11.077  -5.190  -8.269  1.00 0.00 ? 116 LYS A HB3  1  
ATOM 1700  H HG2  . LYS A 1 116 ? 10.560  -4.092  -6.322  1.00 0.00 ? 116 LYS A HG2  1  
ATOM 1701  H HG3  . LYS A 1 116 ? 8.819   -4.254  -6.566  1.00 0.00 ? 116 LYS A HG3  1  
ATOM 1702  H HD2  . LYS A 1 116 ? 9.125   -5.807  -4.916  1.00 0.00 ? 116 LYS A HD2  1  
ATOM 1703  H HD3  . LYS A 1 116 ? 9.385   -6.826  -6.334  1.00 0.00 ? 116 LYS A HD3  1  
ATOM 1704  H HE2  . LYS A 1 116 ? 11.775  -6.602  -6.109  1.00 0.00 ? 116 LYS A HE2  1  
ATOM 1705  H HE3  . LYS A 1 116 ? 11.580  -5.448  -4.791  1.00 0.00 ? 116 LYS A HE3  1  
ATOM 1706  H HZ1  . LYS A 1 116 ? 11.255  -8.354  -4.782  1.00 0.00 ? 116 LYS A HZ1  1  
ATOM 1707  H HZ2  . LYS A 1 116 ? 10.246  -7.452  -3.766  1.00 0.00 ? 116 LYS A HZ2  1  
ATOM 1708  H HZ3  . LYS A 1 116 ? 11.925  -7.338  -3.607  1.00 0.00 ? 116 LYS A HZ3  1  
ATOM 1709  N N    . GLU A 1 117 ? 10.517  -3.945  -11.261 1.00 0.00 ? 117 GLU A N    1  
ATOM 1710  C CA   . GLU A 1 117 ? 10.788  -4.325  -12.642 1.00 0.00 ? 117 GLU A CA   1  
ATOM 1711  C C    . GLU A 1 117 ? 12.289  -4.447  -12.889 1.00 0.00 ? 117 GLU A C    1  
ATOM 1712  O O    . GLU A 1 117 ? 12.810  -3.938  -13.881 1.00 0.00 ? 117 GLU A O    1  
ATOM 1713  C CB   . GLU A 1 117 ? 10.184  -3.300  -13.604 1.00 0.00 ? 117 GLU A CB   1  
ATOM 1714  C CG   . GLU A 1 117 ? 8.828   -2.776  -13.163 1.00 0.00 ? 117 GLU A CG   1  
ATOM 1715  C CD   . GLU A 1 117 ? 7.678   -3.602  -13.707 1.00 0.00 ? 117 GLU A CD   1  
ATOM 1716  O OE1  . GLU A 1 117 ? 7.867   -4.819  -13.914 1.00 0.00 ? 117 GLU A OE1  1  
ATOM 1717  O OE2  . GLU A 1 117 ? 6.589   -3.031  -13.925 1.00 0.00 ? 117 GLU A OE2  1  
ATOM 1718  H H    . GLU A 1 117 ? 11.007  -3.194  -10.867 1.00 0.00 ? 117 GLU A H    1  
ATOM 1719  H HA   . GLU A 1 117 ? 10.328  -5.285  -12.819 1.00 0.00 ? 117 GLU A HA   1  
ATOM 1720  H HB2  . GLU A 1 117 ? 10.860  -2.462  -13.690 1.00 0.00 ? 117 GLU A HB2  1  
ATOM 1721  H HB3  . GLU A 1 117 ? 10.070  -3.759  -14.575 1.00 0.00 ? 117 GLU A HB3  1  
ATOM 1722  H HG2  . GLU A 1 117 ? 8.783   -2.793  -12.084 1.00 0.00 ? 117 GLU A HG2  1  
ATOM 1723  H HG3  . GLU A 1 117 ? 8.717   -1.760  -13.511 1.00 0.00 ? 117 GLU A HG3  1  
ATOM 1724  N N    . VAL A 1 118 ? 12.979  -5.125  -11.977 1.00 0.00 ? 118 VAL A N    1  
ATOM 1725  C CA   . VAL A 1 118 ? 14.420  -5.315  -12.095 1.00 0.00 ? 118 VAL A CA   1  
ATOM 1726  C C    . VAL A 1 118 ? 14.769  -6.120  -13.341 1.00 0.00 ? 118 VAL A C    1  
ATOM 1727  O O    . VAL A 1 118 ? 15.936  -6.225  -13.721 1.00 0.00 ? 118 VAL A O    1  
ATOM 1728  C CB   . VAL A 1 118 ? 14.995  -6.030  -10.857 1.00 0.00 ? 118 VAL A CB   1  
ATOM 1729  C CG1  . VAL A 1 118 ? 14.953  -5.114  -9.644  1.00 0.00 ? 118 VAL A CG1  1  
ATOM 1730  C CG2  . VAL A 1 118 ? 14.235  -7.320  -10.588 1.00 0.00 ? 118 VAL A CG2  1  
ATOM 1731  H H    . VAL A 1 118 ? 12.508  -5.507  -11.208 1.00 0.00 ? 118 VAL A H    1  
ATOM 1732  H HA   . VAL A 1 118 ? 14.881  -4.340  -12.167 1.00 0.00 ? 118 VAL A HA   1  
ATOM 1733  H HB   . VAL A 1 118 ? 16.027  -6.279  -11.057 1.00 0.00 ? 118 VAL A HB   1  
ATOM 1734  H HG11 . VAL A 1 118 ? 15.484  -4.200  -9.865  1.00 0.00 ? 118 VAL A HG11 1  
ATOM 1735  H HG12 . VAL A 1 118 ? 13.926  -4.886  -9.400  1.00 0.00 ? 118 VAL A HG12 1  
ATOM 1736  H HG13 . VAL A 1 118 ? 15.422  -5.607  -8.805  1.00 0.00 ? 118 VAL A HG13 1  
ATOM 1737  H HG21 . VAL A 1 118 ? 13.665  -7.592  -11.463 1.00 0.00 ? 118 VAL A HG21 1  
ATOM 1738  H HG22 . VAL A 1 118 ? 14.937  -8.108  -10.356 1.00 0.00 ? 118 VAL A HG22 1  
ATOM 1739  H HG23 . VAL A 1 118 ? 13.566  -7.177  -9.752  1.00 0.00 ? 118 VAL A HG23 1  
ATOM 1740  N N    . THR A 1 119 ? 13.748  -6.689  -13.976 1.00 0.00 ? 119 THR A N    1  
ATOM 1741  C CA   . THR A 1 119 ? 13.946  -7.486  -15.180 1.00 0.00 ? 119 THR A CA   1  
ATOM 1742  C C    . THR A 1 119 ? 13.794  -6.634  -16.435 1.00 0.00 ? 119 THR A C    1  
ATOM 1743  O O    . THR A 1 119 ? 12.680  -6.375  -16.891 1.00 0.00 ? 119 THR A O    1  
ATOM 1744  C CB   . THR A 1 119 ? 12.951  -8.659  -15.247 1.00 0.00 ? 119 THR A CB   1  
ATOM 1745  O OG1  . THR A 1 119 ? 11.733  -8.308  -14.579 1.00 0.00 ? 119 THR A OG1  1  
ATOM 1746  C CG2  . THR A 1 119 ? 13.542  -9.907  -14.609 1.00 0.00 ? 119 THR A CG2  1  
ATOM 1747  H H    . THR A 1 119 ? 12.842  -6.569  -13.625 1.00 0.00 ? 119 THR A H    1  
ATOM 1748  H HA   . THR A 1 119 ? 14.947  -7.891  -15.151 1.00 0.00 ? 119 THR A HA   1  
ATOM 1749  H HB   . THR A 1 119 ? 12.735  -8.870  -16.285 1.00 0.00 ? 119 THR A HB   1  
ATOM 1750  H HG1  . THR A 1 119 ? 11.831  -8.458  -13.636 1.00 0.00 ? 119 THR A HG1  1  
ATOM 1751  H HG21 . THR A 1 119 ? 13.243  -10.777 -15.175 1.00 0.00 ? 119 THR A HG21 1  
ATOM 1752  H HG22 . THR A 1 119 ? 13.184  -9.998  -13.595 1.00 0.00 ? 119 THR A HG22 1  
ATOM 1753  H HG23 . THR A 1 119 ? 14.619  -9.834  -14.606 1.00 0.00 ? 119 THR A HG23 1  
ATOM 1754  N N    . GLY A 1 1   ? 2.305   -7.639  -35.237 1.00 0.00 ? 1   GLY A N    2  
ATOM 1755  C CA   . GLY A 1 1   ? 1.721   -7.329  -33.945 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1756  C C    . GLY A 1 1   ? 2.696   -6.626  -33.022 1.00 0.00 ? 1   GLY A C    2  
ATOM 1757  O O    . GLY A 1 1   ? 3.480   -7.272  -32.327 1.00 0.00 ? 1   GLY A O    2  
ATOM 1758  H H1   . GLY A 1 1   ? 2.873   -6.979  -35.687 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1759  H HA2  . GLY A 1 1   ? 0.861   -6.694  -34.094 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1760  H HA3  . GLY A 1 1   ? 1.401   -8.248  -33.478 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1761  N N    . SER A 1 2   ? 2.650   -5.297  -33.015 1.00 0.00 ? 2   SER A N    2  
ATOM 1762  C CA   . SER A 1 2   ? 3.540   -4.506  -32.175 1.00 0.00 ? 2   SER A CA   2  
ATOM 1763  C C    . SER A 1 2   ? 3.766   -5.188  -30.829 1.00 0.00 ? 2   SER A C    2  
ATOM 1764  O O    . SER A 1 2   ? 2.896   -5.171  -29.958 1.00 0.00 ? 2   SER A O    2  
ATOM 1765  C CB   . SER A 1 2   ? 2.962   -3.106  -31.959 1.00 0.00 ? 2   SER A CB   2  
ATOM 1766  O OG   . SER A 1 2   ? 3.760   -2.357  -31.059 1.00 0.00 ? 2   SER A OG   2  
ATOM 1767  H H    . SER A 1 2   ? 2.003   -4.839  -33.592 1.00 0.00 ? 2   SER A H    2  
ATOM 1768  H HA   . SER A 1 2   ? 4.488   -4.419  -32.685 1.00 0.00 ? 2   SER A HA   2  
ATOM 1769  H HB2  . SER A 1 2   ? 2.922   -2.586  -32.904 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1770  H HB3  . SER A 1 2   ? 1.964   -3.191  -31.552 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1771  H HG   . SER A 1 2   ? 3.193   -1.872  -30.455 1.00 0.00 ? 2   SER A HG   2  
ATOM 1772  N N    . SER A 1 3   ? 4.941   -5.789  -30.667 1.00 0.00 ? 3   SER A N    2  
ATOM 1773  C CA   . SER A 1 3   ? 5.281   -6.481  -29.429 1.00 0.00 ? 3   SER A CA   2  
ATOM 1774  C C    . SER A 1 3   ? 6.736   -6.227  -29.047 1.00 0.00 ? 3   SER A C    2  
ATOM 1775  O O    . SER A 1 3   ? 7.560   -5.880  -29.893 1.00 0.00 ? 3   SER A O    2  
ATOM 1776  C CB   . SER A 1 3   ? 5.034   -7.983  -29.576 1.00 0.00 ? 3   SER A CB   2  
ATOM 1777  O OG   . SER A 1 3   ? 5.936   -8.560  -30.505 1.00 0.00 ? 3   SER A OG   2  
ATOM 1778  H H    . SER A 1 3   ? 5.593   -5.768  -31.398 1.00 0.00 ? 3   SER A H    2  
ATOM 1779  H HA   . SER A 1 3   ? 4.644   -6.095  -28.647 1.00 0.00 ? 3   SER A HA   2  
ATOM 1780  H HB2  . SER A 1 3   ? 5.168   -8.463  -28.618 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1781  H HB3  . SER A 1 3   ? 4.025   -8.147  -29.923 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1782  H HG   . SER A 1 3   ? 5.831   -9.514  -30.504 1.00 0.00 ? 3   SER A HG   2  
ATOM 1783  N N    . GLY A 1 4   ? 7.045   -6.404  -27.766 1.00 0.00 ? 4   GLY A N    2  
ATOM 1784  C CA   . GLY A 1 4   ? 8.400   -6.190  -27.293 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1785  C C    . GLY A 1 4   ? 8.468   -6.006  -25.790 1.00 0.00 ? 4   GLY A C    2  
ATOM 1786  O O    . GLY A 1 4   ? 7.444   -6.037  -25.108 1.00 0.00 ? 4   GLY A O    2  
ATOM 1787  H H    . GLY A 1 4   ? 6.347   -6.682  -27.137 1.00 0.00 ? 4   GLY A H    2  
ATOM 1788  H HA2  . GLY A 1 4   ? 9.004   -7.042  -27.569 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1789  H HA3  . GLY A 1 4   ? 8.801   -5.308  -27.771 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1790  N N    . SER A 1 5   ? 9.677   -5.816  -25.273 1.00 0.00 ? 5   SER A N    2  
ATOM 1791  C CA   . SER A 1 5   ? 9.875   -5.632  -23.840 1.00 0.00 ? 5   SER A CA   2  
ATOM 1792  C C    . SER A 1 5   ? 10.068  -4.157  -23.503 1.00 0.00 ? 5   SER A C    2  
ATOM 1793  O O    . SER A 1 5   ? 11.195  -3.682  -23.364 1.00 0.00 ? 5   SER A O    2  
ATOM 1794  C CB   . SER A 1 5   ? 11.085  -6.438  -23.363 1.00 0.00 ? 5   SER A CB   2  
ATOM 1795  O OG   . SER A 1 5   ? 10.838  -7.830  -23.453 1.00 0.00 ? 5   SER A OG   2  
ATOM 1796  H H    . SER A 1 5   ? 10.455  -5.802  -25.869 1.00 0.00 ? 5   SER A H    2  
ATOM 1797  H HA   . SER A 1 5   ? 8.991   -5.992  -23.334 1.00 0.00 ? 5   SER A HA   2  
ATOM 1798  H HB2  . SER A 1 5   ? 11.940  -6.196  -23.976 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1799  H HB3  . SER A 1 5   ? 11.297  -6.188  -22.333 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1800  H HG   . SER A 1 5   ? 11.412  -8.298  -22.843 1.00 0.00 ? 5   SER A HG   2  
ATOM 1801  N N    . SER A 1 6   ? 8.959   -3.436  -23.374 1.00 0.00 ? 6   SER A N    2  
ATOM 1802  C CA   . SER A 1 6   ? 9.004   -2.013  -23.057 1.00 0.00 ? 6   SER A CA   2  
ATOM 1803  C C    . SER A 1 6   ? 9.599   -1.784  -21.671 1.00 0.00 ? 6   SER A C    2  
ATOM 1804  O O    . SER A 1 6   ? 9.308   -2.519  -20.729 1.00 0.00 ? 6   SER A O    2  
ATOM 1805  C CB   . SER A 1 6   ? 7.601   -1.408  -23.129 1.00 0.00 ? 6   SER A CB   2  
ATOM 1806  O OG   . SER A 1 6   ? 7.660   -0.002  -23.299 1.00 0.00 ? 6   SER A OG   2  
ATOM 1807  H H    . SER A 1 6   ? 8.089   -3.871  -23.497 1.00 0.00 ? 6   SER A H    2  
ATOM 1808  H HA   . SER A 1 6   ? 9.633   -1.530  -23.791 1.00 0.00 ? 6   SER A HA   2  
ATOM 1809  H HB2  . SER A 1 6   ? 7.068   -1.838  -23.964 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1810  H HB3  . SER A 1 6   ? 7.071   -1.626  -22.213 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1811  H HG   . SER A 1 6   ? 8.042   0.400   -22.516 1.00 0.00 ? 6   SER A HG   2  
ATOM 1812  N N    . GLY A 1 7   ? 10.436  -0.756  -21.556 1.00 0.00 ? 7   GLY A N    2  
ATOM 1813  C CA   . GLY A 1 7   ? 11.059  -0.447  -20.282 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1814  C C    . GLY A 1 7   ? 12.183  0.561   -20.417 1.00 0.00 ? 7   GLY A C    2  
ATOM 1815  O O    . GLY A 1 7   ? 12.209  1.350   -21.361 1.00 0.00 ? 7   GLY A O    2  
ATOM 1816  H H    . GLY A 1 7   ? 10.631  -0.204  -22.342 1.00 0.00 ? 7   GLY A H    2  
ATOM 1817  H HA2  . GLY A 1 7   ? 10.310  -0.049  -19.614 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1818  H HA3  . GLY A 1 7   ? 11.457  -1.358  -19.859 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1819  N N    . ARG A 1 8   ? 13.115  0.536   -19.469 1.00 0.00 ? 8   ARG A N    2  
ATOM 1820  C CA   . ARG A 1 8   ? 14.245  1.456   -19.485 1.00 0.00 ? 8   ARG A CA   2  
ATOM 1821  C C    . ARG A 1 8   ? 15.239  1.117   -18.378 1.00 0.00 ? 8   ARG A C    2  
ATOM 1822  O O    . ARG A 1 8   ? 14.850  0.690   -17.290 1.00 0.00 ? 8   ARG A O    2  
ATOM 1823  C CB   . ARG A 1 8   ? 13.759  2.898   -19.324 1.00 0.00 ? 8   ARG A CB   2  
ATOM 1824  C CG   . ARG A 1 8   ? 13.014  3.147   -18.022 1.00 0.00 ? 8   ARG A CG   2  
ATOM 1825  C CD   . ARG A 1 8   ? 13.961  3.571   -16.911 1.00 0.00 ? 8   ARG A CD   2  
ATOM 1826  N NE   . ARG A 1 8   ? 13.375  3.374   -15.588 1.00 0.00 ? 8   ARG A NE   2  
ATOM 1827  C CZ   . ARG A 1 8   ? 13.911  3.848   -14.468 1.00 0.00 ? 8   ARG A CZ   2  
ATOM 1828  N NH1  . ARG A 1 8   ? 15.039  4.543   -14.513 1.00 0.00 ? 8   ARG A NH1  2  
ATOM 1829  N NH2  . ARG A 1 8   ? 13.318  3.627   -13.302 1.00 0.00 ? 8   ARG A NH2  2  
ATOM 1830  H H    . ARG A 1 8   ? 13.040  -0.117  -18.742 1.00 0.00 ? 8   ARG A H    2  
ATOM 1831  H HA   . ARG A 1 8   ? 14.741  1.358   -20.439 1.00 0.00 ? 8   ARG A HA   2  
ATOM 1832  H HB2  . ARG A 1 8   ? 14.612  3.560   -19.357 1.00 0.00 ? 8   ARG A HB2  2  
ATOM 1833  H HB3  . ARG A 1 8   ? 13.097  3.135   -20.143 1.00 0.00 ? 8   ARG A HB3  2  
ATOM 1834  H HG2  . ARG A 1 8   ? 12.286  3.930   -18.179 1.00 0.00 ? 8   ARG A HG2  2  
ATOM 1835  H HG3  . ARG A 1 8   ? 12.510  2.239   -17.727 1.00 0.00 ? 8   ARG A HG3  2  
ATOM 1836  H HD2  . ARG A 1 8   ? 14.865  2.987   -16.984 1.00 0.00 ? 8   ARG A HD2  2  
ATOM 1837  H HD3  . ARG A 1 8   ? 14.197  4.617   -17.038 1.00 0.00 ? 8   ARG A HD3  2  
ATOM 1838  H HE   . ARG A 1 8   ? 12.541  2.863   -15.532 1.00 0.00 ? 8   ARG A HE   2  
ATOM 1839  H HH11 . ARG A 1 8   ? 15.487  4.712   -15.390 1.00 0.00 ? 8   ARG A HH11 2  
ATOM 1840  H HH12 . ARG A 1 8   ? 15.440  4.900   -13.669 1.00 0.00 ? 8   ARG A HH12 2  
ATOM 1841  H HH21 . ARG A 1 8   ? 12.468  3.104   -13.265 1.00 0.00 ? 8   ARG A HH21 2  
ATOM 1842  H HH22 . ARG A 1 8   ? 13.723  3.984   -12.460 1.00 0.00 ? 8   ARG A HH22 2  
ATOM 1843  N N    . LEU A 1 9   ? 16.522  1.309   -18.662 1.00 0.00 ? 9   LEU A N    2  
ATOM 1844  C CA   . LEU A 1 9   ? 17.572  1.022   -17.690 1.00 0.00 ? 9   LEU A CA   2  
ATOM 1845  C C    . LEU A 1 9   ? 18.587  2.159   -17.634 1.00 0.00 ? 9   LEU A C    2  
ATOM 1846  O O    . LEU A 1 9   ? 19.304  2.414   -18.603 1.00 0.00 ? 9   LEU A O    2  
ATOM 1847  C CB   . LEU A 1 9   ? 18.277  -0.289  -18.043 1.00 0.00 ? 9   LEU A CB   2  
ATOM 1848  C CG   . LEU A 1 9   ? 18.813  -0.399  -19.471 1.00 0.00 ? 9   LEU A CG   2  
ATOM 1849  C CD1  . LEU A 1 9   ? 20.008  -1.339  -19.521 1.00 0.00 ? 9   LEU A CD1  2  
ATOM 1850  C CD2  . LEU A 1 9   ? 17.720  -0.873  -20.417 1.00 0.00 ? 9   LEU A CD2  2  
ATOM 1851  H H    . LEU A 1 9   ? 16.770  1.651   -19.545 1.00 0.00 ? 9   LEU A H    2  
ATOM 1852  H HA   . LEU A 1 9   ? 17.108  0.922   -16.721 1.00 0.00 ? 9   LEU A HA   2  
ATOM 1853  H HB2  . LEU A 1 9   ? 19.109  -0.409  -17.367 1.00 0.00 ? 9   LEU A HB2  2  
ATOM 1854  H HB3  . LEU A 1 9   ? 17.572  -1.094  -17.890 1.00 0.00 ? 9   LEU A HB3  2  
ATOM 1855  H HG   . LEU A 1 9   ? 19.143  0.576   -19.801 1.00 0.00 ? 9   LEU A HG   2  
ATOM 1856  H HD11 . LEU A 1 9   ? 20.898  -0.777  -19.761 1.00 0.00 ? 9   LEU A HD11 2  
ATOM 1857  H HD12 . LEU A 1 9   ? 19.843  -2.092  -20.277 1.00 0.00 ? 9   LEU A HD12 2  
ATOM 1858  H HD13 . LEU A 1 9   ? 20.131  -1.816  -18.559 1.00 0.00 ? 9   LEU A HD13 2  
ATOM 1859  H HD21 . LEU A 1 9   ? 17.006  -1.472  -19.870 1.00 0.00 ? 9   LEU A HD21 2  
ATOM 1860  H HD22 . LEU A 1 9   ? 18.159  -1.467  -21.205 1.00 0.00 ? 9   LEU A HD22 2  
ATOM 1861  H HD23 . LEU A 1 9   ? 17.220  -0.018  -20.846 1.00 0.00 ? 9   LEU A HD23 2  
ATOM 1862  N N    . LEU A 1 10  ? 18.644  2.839   -16.494 1.00 0.00 ? 10  LEU A N    2  
ATOM 1863  C CA   . LEU A 1 10  ? 19.573  3.948   -16.311 1.00 0.00 ? 10  LEU A CA   2  
ATOM 1864  C C    . LEU A 1 10  ? 20.441  3.732   -15.075 1.00 0.00 ? 10  LEU A C    2  
ATOM 1865  O O    . LEU A 1 10  ? 19.939  3.394   -14.003 1.00 0.00 ? 10  LEU A O    2  
ATOM 1866  C CB   . LEU A 1 10  ? 18.807  5.266   -16.186 1.00 0.00 ? 10  LEU A CB   2  
ATOM 1867  C CG   . LEU A 1 10  ? 18.436  5.954   -17.500 1.00 0.00 ? 10  LEU A CG   2  
ATOM 1868  C CD1  . LEU A 1 10  ? 17.203  5.308   -18.112 1.00 0.00 ? 10  LEU A CD1  2  
ATOM 1869  C CD2  . LEU A 1 10  ? 18.206  7.442   -17.276 1.00 0.00 ? 10  LEU A CD2  2  
ATOM 1870  H H    . LEU A 1 10  ? 18.048  2.590   -15.758 1.00 0.00 ? 10  LEU A H    2  
ATOM 1871  H HA   . LEU A 1 10  ? 20.211  3.993   -17.181 1.00 0.00 ? 10  LEU A HA   2  
ATOM 1872  H HB2  . LEU A 1 10  ? 17.893  5.067   -15.648 1.00 0.00 ? 10  LEU A HB2  2  
ATOM 1873  H HB3  . LEU A 1 10  ? 19.418  5.950   -15.613 1.00 0.00 ? 10  LEU A HB3  2  
ATOM 1874  H HG   . LEU A 1 10  ? 19.253  5.843   -18.200 1.00 0.00 ? 10  LEU A HG   2  
ATOM 1875  H HD11 . LEU A 1 10  ? 16.337  5.546   -17.512 1.00 0.00 ? 10  LEU A HD11 2  
ATOM 1876  H HD12 . LEU A 1 10  ? 17.336  4.237   -18.143 1.00 0.00 ? 10  LEU A HD12 2  
ATOM 1877  H HD13 . LEU A 1 10  ? 17.061  5.682   -19.115 1.00 0.00 ? 10  LEU A HD13 2  
ATOM 1878  H HD21 . LEU A 1 10  ? 17.234  7.592   -16.830 1.00 0.00 ? 10  LEU A HD21 2  
ATOM 1879  H HD22 . LEU A 1 10  ? 18.251  7.959   -18.224 1.00 0.00 ? 10  LEU A HD22 2  
ATOM 1880  H HD23 . LEU A 1 10  ? 18.970  7.829   -16.618 1.00 0.00 ? 10  LEU A HD23 2  
ATOM 1881  N N    . ASP A 1 11  ? 21.745  3.932   -15.232 1.00 0.00 ? 11  ASP A N    2  
ATOM 1882  C CA   . ASP A 1 11  ? 22.683  3.763   -14.128 1.00 0.00 ? 11  ASP A CA   2  
ATOM 1883  C C    . ASP A 1 11  ? 22.400  4.767   -13.016 1.00 0.00 ? 11  ASP A C    2  
ATOM 1884  O O    . ASP A 1 11  ? 22.987  4.694   -11.935 1.00 0.00 ? 11  ASP A O    2  
ATOM 1885  C CB   . ASP A 1 11  ? 24.121  3.924   -14.624 1.00 0.00 ? 11  ASP A CB   2  
ATOM 1886  C CG   . ASP A 1 11  ? 25.109  3.115   -13.806 1.00 0.00 ? 11  ASP A CG   2  
ATOM 1887  O OD1  . ASP A 1 11  ? 25.255  1.905   -14.079 1.00 0.00 ? 11  ASP A OD1  2  
ATOM 1888  O OD2  . ASP A 1 11  ? 25.737  3.693   -12.895 1.00 0.00 ? 11  ASP A OD2  2  
ATOM 1889  H H    . ASP A 1 11  ? 22.085  4.201   -16.112 1.00 0.00 ? 11  ASP A H    2  
ATOM 1890  H HA   . ASP A 1 11  ? 22.557  2.765   -13.736 1.00 0.00 ? 11  ASP A HA   2  
ATOM 1891  H HB2  . ASP A 1 11  ? 24.180  3.596   -15.652 1.00 0.00 ? 11  ASP A HB2  2  
ATOM 1892  H HB3  . ASP A 1 11  ? 24.400  4.965   -14.566 1.00 0.00 ? 11  ASP A HB3  2  
ATOM 1893  N N    . LEU A 1 12  ? 21.499  5.705   -13.287 1.00 0.00 ? 12  LEU A N    2  
ATOM 1894  C CA   . LEU A 1 12  ? 21.139  6.726   -12.309 1.00 0.00 ? 12  LEU A CA   2  
ATOM 1895  C C    . LEU A 1 12  ? 20.012  6.238   -11.404 1.00 0.00 ? 12  LEU A C    2  
ATOM 1896  O O    . LEU A 1 12  ? 19.121  7.005   -11.038 1.00 0.00 ? 12  LEU A O    2  
ATOM 1897  C CB   . LEU A 1 12  ? 20.717  8.013   -13.019 1.00 0.00 ? 12  LEU A CB   2  
ATOM 1898  C CG   . LEU A 1 12  ? 21.837  9.007   -13.329 1.00 0.00 ? 12  LEU A CG   2  
ATOM 1899  C CD1  . LEU A 1 12  ? 22.336  9.664   -12.051 1.00 0.00 ? 12  LEU A CD1  2  
ATOM 1900  C CD2  . LEU A 1 12  ? 22.980  8.313   -14.055 1.00 0.00 ? 12  LEU A CD2  2  
ATOM 1901  H H    . LEU A 1 12  ? 21.065  5.712   -14.166 1.00 0.00 ? 12  LEU A H    2  
ATOM 1902  H HA   . LEU A 1 12  ? 22.010  6.927   -11.704 1.00 0.00 ? 12  LEU A HA   2  
ATOM 1903  H HB2  . LEU A 1 12  ? 20.251  7.739   -13.953 1.00 0.00 ? 12  LEU A HB2  2  
ATOM 1904  H HB3  . LEU A 1 12  ? 19.993  8.514   -12.391 1.00 0.00 ? 12  LEU A HB3  2  
ATOM 1905  H HG   . LEU A 1 12  ? 21.452  9.784   -13.974 1.00 0.00 ? 12  LEU A HG   2  
ATOM 1906  H HD11 . LEU A 1 12  ? 23.406  9.792   -12.106 1.00 0.00 ? 12  LEU A HD11 2  
ATOM 1907  H HD12 . LEU A 1 12  ? 22.092  9.038   -11.205 1.00 0.00 ? 12  LEU A HD12 2  
ATOM 1908  H HD13 . LEU A 1 12  ? 21.863  10.628  -11.933 1.00 0.00 ? 12  LEU A HD13 2  
ATOM 1909  H HD21 . LEU A 1 12  ? 23.819  8.203   -13.384 1.00 0.00 ? 12  LEU A HD21 2  
ATOM 1910  H HD22 . LEU A 1 12  ? 23.276  8.905   -14.908 1.00 0.00 ? 12  LEU A HD22 2  
ATOM 1911  H HD23 . LEU A 1 12  ? 22.654  7.338   -14.389 1.00 0.00 ? 12  LEU A HD23 2  
ATOM 1912  N N    . GLU A 1 13  ? 20.060  4.959   -11.044 1.00 0.00 ? 13  GLU A N    2  
ATOM 1913  C CA   . GLU A 1 13  ? 19.044  4.371   -10.179 1.00 0.00 ? 13  GLU A CA   2  
ATOM 1914  C C    . GLU A 1 13  ? 19.174  4.895   -8.752  1.00 0.00 ? 13  GLU A C    2  
ATOM 1915  O O    . GLU A 1 13  ? 20.150  4.609   -8.061  1.00 0.00 ? 13  GLU A O    2  
ATOM 1916  C CB   . GLU A 1 13  ? 19.158  2.845   -10.186 1.00 0.00 ? 13  GLU A CB   2  
ATOM 1917  C CG   . GLU A 1 13  ? 17.876  2.137   -9.781  1.00 0.00 ? 13  GLU A CG   2  
ATOM 1918  C CD   . GLU A 1 13  ? 16.693  2.536   -10.642 1.00 0.00 ? 13  GLU A CD   2  
ATOM 1919  O OE1  . GLU A 1 13  ? 16.063  3.571   -10.340 1.00 0.00 ? 13  GLU A OE1  2  
ATOM 1920  O OE2  . GLU A 1 13  ? 16.397  1.813   -11.616 1.00 0.00 ? 13  GLU A OE2  2  
ATOM 1921  H H    . GLU A 1 13  ? 20.796  4.399   -11.367 1.00 0.00 ? 13  GLU A H    2  
ATOM 1922  H HA   . GLU A 1 13  ? 18.076  4.652   -10.566 1.00 0.00 ? 13  GLU A HA   2  
ATOM 1923  H HB2  . GLU A 1 13  ? 19.427  2.520   -11.180 1.00 0.00 ? 13  GLU A HB2  2  
ATOM 1924  H HB3  . GLU A 1 13  ? 19.938  2.552   -9.499  1.00 0.00 ? 13  GLU A HB3  2  
ATOM 1925  H HG2  . GLU A 1 13  ? 18.024  1.071   -9.872  1.00 0.00 ? 13  GLU A HG2  2  
ATOM 1926  H HG3  . GLU A 1 13  ? 17.654  2.382   -8.753  1.00 0.00 ? 13  GLU A HG3  2  
ATOM 1927  N N    . ASN A 1 14  ? 18.181  5.666   -8.318  1.00 0.00 ? 14  ASN A N    2  
ATOM 1928  C CA   . ASN A 1 14  ? 18.184  6.232   -6.974  1.00 0.00 ? 14  ASN A CA   2  
ATOM 1929  C C    . ASN A 1 14  ? 16.800  6.755   -6.602  1.00 0.00 ? 14  ASN A C    2  
ATOM 1930  O O    . ASN A 1 14  ? 16.374  7.806   -7.081  1.00 0.00 ? 14  ASN A O    2  
ATOM 1931  C CB   . ASN A 1 14  ? 19.212  7.361   -6.876  1.00 0.00 ? 14  ASN A CB   2  
ATOM 1932  C CG   . ASN A 1 14  ? 19.263  7.977   -5.492  1.00 0.00 ? 14  ASN A CG   2  
ATOM 1933  O OD1  . ASN A 1 14  ? 18.995  9.166   -5.319  1.00 0.00 ? 14  ASN A OD1  2  
ATOM 1934  N ND2  . ASN A 1 14  ? 19.610  7.169   -4.497  1.00 0.00 ? 14  ASN A ND2  2  
ATOM 1935  H H    . ASN A 1 14  ? 17.429  5.859   -8.917  1.00 0.00 ? 14  ASN A H    2  
ATOM 1936  H HA   . ASN A 1 14  ? 18.457  5.447   -6.285  1.00 0.00 ? 14  ASN A HA   2  
ATOM 1937  H HB2  . ASN A 1 14  ? 20.191  6.969   -7.111  1.00 0.00 ? 14  ASN A HB2  2  
ATOM 1938  H HB3  . ASN A 1 14  ? 18.959  8.134   -7.586  1.00 0.00 ? 14  ASN A HB3  2  
ATOM 1939  H HD21 . ASN A 1 14  ? 19.810  6.233   -4.708  1.00 0.00 ? 14  ASN A HD21 2  
ATOM 1940  H HD22 . ASN A 1 14  ? 19.650  7.541   -3.591  1.00 0.00 ? 14  ASN A HD22 2  
ATOM 1941  N N    . ILE A 1 15  ? 16.105  6.016   -5.744  1.00 0.00 ? 15  ILE A N    2  
ATOM 1942  C CA   . ILE A 1 15  ? 14.771  6.406   -5.306  1.00 0.00 ? 15  ILE A CA   2  
ATOM 1943  C C    . ILE A 1 15  ? 14.828  7.178   -3.992  1.00 0.00 ? 15  ILE A C    2  
ATOM 1944  O O    . ILE A 1 15  ? 15.562  6.807   -3.075  1.00 0.00 ? 15  ILE A O    2  
ATOM 1945  C CB   . ILE A 1 15  ? 13.855  5.181   -5.130  1.00 0.00 ? 15  ILE A CB   2  
ATOM 1946  C CG1  . ILE A 1 15  ? 13.735  4.413   -6.448  1.00 0.00 ? 15  ILE A CG1  2  
ATOM 1947  C CG2  . ILE A 1 15  ? 12.483  5.612   -4.635  1.00 0.00 ? 15  ILE A CG2  2  
ATOM 1948  C CD1  . ILE A 1 15  ? 14.776  3.327   -6.611  1.00 0.00 ? 15  ILE A CD1  2  
ATOM 1949  H H    . ILE A 1 15  ? 16.499  5.189   -5.397  1.00 0.00 ? 15  ILE A H    2  
ATOM 1950  H HA   . ILE A 1 15  ? 14.344  7.044   -6.067  1.00 0.00 ? 15  ILE A HA   2  
ATOM 1951  H HB   . ILE A 1 15  ? 14.294  4.536   -4.384  1.00 0.00 ? 15  ILE A HB   2  
ATOM 1952  H HG12 . ILE A 1 15  ? 12.763  3.950   -6.501  1.00 0.00 ? 15  ILE A HG12 2  
ATOM 1953  H HG13 . ILE A 1 15  ? 13.845  5.105   -7.270  1.00 0.00 ? 15  ILE A HG13 2  
ATOM 1954  H HG21 . ILE A 1 15  ? 11.719  5.141   -5.237  1.00 0.00 ? 15  ILE A HG21 2  
ATOM 1955  H HG22 . ILE A 1 15  ? 12.362  5.314   -3.605  1.00 0.00 ? 15  ILE A HG22 2  
ATOM 1956  H HG23 . ILE A 1 15  ? 12.392  6.685   -4.714  1.00 0.00 ? 15  ILE A HG23 2  
ATOM 1957  H HD11 . ILE A 1 15  ? 14.891  3.094   -7.660  1.00 0.00 ? 15  ILE A HD11 2  
ATOM 1958  H HD12 . ILE A 1 15  ? 15.720  3.670   -6.214  1.00 0.00 ? 15  ILE A HD12 2  
ATOM 1959  H HD13 . ILE A 1 15  ? 14.460  2.442   -6.080  1.00 0.00 ? 15  ILE A HD13 2  
ATOM 1960  N N    . GLN A 1 16  ? 14.048  8.250   -3.907  1.00 0.00 ? 16  GLN A N    2  
ATOM 1961  C CA   . GLN A 1 16  ? 14.009  9.073   -2.704  1.00 0.00 ? 16  GLN A CA   2  
ATOM 1962  C C    . GLN A 1 16  ? 12.615  9.066   -2.084  1.00 0.00 ? 16  GLN A C    2  
ATOM 1963  O O    . GLN A 1 16  ? 11.765  9.885   -2.436  1.00 0.00 ? 16  GLN A O    2  
ATOM 1964  C CB   . GLN A 1 16  ? 14.429  10.507  -3.027  1.00 0.00 ? 16  GLN A CB   2  
ATOM 1965  C CG   . GLN A 1 16  ? 15.870  10.628  -3.495  1.00 0.00 ? 16  GLN A CG   2  
ATOM 1966  C CD   . GLN A 1 16  ? 16.244  12.048  -3.872  1.00 0.00 ? 16  GLN A CD   2  
ATOM 1967  O OE1  . GLN A 1 16  ? 15.660  12.635  -4.783  1.00 0.00 ? 16  GLN A OE1  2  
ATOM 1968  N NE2  . GLN A 1 16  ? 17.223  12.609  -3.171  1.00 0.00 ? 16  GLN A NE2  2  
ATOM 1969  H H    . GLN A 1 16  ? 13.486  8.494   -4.671  1.00 0.00 ? 16  GLN A H    2  
ATOM 1970  H HA   . GLN A 1 16  ? 14.706  8.655   -1.994  1.00 0.00 ? 16  GLN A HA   2  
ATOM 1971  H HB2  . GLN A 1 16  ? 13.787  10.891  -3.806  1.00 0.00 ? 16  GLN A HB2  2  
ATOM 1972  H HB3  . GLN A 1 16  ? 14.309  11.113  -2.141  1.00 0.00 ? 16  GLN A HB3  2  
ATOM 1973  H HG2  . GLN A 1 16  ? 16.522  10.300  -2.699  1.00 0.00 ? 16  GLN A HG2  2  
ATOM 1974  H HG3  . GLN A 1 16  ? 16.009  9.993   -4.357  1.00 0.00 ? 16  GLN A HG3  2  
ATOM 1975  H HE21 . GLN A 1 16  ? 17.643  12.081  -2.460  1.00 0.00 ? 16  GLN A HE21 2  
ATOM 1976  H HE22 . GLN A 1 16  ? 17.485  13.525  -3.394  1.00 0.00 ? 16  GLN A HE22 2  
ATOM 1977  N N    . ILE A 1 17  ? 12.387  8.137   -1.162  1.00 0.00 ? 17  ILE A N    2  
ATOM 1978  C CA   . ILE A 1 17  ? 11.097  8.025   -0.494  1.00 0.00 ? 17  ILE A CA   2  
ATOM 1979  C C    . ILE A 1 17  ? 10.879  9.179   0.479   1.00 0.00 ? 17  ILE A C    2  
ATOM 1980  O O    . ILE A 1 17  ? 11.784  9.591   1.204   1.00 0.00 ? 17  ILE A O    2  
ATOM 1981  C CB   . ILE A 1 17  ? 10.972  6.694   0.271   1.00 0.00 ? 17  ILE A CB   2  
ATOM 1982  C CG1  . ILE A 1 17  ? 11.100  5.513   -0.693  1.00 0.00 ? 17  ILE A CG1  2  
ATOM 1983  C CG2  . ILE A 1 17  ? 9.649   6.634   1.018   1.00 0.00 ? 17  ILE A CG2  2  
ATOM 1984  C CD1  . ILE A 1 17  ? 11.399  4.200   -0.004  1.00 0.00 ? 17  ILE A CD1  2  
ATOM 1985  H H    . ILE A 1 17  ? 13.104  7.513   -0.924  1.00 0.00 ? 17  ILE A H    2  
ATOM 1986  H HA   . ILE A 1 17  ? 10.326  8.055   -1.251  1.00 0.00 ? 17  ILE A HA   2  
ATOM 1987  H HB   . ILE A 1 17  ? 11.770  6.645   0.996   1.00 0.00 ? 17  ILE A HB   2  
ATOM 1988  H HG12 . ILE A 1 17  ? 10.175  5.398   -1.237  1.00 0.00 ? 17  ILE A HG12 2  
ATOM 1989  H HG13 . ILE A 1 17  ? 11.901  5.712   -1.391  1.00 0.00 ? 17  ILE A HG13 2  
ATOM 1990  H HG21 . ILE A 1 17  ? 8.863   6.341   0.337   1.00 0.00 ? 17  ILE A HG21 2  
ATOM 1991  H HG22 . ILE A 1 17  ? 9.719   5.911   1.817   1.00 0.00 ? 17  ILE A HG22 2  
ATOM 1992  H HG23 . ILE A 1 17  ? 9.423   7.606   1.431   1.00 0.00 ? 17  ILE A HG23 2  
ATOM 1993  H HD11 . ILE A 1 17  ? 10.687  4.042   0.793   1.00 0.00 ? 17  ILE A HD11 2  
ATOM 1994  H HD12 . ILE A 1 17  ? 11.323  3.392   -0.718  1.00 0.00 ? 17  ILE A HD12 2  
ATOM 1995  H HD13 . ILE A 1 17  ? 12.397  4.226   0.406   1.00 0.00 ? 17  ILE A HD13 2  
ATOM 1996  N N    . PRO A 1 18  ? 9.649   9.713   0.496   1.00 0.00 ? 18  PRO A N    2  
ATOM 1997  C CA   . PRO A 1 18  ? 9.282   10.826  1.377   1.00 0.00 ? 18  PRO A CA   2  
ATOM 1998  C C    . PRO A 1 18  ? 9.229   10.412  2.844   1.00 0.00 ? 18  PRO A C    2  
ATOM 1999  O O    . PRO A 1 18  ? 9.387   9.236   3.172   1.00 0.00 ? 18  PRO A O    2  
ATOM 2000  C CB   . PRO A 1 18  ? 7.888   11.225  0.884   1.00 0.00 ? 18  PRO A CB   2  
ATOM 2001  C CG   . PRO A 1 18  ? 7.342   9.990   0.255   1.00 0.00 ? 18  PRO A CG   2  
ATOM 2002  C CD   . PRO A 1 18  ? 8.521   9.272   -0.342  1.00 0.00 ? 18  PRO A CD   2  
ATOM 2003  H HA   . PRO A 1 18  ? 9.958   11.661  1.264   1.00 0.00 ? 18  PRO A HA   2  
ATOM 2004  H HB2  . PRO A 1 18  ? 7.284   11.543  1.722   1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2005  H HB3  . PRO A 1 18  ? 7.972   12.028  0.168   1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2006  H HG2  . PRO A 1 18  ? 6.868   9.374   1.005   1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2007  H HG3  . PRO A 1 18  ? 6.635   10.254  -0.517  1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2008  H HD2  . PRO A 1 18  ? 8.386   8.203   -0.274  1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2009  H HD3  . PRO A 1 18  ? 8.665   9.572   -1.369  1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2010  N N    . ASP A 1 19  ? 9.007   11.384  3.721   1.00 0.00 ? 19  ASP A N    2  
ATOM 2011  C CA   . ASP A 1 19  ? 8.932   11.120  5.153   1.00 0.00 ? 19  ASP A CA   2  
ATOM 2012  C C    . ASP A 1 19  ? 7.581   10.518  5.525   1.00 0.00 ? 19  ASP A C    2  
ATOM 2013  O O    . ASP A 1 19  ? 7.505   9.582   6.320   1.00 0.00 ? 19  ASP A O    2  
ATOM 2014  C CB   . ASP A 1 19  ? 9.165   12.408  5.944   1.00 0.00 ? 19  ASP A CB   2  
ATOM 2015  C CG   . ASP A 1 19  ? 8.165   13.492  5.592   1.00 0.00 ? 19  ASP A CG   2  
ATOM 2016  O OD1  . ASP A 1 19  ? 7.922   13.707  4.386   1.00 0.00 ? 19  ASP A OD1  2  
ATOM 2017  O OD2  . ASP A 1 19  ? 7.625   14.125  6.523   1.00 0.00 ? 19  ASP A OD2  2  
ATOM 2018  H H    . ASP A 1 19  ? 8.889   12.302  3.397   1.00 0.00 ? 19  ASP A H    2  
ATOM 2019  H HA   . ASP A 1 19  ? 9.708   10.411  5.400   1.00 0.00 ? 19  ASP A HA   2  
ATOM 2020  H HB2  . ASP A 1 19  ? 9.080   12.195  7.000   1.00 0.00 ? 19  ASP A HB2  2  
ATOM 2021  H HB3  . ASP A 1 19  ? 10.158  12.777  5.734   1.00 0.00 ? 19  ASP A HB3  2  
ATOM 2022  N N    . ALA A 1 20  ? 6.516   11.062  4.944   1.00 0.00 ? 20  ALA A N    2  
ATOM 2023  C CA   . ALA A 1 20  ? 5.168   10.578  5.213   1.00 0.00 ? 20  ALA A CA   2  
ATOM 2024  C C    . ALA A 1 20  ? 4.469   10.154  3.925   1.00 0.00 ? 20  ALA A C    2  
ATOM 2025  O O    . ALA A 1 20  ? 4.700   10.712  2.853   1.00 0.00 ? 20  ALA A O    2  
ATOM 2026  C CB   . ALA A 1 20  ? 4.356   11.647  5.929   1.00 0.00 ? 20  ALA A CB   2  
ATOM 2027  H H    . ALA A 1 20  ? 6.641   11.806  4.318   1.00 0.00 ? 20  ALA A H    2  
ATOM 2028  H HA   . ALA A 1 20  ? 5.245   9.721   5.867   1.00 0.00 ? 20  ALA A HA   2  
ATOM 2029  H HB1  . ALA A 1 20  ? 5.023   12.398  6.327   1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2030  H HB2  . ALA A 1 20  ? 3.672   12.107  5.231   1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2031  H HB3  . ALA A 1 20  ? 3.799   11.196  6.735   1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2032  N N    . PRO A 1 21  ? 3.595   9.142   4.031   1.00 0.00 ? 21  PRO A N    2  
ATOM 2033  C CA   . PRO A 1 21  ? 2.845   8.621   2.884   1.00 0.00 ? 21  PRO A CA   2  
ATOM 2034  C C    . PRO A 1 21  ? 1.795   9.606   2.382   1.00 0.00 ? 21  PRO A C    2  
ATOM 2035  O O    . PRO A 1 21  ? 1.151   10.313  3.158   1.00 0.00 ? 21  PRO A O    2  
ATOM 2036  C CB   . PRO A 1 21  ? 2.175   7.363   3.441   1.00 0.00 ? 21  PRO A CB   2  
ATOM 2037  C CG   . PRO A 1 21  ? 2.068   7.607   4.907   1.00 0.00 ? 21  PRO A CG   2  
ATOM 2038  C CD   . PRO A 1 21  ? 3.270   8.430   5.278   1.00 0.00 ? 21  PRO A CD   2  
ATOM 2039  H HA   . PRO A 1 21  ? 3.502   8.351   2.070   1.00 0.00 ? 21  PRO A HA   2  
ATOM 2040  H HB2  . PRO A 1 21  ? 1.201   7.240   2.988   1.00 0.00 ? 21  PRO A HB2  2  
ATOM 2041  H HB3  . PRO A 1 21  ? 2.788   6.500   3.229   1.00 0.00 ? 21  PRO A HB3  2  
ATOM 2042  H HG2  . PRO A 1 21  ? 1.160   8.151   5.123   1.00 0.00 ? 21  PRO A HG2  2  
ATOM 2043  H HG3  . PRO A 1 21  ? 2.079   6.667   5.437   1.00 0.00 ? 21  PRO A HG3  2  
ATOM 2044  H HD2  . PRO A 1 21  ? 3.023   9.126   6.066   1.00 0.00 ? 21  PRO A HD2  2  
ATOM 2045  H HD3  . PRO A 1 21  ? 4.087   7.790   5.580   1.00 0.00 ? 21  PRO A HD3  2  
ATOM 2046  N N    . PRO A 1 22  ? 1.616   9.656   1.054   1.00 0.00 ? 22  PRO A N    2  
ATOM 2047  C CA   . PRO A 1 22  ? 0.644   10.550  0.419   1.00 0.00 ? 22  PRO A CA   2  
ATOM 2048  C C    . PRO A 1 22  ? -0.796  10.131  0.696   1.00 0.00 ? 22  PRO A C    2  
ATOM 2049  O O    . PRO A 1 22  ? -1.065  9.040   1.198   1.00 0.00 ? 22  PRO A O    2  
ATOM 2050  C CB   . PRO A 1 22  ? 0.962   10.419  -1.073  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2051  C CG   . PRO A 1 22  ? 1.592   9.076   -1.208  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2052  C CD   . PRO A 1 22  ? 2.349   8.842   0.069   1.00 0.00 ? 22  PRO A CD   2  
ATOM 2053  H HA   . PRO A 1 22  ? 0.785   11.575  0.730   1.00 0.00 ? 22  PRO A HA   2  
ATOM 2054  H HB2  . PRO A 1 22  ? 0.048   10.487  -1.646  1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2055  H HB3  . PRO A 1 22  ? 1.640   11.204  -1.371  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2056  H HG2  . PRO A 1 22  ? 0.828   8.323   -1.335  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2057  H HG3  . PRO A 1 22  ? 2.268   9.071   -2.050  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2058  H HD2  . PRO A 1 22  ? 2.324   7.797   0.338   1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2059  H HD3  . PRO A 1 22  ? 3.369   9.184   -0.029  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2060  N N    . PRO A 1 23  ? -1.746  11.017  0.361   1.00 0.00 ? 23  PRO A N    2  
ATOM 2061  C CA   . PRO A 1 23  ? -3.175  10.761  0.563   1.00 0.00 ? 23  PRO A CA   2  
ATOM 2062  C C    . PRO A 1 23  ? -3.709  9.685   -0.376  1.00 0.00 ? 23  PRO A C    2  
ATOM 2063  O O    . PRO A 1 23  ? -3.496  9.743   -1.587  1.00 0.00 ? 23  PRO A O    2  
ATOM 2064  C CB   . PRO A 1 23  ? -3.825  12.111  0.254   1.00 0.00 ? 23  PRO A CB   2  
ATOM 2065  C CG   . PRO A 1 23  ? -2.868  12.792  -0.663  1.00 0.00 ? 23  PRO A CG   2  
ATOM 2066  C CD   . PRO A 1 23  ? -1.498  12.338  -0.242  1.00 0.00 ? 23  PRO A CD   2  
ATOM 2067  H HA   . PRO A 1 23  ? -3.387  10.483  1.585   1.00 0.00 ? 23  PRO A HA   2  
ATOM 2068  H HB2  . PRO A 1 23  ? -4.783  11.952  -0.220  1.00 0.00 ? 23  PRO A HB2  2  
ATOM 2069  H HB3  . PRO A 1 23  ? -3.959  12.669  1.169   1.00 0.00 ? 23  PRO A HB3  2  
ATOM 2070  H HG2  . PRO A 1 23  ? -3.064  12.497  -1.683  1.00 0.00 ? 23  PRO A HG2  2  
ATOM 2071  H HG3  . PRO A 1 23  ? -2.957  13.863  -0.557  1.00 0.00 ? 23  PRO A HG3  2  
ATOM 2072  H HD2  . PRO A 1 23  ? -0.848  12.254  -1.101  1.00 0.00 ? 23  PRO A HD2  2  
ATOM 2073  H HD3  . PRO A 1 23  ? -1.081  13.020  0.484   1.00 0.00 ? 23  PRO A HD3  2  
ATOM 2074  N N    . ILE A 1 24  ? -4.405  8.704   0.190   1.00 0.00 ? 24  ILE A N    2  
ATOM 2075  C CA   . ILE A 1 24  ? -4.971  7.616   -0.598  1.00 0.00 ? 24  ILE A CA   2  
ATOM 2076  C C    . ILE A 1 24  ? -6.185  8.087   -1.392  1.00 0.00 ? 24  ILE A C    2  
ATOM 2077  O O    . ILE A 1 24  ? -7.048  8.805   -0.886  1.00 0.00 ? 24  ILE A O    2  
ATOM 2078  C CB   . ILE A 1 24  ? -5.382  6.430   0.294   1.00 0.00 ? 24  ILE A CB   2  
ATOM 2079  C CG1  . ILE A 1 24  ? -4.170  5.892   1.056   1.00 0.00 ? 24  ILE A CG1  2  
ATOM 2080  C CG2  . ILE A 1 24  ? -6.017  5.332   -0.546  1.00 0.00 ? 24  ILE A CG2  2  
ATOM 2081  C CD1  . ILE A 1 24  ? -4.509  4.781   2.024   1.00 0.00 ? 24  ILE A CD1  2  
ATOM 2082  H H    . ILE A 1 24  ? -4.541  8.713   1.160   1.00 0.00 ? 24  ILE A H    2  
ATOM 2083  H HA   . ILE A 1 24  ? -4.213  7.276   -1.288  1.00 0.00 ? 24  ILE A HA   2  
ATOM 2084  H HB   . ILE A 1 24  ? -6.118  6.779   1.002   1.00 0.00 ? 24  ILE A HB   2  
ATOM 2085  H HG12 . ILE A 1 24  ? -3.450  5.509   0.351   1.00 0.00 ? 24  ILE A HG12 2  
ATOM 2086  H HG13 . ILE A 1 24  ? -3.722  6.698   1.619   1.00 0.00 ? 24  ILE A HG13 2  
ATOM 2087  H HG21 . ILE A 1 24  ? -6.519  5.772   -1.395  1.00 0.00 ? 24  ILE A HG21 2  
ATOM 2088  H HG22 . ILE A 1 24  ? -5.250  4.656   -0.893  1.00 0.00 ? 24  ILE A HG22 2  
ATOM 2089  H HG23 . ILE A 1 24  ? -6.732  4.788   0.053   1.00 0.00 ? 24  ILE A HG23 2  
ATOM 2090  H HD11 . ILE A 1 24  ? -4.662  3.861   1.477   1.00 0.00 ? 24  ILE A HD11 2  
ATOM 2091  H HD12 . ILE A 1 24  ? -3.696  4.650   2.723   1.00 0.00 ? 24  ILE A HD12 2  
ATOM 2092  H HD13 . ILE A 1 24  ? -5.410  5.033   2.562   1.00 0.00 ? 24  ILE A HD13 2  
ATOM 2093  N N    . PRO A 1 25  ? -6.257  7.671   -2.665  1.00 0.00 ? 25  PRO A N    2  
ATOM 2094  C CA   . PRO A 1 25  ? -7.363  8.036   -3.556  1.00 0.00 ? 25  PRO A CA   2  
ATOM 2095  C C    . PRO A 1 25  ? -8.672  7.362   -3.159  1.00 0.00 ? 25  PRO A C    2  
ATOM 2096  O O    . PRO A 1 25  ? -8.756  6.707   -2.120  1.00 0.00 ? 25  PRO A O    2  
ATOM 2097  C CB   . PRO A 1 25  ? -6.896  7.534   -4.924  1.00 0.00 ? 25  PRO A CB   2  
ATOM 2098  C CG   . PRO A 1 25  ? -5.944  6.429   -4.618  1.00 0.00 ? 25  PRO A CG   2  
ATOM 2099  C CD   . PRO A 1 25  ? -5.264  6.813   -3.333  1.00 0.00 ? 25  PRO A CD   2  
ATOM 2100  H HA   . PRO A 1 25  ? -7.506  9.106   -3.592  1.00 0.00 ? 25  PRO A HA   2  
ATOM 2101  H HB2  . PRO A 1 25  ? -7.746  7.178   -5.489  1.00 0.00 ? 25  PRO A HB2  2  
ATOM 2102  H HB3  . PRO A 1 25  ? -6.411  8.336   -5.460  1.00 0.00 ? 25  PRO A HB3  2  
ATOM 2103  H HG2  . PRO A 1 25  ? -6.483  5.503   -4.495  1.00 0.00 ? 25  PRO A HG2  2  
ATOM 2104  H HG3  . PRO A 1 25  ? -5.218  6.340   -5.413  1.00 0.00 ? 25  PRO A HG3  2  
ATOM 2105  H HD2  . PRO A 1 25  ? -5.053  5.935   -2.741  1.00 0.00 ? 25  PRO A HD2  2  
ATOM 2106  H HD3  . PRO A 1 25  ? -4.356  7.361   -3.536  1.00 0.00 ? 25  PRO A HD3  2  
ATOM 2107  N N    . LYS A 1 26  ? -9.693  7.527   -3.994  1.00 0.00 ? 26  LYS A N    2  
ATOM 2108  C CA   . LYS A 1 26  ? -10.999 6.934   -3.732  1.00 0.00 ? 26  LYS A CA   2  
ATOM 2109  C C    . LYS A 1 26  ? -10.995 5.444   -4.059  1.00 0.00 ? 26  LYS A C    2  
ATOM 2110  O O    . LYS A 1 26  ? -10.418 5.021   -5.060  1.00 0.00 ? 26  LYS A O    2  
ATOM 2111  C CB   . LYS A 1 26  ? -12.078 7.644   -4.553  1.00 0.00 ? 26  LYS A CB   2  
ATOM 2112  C CG   . LYS A 1 26  ? -13.492 7.230   -4.185  1.00 0.00 ? 26  LYS A CG   2  
ATOM 2113  C CD   . LYS A 1 26  ? -13.955 6.036   -5.003  1.00 0.00 ? 26  LYS A CD   2  
ATOM 2114  C CE   . LYS A 1 26  ? -14.592 6.472   -6.314  1.00 0.00 ? 26  LYS A CE   2  
ATOM 2115  N NZ   . LYS A 1 26  ? -14.829 5.319   -7.225  1.00 0.00 ? 26  LYS A NZ   2  
ATOM 2116  H H    . LYS A 1 26  ? -9.564  8.060   -4.807  1.00 0.00 ? 26  LYS A H    2  
ATOM 2117  H HA   . LYS A 1 26  ? -11.216 7.059   -2.683  1.00 0.00 ? 26  LYS A HA   2  
ATOM 2118  H HB2  . LYS A 1 26  ? -11.986 8.709   -4.401  1.00 0.00 ? 26  LYS A HB2  2  
ATOM 2119  H HB3  . LYS A 1 26  ? -11.921 7.423   -5.599  1.00 0.00 ? 26  LYS A HB3  2  
ATOM 2120  H HG2  . LYS A 1 26  ? -13.520 6.968   -3.138  1.00 0.00 ? 26  LYS A HG2  2  
ATOM 2121  H HG3  . LYS A 1 26  ? -14.160 8.061   -4.368  1.00 0.00 ? 26  LYS A HG3  2  
ATOM 2122  H HD2  . LYS A 1 26  ? -13.104 5.409   -5.221  1.00 0.00 ? 26  LYS A HD2  2  
ATOM 2123  H HD3  . LYS A 1 26  ? -14.680 5.477   -4.429  1.00 0.00 ? 26  LYS A HD3  2  
ATOM 2124  H HE2  . LYS A 1 26  ? -15.536 6.949   -6.099  1.00 0.00 ? 26  LYS A HE2  2  
ATOM 2125  H HE3  . LYS A 1 26  ? -13.935 7.177   -6.801  1.00 0.00 ? 26  LYS A HE3  2  
ATOM 2126  H HZ1  . LYS A 1 26  ? -14.048 5.235   -7.907  1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 2127  H HZ2  . LYS A 1 26  ? -15.718 5.453   -7.748  1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 2128  H HZ3  . LYS A 1 26  ? -14.892 4.437   -6.678  1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 2129  N N    . GLU A 1 27  ? -11.644 4.654   -3.210  1.00 0.00 ? 27  GLU A N    2  
ATOM 2130  C CA   . GLU A 1 27  ? -11.715 3.212   -3.410  1.00 0.00 ? 27  GLU A CA   2  
ATOM 2131  C C    . GLU A 1 27  ? -12.754 2.860   -4.471  1.00 0.00 ? 27  GLU A C    2  
ATOM 2132  O O    . GLU A 1 27  ? -13.833 3.450   -4.539  1.00 0.00 ? 27  GLU A O    2  
ATOM 2133  C CB   . GLU A 1 27  ? -12.055 2.507   -2.095  1.00 0.00 ? 27  GLU A CB   2  
ATOM 2134  C CG   . GLU A 1 27  ? -11.025 2.731   -1.001  1.00 0.00 ? 27  GLU A CG   2  
ATOM 2135  C CD   . GLU A 1 27  ? -11.598 2.536   0.389   1.00 0.00 ? 27  GLU A CD   2  
ATOM 2136  O OE1  . GLU A 1 27  ? -12.796 2.832   0.583   1.00 0.00 ? 27  GLU A OE1  2  
ATOM 2137  O OE2  . GLU A 1 27  ? -10.850 2.088   1.283   1.00 0.00 ? 27  GLU A OE2  2  
ATOM 2138  H H    . GLU A 1 27  ? -12.085 5.051   -2.430  1.00 0.00 ? 27  GLU A H    2  
ATOM 2139  H HA   . GLU A 1 27  ? -10.746 2.876   -3.747  1.00 0.00 ? 27  GLU A HA   2  
ATOM 2140  H HB2  . GLU A 1 27  ? -13.009 2.871   -1.742  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 2141  H HB3  . GLU A 1 27  ? -12.130 1.446   -2.279  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 2142  H HG2  . GLU A 1 27  ? -10.214 2.032   -1.140  1.00 0.00 ? 27  GLU A HG2  2  
ATOM 2143  H HG3  . GLU A 1 27  ? -10.647 3.739   -1.080  1.00 0.00 ? 27  GLU A HG3  2  
ATOM 2144  N N    . PRO A 1 28  ? -12.422 1.877   -5.321  1.00 0.00 ? 28  PRO A N    2  
ATOM 2145  C CA   . PRO A 1 28  ? -13.312 1.424   -6.394  1.00 0.00 ? 28  PRO A CA   2  
ATOM 2146  C C    . PRO A 1 28  ? -14.534 0.685   -5.861  1.00 0.00 ? 28  PRO A C    2  
ATOM 2147  O O    . PRO A 1 28  ? -14.515 0.155   -4.750  1.00 0.00 ? 28  PRO A O    2  
ATOM 2148  C CB   . PRO A 1 28  ? -12.429 0.478   -7.212  1.00 0.00 ? 28  PRO A CB   2  
ATOM 2149  C CG   . PRO A 1 28  ? -11.402 -0.008  -6.249  1.00 0.00 ? 28  PRO A CG   2  
ATOM 2150  C CD   . PRO A 1 28  ? -11.153 1.130   -5.299  1.00 0.00 ? 28  PRO A CD   2  
ATOM 2151  H HA   . PRO A 1 28  ? -13.634 2.247   -7.016  1.00 0.00 ? 28  PRO A HA   2  
ATOM 2152  H HB2  . PRO A 1 28  ? -13.028 -0.335  -7.596  1.00 0.00 ? 28  PRO A HB2  2  
ATOM 2153  H HB3  . PRO A 1 28  ? -11.978 1.018   -8.031  1.00 0.00 ? 28  PRO A HB3  2  
ATOM 2154  H HG2  . PRO A 1 28  ? -11.777 -0.868  -5.714  1.00 0.00 ? 28  PRO A HG2  2  
ATOM 2155  H HG3  . PRO A 1 28  ? -10.494 -0.260  -6.777  1.00 0.00 ? 28  PRO A HG3  2  
ATOM 2156  H HD2  . PRO A 1 28  ? -10.943 0.756   -4.308  1.00 0.00 ? 28  PRO A HD2  2  
ATOM 2157  H HD3  . PRO A 1 28  ? -10.339 1.746   -5.652  1.00 0.00 ? 28  PRO A HD3  2  
ATOM 2158  N N    . SER A 1 29  ? -15.596 0.652   -6.660  1.00 0.00 ? 29  SER A N    2  
ATOM 2159  C CA   . SER A 1 29  ? -16.829 -0.021  -6.267  1.00 0.00 ? 29  SER A CA   2  
ATOM 2160  C C    . SER A 1 29  ? -16.783 -1.499  -6.639  1.00 0.00 ? 29  SER A C    2  
ATOM 2161  O O    . SER A 1 29  ? -16.158 -1.883  -7.627  1.00 0.00 ? 29  SER A O    2  
ATOM 2162  C CB   . SER A 1 29  ? -18.034 0.648   -6.931  1.00 0.00 ? 29  SER A CB   2  
ATOM 2163  O OG   . SER A 1 29  ? -18.173 1.991   -6.501  1.00 0.00 ? 29  SER A OG   2  
ATOM 2164  H H    . SER A 1 29  ? -15.550 1.093   -7.534  1.00 0.00 ? 29  SER A H    2  
ATOM 2165  H HA   . SER A 1 29  ? -16.925 0.066   -5.195  1.00 0.00 ? 29  SER A HA   2  
ATOM 2166  H HB2  . SER A 1 29  ? -17.902 0.638   -8.002  1.00 0.00 ? 29  SER A HB2  2  
ATOM 2167  H HB3  . SER A 1 29  ? -18.931 0.104   -6.673  1.00 0.00 ? 29  SER A HB3  2  
ATOM 2168  H HG   . SER A 1 29  ? -18.637 2.011   -5.660  1.00 0.00 ? 29  SER A HG   2  
ATOM 2169  N N    . ASN A 1 30  ? -17.452 -2.325  -5.841  1.00 0.00 ? 30  ASN A N    2  
ATOM 2170  C CA   . ASN A 1 30  ? -17.489 -3.762  -6.086  1.00 0.00 ? 30  ASN A CA   2  
ATOM 2171  C C    . ASN A 1 30  ? -17.498 -4.059  -7.582  1.00 0.00 ? 30  ASN A C    2  
ATOM 2172  O O    . ASN A 1 30  ? -18.490 -3.812  -8.269  1.00 0.00 ? 30  ASN A O    2  
ATOM 2173  C CB   . ASN A 1 30  ? -18.721 -4.382  -5.424  1.00 0.00 ? 30  ASN A CB   2  
ATOM 2174  C CG   . ASN A 1 30  ? -18.575 -4.492  -3.918  1.00 0.00 ? 30  ASN A CG   2  
ATOM 2175  O OD1  . ASN A 1 30  ? -19.188 -3.734  -3.167  1.00 0.00 ? 30  ASN A OD1  2  
ATOM 2176  N ND2  . ASN A 1 30  ? -17.759 -5.439  -3.471  1.00 0.00 ? 30  ASN A ND2  2  
ATOM 2177  H H    . ASN A 1 30  ? -17.932 -1.959  -5.069  1.00 0.00 ? 30  ASN A H    2  
ATOM 2178  H HA   . ASN A 1 30  ? -16.601 -4.195  -5.650  1.00 0.00 ? 30  ASN A HA   2  
ATOM 2179  H HB2  . ASN A 1 30  ? -19.584 -3.769  -5.638  1.00 0.00 ? 30  ASN A HB2  2  
ATOM 2180  H HB3  . ASN A 1 30  ? -18.879 -5.372  -5.825  1.00 0.00 ? 30  ASN A HB3  2  
ATOM 2181  H HD21 . ASN A 1 30  ? -17.303 -6.007  -4.127  1.00 0.00 ? 30  ASN A HD21 2  
ATOM 2182  H HD22 . ASN A 1 30  ? -17.647 -5.533  -2.502  1.00 0.00 ? 30  ASN A HD22 2  
ATOM 2183  N N    . TYR A 1 31  ? -16.388 -4.592  -8.080  1.00 0.00 ? 31  TYR A N    2  
ATOM 2184  C CA   . TYR A 1 31  ? -16.267 -4.922  -9.496  1.00 0.00 ? 31  TYR A CA   2  
ATOM 2185  C C    . TYR A 1 31  ? -16.928 -6.262  -9.801  1.00 0.00 ? 31  TYR A C    2  
ATOM 2186  O O    . TYR A 1 31  ? -17.313 -6.999  -8.893  1.00 0.00 ? 31  TYR A O    2  
ATOM 2187  C CB   . TYR A 1 31  ? -14.795 -4.961  -9.908  1.00 0.00 ? 31  TYR A CB   2  
ATOM 2188  C CG   . TYR A 1 31  ? -14.172 -3.592  -10.063 1.00 0.00 ? 31  TYR A CG   2  
ATOM 2189  C CD1  . TYR A 1 31  ? -14.579 -2.734  -11.078 1.00 0.00 ? 31  TYR A CD1  2  
ATOM 2190  C CD2  . TYR A 1 31  ? -13.178 -3.156  -9.196  1.00 0.00 ? 31  TYR A CD2  2  
ATOM 2191  C CE1  . TYR A 1 31  ? -14.013 -1.482  -11.224 1.00 0.00 ? 31  TYR A CE1  2  
ATOM 2192  C CE2  . TYR A 1 31  ? -12.607 -1.906  -9.334  1.00 0.00 ? 31  TYR A CE2  2  
ATOM 2193  C CZ   . TYR A 1 31  ? -13.028 -1.072  -10.349 1.00 0.00 ? 31  TYR A CZ   2  
ATOM 2194  O OH   . TYR A 1 31  ? -12.461 0.173   -10.491 1.00 0.00 ? 31  TYR A OH   2  
ATOM 2195  H H    . TYR A 1 31  ? -15.631 -4.767  -7.483  1.00 0.00 ? 31  TYR A H    2  
ATOM 2196  H HA   . TYR A 1 31  ? -16.768 -4.149  -10.060 1.00 0.00 ? 31  TYR A HA   2  
ATOM 2197  H HB2  . TYR A 1 31  ? -14.232 -5.497  -9.158  1.00 0.00 ? 31  TYR A HB2  2  
ATOM 2198  H HB3  . TYR A 1 31  ? -14.706 -5.475  -10.853 1.00 0.00 ? 31  TYR A HB3  2  
ATOM 2199  H HD1  . TYR A 1 31  ? -15.350 -3.057  -11.761 1.00 0.00 ? 31  TYR A HD1  2  
ATOM 2200  H HD2  . TYR A 1 31  ? -12.851 -3.812  -8.402  1.00 0.00 ? 31  TYR A HD2  2  
ATOM 2201  H HE1  . TYR A 1 31  ? -14.342 -0.829  -12.019 1.00 0.00 ? 31  TYR A HE1  2  
ATOM 2202  H HE2  . TYR A 1 31  ? -11.836 -1.585  -8.649  1.00 0.00 ? 31  TYR A HE2  2  
ATOM 2203  H HH   . TYR A 1 31  ? -11.575 0.165   -10.122 1.00 0.00 ? 31  TYR A HH   2  
ATOM 2204  N N    . ASP A 1 32  ? -17.056 -6.572  -11.087 1.00 0.00 ? 32  ASP A N    2  
ATOM 2205  C CA   . ASP A 1 32  ? -17.669 -7.824  -11.515 1.00 0.00 ? 32  ASP A CA   2  
ATOM 2206  C C    . ASP A 1 32  ? -16.984 -9.017  -10.856 1.00 0.00 ? 32  ASP A C    2  
ATOM 2207  O O    . ASP A 1 32  ? -15.940 -9.479  -11.316 1.00 0.00 ? 32  ASP A O    2  
ATOM 2208  C CB   . ASP A 1 32  ? -17.599 -7.957  -13.037 1.00 0.00 ? 32  ASP A CB   2  
ATOM 2209  C CG   . ASP A 1 32  ? -18.470 -6.939  -13.747 1.00 0.00 ? 32  ASP A CG   2  
ATOM 2210  O OD1  . ASP A 1 32  ? -19.432 -6.444  -13.124 1.00 0.00 ? 32  ASP A OD1  2  
ATOM 2211  O OD2  . ASP A 1 32  ? -18.190 -6.639  -14.927 1.00 0.00 ? 32  ASP A OD2  2  
ATOM 2212  H H    . ASP A 1 32  ? -16.729 -5.943  -11.765 1.00 0.00 ? 32  ASP A H    2  
ATOM 2213  H HA   . ASP A 1 32  ? -18.705 -7.807  -11.211 1.00 0.00 ? 32  ASP A HA   2  
ATOM 2214  H HB2  . ASP A 1 32  ? -16.577 -7.815  -13.358 1.00 0.00 ? 32  ASP A HB2  2  
ATOM 2215  H HB3  . ASP A 1 32  ? -17.927 -8.946  -13.321 1.00 0.00 ? 32  ASP A HB3  2  
ATOM 2216  N N    . PHE A 1 33  ? -17.578 -9.511  -9.774  1.00 0.00 ? 33  PHE A N    2  
ATOM 2217  C CA   . PHE A 1 33  ? -17.024 -10.649 -9.050  1.00 0.00 ? 33  PHE A CA   2  
ATOM 2218  C C    . PHE A 1 33  ? -17.969 -11.846 -9.114  1.00 0.00 ? 33  PHE A C    2  
ATOM 2219  O O    . PHE A 1 33  ? -19.145 -11.705 -9.447  1.00 0.00 ? 33  PHE A O    2  
ATOM 2220  C CB   . PHE A 1 33  ? -16.758 -10.272 -7.591  1.00 0.00 ? 33  PHE A CB   2  
ATOM 2221  C CG   . PHE A 1 33  ? -15.429 -9.606  -7.377  1.00 0.00 ? 33  PHE A CG   2  
ATOM 2222  C CD1  . PHE A 1 33  ? -14.265 -10.184 -7.857  1.00 0.00 ? 33  PHE A CD1  2  
ATOM 2223  C CD2  . PHE A 1 33  ? -15.344 -8.403  -6.694  1.00 0.00 ? 33  PHE A CD2  2  
ATOM 2224  C CE1  . PHE A 1 33  ? -13.040 -9.574  -7.662  1.00 0.00 ? 33  PHE A CE1  2  
ATOM 2225  C CE2  . PHE A 1 33  ? -14.122 -7.788  -6.497  1.00 0.00 ? 33  PHE A CE2  2  
ATOM 2226  C CZ   . PHE A 1 33  ? -12.969 -8.375  -6.979  1.00 0.00 ? 33  PHE A CZ   2  
ATOM 2227  H H    . PHE A 1 33  ? -18.409 -9.099  -9.455  1.00 0.00 ? 33  PHE A H    2  
ATOM 2228  H HA   . PHE A 1 33  ? -16.090 -10.917 -9.520  1.00 0.00 ? 33  PHE A HA   2  
ATOM 2229  H HB2  . PHE A 1 33  ? -17.527 -9.592  -7.257  1.00 0.00 ? 33  PHE A HB2  2  
ATOM 2230  H HB3  . PHE A 1 33  ? -16.785 -11.165 -6.986  1.00 0.00 ? 33  PHE A HB3  2  
ATOM 2231  H HD1  . PHE A 1 33  ? -14.320 -11.122 -8.391  1.00 0.00 ? 33  PHE A HD1  2  
ATOM 2232  H HD2  . PHE A 1 33  ? -16.245 -7.944  -6.315  1.00 0.00 ? 33  PHE A HD2  2  
ATOM 2233  H HE1  . PHE A 1 33  ? -12.140 -10.035 -8.040  1.00 0.00 ? 33  PHE A HE1  2  
ATOM 2234  H HE2  . PHE A 1 33  ? -14.069 -6.851  -5.963  1.00 0.00 ? 33  PHE A HE2  2  
ATOM 2235  H HZ   . PHE A 1 33  ? -12.013 -7.896  -6.826  1.00 0.00 ? 33  PHE A HZ   2  
ATOM 2236  N N    . SER A 1 34  ? -17.444 -13.024 -8.793  1.00 0.00 ? 34  SER A N    2  
ATOM 2237  C CA   . SER A 1 34  ? -18.237 -14.247 -8.817  1.00 0.00 ? 34  SER A CA   2  
ATOM 2238  C C    . SER A 1 34  ? -17.743 -15.237 -7.767  1.00 0.00 ? 34  SER A C    2  
ATOM 2239  O O    . SER A 1 34  ? -16.566 -15.595 -7.741  1.00 0.00 ? 34  SER A O    2  
ATOM 2240  C CB   . SER A 1 34  ? -18.182 -14.888 -10.205 1.00 0.00 ? 34  SER A CB   2  
ATOM 2241  O OG   . SER A 1 34  ? -18.730 -14.026 -11.187 1.00 0.00 ? 34  SER A OG   2  
ATOM 2242  H H    . SER A 1 34  ? -16.499 -13.072 -8.535  1.00 0.00 ? 34  SER A H    2  
ATOM 2243  H HA   . SER A 1 34  ? -19.260 -13.983 -8.593  1.00 0.00 ? 34  SER A HA   2  
ATOM 2244  H HB2  . SER A 1 34  ? -17.155 -15.098 -10.461 1.00 0.00 ? 34  SER A HB2  2  
ATOM 2245  H HB3  . SER A 1 34  ? -18.746 -15.809 -10.196 1.00 0.00 ? 34  SER A HB3  2  
ATOM 2246  H HG   . SER A 1 34  ? -19.680 -14.156 -11.233 1.00 0.00 ? 34  SER A HG   2  
ATOM 2247  N N    . GLY A 1 35  ? -18.652 -15.676 -6.902  1.00 0.00 ? 35  GLY A N    2  
ATOM 2248  C CA   . GLY A 1 35  ? -18.291 -16.620 -5.861  1.00 0.00 ? 35  GLY A CA   2  
ATOM 2249  C C    . GLY A 1 35  ? -18.112 -15.954 -4.511  1.00 0.00 ? 35  GLY A C    2  
ATOM 2250  O O    . GLY A 1 35  ? -18.139 -14.729 -4.390  1.00 0.00 ? 35  GLY A O    2  
ATOM 2251  H H    . GLY A 1 35  ? -19.576 -15.356 -6.971  1.00 0.00 ? 35  GLY A H    2  
ATOM 2252  H HA2  . GLY A 1 35  ? -19.066 -17.367 -5.783  1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2253  H HA3  . GLY A 1 35  ? -17.365 -17.104 -6.135  1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2254  N N    . PRO A 1 36  ? -17.927 -16.772 -3.463  1.00 0.00 ? 36  PRO A N    2  
ATOM 2255  C CA   . PRO A 1 36  ? -17.742 -16.277 -2.096  1.00 0.00 ? 36  PRO A CA   2  
ATOM 2256  C C    . PRO A 1 36  ? -16.400 -15.575 -1.911  1.00 0.00 ? 36  PRO A C    2  
ATOM 2257  O O    . PRO A 1 36  ? -15.345 -16.206 -1.971  1.00 0.00 ? 36  PRO A O    2  
ATOM 2258  C CB   . PRO A 1 36  ? -17.801 -17.549 -1.247  1.00 0.00 ? 36  PRO A CB   2  
ATOM 2259  C CG   . PRO A 1 36  ? -17.387 -18.641 -2.172  1.00 0.00 ? 36  PRO A CG   2  
ATOM 2260  C CD   . PRO A 1 36  ? -17.884 -18.242 -3.533  1.00 0.00 ? 36  PRO A CD   2  
ATOM 2261  H HA   . PRO A 1 36  ? -18.539 -15.609 -1.804  1.00 0.00 ? 36  PRO A HA   2  
ATOM 2262  H HB2  . PRO A 1 36  ? -17.122 -17.459 -0.411  1.00 0.00 ? 36  PRO A HB2  2  
ATOM 2263  H HB3  . PRO A 1 36  ? -18.808 -17.698 -0.886  1.00 0.00 ? 36  PRO A HB3  2  
ATOM 2264  H HG2  . PRO A 1 36  ? -16.311 -18.730 -2.176  1.00 0.00 ? 36  PRO A HG2  2  
ATOM 2265  H HG3  . PRO A 1 36  ? -17.841 -19.573 -1.866  1.00 0.00 ? 36  PRO A HG3  2  
ATOM 2266  H HD2  . PRO A 1 36  ? -17.197 -18.572 -4.298  1.00 0.00 ? 36  PRO A HD2  2  
ATOM 2267  H HD3  . PRO A 1 36  ? -18.870 -18.648 -3.709  1.00 0.00 ? 36  PRO A HD3  2  
ATOM 2268  N N    . SER A 1 37  ? -16.449 -14.266 -1.684  1.00 0.00 ? 37  SER A N    2  
ATOM 2269  C CA   . SER A 1 37  ? -15.237 -13.479 -1.493  1.00 0.00 ? 37  SER A CA   2  
ATOM 2270  C C    . SER A 1 37  ? -14.967 -13.247 -0.009  1.00 0.00 ? 37  SER A C    2  
ATOM 2271  O O    . SER A 1 37  ? -15.302 -12.196 0.538   1.00 0.00 ? 37  SER A O    2  
ATOM 2272  C CB   . SER A 1 37  ? -15.357 -12.136 -2.216  1.00 0.00 ? 37  SER A CB   2  
ATOM 2273  O OG   . SER A 1 37  ? -15.506 -12.321 -3.613  1.00 0.00 ? 37  SER A OG   2  
ATOM 2274  H H    . SER A 1 37  ? -17.321 -13.820 -1.647  1.00 0.00 ? 37  SER A H    2  
ATOM 2275  H HA   . SER A 1 37  ? -14.411 -14.032 -1.914  1.00 0.00 ? 37  SER A HA   2  
ATOM 2276  H HB2  . SER A 1 37  ? -16.218 -11.604 -1.842  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2277  H HB3  . SER A 1 37  ? -14.466 -11.552 -2.035  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2278  H HG   . SER A 1 37  ? -16.361 -11.984 -3.891  1.00 0.00 ? 37  SER A HG   2  
ATOM 2279  N N    . SER A 1 38  ? -14.360 -14.238 0.637   1.00 0.00 ? 38  SER A N    2  
ATOM 2280  C CA   . SER A 1 38  ? -14.049 -14.145 2.059   1.00 0.00 ? 38  SER A CA   2  
ATOM 2281  C C    . SER A 1 38  ? -15.268 -13.689 2.854   1.00 0.00 ? 38  SER A C    2  
ATOM 2282  O O    . SER A 1 38  ? -15.164 -12.841 3.740   1.00 0.00 ? 38  SER A O    2  
ATOM 2283  C CB   . SER A 1 38  ? -12.886 -13.177 2.286   1.00 0.00 ? 38  SER A CB   2  
ATOM 2284  O OG   . SER A 1 38  ? -11.703 -13.646 1.662   1.00 0.00 ? 38  SER A OG   2  
ATOM 2285  H H    . SER A 1 38  ? -14.118 -15.051 0.146   1.00 0.00 ? 38  SER A H    2  
ATOM 2286  H HA   . SER A 1 38  ? -13.759 -15.128 2.399   1.00 0.00 ? 38  SER A HA   2  
ATOM 2287  H HB2  . SER A 1 38  ? -13.138 -12.212 1.873   1.00 0.00 ? 38  SER A HB2  2  
ATOM 2288  H HB3  . SER A 1 38  ? -12.705 -13.079 3.347   1.00 0.00 ? 38  SER A HB3  2  
ATOM 2289  H HG   . SER A 1 38  ? -10.938 -13.343 2.158   1.00 0.00 ? 38  SER A HG   2  
ATOM 2290  N N    . GLY A 1 39  ? -16.425 -14.257 2.529   1.00 0.00 ? 39  GLY A N    2  
ATOM 2291  C CA   . GLY A 1 39  ? -17.649 -13.897 3.221   1.00 0.00 ? 39  GLY A CA   2  
ATOM 2292  C C    . GLY A 1 39  ? -18.600 -13.107 2.344   1.00 0.00 ? 39  GLY A C    2  
ATOM 2293  O O    . GLY A 1 39  ? -18.247 -12.713 1.232   1.00 0.00 ? 39  GLY A O    2  
ATOM 2294  H H    . GLY A 1 39  ? -16.448 -14.927 1.814   1.00 0.00 ? 39  GLY A H    2  
ATOM 2295  H HA2  . GLY A 1 39  ? -18.144 -14.799 3.549   1.00 0.00 ? 39  GLY A HA2  2  
ATOM 2296  H HA3  . GLY A 1 39  ? -17.398 -13.301 4.086   1.00 0.00 ? 39  GLY A HA3  2  
ATOM 2297  N N    . ILE A 1 40  ? -19.810 -12.876 2.843   1.00 0.00 ? 40  ILE A N    2  
ATOM 2298  C CA   . ILE A 1 40  ? -20.814 -12.129 2.097   1.00 0.00 ? 40  ILE A CA   2  
ATOM 2299  C C    . ILE A 1 40  ? -21.577 -11.172 3.007   1.00 0.00 ? 40  ILE A C    2  
ATOM 2300  O O    . ILE A 1 40  ? -21.583 -11.334 4.227   1.00 0.00 ? 40  ILE A O    2  
ATOM 2301  C CB   . ILE A 1 40  ? -21.817 -13.071 1.404   1.00 0.00 ? 40  ILE A CB   2  
ATOM 2302  C CG1  . ILE A 1 40  ? -22.473 -13.996 2.431   1.00 0.00 ? 40  ILE A CG1  2  
ATOM 2303  C CG2  . ILE A 1 40  ? -21.122 -13.881 0.321   1.00 0.00 ? 40  ILE A CG2  2  
ATOM 2304  C CD1  . ILE A 1 40  ? -23.724 -13.418 3.054   1.00 0.00 ? 40  ILE A CD1  2  
ATOM 2305  H H    . ILE A 1 40  ? -20.031 -13.216 3.735   1.00 0.00 ? 40  ILE A H    2  
ATOM 2306  H HA   . ILE A 1 40  ? -20.305 -11.556 1.335   1.00 0.00 ? 40  ILE A HA   2  
ATOM 2307  H HB   . ILE A 1 40  ? -22.579 -12.467 0.936   1.00 0.00 ? 40  ILE A HB   2  
ATOM 2308  H HG12 . ILE A 1 40  ? -22.741 -14.924 1.951   1.00 0.00 ? 40  ILE A HG12 2  
ATOM 2309  H HG13 . ILE A 1 40  ? -21.769 -14.197 3.225   1.00 0.00 ? 40  ILE A HG13 2  
ATOM 2310  H HG21 . ILE A 1 40  ? -21.801 -14.035 -0.505  1.00 0.00 ? 40  ILE A HG21 2  
ATOM 2311  H HG22 . ILE A 1 40  ? -20.251 -13.346 -0.026  1.00 0.00 ? 40  ILE A HG22 2  
ATOM 2312  H HG23 . ILE A 1 40  ? -20.821 -14.837 0.722   1.00 0.00 ? 40  ILE A HG23 2  
ATOM 2313  H HD11 . ILE A 1 40  ? -24.485 -13.304 2.294   1.00 0.00 ? 40  ILE A HD11 2  
ATOM 2314  H HD12 . ILE A 1 40  ? -24.084 -14.083 3.824   1.00 0.00 ? 40  ILE A HD12 2  
ATOM 2315  H HD13 . ILE A 1 40  ? -23.500 -12.454 3.485   1.00 0.00 ? 40  ILE A HD13 2  
ATOM 2316  N N    . GLU A 1 41  ? -22.220 -10.177 2.404   1.00 0.00 ? 41  GLU A N    2  
ATOM 2317  C CA   . GLU A 1 41  ? -22.987 -9.195  3.162   1.00 0.00 ? 41  GLU A CA   2  
ATOM 2318  C C    . GLU A 1 41  ? -24.459 -9.227  2.760   1.00 0.00 ? 41  GLU A C    2  
ATOM 2319  O O    . GLU A 1 41  ? -24.884 -8.507  1.858   1.00 0.00 ? 41  GLU A O    2  
ATOM 2320  C CB   . GLU A 1 41  ? -22.418 -7.792  2.943   1.00 0.00 ? 41  GLU A CB   2  
ATOM 2321  C CG   . GLU A 1 41  ? -23.188 -6.703  3.670   1.00 0.00 ? 41  GLU A CG   2  
ATOM 2322  C CD   . GLU A 1 41  ? -22.548 -5.336  3.520   1.00 0.00 ? 41  GLU A CD   2  
ATOM 2323  O OE1  . GLU A 1 41  ? -21.361 -5.194  3.881   1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2324  O OE2  . GLU A 1 41  ? -23.234 -4.409  3.041   1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2325  H H    . GLU A 1 41  ? -22.177 -10.102 1.428   1.00 0.00 ? 41  GLU A H    2  
ATOM 2326  H HA   . GLU A 1 41  ? -22.906 -9.447  4.208   1.00 0.00 ? 41  GLU A HA   2  
ATOM 2327  H HB2  . GLU A 1 41  ? -21.395 -7.774  3.288   1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2328  H HB3  . GLU A 1 41  ? -22.436 -7.571  1.886   1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2329  H HG2  . GLU A 1 41  ? -24.190 -6.660  3.271   1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2330  H HG3  . GLU A 1 41  ? -23.230 -6.950  4.721   1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2331  N N    . GLY A 1 42  ? -25.233 -10.071 3.437   1.00 0.00 ? 42  GLY A N    2  
ATOM 2332  C CA   . GLY A 1 42  ? -26.648 -10.182 3.137   1.00 0.00 ? 42  GLY A CA   2  
ATOM 2333  C C    . GLY A 1 42  ? -27.211 -11.544 3.495   1.00 0.00 ? 42  GLY A C    2  
ATOM 2334  O O    . GLY A 1 42  ? -26.690 -12.226 4.377   1.00 0.00 ? 42  GLY A O    2  
ATOM 2335  H H    . GLY A 1 42  ? -24.839 -10.621 4.146   1.00 0.00 ? 42  GLY A H    2  
ATOM 2336  H HA2  . GLY A 1 42  ? -27.184 -9.426  3.691   1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2337  H HA3  . GLY A 1 42  ? -26.795 -10.011 2.081   1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2338  N N    . ARG A 1 43  ? -28.278 -11.940 2.809   1.00 0.00 ? 43  ARG A N    2  
ATOM 2339  C CA   . ARG A 1 43  ? -28.914 -13.227 3.061   1.00 0.00 ? 43  ARG A CA   2  
ATOM 2340  C C    . ARG A 1 43  ? -29.191 -13.962 1.753   1.00 0.00 ? 43  ARG A C    2  
ATOM 2341  O O    . ARG A 1 43  ? -30.165 -13.670 1.059   1.00 0.00 ? 43  ARG A O    2  
ATOM 2342  C CB   . ARG A 1 43  ? -30.219 -13.033 3.836   1.00 0.00 ? 43  ARG A CB   2  
ATOM 2343  C CG   . ARG A 1 43  ? -30.020 -12.457 5.228   1.00 0.00 ? 43  ARG A CG   2  
ATOM 2344  C CD   . ARG A 1 43  ? -29.520 -13.512 6.202   1.00 0.00 ? 43  ARG A CD   2  
ATOM 2345  N NE   . ARG A 1 43  ? -30.511 -14.561 6.429   1.00 0.00 ? 43  ARG A NE   2  
ATOM 2346  C CZ   . ARG A 1 43  ? -30.206 -15.780 6.860   1.00 0.00 ? 43  ARG A CZ   2  
ATOM 2347  N NH1  . ARG A 1 43  ? -28.944 -16.102 7.109   1.00 0.00 ? 43  ARG A NH1  2  
ATOM 2348  N NH2  . ARG A 1 43  ? -31.164 -16.679 7.043   1.00 0.00 ? 43  ARG A NH2  2  
ATOM 2349  H H    . ARG A 1 43  ? -28.648 -11.352 2.118   1.00 0.00 ? 43  ARG A H    2  
ATOM 2350  H HA   . ARG A 1 43  ? -28.237 -13.821 3.657   1.00 0.00 ? 43  ARG A HA   2  
ATOM 2351  H HB2  . ARG A 1 43  ? -30.857 -12.362 3.280   1.00 0.00 ? 43  ARG A HB2  2  
ATOM 2352  H HB3  . ARG A 1 43  ? -30.712 -13.989 3.932   1.00 0.00 ? 43  ARG A HB3  2  
ATOM 2353  H HG2  . ARG A 1 43  ? -29.295 -11.658 5.177   1.00 0.00 ? 43  ARG A HG2  2  
ATOM 2354  H HG3  . ARG A 1 43  ? -30.963 -12.068 5.584   1.00 0.00 ? 43  ARG A HG3  2  
ATOM 2355  H HD2  . ARG A 1 43  ? -28.624 -13.959 5.798   1.00 0.00 ? 43  ARG A HD2  2  
ATOM 2356  H HD3  . ARG A 1 43  ? -29.292 -13.035 7.143   1.00 0.00 ? 43  ARG A HD3  2  
ATOM 2357  H HE   . ARG A 1 43  ? -31.450 -14.344 6.252   1.00 0.00 ? 43  ARG A HE   2  
ATOM 2358  H HH11 . ARG A 1 43  ? -28.220 -15.425 6.973   1.00 0.00 ? 43  ARG A HH11 2  
ATOM 2359  H HH12 . ARG A 1 43  ? -28.717 -17.020 7.435   1.00 0.00 ? 43  ARG A HH12 2  
ATOM 2360  H HH21 . ARG A 1 43  ? -32.116 -16.440 6.857   1.00 0.00 ? 43  ARG A HH21 2  
ATOM 2361  H HH22 . ARG A 1 43  ? -30.933 -17.596 7.367   1.00 0.00 ? 43  ARG A HH22 2  
ATOM 2362  N N    . GLY A 1 44  ? -28.328 -14.918 1.422   1.00 0.00 ? 44  GLY A N    2  
ATOM 2363  C CA   . GLY A 1 44  ? -28.496 -15.679 0.198   1.00 0.00 ? 44  GLY A CA   2  
ATOM 2364  C C    . GLY A 1 44  ? -27.226 -16.392 -0.221  1.00 0.00 ? 44  GLY A C    2  
ATOM 2365  O O    . GLY A 1 44  ? -26.567 -15.989 -1.180  1.00 0.00 ? 44  GLY A O    2  
ATOM 2366  H H    . GLY A 1 44  ? -27.570 -15.107 2.014   1.00 0.00 ? 44  GLY A H    2  
ATOM 2367  H HA2  . GLY A 1 44  ? -29.276 -16.411 0.347   1.00 0.00 ? 44  GLY A HA2  2  
ATOM 2368  H HA3  . GLY A 1 44  ? -28.795 -15.006 -0.592  1.00 0.00 ? 44  GLY A HA3  2  
ATOM 2369  N N    . SER A 1 45  ? -26.880 -17.454 0.500   1.00 0.00 ? 45  SER A N    2  
ATOM 2370  C CA   . SER A 1 45  ? -25.677 -18.221 0.201   1.00 0.00 ? 45  SER A CA   2  
ATOM 2371  C C    . SER A 1 45  ? -26.013 -19.692 -0.024  1.00 0.00 ? 45  SER A C    2  
ATOM 2372  O O    . SER A 1 45  ? -26.702 -20.314 0.785   1.00 0.00 ? 45  SER A O    2  
ATOM 2373  C CB   . SER A 1 45  ? -24.664 -18.086 1.339   1.00 0.00 ? 45  SER A CB   2  
ATOM 2374  O OG   . SER A 1 45  ? -23.548 -18.934 1.132   1.00 0.00 ? 45  SER A OG   2  
ATOM 2375  H H    . SER A 1 45  ? -27.446 -17.726 1.252   1.00 0.00 ? 45  SER A H    2  
ATOM 2376  H HA   . SER A 1 45  ? -25.244 -17.821 -0.704  1.00 0.00 ? 45  SER A HA   2  
ATOM 2377  H HB2  . SER A 1 45  ? -24.319 -17.064 1.391   1.00 0.00 ? 45  SER A HB2  2  
ATOM 2378  H HB3  . SER A 1 45  ? -25.137 -18.354 2.272   1.00 0.00 ? 45  SER A HB3  2  
ATOM 2379  H HG   . SER A 1 45  ? -23.543 -19.625 1.800   1.00 0.00 ? 45  SER A HG   2  
ATOM 2380  N N    . SER A 1 46  ? -25.521 -20.243 -1.129  1.00 0.00 ? 46  SER A N    2  
ATOM 2381  C CA   . SER A 1 46  ? -25.771 -21.640 -1.464  1.00 0.00 ? 46  SER A CA   2  
ATOM 2382  C C    . SER A 1 46  ? -24.852 -22.102 -2.590  1.00 0.00 ? 46  SER A C    2  
ATOM 2383  O O    . SER A 1 46  ? -24.157 -21.297 -3.210  1.00 0.00 ? 46  SER A O    2  
ATOM 2384  C CB   . SER A 1 46  ? -27.233 -21.835 -1.871  1.00 0.00 ? 46  SER A CB   2  
ATOM 2385  O OG   . SER A 1 46  ? -28.047 -22.093 -0.740  1.00 0.00 ? 46  SER A OG   2  
ATOM 2386  H H    . SER A 1 46  ? -24.978 -19.696 -1.735  1.00 0.00 ? 46  SER A H    2  
ATOM 2387  H HA   . SER A 1 46  ? -25.569 -22.233 -0.584  1.00 0.00 ? 46  SER A HA   2  
ATOM 2388  H HB2  . SER A 1 46  ? -27.590 -20.941 -2.360  1.00 0.00 ? 46  SER A HB2  2  
ATOM 2389  H HB3  . SER A 1 46  ? -27.306 -22.671 -2.551  1.00 0.00 ? 46  SER A HB3  2  
ATOM 2390  H HG   . SER A 1 46  ? -27.523 -22.519 -0.058  1.00 0.00 ? 46  SER A HG   2  
ATOM 2391  N N    . GLY A 1 47  ? -24.853 -23.406 -2.850  1.00 0.00 ? 47  GLY A N    2  
ATOM 2392  C CA   . GLY A 1 47  ? -24.016 -23.954 -3.901  1.00 0.00 ? 47  GLY A CA   2  
ATOM 2393  C C    . GLY A 1 47  ? -22.604 -23.403 -3.864  1.00 0.00 ? 47  GLY A C    2  
ATOM 2394  O O    . GLY A 1 47  ? -21.838 -23.700 -2.947  1.00 0.00 ? 47  GLY A O    2  
ATOM 2395  H H    . GLY A 1 47  ? -25.427 -24.001 -2.323  1.00 0.00 ? 47  GLY A H    2  
ATOM 2396  H HA2  . GLY A 1 47  ? -23.975 -25.028 -3.791  1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2397  H HA3  . GLY A 1 47  ? -24.458 -23.717 -4.858  1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2398  N N    . SER A 1 48  ? -22.258 -22.600 -4.865  1.00 0.00 ? 48  SER A N    2  
ATOM 2399  C CA   . SER A 1 48  ? -20.927 -22.011 -4.947  1.00 0.00 ? 48  SER A CA   2  
ATOM 2400  C C    . SER A 1 48  ? -19.867 -22.992 -4.454  1.00 0.00 ? 48  SER A C    2  
ATOM 2401  O O    . SER A 1 48  ? -18.950 -22.617 -3.724  1.00 0.00 ? 48  SER A O    2  
ATOM 2402  C CB   . SER A 1 48  ? -20.866 -20.721 -4.126  1.00 0.00 ? 48  SER A CB   2  
ATOM 2403  O OG   . SER A 1 48  ? -21.331 -20.936 -2.804  1.00 0.00 ? 48  SER A OG   2  
ATOM 2404  H H    . SER A 1 48  ? -22.913 -22.401 -5.567  1.00 0.00 ? 48  SER A H    2  
ATOM 2405  H HA   . SER A 1 48  ? -20.731 -21.777 -5.983  1.00 0.00 ? 48  SER A HA   2  
ATOM 2406  H HB2  . SER A 1 48  ? -19.845 -20.373 -4.083  1.00 0.00 ? 48  SER A HB2  2  
ATOM 2407  H HB3  . SER A 1 48  ? -21.484 -19.969 -4.595  1.00 0.00 ? 48  SER A HB3  2  
ATOM 2408  H HG   . SER A 1 48  ? -21.137 -21.838 -2.539  1.00 0.00 ? 48  SER A HG   2  
ATOM 2409  N N    . SER A 1 49  ? -20.001 -24.250 -4.859  1.00 0.00 ? 49  SER A N    2  
ATOM 2410  C CA   . SER A 1 49  ? -19.058 -25.288 -4.457  1.00 0.00 ? 49  SER A CA   2  
ATOM 2411  C C    . SER A 1 49  ? -17.980 -25.483 -5.518  1.00 0.00 ? 49  SER A C    2  
ATOM 2412  O O    . SER A 1 49  ? -18.118 -26.317 -6.412  1.00 0.00 ? 49  SER A O    2  
ATOM 2413  C CB   . SER A 1 49  ? -19.793 -26.607 -4.210  1.00 0.00 ? 49  SER A CB   2  
ATOM 2414  O OG   . SER A 1 49  ? -18.882 -27.687 -4.109  1.00 0.00 ? 49  SER A OG   2  
ATOM 2415  H H    . SER A 1 49  ? -20.754 -24.488 -5.441  1.00 0.00 ? 49  SER A H    2  
ATOM 2416  H HA   . SER A 1 49  ? -18.589 -24.970 -3.538  1.00 0.00 ? 49  SER A HA   2  
ATOM 2417  H HB2  . SER A 1 49  ? -20.354 -26.537 -3.291  1.00 0.00 ? 49  SER A HB2  2  
ATOM 2418  H HB3  . SER A 1 49  ? -20.469 -26.798 -5.031  1.00 0.00 ? 49  SER A HB3  2  
ATOM 2419  H HG   . SER A 1 49  ? -18.724 -28.057 -4.981  1.00 0.00 ? 49  SER A HG   2  
ATOM 2420  N N    . GLY A 1 50  ? -16.906 -24.707 -5.412  1.00 0.00 ? 50  GLY A N    2  
ATOM 2421  C CA   . GLY A 1 50  ? -15.820 -24.809 -6.369  1.00 0.00 ? 50  GLY A CA   2  
ATOM 2422  C C    . GLY A 1 50  ? -14.827 -23.671 -6.242  1.00 0.00 ? 50  GLY A C    2  
ATOM 2423  O O    . GLY A 1 50  ? -14.885 -22.700 -6.997  1.00 0.00 ? 50  GLY A O    2  
ATOM 2424  H H    . GLY A 1 50  ? -16.851 -24.059 -4.678  1.00 0.00 ? 50  GLY A H    2  
ATOM 2425  H HA2  . GLY A 1 50  ? -15.302 -25.744 -6.211  1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2426  H HA3  . GLY A 1 50  ? -16.232 -24.802 -7.367  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2427  N N    . SER A 1 51  ? -13.913 -23.788 -5.284  1.00 0.00 ? 51  SER A N    2  
ATOM 2428  C CA   . SER A 1 51  ? -12.906 -22.758 -5.057  1.00 0.00 ? 51  SER A CA   2  
ATOM 2429  C C    . SER A 1 51  ? -11.759 -22.891 -6.054  1.00 0.00 ? 51  SER A C    2  
ATOM 2430  O O    . SER A 1 51  ? -11.365 -21.919 -6.698  1.00 0.00 ? 51  SER A O    2  
ATOM 2431  C CB   . SER A 1 51  ? -12.369 -22.846 -3.628  1.00 0.00 ? 51  SER A CB   2  
ATOM 2432  O OG   . SER A 1 51  ? -11.743 -24.095 -3.394  1.00 0.00 ? 51  SER A OG   2  
ATOM 2433  H H    . SER A 1 51  ? -13.918 -24.586 -4.714  1.00 0.00 ? 51  SER A H    2  
ATOM 2434  H HA   . SER A 1 51  ? -13.379 -21.797 -5.197  1.00 0.00 ? 51  SER A HA   2  
ATOM 2435  H HB2  . SER A 1 51  ? -11.646 -22.060 -3.469  1.00 0.00 ? 51  SER A HB2  2  
ATOM 2436  H HB3  . SER A 1 51  ? -13.186 -22.730 -2.931  1.00 0.00 ? 51  SER A HB3  2  
ATOM 2437  H HG   . SER A 1 51  ? -10.808 -23.959 -3.227  1.00 0.00 ? 51  SER A HG   2  
ATOM 2438  N N    . SER A 1 52  ? -11.226 -24.103 -6.174  1.00 0.00 ? 52  SER A N    2  
ATOM 2439  C CA   . SER A 1 52  ? -10.120 -24.365 -7.088  1.00 0.00 ? 52  SER A CA   2  
ATOM 2440  C C    . SER A 1 52  ? -10.429 -23.825 -8.482  1.00 0.00 ? 52  SER A C    2  
ATOM 2441  O O    . SER A 1 52  ? -11.499 -24.076 -9.034  1.00 0.00 ? 52  SER A O    2  
ATOM 2442  C CB   . SER A 1 52  ? -9.836  -25.866 -7.161  1.00 0.00 ? 52  SER A CB   2  
ATOM 2443  O OG   . SER A 1 52  ? -9.596  -26.403 -5.872  1.00 0.00 ? 52  SER A OG   2  
ATOM 2444  H H    . SER A 1 52  ? -11.583 -24.838 -5.633  1.00 0.00 ? 52  SER A H    2  
ATOM 2445  H HA   . SER A 1 52  ? -9.246  -23.860 -6.705  1.00 0.00 ? 52  SER A HA   2  
ATOM 2446  H HB2  . SER A 1 52  ? -10.686 -26.370 -7.595  1.00 0.00 ? 52  SER A HB2  2  
ATOM 2447  H HB3  . SER A 1 52  ? -8.964  -26.035 -7.777  1.00 0.00 ? 52  SER A HB3  2  
ATOM 2448  H HG   . SER A 1 52  ? -9.246  -25.717 -5.299  1.00 0.00 ? 52  SER A HG   2  
ATOM 2449  N N    . GLY A 1 53  ? -9.481  -23.082 -9.045  1.00 0.00 ? 53  GLY A N    2  
ATOM 2450  C CA   . GLY A 1 53  ? -9.669  -22.518 -10.369 1.00 0.00 ? 53  GLY A CA   2  
ATOM 2451  C C    . GLY A 1 53  ? -8.924  -21.211 -10.554 1.00 0.00 ? 53  GLY A C    2  
ATOM 2452  O O    . GLY A 1 53  ? -9.532  -20.142 -10.594 1.00 0.00 ? 53  GLY A O    2  
ATOM 2453  H H    . GLY A 1 53  ? -8.647  -22.915 -8.557  1.00 0.00 ? 53  GLY A H    2  
ATOM 2454  H HA2  . GLY A 1 53  ? -9.320  -23.228 -11.103 1.00 0.00 ? 53  GLY A HA2  2  
ATOM 2455  H HA3  . GLY A 1 53  ? -10.724 -22.342 -10.526 1.00 0.00 ? 53  GLY A HA3  2  
ATOM 2456  N N    . SER A 1 54  ? -7.602  -21.297 -10.665 1.00 0.00 ? 54  SER A N    2  
ATOM 2457  C CA   . SER A 1 54  ? -6.771  -20.111 -10.842 1.00 0.00 ? 54  SER A CA   2  
ATOM 2458  C C    . SER A 1 54  ? -5.976  -20.193 -12.141 1.00 0.00 ? 54  SER A C    2  
ATOM 2459  O O    . SER A 1 54  ? -5.650  -21.282 -12.615 1.00 0.00 ? 54  SER A O    2  
ATOM 2460  C CB   . SER A 1 54  ? -5.817  -19.950 -9.657  1.00 0.00 ? 54  SER A CB   2  
ATOM 2461  O OG   . SER A 1 54  ? -6.495  -19.439 -8.522  1.00 0.00 ? 54  SER A OG   2  
ATOM 2462  H H    . SER A 1 54  ? -7.175  -22.179 -10.626 1.00 0.00 ? 54  SER A H    2  
ATOM 2463  H HA   . SER A 1 54  ? -7.424  -19.253 -10.886 1.00 0.00 ? 54  SER A HA   2  
ATOM 2464  H HB2  . SER A 1 54  ? -5.394  -20.911 -9.405  1.00 0.00 ? 54  SER A HB2  2  
ATOM 2465  H HB3  . SER A 1 54  ? -5.025  -19.267 -9.926  1.00 0.00 ? 54  SER A HB3  2  
ATOM 2466  H HG   . SER A 1 54  ? -6.165  -19.870 -7.730  1.00 0.00 ? 54  SER A HG   2  
ATOM 2467  N N    . SER A 1 55  ? -5.669  -19.034 -12.714 1.00 0.00 ? 55  SER A N    2  
ATOM 2468  C CA   . SER A 1 55  ? -4.916  -18.973 -13.961 1.00 0.00 ? 55  SER A CA   2  
ATOM 2469  C C    . SER A 1 55  ? -3.808  -17.927 -13.876 1.00 0.00 ? 55  SER A C    2  
ATOM 2470  O O    . SER A 1 55  ? -3.792  -17.095 -12.969 1.00 0.00 ? 55  SER A O    2  
ATOM 2471  C CB   . SER A 1 55  ? -5.849  -18.650 -15.129 1.00 0.00 ? 55  SER A CB   2  
ATOM 2472  O OG   . SER A 1 55  ? -6.501  -19.818 -15.599 1.00 0.00 ? 55  SER A OG   2  
ATOM 2473  H H    . SER A 1 55  ? -5.958  -18.199 -12.288 1.00 0.00 ? 55  SER A H    2  
ATOM 2474  H HA   . SER A 1 55  ? -4.468  -19.941 -14.125 1.00 0.00 ? 55  SER A HA   2  
ATOM 2475  H HB2  . SER A 1 55  ? -6.596  -17.941 -14.806 1.00 0.00 ? 55  SER A HB2  2  
ATOM 2476  H HB3  . SER A 1 55  ? -5.274  -18.223 -15.938 1.00 0.00 ? 55  SER A HB3  2  
ATOM 2477  H HG   . SER A 1 55  ? -6.969  -19.618 -16.412 1.00 0.00 ? 55  SER A HG   2  
ATOM 2478  N N    . GLY A 1 56  ? -2.882  -17.976 -14.829 1.00 0.00 ? 56  GLY A N    2  
ATOM 2479  C CA   . GLY A 1 56  ? -1.783  -17.028 -14.845 1.00 0.00 ? 56  GLY A CA   2  
ATOM 2480  C C    . GLY A 1 56  ? -1.936  -15.981 -15.930 1.00 0.00 ? 56  GLY A C    2  
ATOM 2481  O O    . GLY A 1 56  ? -1.775  -16.276 -17.114 1.00 0.00 ? 56  GLY A O    2  
ATOM 2482  H H    . GLY A 1 56  ? -2.946  -18.661 -15.527 1.00 0.00 ? 56  GLY A H    2  
ATOM 2483  H HA2  . GLY A 1 56  ? -1.734  -16.534 -13.886 1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2484  H HA3  . GLY A 1 56  ? -0.861  -17.567 -15.008 1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2485  N N    . ASP A 1 57  ? -2.250  -14.755 -15.526 1.00 0.00 ? 57  ASP A N    2  
ATOM 2486  C CA   . ASP A 1 57  ? -2.426  -13.659 -16.472 1.00 0.00 ? 57  ASP A CA   2  
ATOM 2487  C C    . ASP A 1 57  ? -1.248  -12.692 -16.409 1.00 0.00 ? 57  ASP A C    2  
ATOM 2488  O O    . ASP A 1 57  ? -1.428  -11.474 -16.437 1.00 0.00 ? 57  ASP A O    2  
ATOM 2489  C CB   . ASP A 1 57  ? -3.730  -12.914 -16.186 1.00 0.00 ? 57  ASP A CB   2  
ATOM 2490  C CG   . ASP A 1 57  ? -4.910  -13.504 -16.932 1.00 0.00 ? 57  ASP A CG   2  
ATOM 2491  O OD1  . ASP A 1 57  ? -4.757  -13.820 -18.131 1.00 0.00 ? 57  ASP A OD1  2  
ATOM 2492  O OD2  . ASP A 1 57  ? -5.987  -13.652 -16.317 1.00 0.00 ? 57  ASP A OD2  2  
ATOM 2493  H H    . ASP A 1 57  ? -2.365  -14.582 -14.568 1.00 0.00 ? 57  ASP A H    2  
ATOM 2494  H HA   . ASP A 1 57  ? -2.474  -14.083 -17.464 1.00 0.00 ? 57  ASP A HA   2  
ATOM 2495  H HB2  . ASP A 1 57  ? -3.938  -12.960 -15.127 1.00 0.00 ? 57  ASP A HB2  2  
ATOM 2496  H HB3  . ASP A 1 57  ? -3.619  -11.881 -16.483 1.00 0.00 ? 57  ASP A HB3  2  
ATOM 2497  N N    . LYS A 1 58  ? -0.041  -13.242 -16.322 1.00 0.00 ? 58  LYS A N    2  
ATOM 2498  C CA   . LYS A 1 58  ? 1.167   -12.429 -16.255 1.00 0.00 ? 58  LYS A CA   2  
ATOM 2499  C C    . LYS A 1 58  ? 1.201   -11.610 -14.968 1.00 0.00 ? 58  LYS A C    2  
ATOM 2500  O O    . LYS A 1 58  ? 1.462   -10.407 -14.995 1.00 0.00 ? 58  LYS A O    2  
ATOM 2501  C CB   . LYS A 1 58  ? 1.249   -11.498 -17.467 1.00 0.00 ? 58  LYS A CB   2  
ATOM 2502  C CG   . LYS A 1 58  ? 2.671   -11.151 -17.872 1.00 0.00 ? 58  LYS A CG   2  
ATOM 2503  C CD   . LYS A 1 58  ? 3.177   -9.923  -17.133 1.00 0.00 ? 58  LYS A CD   2  
ATOM 2504  C CE   . LYS A 1 58  ? 4.453   -9.382  -17.759 1.00 0.00 ? 58  LYS A CE   2  
ATOM 2505  N NZ   . LYS A 1 58  ? 5.599   -10.316 -17.579 1.00 0.00 ? 58  LYS A NZ   2  
ATOM 2506  H H    . LYS A 1 58  ? 0.038   -14.219 -16.304 1.00 0.00 ? 58  LYS A H    2  
ATOM 2507  H HA   . LYS A 1 58  ? 2.016   -13.095 -16.265 1.00 0.00 ? 58  LYS A HA   2  
ATOM 2508  H HB2  . LYS A 1 58  ? 0.765   -11.976 -18.306 1.00 0.00 ? 58  LYS A HB2  2  
ATOM 2509  H HB3  . LYS A 1 58  ? 0.728   -10.580 -17.236 1.00 0.00 ? 58  LYS A HB3  2  
ATOM 2510  H HG2  . LYS A 1 58  ? 3.316   -11.986 -17.642 1.00 0.00 ? 58  LYS A HG2  2  
ATOM 2511  H HG3  . LYS A 1 58  ? 2.696   -10.956 -18.934 1.00 0.00 ? 58  LYS A HG3  2  
ATOM 2512  H HD2  . LYS A 1 58  ? 2.419   -9.155  -17.167 1.00 0.00 ? 58  LYS A HD2  2  
ATOM 2513  H HD3  . LYS A 1 58  ? 3.376   -10.189 -16.104 1.00 0.00 ? 58  LYS A HD3  2  
ATOM 2514  H HE2  . LYS A 1 58  ? 4.285   -9.232  -18.814 1.00 0.00 ? 58  LYS A HE2  2  
ATOM 2515  H HE3  . LYS A 1 58  ? 4.693   -8.437  -17.295 1.00 0.00 ? 58  LYS A HE3  2  
ATOM 2516  H HZ1  . LYS A 1 58  ? 6.455   -9.786  -17.318 1.00 0.00 ? 58  LYS A HZ1  2  
ATOM 2517  H HZ2  . LYS A 1 58  ? 5.780   -10.833 -18.462 1.00 0.00 ? 58  LYS A HZ2  2  
ATOM 2518  H HZ3  . LYS A 1 58  ? 5.386   -11.002 -16.826 1.00 0.00 ? 58  LYS A HZ3  2  
ATOM 2519  N N    . GLU A 1 59  ? 0.937   -12.269 -13.845 1.00 0.00 ? 59  GLU A N    2  
ATOM 2520  C CA   . GLU A 1 59  ? 0.938   -11.600 -12.549 1.00 0.00 ? 59  GLU A CA   2  
ATOM 2521  C C    . GLU A 1 59  ? 2.193   -10.749 -12.377 1.00 0.00 ? 59  GLU A C    2  
ATOM 2522  O O    . GLU A 1 59  ? 3.250   -11.066 -12.922 1.00 0.00 ? 59  GLU A O    2  
ATOM 2523  C CB   . GLU A 1 59  ? 0.847   -12.629 -11.419 1.00 0.00 ? 59  GLU A CB   2  
ATOM 2524  C CG   . GLU A 1 59  ? -0.495  -13.337 -11.348 1.00 0.00 ? 59  GLU A CG   2  
ATOM 2525  C CD   . GLU A 1 59  ? -0.393  -14.718 -10.730 1.00 0.00 ? 59  GLU A CD   2  
ATOM 2526  O OE1  . GLU A 1 59  ? 0.526   -14.936 -9.913  1.00 0.00 ? 59  GLU A OE1  2  
ATOM 2527  O OE2  . GLU A 1 59  ? -1.232  -15.581 -11.063 1.00 0.00 ? 59  GLU A OE2  2  
ATOM 2528  H H    . GLU A 1 59  ? 0.736   -13.227 -13.888 1.00 0.00 ? 59  GLU A H    2  
ATOM 2529  H HA   . GLU A 1 59  ? 0.072   -10.957 -12.507 1.00 0.00 ? 59  GLU A HA   2  
ATOM 2530  H HB2  . GLU A 1 59  ? 1.617   -13.372 -11.563 1.00 0.00 ? 59  GLU A HB2  2  
ATOM 2531  H HB3  . GLU A 1 59  ? 1.016   -12.127 -10.478 1.00 0.00 ? 59  GLU A HB3  2  
ATOM 2532  H HG2  . GLU A 1 59  ? -1.170  -12.742 -10.752 1.00 0.00 ? 59  GLU A HG2  2  
ATOM 2533  H HG3  . GLU A 1 59  ? -0.890  -13.435 -12.348 1.00 0.00 ? 59  GLU A HG3  2  
ATOM 2534  N N    . ARG A 1 60  ? 2.067   -9.667  -11.616 1.00 0.00 ? 60  ARG A N    2  
ATOM 2535  C CA   . ARG A 1 60  ? 3.189   -8.769  -11.373 1.00 0.00 ? 60  ARG A CA   2  
ATOM 2536  C C    . ARG A 1 60  ? 3.638   -8.841  -9.917  1.00 0.00 ? 60  ARG A C    2  
ATOM 2537  O O    . ARG A 1 60  ? 2.844   -9.142  -9.025  1.00 0.00 ? 60  ARG A O    2  
ATOM 2538  C CB   . ARG A 1 60  ? 2.805   -7.331  -11.729 1.00 0.00 ? 60  ARG A CB   2  
ATOM 2539  C CG   . ARG A 1 60  ? 3.977   -6.488  -12.204 1.00 0.00 ? 60  ARG A CG   2  
ATOM 2540  C CD   . ARG A 1 60  ? 3.529   -5.407  -13.175 1.00 0.00 ? 60  ARG A CD   2  
ATOM 2541  N NE   . ARG A 1 60  ? 4.657   -4.788  -13.865 1.00 0.00 ? 60  ARG A NE   2  
ATOM 2542  C CZ   . ARG A 1 60  ? 4.531   -3.790  -14.732 1.00 0.00 ? 60  ARG A CZ   2  
ATOM 2543  N NH1  . ARG A 1 60  ? 3.331   -3.299  -15.013 1.00 0.00 ? 60  ARG A NH1  2  
ATOM 2544  N NH2  . ARG A 1 60  ? 5.605   -3.279  -15.320 1.00 0.00 ? 60  ARG A NH2  2  
ATOM 2545  H H    . ARG A 1 60  ? 1.198   -9.467  -11.208 1.00 0.00 ? 60  ARG A H    2  
ATOM 2546  H HA   . ARG A 1 60  ? 4.007   -9.081  -12.006 1.00 0.00 ? 60  ARG A HA   2  
ATOM 2547  H HB2  . ARG A 1 60  ? 2.064   -7.352  -12.515 1.00 0.00 ? 60  ARG A HB2  2  
ATOM 2548  H HB3  . ARG A 1 60  ? 2.380   -6.858  -10.857 1.00 0.00 ? 60  ARG A HB3  2  
ATOM 2549  H HG2  . ARG A 1 60  ? 4.441   -6.018  -11.349 1.00 0.00 ? 60  ARG A HG2  2  
ATOM 2550  H HG3  . ARG A 1 60  ? 4.693   -7.128  -12.698 1.00 0.00 ? 60  ARG A HG3  2  
ATOM 2551  H HD2  . ARG A 1 60  ? 2.870   -5.850  -13.907 1.00 0.00 ? 60  ARG A HD2  2  
ATOM 2552  H HD3  . ARG A 1 60  ? 2.995   -4.647  -12.624 1.00 0.00 ? 60  ARG A HD3  2  
ATOM 2553  H HE   . ARG A 1 60  ? 5.553   -5.135  -13.673 1.00 0.00 ? 60  ARG A HE   2  
ATOM 2554  H HH11 . ARG A 1 60  ? 2.520   -3.681  -14.571 1.00 0.00 ? 60  ARG A HH11 2  
ATOM 2555  H HH12 . ARG A 1 60  ? 3.239   -2.546  -15.665 1.00 0.00 ? 60  ARG A HH12 2  
ATOM 2556  H HH21 . ARG A 1 60  ? 6.511   -3.646  -15.110 1.00 0.00 ? 60  ARG A HH21 2  
ATOM 2557  H HH22 . ARG A 1 60  ? 5.509   -2.528  -15.972 1.00 0.00 ? 60  ARG A HH22 2  
ATOM 2558  N N    . HIS A 1 61  ? 4.916   -8.562  -9.683  1.00 0.00 ? 61  HIS A N    2  
ATOM 2559  C CA   . HIS A 1 61  ? 5.471   -8.595  -8.334  1.00 0.00 ? 61  HIS A CA   2  
ATOM 2560  C C    . HIS A 1 61  ? 5.556   -7.189  -7.747  1.00 0.00 ? 61  HIS A C    2  
ATOM 2561  O O    . HIS A 1 61  ? 6.245   -6.322  -8.282  1.00 0.00 ? 61  HIS A O    2  
ATOM 2562  C CB   . HIS A 1 61  ? 6.858   -9.239  -8.346  1.00 0.00 ? 61  HIS A CB   2  
ATOM 2563  C CG   . HIS A 1 61  ? 7.195   -9.959  -7.077  1.00 0.00 ? 61  HIS A CG   2  
ATOM 2564  N ND1  . HIS A 1 61  ? 8.337   -9.703  -6.347  1.00 0.00 ? 61  HIS A ND1  2  
ATOM 2565  C CD2  . HIS A 1 61  ? 6.532   -10.930 -6.407  1.00 0.00 ? 61  HIS A CD2  2  
ATOM 2566  C CE1  . HIS A 1 61  ? 8.363   -10.488 -5.285  1.00 0.00 ? 61  HIS A CE1  2  
ATOM 2567  N NE2  . HIS A 1 61  ? 7.278   -11.241 -5.297  1.00 0.00 ? 61  HIS A NE2  2  
ATOM 2568  H H    . HIS A 1 61  ? 5.500   -8.328  -10.434 1.00 0.00 ? 61  HIS A H    2  
ATOM 2569  H HA   . HIS A 1 61  ? 4.813   -9.190  -7.719  1.00 0.00 ? 61  HIS A HA   2  
ATOM 2570  H HB2  . HIS A 1 61  ? 6.909   -9.953  -9.155  1.00 0.00 ? 61  HIS A HB2  2  
ATOM 2571  H HB3  . HIS A 1 61  ? 7.603   -8.472  -8.502  1.00 0.00 ? 61  HIS A HB3  2  
ATOM 2572  H HD1  . HIS A 1 61  ? 9.027   -9.047  -6.576  1.00 0.00 ? 61  HIS A HD1  2  
ATOM 2573  H HD2  . HIS A 1 61  ? 5.590   -11.378 -6.692  1.00 0.00 ? 61  HIS A HD2  2  
ATOM 2574  H HE1  . HIS A 1 61  ? 9.137   -10.509 -4.533  1.00 0.00 ? 61  HIS A HE1  2  
ATOM 2575  H HE2  . HIS A 1 61  ? 7.091   -11.970 -4.670  1.00 0.00 ? 61  HIS A HE2  2  
ATOM 2576  N N    . GLY A 1 62  ? 4.848   -6.972  -6.642  1.00 0.00 ? 62  GLY A N    2  
ATOM 2577  C CA   . GLY A 1 62  ? 4.856   -5.670  -6.001  1.00 0.00 ? 62  GLY A CA   2  
ATOM 2578  C C    . GLY A 1 62  ? 5.280   -5.742  -4.547  1.00 0.00 ? 62  GLY A C    2  
ATOM 2579  O O    . GLY A 1 62  ? 5.373   -6.827  -3.973  1.00 0.00 ? 62  GLY A O    2  
ATOM 2580  H H    . GLY A 1 62  ? 4.317   -7.701  -6.259  1.00 0.00 ? 62  GLY A H    2  
ATOM 2581  H HA2  . GLY A 1 62  ? 5.538   -5.023  -6.532  1.00 0.00 ? 62  GLY A HA2  2  
ATOM 2582  H HA3  . GLY A 1 62  ? 3.862   -5.249  -6.053  1.00 0.00 ? 62  GLY A HA3  2  
ATOM 2583  N N    . VAL A 1 63  ? 5.540   -4.583  -3.950  1.00 0.00 ? 63  VAL A N    2  
ATOM 2584  C CA   . VAL A 1 63  ? 5.958   -4.519  -2.555  1.00 0.00 ? 63  VAL A CA   2  
ATOM 2585  C C    . VAL A 1 63  ? 5.365   -3.298  -1.860  1.00 0.00 ? 63  VAL A C    2  
ATOM 2586  O O    . VAL A 1 63  ? 5.430   -2.184  -2.377  1.00 0.00 ? 63  VAL A O    2  
ATOM 2587  C CB   . VAL A 1 63  ? 7.492   -4.473  -2.430  1.00 0.00 ? 63  VAL A CB   2  
ATOM 2588  C CG1  . VAL A 1 63  ? 7.901   -3.941  -1.065  1.00 0.00 ? 63  VAL A CG1  2  
ATOM 2589  C CG2  . VAL A 1 63  ? 8.088   -5.851  -2.674  1.00 0.00 ? 63  VAL A CG2  2  
ATOM 2590  H H    . VAL A 1 63  ? 5.449   -3.751  -4.460  1.00 0.00 ? 63  VAL A H    2  
ATOM 2591  H HA   . VAL A 1 63  ? 5.604   -5.411  -2.059  1.00 0.00 ? 63  VAL A HA   2  
ATOM 2592  H HB   . VAL A 1 63  ? 7.875   -3.800  -3.183  1.00 0.00 ? 63  VAL A HB   2  
ATOM 2593  H HG11 . VAL A 1 63  ? 7.110   -4.129  -0.354  1.00 0.00 ? 63  VAL A HG11 2  
ATOM 2594  H HG12 . VAL A 1 63  ? 8.804   -4.436  -0.740  1.00 0.00 ? 63  VAL A HG12 2  
ATOM 2595  H HG13 . VAL A 1 63  ? 8.078   -2.877  -1.131  1.00 0.00 ? 63  VAL A HG13 2  
ATOM 2596  H HG21 . VAL A 1 63  ? 9.147   -5.758  -2.860  1.00 0.00 ? 63  VAL A HG21 2  
ATOM 2597  H HG22 . VAL A 1 63  ? 7.928   -6.471  -1.804  1.00 0.00 ? 63  VAL A HG22 2  
ATOM 2598  H HG23 . VAL A 1 63  ? 7.610   -6.303  -3.531  1.00 0.00 ? 63  VAL A HG23 2  
ATOM 2599  N N    . ALA A 1 64  ? 4.788   -3.516  -0.683  1.00 0.00 ? 64  ALA A N    2  
ATOM 2600  C CA   . ALA A 1 64  ? 4.185   -2.434  0.085   1.00 0.00 ? 64  ALA A CA   2  
ATOM 2601  C C    . ALA A 1 64  ? 5.254   -1.522  0.679   1.00 0.00 ? 64  ALA A C    2  
ATOM 2602  O O    . ALA A 1 64  ? 6.210   -1.990  1.296   1.00 0.00 ? 64  ALA A O    2  
ATOM 2603  C CB   . ALA A 1 64  ? 3.299   -2.997  1.186   1.00 0.00 ? 64  ALA A CB   2  
ATOM 2604  H H    . ALA A 1 64  ? 4.767   -4.427  -0.322  1.00 0.00 ? 64  ALA A H    2  
ATOM 2605  H HA   . ALA A 1 64  ? 3.563   -1.856  -0.583  1.00 0.00 ? 64  ALA A HA   2  
ATOM 2606  H HB1  . ALA A 1 64  ? 2.710   -2.200  1.616   1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2607  H HB2  . ALA A 1 64  ? 2.643   -3.747  0.771   1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2608  H HB3  . ALA A 1 64  ? 3.916   -3.443  1.952   1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2609  N N    . ILE A 1 65  ? 5.085   -0.218  0.486   1.00 0.00 ? 65  ILE A N    2  
ATOM 2610  C CA   . ILE A 1 65  ? 6.035   0.760   1.003   1.00 0.00 ? 65  ILE A CA   2  
ATOM 2611  C C    . ILE A 1 65  ? 5.447   1.528   2.182   1.00 0.00 ? 65  ILE A C    2  
ATOM 2612  O O    . ILE A 1 65  ? 6.173   2.164   2.946   1.00 0.00 ? 65  ILE A O    2  
ATOM 2613  C CB   . ILE A 1 65  ? 6.461   1.761   -0.087  1.00 0.00 ? 65  ILE A CB   2  
ATOM 2614  C CG1  . ILE A 1 65  ? 5.234   2.290   -0.832  1.00 0.00 ? 65  ILE A CG1  2  
ATOM 2615  C CG2  . ILE A 1 65  ? 7.435   1.107   -1.055  1.00 0.00 ? 65  ILE A CG2  2  
ATOM 2616  C CD1  . ILE A 1 65  ? 5.550   3.409   -1.799  1.00 0.00 ? 65  ILE A CD1  2  
ATOM 2617  H H    . ILE A 1 65  ? 4.302   0.094   -0.014  1.00 0.00 ? 65  ILE A H    2  
ATOM 2618  H HA   . ILE A 1 65  ? 6.913   0.226   1.337   1.00 0.00 ? 65  ILE A HA   2  
ATOM 2619  H HB   . ILE A 1 65  ? 6.966   2.586   0.392   1.00 0.00 ? 65  ILE A HB   2  
ATOM 2620  H HG12 . ILE A 1 65  ? 4.786   1.484   -1.393  1.00 0.00 ? 65  ILE A HG12 2  
ATOM 2621  H HG13 . ILE A 1 65  ? 4.519   2.663   -0.114  1.00 0.00 ? 65  ILE A HG13 2  
ATOM 2622  H HG21 . ILE A 1 65  ? 7.435   0.038   -0.899  1.00 0.00 ? 65  ILE A HG21 2  
ATOM 2623  H HG22 . ILE A 1 65  ? 7.132   1.322   -2.069  1.00 0.00 ? 65  ILE A HG22 2  
ATOM 2624  H HG23 . ILE A 1 65  ? 8.428   1.495   -0.885  1.00 0.00 ? 65  ILE A HG23 2  
ATOM 2625  H HD11 . ILE A 1 65  ? 6.574   3.727   -1.659  1.00 0.00 ? 65  ILE A HD11 2  
ATOM 2626  H HD12 . ILE A 1 65  ? 5.421   3.057   -2.812  1.00 0.00 ? 65  ILE A HD12 2  
ATOM 2627  H HD13 . ILE A 1 65  ? 4.887   4.241   -1.618  1.00 0.00 ? 65  ILE A HD13 2  
ATOM 2628  N N    . TYR A 1 66  ? 4.128   1.463   2.324   1.00 0.00 ? 66  TYR A N    2  
ATOM 2629  C CA   . TYR A 1 66  ? 3.441   2.153   3.410   1.00 0.00 ? 66  TYR A CA   2  
ATOM 2630  C C    . TYR A 1 66  ? 2.385   1.254   4.045   1.00 0.00 ? 66  TYR A C    2  
ATOM 2631  O O    . TYR A 1 66  ? 1.686   0.515   3.354   1.00 0.00 ? 66  TYR A O    2  
ATOM 2632  C CB   . TYR A 1 66  ? 2.790   3.438   2.895   1.00 0.00 ? 66  TYR A CB   2  
ATOM 2633  C CG   . TYR A 1 66  ? 3.778   4.432   2.327   1.00 0.00 ? 66  TYR A CG   2  
ATOM 2634  C CD1  . TYR A 1 66  ? 4.737   5.028   3.137   1.00 0.00 ? 66  TYR A CD1  2  
ATOM 2635  C CD2  . TYR A 1 66  ? 3.753   4.774   0.981   1.00 0.00 ? 66  TYR A CD2  2  
ATOM 2636  C CE1  . TYR A 1 66  ? 5.641   5.937   2.623   1.00 0.00 ? 66  TYR A CE1  2  
ATOM 2637  C CE2  . TYR A 1 66  ? 4.654   5.682   0.458   1.00 0.00 ? 66  TYR A CE2  2  
ATOM 2638  C CZ   . TYR A 1 66  ? 5.596   6.261   1.283   1.00 0.00 ? 66  TYR A CZ   2  
ATOM 2639  O OH   . TYR A 1 66  ? 6.495   7.165   0.767   1.00 0.00 ? 66  TYR A OH   2  
ATOM 2640  H H    . TYR A 1 66  ? 3.602   0.940   1.683   1.00 0.00 ? 66  TYR A H    2  
ATOM 2641  H HA   . TYR A 1 66  ? 4.177   2.409   4.158   1.00 0.00 ? 66  TYR A HA   2  
ATOM 2642  H HB2  . TYR A 1 66  ? 2.086   3.189   2.115   1.00 0.00 ? 66  TYR A HB2  2  
ATOM 2643  H HB3  . TYR A 1 66  ? 2.265   3.918   3.707   1.00 0.00 ? 66  TYR A HB3  2  
ATOM 2644  H HD1  . TYR A 1 66  ? 4.770   4.772   4.186   1.00 0.00 ? 66  TYR A HD1  2  
ATOM 2645  H HD2  . TYR A 1 66  ? 3.014   4.319   0.337   1.00 0.00 ? 66  TYR A HD2  2  
ATOM 2646  H HE1  . TYR A 1 66  ? 6.378   6.390   3.269   1.00 0.00 ? 66  TYR A HE1  2  
ATOM 2647  H HE2  . TYR A 1 66  ? 4.619   5.936   -0.591  1.00 0.00 ? 66  TYR A HE2  2  
ATOM 2648  H HH   . TYR A 1 66  ? 7.300   7.150   1.291   1.00 0.00 ? 66  TYR A HH   2  
ATOM 2649  N N    . ASN A 1 67  ? 2.276   1.324   5.368   1.00 0.00 ? 67  ASN A N    2  
ATOM 2650  C CA   . ASN A 1 67  ? 1.306   0.516   6.099   1.00 0.00 ? 67  ASN A CA   2  
ATOM 2651  C C    . ASN A 1 67  ? -0.120  0.938   5.757   1.00 0.00 ? 67  ASN A C    2  
ATOM 2652  O O    . ASN A 1 67  ? -0.601  1.972   6.221   1.00 0.00 ? 67  ASN A O    2  
ATOM 2653  C CB   . ASN A 1 67  ? 1.539   0.641   7.605   1.00 0.00 ? 67  ASN A CB   2  
ATOM 2654  C CG   . ASN A 1 67  ? 2.564   -0.353  8.116   1.00 0.00 ? 67  ASN A CG   2  
ATOM 2655  O OD1  . ASN A 1 67  ? 2.700   -1.453  7.579   1.00 0.00 ? 67  ASN A OD1  2  
ATOM 2656  N ND2  . ASN A 1 67  ? 3.291   0.030   9.159   1.00 0.00 ? 67  ASN A ND2  2  
ATOM 2657  H H    . ASN A 1 67  ? 2.862   1.932   5.865   1.00 0.00 ? 67  ASN A H    2  
ATOM 2658  H HA   . ASN A 1 67  ? 1.444   -0.513  5.806   1.00 0.00 ? 67  ASN A HA   2  
ATOM 2659  H HB2  . ASN A 1 67  ? 1.891   1.638   7.828   1.00 0.00 ? 67  ASN A HB2  2  
ATOM 2660  H HB3  . ASN A 1 67  ? 0.608   0.469   8.124   1.00 0.00 ? 67  ASN A HB3  2  
ATOM 2661  H HD21 . ASN A 1 67  ? 3.128   0.920   9.535   1.00 0.00 ? 67  ASN A HD21 2  
ATOM 2662  H HD22 . ASN A 1 67  ? 3.962   -0.593  9.509   1.00 0.00 ? 67  ASN A HD22 2  
ATOM 2663  N N    . PHE A 1 68  ? -0.791  0.130   4.943   1.00 0.00 ? 68  PHE A N    2  
ATOM 2664  C CA   . PHE A 1 68  ? -2.162  0.419   4.538   1.00 0.00 ? 68  PHE A CA   2  
ATOM 2665  C C    . PHE A 1 68  ? -3.159  -0.212  5.505   1.00 0.00 ? 68  PHE A C    2  
ATOM 2666  O O    . PHE A 1 68  ? -3.034  -1.382  5.865   1.00 0.00 ? 68  PHE A O    2  
ATOM 2667  C CB   . PHE A 1 68  ? -2.416  -0.094  3.119   1.00 0.00 ? 68  PHE A CB   2  
ATOM 2668  C CG   . PHE A 1 68  ? -3.846  0.043   2.679   1.00 0.00 ? 68  PHE A CG   2  
ATOM 2669  C CD1  . PHE A 1 68  ? -4.380  1.288   2.392   1.00 0.00 ? 68  PHE A CD1  2  
ATOM 2670  C CD2  . PHE A 1 68  ? -4.655  -1.075  2.553   1.00 0.00 ? 68  PHE A CD2  2  
ATOM 2671  C CE1  . PHE A 1 68  ? -5.696  1.416   1.988   1.00 0.00 ? 68  PHE A CE1  2  
ATOM 2672  C CE2  . PHE A 1 68  ? -5.972  -0.953  2.149   1.00 0.00 ? 68  PHE A CE2  2  
ATOM 2673  C CZ   . PHE A 1 68  ? -6.492  0.294   1.866   1.00 0.00 ? 68  PHE A CZ   2  
ATOM 2674  H H    . PHE A 1 68  ? -0.353  -0.680  4.605   1.00 0.00 ? 68  PHE A H    2  
ATOM 2675  H HA   . PHE A 1 68  ? -2.292  1.490   4.553   1.00 0.00 ? 68  PHE A HA   2  
ATOM 2676  H HB2  . PHE A 1 68  ? -1.803  0.463   2.427   1.00 0.00 ? 68  PHE A HB2  2  
ATOM 2677  H HB3  . PHE A 1 68  ? -2.150  -1.139  3.069   1.00 0.00 ? 68  PHE A HB3  2  
ATOM 2678  H HD1  . PHE A 1 68  ? -3.759  2.166   2.486   1.00 0.00 ? 68  PHE A HD1  2  
ATOM 2679  H HD2  . PHE A 1 68  ? -4.249  -2.052  2.775   1.00 0.00 ? 68  PHE A HD2  2  
ATOM 2680  H HE1  . PHE A 1 68  ? -6.101  2.393   1.766   1.00 0.00 ? 68  PHE A HE1  2  
ATOM 2681  H HE2  . PHE A 1 68  ? -6.591  -1.832  2.055   1.00 0.00 ? 68  PHE A HE2  2  
ATOM 2682  H HZ   . PHE A 1 68  ? -7.520  0.392   1.551   1.00 0.00 ? 68  PHE A HZ   2  
ATOM 2683  N N    . GLN A 1 69  ? -4.148  0.573   5.922   1.00 0.00 ? 69  GLN A N    2  
ATOM 2684  C CA   . GLN A 1 69  ? -5.166  0.091   6.848   1.00 0.00 ? 69  GLN A CA   2  
ATOM 2685  C C    . GLN A 1 69  ? -6.566  0.368   6.310   1.00 0.00 ? 69  GLN A C    2  
ATOM 2686  O O    . GLN A 1 69  ? -7.020  1.511   6.291   1.00 0.00 ? 69  GLN A O    2  
ATOM 2687  C CB   . GLN A 1 69  ? -4.993  0.752   8.217   1.00 0.00 ? 69  GLN A CB   2  
ATOM 2688  C CG   . GLN A 1 69  ? -6.035  0.322   9.236   1.00 0.00 ? 69  GLN A CG   2  
ATOM 2689  C CD   . GLN A 1 69  ? -5.860  -1.118  9.677   1.00 0.00 ? 69  GLN A CD   2  
ATOM 2690  O OE1  . GLN A 1 69  ? -4.738  -1.597  9.843   1.00 0.00 ? 69  GLN A OE1  2  
ATOM 2691  N NE2  . GLN A 1 69  ? -6.972  -1.818  9.871   1.00 0.00 ? 69  GLN A NE2  2  
ATOM 2692  H H    . GLN A 1 69  ? -4.193  1.496   5.599   1.00 0.00 ? 69  GLN A H    2  
ATOM 2693  H HA   . GLN A 1 69  ? -5.039  -0.975  6.955   1.00 0.00 ? 69  GLN A HA   2  
ATOM 2694  H HB2  . GLN A 1 69  ? -4.017  0.501   8.604   1.00 0.00 ? 69  GLN A HB2  2  
ATOM 2695  H HB3  . GLN A 1 69  ? -5.059  1.823   8.097   1.00 0.00 ? 69  GLN A HB3  2  
ATOM 2696  H HG2  . GLN A 1 69  ? -5.956  0.959   10.104  1.00 0.00 ? 69  GLN A HG2  2  
ATOM 2697  H HG3  . GLN A 1 69  ? -7.016  0.432   8.798   1.00 0.00 ? 69  GLN A HG3  2  
ATOM 2698  H HE21 . GLN A 1 69  ? -7.832  -1.371  9.718   1.00 0.00 ? 69  GLN A HE21 2  
ATOM 2699  H HE22 . GLN A 1 69  ? -6.889  -2.751  10.155  1.00 0.00 ? 69  GLN A HE22 2  
ATOM 2700  N N    . GLY A 1 70  ? -7.246  -0.688  5.873   1.00 0.00 ? 70  GLY A N    2  
ATOM 2701  C CA   . GLY A 1 70  ? -8.587  -0.538  5.340   1.00 0.00 ? 70  GLY A CA   2  
ATOM 2702  C C    . GLY A 1 70  ? -9.657  -0.883  6.357   1.00 0.00 ? 70  GLY A C    2  
ATOM 2703  O O    . GLY A 1 70  ? -9.439  -0.763  7.563   1.00 0.00 ? 70  GLY A O    2  
ATOM 2704  H H    . GLY A 1 70  ? -6.833  -1.576  5.913   1.00 0.00 ? 70  GLY A H    2  
ATOM 2705  H HA2  . GLY A 1 70  ? -8.724  0.485   5.022   1.00 0.00 ? 70  GLY A HA2  2  
ATOM 2706  H HA3  . GLY A 1 70  ? -8.697  -1.189  4.485   1.00 0.00 ? 70  GLY A HA3  2  
ATOM 2707  N N    . SER A 1 71  ? -10.817 -1.312  5.871   1.00 0.00 ? 71  SER A N    2  
ATOM 2708  C CA   . SER A 1 71  ? -11.927 -1.671  6.746   1.00 0.00 ? 71  SER A CA   2  
ATOM 2709  C C    . SER A 1 71  ? -12.353 -3.118  6.518   1.00 0.00 ? 71  SER A C    2  
ATOM 2710  O O    . SER A 1 71  ? -12.614 -3.857  7.466   1.00 0.00 ? 71  SER A O    2  
ATOM 2711  C CB   . SER A 1 71  ? -13.113 -0.734  6.509   1.00 0.00 ? 71  SER A CB   2  
ATOM 2712  O OG   . SER A 1 71  ? -14.145 -0.970  7.452   1.00 0.00 ? 71  SER A OG   2  
ATOM 2713  H H    . SER A 1 71  ? -10.929 -1.387  4.900   1.00 0.00 ? 71  SER A H    2  
ATOM 2714  H HA   . SER A 1 71  ? -11.592 -1.563  7.767   1.00 0.00 ? 71  SER A HA   2  
ATOM 2715  H HB2  . SER A 1 71  ? -12.785 0.290   6.602   1.00 0.00 ? 71  SER A HB2  2  
ATOM 2716  H HB3  . SER A 1 71  ? -13.505 -0.898  5.516   1.00 0.00 ? 71  SER A HB3  2  
ATOM 2717  H HG   . SER A 1 71  ? -14.049 -0.363  8.190   1.00 0.00 ? 71  SER A HG   2  
ATOM 2718  N N    . GLY A 1 72  ? -12.422 -3.515  5.251   1.00 0.00 ? 72  GLY A N    2  
ATOM 2719  C CA   . GLY A 1 72  ? -12.817 -4.872  4.919   1.00 0.00 ? 72  GLY A CA   2  
ATOM 2720  C C    . GLY A 1 72  ? -12.994 -5.076  3.428   1.00 0.00 ? 72  GLY A C    2  
ATOM 2721  O O    . GLY A 1 72  ? -13.129 -4.112  2.674   1.00 0.00 ? 72  GLY A O    2  
ATOM 2722  H H    . GLY A 1 72  ? -12.202 -2.882  4.535   1.00 0.00 ? 72  GLY A H    2  
ATOM 2723  H HA2  . GLY A 1 72  ? -12.061 -5.553  5.278   1.00 0.00 ? 72  GLY A HA2  2  
ATOM 2724  H HA3  . GLY A 1 72  ? -13.751 -5.093  5.414   1.00 0.00 ? 72  GLY A HA3  2  
ATOM 2725  N N    . ALA A 1 73  ? -12.992 -6.334  3.000   1.00 0.00 ? 73  ALA A N    2  
ATOM 2726  C CA   . ALA A 1 73  ? -13.154 -6.662  1.589   1.00 0.00 ? 73  ALA A CA   2  
ATOM 2727  C C    . ALA A 1 73  ? -14.175 -5.743  0.926   1.00 0.00 ? 73  ALA A C    2  
ATOM 2728  O O    . ALA A 1 73  ? -15.102 -5.244  1.563   1.00 0.00 ? 73  ALA A O    2  
ATOM 2729  C CB   . ALA A 1 73  ? -13.567 -8.117  1.429   1.00 0.00 ? 73  ALA A CB   2  
ATOM 2730  H H    . ALA A 1 73  ? -12.880 -7.060  3.649   1.00 0.00 ? 73  ALA A H    2  
ATOM 2731  H HA   . ALA A 1 73  ? -12.197 -6.529  1.104   1.00 0.00 ? 73  ALA A HA   2  
ATOM 2732  H HB1  . ALA A 1 73  ? -13.387 -8.432  0.411   1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2733  H HB2  . ALA A 1 73  ? -12.990 -8.731  2.104   1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2734  H HB3  . ALA A 1 73  ? -14.618 -8.219  1.656   1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2735  N N    . PRO A 1 74  ? -14.002 -5.514  -0.385  1.00 0.00 ? 74  PRO A N    2  
ATOM 2736  C CA   . PRO A 1 74  ? -12.902 -6.103  -1.153  1.00 0.00 ? 74  PRO A CA   2  
ATOM 2737  C C    . PRO A 1 74  ? -11.548 -5.514  -0.772  1.00 0.00 ? 74  PRO A C    2  
ATOM 2738  O O    . PRO A 1 74  ? -10.510 -5.946  -1.272  1.00 0.00 ? 74  PRO A O    2  
ATOM 2739  C CB   . PRO A 1 74  ? -13.251 -5.748  -2.601  1.00 0.00 ? 74  PRO A CB   2  
ATOM 2740  C CG   . PRO A 1 74  ? -14.094 -4.525  -2.498  1.00 0.00 ? 74  PRO A CG   2  
ATOM 2741  C CD   . PRO A 1 74  ? -14.868 -4.661  -1.216  1.00 0.00 ? 74  PRO A CD   2  
ATOM 2742  H HA   . PRO A 1 74  ? -12.870 -7.177  -1.042  1.00 0.00 ? 74  PRO A HA   2  
ATOM 2743  H HB2  . PRO A 1 74  ? -12.343 -5.558  -3.156  1.00 0.00 ? 74  PRO A HB2  2  
ATOM 2744  H HB3  . PRO A 1 74  ? -13.793 -6.564  -3.055  1.00 0.00 ? 74  PRO A HB3  2  
ATOM 2745  H HG2  . PRO A 1 74  ? -13.466 -3.647  -2.466  1.00 0.00 ? 74  PRO A HG2  2  
ATOM 2746  H HG3  . PRO A 1 74  ? -14.770 -4.473  -3.340  1.00 0.00 ? 74  PRO A HG3  2  
ATOM 2747  H HD2  . PRO A 1 74  ? -15.012 -3.694  -0.758  1.00 0.00 ? 74  PRO A HD2  2  
ATOM 2748  H HD3  . PRO A 1 74  ? -15.819 -5.140  -1.399  1.00 0.00 ? 74  PRO A HD3  2  
ATOM 2749  N N    . GLN A 1 75  ? -11.567 -4.525  0.116   1.00 0.00 ? 75  GLN A N    2  
ATOM 2750  C CA   . GLN A 1 75  ? -10.340 -3.877  0.563   1.00 0.00 ? 75  GLN A CA   2  
ATOM 2751  C C    . GLN A 1 75  ? -9.512  -4.819  1.432   1.00 0.00 ? 75  GLN A C    2  
ATOM 2752  O O    . GLN A 1 75  ? -10.055 -5.564  2.249   1.00 0.00 ? 75  GLN A O    2  
ATOM 2753  C CB   . GLN A 1 75  ? -10.666 -2.601  1.341   1.00 0.00 ? 75  GLN A CB   2  
ATOM 2754  C CG   . GLN A 1 75  ? -11.549 -1.630  0.574   1.00 0.00 ? 75  GLN A CG   2  
ATOM 2755  C CD   . GLN A 1 75  ? -12.349 -0.722  1.487   1.00 0.00 ? 75  GLN A CD   2  
ATOM 2756  O OE1  . GLN A 1 75  ? -13.533 -0.477  1.256   1.00 0.00 ? 75  GLN A OE1  2  
ATOM 2757  N NE2  . GLN A 1 75  ? -11.705 -0.218  2.534   1.00 0.00 ? 75  GLN A NE2  2  
ATOM 2758  H H    . GLN A 1 75  ? -12.426 -4.224  0.478   1.00 0.00 ? 75  GLN A H    2  
ATOM 2759  H HA   . GLN A 1 75  ? -9.764  -3.617  -0.312  1.00 0.00 ? 75  GLN A HA   2  
ATOM 2760  H HB2  . GLN A 1 75  ? -11.174 -2.871  2.255   1.00 0.00 ? 75  GLN A HB2  2  
ATOM 2761  H HB3  . GLN A 1 75  ? -9.743  -2.097  1.587   1.00 0.00 ? 75  GLN A HB3  2  
ATOM 2762  H HG2  . GLN A 1 75  ? -10.924 -1.017  -0.058  1.00 0.00 ? 75  GLN A HG2  2  
ATOM 2763  H HG3  . GLN A 1 75  ? -12.235 -2.195  -0.039  1.00 0.00 ? 75  GLN A HG3  2  
ATOM 2764  H HE21 . GLN A 1 75  ? -10.762 -0.456  2.654   1.00 0.00 ? 75  GLN A HE21 2  
ATOM 2765  H HE22 . GLN A 1 75  ? -12.198 0.372   3.140   1.00 0.00 ? 75  GLN A HE22 2  
ATOM 2766  N N    . LEU A 1 76  ? -8.197  -4.780  1.251   1.00 0.00 ? 76  LEU A N    2  
ATOM 2767  C CA   . LEU A 1 76  ? -7.294  -5.631  2.018   1.00 0.00 ? 76  LEU A CA   2  
ATOM 2768  C C    . LEU A 1 76  ? -6.165  -4.810  2.635   1.00 0.00 ? 76  LEU A C    2  
ATOM 2769  O O    . LEU A 1 76  ? -5.647  -3.883  2.013   1.00 0.00 ? 76  LEU A O    2  
ATOM 2770  C CB   . LEU A 1 76  ? -6.712  -6.728  1.125   1.00 0.00 ? 76  LEU A CB   2  
ATOM 2771  C CG   . LEU A 1 76  ? -5.488  -7.461  1.673   1.00 0.00 ? 76  LEU A CG   2  
ATOM 2772  C CD1  . LEU A 1 76  ? -5.913  -8.594  2.595   1.00 0.00 ? 76  LEU A CD1  2  
ATOM 2773  C CD2  . LEU A 1 76  ? -4.629  -7.991  0.534   1.00 0.00 ? 76  LEU A CD2  2  
ATOM 2774  H H    . LEU A 1 76  ? -7.823  -4.166  0.586   1.00 0.00 ? 76  LEU A H    2  
ATOM 2775  H HA   . LEU A 1 76  ? -7.865  -6.089  2.812   1.00 0.00 ? 76  LEU A HA   2  
ATOM 2776  H HB2  . LEU A 1 76  ? -7.487  -7.460  0.954   1.00 0.00 ? 76  LEU A HB2  2  
ATOM 2777  H HB3  . LEU A 1 76  ? -6.434  -6.274  0.184   1.00 0.00 ? 76  LEU A HB3  2  
ATOM 2778  H HG   . LEU A 1 76  ? -4.890  -6.769  2.250   1.00 0.00 ? 76  LEU A HG   2  
ATOM 2779  H HD11 . LEU A 1 76  ? -5.318  -8.568  3.495   1.00 0.00 ? 76  LEU A HD11 2  
ATOM 2780  H HD12 . LEU A 1 76  ? -5.766  -9.540  2.094   1.00 0.00 ? 76  LEU A HD12 2  
ATOM 2781  H HD13 . LEU A 1 76  ? -6.957  -8.480  2.848   1.00 0.00 ? 76  LEU A HD13 2  
ATOM 2782  H HD21 . LEU A 1 76  ? -4.390  -9.028  0.716   1.00 0.00 ? 76  LEU A HD21 2  
ATOM 2783  H HD22 . LEU A 1 76  ? -3.717  -7.416  0.474   1.00 0.00 ? 76  LEU A HD22 2  
ATOM 2784  H HD23 . LEU A 1 76  ? -5.172  -7.904  -0.396  1.00 0.00 ? 76  LEU A HD23 2  
ATOM 2785  N N    . SER A 1 77  ? -5.789  -5.159  3.861   1.00 0.00 ? 77  SER A N    2  
ATOM 2786  C CA   . SER A 1 77  ? -4.722  -4.454  4.563   1.00 0.00 ? 77  SER A CA   2  
ATOM 2787  C C    . SER A 1 77  ? -3.353  -4.890  4.050   1.00 0.00 ? 77  SER A C    2  
ATOM 2788  O O    . SER A 1 77  ? -3.220  -5.937  3.414   1.00 0.00 ? 77  SER A O    2  
ATOM 2789  C CB   . SER A 1 77  ? -4.820  -4.706  6.068   1.00 0.00 ? 77  SER A CB   2  
ATOM 2790  O OG   . SER A 1 77  ? -4.864  -6.094  6.351   1.00 0.00 ? 77  SER A OG   2  
ATOM 2791  H H    . SER A 1 77  ? -6.240  -5.907  4.305   1.00 0.00 ? 77  SER A H    2  
ATOM 2792  H HA   . SER A 1 77  ? -4.844  -3.397  4.375   1.00 0.00 ? 77  SER A HA   2  
ATOM 2793  H HB2  . SER A 1 77  ? -3.958  -4.279  6.559   1.00 0.00 ? 77  SER A HB2  2  
ATOM 2794  H HB3  . SER A 1 77  ? -5.718  -4.244  6.451   1.00 0.00 ? 77  SER A HB3  2  
ATOM 2795  H HG   . SER A 1 77  ? -4.006  -6.385  6.668   1.00 0.00 ? 77  SER A HG   2  
ATOM 2796  N N    . LEU A 1 78  ? -2.338  -4.080  4.330   1.00 0.00 ? 78  LEU A N    2  
ATOM 2797  C CA   . LEU A 1 78  ? -0.978  -4.380  3.897   1.00 0.00 ? 78  LEU A CA   2  
ATOM 2798  C C    . LEU A 1 78  ? 0.041   -3.862  4.907   1.00 0.00 ? 78  LEU A C    2  
ATOM 2799  O O    . LEU A 1 78  ? -0.240  -2.934  5.665   1.00 0.00 ? 78  LEU A O    2  
ATOM 2800  C CB   . LEU A 1 78  ? -0.710  -3.764  2.523   1.00 0.00 ? 78  LEU A CB   2  
ATOM 2801  C CG   . LEU A 1 78  ? -1.213  -4.564  1.320   1.00 0.00 ? 78  LEU A CG   2  
ATOM 2802  C CD1  . LEU A 1 78  ? -0.916  -3.823  0.026   1.00 0.00 ? 78  LEU A CD1  2  
ATOM 2803  C CD2  . LEU A 1 78  ? -0.584  -5.949  1.300   1.00 0.00 ? 78  LEU A CD2  2  
ATOM 2804  H H    . LEU A 1 78  ? -2.506  -3.260  4.839   1.00 0.00 ? 78  LEU A H    2  
ATOM 2805  H HA   . LEU A 1 78  ? -0.882  -5.454  3.827   1.00 0.00 ? 78  LEU A HA   2  
ATOM 2806  H HB2  . LEU A 1 78  ? -1.185  -2.795  2.497   1.00 0.00 ? 78  LEU A HB2  2  
ATOM 2807  H HB3  . LEU A 1 78  ? 0.358   -3.643  2.418   1.00 0.00 ? 78  LEU A HB3  2  
ATOM 2808  H HG   . LEU A 1 78  ? -2.285  -4.683  1.398   1.00 0.00 ? 78  LEU A HG   2  
ATOM 2809  H HD11 . LEU A 1 78  ? -0.617  -2.810  0.251   1.00 0.00 ? 78  LEU A HD11 2  
ATOM 2810  H HD12 . LEU A 1 78  ? -1.803  -3.807  -0.591  1.00 0.00 ? 78  LEU A HD12 2  
ATOM 2811  H HD13 . LEU A 1 78  ? -0.120  -4.326  -0.503  1.00 0.00 ? 78  LEU A HD13 2  
ATOM 2812  H HD21 . LEU A 1 78  ? -1.118  -6.597  1.979   1.00 0.00 ? 78  LEU A HD21 2  
ATOM 2813  H HD22 . LEU A 1 78  ? 0.450   -5.879  1.607   1.00 0.00 ? 78  LEU A HD22 2  
ATOM 2814  H HD23 . LEU A 1 78  ? -0.635  -6.353  0.299   1.00 0.00 ? 78  LEU A HD23 2  
ATOM 2815  N N    . GLN A 1 79  ? 1.225   -4.465  4.908   1.00 0.00 ? 79  GLN A N    2  
ATOM 2816  C CA   . GLN A 1 79  ? 2.287   -4.063  5.823   1.00 0.00 ? 79  GLN A CA   2  
ATOM 2817  C C    . GLN A 1 79  ? 3.586   -3.802  5.069   1.00 0.00 ? 79  GLN A C    2  
ATOM 2818  O O    . GLN A 1 79  ? 3.965   -4.568  4.182   1.00 0.00 ? 79  GLN A O    2  
ATOM 2819  C CB   . GLN A 1 79  ? 2.508   -5.140  6.886   1.00 0.00 ? 79  GLN A CB   2  
ATOM 2820  C CG   . GLN A 1 79  ? 1.616   -4.982  8.107   1.00 0.00 ? 79  GLN A CG   2  
ATOM 2821  C CD   . GLN A 1 79  ? 1.536   -6.247  8.939   1.00 0.00 ? 79  GLN A CD   2  
ATOM 2822  O OE1  . GLN A 1 79  ? 0.554   -6.987  8.870   1.00 0.00 ? 79  GLN A OE1  2  
ATOM 2823  N NE2  . GLN A 1 79  ? 2.571   -6.502  9.731   1.00 0.00 ? 79  GLN A NE2  2  
ATOM 2824  H H    . GLN A 1 79  ? 1.389   -5.199  4.279   1.00 0.00 ? 79  GLN A H    2  
ATOM 2825  H HA   . GLN A 1 79  ? 1.977   -3.150  6.308   1.00 0.00 ? 79  GLN A HA   2  
ATOM 2826  H HB2  . GLN A 1 79  ? 2.314   -6.107  6.448   1.00 0.00 ? 79  GLN A HB2  2  
ATOM 2827  H HB3  . GLN A 1 79  ? 3.537   -5.101  7.212   1.00 0.00 ? 79  GLN A HB3  2  
ATOM 2828  H HG2  . GLN A 1 79  ? 2.010   -4.189  8.725   1.00 0.00 ? 79  GLN A HG2  2  
ATOM 2829  H HG3  . GLN A 1 79  ? 0.621   -4.721  7.779   1.00 0.00 ? 79  GLN A HG3  2  
ATOM 2830  H HE21 . GLN A 1 79  ? 3.318   -5.867  9.734   1.00 0.00 ? 79  GLN A HE21 2  
ATOM 2831  H HE22 . GLN A 1 79  ? 2.545   -7.313  10.279  1.00 0.00 ? 79  GLN A HE22 2  
ATOM 2832  N N    . ILE A 1 80  ? 4.264   -2.716  5.426   1.00 0.00 ? 80  ILE A N    2  
ATOM 2833  C CA   . ILE A 1 80  ? 5.521   -2.355  4.783   1.00 0.00 ? 80  ILE A CA   2  
ATOM 2834  C C    . ILE A 1 80  ? 6.468   -3.549  4.716   1.00 0.00 ? 80  ILE A C    2  
ATOM 2835  O O    . ILE A 1 80  ? 6.778   -4.166  5.734   1.00 0.00 ? 80  ILE A O    2  
ATOM 2836  C CB   . ILE A 1 80  ? 6.222   -1.201  5.524   1.00 0.00 ? 80  ILE A CB   2  
ATOM 2837  C CG1  . ILE A 1 80  ? 5.300   0.018   5.601   1.00 0.00 ? 80  ILE A CG1  2  
ATOM 2838  C CG2  . ILE A 1 80  ? 7.527   -0.841  4.830   1.00 0.00 ? 80  ILE A CG2  2  
ATOM 2839  C CD1  . ILE A 1 80  ? 5.890   1.174   6.378   1.00 0.00 ? 80  ILE A CD1  2  
ATOM 2840  H H    . ILE A 1 80  ? 3.911   -2.145  6.140   1.00 0.00 ? 80  ILE A H    2  
ATOM 2841  H HA   . ILE A 1 80  ? 5.299   -2.029  3.777   1.00 0.00 ? 80  ILE A HA   2  
ATOM 2842  H HB   . ILE A 1 80  ? 6.453   -1.532  6.524   1.00 0.00 ? 80  ILE A HB   2  
ATOM 2843  H HG12 . ILE A 1 80  ? 5.088   0.365   4.602   1.00 0.00 ? 80  ILE A HG12 2  
ATOM 2844  H HG13 . ILE A 1 80  ? 4.376   -0.269  6.081   1.00 0.00 ? 80  ILE A HG13 2  
ATOM 2845  H HG21 . ILE A 1 80  ? 7.665   -1.479  3.970   1.00 0.00 ? 80  ILE A HG21 2  
ATOM 2846  H HG22 . ILE A 1 80  ? 7.493   0.190   4.511   1.00 0.00 ? 80  ILE A HG22 2  
ATOM 2847  H HG23 . ILE A 1 80  ? 8.349   -0.979  5.516   1.00 0.00 ? 80  ILE A HG23 2  
ATOM 2848  H HD11 . ILE A 1 80  ? 6.933   0.977   6.579   1.00 0.00 ? 80  ILE A HD11 2  
ATOM 2849  H HD12 . ILE A 1 80  ? 5.801   2.081   5.799   1.00 0.00 ? 80  ILE A HD12 2  
ATOM 2850  H HD13 . ILE A 1 80  ? 5.359   1.288   7.312   1.00 0.00 ? 80  ILE A HD13 2  
ATOM 2851  N N    . GLY A 1 81  ? 6.924   -3.869  3.509   1.00 0.00 ? 81  GLY A N    2  
ATOM 2852  C CA   . GLY A 1 81  ? 7.832   -4.987  3.332   1.00 0.00 ? 81  GLY A CA   2  
ATOM 2853  C C    . GLY A 1 81  ? 7.106   -6.276  3.001   1.00 0.00 ? 81  GLY A C    2  
ATOM 2854  O O    . GLY A 1 81  ? 7.656   -7.366  3.166   1.00 0.00 ? 81  GLY A O    2  
ATOM 2855  H H    . GLY A 1 81  ? 6.642   -3.341  2.733   1.00 0.00 ? 81  GLY A H    2  
ATOM 2856  H HA2  . GLY A 1 81  ? 8.518   -4.756  2.530   1.00 0.00 ? 81  GLY A HA2  2  
ATOM 2857  H HA3  . GLY A 1 81  ? 8.394   -5.128  4.243   1.00 0.00 ? 81  GLY A HA3  2  
ATOM 2858  N N    . ASP A 1 82  ? 5.869   -6.154  2.534   1.00 0.00 ? 82  ASP A N    2  
ATOM 2859  C CA   . ASP A 1 82  ? 5.066   -7.319  2.180   1.00 0.00 ? 82  ASP A CA   2  
ATOM 2860  C C    . ASP A 1 82  ? 4.842   -7.386  0.673   1.00 0.00 ? 82  ASP A C    2  
ATOM 2861  O O    . ASP A 1 82  ? 4.492   -6.389  0.041   1.00 0.00 ? 82  ASP A O    2  
ATOM 2862  C CB   . ASP A 1 82  ? 3.721   -7.277  2.906   1.00 0.00 ? 82  ASP A CB   2  
ATOM 2863  C CG   . ASP A 1 82  ? 3.877   -7.275  4.414   1.00 0.00 ? 82  ASP A CG   2  
ATOM 2864  O OD1  . ASP A 1 82  ? 4.927   -6.807  4.901   1.00 0.00 ? 82  ASP A OD1  2  
ATOM 2865  O OD2  . ASP A 1 82  ? 2.949   -7.742  5.108   1.00 0.00 ? 82  ASP A OD2  2  
ATOM 2866  H H    . ASP A 1 82  ? 5.486   -5.258  2.425   1.00 0.00 ? 82  ASP A H    2  
ATOM 2867  H HA   . ASP A 1 82  ? 5.606   -8.200  2.491   1.00 0.00 ? 82  ASP A HA   2  
ATOM 2868  H HB2  . ASP A 1 82  ? 3.190   -6.382  2.617   1.00 0.00 ? 82  ASP A HB2  2  
ATOM 2869  H HB3  . ASP A 1 82  ? 3.140   -8.143  2.624   1.00 0.00 ? 82  ASP A HB3  2  
ATOM 2870  N N    . VAL A 1 83  ? 5.049   -8.569  0.101   1.00 0.00 ? 83  VAL A N    2  
ATOM 2871  C CA   . VAL A 1 83  ? 4.870   -8.767  -1.332  1.00 0.00 ? 83  VAL A CA   2  
ATOM 2872  C C    . VAL A 1 83  ? 3.537   -9.443  -1.631  1.00 0.00 ? 83  VAL A C    2  
ATOM 2873  O O    . VAL A 1 83  ? 3.214   -10.485 -1.059  1.00 0.00 ? 83  VAL A O    2  
ATOM 2874  C CB   . VAL A 1 83  ? 6.009   -9.616  -1.928  1.00 0.00 ? 83  VAL A CB   2  
ATOM 2875  C CG1  . VAL A 1 83  ? 5.754   -9.893  -3.401  1.00 0.00 ? 83  VAL A CG1  2  
ATOM 2876  C CG2  . VAL A 1 83  ? 7.348   -8.922  -1.731  1.00 0.00 ? 83  VAL A CG2  2  
ATOM 2877  H H    . VAL A 1 83  ? 5.328   -9.326  0.657   1.00 0.00 ? 83  VAL A H    2  
ATOM 2878  H HA   . VAL A 1 83  ? 4.886   -7.797  -1.808  1.00 0.00 ? 83  VAL A HA   2  
ATOM 2879  H HB   . VAL A 1 83  ? 6.037   -10.561 -1.406  1.00 0.00 ? 83  VAL A HB   2  
ATOM 2880  H HG11 . VAL A 1 83  ? 6.516   -9.411  -3.995  1.00 0.00 ? 83  VAL A HG11 2  
ATOM 2881  H HG12 . VAL A 1 83  ? 5.779   -10.959 -3.577  1.00 0.00 ? 83  VAL A HG12 2  
ATOM 2882  H HG13 . VAL A 1 83  ? 4.784   -9.505  -3.678  1.00 0.00 ? 83  VAL A HG13 2  
ATOM 2883  H HG21 . VAL A 1 83  ? 7.595   -8.358  -2.618  1.00 0.00 ? 83  VAL A HG21 2  
ATOM 2884  H HG22 . VAL A 1 83  ? 7.287   -8.255  -0.885  1.00 0.00 ? 83  VAL A HG22 2  
ATOM 2885  H HG23 . VAL A 1 83  ? 8.115   -9.663  -1.551  1.00 0.00 ? 83  VAL A HG23 2  
ATOM 2886  N N    . VAL A 1 84  ? 2.765   -8.844  -2.532  1.00 0.00 ? 84  VAL A N    2  
ATOM 2887  C CA   . VAL A 1 84  ? 1.466   -9.389  -2.909  1.00 0.00 ? 84  VAL A CA   2  
ATOM 2888  C C    . VAL A 1 84  ? 1.419   -9.717  -4.398  1.00 0.00 ? 84  VAL A C    2  
ATOM 2889  O O    . VAL A 1 84  ? 1.969   -8.987  -5.222  1.00 0.00 ? 84  VAL A O    2  
ATOM 2890  C CB   . VAL A 1 84  ? 0.327   -8.408  -2.575  1.00 0.00 ? 84  VAL A CB   2  
ATOM 2891  C CG1  . VAL A 1 84  ? 0.228   -8.197  -1.071  1.00 0.00 ? 84  VAL A CG1  2  
ATOM 2892  C CG2  . VAL A 1 84  ? 0.535   -7.085  -3.295  1.00 0.00 ? 84  VAL A CG2  2  
ATOM 2893  H H    . VAL A 1 84  ? 3.076   -8.017  -2.954  1.00 0.00 ? 84  VAL A H    2  
ATOM 2894  H HA   . VAL A 1 84  ? 1.308   -10.297 -2.346  1.00 0.00 ? 84  VAL A HA   2  
ATOM 2895  H HB   . VAL A 1 84  ? -0.603  -8.838  -2.917  1.00 0.00 ? 84  VAL A HB   2  
ATOM 2896  H HG11 . VAL A 1 84  ? -0.810  -8.114  -0.787  1.00 0.00 ? 84  VAL A HG11 2  
ATOM 2897  H HG12 . VAL A 1 84  ? 0.677   -9.036  -0.559  1.00 0.00 ? 84  VAL A HG12 2  
ATOM 2898  H HG13 . VAL A 1 84  ? 0.748   -7.290  -0.801  1.00 0.00 ? 84  VAL A HG13 2  
ATOM 2899  H HG21 . VAL A 1 84  ? -0.142  -6.346  -2.894  1.00 0.00 ? 84  VAL A HG21 2  
ATOM 2900  H HG22 . VAL A 1 84  ? 1.554   -6.755  -3.152  1.00 0.00 ? 84  VAL A HG22 2  
ATOM 2901  H HG23 . VAL A 1 84  ? 0.343   -7.214  -4.350  1.00 0.00 ? 84  VAL A HG23 2  
ATOM 2902  N N    . ARG A 1 85  ? 0.758   -10.820 -4.734  1.00 0.00 ? 85  ARG A N    2  
ATOM 2903  C CA   . ARG A 1 85  ? 0.639   -11.245 -6.124  1.00 0.00 ? 85  ARG A CA   2  
ATOM 2904  C C    . ARG A 1 85  ? -0.510  -10.519 -6.818  1.00 0.00 ? 85  ARG A C    2  
ATOM 2905  O O    . ARG A 1 85  ? -1.680  -10.758 -6.517  1.00 0.00 ? 85  ARG A O    2  
ATOM 2906  C CB   . ARG A 1 85  ? 0.422   -12.757 -6.200  1.00 0.00 ? 85  ARG A CB   2  
ATOM 2907  C CG   . ARG A 1 85  ? 0.891   -13.375 -7.507  1.00 0.00 ? 85  ARG A CG   2  
ATOM 2908  C CD   . ARG A 1 85  ? 2.409   -13.424 -7.586  1.00 0.00 ? 85  ARG A CD   2  
ATOM 2909  N NE   . ARG A 1 85  ? 2.873   -14.037 -8.828  1.00 0.00 ? 85  ARG A NE   2  
ATOM 2910  C CZ   . ARG A 1 85  ? 4.136   -14.382 -9.050  1.00 0.00 ? 85  ARG A CZ   2  
ATOM 2911  N NH1  . ARG A 1 85  ? 5.057   -14.175 -8.119  1.00 0.00 ? 85  ARG A NH1  2  
ATOM 2912  N NH2  . ARG A 1 85  ? 4.481   -14.935 -10.206 1.00 0.00 ? 85  ARG A NH2  2  
ATOM 2913  H H    . ARG A 1 85  ? 0.340   -11.361 -4.032  1.00 0.00 ? 85  ARG A H    2  
ATOM 2914  H HA   . ARG A 1 85  ? 1.562   -10.997 -6.627  1.00 0.00 ? 85  ARG A HA   2  
ATOM 2915  H HB2  . ARG A 1 85  ? 0.961   -13.228 -5.391  1.00 0.00 ? 85  ARG A HB2  2  
ATOM 2916  H HB3  . ARG A 1 85  ? -0.632  -12.963 -6.088  1.00 0.00 ? 85  ARG A HB3  2  
ATOM 2917  H HG2  . ARG A 1 85  ? 0.505   -14.381 -7.578  1.00 0.00 ? 85  ARG A HG2  2  
ATOM 2918  H HG3  . ARG A 1 85  ? 0.515   -12.784 -8.329  1.00 0.00 ? 85  ARG A HG3  2  
ATOM 2919  H HD2  . ARG A 1 85  ? 2.792   -12.417 -7.528  1.00 0.00 ? 85  ARG A HD2  2  
ATOM 2920  H HD3  . ARG A 1 85  ? 2.781   -13.999 -6.751  1.00 0.00 ? 85  ARG A HD3  2  
ATOM 2921  H HE   . ARG A 1 85  ? 2.209   -14.199 -9.529  1.00 0.00 ? 85  ARG A HE   2  
ATOM 2922  H HH11 . ARG A 1 85  ? 4.800   -13.759 -7.247  1.00 0.00 ? 85  ARG A HH11 2  
ATOM 2923  H HH12 . ARG A 1 85  ? 6.008   -14.436 -8.289  1.00 0.00 ? 85  ARG A HH12 2  
ATOM 2924  H HH21 . ARG A 1 85  ? 3.789   -15.093 -10.910 1.00 0.00 ? 85  ARG A HH21 2  
ATOM 2925  H HH22 . ARG A 1 85  ? 5.432   -15.194 -10.372 1.00 0.00 ? 85  ARG A HH22 2  
ATOM 2926  N N    . ILE A 1 86  ? -0.168  -9.633  -7.747  1.00 0.00 ? 86  ILE A N    2  
ATOM 2927  C CA   . ILE A 1 86  ? -1.171  -8.874  -8.484  1.00 0.00 ? 86  ILE A CA   2  
ATOM 2928  C C    . ILE A 1 86  ? -1.767  -9.704  -9.616  1.00 0.00 ? 86  ILE A C    2  
ATOM 2929  O O    . ILE A 1 86  ? -1.040  -10.270 -10.432 1.00 0.00 ? 86  ILE A O    2  
ATOM 2930  C CB   . ILE A 1 86  ? -0.578  -7.579  -9.069  1.00 0.00 ? 86  ILE A CB   2  
ATOM 2931  C CG1  . ILE A 1 86  ? -0.180  -6.621  -7.944  1.00 0.00 ? 86  ILE A CG1  2  
ATOM 2932  C CG2  . ILE A 1 86  ? -1.576  -6.917  -10.008 1.00 0.00 ? 86  ILE A CG2  2  
ATOM 2933  C CD1  . ILE A 1 86  ? 0.959   -5.697  -8.313  1.00 0.00 ? 86  ILE A CD1  2  
ATOM 2934  H H    . ILE A 1 86  ? 0.781   -9.487  -7.942  1.00 0.00 ? 86  ILE A H    2  
ATOM 2935  H HA   . ILE A 1 86  ? -1.959  -8.607  -7.795  1.00 0.00 ? 86  ILE A HA   2  
ATOM 2936  H HB   . ILE A 1 86  ? 0.300   -7.837  -9.640  1.00 0.00 ? 86  ILE A HB   2  
ATOM 2937  H HG12 . ILE A 1 86  ? -1.030  -6.010  -7.682  1.00 0.00 ? 86  ILE A HG12 2  
ATOM 2938  H HG13 . ILE A 1 86  ? 0.124   -7.197  -7.082  1.00 0.00 ? 86  ILE A HG13 2  
ATOM 2939  H HG21 . ILE A 1 86  ? -1.560  -5.848  -9.854  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 2940  H HG22 . ILE A 1 86  ? -1.308  -7.136  -11.030 1.00 0.00 ? 86  ILE A HG22 2  
ATOM 2941  H HG23 . ILE A 1 86  ? -2.567  -7.295  -9.806  1.00 0.00 ? 86  ILE A HG23 2  
ATOM 2942  H HD11 . ILE A 1 86  ? 0.796   -4.728  -7.863  1.00 0.00 ? 86  ILE A HD11 2  
ATOM 2943  H HD12 . ILE A 1 86  ? 1.889   -6.109  -7.950  1.00 0.00 ? 86  ILE A HD12 2  
ATOM 2944  H HD13 . ILE A 1 86  ? 1.005   -5.591  -9.386  1.00 0.00 ? 86  ILE A HD13 2  
ATOM 2945  N N    . GLN A 1 87  ? -3.093  -9.770  -9.660  1.00 0.00 ? 87  GLN A N    2  
ATOM 2946  C CA   . GLN A 1 87  ? -3.787  -10.530 -10.693 1.00 0.00 ? 87  GLN A CA   2  
ATOM 2947  C C    . GLN A 1 87  ? -4.568  -9.603  -11.618 1.00 0.00 ? 87  GLN A C    2  
ATOM 2948  O O    . GLN A 1 87  ? -4.610  -9.812  -12.830 1.00 0.00 ? 87  GLN A O    2  
ATOM 2949  C CB   . GLN A 1 87  ? -4.731  -11.551 -10.057 1.00 0.00 ? 87  GLN A CB   2  
ATOM 2950  C CG   . GLN A 1 87  ? -4.038  -12.511 -9.104  1.00 0.00 ? 87  GLN A CG   2  
ATOM 2951  C CD   . GLN A 1 87  ? -4.723  -13.861 -9.034  1.00 0.00 ? 87  GLN A CD   2  
ATOM 2952  O OE1  . GLN A 1 87  ? -5.696  -14.114 -9.745  1.00 0.00 ? 87  GLN A OE1  2  
ATOM 2953  N NE2  . GLN A 1 87  ? -4.217  -14.738 -8.175  1.00 0.00 ? 87  GLN A NE2  2  
ATOM 2954  H H    . GLN A 1 87  ? -3.618  -9.297  -8.981  1.00 0.00 ? 87  GLN A H    2  
ATOM 2955  H HA   . GLN A 1 87  ? -3.043  -11.054 -11.274 1.00 0.00 ? 87  GLN A HA   2  
ATOM 2956  H HB2  . GLN A 1 87  ? -5.497  -11.023 -9.509  1.00 0.00 ? 87  GLN A HB2  2  
ATOM 2957  H HB3  . GLN A 1 87  ? -5.196  -12.131 -10.842 1.00 0.00 ? 87  GLN A HB3  2  
ATOM 2958  H HG2  . GLN A 1 87  ? -3.021  -12.657 -9.437  1.00 0.00 ? 87  GLN A HG2  2  
ATOM 2959  H HG3  . GLN A 1 87  ? -4.032  -12.074 -8.116  1.00 0.00 ? 87  GLN A HG3  2  
ATOM 2960  H HE21 . GLN A 1 87  ? -3.441  -14.467 -7.640  1.00 0.00 ? 87  GLN A HE21 2  
ATOM 2961  H HE22 . GLN A 1 87  ? -4.640  -15.618 -8.109  1.00 0.00 ? 87  GLN A HE22 2  
ATOM 2962  N N    . GLU A 1 88  ? -5.187  -8.579  -11.038 1.00 0.00 ? 88  GLU A N    2  
ATOM 2963  C CA   . GLU A 1 88  ? -5.968  -7.622  -11.811 1.00 0.00 ? 88  GLU A CA   2  
ATOM 2964  C C    . GLU A 1 88  ? -5.686  -6.193  -11.354 1.00 0.00 ? 88  GLU A C    2  
ATOM 2965  O O    . GLU A 1 88  ? -5.386  -5.951  -10.184 1.00 0.00 ? 88  GLU A O    2  
ATOM 2966  C CB   . GLU A 1 88  ? -7.462  -7.925  -11.680 1.00 0.00 ? 88  GLU A CB   2  
ATOM 2967  C CG   . GLU A 1 88  ? -8.326  -7.176  -12.681 1.00 0.00 ? 88  GLU A CG   2  
ATOM 2968  C CD   . GLU A 1 88  ? -8.343  -7.837  -14.046 1.00 0.00 ? 88  GLU A CD   2  
ATOM 2969  O OE1  . GLU A 1 88  ? -9.123  -8.794  -14.231 1.00 0.00 ? 88  GLU A OE1  2  
ATOM 2970  O OE2  . GLU A 1 88  ? -7.576  -7.397  -14.928 1.00 0.00 ? 88  GLU A OE2  2  
ATOM 2971  H H    . GLU A 1 88  ? -5.116  -8.466  -10.067 1.00 0.00 ? 88  GLU A H    2  
ATOM 2972  H HA   . GLU A 1 88  ? -5.681  -7.719  -12.847 1.00 0.00 ? 88  GLU A HA   2  
ATOM 2973  H HB2  . GLU A 1 88  ? -7.616  -8.984  -11.823 1.00 0.00 ? 88  GLU A HB2  2  
ATOM 2974  H HB3  . GLU A 1 88  ? -7.785  -7.655  -10.685 1.00 0.00 ? 88  GLU A HB3  2  
ATOM 2975  H HG2  . GLU A 1 88  ? -9.337  -7.135  -12.306 1.00 0.00 ? 88  GLU A HG2  2  
ATOM 2976  H HG3  . GLU A 1 88  ? -7.941  -6.172  -12.788 1.00 0.00 ? 88  GLU A HG3  2  
ATOM 2977  N N    . THR A 1 89  ? -5.782  -5.250  -12.286 1.00 0.00 ? 89  THR A N    2  
ATOM 2978  C CA   . THR A 1 89  ? -5.536  -3.846  -11.981 1.00 0.00 ? 89  THR A CA   2  
ATOM 2979  C C    . THR A 1 89  ? -6.771  -2.998  -12.260 1.00 0.00 ? 89  THR A C    2  
ATOM 2980  O O    . THR A 1 89  ? -7.199  -2.867  -13.407 1.00 0.00 ? 89  THR A O    2  
ATOM 2981  C CB   . THR A 1 89  ? -4.352  -3.293  -12.797 1.00 0.00 ? 89  THR A CB   2  
ATOM 2982  O OG1  . THR A 1 89  ? -3.260  -4.219  -12.765 1.00 0.00 ? 89  THR A OG1  2  
ATOM 2983  C CG2  . THR A 1 89  ? -3.899  -1.948  -12.250 1.00 0.00 ? 89  THR A CG2  2  
ATOM 2984  H H    . THR A 1 89  ? -6.024  -5.506  -13.200 1.00 0.00 ? 89  THR A H    2  
ATOM 2985  H HA   . THR A 1 89  ? -5.289  -3.771  -10.932 1.00 0.00 ? 89  THR A HA   2  
ATOM 2986  H HB   . THR A 1 89  ? -4.671  -3.160  -13.821 1.00 0.00 ? 89  THR A HB   2  
ATOM 2987  H HG1  . THR A 1 89  ? -3.138  -4.539  -11.868 1.00 0.00 ? 89  THR A HG1  2  
ATOM 2988  H HG21 . THR A 1 89  ? -2.837  -1.977  -12.060 1.00 0.00 ? 89  THR A HG21 2  
ATOM 2989  H HG22 . THR A 1 89  ? -4.423  -1.739  -11.329 1.00 0.00 ? 89  THR A HG22 2  
ATOM 2990  H HG23 . THR A 1 89  ? -4.115  -1.175  -12.972 1.00 0.00 ? 89  THR A HG23 2  
ATOM 2991  N N    . CYS A 1 90  ? -7.339  -2.423  -11.206 1.00 0.00 ? 90  CYS A N    2  
ATOM 2992  C CA   . CYS A 1 90  ? -8.526  -1.587  -11.338 1.00 0.00 ? 90  CYS A CA   2  
ATOM 2993  C C    . CYS A 1 90  ? -8.227  -0.149  -10.927 1.00 0.00 ? 90  CYS A C    2  
ATOM 2994  O O    . CYS A 1 90  ? -7.891  0.121   -9.775  1.00 0.00 ? 90  CYS A O    2  
ATOM 2995  C CB   . CYS A 1 90  ? -9.667  -2.146  -10.486 1.00 0.00 ? 90  CYS A CB   2  
ATOM 2996  S SG   . CYS A 1 90  ? -10.220 -3.794  -10.984 1.00 0.00 ? 90  CYS A SG   2  
ATOM 2997  H H    . CYS A 1 90  ? -6.951  -2.565  -10.317 1.00 0.00 ? 90  CYS A H    2  
ATOM 2998  H HA   . CYS A 1 90  ? -8.824  -1.597  -12.375 1.00 0.00 ? 90  CYS A HA   2  
ATOM 2999  H HB2  . CYS A 1 90  ? -9.343  -2.205  -9.458  1.00 0.00 ? 90  CYS A HB2  2  
ATOM 3000  H HB3  . CYS A 1 90  ? -10.514 -1.480  -10.551 1.00 0.00 ? 90  CYS A HB3  2  
ATOM 3001  H HG   . CYS A 1 90  ? -9.350  -4.675  -10.515 1.00 0.00 ? 90  CYS A HG   2  
ATOM 3002  N N    . GLY A 1 91  ? -8.349  0.771   -11.879 1.00 0.00 ? 91  GLY A N    2  
ATOM 3003  C CA   . GLY A 1 91  ? -8.086  2.170   -11.597 1.00 0.00 ? 91  GLY A CA   2  
ATOM 3004  C C    . GLY A 1 91  ? -6.853  2.367   -10.738 1.00 0.00 ? 91  GLY A C    2  
ATOM 3005  O O    . GLY A 1 91  ? -5.802  1.784   -11.007 1.00 0.00 ? 91  GLY A O    2  
ATOM 3006  H H    . GLY A 1 91  ? -8.620  0.498   -12.780 1.00 0.00 ? 91  GLY A H    2  
ATOM 3007  H HA2  . GLY A 1 91  ? -7.949  2.695   -12.531 1.00 0.00 ? 91  GLY A HA2  2  
ATOM 3008  H HA3  . GLY A 1 91  ? -8.939  2.589   -11.082 1.00 0.00 ? 91  GLY A HA3  2  
ATOM 3009  N N    . ASP A 1 92  ? -6.979  3.190   -9.704  1.00 0.00 ? 92  ASP A N    2  
ATOM 3010  C CA   . ASP A 1 92  ? -5.865  3.463   -8.803  1.00 0.00 ? 92  ASP A CA   2  
ATOM 3011  C C    . ASP A 1 92  ? -5.832  2.454   -7.659  1.00 0.00 ? 92  ASP A C    2  
ATOM 3012  O O    . ASP A 1 92  ? -5.625  2.819   -6.502  1.00 0.00 ? 92  ASP A O    2  
ATOM 3013  C CB   . ASP A 1 92  ? -5.969  4.883   -8.244  1.00 0.00 ? 92  ASP A CB   2  
ATOM 3014  C CG   . ASP A 1 92  ? -4.629  5.424   -7.785  1.00 0.00 ? 92  ASP A CG   2  
ATOM 3015  O OD1  . ASP A 1 92  ? -4.108  4.930   -6.763  1.00 0.00 ? 92  ASP A OD1  2  
ATOM 3016  O OD2  . ASP A 1 92  ? -4.101  6.340   -8.449  1.00 0.00 ? 92  ASP A OD2  2  
ATOM 3017  H H    . ASP A 1 92  ? -7.843  3.625   -9.541  1.00 0.00 ? 92  ASP A H    2  
ATOM 3018  H HA   . ASP A 1 92  ? -4.951  3.375   -9.370  1.00 0.00 ? 92  ASP A HA   2  
ATOM 3019  H HB2  . ASP A 1 92  ? -6.357  5.537   -9.011  1.00 0.00 ? 92  ASP A HB2  2  
ATOM 3020  H HB3  . ASP A 1 92  ? -6.644  4.882   -7.401  1.00 0.00 ? 92  ASP A HB3  2  
ATOM 3021  N N    . TRP A 1 93  ? -6.038  1.184   -7.991  1.00 0.00 ? 93  TRP A N    2  
ATOM 3022  C CA   . TRP A 1 93  ? -6.033  0.123   -6.991  1.00 0.00 ? 93  TRP A CA   2  
ATOM 3023  C C    . TRP A 1 93  ? -5.708  -1.224  -7.629  1.00 0.00 ? 93  TRP A C    2  
ATOM 3024  O O    . TRP A 1 93  ? -6.220  -1.554  -8.698  1.00 0.00 ? 93  TRP A O    2  
ATOM 3025  C CB   . TRP A 1 93  ? -7.388  0.053   -6.284  1.00 0.00 ? 93  TRP A CB   2  
ATOM 3026  C CG   . TRP A 1 93  ? -7.742  1.312   -5.553  1.00 0.00 ? 93  TRP A CG   2  
ATOM 3027  C CD1  . TRP A 1 93  ? -8.123  2.501   -6.106  1.00 0.00 ? 93  TRP A CD1  2  
ATOM 3028  C CD2  . TRP A 1 93  ? -7.745  1.508   -4.135  1.00 0.00 ? 93  TRP A CD2  2  
ATOM 3029  N NE1  . TRP A 1 93  ? -8.363  3.424   -5.117  1.00 0.00 ? 93  TRP A NE1  2  
ATOM 3030  C CE2  . TRP A 1 93  ? -8.139  2.839   -3.899  1.00 0.00 ? 93  TRP A CE2  2  
ATOM 3031  C CE3  . TRP A 1 93  ? -7.455  0.687   -3.041  1.00 0.00 ? 93  TRP A CE3  2  
ATOM 3032  C CZ2  . TRP A 1 93  ? -8.249  3.366   -2.614  1.00 0.00 ? 93  TRP A CZ2  2  
ATOM 3033  C CZ3  . TRP A 1 93  ? -7.564  1.212   -1.768  1.00 0.00 ? 93  TRP A CZ3  2  
ATOM 3034  C CH2  . TRP A 1 93  ? -7.959  2.540   -1.563  1.00 0.00 ? 93  TRP A CH2  2  
ATOM 3035  H H    . TRP A 1 93  ? -6.198  0.955   -8.931  1.00 0.00 ? 93  TRP A H    2  
ATOM 3036  H HA   . TRP A 1 93  ? -5.269  0.357   -6.264  1.00 0.00 ? 93  TRP A HA   2  
ATOM 3037  H HB2  . TRP A 1 93  ? -8.159  -0.136  -7.016  1.00 0.00 ? 93  TRP A HB2  2  
ATOM 3038  H HB3  . TRP A 1 93  ? -7.370  -0.756  -5.568  1.00 0.00 ? 93  TRP A HB3  2  
ATOM 3039  H HD1  . TRP A 1 93  ? -8.216  2.676   -7.167  1.00 0.00 ? 93  TRP A HD1  2  
ATOM 3040  H HE1  . TRP A 1 93  ? -8.650  4.351   -5.261  1.00 0.00 ? 93  TRP A HE1  2  
ATOM 3041  H HE3  . TRP A 1 93  ? -7.149  -0.339  -3.179  1.00 0.00 ? 93  TRP A HE3  2  
ATOM 3042  H HZ2  . TRP A 1 93  ? -8.553  4.388   -2.440  1.00 0.00 ? 93  TRP A HZ2  2  
ATOM 3043  H HZ3  . TRP A 1 93  ? -7.344  0.593   -0.910  1.00 0.00 ? 93  TRP A HZ3  2  
ATOM 3044  H HH2  . TRP A 1 93  ? -8.031  2.908   -0.551  1.00 0.00 ? 93  TRP A HH2  2  
ATOM 3045  N N    . TYR A 1 94  ? -4.856  -1.997  -6.966  1.00 0.00 ? 94  TYR A N    2  
ATOM 3046  C CA   . TYR A 1 94  ? -4.461  -3.307  -7.470  1.00 0.00 ? 94  TYR A CA   2  
ATOM 3047  C C    . TYR A 1 94  ? -5.341  -4.405  -6.879  1.00 0.00 ? 94  TYR A C    2  
ATOM 3048  O O    . TYR A 1 94  ? -5.943  -4.231  -5.819  1.00 0.00 ? 94  TYR A O    2  
ATOM 3049  C CB   . TYR A 1 94  ? -2.993  -3.582  -7.141  1.00 0.00 ? 94  TYR A CB   2  
ATOM 3050  C CG   . TYR A 1 94  ? -2.024  -2.822  -8.018  1.00 0.00 ? 94  TYR A CG   2  
ATOM 3051  C CD1  . TYR A 1 94  ? -1.954  -3.065  -9.384  1.00 0.00 ? 94  TYR A CD1  2  
ATOM 3052  C CD2  . TYR A 1 94  ? -1.179  -1.859  -7.480  1.00 0.00 ? 94  TYR A CD2  2  
ATOM 3053  C CE1  . TYR A 1 94  ? -1.069  -2.372  -10.188 1.00 0.00 ? 94  TYR A CE1  2  
ATOM 3054  C CE2  . TYR A 1 94  ? -0.292  -1.161  -8.277  1.00 0.00 ? 94  TYR A CE2  2  
ATOM 3055  C CZ   . TYR A 1 94  ? -0.241  -1.421  -9.630  1.00 0.00 ? 94  TYR A CZ   2  
ATOM 3056  O OH   . TYR A 1 94  ? 0.641   -0.729  -10.428 1.00 0.00 ? 94  TYR A OH   2  
ATOM 3057  H H    . TYR A 1 94  ? -4.481  -1.679  -6.118  1.00 0.00 ? 94  TYR A H    2  
ATOM 3058  H HA   . TYR A 1 94  ? -4.585  -3.301  -8.543  1.00 0.00 ? 94  TYR A HA   2  
ATOM 3059  H HB2  . TYR A 1 94  ? -2.802  -3.303  -6.117  1.00 0.00 ? 94  TYR A HB2  2  
ATOM 3060  H HB3  . TYR A 1 94  ? -2.795  -4.637  -7.265  1.00 0.00 ? 94  TYR A HB3  2  
ATOM 3061  H HD1  . TYR A 1 94  ? -2.605  -3.810  -9.818  1.00 0.00 ? 94  TYR A HD1  2  
ATOM 3062  H HD2  . TYR A 1 94  ? -1.221  -1.657  -6.419  1.00 0.00 ? 94  TYR A HD2  2  
ATOM 3063  H HE1  . TYR A 1 94  ? -1.029  -2.576  -11.248 1.00 0.00 ? 94  TYR A HE1  2  
ATOM 3064  H HE2  . TYR A 1 94  ? 0.357   -0.416  -7.840  1.00 0.00 ? 94  TYR A HE2  2  
ATOM 3065  H HH   . TYR A 1 94  ? 1.367   -0.401  -9.893  1.00 0.00 ? 94  TYR A HH   2  
ATOM 3066  N N    . ARG A 1 95  ? -5.408  -5.537  -7.572  1.00 0.00 ? 95  ARG A N    2  
ATOM 3067  C CA   . ARG A 1 95  ? -6.213  -6.665  -7.117  1.00 0.00 ? 95  ARG A CA   2  
ATOM 3068  C C    . ARG A 1 95  ? -5.356  -7.917  -6.961  1.00 0.00 ? 95  ARG A C    2  
ATOM 3069  O O    . ARG A 1 95  ? -4.795  -8.423  -7.932  1.00 0.00 ? 95  ARG A O    2  
ATOM 3070  C CB   . ARG A 1 95  ? -7.353  -6.934  -8.101  1.00 0.00 ? 95  ARG A CB   2  
ATOM 3071  C CG   . ARG A 1 95  ? -8.600  -7.506  -7.447  1.00 0.00 ? 95  ARG A CG   2  
ATOM 3072  C CD   . ARG A 1 95  ? -8.573  -9.026  -7.431  1.00 0.00 ? 95  ARG A CD   2  
ATOM 3073  N NE   . ARG A 1 95  ? -9.596  -9.583  -6.549  1.00 0.00 ? 95  ARG A NE   2  
ATOM 3074  C CZ   . ARG A 1 95  ? -9.816  -10.885 -6.409  1.00 0.00 ? 95  ARG A CZ   2  
ATOM 3075  N NH1  . ARG A 1 95  ? -9.088  -11.761 -7.089  1.00 0.00 ? 95  ARG A NH1  2  
ATOM 3076  N NH2  . ARG A 1 95  ? -10.765 -11.315 -5.587  1.00 0.00 ? 95  ARG A NH2  2  
ATOM 3077  H H    . ARG A 1 95  ? -4.905  -5.616  -8.409  1.00 0.00 ? 95  ARG A H    2  
ATOM 3078  H HA   . ARG A 1 95  ? -6.632  -6.407  -6.156  1.00 0.00 ? 95  ARG A HA   2  
ATOM 3079  H HB2  . ARG A 1 95  ? -7.622  -6.006  -8.586  1.00 0.00 ? 95  ARG A HB2  2  
ATOM 3080  H HB3  . ARG A 1 95  ? -7.011  -7.635  -8.847  1.00 0.00 ? 95  ARG A HB3  2  
ATOM 3081  H HG2  . ARG A 1 95  ? -8.659  -7.148  -6.430  1.00 0.00 ? 95  ARG A HG2  2  
ATOM 3082  H HG3  . ARG A 1 95  ? -9.468  -7.176  -7.997  1.00 0.00 ? 95  ARG A HG3  2  
ATOM 3083  H HD2  . ARG A 1 95  ? -8.742  -9.387  -8.434  1.00 0.00 ? 95  ARG A HD2  2  
ATOM 3084  H HD3  . ARG A 1 95  ? -7.601  -9.352  -7.090  1.00 0.00 ? 95  ARG A HD3  2  
ATOM 3085  H HE   . ARG A 1 95  ? -10.145 -8.954  -6.037  1.00 0.00 ? 95  ARG A HE   2  
ATOM 3086  H HH11 . ARG A 1 95  ? -8.372  -11.440 -7.708  1.00 0.00 ? 95  ARG A HH11 2  
ATOM 3087  H HH12 . ARG A 1 95  ? -9.255  -12.741 -6.981  1.00 0.00 ? 95  ARG A HH12 2  
ATOM 3088  H HH21 . ARG A 1 95  ? -11.315 -10.658 -5.073  1.00 0.00 ? 95  ARG A HH21 2  
ATOM 3089  H HH22 . ARG A 1 95  ? -10.930 -12.295 -5.483  1.00 0.00 ? 95  ARG A HH22 2  
ATOM 3090  N N    . GLY A 1 96  ? -5.259  -8.412  -5.731  1.00 0.00 ? 96  GLY A N    2  
ATOM 3091  C CA   . GLY A 1 96  ? -4.468  -9.600  -5.469  1.00 0.00 ? 96  GLY A CA   2  
ATOM 3092  C C    . GLY A 1 96  ? -4.644  -10.114 -4.054  1.00 0.00 ? 96  GLY A C    2  
ATOM 3093  O O    . GLY A 1 96  ? -5.728  -10.012 -3.479  1.00 0.00 ? 96  GLY A O    2  
ATOM 3094  H H    . GLY A 1 96  ? -5.728  -7.966  -4.994  1.00 0.00 ? 96  GLY A H    2  
ATOM 3095  H HA2  . GLY A 1 96  ? -4.762  -10.375 -6.162  1.00 0.00 ? 96  GLY A HA2  2  
ATOM 3096  H HA3  . GLY A 1 96  ? -3.425  -9.367  -5.628  1.00 0.00 ? 96  GLY A HA3  2  
ATOM 3097  N N    . TYR A 1 97  ? -3.576  -10.669 -3.491  1.00 0.00 ? 97  TYR A N    2  
ATOM 3098  C CA   . TYR A 1 97  ? -3.619  -11.205 -2.136  1.00 0.00 ? 97  TYR A CA   2  
ATOM 3099  C C    . TYR A 1 97  ? -2.219  -11.272 -1.533  1.00 0.00 ? 97  TYR A C    2  
ATOM 3100  O O    . TYR A 1 97  ? -1.218  -11.192 -2.246  1.00 0.00 ? 97  TYR A O    2  
ATOM 3101  C CB   . TYR A 1 97  ? -4.254  -12.597 -2.135  1.00 0.00 ? 97  TYR A CB   2  
ATOM 3102  C CG   . TYR A 1 97  ? -3.519  -13.599 -2.996  1.00 0.00 ? 97  TYR A CG   2  
ATOM 3103  C CD1  . TYR A 1 97  ? -2.294  -14.121 -2.597  1.00 0.00 ? 97  TYR A CD1  2  
ATOM 3104  C CD2  . TYR A 1 97  ? -4.047  -14.023 -4.208  1.00 0.00 ? 97  TYR A CD2  2  
ATOM 3105  C CE1  . TYR A 1 97  ? -1.618  -15.036 -3.380  1.00 0.00 ? 97  TYR A CE1  2  
ATOM 3106  C CE2  . TYR A 1 97  ? -3.379  -14.939 -4.998  1.00 0.00 ? 97  TYR A CE2  2  
ATOM 3107  C CZ   . TYR A 1 97  ? -2.165  -15.442 -4.580  1.00 0.00 ? 97  TYR A CZ   2  
ATOM 3108  O OH   . TYR A 1 97  ? -1.496  -16.354 -5.364  1.00 0.00 ? 97  TYR A OH   2  
ATOM 3109  H H    . TYR A 1 97  ? -2.740  -10.722 -4.000  1.00 0.00 ? 97  TYR A H    2  
ATOM 3110  H HA   . TYR A 1 97  ? -4.226  -10.543 -1.536  1.00 0.00 ? 97  TYR A HA   2  
ATOM 3111  H HB2  . TYR A 1 97  ? -4.270  -12.977 -1.125  1.00 0.00 ? 97  TYR A HB2  2  
ATOM 3112  H HB3  . TYR A 1 97  ? -5.267  -12.523 -2.503  1.00 0.00 ? 97  TYR A HB3  2  
ATOM 3113  H HD1  . TYR A 1 97  ? -1.868  -13.801 -1.657  1.00 0.00 ? 97  TYR A HD1  2  
ATOM 3114  H HD2  . TYR A 1 97  ? -4.998  -13.626 -4.533  1.00 0.00 ? 97  TYR A HD2  2  
ATOM 3115  H HE1  . TYR A 1 97  ? -0.668  -15.431 -3.053  1.00 0.00 ? 97  TYR A HE1  2  
ATOM 3116  H HE2  . TYR A 1 97  ? -3.807  -15.257 -5.937  1.00 0.00 ? 97  TYR A HE2  2  
ATOM 3117  H HH   . TYR A 1 97  ? -1.061  -15.895 -6.087  1.00 0.00 ? 97  TYR A HH   2  
ATOM 3118  N N    . LEU A 1 98  ? -2.157  -11.420 -0.214  1.00 0.00 ? 98  LEU A N    2  
ATOM 3119  C CA   . LEU A 1 98  ? -0.881  -11.499 0.488   1.00 0.00 ? 98  LEU A CA   2  
ATOM 3120  C C    . LEU A 1 98  ? -0.199  -12.839 0.229   1.00 0.00 ? 98  LEU A C    2  
ATOM 3121  O O    . LEU A 1 98  ? -0.688  -13.887 0.651   1.00 0.00 ? 98  LEU A O    2  
ATOM 3122  C CB   . LEU A 1 98  ? -1.089  -11.302 1.990   1.00 0.00 ? 98  LEU A CB   2  
ATOM 3123  C CG   . LEU A 1 98  ? 0.174   -11.064 2.818   1.00 0.00 ? 98  LEU A CG   2  
ATOM 3124  C CD1  . LEU A 1 98  ? 1.126   -10.132 2.083   1.00 0.00 ? 98  LEU A CD1  2  
ATOM 3125  C CD2  . LEU A 1 98  ? -0.182  -10.497 4.184   1.00 0.00 ? 98  LEU A CD2  2  
ATOM 3126  H H    . LEU A 1 98  ? -2.988  -11.478 0.301   1.00 0.00 ? 98  LEU A H    2  
ATOM 3127  H HA   . LEU A 1 98  ? -0.247  -10.709 0.114   1.00 0.00 ? 98  LEU A HA   2  
ATOM 3128  H HB2  . LEU A 1 98  ? -1.738  -10.450 2.125   1.00 0.00 ? 98  LEU A HB2  2  
ATOM 3129  H HB3  . LEU A 1 98  ? -1.576  -12.187 2.375   1.00 0.00 ? 98  LEU A HB3  2  
ATOM 3130  H HG   . LEU A 1 98  ? 0.682   -12.007 2.968   1.00 0.00 ? 98  LEU A HG   2  
ATOM 3131  H HD11 . LEU A 1 98  ? 1.914   -9.822  2.752   1.00 0.00 ? 98  LEU A HD11 2  
ATOM 3132  H HD12 . LEU A 1 98  ? 0.584   -9.264  1.739   1.00 0.00 ? 98  LEU A HD12 2  
ATOM 3133  H HD13 . LEU A 1 98  ? 1.553   -10.649 1.237   1.00 0.00 ? 98  LEU A HD13 2  
ATOM 3134  H HD21 . LEU A 1 98  ? 0.524   -9.723  4.448   1.00 0.00 ? 98  LEU A HD21 2  
ATOM 3135  H HD22 . LEU A 1 98  ? -0.145  -11.285 4.921   1.00 0.00 ? 98  LEU A HD22 2  
ATOM 3136  H HD23 . LEU A 1 98  ? -1.179  -10.080 4.152   1.00 0.00 ? 98  LEU A HD23 2  
ATOM 3137  N N    . ILE A 1 99  ? 0.933   -12.797 -0.465  1.00 0.00 ? 99  ILE A N    2  
ATOM 3138  C CA   . ILE A 1 99  ? 1.684   -14.007 -0.776  1.00 0.00 ? 99  ILE A CA   2  
ATOM 3139  C C    . ILE A 1 99  ? 2.123   -14.724 0.496   1.00 0.00 ? 99  ILE A C    2  
ATOM 3140  O O    . ILE A 1 99  ? 2.008   -15.945 0.606   1.00 0.00 ? 99  ILE A O    2  
ATOM 3141  C CB   . ILE A 1 99  ? 2.926   -13.695 -1.632  1.00 0.00 ? 99  ILE A CB   2  
ATOM 3142  C CG1  . ILE A 1 99  ? 2.517   -12.978 -2.920  1.00 0.00 ? 99  ILE A CG1  2  
ATOM 3143  C CG2  . ILE A 1 99  ? 3.686   -14.974 -1.948  1.00 0.00 ? 99  ILE A CG2  2  
ATOM 3144  C CD1  . ILE A 1 99  ? 3.675   -12.322 -3.640  1.00 0.00 ? 99  ILE A CD1  2  
ATOM 3145  H H    . ILE A 1 99  ? 1.273   -11.931 -0.774  1.00 0.00 ? 99  ILE A H    2  
ATOM 3146  H HA   . ILE A 1 99  ? 1.037   -14.663 -1.341  1.00 0.00 ? 99  ILE A HA   2  
ATOM 3147  H HB   . ILE A 1 99  ? 3.576   -13.050 -1.060  1.00 0.00 ? 99  ILE A HB   2  
ATOM 3148  H HG12 . ILE A 1 99  ? 2.069   -13.691 -3.595  1.00 0.00 ? 99  ILE A HG12 2  
ATOM 3149  H HG13 . ILE A 1 99  ? 1.795   -12.210 -2.683  1.00 0.00 ? 99  ILE A HG13 2  
ATOM 3150  H HG21 . ILE A 1 99  ? 4.425   -15.153 -1.182  1.00 0.00 ? 99  ILE A HG21 2  
ATOM 3151  H HG22 . ILE A 1 99  ? 2.995   -15.804 -1.981  1.00 0.00 ? 99  ILE A HG22 2  
ATOM 3152  H HG23 . ILE A 1 99  ? 4.176   -14.875 -2.905  1.00 0.00 ? 99  ILE A HG23 2  
ATOM 3153  H HD11 . ILE A 1 99  ? 4.568   -12.915 -3.499  1.00 0.00 ? 99  ILE A HD11 2  
ATOM 3154  H HD12 . ILE A 1 99  ? 3.452   -12.254 -4.694  1.00 0.00 ? 99  ILE A HD12 2  
ATOM 3155  H HD13 . ILE A 1 99  ? 3.834   -11.333 -3.239  1.00 0.00 ? 99  ILE A HD13 2  
ATOM 3156  N N    . LYS A 1 100 ? 2.627   -13.957 1.457   1.00 0.00 ? 100 LYS A N    2  
ATOM 3157  C CA   . LYS A 1 100 ? 3.081   -14.517 2.724   1.00 0.00 ? 100 LYS A CA   2  
ATOM 3158  C C    . LYS A 1 100 ? 1.919   -15.137 3.493   1.00 0.00 ? 100 LYS A C    2  
ATOM 3159  O O    . LYS A 1 100 ? 2.121   -15.825 4.495   1.00 0.00 ? 100 LYS A O    2  
ATOM 3160  C CB   . LYS A 1 100 ? 3.748   -13.433 3.574   1.00 0.00 ? 100 LYS A CB   2  
ATOM 3161  C CG   . LYS A 1 100 ? 2.768   -12.435 4.167   1.00 0.00 ? 100 LYS A CG   2  
ATOM 3162  C CD   . LYS A 1 100 ? 3.273   -11.874 5.485   1.00 0.00 ? 100 LYS A CD   2  
ATOM 3163  C CE   . LYS A 1 100 ? 2.123   -11.457 6.390   1.00 0.00 ? 100 LYS A CE   2  
ATOM 3164  N NZ   . LYS A 1 100 ? 2.515   -11.470 7.827   1.00 0.00 ? 100 LYS A NZ   2  
ATOM 3165  H H    . LYS A 1 100 ? 2.693   -12.989 1.310   1.00 0.00 ? 100 LYS A H    2  
ATOM 3166  H HA   . LYS A 1 100 ? 3.805   -15.287 2.506   1.00 0.00 ? 100 LYS A HA   2  
ATOM 3167  H HB2  . LYS A 1 100 ? 4.283   -13.906 4.384   1.00 0.00 ? 100 LYS A HB2  2  
ATOM 3168  H HB3  . LYS A 1 100 ? 4.452   -12.891 2.958   1.00 0.00 ? 100 LYS A HB3  2  
ATOM 3169  H HG2  . LYS A 1 100 ? 2.630   -11.622 3.470   1.00 0.00 ? 100 LYS A HG2  2  
ATOM 3170  H HG3  . LYS A 1 100 ? 1.822   -12.931 4.336   1.00 0.00 ? 100 LYS A HG3  2  
ATOM 3171  H HD2  . LYS A 1 100 ? 3.856   -12.630 5.989   1.00 0.00 ? 100 LYS A HD2  2  
ATOM 3172  H HD3  . LYS A 1 100 ? 3.893   -11.011 5.285   1.00 0.00 ? 100 LYS A HD3  2  
ATOM 3173  H HE2  . LYS A 1 100 ? 1.814   -10.459 6.120   1.00 0.00 ? 100 LYS A HE2  2  
ATOM 3174  H HE3  . LYS A 1 100 ? 1.301   -12.141 6.243   1.00 0.00 ? 100 LYS A HE3  2  
ATOM 3175  H HZ1  . LYS A 1 100 ? 3.263   -12.175 7.987   1.00 0.00 ? 100 LYS A HZ1  2  
ATOM 3176  H HZ2  . LYS A 1 100 ? 1.694   -11.711 8.418   1.00 0.00 ? 100 LYS A HZ2  2  
ATOM 3177  H HZ3  . LYS A 1 100 ? 2.870   -10.535 8.109   1.00 0.00 ? 100 LYS A HZ3  2  
ATOM 3178  N N    . HIS A 1 101 ? 0.703   -14.891 3.018   1.00 0.00 ? 101 HIS A N    2  
ATOM 3179  C CA   . HIS A 1 101 ? -0.492  -15.428 3.660   1.00 0.00 ? 101 HIS A CA   2  
ATOM 3180  C C    . HIS A 1 101 ? -1.690  -15.366 2.717   1.00 0.00 ? 101 HIS A C    2  
ATOM 3181  O O    . HIS A 1 101 ? -2.227  -14.292 2.448   1.00 0.00 ? 101 HIS A O    2  
ATOM 3182  C CB   . HIS A 1 101 ? -0.798  -14.655 4.943   1.00 0.00 ? 101 HIS A CB   2  
ATOM 3183  C CG   . HIS A 1 101 ? -0.063  -15.170 6.142   1.00 0.00 ? 101 HIS A CG   2  
ATOM 3184  N ND1  . HIS A 1 101 ? -0.561  -16.161 6.962   1.00 0.00 ? 101 HIS A ND1  2  
ATOM 3185  C CD2  . HIS A 1 101 ? 1.140   -14.827 6.658   1.00 0.00 ? 101 HIS A CD2  2  
ATOM 3186  C CE1  . HIS A 1 101 ? 0.304   -16.404 7.930   1.00 0.00 ? 101 HIS A CE1  2  
ATOM 3187  N NE2  . HIS A 1 101 ? 1.345   -15.608 7.769   1.00 0.00 ? 101 HIS A NE2  2  
ATOM 3188  H H    . HIS A 1 101 ? 0.606   -14.336 2.216   1.00 0.00 ? 101 HIS A H    2  
ATOM 3189  H HA   . HIS A 1 101 ? -0.299  -16.460 3.909   1.00 0.00 ? 101 HIS A HA   2  
ATOM 3190  H HB2  . HIS A 1 101 ? -0.523  -13.619 4.806   1.00 0.00 ? 101 HIS A HB2  2  
ATOM 3191  H HB3  . HIS A 1 101 ? -1.857  -14.717 5.150   1.00 0.00 ? 101 HIS A HB3  2  
ATOM 3192  H HD1  . HIS A 1 101 ? -1.421  -16.617 6.850   1.00 0.00 ? 101 HIS A HD1  2  
ATOM 3193  H HD2  . HIS A 1 101 ? 1.815   -14.077 6.269   1.00 0.00 ? 101 HIS A HD2  2  
ATOM 3194  H HE1  . HIS A 1 101 ? 0.181   -17.130 8.720   1.00 0.00 ? 101 HIS A HE1  2  
ATOM 3195  H HE2  . HIS A 1 101 ? 2.092   -15.522 8.397   1.00 0.00 ? 101 HIS A HE2  2  
ATOM 3196  N N    . LYS A 1 102 ? -2.103  -16.526 2.217   1.00 0.00 ? 102 LYS A N    2  
ATOM 3197  C CA   . LYS A 1 102 ? -3.238  -16.605 1.305   1.00 0.00 ? 102 LYS A CA   2  
ATOM 3198  C C    . LYS A 1 102 ? -4.553  -16.660 2.075   1.00 0.00 ? 102 LYS A C    2  
ATOM 3199  O O    . LYS A 1 102 ? -5.537  -17.227 1.602   1.00 0.00 ? 102 LYS A O    2  
ATOM 3200  C CB   . LYS A 1 102 ? -3.110  -17.837 0.405   1.00 0.00 ? 102 LYS A CB   2  
ATOM 3201  C CG   . LYS A 1 102 ? -2.039  -17.701 -0.664  1.00 0.00 ? 102 LYS A CG   2  
ATOM 3202  C CD   . LYS A 1 102 ? -2.326  -18.597 -1.857  1.00 0.00 ? 102 LYS A CD   2  
ATOM 3203  C CE   . LYS A 1 102 ? -1.042  -19.038 -2.544  1.00 0.00 ? 102 LYS A CE   2  
ATOM 3204  N NZ   . LYS A 1 102 ? -0.220  -17.876 -2.981  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 3205  H H    . LYS A 1 102 ? -1.634  -17.349 2.469   1.00 0.00 ? 102 LYS A H    2  
ATOM 3206  H HA   . LYS A 1 102 ? -3.231  -15.718 0.689   1.00 0.00 ? 102 LYS A HA   2  
ATOM 3207  H HB2  . LYS A 1 102 ? -2.870  -18.693 1.019   1.00 0.00 ? 102 LYS A HB2  2  
ATOM 3208  H HB3  . LYS A 1 102 ? -4.058  -18.010 -0.084  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 3209  H HG2  . LYS A 1 102 ? -2.005  -16.675 -0.998  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 3210  H HG3  . LYS A 1 102 ? -1.084  -17.976 -0.240  1.00 0.00 ? 102 LYS A HG3  2  
ATOM 3211  H HD2  . LYS A 1 102 ? -2.859  -19.473 -1.518  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 3212  H HD3  . LYS A 1 102 ? -2.935  -18.054 -2.565  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 3213  H HE2  . LYS A 1 102 ? -0.467  -19.636 -1.854  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 3214  H HE3  . LYS A 1 102 ? -1.298  -19.632 -3.408  1.00 0.00 ? 102 LYS A HE3  2  
ATOM 3215  H HZ1  . LYS A 1 102 ? -0.645  -17.432 -3.820  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 3216  H HZ2  . LYS A 1 102 ? 0.744   -18.189 -3.217  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 3217  H HZ3  . LYS A 1 102 ? -0.166  -17.170 -2.219  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 3218  N N    . MET A 1 103 ? -4.562  -16.065 3.264   1.00 0.00 ? 103 MET A N    2  
ATOM 3219  C CA   . MET A 1 103 ? -5.758  -16.044 4.098   1.00 0.00 ? 103 MET A CA   2  
ATOM 3220  C C    . MET A 1 103 ? -6.432  -14.676 4.048   1.00 0.00 ? 103 MET A C    2  
ATOM 3221  O O    . MET A 1 103 ? -7.488  -14.470 4.648   1.00 0.00 ? 103 MET A O    2  
ATOM 3222  C CB   . MET A 1 103 ? -5.404  -16.398 5.543   1.00 0.00 ? 103 MET A CB   2  
ATOM 3223  C CG   . MET A 1 103 ? -5.247  -17.891 5.782   1.00 0.00 ? 103 MET A CG   2  
ATOM 3224  S SD   . MET A 1 103 ? -5.556  -18.357 7.496   1.00 0.00 ? 103 MET A SD   2  
ATOM 3225  C CE   . MET A 1 103 ? -4.303  -17.394 8.339   1.00 0.00 ? 103 MET A CE   2  
ATOM 3226  H H    . MET A 1 103 ? -3.747  -15.629 3.587   1.00 0.00 ? 103 MET A H    2  
ATOM 3227  H HA   . MET A 1 103 ? -6.444  -16.784 3.712   1.00 0.00 ? 103 MET A HA   2  
ATOM 3228  H HB2  . MET A 1 103 ? -4.475  -15.914 5.803   1.00 0.00 ? 103 MET A HB2  2  
ATOM 3229  H HB3  . MET A 1 103 ? -6.185  -16.032 6.193   1.00 0.00 ? 103 MET A HB3  2  
ATOM 3230  H HG2  . MET A 1 103 ? -5.946  -18.419 5.149   1.00 0.00 ? 103 MET A HG2  2  
ATOM 3231  H HG3  . MET A 1 103 ? -4.240  -18.179 5.520   1.00 0.00 ? 103 MET A HG3  2  
ATOM 3232  H HE1  . MET A 1 103 ? -4.777  -16.734 9.052   1.00 0.00 ? 103 MET A HE1  2  
ATOM 3233  H HE2  . MET A 1 103 ? -3.626  -18.057 8.857   1.00 0.00 ? 103 MET A HE2  2  
ATOM 3234  H HE3  . MET A 1 103 ? -3.753  -16.809 7.617   1.00 0.00 ? 103 MET A HE3  2  
ATOM 3235  N N    . LEU A 1 104 ? -5.816  -13.744 3.329   1.00 0.00 ? 104 LEU A N    2  
ATOM 3236  C CA   . LEU A 1 104 ? -6.356  -12.395 3.201   1.00 0.00 ? 104 LEU A CA   2  
ATOM 3237  C C    . LEU A 1 104 ? -6.298  -11.920 1.752   1.00 0.00 ? 104 LEU A C    2  
ATOM 3238  O O    . LEU A 1 104 ? -5.218  -11.783 1.179   1.00 0.00 ? 104 LEU A O    2  
ATOM 3239  C CB   . LEU A 1 104 ? -5.584  -11.428 4.099   1.00 0.00 ? 104 LEU A CB   2  
ATOM 3240  C CG   . LEU A 1 104 ? -5.138  -11.980 5.453   1.00 0.00 ? 104 LEU A CG   2  
ATOM 3241  C CD1  . LEU A 1 104 ? -3.847  -12.771 5.308   1.00 0.00 ? 104 LEU A CD1  2  
ATOM 3242  C CD2  . LEU A 1 104 ? -4.963  -10.850 6.458   1.00 0.00 ? 104 LEU A CD2  2  
ATOM 3243  H H    . LEU A 1 104 ? -4.978  -13.967 2.873   1.00 0.00 ? 104 LEU A H    2  
ATOM 3244  H HA   . LEU A 1 104 ? -7.389  -12.420 3.517   1.00 0.00 ? 104 LEU A HA   2  
ATOM 3245  H HB2  . LEU A 1 104 ? -4.701  -11.113 3.563   1.00 0.00 ? 104 LEU A HB2  2  
ATOM 3246  H HB3  . LEU A 1 104 ? -6.216  -10.571 4.282   1.00 0.00 ? 104 LEU A HB3  2  
ATOM 3247  H HG   . LEU A 1 104 ? -5.898  -12.649 5.830   1.00 0.00 ? 104 LEU A HG   2  
ATOM 3248  H HD11 . LEU A 1 104 ? -4.032  -13.657 4.720   1.00 0.00 ? 104 LEU A HD11 2  
ATOM 3249  H HD12 . LEU A 1 104 ? -3.488  -13.056 6.286   1.00 0.00 ? 104 LEU A HD12 2  
ATOM 3250  H HD13 . LEU A 1 104 ? -3.104  -12.160 4.816   1.00 0.00 ? 104 LEU A HD13 2  
ATOM 3251  H HD21 . LEU A 1 104 ? -5.747  -10.120 6.319   1.00 0.00 ? 104 LEU A HD21 2  
ATOM 3252  H HD22 . LEU A 1 104 ? -4.002  -10.381 6.308   1.00 0.00 ? 104 LEU A HD22 2  
ATOM 3253  H HD23 . LEU A 1 104 ? -5.016  -11.250 7.461   1.00 0.00 ? 104 LEU A HD23 2  
ATOM 3254  N N    . GLN A 1 105 ? -7.465  -11.669 1.169   1.00 0.00 ? 105 GLN A N    2  
ATOM 3255  C CA   . GLN A 1 105 ? -7.545  -11.208 -0.211  1.00 0.00 ? 105 GLN A CA   2  
ATOM 3256  C C    . GLN A 1 105 ? -8.360  -9.922  -0.309  1.00 0.00 ? 105 GLN A C    2  
ATOM 3257  O O    . GLN A 1 105 ? -9.263  -9.685  0.492   1.00 0.00 ? 105 GLN A O    2  
ATOM 3258  C CB   . GLN A 1 105 ? -8.168  -12.289 -1.097  1.00 0.00 ? 105 GLN A CB   2  
ATOM 3259  C CG   . GLN A 1 105 ? -7.647  -13.687 -0.807  1.00 0.00 ? 105 GLN A CG   2  
ATOM 3260  C CD   . GLN A 1 105 ? -8.483  -14.769 -1.462  1.00 0.00 ? 105 GLN A CD   2  
ATOM 3261  O OE1  . GLN A 1 105 ? -9.093  -15.595 -0.782  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3262  N NE2  . GLN A 1 105 ? -8.517  -14.769 -2.789  1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3263  H H    . GLN A 1 105 ? -8.291  -11.798 1.679   1.00 0.00 ? 105 GLN A H    2  
ATOM 3264  H HA   . GLN A 1 105 ? -6.541  -11.010 -0.553  1.00 0.00 ? 105 GLN A HA   2  
ATOM 3265  H HB2  . GLN A 1 105 ? -9.237  -12.288 -0.948  1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3266  H HB3  . GLN A 1 105 ? -7.956  -12.056 -2.130  1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3267  H HG2  . GLN A 1 105 ? -6.635  -13.764 -1.176  1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3268  H HG3  . GLN A 1 105 ? -7.653  -13.845 0.261   1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3269  H HE21 . GLN A 1 105 ? -8.006  -14.081 -3.265  1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3270  H HE22 . GLN A 1 105 ? -9.049  -15.457 -3.239  1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3271  N N    . GLY A 1 106 ? -8.034  -9.095  -1.298  1.00 0.00 ? 106 GLY A N    2  
ATOM 3272  C CA   . GLY A 1 106 ? -8.745  -7.843  -1.482  1.00 0.00 ? 106 GLY A CA   2  
ATOM 3273  C C    . GLY A 1 106 ? -8.048  -6.919  -2.461  1.00 0.00 ? 106 GLY A C    2  
ATOM 3274  O O    . GLY A 1 106 ? -7.415  -7.377  -3.413  1.00 0.00 ? 106 GLY A O    2  
ATOM 3275  H H    . GLY A 1 106 ? -7.305  -9.336  -1.907  1.00 0.00 ? 106 GLY A H    2  
ATOM 3276  H HA2  . GLY A 1 106 ? -9.738  -8.056  -1.848  1.00 0.00 ? 106 GLY A HA2  2  
ATOM 3277  H HA3  . GLY A 1 106 ? -8.824  -7.343  -0.528  1.00 0.00 ? 106 GLY A HA3  2  
ATOM 3278  N N    . ILE A 1 107 ? -8.166  -5.616  -2.229  1.00 0.00 ? 107 ILE A N    2  
ATOM 3279  C CA   . ILE A 1 107 ? -7.542  -4.626  -3.099  1.00 0.00 ? 107 ILE A CA   2  
ATOM 3280  C C    . ILE A 1 107 ? -6.781  -3.584  -2.288  1.00 0.00 ? 107 ILE A C    2  
ATOM 3281  O O    . ILE A 1 107 ? -6.919  -3.509  -1.067  1.00 0.00 ? 107 ILE A O    2  
ATOM 3282  C CB   . ILE A 1 107 ? -8.586  -3.914  -3.979  1.00 0.00 ? 107 ILE A CB   2  
ATOM 3283  C CG1  . ILE A 1 107 ? -9.790  -3.488  -3.137  1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3284  C CG2  . ILE A 1 107 ? -9.024  -4.820  -5.120  1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3285  C CD1  . ILE A 1 107 ? -10.667 -2.458  -3.814  1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3286  H H    . ILE A 1 107 ? -8.683  -5.313  -1.454  1.00 0.00 ? 107 ILE A H    2  
ATOM 3287  H HA   . ILE A 1 107 ? -6.847  -5.142  -3.746  1.00 0.00 ? 107 ILE A HA   2  
ATOM 3288  H HB   . ILE A 1 107 ? -8.125  -3.036  -4.405  1.00 0.00 ? 107 ILE A HB   2  
ATOM 3289  H HG12 . ILE A 1 107 ? -10.399 -4.354  -2.927  1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3290  H HG13 . ILE A 1 107 ? -9.438  -3.066  -2.207  1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3291  H HG21 . ILE A 1 107 ? -9.222  -4.222  -5.998  1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3292  H HG22 . ILE A 1 107 ? -8.239  -5.528  -5.338  1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3293  H HG23 . ILE A 1 107 ? -9.920  -5.350  -4.836  1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3294  H HD11 . ILE A 1 107 ? -10.140 -2.034  -4.657  1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3295  H HD12 . ILE A 1 107 ? -11.576 -2.928  -4.159  1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3296  H HD13 . ILE A 1 107 ? -10.910 -1.674  -3.112  1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3297  N N    . PHE A 1 108 ? -5.977  -2.779  -2.975  1.00 0.00 ? 108 PHE A N    2  
ATOM 3298  C CA   . PHE A 1 108 ? -5.193  -1.739  -2.319  1.00 0.00 ? 108 PHE A CA   2  
ATOM 3299  C C    . PHE A 1 108 ? -4.754  -0.676  -3.320  1.00 0.00 ? 108 PHE A C    2  
ATOM 3300  O O    . PHE A 1 108 ? -4.750  -0.892  -4.533  1.00 0.00 ? 108 PHE A O    2  
ATOM 3301  C CB   . PHE A 1 108 ? -3.967  -2.350  -1.635  1.00 0.00 ? 108 PHE A CB   2  
ATOM 3302  C CG   . PHE A 1 108 ? -3.460  -3.591  -2.312  1.00 0.00 ? 108 PHE A CG   2  
ATOM 3303  C CD1  . PHE A 1 108 ? -2.610  -3.503  -3.403  1.00 0.00 ? 108 PHE A CD1  2  
ATOM 3304  C CD2  . PHE A 1 108 ? -3.833  -4.845  -1.857  1.00 0.00 ? 108 PHE A CD2  2  
ATOM 3305  C CE1  . PHE A 1 108 ? -2.141  -4.644  -4.028  1.00 0.00 ? 108 PHE A CE1  2  
ATOM 3306  C CE2  . PHE A 1 108 ? -3.366  -5.989  -2.477  1.00 0.00 ? 108 PHE A CE2  2  
ATOM 3307  C CZ   . PHE A 1 108 ? -2.521  -5.888  -3.564  1.00 0.00 ? 108 PHE A CZ   2  
ATOM 3308  H H    . PHE A 1 108 ? -5.908  -2.888  -3.947  1.00 0.00 ? 108 PHE A H    2  
ATOM 3309  H HA   . PHE A 1 108 ? -5.818  -1.277  -1.571  1.00 0.00 ? 108 PHE A HA   2  
ATOM 3310  H HB2  . PHE A 1 108 ? -3.168  -1.624  -1.632  1.00 0.00 ? 108 PHE A HB2  2  
ATOM 3311  H HB3  . PHE A 1 108 ? -4.221  -2.605  -0.618  1.00 0.00 ? 108 PHE A HB3  2  
ATOM 3312  H HD1  . PHE A 1 108 ? -2.313  -2.530  -3.766  1.00 0.00 ? 108 PHE A HD1  2  
ATOM 3313  H HD2  . PHE A 1 108 ? -4.495  -4.926  -1.007  1.00 0.00 ? 108 PHE A HD2  2  
ATOM 3314  H HE1  . PHE A 1 108 ? -1.480  -4.561  -4.877  1.00 0.00 ? 108 PHE A HE1  2  
ATOM 3315  H HE2  . PHE A 1 108 ? -3.665  -6.961  -2.113  1.00 0.00 ? 108 PHE A HE2  2  
ATOM 3316  H HZ   . PHE A 1 108 ? -2.155  -6.780  -4.050  1.00 0.00 ? 108 PHE A HZ   2  
ATOM 3317  N N    . PRO A 1 109 ? -4.374  0.503   -2.804  1.00 0.00 ? 109 PRO A N    2  
ATOM 3318  C CA   . PRO A 1 109 ? -3.926  1.624   -3.634  1.00 0.00 ? 109 PRO A CA   2  
ATOM 3319  C C    . PRO A 1 109 ? -2.571  1.361   -4.282  1.00 0.00 ? 109 PRO A C    2  
ATOM 3320  O O    . PRO A 1 109 ? -1.643  0.878   -3.631  1.00 0.00 ? 109 PRO A O    2  
ATOM 3321  C CB   . PRO A 1 109 ? -3.828  2.784   -2.641  1.00 0.00 ? 109 PRO A CB   2  
ATOM 3322  C CG   . PRO A 1 109 ? -3.605  2.134   -1.319  1.00 0.00 ? 109 PRO A CG   2  
ATOM 3323  C CD   . PRO A 1 109 ? -4.353  0.830   -1.368  1.00 0.00 ? 109 PRO A CD   2  
ATOM 3324  H HA   . PRO A 1 109 ? -4.649  1.864   -4.400  1.00 0.00 ? 109 PRO A HA   2  
ATOM 3325  H HB2  . PRO A 1 109 ? -3.000  3.424   -2.912  1.00 0.00 ? 109 PRO A HB2  2  
ATOM 3326  H HB3  . PRO A 1 109 ? -4.746  3.351   -2.651  1.00 0.00 ? 109 PRO A HB3  2  
ATOM 3327  H HG2  . PRO A 1 109 ? -2.551  1.956   -1.171  1.00 0.00 ? 109 PRO A HG2  2  
ATOM 3328  H HG3  . PRO A 1 109 ? -3.996  2.760   -0.531  1.00 0.00 ? 109 PRO A HG3  2  
ATOM 3329  H HD2  . PRO A 1 109 ? -3.827  0.072   -0.807  1.00 0.00 ? 109 PRO A HD2  2  
ATOM 3330  H HD3  . PRO A 1 109 ? -5.356  0.956   -0.987  1.00 0.00 ? 109 PRO A HD3  2  
ATOM 3331  N N    . LYS A 1 110 ? -2.462  1.681   -5.567  1.00 0.00 ? 110 LYS A N    2  
ATOM 3332  C CA   . LYS A 1 110 ? -1.220  1.481   -6.303  1.00 0.00 ? 110 LYS A CA   2  
ATOM 3333  C C    . LYS A 1 110 ? -0.104  2.352   -5.734  1.00 0.00 ? 110 LYS A C    2  
ATOM 3334  O O    . LYS A 1 110 ? 1.067   1.974   -5.764  1.00 0.00 ? 110 LYS A O    2  
ATOM 3335  C CB   . LYS A 1 110 ? -1.425  1.799   -7.786  1.00 0.00 ? 110 LYS A CB   2  
ATOM 3336  C CG   . LYS A 1 110 ? -2.840  1.542   -8.273  1.00 0.00 ? 110 LYS A CG   2  
ATOM 3337  C CD   . LYS A 1 110 ? -2.859  1.121   -9.734  1.00 0.00 ? 110 LYS A CD   2  
ATOM 3338  C CE   . LYS A 1 110 ? -2.140  2.132   -10.614 1.00 0.00 ? 110 LYS A CE   2  
ATOM 3339  N NZ   . LYS A 1 110 ? -3.071  3.168   -11.141 1.00 0.00 ? 110 LYS A NZ   2  
ATOM 3340  H H    . LYS A 1 110 ? -3.237  2.062   -6.032  1.00 0.00 ? 110 LYS A H    2  
ATOM 3341  H HA   . LYS A 1 110 ? -0.937  0.444   -6.202  1.00 0.00 ? 110 LYS A HA   2  
ATOM 3342  H HB2  . LYS A 1 110 ? -1.192  2.841   -7.953  1.00 0.00 ? 110 LYS A HB2  2  
ATOM 3343  H HB3  . LYS A 1 110 ? -0.749  1.190   -8.369  1.00 0.00 ? 110 LYS A HB3  2  
ATOM 3344  H HG2  . LYS A 1 110 ? -3.279  0.755   -7.678  1.00 0.00 ? 110 LYS A HG2  2  
ATOM 3345  H HG3  . LYS A 1 110 ? -3.420  2.447   -8.161  1.00 0.00 ? 110 LYS A HG3  2  
ATOM 3346  H HD2  . LYS A 1 110 ? -2.368  0.164   -9.830  1.00 0.00 ? 110 LYS A HD2  2  
ATOM 3347  H HD3  . LYS A 1 110 ? -3.885  1.036   -10.061 1.00 0.00 ? 110 LYS A HD3  2  
ATOM 3348  H HE2  . LYS A 1 110 ? -1.371  2.615   -10.031 1.00 0.00 ? 110 LYS A HE2  2  
ATOM 3349  H HE3  . LYS A 1 110 ? -1.688  1.610   -11.444 1.00 0.00 ? 110 LYS A HE3  2  
ATOM 3350  H HZ1  . LYS A 1 110 ? -2.895  4.079   -10.672 1.00 0.00 ? 110 LYS A HZ1  2  
ATOM 3351  H HZ2  . LYS A 1 110 ? -4.056  2.885   -10.967 1.00 0.00 ? 110 LYS A HZ2  2  
ATOM 3352  H HZ3  . LYS A 1 110 ? -2.931  3.286   -12.165 1.00 0.00 ? 110 LYS A HZ3  2  
ATOM 3353  N N    . SER A 1 111 ? -0.476  3.518   -5.216  1.00 0.00 ? 111 SER A N    2  
ATOM 3354  C CA   . SER A 1 111 ? 0.494   4.443   -4.642  1.00 0.00 ? 111 SER A CA   2  
ATOM 3355  C C    . SER A 1 111 ? 1.225   3.804   -3.466  1.00 0.00 ? 111 SER A C    2  
ATOM 3356  O O    . SER A 1 111 ? 2.236   4.323   -2.991  1.00 0.00 ? 111 SER A O    2  
ATOM 3357  C CB   . SER A 1 111 ? -0.202  5.728   -4.188  1.00 0.00 ? 111 SER A CB   2  
ATOM 3358  O OG   . SER A 1 111 ? 0.731   6.652   -3.656  1.00 0.00 ? 111 SER A OG   2  
ATOM 3359  H H    . SER A 1 111 ? -1.425  3.762   -5.221  1.00 0.00 ? 111 SER A H    2  
ATOM 3360  H HA   . SER A 1 111 ? 1.214   4.686   -5.409  1.00 0.00 ? 111 SER A HA   2  
ATOM 3361  H HB2  . SER A 1 111 ? -0.700  6.182   -5.031  1.00 0.00 ? 111 SER A HB2  2  
ATOM 3362  H HB3  . SER A 1 111 ? -0.929  5.489   -3.425  1.00 0.00 ? 111 SER A HB3  2  
ATOM 3363  H HG   . SER A 1 111 ? 0.420   6.967   -2.804  1.00 0.00 ? 111 SER A HG   2  
ATOM 3364  N N    . PHE A 1 112 ? 0.707   2.672   -2.999  1.00 0.00 ? 112 PHE A N    2  
ATOM 3365  C CA   . PHE A 1 112 ? 1.309   1.961   -1.878  1.00 0.00 ? 112 PHE A CA   2  
ATOM 3366  C C    . PHE A 1 112 ? 2.066   0.727   -2.359  1.00 0.00 ? 112 PHE A C    2  
ATOM 3367  O O    . PHE A 1 112 ? 2.928   0.201   -1.655  1.00 0.00 ? 112 PHE A O    2  
ATOM 3368  C CB   . PHE A 1 112 ? 0.233   1.552   -0.870  1.00 0.00 ? 112 PHE A CB   2  
ATOM 3369  C CG   . PHE A 1 112 ? -0.226  2.681   0.008   1.00 0.00 ? 112 PHE A CG   2  
ATOM 3370  C CD1  . PHE A 1 112 ? -0.700  3.859   -0.547  1.00 0.00 ? 112 PHE A CD1  2  
ATOM 3371  C CD2  . PHE A 1 112 ? -0.185  2.564   1.388   1.00 0.00 ? 112 PHE A CD2  2  
ATOM 3372  C CE1  . PHE A 1 112 ? -1.122  4.900   0.259   1.00 0.00 ? 112 PHE A CE1  2  
ATOM 3373  C CE2  . PHE A 1 112 ? -0.606  3.601   2.199   1.00 0.00 ? 112 PHE A CE2  2  
ATOM 3374  C CZ   . PHE A 1 112 ? -1.076  4.770   1.633   1.00 0.00 ? 112 PHE A CZ   2  
ATOM 3375  H H    . PHE A 1 112 ? -0.100  2.307   -3.420  1.00 0.00 ? 112 PHE A H    2  
ATOM 3376  H HA   . PHE A 1 112 ? 2.005   2.631   -1.397  1.00 0.00 ? 112 PHE A HA   2  
ATOM 3377  H HB2  . PHE A 1 112 ? -0.627  1.177   -1.404  1.00 0.00 ? 112 PHE A HB2  2  
ATOM 3378  H HB3  . PHE A 1 112 ? 0.624   0.773   -0.233  1.00 0.00 ? 112 PHE A HB3  2  
ATOM 3379  H HD1  . PHE A 1 112 ? -0.737  3.962   -1.621  1.00 0.00 ? 112 PHE A HD1  2  
ATOM 3380  H HD2  . PHE A 1 112 ? 0.183   1.649   1.832   1.00 0.00 ? 112 PHE A HD2  2  
ATOM 3381  H HE1  . PHE A 1 112 ? -1.490  5.812   -0.186  1.00 0.00 ? 112 PHE A HE1  2  
ATOM 3382  H HE2  . PHE A 1 112 ? -0.569  3.496   3.273   1.00 0.00 ? 112 PHE A HE2  2  
ATOM 3383  H HZ   . PHE A 1 112 ? -1.405  5.582   2.265   1.00 0.00 ? 112 PHE A HZ   2  
ATOM 3384  N N    . ILE A 1 113 ? 1.737   0.271   -3.563  1.00 0.00 ? 113 ILE A N    2  
ATOM 3385  C CA   . ILE A 1 113 ? 2.385   -0.901  -4.139  1.00 0.00 ? 113 ILE A CA   2  
ATOM 3386  C C    . ILE A 1 113 ? 3.535   -0.497  -5.056  1.00 0.00 ? 113 ILE A C    2  
ATOM 3387  O O    . ILE A 1 113 ? 3.341   0.231   -6.030  1.00 0.00 ? 113 ILE A O    2  
ATOM 3388  C CB   . ILE A 1 113 ? 1.387   -1.762  -4.935  1.00 0.00 ? 113 ILE A CB   2  
ATOM 3389  C CG1  . ILE A 1 113 ? 0.241   -2.221  -4.031  1.00 0.00 ? 113 ILE A CG1  2  
ATOM 3390  C CG2  . ILE A 1 113 ? 2.095   -2.960  -5.551  1.00 0.00 ? 113 ILE A CG2  2  
ATOM 3391  C CD1  . ILE A 1 113 ? 0.707   -2.908  -2.767  1.00 0.00 ? 113 ILE A CD1  2  
ATOM 3392  H H    . ILE A 1 113 ? 1.042   0.733   -4.076  1.00 0.00 ? 113 ILE A H    2  
ATOM 3393  H HA   . ILE A 1 113 ? 2.778   -1.497  -3.328  1.00 0.00 ? 113 ILE A HA   2  
ATOM 3394  H HB   . ILE A 1 113 ? 0.986   -1.161  -5.737  1.00 0.00 ? 113 ILE A HB   2  
ATOM 3395  H HG12 . ILE A 1 113 ? -0.348  -1.364  -3.744  1.00 0.00 ? 113 ILE A HG12 2  
ATOM 3396  H HG13 . ILE A 1 113 ? -0.382  -2.914  -4.577  1.00 0.00 ? 113 ILE A HG13 2  
ATOM 3397  H HG21 . ILE A 1 113 ? 2.021   -2.907  -6.627  1.00 0.00 ? 113 ILE A HG21 2  
ATOM 3398  H HG22 . ILE A 1 113 ? 3.135   -2.951  -5.262  1.00 0.00 ? 113 ILE A HG22 2  
ATOM 3399  H HG23 . ILE A 1 113 ? 1.632   -3.870  -5.203  1.00 0.00 ? 113 ILE A HG23 2  
ATOM 3400  H HD11 . ILE A 1 113 ? 0.027   -3.712  -2.523  1.00 0.00 ? 113 ILE A HD11 2  
ATOM 3401  H HD12 . ILE A 1 113 ? 1.698   -3.310  -2.919  1.00 0.00 ? 113 ILE A HD12 2  
ATOM 3402  H HD13 . ILE A 1 113 ? 0.727   -2.196  -1.956  1.00 0.00 ? 113 ILE A HD13 2  
ATOM 3403  N N    . HIS A 1 114 ? 4.734   -0.976  -4.739  1.00 0.00 ? 114 HIS A N    2  
ATOM 3404  C CA   . HIS A 1 114 ? 5.916   -0.668  -5.535  1.00 0.00 ? 114 HIS A CA   2  
ATOM 3405  C C    . HIS A 1 114 ? 6.190   -1.772  -6.551  1.00 0.00 ? 114 HIS A C    2  
ATOM 3406  O O    . HIS A 1 114 ? 6.819   -2.781  -6.231  1.00 0.00 ? 114 HIS A O    2  
ATOM 3407  C CB   . HIS A 1 114 ? 7.133   -0.479  -4.629  1.00 0.00 ? 114 HIS A CB   2  
ATOM 3408  C CG   . HIS A 1 114 ? 8.349   0.010   -5.353  1.00 0.00 ? 114 HIS A CG   2  
ATOM 3409  N ND1  . HIS A 1 114 ? 8.435   1.265   -5.918  1.00 0.00 ? 114 HIS A ND1  2  
ATOM 3410  C CD2  . HIS A 1 114 ? 9.534   -0.595  -5.602  1.00 0.00 ? 114 HIS A CD2  2  
ATOM 3411  C CE1  . HIS A 1 114 ? 9.620   1.410   -6.484  1.00 0.00 ? 114 HIS A CE1  2  
ATOM 3412  N NE2  . HIS A 1 114 ? 10.306  0.295   -6.307  1.00 0.00 ? 114 HIS A NE2  2  
ATOM 3413  H H    . HIS A 1 114 ? 4.825   -1.551  -3.951  1.00 0.00 ? 114 HIS A H    2  
ATOM 3414  H HA   . HIS A 1 114 ? 5.727   0.253   -6.066  1.00 0.00 ? 114 HIS A HA   2  
ATOM 3415  H HB2  . HIS A 1 114 ? 6.893   0.242   -3.861  1.00 0.00 ? 114 HIS A HB2  2  
ATOM 3416  H HB3  . HIS A 1 114 ? 7.378   -1.424  -4.166  1.00 0.00 ? 114 HIS A HB3  2  
ATOM 3417  H HD1  . HIS A 1 114 ? 7.732   1.947   -5.907  1.00 0.00 ? 114 HIS A HD1  2  
ATOM 3418  H HD2  . HIS A 1 114 ? 9.820   -1.594  -5.303  1.00 0.00 ? 114 HIS A HD2  2  
ATOM 3419  H HE1  . HIS A 1 114 ? 9.969   2.290   -7.004  1.00 0.00 ? 114 HIS A HE1  2  
ATOM 3420  H HE2  . HIS A 1 114 ? 11.183  0.104   -6.700  1.00 0.00 ? 114 HIS A HE2  2  
ATOM 3421  N N    . ILE A 1 115 ? 5.714   -1.575  -7.776  1.00 0.00 ? 115 ILE A N    2  
ATOM 3422  C CA   . ILE A 1 115 ? 5.908   -2.554  -8.838  1.00 0.00 ? 115 ILE A CA   2  
ATOM 3423  C C    . ILE A 1 115 ? 7.385   -2.695  -9.192  1.00 0.00 ? 115 ILE A C    2  
ATOM 3424  O O    . ILE A 1 115 ? 8.009   -1.755  -9.684  1.00 0.00 ? 115 ILE A O    2  
ATOM 3425  C CB   . ILE A 1 115 ? 5.121   -2.173  -10.106 1.00 0.00 ? 115 ILE A CB   2  
ATOM 3426  C CG1  . ILE A 1 115 ? 3.633   -2.029  -9.785  1.00 0.00 ? 115 ILE A CG1  2  
ATOM 3427  C CG2  . ILE A 1 115 ? 5.336   -3.214  -11.195 1.00 0.00 ? 115 ILE A CG2  2  
ATOM 3428  C CD1  . ILE A 1 115 ? 2.998   -3.304  -9.276  1.00 0.00 ? 115 ILE A CD1  2  
ATOM 3429  H H    . ILE A 1 115 ? 5.221   -0.751  -7.970  1.00 0.00 ? 115 ILE A H    2  
ATOM 3430  H HA   . ILE A 1 115 ? 5.541   -3.507  -8.484  1.00 0.00 ? 115 ILE A HA   2  
ATOM 3431  H HB   . ILE A 1 115 ? 5.498   -1.228  -10.466 1.00 0.00 ? 115 ILE A HB   2  
ATOM 3432  H HG12 . ILE A 1 115 ? 3.506   -1.271  -9.028  1.00 0.00 ? 115 ILE A HG12 2  
ATOM 3433  H HG13 . ILE A 1 115 ? 3.106   -1.729  -10.680 1.00 0.00 ? 115 ILE A HG13 2  
ATOM 3434  H HG21 . ILE A 1 115 ? 6.379   -3.232  -11.475 1.00 0.00 ? 115 ILE A HG21 2  
ATOM 3435  H HG22 . ILE A 1 115 ? 5.046   -4.186  -10.825 1.00 0.00 ? 115 ILE A HG22 2  
ATOM 3436  H HG23 . ILE A 1 115 ? 4.736   -2.963  -12.056 1.00 0.00 ? 115 ILE A HG23 2  
ATOM 3437  H HD11 . ILE A 1 115 ? 3.485   -3.608  -8.361  1.00 0.00 ? 115 ILE A HD11 2  
ATOM 3438  H HD12 . ILE A 1 115 ? 1.949   -3.133  -9.085  1.00 0.00 ? 115 ILE A HD12 2  
ATOM 3439  H HD13 . ILE A 1 115 ? 3.107   -4.082  -10.017 1.00 0.00 ? 115 ILE A HD13 2  
ATOM 3440  N N    . LYS A 1 116 ? 7.938   -3.877  -8.941  1.00 0.00 ? 116 LYS A N    2  
ATOM 3441  C CA   . LYS A 1 116 ? 9.340   -4.144  -9.236  1.00 0.00 ? 116 LYS A CA   2  
ATOM 3442  C C    . LYS A 1 116 ? 9.491   -4.830  -10.590 1.00 0.00 ? 116 LYS A C    2  
ATOM 3443  O O    . LYS A 1 116 ? 8.589   -5.535  -11.041 1.00 0.00 ? 116 LYS A O    2  
ATOM 3444  C CB   . LYS A 1 116 ? 9.956   -5.015  -8.139  1.00 0.00 ? 116 LYS A CB   2  
ATOM 3445  C CG   . LYS A 1 116 ? 9.689   -4.505  -6.734  1.00 0.00 ? 116 LYS A CG   2  
ATOM 3446  C CD   . LYS A 1 116 ? 10.143  -5.502  -5.682  1.00 0.00 ? 116 LYS A CD   2  
ATOM 3447  C CE   . LYS A 1 116 ? 9.693   -6.915  -6.022  1.00 0.00 ? 116 LYS A CE   2  
ATOM 3448  N NZ   . LYS A 1 116 ? 10.713  -7.643  -6.827  1.00 0.00 ? 116 LYS A NZ   2  
ATOM 3449  H H    . LYS A 1 116 ? 7.388   -4.587  -8.548  1.00 0.00 ? 116 LYS A H    2  
ATOM 3450  H HA   . LYS A 1 116 ? 9.859   -3.198  -9.266  1.00 0.00 ? 116 LYS A HA   2  
ATOM 3451  H HB2  . LYS A 1 116 ? 9.552   -6.014  -8.220  1.00 0.00 ? 116 LYS A HB2  2  
ATOM 3452  H HB3  . LYS A 1 116 ? 11.026  -5.056  -8.287  1.00 0.00 ? 116 LYS A HB3  2  
ATOM 3453  H HG2  . LYS A 1 116 ? 10.223  -3.577  -6.590  1.00 0.00 ? 116 LYS A HG2  2  
ATOM 3454  H HG3  . LYS A 1 116 ? 8.628   -4.332  -6.620  1.00 0.00 ? 116 LYS A HG3  2  
ATOM 3455  H HD2  . LYS A 1 116 ? 11.221  -5.484  -5.623  1.00 0.00 ? 116 LYS A HD2  2  
ATOM 3456  H HD3  . LYS A 1 116 ? 9.724   -5.221  -4.726  1.00 0.00 ? 116 LYS A HD3  2  
ATOM 3457  H HE2  . LYS A 1 116 ? 9.520   -7.455  -5.104  1.00 0.00 ? 116 LYS A HE2  2  
ATOM 3458  H HE3  . LYS A 1 116 ? 8.774   -6.860  -6.586  1.00 0.00 ? 116 LYS A HE3  2  
ATOM 3459  H HZ1  . LYS A 1 116 ? 11.250  -8.294  -6.220  1.00 0.00 ? 116 LYS A HZ1  2  
ATOM 3460  H HZ2  . LYS A 1 116 ? 11.374  -6.967  -7.262  1.00 0.00 ? 116 LYS A HZ2  2  
ATOM 3461  H HZ3  . LYS A 1 116 ? 10.250  -8.190  -7.581  1.00 0.00 ? 116 LYS A HZ3  2  
ATOM 3462  N N    . GLU A 1 117 ? 10.636  -4.620  -11.231 1.00 0.00 ? 117 GLU A N    2  
ATOM 3463  C CA   . GLU A 1 117 ? 10.903  -5.220  -12.533 1.00 0.00 ? 117 GLU A CA   2  
ATOM 3464  C C    . GLU A 1 117 ? 12.241  -5.953  -12.530 1.00 0.00 ? 117 GLU A C    2  
ATOM 3465  O O    . GLU A 1 117 ? 13.262  -5.406  -12.948 1.00 0.00 ? 117 GLU A O    2  
ATOM 3466  C CB   . GLU A 1 117 ? 10.899  -4.147  -13.624 1.00 0.00 ? 117 GLU A CB   2  
ATOM 3467  C CG   . GLU A 1 117 ? 9.527   -3.545  -13.881 1.00 0.00 ? 117 GLU A CG   2  
ATOM 3468  C CD   . GLU A 1 117 ? 9.505   -2.645  -15.101 1.00 0.00 ? 117 GLU A CD   2  
ATOM 3469  O OE1  . GLU A 1 117 ? 9.865   -1.456  -14.967 1.00 0.00 ? 117 GLU A OE1  2  
ATOM 3470  O OE2  . GLU A 1 117 ? 9.126   -3.127  -16.188 1.00 0.00 ? 117 GLU A OE2  2  
ATOM 3471  H H    . GLU A 1 117 ? 11.317  -4.048  -10.819 1.00 0.00 ? 117 GLU A H    2  
ATOM 3472  H HA   . GLU A 1 117 ? 10.117  -5.931  -12.738 1.00 0.00 ? 117 GLU A HA   2  
ATOM 3473  H HB2  . GLU A 1 117 ? 11.570  -3.352  -13.333 1.00 0.00 ? 117 GLU A HB2  2  
ATOM 3474  H HB3  . GLU A 1 117 ? 11.254  -4.586  -14.545 1.00 0.00 ? 117 GLU A HB3  2  
ATOM 3475  H HG2  . GLU A 1 117 ? 8.819   -4.346  -14.031 1.00 0.00 ? 117 GLU A HG2  2  
ATOM 3476  H HG3  . GLU A 1 117 ? 9.235   -2.965  -13.018 1.00 0.00 ? 117 GLU A HG3  2  
ATOM 3477  N N    . VAL A 1 118 ? 12.229  -7.194  -12.056 1.00 0.00 ? 118 VAL A N    2  
ATOM 3478  C CA   . VAL A 1 118 ? 13.440  -8.003  -11.998 1.00 0.00 ? 118 VAL A CA   2  
ATOM 3479  C C    . VAL A 1 118 ? 13.803  -8.547  -13.375 1.00 0.00 ? 118 VAL A C    2  
ATOM 3480  O O    . VAL A 1 118 ? 14.896  -8.298  -13.886 1.00 0.00 ? 118 VAL A O    2  
ATOM 3481  C CB   . VAL A 1 118 ? 13.282  -9.181  -11.018 1.00 0.00 ? 118 VAL A CB   2  
ATOM 3482  C CG1  . VAL A 1 118 ? 14.534  -10.046 -11.017 1.00 0.00 ? 118 VAL A CG1  2  
ATOM 3483  C CG2  . VAL A 1 118 ? 12.975  -8.672  -9.618  1.00 0.00 ? 118 VAL A CG2  2  
ATOM 3484  H H    . VAL A 1 118 ? 11.384  -7.575  -11.737 1.00 0.00 ? 118 VAL A H    2  
ATOM 3485  H HA   . VAL A 1 118 ? 14.245  -7.375  -11.646 1.00 0.00 ? 118 VAL A HA   2  
ATOM 3486  H HB   . VAL A 1 118 ? 12.452  -9.789  -11.348 1.00 0.00 ? 118 VAL A HB   2  
ATOM 3487  H HG11 . VAL A 1 118 ? 14.601  -10.580 -10.081 1.00 0.00 ? 118 VAL A HG11 2  
ATOM 3488  H HG12 . VAL A 1 118 ? 14.485  -10.752 -11.833 1.00 0.00 ? 118 VAL A HG12 2  
ATOM 3489  H HG13 . VAL A 1 118 ? 15.405  -9.418  -11.135 1.00 0.00 ? 118 VAL A HG13 2  
ATOM 3490  H HG21 . VAL A 1 118 ? 13.886  -8.632  -9.041  1.00 0.00 ? 118 VAL A HG21 2  
ATOM 3491  H HG22 . VAL A 1 118 ? 12.546  -7.683  -9.682  1.00 0.00 ? 118 VAL A HG22 2  
ATOM 3492  H HG23 . VAL A 1 118 ? 12.273  -9.338  -9.138  1.00 0.00 ? 118 VAL A HG23 2  
ATOM 3493  N N    . THR A 1 119 ? 12.879  -9.292  -13.974 1.00 0.00 ? 119 THR A N    2  
ATOM 3494  C CA   . THR A 1 119 ? 13.102  -9.872  -15.292 1.00 0.00 ? 119 THR A CA   2  
ATOM 3495  C C    . THR A 1 119 ? 12.319  -9.121  -16.363 1.00 0.00 ? 119 THR A C    2  
ATOM 3496  O O    . THR A 1 119 ? 11.338  -8.438  -16.066 1.00 0.00 ? 119 THR A O    2  
ATOM 3497  C CB   . THR A 1 119 ? 12.699  -11.359 -15.327 1.00 0.00 ? 119 THR A CB   2  
ATOM 3498  O OG1  . THR A 1 119 ? 13.039  -11.929 -16.596 1.00 0.00 ? 119 THR A OG1  2  
ATOM 3499  C CG2  . THR A 1 119 ? 11.208  -11.522 -15.074 1.00 0.00 ? 119 THR A CG2  2  
ATOM 3500  H H    . THR A 1 119 ? 12.028  -9.455  -13.517 1.00 0.00 ? 119 THR A H    2  
ATOM 3501  H HA   . THR A 1 119 ? 14.156  -9.801  -15.514 1.00 0.00 ? 119 THR A HA   2  
ATOM 3502  H HB   . THR A 1 119 ? 13.240  -11.881 -14.550 1.00 0.00 ? 119 THR A HB   2  
ATOM 3503  H HG1  . THR A 1 119 ? 13.793  -11.463 -16.965 1.00 0.00 ? 119 THR A HG1  2  
ATOM 3504  H HG21 . THR A 1 119 ? 10.878  -10.771 -14.373 1.00 0.00 ? 119 THR A HG21 2  
ATOM 3505  H HG22 . THR A 1 119 ? 11.017  -12.503 -14.666 1.00 0.00 ? 119 THR A HG22 2  
ATOM 3506  H HG23 . THR A 1 119 ? 10.671  -11.408 -16.004 1.00 0.00 ? 119 THR A HG23 2  
ATOM 3507  N N    . GLY A 1 1   ? -0.662  23.143  28.566  1.00 0.00 ? 1   GLY A N    3  
ATOM 3508  C CA   . GLY A 1 1   ? 0.703   22.679  28.400  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3509  C C    . GLY A 1 1   ? 0.785   21.392  27.604  1.00 0.00 ? 1   GLY A C    3  
ATOM 3510  O O    . GLY A 1 1   ? 0.324   20.344  28.057  1.00 0.00 ? 1   GLY A O    3  
ATOM 3511  H H1   . GLY A 1 1   ? -1.298  23.064  27.824  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3512  H HA2  . GLY A 1 1   ? 1.272   23.443  27.890  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3513  H HA3  . GLY A 1 1   ? 1.136   22.514  29.376  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3514  N N    . SER A 1 2   ? 1.372   21.470  26.414  1.00 0.00 ? 2   SER A N    3  
ATOM 3515  C CA   . SER A 1 2   ? 1.508   20.302  25.551  1.00 0.00 ? 2   SER A CA   3  
ATOM 3516  C C    . SER A 1 2   ? 2.956   20.121  25.106  1.00 0.00 ? 2   SER A C    3  
ATOM 3517  O O    . SER A 1 2   ? 3.698   21.093  24.960  1.00 0.00 ? 2   SER A O    3  
ATOM 3518  C CB   . SER A 1 2   ? 0.600   20.438  24.328  1.00 0.00 ? 2   SER A CB   3  
ATOM 3519  O OG   . SER A 1 2   ? 0.849   21.652  23.640  1.00 0.00 ? 2   SER A OG   3  
ATOM 3520  H H    . SER A 1 2   ? 1.720   22.334  26.109  1.00 0.00 ? 2   SER A H    3  
ATOM 3521  H HA   . SER A 1 2   ? 1.207   19.434  26.118  1.00 0.00 ? 2   SER A HA   3  
ATOM 3522  H HB2  . SER A 1 2   ? 0.781   19.614  23.655  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3523  H HB3  . SER A 1 2   ? -0.432  20.423  24.646  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3524  H HG   . SER A 1 2   ? 1.259   21.462  22.793  1.00 0.00 ? 2   SER A HG   3  
ATOM 3525  N N    . SER A 1 3   ? 3.352   18.870  24.893  1.00 0.00 ? 3   SER A N    3  
ATOM 3526  C CA   . SER A 1 3   ? 4.712   18.560  24.469  1.00 0.00 ? 3   SER A CA   3  
ATOM 3527  C C    . SER A 1 3   ? 4.779   17.177  23.828  1.00 0.00 ? 3   SER A C    3  
ATOM 3528  O O    . SER A 1 3   ? 3.850   16.380  23.948  1.00 0.00 ? 3   SER A O    3  
ATOM 3529  C CB   . SER A 1 3   ? 5.669   18.630  25.660  1.00 0.00 ? 3   SER A CB   3  
ATOM 3530  O OG   . SER A 1 3   ? 7.019   18.624  25.231  1.00 0.00 ? 3   SER A OG   3  
ATOM 3531  H H    . SER A 1 3   ? 2.713   18.138  25.028  1.00 0.00 ? 3   SER A H    3  
ATOM 3532  H HA   . SER A 1 3   ? 5.007   19.297  23.737  1.00 0.00 ? 3   SER A HA   3  
ATOM 3533  H HB2  . SER A 1 3   ? 5.484   19.538  26.214  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3534  H HB3  . SER A 1 3   ? 5.503   17.776  26.302  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3535  H HG   . SER A 1 3   ? 7.252   17.746  24.919  1.00 0.00 ? 3   SER A HG   3  
ATOM 3536  N N    . GLY A 1 4   ? 5.887   16.900  23.147  1.00 0.00 ? 4   GLY A N    3  
ATOM 3537  C CA   . GLY A 1 4   ? 6.056   15.613  22.498  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3538  C C    . GLY A 1 4   ? 7.321   15.546  21.665  1.00 0.00 ? 4   GLY A C    3  
ATOM 3539  O O    . GLY A 1 4   ? 7.332   15.964  20.507  1.00 0.00 ? 4   GLY A O    3  
ATOM 3540  H H    . GLY A 1 4   ? 6.595   17.575  23.086  1.00 0.00 ? 4   GLY A H    3  
ATOM 3541  H HA2  . GLY A 1 4   ? 6.093   14.843  23.253  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3542  H HA3  . GLY A 1 4   ? 5.206   15.433  21.856  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3543  N N    . SER A 1 5   ? 8.389   15.021  22.255  1.00 0.00 ? 5   SER A N    3  
ATOM 3544  C CA   . SER A 1 5   ? 9.667   14.906  21.562  1.00 0.00 ? 5   SER A CA   3  
ATOM 3545  C C    . SER A 1 5   ? 9.549   13.977  20.357  1.00 0.00 ? 5   SER A C    3  
ATOM 3546  O O    . SER A 1 5   ? 8.596   13.207  20.244  1.00 0.00 ? 5   SER A O    3  
ATOM 3547  C CB   . SER A 1 5   ? 10.744  14.388  22.516  1.00 0.00 ? 5   SER A CB   3  
ATOM 3548  O OG   . SER A 1 5   ? 11.155  15.400  23.419  1.00 0.00 ? 5   SER A OG   3  
ATOM 3549  H H    . SER A 1 5   ? 8.317   14.705  23.180  1.00 0.00 ? 5   SER A H    3  
ATOM 3550  H HA   . SER A 1 5   ? 9.946   15.890  21.217  1.00 0.00 ? 5   SER A HA   3  
ATOM 3551  H HB2  . SER A 1 5   ? 10.352  13.556  23.081  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3552  H HB3  . SER A 1 5   ? 11.601  14.062  21.944  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3553  H HG   . SER A 1 5   ? 12.006  15.166  23.796  1.00 0.00 ? 5   SER A HG   3  
ATOM 3554  N N    . SER A 1 6   ? 10.526  14.056  19.459  1.00 0.00 ? 6   SER A N    3  
ATOM 3555  C CA   . SER A 1 6   ? 10.532  13.225  18.261  1.00 0.00 ? 6   SER A CA   3  
ATOM 3556  C C    . SER A 1 6   ? 11.956  12.996  17.765  1.00 0.00 ? 6   SER A C    3  
ATOM 3557  O O    . SER A 1 6   ? 12.888  13.686  18.177  1.00 0.00 ? 6   SER A O    3  
ATOM 3558  C CB   . SER A 1 6   ? 9.695   13.879  17.158  1.00 0.00 ? 6   SER A CB   3  
ATOM 3559  O OG   . SER A 1 6   ? 9.146   12.904  16.289  1.00 0.00 ? 6   SER A OG   3  
ATOM 3560  H H    . SER A 1 6   ? 11.259  14.689  19.606  1.00 0.00 ? 6   SER A H    3  
ATOM 3561  H HA   . SER A 1 6   ? 10.094  12.272  18.516  1.00 0.00 ? 6   SER A HA   3  
ATOM 3562  H HB2  . SER A 1 6   ? 8.889   14.440  17.606  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3563  H HB3  . SER A 1 6   ? 10.322  14.545  16.583  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3564  H HG   . SER A 1 6   ? 8.334   13.240  15.903  1.00 0.00 ? 6   SER A HG   3  
ATOM 3565  N N    . GLY A 1 7   ? 12.117  12.019  16.877  1.00 0.00 ? 7   GLY A N    3  
ATOM 3566  C CA   . GLY A 1 7   ? 13.431  11.715  16.340  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3567  C C    . GLY A 1 7   ? 13.389  11.382  14.861  1.00 0.00 ? 7   GLY A C    3  
ATOM 3568  O O    . GLY A 1 7   ? 12.767  10.400  14.456  1.00 0.00 ? 7   GLY A O    3  
ATOM 3569  H H    . GLY A 1 7   ? 11.338  11.502  16.585  1.00 0.00 ? 7   GLY A H    3  
ATOM 3570  H HA2  . GLY A 1 7   ? 14.075  12.568  16.488  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3571  H HA3  . GLY A 1 7   ? 13.839  10.870  16.875  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3572  N N    . ARG A 1 8   ? 14.051  12.203  14.053  1.00 0.00 ? 8   ARG A N    3  
ATOM 3573  C CA   . ARG A 1 8   ? 14.085  11.993  12.611  1.00 0.00 ? 8   ARG A CA   3  
ATOM 3574  C C    . ARG A 1 8   ? 15.419  11.391  12.180  1.00 0.00 ? 8   ARG A C    3  
ATOM 3575  O O    . ARG A 1 8   ? 16.263  11.063  13.015  1.00 0.00 ? 8   ARG A O    3  
ATOM 3576  C CB   . ARG A 1 8   ? 13.848  13.313  11.875  1.00 0.00 ? 8   ARG A CB   3  
ATOM 3577  C CG   . ARG A 1 8   ? 12.384  13.716  11.804  1.00 0.00 ? 8   ARG A CG   3  
ATOM 3578  C CD   . ARG A 1 8   ? 11.610  12.835  10.836  1.00 0.00 ? 8   ARG A CD   3  
ATOM 3579  N NE   . ARG A 1 8   ? 10.198  12.738  11.194  1.00 0.00 ? 8   ARG A NE   3  
ATOM 3580  C CZ   . ARG A 1 8   ? 9.398   11.766  10.769  1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3581  N NH1  . ARG A 1 8   ? 9.869   10.814  9.976   1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3582  N NH2  . ARG A 1 8   ? 8.124   11.745  11.138  1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3583  H H    . ARG A 1 8   ? 14.528  12.969  14.435  1.00 0.00 ? 8   ARG A H    3  
ATOM 3584  H HA   . ARG A 1 8   ? 13.294  11.303  12.357  1.00 0.00 ? 8   ARG A HA   3  
ATOM 3585  H HB2  . ARG A 1 8   ? 14.390  14.097  12.384  1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3586  H HB3  . ARG A 1 8   ? 14.224  13.222  10.867  1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3587  H HG2  . ARG A 1 8   ? 11.946  13.623  12.787  1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3588  H HG3  . ARG A 1 8   ? 12.319  14.742  11.475  1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3589  H HD2  . ARG A 1 8   ? 11.692  13.255  9.844   1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3590  H HD3  . ARG A 1 8   ? 12.044  11.846  10.845  1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3591  H HE   . ARG A 1 8   ? 9.829   13.431  11.779  1.00 0.00 ? 8   ARG A HE   3  
ATOM 3592  H HH11 . ARG A 1 8   ? 10.829  10.826  9.697   1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3593  H HH12 . ARG A 1 8   ? 9.265   10.082  9.659   1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3594  H HH21 . ARG A 1 8   ? 7.765   12.461  11.736  1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3595  H HH22 . ARG A 1 8   ? 7.522   11.014  10.818  1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3596  N N    . LEU A 1 9   ? 15.603  11.248  10.872  1.00 0.00 ? 9   LEU A N    3  
ATOM 3597  C CA   . LEU A 1 9   ? 16.835  10.685  10.330  1.00 0.00 ? 9   LEU A CA   3  
ATOM 3598  C C    . LEU A 1 9   ? 16.945  10.957  8.833   1.00 0.00 ? 9   LEU A C    3  
ATOM 3599  O O    . LEU A 1 9   ? 15.985  10.769  8.084   1.00 0.00 ? 9   LEU A O    3  
ATOM 3600  C CB   . LEU A 1 9   ? 16.889  9.179   10.591  1.00 0.00 ? 9   LEU A CB   3  
ATOM 3601  C CG   . LEU A 1 9   ? 16.107  8.300   9.615   1.00 0.00 ? 9   LEU A CG   3  
ATOM 3602  C CD1  . LEU A 1 9   ? 16.964  7.948   8.408   1.00 0.00 ? 9   LEU A CD1  3  
ATOM 3603  C CD2  . LEU A 1 9   ? 15.616  7.037   10.309  1.00 0.00 ? 9   LEU A CD2  3  
ATOM 3604  H H    . LEU A 1 9   ? 14.895  11.527  10.256  1.00 0.00 ? 9   LEU A H    3  
ATOM 3605  H HA   . LEU A 1 9   ? 17.665  11.159  10.832  1.00 0.00 ? 9   LEU A HA   3  
ATOM 3606  H HB2  . LEU A 1 9   ? 17.923  8.874   10.554  1.00 0.00 ? 9   LEU A HB2  3  
ATOM 3607  H HB3  . LEU A 1 9   ? 16.498  9.002   11.583  1.00 0.00 ? 9   LEU A HB3  3  
ATOM 3608  H HG   . LEU A 1 9   ? 15.242  8.846   9.262   1.00 0.00 ? 9   LEU A HG   3  
ATOM 3609  H HD11 . LEU A 1 9   ? 17.974  7.746   8.731   1.00 0.00 ? 9   LEU A HD11 3  
ATOM 3610  H HD12 . LEU A 1 9   ? 16.966  8.776   7.715   1.00 0.00 ? 9   LEU A HD12 3  
ATOM 3611  H HD13 . LEU A 1 9   ? 16.558  7.073   7.922   1.00 0.00 ? 9   LEU A HD13 3  
ATOM 3612  H HD21 . LEU A 1 9   ? 15.214  7.292   11.278  1.00 0.00 ? 9   LEU A HD21 3  
ATOM 3613  H HD22 . LEU A 1 9   ? 16.441  6.351   10.430  1.00 0.00 ? 9   LEU A HD22 3  
ATOM 3614  H HD23 . LEU A 1 9   ? 14.847  6.573   9.709   1.00 0.00 ? 9   LEU A HD23 3  
ATOM 3615  N N    . LEU A 1 10  ? 18.122  11.399  8.403   1.00 0.00 ? 10  LEU A N    3  
ATOM 3616  C CA   . LEU A 1 10  ? 18.359  11.695  6.994   1.00 0.00 ? 10  LEU A CA   3  
ATOM 3617  C C    . LEU A 1 10  ? 19.075  10.537  6.307   1.00 0.00 ? 10  LEU A C    3  
ATOM 3618  O O    . LEU A 1 10  ? 19.436  9.549   6.948   1.00 0.00 ? 10  LEU A O    3  
ATOM 3619  C CB   . LEU A 1 10  ? 19.185  12.975  6.854   1.00 0.00 ? 10  LEU A CB   3  
ATOM 3620  C CG   . LEU A 1 10  ? 18.392  14.280  6.772   1.00 0.00 ? 10  LEU A CG   3  
ATOM 3621  C CD1  . LEU A 1 10  ? 17.237  14.142  5.793   1.00 0.00 ? 10  LEU A CD1  3  
ATOM 3622  C CD2  . LEU A 1 10  ? 17.883  14.682  8.148   1.00 0.00 ? 10  LEU A CD2  3  
ATOM 3623  H H    . LEU A 1 10  ? 18.849  11.530  9.046   1.00 0.00 ? 10  LEU A H    3  
ATOM 3624  H HA   . LEU A 1 10  ? 17.400  11.842  6.520   1.00 0.00 ? 10  LEU A HA   3  
ATOM 3625  H HB2  . LEU A 1 10  ? 19.841  13.040  7.708   1.00 0.00 ? 10  LEU A HB2  3  
ATOM 3626  H HB3  . LEU A 1 10  ? 19.777  12.889  5.953   1.00 0.00 ? 10  LEU A HB3  3  
ATOM 3627  H HG   . LEU A 1 10  ? 19.042  15.066  6.412   1.00 0.00 ? 10  LEU A HG   3  
ATOM 3628  H HD11 . LEU A 1 10  ? 17.116  15.065  5.246   1.00 0.00 ? 10  LEU A HD11 3  
ATOM 3629  H HD12 . LEU A 1 10  ? 16.329  13.924  6.336   1.00 0.00 ? 10  LEU A HD12 3  
ATOM 3630  H HD13 . LEU A 1 10  ? 17.445  13.338  5.102   1.00 0.00 ? 10  LEU A HD13 3  
ATOM 3631  H HD21 . LEU A 1 10  ? 18.677  15.161  8.700   1.00 0.00 ? 10  LEU A HD21 3  
ATOM 3632  H HD22 . LEU A 1 10  ? 17.554  13.801  8.681   1.00 0.00 ? 10  LEU A HD22 3  
ATOM 3633  H HD23 . LEU A 1 10  ? 17.054  15.366  8.039   1.00 0.00 ? 10  LEU A HD23 3  
ATOM 3634  N N    . ASP A 1 11  ? 19.278  10.665  5.001   1.00 0.00 ? 11  ASP A N    3  
ATOM 3635  C CA   . ASP A 1 11  ? 19.954  9.630   4.227   1.00 0.00 ? 11  ASP A CA   3  
ATOM 3636  C C    . ASP A 1 11  ? 20.347  10.152  2.848   1.00 0.00 ? 11  ASP A C    3  
ATOM 3637  O O    . ASP A 1 11  ? 19.492  10.373  1.989   1.00 0.00 ? 11  ASP A O    3  
ATOM 3638  C CB   . ASP A 1 11  ? 19.054  8.401   4.083   1.00 0.00 ? 11  ASP A CB   3  
ATOM 3639  C CG   . ASP A 1 11  ? 18.070  8.267   5.229   1.00 0.00 ? 11  ASP A CG   3  
ATOM 3640  O OD1  . ASP A 1 11  ? 17.106  9.060   5.278   1.00 0.00 ? 11  ASP A OD1  3  
ATOM 3641  O OD2  . ASP A 1 11  ? 18.264  7.370   6.075   1.00 0.00 ? 11  ASP A OD2  3  
ATOM 3642  H H    . ASP A 1 11  ? 18.967  11.476  4.546   1.00 0.00 ? 11  ASP A H    3  
ATOM 3643  H HA   . ASP A 1 11  ? 20.849  9.349   4.760   1.00 0.00 ? 11  ASP A HA   3  
ATOM 3644  H HB2  . ASP A 1 11  ? 18.497  8.477   3.161   1.00 0.00 ? 11  ASP A HB2  3  
ATOM 3645  H HB3  . ASP A 1 11  ? 19.670  7.514   4.055   1.00 0.00 ? 11  ASP A HB3  3  
ATOM 3646  N N    . LEU A 1 12  ? 21.645  10.347  2.643   1.00 0.00 ? 12  LEU A N    3  
ATOM 3647  C CA   . LEU A 1 12  ? 22.151  10.844  1.369   1.00 0.00 ? 12  LEU A CA   3  
ATOM 3648  C C    . LEU A 1 12  ? 21.335  10.291  0.205   1.00 0.00 ? 12  LEU A C    3  
ATOM 3649  O O    . LEU A 1 12  ? 20.909  11.037  -0.676  1.00 0.00 ? 12  LEU A O    3  
ATOM 3650  C CB   . LEU A 1 12  ? 23.624  10.464  1.200   1.00 0.00 ? 12  LEU A CB   3  
ATOM 3651  C CG   . LEU A 1 12  ? 24.378  11.182  0.080   1.00 0.00 ? 12  LEU A CG   3  
ATOM 3652  C CD1  . LEU A 1 12  ? 24.632  12.634  0.453   1.00 0.00 ? 12  LEU A CD1  3  
ATOM 3653  C CD2  . LEU A 1 12  ? 25.688  10.470  -0.222  1.00 0.00 ? 12  LEU A CD2  3  
ATOM 3654  H H    . LEU A 1 12  ? 22.278  10.153  3.365   1.00 0.00 ? 12  LEU A H    3  
ATOM 3655  H HA   . LEU A 1 12  ? 22.064  11.921  1.375   1.00 0.00 ? 12  LEU A HA   3  
ATOM 3656  H HB2  . LEU A 1 12  ? 24.129  10.679  2.129   1.00 0.00 ? 12  LEU A HB2  3  
ATOM 3657  H HB3  . LEU A 1 12  ? 23.670  9.402   1.004   1.00 0.00 ? 12  LEU A HB3  3  
ATOM 3658  H HG   . LEU A 1 12  ? 23.774  11.169  -0.818  1.00 0.00 ? 12  LEU A HG   3  
ATOM 3659  H HD11 . LEU A 1 12  ? 25.676  12.866  0.305   1.00 0.00 ? 12  LEU A HD11 3  
ATOM 3660  H HD12 . LEU A 1 12  ? 24.371  12.791  1.489   1.00 0.00 ? 12  LEU A HD12 3  
ATOM 3661  H HD13 . LEU A 1 12  ? 24.028  13.277  -0.171  1.00 0.00 ? 12  LEU A HD13 3  
ATOM 3662  H HD21 . LEU A 1 12  ? 26.454  10.823  0.452   1.00 0.00 ? 12  LEU A HD21 3  
ATOM 3663  H HD22 . LEU A 1 12  ? 25.982  10.675  -1.241  1.00 0.00 ? 12  LEU A HD22 3  
ATOM 3664  H HD23 . LEU A 1 12  ? 25.557  9.405   -0.094  1.00 0.00 ? 12  LEU A HD23 3  
ATOM 3665  N N    . GLU A 1 13  ? 21.119  8.980   0.210   1.00 0.00 ? 13  GLU A N    3  
ATOM 3666  C CA   . GLU A 1 13  ? 20.352  8.328   -0.845  1.00 0.00 ? 13  GLU A CA   3  
ATOM 3667  C C    . GLU A 1 13  ? 19.206  9.219   -1.314  1.00 0.00 ? 13  GLU A C    3  
ATOM 3668  O O    . GLU A 1 13  ? 18.632  9.973   -0.530  1.00 0.00 ? 13  GLU A O    3  
ATOM 3669  C CB   . GLU A 1 13  ? 19.802  6.987   -0.352  1.00 0.00 ? 13  GLU A CB   3  
ATOM 3670  C CG   . GLU A 1 13  ? 20.878  5.946   -0.095  1.00 0.00 ? 13  GLU A CG   3  
ATOM 3671  C CD   . GLU A 1 13  ? 20.351  4.734   0.649   1.00 0.00 ? 13  GLU A CD   3  
ATOM 3672  O OE1  . GLU A 1 13  ? 20.333  4.767   1.897   1.00 0.00 ? 13  GLU A OE1  3  
ATOM 3673  O OE2  . GLU A 1 13  ? 19.957  3.754   -0.016  1.00 0.00 ? 13  GLU A OE2  3  
ATOM 3674  H H    . GLU A 1 13  ? 21.485  8.438   0.941   1.00 0.00 ? 13  GLU A H    3  
ATOM 3675  H HA   . GLU A 1 13  ? 21.017  8.150   -1.676  1.00 0.00 ? 13  GLU A HA   3  
ATOM 3676  H HB2  . GLU A 1 13  ? 19.260  7.150   0.568   1.00 0.00 ? 13  GLU A HB2  3  
ATOM 3677  H HB3  . GLU A 1 13  ? 19.123  6.597   -1.095  1.00 0.00 ? 13  GLU A HB3  3  
ATOM 3678  H HG2  . GLU A 1 13  ? 21.280  5.620   -1.043  1.00 0.00 ? 13  GLU A HG2  3  
ATOM 3679  H HG3  . GLU A 1 13  ? 21.665  6.396   0.492   1.00 0.00 ? 13  GLU A HG3  3  
ATOM 3680  N N    . ASN A 1 14  ? 18.879  9.125   -2.599  1.00 0.00 ? 14  ASN A N    3  
ATOM 3681  C CA   . ASN A 1 14  ? 17.803  9.924   -3.174  1.00 0.00 ? 14  ASN A CA   3  
ATOM 3682  C C    . ASN A 1 14  ? 16.877  9.058   -4.023  1.00 0.00 ? 14  ASN A C    3  
ATOM 3683  O O    . ASN A 1 14  ? 17.188  8.742   -5.172  1.00 0.00 ? 14  ASN A O    3  
ATOM 3684  C CB   . ASN A 1 14  ? 18.379  11.059  -4.023  1.00 0.00 ? 14  ASN A CB   3  
ATOM 3685  C CG   . ASN A 1 14  ? 17.298  11.879  -4.701  1.00 0.00 ? 14  ASN A CG   3  
ATOM 3686  O OD1  . ASN A 1 14  ? 17.220  11.928  -5.929  1.00 0.00 ? 14  ASN A OD1  3  
ATOM 3687  N ND2  . ASN A 1 14  ? 16.459  12.528  -3.902  1.00 0.00 ? 14  ASN A ND2  3  
ATOM 3688  H H    . ASN A 1 14  ? 19.374  8.505   -3.174  1.00 0.00 ? 14  ASN A H    3  
ATOM 3689  H HA   . ASN A 1 14  ? 17.234  10.348  -2.360  1.00 0.00 ? 14  ASN A HA   3  
ATOM 3690  H HB2  . ASN A 1 14  ? 18.958  11.715  -3.390  1.00 0.00 ? 14  ASN A HB2  3  
ATOM 3691  H HB3  . ASN A 1 14  ? 19.020  10.642  -4.784  1.00 0.00 ? 14  ASN A HB3  3  
ATOM 3692  H HD21 . ASN A 1 14  ? 16.582  12.443  -2.934  1.00 0.00 ? 14  ASN A HD21 3  
ATOM 3693  H HD22 . ASN A 1 14  ? 15.751  13.065  -4.314  1.00 0.00 ? 14  ASN A HD22 3  
ATOM 3694  N N    . ILE A 1 15  ? 15.740  8.678   -3.450  1.00 0.00 ? 15  ILE A N    3  
ATOM 3695  C CA   . ILE A 1 15  ? 14.769  7.850   -4.154  1.00 0.00 ? 15  ILE A CA   3  
ATOM 3696  C C    . ILE A 1 15  ? 13.545  8.664   -4.561  1.00 0.00 ? 15  ILE A C    3  
ATOM 3697  O O    . ILE A 1 15  ? 13.413  9.830   -4.191  1.00 0.00 ? 15  ILE A O    3  
ATOM 3698  C CB   . ILE A 1 15  ? 14.315  6.657   -3.292  1.00 0.00 ? 15  ILE A CB   3  
ATOM 3699  C CG1  . ILE A 1 15  ? 15.481  6.138   -2.448  1.00 0.00 ? 15  ILE A CG1  3  
ATOM 3700  C CG2  . ILE A 1 15  ? 13.757  5.549   -4.173  1.00 0.00 ? 15  ILE A CG2  3  
ATOM 3701  C CD1  . ILE A 1 15  ? 16.579  5.495   -3.264  1.00 0.00 ? 15  ILE A CD1  3  
ATOM 3702  H H    . ILE A 1 15  ? 15.550  8.962   -2.531  1.00 0.00 ? 15  ILE A H    3  
ATOM 3703  H HA   . ILE A 1 15  ? 15.244  7.465   -5.045  1.00 0.00 ? 15  ILE A HA   3  
ATOM 3704  H HB   . ILE A 1 15  ? 13.527  6.995   -2.637  1.00 0.00 ? 15  ILE A HB   3  
ATOM 3705  H HG12 . ILE A 1 15  ? 15.914  6.959   -1.899  1.00 0.00 ? 15  ILE A HG12 3  
ATOM 3706  H HG13 . ILE A 1 15  ? 15.109  5.401   -1.750  1.00 0.00 ? 15  ILE A HG13 3  
ATOM 3707  H HG21 . ILE A 1 15  ? 12.686  5.657   -4.252  1.00 0.00 ? 15  ILE A HG21 3  
ATOM 3708  H HG22 . ILE A 1 15  ? 14.198  5.616   -5.157  1.00 0.00 ? 15  ILE A HG22 3  
ATOM 3709  H HG23 . ILE A 1 15  ? 13.992  4.590   -3.737  1.00 0.00 ? 15  ILE A HG23 3  
ATOM 3710  H HD11 . ILE A 1 15  ? 17.161  4.839   -2.632  1.00 0.00 ? 15  ILE A HD11 3  
ATOM 3711  H HD12 . ILE A 1 15  ? 16.142  4.921   -4.069  1.00 0.00 ? 15  ILE A HD12 3  
ATOM 3712  H HD13 . ILE A 1 15  ? 17.220  6.261   -3.674  1.00 0.00 ? 15  ILE A HD13 3  
ATOM 3713  N N    . GLN A 1 16  ? 12.653  8.040   -5.322  1.00 0.00 ? 16  GLN A N    3  
ATOM 3714  C CA   . GLN A 1 16  ? 11.439  8.706   -5.778  1.00 0.00 ? 16  GLN A CA   3  
ATOM 3715  C C    . GLN A 1 16  ? 10.298  8.498   -4.787  1.00 0.00 ? 16  GLN A C    3  
ATOM 3716  O O    . GLN A 1 16  ? 9.143   8.338   -5.180  1.00 0.00 ? 16  GLN A O    3  
ATOM 3717  C CB   . GLN A 1 16  ? 11.032  8.185   -7.158  1.00 0.00 ? 16  GLN A CB   3  
ATOM 3718  C CG   . GLN A 1 16  ? 10.746  6.693   -7.184  1.00 0.00 ? 16  GLN A CG   3  
ATOM 3719  C CD   . GLN A 1 16  ? 9.320   6.365   -6.787  1.00 0.00 ? 16  GLN A CD   3  
ATOM 3720  O OE1  . GLN A 1 16  ? 9.055   5.969   -5.651  1.00 0.00 ? 16  GLN A OE1  3  
ATOM 3721  N NE2  . GLN A 1 16  ? 8.392   6.528   -7.723  1.00 0.00 ? 16  GLN A NE2  3  
ATOM 3722  H H    . GLN A 1 16  ? 12.815  7.110   -5.584  1.00 0.00 ? 16  GLN A H    3  
ATOM 3723  H HA   . GLN A 1 16  ? 11.648  9.763   -5.850  1.00 0.00 ? 16  GLN A HA   3  
ATOM 3724  H HB2  . GLN A 1 16  ? 10.143  8.707   -7.479  1.00 0.00 ? 16  GLN A HB2  3  
ATOM 3725  H HB3  . GLN A 1 16  ? 11.831  8.389   -7.855  1.00 0.00 ? 16  GLN A HB3  3  
ATOM 3726  H HG2  . GLN A 1 16  ? 10.918  6.324   -8.184  1.00 0.00 ? 16  GLN A HG2  3  
ATOM 3727  H HG3  . GLN A 1 16  ? 11.418  6.198   -6.499  1.00 0.00 ? 16  GLN A HG3  3  
ATOM 3728  H HE21 . GLN A 1 16  ? 8.677   6.846   -8.606  1.00 0.00 ? 16  GLN A HE21 3  
ATOM 3729  H HE22 . GLN A 1 16  ? 7.463   6.323   -7.494  1.00 0.00 ? 16  GLN A HE22 3  
ATOM 3730  N N    . ILE A 1 17  ? 10.632  8.500   -3.501  1.00 0.00 ? 17  ILE A N    3  
ATOM 3731  C CA   . ILE A 1 17  ? 9.635   8.311   -2.454  1.00 0.00 ? 17  ILE A CA   3  
ATOM 3732  C C    . ILE A 1 17  ? 9.426   9.594   -1.657  1.00 0.00 ? 17  ILE A C    3  
ATOM 3733  O O    . ILE A 1 17  ? 10.374  10.285  -1.283  1.00 0.00 ? 17  ILE A O    3  
ATOM 3734  C CB   . ILE A 1 17  ? 10.039  7.181   -1.489  1.00 0.00 ? 17  ILE A CB   3  
ATOM 3735  C CG1  . ILE A 1 17  ? 10.297  5.887   -2.263  1.00 0.00 ? 17  ILE A CG1  3  
ATOM 3736  C CG2  . ILE A 1 17  ? 8.959   6.970   -0.438  1.00 0.00 ? 17  ILE A CG2  3  
ATOM 3737  C CD1  . ILE A 1 17  ? 10.756  4.741   -1.390  1.00 0.00 ? 17  ILE A CD1  3  
ATOM 3738  H H    . ILE A 1 17  ? 11.569  8.632   -3.250  1.00 0.00 ? 17  ILE A H    3  
ATOM 3739  H HA   . ILE A 1 17  ? 8.703   8.038   -2.927  1.00 0.00 ? 17  ILE A HA   3  
ATOM 3740  H HB   . ILE A 1 17  ? 10.946  7.476   -0.983  1.00 0.00 ? 17  ILE A HB   3  
ATOM 3741  H HG12 . ILE A 1 17  ? 9.387   5.583   -2.757  1.00 0.00 ? 17  ILE A HG12 3  
ATOM 3742  H HG13 . ILE A 1 17  ? 11.061  6.067   -3.005  1.00 0.00 ? 17  ILE A HG13 3  
ATOM 3743  H HG21 . ILE A 1 17  ? 8.095   6.512   -0.898  1.00 0.00 ? 17  ILE A HG21 3  
ATOM 3744  H HG22 . ILE A 1 17  ? 9.336   6.324   0.340   1.00 0.00 ? 17  ILE A HG22 3  
ATOM 3745  H HG23 . ILE A 1 17  ? 8.679   7.922   -0.013  1.00 0.00 ? 17  ILE A HG23 3  
ATOM 3746  H HD11 . ILE A 1 17  ? 11.629  5.044   -0.828  1.00 0.00 ? 17  ILE A HD11 3  
ATOM 3747  H HD12 . ILE A 1 17  ? 9.966   4.470   -0.705  1.00 0.00 ? 17  ILE A HD12 3  
ATOM 3748  H HD13 . ILE A 1 17  ? 11.005  3.892   -2.009  1.00 0.00 ? 17  ILE A HD13 3  
ATOM 3749  N N    . PRO A 1 18  ? 8.153   9.922   -1.387  1.00 0.00 ? 18  PRO A N    3  
ATOM 3750  C CA   . PRO A 1 18  ? 7.789   11.123  -0.629  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3751  C C    . PRO A 1 18  ? 8.177   11.020  0.842   1.00 0.00 ? 18  PRO A C    3  
ATOM 3752  O O    . PRO A 1 18  ? 8.196   9.930   1.414   1.00 0.00 ? 18  PRO A O    3  
ATOM 3753  C CB   . PRO A 1 18  ? 6.267   11.188  -0.777  1.00 0.00 ? 18  PRO A CB   3  
ATOM 3754  C CG   . PRO A 1 18  ? 5.850   9.779   -1.026  1.00 0.00 ? 18  PRO A CG   3  
ATOM 3755  C CD   . PRO A 1 18  ? 6.972   9.146   -1.801  1.00 0.00 ? 18  PRO A CD   3  
ATOM 3756  H HA   . PRO A 1 18  ? 8.232   12.011  -1.056  1.00 0.00 ? 18  PRO A HA   3  
ATOM 3757  H HB2  . PRO A 1 18  ? 5.830   11.575  0.132   1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3758  H HB3  . PRO A 1 18  ? 6.009   11.828  -1.608  1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3759  H HG2  . PRO A 1 18  ? 5.708   9.267   -0.086  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3760  H HG3  . PRO A 1 18  ? 4.939   9.763   -1.606  1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3761  H HD2  . PRO A 1 18  ? 7.080   8.106   -1.528  1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3762  H HD3  . PRO A 1 18  ? 6.800   9.244   -2.862  1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3763  N N    . ASP A 1 19  ? 8.485   12.161  1.449   1.00 0.00 ? 19  ASP A N    3  
ATOM 3764  C CA   . ASP A 1 19  ? 8.872   12.199  2.854   1.00 0.00 ? 19  ASP A CA   3  
ATOM 3765  C C    . ASP A 1 19  ? 7.839   11.486  3.721   1.00 0.00 ? 19  ASP A C    3  
ATOM 3766  O O    . ASP A 1 19  ? 8.189   10.769  4.658   1.00 0.00 ? 19  ASP A O    3  
ATOM 3767  C CB   . ASP A 1 19  ? 9.035   13.646  3.321   1.00 0.00 ? 19  ASP A CB   3  
ATOM 3768  C CG   . ASP A 1 19  ? 9.606   13.742  4.723   1.00 0.00 ? 19  ASP A CG   3  
ATOM 3769  O OD1  . ASP A 1 19  ? 10.632  13.083  4.991   1.00 0.00 ? 19  ASP A OD1  3  
ATOM 3770  O OD2  . ASP A 1 19  ? 9.025   14.475  5.551   1.00 0.00 ? 19  ASP A OD2  3  
ATOM 3771  H H    . ASP A 1 19  ? 8.451   12.998  0.939   1.00 0.00 ? 19  ASP A H    3  
ATOM 3772  H HA   . ASP A 1 19  ? 9.818   11.690  2.952   1.00 0.00 ? 19  ASP A HA   3  
ATOM 3773  H HB2  . ASP A 1 19  ? 9.702   14.163  2.646   1.00 0.00 ? 19  ASP A HB2  3  
ATOM 3774  H HB3  . ASP A 1 19  ? 8.071   14.133  3.310   1.00 0.00 ? 19  ASP A HB3  3  
ATOM 3775  N N    . ALA A 1 20  ? 6.565   11.689  3.402   1.00 0.00 ? 20  ALA A N    3  
ATOM 3776  C CA   . ALA A 1 20  ? 5.481   11.064  4.151   1.00 0.00 ? 20  ALA A CA   3  
ATOM 3777  C C    . ALA A 1 20  ? 4.464   10.423  3.213   1.00 0.00 ? 20  ALA A C    3  
ATOM 3778  O O    . ALA A 1 20  ? 4.378   10.755  2.031   1.00 0.00 ? 20  ALA A O    3  
ATOM 3779  C CB   . ALA A 1 20  ? 4.802   12.088  5.049   1.00 0.00 ? 20  ALA A CB   3  
ATOM 3780  H H    . ALA A 1 20  ? 6.348   12.271  2.644   1.00 0.00 ? 20  ALA A H    3  
ATOM 3781  H HA   . ALA A 1 20  ? 5.909   10.297  4.781   1.00 0.00 ? 20  ALA A HA   3  
ATOM 3782  H HB1  . ALA A 1 20  ? 4.617   11.648  6.019   1.00 0.00 ? 20  ALA A HB1  3  
ATOM 3783  H HB2  . ALA A 1 20  ? 5.442   12.950  5.160   1.00 0.00 ? 20  ALA A HB2  3  
ATOM 3784  H HB3  . ALA A 1 20  ? 3.865   12.389  4.606   1.00 0.00 ? 20  ALA A HB3  3  
ATOM 3785  N N    . PRO A 1 21  ? 3.674   9.481   3.750   1.00 0.00 ? 21  PRO A N    3  
ATOM 3786  C CA   . PRO A 1 21  ? 2.648   8.774   2.978   1.00 0.00 ? 21  PRO A CA   3  
ATOM 3787  C C    . PRO A 1 21  ? 1.480   9.678   2.601   1.00 0.00 ? 21  PRO A C    3  
ATOM 3788  O O    . PRO A 1 21  ? 0.861   10.320  3.451   1.00 0.00 ? 21  PRO A O    3  
ATOM 3789  C CB   . PRO A 1 21  ? 2.185   7.670   3.932   1.00 0.00 ? 21  PRO A CB   3  
ATOM 3790  C CG   . PRO A 1 21  ? 2.480   8.197   5.294   1.00 0.00 ? 21  PRO A CG   3  
ATOM 3791  C CD   . PRO A 1 21  ? 3.721   9.035   5.153   1.00 0.00 ? 21  PRO A CD   3  
ATOM 3792  H HA   . PRO A 1 21  ? 3.061   8.329   2.084   1.00 0.00 ? 21  PRO A HA   3  
ATOM 3793  H HB2  . PRO A 1 21  ? 1.127   7.495   3.797   1.00 0.00 ? 21  PRO A HB2  3  
ATOM 3794  H HB3  . PRO A 1 21  ? 2.734   6.763   3.733   1.00 0.00 ? 21  PRO A HB3  3  
ATOM 3795  H HG2  . PRO A 1 21  ? 1.657   8.803   5.640   1.00 0.00 ? 21  PRO A HG2  3  
ATOM 3796  H HG3  . PRO A 1 21  ? 2.658   7.377   5.974   1.00 0.00 ? 21  PRO A HG3  3  
ATOM 3797  H HD2  . PRO A 1 21  ? 3.686   9.878   5.827   1.00 0.00 ? 21  PRO A HD2  3  
ATOM 3798  H HD3  . PRO A 1 21  ? 4.602   8.439   5.337   1.00 0.00 ? 21  PRO A HD3  3  
ATOM 3799  N N    . PRO A 1 22  ? 1.168   9.732   1.298   1.00 0.00 ? 22  PRO A N    3  
ATOM 3800  C CA   . PRO A 1 22  ? 0.071   10.554  0.779   1.00 0.00 ? 22  PRO A CA   3  
ATOM 3801  C C    . PRO A 1 22  ? -1.298  10.016  1.185   1.00 0.00 ? 22  PRO A C    3  
ATOM 3802  O O    . PRO A 1 22  ? -1.441  8.868   1.605   1.00 0.00 ? 22  PRO A O    3  
ATOM 3803  C CB   . PRO A 1 22  ? 0.251   10.469  -0.738  1.00 0.00 ? 22  PRO A CB   3  
ATOM 3804  C CG   . PRO A 1 22  ? 0.968   9.183   -0.964  1.00 0.00 ? 22  PRO A CG   3  
ATOM 3805  C CD   . PRO A 1 22  ? 1.863   8.994   0.230   1.00 0.00 ? 22  PRO A CD   3  
ATOM 3806  H HA   . PRO A 1 22  ? 0.161   11.582  1.097   1.00 0.00 ? 22  PRO A HA   3  
ATOM 3807  H HB2  . PRO A 1 22  ? -0.718  10.472  -1.219  1.00 0.00 ? 22  PRO A HB2  3  
ATOM 3808  H HB3  . PRO A 1 22  ? 0.832   11.311  -1.083  1.00 0.00 ? 22  PRO A HB3  3  
ATOM 3809  H HG2  . PRO A 1 22  ? 0.258   8.373   -1.032  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 3810  H HG3  . PRO A 1 22  ? 1.557   9.245   -1.867  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 3811  H HD2  . PRO A 1 22  ? 1.946   7.946   0.477   1.00 0.00 ? 22  PRO A HD2  3  
ATOM 3812  H HD3  . PRO A 1 22  ? 2.838   9.417   0.041   1.00 0.00 ? 22  PRO A HD3  3  
ATOM 3813  N N    . PRO A 1 23  ? -2.329  10.864  1.056   1.00 0.00 ? 23  PRO A N    3  
ATOM 3814  C CA   . PRO A 1 23  ? -3.705  10.495  1.402   1.00 0.00 ? 23  PRO A CA   3  
ATOM 3815  C C    . PRO A 1 23  ? -4.294  9.477   0.433   1.00 0.00 ? 23  PRO A C    3  
ATOM 3816  O O    . PRO A 1 23  ? -4.483  9.768   -0.749  1.00 0.00 ? 23  PRO A O    3  
ATOM 3817  C CB   . PRO A 1 23  ? -4.462  11.823  1.309   1.00 0.00 ? 23  PRO A CB   3  
ATOM 3818  C CG   . PRO A 1 23  ? -3.667  12.646  0.355   1.00 0.00 ? 23  PRO A CG   3  
ATOM 3819  C CD   . PRO A 1 23  ? -2.232  12.248  0.561   1.00 0.00 ? 23  PRO A CD   3  
ATOM 3820  H HA   . PRO A 1 23  ? -3.771  10.112  2.410   1.00 0.00 ? 23  PRO A HA   3  
ATOM 3821  H HB2  . PRO A 1 23  ? -5.462  11.644  0.940   1.00 0.00 ? 23  PRO A HB2  3  
ATOM 3822  H HB3  . PRO A 1 23  ? -4.509  12.284  2.284   1.00 0.00 ? 23  PRO A HB3  3  
ATOM 3823  H HG2  . PRO A 1 23  ? -3.974  12.433  -0.657  1.00 0.00 ? 23  PRO A HG2  3  
ATOM 3824  H HG3  . PRO A 1 23  ? -3.800  13.694  0.577   1.00 0.00 ? 23  PRO A HG3  3  
ATOM 3825  H HD2  . PRO A 1 23  ? -1.692  12.286  -0.374  1.00 0.00 ? 23  PRO A HD2  3  
ATOM 3826  H HD3  . PRO A 1 23  ? -1.764  12.887  1.295   1.00 0.00 ? 23  PRO A HD3  3  
ATOM 3827  N N    . ILE A 1 24  ? -4.581  8.283   0.939   1.00 0.00 ? 24  ILE A N    3  
ATOM 3828  C CA   . ILE A 1 24  ? -5.151  7.222   0.117   1.00 0.00 ? 24  ILE A CA   3  
ATOM 3829  C C    . ILE A 1 24  ? -6.201  7.773   -0.842  1.00 0.00 ? 24  ILE A C    3  
ATOM 3830  O O    . ILE A 1 24  ? -7.020  8.620   -0.484  1.00 0.00 ? 24  ILE A O    3  
ATOM 3831  C CB   . ILE A 1 24  ? -5.789  6.120   0.983   1.00 0.00 ? 24  ILE A CB   3  
ATOM 3832  C CG1  . ILE A 1 24  ? -4.742  5.495   1.906   1.00 0.00 ? 24  ILE A CG1  3  
ATOM 3833  C CG2  . ILE A 1 24  ? -6.428  5.057   0.101   1.00 0.00 ? 24  ILE A CG2  3  
ATOM 3834  C CD1  . ILE A 1 24  ? -5.336  4.630   2.996   1.00 0.00 ? 24  ILE A CD1  3  
ATOM 3835  H H    . ILE A 1 24  ? -4.408  8.111   1.888   1.00 0.00 ? 24  ILE A H    3  
ATOM 3836  H HA   . ILE A 1 24  ? -4.350  6.781   -0.459  1.00 0.00 ? 24  ILE A HA   3  
ATOM 3837  H HB   . ILE A 1 24  ? -6.566  6.570   1.583   1.00 0.00 ? 24  ILE A HB   3  
ATOM 3838  H HG12 . ILE A 1 24  ? -4.076  4.880   1.321   1.00 0.00 ? 24  ILE A HG12 3  
ATOM 3839  H HG13 . ILE A 1 24  ? -4.174  6.283   2.379   1.00 0.00 ? 24  ILE A HG13 3  
ATOM 3840  H HG21 . ILE A 1 24  ? -6.875  5.527   -0.762  1.00 0.00 ? 24  ILE A HG21 3  
ATOM 3841  H HG22 . ILE A 1 24  ? -5.673  4.357   -0.222  1.00 0.00 ? 24  ILE A HG22 3  
ATOM 3842  H HG23 . ILE A 1 24  ? -7.189  4.534   0.661   1.00 0.00 ? 24  ILE A HG23 3  
ATOM 3843  H HD11 . ILE A 1 24  ? -4.570  3.983   3.399   1.00 0.00 ? 24  ILE A HD11 3  
ATOM 3844  H HD12 . ILE A 1 24  ? -5.725  5.258   3.783   1.00 0.00 ? 24  ILE A HD12 3  
ATOM 3845  H HD13 . ILE A 1 24  ? -6.134  4.030   2.585   1.00 0.00 ? 24  ILE A HD13 3  
ATOM 3846  N N    . PRO A 1 25  ? -6.180  7.280   -2.089  1.00 0.00 ? 25  PRO A N    3  
ATOM 3847  C CA   . PRO A 1 25  ? -7.126  7.707   -3.124  1.00 0.00 ? 25  PRO A CA   3  
ATOM 3848  C C    . PRO A 1 25  ? -8.545  7.219   -2.850  1.00 0.00 ? 25  PRO A C    3  
ATOM 3849  O O    . PRO A 1 25  ? -8.820  6.635   -1.802  1.00 0.00 ? 25  PRO A O    3  
ATOM 3850  C CB   . PRO A 1 25  ? -6.575  7.059   -4.397  1.00 0.00 ? 25  PRO A CB   3  
ATOM 3851  C CG   . PRO A 1 25  ? -5.806  5.876   -3.918  1.00 0.00 ? 25  PRO A CG   3  
ATOM 3852  C CD   . PRO A 1 25  ? -5.233  6.268   -2.584  1.00 0.00 ? 25  PRO A CD   3  
ATOM 3853  H HA   . PRO A 1 25  ? -7.131  8.781   -3.238  1.00 0.00 ? 25  PRO A HA   3  
ATOM 3854  H HB2  . PRO A 1 25  ? -7.394  6.766   -5.039  1.00 0.00 ? 25  PRO A HB2  3  
ATOM 3855  H HB3  . PRO A 1 25  ? -5.937  7.760   -4.915  1.00 0.00 ? 25  PRO A HB3  3  
ATOM 3856  H HG2  . PRO A 1 25  ? -6.467  5.029   -3.808  1.00 0.00 ? 25  PRO A HG2  3  
ATOM 3857  H HG3  . PRO A 1 25  ? -5.013  5.647   -4.614  1.00 0.00 ? 25  PRO A HG3  3  
ATOM 3858  H HD2  . PRO A 1 25  ? -5.199  5.414   -1.923  1.00 0.00 ? 25  PRO A HD2  3  
ATOM 3859  H HD3  . PRO A 1 25  ? -4.247  6.691   -2.707  1.00 0.00 ? 25  PRO A HD3  3  
ATOM 3860  N N    . LYS A 1 26  ? -9.442  7.462   -3.799  1.00 0.00 ? 26  LYS A N    3  
ATOM 3861  C CA   . LYS A 1 26  ? -10.833 7.047   -3.662  1.00 0.00 ? 26  LYS A CA   3  
ATOM 3862  C C    . LYS A 1 26  ? -10.999 5.573   -4.019  1.00 0.00 ? 26  LYS A C    3  
ATOM 3863  O O    . LYS A 1 26  ? -10.489 5.112   -5.040  1.00 0.00 ? 26  LYS A O    3  
ATOM 3864  C CB   . LYS A 1 26  ? -11.734 7.904   -4.555  1.00 0.00 ? 26  LYS A CB   3  
ATOM 3865  C CG   . LYS A 1 26  ? -13.217 7.700   -4.298  1.00 0.00 ? 26  LYS A CG   3  
ATOM 3866  C CD   . LYS A 1 26  ? -13.637 8.290   -2.963  1.00 0.00 ? 26  LYS A CD   3  
ATOM 3867  C CE   . LYS A 1 26  ? -14.071 9.741   -3.106  1.00 0.00 ? 26  LYS A CE   3  
ATOM 3868  N NZ   . LYS A 1 26  ? -12.929 10.681  -2.931  1.00 0.00 ? 26  LYS A NZ   3  
ATOM 3869  H H    . LYS A 1 26  ? -9.162  7.932   -4.613  1.00 0.00 ? 26  LYS A H    3  
ATOM 3870  H HA   . LYS A 1 26  ? -11.122 7.190   -2.632  1.00 0.00 ? 26  LYS A HA   3  
ATOM 3871  H HB2  . LYS A 1 26  ? -11.500 8.945   -4.388  1.00 0.00 ? 26  LYS A HB2  3  
ATOM 3872  H HB3  . LYS A 1 26  ? -11.532 7.660   -5.588  1.00 0.00 ? 26  LYS A HB3  3  
ATOM 3873  H HG2  . LYS A 1 26  ? -13.779 8.180   -5.085  1.00 0.00 ? 26  LYS A HG2  3  
ATOM 3874  H HG3  . LYS A 1 26  ? -13.430 6.640   -4.296  1.00 0.00 ? 26  LYS A HG3  3  
ATOM 3875  H HD2  . LYS A 1 26  ? -14.464 7.716   -2.569  1.00 0.00 ? 26  LYS A HD2  3  
ATOM 3876  H HD3  . LYS A 1 26  ? -12.803 8.238   -2.277  1.00 0.00 ? 26  LYS A HD3  3  
ATOM 3877  H HE2  . LYS A 1 26  ? -14.494 9.881   -4.089  1.00 0.00 ? 26  LYS A HE2  3  
ATOM 3878  H HE3  . LYS A 1 26  ? -14.820 9.954   -2.358  1.00 0.00 ? 26  LYS A HE3  3  
ATOM 3879  H HZ1  . LYS A 1 26  ? -13.078 11.270  -2.087  1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 3880  H HZ2  . LYS A 1 26  ? -12.846 11.300  -3.762  1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 3881  H HZ3  . LYS A 1 26  ? -12.043 10.149  -2.818  1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 3882  N N    . GLU A 1 27  ? -11.716 4.841   -3.173  1.00 0.00 ? 27  GLU A N    3  
ATOM 3883  C CA   . GLU A 1 27  ? -11.948 3.419   -3.401  1.00 0.00 ? 27  GLU A CA   3  
ATOM 3884  C C    . GLU A 1 27  ? -12.580 3.185   -4.771  1.00 0.00 ? 27  GLU A C    3  
ATOM 3885  O O    . GLU A 1 27  ? -13.401 3.970   -5.246  1.00 0.00 ? 27  GLU A O    3  
ATOM 3886  C CB   . GLU A 1 27  ? -12.849 2.845   -2.306  1.00 0.00 ? 27  GLU A CB   3  
ATOM 3887  C CG   . GLU A 1 27  ? -12.104 2.482   -1.033  1.00 0.00 ? 27  GLU A CG   3  
ATOM 3888  C CD   . GLU A 1 27  ? -12.879 1.516   -0.158  1.00 0.00 ? 27  GLU A CD   3  
ATOM 3889  O OE1  . GLU A 1 27  ? -14.015 1.853   0.235   1.00 0.00 ? 27  GLU A OE1  3  
ATOM 3890  O OE2  . GLU A 1 27  ? -12.350 0.423   0.133   1.00 0.00 ? 27  GLU A OE2  3  
ATOM 3891  H H    . GLU A 1 27  ? -12.097 5.266   -2.376  1.00 0.00 ? 27  GLU A H    3  
ATOM 3892  H HA   . GLU A 1 27  ? -10.993 2.918   -3.369  1.00 0.00 ? 27  GLU A HA   3  
ATOM 3893  H HB2  . GLU A 1 27  ? -13.607 3.574   -2.061  1.00 0.00 ? 27  GLU A HB2  3  
ATOM 3894  H HB3  . GLU A 1 27  ? -13.329 1.953   -2.683  1.00 0.00 ? 27  GLU A HB3  3  
ATOM 3895  H HG2  . GLU A 1 27  ? -11.162 2.026   -1.300  1.00 0.00 ? 27  GLU A HG2  3  
ATOM 3896  H HG3  . GLU A 1 27  ? -11.919 3.385   -0.470  1.00 0.00 ? 27  GLU A HG3  3  
ATOM 3897  N N    . PRO A 1 28  ? -12.190 2.078   -5.420  1.00 0.00 ? 28  PRO A N    3  
ATOM 3898  C CA   . PRO A 1 28  ? -12.705 1.714   -6.743  1.00 0.00 ? 28  PRO A CA   3  
ATOM 3899  C C    . PRO A 1 28  ? -14.169 1.289   -6.699  1.00 0.00 ? 28  PRO A C    3  
ATOM 3900  O O    . PRO A 1 28  ? -14.627 0.711   -5.714  1.00 0.00 ? 28  PRO A O    3  
ATOM 3901  C CB   . PRO A 1 28  ? -11.819 0.536   -7.157  1.00 0.00 ? 28  PRO A CB   3  
ATOM 3902  C CG   . PRO A 1 28  ? -11.348 -0.053  -5.872  1.00 0.00 ? 28  PRO A CG   3  
ATOM 3903  C CD   . PRO A 1 28  ? -11.215 1.098   -4.913  1.00 0.00 ? 28  PRO A CD   3  
ATOM 3904  H HA   . PRO A 1 28  ? -12.587 2.521   -7.451  1.00 0.00 ? 28  PRO A HA   3  
ATOM 3905  H HB2  . PRO A 1 28  ? -12.401 -0.173  -7.728  1.00 0.00 ? 28  PRO A HB2  3  
ATOM 3906  H HB3  . PRO A 1 28  ? -10.993 0.894   -7.753  1.00 0.00 ? 28  PRO A HB3  3  
ATOM 3907  H HG2  . PRO A 1 28  ? -12.072 -0.765  -5.507  1.00 0.00 ? 28  PRO A HG2  3  
ATOM 3908  H HG3  . PRO A 1 28  ? -10.390 -0.531  -6.017  1.00 0.00 ? 28  PRO A HG3  3  
ATOM 3909  H HD2  . PRO A 1 28  ? -11.469 0.785   -3.911  1.00 0.00 ? 28  PRO A HD2  3  
ATOM 3910  H HD3  . PRO A 1 28  ? -10.213 1.500   -4.942  1.00 0.00 ? 28  PRO A HD3  3  
ATOM 3911  N N    . SER A 1 29  ? -14.897 1.579   -7.772  1.00 0.00 ? 29  SER A N    3  
ATOM 3912  C CA   . SER A 1 29  ? -16.311 1.230   -7.853  1.00 0.00 ? 29  SER A CA   3  
ATOM 3913  C C    . SER A 1 29  ? -16.618 0.513   -9.164  1.00 0.00 ? 29  SER A C    3  
ATOM 3914  O O    . SER A 1 29  ? -15.789 0.473   -10.072 1.00 0.00 ? 29  SER A O    3  
ATOM 3915  C CB   . SER A 1 29  ? -17.176 2.485   -7.731  1.00 0.00 ? 29  SER A CB   3  
ATOM 3916  O OG   . SER A 1 29  ? -17.091 3.280   -8.901  1.00 0.00 ? 29  SER A OG   3  
ATOM 3917  H H    . SER A 1 29  ? -14.474 2.041   -8.526  1.00 0.00 ? 29  SER A H    3  
ATOM 3918  H HA   . SER A 1 29  ? -16.536 0.566   -7.032  1.00 0.00 ? 29  SER A HA   3  
ATOM 3919  H HB2  . SER A 1 29  ? -18.205 2.197   -7.580  1.00 0.00 ? 29  SER A HB2  3  
ATOM 3920  H HB3  . SER A 1 29  ? -16.839 3.070   -6.887  1.00 0.00 ? 29  SER A HB3  3  
ATOM 3921  H HG   . SER A 1 29  ? -16.610 4.088   -8.706  1.00 0.00 ? 29  SER A HG   3  
ATOM 3922  N N    . ASN A 1 30  ? -17.817 -0.054  -9.255  1.00 0.00 ? 30  ASN A N    3  
ATOM 3923  C CA   . ASN A 1 30  ? -18.236 -0.771  -10.454 1.00 0.00 ? 30  ASN A CA   3  
ATOM 3924  C C    . ASN A 1 30  ? -17.209 -1.831  -10.840 1.00 0.00 ? 30  ASN A C    3  
ATOM 3925  O O    . ASN A 1 30  ? -16.845 -1.961  -12.009 1.00 0.00 ? 30  ASN A O    3  
ATOM 3926  C CB   . ASN A 1 30  ? -18.437 0.207   -11.613 1.00 0.00 ? 30  ASN A CB   3  
ATOM 3927  C CG   . ASN A 1 30  ? -19.483 1.261   -11.306 1.00 0.00 ? 30  ASN A CG   3  
ATOM 3928  O OD1  . ASN A 1 30  ? -20.481 0.985   -10.639 1.00 0.00 ? 30  ASN A OD1  3  
ATOM 3929  N ND2  . ASN A 1 30  ? -19.260 2.476   -11.792 1.00 0.00 ? 30  ASN A ND2  3  
ATOM 3930  H H    . ASN A 1 30  ? -18.435 0.011   -8.497  1.00 0.00 ? 30  ASN A H    3  
ATOM 3931  H HA   . ASN A 1 30  ? -19.175 -1.258  -10.238 1.00 0.00 ? 30  ASN A HA   3  
ATOM 3932  H HB2  . ASN A 1 30  ? -17.502 0.706   -11.822 1.00 0.00 ? 30  ASN A HB2  3  
ATOM 3933  H HB3  . ASN A 1 30  ? -18.751 -0.341  -12.489 1.00 0.00 ? 30  ASN A HB3  3  
ATOM 3934  H HD21 . ASN A 1 30  ? -18.444 2.623   -12.315 1.00 0.00 ? 30  ASN A HD21 3  
ATOM 3935  H HD22 . ASN A 1 30  ? -19.920 3.177   -11.608 1.00 0.00 ? 30  ASN A HD22 3  
ATOM 3936  N N    . TYR A 1 31  ? -16.745 -2.586  -9.850  1.00 0.00 ? 31  TYR A N    3  
ATOM 3937  C CA   . TYR A 1 31  ? -15.759 -3.633  -10.086 1.00 0.00 ? 31  TYR A CA   3  
ATOM 3938  C C    . TYR A 1 31  ? -16.125 -4.461  -11.314 1.00 0.00 ? 31  TYR A C    3  
ATOM 3939  O O    . TYR A 1 31  ? -17.301 -4.610  -11.648 1.00 0.00 ? 31  TYR A O    3  
ATOM 3940  C CB   . TYR A 1 31  ? -15.646 -4.542  -8.860  1.00 0.00 ? 31  TYR A CB   3  
ATOM 3941  C CG   . TYR A 1 31  ? -15.688 -3.794  -7.547  1.00 0.00 ? 31  TYR A CG   3  
ATOM 3942  C CD1  . TYR A 1 31  ? -14.557 -3.155  -7.053  1.00 0.00 ? 31  TYR A CD1  3  
ATOM 3943  C CD2  . TYR A 1 31  ? -16.857 -3.728  -6.799  1.00 0.00 ? 31  TYR A CD2  3  
ATOM 3944  C CE1  . TYR A 1 31  ? -14.590 -2.471  -5.853  1.00 0.00 ? 31  TYR A CE1  3  
ATOM 3945  C CE2  . TYR A 1 31  ? -16.900 -3.045  -5.599  1.00 0.00 ? 31  TYR A CE2  3  
ATOM 3946  C CZ   . TYR A 1 31  ? -15.764 -2.419  -5.130  1.00 0.00 ? 31  TYR A CZ   3  
ATOM 3947  O OH   . TYR A 1 31  ? -15.802 -1.739  -3.934  1.00 0.00 ? 31  TYR A OH   3  
ATOM 3948  H H    . TYR A 1 31  ? -17.073 -2.434  -8.939  1.00 0.00 ? 31  TYR A H    3  
ATOM 3949  H HA   . TYR A 1 31  ? -14.805 -3.158  -10.258 1.00 0.00 ? 31  TYR A HA   3  
ATOM 3950  H HB2  . TYR A 1 31  ? -16.464 -5.246  -8.866  1.00 0.00 ? 31  TYR A HB2  3  
ATOM 3951  H HB3  . TYR A 1 31  ? -14.712 -5.082  -8.905  1.00 0.00 ? 31  TYR A HB3  3  
ATOM 3952  H HD1  . TYR A 1 31  ? -13.640 -3.198  -7.621  1.00 0.00 ? 31  TYR A HD1  3  
ATOM 3953  H HD2  . TYR A 1 31  ? -17.745 -4.220  -7.169  1.00 0.00 ? 31  TYR A HD2  3  
ATOM 3954  H HE1  . TYR A 1 31  ? -13.701 -1.980  -5.485  1.00 0.00 ? 31  TYR A HE1  3  
ATOM 3955  H HE2  . TYR A 1 31  ? -17.819 -3.004  -5.032  1.00 0.00 ? 31  TYR A HE2  3  
ATOM 3956  H HH   . TYR A 1 31  ? -15.239 -2.183  -3.296  1.00 0.00 ? 31  TYR A HH   3  
ATOM 3957  N N    . ASP A 1 32  ? -15.110 -4.997  -11.982 1.00 0.00 ? 32  ASP A N    3  
ATOM 3958  C CA   . ASP A 1 32  ? -15.324 -5.812  -13.173 1.00 0.00 ? 32  ASP A CA   3  
ATOM 3959  C C    . ASP A 1 32  ? -15.501 -7.281  -12.802 1.00 0.00 ? 32  ASP A C    3  
ATOM 3960  O O    . ASP A 1 32  ? -16.292 -7.996  -13.418 1.00 0.00 ? 32  ASP A O    3  
ATOM 3961  C CB   . ASP A 1 32  ? -14.150 -5.656  -14.140 1.00 0.00 ? 32  ASP A CB   3  
ATOM 3962  C CG   . ASP A 1 32  ? -14.229 -4.374  -14.945 1.00 0.00 ? 32  ASP A CG   3  
ATOM 3963  O OD1  . ASP A 1 32  ? -14.503 -3.313  -14.346 1.00 0.00 ? 32  ASP A OD1  3  
ATOM 3964  O OD2  . ASP A 1 32  ? -14.017 -4.431  -16.174 1.00 0.00 ? 32  ASP A OD2  3  
ATOM 3965  H H    . ASP A 1 32  ? -14.195 -4.843  -11.666 1.00 0.00 ? 32  ASP A H    3  
ATOM 3966  H HA   . ASP A 1 32  ? -16.224 -5.464  -13.655 1.00 0.00 ? 32  ASP A HA   3  
ATOM 3967  H HB2  . ASP A 1 32  ? -13.227 -5.649  -13.579 1.00 0.00 ? 32  ASP A HB2  3  
ATOM 3968  H HB3  . ASP A 1 32  ? -14.143 -6.491  -14.826 1.00 0.00 ? 32  ASP A HB3  3  
ATOM 3969  N N    . PHE A 1 33  ? -14.761 -7.724  -11.792 1.00 0.00 ? 33  PHE A N    3  
ATOM 3970  C CA   . PHE A 1 33  ? -14.835 -9.109  -11.339 1.00 0.00 ? 33  PHE A CA   3  
ATOM 3971  C C    . PHE A 1 33  ? -15.980 -9.297  -10.349 1.00 0.00 ? 33  PHE A C    3  
ATOM 3972  O O    . PHE A 1 33  ? -15.875 -10.076 -9.402  1.00 0.00 ? 33  PHE A O    3  
ATOM 3973  C CB   . PHE A 1 33  ? -13.513 -9.528  -10.693 1.00 0.00 ? 33  PHE A CB   3  
ATOM 3974  C CG   . PHE A 1 33  ? -13.352 -9.034  -9.284  1.00 0.00 ? 33  PHE A CG   3  
ATOM 3975  C CD1  . PHE A 1 33  ? -13.024 -7.711  -9.032  1.00 0.00 ? 33  PHE A CD1  3  
ATOM 3976  C CD2  . PHE A 1 33  ? -13.528 -9.892  -8.210  1.00 0.00 ? 33  PHE A CD2  3  
ATOM 3977  C CE1  . PHE A 1 33  ? -12.875 -7.253  -7.737  1.00 0.00 ? 33  PHE A CE1  3  
ATOM 3978  C CE2  . PHE A 1 33  ? -13.381 -9.440  -6.913  1.00 0.00 ? 33  PHE A CE2  3  
ATOM 3979  C CZ   . PHE A 1 33  ? -13.053 -8.119  -6.676  1.00 0.00 ? 33  PHE A CZ   3  
ATOM 3980  H H    . PHE A 1 33  ? -14.149 -7.106  -11.340 1.00 0.00 ? 33  PHE A H    3  
ATOM 3981  H HA   . PHE A 1 33  ? -15.016 -9.729  -12.203 1.00 0.00 ? 33  PHE A HA   3  
ATOM 3982  H HB2  . PHE A 1 33  ? -13.455 -10.606 -10.675 1.00 0.00 ? 33  PHE A HB2  3  
ATOM 3983  H HB3  . PHE A 1 33  ? -12.694 -9.138  -11.279 1.00 0.00 ? 33  PHE A HB3  3  
ATOM 3984  H HD1  . PHE A 1 33  ? -12.884 -7.033  -9.862  1.00 0.00 ? 33  PHE A HD1  3  
ATOM 3985  H HD2  . PHE A 1 33  ? -13.783 -10.926 -8.394  1.00 0.00 ? 33  PHE A HD2  3  
ATOM 3986  H HE1  . PHE A 1 33  ? -12.619 -6.220  -7.555  1.00 0.00 ? 33  PHE A HE1  3  
ATOM 3987  H HE2  . PHE A 1 33  ? -13.520 -10.119 -6.085  1.00 0.00 ? 33  PHE A HE2  3  
ATOM 3988  H HZ   . PHE A 1 33  ? -12.938 -7.763  -5.663  1.00 0.00 ? 33  PHE A HZ   3  
ATOM 3989  N N    . SER A 1 34  ? -17.075 -8.578  -10.576 1.00 0.00 ? 34  SER A N    3  
ATOM 3990  C CA   . SER A 1 34  ? -18.239 -8.662  -9.703  1.00 0.00 ? 34  SER A CA   3  
ATOM 3991  C C    . SER A 1 34  ? -19.498 -8.979  -10.504 1.00 0.00 ? 34  SER A C    3  
ATOM 3992  O O    . SER A 1 34  ? -20.073 -8.104  -11.151 1.00 0.00 ? 34  SER A O    3  
ATOM 3993  C CB   . SER A 1 34  ? -18.425 -7.349  -8.938  1.00 0.00 ? 34  SER A CB   3  
ATOM 3994  O OG   . SER A 1 34  ? -18.802 -6.299  -9.812  1.00 0.00 ? 34  SER A OG   3  
ATOM 3995  H H    . SER A 1 34  ? -17.099 -7.975  -11.349 1.00 0.00 ? 34  SER A H    3  
ATOM 3996  H HA   . SER A 1 34  ? -18.066 -9.459  -8.995  1.00 0.00 ? 34  SER A HA   3  
ATOM 3997  H HB2  . SER A 1 34  ? -19.196 -7.476  -8.193  1.00 0.00 ? 34  SER A HB2  3  
ATOM 3998  H HB3  . SER A 1 34  ? -17.496 -7.083  -8.454  1.00 0.00 ? 34  SER A HB3  3  
ATOM 3999  H HG   . SER A 1 34  ? -18.040 -5.744  -9.993  1.00 0.00 ? 34  SER A HG   3  
ATOM 4000  N N    . GLY A 1 35  ? -19.922 -10.238 -10.455 1.00 0.00 ? 35  GLY A N    3  
ATOM 4001  C CA   . GLY A 1 35  ? -21.109 -10.651 -11.180 1.00 0.00 ? 35  GLY A CA   3  
ATOM 4002  C C    . GLY A 1 35  ? -22.389 -10.241 -10.478 1.00 0.00 ? 35  GLY A C    3  
ATOM 4003  O O    . GLY A 1 35  ? -22.368 -9.559  -9.454  1.00 0.00 ? 35  GLY A O    3  
ATOM 4004  H H    . GLY A 1 35  ? -19.423 -10.893 -9.922  1.00 0.00 ? 35  GLY A H    3  
ATOM 4005  H HA2  . GLY A 1 35  ? -21.091 -10.204 -12.163 1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4006  H HA3  . GLY A 1 35  ? -21.098 -11.726 -11.285 1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4007  N N    . PRO A 1 36  ? -23.534 -10.659 -11.036 1.00 0.00 ? 36  PRO A N    3  
ATOM 4008  C CA   . PRO A 1 36  ? -24.851 -10.342 -10.474 1.00 0.00 ? 36  PRO A CA   3  
ATOM 4009  C C    . PRO A 1 36  ? -25.110 -11.070 -9.159  1.00 0.00 ? 36  PRO A C    3  
ATOM 4010  O O    . PRO A 1 36  ? -26.171 -10.918 -8.554  1.00 0.00 ? 36  PRO A O    3  
ATOM 4011  C CB   . PRO A 1 36  ? -25.823 -10.824 -11.553 1.00 0.00 ? 36  PRO A CB   3  
ATOM 4012  C CG   . PRO A 1 36  ? -25.079 -11.888 -12.285 1.00 0.00 ? 36  PRO A CG   3  
ATOM 4013  C CD   . PRO A 1 36  ? -23.633 -11.475 -12.258 1.00 0.00 ? 36  PRO A CD   3  
ATOM 4014  H HA   . PRO A 1 36  ? -24.973 -9.279  -10.326 1.00 0.00 ? 36  PRO A HA   3  
ATOM 4015  H HB2  . PRO A 1 36  ? -26.716 -11.216 -11.087 1.00 0.00 ? 36  PRO A HB2  3  
ATOM 4016  H HB3  . PRO A 1 36  ? -26.080 -10.003 -12.205 1.00 0.00 ? 36  PRO A HB3  3  
ATOM 4017  H HG2  . PRO A 1 36  ? -25.208 -12.836 -11.786 1.00 0.00 ? 36  PRO A HG2  3  
ATOM 4018  H HG3  . PRO A 1 36  ? -25.432 -11.947 -13.304 1.00 0.00 ? 36  PRO A HG3  3  
ATOM 4019  H HD2  . PRO A 1 36  ? -22.994 -12.343 -12.195 1.00 0.00 ? 36  PRO A HD2  3  
ATOM 4020  H HD3  . PRO A 1 36  ? -23.391 -10.889 -13.132 1.00 0.00 ? 36  PRO A HD3  3  
ATOM 4021  N N    . SER A 1 37  ? -24.134 -11.859 -8.722  1.00 0.00 ? 37  SER A N    3  
ATOM 4022  C CA   . SER A 1 37  ? -24.259 -12.613 -7.481  1.00 0.00 ? 37  SER A CA   3  
ATOM 4023  C C    . SER A 1 37  ? -25.390 -13.632 -7.575  1.00 0.00 ? 37  SER A C    3  
ATOM 4024  O O    . SER A 1 37  ? -26.151 -13.821 -6.626  1.00 0.00 ? 37  SER A O    3  
ATOM 4025  C CB   . SER A 1 37  ? -24.508 -11.665 -6.306  1.00 0.00 ? 37  SER A CB   3  
ATOM 4026  O OG   . SER A 1 37  ? -24.424 -12.351 -5.069  1.00 0.00 ? 37  SER A OG   3  
ATOM 4027  H H    . SER A 1 37  ? -23.312 -11.938 -9.250  1.00 0.00 ? 37  SER A H    3  
ATOM 4028  H HA   . SER A 1 37  ? -23.330 -13.139 -7.317  1.00 0.00 ? 37  SER A HA   3  
ATOM 4029  H HB2  . SER A 1 37  ? -23.769 -10.879 -6.319  1.00 0.00 ? 37  SER A HB2  3  
ATOM 4030  H HB3  . SER A 1 37  ? -25.494 -11.233 -6.399  1.00 0.00 ? 37  SER A HB3  3  
ATOM 4031  H HG   . SER A 1 37  ? -23.732 -11.959 -4.531  1.00 0.00 ? 37  SER A HG   3  
ATOM 4032  N N    . SER A 1 38  ? -25.495 -14.286 -8.727  1.00 0.00 ? 38  SER A N    3  
ATOM 4033  C CA   . SER A 1 38  ? -26.535 -15.283 -8.949  1.00 0.00 ? 38  SER A CA   3  
ATOM 4034  C C    . SER A 1 38  ? -26.176 -16.192 -10.121 1.00 0.00 ? 38  SER A C    3  
ATOM 4035  O O    . SER A 1 38  ? -25.348 -15.843 -10.961 1.00 0.00 ? 38  SER A O    3  
ATOM 4036  C CB   . SER A 1 38  ? -27.879 -14.600 -9.212  1.00 0.00 ? 38  SER A CB   3  
ATOM 4037  O OG   . SER A 1 38  ? -27.944 -14.096 -10.534 1.00 0.00 ? 38  SER A OG   3  
ATOM 4038  H H    . SER A 1 38  ? -24.858 -14.091 -9.447  1.00 0.00 ? 38  SER A H    3  
ATOM 4039  H HA   . SER A 1 38  ? -26.615 -15.883 -8.055  1.00 0.00 ? 38  SER A HA   3  
ATOM 4040  H HB2  . SER A 1 38  ? -28.676 -15.314 -9.071  1.00 0.00 ? 38  SER A HB2  3  
ATOM 4041  H HB3  . SER A 1 38  ? -28.003 -13.780 -8.520  1.00 0.00 ? 38  SER A HB3  3  
ATOM 4042  H HG   . SER A 1 38  ? -27.310 -13.383 -10.637 1.00 0.00 ? 38  SER A HG   3  
ATOM 4043  N N    . GLY A 1 39  ? -26.806 -17.362 -10.169 1.00 0.00 ? 39  GLY A N    3  
ATOM 4044  C CA   . GLY A 1 39  ? -26.541 -18.304 -11.241 1.00 0.00 ? 39  GLY A CA   3  
ATOM 4045  C C    . GLY A 1 39  ? -27.300 -19.605 -11.071 1.00 0.00 ? 39  GLY A C    3  
ATOM 4046  O O    . GLY A 1 39  ? -28.139 -19.729 -10.178 1.00 0.00 ? 39  GLY A O    3  
ATOM 4047  H H    . GLY A 1 39  ? -27.457 -17.587 -9.472  1.00 0.00 ? 39  GLY A H    3  
ATOM 4048  H HA2  . GLY A 1 39  ? -26.825 -17.853 -12.180 1.00 0.00 ? 39  GLY A HA2  3  
ATOM 4049  H HA3  . GLY A 1 39  ? -25.482 -18.518 -11.262 1.00 0.00 ? 39  GLY A HA3  3  
ATOM 4050  N N    . ILE A 1 40  ? -27.006 -20.576 -11.929 1.00 0.00 ? 40  ILE A N    3  
ATOM 4051  C CA   . ILE A 1 40  ? -27.668 -21.873 -11.870 1.00 0.00 ? 40  ILE A CA   3  
ATOM 4052  C C    . ILE A 1 40  ? -27.358 -22.588 -10.559 1.00 0.00 ? 40  ILE A C    3  
ATOM 4053  O O    . ILE A 1 40  ? -27.947 -23.624 -10.252 1.00 0.00 ? 40  ILE A O    3  
ATOM 4054  C CB   . ILE A 1 40  ? -27.247 -22.774 -13.045 1.00 0.00 ? 40  ILE A CB   3  
ATOM 4055  C CG1  . ILE A 1 40  ? -25.746 -23.066 -12.981 1.00 0.00 ? 40  ILE A CG1  3  
ATOM 4056  C CG2  . ILE A 1 40  ? -27.608 -22.120 -14.370 1.00 0.00 ? 40  ILE A CG2  3  
ATOM 4057  C CD1  . ILE A 1 40  ? -25.363 -24.401 -13.581 1.00 0.00 ? 40  ILE A CD1  3  
ATOM 4058  H H    . ILE A 1 40  ? -26.329 -20.416 -12.619 1.00 0.00 ? 40  ILE A H    3  
ATOM 4059  H HA   . ILE A 1 40  ? -28.734 -21.707 -11.933 1.00 0.00 ? 40  ILE A HA   3  
ATOM 4060  H HB   . ILE A 1 40  ? -27.790 -23.704 -12.970 1.00 0.00 ? 40  ILE A HB   3  
ATOM 4061  H HG12 . ILE A 1 40  ? -25.213 -22.297 -13.517 1.00 0.00 ? 40  ILE A HG12 3  
ATOM 4062  H HG13 . ILE A 1 40  ? -25.431 -23.063 -11.947 1.00 0.00 ? 40  ILE A HG13 3  
ATOM 4063  H HG21 . ILE A 1 40  ? -26.977 -22.516 -15.152 1.00 0.00 ? 40  ILE A HG21 3  
ATOM 4064  H HG22 . ILE A 1 40  ? -28.642 -22.328 -14.604 1.00 0.00 ? 40  ILE A HG22 3  
ATOM 4065  H HG23 . ILE A 1 40  ? -27.463 -21.053 -14.297 1.00 0.00 ? 40  ILE A HG23 3  
ATOM 4066  H HD11 . ILE A 1 40  ? -26.189 -24.783 -14.164 1.00 0.00 ? 40  ILE A HD11 3  
ATOM 4067  H HD12 . ILE A 1 40  ? -24.502 -24.275 -14.220 1.00 0.00 ? 40  ILE A HD12 3  
ATOM 4068  H HD13 . ILE A 1 40  ? -25.129 -25.097 -12.790 1.00 0.00 ? 40  ILE A HD13 3  
ATOM 4069  N N    . GLU A 1 41  ? -26.431 -22.027 -9.790  1.00 0.00 ? 41  GLU A N    3  
ATOM 4070  C CA   . GLU A 1 41  ? -26.044 -22.611 -8.511  1.00 0.00 ? 41  GLU A CA   3  
ATOM 4071  C C    . GLU A 1 41  ? -26.655 -21.833 -7.350  1.00 0.00 ? 41  GLU A C    3  
ATOM 4072  O O    . GLU A 1 41  ? -26.158 -20.774 -6.969  1.00 0.00 ? 41  GLU A O    3  
ATOM 4073  C CB   . GLU A 1 41  ? -24.520 -22.637 -8.377  1.00 0.00 ? 41  GLU A CB   3  
ATOM 4074  C CG   . GLU A 1 41  ? -24.024 -23.490 -7.221  1.00 0.00 ? 41  GLU A CG   3  
ATOM 4075  C CD   . GLU A 1 41  ? -24.776 -23.219 -5.933  1.00 0.00 ? 41  GLU A CD   3  
ATOM 4076  O OE1  . GLU A 1 41  ? -25.823 -23.862 -5.709  1.00 0.00 ? 41  GLU A OE1  3  
ATOM 4077  O OE2  . GLU A 1 41  ? -24.316 -22.364 -5.147  1.00 0.00 ? 41  GLU A OE2  3  
ATOM 4078  H H    . GLU A 1 41  ? -25.996 -21.201 -10.089 1.00 0.00 ? 41  GLU A H    3  
ATOM 4079  H HA   . GLU A 1 41  ? -26.415 -23.625 -8.484  1.00 0.00 ? 41  GLU A HA   3  
ATOM 4080  H HB2  . GLU A 1 41  ? -24.096 -23.024 -9.292  1.00 0.00 ? 41  GLU A HB2  3  
ATOM 4081  H HB3  . GLU A 1 41  ? -24.167 -21.627 -8.228  1.00 0.00 ? 41  GLU A HB3  3  
ATOM 4082  H HG2  . GLU A 1 41  ? -24.148 -24.531 -7.480  1.00 0.00 ? 41  GLU A HG2  3  
ATOM 4083  H HG3  . GLU A 1 41  ? -22.977 -23.282 -7.060  1.00 0.00 ? 41  GLU A HG3  3  
ATOM 4084  N N    . GLY A 1 42  ? -27.737 -22.366 -6.791  1.00 0.00 ? 42  GLY A N    3  
ATOM 4085  C CA   . GLY A 1 42  ? -28.399 -21.708 -5.680  1.00 0.00 ? 42  GLY A CA   3  
ATOM 4086  C C    . GLY A 1 42  ? -29.182 -22.677 -4.816  1.00 0.00 ? 42  GLY A C    3  
ATOM 4087  O O    . GLY A 1 42  ? -28.614 -23.608 -4.246  1.00 0.00 ? 42  GLY A O    3  
ATOM 4088  H H    . GLY A 1 42  ? -28.089 -23.213 -7.137  1.00 0.00 ? 42  GLY A H    3  
ATOM 4089  H HA2  . GLY A 1 42  ? -27.654 -21.219 -5.070  1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4090  H HA3  . GLY A 1 42  ? -29.077 -20.963 -6.070  1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4091  N N    . ARG A 1 43  ? -30.489 -22.456 -4.717  1.00 0.00 ? 43  ARG A N    3  
ATOM 4092  C CA   . ARG A 1 43  ? -31.350 -23.315 -3.913  1.00 0.00 ? 43  ARG A CA   3  
ATOM 4093  C C    . ARG A 1 43  ? -31.819 -24.523 -4.720  1.00 0.00 ? 43  ARG A C    3  
ATOM 4094  O O    . ARG A 1 43  ? -32.886 -24.497 -5.332  1.00 0.00 ? 43  ARG A O    3  
ATOM 4095  C CB   . ARG A 1 43  ? -32.558 -22.528 -3.404  1.00 0.00 ? 43  ARG A CB   3  
ATOM 4096  C CG   . ARG A 1 43  ? -32.225 -21.561 -2.280  1.00 0.00 ? 43  ARG A CG   3  
ATOM 4097  C CD   . ARG A 1 43  ? -32.053 -22.285 -0.954  1.00 0.00 ? 43  ARG A CD   3  
ATOM 4098  N NE   . ARG A 1 43  ? -33.322 -22.790 -0.437  1.00 0.00 ? 43  ARG A NE   3  
ATOM 4099  C CZ   . ARG A 1 43  ? -33.508 -23.154 0.827   1.00 0.00 ? 43  ARG A CZ   3  
ATOM 4100  N NH1  . ARG A 1 43  ? -32.512 -23.069 1.698   1.00 0.00 ? 43  ARG A NH1  3  
ATOM 4101  N NH2  . ARG A 1 43  ? -34.692 -23.603 1.222   1.00 0.00 ? 43  ARG A NH2  3  
ATOM 4102  H H    . ARG A 1 43  ? -30.883 -21.697 -5.195  1.00 0.00 ? 43  ARG A H    3  
ATOM 4103  H HA   . ARG A 1 43  ? -30.775 -23.664 -3.068  1.00 0.00 ? 43  ARG A HA   3  
ATOM 4104  H HB2  . ARG A 1 43  ? -32.977 -21.963 -4.223  1.00 0.00 ? 43  ARG A HB2  3  
ATOM 4105  H HB3  . ARG A 1 43  ? -33.299 -23.225 -3.042  1.00 0.00 ? 43  ARG A HB3  3  
ATOM 4106  H HG2  . ARG A 1 43  ? -31.305 -21.048 -2.519  1.00 0.00 ? 43  ARG A HG2  3  
ATOM 4107  H HG3  . ARG A 1 43  ? -33.026 -20.843 -2.187  1.00 0.00 ? 43  ARG A HG3  3  
ATOM 4108  H HD2  . ARG A 1 43  ? -31.378 -23.116 -1.098  1.00 0.00 ? 43  ARG A HD2  3  
ATOM 4109  H HD3  . ARG A 1 43  ? -31.630 -21.598 -0.236  1.00 0.00 ? 43  ARG A HD3  3  
ATOM 4110  H HE   . ARG A 1 43  ? -34.072 -22.860 -1.063  1.00 0.00 ? 43  ARG A HE   3  
ATOM 4111  H HH11 . ARG A 1 43  ? -31.619 -22.730 1.404   1.00 0.00 ? 43  ARG A HH11 3  
ATOM 4112  H HH12 . ARG A 1 43  ? -32.655 -23.343 2.650   1.00 0.00 ? 43  ARG A HH12 3  
ATOM 4113  H HH21 . ARG A 1 43  ? -35.446 -23.668 0.568   1.00 0.00 ? 43  ARG A HH21 3  
ATOM 4114  H HH22 . ARG A 1 43  ? -34.831 -23.877 2.173   1.00 0.00 ? 43  ARG A HH22 3  
ATOM 4115  N N    . GLY A 1 44  ? -31.012 -25.580 -4.717  1.00 0.00 ? 44  GLY A N    3  
ATOM 4116  C CA   . GLY A 1 44  ? -31.361 -26.781 -5.453  1.00 0.00 ? 44  GLY A CA   3  
ATOM 4117  C C    . GLY A 1 44  ? -30.223 -27.781 -5.504  1.00 0.00 ? 44  GLY A C    3  
ATOM 4118  O O    . GLY A 1 44  ? -29.088 -27.424 -5.817  1.00 0.00 ? 44  GLY A O    3  
ATOM 4119  H H    . GLY A 1 44  ? -30.173 -25.543 -4.212  1.00 0.00 ? 44  GLY A H    3  
ATOM 4120  H HA2  . GLY A 1 44  ? -32.213 -27.245 -4.979  1.00 0.00 ? 44  GLY A HA2  3  
ATOM 4121  H HA3  . GLY A 1 44  ? -31.629 -26.506 -6.462  1.00 0.00 ? 44  GLY A HA3  3  
ATOM 4122  N N    . SER A 1 45  ? -30.527 -29.037 -5.193  1.00 0.00 ? 45  SER A N    3  
ATOM 4123  C CA   . SER A 1 45  ? -29.519 -30.091 -5.200  1.00 0.00 ? 45  SER A CA   3  
ATOM 4124  C C    . SER A 1 45  ? -28.546 -29.906 -6.361  1.00 0.00 ? 45  SER A C    3  
ATOM 4125  O O    . SER A 1 45  ? -27.335 -30.056 -6.201  1.00 0.00 ? 45  SER A O    3  
ATOM 4126  C CB   . SER A 1 45  ? -30.187 -31.464 -5.294  1.00 0.00 ? 45  SER A CB   3  
ATOM 4127  O OG   . SER A 1 45  ? -31.095 -31.516 -6.380  1.00 0.00 ? 45  SER A OG   3  
ATOM 4128  H H    . SER A 1 45  ? -31.450 -29.260 -4.952  1.00 0.00 ? 45  SER A H    3  
ATOM 4129  H HA   . SER A 1 45  ? -28.969 -30.030 -4.272  1.00 0.00 ? 45  SER A HA   3  
ATOM 4130  H HB2  . SER A 1 45  ? -29.430 -32.221 -5.436  1.00 0.00 ? 45  SER A HB2  3  
ATOM 4131  H HB3  . SER A 1 45  ? -30.726 -31.662 -4.379  1.00 0.00 ? 45  SER A HB3  3  
ATOM 4132  H HG   . SER A 1 45  ? -31.649 -30.732 -6.372  1.00 0.00 ? 45  SER A HG   3  
ATOM 4133  N N    . SER A 1 46  ? -29.087 -29.578 -7.530  1.00 0.00 ? 46  SER A N    3  
ATOM 4134  C CA   . SER A 1 46  ? -28.268 -29.375 -8.720  1.00 0.00 ? 46  SER A CA   3  
ATOM 4135  C C    . SER A 1 46  ? -27.293 -28.220 -8.519  1.00 0.00 ? 46  SER A C    3  
ATOM 4136  O O    . SER A 1 46  ? -27.666 -27.157 -8.024  1.00 0.00 ? 46  SER A O    3  
ATOM 4137  C CB   . SER A 1 46  ? -29.157 -29.102 -9.935  1.00 0.00 ? 46  SER A CB   3  
ATOM 4138  O OG   . SER A 1 46  ? -28.378 -28.786 -11.076 1.00 0.00 ? 46  SER A OG   3  
ATOM 4139  H H    . SER A 1 46  ? -30.059 -29.472 -7.594  1.00 0.00 ? 46  SER A H    3  
ATOM 4140  H HA   . SER A 1 46  ? -27.705 -30.280 -8.893  1.00 0.00 ? 46  SER A HA   3  
ATOM 4141  H HB2  . SER A 1 46  ? -29.749 -29.978 -10.150 1.00 0.00 ? 46  SER A HB2  3  
ATOM 4142  H HB3  . SER A 1 46  ? -29.811 -28.269 -9.719  1.00 0.00 ? 46  SER A HB3  3  
ATOM 4143  H HG   . SER A 1 46  ? -28.947 -28.731 -11.847 1.00 0.00 ? 46  SER A HG   3  
ATOM 4144  N N    . GLY A 1 47  ? -26.040 -28.436 -8.906  1.00 0.00 ? 47  GLY A N    3  
ATOM 4145  C CA   . GLY A 1 47  ? -25.029 -27.405 -8.760  1.00 0.00 ? 47  GLY A CA   3  
ATOM 4146  C C    . GLY A 1 47  ? -24.278 -27.142 -10.051 1.00 0.00 ? 47  GLY A C    3  
ATOM 4147  O O    . GLY A 1 47  ? -24.652 -27.649 -11.108 1.00 0.00 ? 47  GLY A O    3  
ATOM 4148  H H    . GLY A 1 47  ? -25.800 -29.304 -9.295  1.00 0.00 ? 47  GLY A H    3  
ATOM 4149  H HA2  . GLY A 1 47  ? -25.507 -26.491 -8.441  1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4150  H HA3  . GLY A 1 47  ? -24.323 -27.714 -8.003  1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4151  N N    . SER A 1 48  ? -23.217 -26.346 -9.965  1.00 0.00 ? 48  SER A N    3  
ATOM 4152  C CA   . SER A 1 48  ? -22.415 -26.012 -11.136 1.00 0.00 ? 48  SER A CA   3  
ATOM 4153  C C    . SER A 1 48  ? -20.956 -26.404 -10.924 1.00 0.00 ? 48  SER A C    3  
ATOM 4154  O O    . SER A 1 48  ? -20.484 -26.496 -9.791  1.00 0.00 ? 48  SER A O    3  
ATOM 4155  C CB   . SER A 1 48  ? -22.515 -24.516 -11.439 1.00 0.00 ? 48  SER A CB   3  
ATOM 4156  O OG   . SER A 1 48  ? -21.590 -24.137 -12.443 1.00 0.00 ? 48  SER A OG   3  
ATOM 4157  H H    . SER A 1 48  ? -22.970 -25.973 -9.093  1.00 0.00 ? 48  SER A H    3  
ATOM 4158  H HA   . SER A 1 48  ? -22.807 -26.568 -11.975 1.00 0.00 ? 48  SER A HA   3  
ATOM 4159  H HB2  . SER A 1 48  ? -23.513 -24.286 -11.779 1.00 0.00 ? 48  SER A HB2  3  
ATOM 4160  H HB3  . SER A 1 48  ? -22.302 -23.955 -10.540 1.00 0.00 ? 48  SER A HB3  3  
ATOM 4161  H HG   . SER A 1 48  ? -20.855 -23.668 -12.042 1.00 0.00 ? 48  SER A HG   3  
ATOM 4162  N N    . SER A 1 49  ? -20.246 -26.634 -12.024 1.00 0.00 ? 49  SER A N    3  
ATOM 4163  C CA   . SER A 1 49  ? -18.841 -27.020 -11.961 1.00 0.00 ? 49  SER A CA   3  
ATOM 4164  C C    . SER A 1 49  ? -18.230 -27.076 -13.358 1.00 0.00 ? 49  SER A C    3  
ATOM 4165  O O    . SER A 1 49  ? -18.938 -27.231 -14.352 1.00 0.00 ? 49  SER A O    3  
ATOM 4166  C CB   . SER A 1 49  ? -18.694 -28.378 -11.272 1.00 0.00 ? 49  SER A CB   3  
ATOM 4167  O OG   . SER A 1 49  ? -19.348 -29.397 -12.008 1.00 0.00 ? 49  SER A OG   3  
ATOM 4168  H H    . SER A 1 49  ? -20.679 -26.544 -12.900 1.00 0.00 ? 49  SER A H    3  
ATOM 4169  H HA   . SER A 1 49  ? -18.318 -26.273 -11.382 1.00 0.00 ? 49  SER A HA   3  
ATOM 4170  H HB2  . SER A 1 49  ? -17.647 -28.625 -11.190 1.00 0.00 ? 49  SER A HB2  3  
ATOM 4171  H HB3  . SER A 1 49  ? -19.130 -28.326 -10.285 1.00 0.00 ? 49  SER A HB3  3  
ATOM 4172  H HG   . SER A 1 49  ? -18.695 -29.928 -12.469 1.00 0.00 ? 49  SER A HG   3  
ATOM 4173  N N    . GLY A 1 50  ? -16.908 -26.950 -13.424 1.00 0.00 ? 50  GLY A N    3  
ATOM 4174  C CA   . GLY A 1 50  ? -16.222 -26.989 -14.702 1.00 0.00 ? 50  GLY A CA   3  
ATOM 4175  C C    . GLY A 1 50  ? -14.860 -27.647 -14.609 1.00 0.00 ? 50  GLY A C    3  
ATOM 4176  O O    . GLY A 1 50  ? -14.564 -28.344 -13.639 1.00 0.00 ? 50  GLY A O    3  
ATOM 4177  H H    . GLY A 1 50  ? -16.394 -26.829 -12.598 1.00 0.00 ? 50  GLY A H    3  
ATOM 4178  H HA2  . GLY A 1 50  ? -16.828 -27.538 -15.407 1.00 0.00 ? 50  GLY A HA2  3  
ATOM 4179  H HA3  . GLY A 1 50  ? -16.097 -25.978 -15.061 1.00 0.00 ? 50  GLY A HA3  3  
ATOM 4180  N N    . SER A 1 51  ? -14.027 -27.426 -15.622 1.00 0.00 ? 51  SER A N    3  
ATOM 4181  C CA   . SER A 1 51  ? -12.690 -28.007 -15.653 1.00 0.00 ? 51  SER A CA   3  
ATOM 4182  C C    . SER A 1 51  ? -11.642 -26.983 -15.228 1.00 0.00 ? 51  SER A C    3  
ATOM 4183  O O    . SER A 1 51  ? -10.816 -27.250 -14.355 1.00 0.00 ? 51  SER A O    3  
ATOM 4184  C CB   . SER A 1 51  ? -12.371 -28.529 -17.055 1.00 0.00 ? 51  SER A CB   3  
ATOM 4185  O OG   . SER A 1 51  ? -13.400 -29.380 -17.530 1.00 0.00 ? 51  SER A OG   3  
ATOM 4186  H H    . SER A 1 51  ? -14.321 -26.860 -16.367 1.00 0.00 ? 51  SER A H    3  
ATOM 4187  H HA   . SER A 1 51  ? -12.672 -28.834 -14.958 1.00 0.00 ? 51  SER A HA   3  
ATOM 4188  H HB2  . SER A 1 51  ? -12.269 -27.695 -17.733 1.00 0.00 ? 51  SER A HB2  3  
ATOM 4189  H HB3  . SER A 1 51  ? -11.445 -29.085 -17.027 1.00 0.00 ? 51  SER A HB3  3  
ATOM 4190  H HG   . SER A 1 51  ? -13.723 -29.924 -16.809 1.00 0.00 ? 51  SER A HG   3  
ATOM 4191  N N    . SER A 1 52  ? -11.684 -25.810 -15.852 1.00 0.00 ? 52  SER A N    3  
ATOM 4192  C CA   . SER A 1 52  ? -10.736 -24.746 -15.542 1.00 0.00 ? 52  SER A CA   3  
ATOM 4193  C C    . SER A 1 52  ? -11.466 -23.476 -15.114 1.00 0.00 ? 52  SER A C    3  
ATOM 4194  O O    . SER A 1 52  ? -12.479 -23.101 -15.702 1.00 0.00 ? 52  SER A O    3  
ATOM 4195  C CB   . SER A 1 52  ? -9.850  -24.454 -16.754 1.00 0.00 ? 52  SER A CB   3  
ATOM 4196  O OG   . SER A 1 52  ? -10.599 -23.867 -17.804 1.00 0.00 ? 52  SER A OG   3  
ATOM 4197  H H    . SER A 1 52  ? -12.366 -25.658 -16.539 1.00 0.00 ? 52  SER A H    3  
ATOM 4198  H HA   . SER A 1 52  ? -10.115 -25.083 -14.725 1.00 0.00 ? 52  SER A HA   3  
ATOM 4199  H HB2  . SER A 1 52  ? -9.062  -23.775 -16.466 1.00 0.00 ? 52  SER A HB2  3  
ATOM 4200  H HB3  . SER A 1 52  ? -9.416  -25.378 -17.110 1.00 0.00 ? 52  SER A HB3  3  
ATOM 4201  H HG   . SER A 1 52  ? -11.218 -23.230 -17.439 1.00 0.00 ? 52  SER A HG   3  
ATOM 4202  N N    . GLY A 1 53  ? -10.942 -22.819 -14.084 1.00 0.00 ? 53  GLY A N    3  
ATOM 4203  C CA   . GLY A 1 53  ? -11.555 -21.598 -13.593 1.00 0.00 ? 53  GLY A CA   3  
ATOM 4204  C C    . GLY A 1 53  ? -10.745 -20.364 -13.935 1.00 0.00 ? 53  GLY A C    3  
ATOM 4205  O O    . GLY A 1 53  ? -10.941 -19.757 -14.988 1.00 0.00 ? 53  GLY A O    3  
ATOM 4206  H H    . GLY A 1 53  ? -10.132 -23.165 -13.653 1.00 0.00 ? 53  GLY A H    3  
ATOM 4207  H HA2  . GLY A 1 53  ? -12.539 -21.503 -14.028 1.00 0.00 ? 53  GLY A HA2  3  
ATOM 4208  H HA3  . GLY A 1 53  ? -11.652 -21.664 -12.520 1.00 0.00 ? 53  GLY A HA3  3  
ATOM 4209  N N    . SER A 1 54  ? -9.833  -19.991 -13.044 1.00 0.00 ? 54  SER A N    3  
ATOM 4210  C CA   . SER A 1 54  ? -8.993  -18.817 -13.254 1.00 0.00 ? 54  SER A CA   3  
ATOM 4211  C C    . SER A 1 54  ? -7.580  -19.225 -13.660 1.00 0.00 ? 54  SER A C    3  
ATOM 4212  O O    . SER A 1 54  ? -6.887  -19.922 -12.920 1.00 0.00 ? 54  SER A O    3  
ATOM 4213  C CB   . SER A 1 54  ? -8.945  -17.964 -11.985 1.00 0.00 ? 54  SER A CB   3  
ATOM 4214  O OG   . SER A 1 54  ? -10.094 -17.142 -11.878 1.00 0.00 ? 54  SER A OG   3  
ATOM 4215  H H    . SER A 1 54  ? -9.724  -20.516 -12.223 1.00 0.00 ? 54  SER A H    3  
ATOM 4216  H HA   . SER A 1 54  ? -9.431  -18.235 -14.052 1.00 0.00 ? 54  SER A HA   3  
ATOM 4217  H HB2  . SER A 1 54  ? -8.898  -18.610 -11.122 1.00 0.00 ? 54  SER A HB2  3  
ATOM 4218  H HB3  . SER A 1 54  ? -8.067  -17.334 -12.011 1.00 0.00 ? 54  SER A HB3  3  
ATOM 4219  H HG   . SER A 1 54  ? -10.232 -16.676 -12.706 1.00 0.00 ? 54  SER A HG   3  
ATOM 4220  N N    . SER A 1 55  ? -7.161  -18.786 -14.843 1.00 0.00 ? 55  SER A N    3  
ATOM 4221  C CA   . SER A 1 55  ? -5.833  -19.108 -15.351 1.00 0.00 ? 55  SER A CA   3  
ATOM 4222  C C    . SER A 1 55  ? -4.933  -17.877 -15.337 1.00 0.00 ? 55  SER A C    3  
ATOM 4223  O O    . SER A 1 55  ? -4.929  -17.086 -16.279 1.00 0.00 ? 55  SER A O    3  
ATOM 4224  C CB   . SER A 1 55  ? -5.929  -19.668 -16.772 1.00 0.00 ? 55  SER A CB   3  
ATOM 4225  O OG   . SER A 1 55  ? -6.786  -20.795 -16.819 1.00 0.00 ? 55  SER A OG   3  
ATOM 4226  H H    . SER A 1 55  ? -7.761  -18.234 -15.388 1.00 0.00 ? 55  SER A H    3  
ATOM 4227  H HA   . SER A 1 55  ? -5.405  -19.860 -14.705 1.00 0.00 ? 55  SER A HA   3  
ATOM 4228  H HB2  . SER A 1 55  ? -6.319  -18.907 -17.430 1.00 0.00 ? 55  SER A HB2  3  
ATOM 4229  H HB3  . SER A 1 55  ? -4.945  -19.963 -17.106 1.00 0.00 ? 55  SER A HB3  3  
ATOM 4230  H HG   . SER A 1 55  ? -6.264  -21.598 -16.743 1.00 0.00 ? 55  SER A HG   3  
ATOM 4231  N N    . GLY A 1 56  ? -4.169  -17.721 -14.259 1.00 0.00 ? 56  GLY A N    3  
ATOM 4232  C CA   . GLY A 1 56  ? -3.275  -16.584 -14.141 1.00 0.00 ? 56  GLY A CA   3  
ATOM 4233  C C    . GLY A 1 56  ? -1.820  -16.998 -14.054 1.00 0.00 ? 56  GLY A C    3  
ATOM 4234  O O    . GLY A 1 56  ? -1.462  -17.869 -13.261 1.00 0.00 ? 56  GLY A O    3  
ATOM 4235  H H    . GLY A 1 56  ? -4.214  -18.384 -13.539 1.00 0.00 ? 56  GLY A H    3  
ATOM 4236  H HA2  . GLY A 1 56  ? -3.406  -15.946 -15.003 1.00 0.00 ? 56  GLY A HA2  3  
ATOM 4237  H HA3  . GLY A 1 56  ? -3.533  -16.029 -13.252 1.00 0.00 ? 56  GLY A HA3  3  
ATOM 4238  N N    . ASP A 1 57  ? -0.979  -16.374 -14.871 1.00 0.00 ? 57  ASP A N    3  
ATOM 4239  C CA   . ASP A 1 57  ? 0.446   -16.683 -14.883 1.00 0.00 ? 57  ASP A CA   3  
ATOM 4240  C C    . ASP A 1 57  ? 1.273   -15.424 -15.128 1.00 0.00 ? 57  ASP A C    3  
ATOM 4241  O O    . ASP A 1 57  ? 0.735   -14.372 -15.473 1.00 0.00 ? 57  ASP A O    3  
ATOM 4242  C CB   . ASP A 1 57  ? 0.755   -17.728 -15.957 1.00 0.00 ? 57  ASP A CB   3  
ATOM 4243  C CG   . ASP A 1 57  ? -0.086  -17.541 -17.205 1.00 0.00 ? 57  ASP A CG   3  
ATOM 4244  O OD1  . ASP A 1 57  ? 0.339   -16.779 -18.098 1.00 0.00 ? 57  ASP A OD1  3  
ATOM 4245  O OD2  . ASP A 1 57  ? -1.170  -18.156 -17.288 1.00 0.00 ? 57  ASP A OD2  3  
ATOM 4246  H H    . ASP A 1 57  ? -1.325  -15.689 -15.481 1.00 0.00 ? 57  ASP A H    3  
ATOM 4247  H HA   . ASP A 1 57  ? 0.707   -17.087 -13.917 1.00 0.00 ? 57  ASP A HA   3  
ATOM 4248  H HB2  . ASP A 1 57  ? 1.796   -17.654 -16.234 1.00 0.00 ? 57  ASP A HB2  3  
ATOM 4249  H HB3  . ASP A 1 57  ? 0.561   -18.712 -15.558 1.00 0.00 ? 57  ASP A HB3  3  
ATOM 4250  N N    . LYS A 1 58  ? 2.584   -15.540 -14.948 1.00 0.00 ? 58  LYS A N    3  
ATOM 4251  C CA   . LYS A 1 58  ? 3.487   -14.412 -15.149 1.00 0.00 ? 58  LYS A CA   3  
ATOM 4252  C C    . LYS A 1 58  ? 2.881   -13.125 -14.597 1.00 0.00 ? 58  LYS A C    3  
ATOM 4253  O O    . LYS A 1 58  ? 2.989   -12.065 -15.213 1.00 0.00 ? 58  LYS A O    3  
ATOM 4254  C CB   . LYS A 1 58  ? 3.802   -14.244 -16.637 1.00 0.00 ? 58  LYS A CB   3  
ATOM 4255  C CG   . LYS A 1 58  ? 4.995   -13.343 -16.908 1.00 0.00 ? 58  LYS A CG   3  
ATOM 4256  C CD   . LYS A 1 58  ? 5.370   -13.343 -18.380 1.00 0.00 ? 58  LYS A CD   3  
ATOM 4257  C CE   . LYS A 1 58  ? 6.144   -12.090 -18.758 1.00 0.00 ? 58  LYS A CE   3  
ATOM 4258  N NZ   . LYS A 1 58  ? 7.023   -12.316 -19.939 1.00 0.00 ? 58  LYS A NZ   3  
ATOM 4259  H H    . LYS A 1 58  ? 2.955   -16.405 -14.673 1.00 0.00 ? 58  LYS A H    3  
ATOM 4260  H HA   . LYS A 1 58  ? 4.403   -14.622 -14.617 1.00 0.00 ? 58  LYS A HA   3  
ATOM 4261  H HB2  . LYS A 1 58  ? 4.006   -15.215 -17.062 1.00 0.00 ? 58  LYS A HB2  3  
ATOM 4262  H HB3  . LYS A 1 58  ? 2.938   -13.820 -17.129 1.00 0.00 ? 58  LYS A HB3  3  
ATOM 4263  H HG2  . LYS A 1 58  ? 4.748   -12.335 -16.611 1.00 0.00 ? 58  LYS A HG2  3  
ATOM 4264  H HG3  . LYS A 1 58  ? 5.838   -13.695 -16.331 1.00 0.00 ? 58  LYS A HG3  3  
ATOM 4265  H HD2  . LYS A 1 58  ? 5.984   -14.208 -18.587 1.00 0.00 ? 58  LYS A HD2  3  
ATOM 4266  H HD3  . LYS A 1 58  ? 4.467   -13.391 -18.973 1.00 0.00 ? 58  LYS A HD3  3  
ATOM 4267  H HE2  . LYS A 1 58  ? 5.441   -11.304 -18.988 1.00 0.00 ? 58  LYS A HE2  3  
ATOM 4268  H HE3  . LYS A 1 58  ? 6.754   -11.793 -17.918 1.00 0.00 ? 58  LYS A HE3  3  
ATOM 4269  H HZ1  . LYS A 1 58  ? 8.012   -12.412 -19.636 1.00 0.00 ? 58  LYS A HZ1  3  
ATOM 4270  H HZ2  . LYS A 1 58  ? 6.950   -11.513 -20.597 1.00 0.00 ? 58  LYS A HZ2  3  
ATOM 4271  H HZ3  . LYS A 1 58  ? 6.737   -13.183 -20.437 1.00 0.00 ? 58  LYS A HZ3  3  
ATOM 4272  N N    . GLU A 1 59  ? 2.247   -13.226 -13.433 1.00 0.00 ? 59  GLU A N    3  
ATOM 4273  C CA   . GLU A 1 59  ? 1.625   -12.069 -12.800 1.00 0.00 ? 59  GLU A CA   3  
ATOM 4274  C C    . GLU A 1 59  ? 2.672   -11.021 -12.436 1.00 0.00 ? 59  GLU A C    3  
ATOM 4275  O O    . GLU A 1 59  ? 3.869   -11.227 -12.638 1.00 0.00 ? 59  GLU A O    3  
ATOM 4276  C CB   . GLU A 1 59  ? 0.858   -12.497 -11.547 1.00 0.00 ? 59  GLU A CB   3  
ATOM 4277  C CG   . GLU A 1 59  ? -0.454  -13.202 -11.848 1.00 0.00 ? 59  GLU A CG   3  
ATOM 4278  C CD   . GLU A 1 59  ? -1.239  -12.526 -12.956 1.00 0.00 ? 59  GLU A CD   3  
ATOM 4279  O OE1  . GLU A 1 59  ? -1.310  -11.280 -12.959 1.00 0.00 ? 59  GLU A OE1  3  
ATOM 4280  O OE2  . GLU A 1 59  ? -1.781  -13.246 -13.821 1.00 0.00 ? 59  GLU A OE2  3  
ATOM 4281  H H    . GLU A 1 59  ? 2.195   -14.099 -12.991 1.00 0.00 ? 59  GLU A H    3  
ATOM 4282  H HA   . GLU A 1 59  ? 0.932   -11.638 -13.506 1.00 0.00 ? 59  GLU A HA   3  
ATOM 4283  H HB2  . GLU A 1 59  ? 1.479   -13.166 -10.970 1.00 0.00 ? 59  GLU A HB2  3  
ATOM 4284  H HB3  . GLU A 1 59  ? 0.643   -11.619 -10.955 1.00 0.00 ? 59  GLU A HB3  3  
ATOM 4285  H HG2  . GLU A 1 59  ? -0.242  -14.218 -12.146 1.00 0.00 ? 59  GLU A HG2  3  
ATOM 4286  H HG3  . GLU A 1 59  ? -1.058  -13.209 -10.952 1.00 0.00 ? 59  GLU A HG3  3  
ATOM 4287  N N    . ARG A 1 60  ? 2.213   -9.896  -11.898 1.00 0.00 ? 60  ARG A N    3  
ATOM 4288  C CA   . ARG A 1 60  ? 3.108   -8.814  -11.507 1.00 0.00 ? 60  ARG A CA   3  
ATOM 4289  C C    . ARG A 1 60  ? 3.587   -8.997  -10.070 1.00 0.00 ? 60  ARG A C    3  
ATOM 4290  O O    . ARG A 1 60  ? 2.913   -9.629  -9.256  1.00 0.00 ? 60  ARG A O    3  
ATOM 4291  C CB   . ARG A 1 60  ? 2.405   -7.463  -11.654 1.00 0.00 ? 60  ARG A CB   3  
ATOM 4292  C CG   . ARG A 1 60  ? 3.353   -6.313  -11.955 1.00 0.00 ? 60  ARG A CG   3  
ATOM 4293  C CD   . ARG A 1 60  ? 2.593   -5.033  -12.267 1.00 0.00 ? 60  ARG A CD   3  
ATOM 4294  N NE   . ARG A 1 60  ? 2.173   -4.972  -13.664 1.00 0.00 ? 60  ARG A NE   3  
ATOM 4295  C CZ   . ARG A 1 60  ? 2.986   -4.644  -14.662 1.00 0.00 ? 60  ARG A CZ   3  
ATOM 4296  N NH1  . ARG A 1 60  ? 4.255   -4.349  -14.418 1.00 0.00 ? 60  ARG A NH1  3  
ATOM 4297  N NH2  . ARG A 1 60  ? 2.530   -4.611  -15.908 1.00 0.00 ? 60  ARG A NH2  3  
ATOM 4298  H H    . ARG A 1 60  ? 1.248   -9.790  -11.762 1.00 0.00 ? 60  ARG A H    3  
ATOM 4299  H HA   . ARG A 1 60  ? 3.964   -8.838  -12.165 1.00 0.00 ? 60  ARG A HA   3  
ATOM 4300  H HB2  . ARG A 1 60  ? 1.687   -7.529  -12.458 1.00 0.00 ? 60  ARG A HB2  3  
ATOM 4301  H HB3  . ARG A 1 60  ? 1.885   -7.240  -10.735 1.00 0.00 ? 60  ARG A HB3  3  
ATOM 4302  H HG2  . ARG A 1 60  ? 3.984   -6.144  -11.095 1.00 0.00 ? 60  ARG A HG2  3  
ATOM 4303  H HG3  . ARG A 1 60  ? 3.963   -6.576  -12.806 1.00 0.00 ? 60  ARG A HG3  3  
ATOM 4304  H HD2  . ARG A 1 60  ? 1.718   -4.987  -11.636 1.00 0.00 ? 60  ARG A HD2  3  
ATOM 4305  H HD3  . ARG A 1 60  ? 3.234   -4.190  -12.056 1.00 0.00 ? 60  ARG A HD3  3  
ATOM 4306  H HE   . ARG A 1 60  ? 1.239   -5.186  -13.867 1.00 0.00 ? 60  ARG A HE   3  
ATOM 4307  H HH11 . ARG A 1 60  ? 4.602   -4.375  -13.481 1.00 0.00 ? 60  ARG A HH11 3  
ATOM 4308  H HH12 . ARG A 1 60  ? 4.866   -4.104  -15.172 1.00 0.00 ? 60  ARG A HH12 3  
ATOM 4309  H HH21 . ARG A 1 60  ? 1.573   -4.833  -16.096 1.00 0.00 ? 60  ARG A HH21 3  
ATOM 4310  H HH22 . ARG A 1 60  ? 3.142   -4.364  -16.658 1.00 0.00 ? 60  ARG A HH22 3  
ATOM 4311  N N    . HIS A 1 61  ? 4.754   -8.440  -9.765  1.00 0.00 ? 61  HIS A N    3  
ATOM 4312  C CA   . HIS A 1 61  ? 5.323   -8.542  -8.426  1.00 0.00 ? 61  HIS A CA   3  
ATOM 4313  C C    . HIS A 1 61  ? 5.347   -7.179  -7.740  1.00 0.00 ? 61  HIS A C    3  
ATOM 4314  O O    . HIS A 1 61  ? 5.997   -6.247  -8.212  1.00 0.00 ? 61  HIS A O    3  
ATOM 4315  C CB   . HIS A 1 61  ? 6.739   -9.117  -8.492  1.00 0.00 ? 61  HIS A CB   3  
ATOM 4316  C CG   . HIS A 1 61  ? 7.114   -9.925  -7.288  1.00 0.00 ? 61  HIS A CG   3  
ATOM 4317  N ND1  . HIS A 1 61  ? 8.233   -9.665  -6.526  1.00 0.00 ? 61  HIS A ND1  3  
ATOM 4318  C CD2  . HIS A 1 61  ? 6.510   -10.993 -6.716  1.00 0.00 ? 61  HIS A CD2  3  
ATOM 4319  C CE1  . HIS A 1 61  ? 8.302   -10.538 -5.537  1.00 0.00 ? 61  HIS A CE1  3  
ATOM 4320  N NE2  . HIS A 1 61  ? 7.268   -11.355 -5.629  1.00 0.00 ? 61  HIS A NE2  3  
ATOM 4321  H H    . HIS A 1 61  ? 5.245   -7.949  -10.456 1.00 0.00 ? 61  HIS A H    3  
ATOM 4322  H HA   . HIS A 1 61  ? 4.700   -9.209  -7.850  1.00 0.00 ? 61  HIS A HA   3  
ATOM 4323  H HB2  . HIS A 1 61  ? 6.820   -9.757  -9.359  1.00 0.00 ? 61  HIS A HB2  3  
ATOM 4324  H HB3  . HIS A 1 61  ? 7.446   -8.306  -8.582  1.00 0.00 ? 61  HIS A HB3  3  
ATOM 4325  H HD1  . HIS A 1 61  ? 8.880   -8.948  -6.686  1.00 0.00 ? 61  HIS A HD1  3  
ATOM 4326  H HD2  . HIS A 1 61  ? 5.601   -11.473 -7.051  1.00 0.00 ? 61  HIS A HD2  3  
ATOM 4327  H HE1  . HIS A 1 61  ? 9.072   -10.578 -4.781  1.00 0.00 ? 61  HIS A HE1  3  
ATOM 4328  H HE2  . HIS A 1 61  ? 7.124   -12.148 -5.072  1.00 0.00 ? 61  HIS A HE2  3  
ATOM 4329  N N    . GLY A 1 62  ? 4.633   -7.070  -6.624  1.00 0.00 ? 62  GLY A N    3  
ATOM 4330  C CA   . GLY A 1 62  ? 4.586   -5.818  -5.893  1.00 0.00 ? 62  GLY A CA   3  
ATOM 4331  C C    . GLY A 1 62  ? 5.037   -5.969  -4.454  1.00 0.00 ? 62  GLY A C    3  
ATOM 4332  O O    . GLY A 1 62  ? 5.071   -7.077  -3.919  1.00 0.00 ? 62  GLY A O    3  
ATOM 4333  H H    . GLY A 1 62  ? 4.135   -7.847  -6.294  1.00 0.00 ? 62  GLY A H    3  
ATOM 4334  H HA2  . GLY A 1 62  ? 5.225   -5.101  -6.386  1.00 0.00 ? 62  GLY A HA2  3  
ATOM 4335  H HA3  . GLY A 1 62  ? 3.571   -5.447  -5.903  1.00 0.00 ? 62  GLY A HA3  3  
ATOM 4336  N N    . VAL A 1 63  ? 5.385   -4.851  -3.824  1.00 0.00 ? 63  VAL A N    3  
ATOM 4337  C CA   . VAL A 1 63  ? 5.837   -4.864  -2.438  1.00 0.00 ? 63  VAL A CA   3  
ATOM 4338  C C    . VAL A 1 63  ? 5.322   -3.645  -1.680  1.00 0.00 ? 63  VAL A C    3  
ATOM 4339  O O    . VAL A 1 63  ? 5.503   -2.509  -2.117  1.00 0.00 ? 63  VAL A O    3  
ATOM 4340  C CB   . VAL A 1 63  ? 7.375   -4.899  -2.349  1.00 0.00 ? 63  VAL A CB   3  
ATOM 4341  C CG1  . VAL A 1 63  ? 7.839   -4.470  -0.965  1.00 0.00 ? 63  VAL A CG1  3  
ATOM 4342  C CG2  . VAL A 1 63  ? 7.897   -6.286  -2.689  1.00 0.00 ? 63  VAL A CG2  3  
ATOM 4343  H H    . VAL A 1 63  ? 5.336   -3.998  -4.303  1.00 0.00 ? 63  VAL A H    3  
ATOM 4344  H HA   . VAL A 1 63  ? 5.450   -5.757  -1.968  1.00 0.00 ? 63  VAL A HA   3  
ATOM 4345  H HB   . VAL A 1 63  ? 7.772   -4.200  -3.070  1.00 0.00 ? 63  VAL A HB   3  
ATOM 4346  H HG11 . VAL A 1 63  ? 7.222   -4.943  -0.216  1.00 0.00 ? 63  VAL A HG11 3  
ATOM 4347  H HG12 . VAL A 1 63  ? 8.869   -4.764  -0.824  1.00 0.00 ? 63  VAL A HG12 3  
ATOM 4348  H HG13 . VAL A 1 63  ? 7.756   -3.397  -0.874  1.00 0.00 ? 63  VAL A HG13 3  
ATOM 4349  H HG21 . VAL A 1 63  ? 8.826   -6.199  -3.232  1.00 0.00 ? 63  VAL A HG21 3  
ATOM 4350  H HG22 . VAL A 1 63  ? 8.062   -6.841  -1.778  1.00 0.00 ? 63  VAL A HG22 3  
ATOM 4351  H HG23 . VAL A 1 63  ? 7.171   -6.804  -3.300  1.00 0.00 ? 63  VAL A HG23 3  
ATOM 4352  N N    . ALA A 1 64  ? 4.681   -3.890  -0.542  1.00 0.00 ? 64  ALA A N    3  
ATOM 4353  C CA   . ALA A 1 64  ? 4.142   -2.812  0.278   1.00 0.00 ? 64  ALA A CA   3  
ATOM 4354  C C    . ALA A 1 64  ? 5.258   -1.932  0.831   1.00 0.00 ? 64  ALA A C    3  
ATOM 4355  O O    . ALA A 1 64  ? 6.172   -2.419  1.498   1.00 0.00 ? 64  ALA A O    3  
ATOM 4356  C CB   . ALA A 1 64  ? 3.304   -3.381  1.413   1.00 0.00 ? 64  ALA A CB   3  
ATOM 4357  H H    . ALA A 1 64  ? 4.569   -4.817  -0.247  1.00 0.00 ? 64  ALA A H    3  
ATOM 4358  H HA   . ALA A 1 64  ? 3.498   -2.209  -0.345  1.00 0.00 ? 64  ALA A HA   3  
ATOM 4359  H HB1  . ALA A 1 64  ? 3.929   -3.991  2.049   1.00 0.00 ? 64  ALA A HB1  3  
ATOM 4360  H HB2  . ALA A 1 64  ? 2.884   -2.571  1.990   1.00 0.00 ? 64  ALA A HB2  3  
ATOM 4361  H HB3  . ALA A 1 64  ? 2.508   -3.985  1.004   1.00 0.00 ? 64  ALA A HB3  3  
ATOM 4362  N N    . ILE A 1 65  ? 5.179   -0.636  0.549   1.00 0.00 ? 65  ILE A N    3  
ATOM 4363  C CA   . ILE A 1 65  ? 6.183   0.310   1.019   1.00 0.00 ? 65  ILE A CA   3  
ATOM 4364  C C    . ILE A 1 65  ? 5.650   1.146   2.179   1.00 0.00 ? 65  ILE A C    3  
ATOM 4365  O O    . ILE A 1 65  ? 6.420   1.728   2.943   1.00 0.00 ? 65  ILE A O    3  
ATOM 4366  C CB   . ILE A 1 65  ? 6.640   1.252   -0.110  1.00 0.00 ? 65  ILE A CB   3  
ATOM 4367  C CG1  . ILE A 1 65  ? 5.434   1.945   -0.747  1.00 0.00 ? 65  ILE A CG1  3  
ATOM 4368  C CG2  . ILE A 1 65  ? 7.429   0.480   -1.157  1.00 0.00 ? 65  ILE A CG2  3  
ATOM 4369  C CD1  . ILE A 1 65  ? 5.799   2.863   -1.892  1.00 0.00 ? 65  ILE A CD1  3  
ATOM 4370  H H    . ILE A 1 65  ? 4.427   -0.309  0.013   1.00 0.00 ? 65  ILE A H    3  
ATOM 4371  H HA   . ILE A 1 65  ? 7.039   -0.254  1.360   1.00 0.00 ? 65  ILE A HA   3  
ATOM 4372  H HB   . ILE A 1 65  ? 7.292   2.000   0.317   1.00 0.00 ? 65  ILE A HB   3  
ATOM 4373  H HG12 . ILE A 1 65  ? 4.756   1.197   -1.126  1.00 0.00 ? 65  ILE A HG12 3  
ATOM 4374  H HG13 . ILE A 1 65  ? 4.929   2.535   0.005   1.00 0.00 ? 65  ILE A HG13 3  
ATOM 4375  H HG21 . ILE A 1 65  ? 8.413   0.256   -0.774  1.00 0.00 ? 65  ILE A HG21 3  
ATOM 4376  H HG22 . ILE A 1 65  ? 6.914   -0.441  -1.387  1.00 0.00 ? 65  ILE A HG22 3  
ATOM 4377  H HG23 . ILE A 1 65  ? 7.518   1.076   -2.053  1.00 0.00 ? 65  ILE A HG23 3  
ATOM 4378  H HD11 . ILE A 1 65  ? 4.965   3.516   -2.109  1.00 0.00 ? 65  ILE A HD11 3  
ATOM 4379  H HD12 . ILE A 1 65  ? 6.658   3.458   -1.617  1.00 0.00 ? 65  ILE A HD12 3  
ATOM 4380  H HD13 . ILE A 1 65  ? 6.032   2.275   -2.766  1.00 0.00 ? 65  ILE A HD13 3  
ATOM 4381  N N    . TYR A 1 66  ? 4.329   1.198   2.305   1.00 0.00 ? 66  TYR A N    3  
ATOM 4382  C CA   . TYR A 1 66  ? 3.692   1.962   3.371   1.00 0.00 ? 66  TYR A CA   3  
ATOM 4383  C C    . TYR A 1 66  ? 2.724   1.090   4.164   1.00 0.00 ? 66  TYR A C    3  
ATOM 4384  O O    . TYR A 1 66  ? 2.005   0.268   3.597   1.00 0.00 ? 66  TYR A O    3  
ATOM 4385  C CB   . TYR A 1 66  ? 2.952   3.168   2.790   1.00 0.00 ? 66  TYR A CB   3  
ATOM 4386  C CG   . TYR A 1 66  ? 3.870   4.238   2.245   1.00 0.00 ? 66  TYR A CG   3  
ATOM 4387  C CD1  . TYR A 1 66  ? 4.846   4.819   3.045   1.00 0.00 ? 66  TYR A CD1  3  
ATOM 4388  C CD2  . TYR A 1 66  ? 3.764   4.666   0.927   1.00 0.00 ? 66  TYR A CD2  3  
ATOM 4389  C CE1  . TYR A 1 66  ? 5.686   5.797   2.551   1.00 0.00 ? 66  TYR A CE1  3  
ATOM 4390  C CE2  . TYR A 1 66  ? 4.601   5.643   0.424   1.00 0.00 ? 66  TYR A CE2  3  
ATOM 4391  C CZ   . TYR A 1 66  ? 5.561   6.205   1.239   1.00 0.00 ? 66  TYR A CZ   3  
ATOM 4392  O OH   . TYR A 1 66  ? 6.397   7.178   0.743   1.00 0.00 ? 66  TYR A OH   3  
ATOM 4393  H H    . TYR A 1 66  ? 3.768   0.712   1.665   1.00 0.00 ? 66  TYR A H    3  
ATOM 4394  H HA   . TYR A 1 66  ? 4.468   2.314   4.035   1.00 0.00 ? 66  TYR A HA   3  
ATOM 4395  H HB2  . TYR A 1 66  ? 2.314   2.837   1.985   1.00 0.00 ? 66  TYR A HB2  3  
ATOM 4396  H HB3  . TYR A 1 66  ? 2.344   3.615   3.564   1.00 0.00 ? 66  TYR A HB3  3  
ATOM 4397  H HD1  . TYR A 1 66  ? 4.942   4.496   4.072   1.00 0.00 ? 66  TYR A HD1  3  
ATOM 4398  H HD2  . TYR A 1 66  ? 3.011   4.224   0.290   1.00 0.00 ? 66  TYR A HD2  3  
ATOM 4399  H HE1  . TYR A 1 66  ? 6.438   6.237   3.189   1.00 0.00 ? 66  TYR A HE1  3  
ATOM 4400  H HE2  . TYR A 1 66  ? 4.503   5.963   -0.603  1.00 0.00 ? 66  TYR A HE2  3  
ATOM 4401  H HH   . TYR A 1 66  ? 7.111   7.335   1.365   1.00 0.00 ? 66  TYR A HH   3  
ATOM 4402  N N    . ASN A 1 67  ? 2.711   1.276   5.479   1.00 0.00 ? 67  ASN A N    3  
ATOM 4403  C CA   . ASN A 1 67  ? 1.832   0.506   6.352   1.00 0.00 ? 67  ASN A CA   3  
ATOM 4404  C C    . ASN A 1 67  ? 0.373   0.899   6.137   1.00 0.00 ? 67  ASN A C    3  
ATOM 4405  O O    . ASN A 1 67  ? -0.050  1.991   6.517   1.00 0.00 ? 67  ASN A O    3  
ATOM 4406  C CB   . ASN A 1 67  ? 2.218   0.720   7.817   1.00 0.00 ? 67  ASN A CB   3  
ATOM 4407  C CG   . ASN A 1 67  ? 3.718   0.671   8.032   1.00 0.00 ? 67  ASN A CG   3  
ATOM 4408  O OD1  . ASN A 1 67  ? 4.333   -0.393  7.958   1.00 0.00 ? 67  ASN A OD1  3  
ATOM 4409  N ND2  . ASN A 1 67  ? 4.315   1.827   8.300   1.00 0.00 ? 67  ASN A ND2  3  
ATOM 4410  H H    . ASN A 1 67  ? 3.308   1.946   5.874   1.00 0.00 ? 67  ASN A H    3  
ATOM 4411  H HA   . ASN A 1 67  ? 1.951   -0.538  6.106   1.00 0.00 ? 67  ASN A HA   3  
ATOM 4412  H HB2  . ASN A 1 67  ? 1.858   1.685   8.141   1.00 0.00 ? 67  ASN A HB2  3  
ATOM 4413  H HB3  . ASN A 1 67  ? 1.761   -0.051  8.420   1.00 0.00 ? 67  ASN A HB3  3  
ATOM 4414  H HD21 . ASN A 1 67  ? 3.761   2.635   8.344   1.00 0.00 ? 67  ASN A HD21 3  
ATOM 4415  H HD22 . ASN A 1 67  ? 5.284   1.825   8.443   1.00 0.00 ? 67  ASN A HD22 3  
ATOM 4416  N N    . PHE A 1 68  ? -0.392  0.001   5.525   1.00 0.00 ? 68  PHE A N    3  
ATOM 4417  C CA   . PHE A 1 68  ? -1.803  0.253   5.259   1.00 0.00 ? 68  PHE A CA   3  
ATOM 4418  C C    . PHE A 1 68  ? -2.687  -0.500  6.250   1.00 0.00 ? 68  PHE A C    3  
ATOM 4419  O O    . PHE A 1 68  ? -2.449  -1.671  6.542   1.00 0.00 ? 68  PHE A O    3  
ATOM 4420  C CB   . PHE A 1 68  ? -2.156  -0.160  3.828   1.00 0.00 ? 68  PHE A CB   3  
ATOM 4421  C CG   . PHE A 1 68  ? -3.609  0.020   3.493   1.00 0.00 ? 68  PHE A CG   3  
ATOM 4422  C CD1  . PHE A 1 68  ? -4.544  -0.928  3.875   1.00 0.00 ? 68  PHE A CD1  3  
ATOM 4423  C CD2  . PHE A 1 68  ? -4.039  1.138   2.796   1.00 0.00 ? 68  PHE A CD2  3  
ATOM 4424  C CE1  . PHE A 1 68  ? -5.882  -0.765  3.569   1.00 0.00 ? 68  PHE A CE1  3  
ATOM 4425  C CE2  . PHE A 1 68  ? -5.376  1.306   2.487   1.00 0.00 ? 68  PHE A CE2  3  
ATOM 4426  C CZ   . PHE A 1 68  ? -6.298  0.353   2.873   1.00 0.00 ? 68  PHE A CZ   3  
ATOM 4427  H H    . PHE A 1 68  ? 0.003   -0.852  5.246   1.00 0.00 ? 68  PHE A H    3  
ATOM 4428  H HA   . PHE A 1 68  ? -1.977  1.312   5.372   1.00 0.00 ? 68  PHE A HA   3  
ATOM 4429  H HB2  . PHE A 1 68  ? -1.580  0.436   3.137   1.00 0.00 ? 68  PHE A HB2  3  
ATOM 4430  H HB3  . PHE A 1 68  ? -1.909  -1.202  3.691   1.00 0.00 ? 68  PHE A HB3  3  
ATOM 4431  H HD1  . PHE A 1 68  ? -4.220  -1.804  4.419   1.00 0.00 ? 68  PHE A HD1  3  
ATOM 4432  H HD2  . PHE A 1 68  ? -3.319  1.883   2.493   1.00 0.00 ? 68  PHE A HD2  3  
ATOM 4433  H HE1  . PHE A 1 68  ? -6.601  -1.512  3.872   1.00 0.00 ? 68  PHE A HE1  3  
ATOM 4434  H HE2  . PHE A 1 68  ? -5.698  2.181   1.943   1.00 0.00 ? 68  PHE A HE2  3  
ATOM 4435  H HZ   . PHE A 1 68  ? -7.343  0.483   2.633   1.00 0.00 ? 68  PHE A HZ   3  
ATOM 4436  N N    . GLN A 1 69  ? -3.705  0.183   6.763   1.00 0.00 ? 69  GLN A N    3  
ATOM 4437  C CA   . GLN A 1 69  ? -4.623  -0.420  7.722   1.00 0.00 ? 69  GLN A CA   3  
ATOM 4438  C C    . GLN A 1 69  ? -6.070  -0.097  7.367   1.00 0.00 ? 69  GLN A C    3  
ATOM 4439  O O    . GLN A 1 69  ? -6.476  1.064   7.366   1.00 0.00 ? 69  GLN A O    3  
ATOM 4440  C CB   . GLN A 1 69  ? -4.311  0.071   9.137   1.00 0.00 ? 69  GLN A CB   3  
ATOM 4441  C CG   . GLN A 1 69  ? -5.139  -0.611  10.214  1.00 0.00 ? 69  GLN A CG   3  
ATOM 4442  C CD   . GLN A 1 69  ? -4.636  -2.002  10.544  1.00 0.00 ? 69  GLN A CD   3  
ATOM 4443  O OE1  . GLN A 1 69  ? -5.383  -2.978  10.471  1.00 0.00 ? 69  GLN A OE1  3  
ATOM 4444  N NE2  . GLN A 1 69  ? -3.364  -2.100  10.911  1.00 0.00 ? 69  GLN A NE2  3  
ATOM 4445  H H    . GLN A 1 69  ? -3.842  1.114   6.490   1.00 0.00 ? 69  GLN A H    3  
ATOM 4446  H HA   . GLN A 1 69  ? -4.486  -1.490  7.683   1.00 0.00 ? 69  GLN A HA   3  
ATOM 4447  H HB2  . GLN A 1 69  ? -3.267  -0.112  9.346   1.00 0.00 ? 69  GLN A HB2  3  
ATOM 4448  H HB3  . GLN A 1 69  ? -4.499  1.133   9.186   1.00 0.00 ? 69  GLN A HB3  3  
ATOM 4449  H HG2  . GLN A 1 69  ? -5.105  -0.010  11.110  1.00 0.00 ? 69  GLN A HG2  3  
ATOM 4450  H HG3  . GLN A 1 69  ? -6.161  -0.685  9.870   1.00 0.00 ? 69  GLN A HG3  3  
ATOM 4451  H HE21 . GLN A 1 69  ? -2.829  -1.279  10.948  1.00 0.00 ? 69  GLN A HE21 3  
ATOM 4452  H HE22 . GLN A 1 69  ? -3.013  -2.987  11.131  1.00 0.00 ? 69  GLN A HE22 3  
ATOM 4453  N N    . GLY A 1 70  ? -6.846  -1.134  7.065   1.00 0.00 ? 70  GLY A N    3  
ATOM 4454  C CA   . GLY A 1 70  ? -8.240  -0.940  6.711   1.00 0.00 ? 70  GLY A CA   3  
ATOM 4455  C C    . GLY A 1 70  ? -9.186  -1.447  7.782   1.00 0.00 ? 70  GLY A C    3  
ATOM 4456  O O    . GLY A 1 70  ? -8.834  -1.489  8.961   1.00 0.00 ? 70  GLY A O    3  
ATOM 4457  H H    . GLY A 1 70  ? -6.468  -2.038  7.081   1.00 0.00 ? 70  GLY A H    3  
ATOM 4458  H HA2  . GLY A 1 70  ? -8.418  0.114   6.559   1.00 0.00 ? 70  GLY A HA2  3  
ATOM 4459  H HA3  . GLY A 1 70  ? -8.443  -1.466  5.790   1.00 0.00 ? 70  GLY A HA3  3  
ATOM 4460  N N    . SER A 1 71  ? -10.390 -1.831  7.372   1.00 0.00 ? 71  SER A N    3  
ATOM 4461  C CA   . SER A 1 71  ? -11.392 -2.332  8.306   1.00 0.00 ? 71  SER A CA   3  
ATOM 4462  C C    . SER A 1 71  ? -11.808 -3.755  7.945   1.00 0.00 ? 71  SER A C    3  
ATOM 4463  O O    . SER A 1 71  ? -11.872 -4.632  8.805   1.00 0.00 ? 71  SER A O    3  
ATOM 4464  C CB   . SER A 1 71  ? -12.618 -1.416  8.312   1.00 0.00 ? 71  SER A CB   3  
ATOM 4465  O OG   . SER A 1 71  ? -13.670 -1.979  9.077   1.00 0.00 ? 71  SER A OG   3  
ATOM 4466  H H    . SER A 1 71  ? -10.611 -1.773  6.419   1.00 0.00 ? 71  SER A H    3  
ATOM 4467  H HA   . SER A 1 71  ? -10.952 -2.337  9.292   1.00 0.00 ? 71  SER A HA   3  
ATOM 4468  H HB2  . SER A 1 71  ? -12.349 -0.462  8.740   1.00 0.00 ? 71  SER A HB2  3  
ATOM 4469  H HB3  . SER A 1 71  ? -12.961 -1.273  7.298   1.00 0.00 ? 71  SER A HB3  3  
ATOM 4470  H HG   . SER A 1 71  ? -14.301 -1.293  9.306   1.00 0.00 ? 71  SER A HG   3  
ATOM 4471  N N    . GLY A 1 72  ? -12.089 -3.975  6.664   1.00 0.00 ? 72  GLY A N    3  
ATOM 4472  C CA   . GLY A 1 72  ? -12.495 -5.292  6.210   1.00 0.00 ? 72  GLY A CA   3  
ATOM 4473  C C    . GLY A 1 72  ? -12.815 -5.322  4.728   1.00 0.00 ? 72  GLY A C    3  
ATOM 4474  O O    . GLY A 1 72  ? -13.111 -4.288  4.130   1.00 0.00 ? 72  GLY A O    3  
ATOM 4475  H H    . GLY A 1 72  ? -12.021 -3.237  6.022   1.00 0.00 ? 72  GLY A H    3  
ATOM 4476  H HA2  . GLY A 1 72  ? -11.698 -5.992  6.410   1.00 0.00 ? 72  GLY A HA2  3  
ATOM 4477  H HA3  . GLY A 1 72  ? -13.373 -5.596  6.762   1.00 0.00 ? 72  GLY A HA3  3  
ATOM 4478  N N    . ALA A 1 73  ? -12.753 -6.509  4.135   1.00 0.00 ? 73  ALA A N    3  
ATOM 4479  C CA   . ALA A 1 73  ? -13.039 -6.669  2.715   1.00 0.00 ? 73  ALA A CA   3  
ATOM 4480  C C    . ALA A 1 73  ? -14.148 -5.724  2.268   1.00 0.00 ? 73  ALA A C    3  
ATOM 4481  O O    . ALA A 1 73  ? -15.009 -5.323  3.052   1.00 0.00 ? 73  ALA A O    3  
ATOM 4482  C CB   . ALA A 1 73  ? -13.418 -8.111  2.411   1.00 0.00 ? 73  ALA A CB   3  
ATOM 4483  H H    . ALA A 1 73  ? -12.512 -7.297  4.666   1.00 0.00 ? 73  ALA A H    3  
ATOM 4484  H HA   . ALA A 1 73  ? -12.138 -6.436  2.165   1.00 0.00 ? 73  ALA A HA   3  
ATOM 4485  H HB1  . ALA A 1 73  ? -13.971 -8.520  3.244   1.00 0.00 ? 73  ALA A HB1  3  
ATOM 4486  H HB2  . ALA A 1 73  ? -14.029 -8.143  1.522   1.00 0.00 ? 73  ALA A HB2  3  
ATOM 4487  H HB3  . ALA A 1 73  ? -12.522 -8.693  2.255   1.00 0.00 ? 73  ALA A HB3  3  
ATOM 4488  N N    . PRO A 1 74  ? -14.130 -5.357  0.978   1.00 0.00 ? 74  PRO A N    3  
ATOM 4489  C CA   . PRO A 1 74  ? -13.111 -5.827  0.035   1.00 0.00 ? 74  PRO A CA   3  
ATOM 4490  C C    . PRO A 1 74  ? -11.736 -5.234  0.324   1.00 0.00 ? 74  PRO A C    3  
ATOM 4491  O O    . PRO A 1 74  ? -10.755 -5.567  -0.340  1.00 0.00 ? 74  PRO A O    3  
ATOM 4492  C CB   . PRO A 1 74  ? -13.629 -5.339  -1.320  1.00 0.00 ? 74  PRO A CB   3  
ATOM 4493  C CG   . PRO A 1 74  ? -14.483 -4.162  -0.998  1.00 0.00 ? 74  PRO A CG   3  
ATOM 4494  C CD   . PRO A 1 74  ? -15.104 -4.454  0.340   1.00 0.00 ? 74  PRO A CD   3  
ATOM 4495  H HA   . PRO A 1 74  ? -13.043 -6.905  0.030   1.00 0.00 ? 74  PRO A HA   3  
ATOM 4496  H HB2  . PRO A 1 74  ? -12.795 -5.063  -1.949  1.00 0.00 ? 74  PRO A HB2  3  
ATOM 4497  H HB3  . PRO A 1 74  ? -14.201 -6.123  -1.794  1.00 0.00 ? 74  PRO A HB3  3  
ATOM 4498  H HG2  . PRO A 1 74  ? -13.875 -3.271  -0.943  1.00 0.00 ? 74  PRO A HG2  3  
ATOM 4499  H HG3  . PRO A 1 74  ? -15.250 -4.048  -1.750  1.00 0.00 ? 74  PRO A HG3  3  
ATOM 4500  H HD2  . PRO A 1 74  ? -15.217 -3.544  0.911   1.00 0.00 ? 74  PRO A HD2  3  
ATOM 4501  H HD3  . PRO A 1 74  ? -16.058 -4.944  0.215   1.00 0.00 ? 74  PRO A HD3  3  
ATOM 4502  N N    . GLN A 1 75  ? -11.674 -4.355  1.319   1.00 0.00 ? 75  GLN A N    3  
ATOM 4503  C CA   . GLN A 1 75  ? -10.418 -3.716  1.695   1.00 0.00 ? 75  GLN A CA   3  
ATOM 4504  C C    . GLN A 1 75  ? -9.480  -4.713  2.368   1.00 0.00 ? 75  GLN A C    3  
ATOM 4505  O O    . GLN A 1 75  ? -9.864  -5.400  3.315   1.00 0.00 ? 75  GLN A O    3  
ATOM 4506  C CB   . GLN A 1 75  ? -10.682 -2.535  2.631   1.00 0.00 ? 75  GLN A CB   3  
ATOM 4507  C CG   . GLN A 1 75  ? -10.983 -1.236  1.900   1.00 0.00 ? 75  GLN A CG   3  
ATOM 4508  C CD   . GLN A 1 75  ? -11.548 -0.168  2.817   1.00 0.00 ? 75  GLN A CD   3  
ATOM 4509  O OE1  . GLN A 1 75  ? -10.840 0.377   3.664   1.00 0.00 ? 75  GLN A OE1  3  
ATOM 4510  N NE2  . GLN A 1 75  ? -12.830 0.136   2.652   1.00 0.00 ? 75  GLN A NE2  3  
ATOM 4511  H H    . GLN A 1 75  ? -12.490 -4.130  1.811   1.00 0.00 ? 75  GLN A H    3  
ATOM 4512  H HA   . GLN A 1 75  ? -9.949  -3.351  0.794   1.00 0.00 ? 75  GLN A HA   3  
ATOM 4513  H HB2  . GLN A 1 75  ? -11.526 -2.772  3.261   1.00 0.00 ? 75  GLN A HB2  3  
ATOM 4514  H HB3  . GLN A 1 75  ? -9.812  -2.380  3.251   1.00 0.00 ? 75  GLN A HB3  3  
ATOM 4515  H HG2  . GLN A 1 75  ? -10.069 -0.864  1.461   1.00 0.00 ? 75  GLN A HG2  3  
ATOM 4516  H HG3  . GLN A 1 75  ? -11.701 -1.436  1.119   1.00 0.00 ? 75  GLN A HG3  3  
ATOM 4517  H HE21 . GLN A 1 75  ? -13.333 -0.340  1.958   1.00 0.00 ? 75  GLN A HE21 3  
ATOM 4518  H HE22 . GLN A 1 75  ? -13.221 0.822   3.231   1.00 0.00 ? 75  GLN A HE22 3  
ATOM 4519  N N    . LEU A 1 76  ? -8.250  -4.786  1.873   1.00 0.00 ? 76  LEU A N    3  
ATOM 4520  C CA   . LEU A 1 76  ? -7.256  -5.700  2.426   1.00 0.00 ? 76  LEU A CA   3  
ATOM 4521  C C    . LEU A 1 76  ? -6.105  -4.930  3.066   1.00 0.00 ? 76  LEU A C    3  
ATOM 4522  O O    . LEU A 1 76  ? -5.639  -3.928  2.525   1.00 0.00 ? 76  LEU A O    3  
ATOM 4523  C CB   . LEU A 1 76  ? -6.719  -6.624  1.332   1.00 0.00 ? 76  LEU A CB   3  
ATOM 4524  C CG   . LEU A 1 76  ? -5.555  -7.532  1.731   1.00 0.00 ? 76  LEU A CG   3  
ATOM 4525  C CD1  . LEU A 1 76  ? -6.070  -8.809  2.377   1.00 0.00 ? 76  LEU A CD1  3  
ATOM 4526  C CD2  . LEU A 1 76  ? -4.691  -7.855  0.520   1.00 0.00 ? 76  LEU A CD2  3  
ATOM 4527  H H    . LEU A 1 76  ? -8.002  -4.214  1.117   1.00 0.00 ? 76  LEU A H    3  
ATOM 4528  H HA   . LEU A 1 76  ? -7.740  -6.297  3.184   1.00 0.00 ? 76  LEU A HA   3  
ATOM 4529  H HB2  . LEU A 1 76  ? -7.531  -7.255  1.004   1.00 0.00 ? 76  LEU A HB2  3  
ATOM 4530  H HB3  . LEU A 1 76  ? -6.391  -6.006  0.509   1.00 0.00 ? 76  LEU A HB3  3  
ATOM 4531  H HG   . LEU A 1 76  ? -4.938  -7.017  2.455   1.00 0.00 ? 76  LEU A HG   3  
ATOM 4532  H HD11 . LEU A 1 76  ? -5.358  -9.153  3.111   1.00 0.00 ? 76  LEU A HD11 3  
ATOM 4533  H HD12 . LEU A 1 76  ? -6.202  -9.567  1.619   1.00 0.00 ? 76  LEU A HD12 3  
ATOM 4534  H HD13 . LEU A 1 76  ? -7.017  -8.612  2.857   1.00 0.00 ? 76  LEU A HD13 3  
ATOM 4535  H HD21 . LEU A 1 76  ? -4.125  -6.980  0.238   1.00 0.00 ? 76  LEU A HD21 3  
ATOM 4536  H HD22 . LEU A 1 76  ? -5.323  -8.156  -0.302  1.00 0.00 ? 76  LEU A HD22 3  
ATOM 4537  H HD23 . LEU A 1 76  ? -4.013  -8.660  0.766   1.00 0.00 ? 76  LEU A HD23 3  
ATOM 4538  N N    . SER A 1 77  ? -5.651  -5.407  4.221   1.00 0.00 ? 77  SER A N    3  
ATOM 4539  C CA   . SER A 1 77  ? -4.556  -4.763  4.936   1.00 0.00 ? 77  SER A CA   3  
ATOM 4540  C C    . SER A 1 77  ? -3.215  -5.093  4.289   1.00 0.00 ? 77  SER A C    3  
ATOM 4541  O O    . SER A 1 77  ? -3.094  -6.070  3.548   1.00 0.00 ? 77  SER A O    3  
ATOM 4542  C CB   . SER A 1 77  ? -4.549  -5.200  6.402   1.00 0.00 ? 77  SER A CB   3  
ATOM 4543  O OG   . SER A 1 77  ? -4.035  -6.514  6.540   1.00 0.00 ? 77  SER A OG   3  
ATOM 4544  H H    . SER A 1 77  ? -6.065  -6.210  4.602   1.00 0.00 ? 77  SER A H    3  
ATOM 4545  H HA   . SER A 1 77  ? -4.712  -3.695  4.889   1.00 0.00 ? 77  SER A HA   3  
ATOM 4546  H HB2  . SER A 1 77  ? -3.932  -4.524  6.974   1.00 0.00 ? 77  SER A HB2  3  
ATOM 4547  H HB3  . SER A 1 77  ? -5.559  -5.179  6.786   1.00 0.00 ? 77  SER A HB3  3  
ATOM 4548  H HG   . SER A 1 77  ? -4.580  -7.125  6.039   1.00 0.00 ? 77  SER A HG   3  
ATOM 4549  N N    . LEU A 1 78  ? -2.209  -4.273  4.573   1.00 0.00 ? 78  LEU A N    3  
ATOM 4550  C CA   . LEU A 1 78  ? -0.875  -4.477  4.019   1.00 0.00 ? 78  LEU A CA   3  
ATOM 4551  C C    . LEU A 1 78  ? 0.195   -3.944  4.966   1.00 0.00 ? 78  LEU A C    3  
ATOM 4552  O O    . LEU A 1 78  ? -0.030  -2.973  5.688   1.00 0.00 ? 78  LEU A O    3  
ATOM 4553  C CB   . LEU A 1 78  ? -0.757  -3.790  2.658   1.00 0.00 ? 78  LEU A CB   3  
ATOM 4554  C CG   . LEU A 1 78  ? -1.332  -4.557  1.467   1.00 0.00 ? 78  LEU A CG   3  
ATOM 4555  C CD1  . LEU A 1 78  ? -1.304  -3.695  0.214   1.00 0.00 ? 78  LEU A CD1  3  
ATOM 4556  C CD2  . LEU A 1 78  ? -0.564  -5.851  1.244   1.00 0.00 ? 78  LEU A CD2  3  
ATOM 4557  H H    . LEU A 1 78  ? -2.367  -3.513  5.170   1.00 0.00 ? 78  LEU A H    3  
ATOM 4558  H HA   . LEU A 1 78  ? -0.729  -5.540  3.891   1.00 0.00 ? 78  LEU A HA   3  
ATOM 4559  H HB2  . LEU A 1 78  ? -1.269  -2.843  2.720   1.00 0.00 ? 78  LEU A HB2  3  
ATOM 4560  H HB3  . LEU A 1 78  ? 0.293   -3.618  2.466   1.00 0.00 ? 78  LEU A HB3  3  
ATOM 4561  H HG   . LEU A 1 78  ? -2.363  -4.810  1.673   1.00 0.00 ? 78  LEU A HG   3  
ATOM 4562  H HD11 . LEU A 1 78  ? -2.151  -3.026  0.217   1.00 0.00 ? 78  LEU A HD11 3  
ATOM 4563  H HD12 . LEU A 1 78  ? -1.349  -4.329  -0.660  1.00 0.00 ? 78  LEU A HD12 3  
ATOM 4564  H HD13 . LEU A 1 78  ? -0.390  -3.119  0.193   1.00 0.00 ? 78  LEU A HD13 3  
ATOM 4565  H HD21 . LEU A 1 78  ? -0.172  -5.868  0.237   1.00 0.00 ? 78  LEU A HD21 3  
ATOM 4566  H HD22 . LEU A 1 78  ? -1.226  -6.692  1.387   1.00 0.00 ? 78  LEU A HD22 3  
ATOM 4567  H HD23 . LEU A 1 78  ? 0.252   -5.911  1.950   1.00 0.00 ? 78  LEU A HD23 3  
ATOM 4568  N N    . GLN A 1 79  ? 1.359   -4.584  4.955   1.00 0.00 ? 79  GLN A N    3  
ATOM 4569  C CA   . GLN A 1 79  ? 2.465   -4.173  5.813   1.00 0.00 ? 79  GLN A CA   3  
ATOM 4570  C C    . GLN A 1 79  ? 3.753   -4.031  5.009   1.00 0.00 ? 79  GLN A C    3  
ATOM 4571  O O    . GLN A 1 79  ? 4.047   -4.852  4.139   1.00 0.00 ? 79  GLN A O    3  
ATOM 4572  C CB   . GLN A 1 79  ? 2.664   -5.182  6.944   1.00 0.00 ? 79  GLN A CB   3  
ATOM 4573  C CG   . GLN A 1 79  ? 1.784   -4.920  8.155   1.00 0.00 ? 79  GLN A CG   3  
ATOM 4574  C CD   . GLN A 1 79  ? 1.643   -6.136  9.049   1.00 0.00 ? 79  GLN A CD   3  
ATOM 4575  O OE1  . GLN A 1 79  ? 2.583   -6.524  9.743   1.00 0.00 ? 79  GLN A OE1  3  
ATOM 4576  N NE2  . GLN A 1 79  ? 0.463   -6.747  9.036   1.00 0.00 ? 79  GLN A NE2  3  
ATOM 4577  H H    . GLN A 1 79  ? 1.478   -5.351  4.358   1.00 0.00 ? 79  GLN A H    3  
ATOM 4578  H HA   . GLN A 1 79  ? 2.214   -3.213  6.239   1.00 0.00 ? 79  GLN A HA   3  
ATOM 4579  H HB2  . GLN A 1 79  ? 2.442   -6.171  6.572   1.00 0.00 ? 79  GLN A HB2  3  
ATOM 4580  H HB3  . GLN A 1 79  ? 3.696   -5.150  7.262   1.00 0.00 ? 79  GLN A HB3  3  
ATOM 4581  H HG2  . GLN A 1 79  ? 2.218   -4.117  8.733   1.00 0.00 ? 79  GLN A HG2  3  
ATOM 4582  H HG3  . GLN A 1 79  ? 0.803   -4.626  7.814   1.00 0.00 ? 79  GLN A HG3  3  
ATOM 4583  H HE21 . GLN A 1 79  ? -0.239  -6.383  8.457   1.00 0.00 ? 79  GLN A HE21 3  
ATOM 4584  H HE22 . GLN A 1 79  ? 0.344   -7.536  9.603   1.00 0.00 ? 79  GLN A HE22 3  
ATOM 4585  N N    . ILE A 1 80  ? 4.518   -2.986  5.305   1.00 0.00 ? 80  ILE A N    3  
ATOM 4586  C CA   . ILE A 1 80  ? 5.775   -2.738  4.611   1.00 0.00 ? 80  ILE A CA   3  
ATOM 4587  C C    . ILE A 1 80  ? 6.627   -4.001  4.547   1.00 0.00 ? 80  ILE A C    3  
ATOM 4588  O O    . ILE A 1 80  ? 6.745   -4.733  5.530   1.00 0.00 ? 80  ILE A O    3  
ATOM 4589  C CB   . ILE A 1 80  ? 6.585   -1.620  5.294   1.00 0.00 ? 80  ILE A CB   3  
ATOM 4590  C CG1  . ILE A 1 80  ? 5.792   -0.312  5.293   1.00 0.00 ? 80  ILE A CG1  3  
ATOM 4591  C CG2  . ILE A 1 80  ? 7.924   -1.434  4.596   1.00 0.00 ? 80  ILE A CG2  3  
ATOM 4592  C CD1  . ILE A 1 80  ? 6.480   0.812   6.035   1.00 0.00 ? 80  ILE A CD1  3  
ATOM 4593  H H    . ILE A 1 80  ? 4.230   -2.367  6.009   1.00 0.00 ? 80  ILE A H    3  
ATOM 4594  H HA   . ILE A 1 80  ? 5.543   -2.423  3.604   1.00 0.00 ? 80  ILE A HA   3  
ATOM 4595  H HB   . ILE A 1 80  ? 6.776   -1.917  6.314   1.00 0.00 ? 80  ILE A HB   3  
ATOM 4596  H HG12 . ILE A 1 80  ? 5.639   0.008   4.275   1.00 0.00 ? 80  ILE A HG12 3  
ATOM 4597  H HG13 . ILE A 1 80  ? 4.833   -0.481  5.761   1.00 0.00 ? 80  ILE A HG13 3  
ATOM 4598  H HG21 . ILE A 1 80  ? 7.784   -0.850  3.698   1.00 0.00 ? 80  ILE A HG21 3  
ATOM 4599  H HG22 . ILE A 1 80  ? 8.605   -0.919  5.257   1.00 0.00 ? 80  ILE A HG22 3  
ATOM 4600  H HG23 . ILE A 1 80  ? 8.333   -2.400  4.338   1.00 0.00 ? 80  ILE A HG23 3  
ATOM 4601  H HD11 . ILE A 1 80  ? 7.548   0.647   6.029   1.00 0.00 ? 80  ILE A HD11 3  
ATOM 4602  H HD12 . ILE A 1 80  ? 6.260   1.752   5.550   1.00 0.00 ? 80  ILE A HD12 3  
ATOM 4603  H HD13 . ILE A 1 80  ? 6.126   0.841   7.055   1.00 0.00 ? 80  ILE A HD13 3  
ATOM 4604  N N    . GLY A 1 81  ? 7.220   -4.251  3.384   1.00 0.00 ? 81  GLY A N    3  
ATOM 4605  C CA   . GLY A 1 81  ? 8.055   -5.426  3.214   1.00 0.00 ? 81  GLY A CA   3  
ATOM 4606  C C    . GLY A 1 81  ? 7.249   -6.668  2.892   1.00 0.00 ? 81  GLY A C    3  
ATOM 4607  O O    . GLY A 1 81  ? 7.749   -7.788  3.004   1.00 0.00 ? 81  GLY A O    3  
ATOM 4608  H H    . GLY A 1 81  ? 7.090   -3.632  2.635   1.00 0.00 ? 81  GLY A H    3  
ATOM 4609  H HA2  . GLY A 1 81  ? 8.754   -5.244  2.412   1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4610  H HA3  . GLY A 1 81  ? 8.607   -5.596  4.127   1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4611  N N    . ASP A 1 82  ? 5.998   -6.472  2.492   1.00 0.00 ? 82  ASP A N    3  
ATOM 4612  C CA   . ASP A 1 82  ? 5.120   -7.586  2.152   1.00 0.00 ? 82  ASP A CA   3  
ATOM 4613  C C    . ASP A 1 82  ? 4.861   -7.636  0.650   1.00 0.00 ? 82  ASP A C    3  
ATOM 4614  O O    . ASP A 1 82  ? 4.578   -6.615  0.024   1.00 0.00 ? 82  ASP A O    3  
ATOM 4615  C CB   . ASP A 1 82  ? 3.795   -7.467  2.907   1.00 0.00 ? 82  ASP A CB   3  
ATOM 4616  C CG   . ASP A 1 82  ? 3.977   -7.529  4.411   1.00 0.00 ? 82  ASP A CG   3  
ATOM 4617  O OD1  . ASP A 1 82  ? 4.978   -6.975  4.910   1.00 0.00 ? 82  ASP A OD1  3  
ATOM 4618  O OD2  . ASP A 1 82  ? 3.119   -8.133  5.088   1.00 0.00 ? 82  ASP A OD2  3  
ATOM 4619  H H    . ASP A 1 82  ? 5.656   -5.556  2.422   1.00 0.00 ? 82  ASP A H    3  
ATOM 4620  H HA   . ASP A 1 82  ? 5.613   -8.499  2.451   1.00 0.00 ? 82  ASP A HA   3  
ATOM 4621  H HB2  . ASP A 1 82  ? 3.330   -6.525  2.658   1.00 0.00 ? 82  ASP A HB2  3  
ATOM 4622  H HB3  . ASP A 1 82  ? 3.144   -8.276  2.607   1.00 0.00 ? 82  ASP A HB3  3  
ATOM 4623  N N    . VAL A 1 83  ? 4.962   -8.832  0.077   1.00 0.00 ? 83  VAL A N    3  
ATOM 4624  C CA   . VAL A 1 83  ? 4.739   -9.015  -1.352  1.00 0.00 ? 83  VAL A CA   3  
ATOM 4625  C C    . VAL A 1 83  ? 3.385   -9.664  -1.619  1.00 0.00 ? 83  VAL A C    3  
ATOM 4626  O O    . VAL A 1 83  ? 2.975   -10.584 -0.911  1.00 0.00 ? 83  VAL A O    3  
ATOM 4627  C CB   . VAL A 1 83  ? 5.844   -9.881  -1.986  1.00 0.00 ? 83  VAL A CB   3  
ATOM 4628  C CG1  . VAL A 1 83  ? 5.562   -10.110 -3.463  1.00 0.00 ? 83  VAL A CG1  3  
ATOM 4629  C CG2  . VAL A 1 83  ? 7.206   -9.233  -1.789  1.00 0.00 ? 83  VAL A CG2  3  
ATOM 4630  H H    . VAL A 1 83  ? 5.190   -9.609  0.628   1.00 0.00 ? 83  VAL A H    3  
ATOM 4631  H HA   . VAL A 1 83  ? 4.759   -8.042  -1.821  1.00 0.00 ? 83  VAL A HA   3  
ATOM 4632  H HB   . VAL A 1 83  ? 5.850   -10.840 -1.491  1.00 0.00 ? 83  VAL A HB   3  
ATOM 4633  H HG11 . VAL A 1 83  ? 6.036   -9.332  -4.044  1.00 0.00 ? 83  VAL A HG11 3  
ATOM 4634  H HG12 . VAL A 1 83  ? 5.953   -11.072 -3.760  1.00 0.00 ? 83  VAL A HG12 3  
ATOM 4635  H HG13 . VAL A 1 83  ? 4.496   -10.086 -3.634  1.00 0.00 ? 83  VAL A HG13 3  
ATOM 4636  H HG21 . VAL A 1 83  ? 7.132   -8.459  -1.040  1.00 0.00 ? 83  VAL A HG21 3  
ATOM 4637  H HG22 . VAL A 1 83  ? 7.916   -9.980  -1.467  1.00 0.00 ? 83  VAL A HG22 3  
ATOM 4638  H HG23 . VAL A 1 83  ? 7.538   -8.800  -2.722  1.00 0.00 ? 83  VAL A HG23 3  
ATOM 4639  N N    . VAL A 1 84  ? 2.694   -9.179  -2.645  1.00 0.00 ? 84  VAL A N    3  
ATOM 4640  C CA   . VAL A 1 84  ? 1.386   -9.712  -3.007  1.00 0.00 ? 84  VAL A CA   3  
ATOM 4641  C C    . VAL A 1 84  ? 1.320   -10.045 -4.493  1.00 0.00 ? 84  VAL A C    3  
ATOM 4642  O O    . VAL A 1 84  ? 1.916   -9.356  -5.321  1.00 0.00 ? 84  VAL A O    3  
ATOM 4643  C CB   . VAL A 1 84  ? 0.260   -8.718  -2.664  1.00 0.00 ? 84  VAL A CB   3  
ATOM 4644  C CG1  . VAL A 1 84  ? 0.143   -8.543  -1.158  1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4645  C CG2  . VAL A 1 84  ? 0.504   -7.382  -3.348  1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4646  H H    . VAL A 1 84  ? 3.073   -8.445  -3.172  1.00 0.00 ? 84  VAL A H    3  
ATOM 4647  H HA   . VAL A 1 84  ? 1.225   -10.616 -2.438  1.00 0.00 ? 84  VAL A HA   3  
ATOM 4648  H HB   . VAL A 1 84  ? -0.672  -9.122  -3.031  1.00 0.00 ? 84  VAL A HB   3  
ATOM 4649  H HG11 . VAL A 1 84  ? 1.059   -8.866  -0.686  1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4650  H HG12 . VAL A 1 84  ? -0.034  -7.502  -0.929  1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4651  H HG13 . VAL A 1 84  ? -0.680  -9.137  -0.790  1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4652  H HG21 . VAL A 1 84  ? -0.116  -6.625  -2.892  1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4653  H HG22 . VAL A 1 84  ? 1.543   -7.108  -3.242  1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4654  H HG23 . VAL A 1 84  ? 0.258   -7.463  -4.397  1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4655  N N    . ARG A 1 85  ? 0.591   -11.106 -4.824  1.00 0.00 ? 85  ARG A N    3  
ATOM 4656  C CA   . ARG A 1 85  ? 0.448   -11.532 -6.211  1.00 0.00 ? 85  ARG A CA   3  
ATOM 4657  C C    . ARG A 1 85  ? -0.662  -10.750 -6.908  1.00 0.00 ? 85  ARG A C    3  
ATOM 4658  O O    . ARG A 1 85  ? -1.844  -11.055 -6.746  1.00 0.00 ? 85  ARG A O    3  
ATOM 4659  C CB   . ARG A 1 85  ? 0.151   -13.031 -6.279  1.00 0.00 ? 85  ARG A CB   3  
ATOM 4660  C CG   . ARG A 1 85  ? 0.676   -13.699 -7.539  1.00 0.00 ? 85  ARG A CG   3  
ATOM 4661  C CD   . ARG A 1 85  ? 2.179   -13.920 -7.468  1.00 0.00 ? 85  ARG A CD   3  
ATOM 4662  N NE   . ARG A 1 85  ? 2.517   -15.173 -6.798  1.00 0.00 ? 85  ARG A NE   3  
ATOM 4663  C CZ   . ARG A 1 85  ? 2.468   -16.360 -7.391  1.00 0.00 ? 85  ARG A CZ   3  
ATOM 4664  N NH1  . ARG A 1 85  ? 2.097   -16.456 -8.661  1.00 0.00 ? 85  ARG A NH1  3  
ATOM 4665  N NH2  . ARG A 1 85  ? 2.791   -17.455 -6.715  1.00 0.00 ? 85  ARG A NH2  3  
ATOM 4666  H H    . ARG A 1 85  ? 0.140   -11.616 -4.119  1.00 0.00 ? 85  ARG A H    3  
ATOM 4667  H HA   . ARG A 1 85  ? 1.382   -11.335 -6.717  1.00 0.00 ? 85  ARG A HA   3  
ATOM 4668  H HB2  . ARG A 1 85  ? 0.604   -13.515 -5.426  1.00 0.00 ? 85  ARG A HB2  3  
ATOM 4669  H HB3  . ARG A 1 85  ? -0.918  -13.176 -6.240  1.00 0.00 ? 85  ARG A HB3  3  
ATOM 4670  H HG2  . ARG A 1 85  ? 0.189   -14.656 -7.658  1.00 0.00 ? 85  ARG A HG2  3  
ATOM 4671  H HG3  . ARG A 1 85  ? 0.453   -13.071 -8.388  1.00 0.00 ? 85  ARG A HG3  3  
ATOM 4672  H HD2  . ARG A 1 85  ? 2.574   -13.942 -8.472  1.00 0.00 ? 85  ARG A HD2  3  
ATOM 4673  H HD3  . ARG A 1 85  ? 2.624   -13.100 -6.924  1.00 0.00 ? 85  ARG A HD3  3  
ATOM 4674  H HE   . ARG A 1 85  ? 2.794   -15.125 -5.859  1.00 0.00 ? 85  ARG A HE   3  
ATOM 4675  H HH11 . ARG A 1 85  ? 1.854   -15.632 -9.173  1.00 0.00 ? 85  ARG A HH11 3  
ATOM 4676  H HH12 . ARG A 1 85  ? 2.062   -17.351 -9.105  1.00 0.00 ? 85  ARG A HH12 3  
ATOM 4677  H HH21 . ARG A 1 85  ? 3.071   -17.387 -5.758  1.00 0.00 ? 85  ARG A HH21 3  
ATOM 4678  H HH22 . ARG A 1 85  ? 2.753   -18.348 -7.162  1.00 0.00 ? 85  ARG A HH22 3  
ATOM 4679  N N    . ILE A 1 86  ? -0.274  -9.742  -7.681  1.00 0.00 ? 86  ILE A N    3  
ATOM 4680  C CA   . ILE A 1 86  ? -1.236  -8.918  -8.402  1.00 0.00 ? 86  ILE A CA   3  
ATOM 4681  C C    . ILE A 1 86  ? -1.902  -9.706  -9.525  1.00 0.00 ? 86  ILE A C    3  
ATOM 4682  O O    . ILE A 1 86  ? -1.240  -10.144 -10.466 1.00 0.00 ? 86  ILE A O    3  
ATOM 4683  C CB   . ILE A 1 86  ? -0.569  -7.663  -8.996  1.00 0.00 ? 86  ILE A CB   3  
ATOM 4684  C CG1  . ILE A 1 86  ? 0.055   -6.816  -7.885  1.00 0.00 ? 86  ILE A CG1  3  
ATOM 4685  C CG2  . ILE A 1 86  ? -1.583  -6.848  -9.785  1.00 0.00 ? 86  ILE A CG2  3  
ATOM 4686  C CD1  . ILE A 1 86  ? 1.080   -5.824  -8.385  1.00 0.00 ? 86  ILE A CD1  3  
ATOM 4687  H H    . ILE A 1 86  ? 0.683   -9.549  -7.770  1.00 0.00 ? 86  ILE A H    3  
ATOM 4688  H HA   . ILE A 1 86  ? -1.994  -8.601  -7.701  1.00 0.00 ? 86  ILE A HA   3  
ATOM 4689  H HB   . ILE A 1 86  ? 0.207   -7.982  -9.675  1.00 0.00 ? 86  ILE A HB   3  
ATOM 4690  H HG12 . ILE A 1 86  ? -0.723  -6.264  -7.382  1.00 0.00 ? 86  ILE A HG12 3  
ATOM 4691  H HG13 . ILE A 1 86  ? 0.543   -7.470  -7.176  1.00 0.00 ? 86  ILE A HG13 3  
ATOM 4692  H HG21 . ILE A 1 86  ? -2.540  -6.884  -9.286  1.00 0.00 ? 86  ILE A HG21 3  
ATOM 4693  H HG22 . ILE A 1 86  ? -1.249  -5.823  -9.848  1.00 0.00 ? 86  ILE A HG22 3  
ATOM 4694  H HG23 . ILE A 1 86  ? -1.679  -7.258  -10.779 1.00 0.00 ? 86  ILE A HG23 3  
ATOM 4695  H HD11 . ILE A 1 86  ? 2.062   -6.276  -8.360  1.00 0.00 ? 86  ILE A HD11 3  
ATOM 4696  H HD12 . ILE A 1 86  ? 0.843   -5.540  -9.400  1.00 0.00 ? 86  ILE A HD12 3  
ATOM 4697  H HD13 . ILE A 1 86  ? 1.072   -4.948  -7.754  1.00 0.00 ? 86  ILE A HD13 3  
ATOM 4698  N N    . GLN A 1 87  ? -3.215  -9.880  -9.420  1.00 0.00 ? 87  GLN A N    3  
ATOM 4699  C CA   . GLN A 1 87  ? -3.971  -10.614 -10.428 1.00 0.00 ? 87  GLN A CA   3  
ATOM 4700  C C    . GLN A 1 87  ? -4.840  -9.669  -11.252 1.00 0.00 ? 87  GLN A C    3  
ATOM 4701  O O    . GLN A 1 87  ? -4.985  -9.841  -12.462 1.00 0.00 ? 87  GLN A O    3  
ATOM 4702  C CB   . GLN A 1 87  ? -4.844  -11.681 -9.765  1.00 0.00 ? 87  GLN A CB   3  
ATOM 4703  C CG   . GLN A 1 87  ? -4.075  -12.600 -8.830  1.00 0.00 ? 87  GLN A CG   3  
ATOM 4704  C CD   . GLN A 1 87  ? -4.669  -13.993 -8.762  1.00 0.00 ? 87  GLN A CD   3  
ATOM 4705  O OE1  . GLN A 1 87  ? -5.460  -14.386 -9.620  1.00 0.00 ? 87  GLN A OE1  3  
ATOM 4706  N NE2  . GLN A 1 87  ? -4.291  -14.750 -7.738  1.00 0.00 ? 87  GLN A NE2  3  
ATOM 4707  H H    . GLN A 1 87  ? -3.687  -9.507  -8.647  1.00 0.00 ? 87  GLN A H    3  
ATOM 4708  H HA   . GLN A 1 87  ? -3.264  -11.098 -11.085 1.00 0.00 ? 87  GLN A HA   3  
ATOM 4709  H HB2  . GLN A 1 87  ? -5.620  -11.192 -9.197  1.00 0.00 ? 87  GLN A HB2  3  
ATOM 4710  H HB3  . GLN A 1 87  ? -5.299  -12.286 -10.535 1.00 0.00 ? 87  GLN A HB3  3  
ATOM 4711  H HG2  . GLN A 1 87  ? -3.056  -12.677 -9.178  1.00 0.00 ? 87  GLN A HG2  3  
ATOM 4712  H HG3  . GLN A 1 87  ? -4.084  -12.172 -7.838  1.00 0.00 ? 87  GLN A HG3  3  
ATOM 4713  H HE21 . GLN A 1 87  ? -3.658  -14.370 -7.092  1.00 0.00 ? 87  GLN A HE21 3  
ATOM 4714  H HE22 . GLN A 1 87  ? -4.660  -15.654 -7.670  1.00 0.00 ? 87  GLN A HE22 3  
ATOM 4715  N N    . GLU A 1 88  ? -5.416  -8.673  -10.588 1.00 0.00 ? 88  GLU A N    3  
ATOM 4716  C CA   . GLU A 1 88  ? -6.272  -7.702  -11.259 1.00 0.00 ? 88  GLU A CA   3  
ATOM 4717  C C    . GLU A 1 88  ? -5.821  -6.276  -10.955 1.00 0.00 ? 88  GLU A C    3  
ATOM 4718  O O    . GLU A 1 88  ? -5.047  -6.042  -10.026 1.00 0.00 ? 88  GLU A O    3  
ATOM 4719  C CB   . GLU A 1 88  ? -7.729  -7.890  -10.830 1.00 0.00 ? 88  GLU A CB   3  
ATOM 4720  C CG   . GLU A 1 88  ? -8.504  -8.853  -11.714 1.00 0.00 ? 88  GLU A CG   3  
ATOM 4721  C CD   . GLU A 1 88  ? -9.004  -8.201  -12.989 1.00 0.00 ? 88  GLU A CD   3  
ATOM 4722  O OE1  . GLU A 1 88  ? -8.241  -7.418  -13.593 1.00 0.00 ? 88  GLU A OE1  3  
ATOM 4723  O OE2  . GLU A 1 88  ? -10.157 -8.474  -13.383 1.00 0.00 ? 88  GLU A OE2  3  
ATOM 4724  H H    . GLU A 1 88  ? -5.263  -8.588  -9.623  1.00 0.00 ? 88  GLU A H    3  
ATOM 4725  H HA   . GLU A 1 88  ? -6.195  -7.872  -12.323 1.00 0.00 ? 88  GLU A HA   3  
ATOM 4726  H HB2  . GLU A 1 88  ? -7.748  -8.267  -9.818  1.00 0.00 ? 88  GLU A HB2  3  
ATOM 4727  H HB3  . GLU A 1 88  ? -8.226  -6.931  -10.857 1.00 0.00 ? 88  GLU A HB3  3  
ATOM 4728  H HG2  . GLU A 1 88  ? -7.859  -9.677  -11.979 1.00 0.00 ? 88  GLU A HG2  3  
ATOM 4729  H HG3  . GLU A 1 88  ? -9.354  -9.225  -11.160 1.00 0.00 ? 88  GLU A HG3  3  
ATOM 4730  N N    . THR A 1 89  ? -6.310  -5.325  -11.745 1.00 0.00 ? 89  THR A N    3  
ATOM 4731  C CA   . THR A 1 89  ? -5.957  -3.923  -11.563 1.00 0.00 ? 89  THR A CA   3  
ATOM 4732  C C    . THR A 1 89  ? -7.131  -3.012  -11.903 1.00 0.00 ? 89  THR A C    3  
ATOM 4733  O O    . THR A 1 89  ? -7.571  -2.954  -13.052 1.00 0.00 ? 89  THR A O    3  
ATOM 4734  C CB   . THR A 1 89  ? -4.748  -3.531  -12.433 1.00 0.00 ? 89  THR A CB   3  
ATOM 4735  O OG1  . THR A 1 89  ? -3.593  -4.275  -12.030 1.00 0.00 ? 89  THR A OG1  3  
ATOM 4736  C CG2  . THR A 1 89  ? -4.462  -2.041  -12.321 1.00 0.00 ? 89  THR A CG2  3  
ATOM 4737  H H    . THR A 1 89  ? -6.922  -5.575  -12.469 1.00 0.00 ? 89  THR A H    3  
ATOM 4738  H HA   . THR A 1 89  ? -5.690  -3.779  -10.526 1.00 0.00 ? 89  THR A HA   3  
ATOM 4739  H HB   . THR A 1 89  ? -4.975  -3.762  -13.463 1.00 0.00 ? 89  THR A HB   3  
ATOM 4740  H HG1  . THR A 1 89  ? -3.868  -5.109  -11.642 1.00 0.00 ? 89  THR A HG1  3  
ATOM 4741  H HG21 . THR A 1 89  ? -3.788  -1.744  -13.110 1.00 0.00 ? 89  THR A HG21 3  
ATOM 4742  H HG22 . THR A 1 89  ? -4.008  -1.832  -11.363 1.00 0.00 ? 89  THR A HG22 3  
ATOM 4743  H HG23 . THR A 1 89  ? -5.386  -1.489  -12.409 1.00 0.00 ? 89  THR A HG23 3  
ATOM 4744  N N    . CYS A 1 90  ? -7.633  -2.302  -10.899 1.00 0.00 ? 90  CYS A N    3  
ATOM 4745  C CA   . CYS A 1 90  ? -8.756  -1.392  -11.093 1.00 0.00 ? 90  CYS A CA   3  
ATOM 4746  C C    . CYS A 1 90  ? -8.386  0.026   -10.672 1.00 0.00 ? 90  CYS A C    3  
ATOM 4747  O O    . CYS A 1 90  ? -7.860  0.244   -9.582  1.00 0.00 ? 90  CYS A O    3  
ATOM 4748  C CB   . CYS A 1 90  ? -9.971  -1.873  -10.298 1.00 0.00 ? 90  CYS A CB   3  
ATOM 4749  S SG   . CYS A 1 90  ? -10.664 -3.437  -10.883 1.00 0.00 ? 90  CYS A SG   3  
ATOM 4750  H H    . CYS A 1 90  ? -7.239  -2.391  -10.006 1.00 0.00 ? 90  CYS A H    3  
ATOM 4751  H HA   . CYS A 1 90  ? -9.002  -1.390  -12.144 1.00 0.00 ? 90  CYS A HA   3  
ATOM 4752  H HB2  . CYS A 1 90  ? -9.686  -2.007  -9.265  1.00 0.00 ? 90  CYS A HB2  3  
ATOM 4753  H HB3  . CYS A 1 90  ? -10.748 -1.125  -10.356 1.00 0.00 ? 90  CYS A HB3  3  
ATOM 4754  H HG   . CYS A 1 90  ? -9.958  -3.830  -11.931 1.00 0.00 ? 90  CYS A HG   3  
ATOM 4755  N N    . GLY A 1 91  ? -8.664  0.989   -11.546 1.00 0.00 ? 91  GLY A N    3  
ATOM 4756  C CA   . GLY A 1 91  ? -8.353  2.375   -11.248 1.00 0.00 ? 91  GLY A CA   3  
ATOM 4757  C C    . GLY A 1 91  ? -7.063  2.523   -10.465 1.00 0.00 ? 91  GLY A C    3  
ATOM 4758  O O    . GLY A 1 91  ? -6.036  1.952   -10.833 1.00 0.00 ? 91  GLY A O    3  
ATOM 4759  H H    . GLY A 1 91  ? -9.085  0.757   -12.401 1.00 0.00 ? 91  GLY A H    3  
ATOM 4760  H HA2  . GLY A 1 91  ? -8.264  2.920   -12.175 1.00 0.00 ? 91  GLY A HA2  3  
ATOM 4761  H HA3  . GLY A 1 91  ? -9.161  2.797   -10.669 1.00 0.00 ? 91  GLY A HA3  3  
ATOM 4762  N N    . ASP A 1 92  ? -7.114  3.293   -9.384  1.00 0.00 ? 92  ASP A N    3  
ATOM 4763  C CA   . ASP A 1 92  ? -5.940  3.516   -8.547  1.00 0.00 ? 92  ASP A CA   3  
ATOM 4764  C C    . ASP A 1 92  ? -5.893  2.512   -7.400  1.00 0.00 ? 92  ASP A C    3  
ATOM 4765  O O    . ASP A 1 92  ? -5.572  2.867   -6.265  1.00 0.00 ? 92  ASP A O    3  
ATOM 4766  C CB   . ASP A 1 92  ? -5.945  4.942   -7.995  1.00 0.00 ? 92  ASP A CB   3  
ATOM 4767  C CG   . ASP A 1 92  ? -5.599  5.973   -9.051  1.00 0.00 ? 92  ASP A CG   3  
ATOM 4768  O OD1  . ASP A 1 92  ? -4.638  5.742   -9.814  1.00 0.00 ? 92  ASP A OD1  3  
ATOM 4769  O OD2  . ASP A 1 92  ? -6.291  7.011   -9.115  1.00 0.00 ? 92  ASP A OD2  3  
ATOM 4770  H H    . ASP A 1 92  ? -7.962  3.722   -9.142  1.00 0.00 ? 92  ASP A H    3  
ATOM 4771  H HA   . ASP A 1 92  ? -5.064  3.381   -9.163  1.00 0.00 ? 92  ASP A HA   3  
ATOM 4772  H HB2  . ASP A 1 92  ? -6.927  5.167   -7.606  1.00 0.00 ? 92  ASP A HB2  3  
ATOM 4773  H HB3  . ASP A 1 92  ? -5.221  5.014   -7.196  1.00 0.00 ? 92  ASP A HB3  3  
ATOM 4774  N N    . TRP A 1 93  ? -6.216  1.260   -7.702  1.00 0.00 ? 93  TRP A N    3  
ATOM 4775  C CA   . TRP A 1 93  ? -6.211  0.205   -6.695  1.00 0.00 ? 93  TRP A CA   3  
ATOM 4776  C C    . TRP A 1 93  ? -5.941  -1.154  -7.331  1.00 0.00 ? 93  TRP A C    3  
ATOM 4777  O O    . TRP A 1 93  ? -6.393  -1.430  -8.443  1.00 0.00 ? 93  TRP A O    3  
ATOM 4778  C CB   . TRP A 1 93  ? -7.546  0.177   -5.950  1.00 0.00 ? 93  TRP A CB   3  
ATOM 4779  C CG   . TRP A 1 93  ? -7.827  1.436   -5.186  1.00 0.00 ? 93  TRP A CG   3  
ATOM 4780  C CD1  . TRP A 1 93  ? -8.107  2.666   -5.709  1.00 0.00 ? 93  TRP A CD1  3  
ATOM 4781  C CD2  . TRP A 1 93  ? -7.852  1.587   -3.763  1.00 0.00 ? 93  TRP A CD2  3  
ATOM 4782  N NE1  . TRP A 1 93  ? -8.305  3.573   -4.696  1.00 0.00 ? 93  TRP A NE1  3  
ATOM 4783  C CE2  . TRP A 1 93  ? -8.155  2.936   -3.493  1.00 0.00 ? 93  TRP A CE2  3  
ATOM 4784  C CE3  . TRP A 1 93  ? -7.650  0.715   -2.690  1.00 0.00 ? 93  TRP A CE3  3  
ATOM 4785  C CZ2  . TRP A 1 93  ? -8.259  3.430   -2.195  1.00 0.00 ? 93  TRP A CZ2  3  
ATOM 4786  C CZ3  . TRP A 1 93  ? -7.754  1.206   -1.403  1.00 0.00 ? 93  TRP A CZ3  3  
ATOM 4787  C CH2  . TRP A 1 93  ? -8.057  2.553   -1.164  1.00 0.00 ? 93  TRP A CH2  3  
ATOM 4788  H H    . TRP A 1 93  ? -6.463  1.039   -8.625  1.00 0.00 ? 93  TRP A H    3  
ATOM 4789  H HA   . TRP A 1 93  ? -5.421  0.423   -5.991  1.00 0.00 ? 93  TRP A HA   3  
ATOM 4790  H HB2  . TRP A 1 93  ? -8.346  0.034   -6.661  1.00 0.00 ? 93  TRP A HB2  3  
ATOM 4791  H HB3  . TRP A 1 93  ? -7.541  -0.645  -5.248  1.00 0.00 ? 93  TRP A HB3  3  
ATOM 4792  H HD1  . TRP A 1 93  ? -8.160  2.880   -6.765  1.00 0.00 ? 93  TRP A HD1  3  
ATOM 4793  H HE1  . TRP A 1 93  ? -8.521  4.522   -4.816  1.00 0.00 ? 93  TRP A HE1  3  
ATOM 4794  H HE3  . TRP A 1 93  ? -7.416  -0.327  -2.854  1.00 0.00 ? 93  TRP A HE3  3  
ATOM 4795  H HZ2  . TRP A 1 93  ? -8.493  4.466   -1.994  1.00 0.00 ? 93  TRP A HZ2  3  
ATOM 4796  H HZ3  . TRP A 1 93  ? -7.601  0.547   -0.561  1.00 0.00 ? 93  TRP A HZ3  3  
ATOM 4797  H HH2  . TRP A 1 93  ? -8.127  2.894   -0.142  1.00 0.00 ? 93  TRP A HH2  3  
ATOM 4798  N N    . TYR A 1 94  ? -5.204  -1.999  -6.620  1.00 0.00 ? 94  TYR A N    3  
ATOM 4799  C CA   . TYR A 1 94  ? -4.872  -3.329  -7.117  1.00 0.00 ? 94  TYR A CA   3  
ATOM 4800  C C    . TYR A 1 94  ? -5.874  -4.364  -6.614  1.00 0.00 ? 94  TYR A C    3  
ATOM 4801  O O    . TYR A 1 94  ? -6.729  -4.063  -5.781  1.00 0.00 ? 94  TYR A O    3  
ATOM 4802  C CB   . TYR A 1 94  ? -3.458  -3.720  -6.685  1.00 0.00 ? 94  TYR A CB   3  
ATOM 4803  C CG   . TYR A 1 94  ? -2.371  -3.059  -7.502  1.00 0.00 ? 94  TYR A CG   3  
ATOM 4804  C CD1  . TYR A 1 94  ? -2.294  -3.248  -8.876  1.00 0.00 ? 94  TYR A CD1  3  
ATOM 4805  C CD2  . TYR A 1 94  ? -1.421  -2.243  -6.899  1.00 0.00 ? 94  TYR A CD2  3  
ATOM 4806  C CE1  . TYR A 1 94  ? -1.302  -2.646  -9.626  1.00 0.00 ? 94  TYR A CE1  3  
ATOM 4807  C CE2  . TYR A 1 94  ? -0.427  -1.635  -7.641  1.00 0.00 ? 94  TYR A CE2  3  
ATOM 4808  C CZ   . TYR A 1 94  ? -0.371  -1.840  -9.003  1.00 0.00 ? 94  TYR A CZ   3  
ATOM 4809  O OH   . TYR A 1 94  ? 0.618   -1.237  -9.747  1.00 0.00 ? 94  TYR A OH   3  
ATOM 4810  H H    . TYR A 1 94  ? -4.872  -1.722  -5.740  1.00 0.00 ? 94  TYR A H    3  
ATOM 4811  H HA   . TYR A 1 94  ? -4.913  -3.300  -8.196  1.00 0.00 ? 94  TYR A HA   3  
ATOM 4812  H HB2  . TYR A 1 94  ? -3.313  -3.440  -5.653  1.00 0.00 ? 94  TYR A HB2  3  
ATOM 4813  H HB3  . TYR A 1 94  ? -3.342  -4.790  -6.783  1.00 0.00 ? 94  TYR A HB3  3  
ATOM 4814  H HD1  . TYR A 1 94  ? -3.025  -3.879  -9.360  1.00 0.00 ? 94  TYR A HD1  3  
ATOM 4815  H HD2  . TYR A 1 94  ? -1.467  -2.084  -5.831  1.00 0.00 ? 94  TYR A HD2  3  
ATOM 4816  H HE1  . TYR A 1 94  ? -1.259  -2.805  -10.693 1.00 0.00 ? 94  TYR A HE1  3  
ATOM 4817  H HE2  . TYR A 1 94  ? 0.303   -1.005  -7.154  1.00 0.00 ? 94  TYR A HE2  3  
ATOM 4818  H HH   . TYR A 1 94  ? 0.329   -0.361  -10.012 1.00 0.00 ? 94  TYR A HH   3  
ATOM 4819  N N    . ARG A 1 95  ? -5.760  -5.586  -7.125  1.00 0.00 ? 95  ARG A N    3  
ATOM 4820  C CA   . ARG A 1 95  ? -6.655  -6.666  -6.729  1.00 0.00 ? 95  ARG A CA   3  
ATOM 4821  C C    . ARG A 1 95  ? -5.917  -8.001  -6.700  1.00 0.00 ? 95  ARG A C    3  
ATOM 4822  O O    . ARG A 1 95  ? -5.560  -8.547  -7.743  1.00 0.00 ? 95  ARG A O    3  
ATOM 4823  C CB   . ARG A 1 95  ? -7.844  -6.749  -7.688  1.00 0.00 ? 95  ARG A CB   3  
ATOM 4824  C CG   . ARG A 1 95  ? -8.607  -8.061  -7.600  1.00 0.00 ? 95  ARG A CG   3  
ATOM 4825  C CD   . ARG A 1 95  ? -9.473  -8.119  -6.351  1.00 0.00 ? 95  ARG A CD   3  
ATOM 4826  N NE   . ARG A 1 95  ? -10.087 -9.432  -6.171  1.00 0.00 ? 95  ARG A NE   3  
ATOM 4827  C CZ   . ARG A 1 95  ? -9.444  -10.482 -5.674  1.00 0.00 ? 95  ARG A CZ   3  
ATOM 4828  N NH1  . ARG A 1 95  ? -8.174  -10.374 -5.309  1.00 0.00 ? 95  ARG A NH1  3  
ATOM 4829  N NH2  . ARG A 1 95  ? -10.071 -11.644 -5.541  1.00 0.00 ? 95  ARG A NH2  3  
ATOM 4830  H H    . ARG A 1 95  ? -5.058  -5.764  -7.785  1.00 0.00 ? 95  ARG A H    3  
ATOM 4831  H HA   . ARG A 1 95  ? -7.020  -6.448  -5.736  1.00 0.00 ? 95  ARG A HA   3  
ATOM 4832  H HB2  . ARG A 1 95  ? -8.529  -5.945  -7.465  1.00 0.00 ? 95  ARG A HB2  3  
ATOM 4833  H HB3  . ARG A 1 95  ? -7.484  -6.635  -8.699  1.00 0.00 ? 95  ARG A HB3  3  
ATOM 4834  H HG2  . ARG A 1 95  ? -9.241  -8.157  -8.469  1.00 0.00 ? 95  ARG A HG2  3  
ATOM 4835  H HG3  . ARG A 1 95  ? -7.900  -8.877  -7.575  1.00 0.00 ? 95  ARG A HG3  3  
ATOM 4836  H HD2  . ARG A 1 95  ? -8.858  -7.899  -5.492  1.00 0.00 ? 95  ARG A HD2  3  
ATOM 4837  H HD3  . ARG A 1 95  ? -10.252 -7.376  -6.435  1.00 0.00 ? 95  ARG A HD3  3  
ATOM 4838  H HE   . ARG A 1 95  ? -11.026 -9.534  -6.434  1.00 0.00 ? 95  ARG A HE   3  
ATOM 4839  H HH11 . ARG A 1 95  ? -7.699  -9.500  -5.408  1.00 0.00 ? 95  ARG A HH11 3  
ATOM 4840  H HH12 . ARG A 1 95  ? -7.692  -11.166 -4.934  1.00 0.00 ? 95  ARG A HH12 3  
ATOM 4841  H HH21 . ARG A 1 95  ? -11.029 -11.729 -5.815  1.00 0.00 ? 95  ARG A HH21 3  
ATOM 4842  H HH22 . ARG A 1 95  ? -9.586  -12.434 -5.167  1.00 0.00 ? 95  ARG A HH22 3  
ATOM 4843  N N    . GLY A 1 96  ? -5.691  -8.521  -5.497  1.00 0.00 ? 96  GLY A N    3  
ATOM 4844  C CA   . GLY A 1 96  ? -4.996  -9.787  -5.355  1.00 0.00 ? 96  GLY A CA   3  
ATOM 4845  C C    . GLY A 1 96  ? -5.039  -10.315 -3.935  1.00 0.00 ? 96  GLY A C    3  
ATOM 4846  O O    . GLY A 1 96  ? -6.065  -10.219 -3.260  1.00 0.00 ? 96  GLY A O    3  
ATOM 4847  H H    . GLY A 1 96  ? -5.999  -8.041  -4.700  1.00 0.00 ? 96  GLY A H    3  
ATOM 4848  H HA2  . GLY A 1 96  ? -5.452  -10.512 -6.012  1.00 0.00 ? 96  GLY A HA2  3  
ATOM 4849  H HA3  . GLY A 1 96  ? -3.964  -9.652  -5.645  1.00 0.00 ? 96  GLY A HA3  3  
ATOM 4850  N N    . TYR A 1 97  ? -3.924  -10.877 -3.480  1.00 0.00 ? 97  TYR A N    3  
ATOM 4851  C CA   . TYR A 1 97  ? -3.840  -11.427 -2.133  1.00 0.00 ? 97  TYR A CA   3  
ATOM 4852  C C    . TYR A 1 97  ? -2.391  -11.502 -1.664  1.00 0.00 ? 97  TYR A C    3  
ATOM 4853  O O    . TYR A 1 97  ? -1.461  -11.328 -2.453  1.00 0.00 ? 97  TYR A O    3  
ATOM 4854  C CB   . TYR A 1 97  ? -4.475  -12.818 -2.086  1.00 0.00 ? 97  TYR A CB   3  
ATOM 4855  C CG   . TYR A 1 97  ? -3.790  -13.826 -2.981  1.00 0.00 ? 97  TYR A CG   3  
ATOM 4856  C CD1  . TYR A 1 97  ? -2.478  -14.216 -2.744  1.00 0.00 ? 97  TYR A CD1  3  
ATOM 4857  C CD2  . TYR A 1 97  ? -4.455  -14.388 -4.064  1.00 0.00 ? 97  TYR A CD2  3  
ATOM 4858  C CE1  . TYR A 1 97  ? -1.848  -15.136 -3.559  1.00 0.00 ? 97  TYR A CE1  3  
ATOM 4859  C CE2  . TYR A 1 97  ? -3.833  -15.310 -4.884  1.00 0.00 ? 97  TYR A CE2  3  
ATOM 4860  C CZ   . TYR A 1 97  ? -2.529  -15.681 -4.627  1.00 0.00 ? 97  TYR A CZ   3  
ATOM 4861  O OH   . TYR A 1 97  ? -1.906  -16.598 -5.442  1.00 0.00 ? 97  TYR A OH   3  
ATOM 4862  H H    . TYR A 1 97  ? -3.140  -10.924 -4.065  1.00 0.00 ? 97  TYR A H    3  
ATOM 4863  H HA   . TYR A 1 97  ? -4.387  -10.770 -1.472  1.00 0.00 ? 97  TYR A HA   3  
ATOM 4864  H HB2  . TYR A 1 97  ? -4.434  -13.191 -1.075  1.00 0.00 ? 97  TYR A HB2  3  
ATOM 4865  H HB3  . TYR A 1 97  ? -5.507  -12.745 -2.397  1.00 0.00 ? 97  TYR A HB3  3  
ATOM 4866  H HD1  . TYR A 1 97  ? -1.946  -13.788 -1.906  1.00 0.00 ? 97  TYR A HD1  3  
ATOM 4867  H HD2  . TYR A 1 97  ? -5.476  -14.095 -4.263  1.00 0.00 ? 97  TYR A HD2  3  
ATOM 4868  H HE1  . TYR A 1 97  ? -0.827  -15.427 -3.358  1.00 0.00 ? 97  TYR A HE1  3  
ATOM 4869  H HE2  . TYR A 1 97  ? -4.366  -15.736 -5.720  1.00 0.00 ? 97  TYR A HE2  3  
ATOM 4870  H HH   . TYR A 1 97  ? -1.827  -16.237 -6.328  1.00 0.00 ? 97  TYR A HH   3  
ATOM 4871  N N    . LEU A 1 98  ? -2.205  -11.762 -0.375  1.00 0.00 ? 98  LEU A N    3  
ATOM 4872  C CA   . LEU A 1 98  ? -0.869  -11.861 0.202   1.00 0.00 ? 98  LEU A CA   3  
ATOM 4873  C C    . LEU A 1 98  ? -0.242  -13.217 -0.107  1.00 0.00 ? 98  LEU A C    3  
ATOM 4874  O O    . LEU A 1 98  ? -0.743  -14.256 0.323   1.00 0.00 ? 98  LEU A O    3  
ATOM 4875  C CB   . LEU A 1 98  ? -0.927  -11.646 1.715   1.00 0.00 ? 98  LEU A CB   3  
ATOM 4876  C CG   . LEU A 1 98  ? 0.321   -11.037 2.355   1.00 0.00 ? 98  LEU A CG   3  
ATOM 4877  C CD1  . LEU A 1 98  ? 0.696   -9.737  1.662   1.00 0.00 ? 98  LEU A CD1  3  
ATOM 4878  C CD2  . LEU A 1 98  ? 0.098   -10.806 3.843   1.00 0.00 ? 98  LEU A CD2  3  
ATOM 4879  H H    . LEU A 1 98  ? -2.985  -11.891 0.205   1.00 0.00 ? 98  LEU A H    3  
ATOM 4880  H HA   . LEU A 1 98  ? -0.259  -11.087 -0.240  1.00 0.00 ? 98  LEU A HA   3  
ATOM 4881  H HB2  . LEU A 1 98  ? -1.759  -10.991 1.924   1.00 0.00 ? 98  LEU A HB2  3  
ATOM 4882  H HB3  . LEU A 1 98  ? -1.103  -12.607 2.178   1.00 0.00 ? 98  LEU A HB3  3  
ATOM 4883  H HG   . LEU A 1 98  ? 1.148   -11.725 2.243   1.00 0.00 ? 98  LEU A HG   3  
ATOM 4884  H HD11 . LEU A 1 98  ? 1.492   -9.922  0.956   1.00 0.00 ? 98  LEU A HD11 3  
ATOM 4885  H HD12 . LEU A 1 98  ? 1.027   -9.019  2.398   1.00 0.00 ? 98  LEU A HD12 3  
ATOM 4886  H HD13 . LEU A 1 98  ? -0.165  -9.346  1.140   1.00 0.00 ? 98  LEU A HD13 3  
ATOM 4887  H HD21 . LEU A 1 98  ? 0.117   -9.746  4.049   1.00 0.00 ? 98  LEU A HD21 3  
ATOM 4888  H HD22 . LEU A 1 98  ? 0.881   -11.296 4.404   1.00 0.00 ? 98  LEU A HD22 3  
ATOM 4889  H HD23 . LEU A 1 98  ? -0.860  -11.213 4.131   1.00 0.00 ? 98  LEU A HD23 3  
ATOM 4890  N N    . ILE A 1 99  ? 0.858   -13.198 -0.853  1.00 0.00 ? 99  ILE A N    3  
ATOM 4891  C CA   . ILE A 1 99  ? 1.555   -14.426 -1.216  1.00 0.00 ? 99  ILE A CA   3  
ATOM 4892  C C    . ILE A 1 99  ? 1.962   -15.214 0.024   1.00 0.00 ? 99  ILE A C    3  
ATOM 4893  O O    . ILE A 1 99  ? 1.652   -16.399 0.150   1.00 0.00 ? 99  ILE A O    3  
ATOM 4894  C CB   . ILE A 1 99  ? 2.810   -14.132 -2.060  1.00 0.00 ? 99  ILE A CB   3  
ATOM 4895  C CG1  . ILE A 1 99  ? 2.446   -13.278 -3.276  1.00 0.00 ? 99  ILE A CG1  3  
ATOM 4896  C CG2  . ILE A 1 99  ? 3.470   -15.431 -2.497  1.00 0.00 ? 99  ILE A CG2  3  
ATOM 4897  C CD1  . ILE A 1 99  ? 3.621   -12.528 -3.861  1.00 0.00 ? 99  ILE A CD1  3  
ATOM 4898  H H    . ILE A 1 99  ? 1.208   -12.339 -1.167  1.00 0.00 ? 99  ILE A H    3  
ATOM 4899  H HA   . ILE A 1 99  ? 0.881   -15.029 -1.808  1.00 0.00 ? 99  ILE A HA   3  
ATOM 4900  H HB   . ILE A 1 99  ? 3.511   -13.590 -1.444  1.00 0.00 ? 99  ILE A HB   3  
ATOM 4901  H HG12 . ILE A 1 99  ? 2.042   -13.914 -4.047  1.00 0.00 ? 99  ILE A HG12 3  
ATOM 4902  H HG13 . ILE A 1 99  ? 1.699   -12.553 -2.986  1.00 0.00 ? 99  ILE A HG13 3  
ATOM 4903  H HG21 . ILE A 1 99  ? 2.710   -16.174 -2.690  1.00 0.00 ? 99  ILE A HG21 3  
ATOM 4904  H HG22 . ILE A 1 99  ? 4.041   -15.259 -3.397  1.00 0.00 ? 99  ILE A HG22 3  
ATOM 4905  H HG23 . ILE A 1 99  ? 4.126   -15.783 -1.715  1.00 0.00 ? 99  ILE A HG23 3  
ATOM 4906  H HD11 . ILE A 1 99  ? 4.372   -12.382 -3.097  1.00 0.00 ? 99  ILE A HD11 3  
ATOM 4907  H HD12 . ILE A 1 99  ? 4.044   -13.098 -4.675  1.00 0.00 ? 99  ILE A HD12 3  
ATOM 4908  H HD13 . ILE A 1 99  ? 3.291   -11.568 -4.227  1.00 0.00 ? 99  ILE A HD13 3  
ATOM 4909  N N    . LYS A 1 100 ? 2.657   -14.548 0.939   1.00 0.00 ? 100 LYS A N    3  
ATOM 4910  C CA   . LYS A 1 100 ? 3.105   -15.184 2.173   1.00 0.00 ? 100 LYS A CA   3  
ATOM 4911  C C    . LYS A 1 100 ? 1.926   -15.772 2.941   1.00 0.00 ? 100 LYS A C    3  
ATOM 4912  O O    . LYS A 1 100 ? 2.085   -16.719 3.712   1.00 0.00 ? 100 LYS A O    3  
ATOM 4913  C CB   . LYS A 1 100 ? 3.847   -14.174 3.051   1.00 0.00 ? 100 LYS A CB   3  
ATOM 4914  C CG   . LYS A 1 100 ? 3.129   -12.841 3.185   1.00 0.00 ? 100 LYS A CG   3  
ATOM 4915  C CD   . LYS A 1 100 ? 3.850   -11.914 4.149   1.00 0.00 ? 100 LYS A CD   3  
ATOM 4916  C CE   . LYS A 1 100 ? 4.879   -11.054 3.431   1.00 0.00 ? 100 LYS A CE   3  
ATOM 4917  N NZ   . LYS A 1 100 ? 6.218   -11.704 3.396   1.00 0.00 ? 100 LYS A NZ   3  
ATOM 4918  H H    . LYS A 1 100 ? 2.873   -13.604 0.782   1.00 0.00 ? 100 LYS A H    3  
ATOM 4919  H HA   . LYS A 1 100 ? 3.781   -15.982 1.908   1.00 0.00 ? 100 LYS A HA   3  
ATOM 4920  H HB2  . LYS A 1 100 ? 3.968   -14.594 4.039   1.00 0.00 ? 100 LYS A HB2  3  
ATOM 4921  H HB3  . LYS A 1 100 ? 4.823   -13.992 2.625   1.00 0.00 ? 100 LYS A HB3  3  
ATOM 4922  H HG2  . LYS A 1 100 ? 3.083   -12.369 2.215   1.00 0.00 ? 100 LYS A HG2  3  
ATOM 4923  H HG3  . LYS A 1 100 ? 2.128   -13.017 3.550   1.00 0.00 ? 100 LYS A HG3  3  
ATOM 4924  H HD2  . LYS A 1 100 ? 3.126   -11.269 4.623   1.00 0.00 ? 100 LYS A HD2  3  
ATOM 4925  H HD3  . LYS A 1 100 ? 4.352   -12.509 4.899   1.00 0.00 ? 100 LYS A HD3  3  
ATOM 4926  H HE2  . LYS A 1 100 ? 4.544   -10.884 2.419   1.00 0.00 ? 100 LYS A HE2  3  
ATOM 4927  H HE3  . LYS A 1 100 ? 4.961   -10.108 3.946   1.00 0.00 ? 100 LYS A HE3  3  
ATOM 4928  H HZ1  . LYS A 1 100 ? 6.824   -11.238 2.690   1.00 0.00 ? 100 LYS A HZ1  3  
ATOM 4929  H HZ2  . LYS A 1 100 ? 6.121   -12.709 3.144   1.00 0.00 ? 100 LYS A HZ2  3  
ATOM 4930  H HZ3  . LYS A 1 100 ? 6.674   -11.635 4.328   1.00 0.00 ? 100 LYS A HZ3  3  
ATOM 4931  N N    . HIS A 1 101 ? 0.743   -15.206 2.725   1.00 0.00 ? 101 HIS A N    3  
ATOM 4932  C CA   . HIS A 1 101 ? -0.464  -15.677 3.396   1.00 0.00 ? 101 HIS A CA   3  
ATOM 4933  C C    . HIS A 1 101 ? -1.671  -15.591 2.466   1.00 0.00 ? 101 HIS A C    3  
ATOM 4934  O O    . HIS A 1 101 ? -2.196  -14.507 2.212   1.00 0.00 ? 101 HIS A O    3  
ATOM 4935  C CB   . HIS A 1 101 ? -0.721  -14.859 4.662   1.00 0.00 ? 101 HIS A CB   3  
ATOM 4936  C CG   . HIS A 1 101 ? 0.340   -15.022 5.706   1.00 0.00 ? 101 HIS A CG   3  
ATOM 4937  N ND1  . HIS A 1 101 ? 0.535   -16.196 6.403   1.00 0.00 ? 101 HIS A ND1  3  
ATOM 4938  C CD2  . HIS A 1 101 ? 1.268   -14.152 6.169   1.00 0.00 ? 101 HIS A CD2  3  
ATOM 4939  C CE1  . HIS A 1 101 ? 1.536   -16.040 7.251   1.00 0.00 ? 101 HIS A CE1  3  
ATOM 4940  N NE2  . HIS A 1 101 ? 1.998   -14.809 7.129   1.00 0.00 ? 101 HIS A NE2  3  
ATOM 4941  H H    . HIS A 1 101 ? 0.680   -14.455 2.099   1.00 0.00 ? 101 HIS A H    3  
ATOM 4942  H HA   . HIS A 1 101 ? -0.310  -16.709 3.670   1.00 0.00 ? 101 HIS A HA   3  
ATOM 4943  H HB2  . HIS A 1 101 ? -0.771  -13.812 4.401   1.00 0.00 ? 101 HIS A HB2  3  
ATOM 4944  H HB3  . HIS A 1 101 ? -1.663  -15.163 5.094   1.00 0.00 ? 101 HIS A HB3  3  
ATOM 4945  H HD1  . HIS A 1 101 ? 0.016   -17.019 6.294   1.00 0.00 ? 101 HIS A HD1  3  
ATOM 4946  H HD2  . HIS A 1 101 ? 1.408   -13.130 5.845   1.00 0.00 ? 101 HIS A HD2  3  
ATOM 4947  H HE1  . HIS A 1 101 ? 1.913   -16.791 7.929   1.00 0.00 ? 101 HIS A HE1  3  
ATOM 4948  H HE2  . HIS A 1 101 ? 2.683   -14.404 7.700   1.00 0.00 ? 101 HIS A HE2  3  
ATOM 4949  N N    . LYS A 1 102 ? -2.106  -16.740 1.961   1.00 0.00 ? 102 LYS A N    3  
ATOM 4950  C CA   . LYS A 1 102 ? -3.251  -16.796 1.060   1.00 0.00 ? 102 LYS A CA   3  
ATOM 4951  C C    . LYS A 1 102 ? -4.559  -16.820 1.844   1.00 0.00 ? 102 LYS A C    3  
ATOM 4952  O O    . LYS A 1 102 ? -5.599  -17.221 1.322   1.00 0.00 ? 102 LYS A O    3  
ATOM 4953  C CB   . LYS A 1 102 ? -3.159  -18.032 0.162   1.00 0.00 ? 102 LYS A CB   3  
ATOM 4954  C CG   . LYS A 1 102 ? -2.105  -17.917 -0.925  1.00 0.00 ? 102 LYS A CG   3  
ATOM 4955  C CD   . LYS A 1 102 ? -2.485  -18.721 -2.157  1.00 0.00 ? 102 LYS A CD   3  
ATOM 4956  C CE   . LYS A 1 102 ? -1.261  -19.096 -2.978  1.00 0.00 ? 102 LYS A CE   3  
ATOM 4957  N NZ   . LYS A 1 102 ? -1.612  -19.968 -4.133  1.00 0.00 ? 102 LYS A NZ   3  
ATOM 4958  H H    . LYS A 1 102 ? -1.645  -17.572 2.201   1.00 0.00 ? 102 LYS A H    3  
ATOM 4959  H HA   . LYS A 1 102 ? -3.231  -15.911 0.443   1.00 0.00 ? 102 LYS A HA   3  
ATOM 4960  H HB2  . LYS A 1 102 ? -2.924  -18.890 0.774   1.00 0.00 ? 102 LYS A HB2  3  
ATOM 4961  H HB3  . LYS A 1 102 ? -4.118  -18.190 -0.311  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 4962  H HG2  . LYS A 1 102 ? -2.000  -16.879 -1.204  1.00 0.00 ? 102 LYS A HG2  3  
ATOM 4963  H HG3  . LYS A 1 102 ? -1.164  -18.286 -0.542  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 4964  H HD2  . LYS A 1 102 ? -2.987  -19.625 -1.846  1.00 0.00 ? 102 LYS A HD2  3  
ATOM 4965  H HD3  . LYS A 1 102 ? -3.151  -18.130 -2.770  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 4966  H HE2  . LYS A 1 102 ? -0.800  -18.192 -3.347  1.00 0.00 ? 102 LYS A HE2  3  
ATOM 4967  H HE3  . LYS A 1 102 ? -0.564  -19.621 -2.341  1.00 0.00 ? 102 LYS A HE3  3  
ATOM 4968  H HZ1  . LYS A 1 102 ? -2.421  -20.574 -3.890  1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 4969  H HZ2  . LYS A 1 102 ? -0.803  -20.571 -4.384  1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 4970  H HZ3  . LYS A 1 102 ? -1.865  -19.385 -4.956  1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 4971  N N    . MET A 1 103 ? -4.500  -16.387 3.099   1.00 0.00 ? 103 MET A N    3  
ATOM 4972  C CA   . MET A 1 103 ? -5.681  -16.356 3.953   1.00 0.00 ? 103 MET A CA   3  
ATOM 4973  C C    . MET A 1 103 ? -6.344  -14.983 3.915   1.00 0.00 ? 103 MET A C    3  
ATOM 4974  O O    . MET A 1 103 ? -7.466  -14.810 4.393   1.00 0.00 ? 103 MET A O    3  
ATOM 4975  C CB   . MET A 1 103 ? -5.306  -16.714 5.392   1.00 0.00 ? 103 MET A CB   3  
ATOM 4976  C CG   . MET A 1 103 ? -4.732  -18.114 5.540   1.00 0.00 ? 103 MET A CG   3  
ATOM 4977  S SD   . MET A 1 103 ? -5.845  -19.390 4.919   1.00 0.00 ? 103 MET A SD   3  
ATOM 4978  C CE   . MET A 1 103 ? -5.107  -19.736 3.324   1.00 0.00 ? 103 MET A CE   3  
ATOM 4979  H H    . MET A 1 103 ? -3.642  -16.079 3.460   1.00 0.00 ? 103 MET A H    3  
ATOM 4980  H HA   . MET A 1 103 ? -6.379  -17.090 3.579   1.00 0.00 ? 103 MET A HA   3  
ATOM 4981  H HB2  . MET A 1 103 ? -4.570  -16.008 5.746   1.00 0.00 ? 103 MET A HB2  3  
ATOM 4982  H HB3  . MET A 1 103 ? -6.188  -16.644 6.011   1.00 0.00 ? 103 MET A HB3  3  
ATOM 4983  H HG2  . MET A 1 103 ? -3.804  -18.169 4.991   1.00 0.00 ? 103 MET A HG2  3  
ATOM 4984  H HG3  . MET A 1 103 ? -4.540  -18.301 6.586   1.00 0.00 ? 103 MET A HG3  3  
ATOM 4985  H HE1  . MET A 1 103 ? -4.583  -20.680 3.368   1.00 0.00 ? 103 MET A HE1  3  
ATOM 4986  H HE2  . MET A 1 103 ? -5.881  -19.789 2.573   1.00 0.00 ? 103 MET A HE2  3  
ATOM 4987  H HE3  . MET A 1 103 ? -4.413  -18.949 3.071   1.00 0.00 ? 103 MET A HE3  3  
ATOM 4988  N N    . LEU A 1 104 ? -5.644  -14.008 3.345   1.00 0.00 ? 104 LEU A N    3  
ATOM 4989  C CA   . LEU A 1 104 ? -6.165  -12.649 3.245   1.00 0.00 ? 104 LEU A CA   3  
ATOM 4990  C C    . LEU A 1 104 ? -6.216  -12.191 1.791   1.00 0.00 ? 104 LEU A C    3  
ATOM 4991  O O    . LEU A 1 104 ? -5.190  -12.129 1.114   1.00 0.00 ? 104 LEU A O    3  
ATOM 4992  C CB   . LEU A 1 104 ? -5.300  -11.689 4.064   1.00 0.00 ? 104 LEU A CB   3  
ATOM 4993  C CG   . LEU A 1 104 ? -4.716  -12.251 5.361   1.00 0.00 ? 104 LEU A CG   3  
ATOM 4994  C CD1  . LEU A 1 104 ? -3.530  -13.155 5.064   1.00 0.00 ? 104 LEU A CD1  3  
ATOM 4995  C CD2  . LEU A 1 104 ? -4.308  -11.121 6.295   1.00 0.00 ? 104 LEU A CD2  3  
ATOM 4996  H H    . LEU A 1 104 ? -4.755  -14.206 2.983   1.00 0.00 ? 104 LEU A H    3  
ATOM 4997  H HA   . LEU A 1 104 ? -7.167  -12.648 3.646   1.00 0.00 ? 104 LEU A HA   3  
ATOM 4998  H HB2  . LEU A 1 104 ? -4.477  -11.373 3.441   1.00 0.00 ? 104 LEU A HB2  3  
ATOM 4999  H HB3  . LEU A 1 104 ? -5.908  -10.832 4.317   1.00 0.00 ? 104 LEU A HB3  3  
ATOM 5000  H HG   . LEU A 1 104 ? -5.470  -12.843 5.861   1.00 0.00 ? 104 LEU A HG   3  
ATOM 5001  H HD11 . LEU A 1 104 ? -2.918  -13.247 5.949   1.00 0.00 ? 104 LEU A HD11 3  
ATOM 5002  H HD12 . LEU A 1 104 ? -2.944  -12.730 4.263   1.00 0.00 ? 104 LEU A HD12 3  
ATOM 5003  H HD13 . LEU A 1 104 ? -3.887  -14.132 4.770   1.00 0.00 ? 104 LEU A HD13 3  
ATOM 5004  H HD21 . LEU A 1 104 ? -3.254  -11.202 6.517   1.00 0.00 ? 104 LEU A HD21 3  
ATOM 5005  H HD22 . LEU A 1 104 ? -4.876  -11.190 7.211   1.00 0.00 ? 104 LEU A HD22 3  
ATOM 5006  H HD23 . LEU A 1 104 ? -4.505  -10.172 5.819   1.00 0.00 ? 104 LEU A HD23 3  
ATOM 5007  N N    . GLN A 1 105 ? -7.416  -11.871 1.319   1.00 0.00 ? 105 GLN A N    3  
ATOM 5008  C CA   . GLN A 1 105 ? -7.600  -11.417 -0.054  1.00 0.00 ? 105 GLN A CA   3  
ATOM 5009  C C    . GLN A 1 105 ? -8.469  -10.164 -0.102  1.00 0.00 ? 105 GLN A C    3  
ATOM 5010  O O    . GLN A 1 105 ? -9.360  -9.982  0.726   1.00 0.00 ? 105 GLN A O    3  
ATOM 5011  C CB   . GLN A 1 105 ? -8.235  -12.524 -0.898  1.00 0.00 ? 105 GLN A CB   3  
ATOM 5012  C CG   . GLN A 1 105 ? -7.518  -13.860 -0.788  1.00 0.00 ? 105 GLN A CG   3  
ATOM 5013  C CD   . GLN A 1 105 ? -7.867  -14.805 -1.921  1.00 0.00 ? 105 GLN A CD   3  
ATOM 5014  O OE1  . GLN A 1 105 ? -8.459  -14.400 -2.922  1.00 0.00 ? 105 GLN A OE1  3  
ATOM 5015  N NE2  . GLN A 1 105 ? -7.502  -16.072 -1.769  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 5016  H H    . GLN A 1 105 ? -8.196  -11.941 1.908   1.00 0.00 ? 105 GLN A H    3  
ATOM 5017  H HA   . GLN A 1 105 ? -6.628  -11.182 -0.458  1.00 0.00 ? 105 GLN A HA   3  
ATOM 5018  H HB2  . GLN A 1 105 ? -9.258  -12.661 -0.581  1.00 0.00 ? 105 GLN A HB2  3  
ATOM 5019  H HB3  . GLN A 1 105 ? -8.225  -12.220 -1.935  1.00 0.00 ? 105 GLN A HB3  3  
ATOM 5020  H HG2  . GLN A 1 105 ? -6.453  -13.685 -0.802  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 5021  H HG3  . GLN A 1 105 ? -7.793  -14.325 0.147   1.00 0.00 ? 105 GLN A HG3  3  
ATOM 5022  H HE21 . GLN A 1 105 ? -7.035  -16.323 -0.943  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 5023  H HE22 . GLN A 1 105 ? -7.716  -16.705 -2.485  1.00 0.00 ? 105 GLN A HE22 3  
ATOM 5024  N N    . GLY A 1 106 ? -8.201  -9.301  -1.077  1.00 0.00 ? 106 GLY A N    3  
ATOM 5025  C CA   . GLY A 1 106 ? -8.966  -8.076  -1.214  1.00 0.00 ? 106 GLY A CA   3  
ATOM 5026  C C    . GLY A 1 106 ? -8.319  -7.092  -2.169  1.00 0.00 ? 106 GLY A C    3  
ATOM 5027  O O    . GLY A 1 106 ? -7.730  -7.489  -3.175  1.00 0.00 ? 106 GLY A O    3  
ATOM 5028  H H    . GLY A 1 106 ? -7.478  -9.499  -1.709  1.00 0.00 ? 106 GLY A H    3  
ATOM 5029  H HA2  . GLY A 1 106 ? -9.953  -8.319  -1.578  1.00 0.00 ? 106 GLY A HA2  3  
ATOM 5030  H HA3  . GLY A 1 106 ? -9.056  -7.611  -0.244  1.00 0.00 ? 106 GLY A HA3  3  
ATOM 5031  N N    . ILE A 1 107 ? -8.431  -5.806  -1.856  1.00 0.00 ? 107 ILE A N    3  
ATOM 5032  C CA   . ILE A 1 107 ? -7.852  -4.763  -2.695  1.00 0.00 ? 107 ILE A CA   3  
ATOM 5033  C C    . ILE A 1 107 ? -7.037  -3.778  -1.864  1.00 0.00 ? 107 ILE A C    3  
ATOM 5034  O O    . ILE A 1 107 ? -7.224  -3.669  -0.652  1.00 0.00 ? 107 ILE A O    3  
ATOM 5035  C CB   . ILE A 1 107 ? -8.941  -3.991  -3.464  1.00 0.00 ? 107 ILE A CB   3  
ATOM 5036  C CG1  . ILE A 1 107 ? -9.983  -3.432  -2.493  1.00 0.00 ? 107 ILE A CG1  3  
ATOM 5037  C CG2  . ILE A 1 107 ? -9.600  -4.892  -4.497  1.00 0.00 ? 107 ILE A CG2  3  
ATOM 5038  C CD1  . ILE A 1 107 ? -10.944 -2.455  -3.134  1.00 0.00 ? 107 ILE A CD1  3  
ATOM 5039  H H    . ILE A 1 107 ? -8.913  -5.552  -1.042  1.00 0.00 ? 107 ILE A H    3  
ATOM 5040  H HA   . ILE A 1 107 ? -7.200  -5.238  -3.414  1.00 0.00 ? 107 ILE A HA   3  
ATOM 5041  H HB   . ILE A 1 107 ? -8.469  -3.172  -3.985  1.00 0.00 ? 107 ILE A HB   3  
ATOM 5042  H HG12 . ILE A 1 107 ? -10.561 -4.247  -2.087  1.00 0.00 ? 107 ILE A HG12 3  
ATOM 5043  H HG13 . ILE A 1 107 ? -9.476  -2.920  -1.688  1.00 0.00 ? 107 ILE A HG13 3  
ATOM 5044  H HG21 . ILE A 1 107 ? -9.117  -5.858  -4.492  1.00 0.00 ? 107 ILE A HG21 3  
ATOM 5045  H HG22 . ILE A 1 107 ? -10.645 -5.013  -4.253  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 5046  H HG23 . ILE A 1 107 ? -9.507  -4.448  -5.476  1.00 0.00 ? 107 ILE A HG23 3  
ATOM 5047  H HD11 . ILE A 1 107 ? -11.660 -2.997  -3.735  1.00 0.00 ? 107 ILE A HD11 3  
ATOM 5048  H HD12 . ILE A 1 107 ? -11.465 -1.905  -2.365  1.00 0.00 ? 107 ILE A HD12 3  
ATOM 5049  H HD13 . ILE A 1 107 ? -10.395 -1.769  -3.761  1.00 0.00 ? 107 ILE A HD13 3  
ATOM 5050  N N    . PHE A 1 108 ? -6.134  -3.061  -2.524  1.00 0.00 ? 108 PHE A N    3  
ATOM 5051  C CA   . PHE A 1 108 ? -5.290  -2.084  -1.846  1.00 0.00 ? 108 PHE A CA   3  
ATOM 5052  C C    . PHE A 1 108 ? -4.843  -0.989  -2.811  1.00 0.00 ? 108 PHE A C    3  
ATOM 5053  O O    . PHE A 1 108 ? -4.868  -1.154  -4.031  1.00 0.00 ? 108 PHE A O    3  
ATOM 5054  C CB   . PHE A 1 108 ? -4.067  -2.771  -1.235  1.00 0.00 ? 108 PHE A CB   3  
ATOM 5055  C CG   . PHE A 1 108 ? -3.627  -3.993  -1.989  1.00 0.00 ? 108 PHE A CG   3  
ATOM 5056  C CD1  . PHE A 1 108 ? -4.216  -5.223  -1.745  1.00 0.00 ? 108 PHE A CD1  3  
ATOM 5057  C CD2  . PHE A 1 108 ? -2.625  -3.911  -2.942  1.00 0.00 ? 108 PHE A CD2  3  
ATOM 5058  C CE1  . PHE A 1 108 ? -3.812  -6.349  -2.437  1.00 0.00 ? 108 PHE A CE1  3  
ATOM 5059  C CE2  . PHE A 1 108 ? -2.217  -5.034  -3.638  1.00 0.00 ? 108 PHE A CE2  3  
ATOM 5060  C CZ   . PHE A 1 108 ? -2.812  -6.255  -3.385  1.00 0.00 ? 108 PHE A CZ   3  
ATOM 5061  H H    . PHE A 1 108 ? -6.032  -3.193  -3.490  1.00 0.00 ? 108 PHE A H    3  
ATOM 5062  H HA   . PHE A 1 108 ? -5.873  -1.635  -1.056  1.00 0.00 ? 108 PHE A HA   3  
ATOM 5063  H HB2  . PHE A 1 108 ? -3.242  -2.075  -1.221  1.00 0.00 ? 108 PHE A HB2  3  
ATOM 5064  H HB3  . PHE A 1 108 ? -4.299  -3.068  -0.224  1.00 0.00 ? 108 PHE A HB3  3  
ATOM 5065  H HD1  . PHE A 1 108 ? -4.999  -5.299  -1.004  1.00 0.00 ? 108 PHE A HD1  3  
ATOM 5066  H HD2  . PHE A 1 108 ? -2.158  -2.957  -3.141  1.00 0.00 ? 108 PHE A HD2  3  
ATOM 5067  H HE1  . PHE A 1 108 ? -4.279  -7.302  -2.238  1.00 0.00 ? 108 PHE A HE1  3  
ATOM 5068  H HE2  . PHE A 1 108 ? -1.435  -4.956  -4.378  1.00 0.00 ? 108 PHE A HE2  3  
ATOM 5069  H HZ   . PHE A 1 108 ? -2.495  -7.133  -3.927  1.00 0.00 ? 108 PHE A HZ   3  
ATOM 5070  N N    . PRO A 1 109 ? -4.426  0.157   -2.253  1.00 0.00 ? 109 PRO A N    3  
ATOM 5071  C CA   . PRO A 1 109 ? -3.965  1.301   -3.044  1.00 0.00 ? 109 PRO A CA   3  
ATOM 5072  C C    . PRO A 1 109 ? -2.629  1.033   -3.729  1.00 0.00 ? 109 PRO A C    3  
ATOM 5073  O O    . PRO A 1 109 ? -1.676  0.579   -3.096  1.00 0.00 ? 109 PRO A O    3  
ATOM 5074  C CB   . PRO A 1 109 ? -3.820  2.416   -2.005  1.00 0.00 ? 109 PRO A CB   3  
ATOM 5075  C CG   . PRO A 1 109 ? -3.588  1.704   -0.717  1.00 0.00 ? 109 PRO A CG   3  
ATOM 5076  C CD   . PRO A 1 109 ? -4.369  0.423   -0.805  1.00 0.00 ? 109 PRO A CD   3  
ATOM 5077  H HA   . PRO A 1 109 ? -4.696  1.591   -3.785  1.00 0.00 ? 109 PRO A HA   3  
ATOM 5078  H HB2  . PRO A 1 109 ? -2.981  3.047   -2.265  1.00 0.00 ? 109 PRO A HB2  3  
ATOM 5079  H HB3  . PRO A 1 109 ? -4.724  3.004   -1.974  1.00 0.00 ? 109 PRO A HB3  3  
ATOM 5080  H HG2  . PRO A 1 109 ? -2.536  1.495   -0.597  1.00 0.00 ? 109 PRO A HG2  3  
ATOM 5081  H HG3  . PRO A 1 109 ? -3.948  2.306   0.104   1.00 0.00 ? 109 PRO A HG3  3  
ATOM 5082  H HD2  . PRO A 1 109 ? -3.852  -0.371  -0.287  1.00 0.00 ? 109 PRO A HD2  3  
ATOM 5083  H HD3  . PRO A 1 109 ? -5.362  0.556   -0.400  1.00 0.00 ? 109 PRO A HD3  3  
ATOM 5084  N N    . LYS A 1 110 ? -2.567  1.318   -5.025  1.00 0.00 ? 110 LYS A N    3  
ATOM 5085  C CA   . LYS A 1 110 ? -1.347  1.109   -5.796  1.00 0.00 ? 110 LYS A CA   3  
ATOM 5086  C C    . LYS A 1 110 ? -0.198  1.938   -5.232  1.00 0.00 ? 110 LYS A C    3  
ATOM 5087  O O    . LYS A 1 110 ? 0.947   1.486   -5.194  1.00 0.00 ? 110 LYS A O    3  
ATOM 5088  C CB   . LYS A 1 110 ? -1.579  1.473   -7.265  1.00 0.00 ? 110 LYS A CB   3  
ATOM 5089  C CG   . LYS A 1 110 ? -2.716  0.700   -7.910  1.00 0.00 ? 110 LYS A CG   3  
ATOM 5090  C CD   . LYS A 1 110 ? -3.165  1.350   -9.208  1.00 0.00 ? 110 LYS A CD   3  
ATOM 5091  C CE   . LYS A 1 110 ? -2.219  1.021   -10.353 1.00 0.00 ? 110 LYS A CE   3  
ATOM 5092  N NZ   . LYS A 1 110 ? -1.111  2.010   -10.459 1.00 0.00 ? 110 LYS A NZ   3  
ATOM 5093  H H    . LYS A 1 110 ? -3.360  1.678   -5.474  1.00 0.00 ? 110 LYS A H    3  
ATOM 5094  H HA   . LYS A 1 110 ? -1.087  0.064   -5.730  1.00 0.00 ? 110 LYS A HA   3  
ATOM 5095  H HB2  . LYS A 1 110 ? -1.805  2.527   -7.331  1.00 0.00 ? 110 LYS A HB2  3  
ATOM 5096  H HB3  . LYS A 1 110 ? -0.674  1.272   -7.820  1.00 0.00 ? 110 LYS A HB3  3  
ATOM 5097  H HG2  . LYS A 1 110 ? -2.383  -0.305  -8.120  1.00 0.00 ? 110 LYS A HG2  3  
ATOM 5098  H HG3  . LYS A 1 110 ? -3.552  0.669   -7.226  1.00 0.00 ? 110 LYS A HG3  3  
ATOM 5099  H HD2  . LYS A 1 110 ? -4.153  0.991   -9.458  1.00 0.00 ? 110 LYS A HD2  3  
ATOM 5100  H HD3  . LYS A 1 110 ? -3.194  2.422   -9.073  1.00 0.00 ? 110 LYS A HD3  3  
ATOM 5101  H HE2  . LYS A 1 110 ? -1.800  0.041   -10.186 1.00 0.00 ? 110 LYS A HE2  3  
ATOM 5102  H HE3  . LYS A 1 110 ? -2.779  1.020   -11.276 1.00 0.00 ? 110 LYS A HE3  3  
ATOM 5103  H HZ1  . LYS A 1 110 ? -1.071  2.400   -11.422 1.00 0.00 ? 110 LYS A HZ1  3  
ATOM 5104  H HZ2  . LYS A 1 110 ? -0.203  1.553   -10.242 1.00 0.00 ? 110 LYS A HZ2  3  
ATOM 5105  H HZ3  . LYS A 1 110 ? -1.263  2.789   -9.787  1.00 0.00 ? 110 LYS A HZ3  3  
ATOM 5106  N N    . SER A 1 111 ? -0.510  3.153   -4.793  1.00 0.00 ? 111 SER A N    3  
ATOM 5107  C CA   . SER A 1 111 ? 0.497   4.046   -4.232  1.00 0.00 ? 111 SER A CA   3  
ATOM 5108  C C    . SER A 1 111 ? 1.228   3.379   -3.071  1.00 0.00 ? 111 SER A C    3  
ATOM 5109  O O    . SER A 1 111 ? 2.294   3.832   -2.652  1.00 0.00 ? 111 SER A O    3  
ATOM 5110  C CB   . SER A 1 111 ? -0.152  5.349   -3.760  1.00 0.00 ? 111 SER A CB   3  
ATOM 5111  O OG   . SER A 1 111 ? -1.083  5.107   -2.720  1.00 0.00 ? 111 SER A OG   3  
ATOM 5112  H H    . SER A 1 111 ? -1.441  3.457   -4.850  1.00 0.00 ? 111 SER A H    3  
ATOM 5113  H HA   . SER A 1 111 ? 1.211   4.271   -5.010  1.00 0.00 ? 111 SER A HA   3  
ATOM 5114  H HB2  . SER A 1 111 ? 0.613   6.017   -3.394  1.00 0.00 ? 111 SER A HB2  3  
ATOM 5115  H HB3  . SER A 1 111 ? -0.668  5.812   -4.589  1.00 0.00 ? 111 SER A HB3  3  
ATOM 5116  H HG   . SER A 1 111 ? -0.776  5.523   -1.911  1.00 0.00 ? 111 SER A HG   3  
ATOM 5117  N N    . PHE A 1 112 ? 0.648   2.301   -2.556  1.00 0.00 ? 112 PHE A N    3  
ATOM 5118  C CA   . PHE A 1 112 ? 1.243   1.570   -1.443  1.00 0.00 ? 112 PHE A CA   3  
ATOM 5119  C C    . PHE A 1 112 ? 2.048   0.375   -1.944  1.00 0.00 ? 112 PHE A C    3  
ATOM 5120  O O    . PHE A 1 112 ? 2.977   -0.085  -1.279  1.00 0.00 ? 112 PHE A O    3  
ATOM 5121  C CB   . PHE A 1 112 ? 0.155   1.097   -0.476  1.00 0.00 ? 112 PHE A CB   3  
ATOM 5122  C CG   . PHE A 1 112 ? -0.300  2.162   0.481   1.00 0.00 ? 112 PHE A CG   3  
ATOM 5123  C CD1  . PHE A 1 112 ? -0.974  3.282   0.022   1.00 0.00 ? 112 PHE A CD1  3  
ATOM 5124  C CD2  . PHE A 1 112 ? -0.055  2.041   1.840   1.00 0.00 ? 112 PHE A CD2  3  
ATOM 5125  C CE1  . PHE A 1 112 ? -1.393  4.263   0.901   1.00 0.00 ? 112 PHE A CE1  3  
ATOM 5126  C CE2  . PHE A 1 112 ? -0.473  3.018   2.723   1.00 0.00 ? 112 PHE A CE2  3  
ATOM 5127  C CZ   . PHE A 1 112 ? -1.143  4.131   2.253   1.00 0.00 ? 112 PHE A CZ   3  
ATOM 5128  H H    . PHE A 1 112 ? -0.201  1.988   -2.934  1.00 0.00 ? 112 PHE A H    3  
ATOM 5129  H HA   . PHE A 1 112 ? 1.907   2.244   -0.923  1.00 0.00 ? 112 PHE A HA   3  
ATOM 5130  H HB2  . PHE A 1 112 ? -0.704  0.772   -1.043  1.00 0.00 ? 112 PHE A HB2  3  
ATOM 5131  H HB3  . PHE A 1 112 ? 0.534   0.269   0.103   1.00 0.00 ? 112 PHE A HB3  3  
ATOM 5132  H HD1  . PHE A 1 112 ? -1.170  3.387   -1.034  1.00 0.00 ? 112 PHE A HD1  3  
ATOM 5133  H HD2  . PHE A 1 112 ? 0.469   1.170   2.208   1.00 0.00 ? 112 PHE A HD2  3  
ATOM 5134  H HE1  . PHE A 1 112 ? -1.917  5.132   0.531   1.00 0.00 ? 112 PHE A HE1  3  
ATOM 5135  H HE2  . PHE A 1 112 ? -0.276  2.911   3.780   1.00 0.00 ? 112 PHE A HE2  3  
ATOM 5136  H HZ   . PHE A 1 112 ? -1.470  4.896   2.942   1.00 0.00 ? 112 PHE A HZ   3  
ATOM 5137  N N    . ILE A 1 113 ? 1.685   -0.123  -3.121  1.00 0.00 ? 113 ILE A N    3  
ATOM 5138  C CA   . ILE A 1 113 ? 2.373   -1.264  -3.713  1.00 0.00 ? 113 ILE A CA   3  
ATOM 5139  C C    . ILE A 1 113 ? 3.504   -0.809  -4.629  1.00 0.00 ? 113 ILE A C    3  
ATOM 5140  O O    . ILE A 1 113 ? 3.305   0.026   -5.511  1.00 0.00 ? 113 ILE A O    3  
ATOM 5141  C CB   . ILE A 1 113 ? 1.404   -2.152  -4.514  1.00 0.00 ? 113 ILE A CB   3  
ATOM 5142  C CG1  . ILE A 1 113 ? 0.215   -2.563  -3.643  1.00 0.00 ? 113 ILE A CG1  3  
ATOM 5143  C CG2  . ILE A 1 113 ? 2.128   -3.380  -5.046  1.00 0.00 ? 113 ILE A CG2  3  
ATOM 5144  C CD1  . ILE A 1 113 ? 0.619   -3.224  -2.343  1.00 0.00 ? 113 ILE A CD1  3  
ATOM 5145  H H    . ILE A 1 113 ? 0.937   0.287   -3.604  1.00 0.00 ? 113 ILE A H    3  
ATOM 5146  H HA   . ILE A 1 113 ? 2.790   -1.854  -2.909  1.00 0.00 ? 113 ILE A HA   3  
ATOM 5147  H HB   . ILE A 1 113 ? 1.044   -1.583  -5.358  1.00 0.00 ? 113 ILE A HB   3  
ATOM 5148  H HG12 . ILE A 1 113 ? -0.367  -1.688  -3.403  1.00 0.00 ? 113 ILE A HG12 3  
ATOM 5149  H HG13 . ILE A 1 113 ? -0.400  -3.260  -4.193  1.00 0.00 ? 113 ILE A HG13 3  
ATOM 5150  H HG21 . ILE A 1 113 ? 1.564   -3.804  -5.864  1.00 0.00 ? 113 ILE A HG21 3  
ATOM 5151  H HG22 . ILE A 1 113 ? 3.109   -3.096  -5.395  1.00 0.00 ? 113 ILE A HG22 3  
ATOM 5152  H HG23 . ILE A 1 113 ? 2.223   -4.112  -4.258  1.00 0.00 ? 113 ILE A HG23 3  
ATOM 5153  H HD11 . ILE A 1 113 ? 0.473   -2.530  -1.527  1.00 0.00 ? 113 ILE A HD11 3  
ATOM 5154  H HD12 . ILE A 1 113 ? 0.010   -4.101  -2.181  1.00 0.00 ? 113 ILE A HD12 3  
ATOM 5155  H HD13 . ILE A 1 113 ? 1.658   -3.509  -2.391  1.00 0.00 ? 113 ILE A HD13 3  
ATOM 5156  N N    . HIS A 1 114 ? 4.692   -1.365  -4.414  1.00 0.00 ? 114 HIS A N    3  
ATOM 5157  C CA   . HIS A 1 114 ? 5.856   -1.019  -5.223  1.00 0.00 ? 114 HIS A CA   3  
ATOM 5158  C C    . HIS A 1 114 ? 6.098   -2.068  -6.304  1.00 0.00 ? 114 HIS A C    3  
ATOM 5159  O O    . HIS A 1 114 ? 6.654   -3.133  -6.035  1.00 0.00 ? 114 HIS A O    3  
ATOM 5160  C CB   . HIS A 1 114 ? 7.096   -0.885  -4.339  1.00 0.00 ? 114 HIS A CB   3  
ATOM 5161  C CG   . HIS A 1 114 ? 8.330   -0.495  -5.092  1.00 0.00 ? 114 HIS A CG   3  
ATOM 5162  N ND1  . HIS A 1 114 ? 8.469   0.719   -5.732  1.00 0.00 ? 114 HIS A ND1  3  
ATOM 5163  C CD2  . HIS A 1 114 ? 9.486   -1.166  -5.306  1.00 0.00 ? 114 HIS A CD2  3  
ATOM 5164  C CE1  . HIS A 1 114 ? 9.657   0.777   -6.307  1.00 0.00 ? 114 HIS A CE1  3  
ATOM 5165  N NE2  . HIS A 1 114 ? 10.294  -0.354  -6.063  1.00 0.00 ? 114 HIS A NE2  3  
ATOM 5166  H H    . HIS A 1 114 ? 4.788   -2.025  -3.696  1.00 0.00 ? 114 HIS A H    3  
ATOM 5167  H HA   . HIS A 1 114 ? 5.659   -0.070  -5.698  1.00 0.00 ? 114 HIS A HA   3  
ATOM 5168  H HB2  . HIS A 1 114 ? 6.915   -0.131  -3.587  1.00 0.00 ? 114 HIS A HB2  3  
ATOM 5169  H HB3  . HIS A 1 114 ? 7.288   -1.831  -3.853  1.00 0.00 ? 114 HIS A HB3  3  
ATOM 5170  H HD1  . HIS A 1 114 ? 7.797   1.431   -5.761  1.00 0.00 ? 114 HIS A HD1  3  
ATOM 5171  H HD2  . HIS A 1 114 ? 9.729   -2.156  -4.947  1.00 0.00 ? 114 HIS A HD2  3  
ATOM 5172  H HE1  . HIS A 1 114 ? 10.042  1.608   -6.879  1.00 0.00 ? 114 HIS A HE1  3  
ATOM 5173  H HE2  . HIS A 1 114 ? 11.160  -0.607  -6.445  1.00 0.00 ? 114 HIS A HE2  3  
ATOM 5174  N N    . ILE A 1 115 ? 5.677   -1.760  -7.526  1.00 0.00 ? 115 ILE A N    3  
ATOM 5175  C CA   . ILE A 1 115 ? 5.849   -2.676  -8.646  1.00 0.00 ? 115 ILE A CA   3  
ATOM 5176  C C    . ILE A 1 115 ? 7.323   -2.844  -8.998  1.00 0.00 ? 115 ILE A C    3  
ATOM 5177  O O    . ILE A 1 115 ? 7.941   -1.949  -9.577  1.00 0.00 ? 115 ILE A O    3  
ATOM 5178  C CB   . ILE A 1 115 ? 5.087   -2.189  -9.893  1.00 0.00 ? 115 ILE A CB   3  
ATOM 5179  C CG1  . ILE A 1 115 ? 3.613   -1.956  -9.558  1.00 0.00 ? 115 ILE A CG1  3  
ATOM 5180  C CG2  . ILE A 1 115 ? 5.227   -3.196  -11.025 1.00 0.00 ? 115 ILE A CG2  3  
ATOM 5181  C CD1  . ILE A 1 115 ? 2.877   -3.216  -9.160  1.00 0.00 ? 115 ILE A CD1  3  
ATOM 5182  H H    . ILE A 1 115 ? 5.241   -0.895  -7.677  1.00 0.00 ? 115 ILE A H    3  
ATOM 5183  H HA   . ILE A 1 115 ? 5.448   -3.636  -8.356  1.00 0.00 ? 115 ILE A HA   3  
ATOM 5184  H HB   . ILE A 1 115 ? 5.527   -1.258  -10.216 1.00 0.00 ? 115 ILE A HB   3  
ATOM 5185  H HG12 . ILE A 1 115 ? 3.542   -1.258  -8.739  1.00 0.00 ? 115 ILE A HG12 3  
ATOM 5186  H HG13 . ILE A 1 115 ? 3.116   -1.541  -10.424 1.00 0.00 ? 115 ILE A HG13 3  
ATOM 5187  H HG21 . ILE A 1 115 ? 4.731   -2.816  -11.907 1.00 0.00 ? 115 ILE A HG21 3  
ATOM 5188  H HG22 . ILE A 1 115 ? 6.273   -3.352  -11.240 1.00 0.00 ? 115 ILE A HG22 3  
ATOM 5189  H HG23 . ILE A 1 115 ? 4.774   -4.131  -10.733 1.00 0.00 ? 115 ILE A HG23 3  
ATOM 5190  H HD11 . ILE A 1 115 ? 3.570   -4.046  -9.139  1.00 0.00 ? 115 ILE A HD11 3  
ATOM 5191  H HD12 . ILE A 1 115 ? 2.445   -3.086  -8.179  1.00 0.00 ? 115 ILE A HD12 3  
ATOM 5192  H HD13 . ILE A 1 115 ? 2.095   -3.419  -9.875  1.00 0.00 ? 115 ILE A HD13 3  
ATOM 5193  N N    . LYS A 1 116 ? 7.882   -3.996  -8.646  1.00 0.00 ? 116 LYS A N    3  
ATOM 5194  C CA   . LYS A 1 116 ? 9.284   -4.285  -8.927  1.00 0.00 ? 116 LYS A CA   3  
ATOM 5195  C C    . LYS A 1 116 ? 9.502   -4.524  -10.418 1.00 0.00 ? 116 LYS A C    3  
ATOM 5196  O O    . LYS A 1 116 ? 8.911   -5.432  -11.002 1.00 0.00 ? 116 LYS A O    3  
ATOM 5197  C CB   . LYS A 1 116 ? 9.743   -5.508  -8.130  1.00 0.00 ? 116 LYS A CB   3  
ATOM 5198  C CG   . LYS A 1 116 ? 9.802   -5.271  -6.631  1.00 0.00 ? 116 LYS A CG   3  
ATOM 5199  C CD   . LYS A 1 116 ? 10.183  -6.536  -5.881  1.00 0.00 ? 116 LYS A CD   3  
ATOM 5200  C CE   . LYS A 1 116 ? 10.923  -6.217  -4.591  1.00 0.00 ? 116 LYS A CE   3  
ATOM 5201  N NZ   . LYS A 1 116 ? 10.943  -7.381  -3.661  1.00 0.00 ? 116 LYS A NZ   3  
ATOM 5202  H H    . LYS A 1 116 ? 7.338   -4.671  -8.187  1.00 0.00 ? 116 LYS A H    3  
ATOM 5203  H HA   . LYS A 1 116 ? 9.866   -3.428  -8.623  1.00 0.00 ? 116 LYS A HA   3  
ATOM 5204  H HB2  . LYS A 1 116 ? 9.060   -6.323  -8.318  1.00 0.00 ? 116 LYS A HB2  3  
ATOM 5205  H HB3  . LYS A 1 116 ? 10.730  -5.792  -8.468  1.00 0.00 ? 116 LYS A HB3  3  
ATOM 5206  H HG2  . LYS A 1 116 ? 10.538  -4.508  -6.425  1.00 0.00 ? 116 LYS A HG2  3  
ATOM 5207  H HG3  . LYS A 1 116 ? 8.832   -4.939  -6.290  1.00 0.00 ? 116 LYS A HG3  3  
ATOM 5208  H HD2  . LYS A 1 116 ? 9.286   -7.086  -5.641  1.00 0.00 ? 116 LYS A HD2  3  
ATOM 5209  H HD3  . LYS A 1 116 ? 10.820  -7.140  -6.511  1.00 0.00 ? 116 LYS A HD3  3  
ATOM 5210  H HE2  . LYS A 1 116 ? 11.938  -5.942  -4.832  1.00 0.00 ? 116 LYS A HE2  3  
ATOM 5211  H HE3  . LYS A 1 116 ? 10.431  -5.387  -4.105  1.00 0.00 ? 116 LYS A HE3  3  
ATOM 5212  H HZ1  . LYS A 1 116 ? 10.387  -8.164  -4.057  1.00 0.00 ? 116 LYS A HZ1  3  
ATOM 5213  H HZ2  . LYS A 1 116 ? 10.537  -7.110  -2.742  1.00 0.00 ? 116 LYS A HZ2  3  
ATOM 5214  H HZ3  . LYS A 1 116 ? 11.921  -7.703  -3.514  1.00 0.00 ? 116 LYS A HZ3  3  
ATOM 5215  N N    . GLU A 1 117 ? 10.355  -3.705  -11.025 1.00 0.00 ? 117 GLU A N    3  
ATOM 5216  C CA   . GLU A 1 117 ? 10.650  -3.830  -12.448 1.00 0.00 ? 117 GLU A CA   3  
ATOM 5217  C C    . GLU A 1 117 ? 12.106  -4.233  -12.668 1.00 0.00 ? 117 GLU A C    3  
ATOM 5218  O O    . GLU A 1 117 ? 12.960  -3.390  -12.943 1.00 0.00 ? 117 GLU A O    3  
ATOM 5219  C CB   . GLU A 1 117 ? 10.360  -2.512  -13.169 1.00 0.00 ? 117 GLU A CB   3  
ATOM 5220  C CG   . GLU A 1 117 ? 8.905   -2.350  -13.577 1.00 0.00 ? 117 GLU A CG   3  
ATOM 5221  C CD   . GLU A 1 117 ? 8.556   -0.918  -13.936 1.00 0.00 ? 117 GLU A CD   3  
ATOM 5222  O OE1  . GLU A 1 117 ? 8.810   -0.020  -13.106 1.00 0.00 ? 117 GLU A OE1  3  
ATOM 5223  O OE2  . GLU A 1 117 ? 8.030   -0.696  -15.047 1.00 0.00 ? 117 GLU A OE2  3  
ATOM 5224  H H    . GLU A 1 117 ? 10.794  -3.001  -10.505 1.00 0.00 ? 117 GLU A H    3  
ATOM 5225  H HA   . GLU A 1 117 ? 10.011  -4.600  -12.853 1.00 0.00 ? 117 GLU A HA   3  
ATOM 5226  H HB2  . GLU A 1 117 ? 10.624  -1.693  -12.517 1.00 0.00 ? 117 GLU A HB2  3  
ATOM 5227  H HB3  . GLU A 1 117 ? 10.969  -2.462  -14.060 1.00 0.00 ? 117 GLU A HB3  3  
ATOM 5228  H HG2  . GLU A 1 117 ? 8.712   -2.977  -14.434 1.00 0.00 ? 117 GLU A HG2  3  
ATOM 5229  H HG3  . GLU A 1 117 ? 8.277   -2.662  -12.755 1.00 0.00 ? 117 GLU A HG3  3  
ATOM 5230  N N    . VAL A 1 118 ? 12.381  -5.527  -12.544 1.00 0.00 ? 118 VAL A N    3  
ATOM 5231  C CA   . VAL A 1 118 ? 13.732  -6.043  -12.729 1.00 0.00 ? 118 VAL A CA   3  
ATOM 5232  C C    . VAL A 1 118 ? 13.779  -7.068  -13.857 1.00 0.00 ? 118 VAL A C    3  
ATOM 5233  O O    . VAL A 1 118 ? 14.514  -6.904  -14.831 1.00 0.00 ? 118 VAL A O    3  
ATOM 5234  C CB   . VAL A 1 118 ? 14.267  -6.691  -11.438 1.00 0.00 ? 118 VAL A CB   3  
ATOM 5235  C CG1  . VAL A 1 118 ? 15.652  -7.277  -11.669 1.00 0.00 ? 118 VAL A CG1  3  
ATOM 5236  C CG2  . VAL A 1 118 ? 14.290  -5.678  -10.304 1.00 0.00 ? 118 VAL A CG2  3  
ATOM 5237  H H    . VAL A 1 118 ? 11.657  -6.151  -12.323 1.00 0.00 ? 118 VAL A H    3  
ATOM 5238  H HA   . VAL A 1 118 ? 14.374  -5.213  -12.983 1.00 0.00 ? 118 VAL A HA   3  
ATOM 5239  H HB   . VAL A 1 118 ? 13.602  -7.496  -11.161 1.00 0.00 ? 118 VAL A HB   3  
ATOM 5240  H HG11 . VAL A 1 118 ? 16.188  -7.313  -10.732 1.00 0.00 ? 118 VAL A HG11 3  
ATOM 5241  H HG12 . VAL A 1 118 ? 15.558  -8.275  -12.071 1.00 0.00 ? 118 VAL A HG12 3  
ATOM 5242  H HG13 . VAL A 1 118 ? 16.193  -6.657  -12.369 1.00 0.00 ? 118 VAL A HG13 3  
ATOM 5243  H HG21 . VAL A 1 118 ? 14.758  -4.766  -10.645 1.00 0.00 ? 118 VAL A HG21 3  
ATOM 5244  H HG22 . VAL A 1 118 ? 13.279  -5.468  -9.989  1.00 0.00 ? 118 VAL A HG22 3  
ATOM 5245  H HG23 . VAL A 1 118 ? 14.850  -6.080  -9.472  1.00 0.00 ? 118 VAL A HG23 3  
ATOM 5246  N N    . THR A 1 119 ? 12.988  -8.128  -13.719 1.00 0.00 ? 119 THR A N    3  
ATOM 5247  C CA   . THR A 1 119 ? 12.939  -9.181  -14.725 1.00 0.00 ? 119 THR A CA   3  
ATOM 5248  C C    . THR A 1 119 ? 12.841  -8.596  -16.129 1.00 0.00 ? 119 THR A C    3  
ATOM 5249  O O    . THR A 1 119 ? 13.626  -8.940  -17.013 1.00 0.00 ? 119 THR A O    3  
ATOM 5250  C CB   . THR A 1 119 ? 11.747  -10.127 -14.491 1.00 0.00 ? 119 THR A CB   3  
ATOM 5251  O OG1  . THR A 1 119 ? 11.725  -10.560 -13.127 1.00 0.00 ? 119 THR A OG1  3  
ATOM 5252  C CG2  . THR A 1 119 ? 11.826  -11.336 -15.411 1.00 0.00 ? 119 THR A CG2  3  
ATOM 5253  H H    . THR A 1 119 ? 12.425  -8.202  -12.920 1.00 0.00 ? 119 THR A H    3  
ATOM 5254  H HA   . THR A 1 119 ? 13.850  -9.758  -14.649 1.00 0.00 ? 119 THR A HA   3  
ATOM 5255  H HB   . THR A 1 119 ? 10.833  -9.590  -14.706 1.00 0.00 ? 119 THR A HB   3  
ATOM 5256  H HG1  . THR A 1 119 ? 12.615  -10.534 -12.768 1.00 0.00 ? 119 THR A HG1  3  
ATOM 5257  H HG21 . THR A 1 119 ? 11.302  -11.124 -16.330 1.00 0.00 ? 119 THR A HG21 3  
ATOM 5258  H HG22 . THR A 1 119 ? 11.373  -12.188 -14.926 1.00 0.00 ? 119 THR A HG22 3  
ATOM 5259  H HG23 . THR A 1 119 ? 12.861  -11.555 -15.629 1.00 0.00 ? 119 THR A HG23 3  
ATOM 5260  N N    . GLY A 1 1   ? 11.706  -9.329  20.487  1.00 0.00 ? 1   GLY A N    4  
ATOM 5261  C CA   . GLY A 1 1   ? 11.213  -10.271 19.500  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5262  C C    . GLY A 1 1   ? 9.973   -11.006 19.968  1.00 0.00 ? 1   GLY A C    4  
ATOM 5263  O O    . GLY A 1 1   ? 10.053  -12.150 20.416  1.00 0.00 ? 1   GLY A O    4  
ATOM 5264  H H1   . GLY A 1 1   ? 12.671  -9.221  20.619  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5265  H HA2  . GLY A 1 1   ? 10.980  -9.736  18.591  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5266  H HA3  . GLY A 1 1   ? 11.988  -10.994 19.290  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5267  N N    . SER A 1 2   ? 8.823   -10.348 19.867  1.00 0.00 ? 2   SER A N    4  
ATOM 5268  C CA   . SER A 1 2   ? 7.561   -10.944 20.290  1.00 0.00 ? 2   SER A CA   4  
ATOM 5269  C C    . SER A 1 2   ? 6.879   -11.655 19.125  1.00 0.00 ? 2   SER A C    4  
ATOM 5270  O O    . SER A 1 2   ? 6.487   -12.816 19.235  1.00 0.00 ? 2   SER A O    4  
ATOM 5271  C CB   . SER A 1 2   ? 6.632   -9.872  20.862  1.00 0.00 ? 2   SER A CB   4  
ATOM 5272  O OG   . SER A 1 2   ? 7.288   -9.109  21.861  1.00 0.00 ? 2   SER A OG   4  
ATOM 5273  H H    . SER A 1 2   ? 8.824   -9.438  19.502  1.00 0.00 ? 2   SER A H    4  
ATOM 5274  H HA   . SER A 1 2   ? 7.778   -11.669 21.060  1.00 0.00 ? 2   SER A HA   4  
ATOM 5275  H HB2  . SER A 1 2   ? 6.318   -9.210  20.069  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5276  H HB3  . SER A 1 2   ? 5.765   -10.346 21.299  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5277  H HG   . SER A 1 2   ? 7.984   -8.586  21.458  1.00 0.00 ? 2   SER A HG   4  
ATOM 5278  N N    . SER A 1 3   ? 6.740   -10.948 18.008  1.00 0.00 ? 3   SER A N    4  
ATOM 5279  C CA   . SER A 1 3   ? 6.102   -11.508 16.822  1.00 0.00 ? 3   SER A CA   4  
ATOM 5280  C C    . SER A 1 3   ? 6.615   -10.828 15.557  1.00 0.00 ? 3   SER A C    4  
ATOM 5281  O O    . SER A 1 3   ? 6.886   -9.628  15.549  1.00 0.00 ? 3   SER A O    4  
ATOM 5282  C CB   . SER A 1 3   ? 4.583   -11.357 16.916  1.00 0.00 ? 3   SER A CB   4  
ATOM 5283  O OG   . SER A 1 3   ? 4.010   -12.416 17.663  1.00 0.00 ? 3   SER A OG   4  
ATOM 5284  H H    . SER A 1 3   ? 7.073   -10.026 17.981  1.00 0.00 ? 3   SER A H    4  
ATOM 5285  H HA   . SER A 1 3   ? 6.349   -12.558 16.778  1.00 0.00 ? 3   SER A HA   4  
ATOM 5286  H HB2  . SER A 1 3   ? 4.345   -10.422 17.400  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5287  H HB3  . SER A 1 3   ? 4.161   -11.365 15.921  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5288  H HG   . SER A 1 3   ? 3.160   -12.138 18.013  1.00 0.00 ? 3   SER A HG   4  
ATOM 5289  N N    . GLY A 1 4   ? 6.747   -11.606 14.486  1.00 0.00 ? 4   GLY A N    4  
ATOM 5290  C CA   . GLY A 1 4   ? 7.227   -11.063 13.229  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5291  C C    . GLY A 1 4   ? 8.736   -11.135 13.105  1.00 0.00 ? 4   GLY A C    4  
ATOM 5292  O O    . GLY A 1 4   ? 9.420   -11.583 14.025  1.00 0.00 ? 4   GLY A O    4  
ATOM 5293  H H    . GLY A 1 4   ? 6.515   -12.556 14.551  1.00 0.00 ? 4   GLY A H    4  
ATOM 5294  H HA2  . GLY A 1 4   ? 6.783   -11.618 12.416  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5295  H HA3  . GLY A 1 4   ? 6.920   -10.030 13.156  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5296  N N    . SER A 1 5   ? 9.256   -10.693 11.965  1.00 0.00 ? 5   SER A N    4  
ATOM 5297  C CA   . SER A 1 5   ? 10.694  -10.714 11.721  1.00 0.00 ? 5   SER A CA   4  
ATOM 5298  C C    . SER A 1 5   ? 11.305  -9.337  11.958  1.00 0.00 ? 5   SER A C    4  
ATOM 5299  O O    . SER A 1 5   ? 10.724  -8.316  11.591  1.00 0.00 ? 5   SER A O    4  
ATOM 5300  C CB   . SER A 1 5   ? 10.984  -11.175 10.292  1.00 0.00 ? 5   SER A CB   4  
ATOM 5301  O OG   . SER A 1 5   ? 10.690  -10.152 9.357   1.00 0.00 ? 5   SER A OG   4  
ATOM 5302  H H    . SER A 1 5   ? 8.658   -10.347 11.269  1.00 0.00 ? 5   SER A H    4  
ATOM 5303  H HA   . SER A 1 5   ? 11.137  -11.415 12.413  1.00 0.00 ? 5   SER A HA   4  
ATOM 5304  H HB2  . SER A 1 5   ? 12.028  -11.436 10.205  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5305  H HB3  . SER A 1 5   ? 10.377  -12.039 10.065  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5306  H HG   . SER A 1 5   ? 10.293  -10.538 8.572   1.00 0.00 ? 5   SER A HG   4  
ATOM 5307  N N    . SER A 1 6   ? 12.483  -9.317  12.574  1.00 0.00 ? 6   SER A N    4  
ATOM 5308  C CA   . SER A 1 6   ? 13.173  -8.065  12.863  1.00 0.00 ? 6   SER A CA   4  
ATOM 5309  C C    . SER A 1 6   ? 14.151  -7.713  11.746  1.00 0.00 ? 6   SER A C    4  
ATOM 5310  O O    . SER A 1 6   ? 14.646  -8.589  11.040  1.00 0.00 ? 6   SER A O    4  
ATOM 5311  C CB   . SER A 1 6   ? 13.918  -8.166  14.196  1.00 0.00 ? 6   SER A CB   4  
ATOM 5312  O OG   . SER A 1 6   ? 13.023  -8.065  15.290  1.00 0.00 ? 6   SER A OG   4  
ATOM 5313  H H    . SER A 1 6   ? 12.897  -10.164 12.842  1.00 0.00 ? 6   SER A H    4  
ATOM 5314  H HA   . SER A 1 6   ? 12.430  -7.286  12.935  1.00 0.00 ? 6   SER A HA   4  
ATOM 5315  H HB2  . SER A 1 6   ? 14.428  -9.116  14.249  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5316  H HB3  . SER A 1 6   ? 14.641  -7.365  14.262  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5317  H HG   . SER A 1 6   ? 12.133  -8.270  14.995  1.00 0.00 ? 6   SER A HG   4  
ATOM 5318  N N    . GLY A 1 7   ? 14.424  -6.420  11.594  1.00 0.00 ? 7   GLY A N    4  
ATOM 5319  C CA   . GLY A 1 7   ? 15.341  -5.973  10.561  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5320  C C    . GLY A 1 7   ? 16.680  -5.539  11.123  1.00 0.00 ? 7   GLY A C    4  
ATOM 5321  O O    . GLY A 1 7   ? 16.738  -4.782  12.093  1.00 0.00 ? 7   GLY A O    4  
ATOM 5322  H H    . GLY A 1 7   ? 14.000  -5.765  12.187  1.00 0.00 ? 7   GLY A H    4  
ATOM 5323  H HA2  . GLY A 1 7   ? 15.500  -6.780  9.862   1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5324  H HA3  . GLY A 1 7   ? 14.896  -5.139  10.038  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5325  N N    . ARG A 1 8   ? 17.759  -6.020  10.515  1.00 0.00 ? 8   ARG A N    4  
ATOM 5326  C CA   . ARG A 1 8   ? 19.104  -5.679  10.963  1.00 0.00 ? 8   ARG A CA   4  
ATOM 5327  C C    . ARG A 1 8   ? 19.565  -4.362  10.346  1.00 0.00 ? 8   ARG A C    4  
ATOM 5328  O O    . ARG A 1 8   ? 19.017  -3.909  9.341   1.00 0.00 ? 8   ARG A O    4  
ATOM 5329  C CB   . ARG A 1 8   ? 20.084  -6.796  10.599  1.00 0.00 ? 8   ARG A CB   4  
ATOM 5330  C CG   . ARG A 1 8   ? 20.072  -7.960  11.577  1.00 0.00 ? 8   ARG A CG   4  
ATOM 5331  C CD   . ARG A 1 8   ? 21.040  -9.054  11.152  1.00 0.00 ? 8   ARG A CD   4  
ATOM 5332  N NE   . ARG A 1 8   ? 20.834  -10.288 11.905  1.00 0.00 ? 8   ARG A NE   4  
ATOM 5333  C CZ   . ARG A 1 8   ? 21.310  -10.490 13.129  1.00 0.00 ? 8   ARG A CZ   4  
ATOM 5334  N NH1  . ARG A 1 8   ? 22.015  -9.545  13.734  1.00 0.00 ? 8   ARG A NH1  4  
ATOM 5335  N NH2  . ARG A 1 8   ? 21.081  -11.641 13.750  1.00 0.00 ? 8   ARG A NH2  4  
ATOM 5336  H H    . ARG A 1 8   ? 17.648  -6.619  9.747   1.00 0.00 ? 8   ARG A H    4  
ATOM 5337  H HA   . ARG A 1 8   ? 19.079  -5.571  12.037  1.00 0.00 ? 8   ARG A HA   4  
ATOM 5338  H HB2  . ARG A 1 8   ? 19.832  -7.176  9.619   1.00 0.00 ? 8   ARG A HB2  4  
ATOM 5339  H HB3  . ARG A 1 8   ? 21.083  -6.387  10.571  1.00 0.00 ? 8   ARG A HB3  4  
ATOM 5340  H HG2  . ARG A 1 8   ? 20.359  -7.600  12.554  1.00 0.00 ? 8   ARG A HG2  4  
ATOM 5341  H HG3  . ARG A 1 8   ? 19.075  -8.370  11.621  1.00 0.00 ? 8   ARG A HG3  4  
ATOM 5342  H HD2  . ARG A 1 8   ? 20.895  -9.257  10.102  1.00 0.00 ? 8   ARG A HD2  4  
ATOM 5343  H HD3  . ARG A 1 8   ? 22.049  -8.707  11.316  1.00 0.00 ? 8   ARG A HD3  4  
ATOM 5344  H HE   . ARG A 1 8   ? 20.316  -11.001 11.477  1.00 0.00 ? 8   ARG A HE   4  
ATOM 5345  H HH11 . ARG A 1 8   ? 22.188  -8.676  13.270  1.00 0.00 ? 8   ARG A HH11 4  
ATOM 5346  H HH12 . ARG A 1 8   ? 22.371  -9.699  14.656  1.00 0.00 ? 8   ARG A HH12 4  
ATOM 5347  H HH21 . ARG A 1 8   ? 20.550  -12.356 13.296  1.00 0.00 ? 8   ARG A HH21 4  
ATOM 5348  H HH22 . ARG A 1 8   ? 21.440  -11.792 14.670  1.00 0.00 ? 8   ARG A HH22 4  
ATOM 5349  N N    . LEU A 1 9   ? 20.576  -3.752  10.955  1.00 0.00 ? 9   LEU A N    4  
ATOM 5350  C CA   . LEU A 1 9   ? 21.111  -2.486  10.466  1.00 0.00 ? 9   LEU A CA   4  
ATOM 5351  C C    . LEU A 1 9   ? 21.204  -2.485  8.944   1.00 0.00 ? 9   LEU A C    4  
ATOM 5352  O O    . LEU A 1 9   ? 20.906  -1.483  8.293   1.00 0.00 ? 9   LEU A O    4  
ATOM 5353  C CB   . LEU A 1 9   ? 22.491  -2.225  11.073  1.00 0.00 ? 9   LEU A CB   4  
ATOM 5354  C CG   . LEU A 1 9   ? 23.511  -3.356  10.933  1.00 0.00 ? 9   LEU A CG   4  
ATOM 5355  C CD1  . LEU A 1 9   ? 24.304  -3.203  9.645   1.00 0.00 ? 9   LEU A CD1  4  
ATOM 5356  C CD2  . LEU A 1 9   ? 24.443  -3.385  12.135  1.00 0.00 ? 9   LEU A CD2  4  
ATOM 5357  H H    . LEU A 1 9   ? 20.972  -4.161  11.752  1.00 0.00 ? 9   LEU A H    4  
ATOM 5358  H HA   . LEU A 1 9   ? 20.437  -1.700  10.774  1.00 0.00 ? 9   LEU A HA   4  
ATOM 5359  H HB2  . LEU A 1 9   ? 22.902  -1.349  10.595  1.00 0.00 ? 9   LEU A HB2  4  
ATOM 5360  H HB3  . LEU A 1 9   ? 22.356  -2.028  12.127  1.00 0.00 ? 9   LEU A HB3  4  
ATOM 5361  H HG   . LEU A 1 9   ? 22.987  -4.301  10.892  1.00 0.00 ? 9   LEU A HG   4  
ATOM 5362  H HD11 . LEU A 1 9   ? 24.344  -2.160  9.368   1.00 0.00 ? 9   LEU A HD11 4  
ATOM 5363  H HD12 . LEU A 1 9   ? 23.824  -3.766  8.858   1.00 0.00 ? 9   LEU A HD12 4  
ATOM 5364  H HD13 . LEU A 1 9   ? 25.307  -3.576  9.793   1.00 0.00 ? 9   LEU A HD13 4  
ATOM 5365  H HD21 . LEU A 1 9   ? 24.659  -4.409  12.399  1.00 0.00 ? 9   LEU A HD21 4  
ATOM 5366  H HD22 . LEU A 1 9   ? 23.968  -2.890  12.970  1.00 0.00 ? 9   LEU A HD22 4  
ATOM 5367  H HD23 . LEU A 1 9   ? 25.363  -2.874  11.890  1.00 0.00 ? 9   LEU A HD23 4  
ATOM 5368  N N    . LEU A 1 10  ? 21.617  -3.616  8.381   1.00 0.00 ? 10  LEU A N    4  
ATOM 5369  C CA   . LEU A 1 10  ? 21.747  -3.747  6.934   1.00 0.00 ? 10  LEU A CA   4  
ATOM 5370  C C    . LEU A 1 10  ? 20.471  -3.297  6.230   1.00 0.00 ? 10  LEU A C    4  
ATOM 5371  O O    . LEU A 1 10  ? 19.414  -3.185  6.850   1.00 0.00 ? 10  LEU A O    4  
ATOM 5372  C CB   . LEU A 1 10  ? 22.065  -5.196  6.561   1.00 0.00 ? 10  LEU A CB   4  
ATOM 5373  C CG   . LEU A 1 10  ? 22.893  -5.395  5.291   1.00 0.00 ? 10  LEU A CG   4  
ATOM 5374  C CD1  . LEU A 1 10  ? 24.379  -5.398  5.617   1.00 0.00 ? 10  LEU A CD1  4  
ATOM 5375  C CD2  . LEU A 1 10  ? 22.496  -6.688  4.592   1.00 0.00 ? 10  LEU A CD2  4  
ATOM 5376  H H    . LEU A 1 10  ? 21.840  -4.380  8.951   1.00 0.00 ? 10  LEU A H    4  
ATOM 5377  H HA   . LEU A 1 10  ? 22.562  -3.115  6.616   1.00 0.00 ? 10  LEU A HA   4  
ATOM 5378  H HB2  . LEU A 1 10  ? 22.609  -5.638  7.382   1.00 0.00 ? 10  LEU A HB2  4  
ATOM 5379  H HB3  . LEU A 1 10  ? 21.127  -5.717  6.431   1.00 0.00 ? 10  LEU A HB3  4  
ATOM 5380  H HG   . LEU A 1 10  ? 22.703  -4.575  4.612   1.00 0.00 ? 10  LEU A HG   4  
ATOM 5381  H HD11 . LEU A 1 10  ? 24.947  -5.495  4.704   1.00 0.00 ? 10  LEU A HD11 4  
ATOM 5382  H HD12 . LEU A 1 10  ? 24.602  -6.229  6.270   1.00 0.00 ? 10  LEU A HD12 4  
ATOM 5383  H HD13 . LEU A 1 10  ? 24.641  -4.473  6.109   1.00 0.00 ? 10  LEU A HD13 4  
ATOM 5384  H HD21 . LEU A 1 10  ? 22.871  -7.530  5.154   1.00 0.00 ? 10  LEU A HD21 4  
ATOM 5385  H HD22 . LEU A 1 10  ? 22.916  -6.702  3.597   1.00 0.00 ? 10  LEU A HD22 4  
ATOM 5386  H HD23 . LEU A 1 10  ? 21.419  -6.747  4.530   1.00 0.00 ? 10  LEU A HD23 4  
ATOM 5387  N N    . ASP A 1 11  ? 20.578  -3.042  4.930   1.00 0.00 ? 11  ASP A N    4  
ATOM 5388  C CA   . ASP A 1 11  ? 19.432  -2.607  4.140   1.00 0.00 ? 11  ASP A CA   4  
ATOM 5389  C C    . ASP A 1 11  ? 19.799  -2.502  2.663   1.00 0.00 ? 11  ASP A C    4  
ATOM 5390  O O    . ASP A 1 11  ? 20.594  -1.646  2.269   1.00 0.00 ? 11  ASP A O    4  
ATOM 5391  C CB   . ASP A 1 11  ? 18.917  -1.260  4.648   1.00 0.00 ? 11  ASP A CB   4  
ATOM 5392  C CG   . ASP A 1 11  ? 20.010  -0.426  5.287   1.00 0.00 ? 11  ASP A CG   4  
ATOM 5393  O OD1  . ASP A 1 11  ? 21.127  -0.384  4.731   1.00 0.00 ? 11  ASP A OD1  4  
ATOM 5394  O OD2  . ASP A 1 11  ? 19.748  0.185   6.344   1.00 0.00 ? 11  ASP A OD2  4  
ATOM 5395  H H    . ASP A 1 11  ? 21.448  -3.150  4.492   1.00 0.00 ? 11  ASP A H    4  
ATOM 5396  H HA   . ASP A 1 11  ? 18.653  -3.345  4.252   1.00 0.00 ? 11  ASP A HA   4  
ATOM 5397  H HB2  . ASP A 1 11  ? 18.505  -0.703  3.818   1.00 0.00 ? 11  ASP A HB2  4  
ATOM 5398  H HB3  . ASP A 1 11  ? 18.143  -1.431  5.381   1.00 0.00 ? 11  ASP A HB3  4  
ATOM 5399  N N    . LEU A 1 12  ? 19.217  -3.376  1.850   1.00 0.00 ? 12  LEU A N    4  
ATOM 5400  C CA   . LEU A 1 12  ? 19.484  -3.383  0.416   1.00 0.00 ? 12  LEU A CA   4  
ATOM 5401  C C    . LEU A 1 12  ? 18.595  -2.376  -0.308  1.00 0.00 ? 12  LEU A C    4  
ATOM 5402  O O    . LEU A 1 12  ? 19.056  -1.643  -1.181  1.00 0.00 ? 12  LEU A O    4  
ATOM 5403  C CB   . LEU A 1 12  ? 19.261  -4.783  -0.158  1.00 0.00 ? 12  LEU A CB   4  
ATOM 5404  C CG   . LEU A 1 12  ? 20.473  -5.714  -0.147  1.00 0.00 ? 12  LEU A CG   4  
ATOM 5405  C CD1  . LEU A 1 12  ? 20.880  -6.044  1.281   1.00 0.00 ? 12  LEU A CD1  4  
ATOM 5406  C CD2  . LEU A 1 12  ? 20.176  -6.987  -0.926  1.00 0.00 ? 12  LEU A CD2  4  
ATOM 5407  H H    . LEU A 1 12  ? 18.594  -4.034  2.222   1.00 0.00 ? 12  LEU A H    4  
ATOM 5408  H HA   . LEU A 1 12  ? 20.517  -3.103  0.270   1.00 0.00 ? 12  LEU A HA   4  
ATOM 5409  H HB2  . LEU A 1 12  ? 18.477  -5.254  0.415   1.00 0.00 ? 12  LEU A HB2  4  
ATOM 5410  H HB3  . LEU A 1 12  ? 18.937  -4.671  -1.183  1.00 0.00 ? 12  LEU A HB3  4  
ATOM 5411  H HG   . LEU A 1 12  ? 21.306  -5.216  -0.623  1.00 0.00 ? 12  LEU A HG   4  
ATOM 5412  H HD11 . LEU A 1 12  ? 21.672  -6.777  1.270   1.00 0.00 ? 12  LEU A HD11 4  
ATOM 5413  H HD12 . LEU A 1 12  ? 20.029  -6.442  1.815   1.00 0.00 ? 12  LEU A HD12 4  
ATOM 5414  H HD13 . LEU A 1 12  ? 21.225  -5.147  1.774   1.00 0.00 ? 12  LEU A HD13 4  
ATOM 5415  H HD21 . LEU A 1 12  ? 20.123  -6.760  -1.980  1.00 0.00 ? 12  LEU A HD21 4  
ATOM 5416  H HD22 . LEU A 1 12  ? 19.232  -7.397  -0.598  1.00 0.00 ? 12  LEU A HD22 4  
ATOM 5417  H HD23 . LEU A 1 12  ? 20.961  -7.708  -0.751  1.00 0.00 ? 12  LEU A HD23 4  
ATOM 5418  N N    . GLU A 1 13  ? 17.319  -2.347  0.064   1.00 0.00 ? 13  GLU A N    4  
ATOM 5419  C CA   . GLU A 1 13  ? 16.366  -1.429  -0.549  1.00 0.00 ? 13  GLU A CA   4  
ATOM 5420  C C    . GLU A 1 13  ? 16.631  0.007   -0.106  1.00 0.00 ? 13  GLU A C    4  
ATOM 5421  O O    . GLU A 1 13  ? 16.327  0.385   1.024   1.00 0.00 ? 13  GLU A O    4  
ATOM 5422  C CB   . GLU A 1 13  ? 14.934  -1.829  -0.188  1.00 0.00 ? 13  GLU A CB   4  
ATOM 5423  C CG   . GLU A 1 13  ? 14.318  -2.826  -1.156  1.00 0.00 ? 13  GLU A CG   4  
ATOM 5424  C CD   . GLU A 1 13  ? 12.834  -3.029  -0.918  1.00 0.00 ? 13  GLU A CD   4  
ATOM 5425  O OE1  . GLU A 1 13  ? 12.481  -3.829  -0.027  1.00 0.00 ? 13  GLU A OE1  4  
ATOM 5426  O OE2  . GLU A 1 13  ? 12.027  -2.389  -1.624  1.00 0.00 ? 13  GLU A OE2  4  
ATOM 5427  H H    . GLU A 1 13  ? 17.011  -2.957  0.767   1.00 0.00 ? 13  GLU A H    4  
ATOM 5428  H HA   . GLU A 1 13  ? 16.488  -1.491  -1.620  1.00 0.00 ? 13  GLU A HA   4  
ATOM 5429  H HB2  . GLU A 1 13  ? 14.933  -2.269  0.799   1.00 0.00 ? 13  GLU A HB2  4  
ATOM 5430  H HB3  . GLU A 1 13  ? 14.317  -0.943  -0.177  1.00 0.00 ? 13  GLU A HB3  4  
ATOM 5431  H HG2  . GLU A 1 13  ? 14.460  -2.465  -2.163  1.00 0.00 ? 13  GLU A HG2  4  
ATOM 5432  H HG3  . GLU A 1 13  ? 14.819  -3.776  -1.041  1.00 0.00 ? 13  GLU A HG3  4  
ATOM 5433  N N    . ASN A 1 14  ? 17.202  0.801   -1.006  1.00 0.00 ? 14  ASN A N    4  
ATOM 5434  C CA   . ASN A 1 14  ? 17.510  2.196   -0.708  1.00 0.00 ? 14  ASN A CA   4  
ATOM 5435  C C    . ASN A 1 14  ? 16.495  3.128   -1.362  1.00 0.00 ? 14  ASN A C    4  
ATOM 5436  O O    . ASN A 1 14  ? 16.852  4.190   -1.873  1.00 0.00 ? 14  ASN A O    4  
ATOM 5437  C CB   . ASN A 1 14  ? 18.921  2.542   -1.188  1.00 0.00 ? 14  ASN A CB   4  
ATOM 5438  C CG   . ASN A 1 14  ? 19.993  1.789   -0.424  1.00 0.00 ? 14  ASN A CG   4  
ATOM 5439  O OD1  . ASN A 1 14  ? 20.014  0.558   -0.412  1.00 0.00 ? 14  ASN A OD1  4  
ATOM 5440  N ND2  . ASN A 1 14  ? 20.889  2.527   0.220   1.00 0.00 ? 14  ASN A ND2  4  
ATOM 5441  H H    . ASN A 1 14  ? 17.421  0.442   -1.891  1.00 0.00 ? 14  ASN A H    4  
ATOM 5442  H HA   . ASN A 1 14  ? 17.462  2.324   0.363   1.00 0.00 ? 14  ASN A HA   4  
ATOM 5443  H HB2  . ASN A 1 14  ? 19.010  2.291   -2.235  1.00 0.00 ? 14  ASN A HB2  4  
ATOM 5444  H HB3  . ASN A 1 14  ? 19.089  3.600   -1.061  1.00 0.00 ? 14  ASN A HB3  4  
ATOM 5445  H HD21 . ASN A 1 14  ? 20.810  3.503   0.166   1.00 0.00 ? 14  ASN A HD21 4  
ATOM 5446  H HD22 . ASN A 1 14  ? 21.594  2.067   0.722   1.00 0.00 ? 14  ASN A HD22 4  
ATOM 5447  N N    . ILE A 1 15  ? 15.229  2.725   -1.341  1.00 0.00 ? 15  ILE A N    4  
ATOM 5448  C CA   . ILE A 1 15  ? 14.163  3.525   -1.929  1.00 0.00 ? 15  ILE A CA   4  
ATOM 5449  C C    . ILE A 1 15  ? 14.192  4.955   -1.400  1.00 0.00 ? 15  ILE A C    4  
ATOM 5450  O O    . ILE A 1 15  ? 14.472  5.185   -0.224  1.00 0.00 ? 15  ILE A O    4  
ATOM 5451  C CB   . ILE A 1 15  ? 12.778  2.913   -1.647  1.00 0.00 ? 15  ILE A CB   4  
ATOM 5452  C CG1  . ILE A 1 15  ? 12.699  1.493   -2.210  1.00 0.00 ? 15  ILE A CG1  4  
ATOM 5453  C CG2  . ILE A 1 15  ? 11.682  3.786   -2.240  1.00 0.00 ? 15  ILE A CG2  4  
ATOM 5454  C CD1  . ILE A 1 15  ? 13.334  1.349   -3.575  1.00 0.00 ? 15  ILE A CD1  4  
ATOM 5455  H H    . ILE A 1 15  ? 15.007  1.869   -0.918  1.00 0.00 ? 15  ILE A H    4  
ATOM 5456  H HA   . ILE A 1 15  ? 14.314  3.546   -2.999  1.00 0.00 ? 15  ILE A HA   4  
ATOM 5457  H HB   . ILE A 1 15  ? 12.637  2.877   -0.577  1.00 0.00 ? 15  ILE A HB   4  
ATOM 5458  H HG12 . ILE A 1 15  ? 13.203  0.817   -1.538  1.00 0.00 ? 15  ILE A HG12 4  
ATOM 5459  H HG13 . ILE A 1 15  ? 11.661  1.204   -2.294  1.00 0.00 ? 15  ILE A HG13 4  
ATOM 5460  H HG21 . ILE A 1 15  ? 11.891  4.823   -2.023  1.00 0.00 ? 15  ILE A HG21 4  
ATOM 5461  H HG22 . ILE A 1 15  ? 11.649  3.644   -3.310  1.00 0.00 ? 15  ILE A HG22 4  
ATOM 5462  H HG23 . ILE A 1 15  ? 10.731  3.512   -1.810  1.00 0.00 ? 15  ILE A HG23 4  
ATOM 5463  H HD11 . ILE A 1 15  ? 13.066  2.197   -4.189  1.00 0.00 ? 15  ILE A HD11 4  
ATOM 5464  H HD12 . ILE A 1 15  ? 14.409  1.308   -3.471  1.00 0.00 ? 15  ILE A HD12 4  
ATOM 5465  H HD13 . ILE A 1 15  ? 12.982  0.441   -4.043  1.00 0.00 ? 15  ILE A HD13 4  
ATOM 5466  N N    . GLN A 1 16  ? 13.900  5.911   -2.276  1.00 0.00 ? 16  GLN A N    4  
ATOM 5467  C CA   . GLN A 1 16  ? 13.892  7.318   -1.896  1.00 0.00 ? 16  GLN A CA   4  
ATOM 5468  C C    . GLN A 1 16  ? 12.517  7.737   -1.387  1.00 0.00 ? 16  GLN A C    4  
ATOM 5469  O O    . GLN A 1 16  ? 12.002  8.792   -1.758  1.00 0.00 ? 16  GLN A O    4  
ATOM 5470  C CB   . GLN A 1 16  ? 14.296  8.192   -3.085  1.00 0.00 ? 16  GLN A CB   4  
ATOM 5471  C CG   . GLN A 1 16  ? 15.798  8.243   -3.320  1.00 0.00 ? 16  GLN A CG   4  
ATOM 5472  C CD   . GLN A 1 16  ? 16.210  9.401   -4.207  1.00 0.00 ? 16  GLN A CD   4  
ATOM 5473  O OE1  . GLN A 1 16  ? 15.664  9.591   -5.294  1.00 0.00 ? 16  GLN A OE1  4  
ATOM 5474  N NE2  . GLN A 1 16  ? 17.180  10.183  -3.747  1.00 0.00 ? 16  GLN A NE2  4  
ATOM 5475  H H    . GLN A 1 16  ? 13.686  5.664   -3.199  1.00 0.00 ? 16  GLN A H    4  
ATOM 5476  H HA   . GLN A 1 16  ? 14.612  7.451   -1.102  1.00 0.00 ? 16  GLN A HA   4  
ATOM 5477  H HB2  . GLN A 1 16  ? 13.827  7.805   -3.977  1.00 0.00 ? 16  GLN A HB2  4  
ATOM 5478  H HB3  . GLN A 1 16  ? 13.947  9.199   -2.912  1.00 0.00 ? 16  GLN A HB3  4  
ATOM 5479  H HG2  . GLN A 1 16  ? 16.295  8.346   -2.367  1.00 0.00 ? 16  GLN A HG2  4  
ATOM 5480  H HG3  . GLN A 1 16  ? 16.107  7.321   -3.789  1.00 0.00 ? 16  GLN A HG3  4  
ATOM 5481  H HE21 . GLN A 1 16  ? 17.570  9.971   -2.873  1.00 0.00 ? 16  GLN A HE21 4  
ATOM 5482  H HE22 . GLN A 1 16  ? 17.467  10.938  -4.301  1.00 0.00 ? 16  GLN A HE22 4  
ATOM 5483  N N    . ILE A 1 17  ? 11.928  6.903   -0.536  1.00 0.00 ? 17  ILE A N    4  
ATOM 5484  C CA   . ILE A 1 17  ? 10.613  7.188   0.024   1.00 0.00 ? 17  ILE A CA   4  
ATOM 5485  C C    . ILE A 1 17  ? 10.558  8.594   0.611   1.00 0.00 ? 17  ILE A C    4  
ATOM 5486  O O    . ILE A 1 17  ? 11.489  9.055   1.271   1.00 0.00 ? 17  ILE A O    4  
ATOM 5487  C CB   . ILE A 1 17  ? 10.235  6.172   1.118   1.00 0.00 ? 17  ILE A CB   4  
ATOM 5488  C CG1  . ILE A 1 17  ? 10.222  4.753   0.545   1.00 0.00 ? 17  ILE A CG1  4  
ATOM 5489  C CG2  . ILE A 1 17  ? 8.881   6.519   1.718   1.00 0.00 ? 17  ILE A CG2  4  
ATOM 5490  C CD1  . ILE A 1 17  ? 10.192  3.674   1.604   1.00 0.00 ? 17  ILE A CD1  4  
ATOM 5491  H H    . ILE A 1 17  ? 12.389  6.078   -0.278  1.00 0.00 ? 17  ILE A H    4  
ATOM 5492  H HA   . ILE A 1 17  ? 9.888   7.114   -0.774  1.00 0.00 ? 17  ILE A HA   4  
ATOM 5493  H HB   . ILE A 1 17  ? 10.974  6.229   1.902   1.00 0.00 ? 17  ILE A HB   4  
ATOM 5494  H HG12 . ILE A 1 17  ? 9.350   4.631   -0.078  1.00 0.00 ? 17  ILE A HG12 4  
ATOM 5495  H HG13 . ILE A 1 17  ? 11.110  4.607   -0.054  1.00 0.00 ? 17  ILE A HG13 4  
ATOM 5496  H HG21 . ILE A 1 17  ? 8.808   7.589   1.848   1.00 0.00 ? 17  ILE A HG21 4  
ATOM 5497  H HG22 . ILE A 1 17  ? 8.097   6.183   1.056   1.00 0.00 ? 17  ILE A HG22 4  
ATOM 5498  H HG23 . ILE A 1 17  ? 8.776   6.032   2.676   1.00 0.00 ? 17  ILE A HG23 4  
ATOM 5499  H HD11 . ILE A 1 17  ? 9.224   3.192   1.599   1.00 0.00 ? 17  ILE A HD11 4  
ATOM 5500  H HD12 . ILE A 1 17  ? 10.957  2.942   1.395   1.00 0.00 ? 17  ILE A HD12 4  
ATOM 5501  H HD13 . ILE A 1 17  ? 10.369  4.115   2.573   1.00 0.00 ? 17  ILE A HD13 4  
ATOM 5502  N N    . PRO A 1 18  ? 9.439   9.293   0.369   1.00 0.00 ? 18  PRO A N    4  
ATOM 5503  C CA   . PRO A 1 18  ? 9.234   10.657  0.866   1.00 0.00 ? 18  PRO A CA   4  
ATOM 5504  C C    . PRO A 1 18  ? 9.050   10.700  2.379   1.00 0.00 ? 18  PRO A C    4  
ATOM 5505  O O    . PRO A 1 18  ? 9.212   9.689   3.063   1.00 0.00 ? 18  PRO A O    4  
ATOM 5506  C CB   . PRO A 1 18  ? 7.953   11.104  0.159   1.00 0.00 ? 18  PRO A CB   4  
ATOM 5507  C CG   . PRO A 1 18  ? 7.227   9.839   -0.146  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5508  C CD   . PRO A 1 18  ? 8.288   8.807   -0.410  1.00 0.00 ? 18  PRO A CD   4  
ATOM 5509  H HA   . PRO A 1 18  ? 10.049  11.308  0.586   1.00 0.00 ? 18  PRO A HA   4  
ATOM 5510  H HB2  . PRO A 1 18  ? 7.378   11.741  0.817   1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5511  H HB3  . PRO A 1 18  ? 8.204   11.642  -0.743  1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5512  H HG2  . PRO A 1 18  ? 6.624   9.549   0.700   1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5513  H HG3  . PRO A 1 18  ? 6.609   9.973   -1.022  1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5514  H HD2  . PRO A 1 18  ? 7.967   7.837   -0.059  1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5515  H HD3  . PRO A 1 18  ? 8.524   8.769   -1.463  1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5516  N N    . ASP A 1 19  ? 8.709   11.876  2.896   1.00 0.00 ? 19  ASP A N    4  
ATOM 5517  C CA   . ASP A 1 19  ? 8.501   12.050  4.329   1.00 0.00 ? 19  ASP A CA   4  
ATOM 5518  C C    . ASP A 1 19  ? 7.188   11.410  4.769   1.00 0.00 ? 19  ASP A C    4  
ATOM 5519  O O    . ASP A 1 19  ? 7.122   10.759  5.810   1.00 0.00 ? 19  ASP A O    4  
ATOM 5520  C CB   . ASP A 1 19  ? 8.505   13.536  4.689   1.00 0.00 ? 19  ASP A CB   4  
ATOM 5521  C CG   . ASP A 1 19  ? 7.245   14.246  4.235   1.00 0.00 ? 19  ASP A CG   4  
ATOM 5522  O OD1  . ASP A 1 19  ? 6.844   14.053  3.068   1.00 0.00 ? 19  ASP A OD1  4  
ATOM 5523  O OD2  . ASP A 1 19  ? 6.660   14.993  5.046   1.00 0.00 ? 19  ASP A OD2  4  
ATOM 5524  H H    . ASP A 1 19  ? 8.595   12.645  2.299   1.00 0.00 ? 19  ASP A H    4  
ATOM 5525  H HA   . ASP A 1 19  ? 9.315   11.562  4.844   1.00 0.00 ? 19  ASP A HA   4  
ATOM 5526  H HB2  . ASP A 1 19  ? 8.587   13.640  5.762   1.00 0.00 ? 19  ASP A HB2  4  
ATOM 5527  H HB3  . ASP A 1 19  ? 9.354   14.011  4.220   1.00 0.00 ? 19  ASP A HB3  4  
ATOM 5528  N N    . ALA A 1 20  ? 6.145   11.603  3.968   1.00 0.00 ? 20  ALA A N    4  
ATOM 5529  C CA   . ALA A 1 20  ? 4.833   11.045  4.275   1.00 0.00 ? 20  ALA A CA   4  
ATOM 5530  C C    . ALA A 1 20  ? 4.183   10.455  3.028   1.00 0.00 ? 20  ALA A C    4  
ATOM 5531  O O    . ALA A 1 20  ? 4.429   10.893  1.904   1.00 0.00 ? 20  ALA A O    4  
ATOM 5532  C CB   . ALA A 1 20  ? 3.936   12.110  4.887   1.00 0.00 ? 20  ALA A CB   4  
ATOM 5533  H H    . ALA A 1 20  ? 6.260   12.132  3.152   1.00 0.00 ? 20  ALA A H    4  
ATOM 5534  H HA   . ALA A 1 20  ? 4.967   10.259  5.004   1.00 0.00 ? 20  ALA A HA   4  
ATOM 5535  H HB1  . ALA A 1 20  ? 4.478   12.635  5.660   1.00 0.00 ? 20  ALA A HB1  4  
ATOM 5536  H HB2  . ALA A 1 20  ? 3.633   12.809  4.121   1.00 0.00 ? 20  ALA A HB2  4  
ATOM 5537  H HB3  . ALA A 1 20  ? 3.062   11.642  5.314   1.00 0.00 ? 20  ALA A HB3  4  
ATOM 5538  N N    . PRO A 1 21  ? 3.332   9.438   3.228   1.00 0.00 ? 21  PRO A N    4  
ATOM 5539  C CA   . PRO A 1 21  ? 2.629   8.766   2.131   1.00 0.00 ? 21  PRO A CA   4  
ATOM 5540  C C    . PRO A 1 21  ? 1.568   9.656   1.492   1.00 0.00 ? 21  PRO A C    4  
ATOM 5541  O O    . PRO A 1 21  ? 1.000   10.542  2.130   1.00 0.00 ? 21  PRO A O    4  
ATOM 5542  C CB   . PRO A 1 21  ? 1.977   7.561   2.813   1.00 0.00 ? 21  PRO A CB   4  
ATOM 5543  C CG   . PRO A 1 21  ? 1.822   7.970   4.237   1.00 0.00 ? 21  PRO A CG   4  
ATOM 5544  C CD   . PRO A 1 21  ? 2.991   8.864   4.541   1.00 0.00 ? 21  PRO A CD   4  
ATOM 5545  H HA   . PRO A 1 21  ? 3.316   8.424   1.370   1.00 0.00 ? 21  PRO A HA   4  
ATOM 5546  H HB2  . PRO A 1 21  ? 1.020   7.359   2.352   1.00 0.00 ? 21  PRO A HB2  4  
ATOM 5547  H HB3  . PRO A 1 21  ? 2.618   6.698   2.717   1.00 0.00 ? 21  PRO A HB3  4  
ATOM 5548  H HG2  . PRO A 1 21  ? 0.895   8.508   4.366   1.00 0.00 ? 21  PRO A HG2  4  
ATOM 5549  H HG3  . PRO A 1 21  ? 1.842   7.097   4.873   1.00 0.00 ? 21  PRO A HG3  4  
ATOM 5550  H HD2  . PRO A 1 21  ? 2.704   9.638   5.237   1.00 0.00 ? 21  PRO A HD2  4  
ATOM 5551  H HD3  . PRO A 1 21  ? 3.815   8.288   4.934   1.00 0.00 ? 21  PRO A HD3  4  
ATOM 5552  N N    . PRO A 1 22  ? 1.293   9.416   0.201   1.00 0.00 ? 22  PRO A N    4  
ATOM 5553  C CA   . PRO A 1 22  ? 0.297   10.185  -0.552  1.00 0.00 ? 22  PRO A CA   4  
ATOM 5554  C C    . PRO A 1 22  ? -1.128  9.895   -0.092  1.00 0.00 ? 22  PRO A C    4  
ATOM 5555  O O    . PRO A 1 22  ? -1.403  8.886   0.557   1.00 0.00 ? 22  PRO A O    4  
ATOM 5556  C CB   . PRO A 1 22  ? 0.500   9.712   -1.993  1.00 0.00 ? 22  PRO A CB   4  
ATOM 5557  C CG   . PRO A 1 22  ? 1.087   8.348   -1.866  1.00 0.00 ? 22  PRO A CG   4  
ATOM 5558  C CD   . PRO A 1 22  ? 1.931   8.375   -0.622  1.00 0.00 ? 22  PRO A CD   4  
ATOM 5559  H HA   . PRO A 1 22  ? 0.486   11.246  -0.489  1.00 0.00 ? 22  PRO A HA   4  
ATOM 5560  H HB2  . PRO A 1 22  ? -0.452  9.687   -2.504  1.00 0.00 ? 22  PRO A HB2  4  
ATOM 5561  H HB3  . PRO A 1 22  ? 1.173   10.384  -2.505  1.00 0.00 ? 22  PRO A HB3  4  
ATOM 5562  H HG2  . PRO A 1 22  ? 0.298   7.617   -1.768  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 5563  H HG3  . PRO A 1 22  ? 1.698   8.130   -2.729  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 5564  H HD2  . PRO A 1 22  ? 1.901   7.417   -0.124  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 5565  H HD3  . PRO A 1 22  ? 2.949   8.645   -0.863  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 5566  N N    . PRO A 1 23  ? -2.056  10.800  -0.435  1.00 0.00 ? 23  PRO A N    4  
ATOM 5567  C CA   . PRO A 1 23  ? -3.469  10.663  -0.069  1.00 0.00 ? 23  PRO A CA   4  
ATOM 5568  C C    . PRO A 1 23  ? -4.156  9.528   -0.821  1.00 0.00 ? 23  PRO A C    4  
ATOM 5569  O O    . PRO A 1 23  ? -4.204  9.528   -2.052  1.00 0.00 ? 23  PRO A O    4  
ATOM 5570  C CB   . PRO A 1 23  ? -4.072  12.012  -0.468  1.00 0.00 ? 23  PRO A CB   4  
ATOM 5571  C CG   . PRO A 1 23  ? -3.178  12.522  -1.545  1.00 0.00 ? 23  PRO A CG   4  
ATOM 5572  C CD   . PRO A 1 23  ? -1.799  12.027  -1.208  1.00 0.00 ? 23  PRO A CD   4  
ATOM 5573  H HA   . PRO A 1 23  ? -3.590  10.513  0.994   1.00 0.00 ? 23  PRO A HA   4  
ATOM 5574  H HB2  . PRO A 1 23  ? -5.081  11.866  -0.828  1.00 0.00 ? 23  PRO A HB2  4  
ATOM 5575  H HB3  . PRO A 1 23  ? -4.080  12.674  0.385   1.00 0.00 ? 23  PRO A HB3  4  
ATOM 5576  H HG2  . PRO A 1 23  ? -3.493  12.131  -2.501  1.00 0.00 ? 23  PRO A HG2  4  
ATOM 5577  H HG3  . PRO A 1 23  ? -3.196  13.602  -1.556  1.00 0.00 ? 23  PRO A HG3  4  
ATOM 5578  H HD2  . PRO A 1 23  ? -1.246  11.806  -2.109  1.00 0.00 ? 23  PRO A HD2  4  
ATOM 5579  H HD3  . PRO A 1 23  ? -1.272  12.756  -0.609  1.00 0.00 ? 23  PRO A HD3  4  
ATOM 5580  N N    . ILE A 1 24  ? -4.685  8.565   -0.075  1.00 0.00 ? 24  ILE A N    4  
ATOM 5581  C CA   . ILE A 1 24  ? -5.370  7.425   -0.674  1.00 0.00 ? 24  ILE A CA   4  
ATOM 5582  C C    . ILE A 1 24  ? -6.510  7.882   -1.577  1.00 0.00 ? 24  ILE A C    4  
ATOM 5583  O O    . ILE A 1 24  ? -7.328  8.725   -1.208  1.00 0.00 ? 24  ILE A O    4  
ATOM 5584  C CB   . ILE A 1 24  ? -5.931  6.478   0.403   1.00 0.00 ? 24  ILE A CB   4  
ATOM 5585  C CG1  . ILE A 1 24  ? -4.797  5.926   1.269   1.00 0.00 ? 24  ILE A CG1  4  
ATOM 5586  C CG2  . ILE A 1 24  ? -6.710  5.343   -0.245  1.00 0.00 ? 24  ILE A CG2  4  
ATOM 5587  C CD1  . ILE A 1 24  ? -5.280  5.136   2.465   1.00 0.00 ? 24  ILE A CD1  4  
ATOM 5588  H H    . ILE A 1 24  ? -4.613  8.621   0.900   1.00 0.00 ? 24  ILE A H    4  
ATOM 5589  H HA   . ILE A 1 24  ? -4.651  6.879   -1.267  1.00 0.00 ? 24  ILE A HA   4  
ATOM 5590  H HB   . ILE A 1 24  ? -6.610  7.039   1.026   1.00 0.00 ? 24  ILE A HB   4  
ATOM 5591  H HG12 . ILE A 1 24  ? -4.179  5.276   0.671   1.00 0.00 ? 24  ILE A HG12 4  
ATOM 5592  H HG13 . ILE A 1 24  ? -4.200  6.749   1.634   1.00 0.00 ? 24  ILE A HG13 4  
ATOM 5593  H HG21 . ILE A 1 24  ? -6.098  4.453   -0.268  1.00 0.00 ? 24  ILE A HG21 4  
ATOM 5594  H HG22 . ILE A 1 24  ? -7.605  5.148   0.328   1.00 0.00 ? 24  ILE A HG22 4  
ATOM 5595  H HG23 . ILE A 1 24  ? -6.980  5.620   -1.253  1.00 0.00 ? 24  ILE A HG23 4  
ATOM 5596  H HD11 . ILE A 1 24  ? -6.339  5.301   2.602   1.00 0.00 ? 24  ILE A HD11 4  
ATOM 5597  H HD12 . ILE A 1 24  ? -5.100  4.084   2.299   1.00 0.00 ? 24  ILE A HD12 4  
ATOM 5598  H HD13 . ILE A 1 24  ? -4.749  5.457   3.348   1.00 0.00 ? 24  ILE A HD13 4  
ATOM 5599  N N    . PRO A 1 25  ? -6.568  7.313   -2.790  1.00 0.00 ? 25  PRO A N    4  
ATOM 5600  C CA   . PRO A 1 25  ? -7.605  7.644   -3.772  1.00 0.00 ? 25  PRO A CA   4  
ATOM 5601  C C    . PRO A 1 25  ? -8.980  7.131   -3.357  1.00 0.00 ? 25  PRO A C    4  
ATOM 5602  O O    . PRO A 1 25  ? -9.125  6.478   -2.324  1.00 0.00 ? 25  PRO A O    4  
ATOM 5603  C CB   . PRO A 1 25  ? -7.131  6.935   -5.042  1.00 0.00 ? 25  PRO A CB   4  
ATOM 5604  C CG   . PRO A 1 25  ? -6.286  5.809   -4.555  1.00 0.00 ? 25  PRO A CG   4  
ATOM 5605  C CD   . PRO A 1 25  ? -5.625  6.301   -3.297  1.00 0.00 ? 25  PRO A CD   4  
ATOM 5606  H HA   . PRO A 1 25  ? -7.657  8.708   -3.950  1.00 0.00 ? 25  PRO A HA   4  
ATOM 5607  H HB2  . PRO A 1 25  ? -7.986  6.577   -5.598  1.00 0.00 ? 25  PRO A HB2  4  
ATOM 5608  H HB3  . PRO A 1 25  ? -6.560  7.621   -5.651  1.00 0.00 ? 25  PRO A HB3  4  
ATOM 5609  H HG2  . PRO A 1 25  ? -6.905  4.951   -4.342  1.00 0.00 ? 25  PRO A HG2  4  
ATOM 5610  H HG3  . PRO A 1 25  ? -5.541  5.561   -5.297  1.00 0.00 ? 25  PRO A HG3  4  
ATOM 5611  H HD2  . PRO A 1 25  ? -5.510  5.493   -2.590  1.00 0.00 ? 25  PRO A HD2  4  
ATOM 5612  H HD3  . PRO A 1 25  ? -4.668  6.746   -3.523  1.00 0.00 ? 25  PRO A HD3  4  
ATOM 5613  N N    . LYS A 1 26  ? -9.988  7.431   -4.170  1.00 0.00 ? 26  LYS A N    4  
ATOM 5614  C CA   . LYS A 1 26  ? -11.352 6.999   -3.890  1.00 0.00 ? 26  LYS A CA   4  
ATOM 5615  C C    . LYS A 1 26  ? -11.540 5.527   -4.244  1.00 0.00 ? 26  LYS A C    4  
ATOM 5616  O O    . LYS A 1 26  ? -11.303 5.118   -5.380  1.00 0.00 ? 26  LYS A O    4  
ATOM 5617  C CB   . LYS A 1 26  ? -12.350 7.855   -4.672  1.00 0.00 ? 26  LYS A CB   4  
ATOM 5618  C CG   . LYS A 1 26  ? -12.798 9.101   -3.927  1.00 0.00 ? 26  LYS A CG   4  
ATOM 5619  C CD   . LYS A 1 26  ? -11.684 10.131  -3.844  1.00 0.00 ? 26  LYS A CD   4  
ATOM 5620  C CE   . LYS A 1 26  ? -12.218 11.500  -3.452  1.00 0.00 ? 26  LYS A CE   4  
ATOM 5621  N NZ   . LYS A 1 26  ? -13.171 12.034  -4.463  1.00 0.00 ? 26  LYS A NZ   4  
ATOM 5622  H H    . LYS A 1 26  ? -9.809  7.955   -4.980  1.00 0.00 ? 26  LYS A H    4  
ATOM 5623  H HA   . LYS A 1 26  ? -11.530 7.128   -2.833  1.00 0.00 ? 26  LYS A HA   4  
ATOM 5624  H HB2  . LYS A 1 26  ? -11.894 8.161   -5.602  1.00 0.00 ? 26  LYS A HB2  4  
ATOM 5625  H HB3  . LYS A 1 26  ? -13.225 7.258   -4.890  1.00 0.00 ? 26  LYS A HB3  4  
ATOM 5626  H HG2  . LYS A 1 26  ? -13.638 9.537   -4.446  1.00 0.00 ? 26  LYS A HG2  4  
ATOM 5627  H HG3  . LYS A 1 26  ? -13.095 8.823   -2.926  1.00 0.00 ? 26  LYS A HG3  4  
ATOM 5628  H HD2  . LYS A 1 26  ? -10.965 9.812   -3.104  1.00 0.00 ? 26  LYS A HD2  4  
ATOM 5629  H HD3  . LYS A 1 26  ? -11.201 10.205  -4.809  1.00 0.00 ? 26  LYS A HD3  4  
ATOM 5630  H HE2  . LYS A 1 26  ? -12.724 11.415  -2.502  1.00 0.00 ? 26  LYS A HE2  4  
ATOM 5631  H HE3  . LYS A 1 26  ? -11.387 12.182  -3.357  1.00 0.00 ? 26  LYS A HE3  4  
ATOM 5632  H HZ1  . LYS A 1 26  ? -12.907 11.704  -5.413  1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 5633  H HZ2  . LYS A 1 26  ? -13.158 13.074  -4.453  1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 5634  H HZ3  . LYS A 1 26  ? -14.136 11.709  -4.252  1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 5635  N N    . GLU A 1 27  ? -11.970 4.738   -3.265  1.00 0.00 ? 27  GLU A N    4  
ATOM 5636  C CA   . GLU A 1 27  ? -12.191 3.312   -3.476  1.00 0.00 ? 27  GLU A CA   4  
ATOM 5637  C C    . GLU A 1 27  ? -13.036 3.070   -4.723  1.00 0.00 ? 27  GLU A C    4  
ATOM 5638  O O    . GLU A 1 27  ? -13.944 3.837   -5.047  1.00 0.00 ? 27  GLU A O    4  
ATOM 5639  C CB   . GLU A 1 27  ? -12.875 2.693   -2.255  1.00 0.00 ? 27  GLU A CB   4  
ATOM 5640  C CG   . GLU A 1 27  ? -11.938 2.468   -1.081  1.00 0.00 ? 27  GLU A CG   4  
ATOM 5641  C CD   . GLU A 1 27  ? -12.352 1.288   -0.222  1.00 0.00 ? 27  GLU A CD   4  
ATOM 5642  O OE1  . GLU A 1 27  ? -13.136 1.493   0.728   1.00 0.00 ? 27  GLU A OE1  4  
ATOM 5643  O OE2  . GLU A 1 27  ? -11.891 0.161   -0.500  1.00 0.00 ? 27  GLU A OE2  4  
ATOM 5644  H H    . GLU A 1 27  ? -12.142 5.123   -2.381  1.00 0.00 ? 27  GLU A H    4  
ATOM 5645  H HA   . GLU A 1 27  ? -11.228 2.844   -3.612  1.00 0.00 ? 27  GLU A HA   4  
ATOM 5646  H HB2  . GLU A 1 27  ? -13.672 3.348   -1.934  1.00 0.00 ? 27  GLU A HB2  4  
ATOM 5647  H HB3  . GLU A 1 27  ? -13.298 1.741   -2.539  1.00 0.00 ? 27  GLU A HB3  4  
ATOM 5648  H HG2  . GLU A 1 27  ? -10.943 2.286   -1.460  1.00 0.00 ? 27  GLU A HG2  4  
ATOM 5649  H HG3  . GLU A 1 27  ? -11.931 3.356   -0.467  1.00 0.00 ? 27  GLU A HG3  4  
ATOM 5650  N N    . PRO A 1 28  ? -12.731 1.980   -5.442  1.00 0.00 ? 28  PRO A N    4  
ATOM 5651  C CA   . PRO A 1 28  ? -13.450 1.612   -6.666  1.00 0.00 ? 28  PRO A CA   4  
ATOM 5652  C C    . PRO A 1 28  ? -14.874 1.147   -6.383  1.00 0.00 ? 28  PRO A C    4  
ATOM 5653  O O    . PRO A 1 28  ? -15.093 0.019   -5.942  1.00 0.00 ? 28  PRO A O    4  
ATOM 5654  C CB   . PRO A 1 28  ? -12.615 0.462   -7.235  1.00 0.00 ? 28  PRO A CB   4  
ATOM 5655  C CG   . PRO A 1 28  ? -11.922 -0.124  -6.054  1.00 0.00 ? 28  PRO A CG   4  
ATOM 5656  C CD   . PRO A 1 28  ? -11.661 1.022   -5.116  1.00 0.00 ? 28  PRO A CD   4  
ATOM 5657  H HA   . PRO A 1 28  ? -13.472 2.427   -7.373  1.00 0.00 ? 28  PRO A HA   4  
ATOM 5658  H HB2  . PRO A 1 28  ? -13.267 -0.259  -7.709  1.00 0.00 ? 28  PRO A HB2  4  
ATOM 5659  H HB3  . PRO A 1 28  ? -11.910 0.847   -7.956  1.00 0.00 ? 28  PRO A HB3  4  
ATOM 5660  H HG2  . PRO A 1 28  ? -12.557 -0.858  -5.581  1.00 0.00 ? 28  PRO A HG2  4  
ATOM 5661  H HG3  . PRO A 1 28  ? -10.990 -0.575  -6.362  1.00 0.00 ? 28  PRO A HG3  4  
ATOM 5662  H HD2  . PRO A 1 28  ? -11.736 0.695   -4.090  1.00 0.00 ? 28  PRO A HD2  4  
ATOM 5663  H HD3  . PRO A 1 28  ? -10.689 1.452   -5.307  1.00 0.00 ? 28  PRO A HD3  4  
ATOM 5664  N N    . SER A 1 29  ? -15.840 2.024   -6.641  1.00 0.00 ? 29  SER A N    4  
ATOM 5665  C CA   . SER A 1 29  ? -17.244 1.704   -6.410  1.00 0.00 ? 29  SER A CA   4  
ATOM 5666  C C    . SER A 1 29  ? -17.823 0.924   -7.587  1.00 0.00 ? 29  SER A C    4  
ATOM 5667  O O    . SER A 1 29  ? -18.896 1.249   -8.093  1.00 0.00 ? 29  SER A O    4  
ATOM 5668  C CB   . SER A 1 29  ? -18.050 2.985   -6.187  1.00 0.00 ? 29  SER A CB   4  
ATOM 5669  O OG   . SER A 1 29  ? -18.123 3.756   -7.374  1.00 0.00 ? 29  SER A OG   4  
ATOM 5670  H H    . SER A 1 29  ? -15.601 2.908   -6.991  1.00 0.00 ? 29  SER A H    4  
ATOM 5671  H HA   . SER A 1 29  ? -17.303 1.092   -5.523  1.00 0.00 ? 29  SER A HA   4  
ATOM 5672  H HB2  . SER A 1 29  ? -19.052 2.727   -5.878  1.00 0.00 ? 29  SER A HB2  4  
ATOM 5673  H HB3  . SER A 1 29  ? -17.576 3.575   -5.416  1.00 0.00 ? 29  SER A HB3  4  
ATOM 5674  H HG   . SER A 1 29  ? -17.884 3.209   -8.126  1.00 0.00 ? 29  SER A HG   4  
ATOM 5675  N N    . ASN A 1 30  ? -17.104 -0.108  -8.016  1.00 0.00 ? 30  ASN A N    4  
ATOM 5676  C CA   . ASN A 1 30  ? -17.545 -0.936  -9.133  1.00 0.00 ? 30  ASN A CA   4  
ATOM 5677  C C    . ASN A 1 30  ? -16.603 -2.118  -9.339  1.00 0.00 ? 30  ASN A C    4  
ATOM 5678  O O    . ASN A 1 30  ? -15.468 -1.951  -9.788  1.00 0.00 ? 30  ASN A O    4  
ATOM 5679  C CB   . ASN A 1 30  ? -17.622 -0.102  -10.413 1.00 0.00 ? 30  ASN A CB   4  
ATOM 5680  C CG   . ASN A 1 30  ? -16.268 0.435   -10.836 1.00 0.00 ? 30  ASN A CG   4  
ATOM 5681  O OD1  . ASN A 1 30  ? -15.544 1.025   -10.034 1.00 0.00 ? 30  ASN A OD1  4  
ATOM 5682  N ND2  . ASN A 1 30  ? -15.921 0.233   -12.102 1.00 0.00 ? 30  ASN A ND2  4  
ATOM 5683  H H    . ASN A 1 30  ? -16.256 -0.318  -7.571  1.00 0.00 ? 30  ASN A H    4  
ATOM 5684  H HA   . ASN A 1 30  ? -18.529 -1.311  -8.898  1.00 0.00 ? 30  ASN A HA   4  
ATOM 5685  H HB2  . ASN A 1 30  ? -18.010 -0.716  -11.213 1.00 0.00 ? 30  ASN A HB2  4  
ATOM 5686  H HB3  . ASN A 1 30  ? -18.287 0.734   -10.252 1.00 0.00 ? 30  ASN A HB3  4  
ATOM 5687  H HD21 . ASN A 1 30  ? -16.549 -0.244  -12.684 1.00 0.00 ? 30  ASN A HD21 4  
ATOM 5688  H HD22 . ASN A 1 30  ? -15.051 0.570   -12.402 1.00 0.00 ? 30  ASN A HD22 4  
ATOM 5689  N N    . TYR A 1 31  ? -17.081 -3.313  -9.009  1.00 0.00 ? 31  TYR A N    4  
ATOM 5690  C CA   . TYR A 1 31  ? -16.281 -4.523  -9.156  1.00 0.00 ? 31  TYR A CA   4  
ATOM 5691  C C    . TYR A 1 31  ? -16.575 -5.211  -10.486 1.00 0.00 ? 31  TYR A C    4  
ATOM 5692  O O    . TYR A 1 31  ? -17.726 -5.294  -10.914 1.00 0.00 ? 31  TYR A O    4  
ATOM 5693  C CB   . TYR A 1 31  ? -16.557 -5.485  -7.999  1.00 0.00 ? 31  TYR A CB   4  
ATOM 5694  C CG   . TYR A 1 31  ? -16.583 -4.812  -6.646  1.00 0.00 ? 31  TYR A CG   4  
ATOM 5695  C CD1  . TYR A 1 31  ? -15.610 -3.886  -6.290  1.00 0.00 ? 31  TYR A CD1  4  
ATOM 5696  C CD2  . TYR A 1 31  ? -17.579 -5.104  -5.722  1.00 0.00 ? 31  TYR A CD2  4  
ATOM 5697  C CE1  . TYR A 1 31  ? -15.629 -3.269  -5.054  1.00 0.00 ? 31  TYR A CE1  4  
ATOM 5698  C CE2  . TYR A 1 31  ? -17.607 -4.491  -4.484  1.00 0.00 ? 31  TYR A CE2  4  
ATOM 5699  C CZ   . TYR A 1 31  ? -16.630 -3.575  -4.155  1.00 0.00 ? 31  TYR A CZ   4  
ATOM 5700  O OH   . TYR A 1 31  ? -16.653 -2.963  -2.922  1.00 0.00 ? 31  TYR A OH   4  
ATOM 5701  H H    . TYR A 1 31  ? -17.992 -3.382  -8.657  1.00 0.00 ? 31  TYR A H    4  
ATOM 5702  H HA   . TYR A 1 31  ? -15.240 -4.238  -9.134  1.00 0.00 ? 31  TYR A HA   4  
ATOM 5703  H HB2  . TYR A 1 31  ? -17.515 -5.957  -8.153  1.00 0.00 ? 31  TYR A HB2  4  
ATOM 5704  H HB3  . TYR A 1 31  ? -15.787 -6.243  -7.979  1.00 0.00 ? 31  TYR A HB3  4  
ATOM 5705  H HD1  . TYR A 1 31  ? -14.827 -3.649  -6.996  1.00 0.00 ? 31  TYR A HD1  4  
ATOM 5706  H HD2  . TYR A 1 31  ? -18.342 -5.822  -5.983  1.00 0.00 ? 31  TYR A HD2  4  
ATOM 5707  H HE1  . TYR A 1 31  ? -14.864 -2.552  -4.795  1.00 0.00 ? 31  TYR A HE1  4  
ATOM 5708  H HE2  . TYR A 1 31  ? -18.390 -4.730  -3.780  1.00 0.00 ? 31  TYR A HE2  4  
ATOM 5709  H HH   . TYR A 1 31  ? -16.981 -2.066  -3.017  1.00 0.00 ? 31  TYR A HH   4  
ATOM 5710  N N    . ASP A 1 32  ? -15.525 -5.704  -11.134 1.00 0.00 ? 32  ASP A N    4  
ATOM 5711  C CA   . ASP A 1 32  ? -15.668 -6.387  -12.414 1.00 0.00 ? 32  ASP A CA   4  
ATOM 5712  C C    . ASP A 1 32  ? -15.567 -7.899  -12.237 1.00 0.00 ? 32  ASP A C    4  
ATOM 5713  O O    . ASP A 1 32  ? -16.096 -8.666  -13.043 1.00 0.00 ? 32  ASP A O    4  
ATOM 5714  C CB   . ASP A 1 32  ? -14.600 -5.904  -13.396 1.00 0.00 ? 32  ASP A CB   4  
ATOM 5715  C CG   . ASP A 1 32  ? -13.294 -5.558  -12.708 1.00 0.00 ? 32  ASP A CG   4  
ATOM 5716  O OD1  . ASP A 1 32  ? -12.598 -6.490  -12.253 1.00 0.00 ? 32  ASP A OD1  4  
ATOM 5717  O OD2  . ASP A 1 32  ? -12.967 -4.356  -12.626 1.00 0.00 ? 32  ASP A OD2  4  
ATOM 5718  H H    . ASP A 1 32  ? -14.632 -5.607  -10.741 1.00 0.00 ? 32  ASP A H    4  
ATOM 5719  H HA   . ASP A 1 32  ? -16.643 -6.148  -12.810 1.00 0.00 ? 32  ASP A HA   4  
ATOM 5720  H HB2  . ASP A 1 32  ? -14.408 -6.682  -14.121 1.00 0.00 ? 32  ASP A HB2  4  
ATOM 5721  H HB3  . ASP A 1 32  ? -14.962 -5.023  -13.907 1.00 0.00 ? 32  ASP A HB3  4  
ATOM 5722  N N    . PHE A 1 33  ? -14.883 -8.322  -11.179 1.00 0.00 ? 33  PHE A N    4  
ATOM 5723  C CA   . PHE A 1 33  ? -14.711 -9.742  -10.897 1.00 0.00 ? 33  PHE A CA   4  
ATOM 5724  C C    . PHE A 1 33  ? -15.785 -10.240 -9.934  1.00 0.00 ? 33  PHE A C    4  
ATOM 5725  O O    . PHE A 1 33  ? -16.216 -11.391 -10.009 1.00 0.00 ? 33  PHE A O    4  
ATOM 5726  C CB   . PHE A 1 33  ? -13.323 -10.003 -10.310 1.00 0.00 ? 33  PHE A CB   4  
ATOM 5727  C CG   . PHE A 1 33  ? -13.085 -9.306  -9.001  1.00 0.00 ? 33  PHE A CG   4  
ATOM 5728  C CD1  . PHE A 1 33  ? -12.788 -7.953  -8.965  1.00 0.00 ? 33  PHE A CD1  4  
ATOM 5729  C CD2  . PHE A 1 33  ? -13.159 -10.003 -7.806  1.00 0.00 ? 33  PHE A CD2  4  
ATOM 5730  C CE1  . PHE A 1 33  ? -12.570 -7.308  -7.762  1.00 0.00 ? 33  PHE A CE1  4  
ATOM 5731  C CE2  . PHE A 1 33  ? -12.942 -9.364  -6.600  1.00 0.00 ? 33  PHE A CE2  4  
ATOM 5732  C CZ   . PHE A 1 33  ? -12.646 -8.015  -6.578  1.00 0.00 ? 33  PHE A CZ   4  
ATOM 5733  H H    . PHE A 1 33  ? -14.485 -7.662  -10.573 1.00 0.00 ? 33  PHE A H    4  
ATOM 5734  H HA   . PHE A 1 33  ? -14.804 -10.278 -11.829 1.00 0.00 ? 33  PHE A HA   4  
ATOM 5735  H HB2  . PHE A 1 33  ? -13.201 -11.063 -10.147 1.00 0.00 ? 33  PHE A HB2  4  
ATOM 5736  H HB3  . PHE A 1 33  ? -12.574 -9.662  -11.009 1.00 0.00 ? 33  PHE A HB3  4  
ATOM 5737  H HD1  . PHE A 1 33  ? -12.728 -7.399  -9.891  1.00 0.00 ? 33  PHE A HD1  4  
ATOM 5738  H HD2  . PHE A 1 33  ? -13.389 -11.058 -7.821  1.00 0.00 ? 33  PHE A HD2  4  
ATOM 5739  H HE1  . PHE A 1 33  ? -12.339 -6.253  -7.749  1.00 0.00 ? 33  PHE A HE1  4  
ATOM 5740  H HE2  . PHE A 1 33  ? -13.001 -9.919  -5.675  1.00 0.00 ? 33  PHE A HE2  4  
ATOM 5741  H HZ   . PHE A 1 33  ? -12.476 -7.513  -5.637  1.00 0.00 ? 33  PHE A HZ   4  
ATOM 5742  N N    . SER A 1 34  ? -16.212 -9.365  -9.030  1.00 0.00 ? 34  SER A N    4  
ATOM 5743  C CA   . SER A 1 34  ? -17.232 -9.715  -8.048  1.00 0.00 ? 34  SER A CA   4  
ATOM 5744  C C    . SER A 1 34  ? -17.090 -11.171 -7.614  1.00 0.00 ? 34  SER A C    4  
ATOM 5745  O O    . SER A 1 34  ? -18.046 -11.943 -7.670  1.00 0.00 ? 34  SER A O    4  
ATOM 5746  C CB   . SER A 1 34  ? -18.629 -9.477  -8.626  1.00 0.00 ? 34  SER A CB   4  
ATOM 5747  O OG   . SER A 1 34  ? -18.929 -10.421 -9.640  1.00 0.00 ? 34  SER A OG   4  
ATOM 5748  H H    . SER A 1 34  ? -15.830 -8.462  -9.021  1.00 0.00 ? 34  SER A H    4  
ATOM 5749  H HA   . SER A 1 34  ? -17.095 -9.080  -7.186  1.00 0.00 ? 34  SER A HA   4  
ATOM 5750  H HB2  . SER A 1 34  ? -19.361 -9.568  -7.839  1.00 0.00 ? 34  SER A HB2  4  
ATOM 5751  H HB3  . SER A 1 34  ? -18.676 -8.484  -9.049  1.00 0.00 ? 34  SER A HB3  4  
ATOM 5752  H HG   . SER A 1 34  ? -18.253 -11.102 -9.653  1.00 0.00 ? 34  SER A HG   4  
ATOM 5753  N N    . GLY A 1 35  ? -15.888 -11.538 -7.180  1.00 0.00 ? 35  GLY A N    4  
ATOM 5754  C CA   . GLY A 1 35  ? -15.641 -12.900 -6.743  1.00 0.00 ? 35  GLY A CA   4  
ATOM 5755  C C    . GLY A 1 35  ? -15.576 -13.878 -7.899  1.00 0.00 ? 35  GLY A C    4  
ATOM 5756  O O    . GLY A 1 35  ? -16.229 -13.700 -8.928  1.00 0.00 ? 35  GLY A O    4  
ATOM 5757  H H    . GLY A 1 35  ? -15.163 -10.879 -7.158  1.00 0.00 ? 35  GLY A H    4  
ATOM 5758  H HA2  . GLY A 1 35  ? -14.705 -12.930 -6.206  1.00 0.00 ? 35  GLY A HA2  4  
ATOM 5759  H HA3  . GLY A 1 35  ? -16.436 -13.201 -6.077  1.00 0.00 ? 35  GLY A HA3  4  
ATOM 5760  N N    . PRO A 1 36  ? -14.770 -14.938 -7.738  1.00 0.00 ? 36  PRO A N    4  
ATOM 5761  C CA   . PRO A 1 36  ? -14.601 -15.968 -8.767  1.00 0.00 ? 36  PRO A CA   4  
ATOM 5762  C C    . PRO A 1 36  ? -15.852 -16.822 -8.943  1.00 0.00 ? 36  PRO A C    4  
ATOM 5763  O O    . PRO A 1 36  ? -16.856 -16.617 -8.260  1.00 0.00 ? 36  PRO A O    4  
ATOM 5764  C CB   . PRO A 1 36  ? -13.445 -16.817 -8.233  1.00 0.00 ? 36  PRO A CB   4  
ATOM 5765  C CG   . PRO A 1 36  ? -13.481 -16.620 -6.757  1.00 0.00 ? 36  PRO A CG   4  
ATOM 5766  C CD   . PRO A 1 36  ? -13.962 -15.213 -6.538  1.00 0.00 ? 36  PRO A CD   4  
ATOM 5767  H HA   . PRO A 1 36  ? -14.325 -15.537 -9.718  1.00 0.00 ? 36  PRO A HA   4  
ATOM 5768  H HB2  . PRO A 1 36  ? -13.603 -17.853 -8.499  1.00 0.00 ? 36  PRO A HB2  4  
ATOM 5769  H HB3  . PRO A 1 36  ? -12.514 -16.469 -8.655  1.00 0.00 ? 36  PRO A HB3  4  
ATOM 5770  H HG2  . PRO A 1 36  ? -14.166 -17.325 -6.309  1.00 0.00 ? 36  PRO A HG2  4  
ATOM 5771  H HG3  . PRO A 1 36  ? -12.490 -16.746 -6.346  1.00 0.00 ? 36  PRO A HG3  4  
ATOM 5772  H HD2  . PRO A 1 36  ? -14.566 -15.155 -5.644  1.00 0.00 ? 36  PRO A HD2  4  
ATOM 5773  H HD3  . PRO A 1 36  ? -13.124 -14.533 -6.474  1.00 0.00 ? 36  PRO A HD3  4  
ATOM 5774  N N    . SER A 1 37  ? -15.785 -17.780 -9.861  1.00 0.00 ? 37  SER A N    4  
ATOM 5775  C CA   . SER A 1 37  ? -16.914 -18.664 -10.128 1.00 0.00 ? 37  SER A CA   4  
ATOM 5776  C C    . SER A 1 37  ? -17.034 -19.734 -9.048  1.00 0.00 ? 37  SER A C    4  
ATOM 5777  O O    . SER A 1 37  ? -16.351 -20.757 -9.093  1.00 0.00 ? 37  SER A O    4  
ATOM 5778  C CB   . SER A 1 37  ? -16.759 -19.323 -11.500 1.00 0.00 ? 37  SER A CB   4  
ATOM 5779  O OG   . SER A 1 37  ? -17.930 -20.035 -11.859 1.00 0.00 ? 37  SER A OG   4  
ATOM 5780  H H    . SER A 1 37  ? -14.956 -17.894 -10.373 1.00 0.00 ? 37  SER A H    4  
ATOM 5781  H HA   . SER A 1 37  ? -17.812 -18.064 -10.126 1.00 0.00 ? 37  SER A HA   4  
ATOM 5782  H HB2  . SER A 1 37  ? -16.573 -18.563 -12.243 1.00 0.00 ? 37  SER A HB2  4  
ATOM 5783  H HB3  . SER A 1 37  ? -15.927 -20.012 -11.473 1.00 0.00 ? 37  SER A HB3  4  
ATOM 5784  H HG   . SER A 1 37  ? -18.451 -19.508 -12.469 1.00 0.00 ? 37  SER A HG   4  
ATOM 5785  N N    . SER A 1 38  ? -17.907 -19.489 -8.076  1.00 0.00 ? 38  SER A N    4  
ATOM 5786  C CA   . SER A 1 38  ? -18.115 -20.429 -6.981  1.00 0.00 ? 38  SER A CA   4  
ATOM 5787  C C    . SER A 1 38  ? -18.736 -21.727 -7.489  1.00 0.00 ? 38  SER A C    4  
ATOM 5788  O O    . SER A 1 38  ? -19.226 -21.794 -8.616  1.00 0.00 ? 38  SER A O    4  
ATOM 5789  C CB   . SER A 1 38  ? -19.012 -19.806 -5.909  1.00 0.00 ? 38  SER A CB   4  
ATOM 5790  O OG   . SER A 1 38  ? -20.371 -19.817 -6.313  1.00 0.00 ? 38  SER A OG   4  
ATOM 5791  H H    . SER A 1 38  ? -18.422 -18.655 -8.095  1.00 0.00 ? 38  SER A H    4  
ATOM 5792  H HA   . SER A 1 38  ? -17.152 -20.651 -6.547  1.00 0.00 ? 38  SER A HA   4  
ATOM 5793  H HB2  . SER A 1 38  ? -18.917 -20.368 -4.993  1.00 0.00 ? 38  SER A HB2  4  
ATOM 5794  H HB3  . SER A 1 38  ? -18.707 -18.784 -5.738  1.00 0.00 ? 38  SER A HB3  4  
ATOM 5795  H HG   . SER A 1 38  ? -20.884 -19.259 -5.724  1.00 0.00 ? 38  SER A HG   4  
ATOM 5796  N N    . GLY A 1 39  ? -18.713 -22.757 -6.648  1.00 0.00 ? 39  GLY A N    4  
ATOM 5797  C CA   . GLY A 1 39  ? -19.276 -24.039 -7.029  1.00 0.00 ? 39  GLY A CA   4  
ATOM 5798  C C    . GLY A 1 39  ? -20.612 -24.305 -6.364  1.00 0.00 ? 39  GLY A C    4  
ATOM 5799  O O    . GLY A 1 39  ? -21.613 -24.542 -7.041  1.00 0.00 ? 39  GLY A O    4  
ATOM 5800  H H    . GLY A 1 39  ? -18.309 -22.644 -5.762  1.00 0.00 ? 39  GLY A H    4  
ATOM 5801  H HA2  . GLY A 1 39  ? -19.408 -24.057 -8.100  1.00 0.00 ? 39  GLY A HA2  4  
ATOM 5802  H HA3  . GLY A 1 39  ? -18.585 -24.820 -6.748  1.00 0.00 ? 39  GLY A HA3  4  
ATOM 5803  N N    . ILE A 1 40  ? -20.628 -24.269 -5.036  1.00 0.00 ? 40  ILE A N    4  
ATOM 5804  C CA   . ILE A 1 40  ? -21.851 -24.509 -4.281  1.00 0.00 ? 40  ILE A CA   4  
ATOM 5805  C C    . ILE A 1 40  ? -21.898 -23.650 -3.022  1.00 0.00 ? 40  ILE A C    4  
ATOM 5806  O O    . ILE A 1 40  ? -20.860 -23.265 -2.483  1.00 0.00 ? 40  ILE A O    4  
ATOM 5807  C CB   . ILE A 1 40  ? -21.985 -25.991 -3.883  1.00 0.00 ? 40  ILE A CB   4  
ATOM 5808  C CG1  . ILE A 1 40  ? -20.788 -26.424 -3.035  1.00 0.00 ? 40  ILE A CG1  4  
ATOM 5809  C CG2  . ILE A 1 40  ? -22.106 -26.863 -5.123  1.00 0.00 ? 40  ILE A CG2  4  
ATOM 5810  C CD1  . ILE A 1 40  ? -20.995 -26.225 -1.550  1.00 0.00 ? 40  ILE A CD1  4  
ATOM 5811  H H    . ILE A 1 40  ? -19.798 -24.075 -4.553  1.00 0.00 ? 40  ILE A H    4  
ATOM 5812  H HA   . ILE A 1 40  ? -22.689 -24.249 -4.912  1.00 0.00 ? 40  ILE A HA   4  
ATOM 5813  H HB   . ILE A 1 40  ? -22.888 -26.105 -3.303  1.00 0.00 ? 40  ILE A HB   4  
ATOM 5814  H HG12 . ILE A 1 40  ? -20.595 -27.472 -3.204  1.00 0.00 ? 40  ILE A HG12 4  
ATOM 5815  H HG13 . ILE A 1 40  ? -19.921 -25.850 -3.330  1.00 0.00 ? 40  ILE A HG13 4  
ATOM 5816  H HG21 . ILE A 1 40  ? -22.525 -26.283 -5.932  1.00 0.00 ? 40  ILE A HG21 4  
ATOM 5817  H HG22 . ILE A 1 40  ? -21.129 -27.222 -5.407  1.00 0.00 ? 40  ILE A HG22 4  
ATOM 5818  H HG23 . ILE A 1 40  ? -22.751 -27.703 -4.912  1.00 0.00 ? 40  ILE A HG23 4  
ATOM 5819  H HD11 . ILE A 1 40  ? -21.620 -25.358 -1.387  1.00 0.00 ? 40  ILE A HD11 4  
ATOM 5820  H HD12 . ILE A 1 40  ? -21.477 -27.097 -1.133  1.00 0.00 ? 40  ILE A HD12 4  
ATOM 5821  H HD13 . ILE A 1 40  ? -20.041 -26.075 -1.069  1.00 0.00 ? 40  ILE A HD13 4  
ATOM 5822  N N    . GLU A 1 41  ? -23.108 -23.356 -2.557  1.00 0.00 ? 41  GLU A N    4  
ATOM 5823  C CA   . GLU A 1 41  ? -23.288 -22.543 -1.360  1.00 0.00 ? 41  GLU A CA   4  
ATOM 5824  C C    . GLU A 1 41  ? -23.620 -23.417 -0.154  1.00 0.00 ? 41  GLU A C    4  
ATOM 5825  O O    . GLU A 1 41  ? -24.162 -24.512 -0.297  1.00 0.00 ? 41  GLU A O    4  
ATOM 5826  C CB   . GLU A 1 41  ? -24.399 -21.513 -1.578  1.00 0.00 ? 41  GLU A CB   4  
ATOM 5827  C CG   . GLU A 1 41  ? -25.798 -22.104 -1.513  1.00 0.00 ? 41  GLU A CG   4  
ATOM 5828  C CD   . GLU A 1 41  ? -26.067 -23.091 -2.633  1.00 0.00 ? 41  GLU A CD   4  
ATOM 5829  O OE1  . GLU A 1 41  ? -25.735 -24.283 -2.466  1.00 0.00 ? 41  GLU A OE1  4  
ATOM 5830  O OE2  . GLU A 1 41  ? -26.610 -22.670 -3.676  1.00 0.00 ? 41  GLU A OE2  4  
ATOM 5831  H H    . GLU A 1 41  ? -23.897 -23.692 -3.030  1.00 0.00 ? 41  GLU A H    4  
ATOM 5832  H HA   . GLU A 1 41  ? -22.362 -22.024 -1.168  1.00 0.00 ? 41  GLU A HA   4  
ATOM 5833  H HB2  . GLU A 1 41  ? -24.318 -20.748 -0.821  1.00 0.00 ? 41  GLU A HB2  4  
ATOM 5834  H HB3  . GLU A 1 41  ? -24.267 -21.061 -2.550  1.00 0.00 ? 41  GLU A HB3  4  
ATOM 5835  H HG2  . GLU A 1 41  ? -25.916 -22.613 -0.569  1.00 0.00 ? 41  GLU A HG2  4  
ATOM 5836  H HG3  . GLU A 1 41  ? -26.517 -21.301 -1.580  1.00 0.00 ? 41  GLU A HG3  4  
ATOM 5837  N N    . GLY A 1 42  ? -23.290 -22.924 1.036   1.00 0.00 ? 42  GLY A N    4  
ATOM 5838  C CA   . GLY A 1 42  ? -23.560 -23.672 2.250   1.00 0.00 ? 42  GLY A CA   4  
ATOM 5839  C C    . GLY A 1 42  ? -23.020 -22.983 3.488   1.00 0.00 ? 42  GLY A C    4  
ATOM 5840  O O    . GLY A 1 42  ? -22.222 -22.050 3.389   1.00 0.00 ? 42  GLY A O    4  
ATOM 5841  H H    . GLY A 1 42  ? -22.860 -22.044 1.090   1.00 0.00 ? 42  GLY A H    4  
ATOM 5842  H HA2  . GLY A 1 42  ? -24.627 -23.794 2.355   1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5843  H HA3  . GLY A 1 42  ? -23.102 -24.647 2.167   1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5844  N N    . ARG A 1 43  ? -23.457 -23.441 4.656   1.00 0.00 ? 43  ARG A N    4  
ATOM 5845  C CA   . ARG A 1 43  ? -23.015 -22.860 5.918   1.00 0.00 ? 43  ARG A CA   4  
ATOM 5846  C C    . ARG A 1 43  ? -21.492 -22.797 5.984   1.00 0.00 ? 43  ARG A C    4  
ATOM 5847  O O    . ARG A 1 43  ? -20.817 -23.825 5.984   1.00 0.00 ? 43  ARG A O    4  
ATOM 5848  C CB   . ARG A 1 43  ? -23.553 -23.676 7.096   1.00 0.00 ? 43  ARG A CB   4  
ATOM 5849  C CG   . ARG A 1 43  ? -23.307 -23.028 8.448   1.00 0.00 ? 43  ARG A CG   4  
ATOM 5850  C CD   . ARG A 1 43  ? -24.184 -21.801 8.646   1.00 0.00 ? 43  ARG A CD   4  
ATOM 5851  N NE   . ARG A 1 43  ? -25.603 -22.144 8.692   1.00 0.00 ? 43  ARG A NE   4  
ATOM 5852  C CZ   . ARG A 1 43  ? -26.579 -21.263 8.502   1.00 0.00 ? 43  ARG A CZ   4  
ATOM 5853  N NH1  . ARG A 1 43  ? -26.291 -19.993 8.253   1.00 0.00 ? 43  ARG A NH1  4  
ATOM 5854  N NH2  . ARG A 1 43  ? -27.846 -21.653 8.559   1.00 0.00 ? 43  ARG A NH2  4  
ATOM 5855  H H    . ARG A 1 43  ? -24.093 -24.187 4.670   1.00 0.00 ? 43  ARG A H    4  
ATOM 5856  H HA   . ARG A 1 43  ? -23.409 -21.856 5.978   1.00 0.00 ? 43  ARG A HA   4  
ATOM 5857  H HB2  . ARG A 1 43  ? -24.618 -23.806 6.972   1.00 0.00 ? 43  ARG A HB2  4  
ATOM 5858  H HB3  . ARG A 1 43  ? -23.078 -24.645 7.093   1.00 0.00 ? 43  ARG A HB3  4  
ATOM 5859  H HG2  . ARG A 1 43  ? -23.529 -23.744 9.226   1.00 0.00 ? 43  ARG A HG2  4  
ATOM 5860  H HG3  . ARG A 1 43  ? -22.271 -22.733 8.512   1.00 0.00 ? 43  ARG A HG3  4  
ATOM 5861  H HD2  . ARG A 1 43  ? -23.909 -21.324 9.575   1.00 0.00 ? 43  ARG A HD2  4  
ATOM 5862  H HD3  . ARG A 1 43  ? -24.015 -21.118 7.827   1.00 0.00 ? 43  ARG A HD3  4  
ATOM 5863  H HE   . ARG A 1 43  ? -25.839 -23.078 8.874   1.00 0.00 ? 43  ARG A HE   4  
ATOM 5864  H HH11 . ARG A 1 43  ? -25.337 -19.698 8.209   1.00 0.00 ? 43  ARG A HH11 4  
ATOM 5865  H HH12 . ARG A 1 43  ? -27.027 -19.332 8.109   1.00 0.00 ? 43  ARG A HH12 4  
ATOM 5866  H HH21 . ARG A 1 43  ? -28.067 -22.609 8.745   1.00 0.00 ? 43  ARG A HH21 4  
ATOM 5867  H HH22 . ARG A 1 43  ? -28.580 -20.989 8.415   1.00 0.00 ? 43  ARG A HH22 4  
ATOM 5868  N N    . GLY A 1 44  ? -20.958 -21.580 6.039   1.00 0.00 ? 44  GLY A N    4  
ATOM 5869  C CA   . GLY A 1 44  ? -19.518 -21.405 6.103   1.00 0.00 ? 44  GLY A CA   4  
ATOM 5870  C C    . GLY A 1 44  ? -18.831 -21.774 4.803   1.00 0.00 ? 44  GLY A C    4  
ATOM 5871  O O    . GLY A 1 44  ? -18.230 -22.842 4.692   1.00 0.00 ? 44  GLY A O    4  
ATOM 5872  H H    . GLY A 1 44  ? -21.545 -20.796 6.036   1.00 0.00 ? 44  GLY A H    4  
ATOM 5873  H HA2  . GLY A 1 44  ? -19.302 -20.372 6.332   1.00 0.00 ? 44  GLY A HA2  4  
ATOM 5874  H HA3  . GLY A 1 44  ? -19.126 -22.028 6.893   1.00 0.00 ? 44  GLY A HA3  4  
ATOM 5875  N N    . SER A 1 45  ? -18.921 -20.888 3.816   1.00 0.00 ? 45  SER A N    4  
ATOM 5876  C CA   . SER A 1 45  ? -18.307 -21.129 2.515   1.00 0.00 ? 45  SER A CA   4  
ATOM 5877  C C    . SER A 1 45  ? -17.038 -20.299 2.351   1.00 0.00 ? 45  SER A C    4  
ATOM 5878  O O    . SER A 1 45  ? -17.092 -19.132 1.961   1.00 0.00 ? 45  SER A O    4  
ATOM 5879  C CB   . SER A 1 45  ? -19.294 -20.799 1.393   1.00 0.00 ? 45  SER A CB   4  
ATOM 5880  O OG   . SER A 1 45  ? -18.813 -21.256 0.141   1.00 0.00 ? 45  SER A OG   4  
ATOM 5881  H H    . SER A 1 45  ? -19.414 -20.055 3.965   1.00 0.00 ? 45  SER A H    4  
ATOM 5882  H HA   . SER A 1 45  ? -18.049 -22.176 2.459   1.00 0.00 ? 45  SER A HA   4  
ATOM 5883  H HB2  . SER A 1 45  ? -20.240 -21.276 1.598   1.00 0.00 ? 45  SER A HB2  4  
ATOM 5884  H HB3  . SER A 1 45  ? -19.434 -19.729 1.343   1.00 0.00 ? 45  SER A HB3  4  
ATOM 5885  H HG   . SER A 1 45  ? -18.045 -21.814 0.277   1.00 0.00 ? 45  SER A HG   4  
ATOM 5886  N N    . SER A 1 46  ? -15.896 -20.909 2.653   1.00 0.00 ? 46  SER A N    4  
ATOM 5887  C CA   . SER A 1 46  ? -14.612 -20.226 2.543   1.00 0.00 ? 46  SER A CA   4  
ATOM 5888  C C    . SER A 1 46  ? -13.508 -21.205 2.157   1.00 0.00 ? 46  SER A C    4  
ATOM 5889  O O    . SER A 1 46  ? -13.271 -22.196 2.846   1.00 0.00 ? 46  SER A O    4  
ATOM 5890  C CB   . SER A 1 46  ? -14.262 -19.540 3.865   1.00 0.00 ? 46  SER A CB   4  
ATOM 5891  O OG   . SER A 1 46  ? -14.119 -20.487 4.909   1.00 0.00 ? 46  SER A OG   4  
ATOM 5892  H H    . SER A 1 46  ? -15.919 -21.840 2.958   1.00 0.00 ? 46  SER A H    4  
ATOM 5893  H HA   . SER A 1 46  ? -14.700 -19.477 1.770   1.00 0.00 ? 46  SER A HA   4  
ATOM 5894  H HB2  . SER A 1 46  ? -13.332 -19.003 3.753   1.00 0.00 ? 46  SER A HB2  4  
ATOM 5895  H HB3  . SER A 1 46  ? -15.048 -18.847 4.127   1.00 0.00 ? 46  SER A HB3  4  
ATOM 5896  H HG   . SER A 1 46  ? -13.253 -20.391 5.312   1.00 0.00 ? 46  SER A HG   4  
ATOM 5897  N N    . GLY A 1 47  ? -12.834 -20.919 1.047   1.00 0.00 ? 47  GLY A N    4  
ATOM 5898  C CA   . GLY A 1 47  ? -11.762 -21.783 0.586   1.00 0.00 ? 47  GLY A CA   4  
ATOM 5899  C C    . GLY A 1 47  ? -11.663 -21.827 -0.926  1.00 0.00 ? 47  GLY A C    4  
ATOM 5900  O O    . GLY A 1 47  ? -12.678 -21.846 -1.621  1.00 0.00 ? 47  GLY A O    4  
ATOM 5901  H H    . GLY A 1 47  ? -13.066 -20.115 0.536   1.00 0.00 ? 47  GLY A H    4  
ATOM 5902  H HA2  . GLY A 1 47  ? -10.827 -21.423 0.988   1.00 0.00 ? 47  GLY A HA2  4  
ATOM 5903  H HA3  . GLY A 1 47  ? -11.939 -22.783 0.953   1.00 0.00 ? 47  GLY A HA3  4  
ATOM 5904  N N    . SER A 1 48  ? -10.435 -21.842 -1.436  1.00 0.00 ? 48  SER A N    4  
ATOM 5905  C CA   . SER A 1 48  ? -10.207 -21.878 -2.876  1.00 0.00 ? 48  SER A CA   4  
ATOM 5906  C C    . SER A 1 48  ? -10.485 -23.270 -3.435  1.00 0.00 ? 48  SER A C    4  
ATOM 5907  O O    . SER A 1 48  ? -9.644  -24.165 -3.350  1.00 0.00 ? 48  SER A O    4  
ATOM 5908  C CB   . SER A 1 48  ? -8.769  -21.466 -3.196  1.00 0.00 ? 48  SER A CB   4  
ATOM 5909  O OG   . SER A 1 48  ? -7.840  -22.380 -2.639  1.00 0.00 ? 48  SER A OG   4  
ATOM 5910  H H    . SER A 1 48  ? -9.665  -21.825 -0.830  1.00 0.00 ? 48  SER A H    4  
ATOM 5911  H HA   . SER A 1 48  ? -10.885 -21.176 -3.337  1.00 0.00 ? 48  SER A HA   4  
ATOM 5912  H HB2  . SER A 1 48  ? -8.634  -21.441 -4.266  1.00 0.00 ? 48  SER A HB2  4  
ATOM 5913  H HB3  . SER A 1 48  ? -8.579  -20.484 -2.786  1.00 0.00 ? 48  SER A HB3  4  
ATOM 5914  H HG   . SER A 1 48  ? -7.858  -23.200 -3.140  1.00 0.00 ? 48  SER A HG   4  
ATOM 5915  N N    . SER A 1 49  ? -11.672 -23.445 -4.006  1.00 0.00 ? 49  SER A N    4  
ATOM 5916  C CA   . SER A 1 49  ? -12.065 -24.728 -4.576  1.00 0.00 ? 49  SER A CA   4  
ATOM 5917  C C    . SER A 1 49  ? -11.810 -24.755 -6.080  1.00 0.00 ? 49  SER A C    4  
ATOM 5918  O O    . SER A 1 49  ? -12.429 -24.011 -6.840  1.00 0.00 ? 49  SER A O    4  
ATOM 5919  C CB   . SER A 1 49  ? -13.543 -25.006 -4.293  1.00 0.00 ? 49  SER A CB   4  
ATOM 5920  O OG   . SER A 1 49  ? -13.833 -26.388 -4.406  1.00 0.00 ? 49  SER A OG   4  
ATOM 5921  H H    . SER A 1 49  ? -12.300 -22.693 -4.043  1.00 0.00 ? 49  SER A H    4  
ATOM 5922  H HA   . SER A 1 49  ? -11.467 -25.496 -4.108  1.00 0.00 ? 49  SER A HA   4  
ATOM 5923  H HB2  . SER A 1 49  ? -13.781 -24.681 -3.292  1.00 0.00 ? 49  SER A HB2  4  
ATOM 5924  H HB3  . SER A 1 49  ? -14.150 -24.463 -5.002  1.00 0.00 ? 49  SER A HB3  4  
ATOM 5925  H HG   . SER A 1 49  ? -13.036 -26.897 -4.242  1.00 0.00 ? 49  SER A HG   4  
ATOM 5926  N N    . GLY A 1 50  ? -10.893 -25.620 -6.504  1.00 0.00 ? 50  GLY A N    4  
ATOM 5927  C CA   . GLY A 1 50  ? -10.571 -25.729 -7.915  1.00 0.00 ? 50  GLY A CA   4  
ATOM 5928  C C    . GLY A 1 50  ? -10.392 -24.376 -8.575  1.00 0.00 ? 50  GLY A C    4  
ATOM 5929  O O    . GLY A 1 50  ? -11.317 -23.855 -9.197  1.00 0.00 ? 50  GLY A O    4  
ATOM 5930  H H    . GLY A 1 50  ? -10.431 -26.189 -5.852  1.00 0.00 ? 50  GLY A H    4  
ATOM 5931  H HA2  . GLY A 1 50  ? -9.657  -26.294 -8.022  1.00 0.00 ? 50  GLY A HA2  4  
ATOM 5932  H HA3  . GLY A 1 50  ? -11.370 -26.258 -8.414  1.00 0.00 ? 50  GLY A HA3  4  
ATOM 5933  N N    . SER A 1 51  ? -9.200  -23.806 -8.438  1.00 0.00 ? 51  SER A N    4  
ATOM 5934  C CA   . SER A 1 51  ? -8.904  -22.503 -9.021  1.00 0.00 ? 51  SER A CA   4  
ATOM 5935  C C    . SER A 1 51  ? -8.590  -22.632 -10.509 1.00 0.00 ? 51  SER A C    4  
ATOM 5936  O O    . SER A 1 51  ? -8.139  -23.680 -10.970 1.00 0.00 ? 51  SER A O    4  
ATOM 5937  C CB   . SER A 1 51  ? -7.727  -21.850 -8.294  1.00 0.00 ? 51  SER A CB   4  
ATOM 5938  O OG   . SER A 1 51  ? -8.103  -21.421 -6.997  1.00 0.00 ? 51  SER A OG   4  
ATOM 5939  H H    . SER A 1 51  ? -8.503  -24.272 -7.930  1.00 0.00 ? 51  SER A H    4  
ATOM 5940  H HA   . SER A 1 51  ? -9.779  -21.881 -8.903  1.00 0.00 ? 51  SER A HA   4  
ATOM 5941  H HB2  . SER A 1 51  ? -6.922  -22.563 -8.205  1.00 0.00 ? 51  SER A HB2  4  
ATOM 5942  H HB3  . SER A 1 51  ? -7.388  -20.994 -8.860  1.00 0.00 ? 51  SER A HB3  4  
ATOM 5943  H HG   . SER A 1 51  ? -8.511  -20.554 -7.052  1.00 0.00 ? 51  SER A HG   4  
ATOM 5944  N N    . SER A 1 52  ? -8.832  -21.558 -11.254 1.00 0.00 ? 52  SER A N    4  
ATOM 5945  C CA   . SER A 1 52  ? -8.579  -21.551 -12.690 1.00 0.00 ? 52  SER A CA   4  
ATOM 5946  C C    . SER A 1 52  ? -7.085  -21.668 -12.979 1.00 0.00 ? 52  SER A C    4  
ATOM 5947  O O    . SER A 1 52  ? -6.262  -21.655 -12.065 1.00 0.00 ? 52  SER A O    4  
ATOM 5948  C CB   . SER A 1 52  ? -9.133  -20.272 -13.320 1.00 0.00 ? 52  SER A CB   4  
ATOM 5949  O OG   . SER A 1 52  ? -8.332  -19.152 -12.989 1.00 0.00 ? 52  SER A OG   4  
ATOM 5950  H H    . SER A 1 52  ? -9.192  -20.752 -10.827 1.00 0.00 ? 52  SER A H    4  
ATOM 5951  H HA   . SER A 1 52  ? -9.084  -22.403 -13.119 1.00 0.00 ? 52  SER A HA   4  
ATOM 5952  H HB2  . SER A 1 52  ? -9.151  -20.382 -14.394 1.00 0.00 ? 52  SER A HB2  4  
ATOM 5953  H HB3  . SER A 1 52  ? -10.137 -20.102 -12.959 1.00 0.00 ? 52  SER A HB3  4  
ATOM 5954  H HG   . SER A 1 52  ? -8.897  -18.407 -12.771 1.00 0.00 ? 52  SER A HG   4  
ATOM 5955  N N    . GLY A 1 53  ? -6.743  -21.783 -14.258 1.00 0.00 ? 53  GLY A N    4  
ATOM 5956  C CA   . GLY A 1 53  ? -5.350  -21.901 -14.646 1.00 0.00 ? 53  GLY A CA   4  
ATOM 5957  C C    . GLY A 1 53  ? -5.083  -21.335 -16.027 1.00 0.00 ? 53  GLY A C    4  
ATOM 5958  O O    . GLY A 1 53  ? -4.131  -20.580 -16.222 1.00 0.00 ? 53  GLY A O    4  
ATOM 5959  H H    . GLY A 1 53  ? -7.443  -21.788 -14.945 1.00 0.00 ? 53  GLY A H    4  
ATOM 5960  H HA2  . GLY A 1 53  ? -4.742  -21.372 -13.928 1.00 0.00 ? 53  GLY A HA2  4  
ATOM 5961  H HA3  . GLY A 1 53  ? -5.073  -22.945 -14.638 1.00 0.00 ? 53  GLY A HA3  4  
ATOM 5962  N N    . SER A 1 54  ? -5.924  -21.702 -16.988 1.00 0.00 ? 54  SER A N    4  
ATOM 5963  C CA   . SER A 1 54  ? -5.771  -21.230 -18.360 1.00 0.00 ? 54  SER A CA   4  
ATOM 5964  C C    . SER A 1 54  ? -5.330  -19.770 -18.386 1.00 0.00 ? 54  SER A C    4  
ATOM 5965  O O    . SER A 1 54  ? -4.381  -19.409 -19.081 1.00 0.00 ? 54  SER A O    4  
ATOM 5966  C CB   . SER A 1 54  ? -7.085  -21.392 -19.127 1.00 0.00 ? 54  SER A CB   4  
ATOM 5967  O OG   . SER A 1 54  ? -7.303  -22.746 -19.485 1.00 0.00 ? 54  SER A OG   4  
ATOM 5968  H H    . SER A 1 54  ? -6.664  -22.307 -16.770 1.00 0.00 ? 54  SER A H    4  
ATOM 5969  H HA   . SER A 1 54  ? -5.010  -21.832 -18.834 1.00 0.00 ? 54  SER A HA   4  
ATOM 5970  H HB2  . SER A 1 54  ? -7.904  -21.060 -18.508 1.00 0.00 ? 54  SER A HB2  4  
ATOM 5971  H HB3  . SER A 1 54  ? -7.048  -20.796 -20.027 1.00 0.00 ? 54  SER A HB3  4  
ATOM 5972  H HG   . SER A 1 54  ? -7.496  -23.258 -18.696 1.00 0.00 ? 54  SER A HG   4  
ATOM 5973  N N    . SER A 1 55  ? -6.028  -18.934 -17.622 1.00 0.00 ? 55  SER A N    4  
ATOM 5974  C CA   . SER A 1 55  ? -5.712  -17.512 -17.560 1.00 0.00 ? 55  SER A CA   4  
ATOM 5975  C C    . SER A 1 55  ? -5.292  -17.110 -16.149 1.00 0.00 ? 55  SER A C    4  
ATOM 5976  O O    . SER A 1 55  ? -5.608  -17.795 -15.177 1.00 0.00 ? 55  SER A O    4  
ATOM 5977  C CB   . SER A 1 55  ? -6.917  -16.681 -18.002 1.00 0.00 ? 55  SER A CB   4  
ATOM 5978  O OG   . SER A 1 55  ? -7.922  -16.667 -17.003 1.00 0.00 ? 55  SER A OG   4  
ATOM 5979  H H    . SER A 1 55  ? -6.774  -19.283 -17.091 1.00 0.00 ? 55  SER A H    4  
ATOM 5980  H HA   . SER A 1 55  ? -4.889  -17.325 -18.234 1.00 0.00 ? 55  SER A HA   4  
ATOM 5981  H HB2  . SER A 1 55  ? -6.602  -15.666 -18.191 1.00 0.00 ? 55  SER A HB2  4  
ATOM 5982  H HB3  . SER A 1 55  ? -7.331  -17.104 -18.906 1.00 0.00 ? 55  SER A HB3  4  
ATOM 5983  H HG   . SER A 1 55  ? -7.911  -17.501 -16.526 1.00 0.00 ? 55  SER A HG   4  
ATOM 5984  N N    . GLY A 1 56  ? -4.578  -15.993 -16.046 1.00 0.00 ? 56  GLY A N    4  
ATOM 5985  C CA   . GLY A 1 56  ? -4.126  -15.519 -14.752 1.00 0.00 ? 56  GLY A CA   4  
ATOM 5986  C C    . GLY A 1 56  ? -2.820  -16.158 -14.323 1.00 0.00 ? 56  GLY A C    4  
ATOM 5987  O O    . GLY A 1 56  ? -2.708  -16.670 -13.209 1.00 0.00 ? 56  GLY A O    4  
ATOM 5988  H H    . GLY A 1 56  ? -4.356  -15.488 -16.856 1.00 0.00 ? 56  GLY A H    4  
ATOM 5989  H HA2  . GLY A 1 56  ? -3.992  -14.448 -14.800 1.00 0.00 ? 56  GLY A HA2  4  
ATOM 5990  H HA3  . GLY A 1 56  ? -4.882  -15.744 -14.014 1.00 0.00 ? 56  GLY A HA3  4  
ATOM 5991  N N    . ASP A 1 57  ? -1.831  -16.130 -15.209 1.00 0.00 ? 57  ASP A N    4  
ATOM 5992  C CA   . ASP A 1 57  ? -0.526  -16.711 -14.917 1.00 0.00 ? 57  ASP A CA   4  
ATOM 5993  C C    . ASP A 1 57  ? 0.531   -15.623 -14.756 1.00 0.00 ? 57  ASP A C    4  
ATOM 5994  O O    . ASP A 1 57  ? 1.311   -15.635 -13.803 1.00 0.00 ? 57  ASP A O    4  
ATOM 5995  C CB   . ASP A 1 57  ? -0.114  -17.678 -16.029 1.00 0.00 ? 57  ASP A CB   4  
ATOM 5996  C CG   . ASP A 1 57  ? -1.269  -18.538 -16.505 1.00 0.00 ? 57  ASP A CG   4  
ATOM 5997  O OD1  . ASP A 1 57  ? -2.253  -17.973 -17.027 1.00 0.00 ? 57  ASP A OD1  4  
ATOM 5998  O OD2  . ASP A 1 57  ? -1.189  -19.775 -16.355 1.00 0.00 ? 57  ASP A OD2  4  
ATOM 5999  H H    . ASP A 1 57  ? -1.982  -15.707 -16.081 1.00 0.00 ? 57  ASP A H    4  
ATOM 6000  H HA   . ASP A 1 57  ? -0.606  -17.257 -13.990 1.00 0.00 ? 57  ASP A HA   4  
ATOM 6001  H HB2  . ASP A 1 57  ? 0.259   -17.112 -16.870 1.00 0.00 ? 57  ASP A HB2  4  
ATOM 6002  H HB3  . ASP A 1 57  ? 0.667   -18.327 -15.662 1.00 0.00 ? 57  ASP A HB3  4  
ATOM 6003  N N    . LYS A 1 58  ? 0.552   -14.682 -15.694 1.00 0.00 ? 58  LYS A N    4  
ATOM 6004  C CA   . LYS A 1 58  ? 1.512   -13.585 -15.658 1.00 0.00 ? 58  LYS A CA   4  
ATOM 6005  C C    . LYS A 1 58  ? 1.089   -12.526 -14.645 1.00 0.00 ? 58  LYS A C    4  
ATOM 6006  O O    . LYS A 1 58  ? 0.511   -11.502 -15.010 1.00 0.00 ? 58  LYS A O    4  
ATOM 6007  C CB   . LYS A 1 58  ? 1.649   -12.954 -17.045 1.00 0.00 ? 58  LYS A CB   4  
ATOM 6008  C CG   . LYS A 1 58  ? 2.981   -12.257 -17.267 1.00 0.00 ? 58  LYS A CG   4  
ATOM 6009  C CD   . LYS A 1 58  ? 3.319   -12.158 -18.745 1.00 0.00 ? 58  LYS A CD   4  
ATOM 6010  C CE   . LYS A 1 58  ? 4.730   -11.634 -18.960 1.00 0.00 ? 58  LYS A CE   4  
ATOM 6011  N NZ   . LYS A 1 58  ? 5.734   -12.734 -18.975 1.00 0.00 ? 58  LYS A NZ   4  
ATOM 6012  H H    . LYS A 1 58  ? -0.096  -14.726 -16.430 1.00 0.00 ? 58  LYS A H    4  
ATOM 6013  H HA   . LYS A 1 58  ? 2.467   -13.990 -15.359 1.00 0.00 ? 58  LYS A HA   4  
ATOM 6014  H HB2  . LYS A 1 58  ? 1.543   -13.728 -17.791 1.00 0.00 ? 58  LYS A HB2  4  
ATOM 6015  H HB3  . LYS A 1 58  ? 0.860   -12.228 -17.176 1.00 0.00 ? 58  LYS A HB3  4  
ATOM 6016  H HG2  . LYS A 1 58  ? 2.929   -11.261 -16.853 1.00 0.00 ? 58  LYS A HG2  4  
ATOM 6017  H HG3  . LYS A 1 58  ? 3.758   -12.818 -16.766 1.00 0.00 ? 58  LYS A HG3  4  
ATOM 6018  H HD2  . LYS A 1 58  ? 3.239   -13.139 -19.190 1.00 0.00 ? 58  LYS A HD2  4  
ATOM 6019  H HD3  . LYS A 1 58  ? 2.618   -11.486 -19.221 1.00 0.00 ? 58  LYS A HD3  4  
ATOM 6020  H HE2  . LYS A 1 58  ? 4.767   -11.112 -19.904 1.00 0.00 ? 58  LYS A HE2  4  
ATOM 6021  H HE3  . LYS A 1 58  ? 4.971   -10.949 -18.160 1.00 0.00 ? 58  LYS A HE3  4  
ATOM 6022  H HZ1  . LYS A 1 58  ? 5.719   -13.219 -19.894 1.00 0.00 ? 58  LYS A HZ1  4  
ATOM 6023  H HZ2  . LYS A 1 58  ? 5.518   -13.424 -18.227 1.00 0.00 ? 58  LYS A HZ2  4  
ATOM 6024  H HZ3  . LYS A 1 58  ? 6.687   -12.350 -18.812 1.00 0.00 ? 58  LYS A HZ3  4  
ATOM 6025  N N    . GLU A 1 59  ? 1.382   -12.778 -13.373 1.00 0.00 ? 59  GLU A N    4  
ATOM 6026  C CA   . GLU A 1 59  ? 1.032   -11.845 -12.309 1.00 0.00 ? 59  GLU A CA   4  
ATOM 6027  C C    . GLU A 1 59  ? 2.131   -10.803 -12.116 1.00 0.00 ? 59  GLU A C    4  
ATOM 6028  O O    . GLU A 1 59  ? 3.310   -11.084 -12.329 1.00 0.00 ? 59  GLU A O    4  
ATOM 6029  C CB   . GLU A 1 59  ? 0.791   -12.597 -10.999 1.00 0.00 ? 59  GLU A CB   4  
ATOM 6030  C CG   . GLU A 1 59  ? -0.527  -13.352 -10.964 1.00 0.00 ? 59  GLU A CG   4  
ATOM 6031  C CD   . GLU A 1 59  ? -0.543  -14.450 -9.918  1.00 0.00 ? 59  GLU A CD   4  
ATOM 6032  O OE1  . GLU A 1 59  ? 0.280   -15.383 -10.023 1.00 0.00 ? 59  GLU A OE1  4  
ATOM 6033  O OE2  . GLU A 1 59  ? -1.380  -14.375 -8.994  1.00 0.00 ? 59  GLU A OE2  4  
ATOM 6034  H H    . GLU A 1 59  ? 1.844   -13.612 -13.145 1.00 0.00 ? 59  GLU A H    4  
ATOM 6035  H HA   . GLU A 1 59  ? 0.122   -11.341 -12.597 1.00 0.00 ? 59  GLU A HA   4  
ATOM 6036  H HB2  . GLU A 1 59  ? 1.593   -13.306 -10.852 1.00 0.00 ? 59  GLU A HB2  4  
ATOM 6037  H HB3  . GLU A 1 59  ? 0.796   -11.888 -10.185 1.00 0.00 ? 59  GLU A HB3  4  
ATOM 6038  H HG2  . GLU A 1 59  ? -1.321  -12.655 -10.744 1.00 0.00 ? 59  GLU A HG2  4  
ATOM 6039  H HG3  . GLU A 1 59  ? -0.698  -13.797 -11.934 1.00 0.00 ? 59  GLU A HG3  4  
ATOM 6040  N N    . ARG A 1 60  ? 1.734   -9.601  -11.711 1.00 0.00 ? 60  ARG A N    4  
ATOM 6041  C CA   . ARG A 1 60  ? 2.684   -8.517  -11.491 1.00 0.00 ? 60  ARG A CA   4  
ATOM 6042  C C    . ARG A 1 60  ? 3.235   -8.558  -10.069 1.00 0.00 ? 60  ARG A C    4  
ATOM 6043  O O    . ARG A 1 60  ? 2.499   -8.809  -9.113  1.00 0.00 ? 60  ARG A O    4  
ATOM 6044  C CB   . ARG A 1 60  ? 2.017   -7.166  -11.752 1.00 0.00 ? 60  ARG A CB   4  
ATOM 6045  C CG   . ARG A 1 60  ? 2.977   -6.099  -12.251 1.00 0.00 ? 60  ARG A CG   4  
ATOM 6046  C CD   . ARG A 1 60  ? 2.238   -4.962  -12.939 1.00 0.00 ? 60  ARG A CD   4  
ATOM 6047  N NE   . ARG A 1 60  ? 2.006   -5.237  -14.354 1.00 0.00 ? 60  ARG A NE   4  
ATOM 6048  C CZ   . ARG A 1 60  ? 1.056   -4.647  -15.071 1.00 0.00 ? 60  ARG A CZ   4  
ATOM 6049  N NH1  . ARG A 1 60  ? 0.254   -3.753  -14.509 1.00 0.00 ? 60  ARG A NH1  4  
ATOM 6050  N NH2  . ARG A 1 60  ? 0.906   -4.951  -16.354 1.00 0.00 ? 60  ARG A NH2  4  
ATOM 6051  H H    . ARG A 1 60  ? 0.780   -9.439  -11.558 1.00 0.00 ? 60  ARG A H    4  
ATOM 6052  H HA   . ARG A 1 60  ? 3.501   -8.646  -12.185 1.00 0.00 ? 60  ARG A HA   4  
ATOM 6053  H HB2  . ARG A 1 60  ? 1.242   -7.296  -12.493 1.00 0.00 ? 60  ARG A HB2  4  
ATOM 6054  H HB3  . ARG A 1 60  ? 1.570   -6.815  -10.834 1.00 0.00 ? 60  ARG A HB3  4  
ATOM 6055  H HG2  . ARG A 1 60  ? 3.526   -5.700  -11.411 1.00 0.00 ? 60  ARG A HG2  4  
ATOM 6056  H HG3  . ARG A 1 60  ? 3.665   -6.547  -12.953 1.00 0.00 ? 60  ARG A HG3  4  
ATOM 6057  H HD2  . ARG A 1 60  ? 1.287   -4.820  -12.449 1.00 0.00 ? 60  ARG A HD2  4  
ATOM 6058  H HD3  . ARG A 1 60  ? 2.827   -4.061  -12.849 1.00 0.00 ? 60  ARG A HD3  4  
ATOM 6059  H HE   . ARG A 1 60  ? 2.587   -5.895  -14.790 1.00 0.00 ? 60  ARG A HE   4  
ATOM 6060  H HH11 . ARG A 1 60  ? 0.365   -3.522  -13.542 1.00 0.00 ? 60  ARG A HH11 4  
ATOM 6061  H HH12 . ARG A 1 60  ? -0.459  -3.310  -15.051 1.00 0.00 ? 60  ARG A HH12 4  
ATOM 6062  H HH21 . ARG A 1 60  ? 1.509   -5.624  -16.782 1.00 0.00 ? 60  ARG A HH21 4  
ATOM 6063  H HH22 . ARG A 1 60  ? 0.191   -4.507  -16.893 1.00 0.00 ? 60  ARG A HH22 4  
ATOM 6064  N N    . HIS A 1 61  ? 4.534   -8.312  -9.936  1.00 0.00 ? 61  HIS A N    4  
ATOM 6065  C CA   . HIS A 1 61  ? 5.185   -8.320  -8.630  1.00 0.00 ? 61  HIS A CA   4  
ATOM 6066  C C    . HIS A 1 61  ? 5.246   -6.913  -8.045  1.00 0.00 ? 61  HIS A C    4  
ATOM 6067  O O    . HIS A 1 61  ? 5.784   -5.995  -8.663  1.00 0.00 ? 61  HIS A O    4  
ATOM 6068  C CB   . HIS A 1 61  ? 6.595   -8.900  -8.743  1.00 0.00 ? 61  HIS A CB   4  
ATOM 6069  C CG   . HIS A 1 61  ? 7.030   -9.659  -7.528  1.00 0.00 ? 61  HIS A CG   4  
ATOM 6070  N ND1  . HIS A 1 61  ? 8.089   -9.269  -6.736  1.00 0.00 ? 61  HIS A ND1  4  
ATOM 6071  C CD2  . HIS A 1 61  ? 6.541   -10.791 -6.969  1.00 0.00 ? 61  HIS A CD2  4  
ATOM 6072  C CE1  . HIS A 1 61  ? 8.234   -10.129 -5.743  1.00 0.00 ? 61  HIS A CE1  4  
ATOM 6073  N NE2  . HIS A 1 61  ? 7.306   -11.062 -5.861  1.00 0.00 ? 61  HIS A NE2  4  
ATOM 6074  H H    . HIS A 1 61  ? 5.068   -8.119  -10.735 1.00 0.00 ? 61  HIS A H    4  
ATOM 6075  H HA   . HIS A 1 61  ? 4.600   -8.945  -7.973  1.00 0.00 ? 61  HIS A HA   4  
ATOM 6076  H HB2  . HIS A 1 61  ? 6.633   -9.574  -9.586  1.00 0.00 ? 61  HIS A HB2  4  
ATOM 6077  H HB3  . HIS A 1 61  ? 7.297   -8.094  -8.901  1.00 0.00 ? 61  HIS A HB3  4  
ATOM 6078  H HD1  . HIS A 1 61  ? 8.652   -8.481  -6.881  1.00 0.00 ? 61  HIS A HD1  4  
ATOM 6079  H HD2  . HIS A 1 61  ? 5.703   -11.374 -7.327  1.00 0.00 ? 61  HIS A HD2  4  
ATOM 6080  H HE1  . HIS A 1 61  ? 8.982   -10.078 -4.967  1.00 0.00 ? 61  HIS A HE1  4  
ATOM 6081  H HE2  . HIS A 1 61  ? 7.241   -11.866 -5.306  1.00 0.00 ? 61  HIS A HE2  4  
ATOM 6082  N N    . GLY A 1 62  ? 4.690   -6.751  -6.848  1.00 0.00 ? 62  GLY A N    4  
ATOM 6083  C CA   . GLY A 1 62  ? 4.692   -5.452  -6.199  1.00 0.00 ? 62  GLY A CA   4  
ATOM 6084  C C    . GLY A 1 62  ? 5.141   -5.527  -4.753  1.00 0.00 ? 62  GLY A C    4  
ATOM 6085  O O    . GLY A 1 62  ? 5.213   -6.610  -4.173  1.00 0.00 ? 62  GLY A O    4  
ATOM 6086  H H    . GLY A 1 62  ? 4.276   -7.518  -6.401  1.00 0.00 ? 62  GLY A H    4  
ATOM 6087  H HA2  . GLY A 1 62  ? 5.355   -4.793  -6.738  1.00 0.00 ? 62  GLY A HA2  4  
ATOM 6088  H HA3  . GLY A 1 62  ? 3.692   -5.045  -6.232  1.00 0.00 ? 62  GLY A HA3  4  
ATOM 6089  N N    . VAL A 1 63  ? 5.448   -4.372  -4.170  1.00 0.00 ? 63  VAL A N    4  
ATOM 6090  C CA   . VAL A 1 63  ? 5.894   -4.311  -2.784  1.00 0.00 ? 63  VAL A CA   4  
ATOM 6091  C C    . VAL A 1 63  ? 5.285   -3.113  -2.063  1.00 0.00 ? 63  VAL A C    4  
ATOM 6092  O O    . VAL A 1 63  ? 5.376   -1.980  -2.534  1.00 0.00 ? 63  VAL A O    4  
ATOM 6093  C CB   . VAL A 1 63  ? 7.429   -4.225  -2.691  1.00 0.00 ? 63  VAL A CB   4  
ATOM 6094  C CG1  . VAL A 1 63  ? 7.855   -3.720  -1.321  1.00 0.00 ? 63  VAL A CG1  4  
ATOM 6095  C CG2  . VAL A 1 63  ? 8.057   -5.579  -2.989  1.00 0.00 ? 63  VAL A CG2  4  
ATOM 6096  H H    . VAL A 1 63  ? 5.371   -3.542  -4.685  1.00 0.00 ? 63  VAL A H    4  
ATOM 6097  H HA   . VAL A 1 63  ? 5.575   -5.217  -2.290  1.00 0.00 ? 63  VAL A HA   4  
ATOM 6098  H HB   . VAL A 1 63  ? 7.776   -3.521  -3.433  1.00 0.00 ? 63  VAL A HB   4  
ATOM 6099  H HG11 . VAL A 1 63  ? 7.333   -4.276  -0.555  1.00 0.00 ? 63  VAL A HG11 4  
ATOM 6100  H HG12 . VAL A 1 63  ? 8.920   -3.854  -1.203  1.00 0.00 ? 63  VAL A HG12 4  
ATOM 6101  H HG13 . VAL A 1 63  ? 7.611   -2.672  -1.232  1.00 0.00 ? 63  VAL A HG13 4  
ATOM 6102  H HG21 . VAL A 1 63  ? 7.461   -6.099  -3.723  1.00 0.00 ? 63  VAL A HG21 4  
ATOM 6103  H HG22 . VAL A 1 63  ? 9.056   -5.435  -3.372  1.00 0.00 ? 63  VAL A HG22 4  
ATOM 6104  H HG23 . VAL A 1 63  ? 8.100   -6.163  -2.081  1.00 0.00 ? 63  VAL A HG23 4  
ATOM 6105  N N    . ALA A 1 64  ? 4.665   -3.373  -0.917  1.00 0.00 ? 64  ALA A N    4  
ATOM 6106  C CA   . ALA A 1 64  ? 4.042   -2.316  -0.129  1.00 0.00 ? 64  ALA A CA   4  
ATOM 6107  C C    . ALA A 1 64  ? 5.090   -1.359  0.430   1.00 0.00 ? 64  ALA A C    4  
ATOM 6108  O O    . ALA A 1 64  ? 5.979   -1.765  1.178   1.00 0.00 ? 64  ALA A O    4  
ATOM 6109  C CB   . ALA A 1 64  ? 3.217   -2.916  1.000   1.00 0.00 ? 64  ALA A CB   4  
ATOM 6110  H H    . ALA A 1 64  ? 4.626   -4.297  -0.593  1.00 0.00 ? 64  ALA A H    4  
ATOM 6111  H HA   . ALA A 1 64  ? 3.375   -1.765  -0.776  1.00 0.00 ? 64  ALA A HA   4  
ATOM 6112  H HB1  . ALA A 1 64  ? 3.878   -3.350  1.736   1.00 0.00 ? 64  ALA A HB1  4  
ATOM 6113  H HB2  . ALA A 1 64  ? 2.622   -2.141  1.462   1.00 0.00 ? 64  ALA A HB2  4  
ATOM 6114  H HB3  . ALA A 1 64  ? 2.567   -3.681  0.603   1.00 0.00 ? 64  ALA A HB3  4  
ATOM 6115  N N    . ILE A 1 65  ? 4.978   -0.087  0.062   1.00 0.00 ? 65  ILE A N    4  
ATOM 6116  C CA   . ILE A 1 65  ? 5.916   0.927   0.527   1.00 0.00 ? 65  ILE A CA   4  
ATOM 6117  C C    . ILE A 1 65  ? 5.357   1.683   1.728   1.00 0.00 ? 65  ILE A C    4  
ATOM 6118  O O    . ILE A 1 65  ? 6.105   2.118   2.604   1.00 0.00 ? 65  ILE A O    4  
ATOM 6119  C CB   . ILE A 1 65  ? 6.254   1.935   -0.588  1.00 0.00 ? 65  ILE A CB   4  
ATOM 6120  C CG1  . ILE A 1 65  ? 4.972   2.540   -1.164  1.00 0.00 ? 65  ILE A CG1  4  
ATOM 6121  C CG2  . ILE A 1 65  ? 7.068   1.262   -1.682  1.00 0.00 ? 65  ILE A CG2  4  
ATOM 6122  C CD1  . ILE A 1 65  ? 5.222   3.590   -2.223  1.00 0.00 ? 65  ILE A CD1  4  
ATOM 6123  H H    . ILE A 1 65  ? 4.248   0.175   -0.536  1.00 0.00 ? 65  ILE A H    4  
ATOM 6124  H HA   . ILE A 1 65  ? 6.828   0.428   0.822   1.00 0.00 ? 65  ILE A HA   4  
ATOM 6125  H HB   . ILE A 1 65  ? 6.854   2.724   -0.160  1.00 0.00 ? 65  ILE A HB   4  
ATOM 6126  H HG12 . ILE A 1 65  ? 4.380   1.755   -1.610  1.00 0.00 ? 65  ILE A HG12 4  
ATOM 6127  H HG13 . ILE A 1 65  ? 4.409   3.000   -0.365  1.00 0.00 ? 65  ILE A HG13 4  
ATOM 6128  H HG21 . ILE A 1 65  ? 8.099   1.573   -1.607  1.00 0.00 ? 65  ILE A HG21 4  
ATOM 6129  H HG22 . ILE A 1 65  ? 7.007   0.190   -1.567  1.00 0.00 ? 65  ILE A HG22 4  
ATOM 6130  H HG23 . ILE A 1 65  ? 6.676   1.544   -2.648  1.00 0.00 ? 65  ILE A HG23 4  
ATOM 6131  H HD11 . ILE A 1 65  ? 4.383   4.270   -2.261  1.00 0.00 ? 65  ILE A HD11 4  
ATOM 6132  H HD12 . ILE A 1 65  ? 6.119   4.140   -1.980  1.00 0.00 ? 65  ILE A HD12 4  
ATOM 6133  H HD13 . ILE A 1 65  ? 5.341   3.113   -3.184  1.00 0.00 ? 65  ILE A HD13 4  
ATOM 6134  N N    . TYR A 1 66  ? 4.038   1.834   1.763   1.00 0.00 ? 66  TYR A N    4  
ATOM 6135  C CA   . TYR A 1 66  ? 3.378   2.538   2.856   1.00 0.00 ? 66  TYR A CA   4  
ATOM 6136  C C    . TYR A 1 66  ? 2.490   1.590   3.657   1.00 0.00 ? 66  TYR A C    4  
ATOM 6137  O O    . TYR A 1 66  ? 1.807   0.737   3.093   1.00 0.00 ? 66  TYR A O    4  
ATOM 6138  C CB   . TYR A 1 66  ? 2.544   3.699   2.314   1.00 0.00 ? 66  TYR A CB   4  
ATOM 6139  C CG   . TYR A 1 66  ? 3.349   4.705   1.522   1.00 0.00 ? 66  TYR A CG   4  
ATOM 6140  C CD1  . TYR A 1 66  ? 4.471   5.314   2.072   1.00 0.00 ? 66  TYR A CD1  4  
ATOM 6141  C CD2  . TYR A 1 66  ? 2.989   5.045   0.224   1.00 0.00 ? 66  TYR A CD2  4  
ATOM 6142  C CE1  . TYR A 1 66  ? 5.209   6.234   1.352   1.00 0.00 ? 66  TYR A CE1  4  
ATOM 6143  C CE2  . TYR A 1 66  ? 3.722   5.963   -0.503  1.00 0.00 ? 66  TYR A CE2  4  
ATOM 6144  C CZ   . TYR A 1 66  ? 4.830   6.555   0.065   1.00 0.00 ? 66  TYR A CZ   4  
ATOM 6145  O OH   . TYR A 1 66  ? 5.564   7.470   -0.655  1.00 0.00 ? 66  TYR A OH   4  
ATOM 6146  H H    . TYR A 1 66  ? 3.495   1.466   1.036   1.00 0.00 ? 66  TYR A H    4  
ATOM 6147  H HA   . TYR A 1 66  ? 4.145   2.931   3.508   1.00 0.00 ? 66  TYR A HA   4  
ATOM 6148  H HB2  . TYR A 1 66  ? 1.774   3.309   1.667   1.00 0.00 ? 66  TYR A HB2  4  
ATOM 6149  H HB3  . TYR A 1 66  ? 2.083   4.220   3.141   1.00 0.00 ? 66  TYR A HB3  4  
ATOM 6150  H HD1  . TYR A 1 66  ? 4.764   5.060   3.080   1.00 0.00 ? 66  TYR A HD1  4  
ATOM 6151  H HD2  . TYR A 1 66  ? 2.120   4.580   -0.219  1.00 0.00 ? 66  TYR A HD2  4  
ATOM 6152  H HE1  . TYR A 1 66  ? 6.077   6.697   1.797   1.00 0.00 ? 66  TYR A HE1  4  
ATOM 6153  H HE2  . TYR A 1 66  ? 3.426   6.215   -1.511  1.00 0.00 ? 66  TYR A HE2  4  
ATOM 6154  H HH   . TYR A 1 66  ? 5.606   7.194   -1.574  1.00 0.00 ? 66  TYR A HH   4  
ATOM 6155  N N    . ASN A 1 67  ? 2.506   1.748   4.977   1.00 0.00 ? 67  ASN A N    4  
ATOM 6156  C CA   . ASN A 1 67  ? 1.703   0.907   5.857   1.00 0.00 ? 67  ASN A CA   4  
ATOM 6157  C C    . ASN A 1 67  ? 0.216   1.204   5.685   1.00 0.00 ? 67  ASN A C    4  
ATOM 6158  O O    . ASN A 1 67  ? -0.265  2.266   6.078   1.00 0.00 ? 67  ASN A O    4  
ATOM 6159  C CB   . ASN A 1 67  ? 2.112   1.122   7.315   1.00 0.00 ? 67  ASN A CB   4  
ATOM 6160  C CG   . ASN A 1 67  ? 2.266   2.590   7.662   1.00 0.00 ? 67  ASN A CG   4  
ATOM 6161  O OD1  . ASN A 1 67  ? 1.352   3.388   7.455   1.00 0.00 ? 67  ASN A OD1  4  
ATOM 6162  N ND2  . ASN A 1 67  ? 3.429   2.954   8.192   1.00 0.00 ? 67  ASN A ND2  4  
ATOM 6163  H H    . ASN A 1 67  ? 3.071   2.446   5.368   1.00 0.00 ? 67  ASN A H    4  
ATOM 6164  H HA   . ASN A 1 67  ? 1.886   -0.123  5.589   1.00 0.00 ? 67  ASN A HA   4  
ATOM 6165  H HB2  . ASN A 1 67  ? 1.357   0.697   7.961   1.00 0.00 ? 67  ASN A HB2  4  
ATOM 6166  H HB3  . ASN A 1 67  ? 3.054   0.627   7.496   1.00 0.00 ? 67  ASN A HB3  4  
ATOM 6167  H HD21 . ASN A 1 67  ? 4.112   2.264   8.327   1.00 0.00 ? 67  ASN A HD21 4  
ATOM 6168  H HD22 . ASN A 1 67  ? 3.555   3.897   8.426   1.00 0.00 ? 67  ASN A HD22 4  
ATOM 6169  N N    . PHE A 1 68  ? -0.506  0.257   5.095   1.00 0.00 ? 68  PHE A N    4  
ATOM 6170  C CA   . PHE A 1 68  ? -1.938  0.416   4.870   1.00 0.00 ? 68  PHE A CA   4  
ATOM 6171  C C    . PHE A 1 68  ? -2.741  -0.285  5.961   1.00 0.00 ? 68  PHE A C    4  
ATOM 6172  O O    . PHE A 1 68  ? -2.316  -1.307  6.499   1.00 0.00 ? 68  PHE A O    4  
ATOM 6173  C CB   . PHE A 1 68  ? -2.326  -0.140  3.498   1.00 0.00 ? 68  PHE A CB   4  
ATOM 6174  C CG   . PHE A 1 68  ? -3.800  -0.070  3.218   1.00 0.00 ? 68  PHE A CG   4  
ATOM 6175  C CD1  . PHE A 1 68  ? -4.645  -1.090  3.624   1.00 0.00 ? 68  PHE A CD1  4  
ATOM 6176  C CD2  . PHE A 1 68  ? -4.340  1.016   2.548   1.00 0.00 ? 68  PHE A CD2  4  
ATOM 6177  C CE1  . PHE A 1 68  ? -6.002  -1.029  3.367   1.00 0.00 ? 68  PHE A CE1  4  
ATOM 6178  C CE2  . PHE A 1 68  ? -5.696  1.083   2.290   1.00 0.00 ? 68  PHE A CE2  4  
ATOM 6179  C CZ   . PHE A 1 68  ? -6.528  0.059   2.699   1.00 0.00 ? 68  PHE A CZ   4  
ATOM 6180  H H    . PHE A 1 68  ? -0.065  -0.569  4.803   1.00 0.00 ? 68  PHE A H    4  
ATOM 6181  H HA   . PHE A 1 68  ? -2.162  1.472   4.898   1.00 0.00 ? 68  PHE A HA   4  
ATOM 6182  H HB2  . PHE A 1 68  ? -1.816  0.424   2.732   1.00 0.00 ? 68  PHE A HB2  4  
ATOM 6183  H HB3  . PHE A 1 68  ? -2.024  -1.174  3.439   1.00 0.00 ? 68  PHE A HB3  4  
ATOM 6184  H HD1  . PHE A 1 68  ? -4.234  -1.942  4.147   1.00 0.00 ? 68  PHE A HD1  4  
ATOM 6185  H HD2  . PHE A 1 68  ? -3.691  1.817   2.227   1.00 0.00 ? 68  PHE A HD2  4  
ATOM 6186  H HE1  . PHE A 1 68  ? -6.649  -1.832  3.689   1.00 0.00 ? 68  PHE A HE1  4  
ATOM 6187  H HE2  . PHE A 1 68  ? -6.105  1.934   1.766   1.00 0.00 ? 68  PHE A HE2  4  
ATOM 6188  H HZ   . PHE A 1 68  ? -7.588  0.109   2.498   1.00 0.00 ? 68  PHE A HZ   4  
ATOM 6189  N N    . GLN A 1 69  ? -3.904  0.272   6.283   1.00 0.00 ? 69  GLN A N    4  
ATOM 6190  C CA   . GLN A 1 69  ? -4.767  -0.299  7.311   1.00 0.00 ? 69  GLN A CA   4  
ATOM 6191  C C    . GLN A 1 69  ? -6.224  -0.295  6.863   1.00 0.00 ? 69  GLN A C    4  
ATOM 6192  O O    . GLN A 1 69  ? -6.760  0.740   6.470   1.00 0.00 ? 69  GLN A O    4  
ATOM 6193  C CB   . GLN A 1 69  ? -4.620  0.479   8.619   1.00 0.00 ? 69  GLN A CB   4  
ATOM 6194  C CG   . GLN A 1 69  ? -4.865  -0.365  9.860   1.00 0.00 ? 69  GLN A CG   4  
ATOM 6195  C CD   . GLN A 1 69  ? -4.803  0.446   11.139  1.00 0.00 ? 69  GLN A CD   4  
ATOM 6196  O OE1  . GLN A 1 69  ? -3.875  0.301   11.935  1.00 0.00 ? 69  GLN A OE1  4  
ATOM 6197  N NE2  . GLN A 1 69  ? -5.793  1.307   11.343  1.00 0.00 ? 69  GLN A NE2  4  
ATOM 6198  H H    . GLN A 1 69  ? -4.189  1.086   5.819   1.00 0.00 ? 69  GLN A H    4  
ATOM 6199  H HA   . GLN A 1 69  ? -4.456  -1.320  7.473   1.00 0.00 ? 69  GLN A HA   4  
ATOM 6200  H HB2  . GLN A 1 69  ? -3.620  0.882   8.675   1.00 0.00 ? 69  GLN A HB2  4  
ATOM 6201  H HB3  . GLN A 1 69  ? -5.329  1.294   8.620   1.00 0.00 ? 69  GLN A HB3  4  
ATOM 6202  H HG2  . GLN A 1 69  ? -5.844  -0.816  9.785   1.00 0.00 ? 69  GLN A HG2  4  
ATOM 6203  H HG3  . GLN A 1 69  ? -4.115  -1.140  9.905   1.00 0.00 ? 69  GLN A HG3  4  
ATOM 6204  H HE21 . GLN A 1 69  ? -6.500  1.369   10.666  1.00 0.00 ? 69  GLN A HE21 4  
ATOM 6205  H HE22 . GLN A 1 69  ? -5.779  1.844   12.162  1.00 0.00 ? 69  GLN A HE22 4  
ATOM 6206  N N    . GLY A 1 70  ? -6.861  -1.461  6.923   1.00 0.00 ? 70  GLY A N    4  
ATOM 6207  C CA   . GLY A 1 70  ? -8.251  -1.569  6.520   1.00 0.00 ? 70  GLY A CA   4  
ATOM 6208  C C    . GLY A 1 70  ? -9.122  -2.180  7.600   1.00 0.00 ? 70  GLY A C    4  
ATOM 6209  O O    . GLY A 1 70  ? -8.643  -2.493  8.690   1.00 0.00 ? 70  GLY A O    4  
ATOM 6210  H H    . GLY A 1 70  ? -6.382  -2.254  7.245   1.00 0.00 ? 70  GLY A H    4  
ATOM 6211  H HA2  . GLY A 1 70  ? -8.624  -0.584  6.286   1.00 0.00 ? 70  GLY A HA2  4  
ATOM 6212  H HA3  . GLY A 1 70  ? -8.310  -2.185  5.635   1.00 0.00 ? 70  GLY A HA3  4  
ATOM 6213  N N    . SER A 1 71  ? -10.405 -2.349  7.298   1.00 0.00 ? 71  SER A N    4  
ATOM 6214  C CA   . SER A 1 71  ? -11.346 -2.921  8.253   1.00 0.00 ? 71  SER A CA   4  
ATOM 6215  C C    . SER A 1 71  ? -11.770 -4.323  7.825   1.00 0.00 ? 71  SER A C    4  
ATOM 6216  O O    . SER A 1 71  ? -11.944 -5.212  8.657   1.00 0.00 ? 71  SER A O    4  
ATOM 6217  C CB   . SER A 1 71  ? -12.577 -2.023  8.389   1.00 0.00 ? 71  SER A CB   4  
ATOM 6218  O OG   . SER A 1 71  ? -13.522 -2.585  9.284   1.00 0.00 ? 71  SER A OG   4  
ATOM 6219  H H    . SER A 1 71  ? -10.727 -2.079  6.412   1.00 0.00 ? 71  SER A H    4  
ATOM 6220  H HA   . SER A 1 71  ? -10.850 -2.984  9.210   1.00 0.00 ? 71  SER A HA   4  
ATOM 6221  H HB2  . SER A 1 71  ? -12.275 -1.057  8.764   1.00 0.00 ? 71  SER A HB2  4  
ATOM 6222  H HB3  . SER A 1 71  ? -13.041 -1.904  7.421   1.00 0.00 ? 71  SER A HB3  4  
ATOM 6223  H HG   . SER A 1 71  ? -14.166 -1.916  9.531   1.00 0.00 ? 71  SER A HG   4  
ATOM 6224  N N    . GLY A 1 72  ? -11.936 -4.511  6.519   1.00 0.00 ? 72  GLY A N    4  
ATOM 6225  C CA   . GLY A 1 72  ? -12.339 -5.806  6.002   1.00 0.00 ? 72  GLY A CA   4  
ATOM 6226  C C    . GLY A 1 72  ? -12.629 -5.771  4.515   1.00 0.00 ? 72  GLY A C    4  
ATOM 6227  O O    . GLY A 1 72  ? -12.866 -4.705  3.947   1.00 0.00 ? 72  GLY A O    4  
ATOM 6228  H H    . GLY A 1 72  ? -11.784 -3.765  5.902   1.00 0.00 ? 72  GLY A H    4  
ATOM 6229  H HA2  . GLY A 1 72  ? -11.548 -6.517  6.187   1.00 0.00 ? 72  GLY A HA2  4  
ATOM 6230  H HA3  . GLY A 1 72  ? -13.228 -6.128  6.523   1.00 0.00 ? 72  GLY A HA3  4  
ATOM 6231  N N    . ALA A 1 73  ? -12.610 -6.939  3.882   1.00 0.00 ? 73  ALA A N    4  
ATOM 6232  C CA   . ALA A 1 73  ? -12.874 -7.038  2.452   1.00 0.00 ? 73  ALA A CA   4  
ATOM 6233  C C    . ALA A 1 73  ? -14.007 -6.106  2.037   1.00 0.00 ? 73  ALA A C    4  
ATOM 6234  O O    . ALA A 1 73  ? -14.898 -5.785  2.823   1.00 0.00 ? 73  ALA A O    4  
ATOM 6235  C CB   . ALA A 1 73  ? -13.204 -8.474  2.074   1.00 0.00 ? 73  ALA A CB   4  
ATOM 6236  H H    . ALA A 1 73  ? -12.415 -7.754  4.389   1.00 0.00 ? 73  ALA A H    4  
ATOM 6237  H HA   . ALA A 1 73  ? -11.974 -6.751  1.926   1.00 0.00 ? 73  ALA A HA   4  
ATOM 6238  H HB1  . ALA A 1 73  ? -12.288 -9.041  1.982   1.00 0.00 ? 73  ALA A HB1  4  
ATOM 6239  H HB2  . ALA A 1 73  ? -13.825 -8.914  2.840   1.00 0.00 ? 73  ALA A HB2  4  
ATOM 6240  H HB3  . ALA A 1 73  ? -13.730 -8.486  1.131   1.00 0.00 ? 73  ALA A HB3  4  
ATOM 6241  N N    . PRO A 1 74  ? -13.975 -5.660  0.772   1.00 0.00 ? 74  PRO A N    4  
ATOM 6242  C CA   . PRO A 1 74  ? -12.919 -6.035  -0.173  1.00 0.00 ? 74  PRO A CA   4  
ATOM 6243  C C    . PRO A 1 74  ? -11.573 -5.414  0.185   1.00 0.00 ? 74  PRO A C    4  
ATOM 6244  O O    . PRO A 1 74  ? -10.564 -5.681  -0.467  1.00 0.00 ? 74  PRO A O    4  
ATOM 6245  C CB   . PRO A 1 74  ? -13.425 -5.484  -1.508  1.00 0.00 ? 74  PRO A CB   4  
ATOM 6246  C CG   . PRO A 1 74  ? -14.328 -4.359  -1.135  1.00 0.00 ? 74  PRO A CG   4  
ATOM 6247  C CD   . PRO A 1 74  ? -14.966 -4.754  0.168   1.00 0.00 ? 74  PRO A CD   4  
ATOM 6248  H HA   . PRO A 1 74  ? -12.811 -7.108  -0.242  1.00 0.00 ? 74  PRO A HA   4  
ATOM 6249  H HB2  . PRO A 1 74  ? -12.588 -5.140  -2.099  1.00 0.00 ? 74  PRO A HB2  4  
ATOM 6250  H HB3  . PRO A 1 74  ? -13.958 -6.256  -2.042  1.00 0.00 ? 74  PRO A HB3  4  
ATOM 6251  H HG2  . PRO A 1 74  ? -13.754 -3.453  -1.012  1.00 0.00 ? 74  PRO A HG2  4  
ATOM 6252  H HG3  . PRO A 1 74  ? -15.082 -4.226  -1.896  1.00 0.00 ? 74  PRO A HG3  4  
ATOM 6253  H HD2  . PRO A 1 74  ? -15.125 -3.886  0.790   1.00 0.00 ? 74  PRO A HD2  4  
ATOM 6254  H HD3  . PRO A 1 74  ? -15.899 -5.269  -0.010  1.00 0.00 ? 74  PRO A HD3  4  
ATOM 6255  N N    . GLN A 1 75  ? -11.567 -4.584  1.223   1.00 0.00 ? 75  GLN A N    4  
ATOM 6256  C CA   . GLN A 1 75  ? -10.344 -3.925  1.666   1.00 0.00 ? 75  GLN A CA   4  
ATOM 6257  C C    . GLN A 1 75  ? -9.399  -4.920  2.331   1.00 0.00 ? 75  GLN A C    4  
ATOM 6258  O O    . GLN A 1 75  ? -9.814  -5.722  3.168   1.00 0.00 ? 75  GLN A O    4  
ATOM 6259  C CB   . GLN A 1 75  ? -10.675 -2.790  2.637   1.00 0.00 ? 75  GLN A CB   4  
ATOM 6260  C CG   . GLN A 1 75  ? -11.341 -1.596  1.974   1.00 0.00 ? 75  GLN A CG   4  
ATOM 6261  C CD   . GLN A 1 75  ? -11.903 -0.609  2.978   1.00 0.00 ? 75  GLN A CD   4  
ATOM 6262  O OE1  . GLN A 1 75  ? -11.287 -0.334  4.008   1.00 0.00 ? 75  GLN A OE1  4  
ATOM 6263  N NE2  . GLN A 1 75  ? -13.080 -0.069  2.682   1.00 0.00 ? 75  GLN A NE2  4  
ATOM 6264  H H    . GLN A 1 75  ? -12.403 -4.412  1.702   1.00 0.00 ? 75  GLN A H    4  
ATOM 6265  H HA   . GLN A 1 75  ? -9.857  -3.511  0.796   1.00 0.00 ? 75  GLN A HA   4  
ATOM 6266  H HB2  . GLN A 1 75  ? -11.338 -3.168  3.401   1.00 0.00 ? 75  GLN A HB2  4  
ATOM 6267  H HB3  . GLN A 1 75  ? -9.760  -2.452  3.102   1.00 0.00 ? 75  GLN A HB3  4  
ATOM 6268  H HG2  . GLN A 1 75  ? -10.611 -1.086  1.362   1.00 0.00 ? 75  GLN A HG2  4  
ATOM 6269  H HG3  . GLN A 1 75  ? -12.147 -1.951  1.349   1.00 0.00 ? 75  GLN A HG3  4  
ATOM 6270  H HE21 . GLN A 1 75  ? -13.514 -0.335  1.844   1.00 0.00 ? 75  GLN A HE21 4  
ATOM 6271  H HE22 . GLN A 1 75  ? -13.467 0.572   3.314   1.00 0.00 ? 75  GLN A HE22 4  
ATOM 6272  N N    . LEU A 1 76  ? -8.127  -4.863  1.952   1.00 0.00 ? 76  LEU A N    4  
ATOM 6273  C CA   . LEU A 1 76  ? -7.121  -5.760  2.511   1.00 0.00 ? 76  LEU A CA   4  
ATOM 6274  C C    . LEU A 1 76  ? -5.989  -4.972  3.160   1.00 0.00 ? 76  LEU A C    4  
ATOM 6275  O O    . LEU A 1 76  ? -5.535  -3.962  2.623   1.00 0.00 ? 76  LEU A O    4  
ATOM 6276  C CB   . LEU A 1 76  ? -6.561  -6.674  1.420   1.00 0.00 ? 76  LEU A CB   4  
ATOM 6277  C CG   . LEU A 1 76  ? -5.313  -7.476  1.791   1.00 0.00 ? 76  LEU A CG   4  
ATOM 6278  C CD1  . LEU A 1 76  ? -5.692  -8.718  2.581   1.00 0.00 ? 76  LEU A CD1  4  
ATOM 6279  C CD2  . LEU A 1 76  ? -4.531  -7.854  0.541   1.00 0.00 ? 76  LEU A CD2  4  
ATOM 6280  H H    . LEU A 1 76  ? -7.856  -4.203  1.281   1.00 0.00 ? 76  LEU A H    4  
ATOM 6281  H HA   . LEU A 1 76  ? -7.601  -6.366  3.266   1.00 0.00 ? 76  LEU A HA   4  
ATOM 6282  H HB2  . LEU A 1 76  ? -7.335  -7.376  1.147   1.00 0.00 ? 76  LEU A HB2  4  
ATOM 6283  H HB3  . LEU A 1 76  ? -6.319  -6.058  0.566   1.00 0.00 ? 76  LEU A HB3  4  
ATOM 6284  H HG   . LEU A 1 76  ? -4.674  -6.866  2.414   1.00 0.00 ? 76  LEU A HG   4  
ATOM 6285  H HD11 . LEU A 1 76  ? -5.842  -8.454  3.617   1.00 0.00 ? 76  LEU A HD11 4  
ATOM 6286  H HD12 . LEU A 1 76  ? -4.899  -9.448  2.507   1.00 0.00 ? 76  LEU A HD12 4  
ATOM 6287  H HD13 . LEU A 1 76  ? -6.604  -9.136  2.180   1.00 0.00 ? 76  LEU A HD13 4  
ATOM 6288  H HD21 . LEU A 1 76  ? -3.795  -8.603  0.790   1.00 0.00 ? 76  LEU A HD21 4  
ATOM 6289  H HD22 . LEU A 1 76  ? -4.036  -6.978  0.148   1.00 0.00 ? 76  LEU A HD22 4  
ATOM 6290  H HD23 . LEU A 1 76  ? -5.210  -8.248  -0.202  1.00 0.00 ? 76  LEU A HD23 4  
ATOM 6291  N N    . SER A 1 77  ? -5.536  -5.441  4.319   1.00 0.00 ? 77  SER A N    4  
ATOM 6292  C CA   . SER A 1 77  ? -4.457  -4.779  5.042   1.00 0.00 ? 77  SER A CA   4  
ATOM 6293  C C    . SER A 1 77  ? -3.104  -5.101  4.414   1.00 0.00 ? 77  SER A C    4  
ATOM 6294  O O    . SER A 1 77  ? -2.937  -6.135  3.767   1.00 0.00 ? 77  SER A O    4  
ATOM 6295  C CB   . SER A 1 77  ? -4.464  -5.204  6.512   1.00 0.00 ? 77  SER A CB   4  
ATOM 6296  O OG   . SER A 1 77  ? -5.277  -4.342  7.288   1.00 0.00 ? 77  SER A OG   4  
ATOM 6297  H H    . SER A 1 77  ? -5.939  -6.251  4.696   1.00 0.00 ? 77  SER A H    4  
ATOM 6298  H HA   . SER A 1 77  ? -4.623  -3.714  4.984   1.00 0.00 ? 77  SER A HA   4  
ATOM 6299  H HB2  . SER A 1 77  ? -4.848  -6.210  6.591   1.00 0.00 ? 77  SER A HB2  4  
ATOM 6300  H HB3  . SER A 1 77  ? -3.455  -5.172  6.898   1.00 0.00 ? 77  SER A HB3  4  
ATOM 6301  H HG   . SER A 1 77  ? -4.812  -3.517  7.445   1.00 0.00 ? 77  SER A HG   4  
ATOM 6302  N N    . LEU A 1 78  ? -2.141  -4.208  4.611   1.00 0.00 ? 78  LEU A N    4  
ATOM 6303  C CA   . LEU A 1 78  ? -0.801  -4.395  4.065   1.00 0.00 ? 78  LEU A CA   4  
ATOM 6304  C C    . LEU A 1 78  ? 0.249   -3.751  4.965   1.00 0.00 ? 78  LEU A C    4  
ATOM 6305  O O    . LEU A 1 78  ? -0.040  -2.797  5.687   1.00 0.00 ? 78  LEU A O    4  
ATOM 6306  C CB   . LEU A 1 78  ? -0.715  -3.802  2.657   1.00 0.00 ? 78  LEU A CB   4  
ATOM 6307  C CG   . LEU A 1 78  ? -1.252  -4.679  1.526   1.00 0.00 ? 78  LEU A CG   4  
ATOM 6308  C CD1  . LEU A 1 78  ? -1.270  -3.907  0.215   1.00 0.00 ? 78  LEU A CD1  4  
ATOM 6309  C CD2  . LEU A 1 78  ? -0.418  -5.944  1.390   1.00 0.00 ? 78  LEU A CD2  4  
ATOM 6310  H H    . LEU A 1 78  ? -2.333  -3.403  5.135   1.00 0.00 ? 78  LEU A H    4  
ATOM 6311  H HA   . LEU A 1 78  ? -0.610  -5.456  4.012   1.00 0.00 ? 78  LEU A HA   4  
ATOM 6312  H HB2  . LEU A 1 78  ? -1.273  -2.878  2.653   1.00 0.00 ? 78  LEU A HB2  4  
ATOM 6313  H HB3  . LEU A 1 78  ? 0.325   -3.593  2.450   1.00 0.00 ? 78  LEU A HB3  4  
ATOM 6314  H HG   . LEU A 1 78  ? -2.268  -4.970  1.755   1.00 0.00 ? 78  LEU A HG   4  
ATOM 6315  H HD11 . LEU A 1 78  ? -1.913  -3.046  0.314   1.00 0.00 ? 78  LEU A HD11 4  
ATOM 6316  H HD12 . LEU A 1 78  ? -1.641  -4.545  -0.573  1.00 0.00 ? 78  LEU A HD12 4  
ATOM 6317  H HD13 . LEU A 1 78  ? -0.268  -3.584  -0.026  1.00 0.00 ? 78  LEU A HD13 4  
ATOM 6318  H HD21 . LEU A 1 78  ? 0.225   -5.861  0.526   1.00 0.00 ? 78  LEU A HD21 4  
ATOM 6319  H HD22 . LEU A 1 78  ? -1.073  -6.795  1.271   1.00 0.00 ? 78  LEU A HD22 4  
ATOM 6320  H HD23 . LEU A 1 78  ? 0.185   -6.075  2.277   1.00 0.00 ? 78  LEU A HD23 4  
ATOM 6321  N N    . GLN A 1 79  ? 1.468   -4.279  4.915   1.00 0.00 ? 79  GLN A N    4  
ATOM 6322  C CA   . GLN A 1 79  ? 2.561   -3.755  5.725   1.00 0.00 ? 79  GLN A CA   4  
ATOM 6323  C C    . GLN A 1 79  ? 3.797   -3.497  4.870   1.00 0.00 ? 79  GLN A C    4  
ATOM 6324  O O    . GLN A 1 79  ? 4.153   -4.309  4.015   1.00 0.00 ? 79  GLN A O    4  
ATOM 6325  C CB   . GLN A 1 79  ? 2.901   -4.730  6.853   1.00 0.00 ? 79  GLN A CB   4  
ATOM 6326  C CG   . GLN A 1 79  ? 2.066   -4.524  8.107   1.00 0.00 ? 79  GLN A CG   4  
ATOM 6327  C CD   . GLN A 1 79  ? 2.449   -5.473  9.226   1.00 0.00 ? 79  GLN A CD   4  
ATOM 6328  O OE1  . GLN A 1 79  ? 3.438   -6.200  9.127   1.00 0.00 ? 79  GLN A OE1  4  
ATOM 6329  N NE2  . GLN A 1 79  ? 1.667   -5.470  10.299  1.00 0.00 ? 79  GLN A NE2  4  
ATOM 6330  H H    . GLN A 1 79  ? 1.636   -5.039  4.320   1.00 0.00 ? 79  GLN A H    4  
ATOM 6331  H HA   . GLN A 1 79  ? 2.235   -2.820  6.155   1.00 0.00 ? 79  GLN A HA   4  
ATOM 6332  H HB2  . GLN A 1 79  ? 2.742   -5.738  6.502   1.00 0.00 ? 79  GLN A HB2  4  
ATOM 6333  H HB3  . GLN A 1 79  ? 3.941   -4.608  7.117   1.00 0.00 ? 79  GLN A HB3  4  
ATOM 6334  H HG2  . GLN A 1 79  ? 2.202   -3.510  8.453   1.00 0.00 ? 79  GLN A HG2  4  
ATOM 6335  H HG3  . GLN A 1 79  ? 1.026   -4.682  7.861   1.00 0.00 ? 79  GLN A HG3  4  
ATOM 6336  H HE21 . GLN A 1 79  ? 0.896   -4.864  10.307  1.00 0.00 ? 79  GLN A HE21 4  
ATOM 6337  H HE22 . GLN A 1 79  ? 1.891   -6.073  11.036  1.00 0.00 ? 79  GLN A HE22 4  
ATOM 6338  N N    . ILE A 1 80  ? 4.448   -2.363  5.106   1.00 0.00 ? 80  ILE A N    4  
ATOM 6339  C CA   . ILE A 1 80  ? 5.645   -1.999  4.357   1.00 0.00 ? 80  ILE A CA   4  
ATOM 6340  C C    . ILE A 1 80  ? 6.632   -3.160  4.301   1.00 0.00 ? 80  ILE A C    4  
ATOM 6341  O O    . ILE A 1 80  ? 6.890   -3.818  5.308   1.00 0.00 ? 80  ILE A O    4  
ATOM 6342  C CB   . ILE A 1 80  ? 6.345   -0.774  4.975   1.00 0.00 ? 80  ILE A CB   4  
ATOM 6343  C CG1  . ILE A 1 80  ? 5.379   0.411   5.046   1.00 0.00 ? 80  ILE A CG1  4  
ATOM 6344  C CG2  . ILE A 1 80  ? 7.582   -0.409  4.169   1.00 0.00 ? 80  ILE A CG2  4  
ATOM 6345  C CD1  . ILE A 1 80  ? 5.927   1.592   5.816   1.00 0.00 ? 80  ILE A CD1  4  
ATOM 6346  H H    . ILE A 1 80  ? 4.115   -1.756  5.800   1.00 0.00 ? 80  ILE A H    4  
ATOM 6347  H HA   . ILE A 1 80  ? 5.344   -1.747  3.350   1.00 0.00 ? 80  ILE A HA   4  
ATOM 6348  H HB   . ILE A 1 80  ? 6.659   -1.033  5.975   1.00 0.00 ? 80  ILE A HB   4  
ATOM 6349  H HG12 . ILE A 1 80  ? 5.154   0.744   4.045   1.00 0.00 ? 80  ILE A HG12 4  
ATOM 6350  H HG13 . ILE A 1 80  ? 4.466   0.093   5.529   1.00 0.00 ? 80  ILE A HG13 4  
ATOM 6351  H HG21 . ILE A 1 80  ? 8.430   -0.966  4.540   1.00 0.00 ? 80  ILE A HG21 4  
ATOM 6352  H HG22 . ILE A 1 80  ? 7.419   -0.652  3.130   1.00 0.00 ? 80  ILE A HG22 4  
ATOM 6353  H HG23 . ILE A 1 80  ? 7.776   0.648   4.266   1.00 0.00 ? 80  ILE A HG23 4  
ATOM 6354  H HD11 . ILE A 1 80  ? 5.803   2.492   5.230   1.00 0.00 ? 80  ILE A HD11 4  
ATOM 6355  H HD12 . ILE A 1 80  ? 5.391   1.694   6.748   1.00 0.00 ? 80  ILE A HD12 4  
ATOM 6356  H HD13 . ILE A 1 80  ? 6.976   1.435   6.017   1.00 0.00 ? 80  ILE A HD13 4  
ATOM 6357  N N    . GLY A 1 81  ? 7.182   -3.405  3.116   1.00 0.00 ? 81  GLY A N    4  
ATOM 6358  C CA   . GLY A 1 81  ? 8.136   -4.486  2.951   1.00 0.00 ? 81  GLY A CA   4  
ATOM 6359  C C    . GLY A 1 81  ? 7.465   -5.811  2.650   1.00 0.00 ? 81  GLY A C    4  
ATOM 6360  O O    . GLY A 1 81  ? 8.084   -6.869  2.764   1.00 0.00 ? 81  GLY A O    4  
ATOM 6361  H H    . GLY A 1 81  ? 6.938   -2.848  2.348   1.00 0.00 ? 81  GLY A H    4  
ATOM 6362  H HA2  . GLY A 1 81  ? 8.805   -4.241  2.139   1.00 0.00 ? 81  GLY A HA2  4  
ATOM 6363  H HA3  . GLY A 1 81  ? 8.711   -4.585  3.860   1.00 0.00 ? 81  GLY A HA3  4  
ATOM 6364  N N    . ASP A 1 82  ? 6.194   -5.755  2.266   1.00 0.00 ? 82  ASP A N    4  
ATOM 6365  C CA   . ASP A 1 82  ? 5.438   -6.961  1.949   1.00 0.00 ? 82  ASP A CA   4  
ATOM 6366  C C    . ASP A 1 82  ? 5.147   -7.043  0.454   1.00 0.00 ? 82  ASP A C    4  
ATOM 6367  O O    . ASP A 1 82  ? 4.935   -6.024  -0.205  1.00 0.00 ? 82  ASP A O    4  
ATOM 6368  C CB   . ASP A 1 82  ? 4.127   -6.989  2.738   1.00 0.00 ? 82  ASP A CB   4  
ATOM 6369  C CG   . ASP A 1 82  ? 4.346   -7.256  4.214   1.00 0.00 ? 82  ASP A CG   4  
ATOM 6370  O OD1  . ASP A 1 82  ? 5.502   -7.520  4.604   1.00 0.00 ? 82  ASP A OD1  4  
ATOM 6371  O OD2  . ASP A 1 82  ? 3.360   -7.203  4.979   1.00 0.00 ? 82  ASP A OD2  4  
ATOM 6372  H H    . ASP A 1 82  ? 5.755   -4.882  2.194   1.00 0.00 ? 82  ASP A H    4  
ATOM 6373  H HA   . ASP A 1 82  ? 6.036   -7.813  2.234   1.00 0.00 ? 82  ASP A HA   4  
ATOM 6374  H HB2  . ASP A 1 82  ? 3.632   -6.034  2.633   1.00 0.00 ? 82  ASP A HB2  4  
ATOM 6375  H HB3  . ASP A 1 82  ? 3.491   -7.765  2.339   1.00 0.00 ? 82  ASP A HB3  4  
ATOM 6376  N N    . VAL A 1 83  ? 5.141   -8.261  -0.077  1.00 0.00 ? 83  VAL A N    4  
ATOM 6377  C CA   . VAL A 1 83  ? 4.877   -8.476  -1.495  1.00 0.00 ? 83  VAL A CA   4  
ATOM 6378  C C    . VAL A 1 83  ? 3.524   -9.146  -1.707  1.00 0.00 ? 83  VAL A C    4  
ATOM 6379  O O    . VAL A 1 83  ? 3.106   -9.990  -0.914  1.00 0.00 ? 83  VAL A O    4  
ATOM 6380  C CB   . VAL A 1 83  ? 5.973   -9.342  -2.145  1.00 0.00 ? 83  VAL A CB   4  
ATOM 6381  C CG1  . VAL A 1 83  ? 5.622   -9.650  -3.592  1.00 0.00 ? 83  VAL A CG1  4  
ATOM 6382  C CG2  . VAL A 1 83  ? 7.324   -8.649  -2.051  1.00 0.00 ? 83  VAL A CG2  4  
ATOM 6383  H H    . VAL A 1 83  ? 5.317   -9.034  0.499   1.00 0.00 ? 83  VAL A H    4  
ATOM 6384  H HA   . VAL A 1 83  ? 4.871   -7.513  -1.983  1.00 0.00 ? 83  VAL A HA   4  
ATOM 6385  H HB   . VAL A 1 83  ? 6.032   -10.276 -1.606  1.00 0.00 ? 83  VAL A HB   4  
ATOM 6386  H HG11 . VAL A 1 83  ? 6.210   -10.488 -3.935  1.00 0.00 ? 83  VAL A HG11 4  
ATOM 6387  H HG12 . VAL A 1 83  ? 4.571   -9.892  -3.665  1.00 0.00 ? 83  VAL A HG12 4  
ATOM 6388  H HG13 . VAL A 1 83  ? 5.836   -8.787  -4.206  1.00 0.00 ? 83  VAL A HG13 4  
ATOM 6389  H HG21 . VAL A 1 83  ? 7.261   -7.830  -1.350  1.00 0.00 ? 83  VAL A HG21 4  
ATOM 6390  H HG22 . VAL A 1 83  ? 8.067   -9.356  -1.713  1.00 0.00 ? 83  VAL A HG22 4  
ATOM 6391  H HG23 . VAL A 1 83  ? 7.603   -8.270  -3.023  1.00 0.00 ? 83  VAL A HG23 4  
ATOM 6392  N N    . VAL A 1 84  ? 2.842   -8.763  -2.782  1.00 0.00 ? 84  VAL A N    4  
ATOM 6393  C CA   . VAL A 1 84  ? 1.536   -9.327  -3.100  1.00 0.00 ? 84  VAL A CA   4  
ATOM 6394  C C    . VAL A 1 84  ? 1.457   -9.740  -4.565  1.00 0.00 ? 84  VAL A C    4  
ATOM 6395  O O    . VAL A 1 84  ? 2.031   -9.086  -5.436  1.00 0.00 ? 84  VAL A O    4  
ATOM 6396  C CB   . VAL A 1 84  ? 0.404   -8.327  -2.798  1.00 0.00 ? 84  VAL A CB   4  
ATOM 6397  C CG1  . VAL A 1 84  ? 0.359   -8.003  -1.312  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 6398  C CG2  . VAL A 1 84  ? 0.578   -7.061  -3.623  1.00 0.00 ? 84  VAL A CG2  4  
ATOM 6399  H H    . VAL A 1 84  ? 3.227   -8.086  -3.376  1.00 0.00 ? 84  VAL A H    4  
ATOM 6400  H HA   . VAL A 1 84  ? 1.390   -10.201 -2.481  1.00 0.00 ? 84  VAL A HA   4  
ATOM 6401  H HB   . VAL A 1 84  ? -0.536  -8.784  -3.072  1.00 0.00 ? 84  VAL A HB   4  
ATOM 6402  H HG11 . VAL A 1 84  ? -0.540  -8.418  -0.880  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 6403  H HG12 . VAL A 1 84  ? 1.224   -8.430  -0.824  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 6404  H HG13 . VAL A 1 84  ? 0.361   -6.932  -1.177  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 6405  H HG21 . VAL A 1 84  ? 1.629   -6.887  -3.799  1.00 0.00 ? 84  VAL A HG21 4  
ATOM 6406  H HG22 . VAL A 1 84  ? 0.067   -7.175  -4.567  1.00 0.00 ? 84  VAL A HG22 4  
ATOM 6407  H HG23 . VAL A 1 84  ? 0.159   -6.221  -3.087  1.00 0.00 ? 84  VAL A HG23 4  
ATOM 6408  N N    . ARG A 1 85  ? 0.742   -10.828 -4.830  1.00 0.00 ? 85  ARG A N    4  
ATOM 6409  C CA   . ARG A 1 85  ? 0.588   -11.328 -6.191  1.00 0.00 ? 85  ARG A CA   4  
ATOM 6410  C C    . ARG A 1 85  ? -0.541  -10.600 -6.914  1.00 0.00 ? 85  ARG A C    4  
ATOM 6411  O O    . ARG A 1 85  ? -1.715  -10.930 -6.742  1.00 0.00 ? 85  ARG A O    4  
ATOM 6412  C CB   . ARG A 1 85  ? 0.312   -12.833 -6.176  1.00 0.00 ? 85  ARG A CB   4  
ATOM 6413  C CG   . ARG A 1 85  ? 0.813   -13.557 -7.415  1.00 0.00 ? 85  ARG A CG   4  
ATOM 6414  C CD   . ARG A 1 85  ? 2.322   -13.738 -7.382  1.00 0.00 ? 85  ARG A CD   4  
ATOM 6415  N NE   . ARG A 1 85  ? 2.710   -14.990 -6.738  1.00 0.00 ? 85  ARG A NE   4  
ATOM 6416  C CZ   . ARG A 1 85  ? 3.937   -15.240 -6.294  1.00 0.00 ? 85  ARG A CZ   4  
ATOM 6417  N NH1  . ARG A 1 85  ? 4.890   -14.328 -6.424  1.00 0.00 ? 85  ARG A NH1  4  
ATOM 6418  N NH2  . ARG A 1 85  ? 4.212   -16.403 -5.719  1.00 0.00 ? 85  ARG A NH2  4  
ATOM 6419  H H    . ARG A 1 85  ? 0.307   -11.306 -4.094  1.00 0.00 ? 85  ARG A H    4  
ATOM 6420  H HA   . ARG A 1 85  ? 1.513   -11.146 -6.718  1.00 0.00 ? 85  ARG A HA   4  
ATOM 6421  H HB2  . ARG A 1 85  ? 0.794   -13.267 -5.312  1.00 0.00 ? 85  ARG A HB2  4  
ATOM 6422  H HB3  . ARG A 1 85  ? -0.753  -12.990 -6.100  1.00 0.00 ? 85  ARG A HB3  4  
ATOM 6423  H HG2  . ARG A 1 85  ? 0.346   -14.529 -7.466  1.00 0.00 ? 85  ARG A HG2  4  
ATOM 6424  H HG3  . ARG A 1 85  ? 0.547   -12.981 -8.289  1.00 0.00 ? 85  ARG A HG3  4  
ATOM 6425  H HD2  . ARG A 1 85  ? 2.694   -13.736 -8.396  1.00 0.00 ? 85  ARG A HD2  4  
ATOM 6426  H HD3  . ARG A 1 85  ? 2.758   -12.914 -6.837  1.00 0.00 ? 85  ARG A HD3  4  
ATOM 6427  H HE   . ARG A 1 85  ? 2.020   -15.678 -6.632  1.00 0.00 ? 85  ARG A HE   4  
ATOM 6428  H HH11 . ARG A 1 85  ? 4.686   -13.450 -6.856  1.00 0.00 ? 85  ARG A HH11 4  
ATOM 6429  H HH12 . ARG A 1 85  ? 5.813   -14.518 -6.088  1.00 0.00 ? 85  ARG A HH12 4  
ATOM 6430  H HH21 . ARG A 1 85  ? 3.495   -17.093 -5.620  1.00 0.00 ? 85  ARG A HH21 4  
ATOM 6431  H HH22 . ARG A 1 85  ? 5.135   -16.590 -5.386  1.00 0.00 ? 85  ARG A HH22 4  
ATOM 6432  N N    . ILE A 1 86  ? -0.178  -9.609  -7.721  1.00 0.00 ? 86  ILE A N    4  
ATOM 6433  C CA   . ILE A 1 86  ? -1.161  -8.836  -8.470  1.00 0.00 ? 86  ILE A CA   4  
ATOM 6434  C C    . ILE A 1 86  ? -1.776  -9.666  -9.591  1.00 0.00 ? 86  ILE A C    4  
ATOM 6435  O O    . ILE A 1 86  ? -1.080  -10.096 -10.511 1.00 0.00 ? 86  ILE A O    4  
ATOM 6436  C CB   . ILE A 1 86  ? -0.535  -7.563  -9.072  1.00 0.00 ? 86  ILE A CB   4  
ATOM 6437  C CG1  . ILE A 1 86  ? 0.054   -6.686  -7.966  1.00 0.00 ? 86  ILE A CG1  4  
ATOM 6438  C CG2  . ILE A 1 86  ? -1.573  -6.791  -9.872  1.00 0.00 ? 86  ILE A CG2  4  
ATOM 6439  C CD1  . ILE A 1 86  ? 0.942   -5.576  -8.484  1.00 0.00 ? 86  ILE A CD1  4  
ATOM 6440  H H    . ILE A 1 86  ? 0.773   -9.394  -7.816  1.00 0.00 ? 86  ILE A H    4  
ATOM 6441  H HA   . ILE A 1 86  ? -1.943  -8.539  -7.786  1.00 0.00 ? 86  ILE A HA   4  
ATOM 6442  H HB   . ILE A 1 86  ? 0.254   -7.861  -9.745  1.00 0.00 ? 86  ILE A HB   4  
ATOM 6443  H HG12 . ILE A 1 86  ? -0.750  -6.234  -7.407  1.00 0.00 ? 86  ILE A HG12 4  
ATOM 6444  H HG13 . ILE A 1 86  ? 0.645   -7.303  -7.304  1.00 0.00 ? 86  ILE A HG13 4  
ATOM 6445  H HG21 . ILE A 1 86  ? -1.213  -5.789  -10.056 1.00 0.00 ? 86  ILE A HG21 4  
ATOM 6446  H HG22 . ILE A 1 86  ? -1.744  -7.289  -10.815 1.00 0.00 ? 86  ILE A HG22 4  
ATOM 6447  H HG23 . ILE A 1 86  ? -2.497  -6.745  -9.315  1.00 0.00 ? 86  ILE A HG23 4  
ATOM 6448  H HD11 . ILE A 1 86  ? 1.306   -4.989  -7.652  1.00 0.00 ? 86  ILE A HD11 4  
ATOM 6449  H HD12 . ILE A 1 86  ? 1.779   -6.002  -9.016  1.00 0.00 ? 86  ILE A HD12 4  
ATOM 6450  H HD13 . ILE A 1 86  ? 0.375   -4.942  -9.149  1.00 0.00 ? 86  ILE A HD13 4  
ATOM 6451  N N    . GLN A 1 87  ? -3.084  -9.886  -9.508  1.00 0.00 ? 87  GLN A N    4  
ATOM 6452  C CA   . GLN A 1 87  ? -3.793  -10.664 -10.517 1.00 0.00 ? 87  GLN A CA   4  
ATOM 6453  C C    . GLN A 1 87  ? -4.580  -9.753  -11.454 1.00 0.00 ? 87  GLN A C    4  
ATOM 6454  O O    . GLN A 1 87  ? -4.590  -9.955  -12.667 1.00 0.00 ? 87  GLN A O    4  
ATOM 6455  C CB   . GLN A 1 87  ? -4.736  -11.666 -9.850  1.00 0.00 ? 87  GLN A CB   4  
ATOM 6456  C CG   . GLN A 1 87  ? -4.040  -12.595 -8.868  1.00 0.00 ? 87  GLN A CG   4  
ATOM 6457  C CD   . GLN A 1 87  ? -4.793  -13.894 -8.660  1.00 0.00 ? 87  GLN A CD   4  
ATOM 6458  O OE1  . GLN A 1 87  ? -6.022  -13.906 -8.576  1.00 0.00 ? 87  GLN A OE1  4  
ATOM 6459  N NE2  . GLN A 1 87  ? -4.059  -14.998 -8.575  1.00 0.00 ? 87  GLN A NE2  4  
ATOM 6460  H H    . GLN A 1 87  ? -3.583  -9.517  -8.751  1.00 0.00 ? 87  GLN A H    4  
ATOM 6461  H HA   . GLN A 1 87  ? -3.058  -11.205 -11.095 1.00 0.00 ? 87  GLN A HA   4  
ATOM 6462  H HB2  . GLN A 1 87  ? -5.501  -11.122 -9.317  1.00 0.00 ? 87  GLN A HB2  4  
ATOM 6463  H HB3  . GLN A 1 87  ? -5.201  -12.270 -10.615 1.00 0.00 ? 87  GLN A HB3  4  
ATOM 6464  H HG2  . GLN A 1 87  ? -3.055  -12.826 -9.246  1.00 0.00 ? 87  GLN A HG2  4  
ATOM 6465  H HG3  . GLN A 1 87  ? -3.951  -12.091 -7.917  1.00 0.00 ? 87  GLN A HG3  4  
ATOM 6466  H HE21 . GLN A 1 87  ? -3.085  -14.912 -8.649  1.00 0.00 ? 87  GLN A HE21 4  
ATOM 6467  H HE22 . GLN A 1 87  ? -4.520  -15.851 -8.440  1.00 0.00 ? 87  GLN A HE22 4  
ATOM 6468  N N    . GLU A 1 88  ? -5.238  -8.750  -10.881 1.00 0.00 ? 88  GLU A N    4  
ATOM 6469  C CA   . GLU A 1 88  ? -6.029  -7.809  -11.665 1.00 0.00 ? 88  GLU A CA   4  
ATOM 6470  C C    . GLU A 1 88  ? -5.769  -6.374  -11.217 1.00 0.00 ? 88  GLU A C    4  
ATOM 6471  O O    . GLU A 1 88  ? -5.305  -6.133  -10.102 1.00 0.00 ? 88  GLU A O    4  
ATOM 6472  C CB   . GLU A 1 88  ? -7.519  -8.132  -11.539 1.00 0.00 ? 88  GLU A CB   4  
ATOM 6473  C CG   . GLU A 1 88  ? -8.334  -7.727  -12.756 1.00 0.00 ? 88  GLU A CG   4  
ATOM 6474  C CD   . GLU A 1 88  ? -8.002  -8.554  -13.983 1.00 0.00 ? 88  GLU A CD   4  
ATOM 6475  O OE1  . GLU A 1 88  ? -7.710  -9.758  -13.825 1.00 0.00 ? 88  GLU A OE1  4  
ATOM 6476  O OE2  . GLU A 1 88  ? -8.033  -7.997  -15.100 1.00 0.00 ? 88  GLU A OE2  4  
ATOM 6477  H H    . GLU A 1 88  ? -5.191  -8.641  -9.908  1.00 0.00 ? 88  GLU A H    4  
ATOM 6478  H HA   . GLU A 1 88  ? -5.734  -7.909  -12.699 1.00 0.00 ? 88  GLU A HA   4  
ATOM 6479  H HB2  . GLU A 1 88  ? -7.633  -9.196  -11.393 1.00 0.00 ? 88  GLU A HB2  4  
ATOM 6480  H HB3  . GLU A 1 88  ? -7.915  -7.615  -10.678 1.00 0.00 ? 88  GLU A HB3  4  
ATOM 6481  H HG2  . GLU A 1 88  ? -9.383  -7.854  -12.529 1.00 0.00 ? 88  GLU A HG2  4  
ATOM 6482  H HG3  . GLU A 1 88  ? -8.138  -6.688  -12.975 1.00 0.00 ? 88  GLU A HG3  4  
ATOM 6483  N N    . THR A 1 89  ? -6.071  -5.422  -12.095 1.00 0.00 ? 89  THR A N    4  
ATOM 6484  C CA   . THR A 1 89  ? -5.868  -4.011  -11.792 1.00 0.00 ? 89  THR A CA   4  
ATOM 6485  C C    . THR A 1 89  ? -7.052  -3.173  -12.261 1.00 0.00 ? 89  THR A C    4  
ATOM 6486  O O    . THR A 1 89  ? -7.465  -3.257  -13.418 1.00 0.00 ? 89  THR A O    4  
ATOM 6487  C CB   . THR A 1 89  ? -4.582  -3.474  -12.447 1.00 0.00 ? 89  THR A CB   4  
ATOM 6488  O OG1  . THR A 1 89  ? -3.460  -4.270  -12.048 1.00 0.00 ? 89  THR A OG1  4  
ATOM 6489  C CG2  . THR A 1 89  ? -4.343  -2.022  -12.061 1.00 0.00 ? 89  THR A CG2  4  
ATOM 6490  H H    . THR A 1 89  ? -6.437  -5.677  -12.967 1.00 0.00 ? 89  THR A H    4  
ATOM 6491  H HA   . THR A 1 89  ? -5.771  -3.910  -10.720 1.00 0.00 ? 89  THR A HA   4  
ATOM 6492  H HB   . THR A 1 89  ? -4.692  -3.532  -13.521 1.00 0.00 ? 89  THR A HB   4  
ATOM 6493  H HG1  . THR A 1 89  ? -2.653  -3.759  -12.151 1.00 0.00 ? 89  THR A HG1  4  
ATOM 6494  H HG21 . THR A 1 89  ? -4.010  -1.470  -12.927 1.00 0.00 ? 89  THR A HG21 4  
ATOM 6495  H HG22 . THR A 1 89  ? -3.588  -1.974  -11.291 1.00 0.00 ? 89  THR A HG22 4  
ATOM 6496  H HG23 . THR A 1 89  ? -5.263  -1.592  -11.692 1.00 0.00 ? 89  THR A HG23 4  
ATOM 6497  N N    . CYS A 1 90  ? -7.594  -2.365  -11.356 1.00 0.00 ? 90  CYS A N    4  
ATOM 6498  C CA   . CYS A 1 90  ? -8.732  -1.510  -11.678 1.00 0.00 ? 90  CYS A CA   4  
ATOM 6499  C C    . CYS A 1 90  ? -8.452  -0.063  -11.288 1.00 0.00 ? 90  CYS A C    4  
ATOM 6500  O O    . CYS A 1 90  ? -7.855  0.206   -10.247 1.00 0.00 ? 90  CYS A O    4  
ATOM 6501  C CB   . CYS A 1 90  ? -9.989  -2.010  -10.965 1.00 0.00 ? 90  CYS A CB   4  
ATOM 6502  S SG   . CYS A 1 90  ? -10.398 -3.736  -11.313 1.00 0.00 ? 90  CYS A SG   4  
ATOM 6503  H H    . CYS A 1 90  ? -7.221  -2.341  -10.450 1.00 0.00 ? 90  CYS A H    4  
ATOM 6504  H HA   . CYS A 1 90  ? -8.890  -1.559  -12.745 1.00 0.00 ? 90  CYS A HA   4  
ATOM 6505  H HB2  . CYS A 1 90  ? -9.850  -1.915  -9.898  1.00 0.00 ? 90  CYS A HB2  4  
ATOM 6506  H HB3  . CYS A 1 90  ? -10.830 -1.404  -11.267 1.00 0.00 ? 90  CYS A HB3  4  
ATOM 6507  H HG   . CYS A 1 90  ? -9.496  -4.499  -10.714 1.00 0.00 ? 90  CYS A HG   4  
ATOM 6508  N N    . GLY A 1 91  ? -8.887  0.867   -12.133 1.00 0.00 ? 91  GLY A N    4  
ATOM 6509  C CA   . GLY A 1 91  ? -8.673  2.276   -11.860 1.00 0.00 ? 91  GLY A CA   4  
ATOM 6510  C C    . GLY A 1 91  ? -7.349  2.538   -11.169 1.00 0.00 ? 91  GLY A C    4  
ATOM 6511  O O    . GLY A 1 91  ? -6.286  2.385   -11.771 1.00 0.00 ? 91  GLY A O    4  
ATOM 6512  H H    . GLY A 1 91  ? -9.357  0.594   -12.949 1.00 0.00 ? 91  GLY A H    4  
ATOM 6513  H HA2  . GLY A 1 91  ? -8.693  2.820   -12.793 1.00 0.00 ? 91  GLY A HA2  4  
ATOM 6514  H HA3  . GLY A 1 91  ? -9.472  2.635   -11.229 1.00 0.00 ? 91  GLY A HA3  4  
ATOM 6515  N N    . ASP A 1 92  ? -7.413  2.935   -9.903  1.00 0.00 ? 92  ASP A N    4  
ATOM 6516  C CA   . ASP A 1 92  ? -6.210  3.219   -9.129  1.00 0.00 ? 92  ASP A CA   4  
ATOM 6517  C C    . ASP A 1 92  ? -6.107  2.290   -7.924  1.00 0.00 ? 92  ASP A C    4  
ATOM 6518  O O    . ASP A 1 92  ? -5.801  2.727   -6.815  1.00 0.00 ? 92  ASP A O    4  
ATOM 6519  C CB   . ASP A 1 92  ? -6.209  4.677   -8.665  1.00 0.00 ? 92  ASP A CB   4  
ATOM 6520  C CG   . ASP A 1 92  ? -5.611  5.612   -9.697  1.00 0.00 ? 92  ASP A CG   4  
ATOM 6521  O OD1  . ASP A 1 92  ? -4.482  5.343   -10.159 1.00 0.00 ? 92  ASP A OD1  4  
ATOM 6522  O OD2  . ASP A 1 92  ? -6.271  6.614   -10.044 1.00 0.00 ? 92  ASP A OD2  4  
ATOM 6523  H H    . ASP A 1 92  ? -8.291  3.038   -9.478  1.00 0.00 ? 92  ASP A H    4  
ATOM 6524  H HA   . ASP A 1 92  ? -5.357  3.055   -9.770  1.00 0.00 ? 92  ASP A HA   4  
ATOM 6525  H HB2  . ASP A 1 92  ? -7.226  4.988   -8.473  1.00 0.00 ? 92  ASP A HB2  4  
ATOM 6526  H HB3  . ASP A 1 92  ? -5.634  4.758   -7.755  1.00 0.00 ? 92  ASP A HB3  4  
ATOM 6527  N N    . TRP A 1 93  ? -6.364  1.007   -8.150  1.00 0.00 ? 93  TRP A N    4  
ATOM 6528  C CA   . TRP A 1 93  ? -6.301  0.015   -7.083  1.00 0.00 ? 93  TRP A CA   4  
ATOM 6529  C C    . TRP A 1 93  ? -5.927  -1.356  -7.635  1.00 0.00 ? 93  TRP A C    4  
ATOM 6530  O O    . TRP A 1 93  ? -6.353  -1.733  -8.727  1.00 0.00 ? 93  TRP A O    4  
ATOM 6531  C CB   . TRP A 1 93  ? -7.642  -0.064  -6.352  1.00 0.00 ? 93  TRP A CB   4  
ATOM 6532  C CG   . TRP A 1 93  ? -7.950  1.158   -5.541  1.00 0.00 ? 93  TRP A CG   4  
ATOM 6533  C CD1  . TRP A 1 93  ? -8.322  2.384   -6.015  1.00 0.00 ? 93  TRP A CD1  4  
ATOM 6534  C CD2  . TRP A 1 93  ? -7.909  1.273   -4.114  1.00 0.00 ? 93  TRP A CD2  4  
ATOM 6535  N NE1  . TRP A 1 93  ? -8.515  3.254   -4.968  1.00 0.00 ? 93  TRP A NE1  4  
ATOM 6536  C CE2  . TRP A 1 93  ? -8.269  2.596   -3.792  1.00 0.00 ? 93  TRP A CE2  4  
ATOM 6537  C CE3  . TRP A 1 93  ? -7.606  0.386   -3.078  1.00 0.00 ? 93  TRP A CE3  4  
ATOM 6538  C CZ2  . TRP A 1 93  ? -8.332  3.051   -2.478  1.00 0.00 ? 93  TRP A CZ2  4  
ATOM 6539  C CZ3  . TRP A 1 93  ? -7.669  0.839   -1.774  1.00 0.00 ? 93  TRP A CZ3  4  
ATOM 6540  C CH2  . TRP A 1 93  ? -8.030  2.161   -1.483  1.00 0.00 ? 93  TRP A CH2  4  
ATOM 6541  H H    . TRP A 1 93  ? -6.602  0.719   -9.057  1.00 0.00 ? 93  TRP A H    4  
ATOM 6542  H HA   . TRP A 1 93  ? -5.539  0.329   -6.385  1.00 0.00 ? 93  TRP A HA   4  
ATOM 6543  H HB2  . TRP A 1 93  ? -8.433  -0.191  -7.076  1.00 0.00 ? 93  TRP A HB2  4  
ATOM 6544  H HB3  . TRP A 1 93  ? -7.630  -0.914  -5.684  1.00 0.00 ? 93  TRP A HB3  4  
ATOM 6545  H HD1  . TRP A 1 93  ? -8.440  2.621   -7.061  1.00 0.00 ? 93  TRP A HD1  4  
ATOM 6546  H HE1  . TRP A 1 93  ? -8.786  4.192   -5.052  1.00 0.00 ? 93  TRP A HE1  4  
ATOM 6547  H HE3  . TRP A 1 93  ? -7.326  -0.637  -3.282  1.00 0.00 ? 93  TRP A HE3  4  
ATOM 6548  H HZ2  . TRP A 1 93  ? -8.610  4.067   -2.237  1.00 0.00 ? 93  TRP A HZ2  4  
ATOM 6549  H HZ3  . TRP A 1 93  ? -7.437  0.168   -0.959  1.00 0.00 ? 93  TRP A HZ3  4  
ATOM 6550  H HH2  . TRP A 1 93  ? -8.066  2.472   -0.450  1.00 0.00 ? 93  TRP A HH2  4  
ATOM 6551  N N    . TYR A 1 94  ? -5.131  -2.099  -6.874  1.00 0.00 ? 94  TYR A N    4  
ATOM 6552  C CA   . TYR A 1 94  ? -4.699  -3.428  -7.289  1.00 0.00 ? 94  TYR A CA   4  
ATOM 6553  C C    . TYR A 1 94  ? -5.617  -4.503  -6.717  1.00 0.00 ? 94  TYR A C    4  
ATOM 6554  O O    . TYR A 1 94  ? -6.254  -4.305  -5.681  1.00 0.00 ? 94  TYR A O    4  
ATOM 6555  C CB   . TYR A 1 94  ? -3.258  -3.682  -6.842  1.00 0.00 ? 94  TYR A CB   4  
ATOM 6556  C CG   . TYR A 1 94  ? -2.224  -3.033  -7.734  1.00 0.00 ? 94  TYR A CG   4  
ATOM 6557  C CD1  . TYR A 1 94  ? -2.245  -3.226  -9.109  1.00 0.00 ? 94  TYR A CD1  4  
ATOM 6558  C CD2  . TYR A 1 94  ? -1.227  -2.225  -7.201  1.00 0.00 ? 94  TYR A CD2  4  
ATOM 6559  C CE1  . TYR A 1 94  ? -1.301  -2.636  -9.928  1.00 0.00 ? 94  TYR A CE1  4  
ATOM 6560  C CE2  . TYR A 1 94  ? -0.280  -1.630  -8.012  1.00 0.00 ? 94  TYR A CE2  4  
ATOM 6561  C CZ   . TYR A 1 94  ? -0.321  -1.838  -9.374  1.00 0.00 ? 94  TYR A CZ   4  
ATOM 6562  O OH   . TYR A 1 94  ? 0.619   -1.248  -10.187 1.00 0.00 ? 94  TYR A OH   4  
ATOM 6563  H H    . TYR A 1 94  ? -4.825  -1.744  -6.013  1.00 0.00 ? 94  TYR A H    4  
ATOM 6564  H HA   . TYR A 1 94  ? -4.743  -3.470  -8.368  1.00 0.00 ? 94  TYR A HA   4  
ATOM 6565  H HB2  . TYR A 1 94  ? -3.125  -3.294  -5.844  1.00 0.00 ? 94  TYR A HB2  4  
ATOM 6566  H HB3  . TYR A 1 94  ? -3.072  -4.746  -6.837  1.00 0.00 ? 94  TYR A HB3  4  
ATOM 6567  H HD1  . TYR A 1 94  ? -3.014  -3.851  -9.540  1.00 0.00 ? 94  TYR A HD1  4  
ATOM 6568  H HD2  . TYR A 1 94  ? -1.197  -2.064  -6.133  1.00 0.00 ? 94  TYR A HD2  4  
ATOM 6569  H HE1  . TYR A 1 94  ? -1.334  -2.798  -10.995 1.00 0.00 ? 94  TYR A HE1  4  
ATOM 6570  H HE2  . TYR A 1 94  ? 0.488   -1.006  -7.579  1.00 0.00 ? 94  TYR A HE2  4  
ATOM 6571  H HH   . TYR A 1 94  ? 0.196   -0.929  -10.987 1.00 0.00 ? 94  TYR A HH   4  
ATOM 6572  N N    . ARG A 1 95  ? -5.681  -5.642  -7.398  1.00 0.00 ? 95  ARG A N    4  
ATOM 6573  C CA   . ARG A 1 95  ? -6.521  -6.750  -6.959  1.00 0.00 ? 95  ARG A CA   4  
ATOM 6574  C C    . ARG A 1 95  ? -5.706  -8.033  -6.830  1.00 0.00 ? 95  ARG A C    4  
ATOM 6575  O O    . ARG A 1 95  ? -5.282  -8.614  -7.828  1.00 0.00 ? 95  ARG A O    4  
ATOM 6576  C CB   . ARG A 1 95  ? -7.675  -6.962  -7.941  1.00 0.00 ? 95  ARG A CB   4  
ATOM 6577  C CG   . ARG A 1 95  ? -8.932  -7.520  -7.292  1.00 0.00 ? 95  ARG A CG   4  
ATOM 6578  C CD   . ARG A 1 95  ? -8.933  -9.040  -7.296  1.00 0.00 ? 95  ARG A CD   4  
ATOM 6579  N NE   . ARG A 1 95  ? -8.309  -9.592  -6.097  1.00 0.00 ? 95  ARG A NE   4  
ATOM 6580  C CZ   . ARG A 1 95  ? -8.296  -10.887 -5.804  1.00 0.00 ? 95  ARG A CZ   4  
ATOM 6581  N NH1  . ARG A 1 95  ? -8.870  -11.760 -6.620  1.00 0.00 ? 95  ARG A NH1  4  
ATOM 6582  N NH2  . ARG A 1 95  ? -7.707  -11.312 -4.693  1.00 0.00 ? 95  ARG A NH2  4  
ATOM 6583  H H    . ARG A 1 95  ? -5.150  -5.740  -8.216  1.00 0.00 ? 95  ARG A H    4  
ATOM 6584  H HA   . ARG A 1 95  ? -6.926  -6.495  -5.991  1.00 0.00 ? 95  ARG A HA   4  
ATOM 6585  H HB2  . ARG A 1 95  ? -7.923  -6.015  -8.398  1.00 0.00 ? 95  ARG A HB2  4  
ATOM 6586  H HB3  . ARG A 1 95  ? -7.356  -7.651  -8.708  1.00 0.00 ? 95  ARG A HB3  4  
ATOM 6587  H HG2  . ARG A 1 95  ? -8.982  -7.174  -6.270  1.00 0.00 ? 95  ARG A HG2  4  
ATOM 6588  H HG3  . ARG A 1 95  ? -9.794  -7.166  -7.837  1.00 0.00 ? 95  ARG A HG3  4  
ATOM 6589  H HD2  . ARG A 1 95  ? -9.954  -9.386  -7.350  1.00 0.00 ? 95  ARG A HD2  4  
ATOM 6590  H HD3  . ARG A 1 95  ? -8.391  -9.385  -8.164  1.00 0.00 ? 95  ARG A HD3  4  
ATOM 6591  H HE   . ARG A 1 95  ? -7.879  -8.964  -5.480  1.00 0.00 ? 95  ARG A HE   4  
ATOM 6592  H HH11 . ARG A 1 95  ? -9.313  -11.443 -7.459  1.00 0.00 ? 95  ARG A HH11 4  
ATOM 6593  H HH12 . ARG A 1 95  ? -8.858  -12.736 -6.398  1.00 0.00 ? 95  ARG A HH12 4  
ATOM 6594  H HH21 . ARG A 1 95  ? -7.273  -10.657 -4.076  1.00 0.00 ? 95  ARG A HH21 4  
ATOM 6595  H HH22 . ARG A 1 95  ? -7.698  -12.287 -4.474  1.00 0.00 ? 95  ARG A HH22 4  
ATOM 6596  N N    . GLY A 1 96  ? -5.490  -8.469  -5.593  1.00 0.00 ? 96  GLY A N    4  
ATOM 6597  C CA   . GLY A 1 96  ? -4.726  -9.680  -5.356  1.00 0.00 ? 96  GLY A CA   4  
ATOM 6598  C C    . GLY A 1 96  ? -4.791  -10.133 -3.910  1.00 0.00 ? 96  GLY A C    4  
ATOM 6599  O O    . GLY A 1 96  ? -5.819  -9.980  -3.250  1.00 0.00 ? 96  GLY A O    4  
ATOM 6600  H H    . GLY A 1 96  ? -5.853  -7.965  -4.834  1.00 0.00 ? 96  GLY A H    4  
ATOM 6601  H HA2  . GLY A 1 96  ? -5.114  -10.466 -5.986  1.00 0.00 ? 96  GLY A HA2  4  
ATOM 6602  H HA3  . GLY A 1 96  ? -3.694  -9.498  -5.618  1.00 0.00 ? 96  GLY A HA3  4  
ATOM 6603  N N    . TYR A 1 97  ? -3.691  -10.692 -3.418  1.00 0.00 ? 97  TYR A N    4  
ATOM 6604  C CA   . TYR A 1 97  ? -3.628  -11.172 -2.043  1.00 0.00 ? 97  TYR A CA   4  
ATOM 6605  C C    . TYR A 1 97  ? -2.183  -11.258 -1.561  1.00 0.00 ? 97  TYR A C    4  
ATOM 6606  O O    . TYR A 1 97  ? -1.249  -11.284 -2.364  1.00 0.00 ? 97  TYR A O    4  
ATOM 6607  C CB   . TYR A 1 97  ? -4.298  -12.543 -1.928  1.00 0.00 ? 97  TYR A CB   4  
ATOM 6608  C CG   . TYR A 1 97  ? -3.669  -13.600 -2.808  1.00 0.00 ? 97  TYR A CG   4  
ATOM 6609  C CD1  . TYR A 1 97  ? -2.357  -14.009 -2.606  1.00 0.00 ? 97  TYR A CD1  4  
ATOM 6610  C CD2  . TYR A 1 97  ? -4.387  -14.188 -3.842  1.00 0.00 ? 97  TYR A CD2  4  
ATOM 6611  C CE1  . TYR A 1 97  ? -1.778  -14.973 -3.408  1.00 0.00 ? 97  TYR A CE1  4  
ATOM 6612  C CE2  . TYR A 1 97  ? -3.817  -15.154 -4.648  1.00 0.00 ? 97  TYR A CE2  4  
ATOM 6613  C CZ   . TYR A 1 97  ? -2.512  -15.543 -4.427  1.00 0.00 ? 97  TYR A CZ   4  
ATOM 6614  O OH   . TYR A 1 97  ? -1.940  -16.504 -5.229  1.00 0.00 ? 97  TYR A OH   4  
ATOM 6615  H H    . TYR A 1 97  ? -2.903  -10.786 -3.993  1.00 0.00 ? 97  TYR A H    4  
ATOM 6616  H HA   . TYR A 1 97  ? -4.162  -10.469 -1.421  1.00 0.00 ? 97  TYR A HA   4  
ATOM 6617  H HB2  . TYR A 1 97  ? -4.234  -12.883 -0.906  1.00 0.00 ? 97  TYR A HB2  4  
ATOM 6618  H HB3  . TYR A 1 97  ? -5.337  -12.453 -2.208  1.00 0.00 ? 97  TYR A HB3  4  
ATOM 6619  H HD1  . TYR A 1 97  ? -1.784  -13.561 -1.807  1.00 0.00 ? 97  TYR A HD1  4  
ATOM 6620  H HD2  . TYR A 1 97  ? -5.409  -13.880 -4.012  1.00 0.00 ? 97  TYR A HD2  4  
ATOM 6621  H HE1  . TYR A 1 97  ? -0.756  -15.279 -3.235  1.00 0.00 ? 97  TYR A HE1  4  
ATOM 6622  H HE2  . TYR A 1 97  ? -4.391  -15.600 -5.446  1.00 0.00 ? 97  TYR A HE2  4  
ATOM 6623  H HH   . TYR A 1 97  ? -1.456  -17.129 -4.683  1.00 0.00 ? 97  TYR A HH   4  
ATOM 6624  N N    . LEU A 1 98  ? -2.007  -11.302 -0.245  1.00 0.00 ? 98  LEU A N    4  
ATOM 6625  C CA   . LEU A 1 98  ? -0.676  -11.386 0.346   1.00 0.00 ? 98  LEU A CA   4  
ATOM 6626  C C    . LEU A 1 98  ? -0.056  -12.758 0.102   1.00 0.00 ? 98  LEU A C    4  
ATOM 6627  O O    . LEU A 1 98  ? -0.550  -13.770 0.599   1.00 0.00 ? 98  LEU A O    4  
ATOM 6628  C CB   . LEU A 1 98  ? -0.745  -11.105 1.848   1.00 0.00 ? 98  LEU A CB   4  
ATOM 6629  C CG   . LEU A 1 98  ? 0.546   -10.608 2.498   1.00 0.00 ? 98  LEU A CG   4  
ATOM 6630  C CD1  . LEU A 1 98  ? 0.920   -9.235  1.962   1.00 0.00 ? 98  LEU A CD1  4  
ATOM 6631  C CD2  . LEU A 1 98  ? 0.401   -10.569 4.013   1.00 0.00 ? 98  LEU A CD2  4  
ATOM 6632  H H    . LEU A 1 98  ? -2.789  -11.278 0.344   1.00 0.00 ? 98  LEU A H    4  
ATOM 6633  H HA   . LEU A 1 98  ? -0.057  -10.636 -0.124  1.00 0.00 ? 98  LEU A HA   4  
ATOM 6634  H HB2  . LEU A 1 98  ? -1.506  -10.357 2.010   1.00 0.00 ? 98  LEU A HB2  4  
ATOM 6635  H HB3  . LEU A 1 98  ? -1.034  -12.022 2.342   1.00 0.00 ? 98  LEU A HB3  4  
ATOM 6636  H HG   . LEU A 1 98  ? 1.350   -11.290 2.256   1.00 0.00 ? 98  LEU A HG   4  
ATOM 6637  H HD11 . LEU A 1 98  ? 0.588   -8.476  2.653   1.00 0.00 ? 98  LEU A HD11 4  
ATOM 6638  H HD12 . LEU A 1 98  ? 0.445   -9.082  1.004   1.00 0.00 ? 98  LEU A HD12 4  
ATOM 6639  H HD13 . LEU A 1 98  ? 1.992   -9.173  1.845   1.00 0.00 ? 98  LEU A HD13 4  
ATOM 6640  H HD21 . LEU A 1 98  ? 0.856   -9.668  4.395   1.00 0.00 ? 98  LEU A HD21 4  
ATOM 6641  H HD22 . LEU A 1 98  ? 0.890   -11.430 4.443   1.00 0.00 ? 98  LEU A HD22 4  
ATOM 6642  H HD23 . LEU A 1 98  ? -0.648  -10.582 4.274   1.00 0.00 ? 98  LEU A HD23 4  
ATOM 6643  N N    . ILE A 1 99  ? 1.028   -12.784 -0.666  1.00 0.00 ? 99  ILE A N    4  
ATOM 6644  C CA   . ILE A 1 99  ? 1.716   -14.031 -0.973  1.00 0.00 ? 99  ILE A CA   4  
ATOM 6645  C C    . ILE A 1 99  ? 2.151   -14.747 0.301   1.00 0.00 ? 99  ILE A C    4  
ATOM 6646  O O    . ILE A 1 99  ? 1.814   -15.911 0.519   1.00 0.00 ? 99  ILE A O    4  
ATOM 6647  C CB   . ILE A 1 99  ? 2.952   -13.788 -1.859  1.00 0.00 ? 99  ILE A CB   4  
ATOM 6648  C CG1  . ILE A 1 99  ? 2.560   -13.012 -3.118  1.00 0.00 ? 99  ILE A CG1  4  
ATOM 6649  C CG2  . ILE A 1 99  ? 3.607   -15.111 -2.229  1.00 0.00 ? 99  ILE A CG2  4  
ATOM 6650  C CD1  . ILE A 1 99  ? 3.743   -12.451 -3.876  1.00 0.00 ? 99  ILE A CD1  4  
ATOM 6651  H H    . ILE A 1 99  ? 1.374   -11.944 -1.033  1.00 0.00 ? 99  ILE A H    4  
ATOM 6652  H HA   . ILE A 1 99  ? 1.029   -14.666 -1.514  1.00 0.00 ? 99  ILE A HA   4  
ATOM 6653  H HB   . ILE A 1 99  ? 3.665   -13.208 -1.294  1.00 0.00 ? 99  ILE A HB   4  
ATOM 6654  H HG12 . ILE A 1 99  ? 2.020   -13.666 -3.784  1.00 0.00 ? 99  ILE A HG12 4  
ATOM 6655  H HG13 . ILE A 1 99  ? 1.923   -12.185 -2.837  1.00 0.00 ? 99  ILE A HG13 4  
ATOM 6656  H HG21 . ILE A 1 99  ? 4.389   -15.336 -1.520  1.00 0.00 ? 99  ILE A HG21 4  
ATOM 6657  H HG22 . ILE A 1 99  ? 2.866   -15.897 -2.209  1.00 0.00 ? 99  ILE A HG22 4  
ATOM 6658  H HG23 . ILE A 1 99  ? 4.029   -15.039 -3.220  1.00 0.00 ? 99  ILE A HG23 4  
ATOM 6659  H HD11 . ILE A 1 99  ? 3.497   -11.469 -4.252  1.00 0.00 ? 99  ILE A HD11 4  
ATOM 6660  H HD12 . ILE A 1 99  ? 4.593   -12.378 -3.214  1.00 0.00 ? 99  ILE A HD12 4  
ATOM 6661  H HD13 . ILE A 1 99  ? 3.984   -13.103 -4.702  1.00 0.00 ? 99  ILE A HD13 4  
ATOM 6662  N N    . LYS A 1 100 ? 2.901   -14.043 1.142   1.00 0.00 ? 100 LYS A N    4  
ATOM 6663  C CA   . LYS A 1 100 ? 3.381   -14.609 2.398   1.00 0.00 ? 100 LYS A CA   4  
ATOM 6664  C C    . LYS A 1 100 ? 2.218   -15.121 3.243   1.00 0.00 ? 100 LYS A C    4  
ATOM 6665  O O    . LYS A 1 100 ? 2.368   -16.071 4.012   1.00 0.00 ? 100 LYS A O    4  
ATOM 6666  C CB   . LYS A 1 100 ? 4.174   -13.563 3.183   1.00 0.00 ? 100 LYS A CB   4  
ATOM 6667  C CG   . LYS A 1 100 ? 3.466   -12.224 3.300   1.00 0.00 ? 100 LYS A CG   4  
ATOM 6668  C CD   . LYS A 1 100 ? 4.302   -11.216 4.070   1.00 0.00 ? 100 LYS A CD   4  
ATOM 6669  C CE   . LYS A 1 100 ? 5.228   -10.438 3.148   1.00 0.00 ? 100 LYS A CE   4  
ATOM 6670  N NZ   . LYS A 1 100 ? 6.544   -11.115 2.984   1.00 0.00 ? 100 LYS A NZ   4  
ATOM 6671  H H    . LYS A 1 100 ? 3.137   -13.120 0.913   1.00 0.00 ? 100 LYS A H    4  
ATOM 6672  H HA   . LYS A 1 100 ? 4.030   -15.438 2.161   1.00 0.00 ? 100 LYS A HA   4  
ATOM 6673  H HB2  . LYS A 1 100 ? 4.356   -13.938 4.179   1.00 0.00 ? 100 LYS A HB2  4  
ATOM 6674  H HB3  . LYS A 1 100 ? 5.122   -13.403 2.689   1.00 0.00 ? 100 LYS A HB3  4  
ATOM 6675  H HG2  . LYS A 1 100 ? 3.280   -11.838 2.308   1.00 0.00 ? 100 LYS A HG2  4  
ATOM 6676  H HG3  . LYS A 1 100 ? 2.527   -12.368 3.814   1.00 0.00 ? 100 LYS A HG3  4  
ATOM 6677  H HD2  . LYS A 1 100 ? 3.643   -10.521 4.570   1.00 0.00 ? 100 LYS A HD2  4  
ATOM 6678  H HD3  . LYS A 1 100 ? 4.897   -11.742 4.804   1.00 0.00 ? 100 LYS A HD3  4  
ATOM 6679  H HE2  . LYS A 1 100 ? 4.757   -10.346 2.181   1.00 0.00 ? 100 LYS A HE2  4  
ATOM 6680  H HE3  . LYS A 1 100 ? 5.387   -9.455  3.566   1.00 0.00 ? 100 LYS A HE3  4  
ATOM 6681  H HZ1  . LYS A 1 100 ? 6.706   -11.778 3.769   1.00 0.00 ? 100 LYS A HZ1  4  
ATOM 6682  H HZ2  . LYS A 1 100 ? 7.309   -10.410 2.976   1.00 0.00 ? 100 LYS A HZ2  4  
ATOM 6683  H HZ3  . LYS A 1 100 ? 6.566   -11.643 2.089   1.00 0.00 ? 100 LYS A HZ3  4  
ATOM 6684  N N    . HIS A 1 101 ? 1.060   -14.485 3.095   1.00 0.00 ? 101 HIS A N    4  
ATOM 6685  C CA   . HIS A 1 101 ? -0.128  -14.878 3.844   1.00 0.00 ? 101 HIS A CA   4  
ATOM 6686  C C    . HIS A 1 101 ? -1.352  -14.928 2.934   1.00 0.00 ? 101 HIS A C    4  
ATOM 6687  O O    . HIS A 1 101 ? -2.058  -13.933 2.770   1.00 0.00 ? 101 HIS A O    4  
ATOM 6688  C CB   . HIS A 1 101 ? -0.375  -13.904 4.996   1.00 0.00 ? 101 HIS A CB   4  
ATOM 6689  C CG   . HIS A 1 101 ? 0.709   -13.912 6.030   1.00 0.00 ? 101 HIS A CG   4  
ATOM 6690  N ND1  . HIS A 1 101 ? 1.179   -15.066 6.619   1.00 0.00 ? 101 HIS A ND1  4  
ATOM 6691  C CD2  . HIS A 1 101 ? 1.417   -12.897 6.577   1.00 0.00 ? 101 HIS A CD2  4  
ATOM 6692  C CE1  . HIS A 1 101 ? 2.128   -14.761 7.485   1.00 0.00 ? 101 HIS A CE1  4  
ATOM 6693  N NE2  . HIS A 1 101 ? 2.292   -13.451 7.479   1.00 0.00 ? 101 HIS A NE2  4  
ATOM 6694  H H    . HIS A 1 101 ? 1.004   -13.735 2.467   1.00 0.00 ? 101 HIS A H    4  
ATOM 6695  H HA   . HIS A 1 101 ? 0.045   -15.864 4.248   1.00 0.00 ? 101 HIS A HA   4  
ATOM 6696  H HB2  . HIS A 1 101 ? -0.450  -12.901 4.602   1.00 0.00 ? 101 HIS A HB2  4  
ATOM 6697  H HB3  . HIS A 1 101 ? -1.303  -14.163 5.486   1.00 0.00 ? 101 HIS A HB3  4  
ATOM 6698  H HD1  . HIS A 1 101 ? 0.863   -15.974 6.431   1.00 0.00 ? 101 HIS A HD1  4  
ATOM 6699  H HD2  . HIS A 1 101 ? 1.314   -11.845 6.348   1.00 0.00 ? 101 HIS A HD2  4  
ATOM 6700  H HE1  . HIS A 1 101 ? 2.677   -15.463 8.095   1.00 0.00 ? 101 HIS A HE1  4  
ATOM 6701  H HE2  . HIS A 1 101 ? 2.873   -12.952 8.090   1.00 0.00 ? 101 HIS A HE2  4  
ATOM 6702  N N    . LYS A 1 102 ? -1.597  -16.093 2.343   1.00 0.00 ? 102 LYS A N    4  
ATOM 6703  C CA   . LYS A 1 102 ? -2.734  -16.274 1.449   1.00 0.00 ? 102 LYS A CA   4  
ATOM 6704  C C    . LYS A 1 102 ? -4.046  -16.245 2.227   1.00 0.00 ? 102 LYS A C    4  
ATOM 6705  O O    . LYS A 1 102 ? -5.125  -16.369 1.647   1.00 0.00 ? 102 LYS A O    4  
ATOM 6706  C CB   . LYS A 1 102 ? -2.608  -17.597 0.691   1.00 0.00 ? 102 LYS A CB   4  
ATOM 6707  C CG   . LYS A 1 102 ? -1.268  -17.775 -0.003  1.00 0.00 ? 102 LYS A CG   4  
ATOM 6708  C CD   . LYS A 1 102 ? -1.294  -17.216 -1.416  1.00 0.00 ? 102 LYS A CD   4  
ATOM 6709  C CE   . LYS A 1 102 ? -0.135  -17.746 -2.246  1.00 0.00 ? 102 LYS A CE   4  
ATOM 6710  N NZ   . LYS A 1 102 ? -0.294  -19.193 -2.560  1.00 0.00 ? 102 LYS A NZ   4  
ATOM 6711  H H    . LYS A 1 102 ? -0.997  -16.850 2.513   1.00 0.00 ? 102 LYS A H    4  
ATOM 6712  H HA   . LYS A 1 102 ? -2.732  -15.460 0.740   1.00 0.00 ? 102 LYS A HA   4  
ATOM 6713  H HB2  . LYS A 1 102 ? -2.739  -18.412 1.388   1.00 0.00 ? 102 LYS A HB2  4  
ATOM 6714  H HB3  . LYS A 1 102 ? -3.386  -17.645 -0.057  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 6715  H HG2  . LYS A 1 102 ? -0.508  -17.257 0.563   1.00 0.00 ? 102 LYS A HG2  4  
ATOM 6716  H HG3  . LYS A 1 102 ? -1.033  -18.828 -0.047  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 6717  H HD2  . LYS A 1 102 ? -2.221  -17.501 -1.890  1.00 0.00 ? 102 LYS A HD2  4  
ATOM 6718  H HD3  . LYS A 1 102 ? -1.228  -16.138 -1.368  1.00 0.00 ? 102 LYS A HD3  4  
ATOM 6719  H HE2  . LYS A 1 102 ? -0.086  -17.189 -3.169  1.00 0.00 ? 102 LYS A HE2  4  
ATOM 6720  H HE3  . LYS A 1 102 ? 0.782   -17.605 -1.692  1.00 0.00 ? 102 LYS A HE3  4  
ATOM 6721  H HZ1  . LYS A 1 102 ? 0.639   -19.638 -2.677  1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 6722  H HZ2  . LYS A 1 102 ? -0.835  -19.309 -3.441  1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 6723  H HZ3  . LYS A 1 102 ? -0.801  -19.672 -1.789  1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 6724  N N    . MET A 1 103 ? -3.947  -16.080 3.542   1.00 0.00 ? 103 MET A N    4  
ATOM 6725  C CA   . MET A 1 103 ? -5.127  -16.032 4.397   1.00 0.00 ? 103 MET A CA   4  
ATOM 6726  C C    . MET A 1 103 ? -5.765  -14.647 4.366   1.00 0.00 ? 103 MET A C    4  
ATOM 6727  O O    . MET A 1 103 ? -6.728  -14.380 5.086   1.00 0.00 ? 103 MET A O    4  
ATOM 6728  C CB   . MET A 1 103 ? -4.756  -16.403 5.834   1.00 0.00 ? 103 MET A CB   4  
ATOM 6729  C CG   . MET A 1 103 ? -4.818  -17.897 6.111   1.00 0.00 ? 103 MET A CG   4  
ATOM 6730  S SD   . MET A 1 103 ? -6.447  -18.597 5.784   1.00 0.00 ? 103 MET A SD   4  
ATOM 6731  C CE   . MET A 1 103 ? -7.506  -17.320 6.457   1.00 0.00 ? 103 MET A CE   4  
ATOM 6732  H H    . MET A 1 103 ? -3.059  -15.987 3.947   1.00 0.00 ? 103 MET A H    4  
ATOM 6733  H HA   . MET A 1 103 ? -5.838  -16.752 4.021   1.00 0.00 ? 103 MET A HA   4  
ATOM 6734  H HB2  . MET A 1 103 ? -3.751  -16.063 6.034   1.00 0.00 ? 103 MET A HB2  4  
ATOM 6735  H HB3  . MET A 1 103 ? -5.436  -15.906 6.509   1.00 0.00 ? 103 MET A HB3  4  
ATOM 6736  H HG2  . MET A 1 103 ? -4.095  -18.396 5.484   1.00 0.00 ? 103 MET A HG2  4  
ATOM 6737  H HG3  . MET A 1 103 ? -4.570  -18.066 7.149   1.00 0.00 ? 103 MET A HG3  4  
ATOM 6738  H HE1  . MET A 1 103 ? -7.300  -16.382 5.961   1.00 0.00 ? 103 MET A HE1  4  
ATOM 6739  H HE2  . MET A 1 103 ? -8.540  -17.590 6.301   1.00 0.00 ? 103 MET A HE2  4  
ATOM 6740  H HE3  . MET A 1 103 ? -7.317  -17.216 7.515   1.00 0.00 ? 103 MET A HE3  4  
ATOM 6741  N N    . LEU A 1 104 ? -5.222  -13.769 3.529   1.00 0.00 ? 104 LEU A N    4  
ATOM 6742  C CA   . LEU A 1 104 ? -5.739  -12.411 3.405   1.00 0.00 ? 104 LEU A CA   4  
ATOM 6743  C C    . LEU A 1 104 ? -5.824  -11.993 1.940   1.00 0.00 ? 104 LEU A C    4  
ATOM 6744  O O    . LEU A 1 104 ? -4.807  -11.893 1.254   1.00 0.00 ? 104 LEU A O    4  
ATOM 6745  C CB   . LEU A 1 104 ? -4.850  -11.433 4.176   1.00 0.00 ? 104 LEU A CB   4  
ATOM 6746  C CG   . LEU A 1 104 ? -4.469  -11.850 5.597   1.00 0.00 ? 104 LEU A CG   4  
ATOM 6747  C CD1  . LEU A 1 104 ? -3.184  -12.663 5.588   1.00 0.00 ? 104 LEU A CD1  4  
ATOM 6748  C CD2  . LEU A 1 104 ? -4.323  -10.627 6.490   1.00 0.00 ? 104 LEU A CD2  4  
ATOM 6749  H H    . LEU A 1 104 ? -4.457  -14.040 2.982   1.00 0.00 ? 104 LEU A H    4  
ATOM 6750  H HA   . LEU A 1 104 ? -6.732  -12.394 3.829   1.00 0.00 ? 104 LEU A HA   4  
ATOM 6751  H HB2  . LEU A 1 104 ? -3.938  -11.302 3.614   1.00 0.00 ? 104 LEU A HB2  4  
ATOM 6752  H HB3  . LEU A 1 104 ? -5.373  -10.489 4.235   1.00 0.00 ? 104 LEU A HB3  4  
ATOM 6753  H HG   . LEU A 1 104 ? -5.254  -12.472 6.005   1.00 0.00 ? 104 LEU A HG   4  
ATOM 6754  H HD11 . LEU A 1 104 ? -3.379  -13.649 5.981   1.00 0.00 ? 104 LEU A HD11 4  
ATOM 6755  H HD12 . LEU A 1 104 ? -2.443  -12.171 6.201   1.00 0.00 ? 104 LEU A HD12 4  
ATOM 6756  H HD13 . LEU A 1 104 ? -2.816  -12.743 4.575   1.00 0.00 ? 104 LEU A HD13 4  
ATOM 6757  H HD21 . LEU A 1 104 ? -3.276  -10.401 6.623   1.00 0.00 ? 104 LEU A HD21 4  
ATOM 6758  H HD22 . LEU A 1 104 ? -4.774  -10.827 7.451   1.00 0.00 ? 104 LEU A HD22 4  
ATOM 6759  H HD23 . LEU A 1 104 ? -4.818  -9.784  6.029   1.00 0.00 ? 104 LEU A HD23 4  
ATOM 6760  N N    . GLN A 1 105 ? -7.042  -11.748 1.469   1.00 0.00 ? 105 GLN A N    4  
ATOM 6761  C CA   . GLN A 1 105 ? -7.259  -11.339 0.087   1.00 0.00 ? 105 GLN A CA   4  
ATOM 6762  C C    . GLN A 1 105 ? -8.154  -10.106 0.017   1.00 0.00 ? 105 GLN A C    4  
ATOM 6763  O O    . GLN A 1 105 ? -9.009  -9.898  0.877   1.00 0.00 ? 105 GLN A O    4  
ATOM 6764  C CB   . GLN A 1 105 ? -7.883  -12.483 -0.714  1.00 0.00 ? 105 GLN A CB   4  
ATOM 6765  C CG   . GLN A 1 105 ? -7.162  -13.810 -0.543  1.00 0.00 ? 105 GLN A CG   4  
ATOM 6766  C CD   . GLN A 1 105 ? -7.770  -14.917 -1.382  1.00 0.00 ? 105 GLN A CD   4  
ATOM 6767  O OE1  . GLN A 1 105 ? -8.301  -15.893 -0.851  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 6768  N NE2  . GLN A 1 105 ? -7.697  -14.770 -2.699  1.00 0.00 ? 105 GLN A NE2  4  
ATOM 6769  H H    . GLN A 1 105 ? -7.814  -11.845 2.065   1.00 0.00 ? 105 GLN A H    4  
ATOM 6770  H HA   . GLN A 1 105 ? -6.298  -11.095 -0.341  1.00 0.00 ? 105 GLN A HA   4  
ATOM 6771  H HB2  . GLN A 1 105 ? -8.908  -12.611 -0.397  1.00 0.00 ? 105 GLN A HB2  4  
ATOM 6772  H HB3  . GLN A 1 105 ? -7.869  -12.222 -1.762  1.00 0.00 ? 105 GLN A HB3  4  
ATOM 6773  H HG2  . GLN A 1 105 ? -6.130  -13.684 -0.835  1.00 0.00 ? 105 GLN A HG2  4  
ATOM 6774  H HG3  . GLN A 1 105 ? -7.208  -14.098 0.496   1.00 0.00 ? 105 GLN A HG3  4  
ATOM 6775  H HE21 . GLN A 1 105 ? -7.259  -13.967 -3.052  1.00 0.00 ? 105 GLN A HE21 4  
ATOM 6776  H HE22 . GLN A 1 105 ? -8.081  -15.471 -3.265  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 6777  N N    . GLY A 1 106 ? -7.949  -9.289  -1.012  1.00 0.00 ? 106 GLY A N    4  
ATOM 6778  C CA   . GLY A 1 106 ? -8.745  -8.086  -1.174  1.00 0.00 ? 106 GLY A CA   4  
ATOM 6779  C C    . GLY A 1 106 ? -8.148  -7.128  -2.185  1.00 0.00 ? 106 GLY A C    4  
ATOM 6780  O O    . GLY A 1 106 ? -7.606  -7.552  -3.207  1.00 0.00 ? 106 GLY A O    4  
ATOM 6781  H H    . GLY A 1 106 ? -7.253  -9.505  -1.667  1.00 0.00 ? 106 GLY A H    4  
ATOM 6782  H HA2  . GLY A 1 106 ? -9.736  -8.365  -1.499  1.00 0.00 ? 106 GLY A HA2  4  
ATOM 6783  H HA3  . GLY A 1 106 ? -8.817  -7.585  -0.220  1.00 0.00 ? 106 GLY A HA3  4  
ATOM 6784  N N    . ILE A 1 107 ? -8.249  -5.834  -1.903  1.00 0.00 ? 107 ILE A N    4  
ATOM 6785  C CA   . ILE A 1 107 ? -7.715  -4.813  -2.797  1.00 0.00 ? 107 ILE A CA   4  
ATOM 6786  C C    . ILE A 1 107 ? -6.936  -3.756  -2.021  1.00 0.00 ? 107 ILE A C    4  
ATOM 6787  O O    . ILE A 1 107 ? -7.046  -3.661  -0.798  1.00 0.00 ? 107 ILE A O    4  
ATOM 6788  C CB   . ILE A 1 107 ? -8.835  -4.125  -3.598  1.00 0.00 ? 107 ILE A CB   4  
ATOM 6789  C CG1  . ILE A 1 107 ? -9.938  -3.635  -2.657  1.00 0.00 ? 107 ILE A CG1  4  
ATOM 6790  C CG2  . ILE A 1 107 ? -9.405  -5.077  -4.639  1.00 0.00 ? 107 ILE A CG2  4  
ATOM 6791  C CD1  . ILE A 1 107 ? -10.893 -2.656  -3.303  1.00 0.00 ? 107 ILE A CD1  4  
ATOM 6792  H H    . ILE A 1 107 ? -8.692  -5.559  -1.074  1.00 0.00 ? 107 ILE A H    4  
ATOM 6793  H HA   . ILE A 1 107 ? -7.047  -5.298  -3.494  1.00 0.00 ? 107 ILE A HA   4  
ATOM 6794  H HB   . ILE A 1 107 ? -8.410  -3.278  -4.114  1.00 0.00 ? 107 ILE A HB   4  
ATOM 6795  H HG12 . ILE A 1 107 ? -10.513 -4.480  -2.314  1.00 0.00 ? 107 ILE A HG12 4  
ATOM 6796  H HG13 . ILE A 1 107 ? -9.484  -3.145  -1.807  1.00 0.00 ? 107 ILE A HG13 4  
ATOM 6797  H HG21 . ILE A 1 107 ? -10.083 -4.540  -5.285  1.00 0.00 ? 107 ILE A HG21 4  
ATOM 6798  H HG22 . ILE A 1 107 ? -8.599  -5.489  -5.228  1.00 0.00 ? 107 ILE A HG22 4  
ATOM 6799  H HG23 . ILE A 1 107 ? -9.935  -5.876  -4.144  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 6800  H HD11 . ILE A 1 107 ? -11.440 -2.126  -2.536  1.00 0.00 ? 107 ILE A HD11 4  
ATOM 6801  H HD12 . ILE A 1 107 ? -10.336 -1.948  -3.899  1.00 0.00 ? 107 ILE A HD12 4  
ATOM 6802  H HD13 . ILE A 1 107 ? -11.586 -3.191  -3.934  1.00 0.00 ? 107 ILE A HD13 4  
ATOM 6803  N N    . PHE A 1 108 ? -6.150  -2.962  -2.740  1.00 0.00 ? 108 PHE A N    4  
ATOM 6804  C CA   . PHE A 1 108 ? -5.353  -1.910  -2.120  1.00 0.00 ? 108 PHE A CA   4  
ATOM 6805  C C    . PHE A 1 108 ? -4.964  -0.847  -3.143  1.00 0.00 ? 108 PHE A C    4  
ATOM 6806  O O    . PHE A 1 108 ? -4.995  -1.074  -4.353  1.00 0.00 ? 108 PHE A O    4  
ATOM 6807  C CB   . PHE A 1 108 ? -4.096  -2.503  -1.480  1.00 0.00 ? 108 PHE A CB   4  
ATOM 6808  C CG   . PHE A 1 108 ? -3.591  -3.733  -2.180  1.00 0.00 ? 108 PHE A CG   4  
ATOM 6809  C CD1  . PHE A 1 108 ? -2.704  -3.628  -3.239  1.00 0.00 ? 108 PHE A CD1  4  
ATOM 6810  C CD2  . PHE A 1 108 ? -4.003  -4.993  -1.779  1.00 0.00 ? 108 PHE A CD2  4  
ATOM 6811  C CE1  . PHE A 1 108 ? -2.237  -4.757  -3.885  1.00 0.00 ? 108 PHE A CE1  4  
ATOM 6812  C CE2  . PHE A 1 108 ? -3.539  -6.126  -2.420  1.00 0.00 ? 108 PHE A CE2  4  
ATOM 6813  C CZ   . PHE A 1 108 ? -2.656  -6.007  -3.476  1.00 0.00 ? 108 PHE A CZ   4  
ATOM 6814  H H    . PHE A 1 108 ? -6.105  -3.087  -3.712  1.00 0.00 ? 108 PHE A H    4  
ATOM 6815  H HA   . PHE A 1 108 ? -5.955  -1.449  -1.351  1.00 0.00 ? 108 PHE A HA   4  
ATOM 6816  H HB2  . PHE A 1 108 ? -3.309  -1.765  -1.499  1.00 0.00 ? 108 PHE A HB2  4  
ATOM 6817  H HB3  . PHE A 1 108 ? -4.313  -2.768  -0.457  1.00 0.00 ? 108 PHE A HB3  4  
ATOM 6818  H HD1  . PHE A 1 108 ? -2.376  -2.649  -3.561  1.00 0.00 ? 108 PHE A HD1  4  
ATOM 6819  H HD2  . PHE A 1 108 ? -4.695  -5.087  -0.954  1.00 0.00 ? 108 PHE A HD2  4  
ATOM 6820  H HE1  . PHE A 1 108 ? -1.546  -4.661  -4.710  1.00 0.00 ? 108 PHE A HE1  4  
ATOM 6821  H HE2  . PHE A 1 108 ? -3.868  -7.102  -2.098  1.00 0.00 ? 108 PHE A HE2  4  
ATOM 6822  H HZ   . PHE A 1 108 ? -2.291  -6.891  -3.978  1.00 0.00 ? 108 PHE A HZ   4  
ATOM 6823  N N    . PRO A 1 109 ? -4.589  0.341   -2.648  1.00 0.00 ? 109 PRO A N    4  
ATOM 6824  C CA   . PRO A 1 109 ? -4.187  1.463   -3.502  1.00 0.00 ? 109 PRO A CA   4  
ATOM 6825  C C    . PRO A 1 109 ? -2.848  1.217   -4.189  1.00 0.00 ? 109 PRO A C    4  
ATOM 6826  O O    . PRO A 1 109 ? -1.841  0.949   -3.533  1.00 0.00 ? 109 PRO A O    4  
ATOM 6827  C CB   . PRO A 1 109 ? -4.078  2.633   -2.521  1.00 0.00 ? 109 PRO A CB   4  
ATOM 6828  C CG   . PRO A 1 109 ? -3.802  1.998   -1.202  1.00 0.00 ? 109 PRO A CG   4  
ATOM 6829  C CD   . PRO A 1 109 ? -4.529  0.682   -1.217  1.00 0.00 ? 109 PRO A CD   4  
ATOM 6830  H HA   . PRO A 1 109 ? -4.937  1.684   -4.246  1.00 0.00 ? 109 PRO A HA   4  
ATOM 6831  H HB2  . PRO A 1 109 ? -3.270  3.285   -2.823  1.00 0.00 ? 109 PRO A HB2  4  
ATOM 6832  H HB3  . PRO A 1 109 ? -5.006  3.184   -2.508  1.00 0.00 ? 109 PRO A HB3  4  
ATOM 6833  H HG2  . PRO A 1 109 ? -2.741  1.839   -1.085  1.00 0.00 ? 109 PRO A HG2  4  
ATOM 6834  H HG3  . PRO A 1 109 ? -4.179  2.625   -0.407  1.00 0.00 ? 109 PRO A HG3  4  
ATOM 6835  H HD2  . PRO A 1 109 ? -3.973  -0.063  -0.666  1.00 0.00 ? 109 PRO A HD2  4  
ATOM 6836  H HD3  . PRO A 1 109 ? -5.522  0.794   -0.806  1.00 0.00 ? 109 PRO A HD3  4  
ATOM 6837  N N    . LYS A 1 110 ? -2.843  1.311   -5.514  1.00 0.00 ? 110 LYS A N    4  
ATOM 6838  C CA   . LYS A 1 110 ? -1.627  1.101   -6.292  1.00 0.00 ? 110 LYS A CA   4  
ATOM 6839  C C    . LYS A 1 110 ? -0.509  2.022   -5.814  1.00 0.00 ? 110 LYS A C    4  
ATOM 6840  O O    . LYS A 1 110 ? 0.662   1.642   -5.809  1.00 0.00 ? 110 LYS A O    4  
ATOM 6841  C CB   . LYS A 1 110 ? -1.900  1.341   -7.778  1.00 0.00 ? 110 LYS A CB   4  
ATOM 6842  C CG   . LYS A 1 110 ? -2.852  0.330   -8.393  1.00 0.00 ? 110 LYS A CG   4  
ATOM 6843  C CD   . LYS A 1 110 ? -3.382  0.807   -9.735  1.00 0.00 ? 110 LYS A CD   4  
ATOM 6844  C CE   . LYS A 1 110 ? -2.275  0.884   -10.776 1.00 0.00 ? 110 LYS A CE   4  
ATOM 6845  N NZ   . LYS A 1 110 ? -2.719  1.594   -12.007 1.00 0.00 ? 110 LYS A NZ   4  
ATOM 6846  H H    . LYS A 1 110 ? -3.677  1.528   -5.981  1.00 0.00 ? 110 LYS A H    4  
ATOM 6847  H HA   . LYS A 1 110 ? -1.317  0.076   -6.152  1.00 0.00 ? 110 LYS A HA   4  
ATOM 6848  H HB2  . LYS A 1 110 ? -2.327  2.326   -7.899  1.00 0.00 ? 110 LYS A HB2  4  
ATOM 6849  H HB3  . LYS A 1 110 ? -0.964  1.296   -8.316  1.00 0.00 ? 110 LYS A HB3  4  
ATOM 6850  H HG2  . LYS A 1 110 ? -2.329  -0.603  -8.537  1.00 0.00 ? 110 LYS A HG2  4  
ATOM 6851  H HG3  . LYS A 1 110 ? -3.685  0.178   -7.721  1.00 0.00 ? 110 LYS A HG3  4  
ATOM 6852  H HD2  . LYS A 1 110 ? -4.138  0.118   -10.080 1.00 0.00 ? 110 LYS A HD2  4  
ATOM 6853  H HD3  . LYS A 1 110 ? -3.817  1.789   -9.612  1.00 0.00 ? 110 LYS A HD3  4  
ATOM 6854  H HE2  . LYS A 1 110 ? -1.435  1.410   -10.350 1.00 0.00 ? 110 LYS A HE2  4  
ATOM 6855  H HE3  . LYS A 1 110 ? -1.976  -0.120  -11.038 1.00 0.00 ? 110 LYS A HE3  4  
ATOM 6856  H HZ1  . LYS A 1 110 ? -3.412  2.331   -11.764 1.00 0.00 ? 110 LYS A HZ1  4  
ATOM 6857  H HZ2  . LYS A 1 110 ? -3.161  0.922   -12.667 1.00 0.00 ? 110 LYS A HZ2  4  
ATOM 6858  H HZ3  . LYS A 1 110 ? -1.905  2.039   -12.476 1.00 0.00 ? 110 LYS A HZ3  4  
ATOM 6859  N N    . SER A 1 111 ? -0.879  3.234   -5.411  1.00 0.00 ? 111 SER A N    4  
ATOM 6860  C CA   . SER A 1 111 ? 0.094   4.210   -4.933  1.00 0.00 ? 111 SER A CA   4  
ATOM 6861  C C    . SER A 1 111 ? 0.855   3.671   -3.725  1.00 0.00 ? 111 SER A C    4  
ATOM 6862  O O    . SER A 1 111 ? 1.862   4.243   -3.307  1.00 0.00 ? 111 SER A O    4  
ATOM 6863  C CB   . SER A 1 111 ? -0.606  5.520   -4.567  1.00 0.00 ? 111 SER A CB   4  
ATOM 6864  O OG   . SER A 1 111 ? -1.577  5.315   -3.556  1.00 0.00 ? 111 SER A OG   4  
ATOM 6865  H H    . SER A 1 111 ? -1.828  3.477   -5.439  1.00 0.00 ? 111 SER A H    4  
ATOM 6866  H HA   . SER A 1 111 ? 0.796   4.397   -5.732  1.00 0.00 ? 111 SER A HA   4  
ATOM 6867  H HB2  . SER A 1 111 ? 0.126   6.227   -4.208  1.00 0.00 ? 111 SER A HB2  4  
ATOM 6868  H HB3  . SER A 1 111 ? -1.094  5.921   -5.443  1.00 0.00 ? 111 SER A HB3  4  
ATOM 6869  H HG   . SER A 1 111 ? -1.549  6.044   -2.932  1.00 0.00 ? 111 SER A HG   4  
ATOM 6870  N N    . PHE A 1 112 ? 0.366   2.568   -3.169  1.00 0.00 ? 112 PHE A N    4  
ATOM 6871  C CA   . PHE A 1 112 ? 0.998   1.952   -2.009  1.00 0.00 ? 112 PHE A CA   4  
ATOM 6872  C C    . PHE A 1 112 ? 1.837   0.746   -2.423  1.00 0.00 ? 112 PHE A C    4  
ATOM 6873  O O    . PHE A 1 112 ? 2.707   0.296   -1.677  1.00 0.00 ? 112 PHE A O    4  
ATOM 6874  C CB   . PHE A 1 112 ? -0.061  1.525   -0.991  1.00 0.00 ? 112 PHE A CB   4  
ATOM 6875  C CG   . PHE A 1 112 ? -0.610  2.666   -0.183  1.00 0.00 ? 112 PHE A CG   4  
ATOM 6876  C CD1  . PHE A 1 112 ? -1.133  3.786   -0.810  1.00 0.00 ? 112 PHE A CD1  4  
ATOM 6877  C CD2  . PHE A 1 112 ? -0.605  2.619   1.201   1.00 0.00 ? 112 PHE A CD2  4  
ATOM 6878  C CE1  . PHE A 1 112 ? -1.639  4.838   -0.069  1.00 0.00 ? 112 PHE A CE1  4  
ATOM 6879  C CE2  . PHE A 1 112 ? -1.109  3.668   1.947   1.00 0.00 ? 112 PHE A CE2  4  
ATOM 6880  C CZ   . PHE A 1 112 ? -1.628  4.778   1.311   1.00 0.00 ? 112 PHE A CZ   4  
ATOM 6881  H H    . PHE A 1 112 ? -0.440  2.158   -3.549  1.00 0.00 ? 112 PHE A H    4  
ATOM 6882  H HA   . PHE A 1 112 ? 1.646   2.687   -1.556  1.00 0.00 ? 112 PHE A HA   4  
ATOM 6883  H HB2  . PHE A 1 112 ? -0.885  1.061   -1.512  1.00 0.00 ? 112 PHE A HB2  4  
ATOM 6884  H HB3  . PHE A 1 112 ? 0.374   0.812   -0.307  1.00 0.00 ? 112 PHE A HB3  4  
ATOM 6885  H HD1  . PHE A 1 112 ? -1.144  3.834   -1.889  1.00 0.00 ? 112 PHE A HD1  4  
ATOM 6886  H HD2  . PHE A 1 112 ? -0.199  1.750   1.700   1.00 0.00 ? 112 PHE A HD2  4  
ATOM 6887  H HE1  . PHE A 1 112 ? -2.044  5.705   -0.569  1.00 0.00 ? 112 PHE A HE1  4  
ATOM 6888  H HE2  . PHE A 1 112 ? -1.099  3.617   3.026   1.00 0.00 ? 112 PHE A HE2  4  
ATOM 6889  H HZ   . PHE A 1 112 ? -2.022  5.599   1.891   1.00 0.00 ? 112 PHE A HZ   4  
ATOM 6890  N N    . ILE A 1 113 ? 1.568   0.227   -3.616  1.00 0.00 ? 113 ILE A N    4  
ATOM 6891  C CA   . ILE A 1 113 ? 2.297   -0.926  -4.129  1.00 0.00 ? 113 ILE A CA   4  
ATOM 6892  C C    . ILE A 1 113 ? 3.373   -0.498  -5.122  1.00 0.00 ? 113 ILE A C    4  
ATOM 6893  O O    . ILE A 1 113 ? 3.110   0.275   -6.044  1.00 0.00 ? 113 ILE A O    4  
ATOM 6894  C CB   . ILE A 1 113 ? 1.352   -1.930  -4.815  1.00 0.00 ? 113 ILE A CB   4  
ATOM 6895  C CG1  . ILE A 1 113 ? 0.236   -2.350  -3.856  1.00 0.00 ? 113 ILE A CG1  4  
ATOM 6896  C CG2  . ILE A 1 113 ? 2.130   -3.146  -5.296  1.00 0.00 ? 113 ILE A CG2  4  
ATOM 6897  C CD1  . ILE A 1 113 ? 0.741   -3.021  -2.598  1.00 0.00 ? 113 ILE A CD1  4  
ATOM 6898  H H    . ILE A 1 113 ? 0.863   0.630   -4.164  1.00 0.00 ? 113 ILE A H    4  
ATOM 6899  H HA   . ILE A 1 113 ? 2.770   -1.420  -3.293  1.00 0.00 ? 113 ILE A HA   4  
ATOM 6900  H HB   . ILE A 1 113 ? 0.914   -1.449  -5.676  1.00 0.00 ? 113 ILE A HB   4  
ATOM 6901  H HG12 . ILE A 1 113 ? -0.326  -1.478  -3.563  1.00 0.00 ? 113 ILE A HG12 4  
ATOM 6902  H HG13 . ILE A 1 113 ? -0.421  -3.043  -4.362  1.00 0.00 ? 113 ILE A HG13 4  
ATOM 6903  H HG21 . ILE A 1 113 ? 3.181   -2.904  -5.346  1.00 0.00 ? 113 ILE A HG21 4  
ATOM 6904  H HG22 . ILE A 1 113 ? 1.982   -3.963  -4.607  1.00 0.00 ? 113 ILE A HG22 4  
ATOM 6905  H HG23 . ILE A 1 113 ? 1.780   -3.432  -6.277  1.00 0.00 ? 113 ILE A HG23 4  
ATOM 6906  H HD11 . ILE A 1 113 ? 1.789   -3.260  -2.714  1.00 0.00 ? 113 ILE A HD11 4  
ATOM 6907  H HD12 . ILE A 1 113 ? 0.616   -2.354  -1.758  1.00 0.00 ? 113 ILE A HD12 4  
ATOM 6908  H HD13 . ILE A 1 113 ? 0.183   -3.929  -2.425  1.00 0.00 ? 113 ILE A HD13 4  
ATOM 6909  N N    . HIS A 1 114 ? 4.585   -1.008  -4.928  1.00 0.00 ? 114 HIS A N    4  
ATOM 6910  C CA   . HIS A 1 114 ? 5.702   -0.680  -5.808  1.00 0.00 ? 114 HIS A CA   4  
ATOM 6911  C C    . HIS A 1 114 ? 5.946   -1.800  -6.815  1.00 0.00 ? 114 HIS A C    4  
ATOM 6912  O O    . HIS A 1 114 ? 6.451   -2.866  -6.461  1.00 0.00 ? 114 HIS A O    4  
ATOM 6913  C CB   . HIS A 1 114 ? 6.968   -0.430  -4.988  1.00 0.00 ? 114 HIS A CB   4  
ATOM 6914  C CG   . HIS A 1 114 ? 8.154   -0.047  -5.820  1.00 0.00 ? 114 HIS A CG   4  
ATOM 6915  N ND1  . HIS A 1 114 ? 8.211   1.116   -6.557  1.00 0.00 ? 114 HIS A ND1  4  
ATOM 6916  C CD2  . HIS A 1 114 ? 9.332   -0.681  -6.026  1.00 0.00 ? 114 HIS A CD2  4  
ATOM 6917  C CE1  . HIS A 1 114 ? 9.373   1.181   -7.183  1.00 0.00 ? 114 HIS A CE1  4  
ATOM 6918  N NE2  . HIS A 1 114 ? 10.072  0.103   -6.877  1.00 0.00 ? 114 HIS A NE2  4  
ATOM 6919  H H    . HIS A 1 114 ? 4.732   -1.618  -4.176  1.00 0.00 ? 114 HIS A H    4  
ATOM 6920  H HA   . HIS A 1 114 ? 5.447   0.220   -6.345  1.00 0.00 ? 114 HIS A HA   4  
ATOM 6921  H HB2  . HIS A 1 114 ? 6.783   0.370   -4.287  1.00 0.00 ? 114 HIS A HB2  4  
ATOM 6922  H HB3  . HIS A 1 114 ? 7.220   -1.329  -4.444  1.00 0.00 ? 114 HIS A HB3  4  
ATOM 6923  H HD1  . HIS A 1 114 ? 7.505   1.793   -6.615  1.00 0.00 ? 114 HIS A HD1  4  
ATOM 6924  H HD2  . HIS A 1 114 ? 9.634   -1.628  -5.602  1.00 0.00 ? 114 HIS A HD2  4  
ATOM 6925  H HE1  . HIS A 1 114 ? 9.697   1.980   -7.834  1.00 0.00 ? 114 HIS A HE1  4  
ATOM 6926  H HE2  . HIS A 1 114 ? 10.934  -0.142  -7.273  1.00 0.00 ? 114 HIS A HE2  4  
ATOM 6927  N N    . ILE A 1 115 ? 5.584   -1.551  -8.069  1.00 0.00 ? 115 ILE A N    4  
ATOM 6928  C CA   . ILE A 1 115 ? 5.764   -2.539  -9.126  1.00 0.00 ? 115 ILE A CA   4  
ATOM 6929  C C    . ILE A 1 115 ? 7.244   -2.805  -9.383  1.00 0.00 ? 115 ILE A C    4  
ATOM 6930  O O    . ILE A 1 115 ? 7.984   -1.911  -9.794  1.00 0.00 ? 115 ILE A O    4  
ATOM 6931  C CB   . ILE A 1 115 ? 5.100   -2.085  -10.439 1.00 0.00 ? 115 ILE A CB   4  
ATOM 6932  C CG1  . ILE A 1 115 ? 3.608   -1.827  -10.219 1.00 0.00 ? 115 ILE A CG1  4  
ATOM 6933  C CG2  . ILE A 1 115 ? 5.308   -3.129  -11.526 1.00 0.00 ? 115 ILE A CG2  4  
ATOM 6934  C CD1  . ILE A 1 115 ? 2.860   -3.028  -9.682  1.00 0.00 ? 115 ILE A CD1  4  
ATOM 6935  H H    . ILE A 1 115 ? 5.187   -0.683  -8.288  1.00 0.00 ? 115 ILE A H    4  
ATOM 6936  H HA   . ILE A 1 115 ? 5.294   -3.458  -8.807  1.00 0.00 ? 115 ILE A HA   4  
ATOM 6937  H HB   . ILE A 1 115 ? 5.573   -1.169  -10.758 1.00 0.00 ? 115 ILE A HB   4  
ATOM 6938  H HG12 . ILE A 1 115 ? 3.489   -1.020  -9.514  1.00 0.00 ? 115 ILE A HG12 4  
ATOM 6939  H HG13 . ILE A 1 115 ? 3.156   -1.547  -11.160 1.00 0.00 ? 115 ILE A HG13 4  
ATOM 6940  H HG21 . ILE A 1 115 ? 4.435   -3.761  -11.590 1.00 0.00 ? 115 ILE A HG21 4  
ATOM 6941  H HG22 . ILE A 1 115 ? 5.464   -2.635  -12.473 1.00 0.00 ? 115 ILE A HG22 4  
ATOM 6942  H HG23 . ILE A 1 115 ? 6.171   -3.731  -11.287 1.00 0.00 ? 115 ILE A HG23 4  
ATOM 6943  H HD11 . ILE A 1 115 ? 1.960   -3.179  -10.261 1.00 0.00 ? 115 ILE A HD11 4  
ATOM 6944  H HD12 . ILE A 1 115 ? 3.486   -3.905  -9.756  1.00 0.00 ? 115 ILE A HD12 4  
ATOM 6945  H HD13 . ILE A 1 115 ? 2.599   -2.857  -8.649  1.00 0.00 ? 115 ILE A HD13 4  
ATOM 6946  N N    . LYS A 1 116 ? 7.668   -4.040  -9.139  1.00 0.00 ? 116 LYS A N    4  
ATOM 6947  C CA   . LYS A 1 116 ? 9.059   -4.427  -9.347  1.00 0.00 ? 116 LYS A CA   4  
ATOM 6948  C C    . LYS A 1 116 ? 9.325   -4.729  -10.818 1.00 0.00 ? 116 LYS A C    4  
ATOM 6949  O O    . LYS A 1 116 ? 8.920   -5.772  -11.330 1.00 0.00 ? 116 LYS A O    4  
ATOM 6950  C CB   . LYS A 1 116 ? 9.402   -5.650  -8.493  1.00 0.00 ? 116 LYS A CB   4  
ATOM 6951  C CG   . LYS A 1 116 ? 9.829   -5.303  -7.078  1.00 0.00 ? 116 LYS A CG   4  
ATOM 6952  C CD   . LYS A 1 116 ? 10.008  -6.550  -6.228  1.00 0.00 ? 116 LYS A CD   4  
ATOM 6953  C CE   . LYS A 1 116 ? 11.078  -6.352  -5.165  1.00 0.00 ? 116 LYS A CE   4  
ATOM 6954  N NZ   . LYS A 1 116 ? 12.422  -6.774  -5.646  1.00 0.00 ? 116 LYS A NZ   4  
ATOM 6955  H H    . LYS A 1 116 ? 7.030   -4.709  -8.812  1.00 0.00 ? 116 LYS A H    4  
ATOM 6956  H HA   . LYS A 1 116 ? 9.682   -3.600  -9.043  1.00 0.00 ? 116 LYS A HA   4  
ATOM 6957  H HB2  . LYS A 1 116 ? 8.534   -6.291  -8.439  1.00 0.00 ? 116 LYS A HB2  4  
ATOM 6958  H HB3  . LYS A 1 116 ? 10.208  -6.190  -8.968  1.00 0.00 ? 116 LYS A HB3  4  
ATOM 6959  H HG2  . LYS A 1 116 ? 10.767  -4.769  -7.115  1.00 0.00 ? 116 LYS A HG2  4  
ATOM 6960  H HG3  . LYS A 1 116 ? 9.073   -4.676  -6.627  1.00 0.00 ? 116 LYS A HG3  4  
ATOM 6961  H HD2  . LYS A 1 116 ? 9.072   -6.781  -5.742  1.00 0.00 ? 116 LYS A HD2  4  
ATOM 6962  H HD3  . LYS A 1 116 ? 10.296  -7.373  -6.868  1.00 0.00 ? 116 LYS A HD3  4  
ATOM 6963  H HE2  . LYS A 1 116 ? 11.112  -5.307  -4.899  1.00 0.00 ? 116 LYS A HE2  4  
ATOM 6964  H HE3  . LYS A 1 116 ? 10.816  -6.937  -4.296  1.00 0.00 ? 116 LYS A HE3  4  
ATOM 6965  H HZ1  . LYS A 1 116 ? 12.376  -7.737  -6.037  1.00 0.00 ? 116 LYS A HZ1  4  
ATOM 6966  H HZ2  . LYS A 1 116 ? 13.103  -6.763  -4.859  1.00 0.00 ? 116 LYS A HZ2  4  
ATOM 6967  H HZ3  . LYS A 1 116 ? 12.757  -6.126  -6.387  1.00 0.00 ? 116 LYS A HZ3  4  
ATOM 6968  N N    . GLU A 1 117 ? 10.011  -3.810  -11.491 1.00 0.00 ? 117 GLU A N    4  
ATOM 6969  C CA   . GLU A 1 117 ? 10.332  -3.980  -12.903 1.00 0.00 ? 117 GLU A CA   4  
ATOM 6970  C C    . GLU A 1 117 ? 11.769  -4.464  -13.080 1.00 0.00 ? 117 GLU A C    4  
ATOM 6971  O O    . GLU A 1 117 ? 12.525  -3.918  -13.883 1.00 0.00 ? 117 GLU A O    4  
ATOM 6972  C CB   . GLU A 1 117 ? 10.129  -2.665  -13.657 1.00 0.00 ? 117 GLU A CB   4  
ATOM 6973  C CG   . GLU A 1 117 ? 8.762   -2.040  -13.435 1.00 0.00 ? 117 GLU A CG   4  
ATOM 6974  C CD   . GLU A 1 117 ? 8.789   -0.527  -13.529 1.00 0.00 ? 117 GLU A CD   4  
ATOM 6975  O OE1  . GLU A 1 117 ? 9.725   0.084   -12.972 1.00 0.00 ? 117 GLU A OE1  4  
ATOM 6976  O OE2  . GLU A 1 117 ? 7.876   0.045   -14.158 1.00 0.00 ? 117 GLU A OE2  4  
ATOM 6977  H H    . GLU A 1 117 ? 10.308  -2.999  -11.028 1.00 0.00 ? 117 GLU A H    4  
ATOM 6978  H HA   . GLU A 1 117 ? 9.662   -4.724  -13.308 1.00 0.00 ? 117 GLU A HA   4  
ATOM 6979  H HB2  . GLU A 1 117 ? 10.881  -1.959  -13.336 1.00 0.00 ? 117 GLU A HB2  4  
ATOM 6980  H HB3  . GLU A 1 117 ? 10.250  -2.848  -14.715 1.00 0.00 ? 117 GLU A HB3  4  
ATOM 6981  H HG2  . GLU A 1 117 ? 8.081   -2.420  -14.182 1.00 0.00 ? 117 GLU A HG2  4  
ATOM 6982  H HG3  . GLU A 1 117 ? 8.409   -2.319  -12.453 1.00 0.00 ? 117 GLU A HG3  4  
ATOM 6983  N N    . VAL A 1 118 ? 12.137  -5.494  -12.324 1.00 0.00 ? 118 VAL A N    4  
ATOM 6984  C CA   . VAL A 1 118 ? 13.482  -6.053  -12.397 1.00 0.00 ? 118 VAL A CA   4  
ATOM 6985  C C    . VAL A 1 118 ? 13.607  -7.036  -13.556 1.00 0.00 ? 118 VAL A C    4  
ATOM 6986  O O    . VAL A 1 118 ? 14.533  -6.948  -14.363 1.00 0.00 ? 118 VAL A O    4  
ATOM 6987  C CB   . VAL A 1 118 ? 13.864  -6.768  -11.088 1.00 0.00 ? 118 VAL A CB   4  
ATOM 6988  C CG1  . VAL A 1 118 ? 15.289  -7.296  -11.163 1.00 0.00 ? 118 VAL A CG1  4  
ATOM 6989  C CG2  . VAL A 1 118 ? 13.696  -5.832  -9.901  1.00 0.00 ? 118 VAL A CG2  4  
ATOM 6990  H H    . VAL A 1 118 ? 11.489  -5.887  -11.704 1.00 0.00 ? 118 VAL A H    4  
ATOM 6991  H HA   . VAL A 1 118 ? 14.174  -5.238  -12.553 1.00 0.00 ? 118 VAL A HA   4  
ATOM 6992  H HB   . VAL A 1 118 ? 13.199  -7.609  -10.954 1.00 0.00 ? 118 VAL A HB   4  
ATOM 6993  H HG11 . VAL A 1 118 ? 15.426  -7.830  -12.092 1.00 0.00 ? 118 VAL A HG11 4  
ATOM 6994  H HG12 . VAL A 1 118 ? 15.982  -6.469  -11.117 1.00 0.00 ? 118 VAL A HG12 4  
ATOM 6995  H HG13 . VAL A 1 118 ? 15.469  -7.965  -10.335 1.00 0.00 ? 118 VAL A HG13 4  
ATOM 6996  H HG21 . VAL A 1 118 ? 13.780  -6.395  -8.983  1.00 0.00 ? 118 VAL A HG21 4  
ATOM 6997  H HG22 . VAL A 1 118 ? 14.463  -5.073  -9.930  1.00 0.00 ? 118 VAL A HG22 4  
ATOM 6998  H HG23 . VAL A 1 118 ? 12.724  -5.363  -9.947  1.00 0.00 ? 118 VAL A HG23 4  
ATOM 6999  N N    . THR A 1 119 ? 12.667  -7.973  -13.633 1.00 0.00 ? 119 THR A N    4  
ATOM 7000  C CA   . THR A 1 119 ? 12.671  -8.974  -14.693 1.00 0.00 ? 119 THR A CA   4  
ATOM 7001  C C    . THR A 1 119 ? 11.279  -9.152  -15.286 1.00 0.00 ? 119 THR A C    4  
ATOM 7002  O O    . THR A 1 119 ? 10.275  -8.839  -14.646 1.00 0.00 ? 119 THR A O    4  
ATOM 7003  C CB   . THR A 1 119 ? 13.176  -10.335 -14.178 1.00 0.00 ? 119 THR A CB   4  
ATOM 7004  O OG1  . THR A 1 119 ? 14.497  -10.198 -13.644 1.00 0.00 ? 119 THR A OG1  4  
ATOM 7005  C CG2  . THR A 1 119 ? 13.178  -11.369 -15.294 1.00 0.00 ? 119 THR A CG2  4  
ATOM 7006  H H    . THR A 1 119 ? 11.955  -7.991  -12.960 1.00 0.00 ? 119 THR A H    4  
ATOM 7007  H HA   . THR A 1 119 ? 13.342  -8.635  -15.469 1.00 0.00 ? 119 THR A HA   4  
ATOM 7008  H HB   . THR A 1 119 ? 12.513  -10.674 -13.394 1.00 0.00 ? 119 THR A HB   4  
ATOM 7009  H HG1  . THR A 1 119 ? 14.632  -9.294  -13.350 1.00 0.00 ? 119 THR A HG1  4  
ATOM 7010  H HG21 . THR A 1 119 ? 13.255  -10.868 -16.247 1.00 0.00 ? 119 THR A HG21 4  
ATOM 7011  H HG22 . THR A 1 119 ? 12.261  -11.938 -15.259 1.00 0.00 ? 119 THR A HG22 4  
ATOM 7012  H HG23 . THR A 1 119 ? 14.020  -12.033 -15.167 1.00 0.00 ? 119 THR A HG23 4  
ATOM 7013  N N    . GLY A 1 1   ? 20.874  26.031  8.257   1.00 0.00 ? 1   GLY A N    5  
ATOM 7014  C CA   . GLY A 1 1   ? 20.194  24.795  7.919   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7015  C C    . GLY A 1 1   ? 18.755  25.021  7.497   1.00 0.00 ? 1   GLY A C    5  
ATOM 7016  O O    . GLY A 1 1   ? 17.922  25.431  8.305   1.00 0.00 ? 1   GLY A O    5  
ATOM 7017  H H1   . GLY A 1 1   ? 21.152  26.198  9.182   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7018  H HA2  . GLY A 1 1   ? 20.724  24.314  7.110   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7019  H HA3  . GLY A 1 1   ? 20.206  24.143  8.780   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7020  N N    . SER A 1 2   ? 18.463  24.754  6.228   1.00 0.00 ? 2   SER A N    5  
ATOM 7021  C CA   . SER A 1 2   ? 17.117  24.937  5.699   1.00 0.00 ? 2   SER A CA   5  
ATOM 7022  C C    . SER A 1 2   ? 16.592  23.639  5.092   1.00 0.00 ? 2   SER A C    5  
ATOM 7023  O O    . SER A 1 2   ? 15.587  23.091  5.545   1.00 0.00 ? 2   SER A O    5  
ATOM 7024  C CB   . SER A 1 2   ? 17.105  26.047  4.647   1.00 0.00 ? 2   SER A CB   5  
ATOM 7025  O OG   . SER A 1 2   ? 15.905  26.023  3.893   1.00 0.00 ? 2   SER A OG   5  
ATOM 7026  H H    . SER A 1 2   ? 19.171  24.430  5.633   1.00 0.00 ? 2   SER A H    5  
ATOM 7027  H HA   . SER A 1 2   ? 16.474  25.222  6.519   1.00 0.00 ? 2   SER A HA   5  
ATOM 7028  H HB2  . SER A 1 2   ? 17.190  27.005  5.137   1.00 0.00 ? 2   SER A HB2  5  
ATOM 7029  H HB3  . SER A 1 2   ? 17.941  25.911  3.975   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7030  H HG   . SER A 1 2   ? 16.100  25.767  2.989   1.00 0.00 ? 2   SER A HG   5  
ATOM 7031  N N    . SER A 1 3   ? 17.279  23.154  4.063   1.00 0.00 ? 3   SER A N    5  
ATOM 7032  C CA   . SER A 1 3   ? 16.881  21.923  3.390   1.00 0.00 ? 3   SER A CA   5  
ATOM 7033  C C    . SER A 1 3   ? 18.103  21.161  2.885   1.00 0.00 ? 3   SER A C    5  
ATOM 7034  O O    . SER A 1 3   ? 18.902  21.688  2.113   1.00 0.00 ? 3   SER A O    5  
ATOM 7035  C CB   . SER A 1 3   ? 15.943  22.236  2.223   1.00 0.00 ? 3   SER A CB   5  
ATOM 7036  O OG   . SER A 1 3   ? 14.622  22.469  2.679   1.00 0.00 ? 3   SER A OG   5  
ATOM 7037  H H    . SER A 1 3   ? 18.072  23.637  3.748   1.00 0.00 ? 3   SER A H    5  
ATOM 7038  H HA   . SER A 1 3   ? 16.358  21.308  4.106   1.00 0.00 ? 3   SER A HA   5  
ATOM 7039  H HB2  . SER A 1 3   ? 16.294  23.117  1.708   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7040  H HB3  . SER A 1 3   ? 15.932  21.399  1.539   1.00 0.00 ? 3   SER A HB3  5  
ATOM 7041  H HG   . SER A 1 3   ? 14.477  21.991  3.499   1.00 0.00 ? 3   SER A HG   5  
ATOM 7042  N N    . GLY A 1 4   ? 18.239  19.914  3.328   1.00 0.00 ? 4   GLY A N    5  
ATOM 7043  C CA   . GLY A 1 4   ? 19.365  19.098  2.911   1.00 0.00 ? 4   GLY A CA   5  
ATOM 7044  C C    . GLY A 1 4   ? 19.150  18.466  1.550   1.00 0.00 ? 4   GLY A C    5  
ATOM 7045  O O    . GLY A 1 4   ? 20.024  18.528  0.685   1.00 0.00 ? 4   GLY A O    5  
ATOM 7046  H H    . GLY A 1 4   ? 17.570  19.546  3.942   1.00 0.00 ? 4   GLY A H    5  
ATOM 7047  H HA2  . GLY A 1 4   ? 20.249  19.717  2.875   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7048  H HA3  . GLY A 1 4   ? 19.515  18.315  3.640   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7049  N N    . SER A 1 5   ? 17.986  17.855  1.360   1.00 0.00 ? 5   SER A N    5  
ATOM 7050  C CA   . SER A 1 5   ? 17.661  17.204  0.097   1.00 0.00 ? 5   SER A CA   5  
ATOM 7051  C C    . SER A 1 5   ? 18.256  17.973  -1.079  1.00 0.00 ? 5   SER A C    5  
ATOM 7052  O O    . SER A 1 5   ? 18.827  17.382  -1.997  1.00 0.00 ? 5   SER A O    5  
ATOM 7053  C CB   . SER A 1 5   ? 16.145  17.090  -0.069  1.00 0.00 ? 5   SER A CB   5  
ATOM 7054  O OG   . SER A 1 5   ? 15.808  16.577  -1.346  1.00 0.00 ? 5   SER A OG   5  
ATOM 7055  H H    . SER A 1 5   ? 17.330  17.840  2.089   1.00 0.00 ? 5   SER A H    5  
ATOM 7056  H HA   . SER A 1 5   ? 18.088  16.212  0.116   1.00 0.00 ? 5   SER A HA   5  
ATOM 7057  H HB2  . SER A 1 5   ? 15.751  16.428  0.687   1.00 0.00 ? 5   SER A HB2  5  
ATOM 7058  H HB3  . SER A 1 5   ? 15.699  18.068  0.043   1.00 0.00 ? 5   SER A HB3  5  
ATOM 7059  H HG   . SER A 1 5   ? 16.525  16.028  -1.670  1.00 0.00 ? 5   SER A HG   5  
ATOM 7060  N N    . SER A 1 6   ? 18.119  19.294  -1.044  1.00 0.00 ? 6   SER A N    5  
ATOM 7061  C CA   . SER A 1 6   ? 18.639  20.145  -2.108  1.00 0.00 ? 6   SER A CA   5  
ATOM 7062  C C    . SER A 1 6   ? 19.978  19.621  -2.617  1.00 0.00 ? 6   SER A C    5  
ATOM 7063  O O    . SER A 1 6   ? 20.945  19.521  -1.864  1.00 0.00 ? 6   SER A O    5  
ATOM 7064  C CB   . SER A 1 6   ? 18.797  21.583  -1.608  1.00 0.00 ? 6   SER A CB   5  
ATOM 7065  O OG   . SER A 1 6   ? 19.692  21.646  -0.511  1.00 0.00 ? 6   SER A OG   5  
ATOM 7066  H H    . SER A 1 6   ? 17.654  19.706  -0.286  1.00 0.00 ? 6   SER A H    5  
ATOM 7067  H HA   . SER A 1 6   ? 17.928  20.132  -2.921  1.00 0.00 ? 6   SER A HA   5  
ATOM 7068  H HB2  . SER A 1 6   ? 19.182  22.198  -2.407  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7069  H HB3  . SER A 1 6   ? 17.834  21.960  -1.295  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7070  H HG   . SER A 1 6   ? 20.565  21.892  -0.824  1.00 0.00 ? 6   SER A HG   5  
ATOM 7071  N N    . GLY A 1 7   ? 20.025  19.288  -3.904  1.00 0.00 ? 7   GLY A N    5  
ATOM 7072  C CA   . GLY A 1 7   ? 21.250  18.778  -4.493  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7073  C C    . GLY A 1 7   ? 21.354  17.268  -4.398  1.00 0.00 ? 7   GLY A C    5  
ATOM 7074  O O    . GLY A 1 7   ? 21.529  16.719  -3.310  1.00 0.00 ? 7   GLY A O    5  
ATOM 7075  H H    . GLY A 1 7   ? 19.222  19.388  -4.457  1.00 0.00 ? 7   GLY A H    5  
ATOM 7076  H HA2  . GLY A 1 7   ? 21.283  19.066  -5.533  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7077  H HA3  . GLY A 1 7   ? 22.093  19.218  -3.981  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7078  N N    . ARG A 1 8   ? 21.244  16.596  -5.539  1.00 0.00 ? 8   ARG A N    5  
ATOM 7079  C CA   . ARG A 1 8   ? 21.324  15.141  -5.580  1.00 0.00 ? 8   ARG A CA   5  
ATOM 7080  C C    . ARG A 1 8   ? 22.778  14.677  -5.593  1.00 0.00 ? 8   ARG A C    5  
ATOM 7081  O O    . ARG A 1 8   ? 23.139  13.754  -6.325  1.00 0.00 ? 8   ARG A O    5  
ATOM 7082  C CB   . ARG A 1 8   ? 20.594  14.603  -6.812  1.00 0.00 ? 8   ARG A CB   5  
ATOM 7083  C CG   . ARG A 1 8   ? 21.165  15.108  -8.127  1.00 0.00 ? 8   ARG A CG   5  
ATOM 7084  C CD   . ARG A 1 8   ? 20.420  14.525  -9.318  1.00 0.00 ? 8   ARG A CD   5  
ATOM 7085  N NE   . ARG A 1 8   ? 20.574  15.347  -10.515 1.00 0.00 ? 8   ARG A NE   5  
ATOM 7086  C CZ   . ARG A 1 8   ? 19.787  15.248  -11.580 1.00 0.00 ? 8   ARG A CZ   5  
ATOM 7087  N NH1  . ARG A 1 8   ? 18.795  14.369  -11.596 1.00 0.00 ? 8   ARG A NH1  5  
ATOM 7088  N NH2  . ARG A 1 8   ? 19.990  16.031  -12.632 1.00 0.00 ? 8   ARG A NH2  5  
ATOM 7089  H H    . ARG A 1 8   ? 21.105  17.091  -6.374  1.00 0.00 ? 8   ARG A H    5  
ATOM 7090  H HA   . ARG A 1 8   ? 20.844  14.757  -4.692  1.00 0.00 ? 8   ARG A HA   5  
ATOM 7091  H HB2  . ARG A 1 8   ? 20.655  13.524  -6.809  1.00 0.00 ? 8   ARG A HB2  5  
ATOM 7092  H HB3  . ARG A 1 8   ? 19.557  14.897  -6.757  1.00 0.00 ? 8   ARG A HB3  5  
ATOM 7093  H HG2  . ARG A 1 8   ? 21.080  16.185  -8.155  1.00 0.00 ? 8   ARG A HG2  5  
ATOM 7094  H HG3  . ARG A 1 8   ? 22.205  14.825  -8.189  1.00 0.00 ? 8   ARG A HG3  5  
ATOM 7095  H HD2  . ARG A 1 8   ? 20.807  13.537  -9.518  1.00 0.00 ? 8   ARG A HD2  5  
ATOM 7096  H HD3  . ARG A 1 8   ? 19.371  14.457  -9.071  1.00 0.00 ? 8   ARG A HD3  5  
ATOM 7097  H HE   . ARG A 1 8   ? 21.301  16.003  -10.525 1.00 0.00 ? 8   ARG A HE   5  
ATOM 7098  H HH11 . ARG A 1 8   ? 18.639  13.778  -10.805 1.00 0.00 ? 8   ARG A HH11 5  
ATOM 7099  H HH12 . ARG A 1 8   ? 18.202  14.297  -12.399 1.00 0.00 ? 8   ARG A HH12 5  
ATOM 7100  H HH21 . ARG A 1 8   ? 20.737  16.696  -12.623 1.00 0.00 ? 8   ARG A HH21 5  
ATOM 7101  H HH22 . ARG A 1 8   ? 19.397  15.956  -13.433 1.00 0.00 ? 8   ARG A HH22 5  
ATOM 7102  N N    . LEU A 1 9   ? 23.607  15.322  -4.780  1.00 0.00 ? 9   LEU A N    5  
ATOM 7103  C CA   . LEU A 1 9   ? 25.022  14.976  -4.698  1.00 0.00 ? 9   LEU A CA   5  
ATOM 7104  C C    . LEU A 1 9   ? 25.204  13.531  -4.245  1.00 0.00 ? 9   LEU A C    5  
ATOM 7105  O O    . LEU A 1 9   ? 25.776  12.711  -4.964  1.00 0.00 ? 9   LEU A O    5  
ATOM 7106  C CB   . LEU A 1 9   ? 25.743  15.919  -3.734  1.00 0.00 ? 9   LEU A CB   5  
ATOM 7107  C CG   . LEU A 1 9   ? 27.218  16.189  -4.036  1.00 0.00 ? 9   LEU A CG   5  
ATOM 7108  C CD1  . LEU A 1 9   ? 27.987  14.882  -4.147  1.00 0.00 ? 9   LEU A CD1  5  
ATOM 7109  C CD2  . LEU A 1 9   ? 27.360  17.004  -5.313  1.00 0.00 ? 9   LEU A CD2  5  
ATOM 7110  H H    . LEU A 1 9   ? 23.261  16.048  -4.221  1.00 0.00 ? 9   LEU A H    5  
ATOM 7111  H HA   . LEU A 1 9   ? 25.448  15.087  -5.684  1.00 0.00 ? 9   LEU A HA   5  
ATOM 7112  H HB2  . LEU A 1 9   ? 25.225  16.866  -3.748  1.00 0.00 ? 9   LEU A HB2  5  
ATOM 7113  H HB3  . LEU A 1 9   ? 25.679  15.491  -2.744  1.00 0.00 ? 9   LEU A HB3  5  
ATOM 7114  H HG   . LEU A 1 9   ? 27.646  16.760  -3.224  1.00 0.00 ? 9   LEU A HG   5  
ATOM 7115  H HD11 . LEU A 1 9   ? 28.154  14.478  -3.160  1.00 0.00 ? 9   LEU A HD11 5  
ATOM 7116  H HD12 . LEU A 1 9   ? 28.937  15.063  -4.628  1.00 0.00 ? 9   LEU A HD12 5  
ATOM 7117  H HD13 . LEU A 1 9   ? 27.416  14.177  -4.734  1.00 0.00 ? 9   LEU A HD13 5  
ATOM 7118  H HD21 . LEU A 1 9   ? 26.401  17.077  -5.803  1.00 0.00 ? 9   LEU A HD21 5  
ATOM 7119  H HD22 . LEU A 1 9   ? 28.066  16.520  -5.972  1.00 0.00 ? 9   LEU A HD22 5  
ATOM 7120  H HD23 . LEU A 1 9   ? 27.717  17.995  -5.069  1.00 0.00 ? 9   LEU A HD23 5  
ATOM 7121  N N    . LEU A 1 10  ? 24.712  13.225  -3.050  1.00 0.00 ? 10  LEU A N    5  
ATOM 7122  C CA   . LEU A 1 10  ? 24.818  11.878  -2.500  1.00 0.00 ? 10  LEU A CA   5  
ATOM 7123  C C    . LEU A 1 10  ? 23.447  11.345  -2.096  1.00 0.00 ? 10  LEU A C    5  
ATOM 7124  O O    . LEU A 1 10  ? 22.740  11.963  -1.300  1.00 0.00 ? 10  LEU A O    5  
ATOM 7125  C CB   . LEU A 1 10  ? 25.757  11.870  -1.293  1.00 0.00 ? 10  LEU A CB   5  
ATOM 7126  C CG   . LEU A 1 10  ? 26.474  10.550  -1.009  1.00 0.00 ? 10  LEU A CG   5  
ATOM 7127  C CD1  . LEU A 1 10  ? 27.588  10.320  -2.019  1.00 0.00 ? 10  LEU A CD1  5  
ATOM 7128  C CD2  . LEU A 1 10  ? 27.027  10.537  0.409   1.00 0.00 ? 10  LEU A CD2  5  
ATOM 7129  H H    . LEU A 1 10  ? 24.267  13.921  -2.523  1.00 0.00 ? 10  LEU A H    5  
ATOM 7130  H HA   . LEU A 1 10  ? 25.227  11.238  -3.269  1.00 0.00 ? 10  LEU A HA   5  
ATOM 7131  H HB2  . LEU A 1 10  ? 26.509  12.627  -1.455  1.00 0.00 ? 10  LEU A HB2  5  
ATOM 7132  H HB3  . LEU A 1 10  ? 25.173  12.125  -0.420  1.00 0.00 ? 10  LEU A HB3  5  
ATOM 7133  H HG   . LEU A 1 10  ? 25.768  9.737   -1.101  1.00 0.00 ? 10  LEU A HG   5  
ATOM 7134  H HD11 . LEU A 1 10  ? 27.350  10.831  -2.939  1.00 0.00 ? 10  LEU A HD11 5  
ATOM 7135  H HD12 . LEU A 1 10  ? 27.687  9.261   -2.210  1.00 0.00 ? 10  LEU A HD12 5  
ATOM 7136  H HD13 . LEU A 1 10  ? 28.517  10.702  -1.623  1.00 0.00 ? 10  LEU A HD13 5  
ATOM 7137  H HD21 . LEU A 1 10  ? 26.215  10.652  1.112   1.00 0.00 ? 10  LEU A HD21 5  
ATOM 7138  H HD22 . LEU A 1 10  ? 27.726  11.352  0.529   1.00 0.00 ? 10  LEU A HD22 5  
ATOM 7139  H HD23 . LEU A 1 10  ? 27.532  9.600   0.590   1.00 0.00 ? 10  LEU A HD23 5  
ATOM 7140  N N    . ASP A 1 11  ? 23.078  10.195  -2.649  1.00 0.00 ? 11  ASP A N    5  
ATOM 7141  C CA   . ASP A 1 11  ? 21.793  9.577   -2.343  1.00 0.00 ? 11  ASP A CA   5  
ATOM 7142  C C    . ASP A 1 11  ? 21.672  8.213   -3.017  1.00 0.00 ? 11  ASP A C    5  
ATOM 7143  O O    . ASP A 1 11  ? 21.602  8.119   -4.243  1.00 0.00 ? 11  ASP A O    5  
ATOM 7144  C CB   . ASP A 1 11  ? 20.647  10.485  -2.792  1.00 0.00 ? 11  ASP A CB   5  
ATOM 7145  C CG   . ASP A 1 11  ? 21.031  11.365  -3.965  1.00 0.00 ? 11  ASP A CG   5  
ATOM 7146  O OD1  . ASP A 1 11  ? 21.552  10.828  -4.965  1.00 0.00 ? 11  ASP A OD1  5  
ATOM 7147  O OD2  . ASP A 1 11  ? 20.809  12.591  -3.884  1.00 0.00 ? 11  ASP A OD2  5  
ATOM 7148  H H    . ASP A 1 11  ? 23.686  9.750   -3.277  1.00 0.00 ? 11  ASP A H    5  
ATOM 7149  H HA   . ASP A 1 11  ? 21.736  9.442   -1.274  1.00 0.00 ? 11  ASP A HA   5  
ATOM 7150  H HB2  . ASP A 1 11  ? 19.806  9.873   -3.085  1.00 0.00 ? 11  ASP A HB2  5  
ATOM 7151  H HB3  . ASP A 1 11  ? 20.356  11.120  -1.968  1.00 0.00 ? 11  ASP A HB3  5  
ATOM 7152  N N    . LEU A 1 12  ? 21.649  7.160   -2.208  1.00 0.00 ? 12  LEU A N    5  
ATOM 7153  C CA   . LEU A 1 12  ? 21.538  5.800   -2.725  1.00 0.00 ? 12  LEU A CA   5  
ATOM 7154  C C    . LEU A 1 12  ? 20.076  5.405   -2.907  1.00 0.00 ? 12  LEU A C    5  
ATOM 7155  O O    . LEU A 1 12  ? 19.678  4.290   -2.571  1.00 0.00 ? 12  LEU A O    5  
ATOM 7156  C CB   . LEU A 1 12  ? 22.231  4.816   -1.781  1.00 0.00 ? 12  LEU A CB   5  
ATOM 7157  C CG   . LEU A 1 12  ? 23.728  5.034   -1.565  1.00 0.00 ? 12  LEU A CG   5  
ATOM 7158  C CD1  . LEU A 1 12  ? 24.145  4.546   -0.187  1.00 0.00 ? 12  LEU A CD1  5  
ATOM 7159  C CD2  . LEU A 1 12  ? 24.532  4.329   -2.648  1.00 0.00 ? 12  LEU A CD2  5  
ATOM 7160  H H    . LEU A 1 12  ? 21.709  7.298   -1.240  1.00 0.00 ? 12  LEU A H    5  
ATOM 7161  H HA   . LEU A 1 12  ? 22.029  5.771   -3.687  1.00 0.00 ? 12  LEU A HA   5  
ATOM 7162  H HB2  . LEU A 1 12  ? 21.745  4.882   -0.820  1.00 0.00 ? 12  LEU A HB2  5  
ATOM 7163  H HB3  . LEU A 1 12  ? 22.094  3.822   -2.184  1.00 0.00 ? 12  LEU A HB3  5  
ATOM 7164  H HG   . LEU A 1 12  ? 23.944  6.092   -1.623  1.00 0.00 ? 12  LEU A HG   5  
ATOM 7165  H HD11 . LEU A 1 12  ? 25.054  3.969   -0.269  1.00 0.00 ? 12  LEU A HD11 5  
ATOM 7166  H HD12 . LEU A 1 12  ? 23.363  3.928   0.228   1.00 0.00 ? 12  LEU A HD12 5  
ATOM 7167  H HD13 . LEU A 1 12  ? 24.314  5.395   0.460   1.00 0.00 ? 12  LEU A HD13 5  
ATOM 7168  H HD21 . LEU A 1 12  ? 24.594  3.275   -2.422  1.00 0.00 ? 12  LEU A HD21 5  
ATOM 7169  H HD22 . LEU A 1 12  ? 25.526  4.749   -2.689  1.00 0.00 ? 12  LEU A HD22 5  
ATOM 7170  H HD23 . LEU A 1 12  ? 24.045  4.465   -3.603  1.00 0.00 ? 12  LEU A HD23 5  
ATOM 7171  N N    . GLU A 1 13  ? 19.281  6.326   -3.443  1.00 0.00 ? 13  GLU A N    5  
ATOM 7172  C CA   . GLU A 1 13  ? 17.864  6.072   -3.671  1.00 0.00 ? 13  GLU A CA   5  
ATOM 7173  C C    . GLU A 1 13  ? 17.465  6.450   -5.095  1.00 0.00 ? 13  GLU A C    5  
ATOM 7174  O O    . GLU A 1 13  ? 17.215  7.617   -5.392  1.00 0.00 ? 13  GLU A O    5  
ATOM 7175  C CB   . GLU A 1 13  ? 17.015  6.856   -2.668  1.00 0.00 ? 13  GLU A CB   5  
ATOM 7176  C CG   . GLU A 1 13  ? 17.338  6.538   -1.218  1.00 0.00 ? 13  GLU A CG   5  
ATOM 7177  C CD   . GLU A 1 13  ? 16.470  7.310   -0.243  1.00 0.00 ? 13  GLU A CD   5  
ATOM 7178  O OE1  . GLU A 1 13  ? 15.282  6.955   -0.096  1.00 0.00 ? 13  GLU A OE1  5  
ATOM 7179  O OE2  . GLU A 1 13  ? 16.980  8.270   0.372   1.00 0.00 ? 13  GLU A OE2  5  
ATOM 7180  H H    . GLU A 1 13  ? 19.657  7.197   -3.691  1.00 0.00 ? 13  GLU A H    5  
ATOM 7181  H HA   . GLU A 1 13  ? 17.689  5.016   -3.529  1.00 0.00 ? 13  GLU A HA   5  
ATOM 7182  H HB2  . GLU A 1 13  ? 17.173  7.912   -2.828  1.00 0.00 ? 13  GLU A HB2  5  
ATOM 7183  H HB3  . GLU A 1 13  ? 15.973  6.628   -2.841  1.00 0.00 ? 13  GLU A HB3  5  
ATOM 7184  H HG2  . GLU A 1 13  ? 17.186  5.482   -1.052  1.00 0.00 ? 13  GLU A HG2  5  
ATOM 7185  H HG3  . GLU A 1 13  ? 18.373  6.785   -1.030  1.00 0.00 ? 13  GLU A HG3  5  
ATOM 7186  N N    . ASN A 1 14  ? 17.409  5.452   -5.972  1.00 0.00 ? 14  ASN A N    5  
ATOM 7187  C CA   . ASN A 1 14  ? 17.042  5.679   -7.365  1.00 0.00 ? 14  ASN A CA   5  
ATOM 7188  C C    . ASN A 1 14  ? 15.588  6.124   -7.479  1.00 0.00 ? 14  ASN A C    5  
ATOM 7189  O O    . ASN A 1 14  ? 15.238  6.918   -8.353  1.00 0.00 ? 14  ASN A O    5  
ATOM 7190  C CB   . ASN A 1 14  ? 17.264  4.406   -8.186  1.00 0.00 ? 14  ASN A CB   5  
ATOM 7191  C CG   . ASN A 1 14  ? 18.717  3.973   -8.200  1.00 0.00 ? 14  ASN A CG   5  
ATOM 7192  O OD1  . ASN A 1 14  ? 19.592  4.713   -8.651  1.00 0.00 ? 14  ASN A OD1  5  
ATOM 7193  N ND2  . ASN A 1 14  ? 18.981  2.769   -7.706  1.00 0.00 ? 14  ASN A ND2  5  
ATOM 7194  H H    . ASN A 1 14  ? 17.620  4.542   -5.675  1.00 0.00 ? 14  ASN A H    5  
ATOM 7195  H HA   . ASN A 1 14  ? 17.678  6.461   -7.752  1.00 0.00 ? 14  ASN A HA   5  
ATOM 7196  H HB2  . ASN A 1 14  ? 16.674  3.606   -7.763  1.00 0.00 ? 14  ASN A HB2  5  
ATOM 7197  H HB3  . ASN A 1 14  ? 16.949  4.582   -9.203  1.00 0.00 ? 14  ASN A HB3  5  
ATOM 7198  H HD21 . ASN A 1 14  ? 18.233  2.235   -7.364  1.00 0.00 ? 14  ASN A HD21 5  
ATOM 7199  H HD22 . ASN A 1 14  ? 19.912  2.464   -7.702  1.00 0.00 ? 14  ASN A HD22 5  
ATOM 7200  N N    . ILE A 1 15  ? 14.745  5.608   -6.591  1.00 0.00 ? 15  ILE A N    5  
ATOM 7201  C CA   . ILE A 1 15  ? 13.329  5.954   -6.591  1.00 0.00 ? 15  ILE A CA   5  
ATOM 7202  C C    . ILE A 1 15  ? 13.054  7.142   -5.675  1.00 0.00 ? 15  ILE A C    5  
ATOM 7203  O O    . ILE A 1 15  ? 13.578  7.216   -4.565  1.00 0.00 ? 15  ILE A O    5  
ATOM 7204  C CB   . ILE A 1 15  ? 12.459  4.764   -6.145  1.00 0.00 ? 15  ILE A CB   5  
ATOM 7205  C CG1  . ILE A 1 15  ? 12.629  3.589   -7.111  1.00 0.00 ? 15  ILE A CG1  5  
ATOM 7206  C CG2  . ILE A 1 15  ? 10.998  5.179   -6.059  1.00 0.00 ? 15  ILE A CG2  5  
ATOM 7207  C CD1  . ILE A 1 15  ? 13.847  2.740   -6.821  1.00 0.00 ? 15  ILE A CD1  5  
ATOM 7208  H H    . ILE A 1 15  ? 15.084  4.980   -5.919  1.00 0.00 ? 15  ILE A H    5  
ATOM 7209  H HA   . ILE A 1 15  ? 13.051  6.219   -7.601  1.00 0.00 ? 15  ILE A HA   5  
ATOM 7210  H HB   . ILE A 1 15  ? 12.780  4.460   -5.160  1.00 0.00 ? 15  ILE A HB   5  
ATOM 7211  H HG12 . ILE A 1 15  ? 11.760  2.954   -7.051  1.00 0.00 ? 15  ILE A HG12 5  
ATOM 7212  H HG13 . ILE A 1 15  ? 12.722  3.971   -8.117  1.00 0.00 ? 15  ILE A HG13 5  
ATOM 7213  H HG21 . ILE A 1 15  ? 10.415  4.588   -6.750  1.00 0.00 ? 15  ILE A HG21 5  
ATOM 7214  H HG22 . ILE A 1 15  ? 10.637  5.017   -5.055  1.00 0.00 ? 15  ILE A HG22 5  
ATOM 7215  H HG23 . ILE A 1 15  ? 10.905  6.224   -6.312  1.00 0.00 ? 15  ILE A HG23 5  
ATOM 7216  H HD11 . ILE A 1 15  ? 14.733  3.358   -6.852  1.00 0.00 ? 15  ILE A HD11 5  
ATOM 7217  H HD12 . ILE A 1 15  ? 13.752  2.298   -5.840  1.00 0.00 ? 15  ILE A HD12 5  
ATOM 7218  H HD13 . ILE A 1 15  ? 13.927  1.959   -7.562  1.00 0.00 ? 15  ILE A HD13 5  
ATOM 7219  N N    . GLN A 1 16  ? 12.226  8.067   -6.149  1.00 0.00 ? 16  GLN A N    5  
ATOM 7220  C CA   . GLN A 1 16  ? 11.880  9.252   -5.373  1.00 0.00 ? 16  GLN A CA   5  
ATOM 7221  C C    . GLN A 1 16  ? 10.598  9.026   -4.578  1.00 0.00 ? 16  GLN A C    5  
ATOM 7222  O O    . GLN A 1 16  ? 9.496   9.113   -5.120  1.00 0.00 ? 16  GLN A O    5  
ATOM 7223  C CB   . GLN A 1 16  ? 11.716  10.462  -6.294  1.00 0.00 ? 16  GLN A CB   5  
ATOM 7224  C CG   . GLN A 1 16  ? 13.010  10.900  -6.959  1.00 0.00 ? 16  GLN A CG   5  
ATOM 7225  C CD   . GLN A 1 16  ? 12.791  11.956  -8.024  1.00 0.00 ? 16  GLN A CD   5  
ATOM 7226  O OE1  . GLN A 1 16  ? 11.947  12.840  -7.874  1.00 0.00 ? 16  GLN A OE1  5  
ATOM 7227  N NE2  . GLN A 1 16  ? 13.552  11.869  -9.109  1.00 0.00 ? 16  GLN A NE2  5  
ATOM 7228  H H    . GLN A 1 16  ? 11.840  7.952   -7.042  1.00 0.00 ? 16  GLN A H    5  
ATOM 7229  H HA   . GLN A 1 16  ? 12.687  9.443   -4.682  1.00 0.00 ? 16  GLN A HA   5  
ATOM 7230  H HB2  . GLN A 1 16  ? 11.003  10.217  -7.067  1.00 0.00 ? 16  GLN A HB2  5  
ATOM 7231  H HB3  . GLN A 1 16  ? 11.336  11.291  -5.715  1.00 0.00 ? 16  GLN A HB3  5  
ATOM 7232  H HG2  . GLN A 1 16  ? 13.669  11.304  -6.205  1.00 0.00 ? 16  GLN A HG2  5  
ATOM 7233  H HG3  . GLN A 1 16  ? 13.474  10.038  -7.416  1.00 0.00 ? 16  GLN A HG3  5  
ATOM 7234  H HE21 . GLN A 1 16  ? 14.203  11.138  -9.161  1.00 0.00 ? 16  GLN A HE21 5  
ATOM 7235  H HE22 . GLN A 1 16  ? 13.431  12.538  -9.814  1.00 0.00 ? 16  GLN A HE22 5  
ATOM 7236  N N    . ILE A 1 17  ? 10.750  8.735   -3.290  1.00 0.00 ? 17  ILE A N    5  
ATOM 7237  C CA   . ILE A 1 17  ? 9.604   8.497   -2.421  1.00 0.00 ? 17  ILE A CA   5  
ATOM 7238  C C    . ILE A 1 17  ? 9.393   9.660   -1.458  1.00 0.00 ? 17  ILE A C    5  
ATOM 7239  O O    . ILE A 1 17  ? 10.340  10.215  -0.899  1.00 0.00 ? 17  ILE A O    5  
ATOM 7240  C CB   . ILE A 1 17  ? 9.773   7.198   -1.610  1.00 0.00 ? 17  ILE A CB   5  
ATOM 7241  C CG1  . ILE A 1 17  ? 9.899   5.997   -2.549  1.00 0.00 ? 17  ILE A CG1  5  
ATOM 7242  C CG2  . ILE A 1 17  ? 8.601   7.012   -0.658  1.00 0.00 ? 17  ILE A CG2  5  
ATOM 7243  C CD1  . ILE A 1 17  ? 10.031  4.675   -1.826  1.00 0.00 ? 17  ILE A CD1  5  
ATOM 7244  H H    . ILE A 1 17  ? 11.653  8.679   -2.916  1.00 0.00 ? 17  ILE A H    5  
ATOM 7245  H HA   . ILE A 1 17  ? 8.728   8.396   -3.045  1.00 0.00 ? 17  ILE A HA   5  
ATOM 7246  H HB   . ILE A 1 17  ? 10.673  7.282   -1.021  1.00 0.00 ? 17  ILE A HB   5  
ATOM 7247  H HG12 . ILE A 1 17  ? 9.023   5.945   -3.177  1.00 0.00 ? 17  ILE A HG12 5  
ATOM 7248  H HG13 . ILE A 1 17  ? 10.774  6.125   -3.170  1.00 0.00 ? 17  ILE A HG13 5  
ATOM 7249  H HG21 . ILE A 1 17  ? 8.329   7.967   -0.231  1.00 0.00 ? 17  ILE A HG21 5  
ATOM 7250  H HG22 . ILE A 1 17  ? 7.758   6.609   -1.199  1.00 0.00 ? 17  ILE A HG22 5  
ATOM 7251  H HG23 . ILE A 1 17  ? 8.882   6.331   0.131   1.00 0.00 ? 17  ILE A HG23 5  
ATOM 7252  H HD11 . ILE A 1 17  ? 10.869  4.720   -1.145  1.00 0.00 ? 17  ILE A HD11 5  
ATOM 7253  H HD12 . ILE A 1 17  ? 9.127   4.478   -1.269  1.00 0.00 ? 17  ILE A HD12 5  
ATOM 7254  H HD13 . ILE A 1 17  ? 10.193  3.886   -2.544  1.00 0.00 ? 17  ILE A HD13 5  
ATOM 7255  N N    . PRO A 1 18  ? 8.123   10.040  -1.258  1.00 0.00 ? 18  PRO A N    5  
ATOM 7256  C CA   . PRO A 1 18  ? 7.757   11.140  -0.361  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7257  C C    . PRO A 1 18  ? 7.987   10.793  1.106   1.00 0.00 ? 18  PRO A C    5  
ATOM 7258  O O    . PRO A 1 18  ? 7.674   9.687   1.549   1.00 0.00 ? 18  PRO A O    5  
ATOM 7259  C CB   . PRO A 1 18  ? 6.265   11.340  -0.635  1.00 0.00 ? 18  PRO A CB   5  
ATOM 7260  C CG   . PRO A 1 18  ? 5.790   10.019  -1.134  1.00 0.00 ? 18  PRO A CG   5  
ATOM 7261  C CD   . PRO A 1 18  ? 6.945   9.424   -1.892  1.00 0.00 ? 18  PRO A CD   5  
ATOM 7262  H HA   . PRO A 1 18  ? 8.294   12.045  -0.603  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7263  H HB2  . PRO A 1 18  ? 5.762   11.621  0.280   1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7264  H HB3  . PRO A 1 18  ? 6.132   12.113  -1.377  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7265  H HG2  . PRO A 1 18  ? 5.523   9.387   -0.301  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7266  H HG3  . PRO A 1 18  ? 4.943   10.157  -1.789  1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7267  H HD2  . PRO A 1 18  ? 6.960   8.351   -1.774  1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7268  H HD3  . PRO A 1 18  ? 6.887   9.690   -2.937  1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7269  N N    . ASP A 1 19  ? 8.537   11.742  1.855   1.00 0.00 ? 19  ASP A N    5  
ATOM 7270  C CA   . ASP A 1 19  ? 8.807   11.537  3.273   1.00 0.00 ? 19  ASP A CA   5  
ATOM 7271  C C    . ASP A 1 19  ? 7.603   10.913  3.972   1.00 0.00 ? 19  ASP A C    5  
ATOM 7272  O O    . ASP A 1 19  ? 7.750   10.016  4.801   1.00 0.00 ? 19  ASP A O    5  
ATOM 7273  C CB   . ASP A 1 19  ? 9.170   12.863  3.942   1.00 0.00 ? 19  ASP A CB   5  
ATOM 7274  C CG   . ASP A 1 19  ? 10.049  12.675  5.164   1.00 0.00 ? 19  ASP A CG   5  
ATOM 7275  O OD1  . ASP A 1 19  ? 10.964  11.827  5.110   1.00 0.00 ? 19  ASP A OD1  5  
ATOM 7276  O OD2  . ASP A 1 19  ? 9.821   13.374  6.173   1.00 0.00 ? 19  ASP A OD2  5  
ATOM 7277  H H    . ASP A 1 19  ? 8.765   12.603  1.444   1.00 0.00 ? 19  ASP A H    5  
ATOM 7278  H HA   . ASP A 1 19  ? 9.645   10.861  3.356   1.00 0.00 ? 19  ASP A HA   5  
ATOM 7279  H HB2  . ASP A 1 19  ? 9.700   13.484  3.234   1.00 0.00 ? 19  ASP A HB2  5  
ATOM 7280  H HB3  . ASP A 1 19  ? 8.264   13.365  4.247   1.00 0.00 ? 19  ASP A HB3  5  
ATOM 7281  N N    . ALA A 1 20  ? 6.412   11.396  3.631   1.00 0.00 ? 20  ALA A N    5  
ATOM 7282  C CA   . ALA A 1 20  ? 5.183   10.885  4.224   1.00 0.00 ? 20  ALA A CA   5  
ATOM 7283  C C    . ALA A 1 20  ? 4.284   10.252  3.167   1.00 0.00 ? 20  ALA A C    5  
ATOM 7284  O O    . ALA A 1 20  ? 4.374   10.558  1.978   1.00 0.00 ? 20  ALA A O    5  
ATOM 7285  C CB   . ALA A 1 20  ? 4.444   12.000  4.949   1.00 0.00 ? 20  ALA A CB   5  
ATOM 7286  H H    . ALA A 1 20  ? 6.360   12.111  2.963   1.00 0.00 ? 20  ALA A H    5  
ATOM 7287  H HA   . ALA A 1 20  ? 5.451   10.132  4.952   1.00 0.00 ? 20  ALA A HA   5  
ATOM 7288  H HB1  . ALA A 1 20  ? 3.452   12.103  4.533   1.00 0.00 ? 20  ALA A HB1  5  
ATOM 7289  H HB2  . ALA A 1 20  ? 4.371   11.761  5.999   1.00 0.00 ? 20  ALA A HB2  5  
ATOM 7290  H HB3  . ALA A 1 20  ? 4.984   12.928  4.827   1.00 0.00 ? 20  ALA A HB3  5  
ATOM 7291  N N    . PRO A 1 21  ? 3.397   9.348   3.607   1.00 0.00 ? 21  PRO A N    5  
ATOM 7292  C CA   . PRO A 1 21  ? 2.465   8.653   2.714   1.00 0.00 ? 21  PRO A CA   5  
ATOM 7293  C C    . PRO A 1 21  ? 1.391   9.583   2.161   1.00 0.00 ? 21  PRO A C    5  
ATOM 7294  O O    . PRO A 1 21  ? 0.828   10.414  2.873   1.00 0.00 ? 21  PRO A O    5  
ATOM 7295  C CB   . PRO A 1 21  ? 1.838   7.587   3.616   1.00 0.00 ? 21  PRO A CB   5  
ATOM 7296  C CG   . PRO A 1 21  ? 1.960   8.138   4.995   1.00 0.00 ? 21  PRO A CG   5  
ATOM 7297  C CD   . PRO A 1 21  ? 3.235   8.935   5.011   1.00 0.00 ? 21  PRO A CD   5  
ATOM 7298  H HA   . PRO A 1 21  ? 2.983   8.175   1.895   1.00 0.00 ? 21  PRO A HA   5  
ATOM 7299  H HB2  . PRO A 1 21  ? 0.803   7.441   3.338   1.00 0.00 ? 21  PRO A HB2  5  
ATOM 7300  H HB3  . PRO A 1 21  ? 2.379   6.659   3.513   1.00 0.00 ? 21  PRO A HB3  5  
ATOM 7301  H HG2  . PRO A 1 21  ? 1.116   8.776   5.211   1.00 0.00 ? 21  PRO A HG2  5  
ATOM 7302  H HG3  . PRO A 1 21  ? 2.014   7.330   5.709   1.00 0.00 ? 21  PRO A HG3  5  
ATOM 7303  H HD2  . PRO A 1 21  ? 3.135   9.794   5.657   1.00 0.00 ? 21  PRO A HD2  5  
ATOM 7304  H HD3  . PRO A 1 21  ? 4.062   8.316   5.328   1.00 0.00 ? 21  PRO A HD3  5  
ATOM 7305  N N    . PRO A 1 22  ? 1.097   9.441   0.860   1.00 0.00 ? 22  PRO A N    5  
ATOM 7306  C CA   . PRO A 1 22  ? 0.087   10.259  0.182   1.00 0.00 ? 22  PRO A CA   5  
ATOM 7307  C C    . PRO A 1 22  ? -1.330  9.927   0.639   1.00 0.00 ? 22  PRO A C    5  
ATOM 7308  O O    . PRO A 1 22  ? -1.596  8.858   1.190   1.00 0.00 ? 22  PRO A O    5  
ATOM 7309  C CB   . PRO A 1 22  ? 0.270   9.899   -1.294  1.00 0.00 ? 22  PRO A CB   5  
ATOM 7310  C CG   . PRO A 1 22  ? 0.865   8.533   -1.280  1.00 0.00 ? 22  PRO A CG   5  
ATOM 7311  C CD   . PRO A 1 22  ? 1.728   8.470   -0.050  1.00 0.00 ? 22  PRO A CD   5  
ATOM 7312  H HA   . PRO A 1 22  ? 0.271   11.314  0.323   1.00 0.00 ? 22  PRO A HA   5  
ATOM 7313  H HB2  . PRO A 1 22  ? -0.689  9.908   -1.791  1.00 0.00 ? 22  PRO A HB2  5  
ATOM 7314  H HB3  . PRO A 1 22  ? 0.932   10.612  -1.762  1.00 0.00 ? 22  PRO A HB3  5  
ATOM 7315  H HG2  . PRO A 1 22  ? 0.082   7.792   -1.227  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 7316  H HG3  . PRO A 1 22  ? 1.465   8.385   -2.166  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 7317  H HD2  . PRO A 1 22  ? 1.710   7.477   0.373   1.00 0.00 ? 22  PRO A HD2  5  
ATOM 7318  H HD3  . PRO A 1 22  ? 2.741   8.764   -0.284  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 7319  N N    . PRO A 1 23  ? -2.262  10.862  0.407   1.00 0.00 ? 23  PRO A N    5  
ATOM 7320  C CA   . PRO A 1 23  ? -3.668  10.691  0.786   1.00 0.00 ? 23  PRO A CA   5  
ATOM 7321  C C    . PRO A 1 23  ? -4.373  9.638   -0.063  1.00 0.00 ? 23  PRO A C    5  
ATOM 7322  O O    . PRO A 1 23  ? -4.692  9.877   -1.227  1.00 0.00 ? 23  PRO A O    5  
ATOM 7323  C CB   . PRO A 1 23  ? -4.274  12.074  0.534   1.00 0.00 ? 23  PRO A CB   5  
ATOM 7324  C CG   . PRO A 1 23  ? -3.400  12.688  -0.504  1.00 0.00 ? 23  PRO A CG   5  
ATOM 7325  C CD   . PRO A 1 23  ? -2.016  12.160  -0.245  1.00 0.00 ? 23  PRO A CD   5  
ATOM 7326  H HA   . PRO A 1 23  ? -3.769  10.436  1.831   1.00 0.00 ? 23  PRO A HA   5  
ATOM 7327  H HB2  . PRO A 1 23  ? -5.291  11.965  0.182   1.00 0.00 ? 23  PRO A HB2  5  
ATOM 7328  H HB3  . PRO A 1 23  ? -4.263  12.647  1.449   1.00 0.00 ? 23  PRO A HB3  5  
ATOM 7329  H HG2  . PRO A 1 23  ? -3.736  12.394  -1.487  1.00 0.00 ? 23  PRO A HG2  5  
ATOM 7330  H HG3  . PRO A 1 23  ? -3.415  13.763  -0.407  1.00 0.00 ? 23  PRO A HG3  5  
ATOM 7331  H HD2  . PRO A 1 23  ? -1.482  12.029  -1.175  1.00 0.00 ? 23  PRO A HD2  5  
ATOM 7332  H HD3  . PRO A 1 23  ? -1.476  12.825  0.413   1.00 0.00 ? 23  PRO A HD3  5  
ATOM 7333  N N    . ILE A 1 24  ? -4.613  8.472   0.529   1.00 0.00 ? 24  ILE A N    5  
ATOM 7334  C CA   . ILE A 1 24  ? -5.281  7.384   -0.173  1.00 0.00 ? 24  ILE A CA   5  
ATOM 7335  C C    . ILE A 1 24  ? -6.416  7.908   -1.046  1.00 0.00 ? 24  ILE A C    5  
ATOM 7336  O O    . ILE A 1 24  ? -7.178  8.791   -0.653  1.00 0.00 ? 24  ILE A O    5  
ATOM 7337  C CB   . ILE A 1 24  ? -5.845  6.342   0.811   1.00 0.00 ? 24  ILE A CB   5  
ATOM 7338  C CG1  . ILE A 1 24  ? -4.716  5.733   1.645   1.00 0.00 ? 24  ILE A CG1  5  
ATOM 7339  C CG2  . ILE A 1 24  ? -6.599  5.256   0.058   1.00 0.00 ? 24  ILE A CG2  5  
ATOM 7340  C CD1  . ILE A 1 24  ? -5.194  5.077   2.922   1.00 0.00 ? 24  ILE A CD1  5  
ATOM 7341  H H    . ILE A 1 24  ? -4.334  8.342   1.459   1.00 0.00 ? 24  ILE A H    5  
ATOM 7342  H HA   . ILE A 1 24  ? -4.552  6.896   -0.803  1.00 0.00 ? 24  ILE A HA   5  
ATOM 7343  H HB   . ILE A 1 24  ? -6.541  6.840   1.469   1.00 0.00 ? 24  ILE A HB   5  
ATOM 7344  H HG12 . ILE A 1 24  ? -4.207  4.984   1.059   1.00 0.00 ? 24  ILE A HG12 5  
ATOM 7345  H HG13 . ILE A 1 24  ? -4.016  6.512   1.913   1.00 0.00 ? 24  ILE A HG13 5  
ATOM 7346  H HG21 . ILE A 1 24  ? -7.273  4.750   0.735   1.00 0.00 ? 24  ILE A HG21 5  
ATOM 7347  H HG22 . ILE A 1 24  ? -7.166  5.703   -0.745  1.00 0.00 ? 24  ILE A HG22 5  
ATOM 7348  H HG23 . ILE A 1 24  ? -5.896  4.545   -0.349  1.00 0.00 ? 24  ILE A HG23 5  
ATOM 7349  H HD11 . ILE A 1 24  ? -6.227  5.342   3.098   1.00 0.00 ? 24  ILE A HD11 5  
ATOM 7350  H HD12 . ILE A 1 24  ? -5.110  4.005   2.830   1.00 0.00 ? 24  ILE A HD12 5  
ATOM 7351  H HD13 . ILE A 1 24  ? -4.590  5.417   3.750   1.00 0.00 ? 24  ILE A HD13 5  
ATOM 7352  N N    . PRO A 1 25  ? -6.535  7.349   -2.260  1.00 0.00 ? 25  PRO A N    5  
ATOM 7353  C CA   . PRO A 1 25  ? -7.576  7.743   -3.214  1.00 0.00 ? 25  PRO A CA   5  
ATOM 7354  C C    . PRO A 1 25  ? -8.966  7.304   -2.769  1.00 0.00 ? 25  PRO A C    5  
ATOM 7355  O O    . PRO A 1 25  ? -9.125  6.678   -1.720  1.00 0.00 ? 25  PRO A O    5  
ATOM 7356  C CB   . PRO A 1 25  ? -7.172  7.017   -4.500  1.00 0.00 ? 25  PRO A CB   5  
ATOM 7357  C CG   . PRO A 1 25  ? -6.379  5.843   -4.038  1.00 0.00 ? 25  PRO A CG   5  
ATOM 7358  C CD   . PRO A 1 25  ? -5.662  6.291   -2.795  1.00 0.00 ? 25  PRO A CD   5  
ATOM 7359  H HA   . PRO A 1 25  ? -7.574  8.810   -3.386  1.00 0.00 ? 25  PRO A HA   5  
ATOM 7360  H HB2  . PRO A 1 25  ? -8.058  6.709   -5.036  1.00 0.00 ? 25  PRO A HB2  5  
ATOM 7361  H HB3  . PRO A 1 25  ? -6.580  7.674   -5.118  1.00 0.00 ? 25  PRO A HB3  5  
ATOM 7362  H HG2  . PRO A 1 25  ? -7.039  5.019   -3.815  1.00 0.00 ? 25  PRO A HG2  5  
ATOM 7363  H HG3  . PRO A 1 25  ? -5.667  5.559   -4.799  1.00 0.00 ? 25  PRO A HG3  5  
ATOM 7364  H HD2  . PRO A 1 25  ? -5.574  5.473   -2.095  1.00 0.00 ? 25  PRO A HD2  5  
ATOM 7365  H HD3  . PRO A 1 25  ? -4.687  6.684   -3.042  1.00 0.00 ? 25  PRO A HD3  5  
ATOM 7366  N N    . LYS A 1 26  ? -9.972  7.635   -3.572  1.00 0.00 ? 26  LYS A N    5  
ATOM 7367  C CA   . LYS A 1 26  ? -11.350 7.273   -3.262  1.00 0.00 ? 26  LYS A CA   5  
ATOM 7368  C C    . LYS A 1 26  ? -11.648 5.842   -3.697  1.00 0.00 ? 26  LYS A C    5  
ATOM 7369  O O    . LYS A 1 26  ? -11.674 5.540   -4.889  1.00 0.00 ? 26  LYS A O    5  
ATOM 7370  C CB   . LYS A 1 26  ? -12.319 8.239   -3.949  1.00 0.00 ? 26  LYS A CB   5  
ATOM 7371  C CG   . LYS A 1 26  ? -13.762 8.071   -3.505  1.00 0.00 ? 26  LYS A CG   5  
ATOM 7372  C CD   . LYS A 1 26  ? -14.512 7.100   -4.401  1.00 0.00 ? 26  LYS A CD   5  
ATOM 7373  C CE   . LYS A 1 26  ? -15.189 7.819   -5.558  1.00 0.00 ? 26  LYS A CE   5  
ATOM 7374  N NZ   . LYS A 1 26  ? -16.057 6.903   -6.349  1.00 0.00 ? 26  LYS A NZ   5  
ATOM 7375  H H    . LYS A 1 26  ? -9.782  8.134   -4.394  1.00 0.00 ? 26  LYS A H    5  
ATOM 7376  H HA   . LYS A 1 26  ? -11.480 7.346   -2.193  1.00 0.00 ? 26  LYS A HA   5  
ATOM 7377  H HB2  . LYS A 1 26  ? -12.013 9.252   -3.732  1.00 0.00 ? 26  LYS A HB2  5  
ATOM 7378  H HB3  . LYS A 1 26  ? -12.272 8.078   -5.016  1.00 0.00 ? 26  LYS A HB3  5  
ATOM 7379  H HG2  . LYS A 1 26  ? -13.776 7.694   -2.493  1.00 0.00 ? 26  LYS A HG2  5  
ATOM 7380  H HG3  . LYS A 1 26  ? -14.253 9.033   -3.540  1.00 0.00 ? 26  LYS A HG3  5  
ATOM 7381  H HD2  . LYS A 1 26  ? -13.814 6.379   -4.800  1.00 0.00 ? 26  LYS A HD2  5  
ATOM 7382  H HD3  . LYS A 1 26  ? -15.264 6.590   -3.816  1.00 0.00 ? 26  LYS A HD3  5  
ATOM 7383  H HE2  . LYS A 1 26  ? -15.793 8.621   -5.162  1.00 0.00 ? 26  LYS A HE2  5  
ATOM 7384  H HE3  . LYS A 1 26  ? -14.427 8.229   -6.205  1.00 0.00 ? 26  LYS A HE3  5  
ATOM 7385  H HZ1  . LYS A 1 26  ? -16.607 6.293   -5.712  1.00 0.00 ? 26  LYS A HZ1  5  
ATOM 7386  H HZ2  . LYS A 1 26  ? -15.473 6.304   -6.967  1.00 0.00 ? 26  LYS A HZ2  5  
ATOM 7387  H HZ3  . LYS A 1 26  ? -16.713 7.453   -6.938  1.00 0.00 ? 26  LYS A HZ3  5  
ATOM 7388  N N    . GLU A 1 27  ? -11.873 4.967   -2.722  1.00 0.00 ? 27  GLU A N    5  
ATOM 7389  C CA   . GLU A 1 27  ? -12.170 3.568   -3.006  1.00 0.00 ? 27  GLU A CA   5  
ATOM 7390  C C    . GLU A 1 27  ? -13.033 3.438   -4.258  1.00 0.00 ? 27  GLU A C    5  
ATOM 7391  O O    . GLU A 1 27  ? -13.958 4.217   -4.488  1.00 0.00 ? 27  GLU A O    5  
ATOM 7392  C CB   . GLU A 1 27  ? -12.880 2.922   -1.815  1.00 0.00 ? 27  GLU A CB   5  
ATOM 7393  C CG   . GLU A 1 27  ? -11.933 2.446   -0.727  1.00 0.00 ? 27  GLU A CG   5  
ATOM 7394  C CD   . GLU A 1 27  ? -12.568 2.465   0.650   1.00 0.00 ? 27  GLU A CD   5  
ATOM 7395  O OE1  . GLU A 1 27  ? -13.598 1.783   0.838   1.00 0.00 ? 27  GLU A OE1  5  
ATOM 7396  O OE2  . GLU A 1 27  ? -12.036 3.162   1.539   1.00 0.00 ? 27  GLU A OE2  5  
ATOM 7397  H H    . GLU A 1 27  ? -11.838 5.269   -1.791  1.00 0.00 ? 27  GLU A H    5  
ATOM 7398  H HA   . GLU A 1 27  ? -11.234 3.058   -3.175  1.00 0.00 ? 27  GLU A HA   5  
ATOM 7399  H HB2  . GLU A 1 27  ? -13.560 3.641   -1.383  1.00 0.00 ? 27  GLU A HB2  5  
ATOM 7400  H HB3  . GLU A 1 27  ? -13.446 2.072   -2.167  1.00 0.00 ? 27  GLU A HB3  5  
ATOM 7401  H HG2  . GLU A 1 27  ? -11.626 1.435   -0.950  1.00 0.00 ? 27  GLU A HG2  5  
ATOM 7402  H HG3  . GLU A 1 27  ? -11.065 3.089   -0.715  1.00 0.00 ? 27  GLU A HG3  5  
ATOM 7403  N N    . PRO A 1 28  ? -12.724 2.430   -5.087  1.00 0.00 ? 28  PRO A N    5  
ATOM 7404  C CA   . PRO A 1 28  ? -13.459 2.174   -6.330  1.00 0.00 ? 28  PRO A CA   5  
ATOM 7405  C C    . PRO A 1 28  ? -14.871 1.659   -6.073  1.00 0.00 ? 28  PRO A C    5  
ATOM 7406  O O    . PRO A 1 28  ? -15.149 1.080   -5.023  1.00 0.00 ? 28  PRO A O    5  
ATOM 7407  C CB   . PRO A 1 28  ? -12.617 1.101   -7.025  1.00 0.00 ? 28  PRO A CB   5  
ATOM 7408  C CG   . PRO A 1 28  ? -11.894 0.412   -5.920  1.00 0.00 ? 28  PRO A CG   5  
ATOM 7409  C CD   . PRO A 1 28  ? -11.634 1.463   -4.876  1.00 0.00 ? 28  PRO A CD   5  
ATOM 7410  H HA   . PRO A 1 28  ? -13.506 3.056   -6.952  1.00 0.00 ? 28  PRO A HA   5  
ATOM 7411  H HB2  . PRO A 1 28  ? -13.266 0.421   -7.558  1.00 0.00 ? 28  PRO A HB2  5  
ATOM 7412  H HB3  . PRO A 1 28  ? -11.931 1.568   -7.715  1.00 0.00 ? 28  PRO A HB3  5  
ATOM 7413  H HG2  . PRO A 1 28  ? -12.510 -0.376  -5.513  1.00 0.00 ? 28  PRO A HG2  5  
ATOM 7414  H HG3  . PRO A 1 28  ? -10.961 0.010   -6.286  1.00 0.00 ? 28  PRO A HG3  5  
ATOM 7415  H HD2  . PRO A 1 28  ? -11.687 1.033   -3.887  1.00 0.00 ? 28  PRO A HD2  5  
ATOM 7416  H HD3  . PRO A 1 28  ? -10.672 1.926   -5.038  1.00 0.00 ? 28  PRO A HD3  5  
ATOM 7417  N N    . SER A 1 29  ? -15.760 1.875   -7.038  1.00 0.00 ? 29  SER A N    5  
ATOM 7418  C CA   . SER A 1 29  ? -17.144 1.435   -6.914  1.00 0.00 ? 29  SER A CA   5  
ATOM 7419  C C    . SER A 1 29  ? -17.598 0.705   -8.175  1.00 0.00 ? 29  SER A C    5  
ATOM 7420  O O    . SER A 1 29  ? -16.868 0.638   -9.162  1.00 0.00 ? 29  SER A O    5  
ATOM 7421  C CB   . SER A 1 29  ? -18.059 2.632   -6.647  1.00 0.00 ? 29  SER A CB   5  
ATOM 7422  O OG   . SER A 1 29  ? -18.068 3.523   -7.748  1.00 0.00 ? 29  SER A OG   5  
ATOM 7423  H H    . SER A 1 29  ? -15.477 2.343   -7.851  1.00 0.00 ? 29  SER A H    5  
ATOM 7424  H HA   . SER A 1 29  ? -17.203 0.755   -6.077  1.00 0.00 ? 29  SER A HA   5  
ATOM 7425  H HB2  . SER A 1 29  ? -19.066 2.281   -6.475  1.00 0.00 ? 29  SER A HB2  5  
ATOM 7426  H HB3  . SER A 1 29  ? -17.709 3.161   -5.773  1.00 0.00 ? 29  SER A HB3  5  
ATOM 7427  H HG   . SER A 1 29  ? -18.953 3.876   -7.868  1.00 0.00 ? 29  SER A HG   5  
ATOM 7428  N N    . ASN A 1 30  ? -18.809 0.160   -8.132  1.00 0.00 ? 30  ASN A N    5  
ATOM 7429  C CA   . ASN A 1 30  ? -19.361 -0.566  -9.270  1.00 0.00 ? 30  ASN A CA   5  
ATOM 7430  C C    . ASN A 1 30  ? -18.322 -1.509  -9.869  1.00 0.00 ? 30  ASN A C    5  
ATOM 7431  O O    . ASN A 1 30  ? -18.220 -1.642  -11.089 1.00 0.00 ? 30  ASN A O    5  
ATOM 7432  C CB   . ASN A 1 30  ? -19.852 0.414   -10.337 1.00 0.00 ? 30  ASN A CB   5  
ATOM 7433  C CG   . ASN A 1 30  ? -21.181 1.047   -9.972  1.00 0.00 ? 30  ASN A CG   5  
ATOM 7434  O OD1  . ASN A 1 30  ? -22.020 0.424   -9.321  1.00 0.00 ? 30  ASN A OD1  5  
ATOM 7435  N ND2  . ASN A 1 30  ? -21.378 2.292   -10.391 1.00 0.00 ? 30  ASN A ND2  5  
ATOM 7436  H H    . ASN A 1 30  ? -19.344 0.247   -7.315  1.00 0.00 ? 30  ASN A H    5  
ATOM 7437  H HA   . ASN A 1 30  ? -20.198 -1.150  -8.917  1.00 0.00 ? 30  ASN A HA   5  
ATOM 7438  H HB2  . ASN A 1 30  ? -19.122 1.201   -10.458 1.00 0.00 ? 30  ASN A HB2  5  
ATOM 7439  H HB3  . ASN A 1 30  ? -19.969 -0.111  -11.273 1.00 0.00 ? 30  ASN A HB3  5  
ATOM 7440  H HD21 . ASN A 1 30  ? -20.665 2.725   -10.906 1.00 0.00 ? 30  ASN A HD21 5  
ATOM 7441  H HD22 . ASN A 1 30  ? -22.228 2.725   -10.169 1.00 0.00 ? 30  ASN A HD22 5  
ATOM 7442  N N    . TYR A 1 31  ? -17.553 -2.161  -9.004  1.00 0.00 ? 31  TYR A N    5  
ATOM 7443  C CA   . TYR A 1 31  ? -16.521 -3.090  -9.447  1.00 0.00 ? 31  TYR A CA   5  
ATOM 7444  C C    . TYR A 1 31  ? -16.976 -3.861  -10.683 1.00 0.00 ? 31  TYR A C    5  
ATOM 7445  O O    . TYR A 1 31  ? -18.123 -4.299  -10.768 1.00 0.00 ? 31  TYR A O    5  
ATOM 7446  C CB   . TYR A 1 31  ? -16.168 -4.067  -8.325  1.00 0.00 ? 31  TYR A CB   5  
ATOM 7447  C CG   . TYR A 1 31  ? -15.725 -3.388  -7.048  1.00 0.00 ? 31  TYR A CG   5  
ATOM 7448  C CD1  . TYR A 1 31  ? -16.654 -2.924  -6.126  1.00 0.00 ? 31  TYR A CD1  5  
ATOM 7449  C CD2  . TYR A 1 31  ? -14.376 -3.213  -6.765  1.00 0.00 ? 31  TYR A CD2  5  
ATOM 7450  C CE1  . TYR A 1 31  ? -16.253 -2.302  -4.959  1.00 0.00 ? 31  TYR A CE1  5  
ATOM 7451  C CE2  . TYR A 1 31  ? -13.965 -2.594  -5.600  1.00 0.00 ? 31  TYR A CE2  5  
ATOM 7452  C CZ   . TYR A 1 31  ? -14.908 -2.140  -4.700  1.00 0.00 ? 31  TYR A CZ   5  
ATOM 7453  O OH   . TYR A 1 31  ? -14.504 -1.523  -3.539  1.00 0.00 ? 31  TYR A OH   5  
ATOM 7454  H H    . TYR A 1 31  ? -17.682 -2.013  -8.044  1.00 0.00 ? 31  TYR A H    5  
ATOM 7455  H HA   . TYR A 1 31  ? -15.642 -2.514  -9.699  1.00 0.00 ? 31  TYR A HA   5  
ATOM 7456  H HB2  . TYR A 1 31  ? -17.034 -4.669  -8.095  1.00 0.00 ? 31  TYR A HB2  5  
ATOM 7457  H HB3  . TYR A 1 31  ? -15.365 -4.710  -8.655  1.00 0.00 ? 31  TYR A HB3  5  
ATOM 7458  H HD1  . TYR A 1 31  ? -17.707 -3.053  -6.332  1.00 0.00 ? 31  TYR A HD1  5  
ATOM 7459  H HD2  . TYR A 1 31  ? -13.640 -3.570  -7.471  1.00 0.00 ? 31  TYR A HD2  5  
ATOM 7460  H HE1  . TYR A 1 31  ? -16.990 -1.947  -4.255  1.00 0.00 ? 31  TYR A HE1  5  
ATOM 7461  H HE2  . TYR A 1 31  ? -12.912 -2.466  -5.397  1.00 0.00 ? 31  TYR A HE2  5  
ATOM 7462  H HH   . TYR A 1 31  ? -14.080 -2.166  -2.966  1.00 0.00 ? 31  TYR A HH   5  
ATOM 7463  N N    . ASP A 1 32  ? -16.067 -4.023  -11.639 1.00 0.00 ? 32  ASP A N    5  
ATOM 7464  C CA   . ASP A 1 32  ? -16.372 -4.742  -12.870 1.00 0.00 ? 32  ASP A CA   5  
ATOM 7465  C C    . ASP A 1 32  ? -16.688 -6.206  -12.580 1.00 0.00 ? 32  ASP A C    5  
ATOM 7466  O O    . ASP A 1 32  ? -17.750 -6.708  -12.949 1.00 0.00 ? 32  ASP A O    5  
ATOM 7467  C CB   . ASP A 1 32  ? -15.200 -4.644  -13.847 1.00 0.00 ? 32  ASP A CB   5  
ATOM 7468  C CG   . ASP A 1 32  ? -15.499 -5.304  -15.179 1.00 0.00 ? 32  ASP A CG   5  
ATOM 7469  O OD1  . ASP A 1 32  ? -16.368 -4.790  -15.914 1.00 0.00 ? 32  ASP A OD1  5  
ATOM 7470  O OD2  . ASP A 1 32  ? -14.864 -6.334  -15.485 1.00 0.00 ? 32  ASP A OD2  5  
ATOM 7471  H H    . ASP A 1 32  ? -15.169 -3.650  -11.512 1.00 0.00 ? 32  ASP A H    5  
ATOM 7472  H HA   . ASP A 1 32  ? -17.241 -4.281  -13.316 1.00 0.00 ? 32  ASP A HA   5  
ATOM 7473  H HB2  . ASP A 1 32  ? -14.975 -3.602  -14.026 1.00 0.00 ? 32  ASP A HB2  5  
ATOM 7474  H HB3  . ASP A 1 32  ? -14.336 -5.125  -13.413 1.00 0.00 ? 32  ASP A HB3  5  
ATOM 7475  N N    . PHE A 1 33  ? -15.758 -6.887  -11.918 1.00 0.00 ? 33  PHE A N    5  
ATOM 7476  C CA   . PHE A 1 33  ? -15.936 -8.294  -11.581 1.00 0.00 ? 33  PHE A CA   5  
ATOM 7477  C C    . PHE A 1 33  ? -17.035 -8.468  -10.537 1.00 0.00 ? 33  PHE A C    5  
ATOM 7478  O O    . PHE A 1 33  ? -17.395 -7.523  -9.835  1.00 0.00 ? 33  PHE A O    5  
ATOM 7479  C CB   . PHE A 1 33  ? -14.624 -8.885  -11.060 1.00 0.00 ? 33  PHE A CB   5  
ATOM 7480  C CG   . PHE A 1 33  ? -13.871 -7.961  -10.147 1.00 0.00 ? 33  PHE A CG   5  
ATOM 7481  C CD1  . PHE A 1 33  ? -14.315 -7.730  -8.855  1.00 0.00 ? 33  PHE A CD1  5  
ATOM 7482  C CD2  . PHE A 1 33  ? -12.719 -7.325  -10.579 1.00 0.00 ? 33  PHE A CD2  5  
ATOM 7483  C CE1  . PHE A 1 33  ? -13.625 -6.879  -8.012  1.00 0.00 ? 33  PHE A CE1  5  
ATOM 7484  C CE2  . PHE A 1 33  ? -12.024 -6.474  -9.741  1.00 0.00 ? 33  PHE A CE2  5  
ATOM 7485  C CZ   . PHE A 1 33  ? -12.477 -6.252  -8.455  1.00 0.00 ? 33  PHE A CZ   5  
ATOM 7486  H H    . PHE A 1 33  ? -14.932 -6.431  -11.651 1.00 0.00 ? 33  PHE A H    5  
ATOM 7487  H HA   . PHE A 1 33  ? -16.224 -8.816  -12.480 1.00 0.00 ? 33  PHE A HA   5  
ATOM 7488  H HB2  . PHE A 1 33  ? -14.838 -9.791  -10.513 1.00 0.00 ? 33  PHE A HB2  5  
ATOM 7489  H HB3  . PHE A 1 33  ? -13.985 -9.119  -11.899 1.00 0.00 ? 33  PHE A HB3  5  
ATOM 7490  H HD1  . PHE A 1 33  ? -15.212 -8.221  -8.506  1.00 0.00 ? 33  PHE A HD1  5  
ATOM 7491  H HD2  . PHE A 1 33  ? -12.363 -7.499  -11.585 1.00 0.00 ? 33  PHE A HD2  5  
ATOM 7492  H HE1  . PHE A 1 33  ? -13.981 -6.707  -7.007  1.00 0.00 ? 33  PHE A HE1  5  
ATOM 7493  H HE2  . PHE A 1 33  ? -11.127 -5.985  -10.091 1.00 0.00 ? 33  PHE A HE2  5  
ATOM 7494  H HZ   . PHE A 1 33  ? -11.936 -5.586  -7.799  1.00 0.00 ? 33  PHE A HZ   5  
ATOM 7495  N N    . SER A 1 34  ? -17.565 -9.684  -10.441 1.00 0.00 ? 34  SER A N    5  
ATOM 7496  C CA   . SER A 1 34  ? -18.626 -9.982  -9.487  1.00 0.00 ? 34  SER A CA   5  
ATOM 7497  C C    . SER A 1 34  ? -18.136 -10.950 -8.414  1.00 0.00 ? 34  SER A C    5  
ATOM 7498  O O    . SER A 1 34  ? -18.372 -12.154 -8.493  1.00 0.00 ? 34  SER A O    5  
ATOM 7499  C CB   . SER A 1 34  ? -19.838 -10.575 -10.208 1.00 0.00 ? 34  SER A CB   5  
ATOM 7500  O OG   . SER A 1 34  ? -20.275 -9.725  -11.254 1.00 0.00 ? 34  SER A OG   5  
ATOM 7501  H H    . SER A 1 34  ? -17.235 -10.396 -11.029 1.00 0.00 ? 34  SER A H    5  
ATOM 7502  H HA   . SER A 1 34  ? -18.917 -9.056  -9.014  1.00 0.00 ? 34  SER A HA   5  
ATOM 7503  H HB2  . SER A 1 34  ? -19.571 -11.533 -10.627 1.00 0.00 ? 34  SER A HB2  5  
ATOM 7504  H HB3  . SER A 1 34  ? -20.646 -10.703 -9.503  1.00 0.00 ? 34  SER A HB3  5  
ATOM 7505  H HG   . SER A 1 34  ? -20.724 -8.963  -10.881 1.00 0.00 ? 34  SER A HG   5  
ATOM 7506  N N    . GLY A 1 35  ? -17.450 -10.412 -7.409  1.00 0.00 ? 35  GLY A N    5  
ATOM 7507  C CA   . GLY A 1 35  ? -16.936 -11.240 -6.334  1.00 0.00 ? 35  GLY A CA   5  
ATOM 7508  C C    . GLY A 1 35  ? -18.040 -11.921 -5.549  1.00 0.00 ? 35  GLY A C    5  
ATOM 7509  O O    . GLY A 1 35  ? -19.226 -11.750 -5.829  1.00 0.00 ? 35  GLY A O    5  
ATOM 7510  H H    . GLY A 1 35  ? -17.292 -9.444  -7.398  1.00 0.00 ? 35  GLY A H    5  
ATOM 7511  H HA2  . GLY A 1 35  ? -16.289 -11.995 -6.754  1.00 0.00 ? 35  GLY A HA2  5  
ATOM 7512  H HA3  . GLY A 1 35  ? -16.361 -10.621 -5.662  1.00 0.00 ? 35  GLY A HA3  5  
ATOM 7513  N N    . PRO A 1 36  ? -17.650 -12.714 -4.540  1.00 0.00 ? 36  PRO A N    5  
ATOM 7514  C CA   . PRO A 1 36  ? -18.600 -13.440 -3.692  1.00 0.00 ? 36  PRO A CA   5  
ATOM 7515  C C    . PRO A 1 36  ? -19.394 -12.508 -2.782  1.00 0.00 ? 36  PRO A C    5  
ATOM 7516  O O    . PRO A 1 36  ? -20.620 -12.597 -2.705  1.00 0.00 ? 36  PRO A O    5  
ATOM 7517  C CB   . PRO A 1 36  ? -17.703 -14.361 -2.861  1.00 0.00 ? 36  PRO A CB   5  
ATOM 7518  C CG   . PRO A 1 36  ? -16.381 -13.674 -2.831  1.00 0.00 ? 36  PRO A CG   5  
ATOM 7519  C CD   . PRO A 1 36  ? -16.253 -12.964 -4.149  1.00 0.00 ? 36  PRO A CD   5  
ATOM 7520  H HA   . PRO A 1 36  ? -19.283 -14.035 -4.280  1.00 0.00 ? 36  PRO A HA   5  
ATOM 7521  H HB2  . PRO A 1 36  ? -18.115 -14.470 -1.868  1.00 0.00 ? 36  PRO A HB2  5  
ATOM 7522  H HB3  . PRO A 1 36  ? -17.634 -15.328 -3.337  1.00 0.00 ? 36  PRO A HB3  5  
ATOM 7523  H HG2  . PRO A 1 36  ? -16.355 -12.964 -2.018  1.00 0.00 ? 36  PRO A HG2  5  
ATOM 7524  H HG3  . PRO A 1 36  ? -15.592 -14.403 -2.720  1.00 0.00 ? 36  PRO A HG3  5  
ATOM 7525  H HD2  . PRO A 1 36  ? -15.715 -12.035 -4.027  1.00 0.00 ? 36  PRO A HD2  5  
ATOM 7526  H HD3  . PRO A 1 36  ? -15.758 -13.596 -4.872  1.00 0.00 ? 36  PRO A HD3  5  
ATOM 7527  N N    . SER A 1 37  ? -18.688 -11.616 -2.096  1.00 0.00 ? 37  SER A N    5  
ATOM 7528  C CA   . SER A 1 37  ? -19.328 -10.670 -1.189  1.00 0.00 ? 37  SER A CA   5  
ATOM 7529  C C    . SER A 1 37  ? -18.940 -9.236  -1.538  1.00 0.00 ? 37  SER A C    5  
ATOM 7530  O O    . SER A 1 37  ? -17.877 -8.755  -1.144  1.00 0.00 ? 37  SER A O    5  
ATOM 7531  C CB   . SER A 1 37  ? -18.940 -10.977 0.259   1.00 0.00 ? 37  SER A CB   5  
ATOM 7532  O OG   . SER A 1 37  ? -19.963 -10.583 1.156   1.00 0.00 ? 37  SER A OG   5  
ATOM 7533  H H    . SER A 1 37  ? -17.714 -11.595 -2.200  1.00 0.00 ? 37  SER A H    5  
ATOM 7534  H HA   . SER A 1 37  ? -20.397 -10.778 -1.297  1.00 0.00 ? 37  SER A HA   5  
ATOM 7535  H HB2  . SER A 1 37  ? -18.773 -12.038 0.367   1.00 0.00 ? 37  SER A HB2  5  
ATOM 7536  H HB3  . SER A 1 37  ? -18.034 -10.442 0.507   1.00 0.00 ? 37  SER A HB3  5  
ATOM 7537  H HG   . SER A 1 37  ? -19.763 -9.713  1.509   1.00 0.00 ? 37  SER A HG   5  
ATOM 7538  N N    . SER A 1 38  ? -19.810 -8.558  -2.279  1.00 0.00 ? 38  SER A N    5  
ATOM 7539  C CA   . SER A 1 38  ? -19.559 -7.180  -2.686  1.00 0.00 ? 38  SER A CA   5  
ATOM 7540  C C    . SER A 1 38  ? -19.240 -6.307  -1.476  1.00 0.00 ? 38  SER A C    5  
ATOM 7541  O O    . SER A 1 38  ? -18.324 -5.487  -1.512  1.00 0.00 ? 38  SER A O    5  
ATOM 7542  C CB   . SER A 1 38  ? -20.770 -6.617  -3.431  1.00 0.00 ? 38  SER A CB   5  
ATOM 7543  O OG   . SER A 1 38  ? -20.655 -5.215  -3.605  1.00 0.00 ? 38  SER A OG   5  
ATOM 7544  H H    . SER A 1 38  ? -20.640 -8.997  -2.562  1.00 0.00 ? 38  SER A H    5  
ATOM 7545  H HA   . SER A 1 38  ? -18.706 -7.181  -3.349  1.00 0.00 ? 38  SER A HA   5  
ATOM 7546  H HB2  . SER A 1 38  ? -20.841 -7.083  -4.402  1.00 0.00 ? 38  SER A HB2  5  
ATOM 7547  H HB3  . SER A 1 38  ? -21.666 -6.825  -2.865  1.00 0.00 ? 38  SER A HB3  5  
ATOM 7548  H HG   . SER A 1 38  ? -21.236 -4.767  -2.987  1.00 0.00 ? 38  SER A HG   5  
ATOM 7549  N N    . GLY A 1 39  ? -20.005 -6.490  -0.404  1.00 0.00 ? 39  GLY A N    5  
ATOM 7550  C CA   . GLY A 1 39  ? -19.790 -5.712  0.802   1.00 0.00 ? 39  GLY A CA   5  
ATOM 7551  C C    . GLY A 1 39  ? -20.657 -6.178  1.955   1.00 0.00 ? 39  GLY A C    5  
ATOM 7552  O O    . GLY A 1 39  ? -20.877 -7.377  2.130   1.00 0.00 ? 39  GLY A O    5  
ATOM 7553  H H    . GLY A 1 39  ? -20.721 -7.158  -0.432  1.00 0.00 ? 39  GLY A H    5  
ATOM 7554  H HA2  . GLY A 1 39  ? -18.752 -5.794  1.090   1.00 0.00 ? 39  GLY A HA2  5  
ATOM 7555  H HA3  . GLY A 1 39  ? -20.015 -4.677  0.594   1.00 0.00 ? 39  GLY A HA3  5  
ATOM 7556  N N    . ILE A 1 40  ? -21.150 -5.229  2.744   1.00 0.00 ? 40  ILE A N    5  
ATOM 7557  C CA   . ILE A 1 40  ? -21.997 -5.550  3.886   1.00 0.00 ? 40  ILE A CA   5  
ATOM 7558  C C    . ILE A 1 40  ? -22.882 -6.756  3.592   1.00 0.00 ? 40  ILE A C    5  
ATOM 7559  O O    . ILE A 1 40  ? -23.546 -6.813  2.558   1.00 0.00 ? 40  ILE A O    5  
ATOM 7560  C CB   . ILE A 1 40  ? -22.888 -4.356  4.278   1.00 0.00 ? 40  ILE A CB   5  
ATOM 7561  C CG1  . ILE A 1 40  ? -23.936 -4.097  3.194   1.00 0.00 ? 40  ILE A CG1  5  
ATOM 7562  C CG2  . ILE A 1 40  ? -22.039 -3.115  4.511   1.00 0.00 ? 40  ILE A CG2  5  
ATOM 7563  C CD1  . ILE A 1 40  ? -23.340 -3.808  1.834   1.00 0.00 ? 40  ILE A CD1  5  
ATOM 7564  H H    . ILE A 1 40  ? -20.939 -4.292  2.553   1.00 0.00 ? 40  ILE A H    5  
ATOM 7565  H HA   . ILE A 1 40  ? -21.354 -5.783  4.722   1.00 0.00 ? 40  ILE A HA   5  
ATOM 7566  H HB   . ILE A 1 40  ? -23.389 -4.599  5.203   1.00 0.00 ? 40  ILE A HB   5  
ATOM 7567  H HG12 . ILE A 1 40  ? -24.571 -4.964  3.100   1.00 0.00 ? 40  ILE A HG12 5  
ATOM 7568  H HG13 . ILE A 1 40  ? -24.537 -3.245  3.481   1.00 0.00 ? 40  ILE A HG13 5  
ATOM 7569  H HG21 . ILE A 1 40  ? -21.025 -3.309  4.194   1.00 0.00 ? 40  ILE A HG21 5  
ATOM 7570  H HG22 . ILE A 1 40  ? -22.442 -2.292  3.940   1.00 0.00 ? 40  ILE A HG22 5  
ATOM 7571  H HG23 . ILE A 1 40  ? -22.048 -2.864  5.560   1.00 0.00 ? 40  ILE A HG23 5  
ATOM 7572  H HD11 . ILE A 1 40  ? -22.417 -3.259  1.955   1.00 0.00 ? 40  ILE A HD11 5  
ATOM 7573  H HD12 . ILE A 1 40  ? -23.139 -4.739  1.324   1.00 0.00 ? 40  ILE A HD12 5  
ATOM 7574  H HD13 . ILE A 1 40  ? -24.034 -3.220  1.253   1.00 0.00 ? 40  ILE A HD13 5  
ATOM 7575  N N    . GLU A 1 41  ? -22.887 -7.717  4.511   1.00 0.00 ? 41  GLU A N    5  
ATOM 7576  C CA   . GLU A 1 41  ? -23.692 -8.922  4.350   1.00 0.00 ? 41  GLU A CA   5  
ATOM 7577  C C    . GLU A 1 41  ? -24.268 -9.374  5.689   1.00 0.00 ? 41  GLU A C    5  
ATOM 7578  O O    . GLU A 1 41  ? -23.553 -9.464  6.687   1.00 0.00 ? 41  GLU A O    5  
ATOM 7579  C CB   . GLU A 1 41  ? -22.853 -10.045 3.739   1.00 0.00 ? 41  GLU A CB   5  
ATOM 7580  C CG   . GLU A 1 41  ? -23.664 -11.272 3.354   1.00 0.00 ? 41  GLU A CG   5  
ATOM 7581  C CD   . GLU A 1 41  ? -24.810 -10.943 2.418   1.00 0.00 ? 41  GLU A CD   5  
ATOM 7582  O OE1  . GLU A 1 41  ? -24.652 -10.028 1.584   1.00 0.00 ? 41  GLU A OE1  5  
ATOM 7583  O OE2  . GLU A 1 41  ? -25.867 -11.601 2.521   1.00 0.00 ? 41  GLU A OE2  5  
ATOM 7584  H H    . GLU A 1 41  ? -22.336 -7.613  5.315   1.00 0.00 ? 41  GLU A H    5  
ATOM 7585  H HA   . GLU A 1 41  ? -24.507 -8.690  3.682   1.00 0.00 ? 41  GLU A HA   5  
ATOM 7586  H HB2  . GLU A 1 41  ? -22.363 -9.671  2.852   1.00 0.00 ? 41  GLU A HB2  5  
ATOM 7587  H HB3  . GLU A 1 41  ? -22.101 -10.347 4.454   1.00 0.00 ? 41  GLU A HB3  5  
ATOM 7588  H HG2  . GLU A 1 41  ? -23.012 -11.980 2.865   1.00 0.00 ? 41  GLU A HG2  5  
ATOM 7589  H HG3  . GLU A 1 41  ? -24.067 -11.716 4.252   1.00 0.00 ? 41  GLU A HG3  5  
ATOM 7590  N N    . GLY A 1 42  ? -25.567 -9.658  5.703   1.00 0.00 ? 42  GLY A N    5  
ATOM 7591  C CA   . GLY A 1 42  ? -26.218 -10.096 6.924   1.00 0.00 ? 42  GLY A CA   5  
ATOM 7592  C C    . GLY A 1 42  ? -27.572 -10.725 6.665   1.00 0.00 ? 42  GLY A C    5  
ATOM 7593  O O    . GLY A 1 42  ? -27.741 -11.935 6.816   1.00 0.00 ? 42  GLY A O    5  
ATOM 7594  H H    . GLY A 1 42  ? -26.088 -9.568  4.877   1.00 0.00 ? 42  GLY A H    5  
ATOM 7595  H HA2  . GLY A 1 42  ? -25.585 -10.819 7.416   1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7596  H HA3  . GLY A 1 42  ? -26.348 -9.244  7.575   1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7597  N N    . ARG A 1 43  ? -28.541 -9.902  6.275   1.00 0.00 ? 43  ARG A N    5  
ATOM 7598  C CA   . ARG A 1 43  ? -29.888 -10.385 5.998   1.00 0.00 ? 43  ARG A CA   5  
ATOM 7599  C C    . ARG A 1 43  ? -30.153 -10.425 4.496   1.00 0.00 ? 43  ARG A C    5  
ATOM 7600  O O    . ARG A 1 43  ? -30.694 -9.480  3.925   1.00 0.00 ? 43  ARG A O    5  
ATOM 7601  C CB   . ARG A 1 43  ? -30.924 -9.493  6.685   1.00 0.00 ? 43  ARG A CB   5  
ATOM 7602  C CG   . ARG A 1 43  ? -32.197 -10.227 7.074   1.00 0.00 ? 43  ARG A CG   5  
ATOM 7603  C CD   . ARG A 1 43  ? -32.851 -9.600  8.295   1.00 0.00 ? 43  ARG A CD   5  
ATOM 7604  N NE   . ARG A 1 43  ? -33.578 -8.379  7.961   1.00 0.00 ? 43  ARG A NE   5  
ATOM 7605  C CZ   . ARG A 1 43  ? -34.039 -7.525  8.869   1.00 0.00 ? 43  ARG A CZ   5  
ATOM 7606  N NH1  . ARG A 1 43  ? -33.848 -7.759  10.160  1.00 0.00 ? 43  ARG A NH1  5  
ATOM 7607  N NH2  . ARG A 1 43  ? -34.692 -6.436  8.486   1.00 0.00 ? 43  ARG A NH2  5  
ATOM 7608  H H    . ARG A 1 43  ? -28.344 -8.948  6.173   1.00 0.00 ? 43  ARG A H    5  
ATOM 7609  H HA   . ARG A 1 43  ? -29.970 -11.387 6.393   1.00 0.00 ? 43  ARG A HA   5  
ATOM 7610  H HB2  . ARG A 1 43  ? -30.486 -9.078  7.582   1.00 0.00 ? 43  ARG A HB2  5  
ATOM 7611  H HB3  . ARG A 1 43  ? -31.188 -8.688  6.017   1.00 0.00 ? 43  ARG A HB3  5  
ATOM 7612  H HG2  . ARG A 1 43  ? -32.891 -10.186 6.247   1.00 0.00 ? 43  ARG A HG2  5  
ATOM 7613  H HG3  . ARG A 1 43  ? -31.956 -11.256 7.293   1.00 0.00 ? 43  ARG A HG3  5  
ATOM 7614  H HD2  . ARG A 1 43  ? -33.540 -10.312 8.724   1.00 0.00 ? 43  ARG A HD2  5  
ATOM 7615  H HD3  . ARG A 1 43  ? -32.082 -9.364  9.017   1.00 0.00 ? 43  ARG A HD3  5  
ATOM 7616  H HE   . ARG A 1 43  ? -33.731 -8.186  7.012   1.00 0.00 ? 43  ARG A HE   5  
ATOM 7617  H HH11 . ARG A 1 43  ? -33.356 -8.579  10.451  1.00 0.00 ? 43  ARG A HH11 5  
ATOM 7618  H HH12 . ARG A 1 43  ? -34.195 -7.114  10.842  1.00 0.00 ? 43  ARG A HH12 5  
ATOM 7619  H HH21 . ARG A 1 43  ? -34.837 -6.256  7.513   1.00 0.00 ? 43  ARG A HH21 5  
ATOM 7620  H HH22 . ARG A 1 43  ? -35.038 -5.794  9.170   1.00 0.00 ? 43  ARG A HH22 5  
ATOM 7621  N N    . GLY A 1 44  ? -29.766 -11.528 3.861   1.00 0.00 ? 44  GLY A N    5  
ATOM 7622  C CA   . GLY A 1 44  ? -29.969 -11.670 2.431   1.00 0.00 ? 44  GLY A CA   5  
ATOM 7623  C C    . GLY A 1 44  ? -30.934 -12.789 2.091   1.00 0.00 ? 44  GLY A C    5  
ATOM 7624  O O    . GLY A 1 44  ? -31.458 -13.457 2.982   1.00 0.00 ? 44  GLY A O    5  
ATOM 7625  H H    . GLY A 1 44  ? -29.339 -12.250 4.368   1.00 0.00 ? 44  GLY A H    5  
ATOM 7626  H HA2  . GLY A 1 44  ? -30.357 -10.742 2.039   1.00 0.00 ? 44  GLY A HA2  5  
ATOM 7627  H HA3  . GLY A 1 44  ? -29.017 -11.877 1.963   1.00 0.00 ? 44  GLY A HA3  5  
ATOM 7628  N N    . SER A 1 45  ? -31.170 -12.992 0.799   1.00 0.00 ? 45  SER A N    5  
ATOM 7629  C CA   . SER A 1 45  ? -32.083 -14.034 0.344   1.00 0.00 ? 45  SER A CA   5  
ATOM 7630  C C    . SER A 1 45  ? -31.433 -15.410 0.450   1.00 0.00 ? 45  SER A C    5  
ATOM 7631  O O    . SER A 1 45  ? -31.942 -16.298 1.135   1.00 0.00 ? 45  SER A O    5  
ATOM 7632  C CB   . SER A 1 45  ? -32.513 -13.770 -1.100  1.00 0.00 ? 45  SER A CB   5  
ATOM 7633  O OG   . SER A 1 45  ? -33.122 -12.497 -1.226  1.00 0.00 ? 45  SER A OG   5  
ATOM 7634  H H    . SER A 1 45  ? -30.721 -12.426 0.137   1.00 0.00 ? 45  SER A H    5  
ATOM 7635  H HA   . SER A 1 45  ? -32.956 -14.011 0.980   1.00 0.00 ? 45  SER A HA   5  
ATOM 7636  H HB2  . SER A 1 45  ? -31.646 -13.806 -1.743  1.00 0.00 ? 45  SER A HB2  5  
ATOM 7637  H HB3  . SER A 1 45  ? -33.220 -14.527 -1.407  1.00 0.00 ? 45  SER A HB3  5  
ATOM 7638  H HG   . SER A 1 45  ? -32.792 -11.914 -0.539  1.00 0.00 ? 45  SER A HG   5  
ATOM 7639  N N    . SER A 1 46  ? -30.306 -15.579 -0.234  1.00 0.00 ? 46  SER A N    5  
ATOM 7640  C CA   . SER A 1 46  ? -29.587 -16.848 -0.221  1.00 0.00 ? 46  SER A CA   5  
ATOM 7641  C C    . SER A 1 46  ? -28.142 -16.649 0.227   1.00 0.00 ? 46  SER A C    5  
ATOM 7642  O O    . SER A 1 46  ? -27.717 -17.189 1.247   1.00 0.00 ? 46  SER A O    5  
ATOM 7643  C CB   . SER A 1 46  ? -29.619 -17.491 -1.609  1.00 0.00 ? 46  SER A CB   5  
ATOM 7644  O OG   . SER A 1 46  ? -29.055 -18.790 -1.582  1.00 0.00 ? 46  SER A OG   5  
ATOM 7645  H H    . SER A 1 46  ? -29.951 -14.834 -0.762  1.00 0.00 ? 46  SER A H    5  
ATOM 7646  H HA   . SER A 1 46  ? -30.083 -17.503 0.481   1.00 0.00 ? 46  SER A HA   5  
ATOM 7647  H HB2  . SER A 1 46  ? -30.642 -17.563 -1.946  1.00 0.00 ? 46  SER A HB2  5  
ATOM 7648  H HB3  . SER A 1 46  ? -29.055 -16.880 -2.299  1.00 0.00 ? 46  SER A HB3  5  
ATOM 7649  H HG   . SER A 1 46  ? -28.441 -18.888 -2.314  1.00 0.00 ? 46  SER A HG   5  
ATOM 7650  N N    . GLY A 1 47  ? -27.392 -15.870 -0.546  1.00 0.00 ? 47  GLY A N    5  
ATOM 7651  C CA   . GLY A 1 47  ? -26.003 -15.613 -0.214  1.00 0.00 ? 47  GLY A CA   5  
ATOM 7652  C C    . GLY A 1 47  ? -25.122 -16.829 -0.422  1.00 0.00 ? 47  GLY A C    5  
ATOM 7653  O O    . GLY A 1 47  ? -25.115 -17.746 0.398   1.00 0.00 ? 47  GLY A O    5  
ATOM 7654  H H    . GLY A 1 47  ? -27.785 -15.466 -1.348  1.00 0.00 ? 47  GLY A H    5  
ATOM 7655  H HA2  . GLY A 1 47  ? -25.639 -14.807 -0.834  1.00 0.00 ? 47  GLY A HA2  5  
ATOM 7656  H HA3  . GLY A 1 47  ? -25.942 -15.312 0.822   1.00 0.00 ? 47  GLY A HA3  5  
ATOM 7657  N N    . SER A 1 48  ? -24.379 -16.837 -1.524  1.00 0.00 ? 48  SER A N    5  
ATOM 7658  C CA   . SER A 1 48  ? -23.495 -17.952 -1.841  1.00 0.00 ? 48  SER A CA   5  
ATOM 7659  C C    . SER A 1 48  ? -22.101 -17.453 -2.211  1.00 0.00 ? 48  SER A C    5  
ATOM 7660  O O    . SER A 1 48  ? -21.945 -16.354 -2.744  1.00 0.00 ? 48  SER A O    5  
ATOM 7661  C CB   . SER A 1 48  ? -24.074 -18.780 -2.990  1.00 0.00 ? 48  SER A CB   5  
ATOM 7662  O OG   . SER A 1 48  ? -23.661 -20.133 -2.903  1.00 0.00 ? 48  SER A OG   5  
ATOM 7663  H H    . SER A 1 48  ? -24.428 -16.076 -2.140  1.00 0.00 ? 48  SER A H    5  
ATOM 7664  H HA   . SER A 1 48  ? -23.419 -18.576 -0.962  1.00 0.00 ? 48  SER A HA   5  
ATOM 7665  H HB2  . SER A 1 48  ? -25.152 -18.742 -2.950  1.00 0.00 ? 48  SER A HB2  5  
ATOM 7666  H HB3  . SER A 1 48  ? -23.734 -18.372 -3.931  1.00 0.00 ? 48  SER A HB3  5  
ATOM 7667  H HG   . SER A 1 48  ? -23.650 -20.521 -3.781  1.00 0.00 ? 48  SER A HG   5  
ATOM 7668  N N    . SER A 1 49  ? -21.092 -18.269 -1.925  1.00 0.00 ? 49  SER A N    5  
ATOM 7669  C CA   . SER A 1 49  ? -19.710 -17.910 -2.224  1.00 0.00 ? 49  SER A CA   5  
ATOM 7670  C C    . SER A 1 49  ? -19.048 -18.974 -3.093  1.00 0.00 ? 49  SER A C    5  
ATOM 7671  O O    . SER A 1 49  ? -19.507 -20.114 -3.156  1.00 0.00 ? 49  SER A O    5  
ATOM 7672  C CB   . SER A 1 49  ? -18.917 -17.726 -0.928  1.00 0.00 ? 49  SER A CB   5  
ATOM 7673  O OG   . SER A 1 49  ? -18.792 -18.953 -0.229  1.00 0.00 ? 49  SER A OG   5  
ATOM 7674  H H    . SER A 1 49  ? -21.281 -19.132 -1.501  1.00 0.00 ? 49  SER A H    5  
ATOM 7675  H HA   . SER A 1 49  ? -19.720 -16.975 -2.765  1.00 0.00 ? 49  SER A HA   5  
ATOM 7676  H HB2  . SER A 1 49  ? -17.930 -17.357 -1.163  1.00 0.00 ? 49  SER A HB2  5  
ATOM 7677  H HB3  . SER A 1 49  ? -19.427 -17.015 -0.295  1.00 0.00 ? 49  SER A HB3  5  
ATOM 7678  H HG   . SER A 1 49  ? -18.382 -19.607 -0.800  1.00 0.00 ? 49  SER A HG   5  
ATOM 7679  N N    . GLY A 1 50  ? -17.964 -18.593 -3.762  1.00 0.00 ? 50  GLY A N    5  
ATOM 7680  C CA   . GLY A 1 50  ? -17.255 -19.525 -4.619  1.00 0.00 ? 50  GLY A CA   5  
ATOM 7681  C C    . GLY A 1 50  ? -15.752 -19.341 -4.557  1.00 0.00 ? 50  GLY A C    5  
ATOM 7682  O O    . GLY A 1 50  ? -15.177 -18.599 -5.353  1.00 0.00 ? 50  GLY A O    5  
ATOM 7683  H H    . GLY A 1 50  ? -17.643 -17.671 -3.673  1.00 0.00 ? 50  GLY A H    5  
ATOM 7684  H HA2  . GLY A 1 50  ? -17.497 -20.532 -4.314  1.00 0.00 ? 50  GLY A HA2  5  
ATOM 7685  H HA3  . GLY A 1 50  ? -17.582 -19.380 -5.638  1.00 0.00 ? 50  GLY A HA3  5  
ATOM 7686  N N    . SER A 1 51  ? -15.113 -20.017 -3.608  1.00 0.00 ? 51  SER A N    5  
ATOM 7687  C CA   . SER A 1 51  ? -13.667 -19.920 -3.441  1.00 0.00 ? 51  SER A CA   5  
ATOM 7688  C C    . SER A 1 51  ? -12.949 -20.930 -4.331  1.00 0.00 ? 51  SER A C    5  
ATOM 7689  O O    . SER A 1 51  ? -11.992 -21.577 -3.907  1.00 0.00 ? 51  SER A O    5  
ATOM 7690  C CB   . SER A 1 51  ? -13.285 -20.150 -1.978  1.00 0.00 ? 51  SER A CB   5  
ATOM 7691  O OG   . SER A 1 51  ? -13.584 -19.012 -1.188  1.00 0.00 ? 51  SER A OG   5  
ATOM 7692  H H    . SER A 1 51  ? -15.626 -20.593 -3.003  1.00 0.00 ? 51  SER A H    5  
ATOM 7693  H HA   . SER A 1 51  ? -13.366 -18.925 -3.731  1.00 0.00 ? 51  SER A HA   5  
ATOM 7694  H HB2  . SER A 1 51  ? -13.835 -20.995 -1.593  1.00 0.00 ? 51  SER A HB2  5  
ATOM 7695  H HB3  . SER A 1 51  ? -12.225 -20.350 -1.913  1.00 0.00 ? 51  SER A HB3  5  
ATOM 7696  H HG   . SER A 1 51  ? -14.512 -19.027 -0.944  1.00 0.00 ? 51  SER A HG   5  
ATOM 7697  N N    . SER A 1 52  ? -13.419 -21.060 -5.568  1.00 0.00 ? 52  SER A N    5  
ATOM 7698  C CA   . SER A 1 52  ? -12.826 -21.994 -6.517  1.00 0.00 ? 52  SER A CA   5  
ATOM 7699  C C    . SER A 1 52  ? -12.655 -21.341 -7.886  1.00 0.00 ? 52  SER A C    5  
ATOM 7700  O O    . SER A 1 52  ? -13.478 -20.529 -8.306  1.00 0.00 ? 52  SER A O    5  
ATOM 7701  C CB   . SER A 1 52  ? -13.693 -23.247 -6.642  1.00 0.00 ? 52  SER A CB   5  
ATOM 7702  O OG   . SER A 1 52  ? -13.331 -24.217 -5.675  1.00 0.00 ? 52  SER A OG   5  
ATOM 7703  H H    . SER A 1 52  ? -14.186 -20.516 -5.847  1.00 0.00 ? 52  SER A H    5  
ATOM 7704  H HA   . SER A 1 52  ? -11.853 -22.275 -6.142  1.00 0.00 ? 52  SER A HA   5  
ATOM 7705  H HB2  . SER A 1 52  ? -14.729 -22.981 -6.497  1.00 0.00 ? 52  SER A HB2  5  
ATOM 7706  H HB3  . SER A 1 52  ? -13.565 -23.673 -7.627  1.00 0.00 ? 52  SER A HB3  5  
ATOM 7707  H HG   . SER A 1 52  ? -13.147 -25.052 -6.111  1.00 0.00 ? 52  SER A HG   5  
ATOM 7708  N N    . GLY A 1 53  ? -11.578 -21.703 -8.577  1.00 0.00 ? 53  GLY A N    5  
ATOM 7709  C CA   . GLY A 1 53  ? -11.317 -21.144 -9.890  1.00 0.00 ? 53  GLY A CA   5  
ATOM 7710  C C    . GLY A 1 53  ? -10.206 -20.113 -9.871  1.00 0.00 ? 53  GLY A C    5  
ATOM 7711  O O    . GLY A 1 53  ? -10.465 -18.913 -9.772  1.00 0.00 ? 53  GLY A O    5  
ATOM 7712  H H    . GLY A 1 53  ? -10.956 -22.355 -8.191  1.00 0.00 ? 53  GLY A H    5  
ATOM 7713  H HA2  . GLY A 1 53  ? -11.040 -21.944 -10.561 1.00 0.00 ? 53  GLY A HA2  5  
ATOM 7714  H HA3  . GLY A 1 53  ? -12.219 -20.677 -10.256 1.00 0.00 ? 53  GLY A HA3  5  
ATOM 7715  N N    . SER A 1 54  ? -8.965  -20.580 -9.965  1.00 0.00 ? 54  SER A N    5  
ATOM 7716  C CA   . SER A 1 54  ? -7.811  -19.689 -9.953  1.00 0.00 ? 54  SER A CA   5  
ATOM 7717  C C    . SER A 1 54  ? -7.049  -19.769 -11.272 1.00 0.00 ? 54  SER A C    5  
ATOM 7718  O O    . SER A 1 54  ? -7.056  -20.800 -11.945 1.00 0.00 ? 54  SER A O    5  
ATOM 7719  C CB   . SER A 1 54  ? -6.880  -20.042 -8.791  1.00 0.00 ? 54  SER A CB   5  
ATOM 7720  O OG   . SER A 1 54  ? -6.566  -21.424 -8.791  1.00 0.00 ? 54  SER A OG   5  
ATOM 7721  H H    . SER A 1 54  ? -8.823  -21.546 -10.042 1.00 0.00 ? 54  SER A H    5  
ATOM 7722  H HA   . SER A 1 54  ? -8.171  -18.680 -9.820  1.00 0.00 ? 54  SER A HA   5  
ATOM 7723  H HB2  . SER A 1 54  ? -5.965  -19.478 -8.882  1.00 0.00 ? 54  SER A HB2  5  
ATOM 7724  H HB3  . SER A 1 54  ? -7.364  -19.795 -7.857  1.00 0.00 ? 54  SER A HB3  5  
ATOM 7725  H HG   . SER A 1 54  ? -5.921  -21.607 -8.104  1.00 0.00 ? 54  SER A HG   5  
ATOM 7726  N N    . SER A 1 55  ? -6.391  -18.673 -11.636 1.00 0.00 ? 55  SER A N    5  
ATOM 7727  C CA   . SER A 1 55  ? -5.626  -18.616 -12.876 1.00 0.00 ? 55  SER A CA   5  
ATOM 7728  C C    . SER A 1 55  ? -4.733  -17.380 -12.907 1.00 0.00 ? 55  SER A C    5  
ATOM 7729  O O    . SER A 1 55  ? -4.860  -16.486 -12.071 1.00 0.00 ? 55  SER A O    5  
ATOM 7730  C CB   . SER A 1 55  ? -6.569  -18.608 -14.081 1.00 0.00 ? 55  SER A CB   5  
ATOM 7731  O OG   . SER A 1 55  ? -7.509  -17.552 -13.986 1.00 0.00 ? 55  SER A OG   5  
ATOM 7732  H H    . SER A 1 55  ? -6.423  -17.882 -11.057 1.00 0.00 ? 55  SER A H    5  
ATOM 7733  H HA   . SER A 1 55  ? -5.004  -19.497 -12.922 1.00 0.00 ? 55  SER A HA   5  
ATOM 7734  H HB2  . SER A 1 55  ? -5.993  -18.481 -14.985 1.00 0.00 ? 55  SER A HB2  5  
ATOM 7735  H HB3  . SER A 1 55  ? -7.103  -19.547 -14.123 1.00 0.00 ? 55  SER A HB3  5  
ATOM 7736  H HG   . SER A 1 55  ? -7.122  -16.746 -14.336 1.00 0.00 ? 55  SER A HG   5  
ATOM 7737  N N    . GLY A 1 56  ? -3.827  -17.336 -13.880 1.00 0.00 ? 56  GLY A N    5  
ATOM 7738  C CA   . GLY A 1 56  ? -2.924  -16.207 -14.003 1.00 0.00 ? 56  GLY A CA   5  
ATOM 7739  C C    . GLY A 1 56  ? -1.881  -16.413 -15.083 1.00 0.00 ? 56  GLY A C    5  
ATOM 7740  O O    . GLY A 1 56  ? -1.806  -17.483 -15.687 1.00 0.00 ? 56  GLY A O    5  
ATOM 7741  H H    . GLY A 1 56  ? -3.770  -18.078 -14.518 1.00 0.00 ? 56  GLY A H    5  
ATOM 7742  H HA2  . GLY A 1 56  ? -3.500  -15.324 -14.237 1.00 0.00 ? 56  GLY A HA2  5  
ATOM 7743  H HA3  . GLY A 1 56  ? -2.422  -16.057 -13.058 1.00 0.00 ? 56  GLY A HA3  5  
ATOM 7744  N N    . ASP A 1 57  ? -1.074  -15.386 -15.328 1.00 0.00 ? 57  ASP A N    5  
ATOM 7745  C CA   . ASP A 1 57  ? -0.030  -15.460 -16.344 1.00 0.00 ? 57  ASP A CA   5  
ATOM 7746  C C    . ASP A 1 57  ? 0.857   -14.220 -16.301 1.00 0.00 ? 57  ASP A C    5  
ATOM 7747  O O    . ASP A 1 57  ? 0.395   -13.103 -16.534 1.00 0.00 ? 57  ASP A O    5  
ATOM 7748  C CB   . ASP A 1 57  ? -0.651  -15.610 -17.733 1.00 0.00 ? 57  ASP A CB   5  
ATOM 7749  C CG   . ASP A 1 57  ? -1.424  -14.378 -18.159 1.00 0.00 ? 57  ASP A CG   5  
ATOM 7750  O OD1  . ASP A 1 57  ? -2.261  -13.899 -17.364 1.00 0.00 ? 57  ASP A OD1  5  
ATOM 7751  O OD2  . ASP A 1 57  ? -1.193  -13.892 -19.285 1.00 0.00 ? 57  ASP A OD2  5  
ATOM 7752  H H    . ASP A 1 57  ? -1.184  -14.559 -14.813 1.00 0.00 ? 57  ASP A H    5  
ATOM 7753  H HA   . ASP A 1 57  ? 0.576   -16.328 -16.134 1.00 0.00 ? 57  ASP A HA   5  
ATOM 7754  H HB2  . ASP A 1 57  ? 0.135   -15.785 -18.454 1.00 0.00 ? 57  ASP A HB2  5  
ATOM 7755  H HB3  . ASP A 1 57  ? -1.325  -16.454 -17.730 1.00 0.00 ? 57  ASP A HB3  5  
ATOM 7756  N N    . LYS A 1 58  ? 2.136   -14.424 -16.000 1.00 0.00 ? 58  LYS A N    5  
ATOM 7757  C CA   . LYS A 1 58  ? 3.090   -13.324 -15.926 1.00 0.00 ? 58  LYS A CA   5  
ATOM 7758  C C    . LYS A 1 58  ? 2.679   -12.318 -14.856 1.00 0.00 ? 58  LYS A C    5  
ATOM 7759  O O    . LYS A 1 58  ? 2.786   -11.108 -15.055 1.00 0.00 ? 58  LYS A O    5  
ATOM 7760  C CB   . LYS A 1 58  ? 3.199   -12.625 -17.283 1.00 0.00 ? 58  LYS A CB   5  
ATOM 7761  C CG   . LYS A 1 58  ? 4.370   -11.662 -17.378 1.00 0.00 ? 58  LYS A CG   5  
ATOM 7762  C CD   . LYS A 1 58  ? 4.585   -11.185 -18.805 1.00 0.00 ? 58  LYS A CD   5  
ATOM 7763  C CE   . LYS A 1 58  ? 3.506   -10.202 -19.233 1.00 0.00 ? 58  LYS A CE   5  
ATOM 7764  N NZ   . LYS A 1 58  ? 3.854   -8.801  -18.865 1.00 0.00 ? 58  LYS A NZ   5  
ATOM 7765  H H    . LYS A 1 58  ? 2.445   -15.338 -15.824 1.00 0.00 ? 58  LYS A H    5  
ATOM 7766  H HA   . LYS A 1 58  ? 4.052   -13.736 -15.665 1.00 0.00 ? 58  LYS A HA   5  
ATOM 7767  H HB2  . LYS A 1 58  ? 3.313   -13.374 -18.053 1.00 0.00 ? 58  LYS A HB2  5  
ATOM 7768  H HB3  . LYS A 1 58  ? 2.289   -12.071 -17.464 1.00 0.00 ? 58  LYS A HB3  5  
ATOM 7769  H HG2  . LYS A 1 58  ? 4.172   -10.806 -16.750 1.00 0.00 ? 58  LYS A HG2  5  
ATOM 7770  H HG3  . LYS A 1 58  ? 5.265   -12.162 -17.037 1.00 0.00 ? 58  LYS A HG3  5  
ATOM 7771  H HD2  . LYS A 1 58  ? 5.546   -10.697 -18.871 1.00 0.00 ? 58  LYS A HD2  5  
ATOM 7772  H HD3  . LYS A 1 58  ? 4.565   -12.038 -19.467 1.00 0.00 ? 58  LYS A HD3  5  
ATOM 7773  H HE2  . LYS A 1 58  ? 3.385   -10.264 -20.303 1.00 0.00 ? 58  LYS A HE2  5  
ATOM 7774  H HE3  . LYS A 1 58  ? 2.579   -10.473 -18.749 1.00 0.00 ? 58  LYS A HE3  5  
ATOM 7775  H HZ1  . LYS A 1 58  ? 4.548   -8.417  -19.537 1.00 0.00 ? 58  LYS A HZ1  5  
ATOM 7776  H HZ2  . LYS A 1 58  ? 4.261   -8.774  -17.908 1.00 0.00 ? 58  LYS A HZ2  5  
ATOM 7777  H HZ3  . LYS A 1 58  ? 3.002   -8.205  -18.883 1.00 0.00 ? 58  LYS A HZ3  5  
ATOM 7778  N N    . GLU A 1 59  ? 2.210   -12.827 -13.721 1.00 0.00 ? 59  GLU A N    5  
ATOM 7779  C CA   . GLU A 1 59  ? 1.784   -11.971 -12.619 1.00 0.00 ? 59  GLU A CA   5  
ATOM 7780  C C    . GLU A 1 59  ? 2.876   -10.971 -12.253 1.00 0.00 ? 59  GLU A C    5  
ATOM 7781  O O    . GLU A 1 59  ? 4.057   -11.204 -12.513 1.00 0.00 ? 59  GLU A O    5  
ATOM 7782  C CB   . GLU A 1 59  ? 1.421   -12.818 -11.397 1.00 0.00 ? 59  GLU A CB   5  
ATOM 7783  C CG   . GLU A 1 59  ? 0.098   -13.553 -11.537 1.00 0.00 ? 59  GLU A CG   5  
ATOM 7784  C CD   . GLU A 1 59  ? 0.037   -14.810 -10.691 1.00 0.00 ? 59  GLU A CD   5  
ATOM 7785  O OE1  . GLU A 1 59  ? 1.052   -15.535 -10.631 1.00 0.00 ? 59  GLU A OE1  5  
ATOM 7786  O OE2  . GLU A 1 59  ? -1.026  -15.067 -10.088 1.00 0.00 ? 59  GLU A OE2  5  
ATOM 7787  H H    . GLU A 1 59  ? 2.148   -13.800 -13.622 1.00 0.00 ? 59  GLU A H    5  
ATOM 7788  H HA   . GLU A 1 59  ? 0.908   -11.428 -12.941 1.00 0.00 ? 59  GLU A HA   5  
ATOM 7789  H HB2  . GLU A 1 59  ? 2.200   -13.548 -11.236 1.00 0.00 ? 59  GLU A HB2  5  
ATOM 7790  H HB3  . GLU A 1 59  ? 1.361   -12.173 -10.533 1.00 0.00 ? 59  GLU A HB3  5  
ATOM 7791  H HG2  . GLU A 1 59  ? -0.699  -12.893 -11.231 1.00 0.00 ? 59  GLU A HG2  5  
ATOM 7792  H HG3  . GLU A 1 59  ? -0.040  -13.826 -12.572 1.00 0.00 ? 59  GLU A HG3  5  
ATOM 7793  N N    . ARG A 1 60  ? 2.473   -9.858  -11.649 1.00 0.00 ? 60  ARG A N    5  
ATOM 7794  C CA   . ARG A 1 60  ? 3.417   -8.822  -11.248 1.00 0.00 ? 60  ARG A CA   5  
ATOM 7795  C C    . ARG A 1 60  ? 3.861   -9.020  -9.802  1.00 0.00 ? 60  ARG A C    5  
ATOM 7796  O O    . ARG A 1 60  ? 3.191   -9.701  -9.024  1.00 0.00 ? 60  ARG A O    5  
ATOM 7797  C CB   . ARG A 1 60  ? 2.788   -7.437  -11.415 1.00 0.00 ? 60  ARG A CB   5  
ATOM 7798  C CG   . ARG A 1 60  ? 3.059   -6.805  -12.770 1.00 0.00 ? 60  ARG A CG   5  
ATOM 7799  C CD   . ARG A 1 60  ? 2.142   -5.619  -13.025 1.00 0.00 ? 60  ARG A CD   5  
ATOM 7800  N NE   . ARG A 1 60  ? 0.882   -6.024  -13.642 1.00 0.00 ? 60  ARG A NE   5  
ATOM 7801  C CZ   . ARG A 1 60  ? 0.027   -5.171  -14.195 1.00 0.00 ? 60  ARG A CZ   5  
ATOM 7802  N NH1  . ARG A 1 60  ? 0.295   -3.873  -14.208 1.00 0.00 ? 60  ARG A NH1  5  
ATOM 7803  N NH2  . ARG A 1 60  ? -1.100  -5.617  -14.737 1.00 0.00 ? 60  ARG A NH2  5  
ATOM 7804  H H    . ARG A 1 60  ? 1.519   -9.731  -11.469 1.00 0.00 ? 60  ARG A H    5  
ATOM 7805  H HA   . ARG A 1 60  ? 4.282   -8.894  -11.891 1.00 0.00 ? 60  ARG A HA   5  
ATOM 7806  H HB2  . ARG A 1 60  ? 1.719   -7.523  -11.290 1.00 0.00 ? 60  ARG A HB2  5  
ATOM 7807  H HB3  . ARG A 1 60  ? 3.180   -6.783  -10.651 1.00 0.00 ? 60  ARG A HB3  5  
ATOM 7808  H HG2  . ARG A 1 60  ? 4.084   -6.465  -12.800 1.00 0.00 ? 60  ARG A HG2  5  
ATOM 7809  H HG3  . ARG A 1 60  ? 2.900   -7.544  -13.541 1.00 0.00 ? 60  ARG A HG3  5  
ATOM 7810  H HD2  . ARG A 1 60  ? 1.931   -5.135  -12.083 1.00 0.00 ? 60  ARG A HD2  5  
ATOM 7811  H HD3  . ARG A 1 60  ? 2.646   -4.925  -13.680 1.00 0.00 ? 60  ARG A HD3  5  
ATOM 7812  H HE   . ARG A 1 60  ? 0.664   -6.979  -13.644 1.00 0.00 ? 60  ARG A HE   5  
ATOM 7813  H HH11 . ARG A 1 60  ? 1.143   -3.534  -13.801 1.00 0.00 ? 60  ARG A HH11 5  
ATOM 7814  H HH12 . ARG A 1 60  ? -0.350  -3.233  -14.626 1.00 0.00 ? 60  ARG A HH12 5  
ATOM 7815  H HH21 . ARG A 1 60  ? -1.305  -6.595  -14.729 1.00 0.00 ? 60  ARG A HH21 5  
ATOM 7816  H HH22 . ARG A 1 60  ? -1.743  -4.975  -15.153 1.00 0.00 ? 60  ARG A HH22 5  
ATOM 7817  N N    . HIS A 1 61  ? 4.993   -8.421  -9.448  1.00 0.00 ? 61  HIS A N    5  
ATOM 7818  C CA   . HIS A 1 61  ? 5.526   -8.531  -8.095  1.00 0.00 ? 61  HIS A CA   5  
ATOM 7819  C C    . HIS A 1 61  ? 5.664   -7.155  -7.451  1.00 0.00 ? 61  HIS A C    5  
ATOM 7820  O O    . HIS A 1 61  ? 6.413   -6.306  -7.932  1.00 0.00 ? 61  HIS A O    5  
ATOM 7821  C CB   . HIS A 1 61  ? 6.883   -9.236  -8.114  1.00 0.00 ? 61  HIS A CB   5  
ATOM 7822  C CG   . HIS A 1 61  ? 7.143   -10.069 -6.897  1.00 0.00 ? 61  HIS A CG   5  
ATOM 7823  N ND1  . HIS A 1 61  ? 8.376   -10.144 -6.285  1.00 0.00 ? 61  HIS A ND1  5  
ATOM 7824  C CD2  . HIS A 1 61  ? 6.318   -10.866 -6.177  1.00 0.00 ? 61  HIS A CD2  5  
ATOM 7825  C CE1  . HIS A 1 61  ? 8.300   -10.951 -5.242  1.00 0.00 ? 61  HIS A CE1  5  
ATOM 7826  N NE2  . HIS A 1 61  ? 7.061   -11.402 -5.155  1.00 0.00 ? 61  HIS A NE2  5  
ATOM 7827  H H    . HIS A 1 61  ? 5.482   -7.892  -10.113 1.00 0.00 ? 61  HIS A H    5  
ATOM 7828  H HA   . HIS A 1 61  ? 4.833   -9.119  -7.512  1.00 0.00 ? 61  HIS A HA   5  
ATOM 7829  H HB2  . HIS A 1 61  ? 6.932   -9.885  -8.977  1.00 0.00 ? 61  HIS A HB2  5  
ATOM 7830  H HB3  . HIS A 1 61  ? 7.666   -8.494  -8.183  1.00 0.00 ? 61  HIS A HB3  5  
ATOM 7831  H HD1  . HIS A 1 61  ? 9.187   -9.676  -6.573  1.00 0.00 ? 61  HIS A HD1  5  
ATOM 7832  H HD2  . HIS A 1 61  ? 5.270   -11.047 -6.371  1.00 0.00 ? 61  HIS A HD2  5  
ATOM 7833  H HE1  . HIS A 1 61  ? 9.111   -11.200 -4.574  1.00 0.00 ? 61  HIS A HE1  5  
ATOM 7834  H HE2  . HIS A 1 61  ? 6.753   -12.084 -4.523  1.00 0.00 ? 61  HIS A HE2  5  
ATOM 7835  N N    . GLY A 1 62  ? 4.935   -6.941  -6.360  1.00 0.00 ? 62  GLY A N    5  
ATOM 7836  C CA   . GLY A 1 62  ? 4.989   -5.666  -5.669  1.00 0.00 ? 62  GLY A CA   5  
ATOM 7837  C C    . GLY A 1 62  ? 5.403   -5.810  -4.218  1.00 0.00 ? 62  GLY A C    5  
ATOM 7838  O O    . GLY A 1 62  ? 5.487   -6.922  -3.696  1.00 0.00 ? 62  GLY A O    5  
ATOM 7839  H H    . GLY A 1 62  ? 4.355   -7.655  -6.022  1.00 0.00 ? 62  GLY A H    5  
ATOM 7840  H HA2  . GLY A 1 62  ? 5.698   -5.026  -6.173  1.00 0.00 ? 62  GLY A HA2  5  
ATOM 7841  H HA3  . GLY A 1 62  ? 4.012   -5.206  -5.709  1.00 0.00 ? 62  GLY A HA3  5  
ATOM 7842  N N    . VAL A 1 63  ? 5.665   -4.683  -3.564  1.00 0.00 ? 63  VAL A N    5  
ATOM 7843  C CA   . VAL A 1 63  ? 6.073   -4.688  -2.165  1.00 0.00 ? 63  VAL A CA   5  
ATOM 7844  C C    . VAL A 1 63  ? 5.487   -3.496  -1.417  1.00 0.00 ? 63  VAL A C    5  
ATOM 7845  O O    . VAL A 1 63  ? 5.564   -2.359  -1.882  1.00 0.00 ? 63  VAL A O    5  
ATOM 7846  C CB   . VAL A 1 63  ? 7.607   -4.662  -2.028  1.00 0.00 ? 63  VAL A CB   5  
ATOM 7847  C CG1  . VAL A 1 63  ? 8.012   -4.139  -0.658  1.00 0.00 ? 63  VAL A CG1  5  
ATOM 7848  C CG2  . VAL A 1 63  ? 8.187   -6.047  -2.272  1.00 0.00 ? 63  VAL A CG2  5  
ATOM 7849  H H    . VAL A 1 63  ? 5.580   -3.827  -4.034  1.00 0.00 ? 63  VAL A H    5  
ATOM 7850  H HA   . VAL A 1 63  ? 5.708   -5.599  -1.714  1.00 0.00 ? 63  VAL A HA   5  
ATOM 7851  H HB   . VAL A 1 63  ? 8.004   -3.991  -2.776  1.00 0.00 ? 63  VAL A HB   5  
ATOM 7852  H HG11 . VAL A 1 63  ? 7.707   -3.107  -0.562  1.00 0.00 ? 63  VAL A HG11 5  
ATOM 7853  H HG12 . VAL A 1 63  ? 7.535   -4.730  0.109   1.00 0.00 ? 63  VAL A HG12 5  
ATOM 7854  H HG13 . VAL A 1 63  ? 9.085   -4.207  -0.550  1.00 0.00 ? 63  VAL A HG13 5  
ATOM 7855  H HG21 . VAL A 1 63  ? 8.266   -6.575  -1.333  1.00 0.00 ? 63  VAL A HG21 5  
ATOM 7856  H HG22 . VAL A 1 63  ? 7.540   -6.594  -2.941  1.00 0.00 ? 63  VAL A HG22 5  
ATOM 7857  H HG23 . VAL A 1 63  ? 9.168   -5.954  -2.716  1.00 0.00 ? 63  VAL A HG23 5  
ATOM 7858  N N    . ALA A 1 64  ? 4.901   -3.764  -0.255  1.00 0.00 ? 64  ALA A N    5  
ATOM 7859  C CA   . ALA A 1 64  ? 4.303   -2.713  0.560   1.00 0.00 ? 64  ALA A CA   5  
ATOM 7860  C C    . ALA A 1 64  ? 5.365   -1.752  1.082   1.00 0.00 ? 64  ALA A C    5  
ATOM 7861  O O    . ALA A 1 64  ? 6.326   -2.167  1.731   1.00 0.00 ? 64  ALA A O    5  
ATOM 7862  C CB   . ALA A 1 64  ? 3.524   -3.321  1.717   1.00 0.00 ? 64  ALA A CB   5  
ATOM 7863  H H    . ALA A 1 64  ? 4.871   -4.691  0.063   1.00 0.00 ? 64  ALA A H    5  
ATOM 7864  H HA   . ALA A 1 64  ? 3.609   -2.165  -0.060  1.00 0.00 ? 64  ALA A HA   5  
ATOM 7865  H HB1  . ALA A 1 64  ? 2.715   -3.923  1.329   1.00 0.00 ? 64  ALA A HB1  5  
ATOM 7866  H HB2  . ALA A 1 64  ? 4.182   -3.941  2.308   1.00 0.00 ? 64  ALA A HB2  5  
ATOM 7867  H HB3  . ALA A 1 64  ? 3.122   -2.532  2.334   1.00 0.00 ? 64  ALA A HB3  5  
ATOM 7868  N N    . ILE A 1 65  ? 5.187   -0.467  0.794   1.00 0.00 ? 65  ILE A N    5  
ATOM 7869  C CA   . ILE A 1 65  ? 6.130   0.552   1.235   1.00 0.00 ? 65  ILE A CA   5  
ATOM 7870  C C    . ILE A 1 65  ? 5.552   1.379   2.378   1.00 0.00 ? 65  ILE A C    5  
ATOM 7871  O O    . ILE A 1 65  ? 6.282   2.067   3.092   1.00 0.00 ? 65  ILE A O    5  
ATOM 7872  C CB   . ILE A 1 65  ? 6.520   1.495   0.081   1.00 0.00 ? 65  ILE A CB   5  
ATOM 7873  C CG1  . ILE A 1 65  ? 5.267   2.060   -0.591  1.00 0.00 ? 65  ILE A CG1  5  
ATOM 7874  C CG2  . ILE A 1 65  ? 7.387   0.762   -0.932  1.00 0.00 ? 65  ILE A CG2  5  
ATOM 7875  C CD1  . ILE A 1 65  ? 5.567   3.009   -1.729  1.00 0.00 ? 65  ILE A CD1  5  
ATOM 7876  H H    . ILE A 1 65  ? 4.401   -0.199  0.273   1.00 0.00 ? 65  ILE A H    5  
ATOM 7877  H HA   . ILE A 1 65  ? 7.023   0.052   1.582   1.00 0.00 ? 65  ILE A HA   5  
ATOM 7878  H HB   . ILE A 1 65  ? 7.098   2.309   0.491   1.00 0.00 ? 65  ILE A HB   5  
ATOM 7879  H HG12 . ILE A 1 65  ? 4.680   1.246   -0.985  1.00 0.00 ? 65  ILE A HG12 5  
ATOM 7880  H HG13 . ILE A 1 65  ? 4.684   2.595   0.144   1.00 0.00 ? 65  ILE A HG13 5  
ATOM 7881  H HG21 . ILE A 1 65  ? 8.427   0.977   -0.738  1.00 0.00 ? 65  ILE A HG21 5  
ATOM 7882  H HG22 . ILE A 1 65  ? 7.218   -0.301  -0.848  1.00 0.00 ? 65  ILE A HG22 5  
ATOM 7883  H HG23 . ILE A 1 65  ? 7.131   1.090   -1.929  1.00 0.00 ? 65  ILE A HG23 5  
ATOM 7884  H HD11 . ILE A 1 65  ? 5.782   2.442   -2.624  1.00 0.00 ? 65  ILE A HD11 5  
ATOM 7885  H HD12 . ILE A 1 65  ? 4.712   3.645   -1.904  1.00 0.00 ? 65  ILE A HD12 5  
ATOM 7886  H HD13 . ILE A 1 65  ? 6.423   3.617   -1.476  1.00 0.00 ? 65  ILE A HD13 5  
ATOM 7887  N N    . TYR A 1 66  ? 4.237   1.304   2.548   1.00 0.00 ? 66  TYR A N    5  
ATOM 7888  C CA   . TYR A 1 66  ? 3.559   2.046   3.605   1.00 0.00 ? 66  TYR A CA   5  
ATOM 7889  C C    . TYR A 1 66  ? 2.536   1.167   4.318   1.00 0.00 ? 66  TYR A C    5  
ATOM 7890  O O    . TYR A 1 66  ? 1.763   0.454   3.680   1.00 0.00 ? 66  TYR A O    5  
ATOM 7891  C CB   . TYR A 1 66  ? 2.871   3.284   3.028   1.00 0.00 ? 66  TYR A CB   5  
ATOM 7892  C CG   . TYR A 1 66  ? 3.835   4.318   2.492   1.00 0.00 ? 66  TYR A CG   5  
ATOM 7893  C CD1  . TYR A 1 66  ? 4.871   4.804   3.279   1.00 0.00 ? 66  TYR A CD1  5  
ATOM 7894  C CD2  . TYR A 1 66  ? 3.709   4.809   1.198   1.00 0.00 ? 66  TYR A CD2  5  
ATOM 7895  C CE1  . TYR A 1 66  ? 5.754   5.750   2.794   1.00 0.00 ? 66  TYR A CE1  5  
ATOM 7896  C CE2  . TYR A 1 66  ? 4.587   5.754   0.704   1.00 0.00 ? 66  TYR A CE2  5  
ATOM 7897  C CZ   . TYR A 1 66  ? 5.608   6.221   1.506   1.00 0.00 ? 66  TYR A CZ   5  
ATOM 7898  O OH   . TYR A 1 66  ? 6.485   7.162   1.018   1.00 0.00 ? 66  TYR A OH   5  
ATOM 7899  H H    . TYR A 1 66  ? 3.708   0.739   1.948   1.00 0.00 ? 66  TYR A H    5  
ATOM 7900  H HA   . TYR A 1 66  ? 4.306   2.362   4.320   1.00 0.00 ? 66  TYR A HA   5  
ATOM 7901  H HB2  . TYR A 1 66  ? 2.224   2.983   2.218   1.00 0.00 ? 66  TYR A HB2  5  
ATOM 7902  H HB3  . TYR A 1 66  ? 2.278   3.751   3.801   1.00 0.00 ? 66  TYR A HB3  5  
ATOM 7903  H HD1  . TYR A 1 66  ? 4.983   4.433   4.287   1.00 0.00 ? 66  TYR A HD1  5  
ATOM 7904  H HD2  . TYR A 1 66  ? 2.909   4.441   0.573   1.00 0.00 ? 66  TYR A HD2  5  
ATOM 7905  H HE1  . TYR A 1 66  ? 6.553   6.116   3.421   1.00 0.00 ? 66  TYR A HE1  5  
ATOM 7906  H HE2  . TYR A 1 66  ? 4.473   6.123   -0.304  1.00 0.00 ? 66  TYR A HE2  5  
ATOM 7907  H HH   . TYR A 1 66  ? 6.079   8.031   1.061   1.00 0.00 ? 66  TYR A HH   5  
ATOM 7908  N N    . ASN A 1 67  ? 2.539   1.225   5.646   1.00 0.00 ? 67  ASN A N    5  
ATOM 7909  C CA   . ASN A 1 67  ? 1.612   0.434   6.447   1.00 0.00 ? 67  ASN A CA   5  
ATOM 7910  C C    . ASN A 1 67  ? 0.166   0.794   6.119   1.00 0.00 ? 67  ASN A C    5  
ATOM 7911  O O    . ASN A 1 67  ? -0.327  1.852   6.512   1.00 0.00 ? 67  ASN A O    5  
ATOM 7912  C CB   . ASN A 1 67  ? 1.878   0.654   7.938   1.00 0.00 ? 67  ASN A CB   5  
ATOM 7913  C CG   . ASN A 1 67  ? 3.148   -0.029  8.405   1.00 0.00 ? 67  ASN A CG   5  
ATOM 7914  O OD1  . ASN A 1 67  ? 3.991   0.584   9.060   1.00 0.00 ? 67  ASN A OD1  5  
ATOM 7915  N ND2  . ASN A 1 67  ? 3.292   -1.306  8.068   1.00 0.00 ? 67  ASN A ND2  5  
ATOM 7916  H H    . ASN A 1 67  ? 3.180   1.812   6.098   1.00 0.00 ? 67  ASN A H    5  
ATOM 7917  H HA   . ASN A 1 67  ? 1.774   -0.607  6.211   1.00 0.00 ? 67  ASN A HA   5  
ATOM 7918  H HB2  . ASN A 1 67  ? 1.971   1.713   8.128   1.00 0.00 ? 67  ASN A HB2  5  
ATOM 7919  H HB3  . ASN A 1 67  ? 1.049   0.261   8.507   1.00 0.00 ? 67  ASN A HB3  5  
ATOM 7920  H HD21 . ASN A 1 67  ? 2.580   -1.730  7.545   1.00 0.00 ? 67  ASN A HD21 5  
ATOM 7921  H HD22 . ASN A 1 67  ? 4.104   -1.772  8.358   1.00 0.00 ? 67  ASN A HD22 5  
ATOM 7922  N N    . PHE A 1 68  ? -0.510  -0.093  5.396   1.00 0.00 ? 68  PHE A N    5  
ATOM 7923  C CA   . PHE A 1 68  ? -1.899  0.131   5.014   1.00 0.00 ? 68  PHE A CA   5  
ATOM 7924  C C    . PHE A 1 68  ? -2.850  -0.510  6.021   1.00 0.00 ? 68  PHE A C    5  
ATOM 7925  O O    . PHE A 1 68  ? -2.596  -1.607  6.518   1.00 0.00 ? 68  PHE A O    5  
ATOM 7926  C CB   . PHE A 1 68  ? -2.163  -0.432  3.616   1.00 0.00 ? 68  PHE A CB   5  
ATOM 7927  C CG   . PHE A 1 68  ? -3.578  -0.242  3.151   1.00 0.00 ? 68  PHE A CG   5  
ATOM 7928  C CD1  . PHE A 1 68  ? -4.071  1.026   2.888   1.00 0.00 ? 68  PHE A CD1  5  
ATOM 7929  C CD2  . PHE A 1 68  ? -4.416  -1.332  2.976   1.00 0.00 ? 68  PHE A CD2  5  
ATOM 7930  C CE1  . PHE A 1 68  ? -5.373  1.203   2.461   1.00 0.00 ? 68  PHE A CE1  5  
ATOM 7931  C CE2  . PHE A 1 68  ? -5.719  -1.160  2.548   1.00 0.00 ? 68  PHE A CE2  5  
ATOM 7932  C CZ   . PHE A 1 68  ? -6.198  0.109   2.289   1.00 0.00 ? 68  PHE A CZ   5  
ATOM 7933  H H    . PHE A 1 68  ? -0.063  -0.918  5.112   1.00 0.00 ? 68  PHE A H    5  
ATOM 7934  H HA   . PHE A 1 68  ? -2.071  1.196   5.002   1.00 0.00 ? 68  PHE A HA   5  
ATOM 7935  H HB2  . PHE A 1 68  ? -1.513  0.060   2.909   1.00 0.00 ? 68  PHE A HB2  5  
ATOM 7936  H HB3  . PHE A 1 68  ? -1.952  -1.491  3.617   1.00 0.00 ? 68  PHE A HB3  5  
ATOM 7937  H HD1  . PHE A 1 68  ? -3.427  1.883   3.021   1.00 0.00 ? 68  PHE A HD1  5  
ATOM 7938  H HD2  . PHE A 1 68  ? -4.042  -2.326  3.177   1.00 0.00 ? 68  PHE A HD2  5  
ATOM 7939  H HE1  . PHE A 1 68  ? -5.745  2.197   2.259   1.00 0.00 ? 68  PHE A HE1  5  
ATOM 7940  H HE2  . PHE A 1 68  ? -6.361  -2.018  2.415   1.00 0.00 ? 68  PHE A HE2  5  
ATOM 7941  H HZ   . PHE A 1 68  ? -7.216  0.245   1.955   1.00 0.00 ? 68  PHE A HZ   5  
ATOM 7942  N N    . GLN A 1 69  ? -3.945  0.183   6.316   1.00 0.00 ? 69  GLN A N    5  
ATOM 7943  C CA   . GLN A 1 69  ? -4.933  -0.317  7.265   1.00 0.00 ? 69  GLN A CA   5  
ATOM 7944  C C    . GLN A 1 69  ? -6.349  -0.018  6.784   1.00 0.00 ? 69  GLN A C    5  
ATOM 7945  O O    . GLN A 1 69  ? -6.805  1.123   6.838   1.00 0.00 ? 69  GLN A O    5  
ATOM 7946  C CB   . GLN A 1 69  ? -4.707  0.304   8.644   1.00 0.00 ? 69  GLN A CB   5  
ATOM 7947  C CG   . GLN A 1 69  ? -4.906  1.811   8.672   1.00 0.00 ? 69  GLN A CG   5  
ATOM 7948  C CD   . GLN A 1 69  ? -4.238  2.465   9.866   1.00 0.00 ? 69  GLN A CD   5  
ATOM 7949  O OE1  . GLN A 1 69  ? -4.874  2.711   10.891  1.00 0.00 ? 69  GLN A OE1  5  
ATOM 7950  N NE2  . GLN A 1 69  ? -2.947  2.751   9.739   1.00 0.00 ? 69  GLN A NE2  5  
ATOM 7951  H H    . GLN A 1 69  ? -4.091  1.052   5.887   1.00 0.00 ? 69  GLN A H    5  
ATOM 7952  H HA   . GLN A 1 69  ? -4.810  -1.387  7.338   1.00 0.00 ? 69  GLN A HA   5  
ATOM 7953  H HB2  . GLN A 1 69  ? -5.398  -0.142  9.344   1.00 0.00 ? 69  GLN A HB2  5  
ATOM 7954  H HB3  . GLN A 1 69  ? -3.697  0.090   8.961   1.00 0.00 ? 69  GLN A HB3  5  
ATOM 7955  H HG2  . GLN A 1 69  ? -4.489  2.233   7.770   1.00 0.00 ? 69  GLN A HG2  5  
ATOM 7956  H HG3  . GLN A 1 69  ? -5.965  2.021   8.711   1.00 0.00 ? 69  GLN A HG3  5  
ATOM 7957  H HE21 . GLN A 1 69  ? -2.505  2.527   8.893   1.00 0.00 ? 69  GLN A HE21 5  
ATOM 7958  H HE22 . GLN A 1 69  ? -2.490  3.175   10.494  1.00 0.00 ? 69  GLN A HE22 5  
ATOM 7959  N N    . GLY A 1 70  ? -7.040  -1.052  6.313   1.00 0.00 ? 70  GLY A N    5  
ATOM 7960  C CA   . GLY A 1 70  ? -8.397  -0.878  5.830   1.00 0.00 ? 70  GLY A CA   5  
ATOM 7961  C C    . GLY A 1 70  ? -9.435  -1.236  6.874   1.00 0.00 ? 70  GLY A C    5  
ATOM 7962  O O    . GLY A 1 70  ? -9.205  -1.066  8.072   1.00 0.00 ? 70  GLY A O    5  
ATOM 7963  H H    . GLY A 1 70  ? -6.625  -1.939  6.294   1.00 0.00 ? 70  GLY A H    5  
ATOM 7964  H HA2  . GLY A 1 70  ? -8.535  0.153   5.539   1.00 0.00 ? 70  GLY A HA2  5  
ATOM 7965  H HA3  . GLY A 1 70  ? -8.542  -1.508  4.964   1.00 0.00 ? 70  GLY A HA3  5  
ATOM 7966  N N    . SER A 1 71  ? -10.582 -1.732  6.421   1.00 0.00 ? 71  SER A N    5  
ATOM 7967  C CA   . SER A 1 71  ? -11.662 -2.109  7.325   1.00 0.00 ? 71  SER A CA   5  
ATOM 7968  C C    . SER A 1 71  ? -12.102 -3.549  7.075   1.00 0.00 ? 71  SER A C    5  
ATOM 7969  O O    . SER A 1 71  ? -12.266 -4.331  8.010   1.00 0.00 ? 71  SER A O    5  
ATOM 7970  C CB   . SER A 1 71  ? -12.853 -1.164  7.155   1.00 0.00 ? 71  SER A CB   5  
ATOM 7971  O OG   . SER A 1 71  ? -13.931 -1.546  7.992   1.00 0.00 ? 71  SER A OG   5  
ATOM 7972  H H    . SER A 1 71  ? -10.706 -1.843  5.455   1.00 0.00 ? 71  SER A H    5  
ATOM 7973  H HA   . SER A 1 71  ? -11.291 -2.029  8.336   1.00 0.00 ? 71  SER A HA   5  
ATOM 7974  H HB2  . SER A 1 71  ? -12.552 -0.160  7.412   1.00 0.00 ? 71  SER A HB2  5  
ATOM 7975  H HB3  . SER A 1 71  ? -13.184 -1.189  6.127   1.00 0.00 ? 71  SER A HB3  5  
ATOM 7976  H HG   . SER A 1 71  ? -14.017 -2.502  7.987   1.00 0.00 ? 71  SER A HG   5  
ATOM 7977  N N    . GLY A 1 72  ? -12.291 -3.891  5.804   1.00 0.00 ? 72  GLY A N    5  
ATOM 7978  C CA   . GLY A 1 72  ? -12.709 -5.235  5.452   1.00 0.00 ? 72  GLY A CA   5  
ATOM 7979  C C    . GLY A 1 72  ? -12.899 -5.411  3.959   1.00 0.00 ? 72  GLY A C    5  
ATOM 7980  O O    . GLY A 1 72  ? -13.107 -4.439  3.234   1.00 0.00 ? 72  GLY A O    5  
ATOM 7981  H H    . GLY A 1 72  ? -12.145 -3.225  5.100   1.00 0.00 ? 72  GLY A H    5  
ATOM 7982  H HA2  . GLY A 1 72  ? -11.961 -5.935  5.795   1.00 0.00 ? 72  GLY A HA2  5  
ATOM 7983  H HA3  . GLY A 1 72  ? -13.644 -5.451  5.950   1.00 0.00 ? 72  GLY A HA3  5  
ATOM 7984  N N    . ALA A 1 73  ? -12.825 -6.655  3.497   1.00 0.00 ? 73  ALA A N    5  
ATOM 7985  C CA   . ALA A 1 73  ? -12.991 -6.955  2.080   1.00 0.00 ? 73  ALA A CA   5  
ATOM 7986  C C    . ALA A 1 73  ? -14.064 -6.071  1.454   1.00 0.00 ? 73  ALA A C    5  
ATOM 7987  O O    . ALA A 1 73  ? -14.982 -5.598  2.124   1.00 0.00 ? 73  ALA A O    5  
ATOM 7988  C CB   . ALA A 1 73  ? -13.337 -8.425  1.889   1.00 0.00 ? 73  ALA A CB   5  
ATOM 7989  H H    . ALA A 1 73  ? -12.657 -7.389  4.125   1.00 0.00 ? 73  ALA A H    5  
ATOM 7990  H HA   . ALA A 1 73  ? -12.049 -6.765  1.587   1.00 0.00 ? 73  ALA A HA   5  
ATOM 7991  H HB1  . ALA A 1 73  ? -13.898 -8.545  0.973   1.00 0.00 ? 73  ALA A HB1  5  
ATOM 7992  H HB2  . ALA A 1 73  ? -12.428 -9.004  1.834   1.00 0.00 ? 73  ALA A HB2  5  
ATOM 7993  H HB3  . ALA A 1 73  ? -13.932 -8.766  2.723   1.00 0.00 ? 73  ALA A HB3  5  
ATOM 7994  N N    . PRO A 1 74  ? -13.947 -5.841  0.137   1.00 0.00 ? 74  PRO A N    5  
ATOM 7995  C CA   . PRO A 1 74  ? -12.858 -6.398  -0.670  1.00 0.00 ? 74  PRO A CA   5  
ATOM 7996  C C    . PRO A 1 74  ? -11.510 -5.766  -0.341  1.00 0.00 ? 74  PRO A C    5  
ATOM 7997  O O    . PRO A 1 74  ? -10.481 -6.158  -0.889  1.00 0.00 ? 74  PRO A O    5  
ATOM 7998  C CB   . PRO A 1 74  ? -13.271 -6.059  -2.105  1.00 0.00 ? 74  PRO A CB   5  
ATOM 7999  C CG   . PRO A 1 74  ? -14.148 -4.862  -1.974  1.00 0.00 ? 74  PRO A CG   5  
ATOM 8000  C CD   . PRO A 1 74  ? -14.869 -5.018  -0.663  1.00 0.00 ? 74  PRO A CD   5  
ATOM 8001  H HA   . PRO A 1 74  ? -12.789 -7.470  -0.558  1.00 0.00 ? 74  PRO A HA   5  
ATOM 8002  H HB2  . PRO A 1 74  ? -12.391 -5.842  -2.694  1.00 0.00 ? 74  PRO A HB2  5  
ATOM 8003  H HB3  . PRO A 1 74  ? -13.804 -6.893  -2.536  1.00 0.00 ? 74  PRO A HB3  5  
ATOM 8004  H HG2  . PRO A 1 74  ? -13.547 -3.965  -1.966  1.00 0.00 ? 74  PRO A HG2  5  
ATOM 8005  H HG3  . PRO A 1 74  ? -14.855 -4.834  -2.789  1.00 0.00 ? 74  PRO A HG3  5  
ATOM 8006  H HD2  . PRO A 1 74  ? -15.026 -4.054  -0.202  1.00 0.00 ? 74  PRO A HD2  5  
ATOM 8007  H HD3  . PRO A 1 74  ? -15.811 -5.527  -0.809  1.00 0.00 ? 74  PRO A HD3  5  
ATOM 8008  N N    . GLN A 1 75  ? -11.525 -4.787  0.558   1.00 0.00 ? 75  GLN A N    5  
ATOM 8009  C CA   . GLN A 1 75  ? -10.302 -4.101  0.959   1.00 0.00 ? 75  GLN A CA   5  
ATOM 8010  C C    . GLN A 1 75  ? -9.425  -5.008  1.816   1.00 0.00 ? 75  GLN A C    5  
ATOM 8011  O O    . GLN A 1 75  ? -9.890  -5.592  2.796   1.00 0.00 ? 75  GLN A O    5  
ATOM 8012  C CB   . GLN A 1 75  ? -10.639 -2.822  1.728   1.00 0.00 ? 75  GLN A CB   5  
ATOM 8013  C CG   . GLN A 1 75  ? -11.557 -1.879  0.968   1.00 0.00 ? 75  GLN A CG   5  
ATOM 8014  C CD   . GLN A 1 75  ? -12.416 -1.033  1.887   1.00 0.00 ? 75  GLN A CD   5  
ATOM 8015  O OE1  . GLN A 1 75  ? -13.613 -0.862  1.655   1.00 0.00 ? 75  GLN A OE1  5  
ATOM 8016  N NE2  . GLN A 1 75  ? -11.808 -0.498  2.940   1.00 0.00 ? 75  GLN A NE2  5  
ATOM 8017  H H    . GLN A 1 75  ? -12.377 -4.519  0.959   1.00 0.00 ? 75  GLN A H    5  
ATOM 8018  H HA   . GLN A 1 75  ? -9.760  -3.839  0.064   1.00 0.00 ? 75  GLN A HA   5  
ATOM 8019  H HB2  . GLN A 1 75  ? -11.122 -3.091  2.656   1.00 0.00 ? 75  GLN A HB2  5  
ATOM 8020  H HB3  . GLN A 1 75  ? -9.721  -2.297  1.949   1.00 0.00 ? 75  GLN A HB3  5  
ATOM 8021  H HG2  . GLN A 1 75  ? -10.953 -1.221  0.360   1.00 0.00 ? 75  GLN A HG2  5  
ATOM 8022  H HG3  . GLN A 1 75  ? -12.204 -2.463  0.331   1.00 0.00 ? 75  GLN A HG3  5  
ATOM 8023  H HE21 . GLN A 1 75  ? -10.851 -0.676  3.061   1.00 0.00 ? 75  GLN A HE21 5  
ATOM 8024  H HE22 . GLN A 1 75  ? -12.338 0.054   3.550   1.00 0.00 ? 75  GLN A HE22 5  
ATOM 8025  N N    . LEU A 1 76  ? -8.156  -5.122  1.441   1.00 0.00 ? 76  LEU A N    5  
ATOM 8026  C CA   . LEU A 1 76  ? -7.214  -5.959  2.176   1.00 0.00 ? 76  LEU A CA   5  
ATOM 8027  C C    . LEU A 1 76  ? -6.089  -5.118  2.771   1.00 0.00 ? 76  LEU A C    5  
ATOM 8028  O O    . LEU A 1 76  ? -5.579  -4.201  2.128   1.00 0.00 ? 76  LEU A O    5  
ATOM 8029  C CB   . LEU A 1 76  ? -6.631  -7.033  1.256   1.00 0.00 ? 76  LEU A CB   5  
ATOM 8030  C CG   . LEU A 1 76  ? -5.356  -7.719  1.748   1.00 0.00 ? 76  LEU A CG   5  
ATOM 8031  C CD1  . LEU A 1 76  ? -5.695  -8.870  2.682   1.00 0.00 ? 76  LEU A CD1  5  
ATOM 8032  C CD2  . LEU A 1 76  ? -4.527  -8.211  0.571   1.00 0.00 ? 76  LEU A CD2  5  
ATOM 8033  H H    . LEU A 1 76  ? -7.845  -4.632  0.652   1.00 0.00 ? 76  LEU A H    5  
ATOM 8034  H HA   . LEU A 1 76  ? -7.753  -6.438  2.979   1.00 0.00 ? 76  LEU A HA   5  
ATOM 8035  H HB2  . LEU A 1 76  ? -7.384  -7.794  1.119   1.00 0.00 ? 76  LEU A HB2  5  
ATOM 8036  H HB3  . LEU A 1 76  ? -6.413  -6.570  0.304   1.00 0.00 ? 76  LEU A HB3  5  
ATOM 8037  H HG   . LEU A 1 76  ? -4.761  -7.005  2.301   1.00 0.00 ? 76  LEU A HG   5  
ATOM 8038  H HD11 . LEU A 1 76  ? -6.670  -9.260  2.434   1.00 0.00 ? 76  LEU A HD11 5  
ATOM 8039  H HD12 . LEU A 1 76  ? -5.698  -8.516  3.703   1.00 0.00 ? 76  LEU A HD12 5  
ATOM 8040  H HD13 . LEU A 1 76  ? -4.956  -9.650  2.574   1.00 0.00 ? 76  LEU A HD13 5  
ATOM 8041  H HD21 . LEU A 1 76  ? -5.066  -8.034  -0.348  1.00 0.00 ? 76  LEU A HD21 5  
ATOM 8042  H HD22 . LEU A 1 76  ? -4.340  -9.269  0.681   1.00 0.00 ? 76  LEU A HD22 5  
ATOM 8043  H HD23 . LEU A 1 76  ? -3.586  -7.680  0.546   1.00 0.00 ? 76  LEU A HD23 5  
ATOM 8044  N N    . SER A 1 77  ? -5.705  -5.440  4.002   1.00 0.00 ? 77  SER A N    5  
ATOM 8045  C CA   . SER A 1 77  ? -4.641  -4.713  4.685   1.00 0.00 ? 77  SER A CA   5  
ATOM 8046  C C    . SER A 1 77  ? -3.270  -5.155  4.180   1.00 0.00 ? 77  SER A C    5  
ATOM 8047  O O    . SER A 1 77  ? -3.136  -6.207  3.553   1.00 0.00 ? 77  SER A O    5  
ATOM 8048  C CB   . SER A 1 77  ? -4.734  -4.932  6.197   1.00 0.00 ? 77  SER A CB   5  
ATOM 8049  O OG   . SER A 1 77  ? -4.789  -6.313  6.510   1.00 0.00 ? 77  SER A OG   5  
ATOM 8050  H H    . SER A 1 77  ? -6.150  -6.182  4.463   1.00 0.00 ? 77  SER A H    5  
ATOM 8051  H HA   . SER A 1 77  ? -4.768  -3.662  4.474   1.00 0.00 ? 77  SER A HA   5  
ATOM 8052  H HB2  . SER A 1 77  ? -3.867  -4.501  6.674   1.00 0.00 ? 77  SER A HB2  5  
ATOM 8053  H HB3  . SER A 1 77  ? -5.627  -4.453  6.572   1.00 0.00 ? 77  SER A HB3  5  
ATOM 8054  H HG   . SER A 1 77  ? -5.552  -6.485  7.067   1.00 0.00 ? 77  SER A HG   5  
ATOM 8055  N N    . LEU A 1 78  ? -2.255  -4.344  4.457   1.00 0.00 ? 78  LEU A N    5  
ATOM 8056  C CA   . LEU A 1 78  ? -0.894  -4.649  4.031   1.00 0.00 ? 78  LEU A CA   5  
ATOM 8057  C C    . LEU A 1 78  ? 0.121   -4.149  5.054   1.00 0.00 ? 78  LEU A C    5  
ATOM 8058  O O    . LEU A 1 78  ? -0.163  -3.235  5.828   1.00 0.00 ? 78  LEU A O    5  
ATOM 8059  C CB   . LEU A 1 78  ? -0.612  -4.019  2.666   1.00 0.00 ? 78  LEU A CB   5  
ATOM 8060  C CG   . LEU A 1 78  ? -1.028  -4.845  1.448   1.00 0.00 ? 78  LEU A CG   5  
ATOM 8061  C CD1  . LEU A 1 78  ? -0.890  -4.024  0.175   1.00 0.00 ? 78  LEU A CD1  5  
ATOM 8062  C CD2  . LEU A 1 78  ? -0.198  -6.117  1.357   1.00 0.00 ? 78  LEU A CD2  5  
ATOM 8063  H H    . LEU A 1 78  ? -2.425  -3.520  4.960   1.00 0.00 ? 78  LEU A H    5  
ATOM 8064  H HA   . LEU A 1 78  ? -0.805  -5.722  3.949   1.00 0.00 ? 78  LEU A HA   5  
ATOM 8065  H HB2  . LEU A 1 78  ? -1.137  -3.077  2.622   1.00 0.00 ? 78  LEU A HB2  5  
ATOM 8066  H HB3  . LEU A 1 78  ? 0.452   -3.840  2.599   1.00 0.00 ? 78  LEU A HB3  5  
ATOM 8067  H HG   . LEU A 1 78  ? -2.067  -5.128  1.550   1.00 0.00 ? 78  LEU A HG   5  
ATOM 8068  H HD11 . LEU A 1 78  ? -1.057  -4.658  -0.682  1.00 0.00 ? 78  LEU A HD11 5  
ATOM 8069  H HD12 . LEU A 1 78  ? 0.104   -3.603  0.124   1.00 0.00 ? 78  LEU A HD12 5  
ATOM 8070  H HD13 . LEU A 1 78  ? -1.618  -3.226  0.180   1.00 0.00 ? 78  LEU A HD13 5  
ATOM 8071  H HD21 . LEU A 1 78  ? 0.266   -6.313  2.312   1.00 0.00 ? 78  LEU A HD21 5  
ATOM 8072  H HD22 . LEU A 1 78  ? 0.566   -5.995  0.604   1.00 0.00 ? 78  LEU A HD22 5  
ATOM 8073  H HD23 . LEU A 1 78  ? -0.838  -6.945  1.090   1.00 0.00 ? 78  LEU A HD23 5  
ATOM 8074  N N    . GLN A 1 79  ? 1.305   -4.753  5.049   1.00 0.00 ? 79  GLN A N    5  
ATOM 8075  C CA   . GLN A 1 79  ? 2.363   -4.367  5.975   1.00 0.00 ? 79  GLN A CA   5  
ATOM 8076  C C    . GLN A 1 79  ? 3.666   -4.093  5.231   1.00 0.00 ? 79  GLN A C    5  
ATOM 8077  O O    . GLN A 1 79  ? 4.046   -4.842  4.330   1.00 0.00 ? 79  GLN A O    5  
ATOM 8078  C CB   . GLN A 1 79  ? 2.580   -5.463  7.020   1.00 0.00 ? 79  GLN A CB   5  
ATOM 8079  C CG   . GLN A 1 79  ? 1.678   -5.330  8.237   1.00 0.00 ? 79  GLN A CG   5  
ATOM 8080  C CD   . GLN A 1 79  ? 1.528   -6.633  8.998   1.00 0.00 ? 79  GLN A CD   5  
ATOM 8081  O OE1  . GLN A 1 79  ? 2.434   -7.052  9.718   1.00 0.00 ? 79  GLN A OE1  5  
ATOM 8082  N NE2  . GLN A 1 79  ? 0.380   -7.281  8.841   1.00 0.00 ? 79  GLN A NE2  5  
ATOM 8083  H H    . GLN A 1 79  ? 1.471   -5.474  4.408   1.00 0.00 ? 79  GLN A H    5  
ATOM 8084  H HA   . GLN A 1 79  ? 2.052   -3.462  6.475   1.00 0.00 ? 79  GLN A HA   5  
ATOM 8085  H HB2  . GLN A 1 79  ? 2.391   -6.423  6.562   1.00 0.00 ? 79  GLN A HB2  5  
ATOM 8086  H HB3  . GLN A 1 79  ? 3.606   -5.428  7.354   1.00 0.00 ? 79  GLN A HB3  5  
ATOM 8087  H HG2  . GLN A 1 79  ? 2.098   -4.590  8.902   1.00 0.00 ? 79  GLN A HG2  5  
ATOM 8088  H HG3  . GLN A 1 79  ? 0.701   -5.006  7.911   1.00 0.00 ? 79  GLN A HG3  5  
ATOM 8089  H HE21 . GLN A 1 79  ? -0.296  -6.888  8.250   1.00 0.00 ? 79  GLN A HE21 5  
ATOM 8090  H HE22 . GLN A 1 79  ? 0.257   -8.126  9.320   1.00 0.00 ? 79  GLN A HE22 5  
ATOM 8091  N N    . ILE A 1 80  ? 4.345   -3.017  5.612   1.00 0.00 ? 80  ILE A N    5  
ATOM 8092  C CA   . ILE A 1 80  ? 5.605   -2.646  4.981   1.00 0.00 ? 80  ILE A CA   5  
ATOM 8093  C C    . ILE A 1 80  ? 6.573   -3.823  4.952   1.00 0.00 ? 80  ILE A C    5  
ATOM 8094  O O    . ILE A 1 80  ? 6.775   -4.499  5.960   1.00 0.00 ? 80  ILE A O    5  
ATOM 8095  C CB   . ILE A 1 80  ? 6.272   -1.464  5.709   1.00 0.00 ? 80  ILE A CB   5  
ATOM 8096  C CG1  . ILE A 1 80  ? 5.334   -0.256  5.733   1.00 0.00 ? 80  ILE A CG1  5  
ATOM 8097  C CG2  . ILE A 1 80  ? 7.590   -1.105  5.038   1.00 0.00 ? 80  ILE A CG2  5  
ATOM 8098  C CD1  . ILE A 1 80  ? 5.850   0.893   6.571   1.00 0.00 ? 80  ILE A CD1  5  
ATOM 8099  H H    . ILE A 1 80  ? 3.990   -2.460  6.336   1.00 0.00 ? 80  ILE A H    5  
ATOM 8100  H HA   . ILE A 1 80  ? 5.392   -2.343  3.966   1.00 0.00 ? 80  ILE A HA   5  
ATOM 8101  H HB   . ILE A 1 80  ? 6.483   -1.768  6.723   1.00 0.00 ? 80  ILE A HB   5  
ATOM 8102  H HG12 . ILE A 1 80  ? 5.196   0.105   4.726   1.00 0.00 ? 80  ILE A HG12 5  
ATOM 8103  H HG13 . ILE A 1 80  ? 4.379   -0.559  6.137   1.00 0.00 ? 80  ILE A HG13 5  
ATOM 8104  H HG21 . ILE A 1 80  ? 8.371   -1.057  5.783   1.00 0.00 ? 80  ILE A HG21 5  
ATOM 8105  H HG22 . ILE A 1 80  ? 7.838   -1.859  4.306   1.00 0.00 ? 80  ILE A HG22 5  
ATOM 8106  H HG23 . ILE A 1 80  ? 7.497   -0.146  4.552   1.00 0.00 ? 80  ILE A HG23 5  
ATOM 8107  H HD11 . ILE A 1 80  ? 6.171   1.696   5.922   1.00 0.00 ? 80  ILE A HD11 5  
ATOM 8108  H HD12 . ILE A 1 80  ? 5.063   1.249   7.219   1.00 0.00 ? 80  ILE A HD12 5  
ATOM 8109  H HD13 . ILE A 1 80  ? 6.685   0.559   7.167   1.00 0.00 ? 80  ILE A HD13 5  
ATOM 8110  N N    . GLY A 1 81  ? 7.172   -4.062  3.790   1.00 0.00 ? 81  GLY A N    5  
ATOM 8111  C CA   . GLY A 1 81  ? 8.114   -5.157  3.651   1.00 0.00 ? 81  GLY A CA   5  
ATOM 8112  C C    . GLY A 1 81  ? 7.435   -6.465  3.296   1.00 0.00 ? 81  GLY A C    5  
ATOM 8113  O O    . GLY A 1 81  ? 8.052   -7.528  3.353   1.00 0.00 ? 81  GLY A O    5  
ATOM 8114  H H    . GLY A 1 81  ? 6.973   -3.489  3.019   1.00 0.00 ? 81  GLY A H    5  
ATOM 8115  H HA2  . GLY A 1 81  ? 8.825   -4.911  2.877   1.00 0.00 ? 81  GLY A HA2  5  
ATOM 8116  H HA3  . GLY A 1 81  ? 8.643   -5.282  4.585   1.00 0.00 ? 81  GLY A HA3  5  
ATOM 8117  N N    . ASP A 1 82  ? 6.160   -6.387  2.930   1.00 0.00 ? 82  ASP A N    5  
ATOM 8118  C CA   . ASP A 1 82  ? 5.396   -7.574  2.564   1.00 0.00 ? 82  ASP A CA   5  
ATOM 8119  C C    . ASP A 1 82  ? 5.103   -7.592  1.067   1.00 0.00 ? 82  ASP A C    5  
ATOM 8120  O O    . ASP A 1 82  ? 4.684   -6.586  0.494   1.00 0.00 ? 82  ASP A O    5  
ATOM 8121  C CB   . ASP A 1 82  ? 4.087   -7.626  3.354   1.00 0.00 ? 82  ASP A CB   5  
ATOM 8122  C CG   . ASP A 1 82  ? 4.314   -7.632  4.852   1.00 0.00 ? 82  ASP A CG   5  
ATOM 8123  O OD1  . ASP A 1 82  ? 5.311   -7.030  5.303   1.00 0.00 ? 82  ASP A OD1  5  
ATOM 8124  O OD2  . ASP A 1 82  ? 3.495   -8.238  5.575   1.00 0.00 ? 82  ASP A OD2  5  
ATOM 8125  H H    . ASP A 1 82  ? 5.723   -5.510  2.904   1.00 0.00 ? 82  ASP A H    5  
ATOM 8126  H HA   . ASP A 1 82  ? 5.990   -8.440  2.813   1.00 0.00 ? 82  ASP A HA   5  
ATOM 8127  H HB2  . ASP A 1 82  ? 3.488   -6.763  3.102   1.00 0.00 ? 82  ASP A HB2  5  
ATOM 8128  H HB3  . ASP A 1 82  ? 3.548   -8.523  3.086   1.00 0.00 ? 82  ASP A HB3  5  
ATOM 8129  N N    . VAL A 1 83  ? 5.328   -8.741  0.439   1.00 0.00 ? 83  VAL A N    5  
ATOM 8130  C CA   . VAL A 1 83  ? 5.088   -8.891  -0.991  1.00 0.00 ? 83  VAL A CA   5  
ATOM 8131  C C    . VAL A 1 83  ? 3.742   -9.556  -1.256  1.00 0.00 ? 83  VAL A C    5  
ATOM 8132  O O    . VAL A 1 83  ? 3.299   -10.412 -0.491  1.00 0.00 ? 83  VAL A O    5  
ATOM 8133  C CB   . VAL A 1 83  ? 6.199   -9.720  -1.663  1.00 0.00 ? 83  VAL A CB   5  
ATOM 8134  C CG1  . VAL A 1 83  ? 5.950   -9.834  -3.159  1.00 0.00 ? 83  VAL A CG1  5  
ATOM 8135  C CG2  . VAL A 1 83  ? 7.563   -9.105  -1.387  1.00 0.00 ? 83  VAL A CG2  5  
ATOM 8136  H H    . VAL A 1 83  ? 5.662   -9.508  0.950   1.00 0.00 ? 83  VAL A H    5  
ATOM 8137  H HA   . VAL A 1 83  ? 5.086   -7.905  -1.434  1.00 0.00 ? 83  VAL A HA   5  
ATOM 8138  H HB   . VAL A 1 83  ? 6.184   -10.714 -1.241  1.00 0.00 ? 83  VAL A HB   5  
ATOM 8139  H HG11 . VAL A 1 83  ? 5.204   -9.111  -3.455  1.00 0.00 ? 83  VAL A HG11 5  
ATOM 8140  H HG12 . VAL A 1 83  ? 6.869   -9.645  -3.693  1.00 0.00 ? 83  VAL A HG12 5  
ATOM 8141  H HG13 . VAL A 1 83  ? 5.597   -10.829 -3.390  1.00 0.00 ? 83  VAL A HG13 5  
ATOM 8142  H HG21 . VAL A 1 83  ? 7.455   -8.284  -0.693  1.00 0.00 ? 83  VAL A HG21 5  
ATOM 8143  H HG22 . VAL A 1 83  ? 8.215   -9.853  -0.962  1.00 0.00 ? 83  VAL A HG22 5  
ATOM 8144  H HG23 . VAL A 1 83  ? 7.988   -8.740  -2.311  1.00 0.00 ? 83  VAL A HG23 5  
ATOM 8145  N N    . VAL A 1 84  ? 3.095   -9.156  -2.346  1.00 0.00 ? 84  VAL A N    5  
ATOM 8146  C CA   . VAL A 1 84  ? 1.800   -9.714  -2.715  1.00 0.00 ? 84  VAL A CA   5  
ATOM 8147  C C    . VAL A 1 84  ? 1.752   -10.060 -4.198  1.00 0.00 ? 84  VAL A C    5  
ATOM 8148  O O    . VAL A 1 84  ? 2.315   -9.349  -5.031  1.00 0.00 ? 84  VAL A O    5  
ATOM 8149  C CB   . VAL A 1 84  ? 0.655   -8.736  -2.390  1.00 0.00 ? 84  VAL A CB   5  
ATOM 8150  C CG1  . VAL A 1 84  ? 0.557   -8.507  -0.890  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 8151  C CG2  . VAL A 1 84  ? 0.854   -7.420  -3.127  1.00 0.00 ? 84  VAL A CG2  5  
ATOM 8152  H H    . VAL A 1 84  ? 3.499   -8.469  -2.917  1.00 0.00 ? 84  VAL A H    5  
ATOM 8153  H HA   . VAL A 1 84  ? 1.649   -10.616 -2.139  1.00 0.00 ? 84  VAL A HA   5  
ATOM 8154  H HB   . VAL A 1 84  ? -0.273  -9.176  -2.726  1.00 0.00 ? 84  VAL A HB   5  
ATOM 8155  H HG11 . VAL A 1 84  ? 0.997   -9.345  -0.369  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 8156  H HG12 . VAL A 1 84  ? 1.084   -7.601  -0.628  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 8157  H HG13 . VAL A 1 84  ? -0.481  -8.414  -0.607  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 8158  H HG21 . VAL A 1 84  ? -0.106  -7.029  -3.433  1.00 0.00 ? 84  VAL A HG21 5  
ATOM 8159  H HG22 . VAL A 1 84  ? 1.339   -6.712  -2.472  1.00 0.00 ? 84  VAL A HG22 5  
ATOM 8160  H HG23 . VAL A 1 84  ? 1.470   -7.585  -3.999  1.00 0.00 ? 84  VAL A HG23 5  
ATOM 8161  N N    . ARG A 1 85  ? 1.076   -11.158 -4.523  1.00 0.00 ? 85  ARG A N    5  
ATOM 8162  C CA   . ARG A 1 85  ? 0.955   -11.599 -5.907  1.00 0.00 ? 85  ARG A CA   5  
ATOM 8163  C C    . ARG A 1 85  ? -0.175  -10.859 -6.617  1.00 0.00 ? 85  ARG A C    5  
ATOM 8164  O O    . ARG A 1 85  ? -1.351  -11.164 -6.419  1.00 0.00 ? 85  ARG A O    5  
ATOM 8165  C CB   . ARG A 1 85  ? 0.705   -13.108 -5.963  1.00 0.00 ? 85  ARG A CB   5  
ATOM 8166  C CG   . ARG A 1 85  ? 1.032   -13.729 -7.311  1.00 0.00 ? 85  ARG A CG   5  
ATOM 8167  C CD   . ARG A 1 85  ? 2.531   -13.914 -7.490  1.00 0.00 ? 85  ARG A CD   5  
ATOM 8168  N NE   . ARG A 1 85  ? 2.867   -14.399 -8.826  1.00 0.00 ? 85  ARG A NE   5  
ATOM 8169  C CZ   . ARG A 1 85  ? 4.088   -14.337 -9.345  1.00 0.00 ? 85  ARG A CZ   5  
ATOM 8170  N NH1  . ARG A 1 85  ? 5.084   -13.814 -8.643  1.00 0.00 ? 85  ARG A NH1  5  
ATOM 8171  N NH2  . ARG A 1 85  ? 4.315   -14.800 -10.568 1.00 0.00 ? 85  ARG A NH2  5  
ATOM 8172  H H    . ARG A 1 85  ? 0.648   -11.683 -3.814  1.00 0.00 ? 85  ARG A H    5  
ATOM 8173  H HA   . ARG A 1 85  ? 1.885   -11.378 -6.408  1.00 0.00 ? 85  ARG A HA   5  
ATOM 8174  H HB2  . ARG A 1 85  ? 1.314   -13.590 -5.212  1.00 0.00 ? 85  ARG A HB2  5  
ATOM 8175  H HB3  . ARG A 1 85  ? -0.336  -13.296 -5.747  1.00 0.00 ? 85  ARG A HB3  5  
ATOM 8176  H HG2  . ARG A 1 85  ? 0.551   -14.694 -7.379  1.00 0.00 ? 85  ARG A HG2  5  
ATOM 8177  H HG3  . ARG A 1 85  ? 0.662   -13.084 -8.094  1.00 0.00 ? 85  ARG A HG3  5  
ATOM 8178  H HD2  . ARG A 1 85  ? 3.020   -12.965 -7.329  1.00 0.00 ? 85  ARG A HD2  5  
ATOM 8179  H HD3  . ARG A 1 85  ? 2.882   -14.628 -6.759  1.00 0.00 ? 85  ARG A HD3  5  
ATOM 8180  H HE   . ARG A 1 85  ? 2.146   -14.790 -9.362  1.00 0.00 ? 85  ARG A HE   5  
ATOM 8181  H HH11 . ARG A 1 85  ? 4.917   -13.466 -7.721  1.00 0.00 ? 85  ARG A HH11 5  
ATOM 8182  H HH12 . ARG A 1 85  ? 6.003   -13.770 -9.036  1.00 0.00 ? 85  ARG A HH12 5  
ATOM 8183  H HH21 . ARG A 1 85  ? 3.567   -15.195 -11.100 1.00 0.00 ? 85  ARG A HH21 5  
ATOM 8184  H HH22 . ARG A 1 85  ? 5.234   -14.752 -10.957 1.00 0.00 ? 85  ARG A HH22 5  
ATOM 8185  N N    . ILE A 1 86  ? 0.191   -9.885  -7.444  1.00 0.00 ? 86  ILE A N    5  
ATOM 8186  C CA   . ILE A 1 86  ? -0.791  -9.103  -8.184  1.00 0.00 ? 86  ILE A CA   5  
ATOM 8187  C C    . ILE A 1 86  ? -1.445  -9.936  -9.280  1.00 0.00 ? 86  ILE A C    5  
ATOM 8188  O O    . ILE A 1 86  ? -0.763  -10.611 -10.050 1.00 0.00 ? 86  ILE A O    5  
ATOM 8189  C CB   . ILE A 1 86  ? -0.153  -7.852  -8.817  1.00 0.00 ? 86  ILE A CB   5  
ATOM 8190  C CG1  . ILE A 1 86  ? 0.439   -6.950  -7.732  1.00 0.00 ? 86  ILE A CG1  5  
ATOM 8191  C CG2  . ILE A 1 86  ? -1.181  -7.093  -9.642  1.00 0.00 ? 86  ILE A CG2  5  
ATOM 8192  C CD1  . ILE A 1 86  ? 1.510   -6.012  -8.243  1.00 0.00 ? 86  ILE A CD1  5  
ATOM 8193  H H    . ILE A 1 86  ? 1.144   -9.689  -7.560  1.00 0.00 ? 86  ILE A H    5  
ATOM 8194  H HA   . ILE A 1 86  ? -1.552  -8.781  -7.488  1.00 0.00 ? 86  ILE A HA   5  
ATOM 8195  H HB   . ILE A 1 86  ? 0.637   -8.174  -9.478  1.00 0.00 ? 86  ILE A HB   5  
ATOM 8196  H HG12 . ILE A 1 86  ? -0.348  -6.350  -7.302  1.00 0.00 ? 86  ILE A HG12 5  
ATOM 8197  H HG13 . ILE A 1 86  ? 0.877   -7.567  -6.961  1.00 0.00 ? 86  ILE A HG13 5  
ATOM 8198  H HG21 . ILE A 1 86  ? -2.108  -7.647  -9.660  1.00 0.00 ? 86  ILE A HG21 5  
ATOM 8199  H HG22 . ILE A 1 86  ? -1.352  -6.123  -9.200  1.00 0.00 ? 86  ILE A HG22 5  
ATOM 8200  H HG23 . ILE A 1 86  ? -0.815  -6.970  -10.650 1.00 0.00 ? 86  ILE A HG23 5  
ATOM 8201  H HD11 . ILE A 1 86  ? 2.412   -6.572  -8.443  1.00 0.00 ? 86  ILE A HD11 5  
ATOM 8202  H HD12 . ILE A 1 86  ? 1.171   -5.540  -9.154  1.00 0.00 ? 86  ILE A HD12 5  
ATOM 8203  H HD13 . ILE A 1 86  ? 1.713   -5.257  -7.499  1.00 0.00 ? 86  ILE A HD13 5  
ATOM 8204  N N    . GLN A 1 87  ? -2.771  -9.882  -9.346  1.00 0.00 ? 87  GLN A N    5  
ATOM 8205  C CA   . GLN A 1 87  ? -3.518  -10.631 -10.349 1.00 0.00 ? 87  GLN A CA   5  
ATOM 8206  C C    . GLN A 1 87  ? -4.271  -9.689  -11.283 1.00 0.00 ? 87  GLN A C    5  
ATOM 8207  O O    . GLN A 1 87  ? -4.432  -9.975  -12.469 1.00 0.00 ? 87  GLN A O    5  
ATOM 8208  C CB   . GLN A 1 87  ? -4.499  -11.591 -9.674  1.00 0.00 ? 87  GLN A CB   5  
ATOM 8209  C CG   . GLN A 1 87  ? -3.823  -12.643 -8.810  1.00 0.00 ? 87  GLN A CG   5  
ATOM 8210  C CD   . GLN A 1 87  ? -4.636  -13.918 -8.699  1.00 0.00 ? 87  GLN A CD   5  
ATOM 8211  O OE1  . GLN A 1 87  ? -5.822  -13.942 -9.031  1.00 0.00 ? 87  GLN A OE1  5  
ATOM 8212  N NE2  . GLN A 1 87  ? -4.002  -14.986 -8.230  1.00 0.00 ? 87  GLN A NE2  5  
ATOM 8213  H H    . GLN A 1 87  ? -3.259  -9.325  -8.704  1.00 0.00 ? 87  GLN A H    5  
ATOM 8214  H HA   . GLN A 1 87  ? -2.810  -11.203 -10.930 1.00 0.00 ? 87  GLN A HA   5  
ATOM 8215  H HB2  . GLN A 1 87  ? -5.171  -11.021 -9.051  1.00 0.00 ? 87  GLN A HB2  5  
ATOM 8216  H HB3  . GLN A 1 87  ? -5.071  -12.097 -10.438 1.00 0.00 ? 87  GLN A HB3  5  
ATOM 8217  H HG2  . GLN A 1 87  ? -2.863  -12.884 -9.242  1.00 0.00 ? 87  GLN A HG2  5  
ATOM 8218  H HG3  . GLN A 1 87  ? -3.679  -12.238 -7.819  1.00 0.00 ? 87  GLN A HG3  5  
ATOM 8219  H HE21 . GLN A 1 87  ? -3.058  -14.892 -7.985  1.00 0.00 ? 87  GLN A HE21 5  
ATOM 8220  H HE22 . GLN A 1 87  ? -4.504  -15.823 -8.147  1.00 0.00 ? 87  GLN A HE22 5  
ATOM 8221  N N    . GLU A 1 88  ? -4.729  -8.566  -10.740 1.00 0.00 ? 88  GLU A N    5  
ATOM 8222  C CA   . GLU A 1 88  ? -5.467  -7.584  -11.526 1.00 0.00 ? 88  GLU A CA   5  
ATOM 8223  C C    . GLU A 1 88  ? -5.226  -6.173  -10.996 1.00 0.00 ? 88  GLU A C    5  
ATOM 8224  O O    . GLU A 1 88  ? -4.757  -5.990  -9.872  1.00 0.00 ? 88  GLU A O    5  
ATOM 8225  C CB   . GLU A 1 88  ? -6.963  -7.900  -11.505 1.00 0.00 ? 88  GLU A CB   5  
ATOM 8226  C CG   . GLU A 1 88  ? -7.711  -7.386  -12.723 1.00 0.00 ? 88  GLU A CG   5  
ATOM 8227  C CD   . GLU A 1 88  ? -9.191  -7.717  -12.683 1.00 0.00 ? 88  GLU A CD   5  
ATOM 8228  O OE1  . GLU A 1 88  ? -9.793  -7.603  -11.595 1.00 0.00 ? 88  GLU A OE1  5  
ATOM 8229  O OE2  . GLU A 1 88  ? -9.745  -8.090  -13.737 1.00 0.00 ? 88  GLU A OE2  5  
ATOM 8230  H H    . GLU A 1 88  ? -4.569  -8.395  -9.788  1.00 0.00 ? 88  GLU A H    5  
ATOM 8231  H HA   . GLU A 1 88  ? -5.111  -7.639  -12.543 1.00 0.00 ? 88  GLU A HA   5  
ATOM 8232  H HB2  . GLU A 1 88  ? -7.092  -8.971  -11.453 1.00 0.00 ? 88  GLU A HB2  5  
ATOM 8233  H HB3  . GLU A 1 88  ? -7.401  -7.452  -10.625 1.00 0.00 ? 88  GLU A HB3  5  
ATOM 8234  H HG2  . GLU A 1 88  ? -7.600  -6.314  -12.773 1.00 0.00 ? 88  GLU A HG2  5  
ATOM 8235  H HG3  . GLU A 1 88  ? -7.282  -7.833  -13.608 1.00 0.00 ? 88  GLU A HG3  5  
ATOM 8236  N N    . THR A 1 89  ? -5.551  -5.177  -11.815 1.00 0.00 ? 89  THR A N    5  
ATOM 8237  C CA   . THR A 1 89  ? -5.369  -3.782  -11.431 1.00 0.00 ? 89  THR A CA   5  
ATOM 8238  C C    . THR A 1 89  ? -6.533  -2.923  -11.914 1.00 0.00 ? 89  THR A C    5  
ATOM 8239  O O    . THR A 1 89  ? -6.826  -2.874  -13.109 1.00 0.00 ? 89  THR A O    5  
ATOM 8240  C CB   . THR A 1 89  ? -4.055  -3.211  -11.996 1.00 0.00 ? 89  THR A CB   5  
ATOM 8241  O OG1  . THR A 1 89  ? -2.979  -4.123  -11.752 1.00 0.00 ? 89  THR A OG1  5  
ATOM 8242  C CG2  . THR A 1 89  ? -3.737  -1.863  -11.367 1.00 0.00 ? 89  THR A CG2  5  
ATOM 8243  H H    . THR A 1 89  ? -5.921  -5.386  -12.698 1.00 0.00 ? 89  THR A H    5  
ATOM 8244  H HA   . THR A 1 89  ? -5.324  -3.736  -10.353 1.00 0.00 ? 89  THR A HA   5  
ATOM 8245  H HB   . THR A 1 89  ? -4.168  -3.076  -13.062 1.00 0.00 ? 89  THR A HB   5  
ATOM 8246  H HG1  . THR A 1 89  ? -3.179  -4.653  -10.976 1.00 0.00 ? 89  THR A HG1  5  
ATOM 8247  H HG21 . THR A 1 89  ? -2.877  -1.432  -11.857 1.00 0.00 ? 89  THR A HG21 5  
ATOM 8248  H HG22 . THR A 1 89  ? -3.522  -1.997  -10.317 1.00 0.00 ? 89  THR A HG22 5  
ATOM 8249  H HG23 . THR A 1 89  ? -4.584  -1.204  -11.480 1.00 0.00 ? 89  THR A HG23 5  
ATOM 8250  N N    . CYS A 1 90  ? -7.192  -2.249  -10.978 1.00 0.00 ? 90  CYS A N    5  
ATOM 8251  C CA   . CYS A 1 90  ? -8.324  -1.391  -11.309 1.00 0.00 ? 90  CYS A CA   5  
ATOM 8252  C C    . CYS A 1 90  ? -8.011  0.068   -10.994 1.00 0.00 ? 90  CYS A C    5  
ATOM 8253  O O    . CYS A 1 90  ? -7.544  0.392   -9.903  1.00 0.00 ? 90  CYS A O    5  
ATOM 8254  C CB   . CYS A 1 90  ? -9.569  -1.835  -10.540 1.00 0.00 ? 90  CYS A CB   5  
ATOM 8255  S SG   . CYS A 1 90  ? -10.978 -0.714  -10.704 1.00 0.00 ? 90  CYS A SG   5  
ATOM 8256  H H    . CYS A 1 90  ? -6.911  -2.329  -10.043 1.00 0.00 ? 90  CYS A H    5  
ATOM 8257  H HA   . CYS A 1 90  ? -8.512  -1.485  -12.367 1.00 0.00 ? 90  CYS A HA   5  
ATOM 8258  H HB2  . CYS A 1 90  ? -9.878  -2.805  -10.900 1.00 0.00 ? 90  CYS A HB2  5  
ATOM 8259  H HB3  . CYS A 1 90  ? -9.327  -1.909  -9.490  1.00 0.00 ? 90  CYS A HB3  5  
ATOM 8260  H HG   . CYS A 1 90  ? -11.459 -0.841  -11.931 1.00 0.00 ? 90  CYS A HG   5  
ATOM 8261  N N    . GLY A 1 91  ? -8.270  0.946   -11.959 1.00 0.00 ? 91  GLY A N    5  
ATOM 8262  C CA   . GLY A 1 91  ? -8.008  2.360   -11.766 1.00 0.00 ? 91  GLY A CA   5  
ATOM 8263  C C    . GLY A 1 91  ? -6.777  2.611   -10.918 1.00 0.00 ? 91  GLY A C    5  
ATOM 8264  O O    . GLY A 1 91  ? -5.652  2.561   -11.415 1.00 0.00 ? 91  GLY A O    5  
ATOM 8265  H H    . GLY A 1 91  ? -8.643  0.630   -12.809 1.00 0.00 ? 91  GLY A H    5  
ATOM 8266  H HA2  . GLY A 1 91  ? -7.869  2.824   -12.731 1.00 0.00 ? 91  GLY A HA2  5  
ATOM 8267  H HA3  . GLY A 1 91  ? -8.863  2.810   -11.282 1.00 0.00 ? 91  GLY A HA3  5  
ATOM 8268  N N    . ASP A 1 92  ? -6.990  2.883   -9.635  1.00 0.00 ? 92  ASP A N    5  
ATOM 8269  C CA   . ASP A 1 92  ? -5.889  3.144   -8.716  1.00 0.00 ? 92  ASP A CA   5  
ATOM 8270  C C    . ASP A 1 92  ? -5.927  2.179   -7.535  1.00 0.00 ? 92  ASP A C    5  
ATOM 8271  O O    . ASP A 1 92  ? -5.880  2.596   -6.378  1.00 0.00 ? 92  ASP A O    5  
ATOM 8272  C CB   . ASP A 1 92  ? -5.947  4.587   -8.213  1.00 0.00 ? 92  ASP A CB   5  
ATOM 8273  C CG   . ASP A 1 92  ? -6.235  5.576   -9.325  1.00 0.00 ? 92  ASP A CG   5  
ATOM 8274  O OD1  . ASP A 1 92  ? -5.543  5.521   -10.363 1.00 0.00 ? 92  ASP A OD1  5  
ATOM 8275  O OD2  . ASP A 1 92  ? -7.154  6.405   -9.158  1.00 0.00 ? 92  ASP A OD2  5  
ATOM 8276  H H    . ASP A 1 92  ? -7.911  2.908   -9.298  1.00 0.00 ? 92  ASP A H    5  
ATOM 8277  H HA   . ASP A 1 92  ? -4.965  2.997   -9.255  1.00 0.00 ? 92  ASP A HA   5  
ATOM 8278  H HB2  . ASP A 1 92  ? -6.727  4.671   -7.470  1.00 0.00 ? 92  ASP A HB2  5  
ATOM 8279  H HB3  . ASP A 1 92  ? -4.999  4.843   -7.764  1.00 0.00 ? 92  ASP A HB3  5  
ATOM 8280  N N    . TRP A 1 93  ? -6.012  0.888   -7.835  1.00 0.00 ? 93  TRP A N    5  
ATOM 8281  C CA   . TRP A 1 93  ? -6.058  -0.137  -6.798  1.00 0.00 ? 93  TRP A CA   5  
ATOM 8282  C C    . TRP A 1 93  ? -5.587  -1.482  -7.340  1.00 0.00 ? 93  TRP A C    5  
ATOM 8283  O O    . TRP A 1 93  ? -6.010  -1.911  -8.414  1.00 0.00 ? 93  TRP A O    5  
ATOM 8284  C CB   . TRP A 1 93  ? -7.477  -0.266  -6.242  1.00 0.00 ? 93  TRP A CB   5  
ATOM 8285  C CG   . TRP A 1 93  ? -7.915  0.929   -5.449  1.00 0.00 ? 93  TRP A CG   5  
ATOM 8286  C CD1  . TRP A 1 93  ? -8.363  2.120   -5.943  1.00 0.00 ? 93  TRP A CD1  5  
ATOM 8287  C CD2  . TRP A 1 93  ? -7.944  1.047   -4.023  1.00 0.00 ? 93  TRP A CD2  5  
ATOM 8288  N NE1  . TRP A 1 93  ? -8.669  2.972   -4.910  1.00 0.00 ? 93  TRP A NE1  5  
ATOM 8289  C CE2  . TRP A 1 93  ? -8.422  2.337   -3.721  1.00 0.00 ? 93  TRP A CE2  5  
ATOM 8290  C CE3  . TRP A 1 93  ? -7.616  0.187   -2.971  1.00 0.00 ? 93  TRP A CE3  5  
ATOM 8291  C CZ2  . TRP A 1 93  ? -8.577  2.786   -2.413  1.00 0.00 ? 93  TRP A CZ2  5  
ATOM 8292  C CZ3  . TRP A 1 93  ? -7.770  0.635   -1.672  1.00 0.00 ? 93  TRP A CZ3  5  
ATOM 8293  C CH2  . TRP A 1 93  ? -8.248  1.924   -1.402  1.00 0.00 ? 93  TRP A CH2  5  
ATOM 8294  H H    . TRP A 1 93  ? -6.046  0.617   -8.777  1.00 0.00 ? 93  TRP A H    5  
ATOM 8295  H HA   . TRP A 1 93  ? -5.395  0.169   -6.002  1.00 0.00 ? 93  TRP A HA   5  
ATOM 8296  H HB2  . TRP A 1 93  ? -8.168  -0.394  -7.061  1.00 0.00 ? 93  TRP A HB2  5  
ATOM 8297  H HB3  . TRP A 1 93  ? -7.525  -1.131  -5.596  1.00 0.00 ? 93  TRP A HB3  5  
ATOM 8298  H HD1  . TRP A 1 93  ? -8.455  2.346   -6.994  1.00 0.00 ? 93  TRP A HD1  5  
ATOM 8299  H HE1  . TRP A 1 93  ? -9.011  3.886   -5.008  1.00 0.00 ? 93  TRP A HE1  5  
ATOM 8300  H HE3  . TRP A 1 93  ? -7.246  -0.810  -3.159  1.00 0.00 ? 93  TRP A HE3  5  
ATOM 8301  H HZ2  . TRP A 1 93  ? -8.945  3.777   -2.188  1.00 0.00 ? 93  TRP A HZ2  5  
ATOM 8302  H HZ3  . TRP A 1 93  ? -7.521  -0.015  -0.846  1.00 0.00 ? 93  TRP A HZ3  5  
ATOM 8303  H HH2  . TRP A 1 93  ? -8.352  2.231   -0.373  1.00 0.00 ? 93  TRP A HH2  5  
ATOM 8304  N N    . TYR A 1 94  ? -4.709  -2.142  -6.593  1.00 0.00 ? 94  TYR A N    5  
ATOM 8305  C CA   . TYR A 1 94  ? -4.180  -3.437  -7.000  1.00 0.00 ? 94  TYR A CA   5  
ATOM 8306  C C    . TYR A 1 94  ? -4.988  -4.575  -6.384  1.00 0.00 ? 94  TYR A C    5  
ATOM 8307  O O    . TYR A 1 94  ? -5.418  -4.493  -5.233  1.00 0.00 ? 94  TYR A O    5  
ATOM 8308  C CB   . TYR A 1 94  ? -2.710  -3.562  -6.593  1.00 0.00 ? 94  TYR A CB   5  
ATOM 8309  C CG   . TYR A 1 94  ? -1.763  -2.825  -7.513  1.00 0.00 ? 94  TYR A CG   5  
ATOM 8310  C CD1  . TYR A 1 94  ? -1.846  -2.972  -8.892  1.00 0.00 ? 94  TYR A CD1  5  
ATOM 8311  C CD2  . TYR A 1 94  ? -0.784  -1.981  -7.002  1.00 0.00 ? 94  TYR A CD2  5  
ATOM 8312  C CE1  . TYR A 1 94  ? -0.982  -2.301  -9.735  1.00 0.00 ? 94  TYR A CE1  5  
ATOM 8313  C CE2  . TYR A 1 94  ? 0.083   -1.305  -7.838  1.00 0.00 ? 94  TYR A CE2  5  
ATOM 8314  C CZ   . TYR A 1 94  ? -0.019  -1.469  -9.204  1.00 0.00 ? 94  TYR A CZ   5  
ATOM 8315  O OH   . TYR A 1 94  ? 0.843   -0.798  -10.041 1.00 0.00 ? 94  TYR A OH   5  
ATOM 8316  H H    . TYR A 1 94  ? -4.410  -1.748  -5.747  1.00 0.00 ? 94  TYR A H    5  
ATOM 8317  H HA   . TYR A 1 94  ? -4.252  -3.502  -8.076  1.00 0.00 ? 94  TYR A HA   5  
ATOM 8318  H HB2  . TYR A 1 94  ? -2.584  -3.163  -5.599  1.00 0.00 ? 94  TYR A HB2  5  
ATOM 8319  H HB3  . TYR A 1 94  ? -2.431  -4.605  -6.595  1.00 0.00 ? 94  TYR A HB3  5  
ATOM 8320  H HD1  . TYR A 1 94  ? -2.602  -3.625  -9.305  1.00 0.00 ? 94  TYR A HD1  5  
ATOM 8321  H HD2  . TYR A 1 94  ? -0.706  -1.855  -5.932  1.00 0.00 ? 94  TYR A HD2  5  
ATOM 8322  H HE1  . TYR A 1 94  ? -1.063  -2.429  -10.805 1.00 0.00 ? 94  TYR A HE1  5  
ATOM 8323  H HE2  . TYR A 1 94  ? 0.838   -0.654  -7.422  1.00 0.00 ? 94  TYR A HE2  5  
ATOM 8324  H HH   . TYR A 1 94  ? 1.238   -0.062  -9.569  1.00 0.00 ? 94  TYR A HH   5  
ATOM 8325  N N    . ARG A 1 95  ? -5.191  -5.636  -7.159  1.00 0.00 ? 95  ARG A N    5  
ATOM 8326  C CA   . ARG A 1 95  ? -5.948  -6.790  -6.691  1.00 0.00 ? 95  ARG A CA   5  
ATOM 8327  C C    . ARG A 1 95  ? -5.044  -8.012  -6.551  1.00 0.00 ? 95  ARG A C    5  
ATOM 8328  O O    . ARG A 1 95  ? -4.195  -8.270  -7.403  1.00 0.00 ? 95  ARG A O    5  
ATOM 8329  C CB   . ARG A 1 95  ? -7.095  -7.099  -7.654  1.00 0.00 ? 95  ARG A CB   5  
ATOM 8330  C CG   . ARG A 1 95  ? -8.305  -7.725  -6.979  1.00 0.00 ? 95  ARG A CG   5  
ATOM 8331  C CD   . ARG A 1 95  ? -9.056  -8.648  -7.926  1.00 0.00 ? 95  ARG A CD   5  
ATOM 8332  N NE   . ARG A 1 95  ? -10.462 -8.784  -7.557  1.00 0.00 ? 95  ARG A NE   5  
ATOM 8333  C CZ   . ARG A 1 95  ? -11.349 -9.460  -8.279  1.00 0.00 ? 95  ARG A CZ   5  
ATOM 8334  N NH1  . ARG A 1 95  ? -10.977 -10.059 -9.401  1.00 0.00 ? 95  ARG A NH1  5  
ATOM 8335  N NH2  . ARG A 1 95  ? -12.612 -9.538  -7.877  1.00 0.00 ? 95  ARG A NH2  5  
ATOM 8336  H H    . ARG A 1 95  ? -4.823  -5.642  -8.067  1.00 0.00 ? 95  ARG A H    5  
ATOM 8337  H HA   . ARG A 1 95  ? -6.358  -6.548  -5.722  1.00 0.00 ? 95  ARG A HA   5  
ATOM 8338  H HB2  . ARG A 1 95  ? -7.410  -6.180  -8.127  1.00 0.00 ? 95  ARG A HB2  5  
ATOM 8339  H HB3  . ARG A 1 95  ? -6.740  -7.781  -8.411  1.00 0.00 ? 95  ARG A HB3  5  
ATOM 8340  H HG2  . ARG A 1 95  ? -7.974  -8.296  -6.125  1.00 0.00 ? 95  ARG A HG2  5  
ATOM 8341  H HG3  . ARG A 1 95  ? -8.970  -6.939  -6.653  1.00 0.00 ? 95  ARG A HG3  5  
ATOM 8342  H HD2  . ARG A 1 95  ? -8.993  -8.244  -8.926  1.00 0.00 ? 95  ARG A HD2  5  
ATOM 8343  H HD3  . ARG A 1 95  ? -8.591  -9.622  -7.901  1.00 0.00 ? 95  ARG A HD3  5  
ATOM 8344  H HE   . ARG A 1 95  ? -10.759 -8.349  -6.731  1.00 0.00 ? 95  ARG A HE   5  
ATOM 8345  H HH11 . ARG A 1 95  ? -10.026 -10.003 -9.706  1.00 0.00 ? 95  ARG A HH11 5  
ATOM 8346  H HH12 . ARG A 1 95  ? -11.646 -10.569 -9.942  1.00 0.00 ? 95  ARG A HH12 5  
ATOM 8347  H HH21 . ARG A 1 95  ? -12.896 -9.088  -7.032  1.00 0.00 ? 95  ARG A HH21 5  
ATOM 8348  H HH22 . ARG A 1 95  ? -13.278 -10.048 -8.421  1.00 0.00 ? 95  ARG A HH22 5  
ATOM 8349  N N    . GLY A 1 96  ? -5.233  -8.761  -5.468  1.00 0.00 ? 96  GLY A N    5  
ATOM 8350  C CA   . GLY A 1 96  ? -4.428  -9.946  -5.236  1.00 0.00 ? 96  GLY A CA   5  
ATOM 8351  C C    . GLY A 1 96  ? -4.557  -10.465 -3.818  1.00 0.00 ? 96  GLY A C    5  
ATOM 8352  O O    . GLY A 1 96  ? -5.613  -10.340 -3.197  1.00 0.00 ? 96  GLY A O    5  
ATOM 8353  H H    . GLY A 1 96  ? -5.925  -8.506  -4.822  1.00 0.00 ? 96  GLY A H    5  
ATOM 8354  H HA2  . GLY A 1 96  ? -4.739  -10.719 -5.921  1.00 0.00 ? 96  GLY A HA2  5  
ATOM 8355  H HA3  . GLY A 1 96  ? -3.392  -9.706  -5.426  1.00 0.00 ? 96  GLY A HA3  5  
ATOM 8356  N N    . TYR A 1 97  ? -3.481  -11.051 -3.304  1.00 0.00 ? 97  TYR A N    5  
ATOM 8357  C CA   . TYR A 1 97  ? -3.480  -11.596 -1.951  1.00 0.00 ? 97  TYR A CA   5  
ATOM 8358  C C    . TYR A 1 97  ? -2.060  -11.683 -1.401  1.00 0.00 ? 97  TYR A C    5  
ATOM 8359  O O    . TYR A 1 97  ? -1.085  -11.627 -2.152  1.00 0.00 ? 97  TYR A O    5  
ATOM 8360  C CB   . TYR A 1 97  ? -4.131  -12.980 -1.936  1.00 0.00 ? 97  TYR A CB   5  
ATOM 8361  C CG   . TYR A 1 97  ? -3.429  -13.989 -2.816  1.00 0.00 ? 97  TYR A CG   5  
ATOM 8362  C CD1  . TYR A 1 97  ? -2.137  -14.412 -2.527  1.00 0.00 ? 97  TYR A CD1  5  
ATOM 8363  C CD2  . TYR A 1 97  ? -4.057  -14.519 -3.936  1.00 0.00 ? 97  TYR A CD2  5  
ATOM 8364  C CE1  . TYR A 1 97  ? -1.491  -15.334 -3.329  1.00 0.00 ? 97  TYR A CE1  5  
ATOM 8365  C CE2  . TYR A 1 97  ? -3.419  -15.442 -4.743  1.00 0.00 ? 97  TYR A CE2  5  
ATOM 8366  C CZ   . TYR A 1 97  ? -2.137  -15.846 -4.435  1.00 0.00 ? 97  TYR A CZ   5  
ATOM 8367  O OH   . TYR A 1 97  ? -1.498  -16.764 -5.237  1.00 0.00 ? 97  TYR A OH   5  
ATOM 8368  H H    . TYR A 1 97  ? -2.669  -11.121 -3.848  1.00 0.00 ? 97  TYR A H    5  
ATOM 8369  H HA   . TYR A 1 97  ? -4.057  -10.931 -1.325  1.00 0.00 ? 97  TYR A HA   5  
ATOM 8370  H HB2  . TYR A 1 97  ? -4.126  -13.361 -0.926  1.00 0.00 ? 97  TYR A HB2  5  
ATOM 8371  H HB3  . TYR A 1 97  ? -5.152  -12.894 -2.278  1.00 0.00 ? 97  TYR A HB3  5  
ATOM 8372  H HD1  . TYR A 1 97  ? -1.634  -14.009 -1.660  1.00 0.00 ? 97  TYR A HD1  5  
ATOM 8373  H HD2  . TYR A 1 97  ? -5.061  -14.200 -4.175  1.00 0.00 ? 97  TYR A HD2  5  
ATOM 8374  H HE1  . TYR A 1 97  ? -0.487  -15.650 -3.088  1.00 0.00 ? 97  TYR A HE1  5  
ATOM 8375  H HE2  . TYR A 1 97  ? -3.924  -15.843 -5.609  1.00 0.00 ? 97  TYR A HE2  5  
ATOM 8376  H HH   . TYR A 1 97  ? -0.584  -16.852 -4.956  1.00 0.00 ? 97  TYR A HH   5  
ATOM 8377  N N    . LEU A 1 98  ? -1.951  -11.821 -0.084  1.00 0.00 ? 98  LEU A N    5  
ATOM 8378  C CA   . LEU A 1 98  ? -0.650  -11.917 0.570   1.00 0.00 ? 98  LEU A CA   5  
ATOM 8379  C C    . LEU A 1 98  ? -0.014  -13.280 0.319   1.00 0.00 ? 98  LEU A C    5  
ATOM 8380  O O    . LEU A 1 98  ? -0.512  -14.304 0.787   1.00 0.00 ? 98  LEU A O    5  
ATOM 8381  C CB   . LEU A 1 98  ? -0.795  -11.678 2.074   1.00 0.00 ? 98  LEU A CB   5  
ATOM 8382  C CG   . LEU A 1 98  ? 0.418   -11.067 2.776   1.00 0.00 ? 98  LEU A CG   5  
ATOM 8383  C CD1  . LEU A 1 98  ? 0.863   -9.798  2.066   1.00 0.00 ? 98  LEU A CD1  5  
ATOM 8384  C CD2  . LEU A 1 98  ? 0.100   -10.779 4.236   1.00 0.00 ? 98  LEU A CD2  5  
ATOM 8385  H H    . LEU A 1 98  ? -2.763  -11.859 0.462   1.00 0.00 ? 98  LEU A H    5  
ATOM 8386  H HA   . LEU A 1 98  ? -0.012  -11.153 0.152   1.00 0.00 ? 98  LEU A HA   5  
ATOM 8387  H HB2  . LEU A 1 98  ? -1.633  -11.015 2.225   1.00 0.00 ? 98  LEU A HB2  5  
ATOM 8388  H HB3  . LEU A 1 98  ? -1.003  -12.631 2.541   1.00 0.00 ? 98  LEU A HB3  5  
ATOM 8389  H HG   . LEU A 1 98  ? 1.238   -11.772 2.744   1.00 0.00 ? 98  LEU A HG   5  
ATOM 8390  H HD11 . LEU A 1 98  ? 1.112   -9.045  2.797   1.00 0.00 ? 98  LEU A HD11 5  
ATOM 8391  H HD12 . LEU A 1 98  ? 0.062   -9.438  1.437   1.00 0.00 ? 98  LEU A HD12 5  
ATOM 8392  H HD13 . LEU A 1 98  ? 1.729   -10.011 1.457   1.00 0.00 ? 98  LEU A HD13 5  
ATOM 8393  H HD21 . LEU A 1 98  ? 0.357   -11.639 4.837   1.00 0.00 ? 98  LEU A HD21 5  
ATOM 8394  H HD22 . LEU A 1 98  ? -0.955  -10.569 4.340   1.00 0.00 ? 98  LEU A HD22 5  
ATOM 8395  H HD23 . LEU A 1 98  ? 0.671   -9.924  4.567   1.00 0.00 ? 98  LEU A HD23 5  
ATOM 8396  N N    . ILE A 1 99  ? 1.090   -13.285 -0.421  1.00 0.00 ? 99  ILE A N    5  
ATOM 8397  C CA   . ILE A 1 99  ? 1.796   -14.521 -0.731  1.00 0.00 ? 99  ILE A CA   5  
ATOM 8398  C C    . ILE A 1 99  ? 2.126   -15.299 0.538   1.00 0.00 ? 99  ILE A C    5  
ATOM 8399  O O    . ILE A 1 99  ? 1.769   -16.470 0.673   1.00 0.00 ? 99  ILE A O    5  
ATOM 8400  C CB   . ILE A 1 99  ? 3.099   -14.247 -1.505  1.00 0.00 ? 99  ILE A CB   5  
ATOM 8401  C CG1  . ILE A 1 99  ? 2.805   -13.446 -2.775  1.00 0.00 ? 99  ILE A CG1  5  
ATOM 8402  C CG2  . ILE A 1 99  ? 3.798   -15.554 -1.847  1.00 0.00 ? 99  ILE A CG2  5  
ATOM 8403  C CD1  . ILE A 1 99  ? 4.049   -12.958 -3.484  1.00 0.00 ? 99  ILE A CD1  5  
ATOM 8404  H H    . ILE A 1 99  ? 1.438   -12.436 -0.766  1.00 0.00 ? 99  ILE A H    5  
ATOM 8405  H HA   . ILE A 1 99  ? 1.152   -15.126 -1.354  1.00 0.00 ? 99  ILE A HA   5  
ATOM 8406  H HB   . ILE A 1 99  ? 3.755   -13.672 -0.869  1.00 0.00 ? 99  ILE A HB   5  
ATOM 8407  H HG12 . ILE A 1 99  ? 2.252   -14.065 -3.464  1.00 0.00 ? 99  ILE A HG12 5  
ATOM 8408  H HG13 . ILE A 1 99  ? 2.209   -12.582 -2.517  1.00 0.00 ? 99  ILE A HG13 5  
ATOM 8409  H HG21 . ILE A 1 99  ? 3.060   -16.300 -2.104  1.00 0.00 ? 99  ILE A HG21 5  
ATOM 8410  H HG22 . ILE A 1 99  ? 4.459   -15.400 -2.686  1.00 0.00 ? 99  ILE A HG22 5  
ATOM 8411  H HG23 . ILE A 1 99  ? 4.368   -15.892 -0.995  1.00 0.00 ? 99  ILE A HG23 5  
ATOM 8412  H HD11 . ILE A 1 99  ? 4.728   -12.527 -2.763  1.00 0.00 ? 99  ILE A HD11 5  
ATOM 8413  H HD12 . ILE A 1 99  ? 4.531   -13.789 -3.978  1.00 0.00 ? 99  ILE A HD12 5  
ATOM 8414  H HD13 . ILE A 1 99  ? 3.778   -12.211 -4.215  1.00 0.00 ? 99  ILE A HD13 5  
ATOM 8415  N N    . LYS A 1 100 ? 2.809   -14.640 1.468   1.00 0.00 ? 100 LYS A N    5  
ATOM 8416  C CA   . LYS A 1 100 ? 3.185   -15.268 2.730   1.00 0.00 ? 100 LYS A CA   5  
ATOM 8417  C C    . LYS A 1 100 ? 1.971   -15.889 3.412   1.00 0.00 ? 100 LYS A C    5  
ATOM 8418  O O    . LYS A 1 100 ? 2.093   -16.869 4.148   1.00 0.00 ? 100 LYS A O    5  
ATOM 8419  C CB   . LYS A 1 100 ? 3.837   -14.241 3.659   1.00 0.00 ? 100 LYS A CB   5  
ATOM 8420  C CG   . LYS A 1 100 ? 3.042   -12.954 3.796   1.00 0.00 ? 100 LYS A CG   5  
ATOM 8421  C CD   . LYS A 1 100 ? 3.513   -12.130 4.983   1.00 0.00 ? 100 LYS A CD   5  
ATOM 8422  C CE   . LYS A 1 100 ? 4.687   -11.238 4.611   1.00 0.00 ? 100 LYS A CE   5  
ATOM 8423  N NZ   . LYS A 1 100 ? 5.556   -10.948 5.786   1.00 0.00 ? 100 LYS A NZ   5  
ATOM 8424  H H    . LYS A 1 100 ? 3.065   -13.709 1.303   1.00 0.00 ? 100 LYS A H    5  
ATOM 8425  H HA   . LYS A 1 100 ? 3.899   -16.047 2.512   1.00 0.00 ? 100 LYS A HA   5  
ATOM 8426  H HB2  . LYS A 1 100 ? 3.944   -14.679 4.640   1.00 0.00 ? 100 LYS A HB2  5  
ATOM 8427  H HB3  . LYS A 1 100 ? 4.816   -13.995 3.274   1.00 0.00 ? 100 LYS A HB3  5  
ATOM 8428  H HG2  . LYS A 1 100 ? 3.162   -12.369 2.896   1.00 0.00 ? 100 LYS A HG2  5  
ATOM 8429  H HG3  . LYS A 1 100 ? 1.998   -13.199 3.931   1.00 0.00 ? 100 LYS A HG3  5  
ATOM 8430  H HD2  . LYS A 1 100 ? 2.698   -11.510 5.325   1.00 0.00 ? 100 LYS A HD2  5  
ATOM 8431  H HD3  . LYS A 1 100 ? 3.816   -12.799 5.776   1.00 0.00 ? 100 LYS A HD3  5  
ATOM 8432  H HE2  . LYS A 1 100 ? 5.275   -11.735 3.854   1.00 0.00 ? 100 LYS A HE2  5  
ATOM 8433  H HE3  . LYS A 1 100 ? 4.305   -10.308 4.218   1.00 0.00 ? 100 LYS A HE3  5  
ATOM 8434  H HZ1  . LYS A 1 100 ? 5.186   -10.130 6.310   1.00 0.00 ? 100 LYS A HZ1  5  
ATOM 8435  H HZ2  . LYS A 1 100 ? 6.524   -10.735 5.470   1.00 0.00 ? 100 LYS A HZ2  5  
ATOM 8436  H HZ3  . LYS A 1 100 ? 5.584   -11.770 6.421   1.00 0.00 ? 100 LYS A HZ3  5  
ATOM 8437  N N    . HIS A 1 101 ? 0.799   -15.313 3.163   1.00 0.00 ? 101 HIS A N    5  
ATOM 8438  C CA   . HIS A 1 101 ? -0.439  -15.812 3.753   1.00 0.00 ? 101 HIS A CA   5  
ATOM 8439  C C    . HIS A 1 101 ? -1.608  -15.640 2.788   1.00 0.00 ? 101 HIS A C    5  
ATOM 8440  O O    . HIS A 1 101 ? -2.108  -14.531 2.593   1.00 0.00 ? 101 HIS A O    5  
ATOM 8441  C CB   . HIS A 1 101 ? -0.733  -15.084 5.065   1.00 0.00 ? 101 HIS A CB   5  
ATOM 8442  C CG   . HIS A 1 101 ? 0.403   -15.126 6.041   1.00 0.00 ? 101 HIS A CG   5  
ATOM 8443  N ND1  . HIS A 1 101 ? 0.802   -16.280 6.681   1.00 0.00 ? 101 HIS A ND1  5  
ATOM 8444  C CD2  . HIS A 1 101 ? 1.226   -14.148 6.483   1.00 0.00 ? 101 HIS A CD2  5  
ATOM 8445  C CE1  . HIS A 1 101 ? 1.821   -16.009 7.477   1.00 0.00 ? 101 HIS A CE1  5  
ATOM 8446  N NE2  . HIS A 1 101 ? 2.099   -14.722 7.375   1.00 0.00 ? 101 HIS A NE2  5  
ATOM 8447  H H    . HIS A 1 101 ? 0.765   -14.535 2.569   1.00 0.00 ? 101 HIS A H    5  
ATOM 8448  H HA   . HIS A 1 101 ? -0.308  -16.864 3.956   1.00 0.00 ? 101 HIS A HA   5  
ATOM 8449  H HB2  . HIS A 1 101 ? -0.950  -14.048 4.853   1.00 0.00 ? 101 HIS A HB2  5  
ATOM 8450  H HB3  . HIS A 1 101 ? -1.593  -15.538 5.536   1.00 0.00 ? 101 HIS A HB3  5  
ATOM 8451  H HD1  . HIS A 1 101 ? 0.398   -17.165 6.571   1.00 0.00 ? 101 HIS A HD1  5  
ATOM 8452  H HD2  . HIS A 1 101 ? 1.202   -13.107 6.190   1.00 0.00 ? 101 HIS A HD2  5  
ATOM 8453  H HE1  . HIS A 1 101 ? 2.340   -16.718 8.104   1.00 0.00 ? 101 HIS A HE1  5  
ATOM 8454  H HE2  . HIS A 1 101 ? 2.754   -14.241 7.921   1.00 0.00 ? 101 HIS A HE2  5  
ATOM 8455  N N    . LYS A 1 102 ? -2.040  -16.743 2.186   1.00 0.00 ? 102 LYS A N    5  
ATOM 8456  C CA   . LYS A 1 102 ? -3.151  -16.715 1.242   1.00 0.00 ? 102 LYS A CA   5  
ATOM 8457  C C    . LYS A 1 102 ? -4.488  -16.790 1.972   1.00 0.00 ? 102 LYS A C    5  
ATOM 8458  O O    . LYS A 1 102 ? -5.481  -17.264 1.421   1.00 0.00 ? 102 LYS A O    5  
ATOM 8459  C CB   . LYS A 1 102 ? -3.033  -17.875 0.250   1.00 0.00 ? 102 LYS A CB   5  
ATOM 8460  C CG   . LYS A 1 102 ? -2.216  -17.538 -0.985  1.00 0.00 ? 102 LYS A CG   5  
ATOM 8461  C CD   . LYS A 1 102 ? -2.650  -18.366 -2.183  1.00 0.00 ? 102 LYS A CD   5  
ATOM 8462  C CE   . LYS A 1 102 ? -1.883  -19.677 -2.262  1.00 0.00 ? 102 LYS A CE   5  
ATOM 8463  N NZ   . LYS A 1 102 ? -0.632  -19.540 -3.058  1.00 0.00 ? 102 LYS A NZ   5  
ATOM 8464  H H    . LYS A 1 102 ? -1.601  -17.597 2.383   1.00 0.00 ? 102 LYS A H    5  
ATOM 8465  H HA   . LYS A 1 102 ? -3.102  -15.783 0.700   1.00 0.00 ? 102 LYS A HA   5  
ATOM 8466  H HB2  . LYS A 1 102 ? -2.567  -18.712 0.748   1.00 0.00 ? 102 LYS A HB2  5  
ATOM 8467  H HB3  . LYS A 1 102 ? -4.025  -18.162 -0.067  1.00 0.00 ? 102 LYS A HB3  5  
ATOM 8468  H HG2  . LYS A 1 102 ? -2.347  -16.492 -1.218  1.00 0.00 ? 102 LYS A HG2  5  
ATOM 8469  H HG3  . LYS A 1 102 ? -1.174  -17.736 -0.781  1.00 0.00 ? 102 LYS A HG3  5  
ATOM 8470  H HD2  . LYS A 1 102 ? -3.704  -18.584 -2.096  1.00 0.00 ? 102 LYS A HD2  5  
ATOM 8471  H HD3  . LYS A 1 102 ? -2.471  -17.799 -3.085  1.00 0.00 ? 102 LYS A HD3  5  
ATOM 8472  H HE2  . LYS A 1 102 ? -1.630  -19.992 -1.261  1.00 0.00 ? 102 LYS A HE2  5  
ATOM 8473  H HE3  . LYS A 1 102 ? -2.514  -20.421 -2.725  1.00 0.00 ? 102 LYS A HE3  5  
ATOM 8474  H HZ1  . LYS A 1 102 ? -0.212  -18.601 -2.905  1.00 0.00 ? 102 LYS A HZ1  5  
ATOM 8475  H HZ2  . LYS A 1 102 ? -0.838  -19.656 -4.071  1.00 0.00 ? 102 LYS A HZ2  5  
ATOM 8476  H HZ3  . LYS A 1 102 ? 0.055   -20.266 -2.771  1.00 0.00 ? 102 LYS A HZ3  5  
ATOM 8477  N N    . MET A 1 103 ? -4.505  -16.318 3.215   1.00 0.00 ? 103 MET A N    5  
ATOM 8478  C CA   . MET A 1 103 ? -5.722  -16.330 4.019   1.00 0.00 ? 103 MET A CA   5  
ATOM 8479  C C    . MET A 1 103 ? -6.388  -14.958 4.017   1.00 0.00 ? 103 MET A C    5  
ATOM 8480  O O    . MET A 1 103 ? -7.498  -14.795 4.526   1.00 0.00 ? 103 MET A O    5  
ATOM 8481  C CB   . MET A 1 103 ? -5.405  -16.754 5.455   1.00 0.00 ? 103 MET A CB   5  
ATOM 8482  C CG   . MET A 1 103 ? -4.912  -18.186 5.571   1.00 0.00 ? 103 MET A CG   5  
ATOM 8483  S SD   . MET A 1 103 ? -3.283  -18.422 4.834   1.00 0.00 ? 103 MET A SD   5  
ATOM 8484  C CE   . MET A 1 103 ? -2.245  -18.402 6.293   1.00 0.00 ? 103 MET A CE   5  
ATOM 8485  H H    . MET A 1 103 ? -3.681  -15.953 3.600   1.00 0.00 ? 103 MET A H    5  
ATOM 8486  H HA   . MET A 1 103 ? -6.400  -17.048 3.583   1.00 0.00 ? 103 MET A HA   5  
ATOM 8487  H HB2  . MET A 1 103 ? -4.643  -16.100 5.851   1.00 0.00 ? 103 MET A HB2  5  
ATOM 8488  H HB3  . MET A 1 103 ? -6.299  -16.655 6.052   1.00 0.00 ? 103 MET A HB3  5  
ATOM 8489  H HG2  . MET A 1 103 ? -4.859  -18.452 6.616   1.00 0.00 ? 103 MET A HG2  5  
ATOM 8490  H HG3  . MET A 1 103 ? -5.615  -18.836 5.071   1.00 0.00 ? 103 MET A HG3  5  
ATOM 8491  H HE1  . MET A 1 103 ? -1.389  -19.043 6.135   1.00 0.00 ? 103 MET A HE1  5  
ATOM 8492  H HE2  . MET A 1 103 ? -1.909  -17.393 6.483   1.00 0.00 ? 103 MET A HE2  5  
ATOM 8493  H HE3  . MET A 1 103 ? -2.810  -18.759 7.141   1.00 0.00 ? 103 MET A HE3  5  
ATOM 8494  N N    . LEU A 1 104 ? -5.705  -13.974 3.441   1.00 0.00 ? 104 LEU A N    5  
ATOM 8495  C CA   . LEU A 1 104 ? -6.232  -12.616 3.373   1.00 0.00 ? 104 LEU A CA   5  
ATOM 8496  C C    . LEU A 1 104 ? -6.217  -12.098 1.938   1.00 0.00 ? 104 LEU A C    5  
ATOM 8497  O O    . LEU A 1 104 ? -5.162  -11.762 1.401   1.00 0.00 ? 104 LEU A O    5  
ATOM 8498  C CB   . LEU A 1 104 ? -5.414  -11.685 4.271   1.00 0.00 ? 104 LEU A CB   5  
ATOM 8499  C CG   . LEU A 1 104 ? -4.934  -12.281 5.595   1.00 0.00 ? 104 LEU A CG   5  
ATOM 8500  C CD1  . LEU A 1 104 ? -3.659  -13.084 5.387   1.00 0.00 ? 104 LEU A CD1  5  
ATOM 8501  C CD2  . LEU A 1 104 ? -4.714  -11.184 6.625   1.00 0.00 ? 104 LEU A CD2  5  
ATOM 8502  H H    . LEU A 1 104 ? -4.826  -14.165 3.053   1.00 0.00 ? 104 LEU A H    5  
ATOM 8503  H HA   . LEU A 1 104 ? -7.252  -12.637 3.725   1.00 0.00 ? 104 LEU A HA   5  
ATOM 8504  H HB2  . LEU A 1 104 ? -4.544  -11.370 3.716   1.00 0.00 ? 104 LEU A HB2  5  
ATOM 8505  H HB3  . LEU A 1 104 ? -6.026  -10.824 4.497   1.00 0.00 ? 104 LEU A HB3  5  
ATOM 8506  H HG   . LEU A 1 104 ? -5.692  -12.952 5.976   1.00 0.00 ? 104 LEU A HG   5  
ATOM 8507  H HD11 . LEU A 1 104 ? -3.175  -13.243 6.339   1.00 0.00 ? 104 LEU A HD11 5  
ATOM 8508  H HD12 . LEU A 1 104 ? -2.995  -12.541 4.732   1.00 0.00 ? 104 LEU A HD12 5  
ATOM 8509  H HD13 . LEU A 1 104 ? -3.903  -14.038 4.943   1.00 0.00 ? 104 LEU A HD13 5  
ATOM 8510  H HD21 . LEU A 1 104 ? -3.697  -11.227 6.985   1.00 0.00 ? 104 LEU A HD21 5  
ATOM 8511  H HD22 . LEU A 1 104 ? -5.395  -11.324 7.451   1.00 0.00 ? 104 LEU A HD22 5  
ATOM 8512  H HD23 . LEU A 1 104 ? -4.895  -10.221 6.170   1.00 0.00 ? 104 LEU A HD23 5  
ATOM 8513  N N    . GLN A 1 105 ? -7.395  -12.035 1.325   1.00 0.00 ? 105 GLN A N    5  
ATOM 8514  C CA   . GLN A 1 105 ? -7.517  -11.556 -0.046  1.00 0.00 ? 105 GLN A CA   5  
ATOM 8515  C C    . GLN A 1 105 ? -8.337  -10.271 -0.104  1.00 0.00 ? 105 GLN A C    5  
ATOM 8516  O O    . GLN A 1 105 ? -9.213  -10.044 0.730   1.00 0.00 ? 105 GLN A O    5  
ATOM 8517  C CB   . GLN A 1 105 ? -8.163  -12.627 -0.927  1.00 0.00 ? 105 GLN A CB   5  
ATOM 8518  C CG   . GLN A 1 105 ? -7.596  -14.020 -0.706  1.00 0.00 ? 105 GLN A CG   5  
ATOM 8519  C CD   . GLN A 1 105 ? -8.602  -15.114 -1.004  1.00 0.00 ? 105 GLN A CD   5  
ATOM 8520  O OE1  . GLN A 1 105 ? -9.453  -14.968 -1.882  1.00 0.00 ? 105 GLN A OE1  5  
ATOM 8521  N NE2  . GLN A 1 105 ? -8.510  -16.219 -0.273  1.00 0.00 ? 105 GLN A NE2  5  
ATOM 8522  H H    . GLN A 1 105 ? -8.200  -12.317 1.807   1.00 0.00 ? 105 GLN A H    5  
ATOM 8523  H HA   . GLN A 1 105 ? -6.524  -11.351 -0.415  1.00 0.00 ? 105 GLN A HA   5  
ATOM 8524  H HB2  . GLN A 1 105 ? -9.223  -12.656 -0.720  1.00 0.00 ? 105 GLN A HB2  5  
ATOM 8525  H HB3  . GLN A 1 105 ? -8.015  -12.362 -1.963  1.00 0.00 ? 105 GLN A HB3  5  
ATOM 8526  H HG2  . GLN A 1 105 ? -6.741  -14.153 -1.352  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 8527  H HG3  . GLN A 1 105 ? -7.285  -14.108 0.325   1.00 0.00 ? 105 GLN A HG3  5  
ATOM 8528  H HE21 . GLN A 1 105 ? -7.808  -16.264 0.410   1.00 0.00 ? 105 GLN A HE21 5  
ATOM 8529  H HE22 . GLN A 1 105 ? -9.148  -16.941 -0.444  1.00 0.00 ? 105 GLN A HE22 5  
ATOM 8530  N N    . GLY A 1 106 ? -8.046  -9.433  -1.094  1.00 0.00 ? 106 GLY A N    5  
ATOM 8531  C CA   . GLY A 1 106 ? -8.765  -8.181  -1.241  1.00 0.00 ? 106 GLY A CA   5  
ATOM 8532  C C    . GLY A 1 106 ? -8.075  -7.224  -2.193  1.00 0.00 ? 106 GLY A C    5  
ATOM 8533  O O    . GLY A 1 106 ? -7.456  -7.649  -3.169  1.00 0.00 ? 106 GLY A O    5  
ATOM 8534  H H    . GLY A 1 106 ? -7.338  -9.666  -1.729  1.00 0.00 ? 106 GLY A H    5  
ATOM 8535  H HA2  . GLY A 1 106 ? -9.757  -8.389  -1.613  1.00 0.00 ? 106 GLY A HA2  5  
ATOM 8536  H HA3  . GLY A 1 106 ? -8.847  -7.710  -0.272  1.00 0.00 ? 106 GLY A HA3  5  
ATOM 8537  N N    . ILE A 1 107 ? -8.182  -5.930  -1.910  1.00 0.00 ? 107 ILE A N    5  
ATOM 8538  C CA   . ILE A 1 107 ? -7.563  -4.912  -2.749  1.00 0.00 ? 107 ILE A CA   5  
ATOM 8539  C C    . ILE A 1 107 ? -6.765  -3.919  -1.911  1.00 0.00 ? 107 ILE A C    5  
ATOM 8540  O O    . ILE A 1 107 ? -6.887  -3.885  -0.686  1.00 0.00 ? 107 ILE A O    5  
ATOM 8541  C CB   . ILE A 1 107 ? -8.615  -4.144  -3.570  1.00 0.00 ? 107 ILE A CB   5  
ATOM 8542  C CG1  . ILE A 1 107 ? -9.676  -3.542  -2.646  1.00 0.00 ? 107 ILE A CG1  5  
ATOM 8543  C CG2  . ILE A 1 107 ? -9.260  -5.062  -4.598  1.00 0.00 ? 107 ILE A CG2  5  
ATOM 8544  C CD1  . ILE A 1 107 ? -10.629 -2.603  -3.351  1.00 0.00 ? 107 ILE A CD1  5  
ATOM 8545  H H    . ILE A 1 107 ? -8.688  -5.654  -1.118  1.00 0.00 ? 107 ILE A H    5  
ATOM 8546  H HA   . ILE A 1 107 ? -6.892  -5.408  -3.435  1.00 0.00 ? 107 ILE A HA   5  
ATOM 8547  H HB   . ILE A 1 107 ? -8.115  -3.347  -4.099  1.00 0.00 ? 107 ILE A HB   5  
ATOM 8548  H HG12 . ILE A 1 107 ? -10.258 -4.339  -2.210  1.00 0.00 ? 107 ILE A HG12 5  
ATOM 8549  H HG13 . ILE A 1 107 ? -9.185  -2.989  -1.859  1.00 0.00 ? 107 ILE A HG13 5  
ATOM 8550  H HG21 . ILE A 1 107 ? -8.528  -5.773  -4.954  1.00 0.00 ? 107 ILE A HG21 5  
ATOM 8551  H HG22 . ILE A 1 107 ? -10.081 -5.593  -4.140  1.00 0.00 ? 107 ILE A HG22 5  
ATOM 8552  H HG23 . ILE A 1 107 ? -9.626  -4.476  -5.426  1.00 0.00 ? 107 ILE A HG23 5  
ATOM 8553  H HD11 . ILE A 1 107 ? -10.156 -2.209  -4.239  1.00 0.00 ? 107 ILE A HD11 5  
ATOM 8554  H HD12 . ILE A 1 107 ? -11.524 -3.139  -3.630  1.00 0.00 ? 107 ILE A HD12 5  
ATOM 8555  H HD13 . ILE A 1 107 ? -10.887 -1.788  -2.691  1.00 0.00 ? 107 ILE A HD13 5  
ATOM 8556  N N    . PHE A 1 108 ? -5.949  -3.110  -2.579  1.00 0.00 ? 108 PHE A N    5  
ATOM 8557  C CA   . PHE A 1 108 ? -5.131  -2.115  -1.895  1.00 0.00 ? 108 PHE A CA   5  
ATOM 8558  C C    . PHE A 1 108 ? -4.712  -1.004  -2.854  1.00 0.00 ? 108 PHE A C    5  
ATOM 8559  O O    . PHE A 1 108 ? -4.733  -1.163  -4.075  1.00 0.00 ? 108 PHE A O    5  
ATOM 8560  C CB   . PHE A 1 108 ? -3.892  -2.773  -1.286  1.00 0.00 ? 108 PHE A CB   5  
ATOM 8561  C CG   . PHE A 1 108 ? -3.414  -3.974  -2.052  1.00 0.00 ? 108 PHE A CG   5  
ATOM 8562  C CD1  . PHE A 1 108 ? -2.493  -3.836  -3.079  1.00 0.00 ? 108 PHE A CD1  5  
ATOM 8563  C CD2  . PHE A 1 108 ? -3.885  -5.240  -1.745  1.00 0.00 ? 108 PHE A CD2  5  
ATOM 8564  C CE1  . PHE A 1 108 ? -2.051  -4.939  -3.785  1.00 0.00 ? 108 PHE A CE1  5  
ATOM 8565  C CE2  . PHE A 1 108 ? -3.446  -6.347  -2.448  1.00 0.00 ? 108 PHE A CE2  5  
ATOM 8566  C CZ   . PHE A 1 108 ? -2.529  -6.195  -3.470  1.00 0.00 ? 108 PHE A CZ   5  
ATOM 8567  H H    . PHE A 1 108 ? -5.896  -3.185  -3.555  1.00 0.00 ? 108 PHE A H    5  
ATOM 8568  H HA   . PHE A 1 108 ? -5.726  -1.686  -1.104  1.00 0.00 ? 108 PHE A HA   5  
ATOM 8569  H HB2  . PHE A 1 108 ? -3.087  -2.055  -1.261  1.00 0.00 ? 108 PHE A HB2  5  
ATOM 8570  H HB3  . PHE A 1 108 ? -4.119  -3.089  -0.279  1.00 0.00 ? 108 PHE A HB3  5  
ATOM 8571  H HD1  . PHE A 1 108 ? -2.119  -2.852  -3.326  1.00 0.00 ? 108 PHE A HD1  5  
ATOM 8572  H HD2  . PHE A 1 108 ? -4.603  -5.360  -0.947  1.00 0.00 ? 108 PHE A HD2  5  
ATOM 8573  H HE1  . PHE A 1 108 ? -1.334  -4.817  -4.583  1.00 0.00 ? 108 PHE A HE1  5  
ATOM 8574  H HE2  . PHE A 1 108 ? -3.821  -7.328  -2.200  1.00 0.00 ? 108 PHE A HE2  5  
ATOM 8575  H HZ   . PHE A 1 108 ? -2.184  -7.058  -4.020  1.00 0.00 ? 108 PHE A HZ   5  
ATOM 8576  N N    . PRO A 1 109 ? -4.323  0.148   -2.289  1.00 0.00 ? 109 PRO A N    5  
ATOM 8577  C CA   . PRO A 1 109 ? -3.892  1.309   -3.074  1.00 0.00 ? 109 PRO A CA   5  
ATOM 8578  C C    . PRO A 1 109 ? -2.549  1.078   -3.760  1.00 0.00 ? 109 PRO A C    5  
ATOM 8579  O O    . PRO A 1 109 ? -1.575  0.677   -3.123  1.00 0.00 ? 109 PRO A O    5  
ATOM 8580  C CB   . PRO A 1 109 ? -3.774  2.421   -2.029  1.00 0.00 ? 109 PRO A CB   5  
ATOM 8581  C CG   . PRO A 1 109 ? -3.525  1.708   -0.745  1.00 0.00 ? 109 PRO A CG   5  
ATOM 8582  C CD   . PRO A 1 109 ? -4.274  0.408   -0.840  1.00 0.00 ? 109 PRO A CD   5  
ATOM 8583  H HA   . PRO A 1 109 ? -4.629  1.584   -3.814  1.00 0.00 ? 109 PRO A HA   5  
ATOM 8584  H HB2  . PRO A 1 109 ? -2.951  3.073   -2.286  1.00 0.00 ? 109 PRO A HB2  5  
ATOM 8585  H HB3  . PRO A 1 109 ? -4.693  2.986   -1.995  1.00 0.00 ? 109 PRO A HB3  5  
ATOM 8586  H HG2  . PRO A 1 109 ? -2.468  1.524   -0.626  1.00 0.00 ? 109 PRO A HG2  5  
ATOM 8587  H HG3  . PRO A 1 109 ? -3.900  2.296   0.080   1.00 0.00 ? 109 PRO A HG3  5  
ATOM 8588  H HD2  . PRO A 1 109 ? -3.737  -0.376  -0.326  1.00 0.00 ? 109 PRO A HD2  5  
ATOM 8589  H HD3  . PRO A 1 109 ? -5.269  0.515   -0.434  1.00 0.00 ? 109 PRO A HD3  5  
ATOM 8590  N N    . LYS A 1 110 ? -2.504  1.333   -5.063  1.00 0.00 ? 110 LYS A N    5  
ATOM 8591  C CA   . LYS A 1 110 ? -1.281  1.155   -5.837  1.00 0.00 ? 110 LYS A CA   5  
ATOM 8592  C C    . LYS A 1 110 ? -0.159  2.031   -5.289  1.00 0.00 ? 110 LYS A C    5  
ATOM 8593  O O    . LYS A 1 110 ? 1.016   1.668   -5.360  1.00 0.00 ? 110 LYS A O    5  
ATOM 8594  C CB   . LYS A 1 110 ? -1.531  1.490   -7.309  1.00 0.00 ? 110 LYS A CB   5  
ATOM 8595  C CG   . LYS A 1 110 ? -2.920  1.112   -7.791  1.00 0.00 ? 110 LYS A CG   5  
ATOM 8596  C CD   . LYS A 1 110 ? -2.923  0.768   -9.271  1.00 0.00 ? 110 LYS A CD   5  
ATOM 8597  C CE   . LYS A 1 110 ? -2.522  1.964   -10.122 1.00 0.00 ? 110 LYS A CE   5  
ATOM 8598  N NZ   . LYS A 1 110 ? -2.887  1.774   -11.553 1.00 0.00 ? 110 LYS A NZ   5  
ATOM 8599  H H    . LYS A 1 110 ? -3.314  1.650   -5.516  1.00 0.00 ? 110 LYS A H    5  
ATOM 8600  H HA   . LYS A 1 110 ? -0.985  0.120   -5.756  1.00 0.00 ? 110 LYS A HA   5  
ATOM 8601  H HB2  . LYS A 1 110 ? -1.399  2.552   -7.452  1.00 0.00 ? 110 LYS A HB2  5  
ATOM 8602  H HB3  . LYS A 1 110 ? -0.807  0.962   -7.913  1.00 0.00 ? 110 LYS A HB3  5  
ATOM 8603  H HG2  . LYS A 1 110 ? -3.265  0.254   -7.233  1.00 0.00 ? 110 LYS A HG2  5  
ATOM 8604  H HG3  . LYS A 1 110 ? -3.588  1.945   -7.623  1.00 0.00 ? 110 LYS A HG3  5  
ATOM 8605  H HD2  . LYS A 1 110 ? -2.222  -0.035  -9.447  1.00 0.00 ? 110 LYS A HD2  5  
ATOM 8606  H HD3  . LYS A 1 110 ? -3.916  0.451   -9.557  1.00 0.00 ? 110 LYS A HD3  5  
ATOM 8607  H HE2  . LYS A 1 110 ? -3.024  2.842   -9.745  1.00 0.00 ? 110 LYS A HE2  5  
ATOM 8608  H HE3  . LYS A 1 110 ? -1.453  2.100   -10.047 1.00 0.00 ? 110 LYS A HE3  5  
ATOM 8609  H HZ1  . LYS A 1 110 ? -3.544  0.974   -11.651 1.00 0.00 ? 110 LYS A HZ1  5  
ATOM 8610  H HZ2  . LYS A 1 110 ? -2.034  1.580   -12.116 1.00 0.00 ? 110 LYS A HZ2  5  
ATOM 8611  H HZ3  . LYS A 1 110 ? -3.344  2.632   -11.922 1.00 0.00 ? 110 LYS A HZ3  5  
ATOM 8612  N N    . SER A 1 111 ? -0.528  3.184   -4.741  1.00 0.00 ? 111 SER A N    5  
ATOM 8613  C CA   . SER A 1 111 ? 0.449   4.113   -4.183  1.00 0.00 ? 111 SER A CA   5  
ATOM 8614  C C    . SER A 1 111 ? 1.165   3.493   -2.987  1.00 0.00 ? 111 SER A C    5  
ATOM 8615  O O    . SER A 1 111 ? 2.136   4.050   -2.473  1.00 0.00 ? 111 SER A O    5  
ATOM 8616  C CB   . SER A 1 111 ? -0.236  5.414   -3.763  1.00 0.00 ? 111 SER A CB   5  
ATOM 8617  O OG   . SER A 1 111 ? -0.923  5.256   -2.533  1.00 0.00 ? 111 SER A OG   5  
ATOM 8618  H H    . SER A 1 111 ? -1.480  3.417   -4.714  1.00 0.00 ? 111 SER A H    5  
ATOM 8619  H HA   . SER A 1 111 ? 1.176   4.330   -4.950  1.00 0.00 ? 111 SER A HA   5  
ATOM 8620  H HB2  . SER A 1 111 ? 0.507   6.189   -3.649  1.00 0.00 ? 111 SER A HB2  5  
ATOM 8621  H HB3  . SER A 1 111 ? -0.946  5.706   -4.523  1.00 0.00 ? 111 SER A HB3  5  
ATOM 8622  H HG   . SER A 1 111 ? -0.292  5.273   -1.810  1.00 0.00 ? 111 SER A HG   5  
ATOM 8623  N N    . PHE A 1 112 ? 0.680   2.336   -2.548  1.00 0.00 ? 112 PHE A N    5  
ATOM 8624  C CA   . PHE A 1 112 ? 1.272   1.640   -1.412  1.00 0.00 ? 112 PHE A CA   5  
ATOM 8625  C C    . PHE A 1 112 ? 2.079   0.430   -1.876  1.00 0.00 ? 112 PHE A C    5  
ATOM 8626  O O    . PHE A 1 112 ? 2.917   -0.090  -1.139  1.00 0.00 ? 112 PHE A O    5  
ATOM 8627  C CB   . PHE A 1 112 ? 0.183   1.196   -0.434  1.00 0.00 ? 112 PHE A CB   5  
ATOM 8628  C CG   . PHE A 1 112 ? -0.342  2.311   0.425   1.00 0.00 ? 112 PHE A CG   5  
ATOM 8629  C CD1  . PHE A 1 112 ? -0.984  3.399   -0.144  1.00 0.00 ? 112 PHE A CD1  5  
ATOM 8630  C CD2  . PHE A 1 112 ? -0.193  2.271   1.802   1.00 0.00 ? 112 PHE A CD2  5  
ATOM 8631  C CE1  . PHE A 1 112 ? -1.467  4.426   0.644   1.00 0.00 ? 112 PHE A CE1  5  
ATOM 8632  C CE2  . PHE A 1 112 ? -0.674  3.295   2.595   1.00 0.00 ? 112 PHE A CE2  5  
ATOM 8633  C CZ   . PHE A 1 112 ? -1.313  4.374   2.016   1.00 0.00 ? 112 PHE A CZ   5  
ATOM 8634  H H    . PHE A 1 112 ? -0.096  1.942   -3.000  1.00 0.00 ? 112 PHE A H    5  
ATOM 8635  H HA   . PHE A 1 112 ? 1.935   2.329   -0.911  1.00 0.00 ? 112 PHE A HA   5  
ATOM 8636  H HB2  . PHE A 1 112 ? -0.648  0.789   -0.992  1.00 0.00 ? 112 PHE A HB2  5  
ATOM 8637  H HB3  . PHE A 1 112 ? 0.582   0.434   0.217   1.00 0.00 ? 112 PHE A HB3  5  
ATOM 8638  H HD1  . PHE A 1 112 ? -1.106  3.441   -1.217  1.00 0.00 ? 112 PHE A HD1  5  
ATOM 8639  H HD2  . PHE A 1 112 ? 0.307   1.427   2.257   1.00 0.00 ? 112 PHE A HD2  5  
ATOM 8640  H HE1  . PHE A 1 112 ? -1.966  5.268   0.188   1.00 0.00 ? 112 PHE A HE1  5  
ATOM 8641  H HE2  . PHE A 1 112 ? -0.552  3.251   3.667   1.00 0.00 ? 112 PHE A HE2  5  
ATOM 8642  H HZ   . PHE A 1 112 ? -1.689  5.176   2.634   1.00 0.00 ? 112 PHE A HZ   5  
ATOM 8643  N N    . ILE A 1 113 ? 1.818   -0.012  -3.102  1.00 0.00 ? 113 ILE A N    5  
ATOM 8644  C CA   . ILE A 1 113 ? 2.519   -1.159  -3.664  1.00 0.00 ? 113 ILE A CA   5  
ATOM 8645  C C    . ILE A 1 113 ? 3.687   -0.716  -4.539  1.00 0.00 ? 113 ILE A C    5  
ATOM 8646  O O    . ILE A 1 113 ? 3.559   0.212   -5.339  1.00 0.00 ? 113 ILE A O    5  
ATOM 8647  C CB   . ILE A 1 113 ? 1.574   -2.043  -4.499  1.00 0.00 ? 113 ILE A CB   5  
ATOM 8648  C CG1  . ILE A 1 113 ? 0.391   -2.508  -3.647  1.00 0.00 ? 113 ILE A CG1  5  
ATOM 8649  C CG2  . ILE A 1 113 ? 2.327   -3.238  -5.065  1.00 0.00 ? 113 ILE A CG2  5  
ATOM 8650  C CD1  . ILE A 1 113 ? 0.802   -3.185  -2.359  1.00 0.00 ? 113 ILE A CD1  5  
ATOM 8651  H H    . ILE A 1 113 ? 1.140   0.445   -3.641  1.00 0.00 ? 113 ILE A H    5  
ATOM 8652  H HA   . ILE A 1 113 ? 2.902   -1.750  -2.844  1.00 0.00 ? 113 ILE A HA   5  
ATOM 8653  H HB   . ILE A 1 113 ? 1.205   -1.456  -5.326  1.00 0.00 ? 113 ILE A HB   5  
ATOM 8654  H HG12 . ILE A 1 113 ? -0.219  -1.655  -3.392  1.00 0.00 ? 113 ILE A HG12 5  
ATOM 8655  H HG13 . ILE A 1 113 ? -0.201  -3.209  -4.218  1.00 0.00 ? 113 ILE A HG13 5  
ATOM 8656  H HG21 . ILE A 1 113 ? 3.363   -2.971  -5.215  1.00 0.00 ? 113 ILE A HG21 5  
ATOM 8657  H HG22 . ILE A 1 113 ? 2.266   -4.063  -4.371  1.00 0.00 ? 113 ILE A HG22 5  
ATOM 8658  H HG23 . ILE A 1 113 ? 1.889   -3.526  -6.008  1.00 0.00 ? 113 ILE A HG23 5  
ATOM 8659  H HD11 . ILE A 1 113 ? 1.834   -3.498  -2.431  1.00 0.00 ? 113 ILE A HD11 5  
ATOM 8660  H HD12 . ILE A 1 113 ? 0.693   -2.493  -1.537  1.00 0.00 ? 113 ILE A HD12 5  
ATOM 8661  H HD13 . ILE A 1 113 ? 0.177   -4.048  -2.190  1.00 0.00 ? 113 ILE A HD13 5  
ATOM 8662  N N    . HIS A 1 114 ? 4.824   -1.385  -4.384  1.00 0.00 ? 114 HIS A N    5  
ATOM 8663  C CA   . HIS A 1 114 ? 6.015   -1.062  -5.162  1.00 0.00 ? 114 HIS A CA   5  
ATOM 8664  C C    . HIS A 1 114 ? 6.264   -2.115  -6.237  1.00 0.00 ? 114 HIS A C    5  
ATOM 8665  O O    . HIS A 1 114 ? 6.846   -3.165  -5.967  1.00 0.00 ? 114 HIS A O    5  
ATOM 8666  C CB   . HIS A 1 114 ? 7.234   -0.953  -4.246  1.00 0.00 ? 114 HIS A CB   5  
ATOM 8667  C CG   . HIS A 1 114 ? 8.435   -0.357  -4.915  1.00 0.00 ? 114 HIS A CG   5  
ATOM 8668  N ND1  . HIS A 1 114 ? 8.439   0.907   -5.466  1.00 0.00 ? 114 HIS A ND1  5  
ATOM 8669  C CD2  . HIS A 1 114 ? 9.675   -0.860  -5.119  1.00 0.00 ? 114 HIS A CD2  5  
ATOM 8670  C CE1  . HIS A 1 114 ? 9.630   1.156   -5.981  1.00 0.00 ? 114 HIS A CE1  5  
ATOM 8671  N NE2  . HIS A 1 114 ? 10.399  0.100   -5.784  1.00 0.00 ? 114 HIS A NE2  5  
ATOM 8672  H H    . HIS A 1 114 ? 4.864   -2.114  -3.730  1.00 0.00 ? 114 HIS A H    5  
ATOM 8673  H HA   . HIS A 1 114 ? 5.849   -0.109  -5.641  1.00 0.00 ? 114 HIS A HA   5  
ATOM 8674  H HB2  . HIS A 1 114 ? 6.985   -0.331  -3.398  1.00 0.00 ? 114 HIS A HB2  5  
ATOM 8675  H HB3  . HIS A 1 114 ? 7.503   -1.939  -3.897  1.00 0.00 ? 114 HIS A HB3  5  
ATOM 8676  H HD1  . HIS A 1 114 ? 7.682   1.528   -5.479  1.00 0.00 ? 114 HIS A HD1  5  
ATOM 8677  H HD2  . HIS A 1 114 ? 10.030  -1.835  -4.817  1.00 0.00 ? 114 HIS A HD2  5  
ATOM 8678  H HE1  . HIS A 1 114 ? 9.926   2.067   -6.479  1.00 0.00 ? 114 HIS A HE1  5  
ATOM 8679  H HE2  . HIS A 1 114 ? 11.303  -0.015  -6.142  1.00 0.00 ? 114 HIS A HE2  5  
ATOM 8680  N N    . ILE A 1 115 ? 5.818   -1.826  -7.455  1.00 0.00 ? 115 ILE A N    5  
ATOM 8681  C CA   . ILE A 1 115 ? 5.993   -2.748  -8.571  1.00 0.00 ? 115 ILE A CA   5  
ATOM 8682  C C    . ILE A 1 115 ? 7.460   -2.851  -8.974  1.00 0.00 ? 115 ILE A C    5  
ATOM 8683  O O    . ILE A 1 115 ? 8.005   -1.950  -9.612  1.00 0.00 ? 115 ILE A O    5  
ATOM 8684  C CB   . ILE A 1 115 ? 5.165   -2.315  -9.795  1.00 0.00 ? 115 ILE A CB   5  
ATOM 8685  C CG1  . ILE A 1 115 ? 3.681   -2.233  -9.431  1.00 0.00 ? 115 ILE A CG1  5  
ATOM 8686  C CG2  . ILE A 1 115 ? 5.380   -3.282  -10.949 1.00 0.00 ? 115 ILE A CG2  5  
ATOM 8687  C CD1  . ILE A 1 115 ? 3.080   -3.565  -9.041  1.00 0.00 ? 115 ILE A CD1  5  
ATOM 8688  H H    . ILE A 1 115 ? 5.361   -0.973  -7.608  1.00 0.00 ? 115 ILE A H    5  
ATOM 8689  H HA   . ILE A 1 115 ? 5.648   -3.722  -8.254  1.00 0.00 ? 115 ILE A HA   5  
ATOM 8690  H HB   . ILE A 1 115 ? 5.507   -1.339  -10.105 1.00 0.00 ? 115 ILE A HB   5  
ATOM 8691  H HG12 . ILE A 1 115 ? 3.558   -1.558  -8.599  1.00 0.00 ? 115 ILE A HG12 5  
ATOM 8692  H HG13 . ILE A 1 115 ? 3.130   -1.855  -10.280 1.00 0.00 ? 115 ILE A HG13 5  
ATOM 8693  H HG21 . ILE A 1 115 ? 4.444   -3.761  -11.196 1.00 0.00 ? 115 ILE A HG21 5  
ATOM 8694  H HG22 . ILE A 1 115 ? 5.744   -2.740  -11.809 1.00 0.00 ? 115 ILE A HG22 5  
ATOM 8695  H HG23 . ILE A 1 115 ? 6.103   -4.031  -10.662 1.00 0.00 ? 115 ILE A HG23 5  
ATOM 8696  H HD11 . ILE A 1 115 ? 2.083   -3.643  -9.451  1.00 0.00 ? 115 ILE A HD11 5  
ATOM 8697  H HD12 . ILE A 1 115 ? 3.692   -4.365  -9.431  1.00 0.00 ? 115 ILE A HD12 5  
ATOM 8698  H HD13 . ILE A 1 115 ? 3.033   -3.638  -7.965  1.00 0.00 ? 115 ILE A HD13 5  
ATOM 8699  N N    . LYS A 1 116 ? 8.095   -3.957  -8.599  1.00 0.00 ? 116 LYS A N    5  
ATOM 8700  C CA   . LYS A 1 116 ? 9.498   -4.181  -8.923  1.00 0.00 ? 116 LYS A CA   5  
ATOM 8701  C C    . LYS A 1 116 ? 9.647   -4.763  -10.325 1.00 0.00 ? 116 LYS A C    5  
ATOM 8702  O O    . LYS A 1 116 ? 9.569   -5.977  -10.514 1.00 0.00 ? 116 LYS A O    5  
ATOM 8703  C CB   . LYS A 1 116 ? 10.136  -5.122  -7.899  1.00 0.00 ? 116 LYS A CB   5  
ATOM 8704  C CG   . LYS A 1 116 ? 9.939   -4.678  -6.459  1.00 0.00 ? 116 LYS A CG   5  
ATOM 8705  C CD   . LYS A 1 116 ? 9.931   -5.861  -5.507  1.00 0.00 ? 116 LYS A CD   5  
ATOM 8706  C CE   . LYS A 1 116 ? 8.645   -6.664  -5.625  1.00 0.00 ? 116 LYS A CE   5  
ATOM 8707  N NZ   . LYS A 1 116 ? 8.664   -7.875  -4.759  1.00 0.00 ? 116 LYS A NZ   5  
ATOM 8708  H H    . LYS A 1 116 ? 7.606   -4.639  -8.092  1.00 0.00 ? 116 LYS A H    5  
ATOM 8709  H HA   . LYS A 1 116 ? 10.004  -3.228  -8.887  1.00 0.00 ? 116 LYS A HA   5  
ATOM 8710  H HB2  . LYS A 1 116 ? 9.703   -6.105  -8.012  1.00 0.00 ? 116 LYS A HB2  5  
ATOM 8711  H HB3  . LYS A 1 116 ? 11.197  -5.181  -8.093  1.00 0.00 ? 116 LYS A HB3  5  
ATOM 8712  H HG2  . LYS A 1 116 ? 10.744  -4.013  -6.184  1.00 0.00 ? 116 LYS A HG2  5  
ATOM 8713  H HG3  . LYS A 1 116 ? 8.996   -4.157  -6.379  1.00 0.00 ? 116 LYS A HG3  5  
ATOM 8714  H HD2  . LYS A 1 116 ? 10.766  -6.506  -5.739  1.00 0.00 ? 116 LYS A HD2  5  
ATOM 8715  H HD3  . LYS A 1 116 ? 10.027  -5.497  -4.493  1.00 0.00 ? 116 LYS A HD3  5  
ATOM 8716  H HE2  . LYS A 1 116 ? 7.816   -6.037  -5.333  1.00 0.00 ? 116 LYS A HE2  5  
ATOM 8717  H HE3  . LYS A 1 116 ? 8.520   -6.969  -6.653  1.00 0.00 ? 116 LYS A HE3  5  
ATOM 8718  H HZ1  . LYS A 1 116 ? 8.920   -7.614  -3.785  1.00 0.00 ? 116 LYS A HZ1  5  
ATOM 8719  H HZ2  . LYS A 1 116 ? 9.361   -8.559  -5.117  1.00 0.00 ? 116 LYS A HZ2  5  
ATOM 8720  H HZ3  . LYS A 1 116 ? 7.727   -8.324  -4.751  1.00 0.00 ? 116 LYS A HZ3  5  
ATOM 8721  N N    . GLU A 1 117 ? 9.862   -3.890  -11.304 1.00 0.00 ? 117 GLU A N    5  
ATOM 8722  C CA   . GLU A 1 117 ? 10.021  -4.319  -12.689 1.00 0.00 ? 117 GLU A CA   5  
ATOM 8723  C C    . GLU A 1 117 ? 11.470  -4.705  -12.975 1.00 0.00 ? 117 GLU A C    5  
ATOM 8724  O O    . GLU A 1 117 ? 12.191  -3.984  -13.663 1.00 0.00 ? 117 GLU A O    5  
ATOM 8725  C CB   . GLU A 1 117 ? 9.579   -3.209  -13.644 1.00 0.00 ? 117 GLU A CB   5  
ATOM 8726  C CG   . GLU A 1 117 ? 9.885   -1.811  -13.136 1.00 0.00 ? 117 GLU A CG   5  
ATOM 8727  C CD   . GLU A 1 117 ? 10.025  -0.800  -14.258 1.00 0.00 ? 117 GLU A CD   5  
ATOM 8728  O OE1  . GLU A 1 117 ? 8.988   -0.389  -14.819 1.00 0.00 ? 117 GLU A OE1  5  
ATOM 8729  O OE2  . GLU A 1 117 ? 11.172  -0.420  -14.574 1.00 0.00 ? 117 GLU A OE2  5  
ATOM 8730  H H    . GLU A 1 117 ? 9.914   -2.935  -11.091 1.00 0.00 ? 117 GLU A H    5  
ATOM 8731  H HA   . GLU A 1 117 ? 9.394   -5.185  -12.842 1.00 0.00 ? 117 GLU A HA   5  
ATOM 8732  H HB2  . GLU A 1 117 ? 10.081  -3.345  -14.591 1.00 0.00 ? 117 GLU A HB2  5  
ATOM 8733  H HB3  . GLU A 1 117 ? 8.513   -3.288  -13.799 1.00 0.00 ? 117 GLU A HB3  5  
ATOM 8734  H HG2  . GLU A 1 117 ? 9.084   -1.494  -12.485 1.00 0.00 ? 117 GLU A HG2  5  
ATOM 8735  H HG3  . GLU A 1 117 ? 10.810  -1.838  -12.579 1.00 0.00 ? 117 GLU A HG3  5  
ATOM 8736  N N    . VAL A 1 118 ? 11.888  -5.848  -12.441 1.00 0.00 ? 118 VAL A N    5  
ATOM 8737  C CA   . VAL A 1 118 ? 13.249  -6.331  -12.639 1.00 0.00 ? 118 VAL A CA   5  
ATOM 8738  C C    . VAL A 1 118 ? 13.436  -6.887  -14.046 1.00 0.00 ? 118 VAL A C    5  
ATOM 8739  O O    . VAL A 1 118 ? 14.545  -6.891  -14.582 1.00 0.00 ? 118 VAL A O    5  
ATOM 8740  C CB   . VAL A 1 118 ? 13.612  -7.424  -11.615 1.00 0.00 ? 118 VAL A CB   5  
ATOM 8741  C CG1  . VAL A 1 118 ? 13.833  -6.814  -10.239 1.00 0.00 ? 118 VAL A CG1  5  
ATOM 8742  C CG2  . VAL A 1 118 ? 12.527  -8.489  -11.567 1.00 0.00 ? 118 VAL A CG2  5  
ATOM 8743  H H    . VAL A 1 118 ? 11.266  -6.380  -11.902 1.00 0.00 ? 118 VAL A H    5  
ATOM 8744  H HA   . VAL A 1 118 ? 13.923  -5.498  -12.498 1.00 0.00 ? 118 VAL A HA   5  
ATOM 8745  H HB   . VAL A 1 118 ? 14.533  -7.892  -11.930 1.00 0.00 ? 118 VAL A HB   5  
ATOM 8746  H HG11 . VAL A 1 118 ? 13.168  -7.282  -9.528  1.00 0.00 ? 118 VAL A HG11 5  
ATOM 8747  H HG12 . VAL A 1 118 ? 14.857  -6.973  -9.935  1.00 0.00 ? 118 VAL A HG12 5  
ATOM 8748  H HG13 . VAL A 1 118 ? 13.629  -5.754  -10.278 1.00 0.00 ? 118 VAL A HG13 5  
ATOM 8749  H HG21 . VAL A 1 118 ? 11.866  -8.294  -10.736 1.00 0.00 ? 118 VAL A HG21 5  
ATOM 8750  H HG22 . VAL A 1 118 ? 11.963  -8.470  -12.488 1.00 0.00 ? 118 VAL A HG22 5  
ATOM 8751  H HG23 . VAL A 1 118 ? 12.982  -9.462  -11.444 1.00 0.00 ? 118 VAL A HG23 5  
ATOM 8752  N N    . THR A 1 119 ? 12.344  -7.355  -14.642 1.00 0.00 ? 119 THR A N    5  
ATOM 8753  C CA   . THR A 1 119 ? 12.387  -7.914  -15.987 1.00 0.00 ? 119 THR A CA   5  
ATOM 8754  C C    . THR A 1 119 ? 11.669  -7.008  -16.982 1.00 0.00 ? 119 THR A C    5  
ATOM 8755  O O    . THR A 1 119 ? 12.301  -6.375  -17.828 1.00 0.00 ? 119 THR A O    5  
ATOM 8756  C CB   . THR A 1 119 ? 11.749  -9.315  -16.034 1.00 0.00 ? 119 THR A CB   5  
ATOM 8757  O OG1  . THR A 1 119 ? 11.992  -9.921  -17.308 1.00 0.00 ? 119 THR A OG1  5  
ATOM 8758  C CG2  . THR A 1 119 ? 10.251  -9.237  -15.781 1.00 0.00 ? 119 THR A CG2  5  
ATOM 8759  H H    . THR A 1 119 ? 11.489  -7.324  -14.163 1.00 0.00 ? 119 THR A H    5  
ATOM 8760  H HA   . THR A 1 119 ? 13.423  -8.003  -16.279 1.00 0.00 ? 119 THR A HA   5  
ATOM 8761  H HB   . THR A 1 119 ? 12.199  -9.924  -15.263 1.00 0.00 ? 119 THR A HB   5  
ATOM 8762  H HG1  . THR A 1 119 ? 12.738  -10.523 -17.240 1.00 0.00 ? 119 THR A HG1  5  
ATOM 8763  H HG21 . THR A 1 119 ? 10.060  -8.563  -14.960 1.00 0.00 ? 119 THR A HG21 5  
ATOM 8764  H HG22 . THR A 1 119 ? 9.877   -10.220 -15.533 1.00 0.00 ? 119 THR A HG22 5  
ATOM 8765  H HG23 . THR A 1 119 ? 9.755   -8.875  -16.668 1.00 0.00 ? 119 THR A HG23 5  
ATOM 8766  N N    . GLY A 1 1   ? 5.972   14.071  -14.152 1.00 0.00 ? 1   GLY A N    6  
ATOM 8767  C CA   . GLY A 1 1   ? 7.380   13.772  -13.970 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8768  C C    . GLY A 1 1   ? 7.967   13.008  -15.140 1.00 0.00 ? 1   GLY A C    6  
ATOM 8769  O O    . GLY A 1 1   ? 7.490   11.928  -15.488 1.00 0.00 ? 1   GLY A O    6  
ATOM 8770  H H1   . GLY A 1 1   ? 5.311   13.348  -14.113 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8771  H HA2  . GLY A 1 1   ? 7.921   14.699  -13.850 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8772  H HA3  . GLY A 1 1   ? 7.497   13.180  -13.074 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8773  N N    . SER A 1 2   ? 9.006   13.570  -15.750 1.00 0.00 ? 2   SER A N    6  
ATOM 8774  C CA   . SER A 1 2   ? 9.655   12.937  -16.892 1.00 0.00 ? 2   SER A CA   6  
ATOM 8775  C C    . SER A 1 2   ? 11.155  12.791  -16.652 1.00 0.00 ? 2   SER A C    6  
ATOM 8776  O O    . SER A 1 2   ? 11.766  13.603  -15.957 1.00 0.00 ? 2   SER A O    6  
ATOM 8777  C CB   . SER A 1 2   ? 9.409   13.753  -18.163 1.00 0.00 ? 2   SER A CB   6  
ATOM 8778  O OG   . SER A 1 2   ? 9.675   12.984  -19.323 1.00 0.00 ? 2   SER A OG   6  
ATOM 8779  H H    . SER A 1 2   ? 9.341   14.432  -15.426 1.00 0.00 ? 2   SER A H    6  
ATOM 8780  H HA   . SER A 1 2   ? 9.225   11.955  -17.016 1.00 0.00 ? 2   SER A HA   6  
ATOM 8781  H HB2  . SER A 1 2   ? 8.378   14.074  -18.187 1.00 0.00 ? 2   SER A HB2  6  
ATOM 8782  H HB3  . SER A 1 2   ? 10.055  14.619  -18.163 1.00 0.00 ? 2   SER A HB3  6  
ATOM 8783  H HG   . SER A 1 2   ? 10.219  12.228  -19.088 1.00 0.00 ? 2   SER A HG   6  
ATOM 8784  N N    . SER A 1 3   ? 11.742  11.748  -17.231 1.00 0.00 ? 3   SER A N    6  
ATOM 8785  C CA   . SER A 1 3   ? 13.169  11.491  -17.077 1.00 0.00 ? 3   SER A CA   6  
ATOM 8786  C C    . SER A 1 3   ? 13.598  11.665  -15.623 1.00 0.00 ? 3   SER A C    6  
ATOM 8787  O O    . SER A 1 3   ? 14.720  12.083  -15.341 1.00 0.00 ? 3   SER A O    6  
ATOM 8788  C CB   . SER A 1 3   ? 13.977  12.430  -17.975 1.00 0.00 ? 3   SER A CB   6  
ATOM 8789  O OG   . SER A 1 3   ? 13.803  13.782  -17.587 1.00 0.00 ? 3   SER A OG   6  
ATOM 8790  H H    . SER A 1 3   ? 11.201  11.136  -17.772 1.00 0.00 ? 3   SER A H    6  
ATOM 8791  H HA   . SER A 1 3   ? 13.356  10.471  -17.376 1.00 0.00 ? 3   SER A HA   6  
ATOM 8792  H HB2  . SER A 1 3   ? 15.024  12.180  -17.903 1.00 0.00 ? 3   SER A HB2  6  
ATOM 8793  H HB3  . SER A 1 3   ? 13.649  12.316  -18.998 1.00 0.00 ? 3   SER A HB3  6  
ATOM 8794  H HG   . SER A 1 3   ? 14.183  13.917  -16.716 1.00 0.00 ? 3   SER A HG   6  
ATOM 8795  N N    . GLY A 1 4   ? 12.696  11.339  -14.703 1.00 0.00 ? 4   GLY A N    6  
ATOM 8796  C CA   . GLY A 1 4   ? 12.998  11.465  -13.289 1.00 0.00 ? 4   GLY A CA   6  
ATOM 8797  C C    . GLY A 1 4   ? 13.011  10.127  -12.577 1.00 0.00 ? 4   GLY A C    6  
ATOM 8798  O O    . GLY A 1 4   ? 13.189  10.065  -11.361 1.00 0.00 ? 4   GLY A O    6  
ATOM 8799  H H    . GLY A 1 4   ? 11.817  11.010  -14.986 1.00 0.00 ? 4   GLY A H    6  
ATOM 8800  H HA2  . GLY A 1 4   ? 13.968  11.929  -13.180 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8801  H HA3  . GLY A 1 4   ? 12.254  12.098  -12.828 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8802  N N    . SER A 1 5   ? 12.820  9.053   -13.337 1.00 0.00 ? 5   SER A N    6  
ATOM 8803  C CA   . SER A 1 5   ? 12.805  7.709   -12.770 1.00 0.00 ? 5   SER A CA   6  
ATOM 8804  C C    . SER A 1 5   ? 13.998  6.898   -13.264 1.00 0.00 ? 5   SER A C    6  
ATOM 8805  O O    . SER A 1 5   ? 13.972  5.667   -13.258 1.00 0.00 ? 5   SER A O    6  
ATOM 8806  C CB   . SER A 1 5   ? 11.502  6.994   -13.134 1.00 0.00 ? 5   SER A CB   6  
ATOM 8807  O OG   . SER A 1 5   ? 10.401  7.885   -13.087 1.00 0.00 ? 5   SER A OG   6  
ATOM 8808  H H    . SER A 1 5   ? 12.684  9.167   -14.301 1.00 0.00 ? 5   SER A H    6  
ATOM 8809  H HA   . SER A 1 5   ? 12.867  7.802   -11.696 1.00 0.00 ? 5   SER A HA   6  
ATOM 8810  H HB2  . SER A 1 5   ? 11.582  6.592   -14.132 1.00 0.00 ? 5   SER A HB2  6  
ATOM 8811  H HB3  . SER A 1 5   ? 11.329  6.189   -12.434 1.00 0.00 ? 5   SER A HB3  6  
ATOM 8812  H HG   . SER A 1 5   ? 10.365  8.393   -13.901 1.00 0.00 ? 5   SER A HG   6  
ATOM 8813  N N    . SER A 1 6   ? 15.045  7.597   -13.691 1.00 0.00 ? 6   SER A N    6  
ATOM 8814  C CA   . SER A 1 6   ? 16.248  6.942   -14.192 1.00 0.00 ? 6   SER A CA   6  
ATOM 8815  C C    . SER A 1 6   ? 17.212  6.631   -13.051 1.00 0.00 ? 6   SER A C    6  
ATOM 8816  O O    . SER A 1 6   ? 17.606  5.482   -12.853 1.00 0.00 ? 6   SER A O    6  
ATOM 8817  C CB   . SER A 1 6   ? 16.939  7.826   -15.232 1.00 0.00 ? 6   SER A CB   6  
ATOM 8818  O OG   . SER A 1 6   ? 17.665  7.044   -16.165 1.00 0.00 ? 6   SER A OG   6  
ATOM 8819  H H    . SER A 1 6   ? 15.006  8.576   -13.671 1.00 0.00 ? 6   SER A H    6  
ATOM 8820  H HA   . SER A 1 6   ? 15.951  6.016   -14.660 1.00 0.00 ? 6   SER A HA   6  
ATOM 8821  H HB2  . SER A 1 6   ? 16.196  8.401   -15.763 1.00 0.00 ? 6   SER A HB2  6  
ATOM 8822  H HB3  . SER A 1 6   ? 17.624  8.497   -14.732 1.00 0.00 ? 6   SER A HB3  6  
ATOM 8823  H HG   . SER A 1 6   ? 17.550  6.113   -15.960 1.00 0.00 ? 6   SER A HG   6  
ATOM 8824  N N    . GLY A 1 7   ? 17.588  7.664   -12.303 1.00 0.00 ? 7   GLY A N    6  
ATOM 8825  C CA   . GLY A 1 7   ? 18.503  7.481   -11.192 1.00 0.00 ? 7   GLY A CA   6  
ATOM 8826  C C    . GLY A 1 7   ? 19.761  6.736   -11.593 1.00 0.00 ? 7   GLY A C    6  
ATOM 8827  O O    . GLY A 1 7   ? 20.729  7.342   -12.053 1.00 0.00 ? 7   GLY A O    6  
ATOM 8828  H H    . GLY A 1 7   ? 17.242  8.557   -12.508 1.00 0.00 ? 7   GLY A H    6  
ATOM 8829  H HA2  . GLY A 1 7   ? 18.779  8.450   -10.804 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8830  H HA3  . GLY A 1 7   ? 18.001  6.923   -10.415 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8831  N N    . ARG A 1 8   ? 19.749  5.419   -11.416 1.00 0.00 ? 8   ARG A N    6  
ATOM 8832  C CA   . ARG A 1 8   ? 20.898  4.591   -11.760 1.00 0.00 ? 8   ARG A CA   6  
ATOM 8833  C C    . ARG A 1 8   ? 22.203  5.346   -11.522 1.00 0.00 ? 8   ARG A C    6  
ATOM 8834  O O    . ARG A 1 8   ? 23.068  5.404   -12.397 1.00 0.00 ? 8   ARG A O    6  
ATOM 8835  C CB   . ARG A 1 8   ? 20.814  4.145   -13.221 1.00 0.00 ? 8   ARG A CB   6  
ATOM 8836  C CG   . ARG A 1 8   ? 20.818  5.298   -14.211 1.00 0.00 ? 8   ARG A CG   6  
ATOM 8837  C CD   . ARG A 1 8   ? 20.223  4.886   -15.549 1.00 0.00 ? 8   ARG A CD   6  
ATOM 8838  N NE   . ARG A 1 8   ? 20.242  5.980   -16.516 1.00 0.00 ? 8   ARG A NE   6  
ATOM 8839  C CZ   . ARG A 1 8   ? 21.321  6.333   -17.206 1.00 0.00 ? 8   ARG A CZ   6  
ATOM 8840  N NH1  . ARG A 1 8   ? 22.463  5.681   -17.036 1.00 0.00 ? 8   ARG A NH1  6  
ATOM 8841  N NH2  . ARG A 1 8   ? 21.260  7.339   -18.068 1.00 0.00 ? 8   ARG A NH2  6  
ATOM 8842  H H    . ARG A 1 8   ? 18.947  4.993   -11.045 1.00 0.00 ? 8   ARG A H    6  
ATOM 8843  H HA   . ARG A 1 8   ? 20.881  3.718   -11.125 1.00 0.00 ? 8   ARG A HA   6  
ATOM 8844  H HB2  . ARG A 1 8   ? 21.658  3.509   -13.441 1.00 0.00 ? 8   ARG A HB2  6  
ATOM 8845  H HB3  . ARG A 1 8   ? 19.903  3.582   -13.361 1.00 0.00 ? 8   ARG A HB3  6  
ATOM 8846  H HG2  . ARG A 1 8   ? 20.233  6.111   -13.805 1.00 0.00 ? 8   ARG A HG2  6  
ATOM 8847  H HG3  . ARG A 1 8   ? 21.835  5.625   -14.364 1.00 0.00 ? 8   ARG A HG3  6  
ATOM 8848  H HD2  . ARG A 1 8   ? 20.796  4.060   -15.943 1.00 0.00 ? 8   ARG A HD2  6  
ATOM 8849  H HD3  . ARG A 1 8   ? 19.202  4.574   -15.392 1.00 0.00 ? 8   ARG A HD3  6  
ATOM 8850  H HE   . ARG A 1 8   ? 19.409  6.476   -16.657 1.00 0.00 ? 8   ARG A HE   6  
ATOM 8851  H HH11 . ARG A 1 8   ? 22.512  4.921   -16.387 1.00 0.00 ? 8   ARG A HH11 6  
ATOM 8852  H HH12 . ARG A 1 8   ? 23.274  5.947   -17.557 1.00 0.00 ? 8   ARG A HH12 6  
ATOM 8853  H HH21 . ARG A 1 8   ? 20.401  7.833   -18.199 1.00 0.00 ? 8   ARG A HH21 6  
ATOM 8854  H HH22 . ARG A 1 8   ? 22.072  7.604   -18.587 1.00 0.00 ? 8   ARG A HH22 6  
ATOM 8855  N N    . LEU A 1 9   ? 22.337  5.924   -10.334 1.00 0.00 ? 9   LEU A N    6  
ATOM 8856  C CA   . LEU A 1 9   ? 23.536  6.677   -9.980  1.00 0.00 ? 9   LEU A CA   6  
ATOM 8857  C C    . LEU A 1 9   ? 24.457  5.847   -9.091  1.00 0.00 ? 9   LEU A C    6  
ATOM 8858  O O    . LEU A 1 9   ? 25.642  5.686   -9.386  1.00 0.00 ? 9   LEU A O    6  
ATOM 8859  C CB   . LEU A 1 9   ? 23.155  7.976   -9.268  1.00 0.00 ? 9   LEU A CB   6  
ATOM 8860  C CG   . LEU A 1 9   ? 22.904  9.186   -10.168 1.00 0.00 ? 9   LEU A CG   6  
ATOM 8861  C CD1  . LEU A 1 9   ? 22.100  10.244  -9.428  1.00 0.00 ? 9   LEU A CD1  6  
ATOM 8862  C CD2  . LEU A 1 9   ? 24.222  9.764   -10.664 1.00 0.00 ? 9   LEU A CD2  6  
ATOM 8863  H H    . LEU A 1 9   ? 21.614  5.844   -9.678  1.00 0.00 ? 9   LEU A H    6  
ATOM 8864  H HA   . LEU A 1 9   ? 24.058  6.917   -10.894 1.00 0.00 ? 9   LEU A HA   6  
ATOM 8865  H HB2  . LEU A 1 9   ? 22.254  7.791   -8.704  1.00 0.00 ? 9   LEU A HB2  6  
ATOM 8866  H HB3  . LEU A 1 9   ? 23.957  8.227   -8.589  1.00 0.00 ? 9   LEU A HB3  6  
ATOM 8867  H HG   . LEU A 1 9   ? 22.330  8.873   -11.030 1.00 0.00 ? 9   LEU A HG   6  
ATOM 8868  H HD11 . LEU A 1 9   ? 22.598  11.198  -9.513  1.00 0.00 ? 9   LEU A HD11 6  
ATOM 8869  H HD12 . LEU A 1 9   ? 22.019  9.971   -8.387  1.00 0.00 ? 9   LEU A HD12 6  
ATOM 8870  H HD13 . LEU A 1 9   ? 21.112  10.313  -9.860  1.00 0.00 ? 9   LEU A HD13 6  
ATOM 8871  H HD21 . LEU A 1 9   ? 25.005  9.531   -9.958  1.00 0.00 ? 9   LEU A HD21 6  
ATOM 8872  H HD22 . LEU A 1 9   ? 24.130  10.836  -10.760 1.00 0.00 ? 9   LEU A HD22 6  
ATOM 8873  H HD23 . LEU A 1 9   ? 24.463  9.336   -11.626 1.00 0.00 ? 9   LEU A HD23 6  
ATOM 8874  N N    . LEU A 1 10  ? 23.905  5.322   -8.003  1.00 0.00 ? 10  LEU A N    6  
ATOM 8875  C CA   . LEU A 1 10  ? 24.676  4.506   -7.072  1.00 0.00 ? 10  LEU A CA   6  
ATOM 8876  C C    . LEU A 1 10  ? 23.759  3.798   -6.079  1.00 0.00 ? 10  LEU A C    6  
ATOM 8877  O O    . LEU A 1 10  ? 22.632  4.233   -5.842  1.00 0.00 ? 10  LEU A O    6  
ATOM 8878  C CB   . LEU A 1 10  ? 25.687  5.374   -6.320  1.00 0.00 ? 10  LEU A CB   6  
ATOM 8879  C CG   . LEU A 1 10  ? 27.063  4.750   -6.083  1.00 0.00 ? 10  LEU A CG   6  
ATOM 8880  C CD1  . LEU A 1 10  ? 28.057  5.806   -5.626  1.00 0.00 ? 10  LEU A CD1  6  
ATOM 8881  C CD2  . LEU A 1 10  ? 26.969  3.625   -5.062  1.00 0.00 ? 10  LEU A CD2  6  
ATOM 8882  H H    . LEU A 1 10  ? 22.956  5.485   -7.821  1.00 0.00 ? 10  LEU A H    6  
ATOM 8883  H HA   . LEU A 1 10  ? 25.209  3.762   -7.645  1.00 0.00 ? 10  LEU A HA   6  
ATOM 8884  H HB2  . LEU A 1 10  ? 25.829  6.282   -6.886  1.00 0.00 ? 10  LEU A HB2  6  
ATOM 8885  H HB3  . LEU A 1 10  ? 25.262  5.616   -5.356  1.00 0.00 ? 10  LEU A HB3  6  
ATOM 8886  H HG   . LEU A 1 10  ? 27.425  4.330   -7.012  1.00 0.00 ? 10  LEU A HG   6  
ATOM 8887  H HD11 . LEU A 1 10  ? 27.534  6.586   -5.095  1.00 0.00 ? 10  LEU A HD11 6  
ATOM 8888  H HD12 . LEU A 1 10  ? 28.555  6.227   -6.486  1.00 0.00 ? 10  LEU A HD12 6  
ATOM 8889  H HD13 . LEU A 1 10  ? 28.788  5.353   -4.973  1.00 0.00 ? 10  LEU A HD13 6  
ATOM 8890  H HD21 . LEU A 1 10  ? 27.787  3.706   -4.361  1.00 0.00 ? 10  LEU A HD21 6  
ATOM 8891  H HD22 . LEU A 1 10  ? 27.023  2.673   -5.570  1.00 0.00 ? 10  LEU A HD22 6  
ATOM 8892  H HD23 . LEU A 1 10  ? 26.031  3.697   -4.532  1.00 0.00 ? 10  LEU A HD23 6  
ATOM 8893  N N    . ASP A 1 11  ? 24.251  2.708   -5.502  1.00 0.00 ? 11  ASP A N    6  
ATOM 8894  C CA   . ASP A 1 11  ? 23.477  1.941   -4.532  1.00 0.00 ? 11  ASP A CA   6  
ATOM 8895  C C    . ASP A 1 11  ? 23.310  2.721   -3.232  1.00 0.00 ? 11  ASP A C    6  
ATOM 8896  O O    . ASP A 1 11  ? 22.702  2.234   -2.277  1.00 0.00 ? 11  ASP A O    6  
ATOM 8897  C CB   . ASP A 1 11  ? 24.155  0.599   -4.253  1.00 0.00 ? 11  ASP A CB   6  
ATOM 8898  C CG   . ASP A 1 11  ? 23.680  -0.495  -5.188  1.00 0.00 ? 11  ASP A CG   6  
ATOM 8899  O OD1  . ASP A 1 11  ? 23.640  -0.254  -6.413  1.00 0.00 ? 11  ASP A OD1  6  
ATOM 8900  O OD2  . ASP A 1 11  ? 23.348  -1.594  -4.696  1.00 0.00 ? 11  ASP A OD2  6  
ATOM 8901  H H    . ASP A 1 11  ? 25.156  2.412   -5.732  1.00 0.00 ? 11  ASP A H    6  
ATOM 8902  H HA   . ASP A 1 11  ? 22.501  1.760   -4.956  1.00 0.00 ? 11  ASP A HA   6  
ATOM 8903  H HB2  . ASP A 1 11  ? 25.223  0.711   -4.373  1.00 0.00 ? 11  ASP A HB2  6  
ATOM 8904  H HB3  . ASP A 1 11  ? 23.941  0.299   -3.238  1.00 0.00 ? 11  ASP A HB3  6  
ATOM 8905  N N    . LEU A 1 12  ? 23.853  3.933   -3.200  1.00 0.00 ? 12  LEU A N    6  
ATOM 8906  C CA   . LEU A 1 12  ? 23.766  4.780   -2.016  1.00 0.00 ? 12  LEU A CA   6  
ATOM 8907  C C    . LEU A 1 12  ? 22.477  5.597   -2.026  1.00 0.00 ? 12  LEU A C    6  
ATOM 8908  O O    . LEU A 1 12  ? 21.749  5.636   -1.034  1.00 0.00 ? 12  LEU A O    6  
ATOM 8909  C CB   . LEU A 1 12  ? 24.975  5.715   -1.943  1.00 0.00 ? 12  LEU A CB   6  
ATOM 8910  C CG   . LEU A 1 12  ? 26.226  5.143   -1.275  1.00 0.00 ? 12  LEU A CG   6  
ATOM 8911  C CD1  . LEU A 1 12  ? 27.455  5.950   -1.663  1.00 0.00 ? 12  LEU A CD1  6  
ATOM 8912  C CD2  . LEU A 1 12  ? 26.058  5.117   0.237   1.00 0.00 ? 12  LEU A CD2  6  
ATOM 8913  H H    . LEU A 1 12  ? 24.325  4.266   -3.992  1.00 0.00 ? 12  LEU A H    6  
ATOM 8914  H HA   . LEU A 1 12  ? 23.764  4.138   -1.149  1.00 0.00 ? 12  LEU A HA   6  
ATOM 8915  H HB2  . LEU A 1 12  ? 25.238  5.995   -2.952  1.00 0.00 ? 12  LEU A HB2  6  
ATOM 8916  H HB3  . LEU A 1 12  ? 24.678  6.596   -1.393  1.00 0.00 ? 12  LEU A HB3  6  
ATOM 8917  H HG   . LEU A 1 12  ? 26.374  4.126   -1.613  1.00 0.00 ? 12  LEU A HG   6  
ATOM 8918  H HD11 . LEU A 1 12  ? 27.780  5.658   -2.649  1.00 0.00 ? 12  LEU A HD11 6  
ATOM 8919  H HD12 . LEU A 1 12  ? 28.246  5.764   -0.952  1.00 0.00 ? 12  LEU A HD12 6  
ATOM 8920  H HD13 . LEU A 1 12  ? 27.209  7.002   -1.661  1.00 0.00 ? 12  LEU A HD13 6  
ATOM 8921  H HD21 . LEU A 1 12  ? 25.873  6.118   0.596   1.00 0.00 ? 12  LEU A HD21 6  
ATOM 8922  H HD22 . LEU A 1 12  ? 26.958  4.731   0.692   1.00 0.00 ? 12  LEU A HD22 6  
ATOM 8923  H HD23 . LEU A 1 12  ? 25.223  4.481   0.496   1.00 0.00 ? 12  LEU A HD23 6  
ATOM 8924  N N    . GLU A 1 13  ? 22.202  6.246   -3.152  1.00 0.00 ? 13  GLU A N    6  
ATOM 8925  C CA   . GLU A 1 13  ? 21.001  7.061   -3.290  1.00 0.00 ? 13  GLU A CA   6  
ATOM 8926  C C    . GLU A 1 13  ? 20.090  6.507   -4.382  1.00 0.00 ? 13  GLU A C    6  
ATOM 8927  O O    . GLU A 1 13  ? 20.130  6.958   -5.526  1.00 0.00 ? 13  GLU A O    6  
ATOM 8928  C CB   . GLU A 1 13  ? 21.374  8.510   -3.608  1.00 0.00 ? 13  GLU A CB   6  
ATOM 8929  C CG   . GLU A 1 13  ? 20.294  9.512   -3.237  1.00 0.00 ? 13  GLU A CG   6  
ATOM 8930  C CD   . GLU A 1 13  ? 18.968  9.219   -3.912  1.00 0.00 ? 13  GLU A CD   6  
ATOM 8931  O OE1  . GLU A 1 13  ? 18.188  8.413   -3.363  1.00 0.00 ? 13  GLU A OE1  6  
ATOM 8932  O OE2  . GLU A 1 13  ? 18.711  9.796   -4.989  1.00 0.00 ? 13  GLU A OE2  6  
ATOM 8933  H H    . GLU A 1 13  ? 22.822  6.177   -3.908  1.00 0.00 ? 13  GLU A H    6  
ATOM 8934  H HA   . GLU A 1 13  ? 20.472  7.033   -2.349  1.00 0.00 ? 13  GLU A HA   6  
ATOM 8935  H HB2  . GLU A 1 13  ? 22.274  8.765   -3.068  1.00 0.00 ? 13  GLU A HB2  6  
ATOM 8936  H HB3  . GLU A 1 13  ? 21.565  8.595   -4.668  1.00 0.00 ? 13  GLU A HB3  6  
ATOM 8937  H HG2  . GLU A 1 13  ? 20.149  9.486   -2.167  1.00 0.00 ? 13  GLU A HG2  6  
ATOM 8938  H HG3  . GLU A 1 13  ? 20.620  10.499  -3.531  1.00 0.00 ? 13  GLU A HG3  6  
ATOM 8939  N N    . ASN A 1 14  ? 19.271  5.526   -4.020  1.00 0.00 ? 14  ASN A N    6  
ATOM 8940  C CA   . ASN A 1 14  ? 18.351  4.909   -4.969  1.00 0.00 ? 14  ASN A CA   6  
ATOM 8941  C C    . ASN A 1 14  ? 16.901  5.166   -4.567  1.00 0.00 ? 14  ASN A C    6  
ATOM 8942  O O    . ASN A 1 14  ? 16.085  5.588   -5.386  1.00 0.00 ? 14  ASN A O    6  
ATOM 8943  C CB   . ASN A 1 14  ? 18.608  3.403   -5.055  1.00 0.00 ? 14  ASN A CB   6  
ATOM 8944  C CG   . ASN A 1 14  ? 19.672  3.056   -6.078  1.00 0.00 ? 14  ASN A CG   6  
ATOM 8945  O OD1  . ASN A 1 14  ? 20.159  3.924   -6.802  1.00 0.00 ? 14  ASN A OD1  6  
ATOM 8946  N ND2  . ASN A 1 14  ? 20.036  1.781   -6.143  1.00 0.00 ? 14  ASN A ND2  6  
ATOM 8947  H H    . ASN A 1 14  ? 19.285  5.208   -3.093  1.00 0.00 ? 14  ASN A H    6  
ATOM 8948  H HA   . ASN A 1 14  ? 18.527  5.351   -5.937  1.00 0.00 ? 14  ASN A HA   6  
ATOM 8949  H HB2  . ASN A 1 14  ? 18.934  3.044   -4.089  1.00 0.00 ? 14  ASN A HB2  6  
ATOM 8950  H HB3  . ASN A 1 14  ? 17.692  2.902   -5.330  1.00 0.00 ? 14  ASN A HB3  6  
ATOM 8951  H HD21 . ASN A 1 14  ? 19.605  1.144   -5.536  1.00 0.00 ? 14  ASN A HD21 6  
ATOM 8952  H HD22 . ASN A 1 14  ? 20.723  1.529   -6.796  1.00 0.00 ? 14  ASN A HD22 6  
ATOM 8953  N N    . ILE A 1 15  ? 16.590  4.909   -3.301  1.00 0.00 ? 15  ILE A N    6  
ATOM 8954  C CA   . ILE A 1 15  ? 15.240  5.114   -2.790  1.00 0.00 ? 15  ILE A CA   6  
ATOM 8955  C C    . ILE A 1 15  ? 14.776  6.548   -3.023  1.00 0.00 ? 15  ILE A C    6  
ATOM 8956  O O    . ILE A 1 15  ? 15.546  7.494   -2.856  1.00 0.00 ? 15  ILE A O    6  
ATOM 8957  C CB   . ILE A 1 15  ? 15.153  4.797   -1.286  1.00 0.00 ? 15  ILE A CB   6  
ATOM 8958  C CG1  . ILE A 1 15  ? 15.332  3.296   -1.048  1.00 0.00 ? 15  ILE A CG1  6  
ATOM 8959  C CG2  . ILE A 1 15  ? 13.823  5.273   -0.720  1.00 0.00 ? 15  ILE A CG2  6  
ATOM 8960  C CD1  . ILE A 1 15  ? 15.022  2.868   0.369   1.00 0.00 ? 15  ILE A CD1  6  
ATOM 8961  H H    . ILE A 1 15  ? 17.284  4.574   -2.696  1.00 0.00 ? 15  ILE A H    6  
ATOM 8962  H HA   . ILE A 1 15  ? 14.578  4.443   -3.318  1.00 0.00 ? 15  ILE A HA   6  
ATOM 8963  H HB   . ILE A 1 15  ? 15.943  5.331   -0.781  1.00 0.00 ? 15  ILE A HB   6  
ATOM 8964  H HG12 . ILE A 1 15  ? 14.676  2.752   -1.709  1.00 0.00 ? 15  ILE A HG12 6  
ATOM 8965  H HG13 . ILE A 1 15  ? 16.357  3.026   -1.261  1.00 0.00 ? 15  ILE A HG13 6  
ATOM 8966  H HG21 . ILE A 1 15  ? 13.023  4.968   -1.378  1.00 0.00 ? 15  ILE A HG21 6  
ATOM 8967  H HG22 . ILE A 1 15  ? 13.671  4.838   0.256   1.00 0.00 ? 15  ILE A HG22 6  
ATOM 8968  H HG23 . ILE A 1 15  ? 13.832  6.349   -0.638  1.00 0.00 ? 15  ILE A HG23 6  
ATOM 8969  H HD11 . ILE A 1 15  ? 15.480  3.559   1.062   1.00 0.00 ? 15  ILE A HD11 6  
ATOM 8970  H HD12 . ILE A 1 15  ? 13.953  2.865   0.519   1.00 0.00 ? 15  ILE A HD12 6  
ATOM 8971  H HD13 . ILE A 1 15  ? 15.413  1.876   0.540   1.00 0.00 ? 15  ILE A HD13 6  
ATOM 8972  N N    . GLN A 1 16  ? 13.513  6.701   -3.408  1.00 0.00 ? 16  GLN A N    6  
ATOM 8973  C CA   . GLN A 1 16  ? 12.947  8.020   -3.663  1.00 0.00 ? 16  GLN A CA   6  
ATOM 8974  C C    . GLN A 1 16  ? 11.609  8.185   -2.950  1.00 0.00 ? 16  GLN A C    6  
ATOM 8975  O O    . GLN A 1 16  ? 10.604  8.536   -3.568  1.00 0.00 ? 16  GLN A O    6  
ATOM 8976  C CB   . GLN A 1 16  ? 12.767  8.239   -5.166  1.00 0.00 ? 16  GLN A CB   6  
ATOM 8977  C CG   . GLN A 1 16  ? 12.381  6.979   -5.923  1.00 0.00 ? 16  GLN A CG   6  
ATOM 8978  C CD   . GLN A 1 16  ? 11.197  6.265   -5.302  1.00 0.00 ? 16  GLN A CD   6  
ATOM 8979  O OE1  . GLN A 1 16  ? 11.362  5.350   -4.495  1.00 0.00 ? 16  GLN A OE1  6  
ATOM 8980  N NE2  . GLN A 1 16  ? 9.992   6.680   -5.677  1.00 0.00 ? 16  GLN A NE2  6  
ATOM 8981  H H    . GLN A 1 16  ? 12.950  5.908   -3.524  1.00 0.00 ? 16  GLN A H    6  
ATOM 8982  H HA   . GLN A 1 16  ? 13.638  8.756   -3.282  1.00 0.00 ? 16  GLN A HA   6  
ATOM 8983  H HB2  . GLN A 1 16  ? 11.994  8.977   -5.321  1.00 0.00 ? 16  GLN A HB2  6  
ATOM 8984  H HB3  . GLN A 1 16  ? 13.694  8.610   -5.577  1.00 0.00 ? 16  GLN A HB3  6  
ATOM 8985  H HG2  . GLN A 1 16  ? 12.128  7.247   -6.938  1.00 0.00 ? 16  GLN A HG2  6  
ATOM 8986  H HG3  . GLN A 1 16  ? 13.226  6.306   -5.930  1.00 0.00 ? 16  GLN A HG3  6  
ATOM 8987  H HE21 . GLN A 1 16  ? 9.937   7.413   -6.325  1.00 0.00 ? 16  GLN A HE21 6  
ATOM 8988  H HE22 . GLN A 1 16  ? 9.209   6.236   -5.292  1.00 0.00 ? 16  GLN A HE22 6  
ATOM 8989  N N    . ILE A 1 17  ? 11.604  7.930   -1.646  1.00 0.00 ? 17  ILE A N    6  
ATOM 8990  C CA   . ILE A 1 17  ? 10.390  8.051   -0.848  1.00 0.00 ? 17  ILE A CA   6  
ATOM 8991  C C    . ILE A 1 17  ? 10.397  9.337   -0.029  1.00 0.00 ? 17  ILE A C    6  
ATOM 8992  O O    . ILE A 1 17  ? 11.410  9.726   0.553   1.00 0.00 ? 17  ILE A O    6  
ATOM 8993  C CB   . ILE A 1 17  ? 10.218  6.851   0.101   1.00 0.00 ? 17  ILE A CB   6  
ATOM 8994  C CG1  . ILE A 1 17  ? 10.189  5.544   -0.694  1.00 0.00 ? 17  ILE A CG1  6  
ATOM 8995  C CG2  . ILE A 1 17  ? 8.948   7.005   0.925   1.00 0.00 ? 17  ILE A CG2  6  
ATOM 8996  C CD1  . ILE A 1 17  ? 10.270  4.307   0.174   1.00 0.00 ? 17  ILE A CD1  6  
ATOM 8997  H H    . ILE A 1 17  ? 12.437  7.654   -1.210  1.00 0.00 ? 17  ILE A H    6  
ATOM 8998  H HA   . ILE A 1 17  ? 9.548   8.073   -1.525  1.00 0.00 ? 17  ILE A HA   6  
ATOM 8999  H HB   . ILE A 1 17  ? 11.058  6.833   0.779   1.00 0.00 ? 17  ILE A HB   6  
ATOM 9000  H HG12 . ILE A 1 17  ? 9.271   5.493   -1.257  1.00 0.00 ? 17  ILE A HG12 6  
ATOM 9001  H HG13 . ILE A 1 17  ? 11.027  5.527   -1.376  1.00 0.00 ? 17  ILE A HG13 6  
ATOM 9002  H HG21 . ILE A 1 17  ? 8.815   8.044   1.189   1.00 0.00 ? 17  ILE A HG21 6  
ATOM 9003  H HG22 . ILE A 1 17  ? 8.101   6.671   0.345   1.00 0.00 ? 17  ILE A HG22 6  
ATOM 9004  H HG23 . ILE A 1 17  ? 9.027   6.412   1.823   1.00 0.00 ? 17  ILE A HG23 6  
ATOM 9005  H HD11 . ILE A 1 17  ? 10.828  3.540   -0.345  1.00 0.00 ? 17  ILE A HD11 6  
ATOM 9006  H HD12 . ILE A 1 17  ? 10.770  4.549   1.100   1.00 0.00 ? 17  ILE A HD12 6  
ATOM 9007  H HD13 . ILE A 1 17  ? 9.274   3.948   0.384   1.00 0.00 ? 17  ILE A HD13 6  
ATOM 9008  N N    . PRO A 1 18  ? 9.240   10.013  0.022   1.00 0.00 ? 18  PRO A N    6  
ATOM 9009  C CA   . PRO A 1 18  ? 9.085   11.264  0.770   1.00 0.00 ? 18  PRO A CA   6  
ATOM 9010  C C    . PRO A 1 18  ? 9.138   11.048  2.278   1.00 0.00 ? 18  PRO A C    6  
ATOM 9011  O O    . PRO A 1 18  ? 9.560   9.991   2.749   1.00 0.00 ? 18  PRO A O    6  
ATOM 9012  C CB   . PRO A 1 18  ? 7.700   11.760  0.348   1.00 0.00 ? 18  PRO A CB   6  
ATOM 9013  C CG   . PRO A 1 18  ? 6.963   10.530  -0.056  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9014  C CD   . PRO A 1 18  ? 7.992   9.607   -0.647  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9015  H HA   . PRO A 1 18  ? 9.832   11.991  0.485   1.00 0.00 ? 18  PRO A HA   6  
ATOM 9016  H HB2  . PRO A 1 18  ? 7.221   12.252  1.184   1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9017  H HB3  . PRO A 1 18  ? 7.796   12.451  -0.476  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9018  H HG2  . PRO A 1 18  ? 6.505   10.076  0.810   1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9019  H HG3  . PRO A 1 18  ? 6.214   10.777  -0.793  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9020  H HD2  . PRO A 1 18  ? 7.751   8.579   -0.422  1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9021  H HD3  . PRO A 1 18  ? 8.062   9.755   -1.715  1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9022  N N    . ASP A 1 19  ? 8.706   12.054  3.031   1.00 0.00 ? 19  ASP A N    6  
ATOM 9023  C CA   . ASP A 1 19  ? 8.702   11.973  4.487   1.00 0.00 ? 19  ASP A CA   6  
ATOM 9024  C C    . ASP A 1 19  ? 7.376   11.418  4.997   1.00 0.00 ? 19  ASP A C    6  
ATOM 9025  O O    . ASP A 1 19  ? 7.310   10.834  6.078   1.00 0.00 ? 19  ASP A O    6  
ATOM 9026  C CB   . ASP A 1 19  ? 8.960   13.351  5.096   1.00 0.00 ? 19  ASP A CB   6  
ATOM 9027  C CG   . ASP A 1 19  ? 10.438  13.685  5.168   1.00 0.00 ? 19  ASP A CG   6  
ATOM 9028  O OD1  . ASP A 1 19  ? 11.047  13.910  4.102   1.00 0.00 ? 19  ASP A OD1  6  
ATOM 9029  O OD2  . ASP A 1 19  ? 10.984  13.720  6.291   1.00 0.00 ? 19  ASP A OD2  6  
ATOM 9030  H H    . ASP A 1 19  ? 8.381   12.870  2.596   1.00 0.00 ? 19  ASP A H    6  
ATOM 9031  H HA   . ASP A 1 19  ? 9.495   11.304  4.784   1.00 0.00 ? 19  ASP A HA   6  
ATOM 9032  H HB2  . ASP A 1 19  ? 8.470   14.102  4.493   1.00 0.00 ? 19  ASP A HB2  6  
ATOM 9033  H HB3  . ASP A 1 19  ? 8.554   13.377  6.096   1.00 0.00 ? 19  ASP A HB3  6  
ATOM 9034  N N    . ALA A 1 20  ? 6.320   11.605  4.211   1.00 0.00 ? 20  ALA A N    6  
ATOM 9035  C CA   . ALA A 1 20  ? 4.996   11.123  4.582   1.00 0.00 ? 20  ALA A CA   6  
ATOM 9036  C C    . ALA A 1 20  ? 4.336   10.384  3.423   1.00 0.00 ? 20  ALA A C    6  
ATOM 9037  O O    . ALA A 1 20  ? 4.629   10.628  2.253   1.00 0.00 ? 20  ALA A O    6  
ATOM 9038  C CB   . ALA A 1 20  ? 4.122   12.281  5.039   1.00 0.00 ? 20  ALA A CB   6  
ATOM 9039  H H    . ALA A 1 20  ? 6.436   12.078  3.360   1.00 0.00 ? 20  ALA A H    6  
ATOM 9040  H HA   . ALA A 1 20  ? 5.110   10.441  5.413   1.00 0.00 ? 20  ALA A HA   6  
ATOM 9041  H HB1  . ALA A 1 20  ? 4.476   13.198  4.590   1.00 0.00 ? 20  ALA A HB1  6  
ATOM 9042  H HB2  . ALA A 1 20  ? 3.101   12.102  4.736   1.00 0.00 ? 20  ALA A HB2  6  
ATOM 9043  H HB3  . ALA A 1 20  ? 4.169   12.365  6.115   1.00 0.00 ? 20  ALA A HB3  6  
ATOM 9044  N N    . PRO A 1 21  ? 3.423   9.458   3.754   1.00 0.00 ? 21  PRO A N    6  
ATOM 9045  C CA   . PRO A 1 21  ? 2.703   8.665   2.754   1.00 0.00 ? 21  PRO A CA   6  
ATOM 9046  C C    . PRO A 1 21  ? 1.708   9.502   1.956   1.00 0.00 ? 21  PRO A C    6  
ATOM 9047  O O    . PRO A 1 21  ? 1.094   10.437  2.471   1.00 0.00 ? 21  PRO A O    6  
ATOM 9048  C CB   . PRO A 1 21  ? 1.967   7.618   3.594   1.00 0.00 ? 21  PRO A CB   6  
ATOM 9049  C CG   . PRO A 1 21  ? 1.810   8.250   4.934   1.00 0.00 ? 21  PRO A CG   6  
ATOM 9050  C CD   . PRO A 1 21  ? 3.024   9.115   5.129   1.00 0.00 ? 21  PRO A CD   6  
ATOM 9051  H HA   . PRO A 1 21  ? 3.382   8.171   2.074   1.00 0.00 ? 21  PRO A HA   6  
ATOM 9052  H HB2  . PRO A 1 21  ? 1.009   7.399   3.144   1.00 0.00 ? 21  PRO A HB2  6  
ATOM 9053  H HB3  . PRO A 1 21  ? 2.559   6.716   3.651   1.00 0.00 ? 21  PRO A HB3  6  
ATOM 9054  H HG2  . PRO A 1 21  ? 0.914   8.852   4.953   1.00 0.00 ? 21  PRO A HG2  6  
ATOM 9055  H HG3  . PRO A 1 21  ? 1.767   7.487   5.697   1.00 0.00 ? 21  PRO A HG3  6  
ATOM 9056  H HD2  . PRO A 1 21  ? 2.769   10.002  5.689   1.00 0.00 ? 21  PRO A HD2  6  
ATOM 9057  H HD3  . PRO A 1 21  ? 3.805   8.562   5.630   1.00 0.00 ? 21  PRO A HD3  6  
ATOM 9058  N N    . PRO A 1 22  ? 1.544   9.160   0.670   1.00 0.00 ? 22  PRO A N    6  
ATOM 9059  C CA   . PRO A 1 22  ? 0.623   9.868   -0.226  1.00 0.00 ? 22  PRO A CA   6  
ATOM 9060  C C    . PRO A 1 22  ? -0.838  9.617   0.129   1.00 0.00 ? 22  PRO A C    6  
ATOM 9061  O O    . PRO A 1 22  ? -1.192  8.597   0.721   1.00 0.00 ? 22  PRO A O    6  
ATOM 9062  C CB   . PRO A 1 22  ? 0.947   9.282   -1.602  1.00 0.00 ? 22  PRO A CB   6  
ATOM 9063  C CG   . PRO A 1 22  ? 1.509   7.932   -1.317  1.00 0.00 ? 22  PRO A CG   6  
ATOM 9064  C CD   . PRO A 1 22  ? 2.243   8.057   -0.010  1.00 0.00 ? 22  PRO A CD   6  
ATOM 9065  H HA   . PRO A 1 22  ? 0.814   10.931  -0.231  1.00 0.00 ? 22  PRO A HA   6  
ATOM 9066  H HB2  . PRO A 1 22  ? 0.043   9.218   -2.191  1.00 0.00 ? 22  PRO A HB2  6  
ATOM 9067  H HB3  . PRO A 1 22  ? 1.667   9.911   -2.105  1.00 0.00 ? 22  PRO A HB3  6  
ATOM 9068  H HG2  . PRO A 1 22  ? 0.710   7.212   -1.231  1.00 0.00 ? 22  PRO A HG2  6  
ATOM 9069  H HG3  . PRO A 1 22  ? 2.192   7.645   -2.103  1.00 0.00 ? 22  PRO A HG3  6  
ATOM 9070  H HD2  . PRO A 1 22  ? 2.162   7.142   0.557   1.00 0.00 ? 22  PRO A HD2  6  
ATOM 9071  H HD3  . PRO A 1 22  ? 3.280   8.306   -0.181  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 9072  N N    . PRO A 1 23  ? -1.709  10.568  -0.239  1.00 0.00 ? 23  PRO A N    6  
ATOM 9073  C CA   . PRO A 1 23  ? -3.147  10.472  0.030   1.00 0.00 ? 23  PRO A CA   6  
ATOM 9074  C C    . PRO A 1 23  ? -3.822  9.392   -0.808  1.00 0.00 ? 23  PRO A C    6  
ATOM 9075  O O    . PRO A 1 23  ? -3.917  9.510   -2.030  1.00 0.00 ? 23  PRO A O    6  
ATOM 9076  C CB   . PRO A 1 23  ? -3.673  11.857  -0.357  1.00 0.00 ? 23  PRO A CB   6  
ATOM 9077  C CG   . PRO A 1 23  ? -2.692  12.370  -1.354  1.00 0.00 ? 23  PRO A CG   6  
ATOM 9078  C CD   . PRO A 1 23  ? -1.357  11.811  -0.946  1.00 0.00 ? 23  PRO A CD   6  
ATOM 9079  H HA   . PRO A 1 23  ? -3.344  10.290  1.077   1.00 0.00 ? 23  PRO A HA   6  
ATOM 9080  H HB2  . PRO A 1 23  ? -4.661  11.762  -0.786  1.00 0.00 ? 23  PRO A HB2  6  
ATOM 9081  H HB3  . PRO A 1 23  ? -3.714  12.488  0.518   1.00 0.00 ? 23  PRO A HB3  6  
ATOM 9082  H HG2  . PRO A 1 23  ? -2.958  12.025  -2.341  1.00 0.00 ? 23  PRO A HG2  6  
ATOM 9083  H HG3  . PRO A 1 23  ? -2.671  13.449  -1.324  1.00 0.00 ? 23  PRO A HG3  6  
ATOM 9084  H HD2  . PRO A 1 23  ? -0.754  11.601  -1.817  1.00 0.00 ? 23  PRO A HD2  6  
ATOM 9085  H HD3  . PRO A 1 23  ? -0.846  12.497  -0.288  1.00 0.00 ? 23  PRO A HD3  6  
ATOM 9086  N N    . ILE A 1 24  ? -4.290  8.341   -0.143  1.00 0.00 ? 24  ILE A N    6  
ATOM 9087  C CA   . ILE A 1 24  ? -4.958  7.241   -0.828  1.00 0.00 ? 24  ILE A CA   6  
ATOM 9088  C C    . ILE A 1 24  ? -6.132  7.744   -1.661  1.00 0.00 ? 24  ILE A C    6  
ATOM 9089  O O    . ILE A 1 24  ? -6.903  8.605   -1.237  1.00 0.00 ? 24  ILE A O    6  
ATOM 9090  C CB   . ILE A 1 24  ? -5.467  6.183   0.169   1.00 0.00 ? 24  ILE A CB   6  
ATOM 9091  C CG1  . ILE A 1 24  ? -4.304  5.622   0.989   1.00 0.00 ? 24  ILE A CG1  6  
ATOM 9092  C CG2  . ILE A 1 24  ? -6.191  5.066   -0.567  1.00 0.00 ? 24  ILE A CG2  6  
ATOM 9093  C CD1  . ILE A 1 24  ? -4.741  4.897   2.242   1.00 0.00 ? 24  ILE A CD1  6  
ATOM 9094  H H    . ILE A 1 24  ? -4.184  8.304   0.830   1.00 0.00 ? 24  ILE A H    6  
ATOM 9095  H HA   . ILE A 1 24  ? -4.240  6.772   -1.484  1.00 0.00 ? 24  ILE A HA   6  
ATOM 9096  H HB   . ILE A 1 24  ? -6.171  6.658   0.835   1.00 0.00 ? 24  ILE A HB   6  
ATOM 9097  H HG12 . ILE A 1 24  ? -3.746  4.927   0.382   1.00 0.00 ? 24  ILE A HG12 6  
ATOM 9098  H HG13 . ILE A 1 24  ? -3.656  6.435   1.284   1.00 0.00 ? 24  ILE A HG13 6  
ATOM 9099  H HG21 . ILE A 1 24  ? -6.810  4.518   0.129   1.00 0.00 ? 24  ILE A HG21 6  
ATOM 9100  H HG22 . ILE A 1 24  ? -6.811  5.489   -1.343  1.00 0.00 ? 24  ILE A HG22 6  
ATOM 9101  H HG23 . ILE A 1 24  ? -5.467  4.397   -1.008  1.00 0.00 ? 24  ILE A HG23 6  
ATOM 9102  H HD11 . ILE A 1 24  ? -4.110  4.034   2.398   1.00 0.00 ? 24  ILE A HD11 6  
ATOM 9103  H HD12 . ILE A 1 24  ? -4.658  5.560   3.091   1.00 0.00 ? 24  ILE A HD12 6  
ATOM 9104  H HD13 . ILE A 1 24  ? -5.767  4.577   2.134   1.00 0.00 ? 24  ILE A HD13 6  
ATOM 9105  N N    . PRO A 1 25  ? -6.274  7.194   -2.876  1.00 0.00 ? 25  PRO A N    6  
ATOM 9106  C CA   . PRO A 1 25  ? -7.353  7.570   -3.794  1.00 0.00 ? 25  PRO A CA   6  
ATOM 9107  C C    . PRO A 1 25  ? -8.718  7.092   -3.311  1.00 0.00 ? 25  PRO A C    6  
ATOM 9108  O O    . PRO A 1 25  ? -8.835  6.496   -2.240  1.00 0.00 ? 25  PRO A O    6  
ATOM 9109  C CB   . PRO A 1 25  ? -6.971  6.866   -5.099  1.00 0.00 ? 25  PRO A CB   6  
ATOM 9110  C CG   . PRO A 1 25  ? -6.135  5.708   -4.673  1.00 0.00 ? 25  PRO A CG   6  
ATOM 9111  C CD   . PRO A 1 25  ? -5.392  6.163   -3.448  1.00 0.00 ? 25  PRO A CD   6  
ATOM 9112  H HA   . PRO A 1 25  ? -7.383  8.638   -3.955  1.00 0.00 ? 25  PRO A HA   6  
ATOM 9113  H HB2  . PRO A 1 25  ? -7.865  6.541   -5.611  1.00 0.00 ? 25  PRO A HB2  6  
ATOM 9114  H HB3  . PRO A 1 25  ? -6.415  7.544   -5.729  1.00 0.00 ? 25  PRO A HB3  6  
ATOM 9115  H HG2  . PRO A 1 25  ? -6.767  4.866   -4.438  1.00 0.00 ? 25  PRO A HG2  6  
ATOM 9116  H HG3  . PRO A 1 25  ? -5.439  5.450   -5.458  1.00 0.00 ? 25  PRO A HG3  6  
ATOM 9117  H HD2  . PRO A 1 25  ? -5.262  5.341   -2.759  1.00 0.00 ? 25  PRO A HD2  6  
ATOM 9118  H HD3  . PRO A 1 25  ? -4.435  6.583   -3.720  1.00 0.00 ? 25  PRO A HD3  6  
ATOM 9119  N N    . LYS A 1 26  ? -9.748  7.356   -4.108  1.00 0.00 ? 26  LYS A N    6  
ATOM 9120  C CA   . LYS A 1 26  ? -11.106 6.951   -3.763  1.00 0.00 ? 26  LYS A CA   6  
ATOM 9121  C C    . LYS A 1 26  ? -11.335 5.480   -4.092  1.00 0.00 ? 26  LYS A C    6  
ATOM 9122  O O    . LYS A 1 26  ? -10.835 4.975   -5.096  1.00 0.00 ? 26  LYS A O    6  
ATOM 9123  C CB   . LYS A 1 26  ? -12.123 7.817   -4.510  1.00 0.00 ? 26  LYS A CB   6  
ATOM 9124  C CG   . LYS A 1 26  ? -12.130 7.588   -6.011  1.00 0.00 ? 26  LYS A CG   6  
ATOM 9125  C CD   . LYS A 1 26  ? -13.115 6.499   -6.405  1.00 0.00 ? 26  LYS A CD   6  
ATOM 9126  C CE   . LYS A 1 26  ? -14.546 7.013   -6.398  1.00 0.00 ? 26  LYS A CE   6  
ATOM 9127  N NZ   . LYS A 1 26  ? -14.903 7.680   -7.681  1.00 0.00 ? 26  LYS A NZ   6  
ATOM 9128  H H    . LYS A 1 26  ? -9.591  7.835   -4.949  1.00 0.00 ? 26  LYS A H    6  
ATOM 9129  H HA   . LYS A 1 26  ? -11.235 7.095   -2.701  1.00 0.00 ? 26  LYS A HA   6  
ATOM 9130  H HB2  . LYS A 1 26  ? -13.111 7.600   -4.129  1.00 0.00 ? 26  LYS A HB2  6  
ATOM 9131  H HB3  . LYS A 1 26  ? -11.896 8.857   -4.326  1.00 0.00 ? 26  LYS A HB3  6  
ATOM 9132  H HG2  . LYS A 1 26  ? -12.410 8.507   -6.505  1.00 0.00 ? 26  LYS A HG2  6  
ATOM 9133  H HG3  . LYS A 1 26  ? -11.139 7.295   -6.326  1.00 0.00 ? 26  LYS A HG3  6  
ATOM 9134  H HD2  . LYS A 1 26  ? -12.874 6.151   -7.399  1.00 0.00 ? 26  LYS A HD2  6  
ATOM 9135  H HD3  . LYS A 1 26  ? -13.031 5.681   -5.704  1.00 0.00 ? 26  LYS A HD3  6  
ATOM 9136  H HE2  . LYS A 1 26  ? -15.213 6.180   -6.238  1.00 0.00 ? 26  LYS A HE2  6  
ATOM 9137  H HE3  . LYS A 1 26  ? -14.656 7.722   -5.591  1.00 0.00 ? 26  LYS A HE3  6  
ATOM 9138  H HZ1  . LYS A 1 26  ? -14.085 8.206   -8.050  1.00 0.00 ? 26  LYS A HZ1  6  
ATOM 9139  H HZ2  . LYS A 1 26  ? -15.690 8.344   -7.532  1.00 0.00 ? 26  LYS A HZ2  6  
ATOM 9140  H HZ3  . LYS A 1 26  ? -15.191 6.970   -8.384  1.00 0.00 ? 26  LYS A HZ3  6  
ATOM 9141  N N    . GLU A 1 27  ? -12.095 4.799   -3.240  1.00 0.00 ? 27  GLU A N    6  
ATOM 9142  C CA   . GLU A 1 27  ? -12.391 3.385   -3.443  1.00 0.00 ? 27  GLU A CA   6  
ATOM 9143  C C    . GLU A 1 27  ? -13.267 3.184   -4.675  1.00 0.00 ? 27  GLU A C    6  
ATOM 9144  O O    . GLU A 1 27  ? -14.179 3.963   -4.954  1.00 0.00 ? 27  GLU A O    6  
ATOM 9145  C CB   . GLU A 1 27  ? -13.085 2.805   -2.209  1.00 0.00 ? 27  GLU A CB   6  
ATOM 9146  C CG   . GLU A 1 27  ? -12.132 2.476   -1.072  1.00 0.00 ? 27  GLU A CG   6  
ATOM 9147  C CD   . GLU A 1 27  ? -12.856 2.116   0.211   1.00 0.00 ? 27  GLU A CD   6  
ATOM 9148  O OE1  . GLU A 1 27  ? -14.007 1.639   0.129   1.00 0.00 ? 27  GLU A OE1  6  
ATOM 9149  O OE2  . GLU A 1 27  ? -12.270 2.312   1.296   1.00 0.00 ? 27  GLU A OE2  6  
ATOM 9150  H H    . GLU A 1 27  ? -12.466 5.257   -2.457  1.00 0.00 ? 27  GLU A H    6  
ATOM 9151  H HA   . GLU A 1 27  ? -11.455 2.869   -3.593  1.00 0.00 ? 27  GLU A HA   6  
ATOM 9152  H HB2  . GLU A 1 27  ? -13.810 3.520   -1.848  1.00 0.00 ? 27  GLU A HB2  6  
ATOM 9153  H HB3  . GLU A 1 27  ? -13.599 1.898   -2.494  1.00 0.00 ? 27  GLU A HB3  6  
ATOM 9154  H HG2  . GLU A 1 27  ? -11.516 1.639   -1.366  1.00 0.00 ? 27  GLU A HG2  6  
ATOM 9155  H HG3  . GLU A 1 27  ? -11.505 3.335   -0.886  1.00 0.00 ? 27  GLU A HG3  6  
ATOM 9156  N N    . PRO A 1 28  ? -12.986 2.113   -5.432  1.00 0.00 ? 28  PRO A N    6  
ATOM 9157  C CA   . PRO A 1 28  ? -13.737 1.783   -6.648  1.00 0.00 ? 28  PRO A CA   6  
ATOM 9158  C C    . PRO A 1 28  ? -15.156 1.317   -6.343  1.00 0.00 ? 28  PRO A C    6  
ATOM 9159  O O    . PRO A 1 28  ? -15.437 0.822   -5.252  1.00 0.00 ? 28  PRO A O    6  
ATOM 9160  C CB   . PRO A 1 28  ? -12.922 0.646   -7.270  1.00 0.00 ? 28  PRO A CB   6  
ATOM 9161  C CG   . PRO A 1 28  ? -12.203 0.024   -6.124  1.00 0.00 ? 28  PRO A CG   6  
ATOM 9162  C CD   . PRO A 1 28  ? -11.913 1.142   -5.160  1.00 0.00 ? 28  PRO A CD   6  
ATOM 9163  H HA   . PRO A 1 28  ? -13.772 2.619   -7.331  1.00 0.00 ? 28  PRO A HA   6  
ATOM 9164  H HB2  . PRO A 1 28  ? -13.589 -0.057  -7.748  1.00 0.00 ? 28  PRO A HB2  6  
ATOM 9165  H HB3  . PRO A 1 28  ? -12.233 1.049   -7.997  1.00 0.00 ? 28  PRO A HB3  6  
ATOM 9166  H HG2  . PRO A 1 28  ? -12.830 -0.720  -5.657  1.00 0.00 ? 28  PRO A HG2  6  
ATOM 9167  H HG3  . PRO A 1 28  ? -11.282 -0.422  -6.467  1.00 0.00 ? 28  PRO A HG3  6  
ATOM 9168  H HD2  . PRO A 1 28  ? -11.965 0.785   -4.142  1.00 0.00 ? 28  PRO A HD2  6  
ATOM 9169  H HD3  . PRO A 1 28  ? -10.944 1.572   -5.362  1.00 0.00 ? 28  PRO A HD3  6  
ATOM 9170  N N    . SER A 1 29  ? -16.048 1.478   -7.316  1.00 0.00 ? 29  SER A N    6  
ATOM 9171  C CA   . SER A 1 29  ? -17.440 1.077   -7.150  1.00 0.00 ? 29  SER A CA   6  
ATOM 9172  C C    . SER A 1 29  ? -17.562 -0.442  -7.076  1.00 0.00 ? 29  SER A C    6  
ATOM 9173  O O    . SER A 1 29  ? -16.579 -1.163  -7.240  1.00 0.00 ? 29  SER A O    6  
ATOM 9174  C CB   . SER A 1 29  ? -18.288 1.612   -8.305  1.00 0.00 ? 29  SER A CB   6  
ATOM 9175  O OG   . SER A 1 29  ? -18.116 0.827   -9.472  1.00 0.00 ? 29  SER A OG   6  
ATOM 9176  H H    . SER A 1 29  ? -15.763 1.879   -8.164  1.00 0.00 ? 29  SER A H    6  
ATOM 9177  H HA   . SER A 1 29  ? -17.800 1.500   -6.224  1.00 0.00 ? 29  SER A HA   6  
ATOM 9178  H HB2  . SER A 1 29  ? -19.330 1.592   -8.023  1.00 0.00 ? 29  SER A HB2  6  
ATOM 9179  H HB3  . SER A 1 29  ? -17.994 2.629   -8.523  1.00 0.00 ? 29  SER A HB3  6  
ATOM 9180  H HG   . SER A 1 29  ? -18.864 0.956   -10.059 1.00 0.00 ? 29  SER A HG   6  
ATOM 9181  N N    . ASN A 1 30  ? -18.777 -0.921  -6.828  1.00 0.00 ? 30  ASN A N    6  
ATOM 9182  C CA   . ASN A 1 30  ? -19.030 -2.354  -6.732  1.00 0.00 ? 30  ASN A CA   6  
ATOM 9183  C C    . ASN A 1 30  ? -18.926 -3.018  -8.102  1.00 0.00 ? 30  ASN A C    6  
ATOM 9184  O O    . ASN A 1 30  ? -19.925 -3.176  -8.804  1.00 0.00 ? 30  ASN A O    6  
ATOM 9185  C CB   . ASN A 1 30  ? -20.414 -2.610  -6.132  1.00 0.00 ? 30  ASN A CB   6  
ATOM 9186  C CG   . ASN A 1 30  ? -20.467 -2.299  -4.649  1.00 0.00 ? 30  ASN A CG   6  
ATOM 9187  O OD1  . ASN A 1 30  ? -19.443 -2.021  -4.024  1.00 0.00 ? 30  ASN A OD1  6  
ATOM 9188  N ND2  . ASN A 1 30  ? -21.665 -2.346  -4.077  1.00 0.00 ? 30  ASN A ND2  6  
ATOM 9189  H H    . ASN A 1 30  ? -19.522 -0.295  -6.707  1.00 0.00 ? 30  ASN A H    6  
ATOM 9190  H HA   . ASN A 1 30  ? -18.281 -2.779  -6.081  1.00 0.00 ? 30  ASN A HA   6  
ATOM 9191  H HB2  . ASN A 1 30  ? -21.139 -1.988  -6.636  1.00 0.00 ? 30  ASN A HB2  6  
ATOM 9192  H HB3  . ASN A 1 30  ? -20.675 -3.648  -6.274  1.00 0.00 ? 30  ASN A HB3  6  
ATOM 9193  H HD21 . ASN A 1 30  ? -22.436 -2.575  -4.637  1.00 0.00 ? 30  ASN A HD21 6  
ATOM 9194  H HD22 . ASN A 1 30  ? -21.728 -2.149  -3.119  1.00 0.00 ? 30  ASN A HD22 6  
ATOM 9195  N N    . TYR A 1 31  ? -17.711 -3.405  -8.475  1.00 0.00 ? 31  TYR A N    6  
ATOM 9196  C CA   . TYR A 1 31  ? -17.476 -4.050  -9.761  1.00 0.00 ? 31  TYR A CA   6  
ATOM 9197  C C    . TYR A 1 31  ? -18.438 -5.217  -9.969  1.00 0.00 ? 31  TYR A C    6  
ATOM 9198  O O    . TYR A 1 31  ? -19.166 -5.606  -9.056  1.00 0.00 ? 31  TYR A O    6  
ATOM 9199  C CB   . TYR A 1 31  ? -16.031 -4.544  -9.851  1.00 0.00 ? 31  TYR A CB   6  
ATOM 9200  C CG   . TYR A 1 31  ? -15.024 -3.434  -10.049 1.00 0.00 ? 31  TYR A CG   6  
ATOM 9201  C CD1  . TYR A 1 31  ? -14.927 -2.766  -11.264 1.00 0.00 ? 31  TYR A CD1  6  
ATOM 9202  C CD2  . TYR A 1 31  ? -14.169 -3.053  -9.022  1.00 0.00 ? 31  TYR A CD2  6  
ATOM 9203  C CE1  . TYR A 1 31  ? -14.007 -1.752  -11.450 1.00 0.00 ? 31  TYR A CE1  6  
ATOM 9204  C CE2  . TYR A 1 31  ? -13.247 -2.039  -9.199  1.00 0.00 ? 31  TYR A CE2  6  
ATOM 9205  C CZ   . TYR A 1 31  ? -13.170 -1.392  -10.414 1.00 0.00 ? 31  TYR A CZ   6  
ATOM 9206  O OH   . TYR A 1 31  ? -12.253 -0.382  -10.595 1.00 0.00 ? 31  TYR A OH   6  
ATOM 9207  H H    . TYR A 1 31  ? -16.954 -3.252  -7.872  1.00 0.00 ? 31  TYR A H    6  
ATOM 9208  H HA   . TYR A 1 31  ? -17.645 -3.317  -10.536 1.00 0.00 ? 31  TYR A HA   6  
ATOM 9209  H HB2  . TYR A 1 31  ? -15.777 -5.062  -8.939  1.00 0.00 ? 31  TYR A HB2  6  
ATOM 9210  H HB3  . TYR A 1 31  ? -15.942 -5.225  -10.684 1.00 0.00 ? 31  TYR A HB3  6  
ATOM 9211  H HD1  . TYR A 1 31  ? -15.584 -3.050  -12.073 1.00 0.00 ? 31  TYR A HD1  6  
ATOM 9212  H HD2  . TYR A 1 31  ? -14.231 -3.563  -8.072  1.00 0.00 ? 31  TYR A HD2  6  
ATOM 9213  H HE1  . TYR A 1 31  ? -13.946 -1.244  -12.401 1.00 0.00 ? 31  TYR A HE1  6  
ATOM 9214  H HE2  . TYR A 1 31  ? -12.591 -1.758  -8.388  1.00 0.00 ? 31  TYR A HE2  6  
ATOM 9215  H HH   . TYR A 1 31  ? -12.589 0.245   -11.239 1.00 0.00 ? 31  TYR A HH   6  
ATOM 9216  N N    . ASP A 1 32  ? -18.433 -5.770  -11.177 1.00 0.00 ? 32  ASP A N    6  
ATOM 9217  C CA   . ASP A 1 32  ? -19.303 -6.893  -11.506 1.00 0.00 ? 32  ASP A CA   6  
ATOM 9218  C C    . ASP A 1 32  ? -19.013 -8.088  -10.603 1.00 0.00 ? 32  ASP A C    6  
ATOM 9219  O O    . ASP A 1 32  ? -19.886 -8.921  -10.359 1.00 0.00 ? 32  ASP A O    6  
ATOM 9220  C CB   . ASP A 1 32  ? -19.124 -7.291  -12.972 1.00 0.00 ? 32  ASP A CB   6  
ATOM 9221  C CG   . ASP A 1 32  ? -17.756 -7.881  -13.250 1.00 0.00 ? 32  ASP A CG   6  
ATOM 9222  O OD1  . ASP A 1 32  ? -16.795 -7.099  -13.410 1.00 0.00 ? 32  ASP A OD1  6  
ATOM 9223  O OD2  . ASP A 1 32  ? -17.645 -9.123  -13.308 1.00 0.00 ? 32  ASP A OD2  6  
ATOM 9224  H H    . ASP A 1 32  ? -17.830 -5.415  -11.863 1.00 0.00 ? 32  ASP A H    6  
ATOM 9225  H HA   . ASP A 1 32  ? -20.324 -6.579  -11.350 1.00 0.00 ? 32  ASP A HA   6  
ATOM 9226  H HB2  . ASP A 1 32  ? -19.872 -8.026  -13.233 1.00 0.00 ? 32  ASP A HB2  6  
ATOM 9227  H HB3  . ASP A 1 32  ? -19.253 -6.417  -13.594 1.00 0.00 ? 32  ASP A HB3  6  
ATOM 9228  N N    . PHE A 1 33  ? -17.781 -8.166  -10.111 1.00 0.00 ? 33  PHE A N    6  
ATOM 9229  C CA   . PHE A 1 33  ? -17.375 -9.260  -9.237  1.00 0.00 ? 33  PHE A CA   6  
ATOM 9230  C C    . PHE A 1 33  ? -17.459 -8.845  -7.771  1.00 0.00 ? 33  PHE A C    6  
ATOM 9231  O O    . PHE A 1 33  ? -16.617 -9.226  -6.958  1.00 0.00 ? 33  PHE A O    6  
ATOM 9232  C CB   . PHE A 1 33  ? -15.950 -9.707  -9.571  1.00 0.00 ? 33  PHE A CB   6  
ATOM 9233  C CG   . PHE A 1 33  ? -14.890 -8.872  -8.911  1.00 0.00 ? 33  PHE A CG   6  
ATOM 9234  C CD1  . PHE A 1 33  ? -14.580 -7.612  -9.395  1.00 0.00 ? 33  PHE A CD1  6  
ATOM 9235  C CD2  . PHE A 1 33  ? -14.203 -9.349  -7.806  1.00 0.00 ? 33  PHE A CD2  6  
ATOM 9236  C CE1  . PHE A 1 33  ? -13.605 -6.841  -8.789  1.00 0.00 ? 33  PHE A CE1  6  
ATOM 9237  C CE2  . PHE A 1 33  ? -13.228 -8.583  -7.196  1.00 0.00 ? 33  PHE A CE2  6  
ATOM 9238  C CZ   . PHE A 1 33  ? -12.928 -7.328  -7.689  1.00 0.00 ? 33  PHE A CZ   6  
ATOM 9239  H H    . PHE A 1 33  ? -17.129 -7.471  -10.342 1.00 0.00 ? 33  PHE A H    6  
ATOM 9240  H HA   . PHE A 1 33  ? -18.050 -10.085 -9.404  1.00 0.00 ? 33  PHE A HA   6  
ATOM 9241  H HB2  . PHE A 1 33  ? -15.815 -10.728 -9.250  1.00 0.00 ? 33  PHE A HB2  6  
ATOM 9242  H HB3  . PHE A 1 33  ? -15.803 -9.647  -10.639 1.00 0.00 ? 33  PHE A HB3  6  
ATOM 9243  H HD1  . PHE A 1 33  ? -15.110 -7.230  -10.257 1.00 0.00 ? 33  PHE A HD1  6  
ATOM 9244  H HD2  . PHE A 1 33  ? -14.436 -10.331 -7.420  1.00 0.00 ? 33  PHE A HD2  6  
ATOM 9245  H HE1  . PHE A 1 33  ? -13.373 -5.861  -9.178  1.00 0.00 ? 33  PHE A HE1  6  
ATOM 9246  H HE2  . PHE A 1 33  ? -12.699 -8.966  -6.336  1.00 0.00 ? 33  PHE A HE2  6  
ATOM 9247  H HZ   . PHE A 1 33  ? -12.166 -6.728  -7.214  1.00 0.00 ? 33  PHE A HZ   6  
ATOM 9248  N N    . SER A 1 34  ? -18.481 -8.062  -7.442  1.00 0.00 ? 34  SER A N    6  
ATOM 9249  C CA   . SER A 1 34  ? -18.674 -7.590  -6.075  1.00 0.00 ? 34  SER A CA   6  
ATOM 9250  C C    . SER A 1 34  ? -19.546 -8.560  -5.284  1.00 0.00 ? 34  SER A C    6  
ATOM 9251  O O    . SER A 1 34  ? -20.757 -8.377  -5.177  1.00 0.00 ? 34  SER A O    6  
ATOM 9252  C CB   . SER A 1 34  ? -19.311 -6.200  -6.078  1.00 0.00 ? 34  SER A CB   6  
ATOM 9253  O OG   . SER A 1 34  ? -20.499 -6.185  -6.851  1.00 0.00 ? 34  SER A OG   6  
ATOM 9254  H H    . SER A 1 34  ? -19.119 -7.792  -8.135  1.00 0.00 ? 34  SER A H    6  
ATOM 9255  H HA   . SER A 1 34  ? -17.703 -7.531  -5.605  1.00 0.00 ? 34  SER A HA   6  
ATOM 9256  H HB2  . SER A 1 34  ? -19.551 -5.914  -5.065  1.00 0.00 ? 34  SER A HB2  6  
ATOM 9257  H HB3  . SER A 1 34  ? -18.615 -5.488  -6.497  1.00 0.00 ? 34  SER A HB3  6  
ATOM 9258  H HG   . SER A 1 34  ? -20.371 -5.633  -7.626  1.00 0.00 ? 34  SER A HG   6  
ATOM 9259  N N    . GLY A 1 35  ? -18.918 -9.594  -4.731  1.00 0.00 ? 35  GLY A N    6  
ATOM 9260  C CA   . GLY A 1 35  ? -19.651 -10.579 -3.957  1.00 0.00 ? 35  GLY A CA   6  
ATOM 9261  C C    . GLY A 1 35  ? -19.464 -11.988 -4.485  1.00 0.00 ? 35  GLY A C    6  
ATOM 9262  O O    . GLY A 1 35  ? -19.115 -12.197 -5.647  1.00 0.00 ? 35  GLY A O    6  
ATOM 9263  H H    . GLY A 1 35  ? -17.950 -9.689  -4.851  1.00 0.00 ? 35  GLY A H    6  
ATOM 9264  H HA2  . GLY A 1 35  ? -19.311 -10.541 -2.933  1.00 0.00 ? 35  GLY A HA2  6  
ATOM 9265  H HA3  . GLY A 1 35  ? -20.703 -10.333 -3.986  1.00 0.00 ? 35  GLY A HA3  6  
ATOM 9266  N N    . PRO A 1 36  ? -19.698 -12.984 -3.618  1.00 0.00 ? 36  PRO A N    6  
ATOM 9267  C CA   . PRO A 1 36  ? -19.559 -14.398 -3.981  1.00 0.00 ? 36  PRO A CA   6  
ATOM 9268  C C    . PRO A 1 36  ? -20.642 -14.856 -4.952  1.00 0.00 ? 36  PRO A C    6  
ATOM 9269  O O    . PRO A 1 36  ? -20.604 -15.980 -5.453  1.00 0.00 ? 36  PRO A O    6  
ATOM 9270  C CB   . PRO A 1 36  ? -19.701 -15.123 -2.641  1.00 0.00 ? 36  PRO A CB   6  
ATOM 9271  C CG   . PRO A 1 36  ? -20.502 -14.198 -1.791  1.00 0.00 ? 36  PRO A CG   6  
ATOM 9272  C CD   . PRO A 1 36  ? -20.118 -12.808 -2.218  1.00 0.00 ? 36  PRO A CD   6  
ATOM 9273  H HA   . PRO A 1 36  ? -18.587 -14.605 -4.403  1.00 0.00 ? 36  PRO A HA   6  
ATOM 9274  H HB2  . PRO A 1 36  ? -20.211 -16.065 -2.790  1.00 0.00 ? 36  PRO A HB2  6  
ATOM 9275  H HB3  . PRO A 1 36  ? -18.723 -15.300 -2.218  1.00 0.00 ? 36  PRO A HB3  6  
ATOM 9276  H HG2  . PRO A 1 36  ? -21.555 -14.364 -1.959  1.00 0.00 ? 36  PRO A HG2  6  
ATOM 9277  H HG3  . PRO A 1 36  ? -20.257 -14.351 -0.751  1.00 0.00 ? 36  PRO A HG3  6  
ATOM 9278  H HD2  . PRO A 1 36  ? -20.967 -12.144 -2.150  1.00 0.00 ? 36  PRO A HD2  6  
ATOM 9279  H HD3  . PRO A 1 36  ? -19.301 -12.441 -1.615  1.00 0.00 ? 36  PRO A HD3  6  
ATOM 9280  N N    . SER A 1 37  ? -21.606 -13.980 -5.214  1.00 0.00 ? 37  SER A N    6  
ATOM 9281  C CA   . SER A 1 37  ? -22.701 -14.296 -6.123  1.00 0.00 ? 37  SER A CA   6  
ATOM 9282  C C    . SER A 1 37  ? -23.038 -13.099 -7.005  1.00 0.00 ? 37  SER A C    6  
ATOM 9283  O O    . SER A 1 37  ? -23.508 -12.069 -6.521  1.00 0.00 ? 37  SER A O    6  
ATOM 9284  C CB   . SER A 1 37  ? -23.939 -14.727 -5.333  1.00 0.00 ? 37  SER A CB   6  
ATOM 9285  O OG   . SER A 1 37  ? -25.025 -15.005 -6.199  1.00 0.00 ? 37  SER A OG   6  
ATOM 9286  H H    . SER A 1 37  ? -21.581 -13.099 -4.783  1.00 0.00 ? 37  SER A H    6  
ATOM 9287  H HA   . SER A 1 37  ? -22.384 -15.115 -6.752  1.00 0.00 ? 37  SER A HA   6  
ATOM 9288  H HB2  . SER A 1 37  ? -23.710 -15.616 -4.766  1.00 0.00 ? 37  SER A HB2  6  
ATOM 9289  H HB3  . SER A 1 37  ? -24.226 -13.933 -4.659  1.00 0.00 ? 37  SER A HB3  6  
ATOM 9290  H HG   . SER A 1 37  ? -25.434 -14.182 -6.475  1.00 0.00 ? 37  SER A HG   6  
ATOM 9291  N N    . SER A 1 38  ? -22.794 -13.242 -8.304  1.00 0.00 ? 38  SER A N    6  
ATOM 9292  C CA   . SER A 1 38  ? -23.068 -12.171 -9.256  1.00 0.00 ? 38  SER A CA   6  
ATOM 9293  C C    . SER A 1 38  ? -24.552 -12.120 -9.605  1.00 0.00 ? 38  SER A C    6  
ATOM 9294  O O    . SER A 1 38  ? -25.166 -13.143 -9.905  1.00 0.00 ? 38  SER A O    6  
ATOM 9295  C CB   . SER A 1 38  ? -22.240 -12.366 -10.527 1.00 0.00 ? 38  SER A CB   6  
ATOM 9296  O OG   . SER A 1 38  ? -20.853 -12.368 -10.237 1.00 0.00 ? 38  SER A OG   6  
ATOM 9297  H H    . SER A 1 38  ? -22.419 -14.087 -8.630  1.00 0.00 ? 38  SER A H    6  
ATOM 9298  H HA   . SER A 1 38  ? -22.787 -11.237 -8.793  1.00 0.00 ? 38  SER A HA   6  
ATOM 9299  H HB2  . SER A 1 38  ? -22.501 -13.309 -10.983 1.00 0.00 ? 38  SER A HB2  6  
ATOM 9300  H HB3  . SER A 1 38  ? -22.450 -11.562 -11.218 1.00 0.00 ? 38  SER A HB3  6  
ATOM 9301  H HG   . SER A 1 38  ? -20.702 -12.802 -9.394  1.00 0.00 ? 38  SER A HG   6  
ATOM 9302  N N    . GLY A 1 39  ? -25.123 -10.920 -9.563  1.00 0.00 ? 39  GLY A N    6  
ATOM 9303  C CA   . GLY A 1 39  ? -26.531 -10.757 -9.876  1.00 0.00 ? 39  GLY A CA   6  
ATOM 9304  C C    . GLY A 1 39  ? -27.395 -10.668 -8.634  1.00 0.00 ? 39  GLY A C    6  
ATOM 9305  O O    . GLY A 1 39  ? -28.133 -9.699  -8.452  1.00 0.00 ? 39  GLY A O    6  
ATOM 9306  H H    . GLY A 1 39  ? -24.584 -10.139 -9.317  1.00 0.00 ? 39  GLY A H    6  
ATOM 9307  H HA2  . GLY A 1 39  ? -26.657 -9.855  -10.456 1.00 0.00 ? 39  GLY A HA2  6  
ATOM 9308  H HA3  . GLY A 1 39  ? -26.856 -11.601 -10.467 1.00 0.00 ? 39  GLY A HA3  6  
ATOM 9309  N N    . ILE A 1 40  ? -27.305 -11.680 -7.778  1.00 0.00 ? 40  ILE A N    6  
ATOM 9310  C CA   . ILE A 1 40  ? -28.085 -11.711 -6.548  1.00 0.00 ? 40  ILE A CA   6  
ATOM 9311  C C    . ILE A 1 40  ? -27.206 -12.045 -5.348  1.00 0.00 ? 40  ILE A C    6  
ATOM 9312  O O    . ILE A 1 40  ? -26.012 -12.306 -5.494  1.00 0.00 ? 40  ILE A O    6  
ATOM 9313  C CB   . ILE A 1 40  ? -29.230 -12.738 -6.633  1.00 0.00 ? 40  ILE A CB   6  
ATOM 9314  C CG1  . ILE A 1 40  ? -28.670 -14.138 -6.892  1.00 0.00 ? 40  ILE A CG1  6  
ATOM 9315  C CG2  . ILE A 1 40  ? -30.214 -12.344 -7.724  1.00 0.00 ? 40  ILE A CG2  6  
ATOM 9316  C CD1  . ILE A 1 40  ? -29.633 -15.249 -6.538  1.00 0.00 ? 40  ILE A CD1  6  
ATOM 9317  H H    . ILE A 1 40  ? -26.698 -12.423 -7.979  1.00 0.00 ? 40  ILE A H    6  
ATOM 9318  H HA   . ILE A 1 40  ? -28.517 -10.731 -6.402  1.00 0.00 ? 40  ILE A HA   6  
ATOM 9319  H HB   . ILE A 1 40  ? -29.755 -12.737 -5.690  1.00 0.00 ? 40  ILE A HB   6  
ATOM 9320  H HG12 . ILE A 1 40  ? -28.425 -14.233 -7.939  1.00 0.00 ? 40  ILE A HG12 6  
ATOM 9321  H HG13 . ILE A 1 40  ? -27.774 -14.274 -6.304  1.00 0.00 ? 40  ILE A HG13 6  
ATOM 9322  H HG21 . ILE A 1 40  ? -29.687 -12.234 -8.661  1.00 0.00 ? 40  ILE A HG21 6  
ATOM 9323  H HG22 . ILE A 1 40  ? -30.966 -13.112 -7.824  1.00 0.00 ? 40  ILE A HG22 6  
ATOM 9324  H HG23 . ILE A 1 40  ? -30.686 -11.409 -7.464  1.00 0.00 ? 40  ILE A HG23 6  
ATOM 9325  H HD11 . ILE A 1 40  ? -29.337 -15.697 -5.600  1.00 0.00 ? 40  ILE A HD11 6  
ATOM 9326  H HD12 . ILE A 1 40  ? -30.631 -14.845 -6.443  1.00 0.00 ? 40  ILE A HD12 6  
ATOM 9327  H HD13 . ILE A 1 40  ? -29.620 -15.999 -7.314  1.00 0.00 ? 40  ILE A HD13 6  
ATOM 9328  N N    . GLU A 1 41  ? -27.805 -12.037 -4.161  1.00 0.00 ? 41  GLU A N    6  
ATOM 9329  C CA   . GLU A 1 41  ? -27.076 -12.341 -2.935  1.00 0.00 ? 41  GLU A CA   6  
ATOM 9330  C C    . GLU A 1 41  ? -27.042 -13.845 -2.681  1.00 0.00 ? 41  GLU A C    6  
ATOM 9331  O O    . GLU A 1 41  ? -27.999 -14.558 -2.980  1.00 0.00 ? 41  GLU A O    6  
ATOM 9332  C CB   . GLU A 1 41  ? -27.716 -11.625 -1.744  1.00 0.00 ? 41  GLU A CB   6  
ATOM 9333  C CG   . GLU A 1 41  ? -27.116 -12.017 -0.404  1.00 0.00 ? 41  GLU A CG   6  
ATOM 9334  C CD   . GLU A 1 41  ? -27.180 -10.896 0.614   1.00 0.00 ? 41  GLU A CD   6  
ATOM 9335  O OE1  . GLU A 1 41  ? -28.243 -10.249 0.719   1.00 0.00 ? 41  GLU A OE1  6  
ATOM 9336  O OE2  . GLU A 1 41  ? -26.167 -10.666 1.307   1.00 0.00 ? 41  GLU A OE2  6  
ATOM 9337  H H    . GLU A 1 41  ? -28.760 -11.822 -4.109  1.00 0.00 ? 41  GLU A H    6  
ATOM 9338  H HA   . GLU A 1 41  ? -26.064 -11.986 -3.055  1.00 0.00 ? 41  GLU A HA   6  
ATOM 9339  H HB2  . GLU A 1 41  ? -27.595 -10.560 -1.872  1.00 0.00 ? 41  GLU A HB2  6  
ATOM 9340  H HB3  . GLU A 1 41  ? -28.770 -11.858 -1.724  1.00 0.00 ? 41  GLU A HB3  6  
ATOM 9341  H HG2  . GLU A 1 41  ? -27.658 -12.867 -0.016  1.00 0.00 ? 41  GLU A HG2  6  
ATOM 9342  H HG3  . GLU A 1 41  ? -26.082 -12.290 -0.553  1.00 0.00 ? 41  GLU A HG3  6  
ATOM 9343  N N    . GLY A 1 42  ? -25.931 -14.321 -2.126  1.00 0.00 ? 42  GLY A N    6  
ATOM 9344  C CA   . GLY A 1 42  ? -25.792 -15.737 -1.841  1.00 0.00 ? 42  GLY A CA   6  
ATOM 9345  C C    . GLY A 1 42  ? -26.540 -16.153 -0.590  1.00 0.00 ? 42  GLY A C    6  
ATOM 9346  O O    . GLY A 1 42  ? -27.535 -16.874 -0.664  1.00 0.00 ? 42  GLY A O    6  
ATOM 9347  H H    . GLY A 1 42  ? -25.200 -13.705 -1.909  1.00 0.00 ? 42  GLY A H    6  
ATOM 9348  H HA2  . GLY A 1 42  ? -26.173 -16.301 -2.679  1.00 0.00 ? 42  GLY A HA2  6  
ATOM 9349  H HA3  . GLY A 1 42  ? -24.744 -15.966 -1.712  1.00 0.00 ? 42  GLY A HA3  6  
ATOM 9350  N N    . ARG A 1 43  ? -26.060 -15.699 0.563   1.00 0.00 ? 43  ARG A N    6  
ATOM 9351  C CA   . ARG A 1 43  ? -26.688 -16.031 1.836   1.00 0.00 ? 43  ARG A CA   6  
ATOM 9352  C C    . ARG A 1 43  ? -27.273 -17.440 1.803   1.00 0.00 ? 43  ARG A C    6  
ATOM 9353  O O    . ARG A 1 43  ? -28.371 -17.679 2.305   1.00 0.00 ? 43  ARG A O    6  
ATOM 9354  C CB   . ARG A 1 43  ? -27.787 -15.018 2.166   1.00 0.00 ? 43  ARG A CB   6  
ATOM 9355  C CG   . ARG A 1 43  ? -27.972 -14.785 3.657   1.00 0.00 ? 43  ARG A CG   6  
ATOM 9356  C CD   . ARG A 1 43  ? -27.102 -13.641 4.154   1.00 0.00 ? 43  ARG A CD   6  
ATOM 9357  N NE   . ARG A 1 43  ? -27.492 -12.362 3.568   1.00 0.00 ? 43  ARG A NE   6  
ATOM 9358  C CZ   . ARG A 1 43  ? -27.069 -11.186 4.019   1.00 0.00 ? 43  ARG A CZ   6  
ATOM 9359  N NH1  . ARG A 1 43  ? -26.246 -11.129 5.057   1.00 0.00 ? 43  ARG A NH1  6  
ATOM 9360  N NH2  . ARG A 1 43  ? -27.469 -10.065 3.433   1.00 0.00 ? 43  ARG A NH2  6  
ATOM 9361  H H    . ARG A 1 43  ? -25.263 -15.128 0.558   1.00 0.00 ? 43  ARG A H    6  
ATOM 9362  H HA   . ARG A 1 43  ? -25.929 -15.987 2.603   1.00 0.00 ? 43  ARG A HA   6  
ATOM 9363  H HB2  . ARG A 1 43  ? -27.540 -14.073 1.704   1.00 0.00 ? 43  ARG A HB2  6  
ATOM 9364  H HB3  . ARG A 1 43  ? -28.721 -15.375 1.761   1.00 0.00 ? 43  ARG A HB3  6  
ATOM 9365  H HG2  . ARG A 1 43  ? -29.007 -14.544 3.848   1.00 0.00 ? 43  ARG A HG2  6  
ATOM 9366  H HG3  . ARG A 1 43  ? -27.706 -15.686 4.188   1.00 0.00 ? 43  ARG A HG3  6  
ATOM 9367  H HD2  . ARG A 1 43  ? -27.194 -13.577 5.228   1.00 0.00 ? 43  ARG A HD2  6  
ATOM 9368  H HD3  . ARG A 1 43  ? -26.075 -13.848 3.893   1.00 0.00 ? 43  ARG A HD3  6  
ATOM 9369  H HE   . ARG A 1 43  ? -28.100 -12.381 2.800   1.00 0.00 ? 43  ARG A HE   6  
ATOM 9370  H HH11 . ARG A 1 43  ? -25.942 -11.972 5.501   1.00 0.00 ? 43  ARG A HH11 6  
ATOM 9371  H HH12 . ARG A 1 43  ? -25.928 -10.243 5.395   1.00 0.00 ? 43  ARG A HH12 6  
ATOM 9372  H HH21 . ARG A 1 43  ? -28.089 -10.105 2.650   1.00 0.00 ? 43  ARG A HH21 6  
ATOM 9373  H HH22 . ARG A 1 43  ? -27.150 -9.182  3.773   1.00 0.00 ? 43  ARG A HH22 6  
ATOM 9374  N N    . GLY A 1 44  ? -26.532 -18.369 1.207   1.00 0.00 ? 44  GLY A N    6  
ATOM 9375  C CA   . GLY A 1 44  ? -26.994 -19.742 1.119   1.00 0.00 ? 44  GLY A CA   6  
ATOM 9376  C C    . GLY A 1 44  ? -25.916 -20.686 0.625   1.00 0.00 ? 44  GLY A C    6  
ATOM 9377  O O    . GLY A 1 44  ? -24.885 -20.856 1.276   1.00 0.00 ? 44  GLY A O    6  
ATOM 9378  H H    . GLY A 1 44  ? -25.665 -18.120 0.824   1.00 0.00 ? 44  GLY A H    6  
ATOM 9379  H HA2  . GLY A 1 44  ? -27.321 -20.064 2.096   1.00 0.00 ? 44  GLY A HA2  6  
ATOM 9380  H HA3  . GLY A 1 44  ? -27.832 -19.784 0.438   1.00 0.00 ? 44  GLY A HA3  6  
ATOM 9381  N N    . SER A 1 45  ? -26.153 -21.303 -0.528  1.00 0.00 ? 45  SER A N    6  
ATOM 9382  C CA   . SER A 1 45  ? -25.196 -22.239 -1.105  1.00 0.00 ? 45  SER A CA   6  
ATOM 9383  C C    . SER A 1 45  ? -23.956 -21.507 -1.608  1.00 0.00 ? 45  SER A C    6  
ATOM 9384  O O    . SER A 1 45  ? -24.051 -20.419 -2.175  1.00 0.00 ? 45  SER A O    6  
ATOM 9385  C CB   . SER A 1 45  ? -25.842 -23.019 -2.252  1.00 0.00 ? 45  SER A CB   6  
ATOM 9386  O OG   . SER A 1 45  ? -26.258 -22.148 -3.290  1.00 0.00 ? 45  SER A OG   6  
ATOM 9387  H H    . SER A 1 45  ? -26.994 -21.125 -1.000  1.00 0.00 ? 45  SER A H    6  
ATOM 9388  H HA   . SER A 1 45  ? -24.902 -22.932 -0.331  1.00 0.00 ? 45  SER A HA   6  
ATOM 9389  H HB2  . SER A 1 45  ? -25.128 -23.721 -2.654  1.00 0.00 ? 45  SER A HB2  6  
ATOM 9390  H HB3  . SER A 1 45  ? -26.704 -23.554 -1.880  1.00 0.00 ? 45  SER A HB3  6  
ATOM 9391  H HG   . SER A 1 45  ? -25.568 -22.089 -3.955  1.00 0.00 ? 45  SER A HG   6  
ATOM 9392  N N    . SER A 1 46  ? -22.792 -22.113 -1.395  1.00 0.00 ? 46  SER A N    6  
ATOM 9393  C CA   . SER A 1 46  ? -21.531 -21.518 -1.823  1.00 0.00 ? 46  SER A CA   6  
ATOM 9394  C C    . SER A 1 46  ? -21.422 -21.510 -3.344  1.00 0.00 ? 46  SER A C    6  
ATOM 9395  O O    . SER A 1 46  ? -21.174 -20.471 -3.955  1.00 0.00 ? 46  SER A O    6  
ATOM 9396  C CB   . SER A 1 46  ? -20.351 -22.283 -1.220  1.00 0.00 ? 46  SER A CB   6  
ATOM 9397  O OG   . SER A 1 46  ? -20.035 -21.797 0.073   1.00 0.00 ? 46  SER A OG   6  
ATOM 9398  H H    . SER A 1 46  ? -22.781 -22.979 -0.937  1.00 0.00 ? 46  SER A H    6  
ATOM 9399  H HA   . SER A 1 46  ? -21.508 -20.499 -1.466  1.00 0.00 ? 46  SER A HA   6  
ATOM 9400  H HB2  . SER A 1 46  ? -20.605 -23.330 -1.145  1.00 0.00 ? 46  SER A HB2  6  
ATOM 9401  H HB3  . SER A 1 46  ? -19.487 -22.167 -1.857  1.00 0.00 ? 46  SER A HB3  6  
ATOM 9402  H HG   . SER A 1 46  ? -20.818 -21.408 0.470   1.00 0.00 ? 46  SER A HG   6  
ATOM 9403  N N    . GLY A 1 47  ? -21.611 -22.678 -3.951  1.00 0.00 ? 47  GLY A N    6  
ATOM 9404  C CA   . GLY A 1 47  ? -21.530 -22.785 -5.396  1.00 0.00 ? 47  GLY A CA   6  
ATOM 9405  C C    . GLY A 1 47  ? -20.146 -22.464 -5.925  1.00 0.00 ? 47  GLY A C    6  
ATOM 9406  O O    . GLY A 1 47  ? -20.005 -21.809 -6.958  1.00 0.00 ? 47  GLY A O    6  
ATOM 9407  H H    . GLY A 1 47  ? -21.806 -23.474 -3.413  1.00 0.00 ? 47  GLY A H    6  
ATOM 9408  H HA2  . GLY A 1 47  ? -21.791 -23.792 -5.687  1.00 0.00 ? 47  GLY A HA2  6  
ATOM 9409  H HA3  . GLY A 1 47  ? -22.239 -22.099 -5.836  1.00 0.00 ? 47  GLY A HA3  6  
ATOM 9410  N N    . SER A 1 48  ? -19.121 -22.924 -5.215  1.00 0.00 ? 48  SER A N    6  
ATOM 9411  C CA   . SER A 1 48  ? -17.741 -22.677 -5.615  1.00 0.00 ? 48  SER A CA   6  
ATOM 9412  C C    . SER A 1 48  ? -17.486 -23.190 -7.029  1.00 0.00 ? 48  SER A C    6  
ATOM 9413  O O    . SER A 1 48  ? -16.969 -22.466 -7.880  1.00 0.00 ? 48  SER A O    6  
ATOM 9414  C CB   . SER A 1 48  ? -16.776 -23.348 -4.636  1.00 0.00 ? 48  SER A CB   6  
ATOM 9415  O OG   . SER A 1 48  ? -16.727 -22.645 -3.406  1.00 0.00 ? 48  SER A OG   6  
ATOM 9416  H H    . SER A 1 48  ? -19.298 -23.440 -4.400  1.00 0.00 ? 48  SER A H    6  
ATOM 9417  H HA   . SER A 1 48  ? -17.576 -21.610 -5.596  1.00 0.00 ? 48  SER A HA   6  
ATOM 9418  H HB2  . SER A 1 48  ? -17.104 -24.359 -4.446  1.00 0.00 ? 48  SER A HB2  6  
ATOM 9419  H HB3  . SER A 1 48  ? -15.785 -23.366 -5.067  1.00 0.00 ? 48  SER A HB3  6  
ATOM 9420  H HG   . SER A 1 48  ? -16.245 -21.824 -3.526  1.00 0.00 ? 48  SER A HG   6  
ATOM 9421  N N    . SER A 1 49  ? -17.854 -24.444 -7.273  1.00 0.00 ? 49  SER A N    6  
ATOM 9422  C CA   . SER A 1 49  ? -17.662 -25.056 -8.582  1.00 0.00 ? 49  SER A CA   6  
ATOM 9423  C C    . SER A 1 49  ? -16.309 -24.668 -9.171  1.00 0.00 ? 49  SER A C    6  
ATOM 9424  O O    . SER A 1 49  ? -16.198 -24.375 -10.361 1.00 0.00 ? 49  SER A O    6  
ATOM 9425  C CB   . SER A 1 49  ? -18.784 -24.637 -9.534  1.00 0.00 ? 49  SER A CB   6  
ATOM 9426  O OG   . SER A 1 49  ? -19.021 -25.634 -10.513 1.00 0.00 ? 49  SER A OG   6  
ATOM 9427  H H    . SER A 1 49  ? -18.261 -24.971 -6.553  1.00 0.00 ? 49  SER A H    6  
ATOM 9428  H HA   . SER A 1 49  ? -17.691 -26.128 -8.455  1.00 0.00 ? 49  SER A HA   6  
ATOM 9429  H HB2  . SER A 1 49  ? -19.691 -24.481 -8.970  1.00 0.00 ? 49  SER A HB2  6  
ATOM 9430  H HB3  . SER A 1 49  ? -18.506 -23.719 -10.031 1.00 0.00 ? 49  SER A HB3  6  
ATOM 9431  H HG   . SER A 1 49  ? -19.275 -26.453 -10.081 1.00 0.00 ? 49  SER A HG   6  
ATOM 9432  N N    . GLY A 1 50  ? -15.281 -24.667 -8.327  1.00 0.00 ? 50  GLY A N    6  
ATOM 9433  C CA   . GLY A 1 50  ? -13.949 -24.313 -8.780  1.00 0.00 ? 50  GLY A CA   6  
ATOM 9434  C C    . GLY A 1 50  ? -13.932 -23.026 -9.581  1.00 0.00 ? 50  GLY A C    6  
ATOM 9435  O O    . GLY A 1 50  ? -14.966 -22.379 -9.751  1.00 0.00 ? 50  GLY A O    6  
ATOM 9436  H H    . GLY A 1 50  ? -15.429 -24.909 -7.389  1.00 0.00 ? 50  GLY A H    6  
ATOM 9437  H HA2  . GLY A 1 50  ? -13.307 -24.198 -7.920  1.00 0.00 ? 50  GLY A HA2  6  
ATOM 9438  H HA3  . GLY A 1 50  ? -13.567 -25.112 -9.398  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 9439  N N    . SER A 1 51  ? -12.756 -22.652 -10.074 1.00 0.00 ? 51  SER A N    6  
ATOM 9440  C CA   . SER A 1 51  ? -12.607 -21.431 -10.856 1.00 0.00 ? 51  SER A CA   6  
ATOM 9441  C C    . SER A 1 51  ? -11.680 -21.658 -12.046 1.00 0.00 ? 51  SER A C    6  
ATOM 9442  O O    . SER A 1 51  ? -10.722 -22.426 -11.963 1.00 0.00 ? 51  SER A O    6  
ATOM 9443  C CB   . SER A 1 51  ? -12.064 -20.301 -9.980  1.00 0.00 ? 51  SER A CB   6  
ATOM 9444  O OG   . SER A 1 51  ? -12.836 -20.155 -8.800  1.00 0.00 ? 51  SER A OG   6  
ATOM 9445  H H    . SER A 1 51  ? -11.968 -23.211 -9.904  1.00 0.00 ? 51  SER A H    6  
ATOM 9446  H HA   . SER A 1 51  ? -13.584 -21.153 -11.224 1.00 0.00 ? 51  SER A HA   6  
ATOM 9447  H HB2  . SER A 1 51  ? -11.045 -20.522 -9.703  1.00 0.00 ? 51  SER A HB2  6  
ATOM 9448  H HB3  . SER A 1 51  ? -12.095 -19.374 -10.533 1.00 0.00 ? 51  SER A HB3  6  
ATOM 9449  H HG   . SER A 1 51  ? -13.304 -19.317 -8.826  1.00 0.00 ? 51  SER A HG   6  
ATOM 9450  N N    . SER A 1 52  ? -11.972 -20.982 -13.153 1.00 0.00 ? 52  SER A N    6  
ATOM 9451  C CA   . SER A 1 52  ? -11.167 -21.112 -14.362 1.00 0.00 ? 52  SER A CA   6  
ATOM 9452  C C    . SER A 1 52  ? -11.094 -19.785 -15.111 1.00 0.00 ? 52  SER A C    6  
ATOM 9453  O O    . SER A 1 52  ? -11.946 -18.914 -14.939 1.00 0.00 ? 52  SER A O    6  
ATOM 9454  C CB   . SER A 1 52  ? -11.749 -22.193 -15.275 1.00 0.00 ? 52  SER A CB   6  
ATOM 9455  O OG   . SER A 1 52  ? -13.126 -21.964 -15.523 1.00 0.00 ? 52  SER A OG   6  
ATOM 9456  H H    . SER A 1 52  ? -12.749 -20.385 -13.157 1.00 0.00 ? 52  SER A H    6  
ATOM 9457  H HA   . SER A 1 52  ? -10.169 -21.401 -14.067 1.00 0.00 ? 52  SER A HA   6  
ATOM 9458  H HB2  . SER A 1 52  ? -11.221 -22.190 -16.215 1.00 0.00 ? 52  SER A HB2  6  
ATOM 9459  H HB3  . SER A 1 52  ? -11.637 -23.158 -14.801 1.00 0.00 ? 52  SER A HB3  6  
ATOM 9460  H HG   . SER A 1 52  ? -13.253 -21.757 -16.452 1.00 0.00 ? 52  SER A HG   6  
ATOM 9461  N N    . GLY A 1 53  ? -10.068 -19.638 -15.944 1.00 0.00 ? 53  GLY A N    6  
ATOM 9462  C CA   . GLY A 1 53  ? -9.901  -18.415 -16.707 1.00 0.00 ? 53  GLY A CA   6  
ATOM 9463  C C    . GLY A 1 53  ? -8.585  -17.723 -16.412 1.00 0.00 ? 53  GLY A C    6  
ATOM 9464  O O    . GLY A 1 53  ? -8.536  -16.773 -15.630 1.00 0.00 ? 53  GLY A O    6  
ATOM 9465  H H    . GLY A 1 53  ? -9.419  -20.366 -16.041 1.00 0.00 ? 53  GLY A H    6  
ATOM 9466  H HA2  . GLY A 1 53  ? -9.943  -18.651 -17.759 1.00 0.00 ? 53  GLY A HA2  6  
ATOM 9467  H HA3  . GLY A 1 53  ? -10.710 -17.741 -16.466 1.00 0.00 ? 53  GLY A HA3  6  
ATOM 9468  N N    . SER A 1 54  ? -7.513  -18.200 -17.037 1.00 0.00 ? 54  SER A N    6  
ATOM 9469  C CA   . SER A 1 54  ? -6.189  -17.624 -16.834 1.00 0.00 ? 54  SER A CA   6  
ATOM 9470  C C    . SER A 1 54  ? -5.938  -16.480 -17.811 1.00 0.00 ? 54  SER A C    6  
ATOM 9471  O O    . SER A 1 54  ? -5.745  -15.334 -17.405 1.00 0.00 ? 54  SER A O    6  
ATOM 9472  C CB   . SER A 1 54  ? -5.112  -18.698 -17.000 1.00 0.00 ? 54  SER A CB   6  
ATOM 9473  O OG   . SER A 1 54  ? -5.205  -19.676 -15.979 1.00 0.00 ? 54  SER A OG   6  
ATOM 9474  H H    . SER A 1 54  ? -7.616  -18.960 -17.649 1.00 0.00 ? 54  SER A H    6  
ATOM 9475  H HA   . SER A 1 54  ? -6.147  -17.238 -15.826 1.00 0.00 ? 54  SER A HA   6  
ATOM 9476  H HB2  . SER A 1 54  ? -5.234  -19.182 -17.957 1.00 0.00 ? 54  SER A HB2  6  
ATOM 9477  H HB3  . SER A 1 54  ? -4.137  -18.236 -16.952 1.00 0.00 ? 54  SER A HB3  6  
ATOM 9478  H HG   . SER A 1 54  ? -6.096  -20.032 -15.956 1.00 0.00 ? 54  SER A HG   6  
ATOM 9479  N N    . SER A 1 55  ? -5.942  -16.800 -19.101 1.00 0.00 ? 55  SER A N    6  
ATOM 9480  C CA   . SER A 1 55  ? -5.711  -15.801 -20.137 1.00 0.00 ? 55  SER A CA   6  
ATOM 9481  C C    . SER A 1 55  ? -4.475  -14.964 -19.819 1.00 0.00 ? 55  SER A C    6  
ATOM 9482  O O    . SER A 1 55  ? -4.476  -13.746 -19.991 1.00 0.00 ? 55  SER A O    6  
ATOM 9483  C CB   . SER A 1 55  ? -6.933  -14.892 -20.281 1.00 0.00 ? 55  SER A CB   6  
ATOM 9484  O OG   . SER A 1 55  ? -8.054  -15.616 -20.758 1.00 0.00 ? 55  SER A OG   6  
ATOM 9485  H H    . SER A 1 55  ? -6.102  -17.732 -19.361 1.00 0.00 ? 55  SER A H    6  
ATOM 9486  H HA   . SER A 1 55  ? -5.549  -16.322 -21.069 1.00 0.00 ? 55  SER A HA   6  
ATOM 9487  H HB2  . SER A 1 55  ? -7.178  -14.468 -19.319 1.00 0.00 ? 55  SER A HB2  6  
ATOM 9488  H HB3  . SER A 1 55  ? -6.708  -14.098 -20.978 1.00 0.00 ? 55  SER A HB3  6  
ATOM 9489  H HG   . SER A 1 55  ? -8.816  -15.428 -20.206 1.00 0.00 ? 55  SER A HG   6  
ATOM 9490  N N    . GLY A 1 56  ? -3.422  -15.629 -19.354 1.00 0.00 ? 56  GLY A N    6  
ATOM 9491  C CA   . GLY A 1 56  ? -2.194  -14.932 -19.019 1.00 0.00 ? 56  GLY A CA   6  
ATOM 9492  C C    . GLY A 1 56  ? -1.866  -15.014 -17.541 1.00 0.00 ? 56  GLY A C    6  
ATOM 9493  O O    . GLY A 1 56  ? -2.239  -14.133 -16.766 1.00 0.00 ? 56  GLY A O    6  
ATOM 9494  H H    . GLY A 1 56  ? -3.479  -16.601 -19.238 1.00 0.00 ? 56  GLY A H    6  
ATOM 9495  H HA2  . GLY A 1 56  ? -1.381  -15.366 -19.582 1.00 0.00 ? 56  GLY A HA2  6  
ATOM 9496  H HA3  . GLY A 1 56  ? -2.296  -13.893 -19.296 1.00 0.00 ? 56  GLY A HA3  6  
ATOM 9497  N N    . ASP A 1 57  ? -1.167  -16.073 -17.150 1.00 0.00 ? 57  ASP A N    6  
ATOM 9498  C CA   . ASP A 1 57  ? -0.789  -16.268 -15.755 1.00 0.00 ? 57  ASP A CA   6  
ATOM 9499  C C    . ASP A 1 57  ? 0.489   -15.503 -15.427 1.00 0.00 ? 57  ASP A C    6  
ATOM 9500  O O    . ASP A 1 57  ? 1.351   -15.995 -14.698 1.00 0.00 ? 57  ASP A O    6  
ATOM 9501  C CB   . ASP A 1 57  ? -0.598  -17.756 -15.458 1.00 0.00 ? 57  ASP A CB   6  
ATOM 9502  C CG   . ASP A 1 57  ? -1.913  -18.507 -15.395 1.00 0.00 ? 57  ASP A CG   6  
ATOM 9503  O OD1  . ASP A 1 57  ? -2.859  -17.996 -14.757 1.00 0.00 ? 57  ASP A OD1  6  
ATOM 9504  O OD2  . ASP A 1 57  ? -1.998  -19.605 -15.983 1.00 0.00 ? 57  ASP A OD2  6  
ATOM 9505  H H    . ASP A 1 57  ? -0.899  -16.741 -17.816 1.00 0.00 ? 57  ASP A H    6  
ATOM 9506  H HA   . ASP A 1 57  ? -1.589  -15.887 -15.138 1.00 0.00 ? 57  ASP A HA   6  
ATOM 9507  H HB2  . ASP A 1 57  ? 0.009   -18.196 -16.236 1.00 0.00 ? 57  ASP A HB2  6  
ATOM 9508  H HB3  . ASP A 1 57  ? -0.095  -17.865 -14.509 1.00 0.00 ? 57  ASP A HB3  6  
ATOM 9509  N N    . LYS A 1 58  ? 0.607   -14.296 -15.971 1.00 0.00 ? 58  LYS A N    6  
ATOM 9510  C CA   . LYS A 1 58  ? 1.779   -13.462 -15.737 1.00 0.00 ? 58  LYS A CA   6  
ATOM 9511  C C    . LYS A 1 58  ? 1.501   -12.422 -14.657 1.00 0.00 ? 58  LYS A C    6  
ATOM 9512  O O    . LYS A 1 58  ? 1.244   -11.256 -14.956 1.00 0.00 ? 58  LYS A O    6  
ATOM 9513  C CB   . LYS A 1 58  ? 2.202   -12.765 -17.033 1.00 0.00 ? 58  LYS A CB   6  
ATOM 9514  C CG   . LYS A 1 58  ? 3.593   -12.159 -16.971 1.00 0.00 ? 58  LYS A CG   6  
ATOM 9515  C CD   . LYS A 1 58  ? 4.254   -12.138 -18.340 1.00 0.00 ? 58  LYS A CD   6  
ATOM 9516  C CE   . LYS A 1 58  ? 5.513   -11.286 -18.338 1.00 0.00 ? 58  LYS A CE   6  
ATOM 9517  N NZ   . LYS A 1 58  ? 6.077   -11.126 -19.707 1.00 0.00 ? 58  LYS A NZ   6  
ATOM 9518  H H    . LYS A 1 58  ? -0.114  -13.958 -16.544 1.00 0.00 ? 58  LYS A H    6  
ATOM 9519  H HA   . LYS A 1 58  ? 2.582   -14.103 -15.405 1.00 0.00 ? 58  LYS A HA   6  
ATOM 9520  H HB2  . LYS A 1 58  ? 2.181   -13.485 -17.838 1.00 0.00 ? 58  LYS A HB2  6  
ATOM 9521  H HB3  . LYS A 1 58  ? 1.497   -11.976 -17.249 1.00 0.00 ? 58  LYS A HB3  6  
ATOM 9522  H HG2  . LYS A 1 58  ? 3.518   -11.146 -16.605 1.00 0.00 ? 58  LYS A HG2  6  
ATOM 9523  H HG3  . LYS A 1 58  ? 4.202   -12.744 -16.297 1.00 0.00 ? 58  LYS A HG3  6  
ATOM 9524  H HD2  . LYS A 1 58  ? 4.517   -13.148 -18.618 1.00 0.00 ? 58  LYS A HD2  6  
ATOM 9525  H HD3  . LYS A 1 58  ? 3.557   -11.734 -19.060 1.00 0.00 ? 58  LYS A HD3  6  
ATOM 9526  H HE2  . LYS A 1 58  ? 5.272   -10.312 -17.941 1.00 0.00 ? 58  LYS A HE2  6  
ATOM 9527  H HE3  . LYS A 1 58  ? 6.251   -11.759 -17.707 1.00 0.00 ? 58  LYS A HE3  6  
ATOM 9528  H HZ1  . LYS A 1 58  ? 6.036   -12.031 -20.218 1.00 0.00 ? 58  LYS A HZ1  6  
ATOM 9529  H HZ2  . LYS A 1 58  ? 7.068   -10.815 -19.651 1.00 0.00 ? 58  LYS A HZ2  6  
ATOM 9530  H HZ3  . LYS A 1 58  ? 5.532   -10.416 -20.237 1.00 0.00 ? 58  LYS A HZ3  6  
ATOM 9531  N N    . GLU A 1 59  ? 1.554   -12.852 -13.400 1.00 0.00 ? 59  GLU A N    6  
ATOM 9532  C CA   . GLU A 1 59  ? 1.307   -11.957 -12.276 1.00 0.00 ? 59  GLU A CA   6  
ATOM 9533  C C    . GLU A 1 59  ? 2.503   -11.039 -12.039 1.00 0.00 ? 59  GLU A C    6  
ATOM 9534  O O    . GLU A 1 59  ? 3.650   -11.425 -12.264 1.00 0.00 ? 59  GLU A O    6  
ATOM 9535  C CB   . GLU A 1 59  ? 1.010   -12.762 -11.009 1.00 0.00 ? 59  GLU A CB   6  
ATOM 9536  C CG   . GLU A 1 59  ? -0.349  -13.442 -11.025 1.00 0.00 ? 59  GLU A CG   6  
ATOM 9537  C CD   . GLU A 1 59  ? -0.297  -14.836 -11.620 1.00 0.00 ? 59  GLU A CD   6  
ATOM 9538  O OE1  . GLU A 1 59  ? 0.666   -15.131 -12.358 1.00 0.00 ? 59  GLU A OE1  6  
ATOM 9539  O OE2  . GLU A 1 59  ? -1.220  -15.631 -11.348 1.00 0.00 ? 59  GLU A OE2  6  
ATOM 9540  H H    . GLU A 1 59  ? 1.763   -13.793 -13.225 1.00 0.00 ? 59  GLU A H    6  
ATOM 9541  H HA   . GLU A 1 59  ? 0.446   -11.352 -12.516 1.00 0.00 ? 59  GLU A HA   6  
ATOM 9542  H HB2  . GLU A 1 59  ? 1.769   -13.522 -10.894 1.00 0.00 ? 59  GLU A HB2  6  
ATOM 9543  H HB3  . GLU A 1 59  ? 1.047   -12.098 -10.158 1.00 0.00 ? 59  GLU A HB3  6  
ATOM 9544  H HG2  . GLU A 1 59  ? -0.713  -13.514 -10.011 1.00 0.00 ? 59  GLU A HG2  6  
ATOM 9545  H HG3  . GLU A 1 59  ? -1.030  -12.842 -11.609 1.00 0.00 ? 59  GLU A HG3  6  
ATOM 9546  N N    . ARG A 1 60  ? 2.226   -9.821  -11.583 1.00 0.00 ? 60  ARG A N    6  
ATOM 9547  C CA   . ARG A 1 60  ? 3.277   -8.847  -11.318 1.00 0.00 ? 60  ARG A CA   6  
ATOM 9548  C C    . ARG A 1 60  ? 3.747   -8.936  -9.868  1.00 0.00 ? 60  ARG A C    6  
ATOM 9549  O O    . ARG A 1 60  ? 3.000   -9.364  -8.988  1.00 0.00 ? 60  ARG A O    6  
ATOM 9550  C CB   . ARG A 1 60  ? 2.779   -7.432  -11.618 1.00 0.00 ? 60  ARG A CB   6  
ATOM 9551  C CG   . ARG A 1 60  ? 3.876   -6.484  -12.073 1.00 0.00 ? 60  ARG A CG   6  
ATOM 9552  C CD   . ARG A 1 60  ? 3.325   -5.377  -12.957 1.00 0.00 ? 60  ARG A CD   6  
ATOM 9553  N NE   . ARG A 1 60  ? 3.291   -5.766  -14.364 1.00 0.00 ? 60  ARG A NE   6  
ATOM 9554  C CZ   . ARG A 1 60  ? 4.367   -5.804  -15.142 1.00 0.00 ? 60  ARG A CZ   6  
ATOM 9555  N NH1  . ARG A 1 60  ? 5.555   -5.479  -14.652 1.00 0.00 ? 60  ARG A NH1  6  
ATOM 9556  N NH2  . ARG A 1 60  ? 4.256   -6.168  -16.413 1.00 0.00 ? 60  ARG A NH2  6  
ATOM 9557  H H    . ARG A 1 60  ? 1.292   -9.572  -11.423 1.00 0.00 ? 60  ARG A H    6  
ATOM 9558  H HA   . ARG A 1 60  ? 4.110   -9.072  -11.968 1.00 0.00 ? 60  ARG A HA   6  
ATOM 9559  H HB2  . ARG A 1 60  ? 2.033   -7.484  -12.397 1.00 0.00 ? 60  ARG A HB2  6  
ATOM 9560  H HB3  . ARG A 1 60  ? 2.328   -7.026  -10.725 1.00 0.00 ? 60  ARG A HB3  6  
ATOM 9561  H HG2  . ARG A 1 60  ? 4.338   -6.039  -11.204 1.00 0.00 ? 60  ARG A HG2  6  
ATOM 9562  H HG3  . ARG A 1 60  ? 4.615   -7.043  -12.628 1.00 0.00 ? 60  ARG A HG3  6  
ATOM 9563  H HD2  . ARG A 1 60  ? 2.321   -5.143  -12.634 1.00 0.00 ? 60  ARG A HD2  6  
ATOM 9564  H HD3  . ARG A 1 60  ? 3.950   -4.503  -12.849 1.00 0.00 ? 60  ARG A HD3  6  
ATOM 9565  H HE   . ARG A 1 60  ? 2.423   -6.010  -14.747 1.00 0.00 ? 60  ARG A HE   6  
ATOM 9566  H HH11 . ARG A 1 60  ? 5.642   -5.205  -13.694 1.00 0.00 ? 60  ARG A HH11 6  
ATOM 9567  H HH12 . ARG A 1 60  ? 6.364   -5.509  -15.239 1.00 0.00 ? 60  ARG A HH12 6  
ATOM 9568  H HH21 . ARG A 1 60  ? 3.362   -6.414  -16.786 1.00 0.00 ? 60  ARG A HH21 6  
ATOM 9569  H HH22 . ARG A 1 60  ? 5.066   -6.196  -16.998 1.00 0.00 ? 60  ARG A HH22 6  
ATOM 9570  N N    . HIS A 1 61  ? 4.989   -8.528  -9.628  1.00 0.00 ? 61  HIS A N    6  
ATOM 9571  C CA   . HIS A 1 61  ? 5.558   -8.562  -8.286  1.00 0.00 ? 61  HIS A CA   6  
ATOM 9572  C C    . HIS A 1 61  ? 5.600   -7.163  -7.679  1.00 0.00 ? 61  HIS A C    6  
ATOM 9573  O O    . HIS A 1 61  ? 6.210   -6.251  -8.236  1.00 0.00 ? 61  HIS A O    6  
ATOM 9574  C CB   . HIS A 1 61  ? 6.966   -9.157  -8.321  1.00 0.00 ? 61  HIS A CB   6  
ATOM 9575  C CG   . HIS A 1 61  ? 7.343   -9.878  -7.063  1.00 0.00 ? 61  HIS A CG   6  
ATOM 9576  N ND1  . HIS A 1 61  ? 8.394   -9.490  -6.259  1.00 0.00 ? 61  HIS A ND1  6  
ATOM 9577  C CD2  . HIS A 1 61  ? 6.801   -10.968 -6.470  1.00 0.00 ? 61  HIS A CD2  6  
ATOM 9578  C CE1  . HIS A 1 61  ? 8.483   -10.311 -5.228  1.00 0.00 ? 61  HIS A CE1  6  
ATOM 9579  N NE2  . HIS A 1 61  ? 7.527   -11.216 -5.332  1.00 0.00 ? 61  HIS A NE2  6  
ATOM 9580  H H    . HIS A 1 61  ? 5.535   -8.198  -10.371 1.00 0.00 ? 61  HIS A H    6  
ATOM 9581  H HA   . HIS A 1 61  ? 4.927   -9.187  -7.673  1.00 0.00 ? 61  HIS A HA   6  
ATOM 9582  H HB2  . HIS A 1 61  ? 7.032   -9.861  -9.138  1.00 0.00 ? 61  HIS A HB2  6  
ATOM 9583  H HB3  . HIS A 1 61  ? 7.682   -8.363  -8.476  1.00 0.00 ? 61  HIS A HB3  6  
ATOM 9584  H HD1  . HIS A 1 61  ? 8.987   -8.727  -6.421  1.00 0.00 ? 61  HIS A HD1  6  
ATOM 9585  H HD2  . HIS A 1 61  ? 5.954   -11.537 -6.827  1.00 0.00 ? 61  HIS A HD2  6  
ATOM 9586  H HE1  . HIS A 1 61  ? 9.213   -10.252 -4.434  1.00 0.00 ? 61  HIS A HE1  6  
ATOM 9587  H HE2  . HIS A 1 61  ? 7.420   -11.994 -4.746  1.00 0.00 ? 61  HIS A HE2  6  
ATOM 9588  N N    . GLY A 1 62  ? 4.946   -7.000  -6.532  1.00 0.00 ? 62  GLY A N    6  
ATOM 9589  C CA   . GLY A 1 62  ? 4.920   -5.709  -5.870  1.00 0.00 ? 62  GLY A CA   6  
ATOM 9590  C C    . GLY A 1 62  ? 5.356   -5.793  -4.420  1.00 0.00 ? 62  GLY A C    6  
ATOM 9591  O O    . GLY A 1 62  ? 5.431   -6.881  -3.849  1.00 0.00 ? 62  GLY A O    6  
ATOM 9592  H H    . GLY A 1 62  ? 4.477   -7.763  -6.134  1.00 0.00 ? 62  GLY A H    6  
ATOM 9593  H HA2  . GLY A 1 62  ? 5.579   -5.034  -6.395  1.00 0.00 ? 62  GLY A HA2  6  
ATOM 9594  H HA3  . GLY A 1 62  ? 3.914   -5.318  -5.908  1.00 0.00 ? 62  GLY A HA3  6  
ATOM 9595  N N    . VAL A 1 63  ? 5.647   -4.641  -3.824  1.00 0.00 ? 63  VAL A N    6  
ATOM 9596  C CA   . VAL A 1 63  ? 6.079   -4.589  -2.432  1.00 0.00 ? 63  VAL A CA   6  
ATOM 9597  C C    . VAL A 1 63  ? 5.477   -3.385  -1.715  1.00 0.00 ? 63  VAL A C    6  
ATOM 9598  O O    . VAL A 1 63  ? 5.594   -2.251  -2.179  1.00 0.00 ? 63  VAL A O    6  
ATOM 9599  C CB   . VAL A 1 63  ? 7.614   -4.523  -2.323  1.00 0.00 ? 63  VAL A CB   6  
ATOM 9600  C CG1  . VAL A 1 63  ? 8.031   -4.025  -0.947  1.00 0.00 ? 63  VAL A CG1  6  
ATOM 9601  C CG2  . VAL A 1 63  ? 8.227   -5.885  -2.614  1.00 0.00 ? 63  VAL A CG2  6  
ATOM 9602  H H    . VAL A 1 63  ? 5.568   -3.807  -4.331  1.00 0.00 ? 63  VAL A H    6  
ATOM 9603  H HA   . VAL A 1 63  ? 5.742   -5.492  -1.944  1.00 0.00 ? 63  VAL A HA   6  
ATOM 9604  H HB   . VAL A 1 63  ? 7.977   -3.823  -3.060  1.00 0.00 ? 63  VAL A HB   6  
ATOM 9605  H HG11 . VAL A 1 63  ? 7.357   -4.422  -0.202  1.00 0.00 ? 63  VAL A HG11 6  
ATOM 9606  H HG12 . VAL A 1 63  ? 9.038   -4.353  -0.736  1.00 0.00 ? 63  VAL A HG12 6  
ATOM 9607  H HG13 . VAL A 1 63  ? 7.991   -2.946  -0.929  1.00 0.00 ? 63  VAL A HG13 6  
ATOM 9608  H HG21 . VAL A 1 63  ? 8.246   -6.473  -1.709  1.00 0.00 ? 63  VAL A HG21 6  
ATOM 9609  H HG22 . VAL A 1 63  ? 7.635   -6.392  -3.361  1.00 0.00 ? 63  VAL A HG22 6  
ATOM 9610  H HG23 . VAL A 1 63  ? 9.235   -5.755  -2.980  1.00 0.00 ? 63  VAL A HG23 6  
ATOM 9611  N N    . ALA A 1 64  ? 4.834   -3.640  -0.580  1.00 0.00 ? 64  ALA A N    6  
ATOM 9612  C CA   . ALA A 1 64  ? 4.216   -2.577  0.203   1.00 0.00 ? 64  ALA A CA   6  
ATOM 9613  C C    . ALA A 1 64  ? 5.271   -1.653  0.803   1.00 0.00 ? 64  ALA A C    6  
ATOM 9614  O O    . ALA A 1 64  ? 6.210   -2.110  1.456   1.00 0.00 ? 64  ALA A O    6  
ATOM 9615  C CB   . ALA A 1 64  ? 3.344   -3.168  1.300   1.00 0.00 ? 64  ALA A CB   6  
ATOM 9616  H H    . ALA A 1 64  ? 4.775   -4.564  -0.262  1.00 0.00 ? 64  ALA A H    6  
ATOM 9617  H HA   . ALA A 1 64  ? 3.582   -2.002  -0.457  1.00 0.00 ? 64  ALA A HA   6  
ATOM 9618  H HB1  . ALA A 1 64  ? 2.450   -3.588  0.861   1.00 0.00 ? 64  ALA A HB1  6  
ATOM 9619  H HB2  . ALA A 1 64  ? 3.891   -3.944  1.815   1.00 0.00 ? 64  ALA A HB2  6  
ATOM 9620  H HB3  . ALA A 1 64  ? 3.071   -2.393  2.000   1.00 0.00 ? 64  ALA A HB3  6  
ATOM 9621  N N    . ILE A 1 65  ? 5.111   -0.354  0.577   1.00 0.00 ? 65  ILE A N    6  
ATOM 9622  C CA   . ILE A 1 65  ? 6.049   0.633   1.097   1.00 0.00 ? 65  ILE A CA   6  
ATOM 9623  C C    . ILE A 1 65  ? 5.406   1.482   2.188   1.00 0.00 ? 65  ILE A C    6  
ATOM 9624  O O    . ILE A 1 65  ? 6.096   2.168   2.942   1.00 0.00 ? 65  ILE A O    6  
ATOM 9625  C CB   . ILE A 1 65  ? 6.569   1.558   -0.019  1.00 0.00 ? 65  ILE A CB   6  
ATOM 9626  C CG1  . ILE A 1 65  ? 5.413   2.014   -0.913  1.00 0.00 ? 65  ILE A CG1  6  
ATOM 9627  C CG2  . ILE A 1 65  ? 7.633   0.849   -0.843  1.00 0.00 ? 65  ILE A CG2  6  
ATOM 9628  C CD1  . ILE A 1 65  ? 5.748   3.217   -1.766  1.00 0.00 ? 65  ILE A CD1  6  
ATOM 9629  H H    . ILE A 1 65  ? 4.342   -0.052  0.050   1.00 0.00 ? 65  ILE A H    6  
ATOM 9630  H HA   . ILE A 1 65  ? 6.891   0.102   1.518   1.00 0.00 ? 65  ILE A HA   6  
ATOM 9631  H HB   . ILE A 1 65  ? 7.021   2.423   0.442   1.00 0.00 ? 65  ILE A HB   6  
ATOM 9632  H HG12 . ILE A 1 65  ? 5.135   1.207   -1.572  1.00 0.00 ? 65  ILE A HG12 6  
ATOM 9633  H HG13 . ILE A 1 65  ? 4.568   2.273   -0.291  1.00 0.00 ? 65  ILE A HG13 6  
ATOM 9634  H HG21 . ILE A 1 65  ? 7.434   -0.213  -0.850  1.00 0.00 ? 65  ILE A HG21 6  
ATOM 9635  H HG22 . ILE A 1 65  ? 7.615   1.225   -1.855  1.00 0.00 ? 65  ILE A HG22 6  
ATOM 9636  H HG23 . ILE A 1 65  ? 8.605   1.030   -0.409  1.00 0.00 ? 65  ILE A HG23 6  
ATOM 9637  H HD11 . ILE A 1 65  ? 6.162   2.886   -2.708  1.00 0.00 ? 65  ILE A HD11 6  
ATOM 9638  H HD12 . ILE A 1 65  ? 4.850   3.789   -1.951  1.00 0.00 ? 65  ILE A HD12 6  
ATOM 9639  H HD13 . ILE A 1 65  ? 6.469   3.834   -1.253  1.00 0.00 ? 65  ILE A HD13 6  
ATOM 9640  N N    . TYR A 1 66  ? 4.081   1.430   2.266   1.00 0.00 ? 66  TYR A N    6  
ATOM 9641  C CA   . TYR A 1 66  ? 3.344   2.195   3.265   1.00 0.00 ? 66  TYR A CA   6  
ATOM 9642  C C    . TYR A 1 66  ? 2.376   1.300   4.031   1.00 0.00 ? 66  TYR A C    6  
ATOM 9643  O O    . TYR A 1 66  ? 1.668   0.484   3.442   1.00 0.00 ? 66  TYR A O    6  
ATOM 9644  C CB   . TYR A 1 66  ? 2.579   3.340   2.598   1.00 0.00 ? 66  TYR A CB   6  
ATOM 9645  C CG   . TYR A 1 66  ? 3.474   4.422   2.039   1.00 0.00 ? 66  TYR A CG   6  
ATOM 9646  C CD1  . TYR A 1 66  ? 4.452   5.018   2.825   1.00 0.00 ? 66  TYR A CD1  6  
ATOM 9647  C CD2  . TYR A 1 66  ? 3.343   4.848   0.722   1.00 0.00 ? 66  TYR A CD2  6  
ATOM 9648  C CE1  . TYR A 1 66  ? 5.272   6.007   2.318   1.00 0.00 ? 66  TYR A CE1  6  
ATOM 9649  C CE2  . TYR A 1 66  ? 4.159   5.836   0.207   1.00 0.00 ? 66  TYR A CE2  6  
ATOM 9650  C CZ   . TYR A 1 66  ? 5.122   6.413   1.008   1.00 0.00 ? 66  TYR A CZ   6  
ATOM 9651  O OH   . TYR A 1 66  ? 5.937   7.397   0.499   1.00 0.00 ? 66  TYR A OH   6  
ATOM 9652  H H    . TYR A 1 66  ? 3.586   0.865   1.637   1.00 0.00 ? 66  TYR A H    6  
ATOM 9653  H HA   . TYR A 1 66  ? 4.060   2.610   3.959   1.00 0.00 ? 66  TYR A HA   6  
ATOM 9654  H HB2  . TYR A 1 66  ? 1.990   2.944   1.785   1.00 0.00 ? 66  TYR A HB2  6  
ATOM 9655  H HB3  . TYR A 1 66  ? 1.921   3.795   3.324   1.00 0.00 ? 66  TYR A HB3  6  
ATOM 9656  H HD1  . TYR A 1 66  ? 4.567   4.697   3.851   1.00 0.00 ? 66  TYR A HD1  6  
ATOM 9657  H HD2  . TYR A 1 66  ? 2.588   4.394   0.097   1.00 0.00 ? 66  TYR A HD2  6  
ATOM 9658  H HE1  . TYR A 1 66  ? 6.026   6.459   2.946   1.00 0.00 ? 66  TYR A HE1  6  
ATOM 9659  H HE2  . TYR A 1 66  ? 4.042   6.154   -0.819  1.00 0.00 ? 66  TYR A HE2  6  
ATOM 9660  H HH   . TYR A 1 66  ? 5.758   8.226   0.950   1.00 0.00 ? 66  TYR A HH   6  
ATOM 9661  N N    . ASN A 1 67  ? 2.350   1.460   5.351   1.00 0.00 ? 67  ASN A N    6  
ATOM 9662  C CA   . ASN A 1 67  ? 1.469   0.667   6.200   1.00 0.00 ? 67  ASN A CA   6  
ATOM 9663  C C    . ASN A 1 67  ? 0.007   1.018   5.945   1.00 0.00 ? 67  ASN A C    6  
ATOM 9664  O O    . ASN A 1 67  ? -0.500  2.019   6.450   1.00 0.00 ? 67  ASN A O    6  
ATOM 9665  C CB   . ASN A 1 67  ? 1.809   0.892   7.675   1.00 0.00 ? 67  ASN A CB   6  
ATOM 9666  C CG   . ASN A 1 67  ? 2.937   -0.003  8.151   1.00 0.00 ? 67  ASN A CG   6  
ATOM 9667  O OD1  . ASN A 1 67  ? 3.102   -1.123  7.667   1.00 0.00 ? 67  ASN A OD1  6  
ATOM 9668  N ND2  . ASN A 1 67  ? 3.719   0.488   9.105   1.00 0.00 ? 67  ASN A ND2  6  
ATOM 9669  H H    . ASN A 1 67  ? 2.938   2.127   5.763   1.00 0.00 ? 67  ASN A H    6  
ATOM 9670  H HA   . ASN A 1 67  ? 1.625   -0.374  5.959   1.00 0.00 ? 67  ASN A HA   6  
ATOM 9671  H HB2  . ASN A 1 67  ? 2.108   1.921   7.816   1.00 0.00 ? 67  ASN A HB2  6  
ATOM 9672  H HB3  . ASN A 1 67  ? 0.935   0.690   8.275   1.00 0.00 ? 67  ASN A HB3  6  
ATOM 9673  H HD21 . ASN A 1 67  ? 3.528   1.388   9.444   1.00 0.00 ? 67  ASN A HD21 6  
ATOM 9674  H HD22 . ASN A 1 67  ? 4.456   -0.069  9.432   1.00 0.00 ? 67  ASN A HD22 6  
ATOM 9675  N N    . PHE A 1 68  ? -0.667  0.186   5.157   1.00 0.00 ? 68  PHE A N    6  
ATOM 9676  C CA   . PHE A 1 68  ? -2.071  0.408   4.834   1.00 0.00 ? 68  PHE A CA   6  
ATOM 9677  C C    . PHE A 1 68  ? -2.979  -0.306  5.831   1.00 0.00 ? 68  PHE A C    6  
ATOM 9678  O O    . PHE A 1 68  ? -2.658  -1.394  6.308   1.00 0.00 ? 68  PHE A O    6  
ATOM 9679  C CB   . PHE A 1 68  ? -2.373  -0.078  3.414   1.00 0.00 ? 68  PHE A CB   6  
ATOM 9680  C CG   . PHE A 1 68  ? -3.808  0.104   3.011   1.00 0.00 ? 68  PHE A CG   6  
ATOM 9681  C CD1  . PHE A 1 68  ? -4.750  -0.873  3.294   1.00 0.00 ? 68  PHE A CD1  6  
ATOM 9682  C CD2  . PHE A 1 68  ? -4.216  1.250   2.348   1.00 0.00 ? 68  PHE A CD2  6  
ATOM 9683  C CE1  . PHE A 1 68  ? -6.072  -0.709  2.925   1.00 0.00 ? 68  PHE A CE1  6  
ATOM 9684  C CE2  . PHE A 1 68  ? -5.536  1.420   1.977   1.00 0.00 ? 68  PHE A CE2  6  
ATOM 9685  C CZ   . PHE A 1 68  ? -6.465  0.439   2.264   1.00 0.00 ? 68  PHE A CZ   6  
ATOM 9686  H H    . PHE A 1 68  ? -0.208  -0.596  4.784   1.00 0.00 ? 68  PHE A H    6  
ATOM 9687  H HA   . PHE A 1 68  ? -2.260  1.469   4.890   1.00 0.00 ? 68  PHE A HA   6  
ATOM 9688  H HB2  . PHE A 1 68  ? -1.761  0.472   2.716   1.00 0.00 ? 68  PHE A HB2  6  
ATOM 9689  H HB3  . PHE A 1 68  ? -2.137  -1.129  3.344   1.00 0.00 ? 68  PHE A HB3  6  
ATOM 9690  H HD1  . PHE A 1 68  ? -4.443  -1.771  3.811   1.00 0.00 ? 68  PHE A HD1  6  
ATOM 9691  H HD2  . PHE A 1 68  ? -3.491  2.018   2.122   1.00 0.00 ? 68  PHE A HD2  6  
ATOM 9692  H HE1  . PHE A 1 68  ? -6.795  -1.478  3.151   1.00 0.00 ? 68  PHE A HE1  6  
ATOM 9693  H HE2  . PHE A 1 68  ? -5.841  2.318   1.460   1.00 0.00 ? 68  PHE A HE2  6  
ATOM 9694  H HZ   . PHE A 1 68  ? -7.497  0.569   1.975   1.00 0.00 ? 68  PHE A HZ   6  
ATOM 9695  N N    . GLN A 1 69  ? -4.112  0.315   6.141   1.00 0.00 ? 69  GLN A N    6  
ATOM 9696  C CA   . GLN A 1 69  ? -5.065  -0.261  7.083   1.00 0.00 ? 69  GLN A CA   6  
ATOM 9697  C C    . GLN A 1 69  ? -6.491  -0.144  6.554   1.00 0.00 ? 69  GLN A C    6  
ATOM 9698  O O    . GLN A 1 69  ? -7.006  0.957   6.367   1.00 0.00 ? 69  GLN A O    6  
ATOM 9699  C CB   . GLN A 1 69  ? -4.954  0.433   8.442   1.00 0.00 ? 69  GLN A CB   6  
ATOM 9700  C CG   . GLN A 1 69  ? -5.160  1.938   8.375   1.00 0.00 ? 69  GLN A CG   6  
ATOM 9701  C CD   . GLN A 1 69  ? -4.654  2.651   9.613   1.00 0.00 ? 69  GLN A CD   6  
ATOM 9702  O OE1  . GLN A 1 69  ? -4.186  2.019   10.561  1.00 0.00 ? 69  GLN A OE1  6  
ATOM 9703  N NE2  . GLN A 1 69  ? -4.745  3.976   9.612   1.00 0.00 ? 69  GLN A NE2  6  
ATOM 9704  H H    . GLN A 1 69  ? -4.312  1.180   5.728   1.00 0.00 ? 69  GLN A H    6  
ATOM 9705  H HA   . GLN A 1 69  ? -4.823  -1.306  7.202   1.00 0.00 ? 69  GLN A HA   6  
ATOM 9706  H HB2  . GLN A 1 69  ? -5.697  0.018   9.106   1.00 0.00 ? 69  GLN A HB2  6  
ATOM 9707  H HB3  . GLN A 1 69  ? -3.972  0.244   8.850   1.00 0.00 ? 69  GLN A HB3  6  
ATOM 9708  H HG2  . GLN A 1 69  ? -4.633  2.323   7.516   1.00 0.00 ? 69  GLN A HG2  6  
ATOM 9709  H HG3  . GLN A 1 69  ? -6.216  2.139   8.268   1.00 0.00 ? 69  GLN A HG3  6  
ATOM 9710  H HE21 . GLN A 1 69  ? -5.130  4.412   8.822   1.00 0.00 ? 69  GLN A HE21 6  
ATOM 9711  H HE22 . GLN A 1 69  ? -4.426  4.463   10.399  1.00 0.00 ? 69  GLN A HE22 6  
ATOM 9712  N N    . GLY A 1 70  ? -7.124  -1.289  6.315   1.00 0.00 ? 70  GLY A N    6  
ATOM 9713  C CA   . GLY A 1 70  ? -8.484  -1.292  5.809   1.00 0.00 ? 70  GLY A CA   6  
ATOM 9714  C C    . GLY A 1 70  ? -9.491  -1.722  6.858   1.00 0.00 ? 70  GLY A C    6  
ATOM 9715  O O    . GLY A 1 70  ? -9.177  -1.772  8.047   1.00 0.00 ? 70  GLY A O    6  
ATOM 9716  H H    . GLY A 1 70  ? -6.663  -2.137  6.483   1.00 0.00 ? 70  GLY A H    6  
ATOM 9717  H HA2  . GLY A 1 70  ? -8.734  -0.298  5.472   1.00 0.00 ? 70  GLY A HA2  6  
ATOM 9718  H HA3  . GLY A 1 70  ? -8.543  -1.971  4.971   1.00 0.00 ? 70  GLY A HA3  6  
ATOM 9719  N N    . SER A 1 71  ? -10.706 -2.033  6.417   1.00 0.00 ? 71  SER A N    6  
ATOM 9720  C CA   . SER A 1 71  ? -11.764 -2.455  7.327   1.00 0.00 ? 71  SER A CA   6  
ATOM 9721  C C    . SER A 1 71  ? -12.246 -3.862  6.984   1.00 0.00 ? 71  SER A C    6  
ATOM 9722  O O    . SER A 1 71  ? -12.497 -4.677  7.870   1.00 0.00 ? 71  SER A O    6  
ATOM 9723  C CB   . SER A 1 71  ? -12.937 -1.474  7.269   1.00 0.00 ? 71  SER A CB   6  
ATOM 9724  O OG   . SER A 1 71  ? -12.749 -0.400  8.173   1.00 0.00 ? 71  SER A OG   6  
ATOM 9725  H H    . SER A 1 71  ? -10.896 -1.974  5.457   1.00 0.00 ? 71  SER A H    6  
ATOM 9726  H HA   . SER A 1 71  ? -11.359 -2.460  8.327   1.00 0.00 ? 71  SER A HA   6  
ATOM 9727  H HB2  . SER A 1 71  ? -13.022 -1.077  6.269   1.00 0.00 ? 71  SER A HB2  6  
ATOM 9728  H HB3  . SER A 1 71  ? -13.849 -1.993  7.529   1.00 0.00 ? 71  SER A HB3  6  
ATOM 9729  H HG   . SER A 1 71  ? -11.837 -0.103  8.132   1.00 0.00 ? 71  SER A HG   6  
ATOM 9730  N N    . GLY A 1 72  ? -12.372 -4.139  5.690   1.00 0.00 ? 72  GLY A N    6  
ATOM 9731  C CA   . GLY A 1 72  ? -12.822 -5.447  5.251   1.00 0.00 ? 72  GLY A CA   6  
ATOM 9732  C C    . GLY A 1 72  ? -13.011 -5.522  3.749   1.00 0.00 ? 72  GLY A C    6  
ATOM 9733  O O    . GLY A 1 72  ? -13.259 -4.509  3.097   1.00 0.00 ? 72  GLY A O    6  
ATOM 9734  H H    . GLY A 1 72  ? -12.157 -3.449  5.027   1.00 0.00 ? 72  GLY A H    6  
ATOM 9735  H HA2  . GLY A 1 72  ? -12.093 -6.185  5.550   1.00 0.00 ? 72  GLY A HA2  6  
ATOM 9736  H HA3  . GLY A 1 72  ? -13.764 -5.670  5.732   1.00 0.00 ? 72  GLY A HA3  6  
ATOM 9737  N N    . ALA A 1 73  ? -12.891 -6.726  3.199   1.00 0.00 ? 73  ALA A N    6  
ATOM 9738  C CA   . ALA A 1 73  ? -13.050 -6.929  1.764   1.00 0.00 ? 73  ALA A CA   6  
ATOM 9739  C C    . ALA A 1 73  ? -14.125 -6.009  1.195   1.00 0.00 ? 73  ALA A C    6  
ATOM 9740  O O    . ALA A 1 73  ? -15.071 -5.622  1.881   1.00 0.00 ? 73  ALA A O    6  
ATOM 9741  C CB   . ALA A 1 73  ? -13.389 -8.383  1.471   1.00 0.00 ? 73  ALA A CB   6  
ATOM 9742  H H    . ALA A 1 73  ? -12.692 -7.495  3.771   1.00 0.00 ? 73  ALA A H    6  
ATOM 9743  H HA   . ALA A 1 73  ? -12.107 -6.702  1.288   1.00 0.00 ? 73  ALA A HA   6  
ATOM 9744  H HB1  . ALA A 1 73  ? -12.664 -9.024  1.952   1.00 0.00 ? 73  ALA A HB1  6  
ATOM 9745  H HB2  . ALA A 1 73  ? -14.375 -8.606  1.850   1.00 0.00 ? 73  ALA A HB2  6  
ATOM 9746  H HB3  . ALA A 1 73  ? -13.366 -8.550  0.405   1.00 0.00 ? 73  ALA A HB3  6  
ATOM 9747  N N    . PRO A 1 74  ? -13.976 -5.647  -0.088  1.00 0.00 ? 74  PRO A N    6  
ATOM 9748  C CA   . PRO A 1 74  ? -12.853 -6.100  -0.913  1.00 0.00 ? 74  PRO A CA   6  
ATOM 9749  C C    . PRO A 1 74  ? -11.529 -5.478  -0.483  1.00 0.00 ? 74  PRO A C    6  
ATOM 9750  O O    . PRO A 1 74  ? -10.473 -5.813  -1.019  1.00 0.00 ? 74  PRO A O    6  
ATOM 9751  C CB   . PRO A 1 74  ? -13.234 -5.630  -2.320  1.00 0.00 ? 74  PRO A CB   6  
ATOM 9752  C CG   . PRO A 1 74  ? -14.140 -4.469  -2.098  1.00 0.00 ? 74  PRO A CG   6  
ATOM 9753  C CD   . PRO A 1 74  ? -14.894 -4.768  -0.832  1.00 0.00 ? 74  PRO A CD   6  
ATOM 9754  H HA   . PRO A 1 74  ? -12.763 -7.177  -0.904  1.00 0.00 ? 74  PRO A HA   6  
ATOM 9755  H HB2  . PRO A 1 74  ? -12.342 -5.339  -2.858  1.00 0.00 ? 74  PRO A HB2  6  
ATOM 9756  H HB3  . PRO A 1 74  ? -13.735 -6.427  -2.846  1.00 0.00 ? 74  PRO A HB3  6  
ATOM 9757  H HG2  . PRO A 1 74  ? -13.560 -3.566  -1.985  1.00 0.00 ? 74  PRO A HG2  6  
ATOM 9758  H HG3  . PRO A 1 74  ? -14.825 -4.375  -2.928  1.00 0.00 ? 74  PRO A HG3  6  
ATOM 9759  H HD2  . PRO A 1 74  ? -15.086 -3.858  -0.283  1.00 0.00 ? 74  PRO A HD2  6  
ATOM 9760  H HD3  . PRO A 1 74  ? -15.820 -5.278  -1.055  1.00 0.00 ? 74  PRO A HD3  6  
ATOM 9761  N N    . GLN A 1 75  ? -11.595 -4.571  0.486   1.00 0.00 ? 75  GLN A N    6  
ATOM 9762  C CA   . GLN A 1 75  ? -10.400 -3.901  0.987   1.00 0.00 ? 75  GLN A CA   6  
ATOM 9763  C C    . GLN A 1 75  ? -9.510  -4.876  1.751   1.00 0.00 ? 75  GLN A C    6  
ATOM 9764  O O    . GLN A 1 75  ? -9.998  -5.712  2.513   1.00 0.00 ? 75  GLN A O    6  
ATOM 9765  C CB   . GLN A 1 75  ? -10.787 -2.730  1.891   1.00 0.00 ? 75  GLN A CB   6  
ATOM 9766  C CG   . GLN A 1 75  ? -11.175 -1.474  1.127   1.00 0.00 ? 75  GLN A CG   6  
ATOM 9767  C CD   . GLN A 1 75  ? -12.156 -0.606  1.890   1.00 0.00 ? 75  GLN A CD   6  
ATOM 9768  O OE1  . GLN A 1 75  ? -11.810 -0.003  2.906   1.00 0.00 ? 75  GLN A OE1  6  
ATOM 9769  N NE2  . GLN A 1 75  ? -13.389 -0.538  1.402   1.00 0.00 ? 75  GLN A NE2  6  
ATOM 9770  H H    . GLN A 1 75  ? -12.466 -4.346  0.873   1.00 0.00 ? 75  GLN A H    6  
ATOM 9771  H HA   . GLN A 1 75  ? -9.852  -3.523  0.138   1.00 0.00 ? 75  GLN A HA   6  
ATOM 9772  H HB2  . GLN A 1 75  ? -11.626 -3.025  2.504   1.00 0.00 ? 75  GLN A HB2  6  
ATOM 9773  H HB3  . GLN A 1 75  ? -9.950  -2.492  2.530   1.00 0.00 ? 75  GLN A HB3  6  
ATOM 9774  H HG2  . GLN A 1 75  ? -10.283 -0.896  0.933   1.00 0.00 ? 75  GLN A HG2  6  
ATOM 9775  H HG3  . GLN A 1 75  ? -11.625 -1.763  0.189   1.00 0.00 ? 75  GLN A HG3  6  
ATOM 9776  H HE21 . GLN A 1 75  ? -13.594 -1.046  0.589   1.00 0.00 ? 75  GLN A HE21 6  
ATOM 9777  H HE22 . GLN A 1 75  ? -14.044 0.015   1.876   1.00 0.00 ? 75  GLN A HE22 6  
ATOM 9778  N N    . LEU A 1 76  ? -8.203  -4.763  1.543   1.00 0.00 ? 76  LEU A N    6  
ATOM 9779  C CA   . LEU A 1 76  ? -7.244  -5.635  2.213   1.00 0.00 ? 76  LEU A CA   6  
ATOM 9780  C C    . LEU A 1 76  ? -6.140  -4.820  2.879   1.00 0.00 ? 76  LEU A C    6  
ATOM 9781  O O    . LEU A 1 76  ? -5.753  -3.761  2.386   1.00 0.00 ? 76  LEU A O    6  
ATOM 9782  C CB   . LEU A 1 76  ? -6.634  -6.619  1.212   1.00 0.00 ? 76  LEU A CB   6  
ATOM 9783  C CG   . LEU A 1 76  ? -5.446  -7.439  1.716   1.00 0.00 ? 76  LEU A CG   6  
ATOM 9784  C CD1  . LEU A 1 76  ? -5.925  -8.731  2.361   1.00 0.00 ? 76  LEU A CD1  6  
ATOM 9785  C CD2  . LEU A 1 76  ? -4.481  -7.735  0.578   1.00 0.00 ? 76  LEU A CD2  6  
ATOM 9786  H H    . LEU A 1 76  ? -7.874  -4.078  0.925   1.00 0.00 ? 76  LEU A H    6  
ATOM 9787  H HA   . LEU A 1 76  ? -7.774  -6.189  2.972   1.00 0.00 ? 76  LEU A HA   6  
ATOM 9788  H HB2  . LEU A 1 76  ? -7.408  -7.308  0.913   1.00 0.00 ? 76  LEU A HB2  6  
ATOM 9789  H HB3  . LEU A 1 76  ? -6.305  -6.053  0.352   1.00 0.00 ? 76  LEU A HB3  6  
ATOM 9790  H HG   . LEU A 1 76  ? -4.916  -6.869  2.467   1.00 0.00 ? 76  LEU A HG   6  
ATOM 9791  H HD11 . LEU A 1 76  ? -5.188  -9.504  2.208   1.00 0.00 ? 76  LEU A HD11 6  
ATOM 9792  H HD12 . LEU A 1 76  ? -6.861  -9.031  1.913   1.00 0.00 ? 76  LEU A HD12 6  
ATOM 9793  H HD13 . LEU A 1 76  ? -6.068  -8.573  3.420   1.00 0.00 ? 76  LEU A HD13 6  
ATOM 9794  H HD21 . LEU A 1 76  ? -4.110  -8.744  0.674   1.00 0.00 ? 76  LEU A HD21 6  
ATOM 9795  H HD22 . LEU A 1 76  ? -3.654  -7.042  0.619   1.00 0.00 ? 76  LEU A HD22 6  
ATOM 9796  H HD23 . LEU A 1 76  ? -4.994  -7.627  -0.367  1.00 0.00 ? 76  LEU A HD23 6  
ATOM 9797  N N    . SER A 1 77  ? -5.636  -5.323  4.001   1.00 0.00 ? 77  SER A N    6  
ATOM 9798  C CA   . SER A 1 77  ? -4.577  -4.641  4.736   1.00 0.00 ? 77  SER A CA   6  
ATOM 9799  C C    . SER A 1 77  ? -3.205  -5.011  4.181   1.00 0.00 ? 77  SER A C    6  
ATOM 9800  O O    . SER A 1 77  ? -3.041  -6.049  3.539   1.00 0.00 ? 77  SER A O    6  
ATOM 9801  C CB   . SER A 1 77  ? -4.650  -4.994  6.223   1.00 0.00 ? 77  SER A CB   6  
ATOM 9802  O OG   . SER A 1 77  ? -4.403  -6.374  6.432   1.00 0.00 ? 77  SER A OG   6  
ATOM 9803  H H    . SER A 1 77  ? -5.986  -6.172  4.344   1.00 0.00 ? 77  SER A H    6  
ATOM 9804  H HA   . SER A 1 77  ? -4.725  -3.577  4.620   1.00 0.00 ? 77  SER A HA   6  
ATOM 9805  H HB2  . SER A 1 77  ? -3.911  -4.422  6.763   1.00 0.00 ? 77  SER A HB2  6  
ATOM 9806  H HB3  . SER A 1 77  ? -5.635  -4.756  6.599   1.00 0.00 ? 77  SER A HB3  6  
ATOM 9807  H HG   . SER A 1 77  ? -4.726  -6.875  5.680   1.00 0.00 ? 77  SER A HG   6  
ATOM 9808  N N    . LEU A 1 78  ? -2.221  -4.154  4.433   1.00 0.00 ? 78  LEU A N    6  
ATOM 9809  C CA   . LEU A 1 78  ? -0.862  -4.389  3.959   1.00 0.00 ? 78  LEU A CA   6  
ATOM 9810  C C    . LEU A 1 78  ? 0.162   -3.820  4.937   1.00 0.00 ? 78  LEU A C    6  
ATOM 9811  O O    . LEU A 1 78  ? -0.117  -2.858  5.651   1.00 0.00 ? 78  LEU A O    6  
ATOM 9812  C CB   . LEU A 1 78  ? -0.667  -3.763  2.577   1.00 0.00 ? 78  LEU A CB   6  
ATOM 9813  C CG   . LEU A 1 78  ? -1.155  -4.592  1.389   1.00 0.00 ? 78  LEU A CG   6  
ATOM 9814  C CD1  . LEU A 1 78  ? -1.006  -3.810  0.094   1.00 0.00 ? 78  LEU A CD1  6  
ATOM 9815  C CD2  . LEU A 1 78  ? -0.395  -5.908  1.310   1.00 0.00 ? 78  LEU A CD2  6  
ATOM 9816  H H    . LEU A 1 78  ? -2.413  -3.344  4.950   1.00 0.00 ? 78  LEU A H    6  
ATOM 9817  H HA   . LEU A 1 78  ? -0.717  -5.456  3.885   1.00 0.00 ? 78  LEU A HA   6  
ATOM 9818  H HB2  . LEU A 1 78  ? -1.196  -2.822  2.563   1.00 0.00 ? 78  LEU A HB2  6  
ATOM 9819  H HB3  . LEU A 1 78  ? 0.390   -3.581  2.444   1.00 0.00 ? 78  LEU A HB3  6  
ATOM 9820  H HG   . LEU A 1 78  ? -2.204  -4.818  1.523   1.00 0.00 ? 78  LEU A HG   6  
ATOM 9821  H HD11 . LEU A 1 78  ? 0.028   -3.823  -0.217  1.00 0.00 ? 78  LEU A HD11 6  
ATOM 9822  H HD12 . LEU A 1 78  ? -1.321  -2.789  0.252   1.00 0.00 ? 78  LEU A HD12 6  
ATOM 9823  H HD13 . LEU A 1 78  ? -1.619  -4.261  -0.672  1.00 0.00 ? 78  LEU A HD13 6  
ATOM 9824  H HD21 . LEU A 1 78  ? 0.196   -5.929  0.407   1.00 0.00 ? 78  LEU A HD21 6  
ATOM 9825  H HD22 . LEU A 1 78  ? -1.097  -6.729  1.300   1.00 0.00 ? 78  LEU A HD22 6  
ATOM 9826  H HD23 . LEU A 1 78  ? 0.254   -6.001  2.169   1.00 0.00 ? 78  LEU A HD23 6  
ATOM 9827  N N    . GLN A 1 79  ? 1.347   -4.421  4.961   1.00 0.00 ? 79  GLN A N    6  
ATOM 9828  C CA   . GLN A 1 79  ? 2.412   -3.972  5.849   1.00 0.00 ? 79  GLN A CA   6  
ATOM 9829  C C    . GLN A 1 79  ? 3.708   -3.750  5.077   1.00 0.00 ? 79  GLN A C    6  
ATOM 9830  O O    . GLN A 1 79  ? 4.095   -4.571  4.245   1.00 0.00 ? 79  GLN A O    6  
ATOM 9831  C CB   . GLN A 1 79  ? 2.639   -4.994  6.965   1.00 0.00 ? 79  GLN A CB   6  
ATOM 9832  C CG   . GLN A 1 79  ? 1.731   -4.793  8.168   1.00 0.00 ? 79  GLN A CG   6  
ATOM 9833  C CD   . GLN A 1 79  ? 1.817   -5.935  9.161   1.00 0.00 ? 79  GLN A CD   6  
ATOM 9834  O OE1  . GLN A 1 79  ? 0.852   -6.675  9.358   1.00 0.00 ? 79  GLN A OE1  6  
ATOM 9835  N NE2  . GLN A 1 79  ? 2.975   -6.085  9.793   1.00 0.00 ? 79  GLN A NE2  6  
ATOM 9836  H H    . GLN A 1 79  ? 1.509   -5.183  4.367   1.00 0.00 ? 79  GLN A H    6  
ATOM 9837  H HA   . GLN A 1 79  ? 2.105   -3.036  6.289   1.00 0.00 ? 79  GLN A HA   6  
ATOM 9838  H HB2  . GLN A 1 79  ? 2.464   -5.984  6.571   1.00 0.00 ? 79  GLN A HB2  6  
ATOM 9839  H HB3  . GLN A 1 79  ? 3.663   -4.924  7.299   1.00 0.00 ? 79  GLN A HB3  6  
ATOM 9840  H HG2  . GLN A 1 79  ? 2.015   -3.880  8.668   1.00 0.00 ? 79  GLN A HG2  6  
ATOM 9841  H HG3  . GLN A 1 79  ? 0.711   -4.711  7.822   1.00 0.00 ? 79  GLN A HG3  6  
ATOM 9842  H HE21 . GLN A 1 79  ? 3.699   -5.458  9.586   1.00 0.00 ? 79  GLN A HE21 6  
ATOM 9843  H HE22 . GLN A 1 79  ? 3.057   -6.815  10.440  1.00 0.00 ? 79  GLN A HE22 6  
ATOM 9844  N N    . ILE A 1 80  ? 4.374   -2.634  5.357   1.00 0.00 ? 80  ILE A N    6  
ATOM 9845  C CA   . ILE A 1 80  ? 5.627   -2.305  4.689   1.00 0.00 ? 80  ILE A CA   6  
ATOM 9846  C C    . ILE A 1 80  ? 6.575   -3.499  4.679   1.00 0.00 ? 80  ILE A C    6  
ATOM 9847  O O    . ILE A 1 80  ? 6.842   -4.103  5.717   1.00 0.00 ? 80  ILE A O    6  
ATOM 9848  C CB   . ILE A 1 80  ? 6.329   -1.112  5.365   1.00 0.00 ? 80  ILE A CB   6  
ATOM 9849  C CG1  . ILE A 1 80  ? 5.389   0.093   5.425   1.00 0.00 ? 80  ILE A CG1  6  
ATOM 9850  C CG2  . ILE A 1 80  ? 7.607   -0.758  4.619   1.00 0.00 ? 80  ILE A CG2  6  
ATOM 9851  C CD1  . ILE A 1 80  ? 5.994   1.298   6.110   1.00 0.00 ? 80  ILE A CD1  6  
ATOM 9852  H H    . ILE A 1 80  ? 4.015   -2.019  6.030   1.00 0.00 ? 80  ILE A H    6  
ATOM 9853  H HA   . ILE A 1 80  ? 5.398   -2.032  3.669   1.00 0.00 ? 80  ILE A HA   6  
ATOM 9854  H HB   . ILE A 1 80  ? 6.596   -1.402  6.369   1.00 0.00 ? 80  ILE A HB   6  
ATOM 9855  H HG12 . ILE A 1 80  ? 5.121   0.384   4.421   1.00 0.00 ? 80  ILE A HG12 6  
ATOM 9856  H HG13 . ILE A 1 80  ? 4.495   -0.183  5.966   1.00 0.00 ? 80  ILE A HG13 6  
ATOM 9857  H HG21 . ILE A 1 80  ? 8.038   -1.654  4.197   1.00 0.00 ? 80  ILE A HG21 6  
ATOM 9858  H HG22 . ILE A 1 80  ? 7.379   -0.062  3.825   1.00 0.00 ? 80  ILE A HG22 6  
ATOM 9859  H HG23 . ILE A 1 80  ? 8.310   -0.307  5.303   1.00 0.00 ? 80  ILE A HG23 6  
ATOM 9860  H HD11 . ILE A 1 80  ? 5.502   1.457   7.059   1.00 0.00 ? 80  ILE A HD11 6  
ATOM 9861  H HD12 . ILE A 1 80  ? 7.048   1.127   6.276   1.00 0.00 ? 80  ILE A HD12 6  
ATOM 9862  H HD13 . ILE A 1 80  ? 5.864   2.171   5.488   1.00 0.00 ? 80  ILE A HD13 6  
ATOM 9863  N N    . GLY A 1 81  ? 7.084   -3.834  3.497   1.00 0.00 ? 81  GLY A N    6  
ATOM 9864  C CA   . GLY A 1 81  ? 7.999   -4.954  3.373   1.00 0.00 ? 81  GLY A CA   6  
ATOM 9865  C C    . GLY A 1 81  ? 7.288   -6.248  3.032   1.00 0.00 ? 81  GLY A C    6  
ATOM 9866  O O    . GLY A 1 81  ? 7.839   -7.334  3.216   1.00 0.00 ? 81  GLY A O    6  
ATOM 9867  H H    . GLY A 1 81  ? 6.836   -3.316  2.702   1.00 0.00 ? 81  GLY A H    6  
ATOM 9868  H HA2  . GLY A 1 81  ? 8.717   -4.734  2.597   1.00 0.00 ? 81  GLY A HA2  6  
ATOM 9869  H HA3  . GLY A 1 81  ? 8.523   -5.080  4.309   1.00 0.00 ? 81  GLY A HA3  6  
ATOM 9870  N N    . ASP A 1 82  ? 6.061   -6.135  2.537   1.00 0.00 ? 82  ASP A N    6  
ATOM 9871  C CA   . ASP A 1 82  ? 5.273   -7.306  2.170   1.00 0.00 ? 82  ASP A CA   6  
ATOM 9872  C C    . ASP A 1 82  ? 5.076   -7.377  0.659   1.00 0.00 ? 82  ASP A C    6  
ATOM 9873  O O    . ASP A 1 82  ? 4.929   -6.353  -0.008  1.00 0.00 ? 82  ASP A O    6  
ATOM 9874  C CB   . ASP A 1 82  ? 3.915   -7.273  2.873   1.00 0.00 ? 82  ASP A CB   6  
ATOM 9875  C CG   . ASP A 1 82  ? 4.018   -7.605  4.348   1.00 0.00 ? 82  ASP A CG   6  
ATOM 9876  O OD1  . ASP A 1 82  ? 5.130   -7.948  4.803   1.00 0.00 ? 82  ASP A OD1  6  
ATOM 9877  O OD2  . ASP A 1 82  ? 2.988   -7.522  5.048   1.00 0.00 ? 82  ASP A OD2  6  
ATOM 9878  H H    . ASP A 1 82  ? 5.676   -5.242  2.414   1.00 0.00 ? 82  ASP A H    6  
ATOM 9879  H HA   . ASP A 1 82  ? 5.813   -8.183  2.492   1.00 0.00 ? 82  ASP A HA   6  
ATOM 9880  H HB2  . ASP A 1 82  ? 3.489   -6.285  2.774   1.00 0.00 ? 82  ASP A HB2  6  
ATOM 9881  H HB3  . ASP A 1 82  ? 3.258   -7.992  2.405   1.00 0.00 ? 82  ASP A HB3  6  
ATOM 9882  N N    . VAL A 1 83  ? 5.076   -8.594  0.124   1.00 0.00 ? 83  VAL A N    6  
ATOM 9883  C CA   . VAL A 1 83  ? 4.898   -8.800  -1.308  1.00 0.00 ? 83  VAL A CA   6  
ATOM 9884  C C    . VAL A 1 83  ? 3.557   -9.462  -1.606  1.00 0.00 ? 83  VAL A C    6  
ATOM 9885  O O    . VAL A 1 83  ? 3.170   -10.427 -0.948  1.00 0.00 ? 83  VAL A O    6  
ATOM 9886  C CB   . VAL A 1 83  ? 6.028   -9.666  -1.896  1.00 0.00 ? 83  VAL A CB   6  
ATOM 9887  C CG1  . VAL A 1 83  ? 5.791   -9.920  -3.377  1.00 0.00 ? 83  VAL A CG1  6  
ATOM 9888  C CG2  . VAL A 1 83  ? 7.379   -9.004  -1.669  1.00 0.00 ? 83  VAL A CG2  6  
ATOM 9889  H H    . VAL A 1 83  ? 5.198   -9.372  0.707   1.00 0.00 ? 83  VAL A H    6  
ATOM 9890  H HA   . VAL A 1 83  ? 4.926   -7.833  -1.790  1.00 0.00 ? 83  VAL A HA   6  
ATOM 9891  H HB   . VAL A 1 83  ? 6.026   -10.618 -1.386  1.00 0.00 ? 83  VAL A HB   6  
ATOM 9892  H HG11 . VAL A 1 83  ? 6.424   -9.267  -3.959  1.00 0.00 ? 83  VAL A HG11 6  
ATOM 9893  H HG12 . VAL A 1 83  ? 6.023   -10.949 -3.608  1.00 0.00 ? 83  VAL A HG12 6  
ATOM 9894  H HG13 . VAL A 1 83  ? 4.756   -9.722  -3.615  1.00 0.00 ? 83  VAL A HG13 6  
ATOM 9895  H HG21 . VAL A 1 83  ? 8.081   -9.736  -1.299  1.00 0.00 ? 83  VAL A HG21 6  
ATOM 9896  H HG22 . VAL A 1 83  ? 7.740   -8.597  -2.602  1.00 0.00 ? 83  VAL A HG22 6  
ATOM 9897  H HG23 . VAL A 1 83  ? 7.273   -8.208  -0.946  1.00 0.00 ? 83  VAL A HG23 6  
ATOM 9898  N N    . VAL A 1 84  ? 2.852   -8.937  -2.603  1.00 0.00 ? 84  VAL A N    6  
ATOM 9899  C CA   . VAL A 1 84  ? 1.555   -9.478  -2.990  1.00 0.00 ? 84  VAL A CA   6  
ATOM 9900  C C    . VAL A 1 84  ? 1.537   -9.861  -4.465  1.00 0.00 ? 84  VAL A C    6  
ATOM 9901  O O    . VAL A 1 84  ? 2.131   -9.179  -5.301  1.00 0.00 ? 84  VAL A O    6  
ATOM 9902  C CB   . VAL A 1 84  ? 0.423   -8.470  -2.718  1.00 0.00 ? 84  VAL A CB   6  
ATOM 9903  C CG1  . VAL A 1 84  ? 0.363   -8.119  -1.239  1.00 0.00 ? 84  VAL A CG1  6  
ATOM 9904  C CG2  . VAL A 1 84  ? 0.609   -7.219  -3.564  1.00 0.00 ? 84  VAL A CG2  6  
ATOM 9905  H H    . VAL A 1 84  ? 3.214   -8.168  -3.090  1.00 0.00 ? 84  VAL A H    6  
ATOM 9906  H HA   . VAL A 1 84  ? 1.371   -10.362 -2.396  1.00 0.00 ? 84  VAL A HA   6  
ATOM 9907  H HB   . VAL A 1 84  ? -0.515  -8.929  -2.995  1.00 0.00 ? 84  VAL A HB   6  
ATOM 9908  H HG11 . VAL A 1 84  ? 0.941   -8.837  -0.676  1.00 0.00 ? 84  VAL A HG11 6  
ATOM 9909  H HG12 . VAL A 1 84  ? 0.768   -7.129  -1.087  1.00 0.00 ? 84  VAL A HG12 6  
ATOM 9910  H HG13 . VAL A 1 84  ? -0.664  -8.143  -0.905  1.00 0.00 ? 84  VAL A HG13 6  
ATOM 9911  H HG21 . VAL A 1 84  ? 0.231   -6.362  -3.028  1.00 0.00 ? 84  VAL A HG21 6  
ATOM 9912  H HG22 . VAL A 1 84  ? 1.660   -7.080  -3.772  1.00 0.00 ? 84  VAL A HG22 6  
ATOM 9913  H HG23 . VAL A 1 84  ? 0.070   -7.329  -4.494  1.00 0.00 ? 84  VAL A HG23 6  
ATOM 9914  N N    . ARG A 1 85  ? 0.851   -10.955 -4.779  1.00 0.00 ? 85  ARG A N    6  
ATOM 9915  C CA   . ARG A 1 85  ? 0.756   -11.429 -6.154  1.00 0.00 ? 85  ARG A CA   6  
ATOM 9916  C C    . ARG A 1 85  ? -0.313  -10.657 -6.923  1.00 0.00 ? 85  ARG A C    6  
ATOM 9917  O O    . ARG A 1 85  ? -1.510  -10.868 -6.721  1.00 0.00 ? 85  ARG A O    6  
ATOM 9918  C CB   . ARG A 1 85  ? 0.437   -12.925 -6.179  1.00 0.00 ? 85  ARG A CB   6  
ATOM 9919  C CG   . ARG A 1 85  ? 0.995   -13.647 -7.395  1.00 0.00 ? 85  ARG A CG   6  
ATOM 9920  C CD   . ARG A 1 85  ? 2.480   -13.936 -7.237  1.00 0.00 ? 85  ARG A CD   6  
ATOM 9921  N NE   . ARG A 1 85  ? 2.722   -15.158 -6.475  1.00 0.00 ? 85  ARG A NE   6  
ATOM 9922  C CZ   . ARG A 1 85  ? 2.465   -16.376 -6.939  1.00 0.00 ? 85  ARG A CZ   6  
ATOM 9923  N NH1  . ARG A 1 85  ? 1.963   -16.534 -8.156  1.00 0.00 ? 85  ARG A NH1  6  
ATOM 9924  N NH2  . ARG A 1 85  ? 2.713   -17.440 -6.185  1.00 0.00 ? 85  ARG A NH2  6  
ATOM 9925  H H    . ARG A 1 85  ? 0.398   -11.456 -4.068  1.00 0.00 ? 85  ARG A H    6  
ATOM 9926  H HA   . ARG A 1 85  ? 1.712   -11.266 -6.628  1.00 0.00 ? 85  ARG A HA   6  
ATOM 9927  H HB2  . ARG A 1 85  ? 0.851   -13.385 -5.294  1.00 0.00 ? 85  ARG A HB2  6  
ATOM 9928  H HB3  . ARG A 1 85  ? -0.635  -13.052 -6.173  1.00 0.00 ? 85  ARG A HB3  6  
ATOM 9929  H HG2  . ARG A 1 85  ? 0.469   -14.582 -7.520  1.00 0.00 ? 85  ARG A HG2  6  
ATOM 9930  H HG3  . ARG A 1 85  ? 0.848   -13.029 -8.268  1.00 0.00 ? 85  ARG A HG3  6  
ATOM 9931  H HD2  . ARG A 1 85  ? 2.918   -14.042 -8.218  1.00 0.00 ? 85  ARG A HD2  6  
ATOM 9932  H HD3  . ARG A 1 85  ? 2.942   -13.106 -6.725  1.00 0.00 ? 85  ARG A HD3  6  
ATOM 9933  H HE   . ARG A 1 85  ? 3.093   -15.065 -5.574  1.00 0.00 ? 85  ARG A HE   6  
ATOM 9934  H HH11 . ARG A 1 85  ? 1.776   -15.734 -8.726  1.00 0.00 ? 85  ARG A HH11 6  
ATOM 9935  H HH12 . ARG A 1 85  ? 1.772   -17.452 -8.503  1.00 0.00 ? 85  ARG A HH12 6  
ATOM 9936  H HH21 . ARG A 1 85  ? 3.092   -17.325 -5.268  1.00 0.00 ? 85  ARG A HH21 6  
ATOM 9937  H HH22 . ARG A 1 85  ? 2.520   -18.356 -6.535  1.00 0.00 ? 85  ARG A HH22 6  
ATOM 9938  N N    . ILE A 1 86  ? 0.127   -9.764  -7.802  1.00 0.00 ? 86  ILE A N    6  
ATOM 9939  C CA   . ILE A 1 86  ? -0.791  -8.962  -8.600  1.00 0.00 ? 86  ILE A CA   6  
ATOM 9940  C C    . ILE A 1 86  ? -1.392  -9.782  -9.737  1.00 0.00 ? 86  ILE A C    6  
ATOM 9941  O O    . ILE A 1 86  ? -0.670  -10.403 -10.516 1.00 0.00 ? 86  ILE A O    6  
ATOM 9942  C CB   . ILE A 1 86  ? -0.090  -7.724  -9.191  1.00 0.00 ? 86  ILE A CB   6  
ATOM 9943  C CG1  . ILE A 1 86  ? 0.480   -6.852  -8.072  1.00 0.00 ? 86  ILE A CG1  6  
ATOM 9944  C CG2  . ILE A 1 86  ? -1.059  -6.927  -10.050 1.00 0.00 ? 86  ILE A CG2  6  
ATOM 9945  C CD1  . ILE A 1 86  ? 1.517   -5.858  -8.548  1.00 0.00 ? 86  ILE A CD1  6  
ATOM 9946  H H    . ILE A 1 86  ? 1.093   -9.642  -7.917  1.00 0.00 ? 86  ILE A H    6  
ATOM 9947  H HA   . ILE A 1 86  ? -1.588  -8.625  -7.953  1.00 0.00 ? 86  ILE A HA   6  
ATOM 9948  H HB   . ILE A 1 86  ? 0.718   -8.063  -9.822  1.00 0.00 ? 86  ILE A HB   6  
ATOM 9949  H HG12 . ILE A 1 86  ? -0.322  -6.298  -7.611  1.00 0.00 ? 86  ILE A HG12 6  
ATOM 9950  H HG13 . ILE A 1 86  ? 0.945   -7.487  -7.331  1.00 0.00 ? 86  ILE A HG13 6  
ATOM 9951  H HG21 . ILE A 1 86  ? -1.452  -6.100  -9.477  1.00 0.00 ? 86  ILE A HG21 6  
ATOM 9952  H HG22 . ILE A 1 86  ? -0.542  -6.547  -10.919 1.00 0.00 ? 86  ILE A HG22 6  
ATOM 9953  H HG23 . ILE A 1 86  ? -1.871  -7.565  -10.365 1.00 0.00 ? 86  ILE A HG23 6  
ATOM 9954  H HD11 . ILE A 1 86  ? 1.449   -4.956  -7.957  1.00 0.00 ? 86  ILE A HD11 6  
ATOM 9955  H HD12 . ILE A 1 86  ? 2.502   -6.285  -8.440  1.00 0.00 ? 86  ILE A HD12 6  
ATOM 9956  H HD13 . ILE A 1 86  ? 1.338   -5.621  -9.586  1.00 0.00 ? 86  ILE A HD13 6  
ATOM 9957  N N    . GLN A 1 87  ? -2.719  -9.779  -9.824  1.00 0.00 ? 87  GLN A N    6  
ATOM 9958  C CA   . GLN A 1 87  ? -3.417  -10.522 -10.866 1.00 0.00 ? 87  GLN A CA   6  
ATOM 9959  C C    . GLN A 1 87  ? -4.144  -9.576  -11.816 1.00 0.00 ? 87  GLN A C    6  
ATOM 9960  O O    . GLN A 1 87  ? -4.162  -9.791  -13.027 1.00 0.00 ? 87  GLN A O    6  
ATOM 9961  C CB   . GLN A 1 87  ? -4.412  -11.503 -10.243 1.00 0.00 ? 87  GLN A CB   6  
ATOM 9962  C CG   . GLN A 1 87  ? -3.811  -12.363 -9.144  1.00 0.00 ? 87  GLN A CG   6  
ATOM 9963  C CD   . GLN A 1 87  ? -4.594  -13.640 -8.908  1.00 0.00 ? 87  GLN A CD   6  
ATOM 9964  O OE1  . GLN A 1 87  ? -4.647  -14.518 -9.770  1.00 0.00 ? 87  GLN A OE1  6  
ATOM 9965  N NE2  . GLN A 1 87  ? -5.209  -13.749 -7.736  1.00 0.00 ? 87  GLN A NE2  6  
ATOM 9966  H H    . GLN A 1 87  ? -3.239  -9.265  -9.173  1.00 0.00 ? 87  GLN A H    6  
ATOM 9967  H HA   . GLN A 1 87  ? -2.681  -11.078 -11.426 1.00 0.00 ? 87  GLN A HA   6  
ATOM 9968  H HB2  . GLN A 1 87  ? -5.235  -10.944 -9.824  1.00 0.00 ? 87  GLN A HB2  6  
ATOM 9969  H HB3  . GLN A 1 87  ? -4.788  -12.156 -11.017 1.00 0.00 ? 87  GLN A HB3  6  
ATOM 9970  H HG2  . GLN A 1 87  ? -2.801  -12.626 -9.422  1.00 0.00 ? 87  GLN A HG2  6  
ATOM 9971  H HG3  . GLN A 1 87  ? -3.795  -11.793 -8.227  1.00 0.00 ? 87  GLN A HG3  6  
ATOM 9972  H HE21 . GLN A 1 87  ? -5.124  -13.009 -7.098  1.00 0.00 ? 87  GLN A HE21 6  
ATOM 9973  H HE22 . GLN A 1 87  ? -5.723  -14.563 -7.557  1.00 0.00 ? 87  GLN A HE22 6  
ATOM 9974  N N    . GLU A 1 88  ? -4.743  -8.529  -11.257 1.00 0.00 ? 88  GLU A N    6  
ATOM 9975  C CA   . GLU A 1 88  ? -5.472  -7.551  -12.055 1.00 0.00 ? 88  GLU A CA   6  
ATOM 9976  C C    . GLU A 1 88  ? -5.236  -6.137  -11.532 1.00 0.00 ? 88  GLU A C    6  
ATOM 9977  O O    . GLU A 1 88  ? -4.914  -5.941  -10.360 1.00 0.00 ? 88  GLU A O    6  
ATOM 9978  C CB   . GLU A 1 88  ? -6.969  -7.866  -12.046 1.00 0.00 ? 88  GLU A CB   6  
ATOM 9979  C CG   . GLU A 1 88  ? -7.764  -7.079  -13.074 1.00 0.00 ? 88  GLU A CG   6  
ATOM 9980  C CD   . GLU A 1 88  ? -7.535  -7.571  -14.490 1.00 0.00 ? 88  GLU A CD   6  
ATOM 9981  O OE1  . GLU A 1 88  ? -6.360  -7.698  -14.892 1.00 0.00 ? 88  GLU A OE1  6  
ATOM 9982  O OE2  . GLU A 1 88  ? -8.533  -7.830  -15.195 1.00 0.00 ? 88  GLU A OE2  6  
ATOM 9983  H H    . GLU A 1 88  ? -4.693  -8.412  -10.285 1.00 0.00 ? 88  GLU A H    6  
ATOM 9984  H HA   . GLU A 1 88  ? -5.107  -7.612  -13.069 1.00 0.00 ? 88  GLU A HA   6  
ATOM 9985  H HB2  . GLU A 1 88  ? -7.104  -8.919  -12.245 1.00 0.00 ? 88  GLU A HB2  6  
ATOM 9986  H HB3  . GLU A 1 88  ? -7.366  -7.641  -11.066 1.00 0.00 ? 88  GLU A HB3  6  
ATOM 9987  H HG2  . GLU A 1 88  ? -8.815  -7.168  -12.843 1.00 0.00 ? 88  GLU A HG2  6  
ATOM 9988  H HG3  . GLU A 1 88  ? -7.472  -6.040  -13.018 1.00 0.00 ? 88  GLU A HG3  6  
ATOM 9989  N N    . THR A 1 89  ? -5.398  -5.152  -12.411 1.00 0.00 ? 89  THR A N    6  
ATOM 9990  C CA   . THR A 1 89  ? -5.201  -3.757  -12.040 1.00 0.00 ? 89  THR A CA   6  
ATOM 9991  C C    . THR A 1 89  ? -6.408  -2.910  -12.426 1.00 0.00 ? 89  THR A C    6  
ATOM 9992  O O    . THR A 1 89  ? -6.614  -2.604  -13.601 1.00 0.00 ? 89  THR A O    6  
ATOM 9993  C CB   . THR A 1 89  ? -3.943  -3.170  -12.707 1.00 0.00 ? 89  THR A CB   6  
ATOM 9994  O OG1  . THR A 1 89  ? -2.829  -4.047  -12.508 1.00 0.00 ? 89  THR A OG1  6  
ATOM 9995  C CG2  . THR A 1 89  ? -3.620  -1.796  -12.140 1.00 0.00 ? 89  THR A CG2  6  
ATOM 9996  H H    . THR A 1 89  ? -5.655  -5.372  -13.331 1.00 0.00 ? 89  THR A H    6  
ATOM 9997  H HA   . THR A 1 89  ? -5.069  -3.712  -10.969 1.00 0.00 ? 89  THR A HA   6  
ATOM 9998  H HB   . THR A 1 89  ? -4.129  -3.071  -13.767 1.00 0.00 ? 89  THR A HB   6  
ATOM 9999  H HG1  . THR A 1 89  ? -2.484  -3.931  -11.619 1.00 0.00 ? 89  THR A HG1  6  
ATOM 10000 H HG21 . THR A 1 89  ? -3.643  -1.838  -11.062 1.00 0.00 ? 89  THR A HG21 6  
ATOM 10001 H HG22 . THR A 1 89  ? -4.352  -1.082  -12.489 1.00 0.00 ? 89  THR A HG22 6  
ATOM 10002 H HG23 . THR A 1 89  ? -2.637  -1.493  -12.468 1.00 0.00 ? 89  THR A HG23 6  
ATOM 10003 N N    . CYS A 1 90  ? -7.203  -2.533  -11.430 1.00 0.00 ? 90  CYS A N    6  
ATOM 10004 C CA   . CYS A 1 90  ? -8.391  -1.720  -11.666 1.00 0.00 ? 90  CYS A CA   6  
ATOM 10005 C C    . CYS A 1 90  ? -8.181  -0.293  -11.171 1.00 0.00 ? 90  CYS A C    6  
ATOM 10006 O O    . CYS A 1 90  ? -7.756  -0.075  -10.037 1.00 0.00 ? 90  CYS A O    6  
ATOM 10007 C CB   . CYS A 1 90  ? -9.604  -2.340  -10.972 1.00 0.00 ? 90  CYS A CB   6  
ATOM 10008 S SG   . CYS A 1 90  ? -10.341 -3.725  -11.871 1.00 0.00 ? 90  CYS A SG   6  
ATOM 10009 H H    . CYS A 1 90  ? -6.986  -2.807  -10.515 1.00 0.00 ? 90  CYS A H    6  
ATOM 10010 H HA   . CYS A 1 90  ? -8.569  -1.696  -12.730 1.00 0.00 ? 90  CYS A HA   6  
ATOM 10011 H HB2  . CYS A 1 90  ? -9.307  -2.702  -9.999  1.00 0.00 ? 90  CYS A HB2  6  
ATOM 10012 H HB3  . CYS A 1 90  ? -10.365 -1.584  -10.850 1.00 0.00 ? 90  CYS A HB3  6  
ATOM 10013 H HG   . CYS A 1 90  ? -9.951  -3.647  -13.134 1.00 0.00 ? 90  CYS A HG   6  
ATOM 10014 N N    . GLY A 1 91  ? -8.479  0.677   -12.030 1.00 0.00 ? 91  GLY A N    6  
ATOM 10015 C CA   . GLY A 1 91  ? -8.314  2.071   -11.662 1.00 0.00 ? 91  GLY A CA   6  
ATOM 10016 C C    . GLY A 1 91  ? -7.112  2.296   -10.768 1.00 0.00 ? 91  GLY A C    6  
ATOM 10017 O O    . GLY A 1 91  ? -6.072  1.661   -10.943 1.00 0.00 ? 91  GLY A O    6  
ATOM 10018 H H    . GLY A 1 91  ? -8.814  0.443   -12.922 1.00 0.00 ? 91  GLY A H    6  
ATOM 10019 H HA2  . GLY A 1 91  ? -8.197  2.657   -12.561 1.00 0.00 ? 91  GLY A HA2  6  
ATOM 10020 H HA3  . GLY A 1 91  ? -9.202  2.401   -11.143 1.00 0.00 ? 91  GLY A HA3  6  
ATOM 10021 N N    . ASP A 1 92  ? -7.252  3.203   -9.808  1.00 0.00 ? 92  ASP A N    6  
ATOM 10022 C CA   . ASP A 1 92  ? -6.168  3.512   -8.882  1.00 0.00 ? 92  ASP A CA   6  
ATOM 10023 C C    . ASP A 1 92  ? -6.101  2.480   -7.761  1.00 0.00 ? 92  ASP A C    6  
ATOM 10024 O O    . ASP A 1 92  ? -5.907  2.827   -6.596  1.00 0.00 ? 92  ASP A O    6  
ATOM 10025 C CB   . ASP A 1 92  ? -6.354  4.912   -8.294  1.00 0.00 ? 92  ASP A CB   6  
ATOM 10026 C CG   . ASP A 1 92  ? -5.889  6.003   -9.239  1.00 0.00 ? 92  ASP A CG   6  
ATOM 10027 O OD1  . ASP A 1 92  ? -5.987  5.804   -10.468 1.00 0.00 ? 92  ASP A OD1  6  
ATOM 10028 O OD2  . ASP A 1 92  ? -5.427  7.055   -8.749  1.00 0.00 ? 92  ASP A OD2  6  
ATOM 10029 H H    . ASP A 1 92  ? -8.106  3.677   -9.719  1.00 0.00 ? 92  ASP A H    6  
ATOM 10030 H HA   . ASP A 1 92  ? -5.242  3.484   -9.436  1.00 0.00 ? 92  ASP A HA   6  
ATOM 10031 H HB2  . ASP A 1 92  ? -7.401  5.069   -8.080  1.00 0.00 ? 92  ASP A HB2  6  
ATOM 10032 H HB3  . ASP A 1 92  ? -5.787  4.988   -7.378  1.00 0.00 ? 92  ASP A HB3  6  
ATOM 10033 N N    . TRP A 1 93  ? -6.264  1.212   -8.120  1.00 0.00 ? 93  TRP A N    6  
ATOM 10034 C CA   . TRP A 1 93  ? -6.223  0.130   -7.143  1.00 0.00 ? 93  TRP A CA   6  
ATOM 10035 C C    . TRP A 1 93  ? -5.744  -1.167  -7.787  1.00 0.00 ? 93  TRP A C    6  
ATOM 10036 O O    . TRP A 1 93  ? -6.070  -1.456  -8.938  1.00 0.00 ? 93  TRP A O    6  
ATOM 10037 C CB   . TRP A 1 93  ? -7.606  -0.076  -6.521  1.00 0.00 ? 93  TRP A CB   6  
ATOM 10038 C CG   . TRP A 1 93  ? -8.124  1.138   -5.811  1.00 0.00 ? 93  TRP A CG   6  
ATOM 10039 C CD1  . TRP A 1 93  ? -8.597  2.284   -6.385  1.00 0.00 ? 93  TRP A CD1  6  
ATOM 10040 C CD2  . TRP A 1 93  ? -8.220  1.327   -4.395  1.00 0.00 ? 93  TRP A CD2  6  
ATOM 10041 N NE1  . TRP A 1 93  ? -8.981  3.174   -5.411  1.00 0.00 ? 93  TRP A NE1  6  
ATOM 10042 C CE2  . TRP A 1 93  ? -8.760  2.610   -4.182  1.00 0.00 ? 93  TRP A CE2  6  
ATOM 10043 C CE3  . TRP A 1 93  ? -7.904  0.537   -3.287  1.00 0.00 ? 93  TRP A CE3  6  
ATOM 10044 C CZ2  . TRP A 1 93  ? -8.989  3.119   -2.906  1.00 0.00 ? 93  TRP A CZ2  6  
ATOM 10045 C CZ3  . TRP A 1 93  ? -8.131  1.043   -2.021  1.00 0.00 ? 93  TRP A CZ3  6  
ATOM 10046 C CH2  . TRP A 1 93  ? -8.670  2.323   -1.839  1.00 0.00 ? 93  TRP A CH2  6  
ATOM 10047 H H    . TRP A 1 93  ? -6.416  0.998   -9.065  1.00 0.00 ? 93  TRP A H    6  
ATOM 10048 H HA   . TRP A 1 93  ? -5.527  0.411   -6.367  1.00 0.00 ? 93  TRP A HA   6  
ATOM 10049 H HB2  . TRP A 1 93  ? -8.309  -0.333  -7.299  1.00 0.00 ? 93  TRP A HB2  6  
ATOM 10050 H HB3  . TRP A 1 93  ? -7.553  -0.884  -5.806  1.00 0.00 ? 93  TRP A HB3  6  
ATOM 10051 H HD1  . TRP A 1 93  ? -8.652  2.452   -7.449  1.00 0.00 ? 93  TRP A HD1  6  
ATOM 10052 H HE1  . TRP A 1 93  ? -9.353  4.066   -5.571  1.00 0.00 ? 93  TRP A HE1  6  
ATOM 10053 H HE3  . TRP A 1 93  ? -7.488  -0.453  -3.407  1.00 0.00 ? 93  TRP A HE3  6  
ATOM 10054 H HZ2  . TRP A 1 93  ? -9.405  4.103   -2.749  1.00 0.00 ? 93  TRP A HZ2  6  
ATOM 10055 H HZ3  . TRP A 1 93  ? -7.893  0.447   -1.153  1.00 0.00 ? 93  TRP A HZ3  6  
ATOM 10056 H HH2  . TRP A 1 93  ? -8.831  2.678   -0.833  1.00 0.00 ? 93  TRP A HH2  6  
ATOM 10057 N N    . TYR A 1 94  ? -4.970  -1.943  -7.037  1.00 0.00 ? 94  TYR A N    6  
ATOM 10058 C CA   . TYR A 1 94  ? -4.444  -3.208  -7.537  1.00 0.00 ? 94  TYR A CA   6  
ATOM 10059 C C    . TYR A 1 94  ? -5.321  -4.375  -7.094  1.00 0.00 ? 94  TYR A C    6  
ATOM 10060 O O    . TYR A 1 94  ? -6.143  -4.240  -6.188  1.00 0.00 ? 94  TYR A O    6  
ATOM 10061 C CB   . TYR A 1 94  ? -3.011  -3.418  -7.046  1.00 0.00 ? 94  TYR A CB   6  
ATOM 10062 C CG   . TYR A 1 94  ? -1.982  -2.629  -7.824  1.00 0.00 ? 94  TYR A CG   6  
ATOM 10063 C CD1  . TYR A 1 94  ? -1.947  -2.676  -9.212  1.00 0.00 ? 94  TYR A CD1  6  
ATOM 10064 C CD2  . TYR A 1 94  ? -1.047  -1.836  -7.171  1.00 0.00 ? 94  TYR A CD2  6  
ATOM 10065 C CE1  . TYR A 1 94  ? -1.008  -1.957  -9.927  1.00 0.00 ? 94  TYR A CE1  6  
ATOM 10066 C CE2  . TYR A 1 94  ? -0.106  -1.113  -7.878  1.00 0.00 ? 94  TYR A CE2  6  
ATOM 10067 C CZ   . TYR A 1 94  ? -0.090  -1.177  -9.256  1.00 0.00 ? 94  TYR A CZ   6  
ATOM 10068 O OH   . TYR A 1 94  ? 0.845   -0.458  -9.965  1.00 0.00 ? 94  TYR A OH   6  
ATOM 10069 H H    . TYR A 1 94  ? -4.745  -1.658  -6.127  1.00 0.00 ? 94  TYR A H    6  
ATOM 10070 H HA   . TYR A 1 94  ? -4.441  -3.163  -8.616  1.00 0.00 ? 94  TYR A HA   6  
ATOM 10071 H HB2  . TYR A 1 94  ? -2.944  -3.118  -6.011  1.00 0.00 ? 94  TYR A HB2  6  
ATOM 10072 H HB3  . TYR A 1 94  ? -2.759  -4.465  -7.129  1.00 0.00 ? 94  TYR A HB3  6  
ATOM 10073 H HD1  . TYR A 1 94  ? -2.668  -3.288  -9.735  1.00 0.00 ? 94  TYR A HD1  6  
ATOM 10074 H HD2  . TYR A 1 94  ? -1.061  -1.787  -6.092  1.00 0.00 ? 94  TYR A HD2  6  
ATOM 10075 H HE1  . TYR A 1 94  ? -0.996  -2.007  -11.006 1.00 0.00 ? 94  TYR A HE1  6  
ATOM 10076 H HE2  . TYR A 1 94  ? 0.614   -0.502  -7.353  1.00 0.00 ? 94  TYR A HE2  6  
ATOM 10077 H HH   . TYR A 1 94  ? 1.547   -1.046  -10.255 1.00 0.00 ? 94  TYR A HH   6  
ATOM 10078 N N    . ARG A 1 95  ? -5.139  -5.522  -7.740  1.00 0.00 ? 95  ARG A N    6  
ATOM 10079 C CA   . ARG A 1 95  ? -5.913  -6.714  -7.415  1.00 0.00 ? 95  ARG A CA   6  
ATOM 10080 C C    . ARG A 1 95  ? -4.995  -7.903  -7.149  1.00 0.00 ? 95  ARG A C    6  
ATOM 10081 O O    . ARG A 1 95  ? -4.242  -8.327  -8.024  1.00 0.00 ? 95  ARG A O    6  
ATOM 10082 C CB   . ARG A 1 95  ? -6.879  -7.047  -8.553  1.00 0.00 ? 95  ARG A CB   6  
ATOM 10083 C CG   . ARG A 1 95  ? -7.892  -8.123  -8.197  1.00 0.00 ? 95  ARG A CG   6  
ATOM 10084 C CD   . ARG A 1 95  ? -9.119  -7.531  -7.521  1.00 0.00 ? 95  ARG A CD   6  
ATOM 10085 N NE   . ARG A 1 95  ? -9.884  -8.541  -6.794  1.00 0.00 ? 95  ARG A NE   6  
ATOM 10086 C CZ   . ARG A 1 95  ? -9.420  -9.191  -5.732  1.00 0.00 ? 95  ARG A CZ   6  
ATOM 10087 N NH1  . ARG A 1 95  ? -8.201  -8.937  -5.276  1.00 0.00 ? 95  ARG A NH1  6  
ATOM 10088 N NH2  . ARG A 1 95  ? -10.177 -10.096 -5.124  1.00 0.00 ? 95  ARG A NH2  6  
ATOM 10089 H H    . ARG A 1 95  ? -4.468  -5.568  -8.453  1.00 0.00 ? 95  ARG A H    6  
ATOM 10090 H HA   . ARG A 1 95  ? -6.482  -6.506  -6.521  1.00 0.00 ? 95  ARG A HA   6  
ATOM 10091 H HB2  . ARG A 1 95  ? -7.419  -6.152  -8.825  1.00 0.00 ? 95  ARG A HB2  6  
ATOM 10092 H HB3  . ARG A 1 95  ? -6.310  -7.387  -9.404  1.00 0.00 ? 95  ARG A HB3  6  
ATOM 10093 H HG2  . ARG A 1 95  ? -8.201  -8.627  -9.101  1.00 0.00 ? 95  ARG A HG2  6  
ATOM 10094 H HG3  . ARG A 1 95  ? -7.429  -8.832  -7.527  1.00 0.00 ? 95  ARG A HG3  6  
ATOM 10095 H HD2  . ARG A 1 95  ? -8.798  -6.768  -6.827  1.00 0.00 ? 95  ARG A HD2  6  
ATOM 10096 H HD3  . ARG A 1 95  ? -9.751  -7.088  -8.276  1.00 0.00 ? 95  ARG A HD3  6  
ATOM 10097 H HE   . ARG A 1 95  ? -10.787 -8.743  -7.114  1.00 0.00 ? 95  ARG A HE   6  
ATOM 10098 H HH11 . ARG A 1 95  ? -7.630  -8.255  -5.731  1.00 0.00 ? 95  ARG A HH11 6  
ATOM 10099 H HH12 . ARG A 1 95  ? -7.855  -9.427  -4.475  1.00 0.00 ? 95  ARG A HH12 6  
ATOM 10100 H HH21 . ARG A 1 95  ? -11.096 -10.289 -5.465  1.00 0.00 ? 95  ARG A HH21 6  
ATOM 10101 H HH22 . ARG A 1 95  ? -9.827  -10.584 -4.326  1.00 0.00 ? 95  ARG A HH22 6  
ATOM 10102 N N    . GLY A 1 96  ? -5.062  -8.436  -5.932  1.00 0.00 ? 96  GLY A N    6  
ATOM 10103 C CA   . GLY A 1 96  ? -4.232  -9.570  -5.572  1.00 0.00 ? 96  GLY A CA   6  
ATOM 10104 C C    . GLY A 1 96  ? -4.410  -9.984  -4.125  1.00 0.00 ? 96  GLY A C    6  
ATOM 10105 O O    . GLY A 1 96  ? -5.437  -9.692  -3.511  1.00 0.00 ? 96  GLY A O    6  
ATOM 10106 H H    . GLY A 1 96  ? -5.681  -8.056  -5.274  1.00 0.00 ? 96  GLY A H    6  
ATOM 10107 H HA2  . GLY A 1 96  ? -4.486  -10.405 -6.208  1.00 0.00 ? 96  GLY A HA2  6  
ATOM 10108 H HA3  . GLY A 1 96  ? -3.196  -9.309  -5.735  1.00 0.00 ? 96  GLY A HA3  6  
ATOM 10109 N N    . TYR A 1 97  ? -3.410  -10.666 -3.578  1.00 0.00 ? 97  TYR A N    6  
ATOM 10110 C CA   . TYR A 1 97  ? -3.463  -11.124 -2.195  1.00 0.00 ? 97  TYR A CA   6  
ATOM 10111 C C    . TYR A 1 97  ? -2.060  -11.246 -1.608  1.00 0.00 ? 97  TYR A C    6  
ATOM 10112 O O    . TYR A 1 97  ? -1.070  -11.291 -2.339  1.00 0.00 ? 97  TYR A O    6  
ATOM 10113 C CB   . TYR A 1 97  ? -4.183  -12.470 -2.109  1.00 0.00 ? 97  TYR A CB   6  
ATOM 10114 C CG   . TYR A 1 97  ? -3.526  -13.562 -2.923  1.00 0.00 ? 97  TYR A CG   6  
ATOM 10115 C CD1  . TYR A 1 97  ? -2.272  -14.052 -2.579  1.00 0.00 ? 97  TYR A CD1  6  
ATOM 10116 C CD2  . TYR A 1 97  ? -4.158  -14.102 -4.036  1.00 0.00 ? 97  TYR A CD2  6  
ATOM 10117 C CE1  . TYR A 1 97  ? -1.668  -15.049 -3.320  1.00 0.00 ? 97  TYR A CE1  6  
ATOM 10118 C CE2  . TYR A 1 97  ? -3.562  -15.100 -4.782  1.00 0.00 ? 97  TYR A CE2  6  
ATOM 10119 C CZ   . TYR A 1 97  ? -2.317  -15.570 -4.420  1.00 0.00 ? 97  TYR A CZ   6  
ATOM 10120 O OH   . TYR A 1 97  ? -1.718  -16.563 -5.162  1.00 0.00 ? 97  TYR A OH   6  
ATOM 10121 H H    . TYR A 1 97  ? -2.617  -10.868 -4.118  1.00 0.00 ? 97  TYR A H    6  
ATOM 10122 H HA   . TYR A 1 97  ? -4.017  -10.393 -1.625  1.00 0.00 ? 97  TYR A HA   6  
ATOM 10123 H HB2  . TYR A 1 97  ? -4.206  -12.793 -1.080  1.00 0.00 ? 97  TYR A HB2  6  
ATOM 10124 H HB3  . TYR A 1 97  ? -5.196  -12.352 -2.467  1.00 0.00 ? 97  TYR A HB3  6  
ATOM 10125 H HD1  . TYR A 1 97  ? -1.767  -13.643 -1.717  1.00 0.00 ? 97  TYR A HD1  6  
ATOM 10126 H HD2  . TYR A 1 97  ? -5.133  -13.731 -4.317  1.00 0.00 ? 97  TYR A HD2  6  
ATOM 10127 H HE1  . TYR A 1 97  ? -0.693  -15.418 -3.037  1.00 0.00 ? 97  TYR A HE1  6  
ATOM 10128 H HE2  . TYR A 1 97  ? -4.069  -15.507 -5.644  1.00 0.00 ? 97  TYR A HE2  6  
ATOM 10129 H HH   . TYR A 1 97  ? -2.365  -16.952 -5.756  1.00 0.00 ? 97  TYR A HH   6  
ATOM 10130 N N    . LEU A 1 98  ? -1.984  -11.300 -0.283  1.00 0.00 ? 98  LEU A N    6  
ATOM 10131 C CA   . LEU A 1 98  ? -0.703  -11.418 0.406   1.00 0.00 ? 98  LEU A CA   6  
ATOM 10132 C C    . LEU A 1 98  ? -0.091  -12.798 0.184   1.00 0.00 ? 98  LEU A C    6  
ATOM 10133 O O    . LEU A 1 98  ? -0.617  -13.804 0.659   1.00 0.00 ? 98  LEU A O    6  
ATOM 10134 C CB   . LEU A 1 98  ? -0.881  -11.161 1.903   1.00 0.00 ? 98  LEU A CB   6  
ATOM 10135 C CG   . LEU A 1 98  ? 0.405   -10.963 2.707   1.00 0.00 ? 98  LEU A CG   6  
ATOM 10136 C CD1  . LEU A 1 98  ? 1.241   -9.843  2.109   1.00 0.00 ? 98  LEU A CD1  6  
ATOM 10137 C CD2  . LEU A 1 98  ? 0.082   -10.669 4.165   1.00 0.00 ? 98  LEU A CD2  6  
ATOM 10138 H H    . LEU A 1 98  ? -2.807  -11.260 0.246   1.00 0.00 ? 98  LEU A H    6  
ATOM 10139 H HA   . LEU A 1 98  ? -0.037  -10.672 -0.003  1.00 0.00 ? 98  LEU A HA   6  
ATOM 10140 H HB2  . LEU A 1 98  ? -1.482  -10.273 2.017   1.00 0.00 ? 98  LEU A HB2  6  
ATOM 10141 H HB3  . LEU A 1 98  ? -1.407  -12.007 2.323   1.00 0.00 ? 98  LEU A HB3  6  
ATOM 10142 H HG   . LEU A 1 98  ? 0.989   -11.872 2.670   1.00 0.00 ? 98  LEU A HG   6  
ATOM 10143 H HD11 . LEU A 1 98  ? 1.545   -10.115 1.109   1.00 0.00 ? 98  LEU A HD11 6  
ATOM 10144 H HD12 . LEU A 1 98  ? 2.117   -9.682  2.720   1.00 0.00 ? 98  LEU A HD12 6  
ATOM 10145 H HD13 . LEU A 1 98  ? 0.656   -8.936  2.073   1.00 0.00 ? 98  LEU A HD13 6  
ATOM 10146 H HD21 . LEU A 1 98  ? -0.981  -10.771 4.326   1.00 0.00 ? 98  LEU A HD21 6  
ATOM 10147 H HD22 . LEU A 1 98  ? 0.388   -9.662  4.405   1.00 0.00 ? 98  LEU A HD22 6  
ATOM 10148 H HD23 . LEU A 1 98  ? 0.611   -11.367 4.798   1.00 0.00 ? 98  LEU A HD23 6  
ATOM 10149 N N    . ILE A 1 99  ? 1.023   -12.835 -0.539  1.00 0.00 ? 99  ILE A N    6  
ATOM 10150 C CA   . ILE A 1 99  ? 1.709   -14.091 -0.820  1.00 0.00 ? 99  ILE A CA   6  
ATOM 10151 C C    . ILE A 1 99  ? 2.061   -14.825 0.468   1.00 0.00 ? 99  ILE A C    6  
ATOM 10152 O O    . ILE A 1 99  ? 1.699   -15.988 0.653   1.00 0.00 ? 99  ILE A O    6  
ATOM 10153 C CB   . ILE A 1 99  ? 2.995   -13.860 -1.635  1.00 0.00 ? 99  ILE A CB   6  
ATOM 10154 C CG1  . ILE A 1 99  ? 2.681   -13.088 -2.918  1.00 0.00 ? 99  ILE A CG1  6  
ATOM 10155 C CG2  . ILE A 1 99  ? 3.663   -15.188 -1.959  1.00 0.00 ? 99  ILE A CG2  6  
ATOM 10156 C CD1  . ILE A 1 99  ? 3.913   -12.681 -3.696  1.00 0.00 ? 99  ILE A CD1  6  
ATOM 10157 H H    . ILE A 1 99  ? 1.394   -11.999 -0.891  1.00 0.00 ? 99  ILE A H    6  
ATOM 10158 H HA   . ILE A 1 99  ? 1.043   -14.710 -1.405  1.00 0.00 ? 99  ILE A HA   6  
ATOM 10159 H HB   . ILE A 1 99  ? 3.677   -13.279 -1.032  1.00 0.00 ? 99  ILE A HB   6  
ATOM 10160 H HG12 . ILE A 1 99  ? 2.072   -13.705 -3.561  1.00 0.00 ? 99  ILE A HG12 6  
ATOM 10161 H HG13 . ILE A 1 99  ? 2.135   -12.191 -2.665  1.00 0.00 ? 99  ILE A HG13 6  
ATOM 10162 H HG21 . ILE A 1 99  ? 4.134   -15.127 -2.929  1.00 0.00 ? 99  ILE A HG21 6  
ATOM 10163 H HG22 . ILE A 1 99  ? 4.409   -15.407 -1.210  1.00 0.00 ? 99  ILE A HG22 6  
ATOM 10164 H HG23 . ILE A 1 99  ? 2.921   -15.972 -1.968  1.00 0.00 ? 99  ILE A HG23 6  
ATOM 10165 H HD11 . ILE A 1 99  ? 4.665   -12.314 -3.012  1.00 0.00 ? 99  ILE A HD11 6  
ATOM 10166 H HD12 . ILE A 1 99  ? 4.301   -13.536 -4.230  1.00 0.00 ? 99  ILE A HD12 6  
ATOM 10167 H HD13 . ILE A 1 99  ? 3.655   -11.903 -4.398  1.00 0.00 ? 99  ILE A HD13 6  
ATOM 10168 N N    . LYS A 1 100 ? 2.769   -14.139 1.359   1.00 0.00 ? 100 LYS A N    6  
ATOM 10169 C CA   . LYS A 1 100 ? 3.169   -14.724 2.634   1.00 0.00 ? 100 LYS A CA   6  
ATOM 10170 C C    . LYS A 1 100 ? 1.954   -15.225 3.408   1.00 0.00 ? 100 LYS A C    6  
ATOM 10171 O O    . LYS A 1 100 ? 2.037   -16.208 4.145   1.00 0.00 ? 100 LYS A O    6  
ATOM 10172 C CB   . LYS A 1 100 ? 3.933   -13.697 3.472   1.00 0.00 ? 100 LYS A CB   6  
ATOM 10173 C CG   . LYS A 1 100 ? 3.214   -12.366 3.607   1.00 0.00 ? 100 LYS A CG   6  
ATOM 10174 C CD   . LYS A 1 100 ? 4.045   -11.360 4.385   1.00 0.00 ? 100 LYS A CD   6  
ATOM 10175 C CE   . LYS A 1 100 ? 4.738   -12.009 5.573   1.00 0.00 ? 100 LYS A CE   6  
ATOM 10176 N NZ   . LYS A 1 100 ? 5.506   -11.018 6.377   1.00 0.00 ? 100 LYS A NZ   6  
ATOM 10177 H H    . LYS A 1 100 ? 3.028   -13.216 1.155   1.00 0.00 ? 100 LYS A H    6  
ATOM 10178 H HA   . LYS A 1 100 ? 3.818   -15.561 2.426   1.00 0.00 ? 100 LYS A HA   6  
ATOM 10179 H HB2  . LYS A 1 100 ? 4.088   -14.101 4.462   1.00 0.00 ? 100 LYS A HB2  6  
ATOM 10180 H HB3  . LYS A 1 100 ? 4.894   -13.518 3.012   1.00 0.00 ? 100 LYS A HB3  6  
ATOM 10181 H HG2  . LYS A 1 100 ? 3.020   -11.970 2.621   1.00 0.00 ? 100 LYS A HG2  6  
ATOM 10182 H HG3  . LYS A 1 100 ? 2.278   -12.524 4.125   1.00 0.00 ? 100 LYS A HG3  6  
ATOM 10183 H HD2  . LYS A 1 100 ? 4.794   -10.941 3.730   1.00 0.00 ? 100 LYS A HD2  6  
ATOM 10184 H HD3  . LYS A 1 100 ? 3.397   -10.572 4.744   1.00 0.00 ? 100 LYS A HD3  6  
ATOM 10185 H HE2  . LYS A 1 100 ? 3.992   -12.469 6.202   1.00 0.00 ? 100 LYS A HE2  6  
ATOM 10186 H HE3  . LYS A 1 100 ? 5.417   -12.766 5.207   1.00 0.00 ? 100 LYS A HE3  6  
ATOM 10187 H HZ1  . LYS A 1 100 ? 5.128   -10.973 7.345   1.00 0.00 ? 100 LYS A HZ1  6  
ATOM 10188 H HZ2  . LYS A 1 100 ? 5.435   -10.075 5.944   1.00 0.00 ? 100 LYS A HZ2  6  
ATOM 10189 H HZ3  . LYS A 1 100 ? 6.508   -11.293 6.420   1.00 0.00 ? 100 LYS A HZ3  6  
ATOM 10190 N N    . HIS A 1 101 ? 0.825   -14.544 3.235   1.00 0.00 ? 101 HIS A N    6  
ATOM 10191 C CA   . HIS A 1 101 ? -0.408  -14.922 3.916   1.00 0.00 ? 101 HIS A CA   6  
ATOM 10192 C C    . HIS A 1 101 ? -1.591  -14.895 2.952   1.00 0.00 ? 101 HIS A C    6  
ATOM 10193 O O    . HIS A 1 101 ? -2.336  -13.916 2.894   1.00 0.00 ? 101 HIS A O    6  
ATOM 10194 C CB   . HIS A 1 101 ? -0.673  -13.983 5.093   1.00 0.00 ? 101 HIS A CB   6  
ATOM 10195 C CG   . HIS A 1 101 ? 0.305   -14.141 6.217   1.00 0.00 ? 101 HIS A CG   6  
ATOM 10196 N ND1  . HIS A 1 101 ? 0.739   -15.369 6.670   1.00 0.00 ? 101 HIS A ND1  6  
ATOM 10197 C CD2  . HIS A 1 101 ? 0.936   -13.217 6.978   1.00 0.00 ? 101 HIS A CD2  6  
ATOM 10198 C CE1  . HIS A 1 101 ? 1.592   -15.193 7.663   1.00 0.00 ? 101 HIS A CE1  6  
ATOM 10199 N NE2  . HIS A 1 101 ? 1.730   -13.896 7.869   1.00 0.00 ? 101 HIS A NE2  6  
ATOM 10200 H H    . HIS A 1 101 ? 0.822   -13.770 2.634   1.00 0.00 ? 101 HIS A H    6  
ATOM 10201 H HA   . HIS A 1 101 ? -0.286  -15.927 4.288   1.00 0.00 ? 101 HIS A HA   6  
ATOM 10202 H HB2  . HIS A 1 101 ? -0.620  -12.961 4.750   1.00 0.00 ? 101 HIS A HB2  6  
ATOM 10203 H HB3  . HIS A 1 101 ? -1.662  -14.176 5.484   1.00 0.00 ? 101 HIS A HB3  6  
ATOM 10204 H HD1  . HIS A 1 101 ? 0.460   -16.240 6.318   1.00 0.00 ? 101 HIS A HD1  6  
ATOM 10205 H HD2  . HIS A 1 101 ? 0.834   -12.143 6.900   1.00 0.00 ? 101 HIS A HD2  6  
ATOM 10206 H HE1  . HIS A 1 101 ? 2.093   -15.976 8.213   1.00 0.00 ? 101 HIS A HE1  6  
ATOM 10207 H HE2  . HIS A 1 101 ? 2.238   -13.492 8.603   1.00 0.00 ? 101 HIS A HE2  6  
ATOM 10208 N N    . LYS A 1 102 ? -1.757  -15.975 2.197   1.00 0.00 ? 102 LYS A N    6  
ATOM 10209 C CA   . LYS A 1 102 ? -2.849  -16.077 1.236   1.00 0.00 ? 102 LYS A CA   6  
ATOM 10210 C C    . LYS A 1 102 ? -4.196  -16.144 1.949   1.00 0.00 ? 102 LYS A C    6  
ATOM 10211 O O    . LYS A 1 102 ? -5.247  -16.161 1.308   1.00 0.00 ? 102 LYS A O    6  
ATOM 10212 C CB   . LYS A 1 102 ? -2.665  -17.313 0.353   1.00 0.00 ? 102 LYS A CB   6  
ATOM 10213 C CG   . LYS A 1 102 ? -1.336  -17.343 -0.382  1.00 0.00 ? 102 LYS A CG   6  
ATOM 10214 C CD   . LYS A 1 102 ? -1.432  -18.132 -1.677  1.00 0.00 ? 102 LYS A CD   6  
ATOM 10215 C CE   . LYS A 1 102 ? -0.112  -18.806 -2.018  1.00 0.00 ? 102 LYS A CE   6  
ATOM 10216 N NZ   . LYS A 1 102 ? 0.748   -17.940 -2.872  1.00 0.00 ? 102 LYS A NZ   6  
ATOM 10217 H H    . LYS A 1 102 ? -1.130  -16.724 2.289   1.00 0.00 ? 102 LYS A H    6  
ATOM 10218 H HA   . LYS A 1 102 ? -2.827  -15.195 0.615   1.00 0.00 ? 102 LYS A HA   6  
ATOM 10219 H HB2  . LYS A 1 102 ? -2.731  -18.196 0.972   1.00 0.00 ? 102 LYS A HB2  6  
ATOM 10220 H HB3  . LYS A 1 102 ? -3.458  -17.338 -0.380  1.00 0.00 ? 102 LYS A HB3  6  
ATOM 10221 H HG2  . LYS A 1 102 ? -1.039  -16.331 -0.612  1.00 0.00 ? 102 LYS A HG2  6  
ATOM 10222 H HG3  . LYS A 1 102 ? -0.593  -17.803 0.255   1.00 0.00 ? 102 LYS A HG3  6  
ATOM 10223 H HD2  . LYS A 1 102 ? -2.193  -18.891 -1.570  1.00 0.00 ? 102 LYS A HD2  6  
ATOM 10224 H HD3  . LYS A 1 102 ? -1.701  -17.460 -2.479  1.00 0.00 ? 102 LYS A HD3  6  
ATOM 10225 H HE2  . LYS A 1 102 ? 0.412   -19.027 -1.101  1.00 0.00 ? 102 LYS A HE2  6  
ATOM 10226 H HE3  . LYS A 1 102 ? -0.318  -19.726 -2.545  1.00 0.00 ? 102 LYS A HE3  6  
ATOM 10227 H HZ1  . LYS A 1 102 ? 1.632   -17.713 -2.373  1.00 0.00 ? 102 LYS A HZ1  6  
ATOM 10228 H HZ2  . LYS A 1 102 ? 0.251   -17.055 -3.097  1.00 0.00 ? 102 LYS A HZ2  6  
ATOM 10229 H HZ3  . LYS A 1 102 ? 0.979   -18.430 -3.759  1.00 0.00 ? 102 LYS A HZ3  6  
ATOM 10230 N N    . MET A 1 103 ? -4.157  -16.181 3.276   1.00 0.00 ? 103 MET A N    6  
ATOM 10231 C CA   . MET A 1 103 ? -5.376  -16.244 4.075   1.00 0.00 ? 103 MET A CA   6  
ATOM 10232 C C    . MET A 1 103 ? -6.187  -14.960 3.930   1.00 0.00 ? 103 MET A C    6  
ATOM 10233 O O    . MET A 1 103 ? -7.372  -14.922 4.265   1.00 0.00 ? 103 MET A O    6  
ATOM 10234 C CB   . MET A 1 103 ? -5.034  -16.481 5.547   1.00 0.00 ? 103 MET A CB   6  
ATOM 10235 C CG   . MET A 1 103 ? -4.324  -15.309 6.203   1.00 0.00 ? 103 MET A CG   6  
ATOM 10236 S SD   . MET A 1 103 ? -4.192  -15.489 7.993   1.00 0.00 ? 103 MET A SD   6  
ATOM 10237 C CE   . MET A 1 103 ? -3.747  -17.218 8.127   1.00 0.00 ? 103 MET A CE   6  
ATOM 10238 H H    . MET A 1 103 ? -3.289  -16.165 3.731   1.00 0.00 ? 103 MET A H    6  
ATOM 10239 H HA   . MET A 1 103 ? -5.966  -17.072 3.713   1.00 0.00 ? 103 MET A HA   6  
ATOM 10240 H HB2  . MET A 1 103 ? -5.948  -16.670 6.091   1.00 0.00 ? 103 MET A HB2  6  
ATOM 10241 H HB3  . MET A 1 103 ? -4.395  -17.348 5.621   1.00 0.00 ? 103 MET A HB3  6  
ATOM 10242 H HG2  . MET A 1 103 ? -3.329  -15.230 5.791   1.00 0.00 ? 103 MET A HG2  6  
ATOM 10243 H HG3  . MET A 1 103 ? -4.874  -14.405 5.985   1.00 0.00 ? 103 MET A HG3  6  
ATOM 10244 H HE1  . MET A 1 103 ? -4.503  -17.823 7.647   1.00 0.00 ? 103 MET A HE1  6  
ATOM 10245 H HE2  . MET A 1 103 ? -2.795  -17.383 7.645   1.00 0.00 ? 103 MET A HE2  6  
ATOM 10246 H HE3  . MET A 1 103 ? -3.675  -17.491 9.169   1.00 0.00 ? 103 MET A HE3  6  
ATOM 10247 N N    . LEU A 1 104 ? -5.543  -13.912 3.429   1.00 0.00 ? 104 LEU A N    6  
ATOM 10248 C CA   . LEU A 1 104 ? -6.206  -12.626 3.239   1.00 0.00 ? 104 LEU A CA   6  
ATOM 10249 C C    . LEU A 1 104 ? -6.075  -12.154 1.795   1.00 0.00 ? 104 LEU A C    6  
ATOM 10250 O O    . LEU A 1 104 ? -4.976  -12.118 1.241   1.00 0.00 ? 104 LEU A O    6  
ATOM 10251 C CB   . LEU A 1 104 ? -5.613  -11.581 4.186   1.00 0.00 ? 104 LEU A CB   6  
ATOM 10252 C CG   . LEU A 1 104 ? -4.088  -11.471 4.194   1.00 0.00 ? 104 LEU A CG   6  
ATOM 10253 C CD1  . LEU A 1 104 ? -3.656  -10.053 4.532   1.00 0.00 ? 104 LEU A CD1  6  
ATOM 10254 C CD2  . LEU A 1 104 ? -3.488  -12.463 5.181   1.00 0.00 ? 104 LEU A CD2  6  
ATOM 10255 H H    . LEU A 1 104 ? -4.600  -14.004 3.180   1.00 0.00 ? 104 LEU A H    6  
ATOM 10256 H HA   . LEU A 1 104 ? -7.252  -12.756 3.469   1.00 0.00 ? 104 LEU A HA   6  
ATOM 10257 H HB2  . LEU A 1 104 ? -6.011  -10.618 3.906   1.00 0.00 ? 104 LEU A HB2  6  
ATOM 10258 H HB3  . LEU A 1 104 ? -5.934  -11.824 5.188   1.00 0.00 ? 104 LEU A HB3  6  
ATOM 10259 H HG   . LEU A 1 104 ? -3.710  -11.709 3.209   1.00 0.00 ? 104 LEU A HG   6  
ATOM 10260 H HD11 . LEU A 1 104 ? -4.454  -9.367  4.291   1.00 0.00 ? 104 LEU A HD11 6  
ATOM 10261 H HD12 . LEU A 1 104 ? -2.777  -9.798  3.960   1.00 0.00 ? 104 LEU A HD12 6  
ATOM 10262 H HD13 . LEU A 1 104 ? -3.430  -9.987  5.587   1.00 0.00 ? 104 LEU A HD13 6  
ATOM 10263 H HD21 . LEU A 1 104 ? -3.451  -13.443 4.729   1.00 0.00 ? 104 LEU A HD21 6  
ATOM 10264 H HD22 . LEU A 1 104 ? -4.099  -12.499 6.071   1.00 0.00 ? 104 LEU A HD22 6  
ATOM 10265 H HD23 . LEU A 1 104 ? -2.488  -12.148 5.443   1.00 0.00 ? 104 LEU A HD23 6  
ATOM 10266 N N    . GLN A 1 105 ? -7.202  -11.790 1.192   1.00 0.00 ? 105 GLN A N    6  
ATOM 10267 C CA   . GLN A 1 105 ? -7.212  -11.319 -0.188  1.00 0.00 ? 105 GLN A CA   6  
ATOM 10268 C C    . GLN A 1 105 ? -8.089  -10.079 -0.332  1.00 0.00 ? 105 GLN A C    6  
ATOM 10269 O O    . GLN A 1 105 ? -9.028  -9.877  0.436   1.00 0.00 ? 105 GLN A O    6  
ATOM 10270 C CB   . GLN A 1 105 ? -7.710  -12.422 -1.123  1.00 0.00 ? 105 GLN A CB   6  
ATOM 10271 C CG   . GLN A 1 105 ? -7.096  -13.783 -0.839  1.00 0.00 ? 105 GLN A CG   6  
ATOM 10272 C CD   . GLN A 1 105 ? -8.019  -14.928 -1.208  1.00 0.00 ? 105 GLN A CD   6  
ATOM 10273 O OE1  . GLN A 1 105 ? -9.032  -14.733 -1.879  1.00 0.00 ? 105 GLN A OE1  6  
ATOM 10274 N NE2  . GLN A 1 105 ? -7.672  -16.133 -0.770  1.00 0.00 ? 105 GLN A NE2  6  
ATOM 10275 H H    . GLN A 1 105 ? -8.046  -11.841 1.686   1.00 0.00 ? 105 GLN A H    6  
ATOM 10276 H HA   . GLN A 1 105 ? -6.199  -11.061 -0.457  1.00 0.00 ? 105 GLN A HA   6  
ATOM 10277 H HB2  . GLN A 1 105 ? -8.782  -12.506 -1.022  1.00 0.00 ? 105 GLN A HB2  6  
ATOM 10278 H HB3  . GLN A 1 105 ? -7.473  -12.150 -2.140  1.00 0.00 ? 105 GLN A HB3  6  
ATOM 10279 H HG2  . GLN A 1 105 ? -6.184  -13.879 -1.409  1.00 0.00 ? 105 GLN A HG2  6  
ATOM 10280 H HG3  . GLN A 1 105 ? -6.869  -13.848 0.215   1.00 0.00 ? 105 GLN A HG3  6  
ATOM 10281 H HE21 . GLN A 1 105 ? -6.851  -16.213 -0.239  1.00 0.00 ? 105 GLN A HE21 6  
ATOM 10282 H HE22 . GLN A 1 105 ? -8.250  -16.891 -0.993  1.00 0.00 ? 105 GLN A HE22 6  
ATOM 10283 N N    . GLY A 1 106 ? -7.775  -9.251  -1.324  1.00 0.00 ? 106 GLY A N    6  
ATOM 10284 C CA   . GLY A 1 106 ? -8.544  -8.041  -1.551  1.00 0.00 ? 106 GLY A CA   6  
ATOM 10285 C C    . GLY A 1 106 ? -7.857  -7.089  -2.511  1.00 0.00 ? 106 GLY A C    6  
ATOM 10286 O O    . GLY A 1 106 ? -7.217  -7.520  -3.470  1.00 0.00 ? 106 GLY A O    6  
ATOM 10287 H H    . GLY A 1 106 ? -7.016  -9.463  -1.906  1.00 0.00 ? 106 GLY A H    6  
ATOM 10288 H HA2  . GLY A 1 106 ? -9.508  -8.310  -1.957  1.00 0.00 ? 106 GLY A HA2  6  
ATOM 10289 H HA3  . GLY A 1 106 ? -8.690  -7.538  -0.607  1.00 0.00 ? 106 GLY A HA3  6  
ATOM 10290 N N    . ILE A 1 107 ? -7.991  -5.793  -2.252  1.00 0.00 ? 107 ILE A N    6  
ATOM 10291 C CA   . ILE A 1 107 ? -7.378  -4.778  -3.101  1.00 0.00 ? 107 ILE A CA   6  
ATOM 10292 C C    . ILE A 1 107 ? -6.612  -3.755  -2.269  1.00 0.00 ? 107 ILE A C    6  
ATOM 10293 O O    . ILE A 1 107 ? -6.739  -3.714  -1.045  1.00 0.00 ? 107 ILE A O    6  
ATOM 10294 C CB   . ILE A 1 107 ? -8.431  -4.046  -3.953  1.00 0.00 ? 107 ILE A CB   6  
ATOM 10295 C CG1  . ILE A 1 107 ? -9.595  -3.581  -3.075  1.00 0.00 ? 107 ILE A CG1  6  
ATOM 10296 C CG2  . ILE A 1 107 ? -8.931  -4.950  -5.070  1.00 0.00 ? 107 ILE A CG2  6  
ATOM 10297 C CD1  . ILE A 1 107 ? -10.589 -2.703  -3.804  1.00 0.00 ? 107 ILE A CD1  6  
ATOM 10298 H H    . ILE A 1 107 ? -8.513  -5.512  -1.473  1.00 0.00 ? 107 ILE A H    6  
ATOM 10299 H HA   . ILE A 1 107 ? -6.687  -5.274  -3.767  1.00 0.00 ? 107 ILE A HA   6  
ATOM 10300 H HB   . ILE A 1 107 ? -7.962  -3.184  -4.402  1.00 0.00 ? 107 ILE A HB   6  
ATOM 10301 H HG12 . ILE A 1 107 ? -10.126 -4.444  -2.705  1.00 0.00 ? 107 ILE A HG12 6  
ATOM 10302 H HG13 . ILE A 1 107 ? -9.204  -3.018  -2.240  1.00 0.00 ? 107 ILE A HG13 6  
ATOM 10303 H HG21 . ILE A 1 107 ? -8.285  -5.811  -5.151  1.00 0.00 ? 107 ILE A HG21 6  
ATOM 10304 H HG22 . ILE A 1 107 ? -9.936  -5.274  -4.847  1.00 0.00 ? 107 ILE A HG22 6  
ATOM 10305 H HG23 . ILE A 1 107 ? -8.925  -4.406  -6.003  1.00 0.00 ? 107 ILE A HG23 6  
ATOM 10306 H HD11 . ILE A 1 107 ? -10.142 -1.739  -3.998  1.00 0.00 ? 107 ILE A HD11 6  
ATOM 10307 H HD12 . ILE A 1 107 ? -10.861 -3.167  -4.740  1.00 0.00 ? 107 ILE A HD12 6  
ATOM 10308 H HD13 . ILE A 1 107 ? -11.471 -2.574  -3.195  1.00 0.00 ? 107 ILE A HD13 6  
ATOM 10309 N N    . PHE A 1 108 ? -5.818  -2.928  -2.942  1.00 0.00 ? 108 PHE A N    6  
ATOM 10310 C CA   . PHE A 1 108 ? -5.032  -1.904  -2.265  1.00 0.00 ? 108 PHE A CA   6  
ATOM 10311 C C    . PHE A 1 108 ? -4.600  -0.815  -3.243  1.00 0.00 ? 108 PHE A C    6  
ATOM 10312 O O    . PHE A 1 108 ? -4.605  -1.001  -4.460  1.00 0.00 ? 108 PHE A O    6  
ATOM 10313 C CB   . PHE A 1 108 ? -3.802  -2.528  -1.603  1.00 0.00 ? 108 PHE A CB   6  
ATOM 10314 C CG   . PHE A 1 108 ? -3.300  -3.756  -2.309  1.00 0.00 ? 108 PHE A CG   6  
ATOM 10315 C CD1  . PHE A 1 108 ? -2.376  -3.652  -3.336  1.00 0.00 ? 108 PHE A CD1  6  
ATOM 10316 C CD2  . PHE A 1 108 ? -3.753  -5.014  -1.945  1.00 0.00 ? 108 PHE A CD2  6  
ATOM 10317 C CE1  . PHE A 1 108 ? -1.913  -4.779  -3.987  1.00 0.00 ? 108 PHE A CE1  6  
ATOM 10318 C CE2  . PHE A 1 108 ? -3.292  -6.145  -2.592  1.00 0.00 ? 108 PHE A CE2  6  
ATOM 10319 C CZ   . PHE A 1 108 ? -2.372  -6.027  -3.615  1.00 0.00 ? 108 PHE A CZ   6  
ATOM 10320 H H    . PHE A 1 108 ? -5.759  -3.010  -3.917  1.00 0.00 ? 108 PHE A H    6  
ATOM 10321 H HA   . PHE A 1 108 ? -5.654  -1.460  -1.502  1.00 0.00 ? 108 PHE A HA   6  
ATOM 10322 H HB2  . PHE A 1 108 ? -3.002  -1.803  -1.591  1.00 0.00 ? 108 PHE A HB2  6  
ATOM 10323 H HB3  . PHE A 1 108 ? -4.048  -2.804  -0.589  1.00 0.00 ? 108 PHE A HB3  6  
ATOM 10324 H HD1  . PHE A 1 108 ? -2.016  -2.675  -3.628  1.00 0.00 ? 108 PHE A HD1  6  
ATOM 10325 H HD2  . PHE A 1 108 ? -4.474  -5.107  -1.146  1.00 0.00 ? 108 PHE A HD2  6  
ATOM 10326 H HE1  . PHE A 1 108 ? -1.193  -4.684  -4.787  1.00 0.00 ? 108 PHE A HE1  6  
ATOM 10327 H HE2  . PHE A 1 108 ? -3.654  -7.119  -2.299  1.00 0.00 ? 108 PHE A HE2  6  
ATOM 10328 H HZ   . PHE A 1 108 ? -2.011  -6.910  -4.122  1.00 0.00 ? 108 PHE A HZ   6  
ATOM 10329 N N    . PRO A 1 109 ? -4.218  0.350   -2.700  1.00 0.00 ? 109 PRO A N    6  
ATOM 10330 C CA   . PRO A 1 109 ? -3.776  1.492   -3.506  1.00 0.00 ? 109 PRO A CA   6  
ATOM 10331 C C    . PRO A 1 109 ? -2.425  1.246   -4.168  1.00 0.00 ? 109 PRO A C    6  
ATOM 10332 O O    . PRO A 1 109 ? -1.481  0.785   -3.526  1.00 0.00 ? 109 PRO A O    6  
ATOM 10333 C CB   . PRO A 1 109 ? -3.671  2.628   -2.484  1.00 0.00 ? 109 PRO A CB   6  
ATOM 10334 C CG   . PRO A 1 109 ? -3.439  1.945   -1.181  1.00 0.00 ? 109 PRO A CG   6  
ATOM 10335 C CD   . PRO A 1 109 ? -4.187  0.642   -1.257  1.00 0.00 ? 109 PRO A CD   6  
ATOM 10336 H HA   . PRO A 1 109 ? -4.504  1.751   -4.260  1.00 0.00 ? 109 PRO A HA   6  
ATOM 10337 H HB2  . PRO A 1 109 ? -2.845  3.275   -2.745  1.00 0.00 ? 109 PRO A HB2  6  
ATOM 10338 H HB3  . PRO A 1 109 ? -4.590  3.194   -2.475  1.00 0.00 ? 109 PRO A HB3  6  
ATOM 10339 H HG2  . PRO A 1 109 ? -2.384  1.764   -1.044  1.00 0.00 ? 109 PRO A HG2  6  
ATOM 10340 H HG3  . PRO A 1 109 ? -3.825  2.552   -0.375  1.00 0.00 ? 109 PRO A HG3  6  
ATOM 10341 H HD2  . PRO A 1 109 ? -3.657  -0.129  -0.718  1.00 0.00 ? 109 PRO A HD2  6  
ATOM 10342 H HD3  . PRO A 1 109 ? -5.188  0.759   -0.866  1.00 0.00 ? 109 PRO A HD3  6  
ATOM 10343 N N    . LYS A 1 110 ? -2.338  1.556   -5.457  1.00 0.00 ? 110 LYS A N    6  
ATOM 10344 C CA   . LYS A 1 110 ? -1.102  1.370   -6.208  1.00 0.00 ? 110 LYS A CA   6  
ATOM 10345 C C    . LYS A 1 110 ? 0.012   2.249   -5.649  1.00 0.00 ? 110 LYS A C    6  
ATOM 10346 O O    . LYS A 1 110 ? 1.193   1.935   -5.789  1.00 0.00 ? 110 LYS A O    6  
ATOM 10347 C CB   . LYS A 1 110 ? -1.326  1.691   -7.687  1.00 0.00 ? 110 LYS A CB   6  
ATOM 10348 C CG   . LYS A 1 110 ? -2.539  0.998   -8.284  1.00 0.00 ? 110 LYS A CG   6  
ATOM 10349 C CD   . LYS A 1 110 ? -3.103  1.775   -9.461  1.00 0.00 ? 110 LYS A CD   6  
ATOM 10350 C CE   . LYS A 1 110 ? -2.225  1.632   -10.695 1.00 0.00 ? 110 LYS A CE   6  
ATOM 10351 N NZ   . LYS A 1 110 ? -2.962  1.974   -11.943 1.00 0.00 ? 110 LYS A NZ   6  
ATOM 10352 H H    . LYS A 1 110 ? -3.125  1.920   -5.915  1.00 0.00 ? 110 LYS A H    6  
ATOM 10353 H HA   . LYS A 1 110 ? -0.809  0.335   -6.114  1.00 0.00 ? 110 LYS A HA   6  
ATOM 10354 H HB2  . LYS A 1 110 ? -1.458  2.758   -7.795  1.00 0.00 ? 110 LYS A HB2  6  
ATOM 10355 H HB3  . LYS A 1 110 ? -0.453  1.387   -8.246  1.00 0.00 ? 110 LYS A HB3  6  
ATOM 10356 H HG2  . LYS A 1 110 ? -2.249  0.014   -8.621  1.00 0.00 ? 110 LYS A HG2  6  
ATOM 10357 H HG3  . LYS A 1 110 ? -3.302  0.910   -7.523  1.00 0.00 ? 110 LYS A HG3  6  
ATOM 10358 H HD2  . LYS A 1 110 ? -4.089  1.400   -9.690  1.00 0.00 ? 110 LYS A HD2  6  
ATOM 10359 H HD3  . LYS A 1 110 ? -3.166  2.820   -9.194  1.00 0.00 ? 110 LYS A HD3  6  
ATOM 10360 H HE2  . LYS A 1 110 ? -1.377  2.292   -10.596 1.00 0.00 ? 110 LYS A HE2  6  
ATOM 10361 H HE3  . LYS A 1 110 ? -1.880  0.611   -10.759 1.00 0.00 ? 110 LYS A HE3  6  
ATOM 10362 H HZ1  . LYS A 1 110 ? -2.324  1.917   -12.762 1.00 0.00 ? 110 LYS A HZ1  6  
ATOM 10363 H HZ2  . LYS A 1 110 ? -3.342  2.941   -11.879 1.00 0.00 ? 110 LYS A HZ2  6  
ATOM 10364 H HZ3  . LYS A 1 110 ? -3.751  1.312   -12.084 1.00 0.00 ? 110 LYS A HZ3  6  
ATOM 10365 N N    . SER A 1 111 ? -0.373  3.352   -5.014  1.00 0.00 ? 111 SER A N    6  
ATOM 10366 C CA   . SER A 1 111 ? 0.593   4.278   -4.435  1.00 0.00 ? 111 SER A CA   6  
ATOM 10367 C C    . SER A 1 111 ? 1.305   3.646   -3.243  1.00 0.00 ? 111 SER A C    6  
ATOM 10368 O O    . SER A 1 111 ? 2.294   4.180   -2.742  1.00 0.00 ? 111 SER A O    6  
ATOM 10369 C CB   . SER A 1 111 ? -0.103  5.570   -4.002  1.00 0.00 ? 111 SER A CB   6  
ATOM 10370 O OG   . SER A 1 111 ? -1.172  5.299   -3.112  1.00 0.00 ? 111 SER A OG   6  
ATOM 10371 H H    . SER A 1 111 ? -1.331  3.548   -4.935  1.00 0.00 ? 111 SER A H    6  
ATOM 10372 H HA   . SER A 1 111 ? 1.325   4.511   -5.195  1.00 0.00 ? 111 SER A HA   6  
ATOM 10373 H HB2  . SER A 1 111 ? 0.610   6.210   -3.505  1.00 0.00 ? 111 SER A HB2  6  
ATOM 10374 H HB3  . SER A 1 111 ? -0.495  6.074   -4.874  1.00 0.00 ? 111 SER A HB3  6  
ATOM 10375 H HG   . SER A 1 111 ? -1.894  4.889   -3.593  1.00 0.00 ? 111 SER A HG   6  
ATOM 10376 N N    . PHE A 1 112 ? 0.794   2.504   -2.795  1.00 0.00 ? 112 PHE A N    6  
ATOM 10377 C CA   . PHE A 1 112 ? 1.380   1.798   -1.661  1.00 0.00 ? 112 PHE A CA   6  
ATOM 10378 C C    . PHE A 1 112 ? 2.169   0.579   -2.128  1.00 0.00 ? 112 PHE A C    6  
ATOM 10379 O O    . PHE A 1 112 ? 2.996   0.042   -1.391  1.00 0.00 ? 112 PHE A O    6  
ATOM 10380 C CB   . PHE A 1 112 ? 0.286   1.367   -0.682  1.00 0.00 ? 112 PHE A CB   6  
ATOM 10381 C CG   . PHE A 1 112 ? -0.266  2.499   0.137   1.00 0.00 ? 112 PHE A CG   6  
ATOM 10382 C CD1  . PHE A 1 112 ? -0.762  3.638   -0.477  1.00 0.00 ? 112 PHE A CD1  6  
ATOM 10383 C CD2  . PHE A 1 112 ? -0.289  2.424   1.520   1.00 0.00 ? 112 PHE A CD2  6  
ATOM 10384 C CE1  . PHE A 1 112 ? -1.269  4.681   0.275   1.00 0.00 ? 112 PHE A CE1  6  
ATOM 10385 C CE2  . PHE A 1 112 ? -0.796  3.463   2.277   1.00 0.00 ? 112 PHE A CE2  6  
ATOM 10386 C CZ   . PHE A 1 112 ? -1.287  4.593   1.653   1.00 0.00 ? 112 PHE A CZ   6  
ATOM 10387 H H    . PHE A 1 112 ? 0.004   2.127   -3.237  1.00 0.00 ? 112 PHE A H    6  
ATOM 10388 H HA   . PHE A 1 112 ? 2.052   2.477   -1.160  1.00 0.00 ? 112 PHE A HA   6  
ATOM 10389 H HB2  . PHE A 1 112 ? -0.531  0.930   -1.236  1.00 0.00 ? 112 PHE A HB2  6  
ATOM 10390 H HB3  . PHE A 1 112 ? 0.690   0.631   -0.003  1.00 0.00 ? 112 PHE A HB3  6  
ATOM 10391 H HD1  . PHE A 1 112 ? -0.749  3.708   -1.554  1.00 0.00 ? 112 PHE A HD1  6  
ATOM 10392 H HD2  . PHE A 1 112 ? 0.095   1.539   2.010   1.00 0.00 ? 112 PHE A HD2  6  
ATOM 10393 H HE1  . PHE A 1 112 ? -1.653  5.563   -0.216  1.00 0.00 ? 112 PHE A HE1  6  
ATOM 10394 H HE2  . PHE A 1 112 ? -0.808  3.391   3.354   1.00 0.00 ? 112 PHE A HE2  6  
ATOM 10395 H HZ   . PHE A 1 112 ? -1.683  5.407   2.242   1.00 0.00 ? 112 PHE A HZ   6  
ATOM 10396 N N    . ILE A 1 113 ? 1.907   0.147   -3.357  1.00 0.00 ? 113 ILE A N    6  
ATOM 10397 C CA   . ILE A 1 113 ? 2.593   -1.008  -3.923  1.00 0.00 ? 113 ILE A CA   6  
ATOM 10398 C C    . ILE A 1 113 ? 3.724   -0.576  -4.850  1.00 0.00 ? 113 ILE A C    6  
ATOM 10399 O O    . ILE A 1 113 ? 3.505   0.159   -5.814  1.00 0.00 ? 113 ILE A O    6  
ATOM 10400 C CB   . ILE A 1 113 ? 1.621   -1.912  -4.704  1.00 0.00 ? 113 ILE A CB   6  
ATOM 10401 C CG1  . ILE A 1 113 ? 0.482   -2.379  -3.795  1.00 0.00 ? 113 ILE A CG1  6  
ATOM 10402 C CG2  . ILE A 1 113 ? 2.362   -3.106  -5.289  1.00 0.00 ? 113 ILE A CG2  6  
ATOM 10403 C CD1  . ILE A 1 113 ? 0.953   -3.165  -2.592  1.00 0.00 ? 113 ILE A CD1  6  
ATOM 10404 H H    . ILE A 1 113 ? 1.237   0.617   -3.896  1.00 0.00 ? 113 ILE A H    6  
ATOM 10405 H HA   . ILE A 1 113 ? 3.009   -1.581  -3.107  1.00 0.00 ? 113 ILE A HA   6  
ATOM 10406 H HB   . ILE A 1 113 ? 1.209   -1.340  -5.521  1.00 0.00 ? 113 ILE A HB   6  
ATOM 10407 H HG12 . ILE A 1 113 ? -0.060  -1.518  -3.437  1.00 0.00 ? 113 ILE A HG12 6  
ATOM 10408 H HG13 . ILE A 1 113 ? -0.187  -3.010  -4.364  1.00 0.00 ? 113 ILE A HG13 6  
ATOM 10409 H HG21 . ILE A 1 113 ? 2.215   -3.967  -4.654  1.00 0.00 ? 113 ILE A HG21 6  
ATOM 10410 H HG22 . ILE A 1 113 ? 1.980   -3.318  -6.276  1.00 0.00 ? 113 ILE A HG22 6  
ATOM 10411 H HG23 . ILE A 1 113 ? 3.416   -2.880  -5.351  1.00 0.00 ? 113 ILE A HG23 6  
ATOM 10412 H HD11 . ILE A 1 113 ? 0.370   -4.071  -2.503  1.00 0.00 ? 113 ILE A HD11 6  
ATOM 10413 H HD12 . ILE A 1 113 ? 1.995   -3.420  -2.713  1.00 0.00 ? 113 ILE A HD12 6  
ATOM 10414 H HD13 . ILE A 1 113 ? 0.828   -2.569  -1.701  1.00 0.00 ? 113 ILE A HD13 6  
ATOM 10415 N N    . HIS A 1 114 ? 4.934   -1.039  -4.554  1.00 0.00 ? 114 HIS A N    6  
ATOM 10416 C CA   . HIS A 1 114 ? 6.100   -0.702  -5.363  1.00 0.00 ? 114 HIS A CA   6  
ATOM 10417 C C    . HIS A 1 114 ? 6.416   -1.820  -6.352  1.00 0.00 ? 114 HIS A C    6  
ATOM 10418 O O    . HIS A 1 114 ? 7.007   -2.836  -5.987  1.00 0.00 ? 114 HIS A O    6  
ATOM 10419 C CB   . HIS A 1 114 ? 7.311   -0.442  -4.466  1.00 0.00 ? 114 HIS A CB   6  
ATOM 10420 C CG   . HIS A 1 114 ? 8.503   0.081   -5.206  1.00 0.00 ? 114 HIS A CG   6  
ATOM 10421 N ND1  . HIS A 1 114 ? 8.480   1.248   -5.940  1.00 0.00 ? 114 HIS A ND1  6  
ATOM 10422 C CD2  . HIS A 1 114 ? 9.760   -0.409  -5.321  1.00 0.00 ? 114 HIS A CD2  6  
ATOM 10423 C CE1  . HIS A 1 114 ? 9.670   1.452   -6.476  1.00 0.00 ? 114 HIS A CE1  6  
ATOM 10424 N NE2  . HIS A 1 114 ? 10.465  0.461   -6.115  1.00 0.00 ? 114 HIS A NE2  6  
ATOM 10425 H H    . HIS A 1 114 ? 5.045   -1.620  -3.773  1.00 0.00 ? 114 HIS A H    6  
ATOM 10426 H HA   . HIS A 1 114 ? 5.873   0.197   -5.915  1.00 0.00 ? 114 HIS A HA   6  
ATOM 10427 H HB2  . HIS A 1 114 ? 7.043   0.284   -3.713  1.00 0.00 ? 114 HIS A HB2  6  
ATOM 10428 H HB3  . HIS A 1 114 ? 7.598   -1.365  -3.983  1.00 0.00 ? 114 HIS A HB3  6  
ATOM 10429 H HD1  . HIS A 1 114 ? 7.706   1.838   -6.053  1.00 0.00 ? 114 HIS A HD1  6  
ATOM 10430 H HD2  . HIS A 1 114 ? 10.138  -1.317  -4.871  1.00 0.00 ? 114 HIS A HD2  6  
ATOM 10431 H HE1  . HIS A 1 114 ? 9.947   2.287   -7.103  1.00 0.00 ? 114 HIS A HE1  6  
ATOM 10432 H HE2  . HIS A 1 114 ? 11.378  0.321   -6.443  1.00 0.00 ? 114 HIS A HE2  6  
ATOM 10433 N N    . ILE A 1 115 ? 6.018   -1.624  -7.604  1.00 0.00 ? 115 ILE A N    6  
ATOM 10434 C CA   . ILE A 1 115 ? 6.259   -2.615  -8.646  1.00 0.00 ? 115 ILE A CA   6  
ATOM 10435 C C    . ILE A 1 115 ? 7.749   -2.760  -8.933  1.00 0.00 ? 115 ILE A C    6  
ATOM 10436 O O    . ILE A 1 115 ? 8.380   -1.851  -9.473  1.00 0.00 ? 115 ILE A O    6  
ATOM 10437 C CB   . ILE A 1 115 ? 5.529   -2.249  -9.952  1.00 0.00 ? 115 ILE A CB   6  
ATOM 10438 C CG1  . ILE A 1 115 ? 4.017   -2.205  -9.722  1.00 0.00 ? 115 ILE A CG1  6  
ATOM 10439 C CG2  . ILE A 1 115 ? 5.875   -3.244  -11.049 1.00 0.00 ? 115 ILE A CG2  6  
ATOM 10440 C CD1  . ILE A 1 115 ? 3.497   -3.363  -8.898  1.00 0.00 ? 115 ILE A CD1  6  
ATOM 10441 H H    . ILE A 1 115 ? 5.551   -0.794  -7.834  1.00 0.00 ? 115 ILE A H    6  
ATOM 10442 H HA   . ILE A 1 115 ? 5.876   -3.564  -8.297  1.00 0.00 ? 115 ILE A HA   6  
ATOM 10443 H HB   . ILE A 1 115 ? 5.867   -1.273  -10.265 1.00 0.00 ? 115 ILE A HB   6  
ATOM 10444 H HG12 . ILE A 1 115 ? 3.763   -1.292  -9.206  1.00 0.00 ? 115 ILE A HG12 6  
ATOM 10445 H HG13 . ILE A 1 115 ? 3.514   -2.225  -10.678 1.00 0.00 ? 115 ILE A HG13 6  
ATOM 10446 H HG21 . ILE A 1 115 ? 5.021   -3.877  -11.243 1.00 0.00 ? 115 ILE A HG21 6  
ATOM 10447 H HG22 . ILE A 1 115 ? 6.138   -2.710  -11.949 1.00 0.00 ? 115 ILE A HG22 6  
ATOM 10448 H HG23 . ILE A 1 115 ? 6.709   -3.853  -10.734 1.00 0.00 ? 115 ILE A HG23 6  
ATOM 10449 H HD11 . ILE A 1 115 ? 2.424   -3.426  -9.004  1.00 0.00 ? 115 ILE A HD11 6  
ATOM 10450 H HD12 . ILE A 1 115 ? 3.947   -4.282  -9.244  1.00 0.00 ? 115 ILE A HD12 6  
ATOM 10451 H HD13 . ILE A 1 115 ? 3.747   -3.208  -7.860  1.00 0.00 ? 115 ILE A HD13 6  
ATOM 10452 N N    . LYS A 1 116 ? 8.307   -3.910  -8.570  1.00 0.00 ? 116 LYS A N    6  
ATOM 10453 C CA   . LYS A 1 116 ? 9.724   -4.177  -8.790  1.00 0.00 ? 116 LYS A CA   6  
ATOM 10454 C C    . LYS A 1 116 ? 9.962   -4.724  -10.194 1.00 0.00 ? 116 LYS A C    6  
ATOM 10455 O O    . LYS A 1 116 ? 9.763   -5.912  -10.448 1.00 0.00 ? 116 LYS A O    6  
ATOM 10456 C CB   . LYS A 1 116 ? 10.245  -5.169  -7.749  1.00 0.00 ? 116 LYS A CB   6  
ATOM 10457 C CG   . LYS A 1 116 ? 10.190  -4.642  -6.325  1.00 0.00 ? 116 LYS A CG   6  
ATOM 10458 C CD   . LYS A 1 116 ? 10.697  -5.672  -5.330  1.00 0.00 ? 116 LYS A CD   6  
ATOM 10459 C CE   . LYS A 1 116 ? 11.265  -5.010  -4.084  1.00 0.00 ? 116 LYS A CE   6  
ATOM 10460 N NZ   . LYS A 1 116 ? 11.580  -6.005  -3.021  1.00 0.00 ? 116 LYS A NZ   6  
ATOM 10461 H H    . LYS A 1 116 ? 7.752   -4.597  -8.143  1.00 0.00 ? 116 LYS A H    6  
ATOM 10462 H HA   . LYS A 1 116 ? 10.257  -3.244  -8.685  1.00 0.00 ? 116 LYS A HA   6  
ATOM 10463 H HB2  . LYS A 1 116 ? 9.652   -6.071  -7.800  1.00 0.00 ? 116 LYS A HB2  6  
ATOM 10464 H HB3  . LYS A 1 116 ? 11.272  -5.411  -7.982  1.00 0.00 ? 116 LYS A HB3  6  
ATOM 10465 H HG2  . LYS A 1 116 ? 10.804  -3.757  -6.255  1.00 0.00 ? 116 LYS A HG2  6  
ATOM 10466 H HG3  . LYS A 1 116 ? 9.167   -4.393  -6.083  1.00 0.00 ? 116 LYS A HG3  6  
ATOM 10467 H HD2  . LYS A 1 116 ? 9.879   -6.314  -5.041  1.00 0.00 ? 116 LYS A HD2  6  
ATOM 10468 H HD3  . LYS A 1 116 ? 11.472  -6.262  -5.798  1.00 0.00 ? 116 LYS A HD3  6  
ATOM 10469 H HE2  . LYS A 1 116 ? 12.169  -4.484  -4.351  1.00 0.00 ? 116 LYS A HE2  6  
ATOM 10470 H HE3  . LYS A 1 116 ? 10.539  -4.306  -3.703  1.00 0.00 ? 116 LYS A HE3  6  
ATOM 10471 H HZ1  . LYS A 1 116 ? 12.605  -6.169  -2.978  1.00 0.00 ? 116 LYS A HZ1  6  
ATOM 10472 H HZ2  . LYS A 1 116 ? 11.103  -6.906  -3.224  1.00 0.00 ? 116 LYS A HZ2  6  
ATOM 10473 H HZ3  . LYS A 1 116 ? 11.256  -5.655  -2.097  1.00 0.00 ? 116 LYS A HZ3  6  
ATOM 10474 N N    . GLU A 1 117 ? 10.390  -3.851  -11.100 1.00 0.00 ? 117 GLU A N    6  
ATOM 10475 C CA   . GLU A 1 117 ? 10.656  -4.249  -12.478 1.00 0.00 ? 117 GLU A CA   6  
ATOM 10476 C C    . GLU A 1 117 ? 12.141  -4.531  -12.686 1.00 0.00 ? 117 GLU A C    6  
ATOM 10477 O O    . GLU A 1 117 ? 12.750  -4.039  -13.636 1.00 0.00 ? 117 GLU A O    6  
ATOM 10478 C CB   . GLU A 1 117 ? 10.191  -3.159  -13.446 1.00 0.00 ? 117 GLU A CB   6  
ATOM 10479 C CG   . GLU A 1 117 ? 10.220  -3.587  -14.903 1.00 0.00 ? 117 GLU A CG   6  
ATOM 10480 C CD   . GLU A 1 117 ? 9.231   -2.817  -15.757 1.00 0.00 ? 117 GLU A CD   6  
ATOM 10481 O OE1  . GLU A 1 117 ? 9.171   -1.577  -15.624 1.00 0.00 ? 117 GLU A OE1  6  
ATOM 10482 O OE2  . GLU A 1 117 ? 8.517   -3.455  -16.558 1.00 0.00 ? 117 GLU A OE2  6  
ATOM 10483 H H    . GLU A 1 117 ? 10.530  -2.918  -10.837 1.00 0.00 ? 117 GLU A H    6  
ATOM 10484 H HA   . GLU A 1 117 ? 10.100  -5.153  -12.675 1.00 0.00 ? 117 GLU A HA   6  
ATOM 10485 H HB2  . GLU A 1 117 ? 9.180   -2.878  -13.194 1.00 0.00 ? 117 GLU A HB2  6  
ATOM 10486 H HB3  . GLU A 1 117 ? 10.833  -2.298  -13.333 1.00 0.00 ? 117 GLU A HB3  6  
ATOM 10487 H HG2  . GLU A 1 117 ? 11.213  -3.423  -15.294 1.00 0.00 ? 117 GLU A HG2  6  
ATOM 10488 H HG3  . GLU A 1 117 ? 9.980   -4.639  -14.961 1.00 0.00 ? 117 GLU A HG3  6  
ATOM 10489 N N    . VAL A 1 118 ? 12.718  -5.325  -11.790 1.00 0.00 ? 118 VAL A N    6  
ATOM 10490 C CA   . VAL A 1 118 ? 14.132  -5.673  -11.874 1.00 0.00 ? 118 VAL A CA   6  
ATOM 10491 C C    . VAL A 1 118 ? 14.339  -6.933  -12.707 1.00 0.00 ? 118 VAL A C    6  
ATOM 10492 O O    . VAL A 1 118 ? 15.471  -7.349  -12.954 1.00 0.00 ? 118 VAL A O    6  
ATOM 10493 C CB   . VAL A 1 118 ? 14.741  -5.889  -10.477 1.00 0.00 ? 118 VAL A CB   6  
ATOM 10494 C CG1  . VAL A 1 118 ? 14.894  -4.561  -9.749  1.00 0.00 ? 118 VAL A CG1  6  
ATOM 10495 C CG2  . VAL A 1 118 ? 13.889  -6.854  -9.667  1.00 0.00 ? 118 VAL A CG2  6  
ATOM 10496 H H    . VAL A 1 118 ? 12.180  -5.686  -11.055 1.00 0.00 ? 118 VAL A H    6  
ATOM 10497 H HA   . VAL A 1 118 ? 14.650  -4.851  -12.347 1.00 0.00 ? 118 VAL A HA   6  
ATOM 10498 H HB   . VAL A 1 118 ? 15.723  -6.322  -10.597 1.00 0.00 ? 118 VAL A HB   6  
ATOM 10499 H HG11 . VAL A 1 118 ? 15.379  -3.849  -10.400 1.00 0.00 ? 118 VAL A HG11 6  
ATOM 10500 H HG12 . VAL A 1 118 ? 13.919  -4.190  -9.469  1.00 0.00 ? 118 VAL A HG12 6  
ATOM 10501 H HG13 . VAL A 1 118 ? 15.493  -4.704  -8.862  1.00 0.00 ? 118 VAL A HG13 6  
ATOM 10502 H HG21 . VAL A 1 118 ? 13.438  -7.579  -10.329 1.00 0.00 ? 118 VAL A HG21 6  
ATOM 10503 H HG22 . VAL A 1 118 ? 14.509  -7.363  -8.945  1.00 0.00 ? 118 VAL A HG22 6  
ATOM 10504 H HG23 . VAL A 1 118 ? 13.113  -6.306  -9.153  1.00 0.00 ? 118 VAL A HG23 6  
ATOM 10505 N N    . THR A 1 119 ? 13.236  -7.538  -13.139 1.00 0.00 ? 119 THR A N    6  
ATOM 10506 C CA   . THR A 1 119 ? 13.296  -8.751  -13.944 1.00 0.00 ? 119 THR A CA   6  
ATOM 10507 C C    . THR A 1 119 ? 13.568  -8.427  -15.408 1.00 0.00 ? 119 THR A C    6  
ATOM 10508 O O    . THR A 1 119 ? 13.941  -9.302  -16.190 1.00 0.00 ? 119 THR A O    6  
ATOM 10509 C CB   . THR A 1 119 ? 11.987  -9.558  -13.843 1.00 0.00 ? 119 THR A CB   6  
ATOM 10510 O OG1  . THR A 1 119 ? 11.693  -9.843  -12.471 1.00 0.00 ? 119 THR A OG1  6  
ATOM 10511 C CG2  . THR A 1 119 ? 12.091  -10.858 -14.626 1.00 0.00 ? 119 THR A CG2  6  
ATOM 10512 H H    . THR A 1 119 ? 12.363  -7.158  -12.909 1.00 0.00 ? 119 THR A H    6  
ATOM 10513 H HA   . THR A 1 119 ? 14.102  -9.364  -13.565 1.00 0.00 ? 119 THR A HA   6  
ATOM 10514 H HB   . THR A 1 119 ? 11.185  -8.966  -14.260 1.00 0.00 ? 119 THR A HB   6  
ATOM 10515 H HG1  . THR A 1 119 ? 10.743  -9.816  -12.335 1.00 0.00 ? 119 THR A HG1  6  
ATOM 10516 H HG21 . THR A 1 119 ? 11.330  -11.544 -14.285 1.00 0.00 ? 119 THR A HG21 6  
ATOM 10517 H HG22 . THR A 1 119 ? 13.066  -11.295 -14.471 1.00 0.00 ? 119 THR A HG22 6  
ATOM 10518 H HG23 . THR A 1 119 ? 11.949  -10.656 -15.678 1.00 0.00 ? 119 THR A HG23 6  
ATOM 10519 N N    . GLY A 1 1   ? 15.080  -5.603  -31.751 1.00 0.00 ? 1   GLY A N    7  
ATOM 10520 C CA   . GLY A 1 1   ? 14.174  -6.348  -30.896 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10521 C C    . GLY A 1 1   ? 14.497  -6.182  -29.425 1.00 0.00 ? 1   GLY A C    7  
ATOM 10522 O O    . GLY A 1 1   ? 15.652  -6.309  -29.017 1.00 0.00 ? 1   GLY A O    7  
ATOM 10523 H H1   . GLY A 1 1   ? 15.328  -5.961  -32.629 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10524 H HA2  . GLY A 1 1   ? 13.166  -6.005  -31.074 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10525 H HA3  . GLY A 1 1   ? 14.238  -7.396  -31.150 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10526 N N    . SER A 1 2   ? 13.475  -5.894  -28.625 1.00 0.00 ? 2   SER A N    7  
ATOM 10527 C CA   . SER A 1 2   ? 13.657  -5.705  -27.190 1.00 0.00 ? 2   SER A CA   7  
ATOM 10528 C C    . SER A 1 2   ? 13.389  -7.001  -26.433 1.00 0.00 ? 2   SER A C    7  
ATOM 10529 O O    . SER A 1 2   ? 12.754  -6.997  -25.378 1.00 0.00 ? 2   SER A O    7  
ATOM 10530 C CB   . SER A 1 2   ? 12.730  -4.600  -26.679 1.00 0.00 ? 2   SER A CB   7  
ATOM 10531 O OG   . SER A 1 2   ? 13.181  -4.091  -25.436 1.00 0.00 ? 2   SER A OG   7  
ATOM 10532 H H    . SER A 1 2   ? 12.578  -5.805  -29.009 1.00 0.00 ? 2   SER A H    7  
ATOM 10533 H HA   . SER A 1 2   ? 14.682  -5.408  -27.022 1.00 0.00 ? 2   SER A HA   7  
ATOM 10534 H HB2  . SER A 1 2   ? 12.704  -3.795  -27.396 1.00 0.00 ? 2   SER A HB2  7  
ATOM 10535 H HB3  . SER A 1 2   ? 11.734  -5.001  -26.551 1.00 0.00 ? 2   SER A HB3  7  
ATOM 10536 H HG   . SER A 1 2   ? 12.510  -3.514  -25.064 1.00 0.00 ? 2   SER A HG   7  
ATOM 10537 N N    . SER A 1 3   ? 13.878  -8.110  -26.978 1.00 0.00 ? 3   SER A N    7  
ATOM 10538 C CA   . SER A 1 3   ? 13.689  -9.416  -26.357 1.00 0.00 ? 3   SER A CA   7  
ATOM 10539 C C    . SER A 1 3   ? 15.014  -9.971  -25.845 1.00 0.00 ? 3   SER A C    7  
ATOM 10540 O O    . SER A 1 3   ? 15.932  -10.234 -26.621 1.00 0.00 ? 3   SER A O    7  
ATOM 10541 C CB   . SER A 1 3   ? 13.065  -10.393 -27.355 1.00 0.00 ? 3   SER A CB   7  
ATOM 10542 O OG   . SER A 1 3   ? 11.682  -10.136 -27.524 1.00 0.00 ? 3   SER A OG   7  
ATOM 10543 H H    . SER A 1 3   ? 14.376  -8.049  -27.820 1.00 0.00 ? 3   SER A H    7  
ATOM 10544 H HA   . SER A 1 3   ? 13.017  -9.291  -25.521 1.00 0.00 ? 3   SER A HA   7  
ATOM 10545 H HB2  . SER A 1 3   ? 13.557  -10.292 -28.310 1.00 0.00 ? 3   SER A HB2  7  
ATOM 10546 H HB3  . SER A 1 3   ? 13.189  -11.403 -26.991 1.00 0.00 ? 3   SER A HB3  7  
ATOM 10547 H HG   . SER A 1 3   ? 11.507  -9.206  -27.363 1.00 0.00 ? 3   SER A HG   7  
ATOM 10548 N N    . GLY A 1 4   ? 15.107  -10.147 -24.530 1.00 0.00 ? 4   GLY A N    7  
ATOM 10549 C CA   . GLY A 1 4   ? 16.323  -10.669 -23.935 1.00 0.00 ? 4   GLY A CA   7  
ATOM 10550 C C    . GLY A 1 4   ? 16.477  -10.266 -22.482 1.00 0.00 ? 4   GLY A C    7  
ATOM 10551 O O    . GLY A 1 4   ? 16.757  -11.104 -21.625 1.00 0.00 ? 4   GLY A O    7  
ATOM 10552 H H    . GLY A 1 4   ? 14.343  -9.919  -23.959 1.00 0.00 ? 4   GLY A H    7  
ATOM 10553 H HA2  . GLY A 1 4   ? 16.308  -11.747 -24.000 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10554 H HA3  . GLY A 1 4   ? 17.171  -10.297 -24.491 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10555 N N    . SER A 1 5   ? 16.296  -8.979  -22.204 1.00 0.00 ? 5   SER A N    7  
ATOM 10556 C CA   . SER A 1 5   ? 16.422  -8.466  -20.845 1.00 0.00 ? 5   SER A CA   7  
ATOM 10557 C C    . SER A 1 5   ? 15.893  -9.476  -19.831 1.00 0.00 ? 5   SER A C    7  
ATOM 10558 O O    . SER A 1 5   ? 14.816  -10.045 -20.009 1.00 0.00 ? 5   SER A O    7  
ATOM 10559 C CB   . SER A 1 5   ? 15.667  -7.142  -20.705 1.00 0.00 ? 5   SER A CB   7  
ATOM 10560 O OG   . SER A 1 5   ? 16.234  -6.142  -21.533 1.00 0.00 ? 5   SER A OG   7  
ATOM 10561 H H    . SER A 1 5   ? 16.075  -8.360  -22.931 1.00 0.00 ? 5   SER A H    7  
ATOM 10562 H HA   . SER A 1 5   ? 17.471  -8.295  -20.651 1.00 0.00 ? 5   SER A HA   7  
ATOM 10563 H HB2  . SER A 1 5   ? 14.636  -7.287  -20.990 1.00 0.00 ? 5   SER A HB2  7  
ATOM 10564 H HB3  . SER A 1 5   ? 15.714  -6.812  -19.677 1.00 0.00 ? 5   SER A HB3  7  
ATOM 10565 H HG   . SER A 1 5   ? 17.034  -5.804  -21.125 1.00 0.00 ? 5   SER A HG   7  
ATOM 10566 N N    . SER A 1 6   ? 16.659  -9.693  -18.767 1.00 0.00 ? 6   SER A N    7  
ATOM 10567 C CA   . SER A 1 6   ? 16.270  -10.637 -17.725 1.00 0.00 ? 6   SER A CA   7  
ATOM 10568 C C    . SER A 1 6   ? 16.873  -10.242 -16.381 1.00 0.00 ? 6   SER A C    7  
ATOM 10569 O O    . SER A 1 6   ? 17.699  -9.333  -16.301 1.00 0.00 ? 6   SER A O    7  
ATOM 10570 C CB   . SER A 1 6   ? 16.714  -12.053 -18.099 1.00 0.00 ? 6   SER A CB   7  
ATOM 10571 O OG   . SER A 1 6   ? 15.874  -12.603 -19.099 1.00 0.00 ? 6   SER A OG   7  
ATOM 10572 H H    . SER A 1 6   ? 17.507  -9.209  -18.681 1.00 0.00 ? 6   SER A H    7  
ATOM 10573 H HA   . SER A 1 6   ? 15.194  -10.616 -17.644 1.00 0.00 ? 6   SER A HA   7  
ATOM 10574 H HB2  . SER A 1 6   ? 17.726  -12.023 -18.473 1.00 0.00 ? 6   SER A HB2  7  
ATOM 10575 H HB3  . SER A 1 6   ? 16.671  -12.684 -17.223 1.00 0.00 ? 6   SER A HB3  7  
ATOM 10576 H HG   . SER A 1 6   ? 16.409  -13.062 -19.751 1.00 0.00 ? 6   SER A HG   7  
ATOM 10577 N N    . GLY A 1 7   ? 16.454  -10.932 -15.325 1.00 0.00 ? 7   GLY A N    7  
ATOM 10578 C CA   . GLY A 1 7   ? 16.962  -10.639 -13.997 1.00 0.00 ? 7   GLY A CA   7  
ATOM 10579 C C    . GLY A 1 7   ? 18.449  -10.905 -13.874 1.00 0.00 ? 7   GLY A C    7  
ATOM 10580 O O    . GLY A 1 7   ? 19.220  -10.591 -14.782 1.00 0.00 ? 7   GLY A O    7  
ATOM 10581 H H    . GLY A 1 7   ? 15.793  -11.646 -15.448 1.00 0.00 ? 7   GLY A H    7  
ATOM 10582 H HA2  . GLY A 1 7   ? 16.772  -9.600  -13.773 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10583 H HA3  . GLY A 1 7   ? 16.437  -11.254 -13.280 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10584 N N    . ARG A 1 8   ? 18.854  -11.483 -12.748 1.00 0.00 ? 8   ARG A N    7  
ATOM 10585 C CA   . ARG A 1 8   ? 20.259  -11.788 -12.508 1.00 0.00 ? 8   ARG A CA   7  
ATOM 10586 C C    . ARG A 1 8   ? 21.156  -10.679 -13.050 1.00 0.00 ? 8   ARG A C    7  
ATOM 10587 O O    . ARG A 1 8   ? 22.172  -10.946 -13.693 1.00 0.00 ? 8   ARG A O    7  
ATOM 10588 C CB   . ARG A 1 8   ? 20.631  -13.123 -13.157 1.00 0.00 ? 8   ARG A CB   7  
ATOM 10589 C CG   . ARG A 1 8   ? 20.360  -13.170 -14.652 1.00 0.00 ? 8   ARG A CG   7  
ATOM 10590 C CD   . ARG A 1 8   ? 20.730  -14.522 -15.242 1.00 0.00 ? 8   ARG A CD   7  
ATOM 10591 N NE   . ARG A 1 8   ? 21.872  -15.123 -14.560 1.00 0.00 ? 8   ARG A NE   7  
ATOM 10592 C CZ   . ARG A 1 8   ? 21.764  -15.880 -13.473 1.00 0.00 ? 8   ARG A CZ   7  
ATOM 10593 N NH1  . ARG A 1 8   ? 20.571  -16.127 -12.949 1.00 0.00 ? 8   ARG A NH1  7  
ATOM 10594 N NH2  . ARG A 1 8   ? 22.850  -16.392 -12.909 1.00 0.00 ? 8   ARG A NH2  7  
ATOM 10595 H H    . ARG A 1 8   ? 18.192  -11.710 -12.062 1.00 0.00 ? 8   ARG A H    7  
ATOM 10596 H HA   . ARG A 1 8   ? 20.405  -11.863 -11.441 1.00 0.00 ? 8   ARG A HA   7  
ATOM 10597 H HB2  . ARG A 1 8   ? 21.684  -13.305 -12.999 1.00 0.00 ? 8   ARG A HB2  7  
ATOM 10598 H HB3  . ARG A 1 8   ? 20.063  -13.910 -12.684 1.00 0.00 ? 8   ARG A HB3  7  
ATOM 10599 H HG2  . ARG A 1 8   ? 19.308  -12.991 -14.823 1.00 0.00 ? 8   ARG A HG2  7  
ATOM 10600 H HG3  . ARG A 1 8   ? 20.942  -12.402 -15.138 1.00 0.00 ? 8   ARG A HG3  7  
ATOM 10601 H HD2  . ARG A 1 8   ? 19.881  -15.183 -15.154 1.00 0.00 ? 8   ARG A HD2  7  
ATOM 10602 H HD3  . ARG A 1 8   ? 20.975  -14.388 -16.285 1.00 0.00 ? 8   ARG A HD3  7  
ATOM 10603 H HE   . ARG A 1 8   ? 22.763  -14.953 -14.930 1.00 0.00 ? 8   ARG A HE   7  
ATOM 10604 H HH11 . ARG A 1 8   ? 19.751  -15.743 -13.373 1.00 0.00 ? 8   ARG A HH11 7  
ATOM 10605 H HH12 . ARG A 1 8   ? 20.492  -16.698 -12.132 1.00 0.00 ? 8   ARG A HH12 7  
ATOM 10606 H HH21 . ARG A 1 8   ? 23.751  -16.208 -13.301 1.00 0.00 ? 8   ARG A HH21 7  
ATOM 10607 H HH22 . ARG A 1 8   ? 22.768  -16.961 -12.091 1.00 0.00 ? 8   ARG A HH22 7  
ATOM 10608 N N    . LEU A 1 9   ? 20.774  -9.434  -12.788 1.00 0.00 ? 9   LEU A N    7  
ATOM 10609 C CA   . LEU A 1 9   ? 21.543  -8.284  -13.250 1.00 0.00 ? 9   LEU A CA   7  
ATOM 10610 C C    . LEU A 1 9   ? 21.344  -7.089  -12.323 1.00 0.00 ? 9   LEU A C    7  
ATOM 10611 O O    . LEU A 1 9   ? 20.220  -6.632  -12.113 1.00 0.00 ? 9   LEU A O    7  
ATOM 10612 C CB   . LEU A 1 9   ? 21.134  -7.911  -14.676 1.00 0.00 ? 9   LEU A CB   7  
ATOM 10613 C CG   . LEU A 1 9   ? 22.188  -7.181  -15.507 1.00 0.00 ? 9   LEU A CG   7  
ATOM 10614 C CD1  . LEU A 1 9   ? 22.958  -6.192  -14.644 1.00 0.00 ? 9   LEU A CD1  7  
ATOM 10615 C CD2  . LEU A 1 9   ? 23.138  -8.176  -16.157 1.00 0.00 ? 9   LEU A CD2  7  
ATOM 10616 H H    . LEU A 1 9   ? 19.955  -9.284  -12.271 1.00 0.00 ? 9   LEU A H    7  
ATOM 10617 H HA   . LEU A 1 9   ? 22.587  -8.560  -13.244 1.00 0.00 ? 9   LEU A HA   7  
ATOM 10618 H HB2  . LEU A 1 9   ? 20.876  -8.822  -15.194 1.00 0.00 ? 9   LEU A HB2  7  
ATOM 10619 H HB3  . LEU A 1 9   ? 20.261  -7.276  -14.613 1.00 0.00 ? 9   LEU A HB3  7  
ATOM 10620 H HG   . LEU A 1 9   ? 21.696  -6.624  -16.293 1.00 0.00 ? 9   LEU A HG   7  
ATOM 10621 H HD11 . LEU A 1 9   ? 23.506  -5.512  -15.278 1.00 0.00 ? 9   LEU A HD11 7  
ATOM 10622 H HD12 . LEU A 1 9   ? 23.647  -6.729  -14.010 1.00 0.00 ? 9   LEU A HD12 7  
ATOM 10623 H HD13 . LEU A 1 9   ? 22.265  -5.634  -14.031 1.00 0.00 ? 9   LEU A HD13 7  
ATOM 10624 H HD21 . LEU A 1 9   ? 24.039  -7.666  -16.465 1.00 0.00 ? 9   LEU A HD21 7  
ATOM 10625 H HD22 . LEU A 1 9   ? 22.661  -8.617  -17.020 1.00 0.00 ? 9   LEU A HD22 7  
ATOM 10626 H HD23 . LEU A 1 9   ? 23.387  -8.952  -15.448 1.00 0.00 ? 9   LEU A HD23 7  
ATOM 10627 N N    . LEU A 1 10  ? 22.443  -6.586  -11.772 1.00 0.00 ? 10  LEU A N    7  
ATOM 10628 C CA   . LEU A 1 10  ? 22.391  -5.441  -10.868 1.00 0.00 ? 10  LEU A CA   7  
ATOM 10629 C C    . LEU A 1 10  ? 21.551  -4.316  -11.463 1.00 0.00 ? 10  LEU A C    7  
ATOM 10630 O O    . LEU A 1 10  ? 21.680  -3.988  -12.643 1.00 0.00 ? 10  LEU A O    7  
ATOM 10631 C CB   . LEU A 1 10  ? 23.804  -4.936  -10.572 1.00 0.00 ? 10  LEU A CB   7  
ATOM 10632 C CG   . LEU A 1 10  ? 23.995  -4.224  -9.232  1.00 0.00 ? 10  LEU A CG   7  
ATOM 10633 C CD1  . LEU A 1 10  ? 23.266  -2.889  -9.229  1.00 0.00 ? 10  LEU A CD1  7  
ATOM 10634 C CD2  . LEU A 1 10  ? 23.509  -5.101  -8.088  1.00 0.00 ? 10  LEU A CD2  7  
ATOM 10635 H H    . LEU A 1 10  ? 23.311  -6.992  -11.976 1.00 0.00 ? 10  LEU A H    7  
ATOM 10636 H HA   . LEU A 1 10  ? 21.933  -5.768  -9.946  1.00 0.00 ? 10  LEU A HA   7  
ATOM 10637 H HB2  . LEU A 1 10  ? 24.470  -5.785  -10.592 1.00 0.00 ? 10  LEU A HB2  7  
ATOM 10638 H HB3  . LEU A 1 10  ? 24.079  -4.246  -11.357 1.00 0.00 ? 10  LEU A HB3  7  
ATOM 10639 H HG   . LEU A 1 10  ? 25.048  -4.029  -9.082  1.00 0.00 ? 10  LEU A HG   7  
ATOM 10640 H HD11 . LEU A 1 10  ? 23.115  -2.559  -10.246 1.00 0.00 ? 10  LEU A HD11 7  
ATOM 10641 H HD12 . LEU A 1 10  ? 23.857  -2.157  -8.697  1.00 0.00 ? 10  LEU A HD12 7  
ATOM 10642 H HD13 . LEU A 1 10  ? 22.309  -3.002  -8.741  1.00 0.00 ? 10  LEU A HD13 7  
ATOM 10643 H HD21 . LEU A 1 10  ? 22.484  -4.853  -7.854  1.00 0.00 ? 10  LEU A HD21 7  
ATOM 10644 H HD22 . LEU A 1 10  ? 24.128  -4.933  -7.219  1.00 0.00 ? 10  LEU A HD22 7  
ATOM 10645 H HD23 . LEU A 1 10  ? 23.572  -6.140  -8.379  1.00 0.00 ? 10  LEU A HD23 7  
ATOM 10646 N N    . ASP A 1 11  ? 20.692  -3.727  -10.639 1.00 0.00 ? 11  ASP A N    7  
ATOM 10647 C CA   . ASP A 1 11  ? 19.832  -2.635  -11.082 1.00 0.00 ? 11  ASP A CA   7  
ATOM 10648 C C    . ASP A 1 11  ? 19.033  -2.065  -9.915  1.00 0.00 ? 11  ASP A C    7  
ATOM 10649 O O    . ASP A 1 11  ? 18.159  -2.734  -9.361  1.00 0.00 ? 11  ASP A O    7  
ATOM 10650 C CB   . ASP A 1 11  ? 18.883  -3.119  -12.179 1.00 0.00 ? 11  ASP A CB   7  
ATOM 10651 C CG   . ASP A 1 11  ? 18.569  -4.598  -12.063 1.00 0.00 ? 11  ASP A CG   7  
ATOM 10652 O OD1  . ASP A 1 11  ? 18.552  -5.113  -10.925 1.00 0.00 ? 11  ASP A OD1  7  
ATOM 10653 O OD2  . ASP A 1 11  ? 18.340  -5.239  -13.109 1.00 0.00 ? 11  ASP A OD2  7  
ATOM 10654 H H    . ASP A 1 11  ? 20.635  -4.033  -9.709  1.00 0.00 ? 11  ASP A H    7  
ATOM 10655 H HA   . ASP A 1 11  ? 20.464  -1.857  -11.483 1.00 0.00 ? 11  ASP A HA   7  
ATOM 10656 H HB2  . ASP A 1 11  ? 17.956  -2.567  -12.113 1.00 0.00 ? 11  ASP A HB2  7  
ATOM 10657 H HB3  . ASP A 1 11  ? 19.336  -2.940  -13.143 1.00 0.00 ? 11  ASP A HB3  7  
ATOM 10658 N N    . LEU A 1 12  ? 19.338  -0.826  -9.545  1.00 0.00 ? 12  LEU A N    7  
ATOM 10659 C CA   . LEU A 1 12  ? 18.648  -0.165  -8.442  1.00 0.00 ? 12  LEU A CA   7  
ATOM 10660 C C    . LEU A 1 12  ? 18.065  1.172   -8.888  1.00 0.00 ? 12  LEU A C    7  
ATOM 10661 O O    . LEU A 1 12  ? 18.564  2.233   -8.513  1.00 0.00 ? 12  LEU A O    7  
ATOM 10662 C CB   . LEU A 1 12  ? 19.607  0.049   -7.270  1.00 0.00 ? 12  LEU A CB   7  
ATOM 10663 C CG   . LEU A 1 12  ? 19.819  -1.152  -6.348  1.00 0.00 ? 12  LEU A CG   7  
ATOM 10664 C CD1  . LEU A 1 12  ? 20.919  -0.863  -5.338  1.00 0.00 ? 12  LEU A CD1  7  
ATOM 10665 C CD2  . LEU A 1 12  ? 18.523  -1.515  -5.638  1.00 0.00 ? 12  LEU A CD2  7  
ATOM 10666 H H    . LEU A 1 12  ? 20.042  -0.343  -10.024 1.00 0.00 ? 12  LEU A H    7  
ATOM 10667 H HA   . LEU A 1 12  ? 17.841  -0.807  -8.124  1.00 0.00 ? 12  LEU A HA   7  
ATOM 10668 H HB2  . LEU A 1 12  ? 20.568  0.328   -7.676  1.00 0.00 ? 12  LEU A HB2  7  
ATOM 10669 H HB3  . LEU A 1 12  ? 19.221  0.863   -6.672  1.00 0.00 ? 12  LEU A HB3  7  
ATOM 10670 H HG   . LEU A 1 12  ? 20.126  -2.003  -6.941  1.00 0.00 ? 12  LEU A HG   7  
ATOM 10671 H HD11 . LEU A 1 12  ? 21.766  -0.426  -5.844  1.00 0.00 ? 12  LEU A HD11 7  
ATOM 10672 H HD12 . LEU A 1 12  ? 21.220  -1.783  -4.861  1.00 0.00 ? 12  LEU A HD12 7  
ATOM 10673 H HD13 . LEU A 1 12  ? 20.550  -0.174  -4.592  1.00 0.00 ? 12  LEU A HD13 7  
ATOM 10674 H HD21 . LEU A 1 12  ? 18.179  -2.478  -5.985  1.00 0.00 ? 12  LEU A HD21 7  
ATOM 10675 H HD22 . LEU A 1 12  ? 17.774  -0.767  -5.853  1.00 0.00 ? 12  LEU A HD22 7  
ATOM 10676 H HD23 . LEU A 1 12  ? 18.695  -1.555  -4.573  1.00 0.00 ? 12  LEU A HD23 7  
ATOM 10677 N N    . GLU A 1 13  ? 17.005  1.113   -9.688  1.00 0.00 ? 13  GLU A N    7  
ATOM 10678 C CA   . GLU A 1 13  ? 16.354  2.320   -10.183 1.00 0.00 ? 13  GLU A CA   7  
ATOM 10679 C C    . GLU A 1 13  ? 16.093  3.303   -9.045  1.00 0.00 ? 13  GLU A C    7  
ATOM 10680 O O    . GLU A 1 13  ? 16.122  2.933   -7.872  1.00 0.00 ? 13  GLU A O    7  
ATOM 10681 C CB   . GLU A 1 13  ? 15.038  1.967   -10.879 1.00 0.00 ? 13  GLU A CB   7  
ATOM 10682 C CG   . GLU A 1 13  ? 15.223  1.352   -12.256 1.00 0.00 ? 13  GLU A CG   7  
ATOM 10683 C CD   . GLU A 1 13  ? 15.849  -0.028  -12.199 1.00 0.00 ? 13  GLU A CD   7  
ATOM 10684 O OE1  . GLU A 1 13  ? 15.340  -0.880  -11.440 1.00 0.00 ? 13  GLU A OE1  7  
ATOM 10685 O OE2  . GLU A 1 13  ? 16.847  -0.256  -12.913 1.00 0.00 ? 13  GLU A OE2  7  
ATOM 10686 H H    . GLU A 1 13  ? 16.653  0.237   -9.952  1.00 0.00 ? 13  GLU A H    7  
ATOM 10687 H HA   . GLU A 1 13  ? 17.016  2.784   -10.899 1.00 0.00 ? 13  GLU A HA   7  
ATOM 10688 H HB2  . GLU A 1 13  ? 14.495  1.265   -10.263 1.00 0.00 ? 13  GLU A HB2  7  
ATOM 10689 H HB3  . GLU A 1 13  ? 14.449  2.867   -10.987 1.00 0.00 ? 13  GLU A HB3  7  
ATOM 10690 H HG2  . GLU A 1 13  ? 14.259  1.274   -12.734 1.00 0.00 ? 13  GLU A HG2  7  
ATOM 10691 H HG3  . GLU A 1 13  ? 15.862  1.997   -12.841 1.00 0.00 ? 13  GLU A HG3  7  
ATOM 10692 N N    . ASN A 1 14  ? 15.837  4.558   -9.402  1.00 0.00 ? 14  ASN A N    7  
ATOM 10693 C CA   . ASN A 1 14  ? 15.572  5.595   -8.411  1.00 0.00 ? 14  ASN A CA   7  
ATOM 10694 C C    . ASN A 1 14  ? 14.102  6.004   -8.432  1.00 0.00 ? 14  ASN A C    7  
ATOM 10695 O O    . ASN A 1 14  ? 13.721  6.949   -9.123  1.00 0.00 ? 14  ASN A O    7  
ATOM 10696 C CB   . ASN A 1 14  ? 16.456  6.816   -8.671  1.00 0.00 ? 14  ASN A CB   7  
ATOM 10697 C CG   . ASN A 1 14  ? 17.873  6.432   -9.053  1.00 0.00 ? 14  ASN A CG   7  
ATOM 10698 O OD1  . ASN A 1 14  ? 18.675  6.048   -8.201  1.00 0.00 ? 14  ASN A OD1  7  
ATOM 10699 N ND2  . ASN A 1 14  ? 18.188  6.536   -10.339 1.00 0.00 ? 14  ASN A ND2  7  
ATOM 10700 H H    . ASN A 1 14  ? 15.827  4.792   -10.353 1.00 0.00 ? 14  ASN A H    7  
ATOM 10701 H HA   . ASN A 1 14  ? 15.807  5.191   -7.438  1.00 0.00 ? 14  ASN A HA   7  
ATOM 10702 H HB2  . ASN A 1 14  ? 16.031  7.395   -9.478  1.00 0.00 ? 14  ASN A HB2  7  
ATOM 10703 H HB3  . ASN A 1 14  ? 16.495  7.422   -7.779  1.00 0.00 ? 14  ASN A HB3  7  
ATOM 10704 H HD21 . ASN A 1 14  ? 17.498  6.850   -10.961 1.00 0.00 ? 14  ASN A HD21 7  
ATOM 10705 H HD22 . ASN A 1 14  ? 19.097  6.294   -10.613 1.00 0.00 ? 14  ASN A HD22 7  
ATOM 10706 N N    . ILE A 1 15  ? 13.283  5.286   -7.672  1.00 0.00 ? 15  ILE A N    7  
ATOM 10707 C CA   . ILE A 1 15  ? 11.856  5.575   -7.602  1.00 0.00 ? 15  ILE A CA   7  
ATOM 10708 C C    . ILE A 1 15  ? 11.586  6.808   -6.746  1.00 0.00 ? 15  ILE A C    7  
ATOM 10709 O O    . ILE A 1 15  ? 12.173  6.974   -5.677  1.00 0.00 ? 15  ILE A O    7  
ATOM 10710 C CB   . ILE A 1 15  ? 11.067  4.383   -7.028  1.00 0.00 ? 15  ILE A CB   7  
ATOM 10711 C CG1  . ILE A 1 15  ? 11.254  3.147   -7.910  1.00 0.00 ? 15  ILE A CG1  7  
ATOM 10712 C CG2  . ILE A 1 15  ? 9.592   4.735   -6.903  1.00 0.00 ? 15  ILE A CG2  7  
ATOM 10713 C CD1  . ILE A 1 15  ? 12.574  2.443   -7.692  1.00 0.00 ? 15  ILE A CD1  7  
ATOM 10714 H H    . ILE A 1 15  ? 13.647  4.544   -7.145  1.00 0.00 ? 15  ILE A H    7  
ATOM 10715 H HA   . ILE A 1 15  ? 11.505  5.763   -8.606  1.00 0.00 ? 15  ILE A HA   7  
ATOM 10716 H HB   . ILE A 1 15  ? 11.447  4.172   -6.040  1.00 0.00 ? 15  ILE A HB   7  
ATOM 10717 H HG12 . ILE A 1 15  ? 10.464  2.443   -7.703  1.00 0.00 ? 15  ILE A HG12 7  
ATOM 10718 H HG13 . ILE A 1 15  ? 11.203  3.445   -8.948  1.00 0.00 ? 15  ILE A HG13 7  
ATOM 10719 H HG21 . ILE A 1 15  ? 9.446   5.772   -7.167  1.00 0.00 ? 15  ILE A HG21 7  
ATOM 10720 H HG22 . ILE A 1 15  ? 9.017   4.110   -7.570  1.00 0.00 ? 15  ILE A HG22 7  
ATOM 10721 H HG23 . ILE A 1 15  ? 9.268   4.572   -5.887  1.00 0.00 ? 15  ILE A HG23 7  
ATOM 10722 H HD11 . ILE A 1 15  ? 13.008  2.772   -6.759  1.00 0.00 ? 15  ILE A HD11 7  
ATOM 10723 H HD12 . ILE A 1 15  ? 12.411  1.375   -7.655  1.00 0.00 ? 15  ILE A HD12 7  
ATOM 10724 H HD13 . ILE A 1 15  ? 13.246  2.677   -8.504  1.00 0.00 ? 15  ILE A HD13 7  
ATOM 10725 N N    . GLN A 1 16  ? 10.694  7.669   -7.224  1.00 0.00 ? 16  GLN A N    7  
ATOM 10726 C CA   . GLN A 1 16  ? 10.346  8.887   -6.502  1.00 0.00 ? 16  GLN A CA   7  
ATOM 10727 C C    . GLN A 1 16  ? 9.311   8.601   -5.419  1.00 0.00 ? 16  GLN A C    7  
ATOM 10728 O O    . GLN A 1 16  ? 8.110   8.562   -5.689  1.00 0.00 ? 16  GLN A O    7  
ATOM 10729 C CB   . GLN A 1 16  ? 9.810   9.944   -7.470  1.00 0.00 ? 16  GLN A CB   7  
ATOM 10730 C CG   . GLN A 1 16  ? 10.827  10.392  -8.507  1.00 0.00 ? 16  GLN A CG   7  
ATOM 10731 C CD   . GLN A 1 16  ? 10.254  11.389  -9.494  1.00 0.00 ? 16  GLN A CD   7  
ATOM 10732 O OE1  . GLN A 1 16  ? 9.871   12.498  -9.121  1.00 0.00 ? 16  GLN A OE1  7  
ATOM 10733 N NE2  . GLN A 1 16  ? 10.193  11.000  -10.762 1.00 0.00 ? 16  GLN A NE2  7  
ATOM 10734 H H    . GLN A 1 16  ? 10.260  7.482   -8.082  1.00 0.00 ? 16  GLN A H    7  
ATOM 10735 H HA   . GLN A 1 16  ? 11.243  9.263   -6.035  1.00 0.00 ? 16  GLN A HA   7  
ATOM 10736 H HB2  . GLN A 1 16  ? 8.954   9.538   -7.989  1.00 0.00 ? 16  GLN A HB2  7  
ATOM 10737 H HB3  . GLN A 1 16  ? 9.500   10.810  -6.903  1.00 0.00 ? 16  GLN A HB3  7  
ATOM 10738 H HG2  . GLN A 1 16  ? 11.662  10.851  -7.998  1.00 0.00 ? 16  GLN A HG2  7  
ATOM 10739 H HG3  . GLN A 1 16  ? 11.172  9.525   -9.051  1.00 0.00 ? 16  GLN A HG3  7  
ATOM 10740 H HE21 . GLN A 1 16  ? 10.516  10.101  -10.985 1.00 0.00 ? 16  GLN A HE21 7  
ATOM 10741 H HE22 . GLN A 1 16  ? 9.827   11.624  -11.421 1.00 0.00 ? 16  GLN A HE22 7  
ATOM 10742 N N    . ILE A 1 17  ? 9.784   8.401   -4.194  1.00 0.00 ? 17  ILE A N    7  
ATOM 10743 C CA   . ILE A 1 17  ? 8.899   8.119   -3.070  1.00 0.00 ? 17  ILE A CA   7  
ATOM 10744 C C    . ILE A 1 17  ? 8.857   9.292   -2.096  1.00 0.00 ? 17  ILE A C    7  
ATOM 10745 O O    . ILE A 1 17  ? 9.881   9.884   -1.754  1.00 0.00 ? 17  ILE A O    7  
ATOM 10746 C CB   . ILE A 1 17  ? 9.338   6.852   -2.312  1.00 0.00 ? 17  ILE A CB   7  
ATOM 10747 C CG1  . ILE A 1 17  ? 9.328   5.642   -3.249  1.00 0.00 ? 17  ILE A CG1  7  
ATOM 10748 C CG2  . ILE A 1 17  ? 8.431   6.610   -1.115  1.00 0.00 ? 17  ILE A CG2  7  
ATOM 10749 C CD1  . ILE A 1 17  ? 9.681   4.342   -2.560  1.00 0.00 ? 17  ILE A CD1  7  
ATOM 10750 H H    . ILE A 1 17  ? 10.751  8.445   -4.041  1.00 0.00 ? 17  ILE A H    7  
ATOM 10751 H HA   . ILE A 1 17  ? 7.906   7.954   -3.462  1.00 0.00 ? 17  ILE A HA   7  
ATOM 10752 H HB   . ILE A 1 17  ? 10.342  7.008   -1.947  1.00 0.00 ? 17  ILE A HB   7  
ATOM 10753 H HG12 . ILE A 1 17  ? 8.344   5.534   -3.677  1.00 0.00 ? 17  ILE A HG12 7  
ATOM 10754 H HG13 . ILE A 1 17  ? 10.045  5.804   -4.041  1.00 0.00 ? 17  ILE A HG13 7  
ATOM 10755 H HG21 . ILE A 1 17  ? 7.597   5.992   -1.415  1.00 0.00 ? 17  ILE A HG21 7  
ATOM 10756 H HG22 . ILE A 1 17  ? 8.987   6.109   -0.338  1.00 0.00 ? 17  ILE A HG22 7  
ATOM 10757 H HG23 . ILE A 1 17  ? 8.063   7.555   -0.745  1.00 0.00 ? 17  ILE A HG23 7  
ATOM 10758 H HD11 . ILE A 1 17  ? 9.746   3.552   -3.295  1.00 0.00 ? 17  ILE A HD11 7  
ATOM 10759 H HD12 . ILE A 1 17  ? 10.632  4.446   -2.060  1.00 0.00 ? 17  ILE A HD12 7  
ATOM 10760 H HD13 . ILE A 1 17  ? 8.917   4.099   -1.837  1.00 0.00 ? 17  ILE A HD13 7  
ATOM 10761 N N    . PRO A 1 18  ? 7.645   9.635   -1.636  1.00 0.00 ? 18  PRO A N    7  
ATOM 10762 C CA   . PRO A 1 18  ? 7.439   10.738  -0.693  1.00 0.00 ? 18  PRO A CA   7  
ATOM 10763 C C    . PRO A 1 18  ? 7.985   10.422  0.696   1.00 0.00 ? 18  PRO A C    7  
ATOM 10764 O O    . PRO A 1 18  ? 7.934   9.278   1.147   1.00 0.00 ? 18  PRO A O    7  
ATOM 10765 C CB   . PRO A 1 18  ? 5.917   10.888  -0.648  1.00 0.00 ? 18  PRO A CB   7  
ATOM 10766 C CG   . PRO A 1 18  ? 5.393   9.544   -1.023  1.00 0.00 ? 18  PRO A CG   7  
ATOM 10767 C CD   . PRO A 1 18  ? 6.381   8.973   -2.002  1.00 0.00 ? 18  PRO A CD   7  
ATOM 10768 H HA   . PRO A 1 18  ? 7.883   11.655  -1.052  1.00 0.00 ? 18  PRO A HA   7  
ATOM 10769 H HB2  . PRO A 1 18  ? 5.609   11.168  0.350   1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10770 H HB3  . PRO A 1 18  ? 5.605   11.644  -1.353  1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10771 H HG2  . PRO A 1 18  ? 5.328   8.918   -0.147  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10772 H HG3  . PRO A 1 18  ? 4.423   9.646   -1.487  1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10773 H HD2  . PRO A 1 18  ? 6.457   7.903   -1.879  1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10774 H HD3  . PRO A 1 18  ? 6.096   9.220   -3.014  1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10775 N N    . ASP A 1 19  ? 8.505   11.443  1.368   1.00 0.00 ? 19  ASP A N    7  
ATOM 10776 C CA   . ASP A 1 19  ? 9.058   11.274  2.707   1.00 0.00 ? 19  ASP A CA   7  
ATOM 10777 C C    . ASP A 1 19  ? 8.014   10.698  3.658   1.00 0.00 ? 19  ASP A C    7  
ATOM 10778 O O    . ASP A 1 19  ? 8.335   9.904   4.541   1.00 0.00 ? 19  ASP A O    7  
ATOM 10779 C CB   . ASP A 1 19  ? 9.572   12.611  3.242   1.00 0.00 ? 19  ASP A CB   7  
ATOM 10780 C CG   . ASP A 1 19  ? 10.663  13.203  2.372   1.00 0.00 ? 19  ASP A CG   7  
ATOM 10781 O OD1  . ASP A 1 19  ? 11.597  12.460  2.004   1.00 0.00 ? 19  ASP A OD1  7  
ATOM 10782 O OD2  . ASP A 1 19  ? 10.583  14.409  2.059   1.00 0.00 ? 19  ASP A OD2  7  
ATOM 10783 H H    . ASP A 1 19  ? 8.516   12.331  0.955   1.00 0.00 ? 19  ASP A H    7  
ATOM 10784 H HA   . ASP A 1 19  ? 9.885   10.583  2.639   1.00 0.00 ? 19  ASP A HA   7  
ATOM 10785 H HB2  . ASP A 1 19  ? 8.751   13.313  3.285   1.00 0.00 ? 19  ASP A HB2  7  
ATOM 10786 H HB3  . ASP A 1 19  ? 9.967   12.466  4.237   1.00 0.00 ? 19  ASP A HB3  7  
ATOM 10787 N N    . ALA A 1 20  ? 6.763   11.105  3.472   1.00 0.00 ? 20  ALA A N    7  
ATOM 10788 C CA   . ALA A 1 20  ? 5.671   10.629  4.312   1.00 0.00 ? 20  ALA A CA   7  
ATOM 10789 C C    . ALA A 1 20  ? 4.614   9.907   3.483   1.00 0.00 ? 20  ALA A C    7  
ATOM 10790 O O    . ALA A 1 20  ? 4.414   10.195  2.303   1.00 0.00 ? 20  ALA A O    7  
ATOM 10791 C CB   . ALA A 1 20  ? 5.046   11.790  5.073   1.00 0.00 ? 20  ALA A CB   7  
ATOM 10792 H H    . ALA A 1 20  ? 6.569   11.740  2.751   1.00 0.00 ? 20  ALA A H    7  
ATOM 10793 H HA   . ALA A 1 20  ? 6.082   9.938   5.034   1.00 0.00 ? 20  ALA A HA   7  
ATOM 10794 H HB1  . ALA A 1 20  ? 4.554   11.415  5.958   1.00 0.00 ? 20  ALA A HB1  7  
ATOM 10795 H HB2  . ALA A 1 20  ? 5.817   12.490  5.357   1.00 0.00 ? 20  ALA A HB2  7  
ATOM 10796 H HB3  . ALA A 1 20  ? 4.324   12.286  4.442   1.00 0.00 ? 20  ALA A HB3  7  
ATOM 10797 N N    . PRO A 1 21  ? 3.922   8.947   4.112   1.00 0.00 ? 21  PRO A N    7  
ATOM 10798 C CA   . PRO A 1 21  ? 2.874   8.163   3.451   1.00 0.00 ? 21  PRO A CA   7  
ATOM 10799 C C    . PRO A 1 21  ? 1.633   8.995   3.148   1.00 0.00 ? 21  PRO A C    7  
ATOM 10800 O O    . PRO A 1 21  ? 0.914   9.432   4.047   1.00 0.00 ? 21  PRO A O    7  
ATOM 10801 C CB   . PRO A 1 21  ? 2.549   7.071   4.473   1.00 0.00 ? 21  PRO A CB   7  
ATOM 10802 C CG   . PRO A 1 21  ? 2.929   7.658   5.789   1.00 0.00 ? 21  PRO A CG   7  
ATOM 10803 C CD   . PRO A 1 21  ? 4.108   8.551   5.519   1.00 0.00 ? 21  PRO A CD   7  
ATOM 10804 H HA   . PRO A 1 21  ? 3.234   7.710   2.539   1.00 0.00 ? 21  PRO A HA   7  
ATOM 10805 H HB2  . PRO A 1 21  ? 1.494   6.839   4.433   1.00 0.00 ? 21  PRO A HB2  7  
ATOM 10806 H HB3  . PRO A 1 21  ? 3.127   6.186   4.255   1.00 0.00 ? 21  PRO A HB3  7  
ATOM 10807 H HG2  . PRO A 1 21  ? 2.106   8.233   6.185   1.00 0.00 ? 21  PRO A HG2  7  
ATOM 10808 H HG3  . PRO A 1 21  ? 3.204   6.872   6.475   1.00 0.00 ? 21  PRO A HG3  7  
ATOM 10809 H HD2  . PRO A 1 21  ? 4.085   9.413   6.168   1.00 0.00 ? 21  PRO A HD2  7  
ATOM 10810 H HD3  . PRO A 1 21  ? 5.032   8.005   5.646   1.00 0.00 ? 21  PRO A HD3  7  
ATOM 10811 N N    . PRO A 1 22  ? 1.373   9.221   1.851   1.00 0.00 ? 22  PRO A N    7  
ATOM 10812 C CA   . PRO A 1 22  ? 0.217   10.002  1.400   1.00 0.00 ? 22  PRO A CA   7  
ATOM 10813 C C    . PRO A 1 22  ? -1.102  9.275   1.639   1.00 0.00 ? 22  PRO A C    7  
ATOM 10814 O O    . PRO A 1 22  ? -1.137  8.075   1.913   1.00 0.00 ? 22  PRO A O    7  
ATOM 10815 C CB   . PRO A 1 22  ? 0.469   10.173  -0.100  1.00 0.00 ? 22  PRO A CB   7  
ATOM 10816 C CG   . PRO A 1 22  ? 1.328   9.015   -0.475  1.00 0.00 ? 22  PRO A CG   7  
ATOM 10817 C CD   . PRO A 1 22  ? 2.187   8.731   0.726   1.00 0.00 ? 22  PRO A CD   7  
ATOM 10818 H HA   . PRO A 1 22  ? 0.184   10.972  1.874   1.00 0.00 ? 22  PRO A HA   7  
ATOM 10819 H HB2  . PRO A 1 22  ? -0.473  10.155  -0.630  1.00 0.00 ? 22  PRO A HB2  7  
ATOM 10820 H HB3  . PRO A 1 22  ? 0.971   11.112  -0.279  1.00 0.00 ? 22  PRO A HB3  7  
ATOM 10821 H HG2  . PRO A 1 22  ? 0.712   8.160   -0.706  1.00 0.00 ? 22  PRO A HG2  7  
ATOM 10822 H HG3  . PRO A 1 22  ? 1.945   9.276   -1.323  1.00 0.00 ? 22  PRO A HG3  7  
ATOM 10823 H HD2  . PRO A 1 22  ? 2.371   7.671   0.816   1.00 0.00 ? 22  PRO A HD2  7  
ATOM 10824 H HD3  . PRO A 1 22  ? 3.119   9.274   0.661   1.00 0.00 ? 22  PRO A HD3  7  
ATOM 10825 N N    . PRO A 1 23  ? -2.215  10.017  1.533   1.00 0.00 ? 23  PRO A N    7  
ATOM 10826 C CA   . PRO A 1 23  ? -3.557  9.463   1.733   1.00 0.00 ? 23  PRO A CA   7  
ATOM 10827 C C    . PRO A 1 23  ? -3.966  8.514   0.612   1.00 0.00 ? 23  PRO A C    7  
ATOM 10828 O O    . PRO A 1 23  ? -3.194  8.265   -0.315  1.00 0.00 ? 23  PRO A O    7  
ATOM 10829 C CB   . PRO A 1 23  ? -4.455  10.703  1.738   1.00 0.00 ? 23  PRO A CB   7  
ATOM 10830 C CG   . PRO A 1 23  ? -3.705  11.717  0.946   1.00 0.00 ? 23  PRO A CG   7  
ATOM 10831 C CD   . PRO A 1 23  ? -2.248  11.453  1.209   1.00 0.00 ? 23  PRO A CD   7  
ATOM 10832 H HA   . PRO A 1 23  ? -3.639  8.954   2.682   1.00 0.00 ? 23  PRO A HA   7  
ATOM 10833 H HB2  . PRO A 1 23  ? -5.404  10.465  1.278   1.00 0.00 ? 23  PRO A HB2  7  
ATOM 10834 H HB3  . PRO A 1 23  ? -4.614  11.033  2.753   1.00 0.00 ? 23  PRO A HB3  7  
ATOM 10835 H HG2  . PRO A 1 23  ? -3.923  11.599  -0.104  1.00 0.00 ? 23  PRO A HG2  7  
ATOM 10836 H HG3  . PRO A 1 23  ? -3.971  12.710  1.277   1.00 0.00 ? 23  PRO A HG3  7  
ATOM 10837 H HD2  . PRO A 1 23  ? -1.661  11.663  0.328   1.00 0.00 ? 23  PRO A HD2  7  
ATOM 10838 H HD3  . PRO A 1 23  ? -1.902  12.044  2.045   1.00 0.00 ? 23  PRO A HD3  7  
ATOM 10839 N N    . ILE A 1 24  ? -5.182  7.987   0.702   1.00 0.00 ? 24  ILE A N    7  
ATOM 10840 C CA   . ILE A 1 24  ? -5.693  7.067   -0.306  1.00 0.00 ? 24  ILE A CA   7  
ATOM 10841 C C    . ILE A 1 24  ? -6.792  7.718   -1.139  1.00 0.00 ? 24  ILE A C    7  
ATOM 10842 O O    . ILE A 1 24  ? -7.664  8.417   -0.623  1.00 0.00 ? 24  ILE A O    7  
ATOM 10843 C CB   . ILE A 1 24  ? -6.244  5.780   0.334   1.00 0.00 ? 24  ILE A CB   7  
ATOM 10844 C CG1  . ILE A 1 24  ? -5.180  5.128   1.220   1.00 0.00 ? 24  ILE A CG1  7  
ATOM 10845 C CG2  . ILE A 1 24  ? -6.712  4.811   -0.741  1.00 0.00 ? 24  ILE A CG2  7  
ATOM 10846 C CD1  . ILE A 1 24  ? -5.145  5.680   2.628   1.00 0.00 ? 24  ILE A CD1  7  
ATOM 10847 H H    . ILE A 1 24  ? -5.750  8.224   1.464   1.00 0.00 ? 24  ILE A H    7  
ATOM 10848 H HA   . ILE A 1 24  ? -4.873  6.799   -0.958  1.00 0.00 ? 24  ILE A HA   7  
ATOM 10849 H HB   . ILE A 1 24  ? -7.096  6.043   0.942   1.00 0.00 ? 24  ILE A HB   7  
ATOM 10850 H HG12 . ILE A 1 24  ? -5.374  4.069   1.284   1.00 0.00 ? 24  ILE A HG12 7  
ATOM 10851 H HG13 . ILE A 1 24  ? -4.208  5.286   0.776   1.00 0.00 ? 24  ILE A HG13 7  
ATOM 10852 H HG21 . ILE A 1 24  ? -7.375  4.080   -0.304  1.00 0.00 ? 24  ILE A HG21 7  
ATOM 10853 H HG22 . ILE A 1 24  ? -7.236  5.355   -1.512  1.00 0.00 ? 24  ILE A HG22 7  
ATOM 10854 H HG23 . ILE A 1 24  ? -5.858  4.310   -1.171  1.00 0.00 ? 24  ILE A HG23 7  
ATOM 10855 H HD11 . ILE A 1 24  ? -5.850  5.140   3.243   1.00 0.00 ? 24  ILE A HD11 7  
ATOM 10856 H HD12 . ILE A 1 24  ? -4.151  5.565   3.035   1.00 0.00 ? 24  ILE A HD12 7  
ATOM 10857 H HD13 . ILE A 1 24  ? -5.409  6.726   2.612   1.00 0.00 ? 24  ILE A HD13 7  
ATOM 10858 N N    . PRO A 1 25  ? -6.751  7.484   -2.459  1.00 0.00 ? 25  PRO A N    7  
ATOM 10859 C CA   . PRO A 1 25  ? -7.738  8.036   -3.392  1.00 0.00 ? 25  PRO A CA   7  
ATOM 10860 C C    . PRO A 1 25  ? -9.114  7.403   -3.223  1.00 0.00 ? 25  PRO A C    7  
ATOM 10861 O O    . PRO A 1 25  ? -9.301  6.511   -2.395  1.00 0.00 ? 25  PRO A O    7  
ATOM 10862 C CB   . PRO A 1 25  ? -7.157  7.694   -4.766  1.00 0.00 ? 25  PRO A CB   7  
ATOM 10863 C CG   . PRO A 1 25  ? -6.300  6.499   -4.528  1.00 0.00 ? 25  PRO A CG   7  
ATOM 10864 C CD   . PRO A 1 25  ? -5.740  6.660   -3.143  1.00 0.00 ? 25  PRO A CD   7  
ATOM 10865 H HA   . PRO A 1 25  ? -7.821  9.109   -3.292  1.00 0.00 ? 25  PRO A HA   7  
ATOM 10866 H HB2  . PRO A 1 25  ? -7.961  7.474   -5.455  1.00 0.00 ? 25  PRO A HB2  7  
ATOM 10867 H HB3  . PRO A 1 25  ? -6.578  8.528   -5.134  1.00 0.00 ? 25  PRO A HB3  7  
ATOM 10868 H HG2  . PRO A 1 25  ? -6.897  5.601   -4.589  1.00 0.00 ? 25  PRO A HG2  7  
ATOM 10869 H HG3  . PRO A 1 25  ? -5.501  6.470   -5.255  1.00 0.00 ? 25  PRO A HG3  7  
ATOM 10870 H HD2  . PRO A 1 25  ? -5.637  5.698   -2.663  1.00 0.00 ? 25  PRO A HD2  7  
ATOM 10871 H HD3  . PRO A 1 25  ? -4.788  7.170   -3.178  1.00 0.00 ? 25  PRO A HD3  7  
ATOM 10872 N N    . LYS A 1 26  ? -10.076 7.869   -4.012  1.00 0.00 ? 26  LYS A N    7  
ATOM 10873 C CA   . LYS A 1 26  ? -11.436 7.348   -3.951  1.00 0.00 ? 26  LYS A CA   7  
ATOM 10874 C C    . LYS A 1 26  ? -11.486 5.901   -4.432  1.00 0.00 ? 26  LYS A C    7  
ATOM 10875 O O    . LYS A 1 26  ? -11.231 5.618   -5.602  1.00 0.00 ? 26  LYS A O    7  
ATOM 10876 C CB   . LYS A 1 26  ? -12.374 8.211   -4.799  1.00 0.00 ? 26  LYS A CB   7  
ATOM 10877 C CG   . LYS A 1 26  ? -13.830 7.785   -4.720  1.00 0.00 ? 26  LYS A CG   7  
ATOM 10878 C CD   . LYS A 1 26  ? -14.494 8.299   -3.454  1.00 0.00 ? 26  LYS A CD   7  
ATOM 10879 C CE   . LYS A 1 26  ? -14.970 9.734   -3.618  1.00 0.00 ? 26  LYS A CE   7  
ATOM 10880 N NZ   . LYS A 1 26  ? -15.773 10.189  -2.449  1.00 0.00 ? 26  LYS A NZ   7  
ATOM 10881 H H    . LYS A 1 26  ? -9.866  8.582   -4.652  1.00 0.00 ? 26  LYS A H    7  
ATOM 10882 H HA   . LYS A 1 26  ? -11.760 7.384   -2.922  1.00 0.00 ? 26  LYS A HA   7  
ATOM 10883 H HB2  . LYS A 1 26  ? -12.301 9.235   -4.464  1.00 0.00 ? 26  LYS A HB2  7  
ATOM 10884 H HB3  . LYS A 1 26  ? -12.060 8.155   -5.831  1.00 0.00 ? 26  LYS A HB3  7  
ATOM 10885 H HG2  . LYS A 1 26  ? -14.357 8.179   -5.576  1.00 0.00 ? 26  LYS A HG2  7  
ATOM 10886 H HG3  . LYS A 1 26  ? -13.880 6.705   -4.730  1.00 0.00 ? 26  LYS A HG3  7  
ATOM 10887 H HD2  . LYS A 1 26  ? -15.344 7.674   -3.224  1.00 0.00 ? 26  LYS A HD2  7  
ATOM 10888 H HD3  . LYS A 1 26  ? -13.782 8.255   -2.642  1.00 0.00 ? 26  LYS A HD3  7  
ATOM 10889 H HE2  . LYS A 1 26  ? -14.109 10.376  -3.723  1.00 0.00 ? 26  LYS A HE2  7  
ATOM 10890 H HE3  . LYS A 1 26  ? -15.577 9.798   -4.508  1.00 0.00 ? 26  LYS A HE3  7  
ATOM 10891 H HZ1  . LYS A 1 26  ? -16.559 10.790  -2.768  1.00 0.00 ? 26  LYS A HZ1  7  
ATOM 10892 H HZ2  . LYS A 1 26  ? -15.176 10.734  -1.796  1.00 0.00 ? 26  LYS A HZ2  7  
ATOM 10893 H HZ3  . LYS A 1 26  ? -16.162 9.368   -1.942  1.00 0.00 ? 26  LYS A HZ3  7  
ATOM 10894 N N    . GLU A 1 27  ? -11.818 4.990   -3.522  1.00 0.00 ? 27  GLU A N    7  
ATOM 10895 C CA   . GLU A 1 27  ? -11.902 3.573   -3.855  1.00 0.00 ? 27  GLU A CA   7  
ATOM 10896 C C    . GLU A 1 27  ? -13.018 3.317   -4.864  1.00 0.00 ? 27  GLU A C    7  
ATOM 10897 O O    . GLU A 1 27  ? -14.083 3.932   -4.820  1.00 0.00 ? 27  GLU A O    7  
ATOM 10898 C CB   . GLU A 1 27  ? -12.141 2.743   -2.593  1.00 0.00 ? 27  GLU A CB   7  
ATOM 10899 C CG   . GLU A 1 27  ? -13.347 3.194   -1.786  1.00 0.00 ? 27  GLU A CG   7  
ATOM 10900 C CD   . GLU A 1 27  ? -14.637 2.552   -2.259  1.00 0.00 ? 27  GLU A CD   7  
ATOM 10901 O OE1  . GLU A 1 27  ? -14.575 1.440   -2.823  1.00 0.00 ? 27  GLU A OE1  7  
ATOM 10902 O OE2  . GLU A 1 27  ? -15.709 3.162   -2.062  1.00 0.00 ? 27  GLU A OE2  7  
ATOM 10903 H H    . GLU A 1 27  ? -12.011 5.278   -2.605  1.00 0.00 ? 27  GLU A H    7  
ATOM 10904 H HA   . GLU A 1 27  ? -10.961 3.280   -4.295  1.00 0.00 ? 27  GLU A HA   7  
ATOM 10905 H HB2  . GLU A 1 27  ? -12.288 1.711   -2.877  1.00 0.00 ? 27  GLU A HB2  7  
ATOM 10906 H HB3  . GLU A 1 27  ? -11.267 2.811   -1.962  1.00 0.00 ? 27  GLU A HB3  7  
ATOM 10907 H HG2  . GLU A 1 27  ? -13.191 2.931   -0.751  1.00 0.00 ? 27  GLU A HG2  7  
ATOM 10908 H HG3  . GLU A 1 27  ? -13.443 4.266   -1.875  1.00 0.00 ? 27  GLU A HG3  7  
ATOM 10909 N N    . PRO A 1 28  ? -12.768 2.387   -5.798  1.00 0.00 ? 28  PRO A N    7  
ATOM 10910 C CA   . PRO A 1 28  ? -13.738 2.027   -6.836  1.00 0.00 ? 28  PRO A CA   7  
ATOM 10911 C C    . PRO A 1 28  ? -14.941 1.278   -6.271  1.00 0.00 ? 28  PRO A C    7  
ATOM 10912 O O    . PRO A 1 28  ? -14.789 0.261   -5.596  1.00 0.00 ? 28  PRO A O    7  
ATOM 10913 C CB   . PRO A 1 28  ? -12.936 1.120   -7.773  1.00 0.00 ? 28  PRO A CB   7  
ATOM 10914 C CG   . PRO A 1 28  ? -11.860 0.548   -6.916  1.00 0.00 ? 28  PRO A CG   7  
ATOM 10915 C CD   . PRO A 1 28  ? -11.520 1.614   -5.912  1.00 0.00 ? 28  PRO A CD   7  
ATOM 10916 H HA   . PRO A 1 28  ? -14.080 2.896   -7.379  1.00 0.00 ? 28  PRO A HA   7  
ATOM 10917 H HB2  . PRO A 1 28  ? -13.580 0.348   -8.169  1.00 0.00 ? 28  PRO A HB2  7  
ATOM 10918 H HB3  . PRO A 1 28  ? -12.527 1.706   -8.583  1.00 0.00 ? 28  PRO A HB3  7  
ATOM 10919 H HG2  . PRO A 1 28  ? -12.220 -0.337  -6.416  1.00 0.00 ? 28  PRO A HG2  7  
ATOM 10920 H HG3  . PRO A 1 28  ? -10.996 0.314   -7.521  1.00 0.00 ? 28  PRO A HG3  7  
ATOM 10921 H HD2  . PRO A 1 28  ? -11.254 1.169   -4.964  1.00 0.00 ? 28  PRO A HD2  7  
ATOM 10922 H HD3  . PRO A 1 28  ? -10.715 2.235   -6.278  1.00 0.00 ? 28  PRO A HD3  7  
ATOM 10923 N N    . SER A 1 29  ? -16.135 1.788   -6.553  1.00 0.00 ? 29  SER A N    7  
ATOM 10924 C CA   . SER A 1 29  ? -17.364 1.169   -6.070  1.00 0.00 ? 29  SER A CA   7  
ATOM 10925 C C    . SER A 1 29  ? -18.203 0.646   -7.233  1.00 0.00 ? 29  SER A C    7  
ATOM 10926 O O    . SER A 1 29  ? -19.405 0.894   -7.306  1.00 0.00 ? 29  SER A O    7  
ATOM 10927 C CB   . SER A 1 29  ? -18.178 2.172   -5.251  1.00 0.00 ? 29  SER A CB   7  
ATOM 10928 O OG   . SER A 1 29  ? -17.715 2.231   -3.912  1.00 0.00 ? 29  SER A OG   7  
ATOM 10929 H H    . SER A 1 29  ? -16.191 2.602   -7.097  1.00 0.00 ? 29  SER A H    7  
ATOM 10930 H HA   . SER A 1 29  ? -17.090 0.338   -5.438  1.00 0.00 ? 29  SER A HA   7  
ATOM 10931 H HB2  . SER A 1 29  ? -18.087 3.152   -5.693  1.00 0.00 ? 29  SER A HB2  7  
ATOM 10932 H HB3  . SER A 1 29  ? -19.216 1.873   -5.247  1.00 0.00 ? 29  SER A HB3  7  
ATOM 10933 H HG   . SER A 1 29  ? -18.462 2.168   -3.312  1.00 0.00 ? 29  SER A HG   7  
ATOM 10934 N N    . ASN A 1 30  ? -17.557 -0.079  -8.141  1.00 0.00 ? 30  ASN A N    7  
ATOM 10935 C CA   . ASN A 1 30  ? -18.242 -0.636  -9.301  1.00 0.00 ? 30  ASN A CA   7  
ATOM 10936 C C    . ASN A 1 30  ? -17.938 -2.124  -9.449  1.00 0.00 ? 30  ASN A C    7  
ATOM 10937 O O    . ASN A 1 30  ? -18.500 -2.800  -10.312 1.00 0.00 ? 30  ASN A O    7  
ATOM 10938 C CB   . ASN A 1 30  ? -17.828 0.109   -10.571 1.00 0.00 ? 30  ASN A CB   7  
ATOM 10939 C CG   . ASN A 1 30  ? -18.922 0.115   -11.622 1.00 0.00 ? 30  ASN A CG   7  
ATOM 10940 O OD1  . ASN A 1 30  ? -19.779 0.999   -11.636 1.00 0.00 ? 30  ASN A OD1  7  
ATOM 10941 N ND2  . ASN A 1 30  ? -18.897 -0.874  -12.507 1.00 0.00 ? 30  ASN A ND2  7  
ATOM 10942 H H    . ASN A 1 30  ? -16.598 -0.242  -8.028  1.00 0.00 ? 30  ASN A H    7  
ATOM 10943 H HA   . ASN A 1 30  ? -19.304 -0.511  -9.151  1.00 0.00 ? 30  ASN A HA   7  
ATOM 10944 H HB2  . ASN A 1 30  ? -17.591 1.133   -10.320 1.00 0.00 ? 30  ASN A HB2  7  
ATOM 10945 H HB3  . ASN A 1 30  ? -16.953 -0.365  -10.991 1.00 0.00 ? 30  ASN A HB3  7  
ATOM 10946 H HD21 . ASN A 1 30  ? -18.185 -1.543  -12.435 1.00 0.00 ? 30  ASN A HD21 7  
ATOM 10947 H HD22 . ASN A 1 30  ? -19.592 -0.894  -13.197 1.00 0.00 ? 30  ASN A HD22 7  
ATOM 10948 N N    . TYR A 1 31  ? -17.047 -2.627  -8.603  1.00 0.00 ? 31  TYR A N    7  
ATOM 10949 C CA   . TYR A 1 31  ? -16.667 -4.034  -8.640  1.00 0.00 ? 31  TYR A CA   7  
ATOM 10950 C C    . TYR A 1 31  ? -17.500 -4.850  -7.656  1.00 0.00 ? 31  TYR A C    7  
ATOM 10951 O O    . TYR A 1 31  ? -17.907 -4.351  -6.607  1.00 0.00 ? 31  TYR A O    7  
ATOM 10952 C CB   . TYR A 1 31  ? -15.179 -4.191  -8.319  1.00 0.00 ? 31  TYR A CB   7  
ATOM 10953 C CG   . TYR A 1 31  ? -14.317 -3.086  -8.887  1.00 0.00 ? 31  TYR A CG   7  
ATOM 10954 C CD1  . TYR A 1 31  ? -14.707 -2.389  -10.024 1.00 0.00 ? 31  TYR A CD1  7  
ATOM 10955 C CD2  . TYR A 1 31  ? -13.113 -2.739  -8.287  1.00 0.00 ? 31  TYR A CD2  7  
ATOM 10956 C CE1  . TYR A 1 31  ? -13.923 -1.380  -10.547 1.00 0.00 ? 31  TYR A CE1  7  
ATOM 10957 C CE2  . TYR A 1 31  ? -12.323 -1.729  -8.802  1.00 0.00 ? 31  TYR A CE2  7  
ATOM 10958 C CZ   . TYR A 1 31  ? -12.732 -1.053  -9.932  1.00 0.00 ? 31  TYR A CZ   7  
ATOM 10959 O OH   . TYR A 1 31  ? -11.947 -0.048  -10.449 1.00 0.00 ? 31  TYR A OH   7  
ATOM 10960 H H    . TYR A 1 31  ? -16.633 -2.038  -7.938  1.00 0.00 ? 31  TYR A H    7  
ATOM 10961 H HA   . TYR A 1 31  ? -16.849 -4.401  -9.639  1.00 0.00 ? 31  TYR A HA   7  
ATOM 10962 H HB2  . TYR A 1 31  ? -15.048 -4.196  -7.248  1.00 0.00 ? 31  TYR A HB2  7  
ATOM 10963 H HB3  . TYR A 1 31  ? -14.827 -5.128  -8.724  1.00 0.00 ? 31  TYR A HB3  7  
ATOM 10964 H HD1  . TYR A 1 31  ? -15.640 -2.648  -10.504 1.00 0.00 ? 31  TYR A HD1  7  
ATOM 10965 H HD2  . TYR A 1 31  ? -12.796 -3.271  -7.402  1.00 0.00 ? 31  TYR A HD2  7  
ATOM 10966 H HE1  . TYR A 1 31  ? -14.243 -0.849  -11.432 1.00 0.00 ? 31  TYR A HE1  7  
ATOM 10967 H HE2  . TYR A 1 31  ? -11.391 -1.474  -8.321  1.00 0.00 ? 31  TYR A HE2  7  
ATOM 10968 H HH   . TYR A 1 31  ? -12.169 0.087   -11.374 1.00 0.00 ? 31  TYR A HH   7  
ATOM 10969 N N    . ASP A 1 32  ? -17.748 -6.108  -8.002  1.00 0.00 ? 32  ASP A N    7  
ATOM 10970 C CA   . ASP A 1 32  ? -18.531 -6.995  -7.150  1.00 0.00 ? 32  ASP A CA   7  
ATOM 10971 C C    . ASP A 1 32  ? -17.663 -8.120  -6.594  1.00 0.00 ? 32  ASP A C    7  
ATOM 10972 O O    . ASP A 1 32  ? -17.647 -8.368  -5.389  1.00 0.00 ? 32  ASP A O    7  
ATOM 10973 C CB   . ASP A 1 32  ? -19.708 -7.581  -7.932  1.00 0.00 ? 32  ASP A CB   7  
ATOM 10974 C CG   . ASP A 1 32  ? -20.348 -8.756  -7.220  1.00 0.00 ? 32  ASP A CG   7  
ATOM 10975 O OD1  . ASP A 1 32  ? -20.276 -8.807  -5.974  1.00 0.00 ? 32  ASP A OD1  7  
ATOM 10976 O OD2  . ASP A 1 32  ? -20.922 -9.626  -7.909  1.00 0.00 ? 32  ASP A OD2  7  
ATOM 10977 H H    . ASP A 1 32  ? -17.396 -6.448  -8.852  1.00 0.00 ? 32  ASP A H    7  
ATOM 10978 H HA   . ASP A 1 32  ? -18.913 -6.412  -6.326  1.00 0.00 ? 32  ASP A HA   7  
ATOM 10979 H HB2  . ASP A 1 32  ? -20.458 -6.815  -8.069  1.00 0.00 ? 32  ASP A HB2  7  
ATOM 10980 H HB3  . ASP A 1 32  ? -19.359 -7.915  -8.898  1.00 0.00 ? 32  ASP A HB3  7  
ATOM 10981 N N    . PHE A 1 33  ? -16.943 -8.799  -7.482  1.00 0.00 ? 33  PHE A N    7  
ATOM 10982 C CA   . PHE A 1 33  ? -16.074 -9.899  -7.081  1.00 0.00 ? 33  PHE A CA   7  
ATOM 10983 C C    . PHE A 1 33  ? -15.373 -9.585  -5.762  1.00 0.00 ? 33  PHE A C    7  
ATOM 10984 O O    . PHE A 1 33  ? -15.184 -8.421  -5.409  1.00 0.00 ? 33  PHE A O    7  
ATOM 10985 C CB   . PHE A 1 33  ? -15.036 -10.180 -8.169  1.00 0.00 ? 33  PHE A CB   7  
ATOM 10986 C CG   . PHE A 1 33  ? -14.092 -9.036  -8.407  1.00 0.00 ? 33  PHE A CG   7  
ATOM 10987 C CD1  . PHE A 1 33  ? -13.120 -8.718  -7.472  1.00 0.00 ? 33  PHE A CD1  7  
ATOM 10988 C CD2  . PHE A 1 33  ? -14.177 -8.280  -9.564  1.00 0.00 ? 33  PHE A CD2  7  
ATOM 10989 C CE1  . PHE A 1 33  ? -12.250 -7.665  -7.688  1.00 0.00 ? 33  PHE A CE1  7  
ATOM 10990 C CE2  . PHE A 1 33  ? -13.310 -7.227  -9.786  1.00 0.00 ? 33  PHE A CE2  7  
ATOM 10991 C CZ   . PHE A 1 33  ? -12.345 -6.920  -8.847  1.00 0.00 ? 33  PHE A CZ   7  
ATOM 10992 H H    . PHE A 1 33  ? -16.998 -8.554  -8.430  1.00 0.00 ? 33  PHE A H    7  
ATOM 10993 H HA   . PHE A 1 33  ? -16.690 -10.775 -6.947  1.00 0.00 ? 33  PHE A HA   7  
ATOM 10994 H HB2  . PHE A 1 33  ? -14.449 -11.040 -7.883  1.00 0.00 ? 33  PHE A HB2  7  
ATOM 10995 H HB3  . PHE A 1 33  ? -15.546 -10.390 -9.097  1.00 0.00 ? 33  PHE A HB3  7  
ATOM 10996 H HD1  . PHE A 1 33  ? -13.044 -9.301  -6.566  1.00 0.00 ? 33  PHE A HD1  7  
ATOM 10997 H HD2  . PHE A 1 33  ? -14.932 -8.520  -10.300 1.00 0.00 ? 33  PHE A HD2  7  
ATOM 10998 H HE1  . PHE A 1 33  ? -11.496 -7.428  -6.953  1.00 0.00 ? 33  PHE A HE1  7  
ATOM 10999 H HE2  . PHE A 1 33  ? -13.386 -6.646  -10.693 1.00 0.00 ? 33  PHE A HE2  7  
ATOM 11000 H HZ   . PHE A 1 33  ? -11.667 -6.097  -9.018  1.00 0.00 ? 33  PHE A HZ   7  
ATOM 11001 N N    . SER A 1 34  ? -14.990 -10.632 -5.039  1.00 0.00 ? 34  SER A N    7  
ATOM 11002 C CA   . SER A 1 34  ? -14.314 -10.470 -3.757  1.00 0.00 ? 34  SER A CA   7  
ATOM 11003 C C    . SER A 1 34  ? -15.242 -9.827  -2.731  1.00 0.00 ? 34  SER A C    7  
ATOM 11004 O O    . SER A 1 34  ? -14.907 -8.811  -2.125  1.00 0.00 ? 34  SER A O    7  
ATOM 11005 C CB   . SER A 1 34  ? -13.054 -9.618  -3.926  1.00 0.00 ? 34  SER A CB   7  
ATOM 11006 O OG   . SER A 1 34  ? -12.330 -9.532  -2.710  1.00 0.00 ? 34  SER A OG   7  
ATOM 11007 H H    . SER A 1 34  ? -15.169 -11.536 -5.374  1.00 0.00 ? 34  SER A H    7  
ATOM 11008 H HA   . SER A 1 34  ? -14.030 -11.450 -3.405  1.00 0.00 ? 34  SER A HA   7  
ATOM 11009 H HB2  . SER A 1 34  ? -12.420 -10.063 -4.677  1.00 0.00 ? 34  SER A HB2  7  
ATOM 11010 H HB3  . SER A 1 34  ? -13.335 -8.622  -4.235  1.00 0.00 ? 34  SER A HB3  7  
ATOM 11011 H HG   . SER A 1 34  ? -12.596 -8.742  -2.234  1.00 0.00 ? 34  SER A HG   7  
ATOM 11012 N N    . GLY A 1 35  ? -16.412 -10.430 -2.541  1.00 0.00 ? 35  GLY A N    7  
ATOM 11013 C CA   . GLY A 1 35  ? -17.372 -9.903  -1.588  1.00 0.00 ? 35  GLY A CA   7  
ATOM 11014 C C    . GLY A 1 35  ? -17.040 -10.287 -0.160  1.00 0.00 ? 35  GLY A C    7  
ATOM 11015 O O    . GLY A 1 35  ? -16.268 -11.212 0.094   1.00 0.00 ? 35  GLY A O    7  
ATOM 11016 H H    . GLY A 1 35  ? -16.625 -11.238 -3.053  1.00 0.00 ? 35  GLY A H    7  
ATOM 11017 H HA2  . GLY A 1 35  ? -17.387 -8.827  -1.667  1.00 0.00 ? 35  GLY A HA2  7  
ATOM 11018 H HA3  . GLY A 1 35  ? -18.351 -10.286 -1.833  1.00 0.00 ? 35  GLY A HA3  7  
ATOM 11019 N N    . PRO A 1 36  ? -17.630 -9.564  0.803   1.00 0.00 ? 36  PRO A N    7  
ATOM 11020 C CA   . PRO A 1 36  ? -17.408 -9.814  2.230   1.00 0.00 ? 36  PRO A CA   7  
ATOM 11021 C C    . PRO A 1 36  ? -18.034 -11.125 2.694   1.00 0.00 ? 36  PRO A C    7  
ATOM 11022 O O    . PRO A 1 36  ? -19.218 -11.173 3.029   1.00 0.00 ? 36  PRO A O    7  
ATOM 11023 C CB   . PRO A 1 36  ? -18.091 -8.625  2.910   1.00 0.00 ? 36  PRO A CB   7  
ATOM 11024 C CG   . PRO A 1 36  ? -19.130 -8.180  1.940   1.00 0.00 ? 36  PRO A CG   7  
ATOM 11025 C CD   . PRO A 1 36  ? -18.562 -8.447  0.573   1.00 0.00 ? 36  PRO A CD   7  
ATOM 11026 H HA   . PRO A 1 36  ? -16.355 -9.814  2.474   1.00 0.00 ? 36  PRO A HA   7  
ATOM 11027 H HB2  . PRO A 1 36  ? -18.532 -8.945  3.844   1.00 0.00 ? 36  PRO A HB2  7  
ATOM 11028 H HB3  . PRO A 1 36  ? -17.366 -7.847  3.097   1.00 0.00 ? 36  PRO A HB3  7  
ATOM 11029 H HG2  . PRO A 1 36  ? -20.036 -8.747  2.087   1.00 0.00 ? 36  PRO A HG2  7  
ATOM 11030 H HG3  . PRO A 1 36  ? -19.321 -7.124  2.066   1.00 0.00 ? 36  PRO A HG3  7  
ATOM 11031 H HD2  . PRO A 1 36  ? -19.346 -8.733  -0.112  1.00 0.00 ? 36  PRO A HD2  7  
ATOM 11032 H HD3  . PRO A 1 36  ? -18.036 -7.577  0.207   1.00 0.00 ? 36  PRO A HD3  7  
ATOM 11033 N N    . SER A 1 37  ? -17.233 -12.185 2.711   1.00 0.00 ? 37  SER A N    7  
ATOM 11034 C CA   . SER A 1 37  ? -17.711 -13.498 3.131   1.00 0.00 ? 37  SER A CA   7  
ATOM 11035 C C    . SER A 1 37  ? -17.015 -13.945 4.412   1.00 0.00 ? 37  SER A C    7  
ATOM 11036 O O    . SER A 1 37  ? -15.895 -13.524 4.703   1.00 0.00 ? 37  SER A O    7  
ATOM 11037 C CB   . SER A 1 37  ? -17.476 -14.527 2.023   1.00 0.00 ? 37  SER A CB   7  
ATOM 11038 O OG   . SER A 1 37  ? -16.108 -14.583 1.661   1.00 0.00 ? 37  SER A OG   7  
ATOM 11039 H H    . SER A 1 37  ? -16.299 -12.083 2.432   1.00 0.00 ? 37  SER A H    7  
ATOM 11040 H HA   . SER A 1 37  ? -18.771 -13.420 3.319   1.00 0.00 ? 37  SER A HA   7  
ATOM 11041 H HB2  . SER A 1 37  ? -17.785 -15.501 2.370   1.00 0.00 ? 37  SER A HB2  7  
ATOM 11042 H HB3  . SER A 1 37  ? -18.056 -14.254 1.153   1.00 0.00 ? 37  SER A HB3  7  
ATOM 11043 H HG   . SER A 1 37  ? -15.869 -13.784 1.185   1.00 0.00 ? 37  SER A HG   7  
ATOM 11044 N N    . SER A 1 38  ? -17.687 -14.801 5.175   1.00 0.00 ? 38  SER A N    7  
ATOM 11045 C CA   . SER A 1 38  ? -17.136 -15.304 6.428   1.00 0.00 ? 38  SER A CA   7  
ATOM 11046 C C    . SER A 1 38  ? -15.793 -15.990 6.195   1.00 0.00 ? 38  SER A C    7  
ATOM 11047 O O    . SER A 1 38  ? -15.492 -16.429 5.086   1.00 0.00 ? 38  SER A O    7  
ATOM 11048 C CB   . SER A 1 38  ? -18.113 -16.281 7.084   1.00 0.00 ? 38  SER A CB   7  
ATOM 11049 O OG   . SER A 1 38  ? -17.890 -16.364 8.481   1.00 0.00 ? 38  SER A OG   7  
ATOM 11050 H H    . SER A 1 38  ? -18.575 -15.100 4.889   1.00 0.00 ? 38  SER A H    7  
ATOM 11051 H HA   . SER A 1 38  ? -16.986 -14.461 7.086   1.00 0.00 ? 38  SER A HA   7  
ATOM 11052 H HB2  . SER A 1 38  ? -19.124 -15.944 6.913   1.00 0.00 ? 38  SER A HB2  7  
ATOM 11053 H HB3  . SER A 1 38  ? -17.982 -17.262 6.652   1.00 0.00 ? 38  SER A HB3  7  
ATOM 11054 H HG   . SER A 1 38  ? -17.397 -15.594 8.773   1.00 0.00 ? 38  SER A HG   7  
ATOM 11055 N N    . GLY A 1 39  ? -14.989 -16.078 7.250   1.00 0.00 ? 39  GLY A N    7  
ATOM 11056 C CA   . GLY A 1 39  ? -13.688 -16.712 7.141   1.00 0.00 ? 39  GLY A CA   7  
ATOM 11057 C C    . GLY A 1 39  ? -13.774 -18.225 7.181   1.00 0.00 ? 39  GLY A C    7  
ATOM 11058 O O    . GLY A 1 39  ? -14.845 -18.786 7.415   1.00 0.00 ? 39  GLY A O    7  
ATOM 11059 H H    . GLY A 1 39  ? -15.282 -15.711 8.110   1.00 0.00 ? 39  GLY A H    7  
ATOM 11060 H HA2  . GLY A 1 39  ? -13.231 -16.412 6.209   1.00 0.00 ? 39  GLY A HA2  7  
ATOM 11061 H HA3  . GLY A 1 39  ? -13.067 -16.377 7.959   1.00 0.00 ? 39  GLY A HA3  7  
ATOM 11062 N N    . ILE A 1 40  ? -12.645 -18.886 6.950   1.00 0.00 ? 40  ILE A N    7  
ATOM 11063 C CA   . ILE A 1 40  ? -12.599 -20.343 6.960   1.00 0.00 ? 40  ILE A CA   7  
ATOM 11064 C C    . ILE A 1 40  ? -11.849 -20.860 8.184   1.00 0.00 ? 40  ILE A C    7  
ATOM 11065 O O    . ILE A 1 40  ? -11.407 -22.008 8.213   1.00 0.00 ? 40  ILE A O    7  
ATOM 11066 C CB   . ILE A 1 40  ? -11.926 -20.894 5.689   1.00 0.00 ? 40  ILE A CB   7  
ATOM 11067 C CG1  . ILE A 1 40  ? -10.449 -20.494 5.654   1.00 0.00 ? 40  ILE A CG1  7  
ATOM 11068 C CG2  . ILE A 1 40  ? -12.646 -20.390 4.448   1.00 0.00 ? 40  ILE A CG2  7  
ATOM 11069 C CD1  . ILE A 1 40  ? -9.536  -21.495 6.327   1.00 0.00 ? 40  ILE A CD1  7  
ATOM 11070 H H    . ILE A 1 40  ? -11.824 -18.383 6.770   1.00 0.00 ? 40  ILE A H    7  
ATOM 11071 H HA   . ILE A 1 40  ? -13.615 -20.709 6.993   1.00 0.00 ? 40  ILE A HA   7  
ATOM 11072 H HB   . ILE A 1 40  ? -12.000 -21.970 5.707   1.00 0.00 ? 40  ILE A HB   7  
ATOM 11073 H HG12 . ILE A 1 40  ? -10.134 -20.397 4.627   1.00 0.00 ? 40  ILE A HG12 7  
ATOM 11074 H HG13 . ILE A 1 40  ? -10.329 -19.545 6.155   1.00 0.00 ? 40  ILE A HG13 7  
ATOM 11075 H HG21 . ILE A 1 40  ? -11.921 -20.053 3.722   1.00 0.00 ? 40  ILE A HG21 7  
ATOM 11076 H HG22 . ILE A 1 40  ? -13.234 -21.190 4.023   1.00 0.00 ? 40  ILE A HG22 7  
ATOM 11077 H HG23 . ILE A 1 40  ? -13.295 -19.570 4.716   1.00 0.00 ? 40  ILE A HG23 7  
ATOM 11078 H HD11 . ILE A 1 40  ? -9.450  -21.254 7.377   1.00 0.00 ? 40  ILE A HD11 7  
ATOM 11079 H HD12 . ILE A 1 40  ? -9.948  -22.488 6.220   1.00 0.00 ? 40  ILE A HD12 7  
ATOM 11080 H HD13 . ILE A 1 40  ? -8.560  -21.458 5.868   1.00 0.00 ? 40  ILE A HD13 7  
ATOM 11081 N N    . GLU A 1 41  ? -11.712 -20.005 9.192   1.00 0.00 ? 41  GLU A N    7  
ATOM 11082 C CA   . GLU A 1 41  ? -11.017 -20.377 10.419  1.00 0.00 ? 41  GLU A CA   7  
ATOM 11083 C C    . GLU A 1 41  ? -11.931 -21.178 11.341  1.00 0.00 ? 41  GLU A C    7  
ATOM 11084 O O    . GLU A 1 41  ? -11.955 -20.959 12.552  1.00 0.00 ? 41  GLU A O    7  
ATOM 11085 C CB   . GLU A 1 41  ? -10.510 -19.128 11.143  1.00 0.00 ? 41  GLU A CB   7  
ATOM 11086 C CG   . GLU A 1 41  ? -9.493  -19.426 12.232  1.00 0.00 ? 41  GLU A CG   7  
ATOM 11087 C CD   . GLU A 1 41  ? -8.265  -20.141 11.702  1.00 0.00 ? 41  GLU A CD   7  
ATOM 11088 O OE1  . GLU A 1 41  ? -7.635  -19.621 10.758  1.00 0.00 ? 41  GLU A OE1  7  
ATOM 11089 O OE2  . GLU A 1 41  ? -7.934  -21.222 12.233  1.00 0.00 ? 41  GLU A OE2  7  
ATOM 11090 H H    . GLU A 1 41  ? -12.086 -19.104 9.109   1.00 0.00 ? 41  GLU A H    7  
ATOM 11091 H HA   . GLU A 1 41  ? -10.172 -20.992 10.148  1.00 0.00 ? 41  GLU A HA   7  
ATOM 11092 H HB2  . GLU A 1 41  ? -10.052 -18.469 10.421  1.00 0.00 ? 41  GLU A HB2  7  
ATOM 11093 H HB3  . GLU A 1 41  ? -11.352 -18.623 11.595  1.00 0.00 ? 41  GLU A HB3  7  
ATOM 11094 H HG2  . GLU A 1 41  ? -9.182  -18.495 12.681  1.00 0.00 ? 41  GLU A HG2  7  
ATOM 11095 H HG3  . GLU A 1 41  ? -9.959  -20.048 12.981  1.00 0.00 ? 41  GLU A HG3  7  
ATOM 11096 N N    . GLY A 1 42  ? -12.684 -22.106 10.759  1.00 0.00 ? 42  GLY A N    7  
ATOM 11097 C CA   . GLY A 1 42  ? -13.591 -22.925 11.542  1.00 0.00 ? 42  GLY A CA   7  
ATOM 11098 C C    . GLY A 1 42  ? -14.830 -22.167 11.974  1.00 0.00 ? 42  GLY A C    7  
ATOM 11099 O O    . GLY A 1 42  ? -15.231 -21.199 11.327  1.00 0.00 ? 42  GLY A O    7  
ATOM 11100 H H    . GLY A 1 42  ? -12.623 -22.236 9.789   1.00 0.00 ? 42  GLY A H    7  
ATOM 11101 H HA2  . GLY A 1 42  ? -13.890 -23.777 10.951  1.00 0.00 ? 42  GLY A HA2  7  
ATOM 11102 H HA3  . GLY A 1 42  ? -13.072 -23.275 12.423  1.00 0.00 ? 42  GLY A HA3  7  
ATOM 11103 N N    . ARG A 1 43  ? -15.439 -22.608 13.070  1.00 0.00 ? 43  ARG A N    7  
ATOM 11104 C CA   . ARG A 1 43  ? -16.642 -21.965 13.586  1.00 0.00 ? 43  ARG A CA   7  
ATOM 11105 C C    . ARG A 1 43  ? -17.722 -21.889 12.510  1.00 0.00 ? 43  ARG A C    7  
ATOM 11106 O O    . ARG A 1 43  ? -18.413 -20.879 12.380  1.00 0.00 ? 43  ARG A O    7  
ATOM 11107 C CB   . ARG A 1 43  ? -16.317 -20.561 14.098  1.00 0.00 ? 43  ARG A CB   7  
ATOM 11108 C CG   . ARG A 1 43  ? -15.847 -20.534 15.543  1.00 0.00 ? 43  ARG A CG   7  
ATOM 11109 C CD   . ARG A 1 43  ? -14.491 -21.203 15.701  1.00 0.00 ? 43  ARG A CD   7  
ATOM 11110 N NE   . ARG A 1 43  ? -14.017 -21.160 17.082  1.00 0.00 ? 43  ARG A NE   7  
ATOM 11111 C CZ   . ARG A 1 43  ? -13.450 -20.092 17.632  1.00 0.00 ? 43  ARG A CZ   7  
ATOM 11112 N NH1  . ARG A 1 43  ? -13.288 -18.984 16.922  1.00 0.00 ? 43  ARG A NH1  7  
ATOM 11113 N NH2  . ARG A 1 43  ? -13.045 -20.131 18.895  1.00 0.00 ? 43  ARG A NH2  7  
ATOM 11114 H H    . ARG A 1 43  ? -15.072 -23.384 13.542  1.00 0.00 ? 43  ARG A H    7  
ATOM 11115 H HA   . ARG A 1 43  ? -17.011 -22.562 14.407  1.00 0.00 ? 43  ARG A HA   7  
ATOM 11116 H HB2  . ARG A 1 43  ? -15.538 -20.137 13.482  1.00 0.00 ? 43  ARG A HB2  7  
ATOM 11117 H HB3  . ARG A 1 43  ? -17.202 -19.948 14.018  1.00 0.00 ? 43  ARG A HB3  7  
ATOM 11118 H HG2  . ARG A 1 43  ? -15.769 -19.506 15.867  1.00 0.00 ? 43  ARG A HG2  7  
ATOM 11119 H HG3  . ARG A 1 43  ? -16.569 -21.053 16.156  1.00 0.00 ? 43  ARG A HG3  7  
ATOM 11120 H HD2  . ARG A 1 43  ? -14.574 -22.234 15.391  1.00 0.00 ? 43  ARG A HD2  7  
ATOM 11121 H HD3  . ARG A 1 43  ? -13.778 -20.694 15.070  1.00 0.00 ? 43  ARG A HD3  7  
ATOM 11122 H HE   . ARG A 1 43  ? -14.127 -21.968 17.624  1.00 0.00 ? 43  ARG A HE   7  
ATOM 11123 H HH11 . ARG A 1 43  ? -13.594 -18.952 15.971  1.00 0.00 ? 43  ARG A HH11 7  
ATOM 11124 H HH12 . ARG A 1 43  ? -12.862 -18.181 17.339  1.00 0.00 ? 43  ARG A HH12 7  
ATOM 11125 H HH21 . ARG A 1 43  ? -13.165 -20.964 19.433  1.00 0.00 ? 43  ARG A HH21 7  
ATOM 11126 H HH22 . ARG A 1 43  ? -12.618 -19.327 19.308  1.00 0.00 ? 43  ARG A HH22 7  
ATOM 11127 N N    . GLY A 1 44  ? -17.860 -22.964 11.740  1.00 0.00 ? 44  GLY A N    7  
ATOM 11128 C CA   . GLY A 1 44  ? -18.856 -22.997 10.685  1.00 0.00 ? 44  GLY A CA   7  
ATOM 11129 C C    . GLY A 1 44  ? -18.686 -24.190 9.765   1.00 0.00 ? 44  GLY A C    7  
ATOM 11130 O O    . GLY A 1 44  ? -19.385 -25.194 9.904   1.00 0.00 ? 44  GLY A O    7  
ATOM 11131 H H    . GLY A 1 44  ? -17.281 -23.740 11.889  1.00 0.00 ? 44  GLY A H    7  
ATOM 11132 H HA2  . GLY A 1 44  ? -19.838 -23.037 11.133  1.00 0.00 ? 44  GLY A HA2  7  
ATOM 11133 H HA3  . GLY A 1 44  ? -18.775 -22.092 10.100  1.00 0.00 ? 44  GLY A HA3  7  
ATOM 11134 N N    . SER A 1 45  ? -17.757 -24.080 8.821   1.00 0.00 ? 45  SER A N    7  
ATOM 11135 C CA   . SER A 1 45  ? -17.502 -25.156 7.870   1.00 0.00 ? 45  SER A CA   7  
ATOM 11136 C C    . SER A 1 45  ? -16.307 -24.824 6.982   1.00 0.00 ? 45  SER A C    7  
ATOM 11137 O O    . SER A 1 45  ? -16.177 -23.703 6.491   1.00 0.00 ? 45  SER A O    7  
ATOM 11138 C CB   . SER A 1 45  ? -18.740 -25.406 7.007   1.00 0.00 ? 45  SER A CB   7  
ATOM 11139 O OG   . SER A 1 45  ? -19.047 -24.272 6.214   1.00 0.00 ? 45  SER A OG   7  
ATOM 11140 H H    . SER A 1 45  ? -17.233 -23.254 8.760   1.00 0.00 ? 45  SER A H    7  
ATOM 11141 H HA   . SER A 1 45  ? -17.280 -26.050 8.434   1.00 0.00 ? 45  SER A HA   7  
ATOM 11142 H HB2  . SER A 1 45  ? -18.557 -26.247 6.355   1.00 0.00 ? 45  SER A HB2  7  
ATOM 11143 H HB3  . SER A 1 45  ? -19.584 -25.623 7.646   1.00 0.00 ? 45  SER A HB3  7  
ATOM 11144 H HG   . SER A 1 45  ? -18.244 -23.775 6.042   1.00 0.00 ? 45  SER A HG   7  
ATOM 11145 N N    . SER A 1 46  ? -15.436 -25.808 6.781   1.00 0.00 ? 46  SER A N    7  
ATOM 11146 C CA   . SER A 1 46  ? -14.249 -25.621 5.955   1.00 0.00 ? 46  SER A CA   7  
ATOM 11147 C C    . SER A 1 46  ? -14.500 -26.095 4.527   1.00 0.00 ? 46  SER A C    7  
ATOM 11148 O O    . SER A 1 46  ? -15.299 -27.001 4.293   1.00 0.00 ? 46  SER A O    7  
ATOM 11149 C CB   . SER A 1 46  ? -13.061 -26.377 6.554   1.00 0.00 ? 46  SER A CB   7  
ATOM 11150 O OG   . SER A 1 46  ? -12.731 -25.874 7.837   1.00 0.00 ? 46  SER A OG   7  
ATOM 11151 H H    . SER A 1 46  ? -15.596 -26.680 7.199   1.00 0.00 ? 46  SER A H    7  
ATOM 11152 H HA   . SER A 1 46  ? -14.021 -24.566 5.937   1.00 0.00 ? 46  SER A HA   7  
ATOM 11153 H HB2  . SER A 1 46  ? -13.312 -27.423 6.644   1.00 0.00 ? 46  SER A HB2  7  
ATOM 11154 H HB3  . SER A 1 46  ? -12.204 -26.267 5.905   1.00 0.00 ? 46  SER A HB3  7  
ATOM 11155 H HG   . SER A 1 46  ? -12.660 -24.918 7.797   1.00 0.00 ? 46  SER A HG   7  
ATOM 11156 N N    . GLY A 1 47  ? -13.811 -25.474 3.574   1.00 0.00 ? 47  GLY A N    7  
ATOM 11157 C CA   . GLY A 1 47  ? -13.973 -25.844 2.180   1.00 0.00 ? 47  GLY A CA   7  
ATOM 11158 C C    . GLY A 1 47  ? -13.099 -27.019 1.787   1.00 0.00 ? 47  GLY A C    7  
ATOM 11159 O O    . GLY A 1 47  ? -13.183 -28.091 2.385   1.00 0.00 ? 47  GLY A O    7  
ATOM 11160 H H    . GLY A 1 47  ? -13.188 -24.758 3.819   1.00 0.00 ? 47  GLY A H    7  
ATOM 11161 H HA2  . GLY A 1 47  ? -15.007 -26.104 2.005   1.00 0.00 ? 47  GLY A HA2  7  
ATOM 11162 H HA3  . GLY A 1 47  ? -13.716 -24.997 1.562   1.00 0.00 ? 47  GLY A HA3  7  
ATOM 11163 N N    . SER A 1 48  ? -12.258 -26.817 0.778   1.00 0.00 ? 48  SER A N    7  
ATOM 11164 C CA   . SER A 1 48  ? -11.369 -27.870 0.302   1.00 0.00 ? 48  SER A CA   7  
ATOM 11165 C C    . SER A 1 48  ? -10.400 -27.331 -0.745  1.00 0.00 ? 48  SER A C    7  
ATOM 11166 O O    . SER A 1 48  ? -10.813 -26.842 -1.797  1.00 0.00 ? 48  SER A O    7  
ATOM 11167 C CB   . SER A 1 48  ? -12.181 -29.026 -0.286  1.00 0.00 ? 48  SER A CB   7  
ATOM 11168 O OG   . SER A 1 48  ? -11.442 -30.235 -0.257  1.00 0.00 ? 48  SER A OG   7  
ATOM 11169 H H    . SER A 1 48  ? -12.237 -25.940 0.341   1.00 0.00 ? 48  SER A H    7  
ATOM 11170 H HA   . SER A 1 48  ? -10.802 -28.233 1.147   1.00 0.00 ? 48  SER A HA   7  
ATOM 11171 H HB2  . SER A 1 48  ? -13.084 -29.157 0.290   1.00 0.00 ? 48  SER A HB2  7  
ATOM 11172 H HB3  . SER A 1 48  ? -12.437 -28.798 -1.310  1.00 0.00 ? 48  SER A HB3  7  
ATOM 11173 H HG   . SER A 1 48  ? -11.421 -30.577 0.640   1.00 0.00 ? 48  SER A HG   7  
ATOM 11174 N N    . SER A 1 49  ? -9.107  -27.423 -0.450  1.00 0.00 ? 49  SER A N    7  
ATOM 11175 C CA   . SER A 1 49  ? -8.078  -26.942 -1.364  1.00 0.00 ? 49  SER A CA   7  
ATOM 11176 C C    . SER A 1 49  ? -8.090  -27.738 -2.665  1.00 0.00 ? 49  SER A C    7  
ATOM 11177 O O    . SER A 1 49  ? -8.338  -28.943 -2.666  1.00 0.00 ? 49  SER A O    7  
ATOM 11178 C CB   . SER A 1 49  ? -6.699  -27.037 -0.708  1.00 0.00 ? 49  SER A CB   7  
ATOM 11179 O OG   . SER A 1 49  ? -6.697  -26.419 0.568   1.00 0.00 ? 49  SER A OG   7  
ATOM 11180 H H    . SER A 1 49  ? -8.840  -27.823 0.404   1.00 0.00 ? 49  SER A H    7  
ATOM 11181 H HA   . SER A 1 49  ? -8.290  -25.907 -1.586  1.00 0.00 ? 49  SER A HA   7  
ATOM 11182 H HB2  . SER A 1 49  ? -6.429  -28.075 -0.591  1.00 0.00 ? 49  SER A HB2  7  
ATOM 11183 H HB3  . SER A 1 49  ? -5.970  -26.543 -1.335  1.00 0.00 ? 49  SER A HB3  7  
ATOM 11184 H HG   . SER A 1 49  ? -6.651  -27.093 1.250   1.00 0.00 ? 49  SER A HG   7  
ATOM 11185 N N    . GLY A 1 50  ? -7.821  -27.053 -3.773  1.00 0.00 ? 50  GLY A N    7  
ATOM 11186 C CA   . GLY A 1 50  ? -7.807  -27.711 -5.066  1.00 0.00 ? 50  GLY A CA   7  
ATOM 11187 C C    . GLY A 1 50  ? -6.401  -27.998 -5.555  1.00 0.00 ? 50  GLY A C    7  
ATOM 11188 O O    . GLY A 1 50  ? -5.431  -27.447 -5.034  1.00 0.00 ? 50  GLY A O    7  
ATOM 11189 H H    . GLY A 1 50  ? -7.631  -26.094 -3.711  1.00 0.00 ? 50  GLY A H    7  
ATOM 11190 H HA2  . GLY A 1 50  ? -8.347  -28.643 -4.990  1.00 0.00 ? 50  GLY A HA2  7  
ATOM 11191 H HA3  . GLY A 1 50  ? -8.303  -27.076 -5.786  1.00 0.00 ? 50  GLY A HA3  7  
ATOM 11192 N N    . SER A 1 51  ? -6.290  -28.863 -6.558  1.00 0.00 ? 51  SER A N    7  
ATOM 11193 C CA   . SER A 1 51  ? -4.991  -29.226 -7.114  1.00 0.00 ? 51  SER A CA   7  
ATOM 11194 C C    . SER A 1 51  ? -4.808  -28.624 -8.504  1.00 0.00 ? 51  SER A C    7  
ATOM 11195 O O    . SER A 1 51  ? -5.031  -29.289 -9.515  1.00 0.00 ? 51  SER A O    7  
ATOM 11196 C CB   . SER A 1 51  ? -4.850  -30.748 -7.182  1.00 0.00 ? 51  SER A CB   7  
ATOM 11197 O OG   . SER A 1 51  ? -3.488  -31.131 -7.262  1.00 0.00 ? 51  SER A OG   7  
ATOM 11198 H H    . SER A 1 51  ? -7.100  -29.268 -6.931  1.00 0.00 ? 51  SER A H    7  
ATOM 11199 H HA   . SER A 1 51  ? -4.229  -28.831 -6.460  1.00 0.00 ? 51  SER A HA   7  
ATOM 11200 H HB2  . SER A 1 51  ? -5.284  -31.187 -6.297  1.00 0.00 ? 51  SER A HB2  7  
ATOM 11201 H HB3  . SER A 1 51  ? -5.367  -31.116 -8.057  1.00 0.00 ? 51  SER A HB3  7  
ATOM 11202 H HG   . SER A 1 51  ? -3.025  -30.545 -7.866  1.00 0.00 ? 51  SER A HG   7  
ATOM 11203 N N    . SER A 1 52  ? -4.399  -27.360 -8.545  1.00 0.00 ? 52  SER A N    7  
ATOM 11204 C CA   . SER A 1 52  ? -4.189  -26.665 -9.809  1.00 0.00 ? 52  SER A CA   7  
ATOM 11205 C C    . SER A 1 52  ? -3.290  -27.481 -10.734 1.00 0.00 ? 52  SER A C    7  
ATOM 11206 O O    . SER A 1 52  ? -2.535  -28.341 -10.284 1.00 0.00 ? 52  SER A O    7  
ATOM 11207 C CB   . SER A 1 52  ? -3.570  -25.288 -9.562  1.00 0.00 ? 52  SER A CB   7  
ATOM 11208 O OG   . SER A 1 52  ? -3.931  -24.376 -10.585 1.00 0.00 ? 52  SER A OG   7  
ATOM 11209 H H    . SER A 1 52  ? -4.238  -26.882 -7.704  1.00 0.00 ? 52  SER A H    7  
ATOM 11210 H HA   . SER A 1 52  ? -5.151  -26.538 -10.282 1.00 0.00 ? 52  SER A HA   7  
ATOM 11211 H HB2  . SER A 1 52  ? -3.919  -24.904 -8.616  1.00 0.00 ? 52  SER A HB2  7  
ATOM 11212 H HB3  . SER A 1 52  ? -2.494  -25.379 -9.540  1.00 0.00 ? 52  SER A HB3  7  
ATOM 11213 H HG   . SER A 1 52  ? -3.254  -24.375 -11.266 1.00 0.00 ? 52  SER A HG   7  
ATOM 11214 N N    . GLY A 1 53  ? -3.378  -27.202 -12.031 1.00 0.00 ? 53  GLY A N    7  
ATOM 11215 C CA   . GLY A 1 53  ? -2.568  -27.918 -13.000 1.00 0.00 ? 53  GLY A CA   7  
ATOM 11216 C C    . GLY A 1 53  ? -1.494  -27.044 -13.616 1.00 0.00 ? 53  GLY A C    7  
ATOM 11217 O O    . GLY A 1 53  ? -1.130  -26.009 -13.057 1.00 0.00 ? 53  GLY A O    7  
ATOM 11218 H H    . GLY A 1 53  ? -3.998  -26.506 -12.333 1.00 0.00 ? 53  GLY A H    7  
ATOM 11219 H HA2  . GLY A 1 53  ? -2.097  -28.757 -12.510 1.00 0.00 ? 53  GLY A HA2  7  
ATOM 11220 H HA3  . GLY A 1 53  ? -3.210  -28.287 -13.786 1.00 0.00 ? 53  GLY A HA3  7  
ATOM 11221 N N    . SER A 1 54  ? -0.985  -27.460 -14.771 1.00 0.00 ? 54  SER A N    7  
ATOM 11222 C CA   . SER A 1 54  ? 0.058   -26.711 -15.462 1.00 0.00 ? 54  SER A CA   7  
ATOM 11223 C C    . SER A 1 54  ? -0.466  -25.357 -15.931 1.00 0.00 ? 54  SER A C    7  
ATOM 11224 O O    . SER A 1 54  ? -1.088  -25.253 -16.989 1.00 0.00 ? 54  SER A O    7  
ATOM 11225 C CB   . SER A 1 54  ? 0.584   -27.509 -16.656 1.00 0.00 ? 54  SER A CB   7  
ATOM 11226 O OG   . SER A 1 54  ? 1.825   -26.995 -17.106 1.00 0.00 ? 54  SER A OG   7  
ATOM 11227 H H    . SER A 1 54  ? -1.317  -28.293 -15.167 1.00 0.00 ? 54  SER A H    7  
ATOM 11228 H HA   . SER A 1 54  ? 0.866   -26.548 -14.764 1.00 0.00 ? 54  SER A HA   7  
ATOM 11229 H HB2  . SER A 1 54  ? 0.719   -28.539 -16.365 1.00 0.00 ? 54  SER A HB2  7  
ATOM 11230 H HB3  . SER A 1 54  ? -0.130  -27.453 -17.465 1.00 0.00 ? 54  SER A HB3  7  
ATOM 11231 H HG   . SER A 1 54  ? 2.416   -26.884 -16.358 1.00 0.00 ? 54  SER A HG   7  
ATOM 11232 N N    . SER A 1 55  ? -0.211  -24.322 -15.137 1.00 0.00 ? 55  SER A N    7  
ATOM 11233 C CA   . SER A 1 55  ? -0.660  -22.975 -15.468 1.00 0.00 ? 55  SER A CA   7  
ATOM 11234 C C    . SER A 1 55  ? 0.211   -21.928 -14.781 1.00 0.00 ? 55  SER A C    7  
ATOM 11235 O O    . SER A 1 55  ? 0.593   -22.085 -13.622 1.00 0.00 ? 55  SER A O    7  
ATOM 11236 C CB   . SER A 1 55  ? -2.122  -22.787 -15.059 1.00 0.00 ? 55  SER A CB   7  
ATOM 11237 O OG   . SER A 1 55  ? -2.988  -23.524 -15.904 1.00 0.00 ? 55  SER A OG   7  
ATOM 11238 H H    . SER A 1 55  ? 0.289   -24.470 -14.307 1.00 0.00 ? 55  SER A H    7  
ATOM 11239 H HA   . SER A 1 55  ? -0.576  -22.851 -16.537 1.00 0.00 ? 55  SER A HA   7  
ATOM 11240 H HB2  . SER A 1 55  ? -2.256  -23.127 -14.043 1.00 0.00 ? 55  SER A HB2  7  
ATOM 11241 H HB3  . SER A 1 55  ? -2.380  -21.740 -15.124 1.00 0.00 ? 55  SER A HB3  7  
ATOM 11242 H HG   . SER A 1 55  ? -3.828  -23.664 -15.461 1.00 0.00 ? 55  SER A HG   7  
ATOM 11243 N N    . GLY A 1 56  ? 0.521   -20.857 -15.506 1.00 0.00 ? 56  GLY A N    7  
ATOM 11244 C CA   . GLY A 1 56  ? 1.345   -19.799 -14.951 1.00 0.00 ? 56  GLY A CA   7  
ATOM 11245 C C    . GLY A 1 56  ? 1.103   -18.463 -15.624 1.00 0.00 ? 56  GLY A C    7  
ATOM 11246 O O    . GLY A 1 56  ? 0.506   -18.400 -16.699 1.00 0.00 ? 56  GLY A O    7  
ATOM 11247 H H    . GLY A 1 56  ? 0.188   -20.785 -16.425 1.00 0.00 ? 56  GLY A H    7  
ATOM 11248 H HA2  . GLY A 1 56  ? 1.129   -19.704 -13.898 1.00 0.00 ? 56  GLY A HA2  7  
ATOM 11249 H HA3  . GLY A 1 56  ? 2.384   -20.067 -15.073 1.00 0.00 ? 56  GLY A HA3  7  
ATOM 11250 N N    . ASP A 1 57  ? 1.565   -17.391 -14.991 1.00 0.00 ? 57  ASP A N    7  
ATOM 11251 C CA   . ASP A 1 57  ? 1.395   -16.048 -15.534 1.00 0.00 ? 57  ASP A CA   7  
ATOM 11252 C C    . ASP A 1 57  ? 2.580   -15.160 -15.169 1.00 0.00 ? 57  ASP A C    7  
ATOM 11253 O O    . ASP A 1 57  ? 3.403   -15.519 -14.327 1.00 0.00 ? 57  ASP A O    7  
ATOM 11254 C CB   . ASP A 1 57  ? 0.097   -15.426 -15.018 1.00 0.00 ? 57  ASP A CB   7  
ATOM 11255 C CG   . ASP A 1 57  ? -0.427  -14.336 -15.932 1.00 0.00 ? 57  ASP A CG   7  
ATOM 11256 O OD1  . ASP A 1 57  ? -0.505  -14.575 -17.155 1.00 0.00 ? 57  ASP A OD1  7  
ATOM 11257 O OD2  . ASP A 1 57  ? -0.757  -13.244 -15.425 1.00 0.00 ? 57  ASP A OD2  7  
ATOM 11258 H H    . ASP A 1 57  ? 2.033   -17.505 -14.137 1.00 0.00 ? 57  ASP A H    7  
ATOM 11259 H HA   . ASP A 1 57  ? 1.341   -16.130 -16.609 1.00 0.00 ? 57  ASP A HA   7  
ATOM 11260 H HB2  . ASP A 1 57  ? -0.657  -16.196 -14.938 1.00 0.00 ? 57  ASP A HB2  7  
ATOM 11261 H HB3  . ASP A 1 57  ? 0.274   -14.999 -14.042 1.00 0.00 ? 57  ASP A HB3  7  
ATOM 11262 N N    . LYS A 1 58  ? 2.662   -13.998 -15.809 1.00 0.00 ? 58  LYS A N    7  
ATOM 11263 C CA   . LYS A 1 58  ? 3.745   -13.057 -15.552 1.00 0.00 ? 58  LYS A CA   7  
ATOM 11264 C C    . LYS A 1 58  ? 3.326   -12.011 -14.524 1.00 0.00 ? 58  LYS A C    7  
ATOM 11265 O O    . LYS A 1 58  ? 3.630   -10.828 -14.670 1.00 0.00 ? 58  LYS A O    7  
ATOM 11266 C CB   . LYS A 1 58  ? 4.169   -12.368 -16.852 1.00 0.00 ? 58  LYS A CB   7  
ATOM 11267 C CG   . LYS A 1 58  ? 5.225   -13.134 -17.630 1.00 0.00 ? 58  LYS A CG   7  
ATOM 11268 C CD   . LYS A 1 58  ? 6.068   -12.205 -18.487 1.00 0.00 ? 58  LYS A CD   7  
ATOM 11269 C CE   . LYS A 1 58  ? 6.933   -12.984 -19.467 1.00 0.00 ? 58  LYS A CE   7  
ATOM 11270 N NZ   . LYS A 1 58  ? 8.184   -13.480 -18.830 1.00 0.00 ? 58  LYS A NZ   7  
ATOM 11271 H H    . LYS A 1 58  ? 1.975   -13.768 -16.470 1.00 0.00 ? 58  LYS A H    7  
ATOM 11272 H HA   . LYS A 1 58  ? 4.583   -13.614 -15.161 1.00 0.00 ? 58  LYS A HA   7  
ATOM 11273 H HB2  . LYS A 1 58  ? 3.300   -12.252 -17.483 1.00 0.00 ? 58  LYS A HB2  7  
ATOM 11274 H HB3  . LYS A 1 58  ? 4.564   -11.391 -16.615 1.00 0.00 ? 58  LYS A HB3  7  
ATOM 11275 H HG2  . LYS A 1 58  ? 5.870   -13.648 -16.933 1.00 0.00 ? 58  LYS A HG2  7  
ATOM 11276 H HG3  . LYS A 1 58  ? 4.736   -13.855 -18.269 1.00 0.00 ? 58  LYS A HG3  7  
ATOM 11277 H HD2  . LYS A 1 58  ? 5.415   -11.550 -19.043 1.00 0.00 ? 58  LYS A HD2  7  
ATOM 11278 H HD3  . LYS A 1 58  ? 6.708   -11.617 -17.844 1.00 0.00 ? 58  LYS A HD3  7  
ATOM 11279 H HE2  . LYS A 1 58  ? 6.368   -13.826 -19.835 1.00 0.00 ? 58  LYS A HE2  7  
ATOM 11280 H HE3  . LYS A 1 58  ? 7.192   -12.336 -20.292 1.00 0.00 ? 58  LYS A HE3  7  
ATOM 11281 H HZ1  . LYS A 1 58  ? 8.270   -14.508 -18.963 1.00 0.00 ? 58  LYS A HZ1  7  
ATOM 11282 H HZ2  . LYS A 1 58  ? 8.172   -13.273 -17.810 1.00 0.00 ? 58  LYS A HZ2  7  
ATOM 11283 H HZ3  . LYS A 1 58  ? 9.011   -13.015 -19.256 1.00 0.00 ? 58  LYS A HZ3  7  
ATOM 11284 N N    . GLU A 1 59  ? 2.628   -12.457 -13.484 1.00 0.00 ? 59  GLU A N    7  
ATOM 11285 C CA   . GLU A 1 59  ? 2.168   -11.559 -12.432 1.00 0.00 ? 59  GLU A CA   7  
ATOM 11286 C C    . GLU A 1 59  ? 3.271   -10.584 -12.029 1.00 0.00 ? 59  GLU A C    7  
ATOM 11287 O O    . GLU A 1 59  ? 4.457   -10.887 -12.153 1.00 0.00 ? 59  GLU A O    7  
ATOM 11288 C CB   . GLU A 1 59  ? 1.709   -12.360 -11.211 1.00 0.00 ? 59  GLU A CB   7  
ATOM 11289 C CG   . GLU A 1 59  ? 0.540   -13.287 -11.496 1.00 0.00 ? 59  GLU A CG   7  
ATOM 11290 C CD   . GLU A 1 59  ? 0.513   -14.493 -10.577 1.00 0.00 ? 59  GLU A CD   7  
ATOM 11291 O OE1  . GLU A 1 59  ? 1.536   -15.205 -10.502 1.00 0.00 ? 59  GLU A OE1  7  
ATOM 11292 O OE2  . GLU A 1 59  ? -0.531  -14.723 -9.932  1.00 0.00 ? 59  GLU A OE2  7  
ATOM 11293 H H    . GLU A 1 59  ? 2.417   -13.412 -13.424 1.00 0.00 ? 59  GLU A H    7  
ATOM 11294 H HA   . GLU A 1 59  ? 1.331   -10.997 -12.817 1.00 0.00 ? 59  GLU A HA   7  
ATOM 11295 H HB2  . GLU A 1 59  ? 2.536   -12.956 -10.855 1.00 0.00 ? 59  GLU A HB2  7  
ATOM 11296 H HB3  . GLU A 1 59  ? 1.413   -11.670 -10.434 1.00 0.00 ? 59  GLU A HB3  7  
ATOM 11297 H HG2  . GLU A 1 59  ? -0.380  -12.736 -11.368 1.00 0.00 ? 59  GLU A HG2  7  
ATOM 11298 H HG3  . GLU A 1 59  ? 0.611   -13.633 -12.517 1.00 0.00 ? 59  GLU A HG3  7  
ATOM 11299 N N    . ARG A 1 60  ? 2.869   -9.413  -11.546 1.00 0.00 ? 60  ARG A N    7  
ATOM 11300 C CA   . ARG A 1 60  ? 3.822   -8.392  -11.126 1.00 0.00 ? 60  ARG A CA   7  
ATOM 11301 C C    . ARG A 1 60  ? 4.185   -8.560  -9.654  1.00 0.00 ? 60  ARG A C    7  
ATOM 11302 O O    . ARG A 1 60  ? 3.321   -8.817  -8.816  1.00 0.00 ? 60  ARG A O    7  
ATOM 11303 C CB   . ARG A 1 60  ? 3.244   -6.996  -11.364 1.00 0.00 ? 60  ARG A CB   7  
ATOM 11304 C CG   . ARG A 1 60  ? 4.302   -5.934  -11.616 1.00 0.00 ? 60  ARG A CG   7  
ATOM 11305 C CD   . ARG A 1 60  ? 3.699   -4.683  -12.237 1.00 0.00 ? 60  ARG A CD   7  
ATOM 11306 N NE   . ARG A 1 60  ? 3.672   -4.755  -13.696 1.00 0.00 ? 60  ARG A NE   7  
ATOM 11307 C CZ   . ARG A 1 60  ? 2.993   -3.908  -14.461 1.00 0.00 ? 60  ARG A CZ   7  
ATOM 11308 N NH1  . ARG A 1 60  ? 2.289   -2.929  -13.909 1.00 0.00 ? 60  ARG A NH1  7  
ATOM 11309 N NH2  . ARG A 1 60  ? 3.018   -4.038  -15.781 1.00 0.00 ? 60  ARG A NH2  7  
ATOM 11310 H H    . ARG A 1 60  ? 1.909   -9.230  -11.471 1.00 0.00 ? 60  ARG A H    7  
ATOM 11311 H HA   . ARG A 1 60  ? 4.716   -8.508  -11.721 1.00 0.00 ? 60  ARG A HA   7  
ATOM 11312 H HB2  . ARG A 1 60  ? 2.589   -7.031  -12.222 1.00 0.00 ? 60  ARG A HB2  7  
ATOM 11313 H HB3  . ARG A 1 60  ? 2.672   -6.704  -10.497 1.00 0.00 ? 60  ARG A HB3  7  
ATOM 11314 H HG2  . ARG A 1 60  ? 4.763   -5.668  -10.676 1.00 0.00 ? 60  ARG A HG2  7  
ATOM 11315 H HG3  . ARG A 1 60  ? 5.048   -6.334  -12.286 1.00 0.00 ? 60  ARG A HG3  7  
ATOM 11316 H HD2  . ARG A 1 60  ? 2.688   -4.568  -11.874 1.00 0.00 ? 60  ARG A HD2  7  
ATOM 11317 H HD3  . ARG A 1 60  ? 4.288   -3.830  -11.939 1.00 0.00 ? 60  ARG A HD3  7  
ATOM 11318 H HE   . ARG A 1 60  ? 4.185   -5.471  -14.124 1.00 0.00 ? 60  ARG A HE   7  
ATOM 11319 H HH11 . ARG A 1 60  ? 2.269   -2.828  -12.915 1.00 0.00 ? 60  ARG A HH11 7  
ATOM 11320 H HH12 . ARG A 1 60  ? 1.780   -2.292  -14.488 1.00 0.00 ? 60  ARG A HH12 7  
ATOM 11321 H HH21 . ARG A 1 60  ? 3.548   -4.775  -16.201 1.00 0.00 ? 60  ARG A HH21 7  
ATOM 11322 H HH22 . ARG A 1 60  ? 2.507   -3.400  -16.356 1.00 0.00 ? 60  ARG A HH22 7  
ATOM 11323 N N    . HIS A 1 61  ? 5.470   -8.413  -9.346  1.00 0.00 ? 61  HIS A N    7  
ATOM 11324 C CA   . HIS A 1 61  ? 5.948   -8.549  -7.975  1.00 0.00 ? 61  HIS A CA   7  
ATOM 11325 C C    . HIS A 1 61  ? 6.029   -7.187  -7.291  1.00 0.00 ? 61  HIS A C    7  
ATOM 11326 O O    . HIS A 1 61  ? 6.773   -6.308  -7.722  1.00 0.00 ? 61  HIS A O    7  
ATOM 11327 C CB   . HIS A 1 61  ? 7.319   -9.225  -7.954  1.00 0.00 ? 61  HIS A CB   7  
ATOM 11328 C CG   . HIS A 1 61  ? 7.568   -10.037 -6.721  1.00 0.00 ? 61  HIS A CG   7  
ATOM 11329 N ND1  . HIS A 1 61  ? 8.663   -9.849  -5.904  1.00 0.00 ? 61  HIS A ND1  7  
ATOM 11330 C CD2  . HIS A 1 61  ? 6.855   -11.045 -6.166  1.00 0.00 ? 61  HIS A CD2  7  
ATOM 11331 C CE1  . HIS A 1 61  ? 8.613   -10.707 -4.901  1.00 0.00 ? 61  HIS A CE1  7  
ATOM 11332 N NE2  . HIS A 1 61  ? 7.526   -11.444 -5.036  1.00 0.00 ? 61  HIS A NE2  7  
ATOM 11333 H H    . HIS A 1 61  ? 6.111   -8.209  -10.058 1.00 0.00 ? 61  HIS A H    7  
ATOM 11334 H HA   . HIS A 1 61  ? 5.244   -9.166  -7.438  1.00 0.00 ? 61  HIS A HA   7  
ATOM 11335 H HB2  . HIS A 1 61  ? 7.401   -9.883  -8.807  1.00 0.00 ? 61  HIS A HB2  7  
ATOM 11336 H HB3  . HIS A 1 61  ? 8.088   -8.468  -8.015  1.00 0.00 ? 61  HIS A HB3  7  
ATOM 11337 H HD1  . HIS A 1 61  ? 9.371   -9.186  -6.040  1.00 0.00 ? 61  HIS A HD1  7  
ATOM 11338 H HD2  . HIS A 1 61  ? 5.931   -11.460 -6.542  1.00 0.00 ? 61  HIS A HD2  7  
ATOM 11339 H HE1  . HIS A 1 61  ? 9.338   -10.791 -4.105  1.00 0.00 ? 61  HIS A HE1  7  
ATOM 11340 H HE2  . HIS A 1 61  ? 7.293   -12.213 -4.476  1.00 0.00 ? 61  HIS A HE2  7  
ATOM 11341 N N    . GLY A 1 62  ? 5.256   -7.021  -6.221  1.00 0.00 ? 62  GLY A N    7  
ATOM 11342 C CA   . GLY A 1 62  ? 5.255   -5.764  -5.495  1.00 0.00 ? 62  GLY A CA   7  
ATOM 11343 C C    . GLY A 1 62  ? 5.558   -5.945  -4.021  1.00 0.00 ? 62  GLY A C    7  
ATOM 11344 O O    . GLY A 1 62  ? 5.544   -7.065  -3.510  1.00 0.00 ? 62  GLY A O    7  
ATOM 11345 H H    . GLY A 1 62  ? 4.683   -7.757  -5.922  1.00 0.00 ? 62  GLY A H    7  
ATOM 11346 H HA2  . GLY A 1 62  ? 5.998   -5.110  -5.928  1.00 0.00 ? 62  GLY A HA2  7  
ATOM 11347 H HA3  . GLY A 1 62  ? 4.283   -5.304  -5.597  1.00 0.00 ? 62  GLY A HA3  7  
ATOM 11348 N N    . VAL A 1 63  ? 5.835   -4.841  -3.336  1.00 0.00 ? 63  VAL A N    7  
ATOM 11349 C CA   . VAL A 1 63  ? 6.144   -4.882  -1.911  1.00 0.00 ? 63  VAL A CA   7  
ATOM 11350 C C    . VAL A 1 63  ? 5.555   -3.678  -1.186  1.00 0.00 ? 63  VAL A C    7  
ATOM 11351 O O    . VAL A 1 63  ? 5.681   -2.542  -1.643  1.00 0.00 ? 63  VAL A O    7  
ATOM 11352 C CB   . VAL A 1 63  ? 7.665   -4.922  -1.668  1.00 0.00 ? 63  VAL A CB   7  
ATOM 11353 C CG1  . VAL A 1 63  ? 7.988   -4.500  -0.242  1.00 0.00 ? 63  VAL A CG1  7  
ATOM 11354 C CG2  . VAL A 1 63  ? 8.215   -6.309  -1.960  1.00 0.00 ? 63  VAL A CG2  7  
ATOM 11355 H H    . VAL A 1 63  ? 5.831   -3.977  -3.799  1.00 0.00 ? 63  VAL A H    7  
ATOM 11356 H HA   . VAL A 1 63  ? 5.712   -5.784  -1.502  1.00 0.00 ? 63  VAL A HA   7  
ATOM 11357 H HB   . VAL A 1 63  ? 8.135   -4.221  -2.342  1.00 0.00 ? 63  VAL A HB   7  
ATOM 11358 H HG11 . VAL A 1 63  ? 8.920   -4.953  0.063   1.00 0.00 ? 63  VAL A HG11 7  
ATOM 11359 H HG12 . VAL A 1 63  ? 8.076   -3.425  -0.196  1.00 0.00 ? 63  VAL A HG12 7  
ATOM 11360 H HG13 . VAL A 1 63  ? 7.198   -4.827  0.417   1.00 0.00 ? 63  VAL A HG13 7  
ATOM 11361 H HG21 . VAL A 1 63  ? 7.881   -6.998  -1.199  1.00 0.00 ? 63  VAL A HG21 7  
ATOM 11362 H HG22 . VAL A 1 63  ? 7.861   -6.640  -2.925  1.00 0.00 ? 63  VAL A HG22 7  
ATOM 11363 H HG23 . VAL A 1 63  ? 9.295   -6.275  -1.965  1.00 0.00 ? 63  VAL A HG23 7  
ATOM 11364 N N    . ALA A 1 64  ? 4.913   -3.933  -0.051  1.00 0.00 ? 64  ALA A N    7  
ATOM 11365 C CA   . ALA A 1 64  ? 4.306   -2.870  0.740   1.00 0.00 ? 64  ALA A CA   7  
ATOM 11366 C C    . ALA A 1 64  ? 5.371   -1.959  1.343   1.00 0.00 ? 64  ALA A C    7  
ATOM 11367 O O    . ALA A 1 64  ? 6.329   -2.430  1.956   1.00 0.00 ? 64  ALA A O    7  
ATOM 11368 C CB   . ALA A 1 64  ? 3.432   -3.460  1.836   1.00 0.00 ? 64  ALA A CB   7  
ATOM 11369 H H    . ALA A 1 64  ? 4.846   -4.859  0.262   1.00 0.00 ? 64  ALA A H    7  
ATOM 11370 H HA   . ALA A 1 64  ? 3.675   -2.285  0.085   1.00 0.00 ? 64  ALA A HA   7  
ATOM 11371 H HB1  . ALA A 1 64  ? 3.997   -4.197  2.389   1.00 0.00 ? 64  ALA A HB1  7  
ATOM 11372 H HB2  . ALA A 1 64  ? 3.113   -2.674  2.505   1.00 0.00 ? 64  ALA A HB2  7  
ATOM 11373 H HB3  . ALA A 1 64  ? 2.566   -3.929  1.392   1.00 0.00 ? 64  ALA A HB3  7  
ATOM 11374 N N    . ILE A 1 65  ? 5.196   -0.654  1.163   1.00 0.00 ? 65  ILE A N    7  
ATOM 11375 C CA   . ILE A 1 65  ? 6.142   0.322   1.690   1.00 0.00 ? 65  ILE A CA   7  
ATOM 11376 C C    . ILE A 1 65  ? 5.534   1.108   2.847   1.00 0.00 ? 65  ILE A C    7  
ATOM 11377 O O    . ILE A 1 65  ? 6.245   1.771   3.603   1.00 0.00 ? 65  ILE A O    7  
ATOM 11378 C CB   . ILE A 1 65  ? 6.601   1.307   0.599   1.00 0.00 ? 65  ILE A CB   7  
ATOM 11379 C CG1  . ILE A 1 65  ? 5.396   1.827   -0.189  1.00 0.00 ? 65  ILE A CG1  7  
ATOM 11380 C CG2  . ILE A 1 65  ? 7.601   0.639   -0.332  1.00 0.00 ? 65  ILE A CG2  7  
ATOM 11381 C CD1  . ILE A 1 65  ? 5.745   2.918   -1.176  1.00 0.00 ? 65  ILE A CD1  7  
ATOM 11382 H H    . ILE A 1 65  ? 4.413   -0.340  0.666   1.00 0.00 ? 65  ILE A H    7  
ATOM 11383 H HA   . ILE A 1 65  ? 7.008   -0.215  2.050   1.00 0.00 ? 65  ILE A HA   7  
ATOM 11384 H HB   . ILE A 1 65  ? 7.093   2.139   1.080   1.00 0.00 ? 65  ILE A HB   7  
ATOM 11385 H HG12 . ILE A 1 65  ? 4.955   1.011   -0.739  1.00 0.00 ? 65  ILE A HG12 7  
ATOM 11386 H HG13 . ILE A 1 65  ? 4.668   2.224   0.503   1.00 0.00 ? 65  ILE A HG13 7  
ATOM 11387 H HG21 . ILE A 1 65  ? 7.273   -0.367  -0.551  1.00 0.00 ? 65  ILE A HG21 7  
ATOM 11388 H HG22 . ILE A 1 65  ? 7.669   1.202   -1.250  1.00 0.00 ? 65  ILE A HG22 7  
ATOM 11389 H HG23 . ILE A 1 65  ? 8.570   0.606   0.144   1.00 0.00 ? 65  ILE A HG23 7  
ATOM 11390 H HD11 . ILE A 1 65  ? 5.015   3.713   -1.107  1.00 0.00 ? 65  ILE A HD11 7  
ATOM 11391 H HD12 . ILE A 1 65  ? 6.725   3.311   -0.948  1.00 0.00 ? 65  ILE A HD12 7  
ATOM 11392 H HD13 . ILE A 1 65  ? 5.742   2.514   -2.177  1.00 0.00 ? 65  ILE A HD13 7  
ATOM 11393 N N    . TYR A 1 66  ? 4.215   1.029   2.979   1.00 0.00 ? 66  TYR A N    7  
ATOM 11394 C CA   . TYR A 1 66  ? 3.510   1.733   4.044   1.00 0.00 ? 66  TYR A CA   7  
ATOM 11395 C C    . TYR A 1 66  ? 2.421   0.854   4.652   1.00 0.00 ? 66  TYR A C    7  
ATOM 11396 O O    . TYR A 1 66  ? 1.745   0.107   3.946   1.00 0.00 ? 66  TYR A O    7  
ATOM 11397 C CB   . TYR A 1 66  ? 2.895   3.027   3.507   1.00 0.00 ? 66  TYR A CB   7  
ATOM 11398 C CG   . TYR A 1 66  ? 3.912   3.994   2.945   1.00 0.00 ? 66  TYR A CG   7  
ATOM 11399 C CD1  . TYR A 1 66  ? 5.004   4.402   3.701   1.00 0.00 ? 66  TYR A CD1  7  
ATOM 11400 C CD2  . TYR A 1 66  ? 3.783   4.498   1.657   1.00 0.00 ? 66  TYR A CD2  7  
ATOM 11401 C CE1  . TYR A 1 66  ? 5.936   5.285   3.192   1.00 0.00 ? 66  TYR A CE1  7  
ATOM 11402 C CE2  . TYR A 1 66  ? 4.710   5.381   1.138   1.00 0.00 ? 66  TYR A CE2  7  
ATOM 11403 C CZ   . TYR A 1 66  ? 5.785   5.772   1.910   1.00 0.00 ? 66  TYR A CZ   7  
ATOM 11404 O OH   . TYR A 1 66  ? 6.711   6.651   1.398   1.00 0.00 ? 66  TYR A OH   7  
ATOM 11405 H H    . TYR A 1 66  ? 3.702   0.485   2.346   1.00 0.00 ? 66  TYR A H    7  
ATOM 11406 H HA   . TYR A 1 66  ? 4.228   1.979   4.811   1.00 0.00 ? 66  TYR A HA   7  
ATOM 11407 H HB2  . TYR A 1 66  ? 2.197   2.787   2.720   1.00 0.00 ? 66  TYR A HB2  7  
ATOM 11408 H HB3  . TYR A 1 66  ? 2.369   3.527   4.307   1.00 0.00 ? 66  TYR A HB3  7  
ATOM 11409 H HD1  . TYR A 1 66  ? 5.120   4.018   4.705   1.00 0.00 ? 66  TYR A HD1  7  
ATOM 11410 H HD2  . TYR A 1 66  ? 2.940   4.190   1.055   1.00 0.00 ? 66  TYR A HD2  7  
ATOM 11411 H HE1  . TYR A 1 66  ? 6.777   5.591   3.795   1.00 0.00 ? 66  TYR A HE1  7  
ATOM 11412 H HE2  . TYR A 1 66  ? 4.592   5.762   0.135   1.00 0.00 ? 66  TYR A HE2  7  
ATOM 11413 H HH   . TYR A 1 66  ? 6.702   7.461   1.914   1.00 0.00 ? 66  TYR A HH   7  
ATOM 11414 N N    . ASN A 1 67  ? 2.259   0.950   5.967   1.00 0.00 ? 67  ASN A N    7  
ATOM 11415 C CA   . ASN A 1 67  ? 1.253   0.163   6.672   1.00 0.00 ? 67  ASN A CA   7  
ATOM 11416 C C    . ASN A 1 67  ? -0.155  0.603   6.279   1.00 0.00 ? 67  ASN A C    7  
ATOM 11417 O O    . ASN A 1 67  ? -0.627  1.659   6.700   1.00 0.00 ? 67  ASN A O    7  
ATOM 11418 C CB   . ASN A 1 67  ? 1.438   0.299   8.185   1.00 0.00 ? 67  ASN A CB   7  
ATOM 11419 C CG   . ASN A 1 67  ? 2.524   -0.615  8.719   1.00 0.00 ? 67  ASN A CG   7  
ATOM 11420 O OD1  . ASN A 1 67  ? 3.503   -0.156  9.308   1.00 0.00 ? 67  ASN A OD1  7  
ATOM 11421 N ND2  . ASN A 1 67  ? 2.356   -1.916  8.514   1.00 0.00 ? 67  ASN A ND2  7  
ATOM 11422 H H    . ASN A 1 67  ? 2.828   1.563   6.476   1.00 0.00 ? 67  ASN A H    7  
ATOM 11423 H HA   . ASN A 1 67  ? 1.386   -0.871  6.393   1.00 0.00 ? 67  ASN A HA   7  
ATOM 11424 H HB2  . ASN A 1 67  ? 1.705   1.319   8.419   1.00 0.00 ? 67  ASN A HB2  7  
ATOM 11425 H HB3  . ASN A 1 67  ? 0.510   0.052   8.679   1.00 0.00 ? 67  ASN A HB3  7  
ATOM 11426 H HD21 . ASN A 1 67  ? 1.552   -2.210  8.037   1.00 0.00 ? 67  ASN A HD21 7  
ATOM 11427 H HD22 . ASN A 1 67  ? 3.043   -2.530  8.849   1.00 0.00 ? 67  ASN A HD22 7  
ATOM 11428 N N    . PHE A 1 68  ? -0.820  -0.216  5.471   1.00 0.00 ? 68  PHE A N    7  
ATOM 11429 C CA   . PHE A 1 68  ? -2.173  0.088   5.020   1.00 0.00 ? 68  PHE A CA   7  
ATOM 11430 C C    . PHE A 1 68  ? -3.206  -0.648  5.868   1.00 0.00 ? 68  PHE A C    7  
ATOM 11431 O O    . PHE A 1 68  ? -3.199  -1.876  5.945   1.00 0.00 ? 68  PHE A O    7  
ATOM 11432 C CB   . PHE A 1 68  ? -2.341  -0.293  3.548   1.00 0.00 ? 68  PHE A CB   7  
ATOM 11433 C CG   . PHE A 1 68  ? -3.731  -0.068  3.025   1.00 0.00 ? 68  PHE A CG   7  
ATOM 11434 C CD1  . PHE A 1 68  ? -4.756  -0.944  3.345   1.00 0.00 ? 68  PHE A CD1  7  
ATOM 11435 C CD2  . PHE A 1 68  ? -4.013  1.019   2.213   1.00 0.00 ? 68  PHE A CD2  7  
ATOM 11436 C CE1  . PHE A 1 68  ? -6.036  -0.740  2.866   1.00 0.00 ? 68  PHE A CE1  7  
ATOM 11437 C CE2  . PHE A 1 68  ? -5.291  1.228   1.732   1.00 0.00 ? 68  PHE A CE2  7  
ATOM 11438 C CZ   . PHE A 1 68  ? -6.304  0.347   2.057   1.00 0.00 ? 68  PHE A CZ   7  
ATOM 11439 H H    . PHE A 1 68  ? -0.389  -1.043  5.169   1.00 0.00 ? 68  PHE A H    7  
ATOM 11440 H HA   . PHE A 1 68  ? -2.327  1.150   5.128   1.00 0.00 ? 68  PHE A HA   7  
ATOM 11441 H HB2  . PHE A 1 68  ? -1.663  0.298   2.951   1.00 0.00 ? 68  PHE A HB2  7  
ATOM 11442 H HB3  . PHE A 1 68  ? -2.104  -1.339  3.425   1.00 0.00 ? 68  PHE A HB3  7  
ATOM 11443 H HD1  . PHE A 1 68  ? -4.547  -1.796  3.977   1.00 0.00 ? 68  PHE A HD1  7  
ATOM 11444 H HD2  . PHE A 1 68  ? -3.222  1.708   1.957   1.00 0.00 ? 68  PHE A HD2  7  
ATOM 11445 H HE1  . PHE A 1 68  ? -6.825  -1.431  3.122   1.00 0.00 ? 68  PHE A HE1  7  
ATOM 11446 H HE2  . PHE A 1 68  ? -5.498  2.079   1.100   1.00 0.00 ? 68  PHE A HE2  7  
ATOM 11447 H HZ   . PHE A 1 68  ? -7.303  0.509   1.683   1.00 0.00 ? 68  PHE A HZ   7  
ATOM 11448 N N    . GLN A 1 69  ? -4.092  0.113   6.503   1.00 0.00 ? 69  GLN A N    7  
ATOM 11449 C CA   . GLN A 1 69  ? -5.131  -0.467  7.347   1.00 0.00 ? 69  GLN A CA   7  
ATOM 11450 C C    . GLN A 1 69  ? -6.515  -0.016  6.893   1.00 0.00 ? 69  GLN A C    7  
ATOM 11451 O O    . GLN A 1 69  ? -6.884  1.146   7.054   1.00 0.00 ? 69  GLN A O    7  
ATOM 11452 C CB   . GLN A 1 69  ? -4.908  -0.075  8.808   1.00 0.00 ? 69  GLN A CB   7  
ATOM 11453 C CG   . GLN A 1 69  ? -5.867  -0.753  9.773   1.00 0.00 ? 69  GLN A CG   7  
ATOM 11454 C CD   . GLN A 1 69  ? -5.350  -2.090  10.267  1.00 0.00 ? 69  GLN A CD   7  
ATOM 11455 O OE1  . GLN A 1 69  ? -4.315  -2.161  10.930  1.00 0.00 ? 69  GLN A OE1  7  
ATOM 11456 N NE2  . GLN A 1 69  ? -6.069  -3.158  9.946   1.00 0.00 ? 69  GLN A NE2  7  
ATOM 11457 H H    . GLN A 1 69  ? -4.046  1.086   6.402   1.00 0.00 ? 69  GLN A H    7  
ATOM 11458 H HA   . GLN A 1 69  ? -5.069  -1.541  7.258   1.00 0.00 ? 69  GLN A HA   7  
ATOM 11459 H HB2  . GLN A 1 69  ? -3.900  -0.340  9.090   1.00 0.00 ? 69  GLN A HB2  7  
ATOM 11460 H HB3  . GLN A 1 69  ? -5.030  0.994   8.905   1.00 0.00 ? 69  GLN A HB3  7  
ATOM 11461 H HG2  . GLN A 1 69  ? -6.018  -0.106  10.625  1.00 0.00 ? 69  GLN A HG2  7  
ATOM 11462 H HG3  . GLN A 1 69  ? -6.810  -0.911  9.271   1.00 0.00 ? 69  GLN A HG3  7  
ATOM 11463 H HE21 . GLN A 1 69  ? -6.882  -3.025  9.414   1.00 0.00 ? 69  GLN A HE21 7  
ATOM 11464 H HE22 . GLN A 1 69  ? -5.758  -4.035  10.252  1.00 0.00 ? 69  GLN A HE22 7  
ATOM 11465 N N    . GLY A 1 70  ? -7.278  -0.945  6.324   1.00 0.00 ? 70  GLY A N    7  
ATOM 11466 C CA   . GLY A 1 70  ? -8.613  -0.623  5.855   1.00 0.00 ? 70  GLY A CA   7  
ATOM 11467 C C    . GLY A 1 70  ? -9.690  -1.068  6.823   1.00 0.00 ? 70  GLY A C    7  
ATOM 11468 O O    . GLY A 1 70  ? -9.449  -1.172  8.026   1.00 0.00 ? 70  GLY A O    7  
ATOM 11469 H H    . GLY A 1 70  ? -6.931  -1.856  6.221   1.00 0.00 ? 70  GLY A H    7  
ATOM 11470 H HA2  . GLY A 1 70  ? -8.686  0.445   5.716   1.00 0.00 ? 70  GLY A HA2  7  
ATOM 11471 H HA3  . GLY A 1 70  ? -8.775  -1.111  4.905   1.00 0.00 ? 70  GLY A HA3  7  
ATOM 11472 N N    . SER A 1 71  ? -10.883 -1.330  6.299   1.00 0.00 ? 71  SER A N    7  
ATOM 11473 C CA   . SER A 1 71  ? -12.004 -1.761  7.127   1.00 0.00 ? 71  SER A CA   7  
ATOM 11474 C C    . SER A 1 71  ? -12.477 -3.153  6.719   1.00 0.00 ? 71  SER A C    7  
ATOM 11475 O O    . SER A 1 71  ? -12.801 -3.984  7.566   1.00 0.00 ? 71  SER A O    7  
ATOM 11476 C CB   . SER A 1 71  ? -13.159 -0.765  7.017   1.00 0.00 ? 71  SER A CB   7  
ATOM 11477 O OG   . SER A 1 71  ? -12.804 0.491   7.568   1.00 0.00 ? 71  SER A OG   7  
ATOM 11478 H H    . SER A 1 71  ? -11.013 -1.229  5.333   1.00 0.00 ? 71  SER A H    7  
ATOM 11479 H HA   . SER A 1 71  ? -11.665 -1.795  8.152   1.00 0.00 ? 71  SER A HA   7  
ATOM 11480 H HB2  . SER A 1 71  ? -13.416 -0.628  5.978   1.00 0.00 ? 71  SER A HB2  7  
ATOM 11481 H HB3  . SER A 1 71  ? -14.016 -1.150  7.552   1.00 0.00 ? 71  SER A HB3  7  
ATOM 11482 H HG   . SER A 1 71  ? -12.562 0.380   8.491   1.00 0.00 ? 71  SER A HG   7  
ATOM 11483 N N    . GLY A 1 72  ? -12.515 -3.399  5.412   1.00 0.00 ? 72  GLY A N    7  
ATOM 11484 C CA   . GLY A 1 72  ? -12.950 -4.690  4.913   1.00 0.00 ? 72  GLY A CA   7  
ATOM 11485 C C    . GLY A 1 72  ? -13.084 -4.713  3.403   1.00 0.00 ? 72  GLY A C    7  
ATOM 11486 O O    . GLY A 1 72  ? -13.210 -3.666  2.769   1.00 0.00 ? 72  GLY A O    7  
ATOM 11487 H H    . GLY A 1 72  ? -12.246 -2.698  4.783   1.00 0.00 ? 72  GLY A H    7  
ATOM 11488 H HA2  . GLY A 1 72  ? -12.233 -5.440  5.212   1.00 0.00 ? 72  GLY A HA2  7  
ATOM 11489 H HA3  . GLY A 1 72  ? -13.908 -4.929  5.351   1.00 0.00 ? 72  GLY A HA3  7  
ATOM 11490 N N    . ALA A 1 73  ? -13.055 -5.910  2.826   1.00 0.00 ? 73  ALA A N    7  
ATOM 11491 C CA   . ALA A 1 73  ? -13.175 -6.065  1.382   1.00 0.00 ? 73  ALA A CA   7  
ATOM 11492 C C    . ALA A 1 73  ? -14.128 -5.029  0.796   1.00 0.00 ? 73  ALA A C    7  
ATOM 11493 O O    . ALA A 1 73  ? -15.059 -4.564  1.454   1.00 0.00 ? 73  ALA A O    7  
ATOM 11494 C CB   . ALA A 1 73  ? -13.644 -7.471  1.039   1.00 0.00 ? 73  ALA A CB   7  
ATOM 11495 H H    . ALA A 1 73  ? -12.952 -6.708  3.385   1.00 0.00 ? 73  ALA A H    7  
ATOM 11496 H HA   . ALA A 1 73  ? -12.195 -5.923  0.949   1.00 0.00 ? 73  ALA A HA   7  
ATOM 11497 H HB1  . ALA A 1 73  ? -14.662 -7.601  1.374   1.00 0.00 ? 73  ALA A HB1  7  
ATOM 11498 H HB2  . ALA A 1 73  ? -13.595 -7.615  -0.030  1.00 0.00 ? 73  ALA A HB2  7  
ATOM 11499 H HB3  . ALA A 1 73  ? -13.008 -8.192  1.529   1.00 0.00 ? 73  ALA A HB3  7  
ATOM 11500 N N    . PRO A 1 74  ? -13.893 -4.656  -0.471  1.00 0.00 ? 74  PRO A N    7  
ATOM 11501 C CA   . PRO A 1 74  ? -12.787 -5.202  -1.264  1.00 0.00 ? 74  PRO A CA   7  
ATOM 11502 C C    . PRO A 1 74  ? -11.427 -4.725  -0.768  1.00 0.00 ? 74  PRO A C    7  
ATOM 11503 O O    . PRO A 1 74  ? -10.388 -5.143  -1.280  1.00 0.00 ? 74  PRO A O    7  
ATOM 11504 C CB   . PRO A 1 74  ? -13.061 -4.666  -2.671  1.00 0.00 ? 74  PRO A CB   7  
ATOM 11505 C CG   . PRO A 1 74  ? -13.856 -3.424  -2.455  1.00 0.00 ? 74  PRO A CG   7  
ATOM 11506 C CD   . PRO A 1 74  ? -14.687 -3.673  -1.227  1.00 0.00 ? 74  PRO A CD   7  
ATOM 11507 H HA   . PRO A 1 74  ? -12.805 -6.282  -1.279  1.00 0.00 ? 74  PRO A HA   7  
ATOM 11508 H HB2  . PRO A 1 74  ? -12.124 -4.455  -3.168  1.00 0.00 ? 74  PRO A HB2  7  
ATOM 11509 H HB3  . PRO A 1 74  ? -13.618 -5.397  -3.237  1.00 0.00 ? 74  PRO A HB3  7  
ATOM 11510 H HG2  . PRO A 1 74  ? -13.194 -2.587  -2.297  1.00 0.00 ? 74  PRO A HG2  7  
ATOM 11511 H HG3  . PRO A 1 74  ? -14.494 -3.244  -3.308  1.00 0.00 ? 74  PRO A HG3  7  
ATOM 11512 H HD2  . PRO A 1 74  ? -14.809 -2.761  -0.663  1.00 0.00 ? 74  PRO A HD2  7  
ATOM 11513 H HD3  . PRO A 1 74  ? -15.649 -4.083  -1.498  1.00 0.00 ? 74  PRO A HD3  7  
ATOM 11514 N N    . GLN A 1 75  ? -11.440 -3.850  0.232   1.00 0.00