data_2RVE
# 
_entry.id   2RVE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2RVE         
RCSB  PDE002       
WWPDB D_1000178607 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2RVE 
_pdbx_database_status.recvd_initial_deposition_date   1991-03-19 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Winkler, F.K.'  1  
'Banner, D.W.'   2  
'Oefner, C.'     3  
'Tsernoglou, D.' 4  
'Brown, R.S.'    5  
'Heathman, S.P.' 6  
'Bryan, R.K.'    7  
'Martin, P.D.'   8  
'Petratos, K.'   9  
'Wilson, K.S.'   10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The crystal structure of EcoRV endonuclease and of its complexes with cognate and non-cognate DNA fragments.' 'EMBO J.'   
12  1781 1795 1993 EMJODG UK 0261-4189 0897 ? 8491171 ? 
1       'Crystallization of Complexes of EcoRV Endonuclease with Cognate and Non-Cognate DNA Fragments'                J.Mol.Biol. 
217 235  238  1991 JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Winkler, F.K.'  1  
primary 'Banner, D.W.'   2  
primary 'Oefner, C.'     3  
primary 'Tsernoglou, D.' 4  
primary 'Brown, R.S.'    5  
primary 'Heathman, S.P.' 6  
primary 'Bryan, R.K.'    7  
primary 'Martin, P.D.'   8  
primary 'Petratos, K.'   9  
primary 'Wilson, K.S.'   10 
1       'Winkler, F.K.'  11 
1       
;D'Arcy, A.
;
12 
1       'Bloecker, H.'   13 
1       'Frank, R.'      14 
1       'Van Boom, J.H.' 15 
# 
_cell.entry_id           2RVE 
_cell.length_a           68.500 
_cell.length_b           79.600 
_cell.length_c           66.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.60 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2RVE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
;
2427.605  4  ? ? ? ? 
2 polymer man 'PROTEIN (ECO RV (E.C.3.1.21.4))'        28559.158 2  ? ? ? ? 
3 water   nat water                                    18.015    68 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DA)(DG)(DC)(DT)(DC)(DG)' CGAGCTCG C,D,E,F ? 
2 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DG  n 
1 5   DC  n 
1 6   DT  n 
1 7   DC  n 
1 8   DG  n 
2 1   SER n 
2 2   LEU n 
2 3   ARG n 
2 4   SER n 
2 5   ASP n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  LEU n 
2 11  TYR n 
2 12  ASP n 
2 13  GLU n 
2 14  ASN n 
2 15  GLN n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  VAL n 
2 20  CYS n 
2 21  GLY n 
2 22  ILE n 
2 23  ILE n 
2 24  SER n 
2 25  ALA n 
2 26  GLU n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  TYR n 
2 31  PRO n 
2 32  LEU n 
2 33  GLY n 
2 34  SER n 
2 35  ASP n 
2 36  THR n 
2 37  LYS n 
2 38  VAL n 
2 39  LEU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  PHE n 
2 44  GLU n 
2 45  LEU n 
2 46  PHE n 
2 47  SER n 
2 48  ARG n 
2 49  PRO n 
2 50  ILE n 
2 51  ILE n 
2 52  ASN n 
2 53  LYS n 
2 54  ILE n 
2 55  ALA n 
2 56  GLU n 
2 57  LYS n 
2 58  HIS n 
2 59  GLY n 
2 60  TYR n 
2 61  ILE n 
2 62  VAL n 
2 63  GLU n 
2 64  GLU n 
2 65  PRO n 
2 66  LYS n 
2 67  GLN n 
2 68  GLN n 
2 69  ASN n 
2 70  HIS n 
2 71  TYR n 
2 72  PRO n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  LYS n 
2 79  PRO n 
2 80  SER n 
2 81  GLU n 
2 82  PRO n 
2 83  ASN n 
2 84  LYS n 
2 85  LYS n 
2 86  ILE n 
2 87  ALA n 
2 88  ILE n 
2 89  ASP n 
2 90  ILE n 
2 91  LYS n 
2 92  THR n 
2 93  THR n 
2 94  TYR n 
2 95  THR n 
2 96  ASN n 
2 97  LYS n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 LYS n 
2 102 ILE n 
2 103 LYS n 
2 104 PHE n 
2 105 THR n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 TYR n 
2 110 THR n 
2 111 SER n 
2 112 PHE n 
2 113 ILE n 
2 114 ARG n 
2 115 ASN n 
2 116 ASN n 
2 117 THR n 
2 118 LYS n 
2 119 ASN n 
2 120 ILE n 
2 121 VAL n 
2 122 TYR n 
2 123 PRO n 
2 124 PHE n 
2 125 ASP n 
2 126 GLN n 
2 127 TYR n 
2 128 ILE n 
2 129 ALA n 
2 130 HIS n 
2 131 TRP n 
2 132 ILE n 
2 133 ILE n 
2 134 GLY n 
2 135 TYR n 
2 136 VAL n 
2 137 TYR n 
2 138 THR n 
2 139 ARG n 
2 140 VAL n 
2 141 ALA n 
2 142 THR n 
2 143 ARG n 
2 144 LYS n 
2 145 SER n 
2 146 SER n 
2 147 LEU n 
2 148 LYS n 
2 149 THR n 
2 150 TYR n 
2 151 ASN n 
2 152 ILE n 
2 153 ASN n 
2 154 GLU n 
2 155 LEU n 
2 156 ASN n 
2 157 GLU n 
2 158 ILE n 
2 159 PRO n 
2 160 LYS n 
2 161 PRO n 
2 162 TYR n 
2 163 LYS n 
2 164 GLY n 
2 165 VAL n 
2 166 LYS n 
2 167 VAL n 
2 168 PHE n 
2 169 LEU n 
2 170 GLN n 
2 171 ASP n 
2 172 LYS n 
2 173 TRP n 
2 174 VAL n 
2 175 ILE n 
2 176 ALA n 
2 177 GLY n 
2 178 ASP n 
2 179 LEU n 
2 180 ALA n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 THR n 
2 186 THR n 
2 187 ASN n 
2 188 ILE n 
2 189 GLY n 
2 190 SER n 
2 191 ILE n 
2 192 HIS n 
2 193 ALA n 
2 194 HIS n 
2 195 TYR n 
2 196 LYS n 
2 197 ASP n 
2 198 PHE n 
2 199 VAL n 
2 200 GLU n 
2 201 GLY n 
2 202 LYS n 
2 203 GLY n 
2 204 ILE n 
2 205 PHE n 
2 206 ASP n 
2 207 SER n 
2 208 GLU n 
2 209 ASP n 
2 210 GLU n 
2 211 PHE n 
2 212 LEU n 
2 213 ASP n 
2 214 TYR n 
2 215 TRP n 
2 216 ARG n 
2 217 ASN n 
2 218 TYR n 
2 219 GLU n 
2 220 ARG n 
2 221 THR n 
2 222 SER n 
2 223 GLN n 
2 224 LEU n 
2 225 ARG n 
2 226 ASN n 
2 227 ASP n 
2 228 LYS n 
2 229 TYR n 
2 230 ASN n 
2 231 ASN n 
2 232 ILE n 
2 233 SER n 
2 234 GLU n 
2 235 TYR n 
2 236 ARG n 
2 237 ASN n 
2 238 TRP n 
2 239 ILE n 
2 240 TYR n 
2 241 ARG n 
2 242 GLY n 
2 243 ARG n 
2 244 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 T2E5_ECOLI UNP 2 P04390 ? ? ? 
2 2RVE       PDB 1 2RVE   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2RVE A 1 ? 244 ? P04390 1 ? 244 ? 2 245 
2 1 2RVE B 1 ? 244 ? P04390 1 ? 244 ? 2 245 
3 2 2RVE C 1 ? 8   ? 2RVE   1 ? 8   ? 1 8   
4 2 2RVE D 1 ? 8   ? 2RVE   1 ? 8   ? 1 8   
5 2 2RVE E 1 ? 8   ? 2RVE   1 ? 8   ? 1 8   
6 2 2RVE F 1 ? 8   ? 2RVE   1 ? 8   ? 1 8   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2RVE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.75 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    'ROOM TEMPERATURE' 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    'pH 6.00, VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 WATER      ? ? ? 
1 2 1 'PEG 4000' ? ? ? 
1 3 1 NACL       ? ? ? 
1 4 2 WATER      ? ? ? 
1 5 2 MES        ? ? ? 
1 6 2 NACL       ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS-NICOLET X100' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ELLIOTT GX-21' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2RVE 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   12143 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2RVE 
_refine.ls_number_reflns_obs                     11127 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.000 
_refine.ls_d_res_high                            3.000 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1780000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE FOLLOWING PROTEIN SIDE CHAINS HAVE NO OR POORLY DEFINED
DENSITY BUT HAVE NOT BEEN EXCLUDED FROM THIS ENTRY:
     A CHAIN:  ASP 19, SER 35, LYS 67, LYS 85, LYS 98,
               LYS 197, LYS 203, ASN 231
     B CHAIN:  GLU 27, LYS 85, LYS 164
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3528 
_refine_hist.pdbx_number_atoms_nucleic_acid   644 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             68 
_refine_hist.number_atoms_total               4240 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        6.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.740 ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2RVE 
_struct.title                     
'THE CRYSTAL STRUCTURE OF ECORV ENDONUCLEASE AND OF ITS COMPLEXES WITH COGNATE AND NON-COGNATE DNA SEGMENTS' 
_struct.pdbx_descriptor           'ECO RV (E.C.3.1.21.4)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RVE 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, DOUBLE HELIX, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER E 1   ? TYR E 11  ? SER A 2   TYR A 12  1 ? 11 
HELX_P HELX_P2  2  LYS E 37  ? PHE E 46  ? LYS A 38  PHE A 47  1 ? 10 
HELX_P HELX_P3  3  PHE E 46  ? LYS E 57  ? PHE A 47  LYS A 58  1 ? 12 
HELX_P HELX_P4  4  SER E 111 ? ASN E 116 ? SER A 112 ASN A 117 1 ? 6  
HELX_P HELX_P5  5  PRO E 123 ? ASP E 125 ? PRO A 124 ASP A 126 5 ? 3  
HELX_P HELX_P6  6  ASN E 153 ? ILE E 158 ? ASN A 154 ILE A 159 5 ? 6  
HELX_P HELX_P7  7  LYS E 172 ? ILE E 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P8  8  HIS E 194 ? GLY E 201 ? HIS A 195 GLY A 202 1 ? 8  
HELX_P HELX_P9  9  SER E 207 ? ASN E 217 ? SER A 208 ASN A 218 1 ? 11 
HELX_P HELX_P10 10 ASN E 231 ? TRP E 238 ? ASN A 232 TRP A 239 1 ? 8  
HELX_P HELX_P11 11 SER F 1   ? TYR F 11  ? SER B 2   TYR B 12  1 ? 11 
HELX_P HELX_P12 12 ASP F 35  ? HIS F 58  ? ASP B 36  HIS B 59  1 ? 24 
HELX_P HELX_P13 13 PRO F 123 ? ASP F 125 ? PRO B 124 ASP B 126 5 ? 3  
HELX_P HELX_P14 14 ASN F 153 ? ILE F 158 ? ASN B 154 ILE B 159 5 ? 6  
HELX_P HELX_P15 15 LYS F 172 ? ALA F 176 ? LYS B 173 ALA B 177 1 ? 5  
HELX_P HELX_P16 16 HIS F 194 ? GLY F 201 ? HIS B 195 GLY B 202 1 ? 8  
HELX_P HELX_P17 17 SER F 207 ? TYR F 218 ? SER B 208 TYR B 219 1 ? 12 
HELX_P HELX_P18 18 ASN F 231 ? ILE F 239 ? ASN B 232 ILE B 240 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 1 N3 ? ? ? 1_555 B DG 8 N1 ? ? C DC 1 D DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 1 N4 ? ? ? 1_555 B DG 8 O6 ? ? C DC 1 D DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 1 O2 ? ? ? 1_555 B DG 8 N2 ? ? C DC 1 D DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 2 N1 ? ? ? 1_555 B DC 7 N3 ? ? C DG 2 D DC 7 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog5  hydrog ? ? A DA 3 N1 ? ? ? 1_555 B DT 6 N3 ? ? C DA 3 D DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DA 3 N6 ? ? ? 1_555 B DT 6 O4 ? ? C DA 3 D DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4 N1 ? ? ? 1_555 B DC 5 N3 ? ? C DG 4 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4 N2 ? ? ? 1_555 B DC 5 O2 ? ? C DG 4 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4 O6 ? ? ? 1_555 B DC 5 N4 ? ? C DG 4 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 5 N3 ? ? ? 1_555 B DG 4 N1 ? ? C DC 5 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5 N4 ? ? ? 1_555 B DG 4 O6 ? ? C DC 5 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DC 5 O2 ? ? ? 1_555 B DG 4 N2 ? ? C DC 5 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6 N3 ? ? ? 1_555 B DA 3 N1 ? ? C DT 6 D DA 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6 O4 ? ? ? 1_555 B DA 3 N6 ? ? C DT 6 D DA 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 7 N3 ? ? ? 1_555 B DG 2 N1 ? ? C DC 7 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 7 N4 ? ? ? 1_555 B DG 2 O6 ? ? C DC 7 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 7 O2 ? ? ? 1_555 B DG 2 N2 ? ? C DC 7 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8 N1 ? ? ? 1_555 B DC 1 N3 ? ? C DG 8 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8 N2 ? ? ? 1_555 B DC 1 O2 ? ? C DG 8 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 8 O6 ? ? ? 1_555 B DC 1 N4 ? ? C DG 8 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DC 1 N3 ? ? ? 1_555 D DG 8 N1 ? ? E DC 1 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DC 1 N4 ? ? ? 1_555 D DG 8 O6 ? ? E DC 1 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DC 1 O2 ? ? ? 1_555 D DG 8 N2 ? ? E DC 1 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DG 2 N1 ? ? ? 1_555 D DC 7 N3 ? ? E DG 2 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DG 2 N2 ? ? ? 1_555 D DC 7 O2 ? ? E DG 2 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DG 2 O6 ? ? ? 1_555 D DC 7 N4 ? ? E DG 2 F DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DA 3 N1 ? ? ? 1_555 D DT 6 N3 ? ? E DA 3 F DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DA 3 N6 ? ? ? 1_555 D DT 6 O4 ? ? E DA 3 F DT 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DG 4 N1 ? ? ? 1_555 D DC 5 N3 ? ? E DG 4 F DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DG 4 N2 ? ? ? 1_555 D DC 5 O2 ? ? E DG 4 F DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DG 4 O6 ? ? ? 1_555 D DC 5 N4 ? ? E DG 4 F DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DC 5 N3 ? ? ? 1_555 D DG 4 N1 ? ? E DC 5 F DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DC 5 N4 ? ? ? 1_555 D DG 4 O6 ? ? E DC 5 F DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DC 5 O2 ? ? ? 1_555 D DG 4 N2 ? ? E DC 5 F DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DT 6 N3 ? ? ? 1_555 D DA 3 N1 ? ? E DT 6 F DA 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DT 6 O4 ? ? ? 1_555 D DA 3 N6 ? ? E DT 6 F DA 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DC 7 N3 ? ? ? 1_555 D DG 2 N1 ? ? E DC 7 F DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DC 7 N4 ? ? ? 1_555 D DG 2 O6 ? ? E DC 7 F DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DC 7 O2 ? ? ? 1_555 D DG 2 N2 ? ? E DC 7 F DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DG 8 N1 ? ? ? 1_555 D DC 1 N3 ? ? E DG 8 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C DG 8 N2 ? ? ? 1_555 D DC 1 O2 ? ? E DG 8 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DG 8 O6 ? ? ? 1_555 D DC 1 N4 ? ? E DG 8 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 E . ? TYR 72 A PRO 72 E ? PRO 73 A 1 -0.28 
2 TYR 71 F . ? TYR 72 B PRO 72 F ? PRO 73 B 1 2.61  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 3 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 29  ? PRO E 31  ? ILE A 30  PRO A 32  
A 2 VAL E 19  ? ILE E 23  ? VAL A 20  ILE A 24  
A 3 ILE F 22  ? SER F 24  ? ILE B 23  SER B 25  
A 4 LYS F 28  ? TYR F 30  ? LYS B 29  TYR B 31  
A 5 TYR F 150 ? ASN F 151 ? TYR B 151 ASN B 152 
B 1 ILE E 61  ? GLU E 63  ? ILE A 62  GLU A 64  
B 2 PHE E 74  ? LYS E 78  ? PHE A 75  LYS A 79  
B 3 GLU E 81  ? THR E 95  ? GLU A 82  THR A 96  
B 4 TYR E 127 ? THR E 138 ? TYR A 128 THR A 139 
B 5 LYS E 163 ? ASP E 171 ? LYS A 164 ASP A 172 
C 1 THR E 105 ? GLY E 108 ? THR A 106 GLY A 109 
C 2 ASN E 187 ? SER E 190 ? ASN A 188 SER A 191 
C 3 ALA E 176 ? ALA E 180 ? ALA A 177 ALA A 181 
D 1 ILE F 61  ? GLU F 63  ? ILE B 62  GLU B 64  
D 2 PHE F 74  ? TYR F 77  ? PHE B 75  TYR B 78  
D 3 LYS F 85  ? THR F 95  ? LYS B 86  THR B 96  
D 4 TYR F 127 ? THR F 138 ? TYR B 128 THR B 139 
D 5 LYS F 166 ? ASP F 171 ? LYS B 167 ASP B 172 
E 1 THR F 105 ? GLY F 108 ? THR B 106 GLY B 109 
E 2 ASN F 187 ? GLY F 189 ? ASN B 188 GLY B 190 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR E 30  ? N TYR A 31  O ILE E 22  ? O ILE A 23  
A 2 3 N CYS E 20  ? N CYS A 21  O ILE F 23  ? O ILE B 24  
A 3 4 N SER F 24  ? N SER B 25  O LYS F 28  ? O LYS B 29  
A 4 5 O ILE F 29  ? O ILE B 30  N TYR F 150 ? N TYR B 151 
B 1 2 N GLU E 63  ? N GLU A 64  O THR E 75  ? O THR A 76  
B 2 3 O LYS E 78  ? O LYS A 79  N GLU E 81  ? N GLU A 82  
B 3 4 O LYS E 85  ? O LYS A 86  N ILE E 128 ? N ILE A 129 
B 4 5 O THR E 138 ? O THR A 139 N LYS E 163 ? N LYS A 164 
C 1 2 O GLY E 107 ? O GLY A 108 N ILE E 188 ? N ILE A 189 
C 2 3 O GLY E 189 ? O GLY A 190 N GLY E 177 ? N GLY A 178 
D 1 2 N GLU F 63  ? N GLU B 64  O THR F 75  ? O THR B 76  
D 2 3 N LEU F 76  ? N LEU B 77  O ILE F 86  ? O ILE B 87  
D 3 4 O LYS F 85  ? O LYS B 86  N ILE F 128 ? N ILE B 129 
D 4 5 O VAL F 136 ? O VAL B 137 N LYS F 166 ? N LYS B 167 
E 1 2 N LEU F 106 ? N LEU B 107 O ILE F 188 ? O ILE B 189 
# 
_database_PDB_matrix.entry_id          2RVE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2RVE 
_atom_sites.fract_transf_matrix[1][1]   0.014599 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003803 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012563 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015563 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 19.115  13.230  15.216  1.00 25.89 ? 1   DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 18.340  14.272  15.776  1.00 23.88 ? 1   DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 17.084  13.667  16.341  1.00 21.62 ? 1   DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 16.449  12.919  15.274  1.00 20.16 ? 1   DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 17.369  12.696  17.466  1.00 21.22 ? 1   DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 16.828  13.142  18.656  1.00 23.48 ? 1   DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 16.681  11.407  17.081  1.00 20.16 ? 1   DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 16.183  11.606  15.666  1.00 17.58 ? 1   DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 16.837  10.674  14.753  1.00 10.80 ? 1   DC  C N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 16.051  9.528   14.670  1.00 10.96 ? 1   DC  C C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 14.968  9.456   15.306  1.00 13.79 ? 1   DC  C O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 16.474  8.525   13.905  1.00 9.10  ? 1   DC  C N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 17.620  8.645   13.262  1.00 9.25  ? 1   DC  C C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 18.015  7.618   12.503  1.00 10.45 ? 1   DC  C N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 18.424  9.799   13.358  1.00 8.05  ? 1   DC  C C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 17.995  10.778  14.117  1.00 7.42  ? 1   DC  C C6    1 
ATOM   17   P P     . DG  A 1 2   ? 17.407  12.473  19.993  1.00 26.29 ? 2   DG  C P     1 
ATOM   18   O OP1   . DG  A 1 2   ? 17.073  13.413  21.073  1.00 28.88 ? 2   DG  C OP1   1 
ATOM   19   O OP2   . DG  A 1 2   ? 18.816  12.131  19.735  1.00 29.81 ? 2   DG  C OP2   1 
ATOM   20   O "O5'" . DG  A 1 2   ? 16.583  11.112  20.211  1.00 23.70 ? 2   DG  C "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 2   ? 15.204  11.216  20.565  1.00 22.74 ? 2   DG  C "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 2   ? 14.560  9.854   20.565  1.00 22.37 ? 2   DG  C "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 2   ? 14.848  9.210   19.292  1.00 22.08 ? 2   DG  C "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 2   ? 15.151  8.947   21.619  1.00 23.98 ? 2   DG  C "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 2   ? 14.214  7.960   22.037  1.00 28.44 ? 2   DG  C "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 2   ? 16.285  8.302   20.860  1.00 22.02 ? 2   DG  C "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 2   ? 15.559  8.024   19.562  1.00 20.11 ? 2   DG  C "C1'" 1 
ATOM   28   N N9    . DG  A 1 2   ? 16.467  7.681   18.488  1.00 15.05 ? 2   DG  C N9    1 
ATOM   29   C C8    . DG  A 1 2   ? 17.555  8.390   18.096  1.00 14.91 ? 2   DG  C C8    1 
ATOM   30   N N7    . DG  A 1 2   ? 18.222  7.825   17.132  1.00 15.30 ? 2   DG  C N7    1 
ATOM   31   C C5    . DG  A 1 2   ? 17.537  6.639   16.894  1.00 13.56 ? 2   DG  C C5    1 
ATOM   32   C C6    . DG  A 1 2   ? 17.799  5.612   15.962  1.00 12.33 ? 2   DG  C C6    1 
ATOM   33   O O6    . DG  A 1 2   ? 18.714  5.532   15.126  1.00 11.55 ? 2   DG  C O6    1 
ATOM   34   N N1    . DG  A 1 2   ? 16.854  4.617   16.039  1.00 12.73 ? 2   DG  C N1    1 
ATOM   35   C C2    . DG  A 1 2   ? 15.796  4.609   16.901  1.00 13.98 ? 2   DG  C C2    1 
ATOM   36   N N2    . DG  A 1 2   ? 14.999  3.550   16.804  1.00 16.01 ? 2   DG  C N2    1 
ATOM   37   N N3    . DG  A 1 2   ? 15.529  5.564   17.801  1.00 12.44 ? 2   DG  C N3    1 
ATOM   38   C C4    . DG  A 1 2   ? 16.449  6.543   17.736  1.00 13.03 ? 2   DG  C C4    1 
ATOM   39   P P     . DA  A 1 3   ? 14.502  7.220   23.438  1.00 33.76 ? 3   DA  C P     1 
ATOM   40   O OP1   . DA  A 1 3   ? 13.401  7.634   24.332  1.00 35.99 ? 3   DA  C OP1   1 
ATOM   41   O OP2   . DA  A 1 3   ? 15.923  7.466   23.798  1.00 36.07 ? 3   DA  C OP2   1 
ATOM   42   O "O5'" . DA  A 1 3   ? 14.387  5.660   23.194  1.00 30.44 ? 3   DA  C "O5'" 1 
ATOM   43   C "C5'" . DA  A 1 3   ? 13.307  5.094   22.551  1.00 27.60 ? 3   DA  C "C5'" 1 
ATOM   44   C "C4'" . DA  A 1 3   ? 13.731  3.725   22.101  1.00 25.15 ? 3   DA  C "C4'" 1 
ATOM   45   O "O4'" . DA  A 1 3   ? 14.739  3.821   21.040  1.00 23.71 ? 3   DA  C "O4'" 1 
ATOM   46   C "C3'" . DA  A 1 3   ? 14.379  2.929   23.200  1.00 23.67 ? 3   DA  C "C3'" 1 
ATOM   47   O "O3'" . DA  A 1 3   ? 14.011  1.624   23.059  1.00 26.42 ? 3   DA  C "O3'" 1 
ATOM   48   C "C2'" . DA  A 1 3   ? 15.856  3.081   22.892  1.00 21.50 ? 3   DA  C "C2'" 1 
ATOM   49   C "C1'" . DA  A 1 3   ? 15.844  3.033   21.375  1.00 20.42 ? 3   DA  C "C1'" 1 
ATOM   50   N N9    . DA  A 1 3   ? 17.018  3.646   20.758  1.00 18.58 ? 3   DA  C N9    1 
ATOM   51   C C8    . DA  A 1 3   ? 17.728  4.800   20.976  1.00 18.94 ? 3   DA  C C8    1 
ATOM   52   N N7    . DA  A 1 3   ? 18.736  4.967   20.153  1.00 17.79 ? 3   DA  C N7    1 
ATOM   53   C C5    . DA  A 1 3   ? 18.693  3.845   19.337  1.00 16.33 ? 3   DA  C C5    1 
ATOM   54   C C6    . DA  A 1 3   ? 19.493  3.423   18.257  1.00 14.39 ? 3   DA  C C6    1 
ATOM   55   N N6    . DA  A 1 3   ? 20.529  4.083   17.801  1.00 14.38 ? 3   DA  C N6    1 
ATOM   56   N N1    . DA  A 1 3   ? 19.189  2.292   17.659  1.00 14.88 ? 3   DA  C N1    1 
ATOM   57   C C2    . DA  A 1 3   ? 18.148  1.624   18.109  1.00 17.37 ? 3   DA  C C2    1 
ATOM   58   N N3    . DA  A 1 3   ? 17.318  1.902   19.118  1.00 18.72 ? 3   DA  C N3    1 
ATOM   59   C C4    . DA  A 1 3   ? 17.648  3.041   19.697  1.00 17.56 ? 3   DA  C C4    1 
ATOM   60   P P     . DG  A 1 4   ? 13.836  0.708   24.345  1.00 28.78 ? 4   DG  C P     1 
ATOM   61   O OP1   . DG  A 1 4   ? 12.378  0.732   24.711  1.00 27.42 ? 4   DG  C OP1   1 
ATOM   62   O OP2   . DG  A 1 4   ? 14.922  1.114   25.283  1.00 31.18 ? 4   DG  C OP2   1 
ATOM   63   O "O5'" . DG  A 1 4   ? 14.190  -0.740  23.824  1.00 25.30 ? 4   DG  C "O5'" 1 
ATOM   64   C "C5'" . DG  A 1 4   ? 13.480  -1.313  22.808  1.00 24.06 ? 4   DG  C "C5'" 1 
ATOM   65   C "C4'" . DG  A 1 4   ? 14.405  -2.285  22.172  1.00 25.51 ? 4   DG  C "C4'" 1 
ATOM   66   O "O4'" . DG  A 1 4   ? 15.519  -1.552  21.625  1.00 27.26 ? 4   DG  C "O4'" 1 
ATOM   67   C "C3'" . DG  A 1 4   ? 14.991  -3.280  23.136  1.00 26.25 ? 4   DG  C "C3'" 1 
ATOM   68   O "O3'" . DG  A 1 4   ? 14.684  -4.553  22.628  1.00 28.55 ? 4   DG  C "O3'" 1 
ATOM   69   C "C2'" . DG  A 1 4   ? 16.495  -2.945  23.200  1.00 26.88 ? 4   DG  C "C2'" 1 
ATOM   70   C "C1'" . DG  A 1 4   ? 16.732  -2.229  21.889  1.00 26.78 ? 4   DG  C "C1'" 1 
ATOM   71   N N9    . DG  A 1 4   ? 17.771  -1.194  21.818  1.00 23.98 ? 4   DG  C N9    1 
ATOM   72   C C8    . DG  A 1 4   ? 17.802  -0.080  22.596  1.00 23.84 ? 4   DG  C C8    1 
ATOM   73   N N7    . DG  A 1 4   ? 18.761  0.748   22.281  1.00 23.59 ? 4   DG  C N7    1 
ATOM   74   C C5    . DG  A 1 4   ? 19.388  0.151   21.208  1.00 23.13 ? 4   DG  C C5    1 
ATOM   75   C C6    . DG  A 1 4   ? 20.497  0.589   20.443  1.00 24.93 ? 4   DG  C C6    1 
ATOM   76   O O6    . DG  A 1 4   ? 21.152  1.624   20.584  1.00 26.51 ? 4   DG  C O6    1 
ATOM   77   N N1    . DG  A 1 4   ? 20.840  -0.318  19.433  1.00 24.86 ? 4   DG  C N1    1 
ATOM   78   C C2    . DG  A 1 4   ? 20.167  -1.496  19.202  1.00 24.05 ? 4   DG  C C2    1 
ATOM   79   N N2    . DG  A 1 4   ? 20.618  -2.245  18.199  1.00 22.74 ? 4   DG  C N2    1 
ATOM   80   N N3    . DG  A 1 4   ? 19.117  -1.910  19.922  1.00 24.10 ? 4   DG  C N3    1 
ATOM   81   C C4    . DG  A 1 4   ? 18.789  -1.043  20.899  1.00 22.88 ? 4   DG  C C4    1 
ATOM   82   P P     . DC  A 1 5   ? 15.177  -5.946  23.213  1.00 30.98 ? 5   DC  C P     1 
ATOM   83   O OP1   . DC  A 1 5   ? 14.270  -7.013  22.693  1.00 29.36 ? 5   DC  C OP1   1 
ATOM   84   O OP2   . DC  A 1 5   ? 15.363  -5.803  24.666  1.00 33.91 ? 5   DC  C OP2   1 
ATOM   85   O "O5'" . DC  A 1 5   ? 16.605  -6.097  22.513  1.00 30.05 ? 5   DC  C "O5'" 1 
ATOM   86   C "C5'" . DC  A 1 5   ? 16.642  -5.978  21.124  1.00 30.40 ? 5   DC  C "C5'" 1 
ATOM   87   C "C4'" . DC  A 1 5   ? 18.056  -6.137  20.635  1.00 32.48 ? 5   DC  C "C4'" 1 
ATOM   88   O "O4'" . DC  A 1 5   ? 18.784  -4.919  20.893  1.00 30.87 ? 5   DC  C "O4'" 1 
ATOM   89   C "C3'" . DC  A 1 5   ? 18.864  -7.267  21.298  1.00 34.93 ? 5   DC  C "C3'" 1 
ATOM   90   O "O3'" . DC  A 1 5   ? 19.399  -8.135  20.263  1.00 42.33 ? 5   DC  C "O3'" 1 
ATOM   91   C "C2'" . DC  A 1 5   ? 19.977  -6.503  22.056  1.00 29.77 ? 5   DC  C "C2'" 1 
ATOM   92   C "C1'" . DC  A 1 5   ? 20.097  -5.246  21.220  1.00 26.07 ? 5   DC  C "C1'" 1 
ATOM   93   N N1    . DC  A 1 5   ? 20.664  -4.099  21.889  1.00 18.84 ? 5   DC  C N1    1 
ATOM   94   C C2    . DC  A 1 5   ? 21.859  -3.542  21.400  1.00 18.30 ? 5   DC  C C2    1 
ATOM   95   O O2    . DC  A 1 5   ? 22.391  -4.060  20.430  1.00 20.01 ? 5   DC  C O2    1 
ATOM   96   N N3    . DC  A 1 5   ? 22.410  -2.460  21.998  1.00 16.31 ? 5   DC  C N3    1 
ATOM   97   C C4    . DC  A 1 5   ? 21.782  -1.918  23.046  1.00 16.52 ? 5   DC  C C4    1 
ATOM   98   N N4    . DC  A 1 5   ? 22.354  -0.852  23.644  1.00 14.93 ? 5   DC  C N4    1 
ATOM   99   C C5    . DC  A 1 5   ? 20.529  -2.468  23.548  1.00 16.70 ? 5   DC  C C5    1 
ATOM   100  C C6    . DC  A 1 5   ? 20.014  -3.550  22.943  1.00 16.25 ? 5   DC  C C6    1 
ATOM   101  P P     . DT  A 1 6   ? 20.073  -9.552  20.623  1.00 48.27 ? 6   DT  C P     1 
ATOM   102  O OP1   . DT  A 1 6   ? 19.460  -10.579 19.761  1.00 48.94 ? 6   DT  C OP1   1 
ATOM   103  O OP2   . DT  A 1 6   ? 20.025  -9.679  22.108  1.00 49.48 ? 6   DT  C OP2   1 
ATOM   104  O "O5'" . DT  A 1 6   ? 21.607  -9.409  20.147  1.00 49.68 ? 6   DT  C "O5'" 1 
ATOM   105  C "C5'" . DT  A 1 6   ? 21.927  -8.605  19.016  1.00 49.80 ? 6   DT  C "C5'" 1 
ATOM   106  C "C4'" . DT  A 1 6   ? 23.437  -8.366  18.900  1.00 50.42 ? 6   DT  C "C4'" 1 
ATOM   107  O "O4'" . DT  A 1 6   ? 23.833  -7.148  19.594  1.00 48.27 ? 6   DT  C "O4'" 1 
ATOM   108  C "C3'" . DT  A 1 6   ? 24.337  -9.441  19.498  1.00 52.74 ? 6   DT  C "C3'" 1 
ATOM   109  O "O3'" . DT  A 1 6   ? 25.587  -9.409  18.797  1.00 57.70 ? 6   DT  C "O3'" 1 
ATOM   110  C "C2'" . DT  A 1 6   ? 24.533  -8.931  20.912  1.00 49.30 ? 6   DT  C "C2'" 1 
ATOM   111  C "C1'" . DT  A 1 6   ? 24.793  -7.466  20.597  1.00 45.93 ? 6   DT  C "C1'" 1 
ATOM   112  N N1    . DT  A 1 6   ? 24.569  -6.551  21.728  1.00 40.32 ? 6   DT  C N1    1 
ATOM   113  C C2    . DT  A 1 6   ? 25.365  -5.421  21.748  1.00 39.10 ? 6   DT  C C2    1 
ATOM   114  O O2    . DT  A 1 6   ? 26.237  -5.214  20.918  1.00 39.82 ? 6   DT  C O2    1 
ATOM   115  N N3    . DT  A 1 6   ? 25.135  -4.553  22.770  1.00 37.07 ? 6   DT  C N3    1 
ATOM   116  C C4    . DT  A 1 6   ? 24.180  -4.712  23.760  1.00 36.16 ? 6   DT  C C4    1 
ATOM   117  O O4    . DT  A 1 6   ? 24.094  -3.845  24.621  1.00 35.99 ? 6   DT  C O4    1 
ATOM   118  C C5    . DT  A 1 6   ? 23.378  -5.922  23.657  1.00 35.50 ? 6   DT  C C5    1 
ATOM   119  C C7    . DT  A 1 6   ? 22.307  -6.209  24.673  1.00 35.55 ? 6   DT  C C7    1 
ATOM   120  C C6    . DT  A 1 6   ? 23.593  -6.766  22.667  1.00 36.84 ? 6   DT  C C6    1 
ATOM   121  P P     . DC  A 1 7   ? 26.172  -10.738 18.096  1.00 60.00 ? 7   DC  C P     1 
ATOM   122  O OP1   . DC  A 1 7   ? 25.836  -10.627 16.643  1.00 60.00 ? 7   DC  C OP1   1 
ATOM   123  O OP2   . DC  A 1 7   ? 25.761  -11.916 18.945  1.00 59.26 ? 7   DC  C OP2   1 
ATOM   124  O "O5'" . DC  A 1 7   ? 27.749  -10.531 18.199  1.00 58.15 ? 7   DC  C "O5'" 1 
ATOM   125  C "C5'" . DC  A 1 7   ? 28.303  -9.257  17.884  1.00 55.20 ? 7   DC  C "C5'" 1 
ATOM   126  C "C4'" . DC  A 1 7   ? 29.519  -9.019  18.746  1.00 52.21 ? 7   DC  C "C4'" 1 
ATOM   127  O "O4'" . DC  A 1 7   ? 29.136  -8.318  19.960  1.00 49.00 ? 7   DC  C "O4'" 1 
ATOM   128  C "C3'" . DC  A 1 7   ? 30.188  -10.300 19.228  1.00 51.20 ? 7   DC  C "C3'" 1 
ATOM   129  O "O3'" . DC  A 1 7   ? 31.547  -10.069 19.350  1.00 53.17 ? 7   DC  C "O3'" 1 
ATOM   130  C "C2'" . DC  A 1 7   ? 29.562  -10.507 20.590  1.00 47.87 ? 7   DC  C "C2'" 1 
ATOM   131  C "C1'" . DC  A 1 7   ? 29.538  -9.074  21.079  1.00 44.13 ? 7   DC  C "C1'" 1 
ATOM   132  N N1    . DC  A 1 7   ? 28.598  -8.852  22.120  1.00 37.47 ? 7   DC  C N1    1 
ATOM   133  C C2    . DC  A 1 7   ? 28.796  -7.642  22.757  1.00 35.98 ? 7   DC  C C2    1 
ATOM   134  O O2    . DC  A 1 7   ? 29.716  -6.933  22.378  1.00 37.71 ? 7   DC  C O2    1 
ATOM   135  N N3    . DC  A 1 7   ? 27.979  -7.267  23.773  1.00 33.66 ? 7   DC  C N3    1 
ATOM   136  C C4    . DC  A 1 7   ? 27.000  -8.095  24.139  1.00 33.67 ? 7   DC  C C4    1 
ATOM   137  N N4    . DC  A 1 7   ? 26.210  -7.721  25.155  1.00 32.72 ? 7   DC  C N4    1 
ATOM   138  C C5    . DC  A 1 7   ? 26.786  -9.353  23.483  1.00 34.40 ? 7   DC  C C5    1 
ATOM   139  C C6    . DC  A 1 7   ? 27.607  -9.679  22.480  1.00 35.50 ? 7   DC  C C6    1 
ATOM   140  P P     . DG  A 1 8   ? 32.510  -10.754 18.302  1.00 53.55 ? 8   DG  C P     1 
ATOM   141  O OP1   . DG  A 1 8   ? 31.774  -10.786 17.016  1.00 55.10 ? 8   DG  C OP1   1 
ATOM   142  O OP2   . DG  A 1 8   ? 32.991  -12.020 18.906  1.00 55.76 ? 8   DG  C OP2   1 
ATOM   143  O "O5'" . DG  A 1 8   ? 33.719  -9.703  18.212  1.00 45.61 ? 8   DG  C "O5'" 1 
ATOM   144  C "C5'" . DG  A 1 8   ? 33.436  -8.366  18.431  1.00 40.08 ? 8   DG  C "C5'" 1 
ATOM   145  C "C4'" . DG  A 1 8   ? 34.124  -7.888  19.690  1.00 37.68 ? 8   DG  C "C4'" 1 
ATOM   146  O "O4'" . DG  A 1 8   ? 33.184  -7.833  20.783  1.00 36.93 ? 8   DG  C "O4'" 1 
ATOM   147  C "C3'" . DG  A 1 8   ? 35.299  -8.732  20.179  1.00 37.20 ? 8   DG  C "C3'" 1 
ATOM   148  O "O3'" . DG  A 1 8   ? 36.411  -7.849  20.488  1.00 36.62 ? 8   DG  C "O3'" 1 
ATOM   149  C "C2'" . DG  A 1 8   ? 34.746  -9.401  21.445  1.00 36.94 ? 8   DG  C "C2'" 1 
ATOM   150  C "C1'" . DG  A 1 8   ? 33.826  -8.286  21.953  1.00 35.43 ? 8   DG  C "C1'" 1 
ATOM   151  N N9    . DG  A 1 8   ? 32.793  -8.700  22.905  1.00 32.16 ? 8   DG  C N9    1 
ATOM   152  C C8    . DG  A 1 8   ? 32.171  -9.894  22.738  1.00 32.79 ? 8   DG  C C8    1 
ATOM   153  N N7    . DG  A 1 8   ? 31.247  -10.117 23.638  1.00 32.88 ? 8   DG  C N7    1 
ATOM   154  C C5    . DG  A 1 8   ? 31.258  -8.995  24.441  1.00 30.11 ? 8   DG  C C5    1 
ATOM   155  C C6    . DG  A 1 8   ? 30.453  -8.676  25.566  1.00 28.31 ? 8   DG  C C6    1 
ATOM   156  O O6    . DG  A 1 8   ? 29.560  -9.377  26.106  1.00 28.87 ? 8   DG  C O6    1 
ATOM   157  N N1    . DG  A 1 8   ? 30.774  -7.427  26.074  1.00 25.43 ? 8   DG  C N1    1 
ATOM   158  C C2    . DG  A 1 8   ? 31.748  -6.615  25.566  1.00 26.06 ? 8   DG  C C2    1 
ATOM   159  N N2    . DG  A 1 8   ? 31.916  -5.476  26.190  1.00 27.51 ? 8   DG  C N2    1 
ATOM   160  N N3    . DG  A 1 8   ? 32.502  -6.901  24.505  1.00 26.76 ? 8   DG  C N3    1 
ATOM   161  C C4    . DG  A 1 8   ? 32.195  -8.103  23.998  1.00 29.13 ? 8   DG  C C4    1 
ATOM   162  O "O5'" . DC  B 1 1   ? 29.120  -5.843  33.396  1.00 35.53 ? 1   DC  D "O5'" 1 
ATOM   163  C "C5'" . DC  B 1 1   ? 29.345  -4.505  33.904  1.00 36.30 ? 1   DC  D "C5'" 1 
ATOM   164  C "C4'" . DC  B 1 1   ? 29.825  -3.518  32.843  1.00 36.31 ? 1   DC  D "C4'" 1 
ATOM   165  O "O4'" . DC  B 1 1   ? 30.058  -4.211  31.570  1.00 35.06 ? 1   DC  D "O4'" 1 
ATOM   166  C "C3'" . DC  B 1 1   ? 28.824  -2.428  32.502  1.00 35.91 ? 1   DC  D "C3'" 1 
ATOM   167  O "O3'" . DC  B 1 1   ? 29.542  -1.393  31.873  1.00 39.80 ? 1   DC  D "O3'" 1 
ATOM   168  C "C2'" . DC  B 1 1   ? 27.967  -3.168  31.500  1.00 32.12 ? 1   DC  D "C2'" 1 
ATOM   169  C "C1'" . DC  B 1 1   ? 29.053  -3.837  30.664  1.00 30.66 ? 1   DC  D "C1'" 1 
ATOM   170  N N1    . DC  B 1 1   ? 28.630  -5.055  29.970  1.00 26.86 ? 1   DC  D N1    1 
ATOM   171  C C2    . DC  B 1 1   ? 29.298  -5.206  28.761  1.00 26.32 ? 1   DC  D C2    1 
ATOM   172  O O2    . DC  B 1 1   ? 30.116  -4.354  28.433  1.00 27.31 ? 1   DC  D O2    1 
ATOM   173  N N3    . DC  B 1 1   ? 29.027  -6.280  27.983  1.00 25.76 ? 1   DC  D N3    1 
ATOM   174  C C4    . DC  B 1 1   ? 28.112  -7.172  28.395  1.00 26.50 ? 1   DC  D C4    1 
ATOM   175  N N4    . DC  B 1 1   ? 27.863  -8.223  27.610  1.00 27.17 ? 1   DC  D N4    1 
ATOM   176  C C5    . DC  B 1 1   ? 27.428  -7.029  29.635  1.00 26.54 ? 1   DC  D C5    1 
ATOM   177  C C6    . DC  B 1 1   ? 27.727  -5.962  30.388  1.00 26.81 ? 1   DC  D C6    1 
ATOM   178  P P     . DG  B 1 2   ? 29.059  0.103   31.911  1.00 44.95 ? 2   DG  D P     1 
ATOM   179  O OP1   . DG  B 1 2   ? 29.891  0.693   32.985  1.00 46.03 ? 2   DG  D OP1   1 
ATOM   180  O OP2   . DG  B 1 2   ? 27.582  0.096   31.982  1.00 47.67 ? 2   DG  D OP2   1 
ATOM   181  O "O5'" . DG  B 1 2   ? 29.451  0.693   30.503  1.00 44.50 ? 2   DG  D "O5'" 1 
ATOM   182  C "C5'" . DG  B 1 2   ? 30.635  0.255   29.950  1.00 44.55 ? 2   DG  D "C5'" 1 
ATOM   183  C "C4'" . DG  B 1 2   ? 30.505  0.255   28.465  1.00 43.87 ? 2   DG  D "C4'" 1 
ATOM   184  O "O4'" . DG  B 1 2   ? 29.870  -0.979  28.060  1.00 40.58 ? 2   DG  D "O4'" 1 
ATOM   185  C "C3'" . DG  B 1 2   ? 29.595  1.369   27.983  1.00 44.94 ? 2   DG  D "C3'" 1 
ATOM   186  O "O3'" . DG  B 1 2   ? 30.167  2.030   26.884  1.00 49.68 ? 2   DG  D "O3'" 1 
ATOM   187  C "C2'" . DG  B 1 2   ? 28.308  0.645   27.610  1.00 40.49 ? 2   DG  D "C2'" 1 
ATOM   188  C "C1'" . DG  B 1 2   ? 28.825  -0.693  27.173  1.00 37.27 ? 2   DG  D "C1'" 1 
ATOM   189  N N9    . DG  B 1 2   ? 27.830  -1.759  27.340  1.00 32.66 ? 2   DG  D N9    1 
ATOM   190  C C8    . DG  B 1 2   ? 26.739  -1.910  28.170  1.00 30.83 ? 2   DG  D C8    1 
ATOM   191  N N7    . DG  B 1 2   ? 26.094  -3.049  28.015  1.00 28.27 ? 2   DG  D N7    1 
ATOM   192  C C5    . DG  B 1 2   ? 26.797  -3.685  27.019  1.00 28.26 ? 2   DG  D C5    1 
ATOM   193  C C6    . DG  B 1 2   ? 26.552  -4.951  26.428  1.00 29.24 ? 2   DG  D C6    1 
ATOM   194  O O6    . DG  B 1 2   ? 25.659  -5.771  26.704  1.00 28.40 ? 2   DG  D O6    1 
ATOM   195  N N1    . DG  B 1 2   ? 27.495  -5.230  25.431  1.00 30.95 ? 2   DG  D N1    1 
ATOM   196  C C2    . DG  B 1 2   ? 28.535  -4.402  25.065  1.00 30.63 ? 2   DG  D C2    1 
ATOM   197  N N2    . DG  B 1 2   ? 29.314  -4.887  24.094  1.00 32.39 ? 2   DG  D N2    1 
ATOM   198  N N3    . DG  B 1 2   ? 28.791  -3.200  25.611  1.00 27.55 ? 2   DG  D N3    1 
ATOM   199  C C4    . DG  B 1 2   ? 27.877  -2.913  26.575  1.00 29.35 ? 2   DG  D C4    1 
ATOM   200  P P     . DA  B 1 3   ? 30.364  3.630   26.865  1.00 52.84 ? 3   DA  D P     1 
ATOM   201  O OP1   . DA  B 1 3   ? 31.335  3.996   27.932  1.00 52.41 ? 3   DA  D OP1   1 
ATOM   202  O OP2   . DA  B 1 3   ? 28.999  4.235   26.820  1.00 53.75 ? 3   DA  D OP2   1 
ATOM   203  O "O5'" . DA  B 1 3   ? 31.107  3.861   25.450  1.00 52.64 ? 3   DA  D "O5'" 1 
ATOM   204  C "C5'" . DA  B 1 3   ? 32.054  2.850   24.994  1.00 50.51 ? 3   DA  D "C5'" 1 
ATOM   205  C "C4'" . DA  B 1 3   ? 31.757  2.324   23.573  1.00 48.00 ? 3   DA  D "C4'" 1 
ATOM   206  O "O4'" . DA  B 1 3   ? 30.784  1.250   23.548  1.00 44.33 ? 3   DA  D "O4'" 1 
ATOM   207  C "C3'" . DA  B 1 3   ? 31.284  3.311   22.538  1.00 46.46 ? 3   DA  D "C3'" 1 
ATOM   208  O "O3'" . DA  B 1 3   ? 31.861  2.929   21.317  1.00 50.05 ? 3   DA  D "O3'" 1 
ATOM   209  C "C2'" . DA  B 1 3   ? 29.791  3.096   22.538  1.00 40.89 ? 3   DA  D "C2'" 1 
ATOM   210  C "C1'" . DA  B 1 3   ? 29.737  1.584   22.667  1.00 37.18 ? 3   DA  D "C1'" 1 
ATOM   211  N N9    . DA  B 1 3   ? 28.523  1.138   23.310  1.00 28.38 ? 3   DA  D N9    1 
ATOM   212  C C8    . DA  B 1 3   ? 27.734  1.688   24.293  1.00 24.45 ? 3   DA  D C8    1 
ATOM   213  N N7    . DA  B 1 3   ? 26.715  0.931   24.608  1.00 22.34 ? 3   DA  D N7    1 
ATOM   214  C C5    . DA  B 1 3   ? 26.843  -0.199  23.792  1.00 22.80 ? 3   DA  D C5    1 
ATOM   215  C C6    . DA  B 1 3   ? 26.055  -1.377  23.663  1.00 23.28 ? 3   DA  D C6    1 
ATOM   216  N N6    . DA  B 1 3   ? 24.940  -1.592  24.396  1.00 24.40 ? 3   DA  D N6    1 
ATOM   217  N N1    . DA  B 1 3   ? 26.474  -2.324  22.757  1.00 22.49 ? 3   DA  D N1    1 
ATOM   218  C C2    . DA  B 1 3   ? 27.594  -2.086  22.030  1.00 22.74 ? 3   DA  D C2    1 
ATOM   219  N N3    . DA  B 1 3   ? 28.414  -1.003  22.063  1.00 22.66 ? 3   DA  D N3    1 
ATOM   220  C C4    . DA  B 1 3   ? 27.971  -0.096  22.982  1.00 24.48 ? 3   DA  D C4    1 
ATOM   221  P P     . DG  B 1 4   ? 31.866  4.044   20.211  1.00 53.84 ? 4   DG  D P     1 
ATOM   222  O OP1   . DG  B 1 4   ? 33.273  4.179   19.697  1.00 53.63 ? 4   DG  D OP1   1 
ATOM   223  O OP2   . DG  B 1 4   ? 31.127  5.198   20.815  1.00 55.85 ? 4   DG  D OP2   1 
ATOM   224  O "O5'" . DG  B 1 4   ? 30.966  3.359   19.080  1.00 49.90 ? 4   DG  D "O5'" 1 
ATOM   225  C "C5'" . DG  B 1 4   ? 31.314  2.038   18.797  1.00 45.52 ? 4   DG  D "C5'" 1 
ATOM   226  C "C4'" . DG  B 1 4   ? 30.116  1.313   18.263  1.00 40.76 ? 4   DG  D "C4'" 1 
ATOM   227  O "O4'" . DG  B 1 4   ? 29.103  1.250   19.266  1.00 36.63 ? 4   DG  D "O4'" 1 
ATOM   228  C "C3'" . DG  B 1 4   ? 29.444  1.974   17.074  1.00 39.74 ? 4   DG  D "C3'" 1 
ATOM   229  O "O3'" . DG  B 1 4   ? 29.251  0.971   16.097  1.00 42.16 ? 4   DG  D "O3'" 1 
ATOM   230  C "C2'" . DG  B 1 4   ? 28.099  2.428   17.666  1.00 36.27 ? 4   DG  D "C2'" 1 
ATOM   231  C "C1'" . DG  B 1 4   ? 27.887  1.266   18.591  1.00 32.23 ? 4   DG  D "C1'" 1 
ATOM   232  N N9    . DG  B 1 4   ? 26.885  1.409   19.607  1.00 24.45 ? 4   DG  D N9    1 
ATOM   233  C C8    . DG  B 1 4   ? 26.805  2.547   20.365  1.00 22.45 ? 4   DG  D C8    1 
ATOM   234  N N7    . DG  B 1 4   ? 25.896  2.468   21.285  1.00 20.59 ? 4   DG  D N7    1 
ATOM   235  C C5    . DG  B 1 4   ? 25.365  1.186   21.137  1.00 19.55 ? 4   DG  D C5    1 
ATOM   236  C C6    . DG  B 1 4   ? 24.352  0.557   21.850  1.00 20.06 ? 4   DG  D C6    1 
ATOM   237  O O6    . DG  B 1 4   ? 23.714  1.027   22.783  1.00 23.42 ? 4   DG  D O6    1 
ATOM   238  N N1    . DG  B 1 4   ? 24.097  -0.732  21.407  1.00 18.25 ? 4   DG  D N1    1 
ATOM   239  C C2    . DG  B 1 4   ? 24.759  -1.337  20.385  1.00 17.52 ? 4   DG  D C2    1 
ATOM   240  N N2    . DG  B 1 4   ? 24.375  -2.603  20.121  1.00 15.74 ? 4   DG  D N2    1 
ATOM   241  N N3    . DG  B 1 4   ? 25.734  -0.748  19.684  1.00 17.97 ? 4   DG  D N3    1 
ATOM   242  C C4    . DG  B 1 4   ? 25.978  0.517   20.121  1.00 20.03 ? 4   DG  D C4    1 
ATOM   243  P P     . DC  B 1 5   ? 29.286  1.337   14.561  1.00 44.75 ? 5   DC  D P     1 
ATOM   244  O OP1   . DC  B 1 5   ? 30.635  0.955   14.059  1.00 45.52 ? 5   DC  D OP1   1 
ATOM   245  O OP2   . DC  B 1 5   ? 28.758  2.722   14.374  1.00 45.29 ? 5   DC  D OP2   1 
ATOM   246  O "O5'" . DC  B 1 5   ? 28.229  0.318   13.956  1.00 44.06 ? 5   DC  D "O5'" 1 
ATOM   247  C "C5'" . DC  B 1 5   ? 28.447  -1.035  14.201  1.00 44.27 ? 5   DC  D "C5'" 1 
ATOM   248  C "C4'" . DC  B 1 5   ? 27.117  -1.743  14.310  1.00 44.94 ? 5   DC  D "C4'" 1 
ATOM   249  O "O4'" . DC  B 1 5   ? 26.378  -1.234  15.473  1.00 43.44 ? 5   DC  D "O4'" 1 
ATOM   250  C "C3'" . DC  B 1 5   ? 26.224  -1.504  13.101  1.00 45.26 ? 5   DC  D "C3'" 1 
ATOM   251  O "O3'" . DC  B 1 5   ? 25.690  -2.762  12.626  1.00 46.79 ? 5   DC  D "O3'" 1 
ATOM   252  C "C2'" . DC  B 1 5   ? 25.162  -0.517  13.635  1.00 43.71 ? 5   DC  D "C2'" 1 
ATOM   253  C "C1'" . DC  B 1 5   ? 25.057  -0.915  15.101  1.00 40.97 ? 5   DC  D "C1'" 1 
ATOM   254  N N1    . DC  B 1 5   ? 24.537  0.151   16.078  1.00 36.37 ? 5   DC  D N1    1 
ATOM   255  C C2    . DC  B 1 5   ? 23.370  -0.088  16.856  1.00 33.92 ? 5   DC  D C2    1 
ATOM   256  O O2    . DC  B 1 5   ? 22.749  -1.130  16.714  1.00 35.00 ? 5   DC  D O2    1 
ATOM   257  N N3    . DC  B 1 5   ? 22.942  0.852   17.743  1.00 31.00 ? 5   DC  D N3    1 
ATOM   258  C C4    . DC  B 1 5   ? 23.624  1.982   17.884  1.00 31.91 ? 5   DC  D C4    1 
ATOM   259  N N4    . DC  B 1 5   ? 23.160  2.874   18.752  1.00 31.79 ? 5   DC  D N4    1 
ATOM   260  C C5    . DC  B 1 5   ? 24.819  2.261   17.132  1.00 33.38 ? 5   DC  D C5    1 
ATOM   261  C C6    . DC  B 1 5   ? 25.238  1.321   16.251  1.00 34.87 ? 5   DC  D C6    1 
ATOM   262  P P     . DT  B 1 6   ? 25.176  -2.921  11.089  1.00 48.44 ? 6   DT  D P     1 
ATOM   263  O OP1   . DT  B 1 6   ? 25.558  -4.275  10.594  1.00 48.29 ? 6   DT  D OP1   1 
ATOM   264  O OP2   . DT  B 1 6   ? 25.540  -1.688  10.318  1.00 49.37 ? 6   DT  D OP2   1 
ATOM   265  O "O5'" . DT  B 1 6   ? 23.587  -2.937  11.301  1.00 44.07 ? 6   DT  D "O5'" 1 
ATOM   266  C "C5'" . DT  B 1 6   ? 23.082  -3.582  12.433  1.00 38.74 ? 6   DT  D "C5'" 1 
ATOM   267  C "C4'" . DT  B 1 6   ? 21.626  -3.256  12.606  1.00 33.03 ? 6   DT  D "C4'" 1 
ATOM   268  O "O4'" . DT  B 1 6   ? 21.498  -2.173  13.551  1.00 29.85 ? 6   DT  D "O4'" 1 
ATOM   269  C "C3'" . DT  B 1 6   ? 20.881  -2.834  11.353  1.00 29.33 ? 6   DT  D "C3'" 1 
ATOM   270  O "O3'" . DT  B 1 6   ? 19.614  -3.447  11.378  1.00 30.51 ? 6   DT  D "O3'" 1 
ATOM   271  C "C2'" . DT  B 1 6   ? 20.766  -1.329  11.533  1.00 25.96 ? 6   DT  D "C2'" 1 
ATOM   272  C "C1'" . DT  B 1 6   ? 20.621  -1.242  13.050  1.00 24.59 ? 6   DT  D "C1'" 1 
ATOM   273  N N1    . DT  B 1 6   ? 20.956  0.056   13.661  1.00 18.07 ? 6   DT  D N1    1 
ATOM   274  C C2    . DT  B 1 6   ? 20.223  0.302   14.824  1.00 15.97 ? 6   DT  D C2    1 
ATOM   275  O O2    . DT  B 1 6   ? 19.386  -0.470  15.306  1.00 15.47 ? 6   DT  D O2    1 
ATOM   276  N N3    . DT  B 1 6   ? 20.485  1.489   15.403  1.00 14.05 ? 6   DT  D N3    1 
ATOM   277  C C4    . DT  B 1 6   ? 21.375  2.436   14.953  1.00 13.62 ? 6   DT  D C4    1 
ATOM   278  O O4    . DT  B 1 6   ? 21.490  3.439   15.596  1.00 15.68 ? 6   DT  D O4    1 
ATOM   279  C C5    . DT  B 1 6   ? 22.092  2.117   13.770  1.00 12.26 ? 6   DT  D C5    1 
ATOM   280  C C7    . DT  B 1 6   ? 23.088  3.120   13.230  1.00 10.52 ? 6   DT  D C7    1 
ATOM   281  C C6    . DT  B 1 6   ? 21.870  0.963   13.172  1.00 14.53 ? 6   DT  D C6    1 
ATOM   282  P P     . DC  B 1 7   ? 18.840  -3.773  10.028  1.00 31.87 ? 7   DC  D P     1 
ATOM   283  O OP1   . DC  B 1 7   ? 19.190  -5.150  9.681   1.00 33.05 ? 7   DC  D OP1   1 
ATOM   284  O OP2   . DC  B 1 7   ? 19.095  -2.667  9.096   1.00 35.38 ? 7   DC  D OP2   1 
ATOM   285  O "O5'" . DC  B 1 7   ? 17.311  -3.725  10.433  1.00 28.45 ? 7   DC  D "O5'" 1 
ATOM   286  C "C5'" . DC  B 1 7   ? 16.964  -4.306  11.642  1.00 26.37 ? 7   DC  D "C5'" 1 
ATOM   287  C "C4'" . DC  B 1 7   ? 16.188  -3.319  12.471  1.00 23.37 ? 7   DC  D "C4'" 1 
ATOM   288  O "O4'" . DC  B 1 7   ? 17.080  -2.245  12.915  1.00 21.21 ? 7   DC  D "O4'" 1 
ATOM   289  C "C3'" . DC  B 1 7   ? 15.058  -2.643  11.700  1.00 21.40 ? 7   DC  D "C3'" 1 
ATOM   290  O "O3'" . DC  B 1 7   ? 13.809  -2.826  12.317  1.00 18.84 ? 7   DC  D "O3'" 1 
ATOM   291  C "C2'" . DC  B 1 7   ? 15.466  -1.186  11.738  1.00 21.80 ? 7   DC  D "C2'" 1 
ATOM   292  C "C1'" . DC  B 1 7   ? 16.269  -1.130  13.031  1.00 19.69 ? 7   DC  D "C1'" 1 
ATOM   293  N N1    . DC  B 1 7   ? 17.044  0.143   13.159  1.00 15.40 ? 7   DC  D N1    1 
ATOM   294  C C2    . DC  B 1 7   ? 16.858  0.923   14.278  1.00 15.07 ? 7   DC  D C2    1 
ATOM   295  O O2    . DC  B 1 7   ? 16.109  0.525   15.158  1.00 16.38 ? 7   DC  D O2    1 
ATOM   296  N N3    . DC  B 1 7   ? 17.509  2.101   14.381  1.00 15.03 ? 7   DC  D N3    1 
ATOM   297  C C4    . DC  B 1 7   ? 18.308  2.507   13.410  1.00 13.50 ? 7   DC  D C4    1 
ATOM   298  N N4    . DC  B 1 7   ? 18.948  3.670   13.558  1.00 11.62 ? 7   DC  D N4    1 
ATOM   299  C C5    . DC  B 1 7   ? 18.506  1.735   12.246  1.00 13.96 ? 7   DC  D C5    1 
ATOM   300  C C6    . DC  B 1 7   ? 17.850  0.573   12.163  1.00 14.89 ? 7   DC  D C6    1 
ATOM   301  P P     . DG  B 1 8   ? 12.516  -2.245  11.546  1.00 19.49 ? 8   DG  D P     1 
ATOM   302  O OP1   . DG  B 1 8   ? 11.452  -3.280  11.578  1.00 19.71 ? 8   DG  D OP1   1 
ATOM   303  O OP2   . DG  B 1 8   ? 12.939  -1.680  10.228  1.00 20.81 ? 8   DG  D OP2   1 
ATOM   304  O "O5'" . DG  B 1 8   ? 12.100  -1.019  12.491  1.00 17.52 ? 8   DG  D "O5'" 1 
ATOM   305  C "C5'" . DG  B 1 8   ? 11.452  -1.321  13.699  1.00 16.83 ? 8   DG  D "C5'" 1 
ATOM   306  C "C4'" . DG  B 1 8   ? 10.997  -0.072  14.400  1.00 15.75 ? 8   DG  D "C4'" 1 
ATOM   307  O "O4'" . DG  B 1 8   ? 12.126  0.836   14.535  1.00 14.60 ? 8   DG  D "O4'" 1 
ATOM   308  C "C3'" . DG  B 1 8   ? 9.939   0.693   13.641  1.00 15.83 ? 8   DG  D "C3'" 1 
ATOM   309  O "O3'" . DG  B 1 8   ? 9.009   1.194   14.535  1.00 16.60 ? 8   DG  D "O3'" 1 
ATOM   310  C "C2'" . DG  B 1 8   ? 10.746  1.807   13.011  1.00 15.97 ? 8   DG  D "C2'" 1 
ATOM   311  C "C1'" . DG  B 1 8   ? 11.746  2.093   14.123  1.00 13.50 ? 8   DG  D "C1'" 1 
ATOM   312  N N9    . DG  B 1 8   ? 12.898  2.794   13.616  1.00 12.13 ? 8   DG  D N9    1 
ATOM   313  C C8    . DG  B 1 8   ? 13.684  2.269   12.645  1.00 13.72 ? 8   DG  D C8    1 
ATOM   314  N N7    . DG  B 1 8   ? 14.667  3.057   12.285  1.00 14.64 ? 8   DG  D N7    1 
ATOM   315  C C5    . DG  B 1 8   ? 14.511  4.171   13.076  1.00 12.82 ? 8   DG  D C5    1 
ATOM   316  C C6    . DG  B 1 8   ? 15.270  5.357   13.133  1.00 12.25 ? 8   DG  D C6    1 
ATOM   317  O O6    . DG  B 1 8   ? 16.261  5.660   12.478  1.00 12.71 ? 8   DG  D O6    1 
ATOM   318  N N1    . DG  B 1 8   ? 14.777  6.233   14.059  1.00 11.68 ? 8   DG  D N1    1 
ATOM   319  C C2    . DG  B 1 8   ? 13.704  5.978   14.843  1.00 12.72 ? 8   DG  D C2    1 
ATOM   320  N N2    . DG  B 1 8   ? 13.384  6.941   15.686  1.00 15.57 ? 8   DG  D N2    1 
ATOM   321  N N3    . DG  B 1 8   ? 12.979  4.887   14.811  1.00 11.54 ? 8   DG  D N3    1 
ATOM   322  C C4    . DG  B 1 8   ? 13.436  4.028   13.892  1.00 11.78 ? 8   DG  D C4    1 
ATOM   323  O "O5'" . DC  C 1 1   ? 12.018  5.078   10.343  1.00 22.23 ? 1   DC  E "O5'" 1 
ATOM   324  C "C5'" . DC  C 1 1   ? 11.069  4.999   11.366  1.00 21.95 ? 1   DC  E "C5'" 1 
ATOM   325  C "C4'" . DC  C 1 1   ? 10.939  6.352   12.002  1.00 22.54 ? 1   DC  E "C4'" 1 
ATOM   326  O "O4'" . DC  C 1 1   ? 12.247  6.862   12.266  1.00 21.24 ? 1   DC  E "O4'" 1 
ATOM   327  C "C3'" . DC  C 1 1   ? 10.276  7.347   11.121  1.00 25.47 ? 1   DC  E "C3'" 1 
ATOM   328  O "O3'" . DC  C 1 1   ? 8.972   7.451   11.501  1.00 31.12 ? 1   DC  E "O3'" 1 
ATOM   329  C "C2'" . DC  C 1 1   ? 10.983  8.653   11.378  1.00 23.47 ? 1   DC  E "C2'" 1 
ATOM   330  C "C1'" . DC  C 1 1   ? 12.295  8.231   12.028  1.00 19.58 ? 1   DC  E "C1'" 1 
ATOM   331  N N1    . DC  C 1 1   ? 13.459  8.422   11.237  1.00 14.08 ? 1   DC  E N1    1 
ATOM   332  C C2    . DC  C 1 1   ? 13.796  9.703   11.629  1.00 13.22 ? 1   DC  E C2    1 
ATOM   333  O O2    . DC  C 1 1   ? 13.050  10.300  12.446  1.00 15.50 ? 1   DC  E O2    1 
ATOM   334  N N3    . DC  C 1 1   ? 14.911  10.260  11.102  1.00 9.24  ? 1   DC  E N3    1 
ATOM   335  C C4    . DC  C 1 1   ? 15.646  9.576   10.247  1.00 6.79  ? 1   DC  E C4    1 
ATOM   336  N N4    . DC  C 1 1   ? 16.726  10.133  9.752   1.00 6.00  ? 1   DC  E N4    1 
ATOM   337  C C5    . DC  C 1 1   ? 15.294  8.270   9.861   1.00 10.02 ? 1   DC  E C5    1 
ATOM   338  C C6    . DC  C 1 1   ? 14.200  7.729   10.382  1.00 11.60 ? 1   DC  E C6    1 
ATOM   339  P P     . DG  C 1 2   ? 7.996   8.040   10.401  1.00 36.99 ? 2   DG  E P     1 
ATOM   340  O OP1   . DG  C 1 2   ? 6.584   7.968   10.909  1.00 37.36 ? 2   DG  E OP1   1 
ATOM   341  O OP2   . DG  C 1 2   ? 8.364   7.427   9.109   1.00 36.82 ? 2   DG  E OP2   1 
ATOM   342  O "O5'" . DG  C 1 2   ? 8.424   9.544   10.388  1.00 37.07 ? 2   DG  E "O5'" 1 
ATOM   343  C "C5'" . DG  C 1 2   ? 8.194   10.237  11.597  1.00 36.01 ? 2   DG  E "C5'" 1 
ATOM   344  C "C4'" . DG  C 1 2   ? 8.346   11.725  11.378  1.00 32.64 ? 2   DG  E "C4'" 1 
ATOM   345  O "O4'" . DG  C 1 2   ? 9.760   12.020  11.102  1.00 28.30 ? 2   DG  E "O4'" 1 
ATOM   346  C "C3'" . DG  C 1 2   ? 7.580   12.179  10.157  1.00 31.26 ? 2   DG  E "C3'" 1 
ATOM   347  O "O3'" . DG  C 1 2   ? 7.313   13.532  10.234  1.00 34.19 ? 2   DG  E "O3'" 1 
ATOM   348  C "C2'" . DG  C 1 2   ? 8.607   11.940  9.071   1.00 27.10 ? 2   DG  E "C2'" 1 
ATOM   349  C "C1'" . DG  C 1 2   ? 9.870   12.418  9.778   1.00 24.03 ? 2   DG  E "C1'" 1 
ATOM   350  N N9    . DG  C 1 2   ? 11.061  11.860  9.199   1.00 18.06 ? 2   DG  E N9    1 
ATOM   351  C C8    . DG  C 1 2   ? 11.454  10.770  8.498   1.00 16.49 ? 2   DG  E C8    1 
ATOM   352  N N7    . DG  C 1 2   ? 12.719  10.802  8.138   1.00 15.06 ? 2   DG  E N7    1 
ATOM   353  C C5    . DG  C 1 2   ? 13.168  12.012  8.627   1.00 14.72 ? 2   DG  E C5    1 
ATOM   354  C C6    . DG  C 1 2   ? 14.452  12.601  8.563   1.00 13.92 ? 2   DG  E C6    1 
ATOM   355  O O6    . DG  C 1 2   ? 15.472  12.163  8.036   1.00 13.51 ? 2   DG  E O6    1 
ATOM   356  N N1    . DG  C 1 2   ? 14.487  13.834  9.193   1.00 13.05 ? 2   DG  E N1    1 
ATOM   357  C C2    . DG  C 1 2   ? 13.427  14.431  9.797   1.00 10.91 ? 2   DG  E C2    1 
ATOM   358  N N2    . DG  C 1 2   ? 13.688  15.618  10.324  1.00 11.16 ? 2   DG  E N2    1 
ATOM   359  N N3    . DG  C 1 2   ? 12.218  13.898  9.887   1.00 10.45 ? 2   DG  E N3    1 
ATOM   360  C C4    . DG  C 1 2   ? 12.162  12.688  9.283   1.00 14.50 ? 2   DG  E C4    1 
ATOM   361  P P     . DA  C 1 3   ? 5.816   14.161  10.459  1.00 34.73 ? 3   DA  E P     1 
ATOM   362  O OP1   . DA  C 1 3   ? 5.330   13.643  11.732  1.00 36.97 ? 3   DA  E OP1   1 
ATOM   363  O OP2   . DA  C 1 3   ? 5.026   13.938  9.251   1.00 36.43 ? 3   DA  E OP2   1 
ATOM   364  O "O5'" . DA  C 1 3   ? 6.218   15.641  10.523  1.00 29.40 ? 3   DA  E "O5'" 1 
ATOM   365  C "C5'" . DA  C 1 3   ? 7.294   16.008  11.340  1.00 26.36 ? 3   DA  E "C5'" 1 
ATOM   366  C "C4'" . DA  C 1 3   ? 7.957   17.289  10.845  1.00 25.07 ? 3   DA  E "C4'" 1 
ATOM   367  O "O4'" . DA  C 1 3   ? 9.153   16.971  10.138  1.00 23.40 ? 3   DA  E "O4'" 1 
ATOM   368  C "C3'" . DA  C 1 3   ? 7.150   18.189  9.938   1.00 27.23 ? 3   DA  E "C3'" 1 
ATOM   369  O "O3'" . DA  C 1 3   ? 7.500   19.550  10.202  1.00 31.94 ? 3   DA  E "O3'" 1 
ATOM   370  C "C2'" . DA  C 1 3   ? 7.603   17.751  8.556   1.00 24.54 ? 3   DA  E "C2'" 1 
ATOM   371  C "C1'" . DA  C 1 3   ? 9.062   17.377  8.794   1.00 21.85 ? 3   DA  E "C1'" 1 
ATOM   372  N N9    . DA  C 1 3   ? 9.523   16.262  7.965   1.00 17.55 ? 3   DA  E N9    1 
ATOM   373  C C8    . DA  C 1 3   ? 8.891   15.156  7.470   1.00 17.10 ? 3   DA  E C8    1 
ATOM   374  N N7    . DA  C 1 3   ? 9.675   14.368  6.769   1.00 15.59 ? 3   DA  E N7    1 
ATOM   375  C C5    . DA  C 1 3   ? 10.910  14.997  6.814   1.00 13.43 ? 3   DA  E C5    1 
ATOM   376  C C6    . DA  C 1 3   ? 12.158  14.662  6.255   1.00 13.54 ? 3   DA  E C6    1 
ATOM   377  N N6    . DA  C 1 3   ? 12.380  13.564  5.503   1.00 13.49 ? 3   DA  E N6    1 
ATOM   378  N N1    . DA  C 1 3   ? 13.170  15.506  6.499   1.00 14.53 ? 3   DA  E N1    1 
ATOM   379  C C2    . DA  C 1 3   ? 12.931  16.605  7.238   1.00 14.73 ? 3   DA  E C2    1 
ATOM   380  N N3    . DA  C 1 3   ? 11.798  17.018  7.804   1.00 12.38 ? 3   DA  E N3    1 
ATOM   381  C C4    . DA  C 1 3   ? 10.829  16.167  7.553   1.00 13.14 ? 3   DA  E C4    1 
ATOM   382  P P     . DG  C 1 4   ? 6.779   20.728  9.386   1.00 36.51 ? 4   DG  E P     1 
ATOM   383  O OP1   . DG  C 1 4   ? 6.433   21.818  10.298  1.00 38.35 ? 4   DG  E OP1   1 
ATOM   384  O OP2   . DG  C 1 4   ? 5.716   20.091  8.569   1.00 38.55 ? 4   DG  E OP2   1 
ATOM   385  O "O5'" . DG  C 1 4   ? 7.914   21.293  8.466   1.00 33.26 ? 4   DG  E "O5'" 1 
ATOM   386  C "C5'" . DG  C 1 4   ? 8.886   22.057  9.026   1.00 30.48 ? 4   DG  E "C5'" 1 
ATOM   387  C "C4'" . DG  C 1 4   ? 9.952   22.216  8.003   1.00 29.78 ? 4   DG  E "C4'" 1 
ATOM   388  O "O4'" . DG  C 1 4   ? 10.214  20.943  7.386   1.00 29.28 ? 4   DG  E "O4'" 1 
ATOM   389  C "C3'" . DG  C 1 4   ? 9.544   23.140  6.878   1.00 29.21 ? 4   DG  E "C3'" 1 
ATOM   390  O "O3'" . DG  C 1 4   ? 10.522  24.127  6.833   1.00 30.24 ? 4   DG  E "O3'" 1 
ATOM   391  C "C2'" . DG  C 1 4   ? 9.550   22.224  5.638   1.00 28.06 ? 4   DG  E "C2'" 1 
ATOM   392  C "C1'" . DG  C 1 4   ? 10.526  21.150  6.049   1.00 28.20 ? 4   DG  E "C1'" 1 
ATOM   393  N N9    . DG  C 1 4   ? 10.363  19.876  5.381   1.00 29.10 ? 4   DG  E N9    1 
ATOM   394  C C8    . DG  C 1 4   ? 9.292   19.032  5.310   1.00 29.58 ? 4   DG  E C8    1 
ATOM   395  N N7    . DG  C 1 4   ? 9.535   17.926  4.635   1.00 29.39 ? 4   DG  E N7    1 
ATOM   396  C C5    . DG  C 1 4   ? 10.863  18.061  4.243   1.00 28.86 ? 4   DG  E C5    1 
ATOM   397  C C6    . DG  C 1 4   ? 11.677  17.186  3.478   1.00 29.74 ? 4   DG  E C6    1 
ATOM   398  O O6    . DG  C 1 4   ? 11.387  16.095  2.983   1.00 30.75 ? 4   DG  E O6    1 
ATOM   399  N N1    . DG  C 1 4   ? 12.957  17.695  3.298   1.00 29.98 ? 4   DG  E N1    1 
ATOM   400  C C2    . DG  C 1 4   ? 13.396  18.889  3.799   1.00 30.92 ? 4   DG  E C2    1 
ATOM   401  N N2    . DG  C 1 4   ? 14.671  19.215  3.529   1.00 32.17 ? 4   DG  E N2    1 
ATOM   402  N N3    . DG  C 1 4   ? 12.644  19.717  4.506   1.00 30.90 ? 4   DG  E N3    1 
ATOM   403  C C4    . DG  C 1 4   ? 11.390  19.239  4.693   1.00 29.68 ? 4   DG  E C4    1 
ATOM   404  P P     . DC  C 1 5   ? 10.382  25.369  5.889   1.00 30.80 ? 5   DC  E P     1 
ATOM   405  O OP1   . DC  C 1 5   ? 11.177  26.459  6.525   1.00 30.03 ? 5   DC  E OP1   1 
ATOM   406  O OP2   . DC  C 1 5   ? 8.936   25.520  5.548   1.00 28.88 ? 5   DC  E OP2   1 
ATOM   407  O "O5'" . DC  C 1 5   ? 11.182  24.923  4.571   1.00 32.17 ? 5   DC  E "O5'" 1 
ATOM   408  C "C5'" . DC  C 1 5   ? 12.565  24.588  4.731   1.00 34.05 ? 5   DC  E "C5'" 1 
ATOM   409  C "C4'" . DC  C 1 5   ? 13.221  24.262  3.388   1.00 34.31 ? 5   DC  E "C4'" 1 
ATOM   410  O "O4'" . DC  C 1 5   ? 12.946  22.869  3.047   1.00 32.24 ? 5   DC  E "O4'" 1 
ATOM   411  C "C3'" . DC  C 1 5   ? 12.741  25.114  2.199   1.00 34.33 ? 5   DC  E "C3'" 1 
ATOM   412  O "O3'" . DC  C 1 5   ? 13.869  25.703  1.491   1.00 37.82 ? 5   DC  E "O3'" 1 
ATOM   413  C "C2'" . DC  C 1 5   ? 11.953  24.127  1.324   1.00 29.99 ? 5   DC  E "C2'" 1 
ATOM   414  C "C1'" . DC  C 1 5   ? 12.578  22.782  1.691   1.00 26.51 ? 5   DC  E "C1'" 1 
ATOM   415  N N1    . DC  C 1 5   ? 11.643  21.627  1.543   1.00 16.77 ? 5   DC  E N1    1 
ATOM   416  C C2    . DC  C 1 5   ? 12.075  20.441  0.932   1.00 13.43 ? 5   DC  E C2    1 
ATOM   417  O O2    . DC  C 1 5   ? 13.254  20.394  0.534   1.00 14.08 ? 5   DC  E O2    1 
ATOM   418  N N3    . DC  C 1 5   ? 11.206  19.399  0.797   1.00 10.02 ? 5   DC  E N3    1 
ATOM   419  C C4    . DC  C 1 5   ? 9.944   19.550  1.254   1.00 11.36 ? 5   DC  E C4    1 
ATOM   420  N N4    . DC  C 1 5   ? 9.083   18.523  1.112   1.00 11.94 ? 5   DC  E N4    1 
ATOM   421  C C5    . DC  C 1 5   ? 9.502   20.760  1.877   1.00 11.29 ? 5   DC  E C5    1 
ATOM   422  C C6    . DC  C 1 5   ? 10.381  21.755  1.999   1.00 12.56 ? 5   DC  E C6    1 
ATOM   423  P P     . DT  C 1 6   ? 13.562  26.491  0.109   1.00 40.41 ? 6   DT  E P     1 
ATOM   424  O OP1   . DT  C 1 6   ? 14.585  27.550  -0.032  1.00 39.95 ? 6   DT  E OP1   1 
ATOM   425  O OP2   . DT  C 1 6   ? 12.098  26.817  0.103   1.00 40.27 ? 6   DT  E OP2   1 
ATOM   426  O "O5'" . DT  C 1 6   ? 13.836  25.416  -1.029  1.00 38.37 ? 6   DT  E "O5'" 1 
ATOM   427  C "C5'" . DT  C 1 6   ? 15.114  24.875  -1.176  1.00 35.51 ? 6   DT  E "C5'" 1 
ATOM   428  C "C4'" . DT  C 1 6   ? 15.147  24.071  -2.443  1.00 32.75 ? 6   DT  E "C4'" 1 
ATOM   429  O "O4'" . DT  C 1 6   ? 14.242  22.933  -2.334  1.00 29.74 ? 6   DT  E "O4'" 1 
ATOM   430  C "C3'" . DT  C 1 6   ? 14.699  24.859  -3.651  1.00 32.54 ? 6   DT  E "C3'" 1 
ATOM   431  O "O3'" . DT  C 1 6   ? 15.573  24.533  -4.725  1.00 34.11 ? 6   DT  E "O3'" 1 
ATOM   432  C "C2'" . DT  C 1 6   ? 13.254  24.366  -3.864  1.00 29.17 ? 6   DT  E "C2'" 1 
ATOM   433  C "C1'" . DT  C 1 6   ? 13.353  22.917  -3.426  1.00 25.28 ? 6   DT  E "C1'" 1 
ATOM   434  N N1    . DT  C 1 6   ? 12.091  22.360  -2.944  1.00 18.84 ? 6   DT  E N1    1 
ATOM   435  C C2    . DT  C 1 6   ? 11.980  21.022  -3.201  1.00 15.16 ? 6   DT  E C2    1 
ATOM   436  O O2    . DT  C 1 6   ? 12.838  20.409  -3.793  1.00 14.97 ? 6   DT  E O2    1 
ATOM   437  N N3    . DT  C 1 6   ? 10.827  20.425  -2.771  1.00 12.83 ? 6   DT  E N3    1 
ATOM   438  C C4    . DT  C 1 6   ? 9.791   21.062  -2.076  1.00 13.69 ? 6   DT  E C4    1 
ATOM   439  O O4    . DT  C 1 6   ? 8.799   20.433  -1.736  1.00 13.06 ? 6   DT  E O4    1 
ATOM   440  C C5    . DT  C 1 6   ? 9.994   22.447  -1.826  1.00 16.27 ? 6   DT  E C5    1 
ATOM   441  C C7    . DT  C 1 6   ? 8.924   23.203  -1.080  1.00 17.21 ? 6   DT  E C7    1 
ATOM   442  C C6    . DT  C 1 6   ? 11.112  23.044  -2.256  1.00 17.65 ? 6   DT  E C6    1 
ATOM   443  P P     . DC  C 1 7   ? 15.661  25.329  -6.126  1.00 34.52 ? 7   DC  E P     1 
ATOM   444  O OP1   . DC  C 1 7   ? 17.109  25.424  -6.403  1.00 35.01 ? 7   DC  E OP1   1 
ATOM   445  O OP2   . DC  C 1 7   ? 14.814  26.539  -6.107  1.00 33.27 ? 7   DC  E OP2   1 
ATOM   446  O "O5'" . DC  C 1 7   ? 14.967  24.270  -7.123  1.00 33.54 ? 7   DC  E "O5'" 1 
ATOM   447  C "C5'" . DC  C 1 7   ? 14.900  22.901  -6.731  1.00 32.29 ? 7   DC  E "C5'" 1 
ATOM   448  C "C4'" . DC  C 1 7   ? 14.174  22.073  -7.766  1.00 32.15 ? 7   DC  E "C4'" 1 
ATOM   449  O "O4'" . DC  C 1 7   ? 13.009  21.428  -7.129  1.00 29.62 ? 7   DC  E "O4'" 1 
ATOM   450  C "C3'" . DC  C 1 7   ? 13.590  22.933  -8.871  1.00 34.92 ? 7   DC  E "C3'" 1 
ATOM   451  O "O3'" . DC  C 1 7   ? 13.549  22.240  -10.170 1.00 37.91 ? 7   DC  E "O3'" 1 
ATOM   452  C "C2'" . DC  C 1 7   ? 12.202  23.219  -8.325  1.00 31.88 ? 7   DC  E "C2'" 1 
ATOM   453  C "C1'" . DC  C 1 7   ? 11.847  21.850  -7.772  1.00 27.01 ? 7   DC  E "C1'" 1 
ATOM   454  N N1    . DC  C 1 7   ? 10.689  21.890  -6.872  1.00 20.15 ? 7   DC  E N1    1 
ATOM   455  C C2    . DC  C 1 7   ? 9.779   20.847  -6.769  1.00 17.99 ? 7   DC  E C2    1 
ATOM   456  O O2    . DC  C 1 7   ? 9.976   19.844  -7.425  1.00 17.86 ? 7   DC  E O2    1 
ATOM   457  N N3    . DC  C 1 7   ? 8.730   20.951  -5.946  1.00 18.11 ? 7   DC  E N3    1 
ATOM   458  C C4    . DC  C 1 7   ? 8.558   22.065  -5.252  1.00 18.92 ? 7   DC  E C4    1 
ATOM   459  N N4    . DC  C 1 7   ? 7.502   22.137  -4.455  1.00 20.27 ? 7   DC  E N4    1 
ATOM   460  C C5    . DC  C 1 7   ? 9.466   23.164  -5.349  1.00 18.25 ? 7   DC  E C5    1 
ATOM   461  C C6    . DC  C 1 7   ? 10.508  23.028  -6.171  1.00 18.29 ? 7   DC  E C6    1 
ATOM   462  P P     . DG  C 1 8   ? 13.651  23.044  -11.571 1.00 37.67 ? 8   DG  E P     1 
ATOM   463  O OP1   . DG  C 1 8   ? 15.097  23.044  -11.918 1.00 37.89 ? 8   DG  E OP1   1 
ATOM   464  O OP2   . DG  C 1 8   ? 12.900  24.326  -11.475 1.00 36.95 ? 8   DG  E OP2   1 
ATOM   465  O "O5'" . DG  C 1 8   ? 12.902  22.097  -12.542 1.00 36.74 ? 8   DG  E "O5'" 1 
ATOM   466  C "C5'" . DG  C 1 8   ? 13.499  20.855  -12.677 1.00 38.86 ? 8   DG  E "C5'" 1 
ATOM   467  C "C4'" . DG  C 1 8   ? 12.416  19.892  -12.992 1.00 40.52 ? 8   DG  E "C4'" 1 
ATOM   468  O "O4'" . DG  C 1 8   ? 11.455  19.980  -11.899 1.00 40.54 ? 8   DG  E "O4'" 1 
ATOM   469  C "C3'" . DG  C 1 8   ? 11.668  20.290  -14.258 1.00 40.84 ? 8   DG  E "C3'" 1 
ATOM   470  O "O3'" . DG  C 1 8   ? 11.265  19.128  -14.978 1.00 40.64 ? 8   DG  E "O3'" 1 
ATOM   471  C "C2'" . DG  C 1 8   ? 10.490  21.094  -13.706 1.00 41.36 ? 8   DG  E "C2'" 1 
ATOM   472  C "C1'" . DG  C 1 8   ? 10.195  20.298  -12.433 1.00 40.19 ? 8   DG  E "C1'" 1 
ATOM   473  N N9    . DG  C 1 8   ? 9.460   21.030  -11.417 1.00 37.05 ? 8   DG  E N9    1 
ATOM   474  C C8    . DG  C 1 8   ? 9.662   22.360  -11.192 1.00 35.69 ? 8   DG  E C8    1 
ATOM   475  N N7    . DG  C 1 8   ? 8.921   22.829  -10.234 1.00 35.93 ? 8   DG  E N7    1 
ATOM   476  C C5    . DG  C 1 8   ? 8.188   21.731  -9.784  1.00 36.20 ? 8   DG  E C5    1 
ATOM   477  C C6    . DG  C 1 8   ? 7.205   21.635  -8.736  1.00 36.51 ? 8   DG  E C6    1 
ATOM   478  O O6    . DG  C 1 8   ? 6.785   22.535  -7.984  1.00 37.03 ? 8   DG  E O6    1 
ATOM   479  N N1    . DG  C 1 8   ? 6.711   20.330  -8.601  1.00 35.18 ? 8   DG  E N1    1 
ATOM   480  C C2    . DG  C 1 8   ? 7.089   19.255  -9.373  1.00 34.20 ? 8   DG  E C2    1 
ATOM   481  N N2    . DG  C 1 8   ? 6.504   18.093  -9.096  1.00 31.73 ? 8   DG  E N2    1 
ATOM   482  N N3    . DG  C 1 8   ? 8.014   19.335  -10.356 1.00 35.76 ? 8   DG  E N3    1 
ATOM   483  C C4    . DG  C 1 8   ? 8.517   20.608  -10.498 1.00 36.23 ? 8   DG  E C4    1 
ATOM   484  O "O5'" . DC  D 1 1   ? -0.169  19.247  -6.551  1.00 40.80 ? 1   DC  F "O5'" 1 
ATOM   485  C "C5'" . DC  D 1 1   ? -0.703  18.396  -7.586  1.00 38.87 ? 1   DC  F "C5'" 1 
ATOM   486  C "C4'" . DC  D 1 1   ? 0.194   17.210  -7.875  1.00 35.18 ? 1   DC  F "C4'" 1 
ATOM   487  O "O4'" . DC  D 1 1   ? 1.506   17.623  -8.286  1.00 32.45 ? 1   DC  F "O4'" 1 
ATOM   488  C "C3'" . DC  D 1 1   ? 0.407   16.286  -6.711  1.00 34.74 ? 1   DC  F "C3'" 1 
ATOM   489  O "O3'" . DC  D 1 1   ? 0.617   15.013  -7.206  1.00 37.33 ? 1   DC  F "O3'" 1 
ATOM   490  C "C2'" . DC  D 1 1   ? 1.662   16.819  -6.056  1.00 32.63 ? 1   DC  F "C2'" 1 
ATOM   491  C "C1'" . DC  D 1 1   ? 2.389   17.504  -7.200  1.00 31.22 ? 1   DC  F "C1'" 1 
ATOM   492  N N1    . DC  D 1 1   ? 2.877   18.833  -6.833  1.00 30.30 ? 1   DC  F N1    1 
ATOM   493  C C2    . DC  D 1 1   ? 4.030   19.016  -7.611  1.00 30.33 ? 1   DC  F C2    1 
ATOM   494  O O2    . DC  D 1 1   ? 4.372   18.133  -8.402  1.00 30.51 ? 1   DC  F O2    1 
ATOM   495  N N3    . DC  D 1 1   ? 4.735   20.163  -7.476  1.00 30.17 ? 1   DC  F N3    1 
ATOM   496  C C4    . DC  D 1 1   ? 4.338   21.086  -6.602  1.00 30.65 ? 1   DC  F C4    1 
ATOM   497  N N4    . DC  D 1 1   ? 5.072   22.208  -6.499  1.00 29.90 ? 1   DC  F N4    1 
ATOM   498  C C5    . DC  D 1 1   ? 3.164   20.911  -5.799  1.00 31.23 ? 1   DC  F C5    1 
ATOM   499  C C6    . DC  D 1 1   ? 2.475   19.773  -5.940  1.00 30.46 ? 1   DC  F C6    1 
ATOM   500  P P     . DG  D 1 2   ? 0.066   13.755  -6.429  1.00 40.88 ? 2   DG  F P     1 
ATOM   501  O OP1   . DG  D 1 2   ? -0.606  12.879  -7.406  1.00 42.12 ? 2   DG  F OP1   1 
ATOM   502  O OP2   . DG  D 1 2   ? -0.700  14.177  -5.239  1.00 42.19 ? 2   DG  F OP2   1 
ATOM   503  O "O5'" . DG  D 1 2   ? 1.394   13.031  -5.921  1.00 39.89 ? 2   DG  F "O5'" 1 
ATOM   504  C "C5'" . DG  D 1 2   ? 2.317   12.633  -6.866  1.00 37.71 ? 2   DG  F "C5'" 1 
ATOM   505  C "C4'" . DG  D 1 2   ? 3.702   13.015  -6.422  1.00 35.44 ? 2   DG  F "C4'" 1 
ATOM   506  O "O4'" . DG  D 1 2   ? 3.748   14.376  -6.017  1.00 33.81 ? 2   DG  F "O4'" 1 
ATOM   507  C "C3'" . DG  D 1 2   ? 4.304   12.250  -5.252  1.00 35.20 ? 2   DG  F "C3'" 1 
ATOM   508  O "O3'" . DG  D 1 2   ? 5.432   11.630  -5.773  1.00 36.60 ? 2   DG  F "O3'" 1 
ATOM   509  C "C2'" . DG  D 1 2   ? 4.738   13.381  -4.281  1.00 33.44 ? 2   DG  F "C2'" 1 
ATOM   510  C "C1'" . DG  D 1 2   ? 4.932   14.487  -5.297  1.00 31.02 ? 2   DG  F "C1'" 1 
ATOM   511  N N9    . DG  D 1 2   ? 5.042   15.848  -4.796  1.00 25.89 ? 2   DG  F N9    1 
ATOM   512  C C8    . DG  D 1 2   ? 4.141   16.421  -3.960  1.00 24.95 ? 2   DG  F C8    1 
ATOM   513  N N7    . DG  D 1 2   ? 4.422   17.663  -3.696  1.00 24.07 ? 2   DG  F N7    1 
ATOM   514  C C5    . DG  D 1 2   ? 5.569   17.934  -4.423  1.00 21.99 ? 2   DG  F C5    1 
ATOM   515  C C6    . DG  D 1 2   ? 6.320   19.128  -4.519  1.00 20.96 ? 2   DG  F C6    1 
ATOM   516  O O6    . DG  D 1 2   ? 6.100   20.195  -3.960  1.00 22.84 ? 2   DG  F O6    1 
ATOM   517  N N1    . DG  D 1 2   ? 7.420   18.993  -5.355  1.00 18.00 ? 2   DG  F N1    1 
ATOM   518  C C2    . DG  D 1 2   ? 7.730   17.846  -6.024  1.00 16.58 ? 2   DG  F C2    1 
ATOM   519  N N2    . DG  D 1 2   ? 8.818   17.894  -6.788  1.00 14.12 ? 2   DG  F N2    1 
ATOM   520  N N3    . DG  D 1 2   ? 7.026   16.716  -5.953  1.00 19.06 ? 2   DG  F N3    1 
ATOM   521  C C4    . DG  D 1 2   ? 5.962   16.835  -5.124  1.00 22.03 ? 2   DG  F C4    1 
ATOM   522  P P     . DA  D 1 3   ? 5.991   10.252  -5.233  1.00 36.18 ? 3   DA  F P     1 
ATOM   523  O OP1   . DA  D 1 3   ? 5.567   9.210   -6.216  1.00 36.29 ? 3   DA  F OP1   1 
ATOM   524  O OP2   . DA  D 1 3   ? 5.644   10.141  -3.812  1.00 37.33 ? 3   DA  F OP2   1 
ATOM   525  O "O5'" . DA  D 1 3   ? 7.557   10.507  -5.381  1.00 32.85 ? 3   DA  F "O5'" 1 
ATOM   526  C "C5'" . DA  D 1 3   ? 7.998   10.547  -6.692  1.00 31.83 ? 3   DA  F "C5'" 1 
ATOM   527  C "C4'" . DA  D 1 3   ? 9.282   11.279  -6.782  1.00 32.46 ? 3   DA  F "C4'" 1 
ATOM   528  O "O4'" . DA  D 1 3   ? 9.076   12.656  -6.384  1.00 29.22 ? 3   DA  F "O4'" 1 
ATOM   529  C "C3'" . DA  D 1 3   ? 10.317  10.722  -5.831  1.00 36.36 ? 3   DA  F "C3'" 1 
ATOM   530  O "O3'" . DA  D 1 3   ? 11.612  10.754  -6.441  1.00 42.59 ? 3   DA  F "O3'" 1 
ATOM   531  C "C2'" . DA  D 1 3   ? 10.200  11.661  -4.635  1.00 32.16 ? 3   DA  F "C2'" 1 
ATOM   532  C "C1'" . DA  D 1 3   ? 9.963   12.983  -5.336  1.00 27.38 ? 3   DA  F "C1'" 1 
ATOM   533  N N9    . DA  D 1 3   ? 9.307   13.986  -4.519  1.00 21.39 ? 3   DA  F N9    1 
ATOM   534  C C8    . DA  D 1 3   ? 8.103   13.978  -3.864  1.00 20.01 ? 3   DA  F C8    1 
ATOM   535  N N7    . DA  D 1 3   ? 7.840   15.100  -3.246  1.00 17.61 ? 3   DA  F N7    1 
ATOM   536  C C5    . DA  D 1 3   ? 8.938   15.880  -3.516  1.00 17.34 ? 3   DA  F C5    1 
ATOM   537  C C6    . DA  D 1 3   ? 9.249   17.186  -3.156  1.00 20.28 ? 3   DA  F C6    1 
ATOM   538  N N6    . DA  D 1 3   ? 8.444   17.934  -2.404  1.00 23.74 ? 3   DA  F N6    1 
ATOM   539  N N1    . DA  D 1 3   ? 10.405  17.703  -3.600  1.00 18.91 ? 3   DA  F N1    1 
ATOM   540  C C2    . DA  D 1 3   ? 11.174  16.931  -4.352  1.00 19.97 ? 3   DA  F C2    1 
ATOM   541  N N3    . DA  D 1 3   ? 10.969  15.673  -4.751  1.00 19.18 ? 3   DA  F N3    1 
ATOM   542  C C4    . DA  D 1 3   ? 9.832   15.212  -4.301  1.00 17.93 ? 3   DA  F C4    1 
ATOM   543  P P     . DG  D 1 4   ? 12.717  9.743   -5.895  1.00 46.75 ? 4   DG  F P     1 
ATOM   544  O OP1   . DG  D 1 4   ? 13.443  9.218   -7.058  1.00 48.93 ? 4   DG  F OP1   1 
ATOM   545  O OP2   . DG  D 1 4   ? 12.076  8.804   -4.950  1.00 48.23 ? 4   DG  F OP2   1 
ATOM   546  O "O5'" . DG  D 1 4   ? 13.681  10.738  -5.143  1.00 45.28 ? 4   DG  F "O5'" 1 
ATOM   547  C "C5'" . DG  D 1 4   ? 14.184  11.669  -6.030  1.00 45.69 ? 4   DG  F "C5'" 1 
ATOM   548  C "C4'" . DG  D 1 4   ? 14.953  12.712  -5.297  1.00 46.90 ? 4   DG  F "C4'" 1 
ATOM   549  O "O4'" . DG  D 1 4   ? 14.031  13.556  -4.564  1.00 46.46 ? 4   DG  F "O4'" 1 
ATOM   550  C "C3'" . DG  D 1 4   ? 15.914  12.147  -4.269  1.00 47.26 ? 4   DG  F "C3'" 1 
ATOM   551  O "O3'" . DG  D 1 4   ? 17.017  13.015  -4.191  1.00 48.65 ? 4   DG  F "O3'" 1 
ATOM   552  C "C2'" . DG  D 1 4   ? 15.047  12.171  -3.009  1.00 46.15 ? 4   DG  F "C2'" 1 
ATOM   553  C "C1'" . DG  D 1 4   ? 14.389  13.524  -3.195  1.00 44.90 ? 4   DG  F "C1'" 1 
ATOM   554  N N9    . DG  D 1 4   ? 13.174  13.731  -2.417  1.00 40.76 ? 4   DG  F N9    1 
ATOM   555  C C8    . DG  D 1 4   ? 12.133  12.863  -2.256  1.00 40.57 ? 4   DG  F C8    1 
ATOM   556  N N7    . DG  D 1 4   ? 11.157  13.349  -1.530  1.00 39.31 ? 4   DG  F N7    1 
ATOM   557  C C5    . DG  D 1 4   ? 11.581  14.638  -1.209  1.00 37.04 ? 4   DG  F C5    1 
ATOM   558  C C6    . DG  D 1 4   ? 10.941  15.657  -0.431  1.00 34.81 ? 4   DG  F C6    1 
ATOM   559  O O6    . DG  D 1 4   ? 9.822   15.618  0.135   1.00 35.17 ? 4   DG  F O6    1 
ATOM   560  N N1    . DG  D 1 4   ? 11.735  16.804  -0.347  1.00 31.92 ? 4   DG  F N1    1 
ATOM   561  C C2    . DG  D 1 4   ? 12.963  16.939  -0.939  1.00 31.61 ? 4   DG  F C2    1 
ATOM   562  N N2    . DG  D 1 4   ? 13.567  18.109  -0.759  1.00 32.27 ? 4   DG  F N2    1 
ATOM   563  N N3    . DG  D 1 4   ? 13.567  16.016  -1.659  1.00 32.22 ? 4   DG  F N3    1 
ATOM   564  C C4    . DG  D 1 4   ? 12.823  14.893  -1.749  1.00 36.35 ? 4   DG  F C4    1 
ATOM   565  P P     . DC  D 1 5   ? 18.414  12.505  -3.606  1.00 51.02 ? 5   DC  F P     1 
ATOM   566  O OP1   . DC  D 1 5   ? 19.421  12.664  -4.693  1.00 52.06 ? 5   DC  F OP1   1 
ATOM   567  O OP2   . DC  D 1 5   ? 18.166  11.200  -2.938  1.00 51.38 ? 5   DC  F OP2   1 
ATOM   568  O "O5'" . DC  D 1 5   ? 18.698  13.596  -2.507  1.00 47.59 ? 5   DC  F "O5'" 1 
ATOM   569  C "C5'" . DC  D 1 5   ? 19.129  14.806  -3.009  1.00 46.12 ? 5   DC  F "C5'" 1 
ATOM   570  C "C4'" . DC  D 1 5   ? 19.201  15.785  -1.909  1.00 44.51 ? 5   DC  F "C4'" 1 
ATOM   571  O "O4'" . DC  D 1 5   ? 17.859  15.904  -1.356  1.00 43.06 ? 5   DC  F "O4'" 1 
ATOM   572  C "C3'" . DC  D 1 5   ? 20.064  15.243  -0.797  1.00 44.23 ? 5   DC  F "C3'" 1 
ATOM   573  O "O3'" . DC  D 1 5   ? 20.641  16.310  -0.167  1.00 46.09 ? 5   DC  F "O3'" 1 
ATOM   574  C "C2'" . DC  D 1 5   ? 19.047  14.535  0.090   1.00 42.39 ? 5   DC  F "C2'" 1 
ATOM   575  C "C1'" . DC  D 1 5   ? 17.914  15.562  -0.006  1.00 41.11 ? 5   DC  F "C1'" 1 
ATOM   576  N N1    . DC  D 1 5   ? 16.567  15.100  0.489   1.00 35.88 ? 5   DC  F N1    1 
ATOM   577  C C2    . DC  D 1 5   ? 15.705  15.944  1.228   1.00 31.27 ? 5   DC  F C2    1 
ATOM   578  O O2    . DC  D 1 5   ? 16.054  17.106  1.466   1.00 29.44 ? 5   DC  F O2    1 
ATOM   579  N N3    . DC  D 1 5   ? 14.521  15.450  1.646   1.00 29.54 ? 5   DC  F N3    1 
ATOM   580  C C4    . DC  D 1 5   ? 14.182  14.201  1.369   1.00 31.53 ? 5   DC  F C4    1 
ATOM   581  N N4    . DC  D 1 5   ? 13.000  13.763  1.806   1.00 32.53 ? 5   DC  F N4    1 
ATOM   582  C C5    . DC  D 1 5   ? 15.046  13.325  0.624   1.00 32.80 ? 5   DC  F C5    1 
ATOM   583  C C6    . DC  D 1 5   ? 16.221  13.819  0.212   1.00 34.20 ? 5   DC  F C6    1 
ATOM   584  P P     . DT  D 1 6   ? 21.910  16.023  0.726   1.00 46.73 ? 6   DT  F P     1 
ATOM   585  O OP1   . DT  D 1 6   ? 23.088  16.597  0.013   1.00 47.32 ? 6   DT  F OP1   1 
ATOM   586  O OP2   . DT  D 1 6   ? 21.845  14.599  1.112   1.00 46.05 ? 6   DT  F OP2   1 
ATOM   587  O "O5'" . DT  D 1 6   ? 21.590  16.955  1.993   1.00 43.37 ? 6   DT  F "O5'" 1 
ATOM   588  C "C5'" . DT  D 1 6   ? 20.640  18.013  1.877   1.00 38.48 ? 6   DT  F "C5'" 1 
ATOM   589  C "C4'" . DT  D 1 6   ? 20.133  18.388  3.253   1.00 34.35 ? 6   DT  F "C4'" 1 
ATOM   590  O "O4'" . DT  D 1 6   ? 18.827  17.783  3.484   1.00 30.15 ? 6   DT  F "O4'" 1 
ATOM   591  C "C3'" . DT  D 1 6   ? 21.047  17.950  4.410   1.00 33.14 ? 6   DT  F "C3'" 1 
ATOM   592  O "O3'" . DT  D 1 6   ? 21.150  19.040  5.361   1.00 36.30 ? 6   DT  F "O3'" 1 
ATOM   593  C "C2'" . DT  D 1 6   ? 20.293  16.764  4.995   1.00 29.37 ? 6   DT  F "C2'" 1 
ATOM   594  C "C1'" . DT  D 1 6   ? 18.842  17.138  4.725   1.00 25.88 ? 6   DT  F "C1'" 1 
ATOM   595  N N1    . DT  D 1 6   ? 17.956  15.984  4.629   1.00 18.98 ? 6   DT  F N1    1 
ATOM   596  C C2    . DT  D 1 6   ? 16.773  16.342  5.201   1.00 19.58 ? 6   DT  F C2    1 
ATOM   597  O O2    . DT  D 1 6   ? 16.568  17.448  5.676   1.00 21.94 ? 6   DT  F O2    1 
ATOM   598  N N3    . DT  D 1 6   ? 15.813  15.371  5.207   1.00 18.02 ? 6   DT  F N3    1 
ATOM   599  C C4    . DT  D 1 6   ? 15.942  14.081  4.680   1.00 17.31 ? 6   DT  F C4    1 
ATOM   600  O O4    . DT  D 1 6   ? 14.960  13.301  4.744   1.00 17.83 ? 6   DT  F O4    1 
ATOM   601  C C5    . DT  D 1 6   ? 17.234  13.811  4.108   1.00 15.04 ? 6   DT  F C5    1 
ATOM   602  C C7    . DT  D 1 6   ? 17.514  12.465  3.504   1.00 14.78 ? 6   DT  F C7    1 
ATOM   603  C C6    . DT  D 1 6   ? 18.152  14.750  4.108   1.00 15.02 ? 6   DT  F C6    1 
ATOM   604  P P     . DC  D 1 7   ? 22.272  19.160  6.506   1.00 38.45 ? 7   DC  F P     1 
ATOM   605  O OP1   . DC  D 1 7   ? 23.054  20.386  6.236   1.00 40.40 ? 7   DC  F OP1   1 
ATOM   606  O OP2   . DC  D 1 7   ? 22.933  17.830  6.705   1.00 38.67 ? 7   DC  F OP2   1 
ATOM   607  O "O5'" . DC  D 1 7   ? 21.408  19.526  7.753   1.00 34.92 ? 7   DC  F "O5'" 1 
ATOM   608  C "C5'" . DC  D 1 7   ? 20.644  20.648  7.528   1.00 32.59 ? 7   DC  F "C5'" 1 
ATOM   609  C "C4'" . DC  D 1 7   ? 19.466  20.585  8.428   1.00 29.98 ? 7   DC  F "C4'" 1 
ATOM   610  O "O4'" . DC  D 1 7   ? 18.712  19.383  8.087   1.00 28.05 ? 7   DC  F "O4'" 1 
ATOM   611  C "C3'" . DC  D 1 7   ? 19.904  20.433  9.861   1.00 27.40 ? 7   DC  F "C3'" 1 
ATOM   612  O "O3'" . DC  D 1 7   ? 19.097  21.190  10.729  1.00 25.21 ? 7   DC  F "O3'" 1 
ATOM   613  C "C2'" . DC  D 1 7   ? 19.758  18.929  10.054  1.00 28.27 ? 7   DC  F "C2'" 1 
ATOM   614  C "C1'" . DC  D 1 7   ? 18.485  18.690  9.257   1.00 26.98 ? 7   DC  F "C1'" 1 
ATOM   615  N N1    . DC  D 1 7   ? 18.207  17.249  8.929   1.00 24.57 ? 7   DC  F N1    1 
ATOM   616  C C2    . DC  D 1 7   ? 16.930  16.700  9.122   1.00 22.58 ? 7   DC  F C2    1 
ATOM   617  O O2    . DC  D 1 7   ? 16.026  17.424  9.546   1.00 24.35 ? 7   DC  F O2    1 
ATOM   618  N N3    . DC  D 1 7   ? 16.724  15.419  8.833   1.00 19.90 ? 7   DC  F N3    1 
ATOM   619  C C4    . DC  D 1 7   ? 17.721  14.678  8.370   1.00 20.63 ? 7   DC  F C4    1 
ATOM   620  N N4    . DC  D 1 7   ? 17.472  13.413  8.087   1.00 21.25 ? 7   DC  F N4    1 
ATOM   621  C C5    . DC  D 1 7   ? 19.021  15.212  8.164   1.00 21.88 ? 7   DC  F C5    1 
ATOM   622  C C6    . DC  D 1 7   ? 19.225  16.493  8.460   1.00 23.33 ? 7   DC  F C6    1 
ATOM   623  P P     . DG  D 1 8   ? 19.524  21.221  12.285  1.00 25.46 ? 8   DG  F P     1 
ATOM   624  O OP1   . DG  D 1 8   ? 19.356  22.598  12.773  1.00 25.99 ? 8   DG  F OP1   1 
ATOM   625  O OP2   . DG  D 1 8   ? 20.823  20.521  12.426  1.00 25.22 ? 8   DG  F OP2   1 
ATOM   626  O "O5'" . DG  D 1 8   ? 18.401  20.338  12.973  1.00 24.36 ? 8   DG  F "O5'" 1 
ATOM   627  C "C5'" . DG  D 1 8   ? 17.100  20.720  12.703  1.00 26.40 ? 8   DG  F "C5'" 1 
ATOM   628  C "C4'" . DG  D 1 8   ? 16.149  20.019  13.628  1.00 29.56 ? 8   DG  F "C4'" 1 
ATOM   629  O "O4'" . DG  D 1 8   ? 15.862  18.706  13.095  1.00 30.26 ? 8   DG  F "O4'" 1 
ATOM   630  C "C3'" . DG  D 1 8   ? 16.665  19.804  15.049  1.00 31.29 ? 8   DG  F "C3'" 1 
ATOM   631  O "O3'" . DG  D 1 8   ? 15.592  19.876  16.020  1.00 31.92 ? 8   DG  F "O3'" 1 
ATOM   632  C "C2'" . DG  D 1 8   ? 17.260  18.419  14.972  1.00 31.03 ? 8   DG  F "C2'" 1 
ATOM   633  C "C1'" . DG  D 1 8   ? 16.289  17.727  14.014  1.00 30.29 ? 8   DG  F "C1'" 1 
ATOM   634  N N9    . DG  D 1 8   ? 16.940  16.660  13.268  1.00 28.01 ? 8   DG  F N9    1 
ATOM   635  C C8    . DG  D 1 8   ? 18.212  16.573  12.748  1.00 28.82 ? 8   DG  F C8    1 
ATOM   636  N N7    . DG  D 1 8   ? 18.449  15.450  12.150  1.00 27.75 ? 8   DG  F N7    1 
ATOM   637  C C5    . DG  D 1 8   ? 17.255  14.758  12.291  1.00 24.95 ? 8   DG  F C5    1 
ATOM   638  C C6    . DG  D 1 8   ? 16.921  13.492  11.835  1.00 23.56 ? 8   DG  F C6    1 
ATOM   639  O O6    . DG  D 1 8   ? 17.635  12.712  11.192  1.00 22.73 ? 8   DG  F O6    1 
ATOM   640  N N1    . DG  D 1 8   ? 15.610  13.166  12.188  1.00 22.83 ? 8   DG  F N1    1 
ATOM   641  C C2    . DG  D 1 8   ? 14.756  13.986  12.896  1.00 21.68 ? 8   DG  F C2    1 
ATOM   642  N N2    . DG  D 1 8   ? 13.539  13.516  13.153  1.00 22.06 ? 8   DG  F N2    1 
ATOM   643  N N3    . DG  D 1 8   ? 15.072  15.180  13.313  1.00 21.22 ? 8   DG  F N3    1 
ATOM   644  C C4    . DG  D 1 8   ? 16.323  15.490  12.979  1.00 23.84 ? 8   DG  F C4    1 
ATOM   645  N N     . SER E 2 1   ? 15.617  38.614  38.912  1.00 55.95 ? 2   SER A N     1 
ATOM   646  C CA    . SER E 2 1   ? 15.880  38.574  37.472  1.00 54.24 ? 2   SER A CA    1 
ATOM   647  C C     . SER E 2 1   ? 14.705  37.945  36.720  1.00 51.50 ? 2   SER A C     1 
ATOM   648  O O     . SER E 2 1   ? 13.670  37.627  37.305  1.00 51.87 ? 2   SER A O     1 
ATOM   649  C CB    . SER E 2 1   ? 17.185  37.802  37.195  1.00 54.31 ? 2   SER A CB    1 
ATOM   650  O OG    . SER E 2 1   ? 17.544  37.006  38.320  1.00 53.69 ? 2   SER A OG    1 
ATOM   651  N N     . LEU E 2 2   ? 14.856  37.770  35.421  1.00 47.98 ? 3   LEU A N     1 
ATOM   652  C CA    . LEU E 2 2   ? 13.800  37.133  34.682  1.00 43.97 ? 3   LEU A CA    1 
ATOM   653  C C     . LEU E 2 2   ? 14.133  35.669  34.797  1.00 41.80 ? 3   LEU A C     1 
ATOM   654  O O     . LEU E 2 2   ? 13.265  34.785  34.817  1.00 43.32 ? 3   LEU A O     1 
ATOM   655  C CB    . LEU E 2 2   ? 13.700  37.579  33.216  1.00 42.78 ? 3   LEU A CB    1 
ATOM   656  C CG    . LEU E 2 2   ? 13.018  36.536  32.329  1.00 42.66 ? 3   LEU A CG    1 
ATOM   657  C CD1   . LEU E 2 2   ? 11.635  36.202  32.856  1.00 42.57 ? 3   LEU A CD1   1 
ATOM   658  C CD2   . LEU E 2 2   ? 12.908  37.070  30.902  1.00 42.88 ? 3   LEU A CD2   1 
ATOM   659  N N     . ARG E 2 3   ? 15.436  35.430  34.900  1.00 37.32 ? 4   ARG A N     1 
ATOM   660  C CA    . ARG E 2 3   ? 15.942  34.101  35.035  1.00 34.17 ? 4   ARG A CA    1 
ATOM   661  C C     . ARG E 2 3   ? 15.476  33.535  36.334  1.00 35.86 ? 4   ARG A C     1 
ATOM   662  O O     . ARG E 2 3   ? 14.891  32.461  36.398  1.00 35.36 ? 4   ARG A O     1 
ATOM   663  C CB    . ARG E 2 3   ? 17.455  34.061  34.984  1.00 29.37 ? 4   ARG A CB    1 
ATOM   664  C CG    . ARG E 2 3   ? 18.015  32.660  34.804  1.00 24.92 ? 4   ARG A CG    1 
ATOM   665  C CD    . ARG E 2 3   ? 19.455  32.684  34.322  1.00 21.15 ? 4   ARG A CD    1 
ATOM   666  N NE    . ARG E 2 3   ? 20.152  31.426  34.540  1.00 18.27 ? 4   ARG A NE    1 
ATOM   667  C CZ    . ARG E 2 3   ? 21.233  31.060  33.859  1.00 15.17 ? 4   ARG A CZ    1 
ATOM   668  N NH1   . ARG E 2 3   ? 21.768  31.840  32.901  1.00 11.82 ? 4   ARG A NH1   1 
ATOM   669  N NH2   . ARG E 2 3   ? 21.790  29.882  34.142  1.00 14.32 ? 4   ARG A NH2   1 
ATOM   670  N N     . SER E 2 4   ? 15.771  34.300  37.362  1.00 38.83 ? 5   SER A N     1 
ATOM   671  C CA    . SER E 2 4   ? 15.440  33.957  38.725  1.00 40.58 ? 5   SER A CA    1 
ATOM   672  C C     . SER E 2 4   ? 13.973  33.615  38.912  1.00 38.31 ? 5   SER A C     1 
ATOM   673  O O     . SER E 2 4   ? 13.635  32.580  39.503  1.00 37.34 ? 5   SER A O     1 
ATOM   674  C CB    . SER E 2 4   ? 15.866  35.056  39.670  1.00 43.49 ? 5   SER A CB    1 
ATOM   675  O OG    . SER E 2 4   ? 15.562  34.650  40.982  1.00 46.94 ? 5   SER A OG    1 
ATOM   676  N N     . ASP E 2 5   ? 13.111  34.491  38.404  1.00 36.76 ? 6   ASP A N     1 
ATOM   677  C CA    . ASP E 2 5   ? 11.672  34.339  38.487  1.00 36.39 ? 6   ASP A CA    1 
ATOM   678  C C     . ASP E 2 5   ? 11.196  33.050  37.812  1.00 35.48 ? 6   ASP A C     1 
ATOM   679  O O     . ASP E 2 5   ? 10.249  32.389  38.269  1.00 36.03 ? 6   ASP A O     1 
ATOM   680  C CB    . ASP E 2 5   ? 10.914  35.565  37.896  1.00 36.82 ? 6   ASP A CB    1 
ATOM   681  C CG    . ASP E 2 5   ? 10.743  36.727  38.847  1.00 36.24 ? 6   ASP A CG    1 
ATOM   682  O OD1   . ASP E 2 5   ? 10.571  36.608  40.043  1.00 36.99 ? 6   ASP A OD1   1 
ATOM   683  O OD2   . ASP E 2 5   ? 10.802  37.890  38.250  1.00 34.77 ? 6   ASP A OD2   1 
ATOM   684  N N     . LEU E 2 6   ? 11.865  32.716  36.707  1.00 32.51 ? 7   LEU A N     1 
ATOM   685  C CA    . LEU E 2 6   ? 11.556  31.530  35.942  1.00 27.70 ? 7   LEU A CA    1 
ATOM   686  C C     . LEU E 2 6   ? 11.987  30.312  36.713  1.00 24.11 ? 7   LEU A C     1 
ATOM   687  O O     . LEU E 2 6   ? 11.237  29.388  36.912  1.00 22.76 ? 7   LEU A O     1 
ATOM   688  C CB    . LEU E 2 6   ? 12.227  31.538  34.566  1.00 27.57 ? 7   LEU A CB    1 
ATOM   689  C CG    . LEU E 2 6   ? 11.245  31.402  33.409  1.00 27.75 ? 7   LEU A CG    1 
ATOM   690  C CD1   . LEU E 2 6   ? 11.960  31.012  32.130  1.00 26.27 ? 7   LEU A CD1   1 
ATOM   691  C CD2   . LEU E 2 6   ? 10.198  30.367  33.750  1.00 29.33 ? 7   LEU A CD2   1 
ATOM   692  N N     . ILE E 2 7   ? 13.220  30.328  37.137  1.00 24.66 ? 8   ILE A N     1 
ATOM   693  C CA    . ILE E 2 7   ? 13.772  29.221  37.890  1.00 26.42 ? 8   ILE A CA    1 
ATOM   694  C C     . ILE E 2 7   ? 12.880  28.863  39.060  1.00 29.19 ? 8   ILE A C     1 
ATOM   695  O O     . ILE E 2 7   ? 12.423  27.725  39.214  1.00 28.05 ? 8   ILE A O     1 
ATOM   696  C CB    . ILE E 2 7   ? 15.166  29.571  38.404  1.00 23.87 ? 8   ILE A CB    1 
ATOM   697  C CG1   . ILE E 2 7   ? 16.125  29.762  37.240  1.00 23.03 ? 8   ILE A CG1   1 
ATOM   698  C CG2   . ILE E 2 7   ? 15.672  28.521  39.387  1.00 21.88 ? 8   ILE A CG2   1 
ATOM   699  C CD1   . ILE E 2 7   ? 17.589  29.874  37.671  1.00 23.54 ? 8   ILE A CD1   1 
ATOM   700  N N     . ASN E 2 8   ? 12.630  29.882  39.870  1.00 32.80 ? 9   ASN A N     1 
ATOM   701  C CA    . ASN E 2 8   ? 11.812  29.731  41.046  1.00 34.63 ? 9   ASN A CA    1 
ATOM   702  C C     . ASN E 2 8   ? 10.494  29.046  40.737  1.00 33.71 ? 9   ASN A C     1 
ATOM   703  O O     . ASN E 2 8   ? 10.049  28.178  41.477  1.00 32.30 ? 9   ASN A O     1 
ATOM   704  C CB    . ASN E 2 8   ? 11.678  31.052  41.882  1.00 35.80 ? 9   ASN A CB    1 
ATOM   705  C CG    . ASN E 2 8   ? 12.943  31.394  42.685  1.00 35.94 ? 9   ASN A CG    1 
ATOM   706  O OD1   . ASN E 2 8   ? 13.603  30.495  43.257  1.00 36.11 ? 9   ASN A OD1   1 
ATOM   707  N ND2   . ASN E 2 8   ? 13.289  32.676  42.724  1.00 35.43 ? 9   ASN A ND2   1 
ATOM   708  N N     . ALA E 2 9   ? 9.895   29.436  39.612  1.00 34.50 ? 10  ALA A N     1 
ATOM   709  C CA    . ALA E 2 9   ? 8.631   28.855  39.201  1.00 34.71 ? 10  ALA A CA    1 
ATOM   710  C C     . ALA E 2 9   ? 8.784   27.406  38.847  1.00 37.10 ? 10  ALA A C     1 
ATOM   711  O O     . ALA E 2 9   ? 7.960   26.586  39.227  1.00 37.68 ? 10  ALA A O     1 
ATOM   712  C CB    . ALA E 2 9   ? 7.966   29.643  38.089  1.00 33.30 ? 10  ALA A CB    1 
ATOM   713  N N     . LEU E 2 10  ? 9.835   27.096  38.095  1.00 39.31 ? 11  LEU A N     1 
ATOM   714  C CA    . LEU E 2 10  ? 10.046  25.719  37.703  1.00 41.63 ? 11  LEU A CA    1 
ATOM   715  C C     . LEU E 2 10  ? 10.226  24.843  38.912  1.00 44.66 ? 11  LEU A C     1 
ATOM   716  O O     . LEU E 2 10  ? 9.677   23.745  38.970  1.00 46.36 ? 11  LEU A O     1 
ATOM   717  C CB    . LEU E 2 10  ? 11.102  25.512  36.610  1.00 41.09 ? 11  LEU A CB    1 
ATOM   718  C CG    . LEU E 2 10  ? 10.776  26.292  35.331  1.00 40.73 ? 11  LEU A CG    1 
ATOM   719  C CD1   . LEU E 2 10  ? 11.688  25.886  34.187  1.00 40.43 ? 11  LEU A CD1   1 
ATOM   720  C CD2   . LEU E 2 10  ? 9.307   26.109  34.945  1.00 39.59 ? 11  LEU A CD2   1 
ATOM   721  N N     . TYR E 2 11  ? 10.967  25.329  39.889  1.00 46.32 ? 12  TYR A N     1 
ATOM   722  C CA    . TYR E 2 11  ? 11.168  24.565  41.097  1.00 49.52 ? 12  TYR A CA    1 
ATOM   723  C C     . TYR E 2 11  ? 9.826   24.469  41.837  1.00 53.45 ? 12  TYR A C     1 
ATOM   724  O O     . TYR E 2 11  ? 9.243   23.379  41.920  1.00 54.49 ? 12  TYR A O     1 
ATOM   725  C CB    . TYR E 2 11  ? 12.283  25.130  41.978  1.00 49.06 ? 12  TYR A CB    1 
ATOM   726  C CG    . TYR E 2 11  ? 13.663  24.700  41.515  1.00 47.98 ? 12  TYR A CG    1 
ATOM   727  C CD1   . TYR E 2 11  ? 13.993  23.347  41.432  1.00 48.35 ? 12  TYR A CD1   1 
ATOM   728  C CD2   . TYR E 2 11  ? 14.628  25.639  41.175  1.00 47.92 ? 12  TYR A CD2   1 
ATOM   729  C CE1   . TYR E 2 11  ? 15.254  22.925  41.007  1.00 49.00 ? 12  TYR A CE1   1 
ATOM   730  C CE2   . TYR E 2 11  ? 15.895  25.249  40.750  1.00 49.09 ? 12  TYR A CE2   1 
ATOM   731  C CZ    . TYR E 2 11  ? 16.206  23.888  40.660  1.00 50.07 ? 12  TYR A CZ    1 
ATOM   732  O OH    . TYR E 2 11  ? 17.450  23.498  40.249  1.00 51.29 ? 12  TYR A OH    1 
ATOM   733  N N     . TYR E 2 17  ? 4.885   18.037  38.057  1.00 57.00 ? 18  TYR A N     1 
ATOM   734  C CA    . TYR E 2 17  ? 4.775   17.703  36.655  1.00 55.57 ? 18  TYR A CA    1 
ATOM   735  C C     . TYR E 2 17  ? 4.255   16.294  36.469  1.00 55.79 ? 18  TYR A C     1 
ATOM   736  O O     . TYR E 2 17  ? 4.907   15.498  35.800  1.00 56.89 ? 18  TYR A O     1 
ATOM   737  C CB    . TYR E 2 17  ? 6.090   17.934  35.890  1.00 55.30 ? 18  TYR A CB    1 
ATOM   738  C CG    . TYR E 2 17  ? 6.694   19.311  36.122  1.00 56.96 ? 18  TYR A CG    1 
ATOM   739  C CD1   . TYR E 2 17  ? 7.649   19.526  37.118  1.00 57.83 ? 18  TYR A CD1   1 
ATOM   740  C CD2   . TYR E 2 17  ? 6.306   20.409  35.344  1.00 56.71 ? 18  TYR A CD2   1 
ATOM   741  C CE1   . TYR E 2 17  ? 8.207   20.784  37.343  1.00 56.78 ? 18  TYR A CE1   1 
ATOM   742  C CE2   . TYR E 2 17  ? 6.856   21.675  35.550  1.00 55.95 ? 18  TYR A CE2   1 
ATOM   743  C CZ    . TYR E 2 17  ? 7.809   21.866  36.552  1.00 55.62 ? 18  TYR A CZ    1 
ATOM   744  O OH    . TYR E 2 17  ? 8.355   23.100  36.771  1.00 54.35 ? 18  TYR A OH    1 
ATOM   745  N N     . ASP E 2 18  ? 3.068   16.008  37.060  1.00 54.78 ? 19  ASP A N     1 
ATOM   746  C CA    . ASP E 2 18  ? 2.413   14.686  36.996  1.00 53.96 ? 19  ASP A CA    1 
ATOM   747  C C     . ASP E 2 18  ? 1.173   14.583  36.096  1.00 50.84 ? 19  ASP A C     1 
ATOM   748  O O     . ASP E 2 18  ? 0.081   15.021  36.450  1.00 50.41 ? 19  ASP A O     1 
ATOM   749  C CB    . ASP E 2 18  ? 2.011   14.248  38.391  1.00 56.15 ? 19  ASP A CB    1 
ATOM   750  C CG    . ASP E 2 18  ? 3.079   14.511  39.375  1.00 58.73 ? 19  ASP A CG    1 
ATOM   751  O OD1   . ASP E 2 18  ? 2.859   15.036  40.461  1.00 60.00 ? 19  ASP A OD1   1 
ATOM   752  O OD2   . ASP E 2 18  ? 4.269   14.121  38.931  1.00 58.80 ? 19  ASP A OD2   1 
ATOM   753  N N     . VAL E 2 19  ? 1.335   13.962  34.939  1.00 48.10 ? 20  VAL A N     1 
ATOM   754  C CA    . VAL E 2 19  ? 0.213   13.779  34.032  1.00 46.88 ? 20  VAL A CA    1 
ATOM   755  C C     . VAL E 2 19  ? -0.532  12.481  34.399  1.00 44.00 ? 20  VAL A C     1 
ATOM   756  O O     . VAL E 2 19  ? 0.074   11.550  34.887  1.00 45.76 ? 20  VAL A O     1 
ATOM   757  C CB    . VAL E 2 19  ? 0.678   13.834  32.554  1.00 47.12 ? 20  VAL A CB    1 
ATOM   758  C CG1   . VAL E 2 19  ? 1.397   12.561  32.155  1.00 47.96 ? 20  VAL A CG1   1 
ATOM   759  C CG2   . VAL E 2 19  ? -0.489  14.057  31.609  1.00 45.87 ? 20  VAL A CG2   1 
ATOM   760  N N     . CYS E 2 20  ? -1.830  12.410  34.200  1.00 39.47 ? 21  CYS A N     1 
ATOM   761  C CA    . CYS E 2 20  ? -2.499  11.176  34.560  1.00 37.46 ? 21  CYS A CA    1 
ATOM   762  C C     . CYS E 2 20  ? -2.736  10.388  33.332  1.00 34.56 ? 21  CYS A C     1 
ATOM   763  O O     . CYS E 2 20  ? -2.449  9.194   33.280  1.00 34.97 ? 21  CYS A O     1 
ATOM   764  C CB    . CYS E 2 20  ? -3.821  11.351  35.357  1.00 39.66 ? 21  CYS A CB    1 
ATOM   765  S SG    . CYS E 2 20  ? -3.737  12.465  36.803  1.00 41.28 ? 21  CYS A SG    1 
ATOM   766  N N     . GLY E 2 21  ? -3.264  11.080  32.329  1.00 31.91 ? 22  GLY A N     1 
ATOM   767  C CA    . GLY E 2 21  ? -3.545  10.459  31.056  1.00 30.70 ? 22  GLY A CA    1 
ATOM   768  C C     . GLY E 2 21  ? -4.171  11.415  30.060  1.00 29.94 ? 22  GLY A C     1 
ATOM   769  O O     . GLY E 2 21  ? -4.132  12.633  30.227  1.00 30.32 ? 22  GLY A O     1 
ATOM   770  N N     . ILE E 2 22  ? -4.751  10.810  29.018  1.00 28.40 ? 23  ILE A N     1 
ATOM   771  C CA    . ILE E 2 22  ? -5.432  11.502  27.945  1.00 26.13 ? 23  ILE A CA    1 
ATOM   772  C C     . ILE E 2 22  ? -6.909  11.542  28.279  1.00 26.62 ? 23  ILE A C     1 
ATOM   773  O O     . ILE E 2 22  ? -7.529  10.507  28.530  1.00 28.27 ? 23  ILE A O     1 
ATOM   774  C CB    . ILE E 2 22  ? -5.235  10.786  26.627  1.00 24.03 ? 23  ILE A CB    1 
ATOM   775  C CG1   . ILE E 2 22  ? -3.818  11.009  26.125  1.00 25.56 ? 23  ILE A CG1   1 
ATOM   776  C CG2   . ILE E 2 22  ? -6.243  11.279  25.598  1.00 22.30 ? 23  ILE A CG2   1 
ATOM   777  C CD1   . ILE E 2 22  ? -3.665  12.314  25.348  1.00 26.31 ? 23  ILE A CD1   1 
ATOM   778  N N     . ILE E 2 23  ? -7.490  12.720  28.298  1.00 25.32 ? 24  ILE A N     1 
ATOM   779  C CA    . ILE E 2 23  ? -8.888  12.824  28.620  1.00 23.65 ? 24  ILE A CA    1 
ATOM   780  C C     . ILE E 2 23  ? -9.786  12.943  27.405  1.00 24.81 ? 24  ILE A C     1 
ATOM   781  O O     . ILE E 2 23  ? -9.400  13.476  26.363  1.00 24.60 ? 24  ILE A O     1 
ATOM   782  C CB    . ILE E 2 23  ? -9.164  13.882  29.687  1.00 21.71 ? 24  ILE A CB    1 
ATOM   783  C CG1   . ILE E 2 23  ? -10.417 13.532  30.478  1.00 21.61 ? 24  ILE A CG1   1 
ATOM   784  C CG2   . ILE E 2 23  ? -9.306  15.267  29.070  1.00 21.01 ? 24  ILE A CG2   1 
ATOM   785  C CD1   . ILE E 2 23  ? -10.977 14.726  31.243  1.00 21.30 ? 24  ILE A CD1   1 
ATOM   786  N N     . SER E 2 24  ? -10.991 12.418  27.559  1.00 26.64 ? 25  SER A N     1 
ATOM   787  C CA    . SER E 2 24  ? -11.990 12.426  26.524  1.00 30.13 ? 25  SER A CA    1 
ATOM   788  C C     . SER E 2 24  ? -13.119 13.341  26.942  1.00 33.04 ? 25  SER A C     1 
ATOM   789  O O     . SER E 2 24  ? -13.502 13.341  28.105  1.00 35.07 ? 25  SER A O     1 
ATOM   790  C CB    . SER E 2 24  ? -12.491 11.025  26.235  1.00 32.48 ? 25  SER A CB    1 
ATOM   791  O OG    . SER E 2 24  ? -13.856 10.889  26.614  1.00 33.86 ? 25  SER A OG    1 
ATOM   792  N N     . ALA E 2 25  ? -13.633 14.113  25.990  1.00 34.49 ? 26  ALA A N     1 
ATOM   793  C CA    . ALA E 2 25  ? -14.715 15.060  26.228  1.00 36.15 ? 26  ALA A CA    1 
ATOM   794  C C     . ALA E 2 25  ? -15.811 14.567  27.180  1.00 36.93 ? 26  ALA A C     1 
ATOM   795  O O     . ALA E 2 25  ? -16.377 15.355  27.964  1.00 35.05 ? 26  ALA A O     1 
ATOM   796  C CB    . ALA E 2 25  ? -15.291 15.586  24.930  1.00 36.34 ? 26  ALA A CB    1 
ATOM   797  N N     . GLU E 2 26  ? -16.075 13.253  27.090  1.00 39.15 ? 27  GLU A N     1 
ATOM   798  C CA    . GLU E 2 26  ? -17.076 12.609  27.913  1.00 43.06 ? 27  GLU A CA    1 
ATOM   799  C C     . GLU E 2 26  ? -16.626 12.513  29.353  1.00 41.40 ? 27  GLU A C     1 
ATOM   800  O O     . GLU E 2 26  ? -17.346 11.996  30.201  1.00 42.77 ? 27  GLU A O     1 
ATOM   801  C CB    . GLU E 2 26  ? -17.429 11.184  27.398  1.00 49.56 ? 27  GLU A CB    1 
ATOM   802  C CG    . GLU E 2 26  ? -17.765 11.112  25.888  1.00 55.48 ? 27  GLU A CG    1 
ATOM   803  C CD    . GLU E 2 26  ? -17.179 9.886   25.187  1.00 59.36 ? 27  GLU A CD    1 
ATOM   804  O OE1   . GLU E 2 26  ? -15.985 9.799   24.859  1.00 60.00 ? 27  GLU A OE1   1 
ATOM   805  O OE2   . GLU E 2 26  ? -18.075 8.947   24.943  1.00 60.00 ? 27  GLU A OE2   1 
ATOM   806  N N     . GLY E 2 27  ? -15.439 13.015  29.635  1.00 38.37 ? 28  GLY A N     1 
ATOM   807  C CA    . GLY E 2 27  ? -14.918 12.967  30.985  1.00 36.69 ? 28  GLY A CA    1 
ATOM   808  C C     . GLY E 2 27  ? -14.076 11.709  31.172  1.00 36.83 ? 28  GLY A C     1 
ATOM   809  O O     . GLY E 2 27  ? -13.308 11.566  32.123  1.00 37.82 ? 28  GLY A O     1 
ATOM   810  N N     . LYS E 2 28  ? -14.213 10.786  30.246  1.00 35.93 ? 29  LYS A N     1 
ATOM   811  C CA    . LYS E 2 28  ? -13.449 9.552   30.310  1.00 35.03 ? 29  LYS A CA    1 
ATOM   812  C C     . LYS E 2 28  ? -11.935 9.831   30.259  1.00 31.63 ? 29  LYS A C     1 
ATOM   813  O O     . LYS E 2 28  ? -11.488 10.595  29.404  1.00 31.45 ? 29  LYS A O     1 
ATOM   814  C CB    . LYS E 2 28  ? -13.874 8.597   29.198  1.00 36.93 ? 29  LYS A CB    1 
ATOM   815  C CG    . LYS E 2 28  ? -14.034 7.164   29.687  1.00 39.31 ? 29  LYS A CG    1 
ATOM   816  C CD    . LYS E 2 28  ? -14.904 6.312   28.787  1.00 41.62 ? 29  LYS A CD    1 
ATOM   817  C CE    . LYS E 2 28  ? -14.482 4.856   28.768  1.00 43.32 ? 29  LYS A CE    1 
ATOM   818  N NZ    . LYS E 2 28  ? -15.596 3.932   29.050  1.00 44.90 ? 29  LYS A NZ    1 
ATOM   819  N N     . ILE E 2 29  ? -11.153 9.226   31.178  1.00 28.49 ? 30  ILE A N     1 
ATOM   820  C CA    . ILE E 2 29  ? -9.681  9.425   31.210  1.00 25.83 ? 30  ILE A CA    1 
ATOM   821  C C     . ILE E 2 29  ? -8.916  8.175   30.793  1.00 26.37 ? 30  ILE A C     1 
ATOM   822  O O     . ILE E 2 29  ? -9.215  7.092   31.236  1.00 27.31 ? 30  ILE A O     1 
ATOM   823  C CB    . ILE E 2 29  ? -9.169  9.894   32.567  1.00 21.66 ? 30  ILE A CB    1 
ATOM   824  C CG1   . ILE E 2 29  ? -9.781  11.240  32.946  1.00 22.24 ? 30  ILE A CG1   1 
ATOM   825  C CG2   . ILE E 2 29  ? -7.648  9.966   32.567  1.00 17.32 ? 30  ILE A CG2   1 
ATOM   826  C CD1   . ILE E 2 29  ? -9.749  11.502  34.437  1.00 22.59 ? 30  ILE A CD1   1 
ATOM   827  N N     . TYR E 2 30  ? -7.917  8.334   29.950  1.00 26.62 ? 31  TYR A N     1 
ATOM   828  C CA    . TYR E 2 30  ? -7.153  7.196   29.513  1.00 29.26 ? 31  TYR A CA    1 
ATOM   829  C C     . TYR E 2 30  ? -5.706  7.299   29.931  1.00 30.48 ? 31  TYR A C     1 
ATOM   830  O O     . TYR E 2 30  ? -4.989  8.167   29.462  1.00 30.05 ? 31  TYR A O     1 
ATOM   831  C CB    . TYR E 2 30  ? -7.201  6.997   27.977  1.00 32.58 ? 31  TYR A CB    1 
ATOM   832  C CG    . TYR E 2 30  ? -8.571  6.941   27.315  1.00 37.09 ? 31  TYR A CG    1 
ATOM   833  C CD1   . TYR E 2 30  ? -8.810  6.034   26.280  1.00 38.53 ? 31  TYR A CD1   1 
ATOM   834  C CD2   . TYR E 2 30  ? -9.608  7.793   27.694  1.00 39.99 ? 31  TYR A CD2   1 
ATOM   835  C CE1   . TYR E 2 30  ? -10.052 5.962   25.650  1.00 40.41 ? 31  TYR A CE1   1 
ATOM   836  C CE2   . TYR E 2 30  ? -10.857 7.745   27.070  1.00 41.85 ? 31  TYR A CE2   1 
ATOM   837  C CZ    . TYR E 2 30  ? -11.078 6.822   26.042  1.00 42.29 ? 31  TYR A CZ    1 
ATOM   838  O OH    . TYR E 2 30  ? -12.307 6.758   25.418  1.00 43.08 ? 31  TYR A OH    1 
ATOM   839  N N     . PRO E 2 31  ? -5.249  6.384   30.812  1.00 32.49 ? 32  PRO A N     1 
ATOM   840  C CA    . PRO E 2 31  ? -3.860  6.408   31.243  1.00 31.07 ? 32  PRO A CA    1 
ATOM   841  C C     . PRO E 2 31  ? -2.929  6.368   30.053  1.00 30.96 ? 32  PRO A C     1 
ATOM   842  O O     . PRO E 2 31  ? -3.206  5.668   29.083  1.00 30.61 ? 32  PRO A O     1 
ATOM   843  C CB    . PRO E 2 31  ? -3.647  5.134   32.059  1.00 30.33 ? 32  PRO A CB    1 
ATOM   844  C CG    . PRO E 2 31  ? -4.751  4.211   31.641  1.00 30.77 ? 32  PRO A CG    1 
ATOM   845  C CD    . PRO E 2 31  ? -5.900  5.158   31.397  1.00 32.78 ? 32  PRO A CD    1 
ATOM   846  N N     . LEU E 2 32  ? -1.826  7.092   30.130  1.00 31.98 ? 33  LEU A N     1 
ATOM   847  C CA    . LEU E 2 32  ? -0.906  7.053   29.038  1.00 33.41 ? 33  LEU A CA    1 
ATOM   848  C C     . LEU E 2 32  ? 0.107   5.970   29.224  1.00 35.02 ? 33  LEU A C     1 
ATOM   849  O O     . LEU E 2 32  ? -0.099  5.039   29.970  1.00 35.16 ? 33  LEU A O     1 
ATOM   850  C CB    . LEU E 2 32  ? -0.416  8.374   28.388  1.00 33.35 ? 33  LEU A CB    1 
ATOM   851  C CG    . LEU E 2 32  ? 0.418   9.289   29.269  1.00 32.33 ? 33  LEU A CG    1 
ATOM   852  C CD1   . LEU E 2 32  ? 1.293   10.149  28.375  1.00 31.12 ? 33  LEU A CD1   1 
ATOM   853  C CD2   . LEU E 2 32  ? -0.525  10.197  30.028  1.00 33.75 ? 33  LEU A CD2   1 
ATOM   854  N N     . GLY E 2 33  ? 1.210   6.058   28.562  1.00 37.30 ? 34  GLY A N     1 
ATOM   855  C CA    . GLY E 2 33  ? 2.162   4.999   28.723  1.00 38.12 ? 34  GLY A CA    1 
ATOM   856  C C     . GLY E 2 33  ? 3.577   5.453   28.761  1.00 39.75 ? 34  GLY A C     1 
ATOM   857  O O     . GLY E 2 33  ? 3.900   6.647   28.755  1.00 40.95 ? 34  GLY A O     1 
ATOM   858  N N     . SER E 2 34  ? 4.402   4.458   28.723  1.00 40.86 ? 35  SER A N     1 
ATOM   859  C CA    . SER E 2 34  ? 5.822   4.537   28.768  1.00 44.13 ? 35  SER A CA    1 
ATOM   860  C C     . SER E 2 34  ? 6.531   4.895   27.456  1.00 44.39 ? 35  SER A C     1 
ATOM   861  O O     . SER E 2 34  ? 7.715   4.625   27.302  1.00 43.97 ? 35  SER A O     1 
ATOM   862  C CB    . SER E 2 34  ? 6.230   3.168   29.256  1.00 47.60 ? 35  SER A CB    1 
ATOM   863  O OG    . SER E 2 34  ? 5.041   2.420   29.243  1.00 48.90 ? 35  SER A OG    1 
ATOM   864  N N     . ASP E 2 35  ? 5.808   5.461   26.492  1.00 45.15 ? 36  ASP A N     1 
ATOM   865  C CA    . ASP E 2 35  ? 6.419   5.835   25.213  1.00 45.80 ? 36  ASP A CA    1 
ATOM   866  C C     . ASP E 2 35  ? 7.296   7.021   25.476  1.00 41.98 ? 36  ASP A C     1 
ATOM   867  O O     . ASP E 2 35  ? 6.830   8.063   25.875  1.00 40.75 ? 36  ASP A O     1 
ATOM   868  C CB    . ASP E 2 35  ? 5.327   6.145   24.165  1.00 51.88 ? 36  ASP A CB    1 
ATOM   869  C CG    . ASP E 2 35  ? 5.818   6.320   22.744  1.00 56.86 ? 36  ASP A CG    1 
ATOM   870  O OD1   . ASP E 2 35  ? 5.099   6.153   21.760  1.00 58.41 ? 36  ASP A OD1   1 
ATOM   871  O OD2   . ASP E 2 35  ? 7.084   6.686   22.667  1.00 58.63 ? 36  ASP A OD2   1 
ATOM   872  N N     . THR E 2 36  ? 8.566   6.822   25.309  1.00 42.51 ? 37  THR A N     1 
ATOM   873  C CA    . THR E 2 36  ? 9.522   7.849   25.560  1.00 43.81 ? 37  THR A CA    1 
ATOM   874  C C     . THR E 2 36  ? 9.384   9.035   24.634  1.00 45.08 ? 37  THR A C     1 
ATOM   875  O O     . THR E 2 36  ? 10.113  10.030  24.756  1.00 46.92 ? 37  THR A O     1 
ATOM   876  C CB    . THR E 2 36  ? 10.978  7.307   25.675  1.00 44.50 ? 37  THR A CB    1 
ATOM   877  O OG1   . THR E 2 36  ? 11.215  6.280   24.705  1.00 44.67 ? 37  THR A OG1   1 
ATOM   878  C CG2   . THR E 2 36  ? 11.244  6.750   27.083  1.00 44.06 ? 37  THR A CG2   1 
ATOM   879  N N     . LYS E 2 37  ? 8.447   8.947   23.702  1.00 44.14 ? 38  LYS A N     1 
ATOM   880  C CA    . LYS E 2 37  ? 8.288   10.061  22.808  1.00 43.56 ? 38  LYS A CA    1 
ATOM   881  C C     . LYS E 2 37  ? 7.117   10.945  23.149  1.00 38.92 ? 38  LYS A C     1 
ATOM   882  O O     . LYS E 2 37  ? 7.242   12.163  23.117  1.00 39.90 ? 38  LYS A O     1 
ATOM   883  C CB    . LYS E 2 37  ? 8.439   9.743   21.323  1.00 47.36 ? 38  LYS A CB    1 
ATOM   884  C CG    . LYS E 2 37  ? 9.469   10.619  20.597  1.00 48.29 ? 38  LYS A CG    1 
ATOM   885  C CD    . LYS E 2 37  ? 9.724   10.173  19.163  1.00 49.20 ? 38  LYS A CD    1 
ATOM   886  C CE    . LYS E 2 37  ? 11.167  10.380  18.746  1.00 50.05 ? 38  LYS A CE    1 
ATOM   887  N NZ    . LYS E 2 37  ? 11.436  10.030  17.338  1.00 50.36 ? 38  LYS A NZ    1 
ATOM   888  N N     . VAL E 2 38  ? 5.978   10.348  23.503  1.00 33.22 ? 39  VAL A N     1 
ATOM   889  C CA    . VAL E 2 38  ? 4.828   11.160  23.869  1.00 28.26 ? 39  VAL A CA    1 
ATOM   890  C C     . VAL E 2 38  ? 5.137   12.083  25.033  1.00 25.65 ? 39  VAL A C     1 
ATOM   891  O O     . VAL E 2 38  ? 4.654   13.230  25.071  1.00 24.30 ? 39  VAL A O     1 
ATOM   892  C CB    . VAL E 2 38  ? 3.580   10.364  24.165  1.00 26.16 ? 39  VAL A CB    1 
ATOM   893  C CG1   . VAL E 2 38  ? 2.628   11.224  25.013  1.00 24.13 ? 39  VAL A CG1   1 
ATOM   894  C CG2   . VAL E 2 38  ? 2.906   9.974   22.853  1.00 26.97 ? 39  VAL A CG2   1 
ATOM   895  N N     . LEU E 2 39  ? 5.963   11.550  25.971  1.00 23.94 ? 40  LEU A N     1 
ATOM   896  C CA    . LEU E 2 39  ? 6.406   12.227  27.199  1.00 22.09 ? 40  LEU A CA    1 
ATOM   897  C C     . LEU E 2 39  ? 7.200   13.492  26.961  1.00 24.08 ? 40  LEU A C     1 
ATOM   898  O O     . LEU E 2 39  ? 6.996   14.503  27.617  1.00 23.14 ? 40  LEU A O     1 
ATOM   899  C CB    . LEU E 2 39  ? 7.229   11.287  28.041  1.00 20.33 ? 40  LEU A CB    1 
ATOM   900  C CG    . LEU E 2 39  ? 6.347   10.300  28.748  1.00 21.55 ? 40  LEU A CG    1 
ATOM   901  C CD1   . LEU E 2 39  ? 7.182   9.488   29.758  1.00 21.83 ? 40  LEU A CD1   1 
ATOM   902  C CD2   . LEU E 2 39  ? 5.198   11.056  29.404  1.00 21.84 ? 40  LEU A CD2   1 
ATOM   903  N N     . SER E 2 40  ? 8.119   13.452  26.029  1.00 26.35 ? 41  SER A N     1 
ATOM   904  C CA    . SER E 2 40  ? 8.861   14.630  25.785  1.00 28.02 ? 41  SER A CA    1 
ATOM   905  C C     . SER E 2 40  ? 7.980   15.745  25.270  1.00 28.98 ? 41  SER A C     1 
ATOM   906  O O     . SER E 2 40  ? 8.333   16.907  25.360  1.00 29.72 ? 41  SER A O     1 
ATOM   907  C CB    . SER E 2 40  ? 10.027  14.400  24.878  1.00 29.58 ? 41  SER A CB    1 
ATOM   908  O OG    . SER E 2 40  ? 10.816  15.554  24.923  1.00 31.67 ? 41  SER A OG    1 
ATOM   909  N N     . THR E 2 41  ? 6.821   15.371  24.718  1.00 29.21 ? 42  THR A N     1 
ATOM   910  C CA    . THR E 2 41  ? 5.892   16.342  24.203  1.00 29.82 ? 42  THR A CA    1 
ATOM   911  C C     . THR E 2 41  ? 5.139   16.955  25.341  1.00 29.54 ? 42  THR A C     1 
ATOM   912  O O     . THR E 2 41  ? 4.773   18.117  25.303  1.00 32.82 ? 42  THR A O     1 
ATOM   913  C CB    . THR E 2 41  ? 4.878   15.745  23.200  1.00 32.25 ? 42  THR A CB    1 
ATOM   914  O OG1   . THR E 2 41  ? 5.445   15.625  21.908  1.00 34.57 ? 42  THR A OG1   1 
ATOM   915  C CG2   . THR E 2 41  ? 3.613   16.613  23.136  1.00 31.34 ? 42  THR A CG2   1 
ATOM   916  N N     . ILE E 2 42  ? 4.902   16.151  26.363  1.00 25.75 ? 43  ILE A N     1 
ATOM   917  C CA    . ILE E 2 42  ? 4.177   16.620  27.527  1.00 22.64 ? 43  ILE A CA    1 
ATOM   918  C C     . ILE E 2 42  ? 4.923   17.679  28.324  1.00 17.29 ? 43  ILE A C     1 
ATOM   919  O O     . ILE E 2 42  ? 4.340   18.682  28.697  1.00 14.14 ? 43  ILE A O     1 
ATOM   920  C CB    . ILE E 2 42  ? 3.763   15.490  28.440  1.00 25.43 ? 43  ILE A CB    1 
ATOM   921  C CG1   . ILE E 2 42  ? 3.041   14.400  27.681  1.00 27.58 ? 43  ILE A CG1   1 
ATOM   922  C CG2   . ILE E 2 42  ? 2.879   16.023  29.552  1.00 26.35 ? 43  ILE A CG2   1 
ATOM   923  C CD1   . ILE E 2 42  ? 2.714   13.206  28.575  1.00 28.71 ? 43  ILE A CD1   1 
ATOM   924  N N     . PHE E 2 43  ? 6.228   17.432  28.600  1.00 16.14 ? 44  PHE A N     1 
ATOM   925  C CA    . PHE E 2 43  ? 7.056   18.348  29.346  1.00 16.08 ? 44  PHE A CA    1 
ATOM   926  C C     . PHE E 2 43  ? 7.107   19.653  28.645  1.00 19.79 ? 44  PHE A C     1 
ATOM   927  O O     . PHE E 2 43  ? 7.608   20.640  29.173  1.00 23.01 ? 44  PHE A O     1 
ATOM   928  C CB    . PHE E 2 43  ? 8.483   17.854  29.603  1.00 16.41 ? 44  PHE A CB    1 
ATOM   929  C CG    . PHE E 2 43  ? 8.604   16.652  30.510  1.00 18.92 ? 44  PHE A CG    1 
ATOM   930  C CD1   . PHE E 2 43  ? 7.881   16.533  31.693  1.00 19.53 ? 44  PHE A CD1   1 
ATOM   931  C CD2   . PHE E 2 43  ? 9.479   15.610  30.175  1.00 20.74 ? 44  PHE A CD2   1 
ATOM   932  C CE1   . PHE E 2 43  ? 8.019   15.411  32.509  1.00 20.08 ? 44  PHE A CE1   1 
ATOM   933  C CE2   . PHE E 2 43  ? 9.627   14.479  30.979  1.00 21.24 ? 44  PHE A CE2   1 
ATOM   934  C CZ    . PHE E 2 43  ? 8.891   14.384  32.155  1.00 20.74 ? 44  PHE A CZ    1 
ATOM   935  N N     . GLU E 2 44  ? 6.589   19.685  27.443  1.00 20.64 ? 45  GLU A N     1 
ATOM   936  C CA    . GLU E 2 44  ? 6.573   20.911  26.685  1.00 21.00 ? 45  GLU A CA    1 
ATOM   937  C C     . GLU E 2 44  ? 5.238   21.627  26.788  1.00 21.09 ? 45  GLU A C     1 
ATOM   938  O O     . GLU E 2 44  ? 5.173   22.829  26.640  1.00 20.31 ? 45  GLU A O     1 
ATOM   939  C CB    . GLU E 2 44  ? 6.961   20.680  25.264  1.00 23.49 ? 45  GLU A CB    1 
ATOM   940  C CG    . GLU E 2 44  ? 6.731   21.906  24.403  1.00 27.32 ? 45  GLU A CG    1 
ATOM   941  C CD    . GLU E 2 44  ? 7.185   21.603  23.046  1.00 30.32 ? 45  GLU A CD    1 
ATOM   942  O OE1   . GLU E 2 44  ? 8.338   21.229  22.828  1.00 31.14 ? 45  GLU A OE1   1 
ATOM   943  O OE2   . GLU E 2 44  ? 6.219   21.707  22.146  1.00 31.05 ? 45  GLU A OE2   1 
ATOM   944  N N     . LEU E 2 45  ? 4.173   20.863  27.064  1.00 23.27 ? 46  LEU A N     1 
ATOM   945  C CA    . LEU E 2 45  ? 2.852   21.428  27.244  1.00 25.13 ? 46  LEU A CA    1 
ATOM   946  C C     . LEU E 2 45  ? 2.853   22.113  28.594  1.00 26.04 ? 46  LEU A C     1 
ATOM   947  O O     . LEU E 2 45  ? 2.407   23.235  28.755  1.00 26.06 ? 46  LEU A O     1 
ATOM   948  C CB    . LEU E 2 45  ? 1.741   20.346  27.225  1.00 27.04 ? 46  LEU A CB    1 
ATOM   949  C CG    . LEU E 2 45  ? 1.475   19.757  25.843  1.00 30.18 ? 46  LEU A CG    1 
ATOM   950  C CD1   . LEU E 2 45  ? 0.378   18.706  25.926  1.00 31.22 ? 46  LEU A CD1   1 
ATOM   951  C CD2   . LEU E 2 45  ? 1.058   20.839  24.859  1.00 31.20 ? 46  LEU A CD2   1 
ATOM   952  N N     . PHE E 2 46  ? 3.408   21.381  29.571  1.00 26.49 ? 47  PHE A N     1 
ATOM   953  C CA    . PHE E 2 46  ? 3.532   21.826  30.947  1.00 26.94 ? 47  PHE A CA    1 
ATOM   954  C C     . PHE E 2 46  ? 4.341   23.108  31.050  1.00 25.35 ? 47  PHE A C     1 
ATOM   955  O O     . PHE E 2 46  ? 4.139   23.920  31.963  1.00 25.20 ? 47  PHE A O     1 
ATOM   956  C CB    . PHE E 2 46  ? 4.214   20.760  31.834  1.00 29.77 ? 47  PHE A CB    1 
ATOM   957  C CG    . PHE E 2 46  ? 3.313   19.629  32.322  1.00 33.68 ? 47  PHE A CG    1 
ATOM   958  C CD1   . PHE E 2 46  ? 3.036   19.486  33.685  1.00 34.90 ? 47  PHE A CD1   1 
ATOM   959  C CD2   . PHE E 2 46  ? 2.767   18.698  31.442  1.00 35.41 ? 47  PHE A CD2   1 
ATOM   960  C CE1   . PHE E 2 46  ? 2.218   18.451  34.148  1.00 35.28 ? 47  PHE A CE1   1 
ATOM   961  C CE2   . PHE E 2 46  ? 1.954   17.655  31.885  1.00 35.26 ? 47  PHE A CE2   1 
ATOM   962  C CZ    . PHE E 2 46  ? 1.678   17.536  33.242  1.00 35.14 ? 47  PHE A CZ    1 
ATOM   963  N N     . SER E 2 47  ? 5.272   23.275  30.124  1.00 23.42 ? 48  SER A N     1 
ATOM   964  C CA    . SER E 2 47  ? 6.134   24.445  30.156  1.00 22.25 ? 48  SER A CA    1 
ATOM   965  C C     . SER E 2 47  ? 5.558   25.759  29.603  1.00 23.00 ? 48  SER A C     1 
ATOM   966  O O     . SER E 2 47  ? 5.597   26.777  30.272  1.00 22.67 ? 48  SER A O     1 
ATOM   967  C CB    . SER E 2 47  ? 7.519   24.143  29.648  1.00 19.98 ? 48  SER A CB    1 
ATOM   968  O OG    . SER E 2 47  ? 8.133   23.203  30.503  1.00 19.21 ? 48  SER A OG    1 
ATOM   969  N N     . ARG E 2 48  ? 5.041   25.703  28.395  1.00 24.17 ? 49  ARG A N     1 
ATOM   970  C CA    . ARG E 2 48  ? 4.480   26.849  27.707  1.00 26.44 ? 49  ARG A CA    1 
ATOM   971  C C     . ARG E 2 48  ? 3.803   27.844  28.575  1.00 25.09 ? 49  ARG A C     1 
ATOM   972  O O     . ARG E 2 48  ? 4.067   29.014  28.453  1.00 26.33 ? 49  ARG A O     1 
ATOM   973  C CB    . ARG E 2 48  ? 3.604   26.499  26.511  1.00 31.64 ? 49  ARG A CB    1 
ATOM   974  C CG    . ARG E 2 48  ? 2.871   27.709  25.926  1.00 33.67 ? 49  ARG A CG    1 
ATOM   975  C CD    . ARG E 2 48  ? 2.266   27.446  24.557  1.00 34.81 ? 49  ARG A CD    1 
ATOM   976  N NE    . ARG E 2 48  ? 3.026   26.483  23.766  1.00 35.80 ? 49  ARG A NE    1 
ATOM   977  C CZ    . ARG E 2 48  ? 2.788   25.177  23.785  1.00 37.28 ? 49  ARG A CZ    1 
ATOM   978  N NH1   . ARG E 2 48  ? 1.823   24.668  24.550  1.00 38.59 ? 49  ARG A NH1   1 
ATOM   979  N NH2   . ARG E 2 48  ? 3.525   24.366  23.027  1.00 37.53 ? 49  ARG A NH2   1 
ATOM   980  N N     . PRO E 2 49  ? 2.940   27.382  29.475  1.00 24.60 ? 50  PRO A N     1 
ATOM   981  C CA    . PRO E 2 49  ? 2.248   28.306  30.349  1.00 25.49 ? 50  PRO A CA    1 
ATOM   982  C C     . PRO E 2 49  ? 3.202   29.062  31.294  1.00 26.64 ? 50  PRO A C     1 
ATOM   983  O O     . PRO E 2 49  ? 3.199   30.304  31.307  1.00 27.35 ? 50  PRO A O     1 
ATOM   984  C CB    . PRO E 2 49  ? 1.151   27.518  31.069  1.00 25.07 ? 50  PRO A CB    1 
ATOM   985  C CG    . PRO E 2 49  ? 1.367   26.053  30.735  1.00 24.62 ? 50  PRO A CG    1 
ATOM   986  C CD    . PRO E 2 49  ? 2.625   25.989  29.873  1.00 24.34 ? 50  PRO A CD    1 
ATOM   987  N N     . ILE E 2 50  ? 4.024   28.298  32.065  1.00 25.13 ? 51  ILE A N     1 
ATOM   988  C CA    . ILE E 2 50  ? 4.990   28.871  33.017  1.00 23.30 ? 51  ILE A CA    1 
ATOM   989  C C     . ILE E 2 50  ? 5.819   29.969  32.355  1.00 26.89 ? 51  ILE A C     1 
ATOM   990  O O     . ILE E 2 50  ? 5.786   31.124  32.772  1.00 28.92 ? 51  ILE A O     1 
ATOM   991  C CB    . ILE E 2 50  ? 5.940   27.820  33.608  1.00 19.64 ? 51  ILE A CB    1 
ATOM   992  C CG1   . ILE E 2 50  ? 5.212   26.634  34.200  1.00 16.81 ? 51  ILE A CG1   1 
ATOM   993  C CG2   . ILE E 2 50  ? 6.847   28.441  34.656  1.00 19.72 ? 51  ILE A CG2   1 
ATOM   994  C CD1   . ILE E 2 50  ? 6.162   25.544  34.656  1.00 14.69 ? 51  ILE A CD1   1 
ATOM   995  N N     . ILE E 2 51  ? 6.592   29.579  31.300  1.00 27.44 ? 52  ILE A N     1 
ATOM   996  C CA    . ILE E 2 51  ? 7.442   30.519  30.555  1.00 27.44 ? 52  ILE A CA    1 
ATOM   997  C C     . ILE E 2 51  ? 6.647   31.729  30.105  1.00 29.71 ? 52  ILE A C     1 
ATOM   998  O O     . ILE E 2 51  ? 7.086   32.867  30.156  1.00 30.47 ? 52  ILE A O     1 
ATOM   999  C CB    . ILE E 2 51  ? 8.087   29.858  29.333  1.00 23.61 ? 52  ILE A CB    1 
ATOM   1000 C CG1   . ILE E 2 51  ? 9.176   28.903  29.758  1.00 23.22 ? 52  ILE A CG1   1 
ATOM   1001 C CG2   . ILE E 2 51  ? 8.660   30.917  28.414  1.00 21.14 ? 52  ILE A CG2   1 
ATOM   1002 C CD1   . ILE E 2 51  ? 9.598   27.987  28.626  1.00 23.26 ? 52  ILE A CD1   1 
ATOM   1003 N N     . ASN E 2 52  ? 5.462   31.466  29.655  1.00 31.09 ? 53  ASN A N     1 
ATOM   1004 C CA    . ASN E 2 52  ? 4.625   32.517  29.211  1.00 33.32 ? 53  ASN A CA    1 
ATOM   1005 C C     . ASN E 2 52  ? 4.299   33.480  30.310  1.00 35.54 ? 53  ASN A C     1 
ATOM   1006 O O     . ASN E 2 52  ? 4.457   34.674  30.150  1.00 38.03 ? 53  ASN A O     1 
ATOM   1007 C CB    . ASN E 2 52  ? 3.354   31.999  28.562  1.00 33.48 ? 53  ASN A CB    1 
ATOM   1008 C CG    . ASN E 2 52  ? 3.466   32.190  27.096  1.00 34.75 ? 53  ASN A CG    1 
ATOM   1009 O OD1   . ASN E 2 52  ? 3.550   33.336  26.640  1.00 35.02 ? 53  ASN A OD1   1 
ATOM   1010 N ND2   . ASN E 2 52  ? 3.513   31.092  26.357  1.00 36.10 ? 53  ASN A ND2   1 
ATOM   1011 N N     . LYS E 2 53  ? 3.825   32.954  31.429  1.00 34.89 ? 54  LYS A N     1 
ATOM   1012 C CA    . LYS E 2 53  ? 3.435   33.758  32.567  1.00 34.92 ? 54  LYS A CA    1 
ATOM   1013 C C     . LYS E 2 53  ? 4.532   34.586  33.197  1.00 35.12 ? 54  LYS A C     1 
ATOM   1014 O O     . LYS E 2 53  ? 4.297   35.748  33.550  1.00 36.17 ? 54  LYS A O     1 
ATOM   1015 C CB    . LYS E 2 53  ? 2.628   32.978  33.595  1.00 35.43 ? 54  LYS A CB    1 
ATOM   1016 C CG    . LYS E 2 53  ? 3.347   32.755  34.920  1.00 35.42 ? 54  LYS A CG    1 
ATOM   1017 C CD    . LYS E 2 53  ? 2.446   32.111  35.967  1.00 35.21 ? 54  LYS A CD    1 
ATOM   1018 C CE    . LYS E 2 53  ? 2.606   30.598  36.064  1.00 34.78 ? 54  LYS A CE    1 
ATOM   1019 N NZ    . LYS E 2 53  ? 3.639   30.184  37.047  1.00 33.44 ? 54  LYS A NZ    1 
ATOM   1020 N N     . ILE E 2 54  ? 5.717   33.997  33.357  1.00 33.33 ? 55  ILE A N     1 
ATOM   1021 C CA    . ILE E 2 54  ? 6.818   34.706  33.975  1.00 31.33 ? 55  ILE A CA    1 
ATOM   1022 C C     . ILE E 2 54  ? 7.448   35.724  33.075  1.00 29.60 ? 55  ILE A C     1 
ATOM   1023 O O     . ILE E 2 54  ? 8.090   36.664  33.531  1.00 28.36 ? 55  ILE A O     1 
ATOM   1024 C CB    . ILE E 2 54  ? 7.820   33.798  34.656  1.00 32.75 ? 55  ILE A CB    1 
ATOM   1025 C CG1   . ILE E 2 54  ? 7.272   33.456  36.032  1.00 33.88 ? 55  ILE A CG1   1 
ATOM   1026 C CG2   . ILE E 2 54  ? 9.182   34.483  34.791  1.00 32.29 ? 55  ILE A CG2   1 
ATOM   1027 C CD1   . ILE E 2 54  ? 7.226   34.666  36.951  1.00 34.40 ? 55  ILE A CD1   1 
ATOM   1028 N N     . ALA E 2 55  ? 7.244   35.541  31.770  1.00 30.16 ? 56  ALA A N     1 
ATOM   1029 C CA    . ALA E 2 55  ? 7.793   36.481  30.812  1.00 29.12 ? 56  ALA A CA    1 
ATOM   1030 C C     . ALA E 2 55  ? 6.952   37.722  30.805  1.00 29.61 ? 56  ALA A C     1 
ATOM   1031 O O     . ALA E 2 55  ? 7.452   38.797  31.018  1.00 30.49 ? 56  ALA A O     1 
ATOM   1032 C CB    . ALA E 2 55  ? 7.908   35.892  29.417  1.00 27.74 ? 56  ALA A CB    1 
ATOM   1033 N N     . GLU E 2 56  ? 5.671   37.531  30.568  1.00 31.50 ? 57  GLU A N     1 
ATOM   1034 C CA    . GLU E 2 56  ? 4.722   38.622  30.529  1.00 36.36 ? 57  GLU A CA    1 
ATOM   1035 C C     . GLU E 2 56  ? 4.835   39.521  31.738  1.00 36.53 ? 57  GLU A C     1 
ATOM   1036 O O     . GLU E 2 56  ? 4.580   40.715  31.660  1.00 35.91 ? 57  GLU A O     1 
ATOM   1037 C CB    . GLU E 2 56  ? 3.272   38.136  30.388  1.00 42.63 ? 57  GLU A CB    1 
ATOM   1038 C CG    . GLU E 2 56  ? 2.254   39.203  30.857  1.00 48.41 ? 57  GLU A CG    1 
ATOM   1039 C CD    . GLU E 2 56  ? 0.840   38.702  30.973  1.00 53.63 ? 57  GLU A CD    1 
ATOM   1040 O OE1   . GLU E 2 56  ? 0.123   38.972  31.918  1.00 55.36 ? 57  GLU A OE1   1 
ATOM   1041 O OE2   . GLU E 2 56  ? 0.449   37.953  29.944  1.00 55.45 ? 57  GLU A OE2   1 
ATOM   1042 N N     . LYS E 2 57  ? 5.201   38.948  32.862  1.00 37.88 ? 58  LYS A N     1 
ATOM   1043 C CA    . LYS E 2 57  ? 5.332   39.728  34.077  1.00 39.21 ? 58  LYS A CA    1 
ATOM   1044 C C     . LYS E 2 57  ? 6.698   40.389  34.174  1.00 38.50 ? 58  LYS A C     1 
ATOM   1045 O O     . LYS E 2 57  ? 7.177   40.723  35.260  1.00 39.62 ? 58  LYS A O     1 
ATOM   1046 C CB    . LYS E 2 57  ? 4.967   38.932  35.331  1.00 39.96 ? 58  LYS A CB    1 
ATOM   1047 C CG    . LYS E 2 57  ? 6.148   38.216  35.955  1.00 40.91 ? 58  LYS A CG    1 
ATOM   1048 C CD    . LYS E 2 57  ? 5.844   37.683  37.343  1.00 42.12 ? 58  LYS A CD    1 
ATOM   1049 C CE    . LYS E 2 57  ? 6.845   38.168  38.397  1.00 42.19 ? 58  LYS A CE    1 
ATOM   1050 N NZ    . LYS E 2 57  ? 8.253   38.057  37.960  1.00 41.26 ? 58  LYS A NZ    1 
ATOM   1051 N N     . HIS E 2 58  ? 7.300   40.564  33.010  1.00 36.16 ? 59  HIS A N     1 
ATOM   1052 C CA    . HIS E 2 58  ? 8.606   41.161  32.888  1.00 35.69 ? 59  HIS A CA    1 
ATOM   1053 C C     . HIS E 2 58  ? 8.697   41.909  31.583  1.00 36.80 ? 59  HIS A C     1 
ATOM   1054 O O     . HIS E 2 58  ? 9.789   42.220  31.095  1.00 35.39 ? 59  HIS A O     1 
ATOM   1055 C CB    . HIS E 2 58  ? 9.690   40.102  32.907  1.00 36.05 ? 59  HIS A CB    1 
ATOM   1056 C CG    . HIS E 2 58  ? 10.185  39.712  34.251  1.00 37.82 ? 59  HIS A CG    1 
ATOM   1057 N ND1   . HIS E 2 58  ? 11.478  40.007  34.656  1.00 39.37 ? 59  HIS A ND1   1 
ATOM   1058 C CD2   . HIS E 2 58  ? 9.571   39.036  35.247  1.00 39.18 ? 59  HIS A CD2   1 
ATOM   1059 C CE1   . HIS E 2 58  ? 11.626  39.521  35.884  1.00 40.09 ? 59  HIS A CE1   1 
ATOM   1060 N NE2   . HIS E 2 58  ? 10.494  38.932  36.263  1.00 40.20 ? 59  HIS A NE2   1 
ATOM   1061 N N     . GLY E 2 59  ? 7.512   42.180  31.024  1.00 39.33 ? 60  GLY A N     1 
ATOM   1062 C CA    . GLY E 2 59  ? 7.366   42.888  29.764  1.00 42.28 ? 60  GLY A CA    1 
ATOM   1063 C C     . GLY E 2 59  ? 8.189   42.284  28.645  1.00 44.51 ? 60  GLY A C     1 
ATOM   1064 O O     . GLY E 2 59  ? 9.106   42.920  28.118  1.00 45.65 ? 60  GLY A O     1 
ATOM   1065 N N     . TYR E 2 60  ? 7.856   41.034  28.292  1.00 44.47 ? 61  TYR A N     1 
ATOM   1066 C CA    . TYR E 2 60  ? 8.531   40.286  27.244  1.00 43.65 ? 61  TYR A CA    1 
ATOM   1067 C C     . TYR E 2 60  ? 7.531   39.553  26.370  1.00 45.09 ? 61  TYR A C     1 
ATOM   1068 O O     . TYR E 2 60  ? 6.692   38.781  26.833  1.00 45.63 ? 61  TYR A O     1 
ATOM   1069 C CB    . TYR E 2 60  ? 9.421   39.187  27.855  1.00 42.10 ? 61  TYR A CB    1 
ATOM   1070 C CG    . TYR E 2 60  ? 10.845  39.537  28.150  1.00 41.62 ? 61  TYR A CG    1 
ATOM   1071 C CD1   . TYR E 2 60  ? 11.893  38.924  27.463  1.00 41.33 ? 61  TYR A CD1   1 
ATOM   1072 C CD2   . TYR E 2 60  ? 11.164  40.437  29.166  1.00 43.83 ? 61  TYR A CD2   1 
ATOM   1073 C CE1   . TYR E 2 60  ? 13.224  39.219  27.745  1.00 43.04 ? 61  TYR A CE1   1 
ATOM   1074 C CE2   . TYR E 2 60  ? 12.492  40.747  29.462  1.00 45.51 ? 61  TYR A CE2   1 
ATOM   1075 C CZ    . TYR E 2 60  ? 13.523  40.134  28.761  1.00 45.06 ? 61  TYR A CZ    1 
ATOM   1076 O OH    . TYR E 2 60  ? 14.842  40.437  29.063  1.00 45.42 ? 61  TYR A OH    1 
ATOM   1077 N N     . ILE E 2 61  ? 7.629   39.760  25.090  1.00 46.32 ? 62  ILE A N     1 
ATOM   1078 C CA    . ILE E 2 61  ? 6.755   39.076  24.178  1.00 46.40 ? 62  ILE A CA    1 
ATOM   1079 C C     . ILE E 2 61  ? 7.331   37.667  23.965  1.00 44.99 ? 62  ILE A C     1 
ATOM   1080 O O     . ILE E 2 61  ? 8.563   37.492  23.914  1.00 45.52 ? 62  ILE A O     1 
ATOM   1081 C CB    . ILE E 2 61  ? 6.670   39.848  22.892  1.00 47.64 ? 62  ILE A CB    1 
ATOM   1082 C CG1   . ILE E 2 61  ? 5.517   40.811  23.008  1.00 50.07 ? 62  ILE A CG1   1 
ATOM   1083 C CG2   . ILE E 2 61  ? 6.483   38.924  21.709  1.00 47.75 ? 62  ILE A CG2   1 
ATOM   1084 C CD1   . ILE E 2 61  ? 5.575   41.893  21.934  1.00 52.51 ? 62  ILE A CD1   1 
ATOM   1085 N N     . VAL E 2 62  ? 6.467   36.648  23.863  1.00 41.44 ? 63  VAL A N     1 
ATOM   1086 C CA    . VAL E 2 62  ? 6.969   35.295  23.670  1.00 36.62 ? 63  VAL A CA    1 
ATOM   1087 C C     . VAL E 2 62  ? 6.606   34.722  22.320  1.00 33.00 ? 63  VAL A C     1 
ATOM   1088 O O     . VAL E 2 62  ? 5.432   34.634  21.985  1.00 32.57 ? 63  VAL A O     1 
ATOM   1089 C CB    . VAL E 2 62  ? 6.627   34.355  24.833  1.00 35.46 ? 63  VAL A CB    1 
ATOM   1090 C CG1   . VAL E 2 62  ? 6.714   32.907  24.390  1.00 35.71 ? 63  VAL A CG1   1 
ATOM   1091 C CG2   . VAL E 2 62  ? 7.597   34.586  25.984  1.00 34.45 ? 63  VAL A CG2   1 
ATOM   1092 N N     . GLU E 2 63  ? 7.648   34.331  21.548  1.00 31.47 ? 64  GLU A N     1 
ATOM   1093 C CA    . GLU E 2 63  ? 7.495   33.774  20.205  1.00 31.46 ? 64  GLU A CA    1 
ATOM   1094 C C     . GLU E 2 63  ? 7.741   32.286  20.102  1.00 29.77 ? 64  GLU A C     1 
ATOM   1095 O O     . GLU E 2 63  ? 8.591   31.721  20.790  1.00 31.06 ? 64  GLU A O     1 
ATOM   1096 C CB    . GLU E 2 63  ? 8.415   34.459  19.189  1.00 34.03 ? 64  GLU A CB    1 
ATOM   1097 C CG    . GLU E 2 63  ? 8.100   35.939  18.951  1.00 37.14 ? 64  GLU A CG    1 
ATOM   1098 C CD    . GLU E 2 63  ? 8.214   36.314  17.505  1.00 40.24 ? 64  GLU A CD    1 
ATOM   1099 O OE1   . GLU E 2 63  ? 8.173   37.460  17.106  1.00 41.40 ? 64  GLU A OE1   1 
ATOM   1100 O OE2   . GLU E 2 63  ? 8.343   35.271  16.714  1.00 41.24 ? 64  GLU A OE2   1 
ATOM   1101 N N     . GLU E 2 64  ? 6.992   31.657  19.208  1.00 27.06 ? 65  GLU A N     1 
ATOM   1102 C CA    . GLU E 2 64  ? 7.114   30.224  18.951  1.00 25.69 ? 65  GLU A CA    1 
ATOM   1103 C C     . GLU E 2 64  ? 7.321   30.025  17.460  1.00 24.10 ? 65  GLU A C     1 
ATOM   1104 O O     . GLU E 2 64  ? 6.838   30.837  16.682  1.00 25.93 ? 65  GLU A O     1 
ATOM   1105 C CB    . GLU E 2 64  ? 5.924   29.420  19.498  1.00 25.80 ? 65  GLU A CB    1 
ATOM   1106 C CG    . GLU E 2 64  ? 6.018   29.237  21.015  1.00 25.49 ? 65  GLU A CG    1 
ATOM   1107 C CD    . GLU E 2 64  ? 5.127   28.155  21.523  1.00 25.08 ? 65  GLU A CD    1 
ATOM   1108 O OE1   . GLU E 2 64  ? 4.003   28.369  21.895  1.00 26.08 ? 65  GLU A OE1   1 
ATOM   1109 O OE2   . GLU E 2 64  ? 5.688   26.968  21.523  1.00 24.44 ? 65  GLU A OE2   1 
ATOM   1110 N N     . PRO E 2 65  ? 8.053   28.966  17.042  1.00 20.33 ? 66  PRO A N     1 
ATOM   1111 C CA    . PRO E 2 65  ? 8.302   28.767  15.602  1.00 20.22 ? 66  PRO A CA    1 
ATOM   1112 C C     . PRO E 2 65  ? 7.064   28.385  14.798  1.00 25.53 ? 66  PRO A C     1 
ATOM   1113 O O     . PRO E 2 65  ? 6.290   27.518  15.197  1.00 27.38 ? 66  PRO A O     1 
ATOM   1114 C CB    . PRO E 2 65  ? 9.425   27.733  15.499  1.00 16.82 ? 66  PRO A CB    1 
ATOM   1115 C CG    . PRO E 2 65  ? 9.936   27.558  16.913  1.00 16.60 ? 66  PRO A CG    1 
ATOM   1116 C CD    . PRO E 2 65  ? 8.766   27.916  17.807  1.00 17.64 ? 66  PRO A CD    1 
ATOM   1117 N N     . LYS E 2 66  ? 6.860   29.030  13.654  1.00 28.41 ? 67  LYS A N     1 
ATOM   1118 C CA    . LYS E 2 66  ? 5.693   28.688  12.870  1.00 32.50 ? 67  LYS A CA    1 
ATOM   1119 C C     . LYS E 2 66  ? 5.817   27.295  12.259  1.00 35.05 ? 67  LYS A C     1 
ATOM   1120 O O     . LYS E 2 66  ? 4.854   26.746  11.719  1.00 36.99 ? 67  LYS A O     1 
ATOM   1121 C CB    . LYS E 2 66  ? 5.344   29.739  11.809  1.00 35.10 ? 67  LYS A CB    1 
ATOM   1122 C CG    . LYS E 2 66  ? 6.163   31.020  11.899  1.00 38.23 ? 67  LYS A CG    1 
ATOM   1123 C CD    . LYS E 2 66  ? 6.117   31.872  10.620  1.00 41.22 ? 67  LYS A CD    1 
ATOM   1124 C CE    . LYS E 2 66  ? 6.926   33.177  10.697  1.00 43.09 ? 67  LYS A CE    1 
ATOM   1125 N NZ    . LYS E 2 66  ? 6.160   34.347  11.198  1.00 43.32 ? 67  LYS A NZ    1 
ATOM   1126 N N     . GLN E 2 67  ? 7.021   26.714  12.343  1.00 34.58 ? 68  GLN A N     1 
ATOM   1127 C CA    . GLN E 2 67  ? 7.271   25.400  11.803  1.00 34.08 ? 68  GLN A CA    1 
ATOM   1128 C C     . GLN E 2 67  ? 8.146   24.517  12.709  1.00 35.29 ? 68  GLN A C     1 
ATOM   1129 O O     . GLN E 2 67  ? 9.152   24.955  13.294  1.00 34.62 ? 68  GLN A O     1 
ATOM   1130 C CB    . GLN E 2 67  ? 7.909   25.520  10.421  1.00 34.31 ? 68  GLN A CB    1 
ATOM   1131 C CG    . GLN E 2 67  ? 9.310   26.149  10.511  1.00 36.98 ? 68  GLN A CG    1 
ATOM   1132 C CD    . GLN E 2 67  ? 9.537   27.279  9.527   1.00 40.03 ? 68  GLN A CD    1 
ATOM   1133 O OE1   . GLN E 2 67  ? 10.288  28.242  9.803   1.00 41.03 ? 68  GLN A OE1   1 
ATOM   1134 N NE2   . GLN E 2 67  ? 8.876   27.175  8.376   1.00 40.84 ? 68  GLN A NE2   1 
ATOM   1135 N N     . GLN E 2 68  ? 7.753   23.259  12.825  1.00 36.00 ? 69  GLN A N     1 
ATOM   1136 C CA    . GLN E 2 68  ? 8.466   22.288  13.616  1.00 35.53 ? 69  GLN A CA    1 
ATOM   1137 C C     . GLN E 2 68  ? 9.898   22.200  13.140  1.00 35.94 ? 69  GLN A C     1 
ATOM   1138 O O     . GLN E 2 68  ? 10.190  22.455  11.983  1.00 37.98 ? 69  GLN A O     1 
ATOM   1139 C CB    . GLN E 2 68  ? 7.860   20.903  13.416  1.00 35.67 ? 69  GLN A CB    1 
ATOM   1140 C CG    . GLN E 2 68  ? 6.680   20.585  14.323  1.00 38.25 ? 69  GLN A CG    1 
ATOM   1141 C CD    . GLN E 2 68  ? 6.192   19.168  14.091  1.00 40.58 ? 69  GLN A CD    1 
ATOM   1142 O OE1   . GLN E 2 68  ? 6.870   18.197  14.490  1.00 41.03 ? 69  GLN A OE1   1 
ATOM   1143 N NE2   . GLN E 2 68  ? 5.025   19.040  13.442  1.00 40.85 ? 69  GLN A NE2   1 
ATOM   1144 N N     . ASN E 2 69  ? 10.788  21.826  14.014  1.00 34.25 ? 70  ASN A N     1 
ATOM   1145 C CA    . ASN E 2 69  ? 12.167  21.683  13.609  1.00 33.61 ? 70  ASN A CA    1 
ATOM   1146 C C     . ASN E 2 69  ? 12.938  22.981  13.436  1.00 31.27 ? 70  ASN A C     1 
ATOM   1147 O O     . ASN E 2 69  ? 13.819  23.076  12.600  1.00 33.34 ? 70  ASN A O     1 
ATOM   1148 C CB    . ASN E 2 69  ? 12.341  20.728  12.407  1.00 36.09 ? 70  ASN A CB    1 
ATOM   1149 C CG    . ASN E 2 69  ? 11.802  19.319  12.690  1.00 38.99 ? 70  ASN A CG    1 
ATOM   1150 O OD1   . ASN E 2 69  ? 12.033  18.746  13.783  1.00 41.70 ? 70  ASN A OD1   1 
ATOM   1151 N ND2   . ASN E 2 69  ? 11.080  18.746  11.719  1.00 37.39 ? 70  ASN A ND2   1 
ATOM   1152 N N     . HIS E 2 70  ? 12.617  23.968  14.252  1.00 27.27 ? 71  HIS A N     1 
ATOM   1153 C CA    . HIS E 2 70  ? 13.283  25.249  14.220  1.00 24.08 ? 71  HIS A CA    1 
ATOM   1154 C C     . HIS E 2 70  ? 13.628  25.687  15.615  1.00 23.77 ? 71  HIS A C     1 
ATOM   1155 O O     . HIS E 2 70  ? 12.859  25.488  16.547  1.00 26.02 ? 71  HIS A O     1 
ATOM   1156 C CB    . HIS E 2 70  ? 12.425  26.316  13.564  1.00 23.92 ? 71  HIS A CB    1 
ATOM   1157 C CG    . HIS E 2 70  ? 12.489  26.212  12.098  1.00 24.26 ? 71  HIS A CG    1 
ATOM   1158 N ND1   . HIS E 2 70  ? 13.064  27.207  11.333  1.00 24.68 ? 71  HIS A ND1   1 
ATOM   1159 C CD2   . HIS E 2 70  ? 12.055  25.225  11.288  1.00 23.29 ? 71  HIS A CD2   1 
ATOM   1160 C CE1   . HIS E 2 70  ? 12.963  26.801  10.080  1.00 24.25 ? 71  HIS A CE1   1 
ATOM   1161 N NE2   . HIS E 2 70  ? 12.362  25.615  10.022  1.00 23.71 ? 71  HIS A NE2   1 
ATOM   1162 N N     . TYR E 2 71  ? 14.787  26.292  15.769  1.00 21.15 ? 72  TYR A N     1 
ATOM   1163 C CA    . TYR E 2 71  ? 15.208  26.730  17.081  1.00 18.17 ? 72  TYR A CA    1 
ATOM   1164 C C     . TYR E 2 71  ? 14.844  28.170  17.351  1.00 16.33 ? 72  TYR A C     1 
ATOM   1165 O O     . TYR E 2 71  ? 14.955  29.006  16.470  1.00 16.75 ? 72  TYR A O     1 
ATOM   1166 C CB    . TYR E 2 71  ? 16.697  26.435  17.254  1.00 16.18 ? 72  TYR A CB    1 
ATOM   1167 C CG    . TYR E 2 71  ? 17.393  27.000  18.456  1.00 15.58 ? 72  TYR A CG    1 
ATOM   1168 C CD1   . TYR E 2 71  ? 17.619  28.377  18.566  1.00 15.05 ? 72  TYR A CD1   1 
ATOM   1169 C CD2   . TYR E 2 71  ? 17.881  26.172  19.459  1.00 16.56 ? 72  TYR A CD2   1 
ATOM   1170 C CE1   . TYR E 2 71  ? 18.299  28.911  19.671  1.00 14.84 ? 72  TYR A CE1   1 
ATOM   1171 C CE2   . TYR E 2 71  ? 18.562  26.682  20.558  1.00 17.15 ? 72  TYR A CE2   1 
ATOM   1172 C CZ    . TYR E 2 71  ? 18.775  28.059  20.661  1.00 16.08 ? 72  TYR A CZ    1 
ATOM   1173 O OH    . TYR E 2 71  ? 19.438  28.584  21.728  1.00 16.29 ? 72  TYR A OH    1 
ATOM   1174 N N     . PRO E 2 72  ? 14.408  28.457  18.585  1.00 13.90 ? 73  PRO A N     1 
ATOM   1175 C CA    . PRO E 2 72  ? 14.277  27.462  19.620  1.00 11.87 ? 73  PRO A CA    1 
ATOM   1176 C C     . PRO E 2 72  ? 12.832  27.359  20.018  1.00 10.55 ? 73  PRO A C     1 
ATOM   1177 O O     . PRO E 2 72  ? 12.000  28.003  19.420  1.00 10.75 ? 73  PRO A O     1 
ATOM   1178 C CB    . PRO E 2 72  ? 15.139  27.963  20.764  1.00 12.16 ? 73  PRO A CB    1 
ATOM   1179 C CG    . PRO E 2 72  ? 15.179  29.468  20.610  1.00 12.45 ? 73  PRO A CG    1 
ATOM   1180 C CD    . PRO E 2 72  ? 14.567  29.770  19.241  1.00 12.88 ? 73  PRO A CD    1 
ATOM   1181 N N     . ASP E 2 73  ? 12.531  26.539  21.021  1.00 11.01 ? 74  ASP A N     1 
ATOM   1182 C CA    . ASP E 2 73  ? 11.168  26.371  21.445  1.00 11.94 ? 74  ASP A CA    1 
ATOM   1183 C C     . ASP E 2 73  ? 10.483  27.653  21.735  1.00 13.54 ? 74  ASP A C     1 
ATOM   1184 O O     . ASP E 2 73  ? 9.357   27.828  21.323  1.00 13.75 ? 74  ASP A O     1 
ATOM   1185 C CB    . ASP E 2 73  ? 10.926  25.281  22.513  1.00 14.87 ? 74  ASP A CB    1 
ATOM   1186 C CG    . ASP E 2 73  ? 11.736  24.015  22.294  1.00 20.14 ? 74  ASP A CG    1 
ATOM   1187 O OD1   . ASP E 2 73  ? 12.544  23.888  21.394  1.00 22.72 ? 74  ASP A OD1   1 
ATOM   1188 O OD2   . ASP E 2 73  ? 11.507  23.068  23.181  1.00 22.03 ? 74  ASP A OD2   1 
ATOM   1189 N N     . PHE E 2 74  ? 11.172  28.576  22.435  1.00 16.90 ? 75  PHE A N     1 
ATOM   1190 C CA    . PHE E 2 74  ? 10.591  29.882  22.776  1.00 18.97 ? 75  PHE A CA    1 
ATOM   1191 C C     . PHE E 2 74  ? 11.597  31.044  22.673  1.00 21.82 ? 75  PHE A C     1 
ATOM   1192 O O     . PHE E 2 74  ? 12.687  30.980  23.226  1.00 23.20 ? 75  PHE A O     1 
ATOM   1193 C CB    . PHE E 2 74  ? 9.956   29.874  24.197  1.00 18.33 ? 75  PHE A CB    1 
ATOM   1194 C CG    . PHE E 2 74  ? 8.956   28.752  24.460  1.00 16.75 ? 75  PHE A CG    1 
ATOM   1195 C CD1   . PHE E 2 74  ? 7.590   28.958  24.287  1.00 16.05 ? 75  PHE A CD1   1 
ATOM   1196 C CD2   . PHE E 2 74  ? 9.393   27.494  24.891  1.00 14.99 ? 75  PHE A CD2   1 
ATOM   1197 C CE1   . PHE E 2 74  ? 6.666   27.932  24.525  1.00 15.34 ? 75  PHE A CE1   1 
ATOM   1198 C CE2   . PHE E 2 74  ? 8.487   26.459  25.135  1.00 14.89 ? 75  PHE A CE2   1 
ATOM   1199 C CZ    . PHE E 2 74  ? 7.116   26.690  24.955  1.00 15.15 ? 75  PHE A CZ    1 
ATOM   1200 N N     . THR E 2 75  ? 11.194  32.111  21.953  1.00 23.14 ? 76  THR A N     1 
ATOM   1201 C CA    . THR E 2 75  ? 11.997  33.313  21.760  1.00 25.41 ? 76  THR A CA    1 
ATOM   1202 C C     . THR E 2 75  ? 11.493  34.355  22.705  1.00 25.69 ? 76  THR A C     1 
ATOM   1203 O O     . THR E 2 75  ? 10.303  34.618  22.725  1.00 25.38 ? 76  THR A O     1 
ATOM   1204 C CB    . THR E 2 75  ? 11.861  33.886  20.327  1.00 28.55 ? 76  THR A CB    1 
ATOM   1205 O OG1   . THR E 2 75  ? 12.992  33.559  19.530  1.00 30.36 ? 76  THR A OG1   1 
ATOM   1206 C CG2   . THR E 2 75  ? 11.723  35.406  20.385  1.00 28.29 ? 76  THR A CG2   1 
ATOM   1207 N N     . LEU E 2 76  ? 12.377  34.968  23.470  1.00 28.01 ? 77  LEU A N     1 
ATOM   1208 C CA    . LEU E 2 76  ? 11.912  35.995  24.396  1.00 31.37 ? 77  LEU A CA    1 
ATOM   1209 C C     . LEU E 2 76  ? 12.549  37.348  24.210  1.00 34.22 ? 77  LEU A C     1 
ATOM   1210 O O     . LEU E 2 76  ? 13.762  37.452  23.998  1.00 33.71 ? 77  LEU A O     1 
ATOM   1211 C CB    . LEU E 2 76  ? 12.129  35.589  25.862  1.00 30.53 ? 77  LEU A CB    1 
ATOM   1212 C CG    . LEU E 2 76  ? 10.906  35.024  26.511  1.00 30.75 ? 77  LEU A CG    1 
ATOM   1213 C CD1   . LEU E 2 76  ? 10.759  33.567  26.074  1.00 31.08 ? 77  LEU A CD1   1 
ATOM   1214 C CD2   . LEU E 2 76  ? 11.070  35.104  28.022  1.00 31.69 ? 77  LEU A CD2   1 
ATOM   1215 N N     . TYR E 2 77  ? 11.738  38.391  24.325  1.00 37.17 ? 78  TYR A N     1 
ATOM   1216 C CA    . TYR E 2 77  ? 12.282  39.712  24.210  1.00 41.10 ? 78  TYR A CA    1 
ATOM   1217 C C     . TYR E 2 77  ? 11.342  40.819  24.640  1.00 44.71 ? 78  TYR A C     1 
ATOM   1218 O O     . TYR E 2 77  ? 10.148  40.612  24.859  1.00 44.84 ? 78  TYR A O     1 
ATOM   1219 C CB    . TYR E 2 77  ? 12.932  39.999  22.860  1.00 41.83 ? 78  TYR A CB    1 
ATOM   1220 C CG    . TYR E 2 77  ? 11.953  39.888  21.748  1.00 42.98 ? 78  TYR A CG    1 
ATOM   1221 C CD1   . TYR E 2 77  ? 11.795  38.678  21.060  1.00 44.32 ? 78  TYR A CD1   1 
ATOM   1222 C CD2   . TYR E 2 77  ? 11.179  40.978  21.375  1.00 44.07 ? 78  TYR A CD2   1 
ATOM   1223 C CE1   . TYR E 2 77  ? 10.879  38.558  20.018  1.00 45.42 ? 78  TYR A CE1   1 
ATOM   1224 C CE2   . TYR E 2 77  ? 10.257  40.875  20.333  1.00 45.47 ? 78  TYR A CE2   1 
ATOM   1225 C CZ    . TYR E 2 77  ? 10.108  39.665  19.665  1.00 46.09 ? 78  TYR A CZ    1 
ATOM   1226 O OH    . TYR E 2 77  ? 9.207   39.553  18.643  1.00 47.25 ? 78  TYR A OH    1 
ATOM   1227 N N     . LYS E 2 78  ? 11.952  42.013  24.769  1.00 46.89 ? 79  LYS A N     1 
ATOM   1228 C CA    . LYS E 2 78  ? 11.291  43.255  25.129  1.00 46.76 ? 79  LYS A CA    1 
ATOM   1229 C C     . LYS E 2 78  ? 11.152  44.027  23.837  1.00 45.89 ? 79  LYS A C     1 
ATOM   1230 O O     . LYS E 2 78  ? 12.157  44.528  23.316  1.00 46.52 ? 79  LYS A O     1 
ATOM   1231 C CB    . LYS E 2 78  ? 12.086  44.067  26.158  1.00 47.12 ? 79  LYS A CB    1 
ATOM   1232 C CG    . LYS E 2 78  ? 11.937  43.541  27.585  1.00 47.91 ? 79  LYS A CG    1 
ATOM   1233 C CD    . LYS E 2 78  ? 12.743  44.313  28.626  1.00 48.56 ? 79  LYS A CD    1 
ATOM   1234 C CE    . LYS E 2 78  ? 11.960  44.600  29.905  1.00 49.54 ? 79  LYS A CE    1 
ATOM   1235 N NZ    . LYS E 2 78  ? 11.769  43.414  30.773  1.00 49.40 ? 79  LYS A NZ    1 
ATOM   1236 N N     . PRO E 2 79  ? 9.924   44.067  23.316  1.00 44.57 ? 80  PRO A N     1 
ATOM   1237 C CA    . PRO E 2 79  ? 9.575   44.735  22.069  1.00 45.27 ? 80  PRO A CA    1 
ATOM   1238 C C     . PRO E 2 79  ? 10.425  45.953  21.773  1.00 48.17 ? 80  PRO A C     1 
ATOM   1239 O O     . PRO E 2 79  ? 10.841  46.208  20.642  1.00 48.45 ? 80  PRO A O     1 
ATOM   1240 C CB    . PRO E 2 79  ? 8.088   45.085  22.178  1.00 43.59 ? 80  PRO A CB    1 
ATOM   1241 C CG    . PRO E 2 79  ? 7.591   44.449  23.464  1.00 43.43 ? 80  PRO A CG    1 
ATOM   1242 C CD    . PRO E 2 79  ? 8.694   43.525  23.940  1.00 43.55 ? 80  PRO A CD    1 
ATOM   1243 N N     . SER E 2 80  ? 10.713  46.677  22.834  1.00 50.69 ? 81  SER A N     1 
ATOM   1244 C CA    . SER E 2 80  ? 11.510  47.863  22.770  1.00 53.76 ? 81  SER A CA    1 
ATOM   1245 C C     . SER E 2 80  ? 12.867  47.601  22.159  1.00 54.55 ? 81  SER A C     1 
ATOM   1246 O O     . SER E 2 80  ? 13.321  48.373  21.304  1.00 55.03 ? 81  SER A O     1 
ATOM   1247 C CB    . SER E 2 80  ? 11.675  48.484  24.145  1.00 56.73 ? 81  SER A CB    1 
ATOM   1248 O OG    . SER E 2 80  ? 10.481  49.153  24.525  1.00 58.74 ? 81  SER A OG    1 
ATOM   1249 N N     . GLU E 2 81  ? 13.502  46.510  22.615  1.00 54.92 ? 82  GLU A N     1 
ATOM   1250 C CA    . GLU E 2 81  ? 14.833  46.096  22.159  1.00 56.11 ? 82  GLU A CA    1 
ATOM   1251 C C     . GLU E 2 81  ? 14.859  44.719  21.478  1.00 57.36 ? 82  GLU A C     1 
ATOM   1252 O O     . GLU E 2 81  ? 14.560  43.708  22.101  1.00 57.23 ? 82  GLU A O     1 
ATOM   1253 C CB    . GLU E 2 81  ? 15.822  46.152  23.342  1.00 55.83 ? 82  GLU A CB    1 
ATOM   1254 C CG    . GLU E 2 81  ? 15.140  45.770  24.679  1.00 55.41 ? 82  GLU A CG    1 
ATOM   1255 C CD    . GLU E 2 81  ? 15.303  46.813  25.746  1.00 55.27 ? 82  GLU A CD    1 
ATOM   1256 O OE1   . GLU E 2 81  ? 14.459  47.664  25.990  1.00 54.86 ? 82  GLU A OE1   1 
ATOM   1257 O OE2   . GLU E 2 81  ? 16.453  46.709  26.383  1.00 55.34 ? 82  GLU A OE2   1 
ATOM   1258 N N     . PRO E 2 82  ? 15.241  44.695  20.185  1.00 58.80 ? 83  PRO A N     1 
ATOM   1259 C CA    . PRO E 2 82  ? 15.288  43.454  19.420  1.00 59.46 ? 83  PRO A CA    1 
ATOM   1260 C C     . PRO E 2 82  ? 16.645  42.761  19.286  1.00 58.50 ? 83  PRO A C     1 
ATOM   1261 O O     . PRO E 2 82  ? 16.702  41.567  18.983  1.00 60.00 ? 83  PRO A O     1 
ATOM   1262 C CB    . PRO E 2 82  ? 14.673  43.772  18.064  1.00 60.00 ? 83  PRO A CB    1 
ATOM   1263 C CG    . PRO E 2 82  ? 14.918  45.245  17.858  1.00 60.00 ? 83  PRO A CG    1 
ATOM   1264 C CD    . PRO E 2 82  ? 15.197  45.834  19.241  1.00 59.78 ? 83  PRO A CD    1 
ATOM   1265 N N     . ASN E 2 83  ? 17.740  43.438  19.472  1.00 55.52 ? 84  ASN A N     1 
ATOM   1266 C CA    . ASN E 2 83  ? 18.964  42.682  19.324  1.00 53.31 ? 84  ASN A CA    1 
ATOM   1267 C C     . ASN E 2 83  ? 19.417  42.037  20.616  1.00 49.93 ? 84  ASN A C     1 
ATOM   1268 O O     . ASN E 2 83  ? 20.606  41.782  20.815  1.00 49.77 ? 84  ASN A O     1 
ATOM   1269 C CB    . ASN E 2 83  ? 20.073  43.462  18.636  1.00 55.68 ? 84  ASN A CB    1 
ATOM   1270 C CG    . ASN E 2 83  ? 19.788  43.581  17.171  1.00 57.88 ? 84  ASN A CG    1 
ATOM   1271 O OD1   . ASN E 2 83  ? 20.689  43.430  16.335  1.00 60.00 ? 84  ASN A OD1   1 
ATOM   1272 N ND2   . ASN E 2 83  ? 18.515  43.844  16.849  1.00 57.39 ? 84  ASN A ND2   1 
ATOM   1273 N N     . LYS E 2 84  ? 18.453  41.766  21.484  1.00 47.66 ? 85  LYS A N     1 
ATOM   1274 C CA    . LYS E 2 84  ? 18.727  41.145  22.783  1.00 46.37 ? 85  LYS A CA    1 
ATOM   1275 C C     . LYS E 2 84  ? 17.675  40.071  23.143  1.00 42.33 ? 85  LYS A C     1 
ATOM   1276 O O     . LYS E 2 84  ? 16.920  40.182  24.100  1.00 43.30 ? 85  LYS A O     1 
ATOM   1277 C CB    . LYS E 2 84  ? 18.840  42.220  23.856  1.00 47.46 ? 85  LYS A CB    1 
ATOM   1278 C CG    . LYS E 2 84  ? 20.280  42.498  24.274  1.00 47.88 ? 85  LYS A CG    1 
ATOM   1279 C CD    . LYS E 2 84  ? 20.537  43.979  24.550  1.00 48.64 ? 85  LYS A CD    1 
ATOM   1280 C CE    . LYS E 2 84  ? 21.695  44.210  25.528  1.00 48.22 ? 85  LYS A CE    1 
ATOM   1281 N NZ    . LYS E 2 84  ? 22.836  43.310  25.303  1.00 47.06 ? 85  LYS A NZ    1 
ATOM   1282 N N     . LYS E 2 85  ? 17.634  39.012  22.345  1.00 36.35 ? 86  LYS A N     1 
ATOM   1283 C CA    . LYS E 2 85  ? 16.692  37.961  22.545  1.00 30.21 ? 86  LYS A CA    1 
ATOM   1284 C C     . LYS E 2 85  ? 17.180  36.855  23.438  1.00 29.82 ? 86  LYS A C     1 
ATOM   1285 O O     . LYS E 2 85  ? 18.380  36.608  23.541  1.00 29.65 ? 86  LYS A O     1 
ATOM   1286 C CB    . LYS E 2 85  ? 16.254  37.372  21.220  1.00 26.58 ? 86  LYS A CB    1 
ATOM   1287 C CG    . LYS E 2 85  ? 15.693  38.391  20.263  1.00 25.21 ? 86  LYS A CG    1 
ATOM   1288 C CD    . LYS E 2 85  ? 14.902  37.746  19.138  1.00 26.44 ? 86  LYS A CD    1 
ATOM   1289 C CE    . LYS E 2 85  ? 14.626  38.694  17.981  1.00 27.78 ? 86  LYS A CE    1 
ATOM   1290 N NZ    . LYS E 2 85  ? 13.498  39.585  18.263  1.00 29.13 ? 86  LYS A NZ    1 
ATOM   1291 N N     . ILE E 2 86  ? 16.202  36.178  24.068  1.00 28.86 ? 87  ILE A N     1 
ATOM   1292 C CA    . ILE E 2 86  ? 16.415  35.048  24.968  1.00 25.70 ? 87  ILE A CA    1 
ATOM   1293 C C     . ILE E 2 86  ? 15.695  33.830  24.390  1.00 23.92 ? 87  ILE A C     1 
ATOM   1294 O O     . ILE E 2 86  ? 14.459  33.766  24.319  1.00 22.62 ? 87  ILE A O     1 
ATOM   1295 C CB    . ILE E 2 86  ? 15.998  35.334  26.421  1.00 23.08 ? 87  ILE A CB    1 
ATOM   1296 C CG1   . ILE E 2 86  ? 16.505  36.696  26.845  1.00 25.19 ? 87  ILE A CG1   1 
ATOM   1297 C CG2   . ILE E 2 86  ? 16.545  34.276  27.379  1.00 19.32 ? 87  ILE A CG2   1 
ATOM   1298 C CD1   . ILE E 2 86  ? 16.043  37.078  28.234  1.00 27.85 ? 87  ILE A CD1   1 
ATOM   1299 N N     . ALA E 2 87  ? 16.512  32.875  23.959  1.00 22.63 ? 88  ALA A N     1 
ATOM   1300 C CA    . ALA E 2 87  ? 16.016  31.665  23.387  1.00 21.68 ? 88  ALA A CA    1 
ATOM   1301 C C     . ALA E 2 87  ? 15.931  30.550  24.403  1.00 23.95 ? 88  ALA A C     1 
ATOM   1302 O O     . ALA E 2 87  ? 16.948  30.168  24.975  1.00 25.32 ? 88  ALA A O     1 
ATOM   1303 C CB    . ALA E 2 87  ? 16.954  31.235  22.275  1.00 20.02 ? 88  ALA A CB    1 
ATOM   1304 N N     . ILE E 2 88  ? 14.703  30.025  24.621  1.00 24.99 ? 89  ILE A N     1 
ATOM   1305 C CA    . ILE E 2 88  ? 14.488  28.911  25.560  1.00 25.08 ? 89  ILE A CA    1 
ATOM   1306 C C     . ILE E 2 88  ? 14.136  27.661  24.775  1.00 21.16 ? 89  ILE A C     1 
ATOM   1307 O O     . ILE E 2 88  ? 13.312  27.709  23.882  1.00 21.03 ? 89  ILE A O     1 
ATOM   1308 C CB    . ILE E 2 88  ? 13.479  29.173  26.678  1.00 27.70 ? 89  ILE A CB    1 
ATOM   1309 C CG1   . ILE E 2 88  ? 13.835  30.439  27.450  1.00 29.59 ? 89  ILE A CG1   1 
ATOM   1310 C CG2   . ILE E 2 88  ? 13.504  27.995  27.643  1.00 27.51 ? 89  ILE A CG2   1 
ATOM   1311 C CD1   . ILE E 2 88  ? 12.633  31.076  28.125  1.00 29.98 ? 89  ILE A CD1   1 
ATOM   1312 N N     . ASP E 2 89  ? 14.808  26.555  25.116  1.00 17.48 ? 90  ASP A N     1 
ATOM   1313 C CA    . ASP E 2 89  ? 14.656  25.257  24.486  1.00 14.98 ? 90  ASP A CA    1 
ATOM   1314 C C     . ASP E 2 89  ? 14.333  24.167  25.521  1.00 12.58 ? 90  ASP A C     1 
ATOM   1315 O O     . ASP E 2 89  ? 15.087  23.960  26.447  1.00 14.76 ? 90  ASP A O     1 
ATOM   1316 C CB    . ASP E 2 89  ? 16.030  24.899  23.863  1.00 15.85 ? 90  ASP A CB    1 
ATOM   1317 C CG    . ASP E 2 89  ? 16.045  24.628  22.371  1.00 15.23 ? 90  ASP A CG    1 
ATOM   1318 O OD1   . ASP E 2 89  ? 15.055  24.867  21.670  1.00 16.49 ? 90  ASP A OD1   1 
ATOM   1319 O OD2   . ASP E 2 89  ? 17.187  24.119  21.876  1.00 12.80 ? 90  ASP A OD2   1 
ATOM   1320 N N     . ILE E 2 90  ? 13.241  23.450  25.373  1.00 8.71  ? 91  ILE A N     1 
ATOM   1321 C CA    . ILE E 2 90  ? 12.925  22.423  26.331  1.00 8.60  ? 91  ILE A CA    1 
ATOM   1322 C C     . ILE E 2 90  ? 13.604  21.078  25.984  1.00 12.32 ? 91  ILE A C     1 
ATOM   1323 O O     . ILE E 2 90  ? 13.447  20.545  24.898  1.00 13.21 ? 91  ILE A O     1 
ATOM   1324 C CB    . ILE E 2 90  ? 11.392  22.272  26.537  1.00 7.40  ? 91  ILE A CB    1 
ATOM   1325 C CG1   . ILE E 2 90  ? 10.677  23.617  26.627  1.00 7.81  ? 91  ILE A CG1   1 
ATOM   1326 C CG2   . ILE E 2 90  ? 11.056  21.460  27.784  1.00 6.00  ? 91  ILE A CG2   1 
ATOM   1327 C CD1   . ILE E 2 90  ? 10.627  24.190  28.041  1.00 7.71  ? 91  ILE A CD1   1 
ATOM   1328 N N     . LYS E 2 91  ? 14.361  20.521  26.923  1.00 15.00 ? 92  LYS A N     1 
ATOM   1329 C CA    . LYS E 2 91  ? 15.045  19.231  26.743  1.00 16.53 ? 92  LYS A CA    1 
ATOM   1330 C C     . LYS E 2 91  ? 14.553  18.236  27.797  1.00 18.63 ? 92  LYS A C     1 
ATOM   1331 O O     . LYS E 2 91  ? 14.276  18.595  28.973  1.00 18.99 ? 92  LYS A O     1 
ATOM   1332 C CB    . LYS E 2 91  ? 16.551  19.303  26.800  1.00 17.22 ? 92  LYS A CB    1 
ATOM   1333 C CG    . LYS E 2 91  ? 17.162  20.139  25.708  1.00 19.57 ? 92  LYS A CG    1 
ATOM   1334 C CD    . LYS E 2 91  ? 16.516  19.884  24.364  1.00 22.23 ? 92  LYS A CD    1 
ATOM   1335 C CE    . LYS E 2 91  ? 17.357  20.386  23.207  1.00 24.14 ? 92  LYS A CE    1 
ATOM   1336 N NZ    . LYS E 2 91  ? 16.737  20.147  21.895  1.00 24.07 ? 92  LYS A NZ    1 
ATOM   1337 N N     . THR E 2 92  ? 14.457  16.971  27.373  1.00 17.17 ? 93  THR A N     1 
ATOM   1338 C CA    . THR E 2 92  ? 13.986  15.896  28.215  1.00 12.01 ? 93  THR A CA    1 
ATOM   1339 C C     . THR E 2 92  ? 14.841  14.638  28.195  1.00 11.68 ? 93  THR A C     1 
ATOM   1340 O O     . THR E 2 92  ? 15.449  14.280  27.193  1.00 11.86 ? 93  THR A O     1 
ATOM   1341 C CB    . THR E 2 92  ? 12.600  15.562  27.720  1.00 8.52  ? 93  THR A CB    1 
ATOM   1342 O OG1   . THR E 2 92  ? 11.700  16.358  28.420  1.00 7.55  ? 93  THR A OG1   1 
ATOM   1343 C CG2   . THR E 2 92  ? 12.297  14.105  27.938  1.00 9.87  ? 93  THR A CG2   1 
ATOM   1344 N N     . THR E 2 93  ? 14.866  13.954  29.314  1.00 11.21 ? 94  THR A N     1 
ATOM   1345 C CA    . THR E 2 93  ? 15.629  12.728  29.410  1.00 13.49 ? 94  THR A CA    1 
ATOM   1346 C C     . THR E 2 93  ? 15.158  11.837  30.516  1.00 16.27 ? 94  THR A C     1 
ATOM   1347 O O     . THR E 2 93  ? 14.475  12.274  31.410  1.00 17.48 ? 94  THR A O     1 
ATOM   1348 C CB    . THR E 2 93  ? 17.126  12.855  29.423  1.00 14.29 ? 94  THR A CB    1 
ATOM   1349 O OG1   . THR E 2 93  ? 17.600  11.534  29.443  1.00 13.99 ? 94  THR A OG1   1 
ATOM   1350 C CG2   . THR E 2 93  ? 17.578  13.564  30.696  1.00 15.72 ? 94  THR A CG2   1 
ATOM   1351 N N     . TYR E 2 94  ? 15.536  10.571  30.458  1.00 19.29 ? 95  TYR A N     1 
ATOM   1352 C CA    . TYR E 2 94  ? 15.090  9.640   31.468  1.00 24.06 ? 95  TYR A CA    1 
ATOM   1353 C C     . TYR E 2 94  ? 16.180  8.748   31.995  1.00 29.03 ? 95  TYR A C     1 
ATOM   1354 O O     . TYR E 2 94  ? 17.229  8.581   31.384  1.00 29.62 ? 95  TYR A O     1 
ATOM   1355 C CB    . TYR E 2 94  ? 13.995  8.724   30.883  1.00 24.89 ? 95  TYR A CB    1 
ATOM   1356 C CG    . TYR E 2 94  ? 14.588  7.833   29.835  1.00 25.91 ? 95  TYR A CG    1 
ATOM   1357 C CD1   . TYR E 2 94  ? 14.991  8.358   28.620  1.00 29.00 ? 95  TYR A CD1   1 
ATOM   1358 C CD2   . TYR E 2 94  ? 14.775  6.471   30.066  1.00 26.96 ? 95  TYR A CD2   1 
ATOM   1359 C CE1   . TYR E 2 94  ? 15.564  7.570   27.623  1.00 31.23 ? 95  TYR A CE1   1 
ATOM   1360 C CE2   . TYR E 2 94  ? 15.351  5.668   29.083  1.00 30.09 ? 95  TYR A CE2   1 
ATOM   1361 C CZ    . TYR E 2 94  ? 15.751  6.217   27.855  1.00 31.35 ? 95  TYR A CZ    1 
ATOM   1362 O OH    . TYR E 2 94  ? 16.310  5.421   26.884  1.00 31.47 ? 95  TYR A OH    1 
ATOM   1363 N N     . THR E 2 95  ? 15.905  8.167   33.139  1.00 33.87 ? 96  THR A N     1 
ATOM   1364 C CA    . THR E 2 95  ? 16.843  7.267   33.775  1.00 38.31 ? 96  THR A CA    1 
ATOM   1365 C C     . THR E 2 95  ? 16.163  5.930   34.020  1.00 42.29 ? 96  THR A C     1 
ATOM   1366 O O     . THR E 2 95  ? 14.947  5.867   34.219  1.00 41.05 ? 96  THR A O     1 
ATOM   1367 C CB    . THR E 2 95  ? 17.463  7.833   35.087  1.00 38.01 ? 96  THR A CB    1 
ATOM   1368 O OG1   . THR E 2 95  ? 16.440  8.302   35.942  1.00 39.07 ? 96  THR A OG1   1 
ATOM   1369 C CG2   . THR E 2 95  ? 18.413  8.979   34.778  1.00 36.47 ? 96  THR A CG2   1 
ATOM   1370 N N     . ASN E 2 96  ? 16.970  4.879   33.975  1.00 47.74 ? 97  ASN A N     1 
ATOM   1371 C CA    . ASN E 2 96  ? 16.475  3.534   34.193  1.00 53.21 ? 97  ASN A CA    1 
ATOM   1372 C C     . ASN E 2 96  ? 16.476  3.240   35.697  1.00 55.90 ? 97  ASN A C     1 
ATOM   1373 O O     . ASN E 2 96  ? 15.567  2.587   36.218  1.00 56.60 ? 97  ASN A O     1 
ATOM   1374 C CB    . ASN E 2 96  ? 17.234  2.476   33.351  1.00 55.05 ? 97  ASN A CB    1 
ATOM   1375 C CG    . ASN E 2 96  ? 16.389  1.831   32.245  1.00 55.87 ? 97  ASN A CG    1 
ATOM   1376 O OD1   . ASN E 2 96  ? 15.984  0.661   32.355  1.00 56.62 ? 97  ASN A OD1   1 
ATOM   1377 N ND2   . ASN E 2 96  ? 16.124  2.579   31.178  1.00 55.42 ? 97  ASN A ND2   1 
ATOM   1378 N N     . LYS E 2 97  ? 17.521  3.765   36.372  1.00 57.08 ? 98  LYS A N     1 
ATOM   1379 C CA    . LYS E 2 97  ? 17.703  3.638   37.812  1.00 58.53 ? 98  LYS A CA    1 
ATOM   1380 C C     . LYS E 2 97  ? 17.545  5.031   38.397  1.00 58.83 ? 98  LYS A C     1 
ATOM   1381 O O     . LYS E 2 97  ? 17.023  5.898   37.742  1.00 60.00 ? 98  LYS A O     1 
ATOM   1382 C CB    . LYS E 2 97  ? 19.050  3.033   38.192  1.00 59.58 ? 98  LYS A CB    1 
ATOM   1383 C CG    . LYS E 2 97  ? 19.082  2.444   39.606  1.00 60.00 ? 98  LYS A CG    1 
ATOM   1384 C CD    . LYS E 2 97  ? 19.804  1.098   39.702  1.00 60.00 ? 98  LYS A CD    1 
ATOM   1385 C CE    . LYS E 2 97  ? 19.294  0.223   40.853  1.00 60.00 ? 98  LYS A CE    1 
ATOM   1386 N NZ    . LYS E 2 97  ? 19.763  -1.186  40.815  1.00 60.00 ? 98  LYS A NZ    1 
ATOM   1387 N N     . GLU E 2 98  ? 17.984  5.277   39.612  1.00 58.76 ? 99  GLU A N     1 
ATOM   1388 C CA    . GLU E 2 98  ? 17.847  6.615   40.172  1.00 59.19 ? 99  GLU A CA    1 
ATOM   1389 C C     . GLU E 2 98  ? 19.207  7.260   40.422  1.00 58.86 ? 99  GLU A C     1 
ATOM   1390 O O     . GLU E 2 98  ? 20.157  6.583   40.802  1.00 60.00 ? 99  GLU A O     1 
ATOM   1391 C CB    . GLU E 2 98  ? 16.940  6.631   41.425  1.00 60.00 ? 99  GLU A CB    1 
ATOM   1392 C CG    . GLU E 2 98  ? 16.984  7.952   42.235  1.00 60.00 ? 99  GLU A CG    1 
ATOM   1393 C CD    . GLU E 2 98  ? 16.881  7.761   43.746  1.00 60.00 ? 99  GLU A CD    1 
ATOM   1394 O OE1   . GLU E 2 98  ? 17.719  7.148   44.402  1.00 60.00 ? 99  GLU A OE1   1 
ATOM   1395 O OE2   . GLU E 2 98  ? 15.806  8.318   44.273  1.00 60.00 ? 99  GLU A OE2   1 
ATOM   1396 N N     . ASN E 2 99  ? 19.316  8.565   40.210  1.00 56.88 ? 100 ASN A N     1 
ATOM   1397 C CA    . ASN E 2 99  ? 20.582  9.257   40.429  1.00 56.40 ? 100 ASN A CA    1 
ATOM   1398 C C     . ASN E 2 99  ? 21.773  8.716   39.638  1.00 54.33 ? 100 ASN A C     1 
ATOM   1399 O O     . ASN E 2 99  ? 22.878  8.501   40.159  1.00 53.28 ? 100 ASN A O     1 
ATOM   1400 C CB    . ASN E 2 99  ? 20.931  9.520   41.914  1.00 58.33 ? 100 ASN A CB    1 
ATOM   1401 C CG    . ASN E 2 99  ? 22.172  10.396  42.068  1.00 59.87 ? 100 ASN A CG    1 
ATOM   1402 O OD1   . ASN E 2 99  ? 22.336  11.407  41.355  1.00 60.00 ? 100 ASN A OD1   1 
ATOM   1403 N ND2   . ASN E 2 99  ? 23.074  10.006  42.975  1.00 59.93 ? 100 ASN A ND2   1 
ATOM   1404 N N     . GLU E 2 100 ? 21.543  8.493   38.352  1.00 52.83 ? 101 GLU A N     1 
ATOM   1405 C CA    . GLU E 2 100 ? 22.562  8.008   37.433  1.00 49.45 ? 101 GLU A CA    1 
ATOM   1406 C C     . GLU E 2 100 ? 23.112  9.242   36.790  1.00 43.62 ? 101 GLU A C     1 
ATOM   1407 O O     . GLU E 2 100 ? 22.676  10.356  37.125  1.00 43.80 ? 101 GLU A O     1 
ATOM   1408 C CB    . GLU E 2 100 ? 21.926  7.188   36.289  1.00 51.43 ? 101 GLU A CB    1 
ATOM   1409 C CG    . GLU E 2 100 ? 21.822  5.668   36.507  1.00 53.35 ? 101 GLU A CG    1 
ATOM   1410 C CD    . GLU E 2 100 ? 20.954  5.007   35.466  1.00 55.39 ? 101 GLU A CD    1 
ATOM   1411 O OE1   . GLU E 2 100 ? 20.343  5.620   34.624  1.00 56.21 ? 101 GLU A OE1   1 
ATOM   1412 O OE2   . GLU E 2 100 ? 20.924  3.709   35.556  1.00 56.64 ? 101 GLU A OE2   1 
ATOM   1413 N N     . LYS E 2 101 ? 24.045  9.051   35.858  1.00 37.87 ? 102 LYS A N     1 
ATOM   1414 C CA    . LYS E 2 101 ? 24.577  10.189  35.151  1.00 34.24 ? 102 LYS A CA    1 
ATOM   1415 C C     . LYS E 2 101 ? 23.742  10.364  33.904  1.00 29.32 ? 102 LYS A C     1 
ATOM   1416 O O     . LYS E 2 101 ? 23.432  9.409   33.197  1.00 26.26 ? 102 LYS A O     1 
ATOM   1417 C CB    . LYS E 2 101 ? 26.056  10.133  34.836  1.00 36.71 ? 102 LYS A CB    1 
ATOM   1418 C CG    . LYS E 2 101 ? 26.556  8.724   34.598  1.00 40.19 ? 102 LYS A CG    1 
ATOM   1419 C CD    . LYS E 2 101 ? 28.049  8.653   34.335  1.00 42.43 ? 102 LYS A CD    1 
ATOM   1420 C CE    . LYS E 2 101 ? 28.856  9.472   35.318  1.00 44.35 ? 102 LYS A CE    1 
ATOM   1421 N NZ    . LYS E 2 101 ? 30.282  9.520   34.971  1.00 46.01 ? 102 LYS A NZ    1 
ATOM   1422 N N     . ILE E 2 102 ? 23.329  11.590  33.672  1.00 27.60 ? 103 ILE A N     1 
ATOM   1423 C CA    . ILE E 2 102 ? 22.515  11.884  32.528  1.00 25.73 ? 103 ILE A CA    1 
ATOM   1424 C C     . ILE E 2 102 ? 23.311  12.505  31.358  1.00 25.87 ? 103 ILE A C     1 
ATOM   1425 O O     . ILE E 2 102 ? 24.531  12.728  31.410  1.00 24.67 ? 103 ILE A O     1 
ATOM   1426 C CB    . ILE E 2 102 ? 21.299  12.720  32.914  1.00 22.67 ? 103 ILE A CB    1 
ATOM   1427 C CG1   . ILE E 2 102 ? 21.757  13.954  33.685  1.00 22.33 ? 103 ILE A CG1   1 
ATOM   1428 C CG2   . ILE E 2 102 ? 20.362  11.908  33.782  1.00 20.63 ? 103 ILE A CG2   1 
ATOM   1429 C CD1   . ILE E 2 102 ? 20.600  14.782  34.212  1.00 22.16 ? 103 ILE A CD1   1 
ATOM   1430 N N     . LYS E 2 103 ? 22.594  12.776  30.291  1.00 25.80 ? 104 LYS A N     1 
ATOM   1431 C CA    . LYS E 2 103 ? 23.184  13.373  29.121  1.00 25.18 ? 104 LYS A CA    1 
ATOM   1432 C C     . LYS E 2 103 ? 22.104  13.755  28.131  1.00 25.90 ? 104 LYS A C     1 
ATOM   1433 O O     . LYS E 2 103 ? 21.186  12.991  27.868  1.00 28.54 ? 104 LYS A O     1 
ATOM   1434 C CB    . LYS E 2 103 ? 24.229  12.449  28.498  1.00 21.78 ? 104 LYS A CB    1 
ATOM   1435 C CG    . LYS E 2 103 ? 23.622  11.494  27.508  1.00 21.62 ? 104 LYS A CG    1 
ATOM   1436 C CD    . LYS E 2 103 ? 24.615  10.483  26.980  1.00 24.69 ? 104 LYS A CD    1 
ATOM   1437 C CE    . LYS E 2 103 ? 23.973  9.146   26.601  1.00 25.93 ? 104 LYS A CE    1 
ATOM   1438 N NZ    . LYS E 2 103 ? 24.267  8.708   25.225  1.00 25.14 ? 104 LYS A NZ    1 
ATOM   1439 N N     . PHE E 2 104 ? 22.205  14.949  27.585  1.00 23.26 ? 105 PHE A N     1 
ATOM   1440 C CA    . PHE E 2 104 ? 21.204  15.371  26.633  1.00 22.24 ? 105 PHE A CA    1 
ATOM   1441 C C     . PHE E 2 104 ? 21.756  15.546  25.213  1.00 23.86 ? 105 PHE A C     1 
ATOM   1442 O O     . PHE E 2 104 ? 22.908  15.251  24.891  1.00 25.76 ? 105 PHE A O     1 
ATOM   1443 C CB    . PHE E 2 104 ? 20.507  16.660  27.103  1.00 20.11 ? 105 PHE A CB    1 
ATOM   1444 C CG    . PHE E 2 104 ? 19.962  16.597  28.523  1.00 19.58 ? 105 PHE A CG    1 
ATOM   1445 C CD1   . PHE E 2 104 ? 18.590  16.485  28.768  1.00 17.66 ? 105 PHE A CD1   1 
ATOM   1446 C CD2   . PHE E 2 104 ? 20.798  16.644  29.635  1.00 20.35 ? 105 PHE A CD2   1 
ATOM   1447 C CE1   . PHE E 2 104 ? 18.066  16.437  30.053  1.00 14.70 ? 105 PHE A CE1   1 
ATOM   1448 C CE2   . PHE E 2 104 ? 20.289  16.597  30.940  1.00 17.90 ? 105 PHE A CE2   1 
ATOM   1449 C CZ    . PHE E 2 104 ? 18.919  16.493  31.153  1.00 14.41 ? 105 PHE A CZ    1 
ATOM   1450 N N     . THR E 2 105 ? 20.917  16.039  24.351  1.00 23.32 ? 106 THR A N     1 
ATOM   1451 C CA    . THR E 2 105 ? 21.273  16.318  22.975  1.00 23.44 ? 106 THR A CA    1 
ATOM   1452 C C     . THR E 2 105 ? 20.933  17.814  22.834  1.00 26.07 ? 106 THR A C     1 
ATOM   1453 O O     . THR E 2 105 ? 19.800  18.212  23.136  1.00 27.89 ? 106 THR A O     1 
ATOM   1454 C CB    . THR E 2 105 ? 20.615  15.307  21.973  1.00 21.89 ? 106 THR A CB    1 
ATOM   1455 O OG1   . THR E 2 105 ? 21.227  15.315  20.719  1.00 21.80 ? 106 THR A OG1   1 
ATOM   1456 C CG2   . THR E 2 105 ? 19.122  15.506  21.812  1.00 22.06 ? 106 THR A CG2   1 
ATOM   1457 N N     . LEU E 2 106 ? 21.894  18.682  22.480  1.00 26.91 ? 107 LEU A N     1 
ATOM   1458 C CA    . LEU E 2 106 ? 21.550  20.115  22.435  1.00 27.80 ? 107 LEU A CA    1 
ATOM   1459 C C     . LEU E 2 106 ? 21.574  20.871  21.150  1.00 29.02 ? 107 LEU A C     1 
ATOM   1460 O O     . LEU E 2 106 ? 21.927  22.049  21.163  1.00 28.81 ? 107 LEU A O     1 
ATOM   1461 C CB    . LEU E 2 106 ? 22.206  20.975  23.528  1.00 27.98 ? 107 LEU A CB    1 
ATOM   1462 C CG    . LEU E 2 106 ? 22.797  20.187  24.685  1.00 29.75 ? 107 LEU A CG    1 
ATOM   1463 C CD1   . LEU E 2 106 ? 23.769  21.070  25.483  1.00 30.63 ? 107 LEU A CD1   1 
ATOM   1464 C CD2   . LEU E 2 106 ? 21.681  19.685  25.585  1.00 29.71 ? 107 LEU A CD2   1 
ATOM   1465 N N     . GLY E 2 107 ? 21.175  20.258  20.044  1.00 30.60 ? 108 GLY A N     1 
ATOM   1466 C CA    . GLY E 2 107 ? 21.155  21.006  18.797  1.00 31.61 ? 108 GLY A CA    1 
ATOM   1467 C C     . GLY E 2 107 ? 22.087  20.513  17.736  1.00 31.49 ? 108 GLY A C     1 
ATOM   1468 O O     . GLY E 2 107 ? 22.794  19.526  17.916  1.00 33.27 ? 108 GLY A O     1 
ATOM   1469 N N     . GLY E 2 108 ? 22.068  21.221  16.618  1.00 29.76 ? 109 GLY A N     1 
ATOM   1470 C CA    . GLY E 2 108 ? 22.907  20.879  15.493  1.00 29.17 ? 109 GLY A CA    1 
ATOM   1471 C C     . GLY E 2 108 ? 24.085  21.802  15.467  1.00 29.60 ? 109 GLY A C     1 
ATOM   1472 O O     . GLY E 2 108 ? 23.924  22.981  15.718  1.00 30.79 ? 109 GLY A O     1 
ATOM   1473 N N     . TYR E 2 109 ? 25.263  21.261  15.178  1.00 29.86 ? 110 TYR A N     1 
ATOM   1474 C CA    . TYR E 2 109 ? 26.478  22.049  15.139  1.00 29.78 ? 110 TYR A CA    1 
ATOM   1475 C C     . TYR E 2 109 ? 26.837  22.543  13.751  1.00 30.81 ? 110 TYR A C     1 
ATOM   1476 O O     . TYR E 2 109 ? 27.986  22.909  13.493  1.00 31.39 ? 110 TYR A O     1 
ATOM   1477 C CB    . TYR E 2 109 ? 27.673  21.341  15.788  1.00 29.61 ? 110 TYR A CB    1 
ATOM   1478 C CG    . TYR E 2 109 ? 28.039  19.980  15.197  1.00 29.86 ? 110 TYR A CG    1 
ATOM   1479 C CD1   . TYR E 2 109 ? 27.660  18.802  15.840  1.00 29.20 ? 110 TYR A CD1   1 
ATOM   1480 C CD2   . TYR E 2 109 ? 28.799  19.876  14.033  1.00 30.86 ? 110 TYR A CD2   1 
ATOM   1481 C CE1   . TYR E 2 109 ? 28.002  17.544  15.338  1.00 29.41 ? 110 TYR A CE1   1 
ATOM   1482 C CE2   . TYR E 2 109 ? 29.161  18.634  13.506  1.00 31.02 ? 110 TYR A CE2   1 
ATOM   1483 C CZ    . TYR E 2 109 ? 28.757  17.472  14.168  1.00 30.68 ? 110 TYR A CZ    1 
ATOM   1484 O OH    . TYR E 2 109 ? 29.097  16.254  13.673  1.00 31.46 ? 110 TYR A OH    1 
ATOM   1485 N N     . THR E 2 110 ? 25.842  22.551  12.857  1.00 30.37 ? 111 THR A N     1 
ATOM   1486 C CA    . THR E 2 110 ? 26.044  22.996  11.494  1.00 29.07 ? 111 THR A CA    1 
ATOM   1487 C C     . THR E 2 110 ? 25.016  24.023  11.018  1.00 31.07 ? 111 THR A C     1 
ATOM   1488 O O     . THR E 2 110 ? 25.191  24.628  9.971   1.00 33.68 ? 111 THR A O     1 
ATOM   1489 C CB    . THR E 2 110 ? 26.091  21.802  10.543  1.00 26.62 ? 111 THR A CB    1 
ATOM   1490 O OG1   . THR E 2 110 ? 24.876  21.126  10.633  1.00 26.96 ? 111 THR A OG1   1 
ATOM   1491 C CG2   . THR E 2 110 ? 27.216  20.855  10.935  1.00 25.12 ? 111 THR A CG2   1 
ATOM   1492 N N     . SER E 2 111 ? 23.938  24.230  11.771  1.00 30.29 ? 112 SER A N     1 
ATOM   1493 C CA    . SER E 2 111 ? 22.930  25.201  11.378  1.00 29.16 ? 112 SER A CA    1 
ATOM   1494 C C     . SER E 2 111 ? 23.385  26.642  11.578  1.00 28.95 ? 112 SER A C     1 
ATOM   1495 O O     . SER E 2 111 ? 24.457  27.040  11.089  1.00 29.40 ? 112 SER A O     1 
ATOM   1496 C CB    . SER E 2 111 ? 21.620  24.971  12.098  1.00 28.33 ? 112 SER A CB    1 
ATOM   1497 O OG    . SER E 2 111 ? 20.878  24.007  11.391  1.00 28.66 ? 112 SER A OG    1 
ATOM   1498 N N     . PHE E 2 112 ? 22.543  27.406  12.317  1.00 27.30 ? 113 PHE A N     1 
ATOM   1499 C CA    . PHE E 2 112 ? 22.767  28.815  12.645  1.00 24.49 ? 113 PHE A CA    1 
ATOM   1500 C C     . PHE E 2 112 ? 24.123  29.030  13.307  1.00 27.28 ? 113 PHE A C     1 
ATOM   1501 O O     . PHE E 2 112 ? 24.813  30.017  13.050  1.00 28.99 ? 113 PHE A O     1 
ATOM   1502 C CB    . PHE E 2 112 ? 21.669  29.325  13.577  1.00 20.92 ? 113 PHE A CB    1 
ATOM   1503 C CG    . PHE E 2 112 ? 21.213  28.242  14.548  1.00 20.00 ? 113 PHE A CG    1 
ATOM   1504 C CD1   . PHE E 2 112 ? 20.198  27.351  14.207  1.00 19.58 ? 113 PHE A CD1   1 
ATOM   1505 C CD2   . PHE E 2 112 ? 21.813  28.115  15.801  1.00 19.35 ? 113 PHE A CD2   1 
ATOM   1506 C CE1   . PHE E 2 112 ? 19.777  26.364  15.094  1.00 18.72 ? 113 PHE A CE1   1 
ATOM   1507 C CE2   . PHE E 2 112 ? 21.416  27.128  16.701  1.00 18.44 ? 113 PHE A CE2   1 
ATOM   1508 C CZ    . PHE E 2 112 ? 20.391  26.252  16.348  1.00 18.05 ? 113 PHE A CZ    1 
ATOM   1509 N N     . ILE E 2 113 ? 24.505  28.083  14.162  1.00 27.63 ? 114 ILE A N     1 
ATOM   1510 C CA    . ILE E 2 113 ? 25.762  28.107  14.863  1.00 25.76 ? 114 ILE A CA    1 
ATOM   1511 C C     . ILE E 2 113 ? 26.897  28.385  13.892  1.00 26.96 ? 114 ILE A C     1 
ATOM   1512 O O     . ILE E 2 113 ? 27.915  28.974  14.246  1.00 27.26 ? 114 ILE A O     1 
ATOM   1513 C CB    . ILE E 2 113 ? 25.950  26.825  15.673  1.00 24.22 ? 114 ILE A CB    1 
ATOM   1514 C CG1   . ILE E 2 113 ? 25.567  27.096  17.126  1.00 24.29 ? 114 ILE A CG1   1 
ATOM   1515 C CG2   . ILE E 2 113 ? 27.372  26.276  15.602  1.00 23.39 ? 114 ILE A CG2   1 
ATOM   1516 C CD1   . ILE E 2 113 ? 25.982  25.958  18.064  1.00 24.34 ? 114 ILE A CD1   1 
ATOM   1517 N N     . ARG E 2 114 ? 26.688  27.971  12.632  1.00 28.27 ? 115 ARG A N     1 
ATOM   1518 C CA    . ARG E 2 114 ? 27.685  28.178  11.584  1.00 29.12 ? 115 ARG A CA    1 
ATOM   1519 C C     . ARG E 2 114 ? 27.263  29.253  10.594  1.00 32.00 ? 115 ARG A C     1 
ATOM   1520 O O     . ARG E 2 114 ? 28.018  30.184  10.350  1.00 33.28 ? 115 ARG A O     1 
ATOM   1521 C CB    . ARG E 2 114 ? 28.128  26.889  10.851  1.00 26.96 ? 115 ARG A CB    1 
ATOM   1522 C CG    . ARG E 2 114 ? 28.839  25.846  11.732  1.00 27.01 ? 115 ARG A CG    1 
ATOM   1523 C CD    . ARG E 2 114 ? 29.698  24.819  10.954  1.00 28.03 ? 115 ARG A CD    1 
ATOM   1524 N NE    . ARG E 2 114 ? 29.902  23.538  11.674  1.00 29.24 ? 115 ARG A NE    1 
ATOM   1525 C CZ    . ARG E 2 114 ? 31.066  22.837  11.783  1.00 29.99 ? 115 ARG A CZ    1 
ATOM   1526 N NH1   . ARG E 2 114 ? 32.207  23.243  11.237  1.00 29.96 ? 115 ARG A NH1   1 
ATOM   1527 N NH2   . ARG E 2 114 ? 31.071  21.691  12.478  1.00 29.97 ? 115 ARG A NH2   1 
ATOM   1528 N N     . ASN E 2 115 ? 26.055  29.142  10.022  1.00 33.79 ? 116 ASN A N     1 
ATOM   1529 C CA    . ASN E 2 115 ? 25.580  30.121  9.026   1.00 35.98 ? 116 ASN A CA    1 
ATOM   1530 C C     . ASN E 2 115 ? 24.671  31.227  9.521   1.00 37.07 ? 116 ASN A C     1 
ATOM   1531 O O     . ASN E 2 115 ? 24.183  32.007  8.730   1.00 37.75 ? 116 ASN A O     1 
ATOM   1532 C CB    . ASN E 2 115 ? 24.938  29.444  7.823   1.00 37.96 ? 116 ASN A CB    1 
ATOM   1533 C CG    . ASN E 2 115 ? 23.801  28.576  8.273   1.00 39.92 ? 116 ASN A CG    1 
ATOM   1534 O OD1   . ASN E 2 115 ? 22.800  29.078  8.807   1.00 39.26 ? 116 ASN A OD1   1 
ATOM   1535 N ND2   . ASN E 2 115 ? 23.968  27.271  8.081   1.00 41.49 ? 116 ASN A ND2   1 
ATOM   1536 N N     . ASN E 2 116 ? 24.429  31.291  10.800  1.00 37.84 ? 117 ASN A N     1 
ATOM   1537 C CA    . ASN E 2 116 ? 23.584  32.334  11.340  1.00 38.32 ? 117 ASN A CA    1 
ATOM   1538 C C     . ASN E 2 116 ? 22.098  32.286  11.018  1.00 39.83 ? 117 ASN A C     1 
ATOM   1539 O O     . ASN E 2 116 ? 21.279  32.787  11.803  1.00 40.86 ? 117 ASN A O     1 
ATOM   1540 C CB    . ASN E 2 116 ? 24.117  33.719  11.051  1.00 38.01 ? 117 ASN A CB    1 
ATOM   1541 C CG    . ASN E 2 116 ? 24.043  34.602  12.266  1.00 39.37 ? 117 ASN A CG    1 
ATOM   1542 O OD1   . ASN E 2 116 ? 24.922  34.546  13.159  1.00 39.97 ? 117 ASN A OD1   1 
ATOM   1543 N ND2   . ASN E 2 116 ? 22.995  35.414  12.317  1.00 39.09 ? 117 ASN A ND2   1 
ATOM   1544 N N     . THR E 2 117 ? 21.723  31.721  9.874   1.00 39.39 ? 118 THR A N     1 
ATOM   1545 C CA    . THR E 2 117 ? 20.311  31.705  9.559   1.00 39.09 ? 118 THR A CA    1 
ATOM   1546 C C     . THR E 2 117 ? 19.664  30.344  9.411   1.00 39.43 ? 118 THR A C     1 
ATOM   1547 O O     . THR E 2 117 ? 18.474  30.192  9.643   1.00 41.46 ? 118 THR A O     1 
ATOM   1548 C CB    . THR E 2 117 ? 20.027  32.556  8.325   1.00 39.50 ? 118 THR A CB    1 
ATOM   1549 O OG1   . THR E 2 117 ? 20.421  31.848  7.174   1.00 39.44 ? 118 THR A OG1   1 
ATOM   1550 C CG2   . THR E 2 117 ? 20.821  33.838  8.434   1.00 40.99 ? 118 THR A CG2   1 
ATOM   1551 N N     . LYS E 2 118 ? 20.432  29.349  9.013   1.00 37.70 ? 119 LYS A N     1 
ATOM   1552 C CA    . LYS E 2 118 ? 19.846  28.051  8.839   1.00 37.31 ? 119 LYS A CA    1 
ATOM   1553 C C     . LYS E 2 118 ? 19.133  27.502  10.061  1.00 38.42 ? 119 LYS A C     1 
ATOM   1554 O O     . LYS E 2 118 ? 19.712  27.335  11.134  1.00 40.47 ? 119 LYS A O     1 
ATOM   1555 C CB    . LYS E 2 118 ? 20.829  27.032  8.299   1.00 37.45 ? 119 LYS A CB    1 
ATOM   1556 C CG    . LYS E 2 118 ? 20.146  25.814  7.682   1.00 37.93 ? 119 LYS A CG    1 
ATOM   1557 C CD    . LYS E 2 118 ? 21.138  24.795  7.129   1.00 39.42 ? 119 LYS A CD    1 
ATOM   1558 C CE    . LYS E 2 118 ? 20.872  24.421  5.670   1.00 41.47 ? 119 LYS A CE    1 
ATOM   1559 N NZ    . LYS E 2 118 ? 21.848  23.466  5.098   1.00 42.67 ? 119 LYS A NZ    1 
ATOM   1560 N N     . ASN E 2 119 ? 17.865  27.215  9.881   1.00 36.67 ? 120 ASN A N     1 
ATOM   1561 C CA    . ASN E 2 119 ? 17.054  26.642  10.922  1.00 34.02 ? 120 ASN A CA    1 
ATOM   1562 C C     . ASN E 2 119 ? 16.757  27.454  12.201  1.00 34.17 ? 120 ASN A C     1 
ATOM   1563 O O     . ASN E 2 119 ? 16.071  26.961  13.082  1.00 37.46 ? 120 ASN A O     1 
ATOM   1564 C CB    . ASN E 2 119 ? 17.445  25.177  11.186  1.00 31.67 ? 120 ASN A CB    1 
ATOM   1565 C CG    . ASN E 2 119 ? 17.401  24.334  9.926   1.00 29.82 ? 120 ASN A CG    1 
ATOM   1566 O OD1   . ASN E 2 119 ? 18.416  24.198  9.206   1.00 28.84 ? 120 ASN A OD1   1 
ATOM   1567 N ND2   . ASN E 2 119 ? 16.227  23.769  9.643   1.00 28.87 ? 120 ASN A ND2   1 
ATOM   1568 N N     . ILE E 2 120 ? 17.226  28.680  12.323  1.00 30.43 ? 121 ILE A N     1 
ATOM   1569 C CA    . ILE E 2 120 ? 16.894  29.428  13.526  1.00 27.74 ? 121 ILE A CA    1 
ATOM   1570 C C     . ILE E 2 120 ? 15.682  30.375  13.262  1.00 28.54 ? 121 ILE A C     1 
ATOM   1571 O O     . ILE E 2 120 ? 15.522  30.845  12.156  1.00 29.44 ? 121 ILE A O     1 
ATOM   1572 C CB    . ILE E 2 120 ? 18.125  30.121  14.066  1.00 24.47 ? 121 ILE A CB    1 
ATOM   1573 C CG1   . ILE E 2 120 ? 17.853  30.789  15.409  1.00 22.37 ? 121 ILE A CG1   1 
ATOM   1574 C CG2   . ILE E 2 120 ? 18.608  31.124  13.043  1.00 24.55 ? 121 ILE A CG2   1 
ATOM   1575 C CD1   . ILE E 2 120 ? 19.083  30.797  16.322  1.00 21.14 ? 121 ILE A CD1   1 
ATOM   1576 N N     . VAL E 2 121 ? 14.808  30.630  14.258  1.00 28.87 ? 122 VAL A N     1 
ATOM   1577 C CA    . VAL E 2 121 ? 13.623  31.522  14.072  1.00 30.25 ? 122 VAL A CA    1 
ATOM   1578 C C     . VAL E 2 121 ? 14.012  32.954  13.731  1.00 32.09 ? 122 VAL A C     1 
ATOM   1579 O O     . VAL E 2 121 ? 13.452  33.607  12.851  1.00 31.99 ? 122 VAL A O     1 
ATOM   1580 C CB    . VAL E 2 121 ? 12.757  31.609  15.326  1.00 30.46 ? 122 VAL A CB    1 
ATOM   1581 C CG1   . VAL E 2 121 ? 11.655  32.636  15.113  1.00 28.67 ? 122 VAL A CG1   1 
ATOM   1582 C CG2   . VAL E 2 121 ? 12.128  30.280  15.692  1.00 32.88 ? 122 VAL A CG2   1 
ATOM   1583 N N     . TYR E 2 122 ? 14.984  33.432  14.477  1.00 33.15 ? 123 TYR A N     1 
ATOM   1584 C CA    . TYR E 2 122 ? 15.529  34.753  14.355  1.00 33.36 ? 123 TYR A CA    1 
ATOM   1585 C C     . TYR E 2 122 ? 17.023  34.602  14.194  1.00 30.68 ? 123 TYR A C     1 
ATOM   1586 O O     . TYR E 2 122 ? 17.601  33.703  14.766  1.00 30.81 ? 123 TYR A O     1 
ATOM   1587 C CB    . TYR E 2 122 ? 15.227  35.573  15.628  1.00 36.23 ? 123 TYR A CB    1 
ATOM   1588 C CG    . TYR E 2 122 ? 13.861  36.226  15.692  1.00 37.83 ? 123 TYR A CG    1 
ATOM   1589 C CD1   . TYR E 2 122 ? 13.639  37.452  15.068  1.00 38.42 ? 123 TYR A CD1   1 
ATOM   1590 C CD2   . TYR E 2 122 ? 12.815  35.645  16.399  1.00 38.80 ? 123 TYR A CD2   1 
ATOM   1591 C CE1   . TYR E 2 122 ? 12.398  38.081  15.126  1.00 38.67 ? 123 TYR A CE1   1 
ATOM   1592 C CE2   . TYR E 2 122 ? 11.562  36.258  16.476  1.00 38.77 ? 123 TYR A CE2   1 
ATOM   1593 C CZ    . TYR E 2 122 ? 11.359  37.484  15.833  1.00 38.55 ? 123 TYR A CZ    1 
ATOM   1594 O OH    . TYR E 2 122 ? 10.147  38.105  15.885  1.00 38.91 ? 123 TYR A OH    1 
ATOM   1595 N N     . PRO E 2 123 ? 17.644  35.462  13.436  1.00 29.08 ? 124 PRO A N     1 
ATOM   1596 C CA    . PRO E 2 123 ? 19.070  35.366  13.217  1.00 30.04 ? 124 PRO A CA    1 
ATOM   1597 C C     . PRO E 2 123 ? 19.878  35.279  14.490  1.00 32.44 ? 124 PRO A C     1 
ATOM   1598 O O     . PRO E 2 123 ? 19.907  36.202  15.281  1.00 35.17 ? 124 PRO A O     1 
ATOM   1599 C CB    . PRO E 2 123 ? 19.442  36.568  12.362  1.00 29.94 ? 124 PRO A CB    1 
ATOM   1600 C CG    . PRO E 2 123 ? 18.128  37.102  11.828  1.00 29.77 ? 124 PRO A CG    1 
ATOM   1601 C CD    . PRO E 2 123 ? 17.114  36.712  12.863  1.00 28.59 ? 124 PRO A CD    1 
ATOM   1602 N N     . PHE E 2 124 ? 20.534  34.132  14.657  1.00 31.96 ? 125 PHE A N     1 
ATOM   1603 C CA    . PHE E 2 124 ? 21.382  33.790  15.801  1.00 32.56 ? 125 PHE A CA    1 
ATOM   1604 C C     . PHE E 2 124 ? 22.104  34.968  16.451  1.00 37.30 ? 125 PHE A C     1 
ATOM   1605 O O     . PHE E 2 124 ? 22.282  35.008  17.672  1.00 38.12 ? 125 PHE A O     1 
ATOM   1606 C CB    . PHE E 2 124 ? 22.401  32.755  15.332  1.00 29.37 ? 125 PHE A CB    1 
ATOM   1607 C CG    . PHE E 2 124 ? 23.216  32.127  16.418  1.00 26.92 ? 125 PHE A CG    1 
ATOM   1608 C CD1   . PHE E 2 124 ? 24.595  32.341  16.489  1.00 26.77 ? 125 PHE A CD1   1 
ATOM   1609 C CD2   . PHE E 2 124 ? 22.639  31.275  17.351  1.00 26.32 ? 125 PHE A CD2   1 
ATOM   1610 C CE1   . PHE E 2 124 ? 25.388  31.760  17.473  1.00 25.99 ? 125 PHE A CE1   1 
ATOM   1611 C CE2   . PHE E 2 124 ? 23.417  30.678  18.341  1.00 26.90 ? 125 PHE A CE2   1 
ATOM   1612 C CZ    . PHE E 2 124 ? 24.791  30.917  18.405  1.00 26.10 ? 125 PHE A CZ    1 
ATOM   1613 N N     . ASP E 2 125 ? 22.530  35.931  15.628  1.00 40.27 ? 126 ASP A N     1 
ATOM   1614 C CA    . ASP E 2 125 ? 23.239  37.102  16.116  1.00 41.89 ? 126 ASP A CA    1 
ATOM   1615 C C     . ASP E 2 125 ? 22.376  38.017  16.965  1.00 39.43 ? 126 ASP A C     1 
ATOM   1616 O O     . ASP E 2 125 ? 22.885  38.837  17.723  1.00 39.55 ? 126 ASP A O     1 
ATOM   1617 C CB    . ASP E 2 125 ? 23.941  37.866  14.991  1.00 46.32 ? 126 ASP A CB    1 
ATOM   1618 C CG    . ASP E 2 125 ? 22.964  38.415  14.001  1.00 51.17 ? 126 ASP A CG    1 
ATOM   1619 O OD1   . ASP E 2 125 ? 22.490  39.537  14.085  1.00 53.51 ? 126 ASP A OD1   1 
ATOM   1620 O OD2   . ASP E 2 125 ? 22.676  37.563  13.050  1.00 52.36 ? 126 ASP A OD2   1 
ATOM   1621 N N     . GLN E 2 126 ? 21.065  37.874  16.843  1.00 37.46 ? 127 GLN A N     1 
ATOM   1622 C CA    . GLN E 2 126 ? 20.165  38.686  17.621  1.00 37.67 ? 127 GLN A CA    1 
ATOM   1623 C C     . GLN E 2 126 ? 19.815  38.033  18.945  1.00 38.93 ? 127 GLN A C     1 
ATOM   1624 O O     . GLN E 2 126 ? 18.982  38.542  19.678  1.00 41.16 ? 127 GLN A O     1 
ATOM   1625 C CB    . GLN E 2 126 ? 18.832  39.004  16.920  1.00 38.16 ? 127 GLN A CB    1 
ATOM   1626 C CG    . GLN E 2 126 ? 18.920  39.362  15.441  1.00 39.26 ? 127 GLN A CG    1 
ATOM   1627 C CD    . GLN E 2 126 ? 17.530  39.625  14.908  1.00 40.99 ? 127 GLN A CD    1 
ATOM   1628 O OE1   . GLN E 2 126 ? 16.622  40.023  15.666  1.00 41.79 ? 127 GLN A OE1   1 
ATOM   1629 N NE2   . GLN E 2 126 ? 17.351  39.394  13.616  1.00 41.50 ? 127 GLN A NE2   1 
ATOM   1630 N N     . TYR E 2 127 ? 20.434  36.895  19.253  1.00 37.49 ? 128 TYR A N     1 
ATOM   1631 C CA    . TYR E 2 127 ? 20.151  36.202  20.507  1.00 35.47 ? 128 TYR A CA    1 
ATOM   1632 C C     . TYR E 2 127 ? 21.274  36.353  21.542  1.00 36.68 ? 128 TYR A C     1 
ATOM   1633 O O     . TYR E 2 127 ? 22.385  35.860  21.323  1.00 37.43 ? 128 TYR A O     1 
ATOM   1634 C CB    . TYR E 2 127 ? 19.868  34.690  20.275  1.00 32.16 ? 128 TYR A CB    1 
ATOM   1635 C CG    . TYR E 2 127 ? 18.504  34.355  19.697  1.00 28.71 ? 128 TYR A CG    1 
ATOM   1636 C CD1   . TYR E 2 127 ? 17.454  33.941  20.500  1.00 25.44 ? 128 TYR A CD1   1 
ATOM   1637 C CD2   . TYR E 2 127 ? 18.278  34.443  18.321  1.00 27.01 ? 128 TYR A CD2   1 
ATOM   1638 C CE1   . TYR E 2 127 ? 16.201  33.631  19.967  1.00 22.70 ? 128 TYR A CE1   1 
ATOM   1639 C CE2   . TYR E 2 127 ? 17.039  34.132  17.762  1.00 24.03 ? 128 TYR A CE2   1 
ATOM   1640 C CZ    . TYR E 2 127 ? 16.002  33.727  18.591  1.00 21.97 ? 128 TYR A CZ    1 
ATOM   1641 O OH    . TYR E 2 127 ? 14.780  33.432  18.045  1.00 20.79 ? 128 TYR A OH    1 
ATOM   1642 N N     . ILE E 2 128 ? 20.966  37.014  22.680  1.00 36.15 ? 129 ILE A N     1 
ATOM   1643 C CA    . ILE E 2 128 ? 21.949  37.213  23.753  1.00 35.48 ? 129 ILE A CA    1 
ATOM   1644 C C     . ILE E 2 128 ? 22.132  35.987  24.685  1.00 34.13 ? 129 ILE A C     1 
ATOM   1645 O O     . ILE E 2 128 ? 23.216  35.796  25.238  1.00 35.31 ? 129 ILE A O     1 
ATOM   1646 C CB    . ILE E 2 128 ? 21.721  38.487  24.583  1.00 36.23 ? 129 ILE A CB    1 
ATOM   1647 C CG1   . ILE E 2 128 ? 20.344  38.479  25.219  1.00 36.43 ? 129 ILE A CG1   1 
ATOM   1648 C CG2   . ILE E 2 128 ? 21.856  39.728  23.715  1.00 37.34 ? 129 ILE A CG2   1 
ATOM   1649 C CD1   . ILE E 2 128 ? 19.954  39.840  25.746  1.00 36.70 ? 129 ILE A CD1   1 
ATOM   1650 N N     . ALA E 2 129 ? 21.093  35.159  24.865  1.00 31.26 ? 130 ALA A N     1 
ATOM   1651 C CA    . ALA E 2 129 ? 21.230  33.997  25.740  1.00 29.17 ? 130 ALA A CA    1 
ATOM   1652 C C     . ALA E 2 129 ? 20.520  32.724  25.225  1.00 29.11 ? 130 ALA A C     1 
ATOM   1653 O O     . ALA E 2 129 ? 19.543  32.771  24.448  1.00 30.76 ? 130 ALA A O     1 
ATOM   1654 C CB    . ALA E 2 129 ? 20.867  34.324  27.167  1.00 27.57 ? 130 ALA A CB    1 
ATOM   1655 N N     . HIS E 2 130 ? 21.029  31.577  25.669  1.00 24.51 ? 131 HIS A N     1 
ATOM   1656 C CA    . HIS E 2 130 ? 20.481  30.296  25.270  1.00 19.86 ? 131 HIS A CA    1 
ATOM   1657 C C     . HIS E 2 130 ? 20.237  29.349  26.453  1.00 14.72 ? 131 HIS A C     1 
ATOM   1658 O O     . HIS E 2 130 ? 21.095  28.568  26.871  1.00 12.05 ? 131 HIS A O     1 
ATOM   1659 C CB    . HIS E 2 130 ? 21.255  29.651  24.107  1.00 19.89 ? 131 HIS A CB    1 
ATOM   1660 C CG    . HIS E 2 130 ? 21.381  30.582  22.956  1.00 20.94 ? 131 HIS A CG    1 
ATOM   1661 N ND1   . HIS E 2 130 ? 20.284  30.901  22.165  1.00 23.44 ? 131 HIS A ND1   1 
ATOM   1662 C CD2   . HIS E 2 130 ? 22.449  31.267  22.480  1.00 21.69 ? 131 HIS A CD2   1 
ATOM   1663 C CE1   . HIS E 2 130 ? 20.710  31.760  21.233  1.00 24.05 ? 131 HIS A CE1   1 
ATOM   1664 N NE2   . HIS E 2 130 ? 22.002  31.999  21.400  1.00 23.69 ? 131 HIS A NE2   1 
ATOM   1665 N N     . TRP E 2 131 ? 19.054  29.436  26.974  1.00 12.03 ? 132 TRP A N     1 
ATOM   1666 C CA    . TRP E 2 131 ? 18.693  28.640  28.080  1.00 13.55 ? 132 TRP A CA    1 
ATOM   1667 C C     . TRP E 2 131 ? 18.205  27.271  27.713  1.00 14.51 ? 132 TRP A C     1 
ATOM   1668 O O     . TRP E 2 131 ? 17.599  27.048  26.665  1.00 16.87 ? 132 TRP A O     1 
ATOM   1669 C CB    . TRP E 2 131 ? 17.625  29.325  28.896  1.00 17.63 ? 132 TRP A CB    1 
ATOM   1670 C CG    . TRP E 2 131 ? 18.073  30.638  29.417  1.00 20.41 ? 132 TRP A CG    1 
ATOM   1671 C CD1   . TRP E 2 131 ? 19.357  31.004  29.642  1.00 20.56 ? 132 TRP A CD1   1 
ATOM   1672 C CD2   . TRP E 2 131 ? 17.250  31.737  29.764  1.00 22.23 ? 132 TRP A CD2   1 
ATOM   1673 N NE1   . TRP E 2 131 ? 19.397  32.294  30.098  1.00 21.52 ? 132 TRP A NE1   1 
ATOM   1674 C CE2   . TRP E 2 131 ? 18.106  32.771  30.188  1.00 23.16 ? 132 TRP A CE2   1 
ATOM   1675 C CE3   . TRP E 2 131 ? 15.868  31.943  29.758  1.00 22.75 ? 132 TRP A CE3   1 
ATOM   1676 C CZ2   . TRP E 2 131 ? 17.606  34.013  30.613  1.00 24.02 ? 132 TRP A CZ2   1 
ATOM   1677 C CZ3   . TRP E 2 131 ? 15.385  33.169  30.169  1.00 23.53 ? 132 TRP A CZ3   1 
ATOM   1678 C CH2   . TRP E 2 131 ? 16.241  34.188  30.593  1.00 23.65 ? 132 TRP A CH2   1 
ATOM   1679 N N     . ILE E 2 132 ? 18.456  26.364  28.626  1.00 13.47 ? 133 ILE A N     1 
ATOM   1680 C CA    . ILE E 2 132 ? 18.038  25.018  28.491  1.00 14.99 ? 133 ILE A CA    1 
ATOM   1681 C C     . ILE E 2 132 ? 17.294  24.565  29.725  1.00 18.16 ? 133 ILE A C     1 
ATOM   1682 O O     . ILE E 2 132 ? 17.870  24.437  30.786  1.00 21.36 ? 133 ILE A O     1 
ATOM   1683 C CB    . ILE E 2 132 ? 19.181  24.071  28.285  1.00 14.86 ? 133 ILE A CB    1 
ATOM   1684 C CG1   . ILE E 2 132 ? 20.081  24.517  27.135  1.00 16.42 ? 133 ILE A CG1   1 
ATOM   1685 C CG2   . ILE E 2 132 ? 18.629  22.662  28.086  1.00 14.12 ? 133 ILE A CG2   1 
ATOM   1686 C CD1   . ILE E 2 132 ? 19.408  24.461  25.765  1.00 17.55 ? 133 ILE A CD1   1 
ATOM   1687 N N     . ILE E 2 133 ? 16.014  24.318  29.590  1.00 16.41 ? 134 ILE A N     1 
ATOM   1688 C CA    . ILE E 2 133 ? 15.240  23.848  30.677  1.00 13.46 ? 134 ILE A CA    1 
ATOM   1689 C C     . ILE E 2 133 ? 15.297  22.352  30.535  1.00 15.69 ? 134 ILE A C     1 
ATOM   1690 O O     . ILE E 2 133 ? 14.822  21.787  29.565  1.00 14.89 ? 134 ILE A O     1 
ATOM   1691 C CB    . ILE E 2 133 ? 13.831  24.342  30.561  1.00 13.02 ? 134 ILE A CB    1 
ATOM   1692 C CG1   . ILE E 2 133 ? 13.732  25.782  30.998  1.00 13.74 ? 134 ILE A CG1   1 
ATOM   1693 C CG2   . ILE E 2 133 ? 12.874  23.490  31.378  1.00 13.48 ? 134 ILE A CG2   1 
ATOM   1694 C CD1   . ILE E 2 133 ? 12.401  26.395  30.555  1.00 14.70 ? 134 ILE A CD1   1 
ATOM   1695 N N     . GLY E 2 134 ? 15.902  21.699  31.480  1.00 19.99 ? 135 GLY A N     1 
ATOM   1696 C CA    . GLY E 2 134 ? 15.992  20.250  31.371  1.00 22.51 ? 135 GLY A CA    1 
ATOM   1697 C C     . GLY E 2 134 ? 15.065  19.558  32.335  1.00 23.67 ? 135 GLY A C     1 
ATOM   1698 O O     . GLY E 2 134 ? 14.763  20.075  33.422  1.00 24.66 ? 135 GLY A O     1 
ATOM   1699 N N     . TYR E 2 135 ? 14.596  18.388  31.924  1.00 23.41 ? 136 TYR A N     1 
ATOM   1700 C CA    . TYR E 2 135 ? 13.711  17.608  32.747  1.00 24.65 ? 136 TYR A CA    1 
ATOM   1701 C C     . TYR E 2 135 ? 14.200  16.183  32.792  1.00 27.69 ? 136 TYR A C     1 
ATOM   1702 O O     . TYR E 2 135 ? 14.380  15.530  31.776  1.00 29.81 ? 136 TYR A O     1 
ATOM   1703 C CB    . TYR E 2 135 ? 12.296  17.615  32.181  1.00 24.32 ? 136 TYR A CB    1 
ATOM   1704 C CG    . TYR E 2 135 ? 11.447  18.825  32.470  1.00 24.88 ? 136 TYR A CG    1 
ATOM   1705 C CD1   . TYR E 2 135 ? 10.777  18.937  33.685  1.00 25.40 ? 136 TYR A CD1   1 
ATOM   1706 C CD2   . TYR E 2 135 ? 11.270  19.820  31.513  1.00 23.87 ? 136 TYR A CD2   1 
ATOM   1707 C CE1   . TYR E 2 135 ? 9.955   20.043  33.949  1.00 24.25 ? 136 TYR A CE1   1 
ATOM   1708 C CE2   . TYR E 2 135 ? 10.467  20.935  31.757  1.00 22.59 ? 136 TYR A CE2   1 
ATOM   1709 C CZ    . TYR E 2 135 ? 9.809   21.038  32.978  1.00 22.34 ? 136 TYR A CZ    1 
ATOM   1710 O OH    . TYR E 2 135 ? 8.997   22.105  33.229  1.00 20.63 ? 136 TYR A OH    1 
ATOM   1711 N N     . VAL E 2 136 ? 14.416  15.681  33.968  1.00 28.58 ? 137 VAL A N     1 
ATOM   1712 C CA    . VAL E 2 136 ? 14.888  14.336  34.077  1.00 29.38 ? 137 VAL A CA    1 
ATOM   1713 C C     . VAL E 2 136 ? 13.816  13.500  34.727  1.00 30.85 ? 137 VAL A C     1 
ATOM   1714 O O     . VAL E 2 136 ? 13.098  13.970  35.595  1.00 31.89 ? 137 VAL A O     1 
ATOM   1715 C CB    . VAL E 2 136 ? 16.175  14.312  34.875  1.00 30.36 ? 137 VAL A CB    1 
ATOM   1716 C CG1   . VAL E 2 136 ? 16.854  12.951  34.765  1.00 30.69 ? 137 VAL A CG1   1 
ATOM   1717 C CG2   . VAL E 2 136 ? 17.091  15.426  34.380  1.00 30.95 ? 137 VAL A CG2   1 
ATOM   1718 N N     . TYR E 2 137 ? 13.684  12.274  34.283  1.00 31.24 ? 138 TYR A N     1 
ATOM   1719 C CA    . TYR E 2 137 ? 12.699  11.415  34.862  1.00 31.70 ? 138 TYR A CA    1 
ATOM   1720 C C     . TYR E 2 137 ? 13.196  10.030  34.952  1.00 33.87 ? 138 TYR A C     1 
ATOM   1721 O O     . TYR E 2 137 ? 14.155  9.663   34.264  1.00 33.76 ? 138 TYR A O     1 
ATOM   1722 C CB    . TYR E 2 137 ? 11.290  11.518  34.245  1.00 31.64 ? 138 TYR A CB    1 
ATOM   1723 C CG    . TYR E 2 137 ? 11.085  10.929  32.862  1.00 31.10 ? 138 TYR A CG    1 
ATOM   1724 C CD1   . TYR E 2 137 ? 11.532  11.590  31.718  1.00 31.38 ? 138 TYR A CD1   1 
ATOM   1725 C CD2   . TYR E 2 137 ? 10.380  9.743   32.702  1.00 30.33 ? 138 TYR A CD2   1 
ATOM   1726 C CE1   . TYR E 2 137 ? 11.322  11.056  30.439  1.00 31.09 ? 138 TYR A CE1   1 
ATOM   1727 C CE2   . TYR E 2 137 ? 10.151  9.186   31.442  1.00 29.75 ? 138 TYR A CE2   1 
ATOM   1728 C CZ    . TYR E 2 137 ? 10.622  9.847   30.310  1.00 29.79 ? 138 TYR A CZ    1 
ATOM   1729 O OH    . TYR E 2 137 ? 10.398  9.313   29.083  1.00 28.82 ? 138 TYR A OH    1 
ATOM   1730 N N     . THR E 2 138 ? 12.571  9.273   35.832  1.00 36.61 ? 139 THR A N     1 
ATOM   1731 C CA    . THR E 2 138 ? 12.958  7.896   36.032  1.00 39.50 ? 139 THR A CA    1 
ATOM   1732 C C     . THR E 2 138 ? 11.915  7.029   35.427  1.00 42.83 ? 139 THR A C     1 
ATOM   1733 O O     . THR E 2 138 ? 10.789  7.037   35.890  1.00 44.90 ? 139 THR A O     1 
ATOM   1734 C CB    . THR E 2 138 ? 13.108  7.570   37.517  1.00 39.05 ? 139 THR A CB    1 
ATOM   1735 O OG1   . THR E 2 138 ? 14.114  8.382   38.076  1.00 39.70 ? 139 THR A OG1   1 
ATOM   1736 C CG2   . THR E 2 138 ? 13.464  6.097   37.677  1.00 38.50 ? 139 THR A CG2   1 
ATOM   1737 N N     . ARG E 2 139 ? 12.308  6.288   34.386  1.00 44.52 ? 140 ARG A N     1 
ATOM   1738 C CA    . ARG E 2 139 ? 11.415  5.397   33.679  1.00 48.36 ? 140 ARG A CA    1 
ATOM   1739 C C     . ARG E 2 139 ? 10.577  4.577   34.643  1.00 52.26 ? 140 ARG A C     1 
ATOM   1740 O O     . ARG E 2 139 ? 10.917  4.474   35.820  1.00 54.94 ? 140 ARG A O     1 
ATOM   1741 C CB    . ARG E 2 139 ? 12.215  4.481   32.760  1.00 50.32 ? 140 ARG A CB    1 
ATOM   1742 C CG    . ARG E 2 139 ? 12.217  4.903   31.294  1.00 52.52 ? 140 ARG A CG    1 
ATOM   1743 C CD    . ARG E 2 139 ? 11.241  4.076   30.458  1.00 55.40 ? 140 ARG A CD    1 
ATOM   1744 N NE    . ARG E 2 139 ? 11.693  3.701   29.108  1.00 56.98 ? 140 ARG A NE    1 
ATOM   1745 C CZ    . ARG E 2 139 ? 12.806  2.993   28.806  1.00 57.71 ? 140 ARG A CZ    1 
ATOM   1746 N NH1   . ARG E 2 139 ? 13.664  2.547   29.725  1.00 57.04 ? 140 ARG A NH1   1 
ATOM   1747 N NH2   . ARG E 2 139 ? 13.054  2.738   27.527  1.00 58.48 ? 140 ARG A NH2   1 
ATOM   1748 N N     . THR E 2 149 ? -10.269 2.436   32.316  1.00 43.41 ? 150 THR A N     1 
ATOM   1749 C CA    . THR E 2 149 ? -10.835 3.749   32.175  1.00 40.13 ? 150 THR A CA    1 
ATOM   1750 C C     . THR E 2 149 ? -10.898 4.466   33.531  1.00 39.02 ? 150 THR A C     1 
ATOM   1751 O O     . THR E 2 149 ? -10.780 3.829   34.560  1.00 40.12 ? 150 THR A O     1 
ATOM   1752 C CB    . THR E 2 149 ? -12.212 3.678   31.487  1.00 39.29 ? 150 THR A CB    1 
ATOM   1753 O OG1   . THR E 2 149 ? -12.406 4.752   30.593  1.00 37.10 ? 150 THR A OG1   1 
ATOM   1754 C CG2   . THR E 2 149 ? -13.329 3.638   32.522  1.00 40.41 ? 150 THR A CG2   1 
ATOM   1755 N N     . TYR E 2 150 ? -11.073 5.787   33.544  1.00 37.78 ? 151 TYR A N     1 
ATOM   1756 C CA    . TYR E 2 150 ? -11.148 6.503   34.817  1.00 37.03 ? 151 TYR A CA    1 
ATOM   1757 C C     . TYR E 2 150 ? -12.003 7.769   34.759  1.00 36.57 ? 151 TYR A C     1 
ATOM   1758 O O     . TYR E 2 150 ? -12.224 8.334   33.679  1.00 35.51 ? 151 TYR A O     1 
ATOM   1759 C CB    . TYR E 2 150 ? -9.797  6.877   35.447  1.00 36.36 ? 151 TYR A CB    1 
ATOM   1760 C CG    . TYR E 2 150 ? -8.779  5.795   35.614  1.00 36.04 ? 151 TYR A CG    1 
ATOM   1761 C CD1   . TYR E 2 150 ? -8.396  5.381   36.887  1.00 36.57 ? 151 TYR A CD1   1 
ATOM   1762 C CD2   . TYR E 2 150 ? -8.157  5.214   34.508  1.00 37.27 ? 151 TYR A CD2   1 
ATOM   1763 C CE1   . TYR E 2 150 ? -7.423  4.402   37.073  1.00 37.87 ? 151 TYR A CE1   1 
ATOM   1764 C CE2   . TYR E 2 150 ? -7.180  4.235   34.675  1.00 38.73 ? 151 TYR A CE2   1 
ATOM   1765 C CZ    . TYR E 2 150 ? -6.812  3.829   35.955  1.00 39.76 ? 151 TYR A CZ    1 
ATOM   1766 O OH    . TYR E 2 150 ? -5.859  2.858   36.109  1.00 41.76 ? 151 TYR A OH    1 
ATOM   1767 N N     . ASN E 2 151 ? -12.453 8.191   35.967  1.00 37.93 ? 152 ASN A N     1 
ATOM   1768 C CA    . ASN E 2 151 ? -13.283 9.369   36.212  1.00 41.83 ? 152 ASN A CA    1 
ATOM   1769 C C     . ASN E 2 151 ? -12.530 10.404  37.035  1.00 42.58 ? 152 ASN A C     1 
ATOM   1770 O O     . ASN E 2 151 ? -11.637 10.046  37.793  1.00 43.95 ? 152 ASN A O     1 
ATOM   1771 C CB    . ASN E 2 151 ? -14.624 9.011   36.893  1.00 45.84 ? 152 ASN A CB    1 
ATOM   1772 C CG    . ASN E 2 151 ? -14.581 8.875   38.423  1.00 49.17 ? 152 ASN A CG    1 
ATOM   1773 O OD1   . ASN E 2 151 ? -13.513 8.756   39.060  1.00 50.11 ? 152 ASN A OD1   1 
ATOM   1774 N ND2   . ASN E 2 151 ? -15.763 8.867   39.021  1.00 50.41 ? 152 ASN A ND2   1 
ATOM   1775 N N     . ILE E 2 152 ? -12.894 11.677  36.880  1.00 42.72 ? 153 ILE A N     1 
ATOM   1776 C CA    . ILE E 2 152 ? -12.245 12.784  37.600  1.00 44.17 ? 153 ILE A CA    1 
ATOM   1777 C C     . ILE E 2 152 ? -11.908 12.505  39.053  1.00 45.10 ? 153 ILE A C     1 
ATOM   1778 O O     . ILE E 2 152 ? -11.013 13.118  39.645  1.00 44.95 ? 153 ILE A O     1 
ATOM   1779 C CB    . ILE E 2 152 ? -13.016 14.089  37.510  1.00 44.40 ? 153 ILE A CB    1 
ATOM   1780 C CG1   . ILE E 2 152 ? -12.107 15.259  37.890  1.00 42.98 ? 153 ILE A CG1   1 
ATOM   1781 C CG2   . ILE E 2 152 ? -14.194 14.033  38.487  1.00 45.53 ? 153 ILE A CG2   1 
ATOM   1782 C CD1   . ILE E 2 152 ? -10.653 15.005  37.562  1.00 42.88 ? 153 ILE A CD1   1 
ATOM   1783 N N     . ASN E 2 153 ? -12.638 11.598  39.651  1.00 46.66 ? 154 ASN A N     1 
ATOM   1784 C CA    . ASN E 2 153 ? -12.408 11.271  41.040  1.00 46.95 ? 154 ASN A CA    1 
ATOM   1785 C C     . ASN E 2 153 ? -11.187 10.396  41.245  1.00 45.91 ? 154 ASN A C     1 
ATOM   1786 O O     . ASN E 2 153 ? -10.396 10.666  42.132  1.00 47.21 ? 154 ASN A O     1 
ATOM   1787 C CB    . ASN E 2 153 ? -13.670 10.682  41.734  1.00 47.99 ? 154 ASN A CB    1 
ATOM   1788 C CG    . ASN E 2 153 ? -14.927 11.526  41.535  1.00 48.22 ? 154 ASN A CG    1 
ATOM   1789 O OD1   . ASN E 2 153 ? -15.992 11.017  41.149  1.00 48.65 ? 154 ASN A OD1   1 
ATOM   1790 N ND2   . ASN E 2 153 ? -14.815 12.824  41.817  1.00 47.81 ? 154 ASN A ND2   1 
ATOM   1791 N N     . GLU E 2 154 ? -11.055 9.353   40.416  1.00 44.58 ? 155 GLU A N     1 
ATOM   1792 C CA    . GLU E 2 154 ? -9.950  8.390   40.487  1.00 45.54 ? 155 GLU A CA    1 
ATOM   1793 C C     . GLU E 2 154 ? -8.540  8.867   40.120  1.00 47.09 ? 155 GLU A C     1 
ATOM   1794 O O     . GLU E 2 154 ? -7.629  8.040   40.095  1.00 46.98 ? 155 GLU A O     1 
ATOM   1795 C CB    . GLU E 2 154 ? -10.276 7.116   39.735  1.00 45.97 ? 155 GLU A CB    1 
ATOM   1796 C CG    . GLU E 2 154 ? -11.752 6.758   39.825  1.00 48.16 ? 155 GLU A CG    1 
ATOM   1797 C CD    . GLU E 2 154 ? -11.977 5.293   39.638  1.00 52.17 ? 155 GLU A CD    1 
ATOM   1798 O OE1   . GLU E 2 154 ? -12.296 4.545   40.551  1.00 54.36 ? 155 GLU A OE1   1 
ATOM   1799 O OE2   . GLU E 2 154 ? -11.802 4.887   38.404  1.00 53.59 ? 155 GLU A OE2   1 
ATOM   1800 N N     . LEU E 2 155 ? -8.349  10.165  39.831  1.00 48.40 ? 156 LEU A N     1 
ATOM   1801 C CA    . LEU E 2 155 ? -7.021  10.714  39.465  1.00 47.98 ? 156 LEU A CA    1 
ATOM   1802 C C     . LEU E 2 155 ? -5.891  10.157  40.313  1.00 49.18 ? 156 LEU A C     1 
ATOM   1803 O O     . LEU E 2 155 ? -4.778  9.998   39.876  1.00 49.61 ? 156 LEU A O     1 
ATOM   1804 C CB    . LEU E 2 155 ? -6.952  12.266  39.542  1.00 46.06 ? 156 LEU A CB    1 
ATOM   1805 C CG    . LEU E 2 155 ? -7.695  12.991  38.442  1.00 44.54 ? 156 LEU A CG    1 
ATOM   1806 C CD1   . LEU E 2 155 ? -7.774  14.471  38.802  1.00 44.01 ? 156 LEU A CD1   1 
ATOM   1807 C CD2   . LEU E 2 155 ? -6.969  12.816  37.118  1.00 44.39 ? 156 LEU A CD2   1 
ATOM   1808 N N     . ASN E 2 156 ? -6.167  9.862   41.541  1.00 51.28 ? 157 ASN A N     1 
ATOM   1809 C CA    . ASN E 2 156 ? -5.121  9.345   42.370  1.00 53.49 ? 157 ASN A CA    1 
ATOM   1810 C C     . ASN E 2 156 ? -4.894  7.872   42.177  1.00 52.16 ? 157 ASN A C     1 
ATOM   1811 O O     . ASN E 2 156 ? -4.037  7.291   42.840  1.00 52.51 ? 157 ASN A O     1 
ATOM   1812 C CB    . ASN E 2 156 ? -5.334  9.695   43.855  1.00 57.06 ? 157 ASN A CB    1 
ATOM   1813 C CG    . ASN E 2 156 ? -4.292  10.666  44.382  1.00 59.65 ? 157 ASN A CG    1 
ATOM   1814 O OD1   . ASN E 2 156 ? -3.102  10.595  43.990  1.00 60.00 ? 157 ASN A OD1   1 
ATOM   1815 N ND2   . ASN E 2 156 ? -4.724  11.582  45.257  1.00 60.00 ? 157 ASN A ND2   1 
ATOM   1816 N N     . GLU E 2 157 ? -5.651  7.275   41.265  1.00 50.96 ? 158 GLU A N     1 
ATOM   1817 C CA    . GLU E 2 157 ? -5.517  5.843   41.014  1.00 50.89 ? 158 GLU A CA    1 
ATOM   1818 C C     . GLU E 2 157 ? -4.824  5.508   39.709  1.00 47.29 ? 158 GLU A C     1 
ATOM   1819 O O     . GLU E 2 157 ? -4.420  4.362   39.471  1.00 47.56 ? 158 GLU A O     1 
ATOM   1820 C CB    . GLU E 2 157 ? -6.836  5.078   41.187  1.00 54.17 ? 158 GLU A CB    1 
ATOM   1821 C CG    . GLU E 2 157 ? -7.298  5.007   42.653  1.00 56.26 ? 158 GLU A CG    1 
ATOM   1822 C CD    . GLU E 2 157 ? -8.611  4.282   42.833  1.00 57.90 ? 158 GLU A CD    1 
ATOM   1823 O OE1   . GLU E 2 157 ? -9.197  4.243   43.907  1.00 58.96 ? 158 GLU A OE1   1 
ATOM   1824 O OE2   . GLU E 2 157 ? -9.057  3.701   41.721  1.00 57.16 ? 158 GLU A OE2   1 
ATOM   1825 N N     . ILE E 2 158 ? -4.680  6.503   38.860  1.00 42.79 ? 159 ILE A N     1 
ATOM   1826 C CA    . ILE E 2 158 ? -4.015  6.280   37.613  1.00 37.56 ? 159 ILE A CA    1 
ATOM   1827 C C     . ILE E 2 158 ? -2.541  6.137   37.877  1.00 35.52 ? 159 ILE A C     1 
ATOM   1828 O O     . ILE E 2 158 ? -1.883  7.108   38.243  1.00 34.91 ? 159 ILE A O     1 
ATOM   1829 C CB    . ILE E 2 158 ? -4.253  7.395   36.630  1.00 35.25 ? 159 ILE A CB    1 
ATOM   1830 C CG1   . ILE E 2 158 ? -5.712  7.403   36.231  1.00 35.99 ? 159 ILE A CG1   1 
ATOM   1831 C CG2   . ILE E 2 158 ? -3.395  7.172   35.402  1.00 34.35 ? 159 ILE A CG2   1 
ATOM   1832 C CD1   . ILE E 2 158 ? -6.052  8.525   35.267  1.00 37.00 ? 159 ILE A CD1   1 
ATOM   1833 N N     . PRO E 2 159 ? -2.036  4.935   37.722  1.00 34.87 ? 160 PRO A N     1 
ATOM   1834 C CA    . PRO E 2 159 ? -0.644  4.665   37.928  1.00 35.22 ? 160 PRO A CA    1 
ATOM   1835 C C     . PRO E 2 159 ? 0.135   5.461   36.906  1.00 35.34 ? 160 PRO A C     1 
ATOM   1836 O O     . PRO E 2 159 ? -0.121  5.333   35.697  1.00 36.33 ? 160 PRO A O     1 
ATOM   1837 C CB    . PRO E 2 159 ? -0.555  3.176   37.639  1.00 36.48 ? 160 PRO A CB    1 
ATOM   1838 C CG    . PRO E 2 159 ? -1.555  2.953   36.501  1.00 36.02 ? 160 PRO A CG    1 
ATOM   1839 C CD    . PRO E 2 159 ? -2.504  4.139   36.565  1.00 35.34 ? 160 PRO A CD    1 
ATOM   1840 N N     . LYS E 2 160 ? 1.065   6.296   37.362  1.00 34.67 ? 161 LYS A N     1 
ATOM   1841 C CA    . LYS E 2 160 ? 1.830   7.116   36.443  1.00 34.58 ? 161 LYS A CA    1 
ATOM   1842 C C     . LYS E 2 160 ? 2.792   6.336   35.582  1.00 33.76 ? 161 LYS A C     1 
ATOM   1843 O O     . LYS E 2 160 ? 3.075   5.182   35.865  1.00 34.82 ? 161 LYS A O     1 
ATOM   1844 C CB    . LYS E 2 160 ? 2.384   8.374   37.054  1.00 36.79 ? 161 LYS A CB    1 
ATOM   1845 C CG    . LYS E 2 160 ? 1.296   9.385   37.369  1.00 39.84 ? 161 LYS A CG    1 
ATOM   1846 C CD    . LYS E 2 160 ? 1.720   10.467  38.352  1.00 43.68 ? 161 LYS A CD    1 
ATOM   1847 C CE    . LYS E 2 160 ? 2.784   11.415  37.787  1.00 46.73 ? 161 LYS A CE    1 
ATOM   1848 N NZ    . LYS E 2 160 ? 3.947   11.606  38.693  1.00 47.83 ? 161 LYS A NZ    1 
ATOM   1849 N N     . PRO E 2 161 ? 3.286   6.973   34.521  1.00 32.58 ? 162 PRO A N     1 
ATOM   1850 C CA    . PRO E 2 161 ? 4.200   6.336   33.582  1.00 32.39 ? 162 PRO A CA    1 
ATOM   1851 C C     . PRO E 2 161 ? 5.655   6.647   33.807  1.00 33.90 ? 162 PRO A C     1 
ATOM   1852 O O     . PRO E 2 161 ? 6.490   6.384   32.965  1.00 35.72 ? 162 PRO A O     1 
ATOM   1853 C CB    . PRO E 2 161 ? 3.772   6.909   32.245  1.00 31.99 ? 162 PRO A CB    1 
ATOM   1854 C CG    . PRO E 2 161 ? 3.310   8.326   32.547  1.00 32.39 ? 162 PRO A CG    1 
ATOM   1855 C CD    . PRO E 2 161 ? 2.943   8.326   34.020  1.00 32.50 ? 162 PRO A CD    1 
ATOM   1856 N N     . TYR E 2 162 ? 5.959   7.204   34.939  1.00 32.96 ? 163 TYR A N     1 
ATOM   1857 C CA    . TYR E 2 162 ? 7.304   7.562   35.247  1.00 31.92 ? 163 TYR A CA    1 
ATOM   1858 C C     . TYR E 2 162 ? 7.268   8.278   36.552  1.00 32.28 ? 163 TYR A C     1 
ATOM   1859 O O     . TYR E 2 162 ? 6.250   8.867   36.912  1.00 31.89 ? 163 TYR A O     1 
ATOM   1860 C CB    . TYR E 2 162 ? 7.816   8.525   34.193  1.00 33.37 ? 163 TYR A CB    1 
ATOM   1861 C CG    . TYR E 2 162 ? 7.046   9.831   34.232  1.00 37.47 ? 163 TYR A CG    1 
ATOM   1862 C CD1   . TYR E 2 162 ? 7.699   11.056  34.277  1.00 39.33 ? 163 TYR A CD1   1 
ATOM   1863 C CD2   . TYR E 2 162 ? 5.649   9.831   34.232  1.00 39.41 ? 163 TYR A CD2   1 
ATOM   1864 C CE1   . TYR E 2 162 ? 6.983   12.242  34.315  1.00 41.54 ? 163 TYR A CE1   1 
ATOM   1865 C CE2   . TYR E 2 162 ? 4.904   11.017  34.277  1.00 40.28 ? 163 TYR A CE2   1 
ATOM   1866 C CZ    . TYR E 2 162 ? 5.594   12.227  34.309  1.00 42.14 ? 163 TYR A CZ    1 
ATOM   1867 O OH    . TYR E 2 162 ? 4.894   13.405  34.341  1.00 44.36 ? 163 TYR A OH    1 
ATOM   1868 N N     . LYS E 2 163 ? 8.369   8.255   37.272  1.00 33.41 ? 164 LYS A N     1 
ATOM   1869 C CA    . LYS E 2 163 ? 8.345   8.931   38.532  1.00 34.17 ? 164 LYS A CA    1 
ATOM   1870 C C     . LYS E 2 163 ? 9.579   9.727   38.847  1.00 32.96 ? 164 LYS A C     1 
ATOM   1871 O O     . LYS E 2 163 ? 10.650  9.528   38.282  1.00 33.25 ? 164 LYS A O     1 
ATOM   1872 C CB    . LYS E 2 163 ? 7.972   8.040   39.683  1.00 36.61 ? 164 LYS A CB    1 
ATOM   1873 C CG    . LYS E 2 163 ? 9.035   7.005   40.024  1.00 39.55 ? 164 LYS A CG    1 
ATOM   1874 C CD    . LYS E 2 163 ? 8.398   5.668   40.339  1.00 42.69 ? 164 LYS A CD    1 
ATOM   1875 C CE    . LYS E 2 163 ? 9.256   4.728   41.181  1.00 43.74 ? 164 LYS A CE    1 
ATOM   1876 N NZ    . LYS E 2 163 ? 8.620   3.407   41.361  1.00 43.90 ? 164 LYS A NZ    1 
ATOM   1877 N N     . GLY E 2 164 ? 9.392   10.635  39.780  1.00 32.00 ? 165 GLY A N     1 
ATOM   1878 C CA    . GLY E 2 164 ? 10.415  11.494  40.275  1.00 31.42 ? 165 GLY A CA    1 
ATOM   1879 C C     . GLY E 2 164 ? 11.102  12.306  39.233  1.00 30.32 ? 165 GLY A C     1 
ATOM   1880 O O     . GLY E 2 164 ? 12.241  11.988  38.828  1.00 30.19 ? 165 GLY A O     1 
ATOM   1881 N N     . VAL E 2 165 ? 10.418  13.381  38.835  1.00 29.91 ? 166 VAL A N     1 
ATOM   1882 C CA    . VAL E 2 165 ? 10.910  14.328  37.857  1.00 30.19 ? 166 VAL A CA    1 
ATOM   1883 C C     . VAL E 2 165 ? 11.787  15.411  38.520  1.00 34.64 ? 166 VAL A C     1 
ATOM   1884 O O     . VAL E 2 165 ? 11.606  15.753  39.696  1.00 35.84 ? 166 VAL A O     1 
ATOM   1885 C CB    . VAL E 2 165 ? 9.773   14.933  37.035  1.00 26.60 ? 166 VAL A CB    1 
ATOM   1886 C CG1   . VAL E 2 165 ? 10.309  15.960  36.051  1.00 25.76 ? 166 VAL A CG1   1 
ATOM   1887 C CG2   . VAL E 2 165 ? 9.065   13.850  36.276  1.00 25.79 ? 166 VAL A CG2   1 
ATOM   1888 N N     . LYS E 2 166 ? 12.743  15.928  37.735  1.00 36.50 ? 167 LYS A N     1 
ATOM   1889 C CA    . LYS E 2 166 ? 13.665  16.955  38.172  1.00 36.08 ? 167 LYS A CA    1 
ATOM   1890 C C     . LYS E 2 166 ? 13.698  18.085  37.144  1.00 35.24 ? 167 LYS A C     1 
ATOM   1891 O O     . LYS E 2 166 ? 13.409  17.862  35.980  1.00 35.63 ? 167 LYS A O     1 
ATOM   1892 C CB    . LYS E 2 166 ? 15.034  16.374  38.385  1.00 36.36 ? 167 LYS A CB    1 
ATOM   1893 C CG    . LYS E 2 166 ? 15.042  15.243  39.387  1.00 36.91 ? 167 LYS A CG    1 
ATOM   1894 C CD    . LYS E 2 166 ? 16.306  15.251  40.223  1.00 39.73 ? 167 LYS A CD    1 
ATOM   1895 C CE    . LYS E 2 166 ? 16.791  13.850  40.545  1.00 43.26 ? 167 LYS A CE    1 
ATOM   1896 N NZ    . LYS E 2 166 ? 16.603  12.927  39.420  1.00 45.55 ? 167 LYS A NZ    1 
ATOM   1897 N N     . VAL E 2 167 ? 14.037  19.295  37.581  1.00 34.67 ? 168 VAL A N     1 
ATOM   1898 C CA    . VAL E 2 167 ? 14.084  20.441  36.681  1.00 34.26 ? 168 VAL A CA    1 
ATOM   1899 C C     . VAL E 2 167 ? 15.343  21.277  36.848  1.00 34.46 ? 168 VAL A C     1 
ATOM   1900 O O     . VAL E 2 167 ? 15.947  21.309  37.902  1.00 35.20 ? 168 VAL A O     1 
ATOM   1901 C CB    . VAL E 2 167 ? 12.894  21.357  36.887  1.00 34.01 ? 168 VAL A CB    1 
ATOM   1902 C CG1   . VAL E 2 167 ? 12.744  22.264  35.665  1.00 33.98 ? 168 VAL A CG1   1 
ATOM   1903 C CG2   . VAL E 2 167 ? 11.630  20.553  37.112  1.00 34.76 ? 168 VAL A CG2   1 
ATOM   1904 N N     . PHE E 2 168 ? 15.706  21.986  35.787  1.00 31.98 ? 169 PHE A N     1 
ATOM   1905 C CA    . PHE E 2 168 ? 16.869  22.837  35.845  1.00 27.47 ? 169 PHE A CA    1 
ATOM   1906 C C     . PHE E 2 168 ? 16.920  23.800  34.695  1.00 26.47 ? 169 PHE A C     1 
ATOM   1907 O O     . PHE E 2 168 ? 16.715  23.426  33.557  1.00 26.95 ? 169 PHE A O     1 
ATOM   1908 C CB    . PHE E 2 168 ? 18.198  22.065  36.006  1.00 24.26 ? 169 PHE A CB    1 
ATOM   1909 C CG    . PHE E 2 168 ? 18.672  21.404  34.727  1.00 23.54 ? 169 PHE A CG    1 
ATOM   1910 C CD1   . PHE E 2 168 ? 18.561  20.019  34.547  1.00 22.40 ? 169 PHE A CD1   1 
ATOM   1911 C CD2   . PHE E 2 168 ? 19.224  22.145  33.679  1.00 22.94 ? 169 PHE A CD2   1 
ATOM   1912 C CE1   . PHE E 2 168 ? 18.981  19.391  33.377  1.00 20.40 ? 169 PHE A CE1   1 
ATOM   1913 C CE2   . PHE E 2 168 ? 19.654  21.532  32.496  1.00 20.87 ? 169 PHE A CE2   1 
ATOM   1914 C CZ    . PHE E 2 168 ? 19.527  20.155  32.348  1.00 19.49 ? 169 PHE A CZ    1 
ATOM   1915 N N     . LEU E 2 169 ? 17.166  25.058  35.016  1.00 25.89 ? 170 LEU A N     1 
ATOM   1916 C CA    . LEU E 2 169 ? 17.307  26.093  34.020  1.00 24.91 ? 170 LEU A CA    1 
ATOM   1917 C C     . LEU E 2 169 ? 18.800  26.244  33.891  1.00 25.52 ? 170 LEU A C     1 
ATOM   1918 O O     . LEU E 2 169 ? 19.491  26.165  34.900  1.00 28.51 ? 170 LEU A O     1 
ATOM   1919 C CB    . LEU E 2 169 ? 16.660  27.438  34.405  1.00 23.15 ? 170 LEU A CB    1 
ATOM   1920 C CG    . LEU E 2 169 ? 16.597  28.401  33.216  1.00 23.51 ? 170 LEU A CG    1 
ATOM   1921 C CD1   . LEU E 2 169 ? 15.514  27.963  32.239  1.00 23.52 ? 170 LEU A CD1   1 
ATOM   1922 C CD2   . LEU E 2 169 ? 16.303  29.818  33.666  1.00 24.16 ? 170 LEU A CD2   1 
ATOM   1923 N N     . GLN E 2 170 ? 19.335  26.411  32.695  1.00 21.96 ? 171 GLN A N     1 
ATOM   1924 C CA    . GLN E 2 170 ? 20.776  26.515  32.605  1.00 17.78 ? 171 GLN A CA    1 
ATOM   1925 C C     . GLN E 2 170 ? 21.214  27.048  31.281  1.00 18.82 ? 171 GLN A C     1 
ATOM   1926 O O     . GLN E 2 170 ? 20.464  27.016  30.343  1.00 20.63 ? 171 GLN A O     1 
ATOM   1927 C CB    . GLN E 2 170 ? 21.389  25.146  32.856  1.00 15.07 ? 171 GLN A CB    1 
ATOM   1928 C CG    . GLN E 2 170 ? 22.901  25.170  32.785  1.00 16.65 ? 171 GLN A CG    1 
ATOM   1929 C CD    . GLN E 2 170 ? 23.549  25.902  33.936  1.00 16.73 ? 171 GLN A CD    1 
ATOM   1930 O OE1   . GLN E 2 170 ? 23.892  27.080  33.827  1.00 16.95 ? 171 GLN A OE1   1 
ATOM   1931 N NE2   . GLN E 2 170 ? 23.720  25.201  35.048  1.00 17.46 ? 171 GLN A NE2   1 
ATOM   1932 N N     . ASP E 2 171 ? 22.433  27.565  31.204  1.00 20.37 ? 172 ASP A N     1 
ATOM   1933 C CA    . ASP E 2 171 ? 22.927  28.091  29.931  1.00 21.19 ? 172 ASP A CA    1 
ATOM   1934 C C     . ASP E 2 171 ? 23.416  26.953  29.044  1.00 21.69 ? 172 ASP A C     1 
ATOM   1935 O O     . ASP E 2 171 ? 24.168  26.085  29.475  1.00 21.47 ? 172 ASP A O     1 
ATOM   1936 C CB    . ASP E 2 171 ? 23.998  29.197  30.053  1.00 21.27 ? 172 ASP A CB    1 
ATOM   1937 C CG    . ASP E 2 171 ? 23.550  30.375  30.857  1.00 23.98 ? 172 ASP A CG    1 
ATOM   1938 O OD1   . ASP E 2 171 ? 23.184  31.442  30.368  1.00 23.54 ? 172 ASP A OD1   1 
ATOM   1939 O OD2   . ASP E 2 171 ? 23.602  30.145  32.143  1.00 26.44 ? 172 ASP A OD2   1 
ATOM   1940 N N     . LYS E 2 172 ? 22.975  26.961  27.784  1.00 21.89 ? 173 LYS A N     1 
ATOM   1941 C CA    . LYS E 2 172 ? 23.363  25.934  26.839  1.00 21.14 ? 173 LYS A CA    1 
ATOM   1942 C C     . LYS E 2 172 ? 24.866  25.727  26.775  1.00 19.73 ? 173 LYS A C     1 
ATOM   1943 O O     . LYS E 2 172 ? 25.351  24.604  26.781  1.00 21.81 ? 173 LYS A O     1 
ATOM   1944 C CB    . LYS E 2 172 ? 22.782  26.204  25.457  1.00 22.39 ? 173 LYS A CB    1 
ATOM   1945 C CG    . LYS E 2 172 ? 23.201  25.154  24.448  1.00 24.76 ? 173 LYS A CG    1 
ATOM   1946 C CD    . LYS E 2 172 ? 22.827  25.496  23.008  1.00 27.15 ? 173 LYS A CD    1 
ATOM   1947 C CE    . LYS E 2 172 ? 21.339  25.767  22.828  1.00 28.99 ? 173 LYS A CE    1 
ATOM   1948 N NZ    . LYS E 2 172 ? 20.541  24.541  22.603  1.00 30.08 ? 173 LYS A NZ    1 
ATOM   1949 N N     . TRP E 2 173 ? 25.633  26.809  26.698  1.00 16.42 ? 174 TRP A N     1 
ATOM   1950 C CA    . TRP E 2 173 ? 27.059  26.634  26.614  1.00 16.28 ? 174 TRP A CA    1 
ATOM   1951 C C     . TRP E 2 173 ? 27.693  26.101  27.816  1.00 17.60 ? 174 TRP A C     1 
ATOM   1952 O O     . TRP E 2 173 ? 28.797  25.647  27.733  1.00 19.39 ? 174 TRP A O     1 
ATOM   1953 C CB    . TRP E 2 173 ? 27.806  27.868  26.215  1.00 17.30 ? 174 TRP A CB    1 
ATOM   1954 C CG    . TRP E 2 173 ? 27.886  28.839  27.308  1.00 17.64 ? 174 TRP A CG    1 
ATOM   1955 C CD1   . TRP E 2 173 ? 26.998  29.818  27.565  1.00 18.92 ? 174 TRP A CD1   1 
ATOM   1956 C CD2   . TRP E 2 173 ? 28.879  28.935  28.292  1.00 18.25 ? 174 TRP A CD2   1 
ATOM   1957 N NE1   . TRP E 2 173 ? 27.373  30.535  28.658  1.00 18.56 ? 174 TRP A NE1   1 
ATOM   1958 C CE2   . TRP E 2 173 ? 28.524  30.025  29.134  1.00 17.93 ? 174 TRP A CE2   1 
ATOM   1959 C CE3   . TRP E 2 173 ? 30.040  28.234  28.543  1.00 19.95 ? 174 TRP A CE3   1 
ATOM   1960 C CZ2   . TRP E 2 173 ? 29.303  30.407  30.201  1.00 18.16 ? 174 TRP A CZ2   1 
ATOM   1961 C CZ3   . TRP E 2 173 ? 30.817  28.624  29.616  1.00 21.08 ? 174 TRP A CZ3   1 
ATOM   1962 C CH2   . TRP E 2 173 ? 30.442  29.699  30.433  1.00 19.95 ? 174 TRP A CH2   1 
ATOM   1963 N N     . VAL E 2 174 ? 27.014  26.180  28.935  1.00 18.82 ? 175 VAL A N     1 
ATOM   1964 C CA    . VAL E 2 174 ? 27.565  25.687  30.195  1.00 19.81 ? 175 VAL A CA    1 
ATOM   1965 C C     . VAL E 2 174 ? 27.457  24.175  30.291  1.00 23.10 ? 175 VAL A C     1 
ATOM   1966 O O     . VAL E 2 174 ? 28.385  23.474  30.703  1.00 24.20 ? 175 VAL A O     1 
ATOM   1967 C CB    . VAL E 2 174 ? 26.830  26.316  31.365  1.00 16.82 ? 175 VAL A CB    1 
ATOM   1968 C CG1   . VAL E 2 174 ? 27.447  25.846  32.663  1.00 14.90 ? 175 VAL A CG1   1 
ATOM   1969 C CG2   . VAL E 2 174 ? 26.915  27.836  31.249  1.00 17.18 ? 175 VAL A CG2   1 
ATOM   1970 N N     . ILE E 2 175 ? 26.292  23.721  29.899  1.00 24.49 ? 176 ILE A N     1 
ATOM   1971 C CA    . ILE E 2 175 ? 25.877  22.344  29.886  1.00 24.73 ? 176 ILE A CA    1 
ATOM   1972 C C     . ILE E 2 175 ? 26.503  21.516  28.710  1.00 24.12 ? 176 ILE A C     1 
ATOM   1973 O O     . ILE E 2 175 ? 26.648  20.290  28.813  1.00 22.34 ? 176 ILE A O     1 
ATOM   1974 C CB    . ILE E 2 175 ? 24.331  22.399  29.880  1.00 26.28 ? 176 ILE A CB    1 
ATOM   1975 C CG1   . ILE E 2 175 ? 23.650  21.062  29.758  1.00 28.75 ? 176 ILE A CG1   1 
ATOM   1976 C CG2   . ILE E 2 175 ? 23.812  23.339  28.787  1.00 26.20 ? 176 ILE A CG2   1 
ATOM   1977 C CD1   . ILE E 2 175 ? 22.129  21.229  29.732  1.00 29.61 ? 176 ILE A CD1   1 
ATOM   1978 N N     . ALA E 2 176 ? 26.887  22.240  27.598  1.00 24.38 ? 177 ALA A N     1 
ATOM   1979 C CA    . ALA E 2 176 ? 27.490  21.691  26.325  1.00 21.85 ? 177 ALA A CA    1 
ATOM   1980 C C     . ALA E 2 176 ? 28.704  20.776  26.479  1.00 17.98 ? 177 ALA A C     1 
ATOM   1981 O O     . ALA E 2 176 ? 29.605  21.046  27.231  1.00 18.61 ? 177 ALA A O     1 
ATOM   1982 C CB    . ALA E 2 176 ? 27.832  22.805  25.348  1.00 21.64 ? 177 ALA A CB    1 
ATOM   1983 N N     . GLY E 2 177 ? 28.718  19.693  25.733  1.00 14.40 ? 178 GLY A N     1 
ATOM   1984 C CA    . GLY E 2 177 ? 29.811  18.762  25.798  1.00 14.66 ? 178 GLY A CA    1 
ATOM   1985 C C     . GLY E 2 177 ? 30.825  18.977  24.685  1.00 17.67 ? 178 GLY A C     1 
ATOM   1986 O O     . GLY E 2 177 ? 30.898  20.027  24.088  1.00 19.33 ? 178 GLY A O     1 
ATOM   1987 N N     . ASP E 2 178 ? 31.614  17.974  24.415  1.00 20.11 ? 179 ASP A N     1 
ATOM   1988 C CA    . ASP E 2 178 ? 32.605  18.069  23.393  1.00 25.03 ? 179 ASP A CA    1 
ATOM   1989 C C     . ASP E 2 178 ? 32.403  16.955  22.397  1.00 28.04 ? 179 ASP A C     1 
ATOM   1990 O O     . ASP E 2 178 ? 32.909  16.995  21.291  1.00 29.52 ? 179 ASP A O     1 
ATOM   1991 C CB    . ASP E 2 178 ? 33.995  17.990  24.004  1.00 29.98 ? 179 ASP A CB    1 
ATOM   1992 C CG    . ASP E 2 178 ? 34.128  16.740  24.840  1.00 36.75 ? 179 ASP A CG    1 
ATOM   1993 O OD1   . ASP E 2 178 ? 33.259  16.342  25.605  1.00 39.30 ? 179 ASP A OD1   1 
ATOM   1994 O OD2   . ASP E 2 178 ? 35.262  16.119  24.640  1.00 39.30 ? 179 ASP A OD2   1 
ATOM   1995 N N     . LEU E 2 179 ? 31.646  15.944  22.808  1.00 29.32 ? 180 LEU A N     1 
ATOM   1996 C CA    . LEU E 2 179 ? 31.352  14.829  21.934  1.00 30.77 ? 180 LEU A CA    1 
ATOM   1997 C C     . LEU E 2 179 ? 30.104  15.148  21.169  1.00 33.09 ? 180 LEU A C     1 
ATOM   1998 O O     . LEU E 2 179 ? 29.433  16.111  21.433  1.00 33.53 ? 180 LEU A O     1 
ATOM   1999 C CB    . LEU E 2 179 ? 31.193  13.508  22.680  1.00 30.90 ? 180 LEU A CB    1 
ATOM   2000 C CG    . LEU E 2 179 ? 32.426  13.198  23.503  1.00 32.01 ? 180 LEU A CG    1 
ATOM   2001 C CD1   . LEU E 2 179 ? 32.439  11.733  23.927  1.00 32.09 ? 180 LEU A CD1   1 
ATOM   2002 C CD2   . LEU E 2 179 ? 33.664  13.540  22.686  1.00 32.85 ? 180 LEU A CD2   1 
ATOM   2003 N N     . ALA E 2 180 ? 29.792  14.344  20.205  1.00 36.18 ? 181 ALA A N     1 
ATOM   2004 C CA    . ALA E 2 180 ? 28.603  14.615  19.453  1.00 38.71 ? 181 ALA A CA    1 
ATOM   2005 C C     . ALA E 2 180 ? 27.591  13.492  19.549  1.00 41.67 ? 181 ALA A C     1 
ATOM   2006 O O     . ALA E 2 180 ? 27.909  12.338  19.273  1.00 42.61 ? 181 ALA A O     1 
ATOM   2007 C CB    . ALA E 2 180 ? 28.972  14.989  18.026  1.00 38.66 ? 181 ALA A CB    1 
ATOM   2008 N N     . GLY E 2 181 ? 26.386  13.874  19.973  1.00 44.11 ? 182 GLY A N     1 
ATOM   2009 C CA    . GLY E 2 181 ? 25.201  13.031  20.185  1.00 47.19 ? 182 GLY A CA    1 
ATOM   2010 C C     . GLY E 2 181 ? 25.375  11.542  19.960  1.00 49.77 ? 182 GLY A C     1 
ATOM   2011 O O     . GLY E 2 181 ? 25.336  10.730  20.905  1.00 49.71 ? 182 GLY A O     1 
ATOM   2012 N N     . SER E 2 182 ? 25.574  11.200  18.688  1.00 51.90 ? 183 SER A N     1 
ATOM   2013 C CA    . SER E 2 182 ? 25.752  9.831   18.263  1.00 53.33 ? 183 SER A CA    1 
ATOM   2014 C C     . SER E 2 182 ? 26.449  9.759   16.920  1.00 53.63 ? 183 SER A C     1 
ATOM   2015 O O     . SER E 2 182 ? 26.296  10.674  16.110  1.00 51.85 ? 183 SER A O     1 
ATOM   2016 C CB    . SER E 2 182 ? 24.418  9.106   18.231  1.00 54.08 ? 183 SER A CB    1 
ATOM   2017 O OG    . SER E 2 182 ? 23.419  9.918   18.836  1.00 54.54 ? 183 SER A OG    1 
ATOM   2018 N N     . THR E 2 186 ? 24.460  15.084  13.223  1.00 43.76 ? 187 THR A N     1 
ATOM   2019 C CA    . THR E 2 186 ? 25.143  16.326  13.442  1.00 38.49 ? 187 THR A CA    1 
ATOM   2020 C C     . THR E 2 186 ? 24.697  17.130  14.638  1.00 36.67 ? 187 THR A C     1 
ATOM   2021 O O     . THR E 2 186 ? 24.689  18.356  14.586  1.00 36.70 ? 187 THR A O     1 
ATOM   2022 C CB    . THR E 2 186 ? 25.161  17.170  12.182  1.00 36.33 ? 187 THR A CB    1 
ATOM   2023 O OG1   . THR E 2 186 ? 23.919  17.066  11.552  1.00 36.00 ? 187 THR A OG1   1 
ATOM   2024 C CG2   . THR E 2 186 ? 26.243  16.644  11.256  1.00 35.73 ? 187 THR A CG2   1 
ATOM   2025 N N     . ASN E 2 187 ? 24.340  16.445  15.724  1.00 35.02 ? 188 ASN A N     1 
ATOM   2026 C CA    . ASN E 2 187 ? 23.906  17.170  16.901  1.00 33.61 ? 188 ASN A CA    1 
ATOM   2027 C C     . ASN E 2 187 ? 24.930  17.170  18.026  1.00 28.75 ? 188 ASN A C     1 
ATOM   2028 O O     . ASN E 2 187 ? 25.765  16.270  18.135  1.00 28.23 ? 188 ASN A O     1 
ATOM   2029 C CB    . ASN E 2 187 ? 22.497  16.788  17.370  1.00 36.26 ? 188 ASN A CB    1 
ATOM   2030 C CG    . ASN E 2 187 ? 22.419  15.371  17.884  1.00 40.24 ? 188 ASN A CG    1 
ATOM   2031 O OD1   . ASN E 2 187 ? 23.273  14.933  18.688  1.00 41.34 ? 188 ASN A OD1   1 
ATOM   2032 N ND2   . ASN E 2 187 ? 21.406  14.646  17.428  1.00 42.13 ? 188 ASN A ND2   1 
ATOM   2033 N N     . ILE E 2 188 ? 24.849  18.197  18.842  1.00 24.10 ? 189 ILE A N     1 
ATOM   2034 C CA    . ILE E 2 188 ? 25.730  18.380  19.967  1.00 22.15 ? 189 ILE A CA    1 
ATOM   2035 C C     . ILE E 2 188 ? 25.291  17.568  21.188  1.00 20.49 ? 189 ILE A C     1 
ATOM   2036 O O     . ILE E 2 188 ? 24.109  17.416  21.465  1.00 22.16 ? 189 ILE A O     1 
ATOM   2037 C CB    . ILE E 2 188 ? 25.811  19.876  20.340  1.00 21.30 ? 189 ILE A CB    1 
ATOM   2038 C CG1   . ILE E 2 188 ? 26.803  20.593  19.446  1.00 20.34 ? 189 ILE A CG1   1 
ATOM   2039 C CG2   . ILE E 2 188 ? 26.263  20.051  21.773  1.00 22.10 ? 189 ILE A CG2   1 
ATOM   2040 C CD1   . ILE E 2 188 ? 26.409  22.033  19.170  1.00 19.95 ? 189 ILE A CD1   1 
ATOM   2041 N N     . GLY E 2 189 ? 26.238  17.042  21.921  1.00 17.25 ? 190 GLY A N     1 
ATOM   2042 C CA    . GLY E 2 189 ? 25.876  16.302  23.085  1.00 19.10 ? 190 GLY A CA    1 
ATOM   2043 C C     . GLY E 2 189 ? 26.192  17.146  24.300  1.00 23.89 ? 190 GLY A C     1 
ATOM   2044 O O     . GLY E 2 189 ? 27.123  17.934  24.274  1.00 25.58 ? 190 GLY A O     1 
ATOM   2045 N N     . SER E 2 190 ? 25.415  16.995  25.367  1.00 26.07 ? 191 SER A N     1 
ATOM   2046 C CA    . SER E 2 190 ? 25.675  17.759  26.588  1.00 26.32 ? 191 SER A CA    1 
ATOM   2047 C C     . SER E 2 190 ? 26.748  17.026  27.392  1.00 27.70 ? 191 SER A C     1 
ATOM   2048 O O     . SER E 2 190 ? 27.279  16.016  26.955  1.00 29.02 ? 191 SER A O     1 
ATOM   2049 C CB    . SER E 2 190 ? 24.414  17.926  27.437  1.00 25.38 ? 191 SER A CB    1 
ATOM   2050 O OG    . SER E 2 190 ? 24.127  16.732  28.150  1.00 23.81 ? 191 SER A OG    1 
ATOM   2051 N N     . ILE E 2 191 ? 27.084  17.520  28.555  1.00 28.65 ? 192 ILE A N     1 
ATOM   2052 C CA    . ILE E 2 191 ? 28.078  16.772  29.295  1.00 30.77 ? 192 ILE A CA    1 
ATOM   2053 C C     . ILE E 2 191 ? 27.415  15.482  29.713  1.00 34.98 ? 192 ILE A C     1 
ATOM   2054 O O     . ILE E 2 191 ? 26.202  15.347  29.558  1.00 36.01 ? 192 ILE A O     1 
ATOM   2055 C CB    . ILE E 2 191 ? 28.598  17.536  30.490  1.00 29.45 ? 192 ILE A CB    1 
ATOM   2056 C CG1   . ILE E 2 191 ? 27.565  17.568  31.596  1.00 27.69 ? 192 ILE A CG1   1 
ATOM   2057 C CG2   . ILE E 2 191 ? 28.905  18.969  30.098  1.00 31.38 ? 192 ILE A CG2   1 
ATOM   2058 C CD1   . ILE E 2 191 ? 27.790  18.738  32.554  1.00 27.09 ? 192 ILE A CD1   1 
ATOM   2059 N N     . HIS E 2 192 ? 28.157  14.535  30.233  1.00 38.45 ? 193 HIS A N     1 
ATOM   2060 C CA    . HIS E 2 192 ? 27.532  13.293  30.664  1.00 43.25 ? 193 HIS A CA    1 
ATOM   2061 C C     . HIS E 2 192 ? 27.648  13.206  32.175  1.00 45.58 ? 193 HIS A C     1 
ATOM   2062 O O     . HIS E 2 192 ? 28.418  12.402  32.695  1.00 47.57 ? 193 HIS A O     1 
ATOM   2063 C CB    . HIS E 2 192 ? 28.080  12.051  29.976  1.00 45.82 ? 193 HIS A CB    1 
ATOM   2064 C CG    . HIS E 2 192 ? 27.369  10.810  30.394  1.00 49.00 ? 193 HIS A CG    1 
ATOM   2065 N ND1   . HIS E 2 192 ? 26.068  10.547  29.995  1.00 50.45 ? 193 HIS A ND1   1 
ATOM   2066 C CD2   . HIS E 2 192 ? 27.774  9.775   31.185  1.00 50.98 ? 193 HIS A CD2   1 
ATOM   2067 C CE1   . HIS E 2 192 ? 25.724  9.377   30.529  1.00 51.30 ? 193 HIS A CE1   1 
ATOM   2068 N NE2   . HIS E 2 192 ? 26.723  8.883   31.249  1.00 51.59 ? 193 HIS A NE2   1 
ATOM   2069 N N     . ALA E 2 193 ? 26.887  14.065  32.869  1.00 44.93 ? 194 ALA A N     1 
ATOM   2070 C CA    . ALA E 2 193 ? 26.930  14.121  34.315  1.00 44.61 ? 194 ALA A CA    1 
ATOM   2071 C C     . ALA E 2 193 ? 25.659  13.787  35.074  1.00 46.01 ? 194 ALA A C     1 
ATOM   2072 O O     . ALA E 2 193 ? 24.660  13.261  34.566  1.00 45.27 ? 194 ALA A O     1 
ATOM   2073 C CB    . ALA E 2 193 ? 27.432  15.482  34.759  1.00 43.27 ? 194 ALA A CB    1 
ATOM   2074 N N     . HIS E 2 194 ? 25.765  14.129  36.360  1.00 46.82 ? 195 HIS A N     1 
ATOM   2075 C CA    . HIS E 2 194 ? 24.747  13.962  37.356  1.00 45.83 ? 195 HIS A CA    1 
ATOM   2076 C C     . HIS E 2 194 ? 23.896  15.212  37.388  1.00 42.54 ? 195 HIS A C     1 
ATOM   2077 O O     . HIS E 2 194 ? 24.350  16.286  37.009  1.00 43.25 ? 195 HIS A O     1 
ATOM   2078 C CB    . HIS E 2 194 ? 25.372  13.707  38.751  1.00 47.57 ? 195 HIS A CB    1 
ATOM   2079 C CG    . HIS E 2 194 ? 25.647  12.258  39.066  1.00 47.50 ? 195 HIS A CG    1 
ATOM   2080 N ND1   . HIS E 2 194 ? 26.949  11.741  39.092  1.00 46.75 ? 195 HIS A ND1   1 
ATOM   2081 C CD2   . HIS E 2 194 ? 24.781  11.247  39.368  1.00 46.49 ? 195 HIS A CD2   1 
ATOM   2082 C CE1   . HIS E 2 194 ? 26.841  10.459  39.400  1.00 46.10 ? 195 HIS A CE1   1 
ATOM   2083 N NE2   . HIS E 2 194 ? 25.552  10.125  39.567  1.00 46.10 ? 195 HIS A NE2   1 
ATOM   2084 N N     . TYR E 2 195 ? 22.678  15.052  37.832  1.00 38.56 ? 196 TYR A N     1 
ATOM   2085 C CA    . TYR E 2 195 ? 21.751  16.151  37.896  1.00 34.64 ? 196 TYR A CA    1 
ATOM   2086 C C     . TYR E 2 195 ? 22.294  17.401  38.603  1.00 36.62 ? 196 TYR A C     1 
ATOM   2087 O O     . TYR E 2 195 ? 21.989  18.523  38.217  1.00 36.67 ? 196 TYR A O     1 
ATOM   2088 C CB    . TYR E 2 195 ? 20.357  15.705  38.385  1.00 28.37 ? 196 TYR A CB    1 
ATOM   2089 C CG    . TYR E 2 195 ? 19.474  16.859  38.648  1.00 21.82 ? 196 TYR A CG    1 
ATOM   2090 C CD1   . TYR E 2 195 ? 19.403  17.393  39.927  1.00 21.41 ? 196 TYR A CD1   1 
ATOM   2091 C CD2   . TYR E 2 195 ? 18.729  17.448  37.632  1.00 19.41 ? 196 TYR A CD2   1 
ATOM   2092 C CE1   . TYR E 2 195 ? 18.607  18.491  40.197  1.00 22.08 ? 196 TYR A CE1   1 
ATOM   2093 C CE2   . TYR E 2 195 ? 17.918  18.555  37.883  1.00 19.82 ? 196 TYR A CE2   1 
ATOM   2094 C CZ    . TYR E 2 195 ? 17.865  19.064  39.175  1.00 22.28 ? 196 TYR A CZ    1 
ATOM   2095 O OH    . TYR E 2 195 ? 17.081  20.155  39.452  1.00 24.37 ? 196 TYR A OH    1 
ATOM   2096 N N     . LYS E 2 196 ? 23.105  17.194  39.625  1.00 39.34 ? 197 LYS A N     1 
ATOM   2097 C CA    . LYS E 2 196 ? 23.686  18.300  40.397  1.00 43.08 ? 197 LYS A CA    1 
ATOM   2098 C C     . LYS E 2 196 ? 24.620  19.200  39.593  1.00 43.89 ? 197 LYS A C     1 
ATOM   2099 O O     . LYS E 2 196 ? 24.580  20.441  39.722  1.00 43.50 ? 197 LYS A O     1 
ATOM   2100 C CB    . LYS E 2 196 ? 24.379  17.767  41.637  1.00 46.22 ? 197 LYS A CB    1 
ATOM   2101 C CG    . LYS E 2 196 ? 23.395  17.106  42.582  1.00 49.71 ? 197 LYS A CG    1 
ATOM   2102 C CD    . LYS E 2 196 ? 22.105  17.910  42.750  1.00 52.02 ? 197 LYS A CD    1 
ATOM   2103 C CE    . LYS E 2 196 ? 20.994  17.138  43.444  1.00 54.30 ? 197 LYS A CE    1 
ATOM   2104 N NZ    . LYS E 2 196 ? 19.848  17.990  43.823  1.00 55.44 ? 197 LYS A NZ    1 
ATOM   2105 N N     . ASP E 2 197 ? 25.467  18.547  38.783  1.00 43.78 ? 198 ASP A N     1 
ATOM   2106 C CA    . ASP E 2 197 ? 26.450  19.184  37.922  1.00 41.76 ? 198 ASP A CA    1 
ATOM   2107 C C     . ASP E 2 197 ? 25.810  20.067  36.874  1.00 40.92 ? 198 ASP A C     1 
ATOM   2108 O O     . ASP E 2 197 ? 26.416  21.030  36.411  1.00 42.34 ? 198 ASP A O     1 
ATOM   2109 C CB    . ASP E 2 197 ? 27.335  18.133  37.253  1.00 41.16 ? 198 ASP A CB    1 
ATOM   2110 C CG    . ASP E 2 197 ? 28.115  17.369  38.262  1.00 40.99 ? 198 ASP A CG    1 
ATOM   2111 O OD1   . ASP E 2 197 ? 28.203  16.151  38.269  1.00 40.93 ? 198 ASP A OD1   1 
ATOM   2112 O OD2   . ASP E 2 197 ? 28.692  18.157  39.130  1.00 40.93 ? 198 ASP A OD2   1 
ATOM   2113 N N     . PHE E 2 198 ? 24.586  19.733  36.495  1.00 38.04 ? 199 PHE A N     1 
ATOM   2114 C CA    . PHE E 2 198 ? 23.867  20.521  35.511  1.00 34.87 ? 199 PHE A CA    1 
ATOM   2115 C C     . PHE E 2 198 ? 23.386  21.842  36.128  1.00 33.62 ? 199 PHE A C     1 
ATOM   2116 O O     . PHE E 2 198 ? 23.630  22.917  35.607  1.00 33.46 ? 199 PHE A O     1 
ATOM   2117 C CB    . PHE E 2 198 ? 22.696  19.725  34.875  1.00 32.18 ? 199 PHE A CB    1 
ATOM   2118 C CG    . PHE E 2 198 ? 23.153  18.682  33.878  1.00 29.68 ? 199 PHE A CG    1 
ATOM   2119 C CD1   . PHE E 2 198 ? 23.289  19.008  32.528  1.00 28.77 ? 199 PHE A CD1   1 
ATOM   2120 C CD2   . PHE E 2 198 ? 23.447  17.369  34.277  1.00 28.71 ? 199 PHE A CD2   1 
ATOM   2121 C CE1   . PHE E 2 198 ? 23.709  18.061  31.596  1.00 28.33 ? 199 PHE A CE1   1 
ATOM   2122 C CE2   . PHE E 2 198 ? 23.870  16.414  33.357  1.00 27.86 ? 199 PHE A CE2   1 
ATOM   2123 C CZ    . PHE E 2 198 ? 24.005  16.764  32.014  1.00 28.39 ? 199 PHE A CZ    1 
ATOM   2124 N N     . VAL E 2 199 ? 22.710  21.739  37.260  1.00 32.45 ? 200 VAL A N     1 
ATOM   2125 C CA    . VAL E 2 199 ? 22.179  22.893  37.960  1.00 32.69 ? 200 VAL A CA    1 
ATOM   2126 C C     . VAL E 2 199 ? 23.254  23.904  38.307  1.00 32.02 ? 200 VAL A C     1 
ATOM   2127 O O     . VAL E 2 199 ? 23.147  25.106  38.005  1.00 28.69 ? 200 VAL A O     1 
ATOM   2128 C CB    . VAL E 2 199 ? 21.420  22.463  39.201  1.00 34.38 ? 200 VAL A CB    1 
ATOM   2129 C CG1   . VAL E 2 199 ? 20.917  23.689  39.927  1.00 35.92 ? 200 VAL A CG1   1 
ATOM   2130 C CG2   . VAL E 2 199 ? 20.223  21.603  38.822  1.00 34.72 ? 200 VAL A CG2   1 
ATOM   2131 N N     . GLU E 2 200 ? 24.302  23.402  38.970  1.00 34.54 ? 201 GLU A N     1 
ATOM   2132 C CA    . GLU E 2 200 ? 25.416  24.230  39.375  1.00 35.99 ? 201 GLU A CA    1 
ATOM   2133 C C     . GLU E 2 200 ? 26.107  24.875  38.160  1.00 36.04 ? 201 GLU A C     1 
ATOM   2134 O O     . GLU E 2 200 ? 26.388  26.069  38.134  1.00 37.61 ? 201 GLU A O     1 
ATOM   2135 C CB    . GLU E 2 200 ? 26.427  23.426  40.236  1.00 37.48 ? 201 GLU A CB    1 
ATOM   2136 C CG    . GLU E 2 200 ? 26.065  23.418  41.740  1.00 41.37 ? 201 GLU A CG    1 
ATOM   2137 C CD    . GLU E 2 200 ? 26.556  22.200  42.518  1.00 44.82 ? 201 GLU A CD    1 
ATOM   2138 O OE1   . GLU E 2 200 ? 27.715  21.818  42.512  1.00 46.32 ? 201 GLU A OE1   1 
ATOM   2139 O OE2   . GLU E 2 200 ? 25.599  21.595  43.200  1.00 45.14 ? 201 GLU A OE2   1 
ATOM   2140 N N     . GLY E 2 201 ? 26.387  24.063  37.131  1.00 33.00 ? 202 GLY A N     1 
ATOM   2141 C CA    . GLY E 2 201 ? 27.030  24.557  35.942  1.00 30.90 ? 202 GLY A CA    1 
ATOM   2142 C C     . GLY E 2 201 ? 28.473  24.103  35.871  1.00 29.28 ? 202 GLY A C     1 
ATOM   2143 O O     . GLY E 2 201 ? 29.361  24.843  35.460  1.00 28.99 ? 202 GLY A O     1 
ATOM   2144 N N     . LYS E 2 202 ? 28.672  22.885  36.295  1.00 29.47 ? 203 LYS A N     1 
ATOM   2145 C CA    . LYS E 2 202 ? 29.969  22.264  36.315  1.00 32.31 ? 203 LYS A CA    1 
ATOM   2146 C C     . LYS E 2 202 ? 30.182  21.611  34.984  1.00 32.09 ? 203 LYS A C     1 
ATOM   2147 O O     . LYS E 2 202 ? 30.099  20.394  34.855  1.00 30.70 ? 203 LYS A O     1 
ATOM   2148 C CB    . LYS E 2 202 ? 30.044  21.261  37.452  1.00 36.83 ? 203 LYS A CB    1 
ATOM   2149 C CG    . LYS E 2 202 ? 31.249  20.338  37.401  1.00 42.11 ? 203 LYS A CG    1 
ATOM   2150 C CD    . LYS E 2 202 ? 32.490  20.983  36.790  1.00 46.11 ? 203 LYS A CD    1 
ATOM   2151 C CE    . LYS E 2 202 ? 33.262  20.027  35.897  1.00 48.56 ? 203 LYS A CE    1 
ATOM   2152 N NZ    . LYS E 2 202 ? 32.379  19.096  35.177  1.00 50.28 ? 203 LYS A NZ    1 
ATOM   2153 N N     . GLY E 2 203 ? 30.452  22.463  33.994  1.00 34.33 ? 204 GLY A N     1 
ATOM   2154 C CA    . GLY E 2 203 ? 30.671  22.081  32.592  1.00 34.79 ? 204 GLY A CA    1 
ATOM   2155 C C     . GLY E 2 203 ? 32.103  21.763  32.194  1.00 33.60 ? 204 GLY A C     1 
ATOM   2156 O O     . GLY E 2 203 ? 32.929  21.349  32.997  1.00 33.41 ? 204 GLY A O     1 
ATOM   2157 N N     . ILE E 2 204 ? 32.367  21.970  30.908  1.00 32.40 ? 205 ILE A N     1 
ATOM   2158 C CA    . ILE E 2 204 ? 33.665  21.707  30.310  1.00 30.94 ? 205 ILE A CA    1 
ATOM   2159 C C     . ILE E 2 204 ? 34.294  22.941  29.655  1.00 31.03 ? 205 ILE A C     1 
ATOM   2160 O O     . ILE E 2 204 ? 35.475  23.211  29.803  1.00 29.29 ? 205 ILE A O     1 
ATOM   2161 C CB    . ILE E 2 204 ? 33.534  20.593  29.282  1.00 30.14 ? 205 ILE A CB    1 
ATOM   2162 C CG1   . ILE E 2 204 ? 33.473  19.247  29.970  1.00 32.26 ? 205 ILE A CG1   1 
ATOM   2163 C CG2   . ILE E 2 204 ? 34.705  20.608  28.330  1.00 29.05 ? 205 ILE A CG2   1 
ATOM   2164 C CD1   . ILE E 2 204 ? 33.825  18.093  29.031  1.00 33.33 ? 205 ILE A CD1   1 
ATOM   2165 N N     . PHE E 2 205 ? 33.497  23.689  28.896  1.00 34.11 ? 206 PHE A N     1 
ATOM   2166 C CA    . PHE E 2 205 ? 34.024  24.875  28.208  1.00 35.77 ? 206 PHE A CA    1 
ATOM   2167 C C     . PHE E 2 205 ? 34.400  25.934  29.166  1.00 39.47 ? 206 PHE A C     1 
ATOM   2168 O O     . PHE E 2 205 ? 33.764  26.069  30.195  1.00 41.01 ? 206 PHE A O     1 
ATOM   2169 C CB    . PHE E 2 205 ? 33.126  25.432  27.070  1.00 32.93 ? 206 PHE A CB    1 
ATOM   2170 C CG    . PHE E 2 205 ? 32.926  24.413  25.965  1.00 30.90 ? 206 PHE A CG    1 
ATOM   2171 C CD1   . PHE E 2 205 ? 33.976  24.071  25.110  1.00 29.55 ? 206 PHE A CD1   1 
ATOM   2172 C CD2   . PHE E 2 205 ? 31.697  23.777  25.791  1.00 30.16 ? 206 PHE A CD2   1 
ATOM   2173 C CE1   . PHE E 2 205 ? 33.805  23.132  24.100  1.00 28.38 ? 206 PHE A CE1   1 
ATOM   2174 C CE2   . PHE E 2 205 ? 31.513  22.837  24.782  1.00 29.26 ? 206 PHE A CE2   1 
ATOM   2175 C CZ    . PHE E 2 205 ? 32.573  22.519  23.940  1.00 28.37 ? 206 PHE A CZ    1 
ATOM   2176 N N     . ASP E 2 206 ? 35.435  26.682  28.819  1.00 41.88 ? 207 ASP A N     1 
ATOM   2177 C CA    . ASP E 2 206 ? 35.880  27.757  29.668  1.00 43.76 ? 207 ASP A CA    1 
ATOM   2178 C C     . ASP E 2 206 ? 35.108  29.022  29.340  1.00 42.70 ? 207 ASP A C     1 
ATOM   2179 O O     . ASP E 2 206 ? 35.298  30.073  29.957  1.00 43.49 ? 207 ASP A O     1 
ATOM   2180 C CB    . ASP E 2 206 ? 37.430  27.956  29.687  1.00 45.59 ? 207 ASP A CB    1 
ATOM   2181 C CG    . ASP E 2 206 ? 38.162  27.112  30.722  1.00 47.06 ? 207 ASP A CG    1 
ATOM   2182 O OD1   . ASP E 2 206 ? 37.625  26.539  31.660  1.00 46.66 ? 207 ASP A OD1   1 
ATOM   2183 O OD2   . ASP E 2 206 ? 39.459  27.056  30.503  1.00 47.99 ? 207 ASP A OD2   1 
ATOM   2184 N N     . SER E 2 207 ? 34.212  28.903  28.356  1.00 41.01 ? 208 SER A N     1 
ATOM   2185 C CA    . SER E 2 207 ? 33.400  30.033  27.945  1.00 40.98 ? 208 SER A CA    1 
ATOM   2186 C C     . SER E 2 207 ? 32.473  29.747  26.762  1.00 40.37 ? 208 SER A C     1 
ATOM   2187 O O     . SER E 2 207 ? 32.545  28.696  26.113  1.00 40.83 ? 208 SER A O     1 
ATOM   2188 C CB    . SER E 2 207 ? 34.273  31.259  27.643  1.00 42.06 ? 208 SER A CB    1 
ATOM   2189 O OG    . SER E 2 207 ? 34.821  31.219  26.318  1.00 41.65 ? 208 SER A OG    1 
ATOM   2190 N N     . GLU E 2 208 ? 31.596  30.718  26.498  1.00 38.42 ? 209 GLU A N     1 
ATOM   2191 C CA    . GLU E 2 208 ? 30.641  30.670  25.399  1.00 35.43 ? 209 GLU A CA    1 
ATOM   2192 C C     . GLU E 2 208 ? 31.425  30.797  24.113  1.00 34.87 ? 209 GLU A C     1 
ATOM   2193 O O     . GLU E 2 208 ? 31.204  30.089  23.143  1.00 34.17 ? 209 GLU A O     1 
ATOM   2194 C CB    . GLU E 2 208 ? 29.575  31.784  25.521  1.00 33.59 ? 209 GLU A CB    1 
ATOM   2195 C CG    . GLU E 2 208 ? 28.386  31.577  24.583  1.00 33.18 ? 209 GLU A CG    1 
ATOM   2196 C CD    . GLU E 2 208 ? 27.146  32.310  25.007  1.00 34.27 ? 209 GLU A CD    1 
ATOM   2197 O OE1   . GLU E 2 208 ? 26.992  33.504  24.885  1.00 34.69 ? 209 GLU A OE1   1 
ATOM   2198 O OE2   . GLU E 2 208 ? 26.227  31.530  25.515  1.00 35.28 ? 209 GLU A OE2   1 
ATOM   2199 N N     . ASP E 2 209 ? 32.378  31.721  24.139  1.00 36.59 ? 210 ASP A N     1 
ATOM   2200 C CA    . ASP E 2 209 ? 33.233  31.951  23.001  1.00 37.75 ? 210 ASP A CA    1 
ATOM   2201 C C     . ASP E 2 209 ? 33.909  30.630  22.667  1.00 37.41 ? 210 ASP A C     1 
ATOM   2202 O O     . ASP E 2 209 ? 33.861  30.145  21.529  1.00 38.55 ? 210 ASP A O     1 
ATOM   2203 C CB    . ASP E 2 209 ? 34.277  33.050  23.284  1.00 38.76 ? 210 ASP A CB    1 
ATOM   2204 C CG    . ASP E 2 209 ? 33.762  34.459  23.078  1.00 40.72 ? 210 ASP A CG    1 
ATOM   2205 O OD1   . ASP E 2 209 ? 34.184  35.414  23.695  1.00 42.10 ? 210 ASP A OD1   1 
ATOM   2206 O OD2   . ASP E 2 209 ? 32.828  34.546  22.159  1.00 40.95 ? 210 ASP A OD2   1 
ATOM   2207 N N     . GLU E 2 210 ? 34.515  30.025  23.689  1.00 34.51 ? 211 GLU A N     1 
ATOM   2208 C CA    . GLU E 2 210 ? 35.181  28.767  23.522  1.00 32.45 ? 211 GLU A CA    1 
ATOM   2209 C C     . GLU E 2 210 ? 34.200  27.701  23.053  1.00 33.14 ? 211 GLU A C     1 
ATOM   2210 O O     . GLU E 2 210 ? 34.551  26.833  22.249  1.00 33.78 ? 211 GLU A O     1 
ATOM   2211 C CB    . GLU E 2 210 ? 35.914  28.322  24.795  1.00 31.56 ? 211 GLU A CB    1 
ATOM   2212 C CG    . GLU E 2 210 ? 36.360  26.849  24.737  1.00 31.43 ? 211 GLU A CG    1 
ATOM   2213 C CD    . GLU E 2 210 ? 37.311  26.459  25.830  1.00 31.69 ? 211 GLU A CD    1 
ATOM   2214 O OE1   . GLU E 2 210 ? 38.494  26.348  25.650  1.00 32.38 ? 211 GLU A OE1   1 
ATOM   2215 O OE2   . GLU E 2 210 ? 36.732  26.244  26.980  1.00 32.28 ? 211 GLU A OE2   1 
ATOM   2216 N N     . PHE E 2 211 ? 32.959  27.757  23.560  1.00 32.81 ? 212 PHE A N     1 
ATOM   2217 C CA    . PHE E 2 211 ? 31.945  26.785  23.162  1.00 31.54 ? 212 PHE A CA    1 
ATOM   2218 C C     . PHE E 2 211 ? 31.715  26.929  21.696  1.00 32.19 ? 212 PHE A C     1 
ATOM   2219 O O     . PHE E 2 211 ? 31.863  25.973  20.938  1.00 33.71 ? 212 PHE A O     1 
ATOM   2220 C CB    . PHE E 2 211 ? 30.619  26.905  23.946  1.00 29.26 ? 212 PHE A CB    1 
ATOM   2221 C CG    . PHE E 2 211 ? 29.379  26.340  23.258  1.00 25.66 ? 212 PHE A CG    1 
ATOM   2222 C CD1   . PHE E 2 211 ? 28.372  27.183  22.783  1.00 23.96 ? 212 PHE A CD1   1 
ATOM   2223 C CD2   . PHE E 2 211 ? 29.202  24.963  23.123  1.00 25.35 ? 212 PHE A CD2   1 
ATOM   2224 C CE1   . PHE E 2 211 ? 27.237  26.666  22.165  1.00 24.42 ? 212 PHE A CE1   1 
ATOM   2225 C CE2   . PHE E 2 211 ? 28.073  24.421  22.506  1.00 24.32 ? 212 PHE A CE2   1 
ATOM   2226 C CZ    . PHE E 2 211 ? 27.088  25.281  22.024  1.00 24.48 ? 212 PHE A CZ    1 
ATOM   2227 N N     . LEU E 2 212 ? 31.376  28.155  21.310  1.00 31.29 ? 213 LEU A N     1 
ATOM   2228 C CA    . LEU E 2 212 ? 31.131  28.465  19.928  1.00 31.57 ? 213 LEU A CA    1 
ATOM   2229 C C     . LEU E 2 212 ? 32.259  27.963  19.035  1.00 32.33 ? 213 LEU A C     1 
ATOM   2230 O O     . LEU E 2 212 ? 32.078  27.080  18.199  1.00 32.31 ? 213 LEU A O     1 
ATOM   2231 C CB    . LEU E 2 212 ? 30.896  29.969  19.723  1.00 30.62 ? 213 LEU A CB    1 
ATOM   2232 C CG    . LEU E 2 212 ? 29.476  30.375  20.050  1.00 30.24 ? 213 LEU A CG    1 
ATOM   2233 C CD1   . LEU E 2 212 ? 29.322  31.872  19.877  1.00 29.98 ? 213 LEU A CD1   1 
ATOM   2234 C CD2   . LEU E 2 212 ? 28.503  29.651  19.125  1.00 30.54 ? 213 LEU A CD2   1 
ATOM   2235 N N     . ASP E 2 213 ? 33.430  28.521  19.247  1.00 32.91 ? 214 ASP A N     1 
ATOM   2236 C CA    . ASP E 2 213 ? 34.589  28.155  18.476  1.00 33.64 ? 214 ASP A CA    1 
ATOM   2237 C C     . ASP E 2 213 ? 34.782  26.658  18.366  1.00 31.75 ? 214 ASP A C     1 
ATOM   2238 O O     . ASP E 2 213 ? 34.982  26.141  17.273  1.00 32.47 ? 214 ASP A O     1 
ATOM   2239 C CB    . ASP E 2 213 ? 35.860  28.815  18.964  1.00 35.99 ? 214 ASP A CB    1 
ATOM   2240 C CG    . ASP E 2 213 ? 37.002  28.433  18.096  1.00 38.49 ? 214 ASP A CG    1 
ATOM   2241 O OD1   . ASP E 2 213 ? 37.863  27.629  18.424  1.00 39.61 ? 214 ASP A OD1   1 
ATOM   2242 O OD2   . ASP E 2 213 ? 36.961  29.038  16.933  1.00 39.31 ? 214 ASP A OD2   1 
ATOM   2243 N N     . TYR E 2 214 ? 34.723  25.989  19.491  1.00 29.61 ? 215 TYR A N     1 
ATOM   2244 C CA    . TYR E 2 214 ? 34.891  24.565  19.504  1.00 27.56 ? 215 TYR A CA    1 
ATOM   2245 C C     . TYR E 2 214 ? 33.927  23.896  18.546  1.00 30.28 ? 215 TYR A C     1 
ATOM   2246 O O     . TYR E 2 214 ? 34.348  23.132  17.659  1.00 32.72 ? 215 TYR A O     1 
ATOM   2247 C CB    . TYR E 2 214 ? 34.764  23.960  20.925  1.00 23.33 ? 215 TYR A CB    1 
ATOM   2248 C CG    . TYR E 2 214 ? 34.974  22.455  20.931  1.00 19.76 ? 215 TYR A CG    1 
ATOM   2249 C CD1   . TYR E 2 214 ? 33.935  21.572  20.661  1.00 18.40 ? 215 TYR A CD1   1 
ATOM   2250 C CD2   . TYR E 2 214 ? 36.237  21.930  21.188  1.00 18.70 ? 215 TYR A CD2   1 
ATOM   2251 C CE1   . TYR E 2 214 ? 34.149  20.187  20.655  1.00 16.50 ? 215 TYR A CE1   1 
ATOM   2252 C CE2   . TYR E 2 214 ? 36.470  20.553  21.188  1.00 15.93 ? 215 TYR A CE2   1 
ATOM   2253 C CZ    . TYR E 2 214 ? 35.414  19.685  20.925  1.00 13.88 ? 215 TYR A CZ    1 
ATOM   2254 O OH    . TYR E 2 214 ? 35.651  18.348  20.912  1.00 11.34 ? 215 TYR A OH    1 
ATOM   2255 N N     . TRP E 2 215 ? 32.633  24.190  18.726  1.00 29.16 ? 216 TRP A N     1 
ATOM   2256 C CA    . TRP E 2 215 ? 31.570  23.609  17.910  1.00 27.79 ? 216 TRP A CA    1 
ATOM   2257 C C     . TRP E 2 215 ? 31.453  24.103  16.483  1.00 31.02 ? 216 TRP A C     1 
ATOM   2258 O O     . TRP E 2 215 ? 30.775  23.474  15.660  1.00 31.65 ? 216 TRP A O     1 
ATOM   2259 C CB    . TRP E 2 215 ? 30.233  23.570  18.630  1.00 23.41 ? 216 TRP A CB    1 
ATOM   2260 C CG    . TRP E 2 215 ? 30.284  22.487  19.626  1.00 21.93 ? 216 TRP A CG    1 
ATOM   2261 C CD1   . TRP E 2 215 ? 30.418  22.638  20.963  1.00 22.21 ? 216 TRP A CD1   1 
ATOM   2262 C CD2   . TRP E 2 215 ? 30.280  21.078  19.375  1.00 20.00 ? 216 TRP A CD2   1 
ATOM   2263 N NE1   . TRP E 2 215 ? 30.452  21.412  21.574  1.00 21.48 ? 216 TRP A NE1   1 
ATOM   2264 C CE2   . TRP E 2 215 ? 30.362  20.433  20.623  1.00 19.69 ? 216 TRP A CE2   1 
ATOM   2265 C CE3   . TRP E 2 215 ? 30.177  20.322  18.238  1.00 18.91 ? 216 TRP A CE3   1 
ATOM   2266 C CZ2   . TRP E 2 215 ? 30.359  19.064  20.738  1.00 18.60 ? 216 TRP A CZ2   1 
ATOM   2267 C CZ3   . TRP E 2 215 ? 30.163  18.961  18.347  1.00 18.97 ? 216 TRP A CZ3   1 
ATOM   2268 C CH2   . TRP E 2 215 ? 30.260  18.332  19.588  1.00 18.75 ? 216 TRP A CH2   1 
ATOM   2269 N N     . ARG E 2 216 ? 32.109  25.217  16.200  1.00 31.82 ? 217 ARG A N     1 
ATOM   2270 C CA    . ARG E 2 216 ? 32.081  25.767  14.876  1.00 29.83 ? 217 ARG A CA    1 
ATOM   2271 C C     . ARG E 2 216 ? 33.102  25.050  14.027  1.00 31.85 ? 217 ARG A C     1 
ATOM   2272 O O     . ARG E 2 216 ? 32.932  24.883  12.831  1.00 32.94 ? 217 ARG A O     1 
ATOM   2273 C CB    . ARG E 2 216 ? 32.340  27.247  14.882  1.00 27.06 ? 217 ARG A CB    1 
ATOM   2274 C CG    . ARG E 2 216 ? 31.265  28.043  15.596  1.00 25.63 ? 217 ARG A CG    1 
ATOM   2275 C CD    . ARG E 2 216 ? 31.059  29.404  14.959  1.00 25.40 ? 217 ARG A CD    1 
ATOM   2276 N NE    . ARG E 2 216 ? 30.837  30.495  15.898  1.00 25.06 ? 217 ARG A NE    1 
ATOM   2277 C CZ    . ARG E 2 216 ? 29.768  31.291  15.821  1.00 25.53 ? 217 ARG A CZ    1 
ATOM   2278 N NH1   . ARG E 2 216 ? 28.838  31.108  14.888  1.00 24.46 ? 217 ARG A NH1   1 
ATOM   2279 N NH2   . ARG E 2 216 ? 29.612  32.270  16.714  1.00 26.36 ? 217 ARG A NH2   1 
ATOM   2280 N N     . ASN E 2 217 ? 34.176  24.596  14.670  1.00 32.49 ? 218 ASN A N     1 
ATOM   2281 C CA    . ASN E 2 217 ? 35.213  23.880  13.943  1.00 33.61 ? 218 ASN A CA    1 
ATOM   2282 C C     . ASN E 2 217 ? 35.239  22.376  14.239  1.00 36.38 ? 218 ASN A C     1 
ATOM   2283 O O     . ASN E 2 217 ? 36.282  21.731  14.233  1.00 36.99 ? 218 ASN A O     1 
ATOM   2284 C CB    . ASN E 2 217 ? 36.621  24.525  14.008  1.00 31.75 ? 218 ASN A CB    1 
ATOM   2285 C CG    . ASN E 2 217 ? 36.646  26.021  14.284  1.00 29.95 ? 218 ASN A CG    1 
ATOM   2286 O OD1   . ASN E 2 217 ? 36.406  26.849  13.384  1.00 28.18 ? 218 ASN A OD1   1 
ATOM   2287 N ND2   . ASN E 2 217 ? 36.952  26.379  15.538  1.00 29.55 ? 218 ASN A ND2   1 
ATOM   2288 N N     . TYR E 2 218 ? 34.075  21.810  14.503  1.00 37.86 ? 219 TYR A N     1 
ATOM   2289 C CA    . TYR E 2 218 ? 34.038  20.394  14.753  1.00 39.56 ? 219 TYR A CA    1 
ATOM   2290 C C     . TYR E 2 218 ? 33.897  19.725  13.416  1.00 44.27 ? 219 TYR A C     1 
ATOM   2291 O O     . TYR E 2 218 ? 32.987  20.067  12.645  1.00 45.94 ? 219 TYR A O     1 
ATOM   2292 C CB    . TYR E 2 218 ? 32.863  20.035  15.641  1.00 37.61 ? 219 TYR A CB    1 
ATOM   2293 C CG    . TYR E 2 218 ? 32.818  18.587  16.078  1.00 34.93 ? 219 TYR A CG    1 
ATOM   2294 C CD1   . TYR E 2 218 ? 32.019  17.655  15.409  1.00 33.13 ? 219 TYR A CD1   1 
ATOM   2295 C CD2   . TYR E 2 218 ? 33.545  18.173  17.190  1.00 33.40 ? 219 TYR A CD2   1 
ATOM   2296 C CE1   . TYR E 2 218 ? 31.960  16.334  15.821  1.00 32.66 ? 219 TYR A CE1   1 
ATOM   2297 C CE2   . TYR E 2 218 ? 33.502  16.851  17.621  1.00 32.44 ? 219 TYR A CE2   1 
ATOM   2298 C CZ    . TYR E 2 218 ? 32.705  15.936  16.939  1.00 33.37 ? 219 TYR A CZ    1 
ATOM   2299 O OH    . TYR E 2 218 ? 32.647  14.638  17.351  1.00 35.73 ? 219 TYR A OH    1 
ATOM   2300 N N     . GLU E 2 219 ? 34.799  18.786  13.108  1.00 46.86 ? 220 GLU A N     1 
ATOM   2301 C CA    . GLU E 2 219 ? 34.761  18.093  11.822  1.00 48.99 ? 220 GLU A CA    1 
ATOM   2302 C C     . GLU E 2 219 ? 33.827  16.899  11.835  1.00 53.34 ? 220 GLU A C     1 
ATOM   2303 O O     . GLU E 2 219 ? 33.999  15.968  12.626  1.00 53.33 ? 220 GLU A O     1 
ATOM   2304 C CB    . GLU E 2 219 ? 36.155  17.679  11.308  1.00 47.43 ? 220 GLU A CB    1 
ATOM   2305 C CG    . GLU E 2 219 ? 37.028  18.873  10.871  1.00 48.21 ? 220 GLU A CG    1 
ATOM   2306 C CD    . GLU E 2 219 ? 36.680  19.422  9.514   1.00 49.31 ? 220 GLU A CD    1 
ATOM   2307 O OE1   . GLU E 2 219 ? 36.114  18.778  8.659   1.00 50.38 ? 220 GLU A OE1   1 
ATOM   2308 O OE2   . GLU E 2 219 ? 37.073  20.664  9.347   1.00 49.01 ? 220 GLU A OE2   1 
ATOM   2309 N N     . TYR E 2 229 ? 41.680  18.109  16.457  1.00 43.05 ? 230 TYR A N     1 
ATOM   2310 C CA    . TYR E 2 229 ? 40.645  17.934  17.466  1.00 39.62 ? 230 TYR A CA    1 
ATOM   2311 C C     . TYR E 2 229 ? 39.480  16.963  17.389  1.00 40.57 ? 230 TYR A C     1 
ATOM   2312 O O     . TYR E 2 229 ? 38.709  16.923  16.425  1.00 40.97 ? 230 TYR A O     1 
ATOM   2313 C CB    . TYR E 2 229 ? 40.438  19.128  18.398  1.00 34.60 ? 230 TYR A CB    1 
ATOM   2314 C CG    . TYR E 2 229 ? 39.502  20.163  17.858  1.00 29.30 ? 230 TYR A CG    1 
ATOM   2315 C CD1   . TYR E 2 229 ? 39.991  21.205  17.081  1.00 27.63 ? 230 TYR A CD1   1 
ATOM   2316 C CD2   . TYR E 2 229 ? 38.141  20.123  18.141  1.00 27.08 ? 230 TYR A CD2   1 
ATOM   2317 C CE1   . TYR E 2 229 ? 39.147  22.192  16.586  1.00 26.06 ? 230 TYR A CE1   1 
ATOM   2318 C CE2   . TYR E 2 229 ? 37.275  21.102  17.653  1.00 25.68 ? 230 TYR A CE2   1 
ATOM   2319 C CZ    . TYR E 2 229 ? 37.784  22.137  16.875  1.00 24.66 ? 230 TYR A CZ    1 
ATOM   2320 O OH    . TYR E 2 229 ? 36.958  23.108  16.386  1.00 23.45 ? 230 TYR A OH    1 
ATOM   2321 N N     . ASN E 2 230 ? 39.369  16.222  18.508  1.00 39.58 ? 231 ASN A N     1 
ATOM   2322 C CA    . ASN E 2 230 ? 38.326  15.235  18.752  1.00 38.59 ? 231 ASN A CA    1 
ATOM   2323 C C     . ASN E 2 230 ? 37.686  15.411  20.140  1.00 34.04 ? 231 ASN A C     1 
ATOM   2324 O O     . ASN E 2 230 ? 36.750  14.694  20.500  1.00 33.08 ? 231 ASN A O     1 
ATOM   2325 C CB    . ASN E 2 230 ? 38.812  13.787  18.540  1.00 42.36 ? 231 ASN A CB    1 
ATOM   2326 C CG    . ASN E 2 230 ? 37.877  12.983  17.653  1.00 45.13 ? 231 ASN A CG    1 
ATOM   2327 O OD1   . ASN E 2 230 ? 38.237  12.617  16.528  1.00 44.72 ? 231 ASN A OD1   1 
ATOM   2328 N ND2   . ASN E 2 230 ? 36.665  12.688  18.154  1.00 46.78 ? 231 ASN A ND2   1 
ATOM   2329 N N     . ASN E 2 231 ? 38.197  16.374  20.918  1.00 31.02 ? 232 ASN A N     1 
ATOM   2330 C CA    . ASN E 2 231 ? 37.708  16.692  22.255  1.00 27.87 ? 232 ASN A CA    1 
ATOM   2331 C C     . ASN E 2 231 ? 38.326  17.966  22.776  1.00 26.51 ? 232 ASN A C     1 
ATOM   2332 O O     . ASN E 2 231 ? 39.336  18.411  22.262  1.00 27.31 ? 232 ASN A O     1 
ATOM   2333 C CB    . ASN E 2 231 ? 37.923  15.554  23.252  1.00 27.97 ? 232 ASN A CB    1 
ATOM   2334 C CG    . ASN E 2 231 ? 39.362  15.315  23.593  1.00 30.08 ? 232 ASN A CG    1 
ATOM   2335 O OD1   . ASN E 2 231 ? 40.140  16.238  23.869  1.00 30.27 ? 232 ASN A OD1   1 
ATOM   2336 N ND2   . ASN E 2 231 ? 39.737  14.041  23.573  1.00 32.06 ? 232 ASN A ND2   1 
ATOM   2337 N N     . ILE E 2 232 ? 37.720  18.531  23.824  1.00 25.17 ? 233 ILE A N     1 
ATOM   2338 C CA    . ILE E 2 232 ? 38.178  19.781  24.435  1.00 22.64 ? 233 ILE A CA    1 
ATOM   2339 C C     . ILE E 2 232 ? 39.659  19.836  24.801  1.00 26.79 ? 233 ILE A C     1 
ATOM   2340 O O     . ILE E 2 232 ? 40.267  20.903  24.756  1.00 27.92 ? 233 ILE A O     1 
ATOM   2341 C CB    . ILE E 2 232 ? 37.324  20.210  25.592  1.00 16.94 ? 233 ILE A CB    1 
ATOM   2342 C CG1   . ILE E 2 232 ? 37.726  21.619  25.997  1.00 13.51 ? 233 ILE A CG1   1 
ATOM   2343 C CG2   . ILE E 2 232 ? 37.546  19.255  26.749  1.00 16.57 ? 233 ILE A CG2   1 
ATOM   2344 C CD1   . ILE E 2 232 ? 37.285  22.670  25.000  1.00 12.18 ? 233 ILE A CD1   1 
ATOM   2345 N N     . SER E 2 233 ? 40.260  18.722  25.180  1.00 30.06 ? 234 SER A N     1 
ATOM   2346 C CA    . SER E 2 233 ? 41.673  18.802  25.515  1.00 34.31 ? 234 SER A CA    1 
ATOM   2347 C C     . SER E 2 233 ? 42.498  18.961  24.261  1.00 35.08 ? 234 SER A C     1 
ATOM   2348 O O     . SER E 2 233 ? 43.317  19.884  24.165  1.00 35.21 ? 234 SER A O     1 
ATOM   2349 C CB    . SER E 2 233 ? 42.148  17.647  26.383  1.00 38.81 ? 234 SER A CB    1 
ATOM   2350 O OG    . SER E 2 233 ? 42.222  16.469  25.618  1.00 42.17 ? 234 SER A OG    1 
ATOM   2351 N N     . GLU E 2 234 ? 42.228  18.053  23.290  1.00 35.52 ? 235 GLU A N     1 
ATOM   2352 C CA    . GLU E 2 234 ? 42.865  18.021  21.966  1.00 35.59 ? 235 GLU A CA    1 
ATOM   2353 C C     . GLU E 2 234 ? 42.632  19.351  21.227  1.00 36.18 ? 235 GLU A C     1 
ATOM   2354 O O     . GLU E 2 234 ? 43.321  19.669  20.256  1.00 37.67 ? 235 GLU A O     1 
ATOM   2355 C CB    . GLU E 2 234 ? 42.242  16.907  21.092  1.00 34.44 ? 235 GLU A CB    1 
ATOM   2356 C CG    . GLU E 2 234 ? 43.056  15.625  20.938  1.00 34.29 ? 235 GLU A CG    1 
ATOM   2357 C CD    . GLU E 2 234 ? 42.337  14.583  20.089  1.00 35.97 ? 235 GLU A CD    1 
ATOM   2358 O OE1   . GLU E 2 234 ? 42.653  14.320  18.945  1.00 36.05 ? 235 GLU A OE1   1 
ATOM   2359 O OE2   . GLU E 2 234 ? 41.343  14.002  20.700  1.00 37.75 ? 235 GLU A OE2   1 
ATOM   2360 N N     . TYR E 2 235 ? 41.627  20.107  21.696  1.00 34.60 ? 236 TYR A N     1 
ATOM   2361 C CA    . TYR E 2 235 ? 41.261  21.396  21.124  1.00 34.70 ? 236 TYR A CA    1 
ATOM   2362 C C     . TYR E 2 235 ? 42.148  22.551  21.613  1.00 38.63 ? 236 TYR A C     1 
ATOM   2363 O O     . TYR E 2 235 ? 42.603  23.410  20.835  1.00 38.97 ? 236 TYR A O     1 
ATOM   2364 C CB    . TYR E 2 235 ? 39.782  21.731  21.413  1.00 30.78 ? 236 TYR A CB    1 
ATOM   2365 C CG    . TYR E 2 235 ? 39.485  23.211  21.291  1.00 28.17 ? 236 TYR A CG    1 
ATOM   2366 C CD1   . TYR E 2 235 ? 39.709  24.079  22.358  1.00 27.94 ? 236 TYR A CD1   1 
ATOM   2367 C CD2   . TYR E 2 235 ? 38.967  23.737  20.115  1.00 28.09 ? 236 TYR A CD2   1 
ATOM   2368 C CE1   . TYR E 2 235 ? 39.435  25.440  22.249  1.00 28.80 ? 236 TYR A CE1   1 
ATOM   2369 C CE2   . TYR E 2 235 ? 38.678  25.098  19.986  1.00 28.42 ? 236 TYR A CE2   1 
ATOM   2370 C CZ    . TYR E 2 235 ? 38.914  25.950  21.060  1.00 28.94 ? 236 TYR A CZ    1 
ATOM   2371 O OH    . TYR E 2 235 ? 38.634  27.295  20.950  1.00 29.23 ? 236 TYR A OH    1 
ATOM   2372 N N     . ARG E 2 236 ? 42.364  22.575  22.924  1.00 40.97 ? 237 ARG A N     1 
ATOM   2373 C CA    . ARG E 2 236 ? 43.177  23.601  23.541  1.00 42.39 ? 237 ARG A CA    1 
ATOM   2374 C C     . ARG E 2 236 ? 44.584  23.530  22.975  1.00 41.80 ? 237 ARG A C     1 
ATOM   2375 O O     . ARG E 2 236 ? 45.203  24.549  22.648  1.00 39.31 ? 237 ARG A O     1 
ATOM   2376 C CB    . ARG E 2 236 ? 43.177  23.434  25.052  1.00 45.05 ? 237 ARG A CB    1 
ATOM   2377 C CG    . ARG E 2 236 ? 42.114  24.278  25.746  1.00 45.90 ? 237 ARG A CG    1 
ATOM   2378 C CD    . ARG E 2 236 ? 41.047  23.450  26.428  1.00 45.97 ? 237 ARG A CD    1 
ATOM   2379 N NE    . ARG E 2 236 ? 39.925  24.270  26.845  1.00 48.17 ? 237 ARG A NE    1 
ATOM   2380 C CZ    . ARG E 2 236 ? 39.225  24.063  27.964  1.00 51.82 ? 237 ARG A CZ    1 
ATOM   2381 N NH1   . ARG E 2 236 ? 39.510  23.052  28.793  1.00 53.59 ? 237 ARG A NH1   1 
ATOM   2382 N NH2   . ARG E 2 236 ? 38.215  24.883  28.266  1.00 52.26 ? 237 ARG A NH2   1 
ATOM   2383 N N     . ASN E 2 237 ? 45.059  22.280  22.860  1.00 43.55 ? 238 ASN A N     1 
ATOM   2384 C CA    . ASN E 2 237 ? 46.368  22.009  22.300  1.00 44.92 ? 238 ASN A CA    1 
ATOM   2385 C C     . ASN E 2 237 ? 46.386  22.590  20.880  1.00 43.81 ? 238 ASN A C     1 
ATOM   2386 O O     . ASN E 2 237 ? 47.304  23.291  20.481  1.00 44.17 ? 238 ASN A O     1 
ATOM   2387 C CB    . ASN E 2 237 ? 46.704  20.497  22.300  1.00 46.11 ? 238 ASN A CB    1 
ATOM   2388 C CG    . ASN E 2 237 ? 46.994  19.932  23.695  1.00 45.86 ? 238 ASN A CG    1 
ATOM   2389 O OD1   . ASN E 2 237 ? 47.798  18.993  23.869  1.00 45.00 ? 238 ASN A OD1   1 
ATOM   2390 N ND2   . ASN E 2 237 ? 46.329  20.505  24.705  1.00 45.22 ? 238 ASN A ND2   1 
ATOM   2391 N N     . TRP E 2 238 ? 45.308  22.304  20.147  1.00 42.25 ? 239 TRP A N     1 
ATOM   2392 C CA    . TRP E 2 238 ? 45.084  22.758  18.791  1.00 41.14 ? 239 TRP A CA    1 
ATOM   2393 C C     . TRP E 2 238 ? 45.170  24.270  18.668  1.00 44.68 ? 239 TRP A C     1 
ATOM   2394 O O     . TRP E 2 238 ? 44.931  24.835  17.608  1.00 44.71 ? 239 TRP A O     1 
ATOM   2395 C CB    . TRP E 2 238 ? 43.676  22.328  18.353  1.00 38.89 ? 239 TRP A CB    1 
ATOM   2396 C CG    . TRP E 2 238 ? 43.423  22.527  16.894  1.00 38.00 ? 239 TRP A CG    1 
ATOM   2397 C CD1   . TRP E 2 238 ? 44.065  21.898  15.898  1.00 38.88 ? 239 TRP A CD1   1 
ATOM   2398 C CD2   . TRP E 2 238 ? 42.463  23.394  16.264  1.00 37.14 ? 239 TRP A CD2   1 
ATOM   2399 N NE1   . TRP E 2 238 ? 43.589  22.304  14.689  1.00 39.26 ? 239 TRP A NE1   1 
ATOM   2400 C CE2   . TRP E 2 238 ? 42.603  23.219  14.876  1.00 38.17 ? 239 TRP A CE2   1 
ATOM   2401 C CE3   . TRP E 2 238 ? 41.514  24.286  16.727  1.00 37.43 ? 239 TRP A CE3   1 
ATOM   2402 C CZ2   . TRP E 2 238 ? 41.828  23.888  13.950  1.00 38.24 ? 239 TRP A CZ2   1 
ATOM   2403 C CZ3   . TRP E 2 238 ? 40.752  24.963  15.808  1.00 38.41 ? 239 TRP A CZ3   1 
ATOM   2404 C CH2   . TRP E 2 238 ? 40.909  24.772  14.432  1.00 38.56 ? 239 TRP A CH2   1 
ATOM   2405 N N     . ILE E 2 239 ? 45.497  24.947  19.761  1.00 48.98 ? 240 ILE A N     1 
ATOM   2406 C CA    . ILE E 2 239 ? 45.610  26.411  19.748  1.00 52.29 ? 240 ILE A CA    1 
ATOM   2407 C C     . ILE E 2 239 ? 47.066  26.841  20.025  1.00 53.28 ? 240 ILE A C     1 
ATOM   2408 O O     . ILE E 2 239 ? 47.985  25.989  19.890  1.00 52.35 ? 240 ILE A O     1 
ATOM   2409 C CB    . ILE E 2 239 ? 44.590  27.104  20.700  1.00 52.50 ? 240 ILE A CB    1 
ATOM   2410 C CG1   . ILE E 2 239 ? 43.178  26.507  20.545  1.00 51.70 ? 240 ILE A CG1   1 
ATOM   2411 C CG2   . ILE E 2 239 ? 44.545  28.616  20.475  1.00 52.34 ? 240 ILE A CG2   1 
ATOM   2412 C CD1   . ILE E 2 239 ? 42.469  26.929  19.260  1.00 51.29 ? 240 ILE A CD1   1 
ATOM   2413 N N     . SER F 2 1   ? -17.174 -13.739 11.976  1.00 35.18 ? 2   SER B N     1 
ATOM   2414 C CA    . SER F 2 1   ? -16.048 -13.150 11.276  1.00 33.82 ? 2   SER B CA    1 
ATOM   2415 C C     . SER F 2 1   ? -15.248 -12.211 12.156  1.00 31.84 ? 2   SER B C     1 
ATOM   2416 O O     . SER F 2 1   ? -15.647 -11.064 12.375  1.00 32.19 ? 2   SER B O     1 
ATOM   2417 C CB    . SER F 2 1   ? -16.513 -12.434 10.028  1.00 35.08 ? 2   SER B CB    1 
ATOM   2418 O OG    . SER F 2 1   ? -15.519 -12.537 9.019   1.00 36.52 ? 2   SER B OG    1 
ATOM   2419 N N     . LEU F 2 2   ? -14.112 -12.688 12.664  1.00 29.14 ? 3   LEU B N     1 
ATOM   2420 C CA    . LEU F 2 2   ? -13.263 -11.876 13.513  1.00 25.64 ? 3   LEU B CA    1 
ATOM   2421 C C     . LEU F 2 2   ? -12.980 -10.499 12.921  1.00 26.04 ? 3   LEU B C     1 
ATOM   2422 O O     . LEU F 2 2   ? -12.799 -9.544  13.654  1.00 28.71 ? 3   LEU B O     1 
ATOM   2423 C CB    . LEU F 2 2   ? -11.962 -12.585 13.911  1.00 22.29 ? 3   LEU B CB    1 
ATOM   2424 C CG    . LEU F 2 2   ? -10.897 -11.653 14.458  1.00 19.12 ? 3   LEU B CG    1 
ATOM   2425 C CD1   . LEU F 2 2   ? -11.330 -11.112 15.814  1.00 18.06 ? 3   LEU B CD1   1 
ATOM   2426 C CD2   . LEU F 2 2   ? -9.578  -12.402 14.599  1.00 18.19 ? 3   LEU B CD2   1 
ATOM   2427 N N     . ARG F 2 3   ? -12.957 -10.380 11.591  1.00 24.04 ? 4   ARG B N     1 
ATOM   2428 C CA    . ARG F 2 3   ? -12.674 -9.058  10.999  1.00 23.50 ? 4   ARG B CA    1 
ATOM   2429 C C     . ARG F 2 3   ? -13.893 -8.310  10.601  1.00 21.83 ? 4   ARG B C     1 
ATOM   2430 O O     . ARG F 2 3   ? -13.877 -7.100  10.536  1.00 20.57 ? 4   ARG B O     1 
ATOM   2431 C CB    . ARG F 2 3   ? -11.604 -9.019  9.906   1.00 23.56 ? 4   ARG B CB    1 
ATOM   2432 C CG    . ARG F 2 3   ? -12.080 -9.472  8.543   1.00 22.36 ? 4   ARG B CG    1 
ATOM   2433 C CD    . ARG F 2 3   ? -10.934 -9.608  7.553   1.00 21.14 ? 4   ARG B CD    1 
ATOM   2434 N NE    . ARG F 2 3   ? -10.769 -8.390  6.782   1.00 19.84 ? 4   ARG B NE    1 
ATOM   2435 C CZ    . ARG F 2 3   ? -9.849  -8.191  5.850   1.00 17.66 ? 4   ARG B CZ    1 
ATOM   2436 N NH1   . ARG F 2 3   ? -8.963  -9.098  5.522   1.00 16.06 ? 4   ARG B NH1   1 
ATOM   2437 N NH2   . ARG F 2 3   ? -9.827  -7.029  5.233   1.00 18.88 ? 4   ARG B NH2   1 
ATOM   2438 N N     . SER F 2 4   ? -14.945 -9.051  10.324  1.00 22.61 ? 5   SER B N     1 
ATOM   2439 C CA    . SER F 2 4   ? -16.180 -8.454  9.932   1.00 22.97 ? 5   SER B CA    1 
ATOM   2440 C C     . SER F 2 4   ? -16.753 -7.713  11.115  1.00 24.60 ? 5   SER B C     1 
ATOM   2441 O O     . SER F 2 4   ? -17.369 -6.670  10.954  1.00 26.00 ? 5   SER B O     1 
ATOM   2442 C CB    . SER F 2 4   ? -17.154 -9.488  9.437   1.00 23.75 ? 5   SER B CB    1 
ATOM   2443 O OG    . SER F 2 4   ? -18.233 -9.608  10.350  1.00 25.76 ? 5   SER B OG    1 
ATOM   2444 N N     . ASP F 2 5   ? -16.517 -8.294  12.298  1.00 24.18 ? 6   ASP B N     1 
ATOM   2445 C CA    . ASP F 2 5   ? -16.956 -7.777  13.571  1.00 22.70 ? 6   ASP B CA    1 
ATOM   2446 C C     . ASP F 2 5   ? -16.083 -6.639  13.956  1.00 22.32 ? 6   ASP B C     1 
ATOM   2447 O O     . ASP F 2 5   ? -16.544 -5.612  14.413  1.00 22.03 ? 6   ASP B O     1 
ATOM   2448 C CB    . ASP F 2 5   ? -16.792 -8.836  14.657  1.00 23.77 ? 6   ASP B CB    1 
ATOM   2449 C CG    . ASP F 2 5   ? -17.903 -9.823  14.689  1.00 25.01 ? 6   ASP B CG    1 
ATOM   2450 O OD1   . ASP F 2 5   ? -18.885 -9.711  13.982  1.00 26.51 ? 6   ASP B OD1   1 
ATOM   2451 O OD2   . ASP F 2 5   ? -17.696 -10.810 15.557  1.00 24.02 ? 6   ASP B OD2   1 
ATOM   2452 N N     . LEU F 2 6   ? -14.780 -6.877  13.763  1.00 23.64 ? 7   LEU B N     1 
ATOM   2453 C CA    . LEU F 2 6   ? -13.728 -5.922  14.066  1.00 24.08 ? 7   LEU B CA    1 
ATOM   2454 C C     . LEU F 2 6   ? -13.883 -4.673  13.211  1.00 26.95 ? 7   LEU B C     1 
ATOM   2455 O O     . LEU F 2 6   ? -13.585 -3.558  13.648  1.00 27.83 ? 7   LEU B O     1 
ATOM   2456 C CB    . LEU F 2 6   ? -12.349 -6.567  13.898  1.00 21.63 ? 7   LEU B CB    1 
ATOM   2457 C CG    . LEU F 2 6   ? -11.176 -5.691  14.316  1.00 20.54 ? 7   LEU B CG    1 
ATOM   2458 C CD1   . LEU F 2 6   ? -11.460 -5.023  15.653  1.00 19.49 ? 7   LEU B CD1   1 
ATOM   2459 C CD2   . LEU F 2 6   ? -9.945  -6.575  14.432  1.00 20.03 ? 7   LEU B CD2   1 
ATOM   2460 N N     . ILE F 2 7   ? -14.364 -4.887  11.970  1.00 27.79 ? 8   ILE B N     1 
ATOM   2461 C CA    . ILE F 2 7   ? -14.565 -3.789  11.051  1.00 26.40 ? 8   ILE B CA    1 
ATOM   2462 C C     . ILE F 2 7   ? -15.774 -3.001  11.488  1.00 26.29 ? 8   ILE B C     1 
ATOM   2463 O O     . ILE F 2 7   ? -15.724 -1.791  11.481  1.00 27.00 ? 8   ILE B O     1 
ATOM   2464 C CB    . ILE F 2 7   ? -14.684 -4.203  9.578   1.00 25.38 ? 8   ILE B CB    1 
ATOM   2465 C CG1   . ILE F 2 7   ? -13.308 -4.497  9.000   1.00 26.36 ? 8   ILE B CG1   1 
ATOM   2466 C CG2   . ILE F 2 7   ? -15.277 -3.073  8.775   1.00 25.12 ? 8   ILE B CG2   1 
ATOM   2467 C CD1   . ILE F 2 7   ? -13.339 -5.556  7.901   1.00 26.97 ? 8   ILE B CD1   1 
ATOM   2468 N N     . ASN F 2 8   ? -16.843 -3.717  11.861  1.00 26.49 ? 9   ASN B N     1 
ATOM   2469 C CA    . ASN F 2 8   ? -18.090 -3.096  12.285  1.00 28.86 ? 9   ASN B CA    1 
ATOM   2470 C C     . ASN F 2 8   ? -17.900 -2.229  13.513  1.00 30.50 ? 9   ASN B C     1 
ATOM   2471 O O     . ASN F 2 8   ? -18.429 -1.138  13.596  1.00 30.33 ? 9   ASN B O     1 
ATOM   2472 C CB    . ASN F 2 8   ? -19.251 -4.107  12.458  1.00 31.60 ? 9   ASN B CB    1 
ATOM   2473 C CG    . ASN F 2 8   ? -19.732 -4.776  11.166  1.00 35.51 ? 9   ASN B CG    1 
ATOM   2474 O OD1   . ASN F 2 8   ? -19.168 -4.617  10.073  1.00 37.27 ? 9   ASN B OD1   1 
ATOM   2475 N ND2   . ASN F 2 8   ? -20.796 -5.548  11.282  1.00 36.68 ? 9   ASN B ND2   1 
ATOM   2476 N N     . ALA F 2 9   ? -17.139 -2.738  14.464  1.00 32.80 ? 10  ALA B N     1 
ATOM   2477 C CA    . ALA F 2 9   ? -16.870 -1.998  15.673  1.00 32.34 ? 10  ALA B CA    1 
ATOM   2478 C C     . ALA F 2 9   ? -16.265 -0.653  15.293  1.00 34.75 ? 10  ALA B C     1 
ATOM   2479 O O     . ALA F 2 9   ? -16.802 0.390   15.596  1.00 35.08 ? 10  ALA B O     1 
ATOM   2480 C CB    . ALA F 2 9   ? -15.958 -2.778  16.598  1.00 29.82 ? 10  ALA B CB    1 
ATOM   2481 N N     . LEU F 2 10  ? -15.155 -0.693  14.580  1.00 37.13 ? 11  LEU B N     1 
ATOM   2482 C CA    . LEU F 2 10  ? -14.477 0.509   14.130  1.00 39.34 ? 11  LEU B CA    1 
ATOM   2483 C C     . LEU F 2 10  ? -15.395 1.512   13.442  1.00 40.33 ? 11  LEU B C     1 
ATOM   2484 O O     . LEU F 2 10  ? -15.491 2.659   13.866  1.00 40.07 ? 11  LEU B O     1 
ATOM   2485 C CB    . LEU F 2 10  ? -13.308 0.183   13.185  1.00 39.65 ? 11  LEU B CB    1 
ATOM   2486 C CG    . LEU F 2 10  ? -12.279 -0.748  13.789  1.00 39.29 ? 11  LEU B CG    1 
ATOM   2487 C CD1   . LEU F 2 10  ? -11.222 -1.059  12.748  1.00 40.23 ? 11  LEU B CD1   1 
ATOM   2488 C CD2   . LEU F 2 10  ? -11.628 -0.103  15.004  1.00 38.59 ? 11  LEU B CD2   1 
ATOM   2489 N N     . TYR F 2 11  ? -16.039 1.059   12.356  1.00 42.09 ? 12  TYR B N     1 
ATOM   2490 C CA    . TYR F 2 11  ? -16.941 1.863   11.552  1.00 44.53 ? 12  TYR B CA    1 
ATOM   2491 C C     . TYR F 2 11  ? -18.053 2.523   12.330  1.00 49.15 ? 12  TYR B C     1 
ATOM   2492 O O     . TYR F 2 11  ? -19.233 2.221   12.124  1.00 49.01 ? 12  TYR B O     1 
ATOM   2493 C CB    . TYR F 2 11  ? -17.502 1.098   10.356  1.00 44.16 ? 12  TYR B CB    1 
ATOM   2494 C CG    . TYR F 2 11  ? -16.458 0.844   9.315   1.00 44.32 ? 12  TYR B CG    1 
ATOM   2495 C CD1   . TYR F 2 11  ? -15.306 1.616   9.283   1.00 45.74 ? 12  TYR B CD1   1 
ATOM   2496 C CD2   . TYR F 2 11  ? -16.613 -0.175  8.376   1.00 44.60 ? 12  TYR B CD2   1 
ATOM   2497 C CE1   . TYR F 2 11  ? -14.317 1.393   8.318   1.00 47.11 ? 12  TYR B CE1   1 
ATOM   2498 C CE2   . TYR F 2 11  ? -15.636 -0.414  7.406   1.00 45.89 ? 12  TYR B CE2   1 
ATOM   2499 C CZ    . TYR F 2 11  ? -14.478 0.374   7.380   1.00 46.52 ? 12  TYR B CZ    1 
ATOM   2500 O OH    . TYR F 2 11  ? -13.501 0.159   6.435   1.00 45.88 ? 12  TYR B OH    1 
ATOM   2501 N N     . VAL F 2 19  ? -11.103 12.784  21.529  1.00 43.69 ? 20  VAL B N     1 
ATOM   2502 C CA    . VAL F 2 19  ? -10.096 12.959  22.564  1.00 38.78 ? 20  VAL B CA    1 
ATOM   2503 C C     . VAL F 2 19  ? -9.672  14.408  22.461  1.00 33.41 ? 20  VAL B C     1 
ATOM   2504 O O     . VAL F 2 19  ? -9.247  14.837  21.375  1.00 31.19 ? 20  VAL B O     1 
ATOM   2505 C CB    . VAL F 2 19  ? -8.890  12.028  22.429  1.00 38.74 ? 20  VAL B CB    1 
ATOM   2506 C CG1   . VAL F 2 19  ? -7.616  12.744  22.905  1.00 38.50 ? 20  VAL B CG1   1 
ATOM   2507 C CG2   . VAL F 2 19  ? -9.108  10.754  23.245  1.00 38.15 ? 20  VAL B CG2   1 
ATOM   2508 N N     . CYS F 2 20  ? -9.804  15.164  23.580  1.00 29.53 ? 21  CYS B N     1 
ATOM   2509 C CA    . CYS F 2 20  ? -9.472  16.597  23.567  1.00 23.60 ? 21  CYS B CA    1 
ATOM   2510 C C     . CYS F 2 20  ? -8.530  17.178  24.615  1.00 17.33 ? 21  CYS B C     1 
ATOM   2511 O O     . CYS F 2 20  ? -8.748  18.316  25.007  1.00 13.97 ? 21  CYS B O     1 
ATOM   2512 C CB    . CYS F 2 20  ? -10.756 17.377  23.657  1.00 21.41 ? 21  CYS B CB    1 
ATOM   2513 S SG    . CYS F 2 20  ? -11.480 17.034  25.238  1.00 19.79 ? 21  CYS B SG    1 
ATOM   2514 N N     . GLY F 2 21  ? -7.488  16.469  25.033  1.00 15.31 ? 22  GLY B N     1 
ATOM   2515 C CA    . GLY F 2 21  ? -6.576  17.050  26.010  1.00 13.05 ? 22  GLY B CA    1 
ATOM   2516 C C     . GLY F 2 21  ? -5.828  16.055  26.878  1.00 12.26 ? 22  GLY B C     1 
ATOM   2517 O O     . GLY F 2 21  ? -6.062  14.853  26.884  1.00 11.83 ? 22  GLY B O     1 
ATOM   2518 N N     . ILE F 2 22  ? -4.899  16.605  27.630  1.00 12.75 ? 23  ILE B N     1 
ATOM   2519 C CA    . ILE F 2 22  ? -4.082  15.848  28.549  1.00 12.81 ? 23  ILE B CA    1 
ATOM   2520 C C     . ILE F 2 22  ? -4.389  16.342  29.950  1.00 15.19 ? 23  ILE B C     1 
ATOM   2521 O O     . ILE F 2 22  ? -4.339  17.552  30.208  1.00 16.82 ? 23  ILE B O     1 
ATOM   2522 C CB    . ILE F 2 22  ? -2.616  16.031  28.234  1.00 11.19 ? 23  ILE B CB    1 
ATOM   2523 C CG1   . ILE F 2 22  ? -2.230  15.188  27.032  1.00 11.42 ? 23  ILE B CG1   1 
ATOM   2524 C CG2   . ILE F 2 22  ? -1.792  15.610  29.417  1.00 11.36 ? 23  ILE B CG2   1 
ATOM   2525 C CD1   . ILE F 2 22  ? -1.039  15.761  26.267  1.00 10.38 ? 23  ILE B CD1   1 
ATOM   2526 N N     . ILE F 2 23  ? -4.742  15.442  30.863  1.00 15.47 ? 24  ILE B N     1 
ATOM   2527 C CA    . ILE F 2 23  ? -5.072  15.880  32.194  1.00 17.25 ? 24  ILE B CA    1 
ATOM   2528 C C     . ILE F 2 23  ? -3.927  15.745  33.171  1.00 20.72 ? 24  ILE B C     1 
ATOM   2529 O O     . ILE F 2 23  ? -3.269  14.710  33.222  1.00 20.25 ? 24  ILE B O     1 
ATOM   2530 C CB    . ILE F 2 23  ? -6.368  15.267  32.702  1.00 17.05 ? 24  ILE B CB    1 
ATOM   2531 C CG1   . ILE F 2 23  ? -6.624  15.689  34.142  1.00 17.81 ? 24  ILE B CG1   1 
ATOM   2532 C CG2   . ILE F 2 23  ? -6.319  13.755  32.618  1.00 15.96 ? 24  ILE B CG2   1 
ATOM   2533 C CD1   . ILE F 2 23  ? -8.101  15.721  34.502  1.00 17.19 ? 24  ILE B CD1   1 
ATOM   2534 N N     . SER F 2 24  ? -3.689  16.804  33.942  1.00 25.20 ? 25  SER B N     1 
ATOM   2535 C CA    . SER F 2 24  ? -2.604  16.796  34.939  1.00 29.06 ? 25  SER B CA    1 
ATOM   2536 C C     . SER F 2 24  ? -3.126  16.270  36.244  1.00 32.07 ? 25  SER B C     1 
ATOM   2537 O O     . SER F 2 24  ? -4.342  16.199  36.443  1.00 31.72 ? 25  SER B O     1 
ATOM   2538 C CB    . SER F 2 24  ? -1.958  18.157  35.170  1.00 28.77 ? 25  SER B CB    1 
ATOM   2539 O OG    . SER F 2 24  ? -2.881  19.016  35.826  1.00 28.52 ? 25  SER B OG    1 
ATOM   2540 N N     . ALA F 2 25  ? -2.210  15.888  37.125  1.00 35.05 ? 26  ALA B N     1 
ATOM   2541 C CA    . ALA F 2 25  ? -2.595  15.363  38.430  1.00 36.08 ? 26  ALA B CA    1 
ATOM   2542 C C     . ALA F 2 25  ? -3.377  16.406  39.201  1.00 35.53 ? 26  ALA B C     1 
ATOM   2543 O O     . ALA F 2 25  ? -4.311  16.095  39.953  1.00 34.85 ? 26  ALA B O     1 
ATOM   2544 C CB    . ALA F 2 25  ? -1.374  14.869  39.188  1.00 36.21 ? 26  ALA B CB    1 
ATOM   2545 N N     . GLU F 2 26  ? -2.990  17.655  38.976  1.00 35.11 ? 27  GLU B N     1 
ATOM   2546 C CA    . GLU F 2 26  ? -3.643  18.762  39.619  1.00 35.92 ? 27  GLU B CA    1 
ATOM   2547 C C     . GLU F 2 26  ? -5.094  18.714  39.246  1.00 32.03 ? 27  GLU B C     1 
ATOM   2548 O O     . GLU F 2 26  ? -5.967  19.128  39.972  1.00 30.92 ? 27  GLU B O     1 
ATOM   2549 C CB    . GLU F 2 26  ? -3.019  20.107  39.169  1.00 41.32 ? 27  GLU B CB    1 
ATOM   2550 C CG    . GLU F 2 26  ? -1.470  20.147  39.297  1.00 47.26 ? 27  GLU B CG    1 
ATOM   2551 C CD    . GLU F 2 26  ? -0.708  19.637  38.070  1.00 52.18 ? 27  GLU B CD    1 
ATOM   2552 O OE1   . GLU F 2 26  ? -0.481  20.322  37.060  1.00 53.39 ? 27  GLU B OE1   1 
ATOM   2553 O OE2   . GLU F 2 26  ? -0.297  18.380  38.205  1.00 53.15 ? 27  GLU B OE2   1 
ATOM   2554 N N     . GLY F 2 27  ? -5.318  18.181  38.070  1.00 31.54 ? 28  GLY B N     1 
ATOM   2555 C CA    . GLY F 2 27  ? -6.642  18.045  37.497  1.00 31.48 ? 28  GLY B CA    1 
ATOM   2556 C C     . GLY F 2 27  ? -6.896  19.104  36.411  1.00 31.10 ? 28  GLY B C     1 
ATOM   2557 O O     . GLY F 2 27  ? -8.050  19.311  35.974  1.00 32.42 ? 28  GLY B O     1 
ATOM   2558 N N     . LYS F 2 28  ? -5.800  19.773  35.987  1.00 27.24 ? 29  LYS B N     1 
ATOM   2559 C CA    . LYS F 2 28  ? -5.888  20.799  34.977  1.00 22.41 ? 29  LYS B CA    1 
ATOM   2560 C C     . LYS F 2 28  ? -5.583  20.226  33.640  1.00 20.00 ? 29  LYS B C     1 
ATOM   2561 O O     . LYS F 2 28  ? -4.610  19.502  33.480  1.00 19.38 ? 29  LYS B O     1 
ATOM   2562 C CB    . LYS F 2 28  ? -5.194  22.105  35.286  1.00 20.62 ? 29  LYS B CB    1 
ATOM   2563 C CG    . LYS F 2 28  ? -3.723  22.121  35.003  1.00 20.49 ? 29  LYS B CG    1 
ATOM   2564 C CD    . LYS F 2 28  ? -3.110  23.410  35.492  1.00 23.58 ? 29  LYS B CD    1 
ATOM   2565 C CE    . LYS F 2 28  ? -2.018  23.187  36.540  1.00 28.42 ? 29  LYS B CE    1 
ATOM   2566 N NZ    . LYS F 2 28  ? -2.455  23.450  37.941  1.00 31.40 ? 29  LYS B NZ    1 
ATOM   2567 N N     . ILE F 2 29  ? -6.457  20.553  32.702  1.00 18.09 ? 30  ILE B N     1 
ATOM   2568 C CA    . ILE F 2 29  ? -6.389  20.067  31.352  1.00 16.77 ? 30  ILE B CA    1 
ATOM   2569 C C     . ILE F 2 29  ? -5.624  20.911  30.330  1.00 18.94 ? 30  ILE B C     1 
ATOM   2570 O O     . ILE F 2 29  ? -6.016  22.041  30.015  1.00 19.49 ? 30  ILE B O     1 
ATOM   2571 C CB    . ILE F 2 29  ? -7.822  19.781  30.883  1.00 12.72 ? 30  ILE B CB    1 
ATOM   2572 C CG1   . ILE F 2 29  ? -8.522  18.897  31.892  1.00 8.47  ? 30  ILE B CG1   1 
ATOM   2573 C CG2   . ILE F 2 29  ? -7.836  19.128  29.507  1.00 12.92 ? 30  ILE B CG2   1 
ATOM   2574 C CD1   . ILE F 2 29  ? -10.026 19.040  31.828  1.00 8.91  ? 30  ILE B CD1   1 
ATOM   2575 N N     . TYR F 2 30  ? -4.541  20.330  29.796  1.00 20.31 ? 31  TYR B N     1 
ATOM   2576 C CA    . TYR F 2 30  ? -3.749  21.006  28.774  1.00 22.50 ? 31  TYR B CA    1 
ATOM   2577 C C     . TYR F 2 30  ? -4.241  20.505  27.443  1.00 24.93 ? 31  TYR B C     1 
ATOM   2578 O O     . TYR F 2 30  ? -4.536  19.319  27.315  1.00 25.73 ? 31  TYR B O     1 
ATOM   2579 C CB    . TYR F 2 30  ? -2.240  20.712  28.896  1.00 24.49 ? 31  TYR B CB    1 
ATOM   2580 C CG    . TYR F 2 30  ? -1.657  21.054  30.246  1.00 26.35 ? 31  TYR B CG    1 
ATOM   2581 C CD1   . TYR F 2 30  ? -1.104  22.320  30.490  1.00 27.91 ? 31  TYR B CD1   1 
ATOM   2582 C CD2   . TYR F 2 30  ? -1.651  20.123  31.281  1.00 27.00 ? 31  TYR B CD2   1 
ATOM   2583 C CE1   . TYR F 2 30  ? -0.570  22.654  31.738  1.00 28.38 ? 31  TYR B CE1   1 
ATOM   2584 C CE2   . TYR F 2 30  ? -1.115  20.441  32.522  1.00 28.52 ? 31  TYR B CE2   1 
ATOM   2585 C CZ    . TYR F 2 30  ? -0.574  21.707  32.760  1.00 28.68 ? 31  TYR B CZ    1 
ATOM   2586 O OH    . TYR F 2 30  ? -0.046  22.001  34.000  1.00 28.52 ? 31  TYR B OH    1 
ATOM   2587 N N     . PRO F 2 31  ? -4.346  21.381  26.447  1.00 27.67 ? 32  PRO B N     1 
ATOM   2588 C CA    . PRO F 2 31  ? -4.843  20.998  25.110  1.00 29.58 ? 32  PRO B CA    1 
ATOM   2589 C C     . PRO F 2 31  ? -3.836  20.290  24.184  1.00 32.25 ? 32  PRO B C     1 
ATOM   2590 O O     . PRO F 2 31  ? -2.614  20.386  24.332  1.00 34.08 ? 32  PRO B O     1 
ATOM   2591 C CB    . PRO F 2 31  ? -5.434  22.248  24.480  1.00 27.86 ? 32  PRO B CB    1 
ATOM   2592 C CG    . PRO F 2 31  ? -5.408  23.315  25.573  1.00 27.88 ? 32  PRO B CG    1 
ATOM   2593 C CD    . PRO F 2 31  ? -4.383  22.853  26.588  1.00 27.78 ? 32  PRO B CD    1 
ATOM   2594 N N     . LEU F 2 32  ? -4.368  19.550  23.220  1.00 31.82 ? 33  LEU B N     1 
ATOM   2595 C CA    . LEU F 2 32  ? -3.527  18.825  22.300  1.00 31.07 ? 33  LEU B CA    1 
ATOM   2596 C C     . LEU F 2 32  ? -2.952  19.749  21.240  1.00 33.56 ? 33  LEU B C     1 
ATOM   2597 O O     . LEU F 2 32  ? -3.621  20.680  20.783  1.00 35.23 ? 33  LEU B O     1 
ATOM   2598 C CB    . LEU F 2 32  ? -4.312  17.671  21.625  1.00 28.79 ? 33  LEU B CB    1 
ATOM   2599 C CG    . LEU F 2 32  ? -4.527  16.469  22.538  1.00 27.36 ? 33  LEU B CG    1 
ATOM   2600 C CD1   . LEU F 2 32  ? -5.558  15.514  21.940  1.00 26.35 ? 33  LEU B CD1   1 
ATOM   2601 C CD2   . LEU F 2 32  ? -3.207  15.753  22.757  1.00 27.83 ? 33  LEU B CD2   1 
ATOM   2602 N N     . GLY F 2 33  ? -1.720  19.494  20.848  1.00 34.22 ? 34  GLY B N     1 
ATOM   2603 C CA    . GLY F 2 33  ? -1.096  20.298  19.813  1.00 33.83 ? 34  GLY B CA    1 
ATOM   2604 C C     . GLY F 2 33  ? -1.417  19.661  18.456  1.00 33.20 ? 34  GLY B C     1 
ATOM   2605 O O     . GLY F 2 33  ? -2.466  19.040  18.276  1.00 33.33 ? 34  GLY B O     1 
ATOM   2606 N N     . SER F 2 34  ? -0.521  19.781  17.511  1.00 32.21 ? 35  SER B N     1 
ATOM   2607 C CA    . SER F 2 34  ? -0.749  19.200  16.219  1.00 32.36 ? 35  SER B CA    1 
ATOM   2608 C C     . SER F 2 34  ? 0.207   18.013  15.994  1.00 30.81 ? 35  SER B C     1 
ATOM   2609 O O     . SER F 2 34  ? 0.064   17.249  15.036  1.00 30.67 ? 35  SER B O     1 
ATOM   2610 C CB    . SER F 2 34  ? -0.528  20.226  15.152  1.00 35.08 ? 35  SER B CB    1 
ATOM   2611 O OG    . SER F 2 34  ? 0.866   20.497  15.088  1.00 36.75 ? 35  SER B OG    1 
ATOM   2612 N N     . ASP F 2 35  ? 1.159   17.910  16.920  1.00 30.11 ? 36  ASP B N     1 
ATOM   2613 C CA    . ASP F 2 35  ? 2.197   16.907  16.958  1.00 31.34 ? 36  ASP B CA    1 
ATOM   2614 C C     . ASP F 2 35  ? 1.700   15.522  16.708  1.00 29.37 ? 36  ASP B C     1 
ATOM   2615 O O     . ASP F 2 35  ? 0.979   14.957  17.511  1.00 30.04 ? 36  ASP B O     1 
ATOM   2616 C CB    . ASP F 2 35  ? 2.966   16.947  18.276  1.00 36.73 ? 36  ASP B CB    1 
ATOM   2617 C CG    . ASP F 2 35  ? 4.156   16.039  18.257  1.00 40.34 ? 36  ASP B CG    1 
ATOM   2618 O OD1   . ASP F 2 35  ? 4.087   14.853  17.968  1.00 40.99 ? 36  ASP B OD1   1 
ATOM   2619 O OD2   . ASP F 2 35  ? 5.270   16.660  18.585  1.00 41.67 ? 36  ASP B OD2   1 
ATOM   2620 N N     . THR F 2 36  ? 2.120   14.973  15.589  1.00 28.14 ? 37  THR B N     1 
ATOM   2621 C CA    . THR F 2 36  ? 1.730   13.659  15.191  1.00 27.23 ? 37  THR B CA    1 
ATOM   2622 C C     . THR F 2 36  ? 1.933   12.617  16.232  1.00 27.96 ? 37  THR B C     1 
ATOM   2623 O O     . THR F 2 36  ? 1.022   11.829  16.470  1.00 29.37 ? 37  THR B O     1 
ATOM   2624 C CB    . THR F 2 36  ? 2.370   13.222  13.879  1.00 26.06 ? 37  THR B CB    1 
ATOM   2625 O OG1   . THR F 2 36  ? 3.713   13.604  13.905  1.00 26.10 ? 37  THR B OG1   1 
ATOM   2626 C CG2   . THR F 2 36  ? 1.645   13.866  12.709  1.00 25.80 ? 37  THR B CG2   1 
ATOM   2627 N N     . LYS F 2 37  ? 3.129   12.609  16.823  1.00 28.11 ? 38  LYS B N     1 
ATOM   2628 C CA    . LYS F 2 37  ? 3.533   11.661  17.858  1.00 29.90 ? 38  LYS B CA    1 
ATOM   2629 C C     . LYS F 2 37  ? 2.407   11.263  18.797  1.00 29.86 ? 38  LYS B C     1 
ATOM   2630 O O     . LYS F 2 37  ? 2.119   10.077  18.983  1.00 28.09 ? 38  LYS B O     1 
ATOM   2631 C CB    . LYS F 2 37  ? 4.685   12.219  18.649  1.00 33.26 ? 38  LYS B CB    1 
ATOM   2632 C CG    . LYS F 2 37  ? 5.932   11.399  18.463  1.00 36.93 ? 38  LYS B CG    1 
ATOM   2633 C CD    . LYS F 2 37  ? 5.774   10.022  19.073  1.00 39.56 ? 38  LYS B CD    1 
ATOM   2634 C CE    . LYS F 2 37  ? 5.012   9.043   18.206  1.00 40.00 ? 38  LYS B CE    1 
ATOM   2635 N NZ    . LYS F 2 37  ? 5.691   7.729   18.173  1.00 39.82 ? 38  LYS B NZ    1 
ATOM   2636 N N     . VAL F 2 38  ? 1.778   12.290  19.375  1.00 31.08 ? 39  VAL B N     1 
ATOM   2637 C CA    . VAL F 2 38  ? 0.687   12.115  20.282  1.00 30.51 ? 39  VAL B CA    1 
ATOM   2638 C C     . VAL F 2 38  ? -0.554  11.733  19.543  1.00 28.50 ? 39  VAL B C     1 
ATOM   2639 O O     . VAL F 2 38  ? -1.264  10.834  19.960  1.00 29.33 ? 39  VAL B O     1 
ATOM   2640 C CB    . VAL F 2 38  ? 0.412   13.373  21.105  1.00 32.32 ? 39  VAL B CB    1 
ATOM   2641 C CG1   . VAL F 2 38  ? 1.525   13.588  22.127  1.00 33.05 ? 39  VAL B CG1   1 
ATOM   2642 C CG2   . VAL F 2 38  ? 0.273   14.591  20.185  1.00 32.64 ? 39  VAL B CG2   1 
ATOM   2643 N N     . LEU F 2 39  ? -0.823  12.441  18.437  1.00 25.94 ? 40  LEU B N     1 
ATOM   2644 C CA    . LEU F 2 39  ? -1.998  12.147  17.659  1.00 23.67 ? 40  LEU B CA    1 
ATOM   2645 C C     . LEU F 2 39  ? -2.153  10.682  17.306  1.00 22.96 ? 40  LEU B C     1 
ATOM   2646 O O     . LEU F 2 39  ? -3.198  10.101  17.531  1.00 23.94 ? 40  LEU B O     1 
ATOM   2647 C CB    . LEU F 2 39  ? -2.296  13.134  16.560  1.00 23.68 ? 40  LEU B CB    1 
ATOM   2648 C CG    . LEU F 2 39  ? -3.030  14.320  17.145  1.00 25.24 ? 40  LEU B CG    1 
ATOM   2649 C CD1   . LEU F 2 39  ? -3.015  15.490  16.187  1.00 25.94 ? 40  LEU B CD1   1 
ATOM   2650 C CD2   . LEU F 2 39  ? -4.461  13.938  17.434  1.00 26.59 ? 40  LEU B CD2   1 
ATOM   2651 N N     . SER F 2 40  ? -1.109  10.038  16.791  1.00 21.83 ? 41  SER B N     1 
ATOM   2652 C CA    . SER F 2 40  ? -1.249  8.629   16.508  1.00 22.15 ? 41  SER B CA    1 
ATOM   2653 C C     . SER F 2 40  ? -1.511  7.880   17.813  1.00 22.48 ? 41  SER B C     1 
ATOM   2654 O O     . SER F 2 40  ? -2.440  7.092   17.936  1.00 22.22 ? 41  SER B O     1 
ATOM   2655 C CB    . SER F 2 40  ? -0.048  8.048   15.814  1.00 23.26 ? 41  SER B CB    1 
ATOM   2656 O OG    . SER F 2 40  ? 1.104   8.716   16.258  1.00 24.58 ? 41  SER B OG    1 
ATOM   2657 N N     . THR F 2 41  ? -0.662  8.167   18.797  1.00 23.40 ? 42  THR B N     1 
ATOM   2658 C CA    . THR F 2 41  ? -0.765  7.570   20.121  1.00 23.47 ? 42  THR B CA    1 
ATOM   2659 C C     . THR F 2 41  ? -2.210  7.546   20.648  1.00 21.63 ? 42  THR B C     1 
ATOM   2660 O O     . THR F 2 41  ? -2.679  6.591   21.246  1.00 22.17 ? 42  THR B O     1 
ATOM   2661 C CB    . THR F 2 41  ? 0.202   8.255   21.098  1.00 24.39 ? 42  THR B CB    1 
ATOM   2662 O OG1   . THR F 2 41  ? 1.536   8.063   20.629  1.00 25.72 ? 42  THR B OG1   1 
ATOM   2663 C CG2   . THR F 2 41  ? 0.052   7.673   22.500  1.00 23.99 ? 42  THR B CG2   1 
ATOM   2664 N N     . ILE F 2 42  ? -2.893  8.613   20.378  1.00 19.56 ? 43  ILE B N     1 
ATOM   2665 C CA    . ILE F 2 42  ? -4.245  8.748   20.783  1.00 19.36 ? 43  ILE B CA    1 
ATOM   2666 C C     . ILE F 2 42  ? -5.083  7.729   20.050  1.00 21.63 ? 43  ILE B C     1 
ATOM   2667 O O     . ILE F 2 42  ? -6.025  7.172   20.623  1.00 22.85 ? 43  ILE B O     1 
ATOM   2668 C CB    . ILE F 2 42  ? -4.689  10.149  20.462  1.00 18.85 ? 43  ILE B CB    1 
ATOM   2669 C CG1   . ILE F 2 42  ? -4.152  11.088  21.510  1.00 20.66 ? 43  ILE B CG1   1 
ATOM   2670 C CG2   . ILE F 2 42  ? -6.196  10.292  20.301  1.00 16.74 ? 43  ILE B CG2   1 
ATOM   2671 C CD1   . ILE F 2 42  ? -4.371  12.521  21.085  1.00 23.01 ? 43  ILE B CD1   1 
ATOM   2672 N N     . PHE F 2 43  ? -4.724  7.482   18.771  1.00 21.66 ? 44  PHE B N     1 
ATOM   2673 C CA    . PHE F 2 43  ? -5.464  6.495   17.974  1.00 22.52 ? 44  PHE B CA    1 
ATOM   2674 C C     . PHE F 2 43  ? -5.263  5.078   18.495  1.00 25.18 ? 44  PHE B C     1 
ATOM   2675 O O     . PHE F 2 43  ? -6.142  4.235   18.373  1.00 24.43 ? 44  PHE B O     1 
ATOM   2676 C CB    . PHE F 2 43  ? -5.187  6.583   16.483  1.00 21.81 ? 44  PHE B CB    1 
ATOM   2677 C CG    . PHE F 2 43  ? -5.785  7.801   15.878  1.00 20.69 ? 44  PHE B CG    1 
ATOM   2678 C CD1   . PHE F 2 43  ? -7.159  8.024   15.975  1.00 21.72 ? 44  PHE B CD1   1 
ATOM   2679 C CD2   . PHE F 2 43  ? -4.987  8.732   15.203  1.00 18.59 ? 44  PHE B CD2   1 
ATOM   2680 C CE1   . PHE F 2 43  ? -7.732  9.162   15.409  1.00 21.50 ? 44  PHE B CE1   1 
ATOM   2681 C CE2   . PHE F 2 43  ? -5.548  9.878   14.644  1.00 18.57 ? 44  PHE B CE2   1 
ATOM   2682 C CZ    . PHE F 2 43  ? -6.925  10.085  14.753  1.00 19.86 ? 44  PHE B CZ    1 
ATOM   2683 N N     . GLU F 2 44  ? -4.085  4.832   19.080  1.00 28.57 ? 45  GLU B N     1 
ATOM   2684 C CA    . GLU F 2 44  ? -3.784  3.542   19.665  1.00 31.76 ? 45  GLU B CA    1 
ATOM   2685 C C     . GLU F 2 44  ? -4.827  3.327   20.758  1.00 33.18 ? 45  GLU B C     1 
ATOM   2686 O O     . GLU F 2 44  ? -5.563  2.340   20.796  1.00 33.56 ? 45  GLU B O     1 
ATOM   2687 C CB    . GLU F 2 44  ? -2.436  3.614   20.359  1.00 35.32 ? 45  GLU B CB    1 
ATOM   2688 C CG    . GLU F 2 44  ? -1.494  2.499   19.948  1.00 40.62 ? 45  GLU B CG    1 
ATOM   2689 C CD    . GLU F 2 44  ? -0.778  2.874   18.688  1.00 46.65 ? 45  GLU B CD    1 
ATOM   2690 O OE1   . GLU F 2 44  ? 0.009   3.805   18.611  1.00 48.01 ? 45  GLU B OE1   1 
ATOM   2691 O OE2   . GLU F 2 44  ? -1.106  2.093   17.678  1.00 49.34 ? 45  GLU B OE2   1 
ATOM   2692 N N     . LEU F 2 45  ? -4.851  4.306   21.645  1.00 33.54 ? 46  LEU B N     1 
ATOM   2693 C CA    . LEU F 2 45  ? -5.743  4.362   22.763  1.00 34.53 ? 46  LEU B CA    1 
ATOM   2694 C C     . LEU F 2 45  ? -7.174  3.996   22.365  1.00 34.69 ? 46  LEU B C     1 
ATOM   2695 O O     . LEU F 2 45  ? -7.744  3.057   22.898  1.00 36.84 ? 46  LEU B O     1 
ATOM   2696 C CB    . LEU F 2 45  ? -5.728  5.787   23.368  1.00 36.96 ? 46  LEU B CB    1 
ATOM   2697 C CG    . LEU F 2 45  ? -5.504  5.859   24.885  1.00 37.78 ? 46  LEU B CG    1 
ATOM   2698 C CD1   . LEU F 2 45  ? -4.191  5.190   25.264  1.00 38.67 ? 46  LEU B CD1   1 
ATOM   2699 C CD2   . LEU F 2 45  ? -5.456  7.315   25.335  1.00 37.40 ? 46  LEU B CD2   1 
ATOM   2700 N N     . PHE F 2 46  ? -7.766  4.728   21.420  1.00 32.34 ? 47  PHE B N     1 
ATOM   2701 C CA    . PHE F 2 46  ? -9.134  4.442   21.015  1.00 31.83 ? 47  PHE B CA    1 
ATOM   2702 C C     . PHE F 2 46  ? -9.351  3.001   20.635  1.00 33.28 ? 47  PHE B C     1 
ATOM   2703 O O     . PHE F 2 46  ? -10.356 2.396   21.028  1.00 36.38 ? 47  PHE B O     1 
ATOM   2704 C CB    . PHE F 2 46  ? -9.636  5.333   19.858  1.00 31.93 ? 47  PHE B CB    1 
ATOM   2705 C CG    . PHE F 2 46  ? -10.018 6.710   20.301  1.00 33.95 ? 47  PHE B CG    1 
ATOM   2706 C CD1   . PHE F 2 46  ? -9.219  7.817   19.993  1.00 34.14 ? 47  PHE B CD1   1 
ATOM   2707 C CD2   . PHE F 2 46  ? -11.182 6.909   21.040  1.00 34.39 ? 47  PHE B CD2   1 
ATOM   2708 C CE1   . PHE F 2 46  ? -9.565  9.106   20.404  1.00 33.06 ? 47  PHE B CE1   1 
ATOM   2709 C CE2   . PHE F 2 46  ? -11.540 8.191   21.471  1.00 33.91 ? 47  PHE B CE2   1 
ATOM   2710 C CZ    . PHE F 2 46  ? -10.729 9.281   21.143  1.00 33.44 ? 47  PHE B CZ    1 
ATOM   2711 N N     . SER F 2 47  ? -8.394  2.484   19.851  1.00 30.22 ? 48  SER B N     1 
ATOM   2712 C CA    . SER F 2 47  ? -8.402  1.138   19.298  1.00 27.13 ? 48  SER B CA    1 
ATOM   2713 C C     . SER F 2 47  ? -8.297  -0.048  20.269  1.00 25.94 ? 48  SER B C     1 
ATOM   2714 O O     . SER F 2 47  ? -9.038  -1.027  20.140  1.00 26.66 ? 48  SER B O     1 
ATOM   2715 C CB    . SER F 2 47  ? -7.366  1.011   18.206  1.00 25.37 ? 48  SER B CB    1 
ATOM   2716 O OG    . SER F 2 47  ? -7.560  2.038   17.261  1.00 24.34 ? 48  SER B OG    1 
ATOM   2717 N N     . ARG F 2 48  ? -7.350  0.040   21.188  1.00 22.33 ? 49  ARG B N     1 
ATOM   2718 C CA    . ARG F 2 48  ? -7.091  -1.003  22.146  1.00 19.16 ? 49  ARG B CA    1 
ATOM   2719 C C     . ARG F 2 48  ? -8.316  -1.672  22.725  1.00 20.30 ? 49  ARG B C     1 
ATOM   2720 O O     . ARG F 2 48  ? -8.387  -2.889  22.840  1.00 20.44 ? 49  ARG B O     1 
ATOM   2721 C CB    . ARG F 2 48  ? -6.122  -0.541  23.194  1.00 16.65 ? 49  ARG B CB    1 
ATOM   2722 C CG    . ARG F 2 48  ? -5.848  -1.568  24.255  1.00 15.39 ? 49  ARG B CG    1 
ATOM   2723 C CD    . ARG F 2 48  ? -5.137  -0.955  25.425  1.00 15.43 ? 49  ARG B CD    1 
ATOM   2724 N NE    . ARG F 2 48  ? -3.693  -0.915  25.245  1.00 17.15 ? 49  ARG B NE    1 
ATOM   2725 C CZ    . ARG F 2 48  ? -3.036  0.080   24.666  1.00 18.75 ? 49  ARG B CZ    1 
ATOM   2726 N NH1   . ARG F 2 48  ? -3.658  1.138   24.184  1.00 20.03 ? 49  ARG B NH1   1 
ATOM   2727 N NH2   . ARG F 2 48  ? -1.720  0.000   24.557  1.00 18.95 ? 49  ARG B NH2   1 
ATOM   2728 N N     . PRO F 2 49  ? -9.294  -0.860  23.091  1.00 21.11 ? 50  PRO B N     1 
ATOM   2729 C CA    . PRO F 2 49  ? -10.534 -1.353  23.676  1.00 19.79 ? 50  PRO B CA    1 
ATOM   2730 C C     . PRO F 2 49  ? -11.314 -2.157  22.693  1.00 19.01 ? 50  PRO B C     1 
ATOM   2731 O O     . PRO F 2 49  ? -11.846 -3.192  23.001  1.00 19.99 ? 50  PRO B O     1 
ATOM   2732 C CB    . PRO F 2 49  ? -11.280 -0.080  24.068  1.00 20.29 ? 50  PRO B CB    1 
ATOM   2733 C CG    . PRO F 2 49  ? -10.195 0.939   24.403  1.00 22.07 ? 50  PRO B CG    1 
ATOM   2734 C CD    . PRO F 2 49  ? -8.907  0.406   23.766  1.00 21.92 ? 50  PRO B CD    1 
ATOM   2735 N N     . ILE F 2 50  ? -11.387 -1.664  21.490  1.00 19.41 ? 51  ILE B N     1 
ATOM   2736 C CA    . ILE F 2 50  ? -12.114 -2.340  20.462  1.00 19.14 ? 51  ILE B CA    1 
ATOM   2737 C C     . ILE F 2 50  ? -11.522 -3.685  20.185  1.00 22.02 ? 51  ILE B C     1 
ATOM   2738 O O     . ILE F 2 50  ? -12.216 -4.680  20.327  1.00 23.80 ? 51  ILE B O     1 
ATOM   2739 C CB    . ILE F 2 50  ? -12.181 -1.512  19.208  1.00 18.48 ? 51  ILE B CB    1 
ATOM   2740 C CG1   . ILE F 2 50  ? -12.399 -0.040  19.575  1.00 19.09 ? 51  ILE B CG1   1 
ATOM   2741 C CG2   . ILE F 2 50  ? -13.313 -2.022  18.341  1.00 18.69 ? 51  ILE B CG2   1 
ATOM   2742 C CD1   . ILE F 2 50  ? -13.220 0.724   18.540  1.00 19.93 ? 51  ILE B CD1   1 
ATOM   2743 N N     . ILE F 2 51  ? -10.227 -3.725  19.787  1.00 23.13 ? 52  ILE B N     1 
ATOM   2744 C CA    . ILE F 2 51  ? -9.534  -4.983  19.491  1.00 21.83 ? 52  ILE B CA    1 
ATOM   2745 C C     . ILE F 2 51  ? -9.762  -5.970  20.584  1.00 21.71 ? 52  ILE B C     1 
ATOM   2746 O O     . ILE F 2 51  ? -10.269 -7.061  20.372  1.00 24.60 ? 52  ILE B O     1 
ATOM   2747 C CB    . ILE F 2 51  ? -8.029  -4.816  19.337  1.00 21.28 ? 52  ILE B CB    1 
ATOM   2748 C CG1   . ILE F 2 51  ? -7.683  -3.908  18.161  1.00 22.06 ? 52  ILE B CG1   1 
ATOM   2749 C CG2   . ILE F 2 51  ? -7.371  -6.185  19.176  1.00 20.41 ? 52  ILE B CG2   1 
ATOM   2750 C CD1   . ILE F 2 51  ? -6.192  -3.558  18.090  1.00 22.27 ? 52  ILE B CD1   1 
ATOM   2751 N N     . ASN F 2 52  ? -9.390  -5.556  21.767  1.00 19.43 ? 53  ASN B N     1 
ATOM   2752 C CA    . ASN F 2 52  ? -9.552  -6.360  22.924  1.00 17.92 ? 53  ASN B CA    1 
ATOM   2753 C C     . ASN F 2 52  ? -10.966 -6.901  23.065  1.00 18.66 ? 53  ASN B C     1 
ATOM   2754 O O     . ASN F 2 52  ? -11.168 -8.048  23.425  1.00 20.85 ? 53  ASN B O     1 
ATOM   2755 C CB    . ASN F 2 52  ? -9.103  -5.604  24.152  1.00 17.35 ? 53  ASN B CB    1 
ATOM   2756 C CG    . ASN F 2 52  ? -7.832  -6.193  24.640  1.00 19.63 ? 53  ASN B CG    1 
ATOM   2757 O OD1   . ASN F 2 52  ? -7.852  -7.307  25.142  1.00 21.50 ? 53  ASN B OD1   1 
ATOM   2758 N ND2   . ASN F 2 52  ? -6.713  -5.476  24.473  1.00 20.41 ? 53  ASN B ND2   1 
ATOM   2759 N N     . LYS F 2 53  ? -11.954 -6.089  22.783  1.00 17.75 ? 54  LYS B N     1 
ATOM   2760 C CA    . LYS F 2 53  ? -13.287 -6.575  22.905  1.00 18.88 ? 54  LYS B CA    1 
ATOM   2761 C C     . LYS F 2 53  ? -13.528 -7.658  21.902  1.00 18.07 ? 54  LYS B C     1 
ATOM   2762 O O     . LYS F 2 53  ? -13.709 -8.812  22.255  1.00 18.54 ? 54  LYS B O     1 
ATOM   2763 C CB    . LYS F 2 53  ? -14.347 -5.484  22.898  1.00 22.68 ? 54  LYS B CB    1 
ATOM   2764 C CG    . LYS F 2 53  ? -15.700 -5.914  22.326  1.00 26.22 ? 54  LYS B CG    1 
ATOM   2765 C CD    . LYS F 2 53  ? -16.298 -4.840  21.407  1.00 28.95 ? 54  LYS B CD    1 
ATOM   2766 C CE    . LYS F 2 53  ? -17.246 -3.884  22.108  1.00 30.17 ? 54  LYS B CE    1 
ATOM   2767 N NZ    . LYS F 2 53  ? -18.638 -4.330  21.979  1.00 32.28 ? 54  LYS B NZ    1 
ATOM   2768 N N     . ILE F 2 54  ? -13.502 -7.267  20.661  1.00 18.36 ? 55  ILE B N     1 
ATOM   2769 C CA    . ILE F 2 54  ? -13.712 -8.167  19.568  1.00 18.40 ? 55  ILE B CA    1 
ATOM   2770 C C     . ILE F 2 54  ? -12.915 -9.456  19.716  1.00 17.16 ? 55  ILE B C     1 
ATOM   2771 O O     . ILE F 2 54  ? -13.405 -10.547 19.440  1.00 17.45 ? 55  ILE B O     1 
ATOM   2772 C CB    . ILE F 2 54  ? -13.512 -7.482  18.212  1.00 18.15 ? 55  ILE B CB    1 
ATOM   2773 C CG1   . ILE F 2 54  ? -14.403 -6.249  18.161  1.00 18.90 ? 55  ILE B CG1   1 
ATOM   2774 C CG2   . ILE F 2 54  ? -13.930 -8.422  17.100  1.00 17.62 ? 55  ILE B CG2   1 
ATOM   2775 C CD1   . ILE F 2 54  ? -15.884 -6.615  18.193  1.00 19.55 ? 55  ILE B CD1   1 
ATOM   2776 N N     . ALA F 2 55  ? -11.706 -9.329  20.179  1.00 16.13 ? 56  ALA B N     1 
ATOM   2777 C CA    . ALA F 2 55  ? -10.886 -10.499 20.346  1.00 20.05 ? 56  ALA B CA    1 
ATOM   2778 C C     . ALA F 2 55  ? -11.462 -11.486 21.381  1.00 25.07 ? 56  ALA B C     1 
ATOM   2779 O O     . ALA F 2 55  ? -11.559 -12.712 21.150  1.00 25.37 ? 56  ALA B O     1 
ATOM   2780 C CB    . ALA F 2 55  ? -9.435  -10.117 20.616  1.00 19.82 ? 56  ALA B CB    1 
ATOM   2781 N N     . GLU F 2 56  ? -11.843 -10.945 22.538  1.00 27.03 ? 57  GLU B N     1 
ATOM   2782 C CA    . GLU F 2 56  ? -12.385 -11.749 23.599  1.00 27.84 ? 57  GLU B CA    1 
ATOM   2783 C C     . GLU F 2 56  ? -13.608 -12.497 23.110  1.00 25.46 ? 57  GLU B C     1 
ATOM   2784 O O     . GLU F 2 56  ? -13.718 -13.699 23.271  1.00 24.91 ? 57  GLU B O     1 
ATOM   2785 C CB    . GLU F 2 56  ? -12.712 -10.881 24.840  1.00 32.88 ? 57  GLU B CB    1 
ATOM   2786 C CG    . GLU F 2 56  ? -12.570 -11.638 26.196  1.00 37.35 ? 57  GLU B CG    1 
ATOM   2787 C CD    . GLU F 2 56  ? -13.378 -11.033 27.334  1.00 39.55 ? 57  GLU B CD    1 
ATOM   2788 O OE1   . GLU F 2 56  ? -12.877 -10.658 28.388  1.00 39.23 ? 57  GLU B OE1   1 
ATOM   2789 O OE2   . GLU F 2 56  ? -14.673 -10.977 27.070  1.00 40.55 ? 57  GLU B OE2   1 
ATOM   2790 N N     . LYS F 2 57  ? -14.518 -11.757 22.500  1.00 24.52 ? 58  LYS B N     1 
ATOM   2791 C CA    . LYS F 2 57  ? -15.762 -12.314 21.985  1.00 22.10 ? 58  LYS B CA    1 
ATOM   2792 C C     . LYS F 2 57  ? -15.555 -13.500 21.079  1.00 19.74 ? 58  LYS B C     1 
ATOM   2793 O O     . LYS F 2 57  ? -16.451 -14.288 20.886  1.00 21.45 ? 58  LYS B O     1 
ATOM   2794 C CB    . LYS F 2 57  ? -16.683 -11.279 21.362  1.00 22.15 ? 58  LYS B CB    1 
ATOM   2795 C CG    . LYS F 2 57  ? -17.730 -11.852 20.430  1.00 23.39 ? 58  LYS B CG    1 
ATOM   2796 C CD    . LYS F 2 57  ? -18.508 -10.746 19.755  1.00 27.59 ? 58  LYS B CD    1 
ATOM   2797 C CE    . LYS F 2 57  ? -19.636 -11.224 18.848  1.00 32.60 ? 58  LYS B CE    1 
ATOM   2798 N NZ    . LYS F 2 57  ? -20.330 -10.125 18.116  1.00 34.39 ? 58  LYS B NZ    1 
ATOM   2799 N N     . HIS F 2 58  ? -14.357 -13.628 20.526  1.00 16.41 ? 59  HIS B N     1 
ATOM   2800 C CA    . HIS F 2 58  ? -14.078 -14.750 19.658  1.00 13.59 ? 59  HIS B CA    1 
ATOM   2801 C C     . HIS F 2 58  ? -13.102 -15.665 20.333  1.00 10.64 ? 59  HIS B C     1 
ATOM   2802 O O     . HIS F 2 58  ? -12.483 -16.557 19.768  1.00 10.46 ? 59  HIS B O     1 
ATOM   2803 C CB    . HIS F 2 58  ? -13.596 -14.328 18.244  1.00 13.86 ? 59  HIS B CB    1 
ATOM   2804 C CG    . HIS F 2 58  ? -14.656 -13.667 17.389  1.00 15.21 ? 59  HIS B CG    1 
ATOM   2805 N ND1   . HIS F 2 58  ? -15.343 -14.376 16.393  1.00 14.77 ? 59  HIS B ND1   1 
ATOM   2806 C CD2   . HIS F 2 58  ? -15.115 -12.362 17.389  1.00 15.65 ? 59  HIS B CD2   1 
ATOM   2807 C CE1   . HIS F 2 58  ? -16.189 -13.500 15.821  1.00 15.15 ? 59  HIS B CE1   1 
ATOM   2808 N NE2   . HIS F 2 58  ? -16.076 -12.282 16.393  1.00 15.76 ? 59  HIS B NE2   1 
ATOM   2809 N N     . GLY F 2 59  ? -12.947 -15.426 21.587  1.00 9.40  ? 60  GLY B N     1 
ATOM   2810 C CA    . GLY F 2 59  ? -12.026 -16.246 22.345  1.00 9.01  ? 60  GLY B CA    1 
ATOM   2811 C C     . GLY F 2 59  ? -10.621 -16.183 21.838  1.00 8.26  ? 60  GLY B C     1 
ATOM   2812 O O     . GLY F 2 59  ? -10.044 -17.202 21.619  1.00 7.67  ? 60  GLY B O     1 
ATOM   2813 N N     . TYR F 2 60  ? -10.107 -14.981 21.651  1.00 10.48 ? 61  TYR B N     1 
ATOM   2814 C CA    . TYR F 2 60  ? -8.751  -14.766 21.175  1.00 13.63 ? 61  TYR B CA    1 
ATOM   2815 C C     . TYR F 2 60  ? -7.934  -14.057 22.255  1.00 14.98 ? 61  TYR B C     1 
ATOM   2816 O O     . TYR F 2 60  ? -8.459  -13.214 22.988  1.00 17.76 ? 61  TYR B O     1 
ATOM   2817 C CB    . TYR F 2 60  ? -8.723  -13.882 19.928  1.00 16.03 ? 61  TYR B CB    1 
ATOM   2818 C CG    . TYR F 2 60  ? -8.791  -14.607 18.604  1.00 18.28 ? 61  TYR B CG    1 
ATOM   2819 C CD1   . TYR F 2 60  ? -7.641  -15.140 18.026  1.00 19.53 ? 61  TYR B CD1   1 
ATOM   2820 C CD2   . TYR F 2 60  ? -10.007 -14.718 17.929  1.00 18.65 ? 61  TYR B CD2   1 
ATOM   2821 C CE1   . TYR F 2 60  ? -7.694  -15.801 16.798  1.00 19.44 ? 61  TYR B CE1   1 
ATOM   2822 C CE2   . TYR F 2 60  ? -10.080 -15.379 16.701  1.00 19.41 ? 61  TYR B CE2   1 
ATOM   2823 C CZ    . TYR F 2 60  ? -8.916  -15.912 16.148  1.00 20.58 ? 61  TYR B CZ    1 
ATOM   2824 O OH    . TYR F 2 60  ? -8.963  -16.557 14.953  1.00 22.62 ? 61  TYR B OH    1 
ATOM   2825 N N     . ILE F 2 61  ? -6.657  -14.376 22.352  1.00 11.30 ? 62  ILE B N     1 
ATOM   2826 C CA    . ILE F 2 61  ? -5.824  -13.731 23.342  1.00 10.01 ? 62  ILE B CA    1 
ATOM   2827 C C     . ILE F 2 61  ? -5.112  -12.505 22.705  1.00 12.65 ? 62  ILE B C     1 
ATOM   2828 O O     . ILE F 2 61  ? -4.519  -12.633 21.658  1.00 17.52 ? 62  ILE B O     1 
ATOM   2829 C CB    . ILE F 2 61  ? -4.858  -14.790 23.895  1.00 7.76  ? 62  ILE B CB    1 
ATOM   2830 C CG1   . ILE F 2 61  ? -5.566  -15.705 24.859  1.00 6.00  ? 62  ILE B CG1   1 
ATOM   2831 C CG2   . ILE F 2 61  ? -3.664  -14.177 24.602  1.00 8.96  ? 62  ILE B CG2   1 
ATOM   2832 C CD1   . ILE F 2 61  ? -4.736  -16.947 25.174  1.00 6.00  ? 62  ILE B CD1   1 
ATOM   2833 N N     . VAL F 2 62  ? -5.141  -11.311 23.297  1.00 9.91  ? 63  VAL B N     1 
ATOM   2834 C CA    . VAL F 2 62  ? -4.451  -10.149 22.693  1.00 9.72  ? 63  VAL B CA    1 
ATOM   2835 C C     . VAL F 2 62  ? -3.045  -9.862  23.297  1.00 14.38 ? 63  VAL B C     1 
ATOM   2836 O O     . VAL F 2 62  ? -2.863  -9.942  24.499  1.00 16.34 ? 63  VAL B O     1 
ATOM   2837 C CB    . VAL F 2 62  ? -5.286  -8.899  22.795  1.00 7.17  ? 63  VAL B CB    1 
ATOM   2838 C CG1   . VAL F 2 62  ? -4.523  -7.761  22.153  1.00 7.64  ? 63  VAL B CG1   1 
ATOM   2839 C CG2   . VAL F 2 62  ? -6.623  -9.098  22.114  1.00 7.59  ? 63  VAL B CG2   1 
ATOM   2840 N N     . GLU F 2 63  ? -2.031  -9.512  22.474  1.00 16.06 ? 64  GLU B N     1 
ATOM   2841 C CA    . GLU F 2 63  ? -0.706  -9.265  23.046  1.00 17.44 ? 64  GLU B CA    1 
ATOM   2842 C C     . GLU F 2 63  ? 0.072   -8.063  22.500  1.00 19.95 ? 64  GLU B C     1 
ATOM   2843 O O     . GLU F 2 63  ? 0.558   -8.119  21.362  1.00 23.05 ? 64  GLU B O     1 
ATOM   2844 C CB    . GLU F 2 63  ? 0.195   -10.491 22.924  1.00 17.15 ? 64  GLU B CB    1 
ATOM   2845 C CG    . GLU F 2 63  ? 0.007   -11.502 24.049  1.00 18.33 ? 64  GLU B CG    1 
ATOM   2846 C CD    . GLU F 2 63  ? 1.062   -12.577 24.023  1.00 19.21 ? 64  GLU B CD    1 
ATOM   2847 O OE1   . GLU F 2 63  ? 0.860   -13.715 24.435  1.00 18.91 ? 64  GLU B OE1   1 
ATOM   2848 O OE2   . GLU F 2 63  ? 2.210   -12.163 23.503  1.00 17.86 ? 64  GLU B OE2   1 
ATOM   2849 N N     . GLU F 2 64  ? 0.228   -7.021  23.329  1.00 18.66 ? 65  GLU B N     1 
ATOM   2850 C CA    . GLU F 2 64  ? 0.976   -5.827  22.950  1.00 17.75 ? 65  GLU B CA    1 
ATOM   2851 C C     . GLU F 2 64  ? 2.455   -6.097  23.194  1.00 18.16 ? 65  GLU B C     1 
ATOM   2852 O O     . GLU F 2 64  ? 2.774   -6.933  24.023  1.00 20.06 ? 65  GLU B O     1 
ATOM   2853 C CB    . GLU F 2 64  ? 0.527   -4.577  23.683  1.00 18.22 ? 65  GLU B CB    1 
ATOM   2854 C CG    . GLU F 2 64  ? -0.901  -4.171  23.271  1.00 19.71 ? 65  GLU B CG    1 
ATOM   2855 C CD    . GLU F 2 64  ? -1.499  -3.128  24.152  1.00 21.31 ? 65  GLU B CD    1 
ATOM   2856 O OE1   . GLU F 2 64  ? -2.649  -3.184  24.544  1.00 23.74 ? 65  GLU B OE1   1 
ATOM   2857 O OE2   . GLU F 2 64  ? -0.652  -2.157  24.454  1.00 19.66 ? 65  GLU B OE2   1 
ATOM   2858 N N     . PRO F 2 65  ? 3.348   -5.413  22.493  1.00 18.55 ? 66  PRO B N     1 
ATOM   2859 C CA    . PRO F 2 65  ? 4.775   -5.668  22.725  1.00 21.56 ? 66  PRO B CA    1 
ATOM   2860 C C     . PRO F 2 65  ? 5.244   -5.206  24.088  1.00 27.68 ? 66  PRO B C     1 
ATOM   2861 O O     . PRO F 2 65  ? 4.682   -4.243  24.673  1.00 28.35 ? 66  PRO B O     1 
ATOM   2862 C CB    . PRO F 2 65  ? 5.528   -4.991  21.561  1.00 18.85 ? 66  PRO B CB    1 
ATOM   2863 C CG    . PRO F 2 65  ? 4.468   -4.680  20.520  1.00 18.27 ? 66  PRO B CG    1 
ATOM   2864 C CD    . PRO F 2 65  ? 3.150   -4.641  21.246  1.00 18.41 ? 66  PRO B CD    1 
ATOM   2865 N N     . LYS F 2 66  ? 6.300   -5.882  24.615  1.00 31.44 ? 67  LYS B N     1 
ATOM   2866 C CA    . LYS F 2 66  ? 6.878   -5.556  25.900  1.00 34.85 ? 67  LYS B CA    1 
ATOM   2867 C C     . LYS F 2 66  ? 7.872   -4.450  25.688  1.00 37.06 ? 67  LYS B C     1 
ATOM   2868 O O     . LYS F 2 66  ? 7.937   -3.510  26.440  1.00 37.78 ? 67  LYS B O     1 
ATOM   2869 C CB    . LYS F 2 66  ? 7.604   -6.718  26.537  1.00 38.55 ? 67  LYS B CB    1 
ATOM   2870 C CG    . LYS F 2 66  ? 6.693   -7.880  26.935  1.00 44.06 ? 67  LYS B CG    1 
ATOM   2871 C CD    . LYS F 2 66  ? 7.282   -8.780  28.022  1.00 47.72 ? 67  LYS B CD    1 
ATOM   2872 C CE    . LYS F 2 66  ? 6.209   -9.512  28.832  1.00 50.41 ? 67  LYS B CE    1 
ATOM   2873 N NZ    . LYS F 2 66  ? 6.761   -10.364 29.905  1.00 52.10 ? 67  LYS B NZ    1 
ATOM   2874 N N     . GLN F 2 67  ? 8.632   -4.617  24.628  1.00 39.60 ? 68  GLN B N     1 
ATOM   2875 C CA    . GLN F 2 67  ? 9.688   -3.725  24.229  1.00 42.97 ? 68  GLN B CA    1 
ATOM   2876 C C     . GLN F 2 67  ? 9.231   -2.706  23.188  1.00 43.32 ? 68  GLN B C     1 
ATOM   2877 O O     . GLN F 2 67  ? 8.337   -2.953  22.378  1.00 45.86 ? 68  GLN B O     1 
ATOM   2878 C CB    . GLN F 2 67  ? 10.832  -4.561  23.644  1.00 47.29 ? 68  GLN B CB    1 
ATOM   2879 C CG    . GLN F 2 67  ? 10.298  -5.588  22.609  1.00 52.27 ? 68  GLN B CG    1 
ATOM   2880 C CD    . GLN F 2 67  ? 10.200  -7.029  23.123  1.00 56.33 ? 68  GLN B CD    1 
ATOM   2881 O OE1   . GLN F 2 67  ? 9.211   -7.753  22.840  1.00 56.78 ? 68  GLN B OE1   1 
ATOM   2882 N NE2   . GLN F 2 67  ? 11.233  -7.459  23.869  1.00 57.95 ? 68  GLN B NE2   1 
ATOM   2883 N N     . GLN F 2 68  ? 9.889   -1.560  23.213  1.00 40.48 ? 69  GLN B N     1 
ATOM   2884 C CA    . GLN F 2 68  ? 9.623   -0.494  22.281  1.00 37.63 ? 69  GLN B CA    1 
ATOM   2885 C C     . GLN F 2 68  ? 10.282  -0.836  20.950  1.00 37.55 ? 69  GLN B C     1 
ATOM   2886 O O     . GLN F 2 68  ? 11.361  -1.433  20.912  1.00 39.32 ? 69  GLN B O     1 
ATOM   2887 C CB    . GLN F 2 68  ? 10.235  0.804   22.828  1.00 36.24 ? 69  GLN B CB    1 
ATOM   2888 C CG    . GLN F 2 68  ? 9.318   2.022   22.718  1.00 36.16 ? 69  GLN B CG    1 
ATOM   2889 C CD    . GLN F 2 68  ? 9.616   3.081   23.766  1.00 36.28 ? 69  GLN B CD    1 
ATOM   2890 O OE1   . GLN F 2 68  ? 10.724  3.614   23.850  1.00 36.14 ? 69  GLN B OE1   1 
ATOM   2891 N NE2   . GLN F 2 68  ? 8.615   3.375   24.589  1.00 37.47 ? 69  GLN B NE2   1 
ATOM   2892 N N     . ASN F 2 69  ? 9.665   -0.462  19.838  1.00 34.69 ? 70  ASN B N     1 
ATOM   2893 C CA    . ASN F 2 69  ? 10.274  -0.748  18.546  1.00 30.86 ? 70  ASN B CA    1 
ATOM   2894 C C     . ASN F 2 69  ? 10.178  -2.213  18.148  1.00 28.84 ? 70  ASN B C     1 
ATOM   2895 O O     . ASN F 2 69  ? 11.140  -2.826  17.685  1.00 30.27 ? 70  ASN B O     1 
ATOM   2896 C CB    . ASN F 2 69  ? 11.732  -0.215  18.418  1.00 28.38 ? 70  ASN B CB    1 
ATOM   2897 C CG    . ASN F 2 69  ? 11.835  1.321   18.495  1.00 26.51 ? 70  ASN B CG    1 
ATOM   2898 O OD1   . ASN F 2 69  ? 12.881  1.887   18.848  1.00 25.10 ? 70  ASN B OD1   1 
ATOM   2899 N ND2   . ASN F 2 69  ? 10.755  2.014   18.141  1.00 26.16 ? 70  ASN B ND2   1 
ATOM   2900 N N     . HIS F 2 70  ? 8.989   -2.770  18.321  1.00 24.80 ? 71  HIS B N     1 
ATOM   2901 C CA    . HIS F 2 70  ? 8.709   -4.155  18.000  1.00 20.51 ? 71  HIS B CA    1 
ATOM   2902 C C     . HIS F 2 70  ? 7.344   -4.290  17.318  1.00 19.95 ? 71  HIS B C     1 
ATOM   2903 O O     . HIS F 2 70  ? 6.333   -3.781  17.813  1.00 19.72 ? 71  HIS B O     1 
ATOM   2904 C CB    . HIS F 2 70  ? 8.788   -5.055  19.260  1.00 18.44 ? 71  HIS B CB    1 
ATOM   2905 C CG    . HIS F 2 70  ? 10.205  -5.421  19.633  1.00 17.79 ? 71  HIS B CG    1 
ATOM   2906 N ND1   . HIS F 2 70  ? 11.158  -4.450  19.948  1.00 16.31 ? 71  HIS B ND1   1 
ATOM   2907 C CD2   . HIS F 2 70  ? 10.814  -6.655  19.742  1.00 16.76 ? 71  HIS B CD2   1 
ATOM   2908 C CE1   . HIS F 2 70  ? 12.278  -5.094  20.224  1.00 15.42 ? 71  HIS B CE1   1 
ATOM   2909 N NE2   . HIS F 2 70  ? 12.116  -6.408  20.108  1.00 15.78 ? 71  HIS B NE2   1 
ATOM   2910 N N     . TYR F 2 71  ? 7.315   -4.967  16.161  1.00 19.19 ? 72  TYR B N     1 
ATOM   2911 C CA    . TYR F 2 71  ? 6.086   -5.214  15.403  1.00 16.05 ? 72  TYR B CA    1 
ATOM   2912 C C     . TYR F 2 71  ? 5.508   -6.543  15.891  1.00 12.55 ? 72  TYR B C     1 
ATOM   2913 O O     . TYR F 2 71  ? 6.279   -7.474  16.142  1.00 13.45 ? 72  TYR B O     1 
ATOM   2914 C CB    . TYR F 2 71  ? 6.377   -5.238  13.879  1.00 16.94 ? 72  TYR B CB    1 
ATOM   2915 C CG    . TYR F 2 71  ? 5.282   -5.898  13.056  1.00 15.12 ? 72  TYR B CG    1 
ATOM   2916 C CD1   . TYR F 2 71  ? 5.263   -7.275  12.889  1.00 13.03 ? 72  TYR B CD1   1 
ATOM   2917 C CD2   . TYR F 2 71  ? 4.274   -5.142  12.452  1.00 13.86 ? 72  TYR B CD2   1 
ATOM   2918 C CE1   . TYR F 2 71  ? 4.268   -7.912  12.156  1.00 10.77 ? 72  TYR B CE1   1 
ATOM   2919 C CE2   . TYR F 2 71  ? 3.273   -5.755  11.713  1.00 12.79 ? 72  TYR B CE2   1 
ATOM   2920 C CZ    . TYR F 2 71  ? 3.275   -7.140  11.571  1.00 11.76 ? 72  TYR B CZ    1 
ATOM   2921 O OH    . TYR F 2 71  ? 2.311   -7.753  10.851  1.00 13.66 ? 72  TYR B OH    1 
ATOM   2922 N N     . PRO F 2 72  ? 4.183   -6.663  16.058  1.00 10.05 ? 73  PRO B N     1 
ATOM   2923 C CA    . PRO F 2 72  ? 3.190   -5.652  15.769  1.00 11.06 ? 73  PRO B CA    1 
ATOM   2924 C C     . PRO F 2 72  ? 2.576   -4.943  16.978  1.00 12.39 ? 73  PRO B C     1 
ATOM   2925 O O     . PRO F 2 72  ? 2.953   -5.118  18.141  1.00 15.03 ? 73  PRO B O     1 
ATOM   2926 C CB    . PRO F 2 72  ? 2.062   -6.408  15.043  1.00 10.62 ? 73  PRO B CB    1 
ATOM   2927 C CG    . PRO F 2 72  ? 2.289   -7.880  15.306  1.00 10.35 ? 73  PRO B CG    1 
ATOM   2928 C CD    . PRO F 2 72  ? 3.518   -7.968  16.193  1.00 10.02 ? 73  PRO B CD    1 
ATOM   2929 N N     . ASP F 2 73  ? 1.587   -4.131  16.669  1.00 9.94  ? 74  ASP B N     1 
ATOM   2930 C CA    . ASP F 2 73  ? 0.899   -3.407  17.659  1.00 11.65 ? 74  ASP B CA    1 
ATOM   2931 C C     . ASP F 2 73  ? 0.143   -4.338  18.598  1.00 13.73 ? 74  ASP B C     1 
ATOM   2932 O O     . ASP F 2 73  ? 0.299   -4.219  19.793  1.00 16.53 ? 74  ASP B O     1 
ATOM   2933 C CB    . ASP F 2 73  ? 0.001   -2.340  17.029  1.00 14.44 ? 74  ASP B CB    1 
ATOM   2934 C CG    . ASP F 2 73  ? 0.703   -1.019  16.881  1.00 17.19 ? 74  ASP B CG    1 
ATOM   2935 O OD1   . ASP F 2 73  ? 1.890   -0.860  17.113  1.00 16.74 ? 74  ASP B OD1   1 
ATOM   2936 O OD2   . ASP F 2 73  ? -0.098  -0.064  16.483  1.00 19.43 ? 74  ASP B OD2   1 
ATOM   2937 N N     . PHE F 2 74  ? -0.671  -5.262  18.038  1.00 11.98 ? 75  PHE B N     1 
ATOM   2938 C CA    . PHE F 2 74  ? -1.448  -6.233  18.816  1.00 9.60  ? 75  PHE B CA    1 
ATOM   2939 C C     . PHE F 2 74  ? -1.355  -7.658  18.270  1.00 10.82 ? 75  PHE B C     1 
ATOM   2940 O O     . PHE F 2 74  ? -1.556  -7.872  17.087  1.00 13.49 ? 75  PHE B O     1 
ATOM   2941 C CB    . PHE F 2 74  ? -2.924  -5.874  18.829  1.00 8.67  ? 75  PHE B CB    1 
ATOM   2942 C CG    . PHE F 2 74  ? -3.169  -4.553  19.433  1.00 11.19 ? 75  PHE B CG    1 
ATOM   2943 C CD1   . PHE F 2 74  ? -3.575  -4.450  20.764  1.00 13.42 ? 75  PHE B CD1   1 
ATOM   2944 C CD2   . PHE F 2 74  ? -2.999  -3.383  18.694  1.00 12.22 ? 75  PHE B CD2   1 
ATOM   2945 C CE1   . PHE F 2 74  ? -3.802  -3.208  21.349  1.00 14.27 ? 75  PHE B CE1   1 
ATOM   2946 C CE2   . PHE F 2 74  ? -3.227  -2.133  19.260  1.00 12.20 ? 75  PHE B CE2   1 
ATOM   2947 C CZ    . PHE F 2 74  ? -3.625  -2.054  20.584  1.00 13.62 ? 75  PHE B CZ    1 
ATOM   2948 N N     . THR F 2 75  ? -1.062  -8.637  19.125  1.00 9.04  ? 76  THR B N     1 
ATOM   2949 C CA    . THR F 2 75  ? -0.984  -10.006 18.636  1.00 7.16  ? 76  THR B CA    1 
ATOM   2950 C C     . THR F 2 75  ? -2.198  -10.770 19.093  1.00 7.54  ? 76  THR B C     1 
ATOM   2951 O O     . THR F 2 75  ? -2.547  -10.746 20.256  1.00 7.45  ? 76  THR B O     1 
ATOM   2952 C CB    . THR F 2 75  ? 0.285   -10.802 19.028  1.00 7.09  ? 76  THR B CB    1 
ATOM   2953 O OG1   . THR F 2 75  ? 1.408   -10.348 18.341  1.00 7.70  ? 76  THR B OG1   1 
ATOM   2954 C CG2   . THR F 2 75  ? 0.107   -12.250 18.656  1.00 8.01  ? 76  THR B CG2   1 
ATOM   2955 N N     . LEU F 2 76  ? -2.827  -11.454 18.161  1.00 8.57  ? 77  LEU B N     1 
ATOM   2956 C CA    . LEU F 2 76  ? -3.979  -12.258 18.431  1.00 9.28  ? 77  LEU B CA    1 
ATOM   2957 C C     . LEU F 2 76  ? -3.640  -13.707 18.154  1.00 14.61 ? 77  LEU B C     1 
ATOM   2958 O O     . LEU F 2 76  ? -2.961  -14.018 17.196  1.00 16.62 ? 77  LEU B O     1 
ATOM   2959 C CB    . LEU F 2 76  ? -5.186  -11.829 17.614  1.00 6.00  ? 77  LEU B CB    1 
ATOM   2960 C CG    . LEU F 2 76  ? -5.982  -10.738 18.283  1.00 6.73  ? 77  LEU B CG    1 
ATOM   2961 C CD1   . LEU F 2 76  ? -5.165  -9.464  18.302  1.00 6.83  ? 77  LEU B CD1   1 
ATOM   2962 C CD2   . LEU F 2 76  ? -7.287  -10.491 17.531  1.00 8.42  ? 77  LEU B CD2   1 
ATOM   2963 N N     . TYR F 2 77  ? -4.125  -14.591 18.996  1.00 18.27 ? 78  TYR B N     1 
ATOM   2964 C CA    . TYR F 2 77  ? -3.895  -16.016 18.848  1.00 21.41 ? 78  TYR B CA    1 
ATOM   2965 C C     . TYR F 2 77  ? -4.592  -16.748 19.980  1.00 23.70 ? 78  TYR B C     1 
ATOM   2966 O O     . TYR F 2 77  ? -4.547  -16.262 21.130  1.00 23.10 ? 78  TYR B O     1 
ATOM   2967 C CB    . TYR F 2 77  ? -2.395  -16.366 18.874  1.00 22.60 ? 78  TYR B CB    1 
ATOM   2968 C CG    . TYR F 2 77  ? -1.863  -16.294 20.288  1.00 23.18 ? 78  TYR B CG    1 
ATOM   2969 C CD1   . TYR F 2 77  ? -1.286  -15.124 20.758  1.00 24.40 ? 78  TYR B CD1   1 
ATOM   2970 C CD2   . TYR F 2 77  ? -1.956  -17.385 21.150  1.00 22.85 ? 78  TYR B CD2   1 
ATOM   2971 C CE1   . TYR F 2 77  ? -0.791  -15.021 22.050  1.00 25.13 ? 78  TYR B CE1   1 
ATOM   2972 C CE2   . TYR F 2 77  ? -1.473  -17.305 22.461  1.00 24.35 ? 78  TYR B CE2   1 
ATOM   2973 C CZ    . TYR F 2 77  ? -0.896  -16.119 22.905  1.00 26.25 ? 78  TYR B CZ    1 
ATOM   2974 O OH    . TYR F 2 77  ? -0.428  -16.023 24.197  1.00 28.50 ? 78  TYR B OH    1 
ATOM   2975 N N     . LYS F 2 78  ? -5.223  -17.910 19.639  1.00 24.59 ? 79  LYS B N     1 
ATOM   2976 C CA    . LYS F 2 78  ? -5.933  -18.738 20.610  1.00 23.95 ? 79  LYS B CA    1 
ATOM   2977 C C     . LYS F 2 78  ? -4.994  -19.661 21.323  1.00 27.20 ? 79  LYS B C     1 
ATOM   2978 O O     . LYS F 2 78  ? -4.046  -20.195 20.758  1.00 27.07 ? 79  LYS B O     1 
ATOM   2979 C CB    . LYS F 2 78  ? -7.067  -19.558 20.044  1.00 21.82 ? 79  LYS B CB    1 
ATOM   2980 C CG    . LYS F 2 78  ? -7.829  -18.849 18.964  1.00 22.77 ? 79  LYS B CG    1 
ATOM   2981 C CD    . LYS F 2 78  ? -8.913  -19.709 18.360  1.00 24.22 ? 79  LYS B CD    1 
ATOM   2982 C CE    . LYS F 2 78  ? -10.278 -19.064 18.501  1.00 27.37 ? 79  LYS B CE    1 
ATOM   2983 N NZ    . LYS F 2 78  ? -11.380 -20.043 18.418  1.00 30.00 ? 79  LYS B NZ    1 
ATOM   2984 N N     . PRO F 2 79  ? -5.275  -19.836 22.596  1.00 30.54 ? 80  PRO B N     1 
ATOM   2985 C CA    . PRO F 2 79  ? -4.501  -20.680 23.470  1.00 31.27 ? 80  PRO B CA    1 
ATOM   2986 C C     . PRO F 2 79  ? -4.136  -22.041 22.853  1.00 29.94 ? 80  PRO B C     1 
ATOM   2987 O O     . PRO F 2 79  ? -3.066  -22.590 23.110  1.00 30.30 ? 80  PRO B O     1 
ATOM   2988 C CB    . PRO F 2 79  ? -5.346  -20.831 24.750  1.00 32.86 ? 80  PRO B CB    1 
ATOM   2989 C CG    . PRO F 2 79  ? -6.772  -20.441 24.383  1.00 32.81 ? 80  PRO B CG    1 
ATOM   2990 C CD    . PRO F 2 79  ? -6.625  -19.542 23.181  1.00 32.50 ? 80  PRO B CD    1 
ATOM   2991 N N     . SER F 2 80  ? -5.033  -22.590 22.056  1.00 28.24 ? 81  SER B N     1 
ATOM   2992 C CA    . SER F 2 80  ? -4.810  -23.872 21.433  1.00 29.93 ? 81  SER B CA    1 
ATOM   2993 C C     . SER F 2 80  ? -4.022  -23.856 20.134  1.00 32.34 ? 81  SER B C     1 
ATOM   2994 O O     . SER F 2 80  ? -3.181  -24.732 19.877  1.00 32.70 ? 81  SER B O     1 
ATOM   2995 C CB    . SER F 2 80  ? -6.141  -24.477 21.150  1.00 31.03 ? 81  SER B CB    1 
ATOM   2996 O OG    . SER F 2 80  ? -7.051  -23.402 21.092  1.00 32.90 ? 81  SER B OG    1 
ATOM   2997 N N     . GLU F 2 81  ? -4.308  -22.853 19.305  1.00 33.48 ? 82  GLU B N     1 
ATOM   2998 C CA    . GLU F 2 81  ? -3.669  -22.710 18.000  1.00 33.15 ? 82  GLU B CA    1 
ATOM   2999 C C     . GLU F 2 81  ? -2.618  -21.588 17.910  1.00 30.31 ? 82  GLU B C     1 
ATOM   3000 O O     . GLU F 2 81  ? -2.769  -20.593 17.196  1.00 28.80 ? 82  GLU B O     1 
ATOM   3001 C CB    . GLU F 2 81  ? -4.753  -22.638 16.920  1.00 34.73 ? 82  GLU B CB    1 
ATOM   3002 C CG    . GLU F 2 81  ? -6.023  -23.355 17.408  1.00 35.42 ? 82  GLU B CG    1 
ATOM   3003 C CD    . GLU F 2 81  ? -7.199  -23.187 16.502  1.00 37.61 ? 82  GLU B CD    1 
ATOM   3004 O OE1   . GLU F 2 81  ? -7.096  -23.028 15.306  1.00 39.99 ? 82  GLU B OE1   1 
ATOM   3005 O OE2   . GLU F 2 81  ? -8.333  -23.243 17.126  1.00 37.66 ? 82  GLU B OE2   1 
ATOM   3006 N N     . PRO F 2 82  ? -1.552  -21.787 18.636  1.00 29.59 ? 83  PRO B N     1 
ATOM   3007 C CA    . PRO F 2 82  ? -0.459  -20.855 18.701  1.00 29.65 ? 83  PRO B CA    1 
ATOM   3008 C C     . PRO F 2 82  ? 0.238   -20.537 17.357  1.00 28.47 ? 83  PRO B C     1 
ATOM   3009 O O     . PRO F 2 82  ? 0.731   -19.430 17.171  1.00 28.93 ? 83  PRO B O     1 
ATOM   3010 C CB    . PRO F 2 82  ? 0.514   -21.516 19.678  1.00 29.82 ? 83  PRO B CB    1 
ATOM   3011 C CG    . PRO F 2 82  ? 0.429   -22.981 19.318  1.00 29.90 ? 83  PRO B CG    1 
ATOM   3012 C CD    . PRO F 2 82  ? -1.025  -23.164 18.874  1.00 30.19 ? 83  PRO B CD    1 
ATOM   3013 N N     . ASN F 2 83  ? 0.320   -21.492 16.431  1.00 27.92 ? 84  ASN B N     1 
ATOM   3014 C CA    . ASN F 2 83  ? 0.991   -21.229 15.158  1.00 29.77 ? 84  ASN B CA    1 
ATOM   3015 C C     . ASN F 2 83  ? 0.180   -20.425 14.111  1.00 27.52 ? 84  ASN B C     1 
ATOM   3016 O O     . ASN F 2 83  ? 0.663   -20.163 13.011  1.00 27.02 ? 84  ASN B O     1 
ATOM   3017 C CB    . ASN F 2 83  ? 1.694   -22.471 14.561  1.00 34.79 ? 84  ASN B CB    1 
ATOM   3018 C CG    . ASN F 2 83  ? 3.223   -22.543 14.792  1.00 40.59 ? 84  ASN B CG    1 
ATOM   3019 O OD1   . ASN F 2 83  ? 3.738   -23.386 15.557  1.00 42.35 ? 84  ASN B OD1   1 
ATOM   3020 N ND2   . ASN F 2 83  ? 3.958   -21.659 14.123  1.00 42.72 ? 84  ASN B ND2   1 
ATOM   3021 N N     . LYS F 2 84  ? -1.052  -20.035 14.451  1.00 25.57 ? 85  LYS B N     1 
ATOM   3022 C CA    . LYS F 2 84  ? -1.888  -19.271 13.551  1.00 26.37 ? 85  LYS B CA    1 
ATOM   3023 C C     . LYS F 2 84  ? -2.241  -17.902 14.149  1.00 22.44 ? 85  LYS B C     1 
ATOM   3024 O O     . LYS F 2 84  ? -3.399  -17.600 14.413  1.00 20.97 ? 85  LYS B O     1 
ATOM   3025 C CB    . LYS F 2 84  ? -3.189  -19.980 13.153  1.00 32.14 ? 85  LYS B CB    1 
ATOM   3026 C CG    . LYS F 2 84  ? -3.036  -21.396 12.613  1.00 37.65 ? 85  LYS B CG    1 
ATOM   3027 C CD    . LYS F 2 84  ? -4.370  -22.145 12.658  1.00 43.31 ? 85  LYS B CD    1 
ATOM   3028 C CE    . LYS F 2 84  ? -4.393  -23.466 11.873  1.00 47.20 ? 85  LYS B CE    1 
ATOM   3029 N NZ    . LYS F 2 84  ? -5.434  -24.421 12.349  1.00 48.16 ? 85  LYS B NZ    1 
ATOM   3030 N N     . LYS F 2 85  ? -1.245  -17.074 14.374  1.00 19.33 ? 86  LYS B N     1 
ATOM   3031 C CA    . LYS F 2 85  ? -1.516  -15.785 14.946  1.00 17.64 ? 86  LYS B CA    1 
ATOM   3032 C C     . LYS F 2 85  ? -1.887  -14.710 13.918  1.00 15.63 ? 86  LYS B C     1 
ATOM   3033 O O     . LYS F 2 85  ? -1.605  -14.806 12.722  1.00 16.52 ? 86  LYS B O     1 
ATOM   3034 C CB    . LYS F 2 85  ? -0.353  -15.267 15.801  1.00 18.03 ? 86  LYS B CB    1 
ATOM   3035 C CG    . LYS F 2 85  ? 0.166   -16.199 16.894  1.00 17.71 ? 86  LYS B CG    1 
ATOM   3036 C CD    . LYS F 2 85  ? 1.541   -15.729 17.376  1.00 17.79 ? 86  LYS B CD    1 
ATOM   3037 C CE    . LYS F 2 85  ? 2.061   -16.453 18.598  1.00 18.16 ? 86  LYS B CE    1 
ATOM   3038 N NZ    . LYS F 2 85  ? 2.174   -17.894 18.398  1.00 18.51 ? 86  LYS B NZ    1 
ATOM   3039 N N     . ILE F 2 86  ? -2.525  -13.667 14.426  1.00 11.26 ? 87  ILE B N     1 
ATOM   3040 C CA    . ILE F 2 86  ? -2.927  -12.561 13.648  1.00 8.78  ? 87  ILE B CA    1 
ATOM   3041 C C     . ILE F 2 86  ? -2.314  -11.303 14.246  1.00 10.87 ? 87  ILE B C     1 
ATOM   3042 O O     . ILE F 2 86  ? -2.463  -11.048 15.428  1.00 9.74  ? 87  ILE B O     1 
ATOM   3043 C CB    . ILE F 2 86  ? -4.422  -12.426 13.577  1.00 6.00  ? 87  ILE B CB    1 
ATOM   3044 C CG1   . ILE F 2 86  ? -5.025  -13.628 12.915  1.00 6.00  ? 87  ILE B CG1   1 
ATOM   3045 C CG2   . ILE F 2 86  ? -4.823  -11.120 12.876  1.00 6.00  ? 87  ILE B CG2   1 
ATOM   3046 C CD1   . ILE F 2 86  ? -6.488  -13.803 13.275  1.00 6.00  ? 87  ILE B CD1   1 
ATOM   3047 N N     . ALA F 2 87  ? -1.622  -10.547 13.397  1.00 12.77 ? 88  ALA B N     1 
ATOM   3048 C CA    . ALA F 2 87  ? -0.973  -9.313  13.776  1.00 11.49 ? 88  ALA B CA    1 
ATOM   3049 C C     . ALA F 2 87  ? -1.748  -8.135  13.249  1.00 12.19 ? 88  ALA B C     1 
ATOM   3050 O O     . ALA F 2 87  ? -2.077  -8.119  12.086  1.00 13.58 ? 88  ALA B O     1 
ATOM   3051 C CB    . ALA F 2 87  ? 0.387   -9.273  13.153  1.00 9.50  ? 88  ALA B CB    1 
ATOM   3052 N N     . ILE F 2 88  ? -2.022  -7.140  14.123  1.00 10.62 ? 89  ILE B N     1 
ATOM   3053 C CA    . ILE F 2 88  ? -2.739  -5.914  13.770  1.00 7.53  ? 89  ILE B CA    1 
ATOM   3054 C C     . ILE F 2 88  ? -1.872  -4.720  14.123  1.00 9.94  ? 89  ILE B C     1 
ATOM   3055 O O     . ILE F 2 88  ? -1.400  -4.609  15.242  1.00 11.24 ? 89  ILE B O     1 
ATOM   3056 C CB    . ILE F 2 88  ? -4.057  -5.803  14.522  1.00 6.27  ? 89  ILE B CB    1 
ATOM   3057 C CG1   . ILE F 2 88  ? -4.833  -7.100  14.451  1.00 6.36  ? 89  ILE B CG1   1 
ATOM   3058 C CG2   . ILE F 2 88  ? -4.884  -4.688  13.931  1.00 7.63  ? 89  ILE B CG2   1 
ATOM   3059 C CD1   . ILE F 2 88  ? -6.200  -7.013  15.101  1.00 6.00  ? 89  ILE B CD1   1 
ATOM   3060 N N     . ASP F 2 89  ? -1.651  -3.813  13.166  1.00 12.29 ? 90  ASP B N     1 
ATOM   3061 C CA    . ASP F 2 89  ? -0.838  -2.603  13.358  1.00 13.10 ? 90  ASP B CA    1 
ATOM   3062 C C     . ASP F 2 89  ? -1.695  -1.361  13.256  1.00 12.98 ? 90  ASP B C     1 
ATOM   3063 O O     . ASP F 2 89  ? -2.551  -1.282  12.407  1.00 16.44 ? 90  ASP B O     1 
ATOM   3064 C CB    . ASP F 2 89  ? 0.195   -2.507  12.253  1.00 16.58 ? 90  ASP B CB    1 
ATOM   3065 C CG    . ASP F 2 89  ? 1.574   -2.476  12.799  1.00 21.69 ? 90  ASP B CG    1 
ATOM   3066 O OD1   . ASP F 2 89  ? 1.741   -2.738  13.982  1.00 25.69 ? 90  ASP B OD1   1 
ATOM   3067 O OD2   . ASP F 2 89  ? 2.573   -2.181  11.957  1.00 22.29 ? 90  ASP B OD2   1 
ATOM   3068 N N     . ILE F 2 90  ? -1.490  -0.390  14.078  1.00 11.17 ? 91  ILE B N     1 
ATOM   3069 C CA    . ILE F 2 90  ? -2.308  0.820   13.956  1.00 11.19 ? 91  ILE B CA    1 
ATOM   3070 C C     . ILE F 2 90  ? -1.540  1.902   13.185  1.00 15.01 ? 91  ILE B C     1 
ATOM   3071 O O     . ILE F 2 90  ? -0.430  2.269   13.609  1.00 19.38 ? 91  ILE B O     1 
ATOM   3072 C CB    . ILE F 2 90  ? -2.677  1.329   15.332  1.00 7.45  ? 91  ILE B CB    1 
ATOM   3073 C CG1   . ILE F 2 90  ? -2.975  0.159   16.245  1.00 6.00  ? 91  ILE B CG1   1 
ATOM   3074 C CG2   . ILE F 2 90  ? -3.811  2.356   15.268  1.00 6.00  ? 91  ILE B CG2   1 
ATOM   3075 C CD1   . ILE F 2 90  ? -4.439  -0.056  16.476  1.00 6.00  ? 91  ILE B CD1   1 
ATOM   3076 N N     . LYS F 2 91  ? -2.103  2.404   12.053  1.00 12.53 ? 92  LYS B N     1 
ATOM   3077 C CA    . LYS F 2 91  ? -1.423  3.439   11.250  1.00 11.14 ? 92  LYS B CA    1 
ATOM   3078 C C     . LYS F 2 91  ? -2.205  4.728   11.121  1.00 17.05 ? 92  LYS B C     1 
ATOM   3079 O O     . LYS F 2 91  ? -3.419  4.720   10.916  1.00 20.06 ? 92  LYS B O     1 
ATOM   3080 C CB    . LYS F 2 91  ? -1.088  2.937   9.900   1.00 7.39  ? 92  LYS B CB    1 
ATOM   3081 C CG    . LYS F 2 91  ? -0.320  1.656   9.977   1.00 6.00  ? 92  LYS B CG    1 
ATOM   3082 C CD    . LYS F 2 91  ? 0.948   1.863   10.691  1.00 6.00  ? 92  LYS B CD    1 
ATOM   3083 C CE    . LYS F 2 91  ? 2.051   1.067   10.080  1.00 6.92  ? 92  LYS B CE    1 
ATOM   3084 N NZ    . LYS F 2 91  ? 3.300   1.218   10.838  1.00 8.28  ? 92  LYS B NZ    1 
ATOM   3085 N N     . THR F 2 92  ? -1.512  5.851   11.250  1.00 20.18 ? 93  THR B N     1 
ATOM   3086 C CA    . THR F 2 92  ? -2.199  7.132   11.153  1.00 23.15 ? 93  THR B CA    1 
ATOM   3087 C C     . THR F 2 92  ? -1.550  8.024   10.125  1.00 24.21 ? 93  THR B C     1 
ATOM   3088 O O     . THR F 2 92  ? -0.346  7.968   9.919   1.00 25.53 ? 93  THR B O     1 
ATOM   3089 C CB    . THR F 2 92  ? -2.262  7.872   12.536  1.00 24.63 ? 93  THR B CB    1 
ATOM   3090 O OG1   . THR F 2 92  ? -2.650  7.029   13.609  1.00 24.70 ? 93  THR B OG1   1 
ATOM   3091 C CG2   . THR F 2 92  ? -3.215  9.066   12.484  1.00 25.12 ? 93  THR B CG2   1 
ATOM   3092 N N     . THR F 2 93  ? -2.375  8.859   9.501   1.00 23.75 ? 94  THR B N     1 
ATOM   3093 C CA    . THR F 2 93  ? -1.967  9.831   8.505   1.00 22.71 ? 94  THR B CA    1 
ATOM   3094 C C     . THR F 2 93  ? -2.951  10.969  8.576   1.00 24.01 ? 94  THR B C     1 
ATOM   3095 O O     . THR F 2 93  ? -3.977  10.802  9.231   1.00 23.60 ? 94  THR B O     1 
ATOM   3096 C CB    . THR F 2 93  ? -1.815  9.257   7.097   1.00 21.60 ? 94  THR B CB    1 
ATOM   3097 O OG1   . THR F 2 93  ? -0.768  9.910   6.441   1.00 21.15 ? 94  THR B OG1   1 
ATOM   3098 C CG2   . THR F 2 93  ? -3.085  9.464   6.313   1.00 21.94 ? 94  THR B CG2   1 
ATOM   3099 N N     . TYR F 2 94  ? -2.644  12.123  7.946   1.00 26.90 ? 95  TYR B N     1 
ATOM   3100 C CA    . TYR F 2 94  ? -3.534  13.301  7.997   1.00 29.28 ? 95  TYR B CA    1 
ATOM   3101 C C     . TYR F 2 94  ? -3.683  14.018  6.692   1.00 33.04 ? 95  TYR B C     1 
ATOM   3102 O O     . TYR F 2 94  ? -2.761  14.089  5.908   1.00 35.17 ? 95  TYR B O     1 
ATOM   3103 C CB    . TYR F 2 94  ? -3.028  14.368  9.006   1.00 26.36 ? 95  TYR B CB    1 
ATOM   3104 C CG    . TYR F 2 94  ? -1.579  14.742  8.781   1.00 23.55 ? 95  TYR B CG    1 
ATOM   3105 C CD1   . TYR F 2 94  ? -0.562  13.914  9.244   1.00 24.37 ? 95  TYR B CD1   1 
ATOM   3106 C CD2   . TYR F 2 94  ? -1.213  15.904  8.106   1.00 22.43 ? 95  TYR B CD2   1 
ATOM   3107 C CE1   . TYR F 2 94  ? 0.793   14.217  9.064   1.00 24.95 ? 95  TYR B CE1   1 
ATOM   3108 C CE2   . TYR F 2 94  ? 0.132   16.230  7.913   1.00 23.44 ? 95  TYR B CE2   1 
ATOM   3109 C CZ    . TYR F 2 94  ? 1.139   15.379  8.389   1.00 25.25 ? 95  TYR B CZ    1 
ATOM   3110 O OH    . TYR F 2 94  ? 2.489   15.689  8.203   1.00 26.65 ? 95  TYR B OH    1 
ATOM   3111 N N     . THR F 2 95  ? -4.834  14.607  6.480   1.00 35.59 ? 96  THR B N     1 
ATOM   3112 C CA    . THR F 2 95  ? -5.062  15.355  5.271   1.00 39.33 ? 96  THR B CA    1 
ATOM   3113 C C     . THR F 2 95  ? -5.204  16.851  5.580   1.00 44.71 ? 96  THR B C     1 
ATOM   3114 O O     . THR F 2 95  ? -5.931  17.225  6.512   1.00 45.96 ? 96  THR B O     1 
ATOM   3115 C CB    . THR F 2 95  ? -6.276  14.845  4.455   1.00 36.64 ? 96  THR B CB    1 
ATOM   3116 O OG1   . THR F 2 95  ? -7.489  15.315  5.014   1.00 34.67 ? 96  THR B OG1   1 
ATOM   3117 C CG2   . THR F 2 95  ? -6.273  13.325  4.391   1.00 36.59 ? 96  THR B CG2   1 
ATOM   3118 N N     . ASN F 2 96  ? -4.504  17.703  4.783   1.00 46.58 ? 97  ASN B N     1 
ATOM   3119 C CA    . ASN F 2 96  ? -4.560  19.160  4.944   1.00 47.27 ? 97  ASN B CA    1 
ATOM   3120 C C     . ASN F 2 96  ? -5.905  19.709  4.532   1.00 46.82 ? 97  ASN B C     1 
ATOM   3121 O O     . ASN F 2 96  ? -6.330  20.792  4.956   1.00 46.30 ? 97  ASN B O     1 
ATOM   3122 C CB    . ASN F 2 96  ? -3.453  19.852  4.159   1.00 48.72 ? 97  ASN B CB    1 
ATOM   3123 C CG    . ASN F 2 96  ? -2.245  20.027  5.027   1.00 51.49 ? 97  ASN B CG    1 
ATOM   3124 O OD1   . ASN F 2 96  ? -2.343  20.553  6.146   1.00 53.05 ? 97  ASN B OD1   1 
ATOM   3125 N ND2   . ASN F 2 96  ? -1.102  19.574  4.526   1.00 52.41 ? 97  ASN B ND2   1 
ATOM   3126 N N     . LYS F 2 97  ? -6.563  18.921  3.709   1.00 46.90 ? 98  LYS B N     1 
ATOM   3127 C CA    . LYS F 2 97  ? -7.866  19.207  3.189   1.00 48.23 ? 98  LYS B CA    1 
ATOM   3128 C C     . LYS F 2 97  ? -8.488  17.902  2.758   1.00 49.39 ? 98  LYS B C     1 
ATOM   3129 O O     . LYS F 2 97  ? -7.806  17.066  2.186   1.00 50.24 ? 98  LYS B O     1 
ATOM   3130 C CB    . LYS F 2 97  ? -7.764  20.187  2.051   1.00 50.12 ? 98  LYS B CB    1 
ATOM   3131 C CG    . LYS F 2 97  ? -6.913  19.661  0.906   1.00 51.69 ? 98  LYS B CG    1 
ATOM   3132 C CD    . LYS F 2 97  ? -6.203  20.752  0.122   1.00 52.79 ? 98  LYS B CD    1 
ATOM   3133 C CE    . LYS F 2 97  ? -5.538  20.210  -1.125  1.00 53.94 ? 98  LYS B CE    1 
ATOM   3134 N NZ    . LYS F 2 97  ? -4.206  19.637  -0.874  1.00 54.43 ? 98  LYS B NZ    1 
ATOM   3135 N N     . GLU F 2 98  ? -9.779  17.727  3.034   1.00 50.48 ? 99  GLU B N     1 
ATOM   3136 C CA    . GLU F 2 98  ? -10.548 16.517  2.726   1.00 52.19 ? 99  GLU B CA    1 
ATOM   3137 C C     . GLU F 2 98  ? -10.489 15.976  1.305   1.00 51.77 ? 99  GLU B C     1 
ATOM   3138 O O     . GLU F 2 98  ? -10.528 16.724  0.315   1.00 53.13 ? 99  GLU B O     1 
ATOM   3139 C CB    . GLU F 2 98  ? -11.983 16.613  3.240   1.00 55.09 ? 99  GLU B CB    1 
ATOM   3140 C CG    . GLU F 2 98  ? -12.032 17.194  4.674   1.00 58.01 ? 99  GLU B CG    1 
ATOM   3141 C CD    . GLU F 2 98  ? -12.026 18.706  4.706   1.00 59.71 ? 99  GLU B CD    1 
ATOM   3142 O OE1   . GLU F 2 98  ? -11.026 19.391  4.519   1.00 60.00 ? 99  GLU B OE1   1 
ATOM   3143 O OE2   . GLU F 2 98  ? -13.202 19.207  4.989   1.00 60.00 ? 99  GLU B OE2   1 
ATOM   3144 N N     . ASN F 2 99  ? -10.408 14.638  1.228   1.00 50.29 ? 100 ASN B N     1 
ATOM   3145 C CA    . ASN F 2 99  ? -10.342 13.882  -0.032  1.00 49.46 ? 100 ASN B CA    1 
ATOM   3146 C C     . ASN F 2 99  ? -8.929  13.834  -0.675  1.00 46.37 ? 100 ASN B C     1 
ATOM   3147 O O     . ASN F 2 99  ? -8.703  13.413  -1.813  1.00 47.19 ? 100 ASN B O     1 
ATOM   3148 C CB    . ASN F 2 99  ? -11.531 14.201  -0.971  1.00 51.50 ? 100 ASN B CB    1 
ATOM   3149 C CG    . ASN F 2 99  ? -11.352 13.811  -2.430  1.00 53.26 ? 100 ASN B CG    1 
ATOM   3150 O OD1   . ASN F 2 99  ? -11.708 12.696  -2.854  1.00 53.66 ? 100 ASN B OD1   1 
ATOM   3151 N ND2   . ASN F 2 99  ? -10.790 14.750  -3.201  1.00 53.30 ? 100 ASN B ND2   1 
ATOM   3152 N N     . GLU F 2 100 ? -7.952  14.256  0.103   1.00 42.02 ? 101 GLU B N     1 
ATOM   3153 C CA    . GLU F 2 100 ? -6.589  14.256  -0.347  1.00 38.20 ? 101 GLU B CA    1 
ATOM   3154 C C     . GLU F 2 100 ? -6.025  12.847  -0.540  1.00 35.99 ? 101 GLU B C     1 
ATOM   3155 O O     . GLU F 2 100 ? -6.362  11.900  0.180   1.00 34.58 ? 101 GLU B O     1 
ATOM   3156 C CB    . GLU F 2 100 ? -5.708  15.052  0.617   1.00 37.30 ? 101 GLU B CB    1 
ATOM   3157 C CG    . GLU F 2 100 ? -4.772  16.055  -0.064  1.00 37.04 ? 101 GLU B CG    1 
ATOM   3158 C CD    . GLU F 2 100 ? -4.202  16.995  0.939   1.00 37.41 ? 101 GLU B CD    1 
ATOM   3159 O OE1   . GLU F 2 100 ? -4.873  17.862  1.466   1.00 36.91 ? 101 GLU B OE1   1 
ATOM   3160 O OE2   . GLU F 2 100 ? -2.931  16.756  1.215   1.00 37.75 ? 101 GLU B OE2   1 
ATOM   3161 N N     . LYS F 2 101 ? -5.148  12.728  -1.524  1.00 35.36 ? 102 LYS B N     1 
ATOM   3162 C CA    . LYS F 2 101 ? -4.489  11.470  -1.845  1.00 33.47 ? 102 LYS B CA    1 
ATOM   3163 C C     . LYS F 2 101 ? -3.539  11.112  -0.726  1.00 30.30 ? 102 LYS B C     1 
ATOM   3164 O O     . LYS F 2 101 ? -2.423  11.645  -0.669  1.00 29.58 ? 102 LYS B O     1 
ATOM   3165 C CB    . LYS F 2 101 ? -3.741  11.566  -3.176  1.00 33.25 ? 102 LYS B CB    1 
ATOM   3166 C CG    . LYS F 2 101 ? -4.606  11.144  -4.359  1.00 33.24 ? 102 LYS B CG    1 
ATOM   3167 C CD    . LYS F 2 101 ? -3.871  11.255  -5.664  1.00 34.61 ? 102 LYS B CD    1 
ATOM   3168 C CE    . LYS F 2 101 ? -2.794  10.197  -5.831  1.00 36.07 ? 102 LYS B CE    1 
ATOM   3169 N NZ    . LYS F 2 101 ? -1.836  10.507  -6.911  1.00 37.27 ? 102 LYS B NZ    1 
ATOM   3170 N N     . ILE F 2 102 ? -4.023  10.205  0.167   1.00 26.89 ? 103 ILE B N     1 
ATOM   3171 C CA    . ILE F 2 102 ? -3.264  9.727   1.337   1.00 21.01 ? 103 ILE B CA    1 
ATOM   3172 C C     . ILE F 2 102 ? -2.264  8.621   1.074   1.00 17.12 ? 103 ILE B C     1 
ATOM   3173 O O     . ILE F 2 102 ? -2.226  8.000   0.026   1.00 15.96 ? 103 ILE B O     1 
ATOM   3174 C CB    . ILE F 2 102 ? -4.178  9.337   2.488   1.00 17.63 ? 103 ILE B CB    1 
ATOM   3175 C CG1   . ILE F 2 102 ? -5.115  8.215   2.031   1.00 17.52 ? 103 ILE B CG1   1 
ATOM   3176 C CG2   . ILE F 2 102 ? -4.971  10.563  2.931   1.00 16.07 ? 103 ILE B CG2   1 
ATOM   3177 C CD1   . ILE F 2 102 ? -6.218  7.880   3.041   1.00 16.88 ? 103 ILE B CD1   1 
ATOM   3178 N N     . LYS F 2 103 ? -1.464  8.398   2.057   1.00 16.78 ? 104 LYS B N     1 
ATOM   3179 C CA    . LYS F 2 103 ? -0.466  7.387   2.012   1.00 18.85 ? 104 LYS B CA    1 
ATOM   3180 C C     . LYS F 2 103 ? 0.129   7.116   3.394   1.00 19.32 ? 104 LYS B C     1 
ATOM   3181 O O     . LYS F 2 103 ? 0.412   8.048   4.153   1.00 20.29 ? 104 LYS B O     1 
ATOM   3182 C CB    . LYS F 2 103 ? 0.600   7.705   0.990   1.00 20.08 ? 104 LYS B CB    1 
ATOM   3183 C CG    . LYS F 2 103 ? 1.766   8.454   1.543   1.00 22.75 ? 104 LYS B CG    1 
ATOM   3184 C CD    . LYS F 2 103 ? 2.943   8.406   0.591   1.00 27.74 ? 104 LYS B CD    1 
ATOM   3185 C CE    . LYS F 2 103 ? 3.222   6.997   0.045   1.00 31.09 ? 104 LYS B CE    1 
ATOM   3186 N NZ    . LYS F 2 103 ? 4.339   6.917   -0.939  1.00 31.97 ? 104 LYS B NZ    1 
ATOM   3187 N N     . PHE F 2 104 ? 0.294   5.827   3.735   1.00 17.11 ? 105 PHE B N     1 
ATOM   3188 C CA    . PHE F 2 104 ? 0.871   5.429   5.001   1.00 14.93 ? 105 PHE B CA    1 
ATOM   3189 C C     . PHE F 2 104 ? 2.190   4.752   4.776   1.00 16.76 ? 105 PHE B C     1 
ATOM   3190 O O     . PHE F 2 104 ? 2.529   4.386   3.651   1.00 16.98 ? 105 PHE B O     1 
ATOM   3191 C CB    . PHE F 2 104 ? 0.007   4.426   5.773   1.00 12.52 ? 105 PHE B CB    1 
ATOM   3192 C CG    . PHE F 2 104 ? -1.422  4.816   5.895   1.00 10.64 ? 105 PHE B CG    1 
ATOM   3193 C CD1   . PHE F 2 104 ? -1.870  5.484   7.020   1.00 10.47 ? 105 PHE B CD1   1 
ATOM   3194 C CD2   . PHE F 2 104 ? -2.325  4.497   4.886   1.00 10.53 ? 105 PHE B CD2   1 
ATOM   3195 C CE1   . PHE F 2 104 ? -3.207  5.867   7.155   1.00 10.61 ? 105 PHE B CE1   1 
ATOM   3196 C CE2   . PHE F 2 104 ? -3.667  4.864   5.014   1.00 12.15 ? 105 PHE B CE2   1 
ATOM   3197 C CZ    . PHE F 2 104 ? -4.110  5.556   6.146   1.00 11.06 ? 105 PHE B CZ    1 
ATOM   3198 N N     . THR F 2 105 ? 2.911   4.569   5.882   1.00 18.41 ? 106 THR B N     1 
ATOM   3199 C CA    . THR F 2 105 ? 4.201   3.908   5.927   1.00 19.19 ? 106 THR B CA    1 
ATOM   3200 C C     . THR F 2 105 ? 3.930   2.555   6.602   1.00 18.56 ? 106 THR B C     1 
ATOM   3201 O O     . THR F 2 105 ? 3.258   2.499   7.611   1.00 19.97 ? 106 THR B O     1 
ATOM   3202 C CB    . THR F 2 105 ? 5.169   4.768   6.711   1.00 22.02 ? 106 THR B CB    1 
ATOM   3203 O OG1   . THR F 2 105 ? 6.341   4.044   6.975   1.00 27.31 ? 106 THR B OG1   1 
ATOM   3204 C CG2   . THR F 2 105 ? 4.529   5.214   8.023   1.00 20.67 ? 106 THR B CG2   1 
ATOM   3205 N N     . LEU F 2 106 ? 4.385   1.441   6.062   1.00 16.89 ? 107 LEU B N     1 
ATOM   3206 C CA    . LEU F 2 106 ? 4.010   0.199   6.743   1.00 16.99 ? 107 LEU B CA    1 
ATOM   3207 C C     . LEU F 2 106 ? 5.099   -0.637  7.354   1.00 19.80 ? 107 LEU B C     1 
ATOM   3208 O O     . LEU F 2 106 ? 5.187   -1.831  7.091   1.00 22.03 ? 107 LEU B O     1 
ATOM   3209 C CB    . LEU F 2 106 ? 3.082   -0.693  5.882   1.00 15.86 ? 107 LEU B CB    1 
ATOM   3210 C CG    . LEU F 2 106 ? 2.009   0.088   5.130   1.00 16.93 ? 107 LEU B CG    1 
ATOM   3211 C CD1   . LEU F 2 106 ? 1.665   -0.589  3.812   1.00 16.34 ? 107 LEU B CD1   1 
ATOM   3212 C CD2   . LEU F 2 106 ? 0.766   0.239   5.991   1.00 18.23 ? 107 LEU B CD2   1 
ATOM   3213 N N     . GLY F 2 107 ? 5.908   -0.080  8.196   1.00 20.78 ? 108 GLY B N     1 
ATOM   3214 C CA    . GLY F 2 107 ? 6.935   -0.915  8.781   1.00 21.83 ? 108 GLY B CA    1 
ATOM   3215 C C     . GLY F 2 107 ? 8.105   -1.027  7.862   1.00 22.28 ? 108 GLY B C     1 
ATOM   3216 O O     . GLY F 2 107 ? 8.124   -0.374  6.833   1.00 23.99 ? 108 GLY B O     1 
ATOM   3217 N N     . GLY F 2 108 ? 9.080   -1.855  8.222   1.00 21.37 ? 109 GLY B N     1 
ATOM   3218 C CA    . GLY F 2 108 ? 10.276  -1.974  7.412   1.00 21.68 ? 109 GLY B CA    1 
ATOM   3219 C C     . GLY F 2 108 ? 10.424  -3.232  6.602   1.00 21.69 ? 109 GLY B C     1 
ATOM   3220 O O     . GLY F 2 108 ? 9.786   -4.235  6.872   1.00 23.46 ? 109 GLY B O     1 
ATOM   3221 N N     . TYR F 2 109 ? 11.310  -3.144  5.612   1.00 20.37 ? 110 TYR B N     1 
ATOM   3222 C CA    . TYR F 2 109 ? 11.608  -4.211  4.699   1.00 18.41 ? 110 TYR B CA    1 
ATOM   3223 C C     . TYR F 2 109 ? 12.852  -4.999  5.027   1.00 18.11 ? 110 TYR B C     1 
ATOM   3224 O O     . TYR F 2 109 ? 13.238  -5.890  4.275   1.00 17.54 ? 110 TYR B O     1 
ATOM   3225 C CB    . TYR F 2 109 ? 11.555  -3.789  3.208   1.00 16.80 ? 110 TYR B CB    1 
ATOM   3226 C CG    . TYR F 2 109 ? 12.627  -2.794  2.771   1.00 14.95 ? 110 TYR B CG    1 
ATOM   3227 C CD1   . TYR F 2 109 ? 12.313  -1.441  2.610   1.00 14.54 ? 110 TYR B CD1   1 
ATOM   3228 C CD2   . TYR F 2 109 ? 13.921  -3.208  2.481   1.00 13.55 ? 110 TYR B CD2   1 
ATOM   3229 C CE1   . TYR F 2 109 ? 13.262  -0.509  2.199   1.00 13.58 ? 110 TYR B CE1   1 
ATOM   3230 C CE2   . TYR F 2 109 ? 14.891  -2.292  2.070   1.00 13.69 ? 110 TYR B CE2   1 
ATOM   3231 C CZ    . TYR F 2 109 ? 14.558  -0.939  1.929   1.00 14.62 ? 110 TYR B CZ    1 
ATOM   3232 O OH    . TYR F 2 109 ? 15.512  -0.040  1.524   1.00 16.16 ? 110 TYR B OH    1 
ATOM   3233 N N     . THR F 2 110 ? 13.494  -4.712  6.146   1.00 18.75 ? 111 THR B N     1 
ATOM   3234 C CA    . THR F 2 110 ? 14.678  -5.469  6.467   1.00 19.21 ? 111 THR B CA    1 
ATOM   3235 C C     . THR F 2 110 ? 14.628  -6.320  7.721   1.00 21.40 ? 111 THR B C     1 
ATOM   3236 O O     . THR F 2 110 ? 15.520  -7.124  7.926   1.00 24.51 ? 111 THR B O     1 
ATOM   3237 C CB    . THR F 2 110 ? 15.928  -4.617  6.454   1.00 19.84 ? 111 THR B CB    1 
ATOM   3238 O OG1   . THR F 2 110 ? 15.867  -3.717  5.368   1.00 17.83 ? 111 THR B OG1   1 
ATOM   3239 C CG2   . THR F 2 110 ? 17.143  -5.540  6.313   1.00 23.17 ? 111 THR B CG2   1 
ATOM   3240 N N     . SER F 2 111 ? 13.621  -6.177  8.569   1.00 20.51 ? 112 SER B N     1 
ATOM   3241 C CA    . SER F 2 111 ? 13.598  -6.997  9.771   1.00 19.25 ? 112 SER B CA    1 
ATOM   3242 C C     . SER F 2 111 ? 12.905  -8.326  9.591   1.00 19.88 ? 112 SER B C     1 
ATOM   3243 O O     . SER F 2 111 ? 13.309  -9.154  8.768   1.00 20.32 ? 112 SER B O     1 
ATOM   3244 C CB    . SER F 2 111 ? 13.059  -6.249  10.980  1.00 18.67 ? 112 SER B CB    1 
ATOM   3245 O OG    . SER F 2 111 ? 12.196  -5.214  10.556  1.00 18.25 ? 112 SER B OG    1 
ATOM   3246 N N     . PHE F 2 112 ? 11.839  -8.533  10.376  1.00 19.58 ? 113 PHE B N     1 
ATOM   3247 C CA    . PHE F 2 112 ? 11.059  -9.759  10.318  1.00 17.83 ? 113 PHE B CA    1 
ATOM   3248 C C     . PHE F 2 112 ? 10.718  -10.229 8.910   1.00 17.66 ? 113 PHE B C     1 
ATOM   3249 O O     . PHE F 2 112 ? 10.519  -11.399 8.723   1.00 19.88 ? 113 PHE B O     1 
ATOM   3250 C CB    . PHE F 2 112 ? 9.786   -9.679  11.160  1.00 16.25 ? 113 PHE B CB    1 
ATOM   3251 C CG    . PHE F 2 112 ? 8.936   -8.501  10.819  1.00 13.72 ? 113 PHE B CG    1 
ATOM   3252 C CD1   . PHE F 2 112 ? 9.228   -7.244  11.359  1.00 13.95 ? 113 PHE B CD1   1 
ATOM   3253 C CD2   . PHE F 2 112 ? 7.850   -8.621  9.958   1.00 11.47 ? 113 PHE B CD2   1 
ATOM   3254 C CE1   . PHE F 2 112 ? 8.448   -6.129  11.063  1.00 13.71 ? 113 PHE B CE1   1 
ATOM   3255 C CE2   . PHE F 2 112 ? 7.059   -7.514  9.656   1.00 11.23 ? 113 PHE B CE2   1 
ATOM   3256 C CZ    . PHE F 2 112 ? 7.359   -6.272  10.215  1.00 11.99 ? 113 PHE B CZ    1 
ATOM   3257 N N     . ILE F 2 113 ? 10.628  -9.345  7.933   1.00 16.47 ? 114 ILE B N     1 
ATOM   3258 C CA    . ILE F 2 113 ? 10.311  -9.791  6.589   1.00 15.87 ? 114 ILE B CA    1 
ATOM   3259 C C     . ILE F 2 113 ? 11.404  -10.706 6.043   1.00 18.29 ? 114 ILE B C     1 
ATOM   3260 O O     . ILE F 2 113 ? 11.143  -11.749 5.413   1.00 17.61 ? 114 ILE B O     1 
ATOM   3261 C CB    . ILE F 2 113 ? 9.971   -8.653  5.625   1.00 13.73 ? 114 ILE B CB    1 
ATOM   3262 C CG1   . ILE F 2 113 ? 8.548   -8.183  5.882   1.00 13.65 ? 114 ILE B CG1   1 
ATOM   3263 C CG2   . ILE F 2 113 ? 10.052  -9.130  4.198   1.00 12.85 ? 114 ILE B CG2   1 
ATOM   3264 C CD1   . ILE F 2 113 ? 7.752   -7.912  4.616   1.00 12.39 ? 114 ILE B CD1   1 
ATOM   3265 N N     . ARG F 2 114 ? 12.644  -10.308 6.306   1.00 20.89 ? 115 ARG B N     1 
ATOM   3266 C CA    . ARG F 2 114 ? 13.804  -11.056 5.876   1.00 23.62 ? 115 ARG B CA    1 
ATOM   3267 C C     . ARG F 2 114 ? 14.335  -11.964 6.949   1.00 27.50 ? 115 ARG B C     1 
ATOM   3268 O O     . ARG F 2 114 ? 14.458  -13.174 6.763   1.00 29.18 ? 115 ARG B O     1 
ATOM   3269 C CB    . ARG F 2 114 ? 14.919  -10.125 5.484   1.00 22.08 ? 115 ARG B CB    1 
ATOM   3270 C CG    . ARG F 2 114 ? 14.424  -8.907  4.751   1.00 21.35 ? 115 ARG B CG    1 
ATOM   3271 C CD    . ARG F 2 114 ? 15.441  -8.454  3.729   1.00 21.13 ? 115 ARG B CD    1 
ATOM   3272 N NE    . ARG F 2 114 ? 14.895  -7.482  2.822   1.00 21.16 ? 115 ARG B NE    1 
ATOM   3273 C CZ    . ARG F 2 114 ? 15.579  -6.917  1.871   1.00 19.05 ? 115 ARG B CZ    1 
ATOM   3274 N NH1   . ARG F 2 114 ? 16.854  -7.228  1.684   1.00 18.84 ? 115 ARG B NH1   1 
ATOM   3275 N NH2   . ARG F 2 114 ? 14.988  -6.026  1.086   1.00 17.18 ? 115 ARG B NH2   1 
ATOM   3276 N N     . ASN F 2 115 ? 14.641  -11.335 8.068   1.00 29.07 ? 116 ASN B N     1 
ATOM   3277 C CA    . ASN F 2 115 ? 15.185  -11.956 9.251   1.00 30.69 ? 116 ASN B CA    1 
ATOM   3278 C C     . ASN F 2 115 ? 14.393  -13.110 9.823   1.00 32.50 ? 116 ASN B C     1 
ATOM   3279 O O     . ASN F 2 115 ? 14.926  -14.185 10.067  1.00 34.64 ? 116 ASN B O     1 
ATOM   3280 C CB    . ASN F 2 115 ? 15.376  -10.897 10.311  1.00 31.09 ? 116 ASN B CB    1 
ATOM   3281 C CG    . ASN F 2 115 ? 16.735  -11.056 10.858  1.00 33.07 ? 116 ASN B CG    1 
ATOM   3282 O OD1   . ASN F 2 115 ? 17.010  -12.107 11.462  1.00 34.49 ? 116 ASN B OD1   1 
ATOM   3283 N ND2   . ASN F 2 115 ? 17.588  -10.053 10.633  1.00 33.21 ? 116 ASN B ND2   1 
ATOM   3284 N N     . ASN F 2 116 ? 13.112  -12.863 10.035  1.00 31.05 ? 117 ASN B N     1 
ATOM   3285 C CA    . ASN F 2 116 ? 12.142  -13.803 10.581  1.00 27.34 ? 117 ASN B CA    1 
ATOM   3286 C C     . ASN F 2 116 ? 11.884  -13.596 12.053  1.00 26.69 ? 117 ASN B C     1 
ATOM   3287 O O     . ASN F 2 116 ? 10.767  -13.795 12.561  1.00 26.00 ? 117 ASN B O     1 
ATOM   3288 C CB    . ASN F 2 116 ? 12.364  -15.275 10.279  1.00 24.16 ? 117 ASN B CB    1 
ATOM   3289 C CG    . ASN F 2 116 ? 11.287  -16.079 10.999  1.00 23.53 ? 117 ASN B CG    1 
ATOM   3290 O OD1   . ASN F 2 116 ? 10.077  -15.801 10.858  1.00 22.45 ? 117 ASN B OD1   1 
ATOM   3291 N ND2   . ASN F 2 116 ? 11.728  -17.058 11.783  1.00 23.68 ? 117 ASN B ND2   1 
ATOM   3292 N N     . THR F 2 117 ? 12.924  -13.174 12.748  1.00 25.68 ? 118 THR B N     1 
ATOM   3293 C CA    . THR F 2 117 ? 12.774  -12.943 14.149  1.00 24.78 ? 118 THR B CA    1 
ATOM   3294 C C     . THR F 2 117 ? 13.056  -11.502 14.567  1.00 24.14 ? 118 THR B C     1 
ATOM   3295 O O     . THR F 2 117 ? 12.499  -11.033 15.557  1.00 26.31 ? 118 THR B O     1 
ATOM   3296 C CB    . THR F 2 117 ? 13.597  -13.962 14.966  1.00 24.02 ? 118 THR B CB    1 
ATOM   3297 O OG1   . THR F 2 117 ? 14.853  -14.161 14.348  1.00 24.33 ? 118 THR B OG1   1 
ATOM   3298 C CG2   . THR F 2 117 ? 12.851  -15.291 15.043  1.00 23.06 ? 118 THR B CG2   1 
ATOM   3299 N N     . LYS F 2 118 ? 13.896  -10.794 13.808  1.00 20.98 ? 119 LYS B N     1 
ATOM   3300 C CA    . LYS F 2 118 ? 14.238  -9.409  14.130  1.00 19.60 ? 119 LYS B CA    1 
ATOM   3301 C C     . LYS F 2 118 ? 13.089  -8.414  14.149  1.00 16.96 ? 119 LYS B C     1 
ATOM   3302 O O     . LYS F 2 118 ? 12.352  -8.215  13.185  1.00 18.74 ? 119 LYS B O     1 
ATOM   3303 C CB    . LYS F 2 118 ? 15.429  -8.875  13.391  1.00 22.47 ? 119 LYS B CB    1 
ATOM   3304 C CG    . LYS F 2 118 ? 15.638  -7.395  13.616  1.00 24.10 ? 119 LYS B CG    1 
ATOM   3305 C CD    . LYS F 2 118 ? 17.098  -7.029  13.667  1.00 26.21 ? 119 LYS B CD    1 
ATOM   3306 C CE    . LYS F 2 118 ? 17.332  -5.763  14.458  1.00 29.80 ? 119 LYS B CE    1 
ATOM   3307 N NZ    . LYS F 2 118 ? 18.765  -5.492  14.689  1.00 32.97 ? 119 LYS B NZ    1 
ATOM   3308 N N     . ASN F 2 119 ? 12.973  -7.777  15.287  1.00 12.81 ? 120 ASN B N     1 
ATOM   3309 C CA    . ASN F 2 119 ? 11.982  -6.806  15.570  1.00 11.30 ? 120 ASN B CA    1 
ATOM   3310 C C     . ASN F 2 119 ? 10.561  -7.299  15.608  1.00 10.89 ? 120 ASN B C     1 
ATOM   3311 O O     . ASN F 2 119 ? 9.622   -6.511  15.557  1.00 14.01 ? 120 ASN B O     1 
ATOM   3312 C CB    . ASN F 2 119 ? 12.132  -5.532  14.805  1.00 12.76 ? 120 ASN B CB    1 
ATOM   3313 C CG    . ASN F 2 119 ? 13.366  -4.824  15.248  1.00 15.25 ? 120 ASN B CG    1 
ATOM   3314 O OD1   . ASN F 2 119 ? 14.492  -5.246  14.921  1.00 15.67 ? 120 ASN B OD1   1 
ATOM   3315 N ND2   . ASN F 2 119 ? 13.157  -3.749  16.007  1.00 15.91 ? 120 ASN B ND2   1 
ATOM   3316 N N     . ILE F 2 120 ? 10.390  -8.581  15.711  1.00 7.58  ? 121 ILE B N     1 
ATOM   3317 C CA    . ILE F 2 120 ? 9.072   -9.114  15.776  1.00 9.12  ? 121 ILE B CA    1 
ATOM   3318 C C     . ILE F 2 120 ? 8.836   -9.759  17.138  1.00 13.17 ? 121 ILE B C     1 
ATOM   3319 O O     . ILE F 2 120 ? 9.709   -10.459 17.685  1.00 16.31 ? 121 ILE B O     1 
ATOM   3320 C CB    . ILE F 2 120 ? 8.762   -10.046 14.618  1.00 8.31  ? 121 ILE B CB    1 
ATOM   3321 C CG1   . ILE F 2 120 ? 7.265   -10.380 14.606  1.00 8.82  ? 121 ILE B CG1   1 
ATOM   3322 C CG2   . ILE F 2 120 ? 9.603   -11.311 14.728  1.00 6.00  ? 121 ILE B CG2   1 
ATOM   3323 C CD1   . ILE F 2 120 ? 6.737   -10.834 13.256  1.00 8.26  ? 121 ILE B CD1   1 
ATOM   3324 N N     . VAL F 2 121 ? 7.673   -9.520  17.691  1.00 12.49 ? 122 VAL B N     1 
ATOM   3325 C CA    . VAL F 2 121 ? 7.328   -10.053 18.971  1.00 15.34 ? 122 VAL B CA    1 
ATOM   3326 C C     . VAL F 2 121 ? 7.460   -11.550 19.041  1.00 20.09 ? 122 VAL B C     1 
ATOM   3327 O O     . VAL F 2 121 ? 8.060   -12.075 19.980  1.00 22.44 ? 122 VAL B O     1 
ATOM   3328 C CB    . VAL F 2 121 ? 5.987   -9.576  19.337  1.00 18.25 ? 122 VAL B CB    1 
ATOM   3329 C CG1   . VAL F 2 121 ? 5.375   -10.467 20.404  1.00 18.36 ? 122 VAL B CG1   1 
ATOM   3330 C CG2   . VAL F 2 121 ? 6.136   -8.135  19.819  1.00 20.02 ? 122 VAL B CG2   1 
ATOM   3331 N N     . TYR F 2 122 ? 6.879   -12.227 18.032  1.00 21.84 ? 123 TYR B N     1 
ATOM   3332 C CA    . TYR F 2 122 ? 6.903   -13.691 17.833  1.00 22.38 ? 123 TYR B CA    1 
ATOM   3333 C C     . TYR F 2 122 ? 7.473   -13.906 16.425  1.00 23.71 ? 123 TYR B C     1 
ATOM   3334 O O     . TYR F 2 122 ? 7.233   -13.062 15.551  1.00 24.66 ? 123 TYR B O     1 
ATOM   3335 C CB    . TYR F 2 122 ? 5.504   -14.320 17.865  1.00 22.40 ? 123 TYR B CB    1 
ATOM   3336 C CG    . TYR F 2 122 ? 4.873   -14.392 19.221  1.00 22.51 ? 123 TYR B CG    1 
ATOM   3337 C CD1   . TYR F 2 122 ? 5.146   -15.466 20.070  1.00 22.03 ? 123 TYR B CD1   1 
ATOM   3338 C CD2   . TYR F 2 122 ? 3.968   -13.429 19.645  1.00 22.75 ? 123 TYR B CD2   1 
ATOM   3339 C CE1   . TYR F 2 122 ? 4.546   -15.562 21.330  1.00 21.61 ? 123 TYR B CE1   1 
ATOM   3340 C CE2   . TYR F 2 122 ? 3.358   -13.500 20.893  1.00 22.38 ? 123 TYR B CE2   1 
ATOM   3341 C CZ    . TYR F 2 122 ? 3.654   -14.567 21.735  1.00 21.60 ? 123 TYR B CZ    1 
ATOM   3342 O OH    . TYR F 2 122 ? 3.085   -14.654 22.956  1.00 21.80 ? 123 TYR B OH    1 
ATOM   3343 N N     . PRO F 2 123 ? 8.221   -15.013 16.181  1.00 22.35 ? 124 PRO B N     1 
ATOM   3344 C CA    . PRO F 2 123 ? 8.805   -15.259 14.850  1.00 20.13 ? 124 PRO B CA    1 
ATOM   3345 C C     . PRO F 2 123 ? 7.799   -15.076 13.731  1.00 20.40 ? 124 PRO B C     1 
ATOM   3346 O O     . PRO F 2 123 ? 6.670   -15.554 13.808  1.00 21.14 ? 124 PRO B O     1 
ATOM   3347 C CB    . PRO F 2 123 ? 9.403   -16.660 14.895  1.00 19.04 ? 124 PRO B CB    1 
ATOM   3348 C CG    . PRO F 2 123 ? 9.244   -17.146 16.328  1.00 18.66 ? 124 PRO B CG    1 
ATOM   3349 C CD    . PRO F 2 123 ? 8.080   -16.334 16.856  1.00 20.60 ? 124 PRO B CD    1 
ATOM   3350 N N     . PHE F 2 124 ? 8.216   -14.360 12.703  1.00 20.08 ? 125 PHE B N     1 
ATOM   3351 C CA    . PHE F 2 124 ? 7.390   -14.057 11.552  1.00 18.23 ? 125 PHE B CA    1 
ATOM   3352 C C     . PHE F 2 124 ? 6.537   -15.196 11.038  1.00 16.59 ? 125 PHE B C     1 
ATOM   3353 O O     . PHE F 2 124 ? 5.400   -14.973 10.691  1.00 15.48 ? 125 PHE B O     1 
ATOM   3354 C CB    . PHE F 2 124 ? 8.209   -13.405 10.427  1.00 19.15 ? 125 PHE B CB    1 
ATOM   3355 C CG    . PHE F 2 124 ? 7.362   -12.855 9.302   1.00 19.65 ? 125 PHE B CG    1 
ATOM   3356 C CD1   . PHE F 2 124 ? 6.771   -13.699 8.357   1.00 18.45 ? 125 PHE B CD1   1 
ATOM   3357 C CD2   . PHE F 2 124 ? 7.153   -11.478 9.186   1.00 20.14 ? 125 PHE B CD2   1 
ATOM   3358 C CE1   . PHE F 2 124 ? 5.984   -13.206 7.322   1.00 17.52 ? 125 PHE B CE1   1 
ATOM   3359 C CE2   . PHE F 2 124 ? 6.364   -10.969 8.158   1.00 20.01 ? 125 PHE B CE2   1 
ATOM   3360 C CZ    . PHE F 2 124 ? 5.781   -11.829 7.232   1.00 18.70 ? 125 PHE B CZ    1 
ATOM   3361 N N     . ASP F 2 125 ? 7.105   -16.414 10.986  1.00 17.89 ? 126 ASP B N     1 
ATOM   3362 C CA    . ASP F 2 125 ? 6.426   -17.615 10.485  1.00 19.42 ? 126 ASP B CA    1 
ATOM   3363 C C     . ASP F 2 125 ? 5.246   -18.212 11.288  1.00 19.67 ? 126 ASP B C     1 
ATOM   3364 O O     . ASP F 2 125 ? 4.827   -19.335 10.999  1.00 19.37 ? 126 ASP B O     1 
ATOM   3365 C CB    . ASP F 2 125 ? 7.429   -18.714 10.208  1.00 20.59 ? 126 ASP B CB    1 
ATOM   3366 C CG    . ASP F 2 125 ? 7.927   -19.263 11.488  1.00 23.66 ? 126 ASP B CG    1 
ATOM   3367 O OD1   . ASP F 2 125 ? 7.260   -19.988 12.188  1.00 25.93 ? 126 ASP B OD1   1 
ATOM   3368 O OD2   . ASP F 2 125 ? 9.137   -18.865 11.790  1.00 24.47 ? 126 ASP B OD2   1 
ATOM   3369 N N     . GLN F 2 126 ? 4.707   -17.480 12.285  1.00 18.39 ? 127 GLN B N     1 
ATOM   3370 C CA    . GLN F 2 126 ? 3.578   -17.974 13.076  1.00 16.00 ? 127 GLN B CA    1 
ATOM   3371 C C     . GLN F 2 126 ? 2.362   -17.114 12.851  1.00 15.99 ? 127 GLN B C     1 
ATOM   3372 O O     . GLN F 2 126 ? 1.289   -17.337 13.423  1.00 16.55 ? 127 GLN B O     1 
ATOM   3373 C CB    . GLN F 2 126 ? 3.891   -18.053 14.567  1.00 15.92 ? 127 GLN B CB    1 
ATOM   3374 C CG    . GLN F 2 126 ? 5.321   -18.523 14.837  1.00 19.60 ? 127 GLN B CG    1 
ATOM   3375 C CD    . GLN F 2 126 ? 5.624   -18.587 16.316  1.00 21.92 ? 127 GLN B CD    1 
ATOM   3376 O OE1   . GLN F 2 126 ? 4.810   -18.165 17.132  1.00 25.32 ? 127 GLN B OE1   1 
ATOM   3377 N NE2   . GLN F 2 126 ? 6.796   -19.104 16.656  1.00 20.32 ? 127 GLN B NE2   1 
ATOM   3378 N N     . TYR F 2 127 ? 2.547   -16.119 12.002  1.00 15.67 ? 128 TYR B N     1 
ATOM   3379 C CA    . TYR F 2 127 ? 1.493   -15.196 11.655  1.00 16.08 ? 128 TYR B CA    1 
ATOM   3380 C C     . TYR F 2 127 ? 0.810   -15.633 10.376  1.00 18.28 ? 128 TYR B C     1 
ATOM   3381 O O     . TYR F 2 127 ? 1.470   -15.848 9.360   1.00 20.29 ? 128 TYR B O     1 
ATOM   3382 C CB    . TYR F 2 127 ? 2.045   -13.787 11.456  1.00 13.66 ? 128 TYR B CB    1 
ATOM   3383 C CG    . TYR F 2 127 ? 2.319   -13.118 12.754  1.00 12.91 ? 128 TYR B CG    1 
ATOM   3384 C CD1   . TYR F 2 127 ? 1.273   -12.561 13.487  1.00 15.42 ? 128 TYR B CD1   1 
ATOM   3385 C CD2   . TYR F 2 127 ? 3.629   -13.038 13.249  1.00 10.29 ? 128 TYR B CD2   1 
ATOM   3386 C CE1   . TYR F 2 127 ? 1.510   -11.924 14.689  1.00 16.30 ? 128 TYR B CE1   1 
ATOM   3387 C CE2   . TYR F 2 127 ? 3.889   -12.394 14.471  1.00 11.42 ? 128 TYR B CE2   1 
ATOM   3388 C CZ    . TYR F 2 127 ? 2.810   -11.844 15.171  1.00 16.01 ? 128 TYR B CZ    1 
ATOM   3389 O OH    . TYR F 2 127 ? 3.037   -11.216 16.361  1.00 19.33 ? 128 TYR B OH    1 
ATOM   3390 N N     . ILE F 2 128 ? -0.513  -15.785 10.433  1.00 15.68 ? 129 ILE B N     1 
ATOM   3391 C CA    . ILE F 2 128 ? -1.248  -16.199 9.276   1.00 12.85 ? 129 ILE B CA    1 
ATOM   3392 C C     . ILE F 2 128 ? -1.877  -15.013 8.582   1.00 16.54 ? 129 ILE B C     1 
ATOM   3393 O O     . ILE F 2 128 ? -2.239  -15.092 7.412   1.00 21.47 ? 129 ILE B O     1 
ATOM   3394 C CB    . ILE F 2 128 ? -2.260  -17.273 9.559   1.00 8.07  ? 129 ILE B CB    1 
ATOM   3395 C CG1   . ILE F 2 128 ? -3.306  -16.756 10.478  1.00 6.00  ? 129 ILE B CG1   1 
ATOM   3396 C CG2   . ILE F 2 128 ? -1.582  -18.467 10.196  1.00 8.28  ? 129 ILE B CG2   1 
ATOM   3397 C CD1   . ILE F 2 128 ? -4.390  -17.775 10.697  1.00 6.00  ? 129 ILE B CD1   1 
ATOM   3398 N N     . ALA F 2 129 ? -1.988  -13.906 9.302   1.00 13.79 ? 130 ALA B N     1 
ATOM   3399 C CA    . ALA F 2 129 ? -2.559  -12.720 8.730   1.00 11.87 ? 130 ALA B CA    1 
ATOM   3400 C C     . ALA F 2 129 ? -1.850  -11.470 9.218   1.00 14.88 ? 130 ALA B C     1 
ATOM   3401 O O     . ALA F 2 129 ? -1.237  -11.478 10.266  1.00 18.22 ? 130 ALA B O     1 
ATOM   3402 C CB    . ALA F 2 129 ? -4.052  -12.640 9.019   1.00 8.01  ? 130 ALA B CB    1 
ATOM   3403 N N     . HIS F 2 130 ? -1.922  -10.388 8.466   1.00 13.30 ? 131 HIS B N     1 
ATOM   3404 C CA    . HIS F 2 130 ? -1.287  -9.162  8.897   1.00 10.17 ? 131 HIS B CA    1 
ATOM   3405 C C     . HIS F 2 130 ? -2.143  -7.968  8.550   1.00 9.93  ? 131 HIS B C     1 
ATOM   3406 O O     . HIS F 2 130 ? -2.065  -7.379  7.483   1.00 9.83  ? 131 HIS B O     1 
ATOM   3407 C CB    . HIS F 2 130 ? 0.113   -8.963  8.383   1.00 7.50  ? 131 HIS B CB    1 
ATOM   3408 C CG    . HIS F 2 130 ? 1.099   -9.974  8.756   1.00 6.00  ? 131 HIS B CG    1 
ATOM   3409 N ND1   . HIS F 2 130 ? 1.990   -9.751  9.758   1.00 6.37  ? 131 HIS B ND1   1 
ATOM   3410 C CD2   . HIS F 2 130 ? 1.343   -11.168 8.235   1.00 6.00  ? 131 HIS B CD2   1 
ATOM   3411 C CE1   . HIS F 2 130 ? 2.762   -10.810 9.848   1.00 6.00  ? 131 HIS B CE1   1 
ATOM   3412 N NE2   . HIS F 2 130 ? 2.399   -11.685 8.948   1.00 6.89  ? 131 HIS B NE2   1 
ATOM   3413 N N     . TRP F 2 131 ? -2.981  -7.618  9.488   1.00 9.00  ? 132 TRP B N     1 
ATOM   3414 C CA    . TRP F 2 131 ? -3.871  -6.535  9.353   1.00 7.98  ? 132 TRP B CA    1 
ATOM   3415 C C     . TRP F 2 131 ? -3.289  -5.190  9.591   1.00 9.87  ? 132 TRP B C     1 
ATOM   3416 O O     . TRP F 2 131 ? -2.114  -5.007  10.003  1.00 9.60  ? 132 TRP B O     1 
ATOM   3417 C CB    . TRP F 2 131 ? -5.080  -6.726  10.215  1.00 6.73  ? 132 TRP B CB    1 
ATOM   3418 C CG    . TRP F 2 131 ? -5.855  -7.880  9.713   1.00 7.33  ? 132 TRP B CG    1 
ATOM   3419 C CD1   . TRP F 2 131 ? -5.657  -8.509  8.550   1.00 6.00  ? 132 TRP B CD1   1 
ATOM   3420 C CD2   . TRP F 2 131 ? -6.922  -8.549  10.369  1.00 8.20  ? 132 TRP B CD2   1 
ATOM   3421 N NE1   . TRP F 2 131 ? -6.552  -9.528  8.434   1.00 6.08  ? 132 TRP B NE1   1 
ATOM   3422 C CE2   . TRP F 2 131 ? -7.334  -9.568  9.527   1.00 6.06  ? 132 TRP B CE2   1 
ATOM   3423 C CE3   . TRP F 2 131 ? -7.541  -8.398  11.597  1.00 10.38 ? 132 TRP B CE3   1 
ATOM   3424 C CZ2   . TRP F 2 131 ? -8.366  -10.404 9.861   1.00 6.43  ? 132 TRP B CZ2   1 
ATOM   3425 C CZ3   . TRP F 2 131 ? -8.566  -9.234  11.931  1.00 10.09 ? 132 TRP B CZ3   1 
ATOM   3426 C CH2   . TRP F 2 131 ? -8.971  -10.221 11.063  1.00 7.84  ? 132 TRP B CH2   1 
ATOM   3427 N N     . ILE F 2 132 ? -4.159  -4.227  9.302   1.00 9.89  ? 133 ILE B N     1 
ATOM   3428 C CA    . ILE F 2 132 ? -3.855  -2.858  9.450   1.00 10.07 ? 133 ILE B CA    1 
ATOM   3429 C C     . ILE F 2 132 ? -5.085  -2.054  9.572   1.00 12.66 ? 133 ILE B C     1 
ATOM   3430 O O     . ILE F 2 132 ? -5.965  -2.141  8.736   1.00 14.47 ? 133 ILE B O     1 
ATOM   3431 C CB    . ILE F 2 132 ? -3.021  -2.285  8.344   1.00 7.96  ? 133 ILE B CB    1 
ATOM   3432 C CG1   . ILE F 2 132 ? -1.571  -2.563  8.672   1.00 9.55  ? 133 ILE B CG1   1 
ATOM   3433 C CG2   . ILE F 2 132 ? -3.232  -0.780  8.338   1.00 6.60  ? 133 ILE B CG2   1 
ATOM   3434 C CD1   . ILE F 2 132 ? -0.607  -1.576  8.016   1.00 10.10 ? 133 ILE B CD1   1 
ATOM   3435 N N     . ILE F 2 133 ? -5.106  -1.274  10.633  1.00 12.88 ? 134 ILE B N     1 
ATOM   3436 C CA    . ILE F 2 133 ? -6.173  -0.366  10.916  1.00 11.40 ? 134 ILE B CA    1 
ATOM   3437 C C     . ILE F 2 133 ? -5.541  0.963   10.620  1.00 11.18 ? 134 ILE B C     1 
ATOM   3438 O O     . ILE F 2 133 ? -4.374  1.178   10.928  1.00 12.07 ? 134 ILE B O     1 
ATOM   3439 C CB    . ILE F 2 133 ? -6.706  -0.470  12.343  1.00 10.07 ? 134 ILE B CB    1 
ATOM   3440 C CG1   . ILE F 2 133 ? -7.365  -1.839  12.561  1.00 8.69  ? 134 ILE B CG1   1 
ATOM   3441 C CG2   . ILE F 2 133 ? -7.728  0.637   12.561  1.00 9.19  ? 134 ILE B CG2   1 
ATOM   3442 C CD1   . ILE F 2 133 ? -7.407  -2.277  14.021  1.00 6.00  ? 134 ILE B CD1   1 
ATOM   3443 N N     . GLY F 2 134 ? -6.259  1.839   9.977   1.00 9.96  ? 135 GLY B N     1 
ATOM   3444 C CA    . GLY F 2 134 ? -5.658  3.088   9.668   1.00 8.45  ? 135 GLY B CA    1 
ATOM   3445 C C     . GLY F 2 134 ? -6.595  4.203   9.926   1.00 9.51  ? 135 GLY B C     1 
ATOM   3446 O O     . GLY F 2 134 ? -7.767  4.115   9.585   1.00 9.22  ? 135 GLY B O     1 
ATOM   3447 N N     . TYR F 2 135 ? -6.068  5.230   10.536  1.00 12.23 ? 136 TYR B N     1 
ATOM   3448 C CA    . TYR F 2 135 ? -6.863  6.384   10.832  1.00 15.47 ? 136 TYR B CA    1 
ATOM   3449 C C     . TYR F 2 135 ? -6.377  7.554   10.009  1.00 16.98 ? 136 TYR B C     1 
ATOM   3450 O O     . TYR F 2 135 ? -5.157  7.793   9.874   1.00 16.03 ? 136 TYR B O     1 
ATOM   3451 C CB    . TYR F 2 135 ? -6.910  6.758   12.336  1.00 17.25 ? 136 TYR B CB    1 
ATOM   3452 C CG    . TYR F 2 135 ? -7.607  5.747   13.230  1.00 17.67 ? 136 TYR B CG    1 
ATOM   3453 C CD1   . TYR F 2 135 ? -8.896  5.986   13.712  1.00 17.76 ? 136 TYR B CD1   1 
ATOM   3454 C CD2   . TYR F 2 135 ? -6.972  4.569   13.609  1.00 17.06 ? 136 TYR B CD2   1 
ATOM   3455 C CE1   . TYR F 2 135 ? -9.547  5.063   14.535  1.00 17.02 ? 136 TYR B CE1   1 
ATOM   3456 C CE2   . TYR F 2 135 ? -7.597  3.638   14.438  1.00 16.64 ? 136 TYR B CE2   1 
ATOM   3457 C CZ    . TYR F 2 135 ? -8.888  3.884   14.901  1.00 16.67 ? 136 TYR B CZ    1 
ATOM   3458 O OH    . TYR F 2 135 ? -9.507  2.977   15.705  1.00 17.21 ? 136 TYR B OH    1 
ATOM   3459 N N     . VAL F 2 136 ? -7.354  8.247   9.443   1.00 18.67 ? 137 VAL B N     1 
ATOM   3460 C CA    . VAL F 2 136 ? -7.167  9.417   8.614   1.00 18.51 ? 137 VAL B CA    1 
ATOM   3461 C C     . VAL F 2 136 ? -8.003  10.547  9.225   1.00 20.01 ? 137 VAL B C     1 
ATOM   3462 O O     . VAL F 2 136 ? -9.217  10.420  9.392   1.00 21.07 ? 137 VAL B O     1 
ATOM   3463 C CB    . VAL F 2 136 ? -7.604  9.170   7.155   1.00 15.50 ? 137 VAL B CB    1 
ATOM   3464 C CG1   . VAL F 2 136 ? -7.260  10.372  6.300   1.00 14.99 ? 137 VAL B CG1   1 
ATOM   3465 C CG2   . VAL F 2 136 ? -6.968  7.912   6.576   1.00 14.35 ? 137 VAL B CG2   1 
ATOM   3466 N N     . TYR F 2 137 ? -7.361  11.622  9.578   1.00 19.96 ? 138 TYR B N     1 
ATOM   3467 C CA    . TYR F 2 137 ? -8.095  12.712  10.163  1.00 22.60 ? 138 TYR B CA    1 
ATOM   3468 C C     . TYR F 2 137 ? -7.775  13.978  9.379   1.00 31.49 ? 138 TYR B C     1 
ATOM   3469 O O     . TYR F 2 137 ? -6.769  14.026  8.640   1.00 32.11 ? 138 TYR B O     1 
ATOM   3470 C CB    . TYR F 2 137 ? -7.737  12.887  11.668  1.00 17.25 ? 138 TYR B CB    1 
ATOM   3471 C CG    . TYR F 2 137 ? -6.256  12.999  11.899  1.00 13.31 ? 138 TYR B CG    1 
ATOM   3472 C CD1   . TYR F 2 137 ? -5.477  11.852  12.092  1.00 14.43 ? 138 TYR B CD1   1 
ATOM   3473 C CD2   . TYR F 2 137 ? -5.600  14.225  11.880  1.00 12.03 ? 138 TYR B CD2   1 
ATOM   3474 C CE1   . TYR F 2 137 ? -4.097  11.924  12.291  1.00 15.07 ? 138 TYR B CE1   1 
ATOM   3475 C CE2   . TYR F 2 137 ? -4.217  14.320  12.066  1.00 12.75 ? 138 TYR B CE2   1 
ATOM   3476 C CZ    . TYR F 2 137 ? -3.463  13.166  12.278  1.00 14.17 ? 138 TYR B CZ    1 
ATOM   3477 O OH    . TYR F 2 137 ? -2.092  13.253  12.458  1.00 13.60 ? 138 TYR B OH    1 
ATOM   3478 N N     . THR F 2 138 ? -8.636  15.013  9.527   1.00 36.82 ? 139 THR B N     1 
ATOM   3479 C CA    . THR F 2 138 ? -8.401  16.278  8.833   1.00 39.67 ? 139 THR B CA    1 
ATOM   3480 C C     . THR F 2 138 ? -7.762  17.281  9.752   1.00 39.38 ? 139 THR B C     1 
ATOM   3481 O O     . THR F 2 138 ? -8.406  17.846  10.601  1.00 40.13 ? 139 THR B O     1 
ATOM   3482 C CB    . THR F 2 138 ? -9.611  16.851  8.055   1.00 42.06 ? 139 THR B CB    1 
ATOM   3483 O OG1   . THR F 2 138 ? -10.432 15.793  7.573   1.00 43.83 ? 139 THR B OG1   1 
ATOM   3484 C CG2   . THR F 2 138 ? -9.093  17.671  6.872   1.00 42.16 ? 139 THR B CG2   1 
ATOM   3485 N N     . ARG F 2 139 ? -6.467  17.464  9.566   1.00 40.31 ? 140 ARG B N     1 
ATOM   3486 C CA    . ARG F 2 139 ? -5.600  18.356  10.318  1.00 43.20 ? 140 ARG B CA    1 
ATOM   3487 C C     . ARG F 2 139 ? -6.061  19.828  10.350  1.00 45.11 ? 140 ARG B C     1 
ATOM   3488 O O     . ARG F 2 139 ? -5.938  20.537  9.373   1.00 45.51 ? 140 ARG B O     1 
ATOM   3489 C CB    . ARG F 2 139 ? -4.204  18.244  9.739   1.00 45.65 ? 140 ARG B CB    1 
ATOM   3490 C CG    . ARG F 2 139 ? -3.258  19.375  10.080  1.00 48.66 ? 140 ARG B CG    1 
ATOM   3491 C CD    . ARG F 2 139 ? -1.832  19.016  9.681   1.00 52.06 ? 140 ARG B CD    1 
ATOM   3492 N NE    . ARG F 2 139 ? -0.811  19.454  10.633  1.00 55.62 ? 140 ARG B NE    1 
ATOM   3493 C CZ    . ARG F 2 139 ? 0.502   19.383  10.376  1.00 58.40 ? 140 ARG B CZ    1 
ATOM   3494 N NH1   . ARG F 2 139 ? 0.971   18.905  9.225   1.00 58.28 ? 140 ARG B NH1   1 
ATOM   3495 N NH2   . ARG F 2 139 ? 1.376   19.804  11.288  1.00 60.00 ? 140 ARG B NH2   1 
ATOM   3496 N N     . THR F 2 149 ? -5.205  26.754  29.185  1.00 39.29 ? 150 THR B N     1 
ATOM   3497 C CA    . THR F 2 149 ? -5.305  25.599  30.047  1.00 32.92 ? 150 THR B CA    1 
ATOM   3498 C C     . THR F 2 149 ? -6.763  25.544  30.413  1.00 28.23 ? 150 THR B C     1 
ATOM   3499 O O     . THR F 2 149 ? -7.394  26.570  30.523  1.00 28.19 ? 150 THR B O     1 
ATOM   3500 C CB    . THR F 2 149 ? -4.478  25.767  31.326  1.00 33.29 ? 150 THR B CB    1 
ATOM   3501 O OG1   . THR F 2 149 ? -3.284  24.986  31.294  1.00 33.52 ? 150 THR B OG1   1 
ATOM   3502 C CG2   . THR F 2 149 ? -5.332  25.392  32.535  1.00 32.92 ? 150 THR B CG2   1 
ATOM   3503 N N     . TYR F 2 150 ? -7.320  24.374  30.580  1.00 24.55 ? 151 TYR B N     1 
ATOM   3504 C CA    . TYR F 2 150 ? -8.723  24.326  30.895  1.00 21.77 ? 151 TYR B CA    1 
ATOM   3505 C C     . TYR F 2 150 ? -9.017  23.514  32.136  1.00 24.16 ? 151 TYR B C     1 
ATOM   3506 O O     . TYR F 2 150 ? -8.132  22.893  32.715  1.00 25.83 ? 151 TYR B O     1 
ATOM   3507 C CB    . TYR F 2 150 ? -9.489  23.697  29.700  1.00 17.72 ? 151 TYR B CB    1 
ATOM   3508 C CG    . TYR F 2 150 ? -9.426  24.509  28.420  1.00 14.69 ? 151 TYR B CG    1 
ATOM   3509 C CD1   . TYR F 2 150 ? -10.509 25.273  28.003  1.00 12.95 ? 151 TYR B CD1   1 
ATOM   3510 C CD2   . TYR F 2 150 ? -8.288  24.501  27.623  1.00 15.38 ? 151 TYR B CD2   1 
ATOM   3511 C CE1   . TYR F 2 150 ? -10.472 26.013  26.826  1.00 13.32 ? 151 TYR B CE1   1 
ATOM   3512 C CE2   . TYR F 2 150 ? -8.215  25.241  26.440  1.00 15.53 ? 151 TYR B CE2   1 
ATOM   3513 C CZ    . TYR F 2 150 ? -9.314  25.997  26.055  1.00 15.94 ? 151 TYR B CZ    1 
ATOM   3514 O OH    . TYR F 2 150 ? -9.261  26.722  24.898  1.00 18.95 ? 151 TYR B OH    1 
ATOM   3515 N N     . ASN F 2 151 ? -10.294 23.490  32.522  1.00 24.53 ? 152 ASN B N     1 
ATOM   3516 C CA    . ASN F 2 151 ? -10.729 22.710  33.672  1.00 24.55 ? 152 ASN B CA    1 
ATOM   3517 C C     . ASN F 2 151 ? -11.893 21.794  33.325  1.00 24.26 ? 152 ASN B C     1 
ATOM   3518 O O     . ASN F 2 151 ? -12.654 22.057  32.374  1.00 23.28 ? 152 ASN B O     1 
ATOM   3519 C CB    . ASN F 2 151 ? -10.976 23.514  34.971  1.00 25.39 ? 152 ASN B CB    1 
ATOM   3520 C CG    . ASN F 2 151 ? -12.301 24.286  35.035  1.00 26.02 ? 152 ASN B CG    1 
ATOM   3521 O OD1   . ASN F 2 151 ? -13.408 23.721  34.894  1.00 24.90 ? 152 ASN B OD1   1 
ATOM   3522 N ND2   . ASN F 2 151 ? -12.172 25.599  35.254  1.00 26.94 ? 152 ASN B ND2   1 
ATOM   3523 N N     . ILE F 2 152 ? -12.000 20.736  34.110  1.00 25.77 ? 153 ILE B N     1 
ATOM   3524 C CA    . ILE F 2 152 ? -13.028 19.725  33.981  1.00 28.18 ? 153 ILE B CA    1 
ATOM   3525 C C     . ILE F 2 152 ? -14.373 20.338  33.724  1.00 31.11 ? 153 ILE B C     1 
ATOM   3526 O O     . ILE F 2 152 ? -15.263 19.773  33.087  1.00 32.14 ? 153 ILE B O     1 
ATOM   3527 C CB    . ILE F 2 152 ? -13.116 18.929  35.273  1.00 28.94 ? 153 ILE B CB    1 
ATOM   3528 C CG1   . ILE F 2 152 ? -11.797 18.228  35.524  1.00 30.91 ? 153 ILE B CG1   1 
ATOM   3529 C CG2   . ILE F 2 152 ? -14.213 17.894  35.170  1.00 28.85 ? 153 ILE B CG2   1 
ATOM   3530 C CD1   . ILE F 2 152 ? -11.694 16.955  34.701  1.00 31.84 ? 153 ILE B CD1   1 
ATOM   3531 N N     . ASN F 2 153 ? -14.542 21.524  34.219  1.00 33.43 ? 154 ASN B N     1 
ATOM   3532 C CA    . ASN F 2 153 ? -15.800 22.153  34.026  1.00 36.70 ? 154 ASN B CA    1 
ATOM   3533 C C     . ASN F 2 153 ? -16.055 22.614  32.599  1.00 38.93 ? 154 ASN B C     1 
ATOM   3534 O O     . ASN F 2 153 ? -17.197 22.638  32.143  1.00 41.58 ? 154 ASN B O     1 
ATOM   3535 C CB    . ASN F 2 153 ? -16.140 23.172  35.125  1.00 37.27 ? 154 ASN B CB    1 
ATOM   3536 C CG    . ASN F 2 153 ? -16.900 22.495  36.237  1.00 39.42 ? 154 ASN B CG    1 
ATOM   3537 O OD1   . ASN F 2 153 ? -16.327 22.065  37.253  1.00 39.93 ? 154 ASN B OD1   1 
ATOM   3538 N ND2   . ASN F 2 153 ? -18.205 22.352  36.038  1.00 41.18 ? 154 ASN B ND2   1 
ATOM   3539 N N     . GLU F 2 154 ? -14.993 22.973  31.885  1.00 37.08 ? 155 GLU B N     1 
ATOM   3540 C CA    . GLU F 2 154 ? -15.143 23.450  30.529  1.00 35.55 ? 155 GLU B CA    1 
ATOM   3541 C C     . GLU F 2 154 ? -14.618 22.463  29.507  1.00 33.30 ? 155 GLU B C     1 
ATOM   3542 O O     . GLU F 2 154 ? -13.942 22.845  28.536  1.00 31.30 ? 155 GLU B O     1 
ATOM   3543 C CB    . GLU F 2 154 ? -14.447 24.803  30.381  1.00 36.42 ? 155 GLU B CB    1 
ATOM   3544 C CG    . GLU F 2 154 ? -13.136 24.867  31.191  1.00 36.35 ? 155 GLU B CG    1 
ATOM   3545 C CD    . GLU F 2 154 ? -12.861 26.236  31.718  1.00 36.74 ? 155 GLU B CD    1 
ATOM   3546 O OE1   . GLU F 2 154 ? -11.768 26.642  32.020  1.00 37.45 ? 155 GLU B OE1   1 
ATOM   3547 O OE2   . GLU F 2 154 ? -13.939 26.961  31.808  1.00 37.10 ? 155 GLU B OE2   1 
ATOM   3548 N N     . LEU F 2 155 ? -14.943 21.190  29.732  1.00 32.65 ? 156 LEU B N     1 
ATOM   3549 C CA    . LEU F 2 155 ? -14.490 20.123  28.851  1.00 31.02 ? 156 LEU B CA    1 
ATOM   3550 C C     . LEU F 2 155 ? -14.662 20.394  27.398  1.00 32.87 ? 156 LEU B C     1 
ATOM   3551 O O     . LEU F 2 155 ? -13.662 20.441  26.685  1.00 33.28 ? 156 LEU B O     1 
ATOM   3552 C CB    . LEU F 2 155 ? -15.061 18.746  29.179  1.00 27.47 ? 156 LEU B CB    1 
ATOM   3553 C CG    . LEU F 2 155 ? -13.971 17.711  29.256  1.00 23.41 ? 156 LEU B CG    1 
ATOM   3554 C CD1   . LEU F 2 155 ? -12.636 18.435  29.391  1.00 21.59 ? 156 LEU B CD1   1 
ATOM   3555 C CD2   . LEU F 2 155 ? -14.208 16.812  30.465  1.00 22.61 ? 156 LEU B CD2   1 
ATOM   3556 N N     . ASN F 2 156 ? -15.929 20.569  26.974  1.00 34.17 ? 157 ASN B N     1 
ATOM   3557 C CA    . ASN F 2 156 ? -16.224 20.831  25.573  1.00 35.47 ? 157 ASN B CA    1 
ATOM   3558 C C     . ASN F 2 156 ? -16.147 22.288  25.116  1.00 35.97 ? 157 ASN B C     1 
ATOM   3559 O O     . ASN F 2 156 ? -17.088 22.845  24.570  1.00 36.22 ? 157 ASN B O     1 
ATOM   3560 C CB    . ASN F 2 156 ? -17.354 19.996  24.936  1.00 35.78 ? 157 ASN B CB    1 
ATOM   3561 C CG    . ASN F 2 156 ? -18.657 20.091  25.682  1.00 36.94 ? 157 ASN B CG    1 
ATOM   3562 O OD1   . ASN F 2 156 ? -19.109 19.120  26.293  1.00 36.39 ? 157 ASN B OD1   1 
ATOM   3563 N ND2   . ASN F 2 156 ? -19.272 21.261  25.624  1.00 38.88 ? 157 ASN B ND2   1 
ATOM   3564 N N     . GLU F 2 157 ? -14.979 22.869  25.341  1.00 35.60 ? 158 GLU B N     1 
ATOM   3565 C CA    . GLU F 2 157 ? -14.667 24.214  24.981  1.00 34.80 ? 158 GLU B CA    1 
ATOM   3566 C C     . GLU F 2 157 ? -13.256 24.254  24.454  1.00 34.57 ? 158 GLU B C     1 
ATOM   3567 O O     . GLU F 2 157 ? -12.711 25.313  24.145  1.00 34.08 ? 158 GLU B O     1 
ATOM   3568 C CB    . GLU F 2 157 ? -14.784 25.122  26.203  1.00 36.20 ? 158 GLU B CB    1 
ATOM   3569 C CG    . GLU F 2 157 ? -16.215 25.583  26.466  1.00 36.86 ? 158 GLU B CG    1 
ATOM   3570 C CD    . GLU F 2 157 ? -16.287 26.523  27.617  1.00 37.22 ? 158 GLU B CD    1 
ATOM   3571 O OE1   . GLU F 2 157 ? -15.354 27.247  27.958  1.00 36.15 ? 158 GLU B OE1   1 
ATOM   3572 O OE2   . GLU F 2 157 ? -17.457 26.467  28.221  1.00 37.94 ? 158 GLU B OE2   1 
ATOM   3573 N N     . ILE F 2 158 ? -12.668 23.060  24.377  1.00 35.43 ? 159 ILE B N     1 
ATOM   3574 C CA    . ILE F 2 158 ? -11.320 22.869  23.908  1.00 36.36 ? 159 ILE B CA    1 
ATOM   3575 C C     . ILE F 2 158 ? -11.221 22.575  22.410  1.00 39.01 ? 159 ILE B C     1 
ATOM   3576 O O     . ILE F 2 158 ? -11.867 21.667  21.889  1.00 40.23 ? 159 ILE B O     1 
ATOM   3577 C CB    . ILE F 2 158 ? -10.669 21.731  24.647  1.00 35.43 ? 159 ILE B CB    1 
ATOM   3578 C CG1   . ILE F 2 158 ? -10.781 21.922  26.138  1.00 35.64 ? 159 ILE B CG1   1 
ATOM   3579 C CG2   . ILE F 2 158 ? -9.206  21.643  24.261  1.00 36.06 ? 159 ILE B CG2   1 
ATOM   3580 C CD1   . ILE F 2 158 ? -9.771  21.070  26.897  1.00 36.08 ? 159 ILE B CD1   1 
ATOM   3581 N N     . PRO F 2 159 ? -10.373 23.331  21.728  1.00 40.32 ? 160 PRO B N     1 
ATOM   3582 C CA    . PRO F 2 159 ? -10.155 23.140  20.327  1.00 40.67 ? 160 PRO B CA    1 
ATOM   3583 C C     . PRO F 2 159 ? -9.358  21.874  20.108  1.00 40.53 ? 160 PRO B C     1 
ATOM   3584 O O     . PRO F 2 159 ? -8.217  21.763  20.597  1.00 41.54 ? 160 PRO B O     1 
ATOM   3585 C CB    . PRO F 2 159 ? -9.312  24.342  19.851  1.00 41.44 ? 160 PRO B CB    1 
ATOM   3586 C CG    . PRO F 2 159 ? -9.219  25.289  21.028  1.00 41.74 ? 160 PRO B CG    1 
ATOM   3587 C CD    . PRO F 2 159 ? -10.263 24.787  22.018  1.00 41.48 ? 160 PRO B CD    1 
ATOM   3588 N N     . LYS F 2 160 ? -9.970  20.927  19.375  1.00 37.93 ? 161 LYS B N     1 
ATOM   3589 C CA    . LYS F 2 160 ? -9.332  19.669  19.028  1.00 34.97 ? 161 LYS B CA    1 
ATOM   3590 C C     . LYS F 2 160 ? -8.469  19.932  17.781  1.00 31.49 ? 161 LYS B C     1 
ATOM   3591 O O     . LYS F 2 160 ? -8.876  20.720  16.920  1.00 30.58 ? 161 LYS B O     1 
ATOM   3592 C CB    . LYS F 2 160 ? -10.365 18.563  18.861  1.00 35.63 ? 161 LYS B CB    1 
ATOM   3593 C CG    . LYS F 2 160 ? -11.433 18.618  19.948  1.00 36.08 ? 161 LYS B CG    1 
ATOM   3594 C CD    . LYS F 2 160 ? -12.646 17.727  19.658  1.00 37.56 ? 161 LYS B CD    1 
ATOM   3595 C CE    . LYS F 2 160 ? -13.885 18.069  20.526  1.00 39.16 ? 161 LYS B CE    1 
ATOM   3596 N NZ    . LYS F 2 160 ? -14.709 16.883  20.854  1.00 39.19 ? 161 LYS B NZ    1 
ATOM   3597 N N     . PRO F 2 161 ? -7.273  19.319  17.685  1.00 28.49 ? 162 PRO B N     1 
ATOM   3598 C CA    . PRO F 2 161 ? -6.375  19.566  16.547  1.00 27.08 ? 162 PRO B CA    1 
ATOM   3599 C C     . PRO F 2 161 ? -6.649  18.730  15.274  1.00 28.96 ? 162 PRO B C     1 
ATOM   3600 O O     . PRO F 2 161 ? -5.746  18.459  14.483  1.00 28.38 ? 162 PRO B O     1 
ATOM   3601 C CB    . PRO F 2 161 ? -5.004  19.255  17.126  1.00 24.05 ? 162 PRO B CB    1 
ATOM   3602 C CG    . PRO F 2 161 ? -5.249  18.069  18.045  1.00 23.94 ? 162 PRO B CG    1 
ATOM   3603 C CD    . PRO F 2 161 ? -6.713  18.173  18.463  1.00 25.52 ? 162 PRO B CD    1 
ATOM   3604 N N     . TYR F 2 162 ? -7.899  18.332  15.075  1.00 30.48 ? 163 TYR B N     1 
ATOM   3605 C CA    . TYR F 2 162 ? -8.245  17.528  13.924  1.00 32.43 ? 163 TYR B CA    1 
ATOM   3606 C C     . TYR F 2 162 ? -9.738  17.456  13.789  1.00 35.17 ? 163 TYR B C     1 
ATOM   3607 O O     . TYR F 2 162 ? -10.446 17.966  14.618  1.00 38.31 ? 163 TYR B O     1 
ATOM   3608 C CB    . TYR F 2 162 ? -7.704  16.111  14.136  1.00 33.08 ? 163 TYR B CB    1 
ATOM   3609 C CG    . TYR F 2 162 ? -8.306  15.411  15.351  1.00 33.55 ? 163 TYR B CG    1 
ATOM   3610 C CD1   . TYR F 2 162 ? -9.487  14.670  15.255  1.00 34.22 ? 163 TYR B CD1   1 
ATOM   3611 C CD2   . TYR F 2 162 ? -7.683  15.474  16.598  1.00 33.39 ? 163 TYR B CD2   1 
ATOM   3612 C CE1   . TYR F 2 162 ? -10.038 14.018  16.354  1.00 34.10 ? 163 TYR B CE1   1 
ATOM   3613 C CE2   . TYR F 2 162 ? -8.218  14.829  17.711  1.00 33.52 ? 163 TYR B CE2   1 
ATOM   3614 C CZ    . TYR F 2 162 ? -9.414  14.121  17.595  1.00 34.00 ? 163 TYR B CZ    1 
ATOM   3615 O OH    . TYR F 2 162 ? -9.931  13.484  18.694  1.00 33.57 ? 163 TYR B OH    1 
ATOM   3616 N N     . LYS F 2 163 ? -10.207 16.804  12.741  1.00 35.58 ? 164 LYS B N     1 
ATOM   3617 C CA    . LYS F 2 163 ? -11.637 16.660  12.523  1.00 36.55 ? 164 LYS B CA    1 
ATOM   3618 C C     . LYS F 2 163 ? -11.935 15.649  11.423  1.00 35.38 ? 164 LYS B C     1 
ATOM   3619 O O     . LYS F 2 163 ? -11.078 15.387  10.575  1.00 35.11 ? 164 LYS B O     1 
ATOM   3620 C CB    . LYS F 2 163 ? -12.344 17.958  12.266  1.00 39.18 ? 164 LYS B CB    1 
ATOM   3621 C CG    . LYS F 2 163 ? -13.841 17.807  12.491  1.00 42.71 ? 164 LYS B CG    1 
ATOM   3622 C CD    . LYS F 2 163 ? -14.608 17.464  11.218  1.00 44.97 ? 164 LYS B CD    1 
ATOM   3623 C CE    . LYS F 2 163 ? -16.094 17.210  11.456  1.00 46.36 ? 164 LYS B CE    1 
ATOM   3624 N NZ    . LYS F 2 163 ? -16.649 16.183  10.556  1.00 47.36 ? 164 LYS B NZ    1 
ATOM   3625 N N     . GLY F 2 164 ? -13.154 15.092  11.449  1.00 34.36 ? 165 GLY B N     1 
ATOM   3626 C CA    . GLY F 2 164 ? -13.538 14.105  10.446  1.00 35.78 ? 165 GLY B CA    1 
ATOM   3627 C C     . GLY F 2 164 ? -12.498 12.999  10.369  1.00 36.28 ? 165 GLY B C     1 
ATOM   3628 O O     . GLY F 2 164 ? -11.581 13.015  9.527   1.00 37.80 ? 165 GLY B O     1 
ATOM   3629 N N     . VAL F 2 165 ? -12.657 12.028  11.276  1.00 34.12 ? 166 VAL B N     1 
ATOM   3630 C CA    . VAL F 2 165 ? -11.755 10.913  11.391  1.00 32.73 ? 166 VAL B CA    1 
ATOM   3631 C C     . VAL F 2 165 ? -12.190 9.632   10.691  1.00 34.30 ? 166 VAL B C     1 
ATOM   3632 O O     . VAL F 2 165 ? -13.012 8.891   11.218  1.00 36.21 ? 166 VAL B O     1 
ATOM   3633 C CB    . VAL F 2 165 ? -11.478 10.666  12.863  1.00 29.63 ? 166 VAL B CB    1 
ATOM   3634 C CG1   . VAL F 2 165 ? -10.829 9.297   13.082  1.00 28.58 ? 166 VAL B CG1   1 
ATOM   3635 C CG2   . VAL F 2 165 ? -10.596 11.789  13.371  1.00 28.86 ? 166 VAL B CG2   1 
ATOM   3636 N N     . LYS F 2 166 ? -11.616 9.369   9.501   1.00 32.73 ? 167 LYS B N     1 
ATOM   3637 C CA    . LYS F 2 166 ? -11.954 8.159   8.768   1.00 31.58 ? 167 LYS B CA    1 
ATOM   3638 C C     . LYS F 2 166 ? -11.126 6.965   9.276   1.00 27.14 ? 167 LYS B C     1 
ATOM   3639 O O     . LYS F 2 166 ? -10.048 7.164   9.823   1.00 24.80 ? 167 LYS B O     1 
ATOM   3640 C CB    . LYS F 2 166 ? -11.775 8.334   7.258   1.00 34.11 ? 167 LYS B CB    1 
ATOM   3641 C CG    . LYS F 2 166 ? -12.542 9.504   6.647   1.00 36.14 ? 167 LYS B CG    1 
ATOM   3642 C CD    . LYS F 2 166 ? -11.976 9.942   5.278   1.00 38.73 ? 167 LYS B CD    1 
ATOM   3643 C CE    . LYS F 2 166 ? -12.938 10.794  4.442   1.00 40.84 ? 167 LYS B CE    1 
ATOM   3644 N NZ    . LYS F 2 166 ? -13.599 10.085  3.317   1.00 41.69 ? 167 LYS B NZ    1 
ATOM   3645 N N     . VAL F 2 167 ? -11.660 5.731   9.090   1.00 24.88 ? 168 VAL B N     1 
ATOM   3646 C CA    . VAL F 2 167 ? -11.001 4.481   9.508   1.00 24.40 ? 168 VAL B CA    1 
ATOM   3647 C C     . VAL F 2 167 ? -11.306 3.311   8.569   1.00 22.68 ? 168 VAL B C     1 
ATOM   3648 O O     . VAL F 2 167 ? -12.339 3.287   7.901   1.00 24.51 ? 168 VAL B O     1 
ATOM   3649 C CB    . VAL F 2 167 ? -11.289 4.099   10.941  1.00 26.14 ? 168 VAL B CB    1 
ATOM   3650 C CG1   . VAL F 2 167 ? -11.367 5.349   11.796  1.00 28.57 ? 168 VAL B CG1   1 
ATOM   3651 C CG2   . VAL F 2 167 ? -12.606 3.343   11.025  1.00 26.37 ? 168 VAL B CG2   1 
ATOM   3652 N N     . PHE F 2 168 ? -10.390 2.324   8.524   1.00 17.95 ? 169 PHE B N     1 
ATOM   3653 C CA    . PHE F 2 168 ? -10.554 1.162   7.676   1.00 13.34 ? 169 PHE B CA    1 
ATOM   3654 C C     . PHE F 2 168 ? -9.676  0.040   8.145   1.00 14.40 ? 169 PHE B C     1 
ATOM   3655 O O     . PHE F 2 168 ? -8.720  0.263   8.871   1.00 16.38 ? 169 PHE B O     1 
ATOM   3656 C CB    . PHE F 2 168 ? -10.179 1.481   6.197   1.00 10.81 ? 169 PHE B CB    1 
ATOM   3657 C CG    . PHE F 2 168 ? -8.698  1.799   5.953   1.00 7.70  ? 169 PHE B CG    1 
ATOM   3658 C CD1   . PHE F 2 168 ? -8.222  3.104   5.966   1.00 6.93  ? 169 PHE B CD1   1 
ATOM   3659 C CD2   . PHE F 2 168 ? -7.780  0.780   5.689   1.00 6.39  ? 169 PHE B CD2   1 
ATOM   3660 C CE1   . PHE F 2 168 ? -6.874  3.391   5.734   1.00 6.73  ? 169 PHE B CE1   1 
ATOM   3661 C CE2   . PHE F 2 168 ? -6.424  1.043   5.477   1.00 6.00  ? 169 PHE B CE2   1 
ATOM   3662 C CZ    . PHE F 2 168 ? -5.963  2.356   5.496   1.00 6.00  ? 169 PHE B CZ    1 
ATOM   3663 N N     . LEU F 2 169 ? -9.999  -1.170  7.727   1.00 13.57 ? 170 LEU B N     1 
ATOM   3664 C CA    . LEU F 2 169 ? -9.238  -2.356  8.068   1.00 12.56 ? 170 LEU B CA    1 
ATOM   3665 C C     . LEU F 2 169 ? -8.895  -3.057  6.769   1.00 12.18 ? 170 LEU B C     1 
ATOM   3666 O O     . LEU F 2 169 ? -9.772  -3.526  6.056   1.00 12.89 ? 170 LEU B O     1 
ATOM   3667 C CB    . LEU F 2 169 ? -9.991  -3.287  9.019   1.00 14.20 ? 170 LEU B CB    1 
ATOM   3668 C CG    . LEU F 2 169 ? -9.059  -4.275  9.733   1.00 16.94 ? 170 LEU B CG    1 
ATOM   3669 C CD1   . LEU F 2 169 ? -9.374  -4.322  11.218  1.00 17.08 ? 170 LEU B CD1   1 
ATOM   3670 C CD2   . LEU F 2 169 ? -9.219  -5.668  9.135   1.00 18.45 ? 170 LEU B CD2   1 
ATOM   3671 N N     . GLN F 2 170 ? -7.617  -3.112  6.461   1.00 11.56 ? 171 GLN B N     1 
ATOM   3672 C CA    . GLN F 2 170 ? -7.155  -3.717  5.233   1.00 10.93 ? 171 GLN B CA    1 
ATOM   3673 C C     . GLN F 2 170 ? -5.920  -4.537  5.464   1.00 10.44 ? 171 GLN B C     1 
ATOM   3674 O O     . GLN F 2 170 ? -5.173  -4.267  6.390   1.00 10.55 ? 171 GLN B O     1 
ATOM   3675 C CB    . GLN F 2 170 ? -6.840  -2.611  4.198   1.00 11.35 ? 171 GLN B CB    1 
ATOM   3676 C CG    . GLN F 2 170 ? -6.794  -3.096  2.751   1.00 11.40 ? 171 GLN B CG    1 
ATOM   3677 C CD    . GLN F 2 170 ? -7.973  -3.980  2.436   1.00 11.88 ? 171 GLN B CD    1 
ATOM   3678 O OE1   . GLN F 2 170 ? -7.912  -5.222  2.623   1.00 12.50 ? 171 GLN B OE1   1 
ATOM   3679 N NE2   . GLN F 2 170 ? -9.042  -3.359  1.961   1.00 10.70 ? 171 GLN B NE2   1 
ATOM   3680 N N     . ASP F 2 171 ? -5.722  -5.540  4.616   1.00 11.14 ? 172 ASP B N     1 
ATOM   3681 C CA    . ASP F 2 171 ? -4.565  -6.416  4.725   1.00 9.75  ? 172 ASP B CA    1 
ATOM   3682 C C     . ASP F 2 171 ? -3.353  -5.668  4.249   1.00 6.52  ? 172 ASP B C     1 
ATOM   3683 O O     . ASP F 2 171 ? -3.421  -5.039  3.214   1.00 6.00  ? 172 ASP B O     1 
ATOM   3684 C CB    . ASP F 2 171 ? -4.733  -7.665  3.838   1.00 12.37 ? 172 ASP B CB    1 
ATOM   3685 C CG    . ASP F 2 171 ? -5.727  -8.684  4.320   1.00 16.35 ? 172 ASP B CG    1 
ATOM   3686 O OD1   . ASP F 2 171 ? -6.929  -8.501  4.333   1.00 17.13 ? 172 ASP B OD1   1 
ATOM   3687 O OD2   . ASP F 2 171 ? -5.169  -9.799  4.706   1.00 19.19 ? 172 ASP B OD2   1 
ATOM   3688 N N     . LYS F 2 172 ? -2.266  -5.739  5.001   1.00 6.87  ? 173 LYS B N     1 
ATOM   3689 C CA    . LYS F 2 172 ? -1.012  -5.071  4.654   1.00 7.22  ? 173 LYS B CA    1 
ATOM   3690 C C     . LYS F 2 172 ? -0.674  -5.214  3.189   1.00 8.49  ? 173 LYS B C     1 
ATOM   3691 O O     . LYS F 2 172 ? -0.676  -4.219  2.481   1.00 9.90  ? 173 LYS B O     1 
ATOM   3692 C CB    . LYS F 2 172 ? 0.156   -5.564  5.490   1.00 6.00  ? 173 LYS B CB    1 
ATOM   3693 C CG    . LYS F 2 172 ? 1.349   -4.625  5.484   1.00 6.00  ? 173 LYS B CG    1 
ATOM   3694 C CD    . LYS F 2 172 ? 2.615   -5.317  5.991   1.00 6.35  ? 173 LYS B CD    1 
ATOM   3695 C CE    . LYS F 2 172 ? 3.207   -4.704  7.251   1.00 6.55  ? 173 LYS B CE    1 
ATOM   3696 N NZ    . LYS F 2 172 ? 4.660   -4.450  7.142   1.00 6.00  ? 173 LYS B NZ    1 
ATOM   3697 N N     . TRP F 2 173 ? -0.398  -6.471  2.732   1.00 7.67  ? 174 TRP B N     1 
ATOM   3698 C CA    . TRP F 2 173 ? -0.031  -6.758  1.337   1.00 6.41  ? 174 TRP B CA    1 
ATOM   3699 C C     . TRP F 2 173 ? -0.962  -6.145  0.302   1.00 9.49  ? 174 TRP B C     1 
ATOM   3700 O O     . TRP F 2 173 ? -0.525  -5.691  -0.752  1.00 10.41 ? 174 TRP B O     1 
ATOM   3701 C CB    . TRP F 2 173 ? 0.215   -8.239  1.048   1.00 6.00  ? 174 TRP B CB    1 
ATOM   3702 C CG    . TRP F 2 173 ? -1.041  -8.939  0.636   1.00 6.05  ? 174 TRP B CG    1 
ATOM   3703 C CD1   . TRP F 2 173 ? -1.874  -9.655  1.446   1.00 6.00  ? 174 TRP B CD1   1 
ATOM   3704 C CD2   . TRP F 2 173 ? -1.623  -8.995  -0.662  1.00 6.38  ? 174 TRP B CD2   1 
ATOM   3705 N NE1   . TRP F 2 173 ? -2.926  -10.149 0.746   1.00 6.00  ? 174 TRP B NE1   1 
ATOM   3706 C CE2   . TRP F 2 173 ? -2.806  -9.759  -0.566  1.00 6.34  ? 174 TRP B CE2   1 
ATOM   3707 C CE3   . TRP F 2 173 ? -1.255  -8.485  -1.903  1.00 6.00  ? 174 TRP B CE3   1 
ATOM   3708 C CZ2   . TRP F 2 173 ? -3.616  -10.006 -1.671  1.00 6.22  ? 174 TRP B CZ2   1 
ATOM   3709 C CZ3   . TRP F 2 173 ? -2.063  -8.732  -2.989  1.00 6.00  ? 174 TRP B CZ3   1 
ATOM   3710 C CH2   . TRP F 2 173 ? -3.228  -9.488  -2.880  1.00 6.00  ? 174 TRP B CH2   1 
ATOM   3711 N N     . VAL F 2 174 ? -2.241  -6.121  0.585   1.00 8.83  ? 175 VAL B N     1 
ATOM   3712 C CA    . VAL F 2 174 ? -3.159  -5.556  -0.366  1.00 10.32 ? 175 VAL B CA    1 
ATOM   3713 C C     . VAL F 2 174 ? -2.935  -4.076  -0.624  1.00 13.46 ? 175 VAL B C     1 
ATOM   3714 O O     . VAL F 2 174 ? -2.978  -3.622  -1.755  1.00 14.41 ? 175 VAL B O     1 
ATOM   3715 C CB    . VAL F 2 174 ? -4.605  -5.843  -0.019  1.00 9.31  ? 175 VAL B CB    1 
ATOM   3716 C CG1   . VAL F 2 174 ? -5.511  -4.959  -0.861  1.00 9.06  ? 175 VAL B CG1   1 
ATOM   3717 C CG2   . VAL F 2 174 ? -4.908  -7.307  -0.276  1.00 8.71  ? 175 VAL B CG2   1 
ATOM   3718 N N     . ILE F 2 175 ? -2.696  -3.303  0.437   1.00 16.13 ? 176 ILE B N     1 
ATOM   3719 C CA    . ILE F 2 175 ? -2.481  -1.863  0.321   1.00 17.28 ? 176 ILE B CA    1 
ATOM   3720 C C     . ILE F 2 175 ? -1.025  -1.457  0.122   1.00 15.97 ? 176 ILE B C     1 
ATOM   3721 O O     . ILE F 2 175 ? -0.766  -0.318  -0.244  1.00 17.76 ? 176 ILE B O     1 
ATOM   3722 C CB    . ILE F 2 175 ? -3.088  -1.075  1.479   1.00 18.86 ? 176 ILE B CB    1 
ATOM   3723 C CG1   . ILE F 2 175 ? -2.374  -1.425  2.796   1.00 17.29 ? 176 ILE B CG1   1 
ATOM   3724 C CG2   . ILE F 2 175 ? -4.589  -1.329  1.562   1.00 20.37 ? 176 ILE B CG2   1 
ATOM   3725 C CD1   . ILE F 2 175 ? -2.491  -0.334  3.857   1.00 16.31 ? 176 ILE B CD1   1 
ATOM   3726 N N     . ALA F 2 176 ? -0.095  -2.372  0.366   1.00 12.62 ? 177 ALA B N     1 
ATOM   3727 C CA    . ALA F 2 176 ? 1.310   -2.062  0.206   1.00 12.78 ? 177 ALA B CA    1 
ATOM   3728 C C     . ALA F 2 176 ? 1.608   -1.441  -1.157  1.00 16.69 ? 177 ALA B C     1 
ATOM   3729 O O     . ALA F 2 176 ? 0.932   -1.688  -2.147  1.00 15.89 ? 177 ALA B O     1 
ATOM   3730 C CB    . ALA F 2 176 ? 2.203   -3.256  0.489   1.00 11.41 ? 177 ALA B CB    1 
ATOM   3731 N N     . GLY F 2 177 ? 2.628   -0.605  -1.183  1.00 21.40 ? 178 GLY B N     1 
ATOM   3732 C CA    . GLY F 2 177 ? 3.050   0.072   -2.391  1.00 24.29 ? 178 GLY B CA    1 
ATOM   3733 C C     . GLY F 2 177 ? 4.330   -0.565  -2.944  1.00 26.09 ? 178 GLY B C     1 
ATOM   3734 O O     . GLY F 2 177 ? 4.790   -1.600  -2.417  1.00 25.28 ? 178 GLY B O     1 
ATOM   3735 N N     . ASP F 2 178 ? 4.887   0.080   -4.011  1.00 26.83 ? 179 ASP B N     1 
ATOM   3736 C CA    . ASP F 2 178 ? 6.101   -0.390  -4.680  1.00 25.76 ? 179 ASP B CA    1 
ATOM   3737 C C     . ASP F 2 178 ? 7.316   0.430   -4.397  1.00 24.49 ? 179 ASP B C     1 
ATOM   3738 O O     . ASP F 2 178 ? 8.434   0.000   -4.667  1.00 21.98 ? 179 ASP B O     1 
ATOM   3739 C CB    . ASP F 2 178 ? 5.929   -0.629  -6.184  1.00 26.56 ? 179 ASP B CB    1 
ATOM   3740 C CG    . ASP F 2 178 ? 5.411   0.557   -6.911  1.00 28.16 ? 179 ASP B CG    1 
ATOM   3741 O OD1   . ASP F 2 178 ? 4.699   1.401   -6.384  1.00 29.69 ? 179 ASP B OD1   1 
ATOM   3742 O OD2   . ASP F 2 178 ? 5.785   0.589   -8.171  1.00 27.70 ? 179 ASP B OD2   1 
ATOM   3743 N N     . LEU F 2 179 ? 7.113   1.616   -3.851  1.00 28.15 ? 180 LEU B N     1 
ATOM   3744 C CA    . LEU F 2 179 ? 8.224   2.468   -3.484  1.00 32.66 ? 180 LEU B CA    1 
ATOM   3745 C C     . LEU F 2 179 ? 8.323   2.762   -2.012  1.00 34.22 ? 180 LEU B C     1 
ATOM   3746 O O     . LEU F 2 179 ? 7.336   3.025   -1.324  1.00 33.65 ? 180 LEU B O     1 
ATOM   3747 C CB    . LEU F 2 179 ? 8.446   3.741   -4.371  1.00 34.37 ? 180 LEU B CB    1 
ATOM   3748 C CG    . LEU F 2 179 ? 7.188   4.290   -5.014  1.00 35.84 ? 180 LEU B CG    1 
ATOM   3749 C CD1   . LEU F 2 179 ? 6.886   5.652   -4.429  1.00 36.41 ? 180 LEU B CD1   1 
ATOM   3750 C CD2   . LEU F 2 179 ? 7.368   4.402   -6.531  1.00 36.62 ? 180 LEU B CD2   1 
ATOM   3751 N N     . ALA F 2 180 ? 9.546   2.690   -1.524  1.00 36.80 ? 181 ALA B N     1 
ATOM   3752 C CA    . ALA F 2 180 ? 9.894   2.905   -0.141  1.00 40.50 ? 181 ALA B CA    1 
ATOM   3753 C C     . ALA F 2 180 ? 9.466   4.275   0.399   1.00 43.34 ? 181 ALA B C     1 
ATOM   3754 O O     . ALA F 2 180 ? 8.945   5.134   -0.315  1.00 42.67 ? 181 ALA B O     1 
ATOM   3755 C CB    . ALA F 2 180 ? 11.390  2.706   0.032   1.00 41.32 ? 181 ALA B CB    1 
ATOM   3756 N N     . GLY F 2 181 ? 9.728   4.458   1.691   1.00 46.67 ? 182 GLY B N     1 
ATOM   3757 C CA    . GLY F 2 181 ? 9.425   5.715   2.359   1.00 49.70 ? 182 GLY B CA    1 
ATOM   3758 C C     . GLY F 2 181 ? 10.453  6.774   1.986   1.00 52.78 ? 182 GLY B C     1 
ATOM   3759 O O     . GLY F 2 181 ? 11.599  6.448   1.633   1.00 52.94 ? 182 GLY B O     1 
ATOM   3760 N N     . SER F 2 182 ? 10.007  8.032   2.070   1.00 55.59 ? 183 SER B N     1 
ATOM   3761 C CA    . SER F 2 182 ? 10.748  9.265   1.774   1.00 58.46 ? 183 SER B CA    1 
ATOM   3762 C C     . SER F 2 182 ? 12.161  9.122   1.209   1.00 59.99 ? 183 SER B C     1 
ATOM   3763 O O     . SER F 2 182 ? 12.513  9.775   0.219   1.00 60.00 ? 183 SER B O     1 
ATOM   3764 C CB    . SER F 2 182 ? 10.638  10.324  2.861   1.00 59.53 ? 183 SER B CB    1 
ATOM   3765 O OG    . SER F 2 182 ? 9.312   10.865  2.848   1.00 59.61 ? 183 SER B OG    1 
ATOM   3766 N N     . THR F 2 186 ? 14.267  2.619   5.914   1.00 31.39 ? 187 THR B N     1 
ATOM   3767 C CA    . THR F 2 186 ? 13.932  1.441   5.194   1.00 24.20 ? 187 THR B CA    1 
ATOM   3768 C C     . THR F 2 186 ? 12.567  0.931   5.599   1.00 22.57 ? 187 THR B C     1 
ATOM   3769 O O     . THR F 2 186 ? 12.427  -0.175  6.114   1.00 21.69 ? 187 THR B O     1 
ATOM   3770 C CB    . THR F 2 186 ? 15.034  0.390   5.278   1.00 20.69 ? 187 THR B CB    1 
ATOM   3771 O OG1   . THR F 2 186 ? 15.339  0.088   6.641   1.00 20.24 ? 187 THR B OG1   1 
ATOM   3772 C CG2   . THR F 2 186 ? 16.288  0.963   4.616   1.00 19.22 ? 187 THR B CG2   1 
ATOM   3773 N N     . ASN F 2 187 ? 11.570  1.719   5.349   1.00 23.58 ? 188 ASN B N     1 
ATOM   3774 C CA    . ASN F 2 187 ? 10.194  1.401   5.638   1.00 25.19 ? 188 ASN B CA    1 
ATOM   3775 C C     . ASN F 2 187 ? 9.403   1.297   4.378   1.00 22.90 ? 188 ASN B C     1 
ATOM   3776 O O     . ASN F 2 187 ? 9.540   2.117   3.478   1.00 24.64 ? 188 ASN B O     1 
ATOM   3777 C CB    . ASN F 2 187 ? 9.533   2.476   6.551   1.00 31.20 ? 188 ASN B CB    1 
ATOM   3778 C CG    . ASN F 2 187 ? 9.452   2.046   8.003   1.00 38.14 ? 188 ASN B CG    1 
ATOM   3779 O OD1   . ASN F 2 187 ? 10.498  1.711   8.621   1.00 41.34 ? 188 ASN B OD1   1 
ATOM   3780 N ND2   . ASN F 2 187 ? 8.232   2.038   8.563   1.00 38.89 ? 188 ASN B ND2   1 
ATOM   3781 N N     . ILE F 2 188 ? 8.572   0.287   4.307   1.00 19.18 ? 189 ILE B N     1 
ATOM   3782 C CA    . ILE F 2 188 ? 7.729   0.048   3.169   1.00 14.83 ? 189 ILE B CA    1 
ATOM   3783 C C     . ILE F 2 188 ? 6.759   1.202   3.054   1.00 12.36 ? 189 ILE B C     1 
ATOM   3784 O O     . ILE F 2 188 ? 6.356   1.759   4.056   1.00 16.72 ? 189 ILE B O     1 
ATOM   3785 C CB    . ILE F 2 188 ? 6.969   -1.258  3.381   1.00 14.79 ? 189 ILE B CB    1 
ATOM   3786 C CG1   . ILE F 2 188 ? 7.948   -2.460  3.356   1.00 15.94 ? 189 ILE B CG1   1 
ATOM   3787 C CG2   . ILE F 2 188 ? 5.836   -1.449  2.385   1.00 14.20 ? 189 ILE B CG2   1 
ATOM   3788 C CD1   . ILE F 2 188 ? 7.241   -3.805  3.362   1.00 16.28 ? 189 ILE B CD1   1 
ATOM   3789 N N     . GLY F 2 189 ? 6.394   1.568   1.871   1.00 7.12  ? 190 GLY B N     1 
ATOM   3790 C CA    . GLY F 2 189 ? 5.454   2.651   1.742   1.00 6.00  ? 190 GLY B CA    1 
ATOM   3791 C C     . GLY F 2 189 ? 4.126   2.109   1.234   1.00 6.60  ? 190 GLY B C     1 
ATOM   3792 O O     . GLY F 2 189 ? 4.102   1.178   0.456   1.00 8.21  ? 190 GLY B O     1 
ATOM   3793 N N     . SER F 2 190 ? 3.024   2.675   1.684   1.00 6.00  ? 191 SER B N     1 
ATOM   3794 C CA    . SER F 2 190 ? 1.748   2.205   1.241   1.00 6.00  ? 191 SER B CA    1 
ATOM   3795 C C     . SER F 2 190 ? 1.363   2.826   -0.077  1.00 8.55  ? 191 SER B C     1 
ATOM   3796 O O     . SER F 2 190 ? 1.974   3.813   -0.508  1.00 9.45  ? 191 SER B O     1 
ATOM   3797 C CB    . SER F 2 190 ? 0.718   2.523   2.282   1.00 6.38  ? 191 SER B CB    1 
ATOM   3798 O OG    . SER F 2 190 ? 0.044   3.725   1.948   1.00 8.24  ? 191 SER B OG    1 
ATOM   3799 N N     . ILE F 2 191 ? 0.347   2.277   -0.759  1.00 8.97  ? 192 ILE B N     1 
ATOM   3800 C CA    . ILE F 2 191 ? -0.067  2.866   -2.019  1.00 8.76  ? 192 ILE B CA    1 
ATOM   3801 C C     . ILE F 2 191 ? -0.438  4.290   -1.774  1.00 11.51 ? 192 ILE B C     1 
ATOM   3802 O O     . ILE F 2 191 ? -0.910  4.601   -0.694  1.00 11.71 ? 192 ILE B O     1 
ATOM   3803 C CB    . ILE F 2 191 ? -1.218  2.141   -2.655  1.00 6.58  ? 192 ILE B CB    1 
ATOM   3804 C CG1   . ILE F 2 191 ? -2.456  2.229   -1.761  1.00 6.22  ? 192 ILE B CG1   1 
ATOM   3805 C CG2   . ILE F 2 191 ? -0.829  0.685   -2.938  1.00 6.00  ? 192 ILE B CG2   1 
ATOM   3806 C CD1   . ILE F 2 191 ? -3.721  1.648   -2.404  1.00 6.00  ? 192 ILE B CD1   1 
ATOM   3807 N N     . HIS F 2 192 ? -0.201  5.150   -2.771  1.00 15.88 ? 193 HIS B N     1 
ATOM   3808 C CA    . HIS F 2 192 ? -0.523  6.575   -2.668  1.00 19.21 ? 193 HIS B CA    1 
ATOM   3809 C C     . HIS F 2 192 ? -1.892  6.838   -3.304  1.00 18.20 ? 193 HIS B C     1 
ATOM   3810 O O     . HIS F 2 192 ? -1.991  7.443   -4.352  1.00 21.21 ? 193 HIS B O     1 
ATOM   3811 C CB    . HIS F 2 192 ? 0.588   7.466   -3.279  1.00 22.43 ? 193 HIS B CB    1 
ATOM   3812 C CG    . HIS F 2 192 ? 0.407   8.923   -2.976  1.00 27.30 ? 193 HIS B CG    1 
ATOM   3813 N ND1   . HIS F 2 192 ? -0.525  9.711   -3.664  1.00 29.28 ? 193 HIS B ND1   1 
ATOM   3814 C CD2   . HIS F 2 192 ? 1.024   9.719   -2.051  1.00 28.99 ? 193 HIS B CD2   1 
ATOM   3815 C CE1   . HIS F 2 192 ? -0.451  10.937  -3.156  1.00 29.75 ? 193 HIS B CE1   1 
ATOM   3816 N NE2   . HIS F 2 192 ? 0.469   10.977  -2.186  1.00 29.83 ? 193 HIS B NE2   1 
ATOM   3817 N N     . ALA F 2 193 ? -2.941  6.368   -2.668  1.00 15.48 ? 194 ALA B N     1 
ATOM   3818 C CA    . ALA F 2 193 ? -4.246  6.527   -3.234  1.00 16.12 ? 194 ALA B CA    1 
ATOM   3819 C C     . ALA F 2 193 ? -5.266  7.244   -2.391  1.00 19.79 ? 194 ALA B C     1 
ATOM   3820 O O     . ALA F 2 193 ? -4.985  7.849   -1.356  1.00 21.13 ? 194 ALA B O     1 
ATOM   3821 C CB    . ALA F 2 193 ? -4.784  5.158   -3.594  1.00 15.51 ? 194 ALA B CB    1 
ATOM   3822 N N     . HIS F 2 194 ? -6.494  7.124   -2.886  1.00 22.08 ? 195 HIS B N     1 
ATOM   3823 C CA    . HIS F 2 194 ? -7.676  7.705   -2.289  1.00 23.70 ? 195 HIS B CA    1 
ATOM   3824 C C     . HIS F 2 194 ? -8.212  6.782   -1.221  1.00 23.28 ? 195 HIS B C     1 
ATOM   3825 O O     . HIS F 2 194 ? -8.174  5.556   -1.369  1.00 24.40 ? 195 HIS B O     1 
ATOM   3826 C CB    . HIS F 2 194 ? -8.755  7.992   -3.362  1.00 26.62 ? 195 HIS B CB    1 
ATOM   3827 C CG    . HIS F 2 194 ? -8.673  9.385   -3.915  1.00 29.89 ? 195 HIS B CG    1 
ATOM   3828 N ND1   . HIS F 2 194 ? -7.479  9.902   -4.429  1.00 30.39 ? 195 HIS B ND1   1 
ATOM   3829 C CD2   . HIS F 2 194 ? -9.625  10.348  -4.024  1.00 31.21 ? 195 HIS B CD2   1 
ATOM   3830 C CE1   . HIS F 2 194 ? -7.740  11.136  -4.821  1.00 30.96 ? 195 HIS B CE1   1 
ATOM   3831 N NE2   . HIS F 2 194 ? -9.019  11.439  -4.590  1.00 31.51 ? 195 HIS B NE2   1 
ATOM   3832 N N     . TYR F 2 195 ? -8.706  7.387   -0.161  1.00 21.95 ? 196 TYR B N     1 
ATOM   3833 C CA    . TYR F 2 195 ? -9.259  6.663   0.971   1.00 20.06 ? 196 TYR B CA    1 
ATOM   3834 C C     . TYR F 2 195 ? -10.120 5.461   0.591   1.00 20.60 ? 196 TYR B C     1 
ATOM   3835 O O     . TYR F 2 195 ? -9.958  4.378   1.131   1.00 20.14 ? 196 TYR B O     1 
ATOM   3836 C CB    . TYR F 2 195 ? -9.936  7.610   1.999   1.00 17.48 ? 196 TYR B CB    1 
ATOM   3837 C CG    . TYR F 2 195 ? -10.795 6.885   2.989   1.00 13.53 ? 196 TYR B CG    1 
ATOM   3838 C CD1   . TYR F 2 195 ? -12.144 6.663   2.726   1.00 12.59 ? 196 TYR B CD1   1 
ATOM   3839 C CD2   . TYR F 2 195 ? -10.253 6.400   4.179   1.00 11.25 ? 196 TYR B CD2   1 
ATOM   3840 C CE1   . TYR F 2 195 ? -12.951 5.986   3.619   1.00 12.91 ? 196 TYR B CE1   1 
ATOM   3841 C CE2   . TYR F 2 195 ? -11.044 5.707   5.091   1.00 11.48 ? 196 TYR B CE2   1 
ATOM   3842 C CZ    . TYR F 2 195 ? -12.394 5.508   4.802   1.00 14.26 ? 196 TYR B CZ    1 
ATOM   3843 O OH    . TYR F 2 195 ? -13.180 4.832   5.696   1.00 17.99 ? 196 TYR B OH    1 
ATOM   3844 N N     . LYS F 2 196 ? -11.035 5.636   -0.347  1.00 23.25 ? 197 LYS B N     1 
ATOM   3845 C CA    . LYS F 2 196 ? -11.885 4.521   -0.739  1.00 26.25 ? 197 LYS B CA    1 
ATOM   3846 C C     . LYS F 2 196 ? -11.118 3.367   -1.350  1.00 23.41 ? 197 LYS B C     1 
ATOM   3847 O O     . LYS F 2 196 ? -11.582 2.229   -1.356  1.00 20.41 ? 197 LYS B O     1 
ATOM   3848 C CB    . LYS F 2 196 ? -13.136 4.927   -1.517  1.00 31.63 ? 197 LYS B CB    1 
ATOM   3849 C CG    . LYS F 2 196 ? -12.875 5.238   -2.976  1.00 36.30 ? 197 LYS B CG    1 
ATOM   3850 C CD    . LYS F 2 196 ? -13.892 6.193   -3.574  1.00 40.15 ? 197 LYS B CD    1 
ATOM   3851 C CE    . LYS F 2 196 ? -14.270 5.819   -5.001  1.00 43.89 ? 197 LYS B CE    1 
ATOM   3852 N NZ    . LYS F 2 196 ? -14.959 4.513   -5.066  1.00 46.09 ? 197 LYS B NZ    1 
ATOM   3853 N N     . ASP F 2 197 ? -9.925  3.678   -1.858  1.00 23.98 ? 198 ASP B N     1 
ATOM   3854 C CA    . ASP F 2 197 ? -9.068  2.690   -2.469  1.00 24.94 ? 198 ASP B CA    1 
ATOM   3855 C C     . ASP F 2 197 ? -8.419  1.791   -1.427  1.00 25.33 ? 198 ASP B C     1 
ATOM   3856 O O     . ASP F 2 197 ? -8.035  0.661   -1.723  1.00 26.20 ? 198 ASP B O     1 
ATOM   3857 C CB    . ASP F 2 197 ? -7.989  3.335   -3.330  1.00 26.47 ? 198 ASP B CB    1 
ATOM   3858 C CG    . ASP F 2 197 ? -8.521  4.060   -4.532  1.00 27.51 ? 198 ASP B CG    1 
ATOM   3859 O OD1   . ASP F 2 197 ? -9.688  3.988   -4.918  1.00 27.66 ? 198 ASP B OD1   1 
ATOM   3860 O OD2   . ASP F 2 197 ? -7.583  4.760   -5.136  1.00 27.20 ? 198 ASP B OD2   1 
ATOM   3861 N N     . PHE F 2 198 ? -8.299  2.316   -0.199  1.00 24.34 ? 199 PHE B N     1 
ATOM   3862 C CA    . PHE F 2 198 ? -7.714  1.592   0.932   1.00 22.04 ? 199 PHE B CA    1 
ATOM   3863 C C     . PHE F 2 198 ? -8.723  0.637   1.549   1.00 21.05 ? 199 PHE B C     1 
ATOM   3864 O O     . PHE F 2 198 ? -8.406  -0.470  2.019   1.00 20.91 ? 199 PHE B O     1 
ATOM   3865 C CB    . PHE F 2 198 ? -7.192  2.571   2.012   1.00 18.41 ? 199 PHE B CB    1 
ATOM   3866 C CG    . PHE F 2 198 ? -5.852  3.152   1.704   1.00 14.36 ? 199 PHE B CG    1 
ATOM   3867 C CD1   . PHE F 2 198 ? -4.688  2.484   2.076   1.00 13.87 ? 199 PHE B CD1   1 
ATOM   3868 C CD2   . PHE F 2 198 ? -5.744  4.370   1.048   1.00 14.02 ? 199 PHE B CD2   1 
ATOM   3869 C CE1   . PHE F 2 198 ? -3.423  3.025   1.794   1.00 14.76 ? 199 PHE B CE1   1 
ATOM   3870 C CE2   . PHE F 2 198 ? -4.496  4.919   0.752   1.00 14.51 ? 199 PHE B CE2   1 
ATOM   3871 C CZ    . PHE F 2 198 ? -3.334  4.243   1.131   1.00 14.81 ? 199 PHE B CZ    1 
ATOM   3872 N N     . VAL F 2 199 ? -9.950  1.106   1.549   1.00 19.71 ? 200 VAL B N     1 
ATOM   3873 C CA    . VAL F 2 199 ? -11.064 0.390   2.070   1.00 21.41 ? 200 VAL B CA    1 
ATOM   3874 C C     . VAL F 2 199 ? -11.472 -0.732  1.106   1.00 23.31 ? 200 VAL B C     1 
ATOM   3875 O O     . VAL F 2 199 ? -11.777 -1.855  1.517   1.00 22.83 ? 200 VAL B O     1 
ATOM   3876 C CB    . VAL F 2 199 ? -12.200 1.377   2.224   1.00 21.83 ? 200 VAL B CB    1 
ATOM   3877 C CG1   . VAL F 2 199 ? -13.518 0.653   2.424   1.00 21.00 ? 200 VAL B CG1   1 
ATOM   3878 C CG2   . VAL F 2 199 ? -11.924 2.332   3.381   1.00 22.79 ? 200 VAL B CG2   1 
ATOM   3879 N N     . GLU F 2 200 ? -11.470 -0.390  -0.199  1.00 24.06 ? 201 GLU B N     1 
ATOM   3880 C CA    . GLU F 2 200 ? -11.823 -1.297  -1.273  1.00 22.53 ? 201 GLU B CA    1 
ATOM   3881 C C     . GLU F 2 200 ? -10.727 -2.277  -1.562  1.00 19.63 ? 201 GLU B C     1 
ATOM   3882 O O     . GLU F 2 200 ? -10.939 -3.327  -2.147  1.00 19.95 ? 201 GLU B O     1 
ATOM   3883 C CB    . GLU F 2 200 ? -12.143 -0.525  -2.552  1.00 25.90 ? 201 GLU B CB    1 
ATOM   3884 C CG    . GLU F 2 200 ? -13.637 -0.183  -2.655  1.00 29.36 ? 201 GLU B CG    1 
ATOM   3885 C CD    . GLU F 2 200 ? -13.995 0.422   -3.973  1.00 31.59 ? 201 GLU B CD    1 
ATOM   3886 O OE1   . GLU F 2 200 ? -13.171 0.971   -4.693  1.00 32.00 ? 201 GLU B OE1   1 
ATOM   3887 O OE2   . GLU F 2 200 ? -15.273 0.302   -4.249  1.00 32.67 ? 201 GLU B OE2   1 
ATOM   3888 N N     . GLY F 2 201 ? -9.534  -1.910  -1.144  1.00 17.90 ? 202 GLY B N     1 
ATOM   3889 C CA    . GLY F 2 201 ? -8.395  -2.754  -1.337  1.00 16.71 ? 202 GLY B CA    1 
ATOM   3890 C C     . GLY F 2 201 ? -7.940  -2.714  -2.751  1.00 17.07 ? 202 GLY B C     1 
ATOM   3891 O O     . GLY F 2 201 ? -7.679  -3.749  -3.336  1.00 19.33 ? 202 GLY B O     1 
ATOM   3892 N N     . LYS F 2 202 ? -7.874  -1.504  -3.298  1.00 16.75 ? 203 LYS B N     1 
ATOM   3893 C CA    . LYS F 2 202 ? -7.450  -1.297  -4.674  1.00 17.01 ? 203 LYS B CA    1 
ATOM   3894 C C     . LYS F 2 202 ? -5.970  -1.130  -4.648  1.00 17.23 ? 203 LYS B C     1 
ATOM   3895 O O     . LYS F 2 202 ? -5.495  0.008   -4.526  1.00 20.59 ? 203 LYS B O     1 
ATOM   3896 C CB    . LYS F 2 202 ? -8.076  -0.056  -5.271  1.00 18.76 ? 203 LYS B CB    1 
ATOM   3897 C CG    . LYS F 2 202 ? -9.017  -0.342  -6.429  1.00 23.44 ? 203 LYS B CG    1 
ATOM   3898 C CD    . LYS F 2 202 ? -9.869  0.884   -6.840  1.00 27.97 ? 203 LYS B CD    1 
ATOM   3899 C CE    . LYS F 2 202 ? -11.333 0.533   -7.193  1.00 29.95 ? 203 LYS B CE    1 
ATOM   3900 N NZ    . LYS F 2 202 ? -12.118 1.672   -7.708  1.00 30.16 ? 203 LYS B NZ    1 
ATOM   3901 N N     . GLY F 2 203 ? -5.245  -2.269  -4.751  1.00 13.32 ? 204 GLY B N     1 
ATOM   3902 C CA    . GLY F 2 203 ? -3.801  -2.253  -4.693  1.00 10.59 ? 204 GLY B CA    1 
ATOM   3903 C C     . GLY F 2 203 ? -3.050  -2.452  -5.979  1.00 10.41 ? 204 GLY B C     1 
ATOM   3904 O O     . GLY F 2 203 ? -3.555  -2.364  -7.071  1.00 12.45 ? 204 GLY B O     1 
ATOM   3905 N N     . ILE F 2 204 ? -1.780  -2.730  -5.779  1.00 9.69  ? 205 ILE B N     1 
ATOM   3906 C CA    . ILE F 2 204 ? -0.805  -2.953  -6.795  1.00 8.69  ? 205 ILE B CA    1 
ATOM   3907 C C     . ILE F 2 204 ? -0.447  -4.426  -6.853  1.00 11.95 ? 205 ILE B C     1 
ATOM   3908 O O     . ILE F 2 204 ? -0.466  -5.086  -7.894  1.00 13.11 ? 205 ILE B O     1 
ATOM   3909 C CB    . ILE F 2 204 ? 0.416   -2.125  -6.377  1.00 8.18  ? 205 ILE B CB    1 
ATOM   3910 C CG1   . ILE F 2 204 ? 0.374   -0.764  -6.956  1.00 10.17 ? 205 ILE B CG1   1 
ATOM   3911 C CG2   . ILE F 2 204 ? 1.765   -2.746  -6.718  1.00 7.99  ? 205 ILE B CG2   1 
ATOM   3912 C CD1   . ILE F 2 204 ? 1.751   -0.151  -6.769  1.00 13.10 ? 205 ILE B CD1   1 
ATOM   3913 N N     . PHE F 2 205 ? -0.106  -4.967  -5.709  1.00 14.41 ? 206 PHE B N     1 
ATOM   3914 C CA    . PHE F 2 205 ? 0.276   -6.352  -5.676  1.00 16.00 ? 206 PHE B CA    1 
ATOM   3915 C C     . PHE F 2 205 ? -0.801  -7.291  -6.171  1.00 19.10 ? 206 PHE B C     1 
ATOM   3916 O O     . PHE F 2 205 ? -1.977  -6.981  -6.075  1.00 21.35 ? 206 PHE B O     1 
ATOM   3917 C CB    . PHE F 2 205 ? 0.959   -6.718  -4.371  1.00 14.12 ? 206 PHE B CB    1 
ATOM   3918 C CG    . PHE F 2 205 ? 2.319   -6.089  -4.359  1.00 11.60 ? 206 PHE B CG    1 
ATOM   3919 C CD1   . PHE F 2 205 ? 3.361   -6.615  -5.130  1.00 10.97 ? 206 PHE B CD1   1 
ATOM   3920 C CD2   . PHE F 2 205 ? 2.563   -4.943  -3.606  1.00 11.58 ? 206 PHE B CD2   1 
ATOM   3921 C CE1   . PHE F 2 205 ? 4.635   -6.034  -5.130  1.00 11.60 ? 206 PHE B CE1   1 
ATOM   3922 C CE2   . PHE F 2 205 ? 3.832   -4.346  -3.587  1.00 12.32 ? 206 PHE B CE2   1 
ATOM   3923 C CZ    . PHE F 2 205 ? 4.866   -4.895  -4.352  1.00 12.09 ? 206 PHE B CZ    1 
ATOM   3924 N N     . ASP F 2 206 ? -0.407  -8.438  -6.718  1.00 20.28 ? 207 ASP B N     1 
ATOM   3925 C CA    . ASP F 2 206 ? -1.389  -9.393  -7.238  1.00 22.67 ? 207 ASP B CA    1 
ATOM   3926 C C     . ASP F 2 206 ? -1.596  -10.539 -6.332  1.00 20.78 ? 207 ASP B C     1 
ATOM   3927 O O     . ASP F 2 206 ? -2.520  -11.327 -6.467  1.00 20.47 ? 207 ASP B O     1 
ATOM   3928 C CB    . ASP F 2 206 ? -1.029  -9.878  -8.627  1.00 28.97 ? 207 ASP B CB    1 
ATOM   3929 C CG    . ASP F 2 206 ? -1.397  -8.859  -9.668  1.00 35.02 ? 207 ASP B CG    1 
ATOM   3930 O OD1   . ASP F 2 206 ? -2.304  -8.008  -9.501  1.00 36.01 ? 207 ASP B OD1   1 
ATOM   3931 O OD2   . ASP F 2 206 ? -0.640  -8.963  -10.768 1.00 36.60 ? 207 ASP B OD2   1 
ATOM   3932 N N     . SER F 2 207 ? -0.725  -10.635 -5.381  1.00 20.06 ? 208 SER B N     1 
ATOM   3933 C CA    . SER F 2 207 ? -0.810  -11.685 -4.442  1.00 17.73 ? 208 SER B CA    1 
ATOM   3934 C C     . SER F 2 207 ? 0.164   -11.423 -3.311  1.00 17.70 ? 208 SER B C     1 
ATOM   3935 O O     . SER F 2 207 ? 1.132   -10.690 -3.478  1.00 18.22 ? 208 SER B O     1 
ATOM   3936 C CB    . SER F 2 207 ? -0.506  -12.975 -5.143  1.00 15.90 ? 208 SER B CB    1 
ATOM   3937 O OG    . SER F 2 207 ? 0.869   -13.023 -5.400  1.00 15.13 ? 208 SER B OG    1 
ATOM   3938 N N     . GLU F 2 208 ? -0.085  -12.020 -2.160  1.00 17.89 ? 209 GLU B N     1 
ATOM   3939 C CA    . GLU F 2 208 ? 0.828   -11.797 -1.054  1.00 17.92 ? 209 GLU B CA    1 
ATOM   3940 C C     . GLU F 2 208 ? 2.229   -12.227 -1.363  1.00 15.02 ? 209 GLU B C     1 
ATOM   3941 O O     . GLU F 2 208 ? 3.188   -11.590 -0.939  1.00 14.49 ? 209 GLU B O     1 
ATOM   3942 C CB    . GLU F 2 208 ? 0.375   -12.426 0.244   1.00 20.37 ? 209 GLU B CB    1 
ATOM   3943 C CG    . GLU F 2 208 ? 1.409   -12.211 1.331   1.00 21.09 ? 209 GLU B CG    1 
ATOM   3944 C CD    . GLU F 2 208 ? 0.822   -12.434 2.674   1.00 23.22 ? 209 GLU B CD    1 
ATOM   3945 O OE1   . GLU F 2 208 ? -0.185  -13.118 2.861   1.00 22.69 ? 209 GLU B OE1   1 
ATOM   3946 O OE2   . GLU F 2 208 ? 1.518   -11.829 3.613   1.00 24.97 ? 209 GLU B OE2   1 
ATOM   3947 N N     . ASP F 2 209 ? 2.354   -13.317 -2.109  1.00 14.37 ? 210 ASP B N     1 
ATOM   3948 C CA    . ASP F 2 209 ? 3.669   -13.803 -2.481  1.00 17.72 ? 210 ASP B CA    1 
ATOM   3949 C C     . ASP F 2 209 ? 4.447   -12.776 -3.291  1.00 18.59 ? 210 ASP B C     1 
ATOM   3950 O O     . ASP F 2 209 ? 5.683   -12.680 -3.221  1.00 20.72 ? 210 ASP B O     1 
ATOM   3951 C CB    . ASP F 2 209 ? 3.611   -15.124 -3.208  1.00 19.62 ? 210 ASP B CB    1 
ATOM   3952 C CG    . ASP F 2 209 ? 2.944   -16.127 -2.353  1.00 22.74 ? 210 ASP B CG    1 
ATOM   3953 O OD1   . ASP F 2 209 ? 1.770   -16.437 -2.501  1.00 25.59 ? 210 ASP B OD1   1 
ATOM   3954 O OD2   . ASP F 2 209 ? 3.746   -16.620 -1.427  1.00 22.18 ? 210 ASP B OD2   1 
ATOM   3955 N N     . GLU F 2 210 ? 3.722   -11.996 -4.063  1.00 15.73 ? 211 GLU B N     1 
ATOM   3956 C CA    . GLU F 2 210 ? 4.357   -11.009 -4.847  1.00 14.82 ? 211 GLU B CA    1 
ATOM   3957 C C     . GLU F 2 210 ? 4.862   -9.926  -3.941  1.00 14.12 ? 211 GLU B C     1 
ATOM   3958 O O     . GLU F 2 210 ? 6.012   -9.536  -4.018  1.00 15.24 ? 211 GLU B O     1 
ATOM   3959 C CB    . GLU F 2 210 ? 3.434   -10.451 -5.940  1.00 16.11 ? 211 GLU B CB    1 
ATOM   3960 C CG    . GLU F 2 210 ? 4.219   -9.894  -7.148  1.00 15.48 ? 211 GLU B CG    1 
ATOM   3961 C CD    . GLU F 2 210 ? 3.341   -9.130  -8.100  1.00 15.33 ? 211 GLU B CD    1 
ATOM   3962 O OE1   . GLU F 2 210 ? 2.342   -8.485  -7.759  1.00 14.73 ? 211 GLU B OE1   1 
ATOM   3963 O OE2   . GLU F 2 210 ? 3.775   -9.234  -9.328  1.00 15.48 ? 211 GLU B OE2   1 
ATOM   3964 N N     . PHE F 2 211 ? 3.988   -9.433  -3.079  1.00 13.08 ? 212 PHE B N     1 
ATOM   3965 C CA    . PHE F 2 211 ? 4.367   -8.382  -2.160  1.00 12.93 ? 212 PHE B CA    1 
ATOM   3966 C C     . PHE F 2 211 ? 5.615   -8.732  -1.395  1.00 13.38 ? 212 PHE B C     1 
ATOM   3967 O O     . PHE F 2 211 ? 6.540   -7.944  -1.344  1.00 13.62 ? 212 PHE B O     1 
ATOM   3968 C CB    . PHE F 2 211 ? 3.246   -8.032  -1.189  1.00 12.97 ? 212 PHE B CB    1 
ATOM   3969 C CG    . PHE F 2 211 ? 3.760   -7.466  0.109   1.00 12.79 ? 212 PHE B CG    1 
ATOM   3970 C CD1   . PHE F 2 211 ? 3.929   -8.278  1.228   1.00 12.49 ? 212 PHE B CD1   1 
ATOM   3971 C CD2   . PHE F 2 211 ? 4.081   -6.113  0.219   1.00 12.46 ? 212 PHE B CD2   1 
ATOM   3972 C CE1   . PHE F 2 211 ? 4.398   -7.769  2.436   1.00 11.37 ? 212 PHE B CE1   1 
ATOM   3973 C CE2   . PHE F 2 211 ? 4.553   -5.572  1.414   1.00 11.73 ? 212 PHE B CE2   1 
ATOM   3974 C CZ    . PHE F 2 211 ? 4.719   -6.408  2.520   1.00 11.35 ? 212 PHE B CZ    1 
ATOM   3975 N N     . LEU F 2 212 ? 5.606   -9.926  -0.804  1.00 13.53 ? 213 LEU B N     1 
ATOM   3976 C CA    . LEU F 2 212 ? 6.716   -10.436 -0.013  1.00 13.22 ? 213 LEU B CA    1 
ATOM   3977 C C     . LEU F 2 212 ? 7.994   -10.563 -0.823  1.00 14.06 ? 213 LEU B C     1 
ATOM   3978 O O     . LEU F 2 212 ? 9.091   -10.252 -0.347  1.00 13.70 ? 213 LEU B O     1 
ATOM   3979 C CB    . LEU F 2 212 ? 6.377   -11.821 0.585   1.00 12.16 ? 213 LEU B CB    1 
ATOM   3980 C CG    . LEU F 2 212 ? 5.788   -11.821 1.986   1.00 9.19  ? 213 LEU B CG    1 
ATOM   3981 C CD1   . LEU F 2 212 ? 5.565   -13.261 2.372   1.00 8.80  ? 213 LEU B CD1   1 
ATOM   3982 C CD2   . LEU F 2 212 ? 6.741   -11.184 2.989   1.00 7.31  ? 213 LEU B CD2   1 
ATOM   3983 N N     . ASP F 2 213 ? 7.867   -11.048 -2.051  1.00 15.84 ? 214 ASP B N     1 
ATOM   3984 C CA    . ASP F 2 213 ? 9.035   -11.232 -2.912  1.00 16.94 ? 214 ASP B CA    1 
ATOM   3985 C C     . ASP F 2 213 ? 9.641   -9.910  -3.349  1.00 16.99 ? 214 ASP B C     1 
ATOM   3986 O O     . ASP F 2 213 ? 10.844  -9.735  -3.420  1.00 15.17 ? 214 ASP B O     1 
ATOM   3987 C CB    . ASP F 2 213 ? 8.786   -12.163 -4.095  1.00 17.28 ? 214 ASP B CB    1 
ATOM   3988 C CG    . ASP F 2 213 ? 10.056  -12.465 -4.821  1.00 19.22 ? 214 ASP B CG    1 
ATOM   3989 O OD1   . ASP F 2 213 ? 11.055  -12.919 -4.288  1.00 18.63 ? 214 ASP B OD1   1 
ATOM   3990 O OD2   . ASP F 2 213 ? 9.966   -12.163 -6.088  1.00 21.70 ? 214 ASP B OD2   1 
ATOM   3991 N N     . TYR F 2 214 ? 8.767   -8.979  -3.626  1.00 19.17 ? 215 TYR B N     1 
ATOM   3992 C CA    . TYR F 2 214 ? 9.168   -7.658  -4.037  1.00 20.22 ? 215 TYR B CA    1 
ATOM   3993 C C     . TYR F 2 214 ? 10.028  -6.981  -2.964  1.00 20.60 ? 215 TYR B C     1 
ATOM   3994 O O     . TYR F 2 214 ? 11.130  -6.495  -3.227  1.00 23.34 ? 215 TYR B O     1 
ATOM   3995 C CB    . TYR F 2 214 ? 7.928   -6.798  -4.352  1.00 20.37 ? 215 TYR B CB    1 
ATOM   3996 C CG    . TYR F 2 214 ? 8.304   -5.421  -4.802  1.00 21.32 ? 215 TYR B CG    1 
ATOM   3997 C CD1   . TYR F 2 214 ? 8.726   -4.466  -3.889  1.00 22.47 ? 215 TYR B CD1   1 
ATOM   3998 C CD2   . TYR F 2 214 ? 8.270   -5.071  -6.152  1.00 22.60 ? 215 TYR B CD2   1 
ATOM   3999 C CE1   . TYR F 2 214 ? 9.097   -3.184  -4.320  1.00 23.25 ? 215 TYR B CE1   1 
ATOM   4000 C CE2   . TYR F 2 214 ? 8.638   -3.805  -6.596  1.00 21.96 ? 215 TYR B CE2   1 
ATOM   4001 C CZ    . TYR F 2 214 ? 9.049   -2.858  -5.670  1.00 21.49 ? 215 TYR B CZ    1 
ATOM   4002 O OH    . TYR F 2 214 ? 9.413   -1.616  -6.069  1.00 20.95 ? 215 TYR B OH    1 
ATOM   4003 N N     . TRP F 2 215 ? 9.516   -6.949  -1.755  1.00 17.32 ? 216 TRP B N     1 
ATOM   4004 C CA    . TRP F 2 215 ? 10.191  -6.320  -0.656  1.00 14.99 ? 216 TRP B CA    1 
ATOM   4005 C C     . TRP F 2 215 ? 11.348  -7.076  -0.071  1.00 14.48 ? 216 TRP B C     1 
ATOM   4006 O O     . TRP F 2 215 ? 12.308  -6.479  0.431   1.00 15.52 ? 216 TRP B O     1 
ATOM   4007 C CB    . TRP F 2 215 ? 9.228   -5.755  0.366   1.00 13.10 ? 216 TRP B CB    1 
ATOM   4008 C CG    . TRP F 2 215 ? 8.465   -4.585  -0.206  1.00 11.26 ? 216 TRP B CG    1 
ATOM   4009 C CD1   . TRP F 2 215 ? 7.214   -4.609  -0.720  1.00 10.28 ? 216 TRP B CD1   1 
ATOM   4010 C CD2   . TRP F 2 215 ? 8.911   -3.224  -0.341  1.00 9.01  ? 216 TRP B CD2   1 
ATOM   4011 N NE1   . TRP F 2 215 ? 6.855   -3.367  -1.157  1.00 9.23  ? 216 TRP B NE1   1 
ATOM   4012 C CE2   . TRP F 2 215 ? 7.872   -2.507  -0.932  1.00 8.23  ? 216 TRP B CE2   1 
ATOM   4013 C CE3   . TRP F 2 215 ? 10.087  -2.563  -0.013  1.00 8.13  ? 216 TRP B CE3   1 
ATOM   4014 C CZ2   . TRP F 2 215 ? 7.978   -1.154  -1.183  1.00 7.44  ? 216 TRP B CZ2   1 
ATOM   4015 C CZ3   . TRP F 2 215 ? 10.192  -1.218  -0.264  1.00 7.64  ? 216 TRP B CZ3   1 
ATOM   4016 C CH2   . TRP F 2 215 ? 9.150   -0.525  -0.842  1.00 7.51  ? 216 TRP B CH2   1 
ATOM   4017 N N     . ARG F 2 216 ? 11.289  -8.390  -0.135  1.00 13.87 ? 217 ARG B N     1 
ATOM   4018 C CA    . ARG F 2 216 ? 12.372  -9.186  0.392   1.00 15.86 ? 217 ARG B CA    1 
ATOM   4019 C C     . ARG F 2 216 ? 13.668  -8.987  -0.405  1.00 20.68 ? 217 ARG B C     1 
ATOM   4020 O O     . ARG F 2 216 ? 14.753  -9.098  0.141   1.00 22.46 ? 217 ARG B O     1 
ATOM   4021 C CB    . ARG F 2 216 ? 12.025  -10.650 0.386   1.00 16.08 ? 217 ARG B CB    1 
ATOM   4022 C CG    . ARG F 2 216 ? 11.080  -11.025 1.498   1.00 18.04 ? 217 ARG B CG    1 
ATOM   4023 C CD    . ARG F 2 216 ? 10.892  -12.529 1.639   1.00 19.97 ? 217 ARG B CD    1 
ATOM   4024 N NE    . ARG F 2 216 ? 10.430  -12.847 2.976   1.00 22.54 ? 217 ARG B NE    1 
ATOM   4025 C CZ    . ARG F 2 216 ? 9.499   -13.731 3.240   1.00 24.68 ? 217 ARG B CZ    1 
ATOM   4026 N NH1   . ARG F 2 216 ? 8.895   -14.431 2.289   1.00 26.44 ? 217 ARG B NH1   1 
ATOM   4027 N NH2   . ARG F 2 216 ? 9.158   -13.914 4.506   1.00 25.05 ? 217 ARG B NH2   1 
ATOM   4028 N N     . ASN F 2 217 ? 13.526  -8.692  -1.710  1.00 23.24 ? 218 ASN B N     1 
ATOM   4029 C CA    . ASN F 2 217 ? 14.618  -8.493  -2.649  1.00 23.91 ? 218 ASN B CA    1 
ATOM   4030 C C     . ASN F 2 217 ? 15.002  -7.029  -2.970  1.00 26.88 ? 218 ASN B C     1 
ATOM   4031 O O     . ASN F 2 217 ? 16.004  -6.774  -3.639  1.00 30.37 ? 218 ASN B O     1 
ATOM   4032 C CB    . ASN F 2 217 ? 14.287  -9.226  -3.966  1.00 23.95 ? 218 ASN B CB    1 
ATOM   4033 C CG    . ASN F 2 217 ? 14.152  -10.746 -3.812  1.00 27.38 ? 218 ASN B CG    1 
ATOM   4034 O OD1   . ASN F 2 217 ? 15.125  -11.486 -3.921  1.00 29.93 ? 218 ASN B OD1   1 
ATOM   4035 N ND2   . ASN F 2 217 ? 12.939  -11.224 -3.574  1.00 28.04 ? 218 ASN B ND2   1 
ATOM   4036 N N     . TYR F 2 218 ? 14.220  -6.073  -2.514  1.00 25.15 ? 219 TYR B N     1 
ATOM   4037 C CA    . TYR F 2 218 ? 14.463  -4.641  -2.764  1.00 24.70 ? 219 TYR B CA    1 
ATOM   4038 C C     . TYR F 2 218 ? 15.739  -4.099  -2.109  1.00 30.96 ? 219 TYR B C     1 
ATOM   4039 O O     . TYR F 2 218 ? 15.911  -4.251  -0.894  1.00 32.88 ? 219 TYR B O     1 
ATOM   4040 C CB    . TYR F 2 218 ? 13.232  -3.940  -2.218  1.00 20.43 ? 219 TYR B CB    1 
ATOM   4041 C CG    . TYR F 2 218 ? 13.118  -2.468  -2.411  1.00 18.67 ? 219 TYR B CG    1 
ATOM   4042 C CD1   . TYR F 2 218 ? 14.003  -1.576  -1.806  1.00 19.53 ? 219 TYR B CD1   1 
ATOM   4043 C CD2   . TYR F 2 218 ? 12.055  -1.966  -3.150  1.00 18.22 ? 219 TYR B CD2   1 
ATOM   4044 C CE1   . TYR F 2 218 ? 13.847  -0.191  -1.974  1.00 19.85 ? 219 TYR B CE1   1 
ATOM   4045 C CE2   . TYR F 2 218 ? 11.883  -0.597  -3.330  1.00 19.16 ? 219 TYR B CE2   1 
ATOM   4046 C CZ    . TYR F 2 218 ? 12.785  0.287   -2.739  1.00 20.20 ? 219 TYR B CZ    1 
ATOM   4047 O OH    . TYR F 2 218 ? 12.604  1.632   -2.912  1.00 21.15 ? 219 TYR B OH    1 
ATOM   4048 N N     . GLU F 2 219 ? 16.650  -3.471  -2.906  1.00 34.44 ? 220 GLU B N     1 
ATOM   4049 C CA    . GLU F 2 219 ? 17.925  -2.913  -2.353  1.00 35.89 ? 220 GLU B CA    1 
ATOM   4050 C C     . GLU F 2 219 ? 17.770  -1.489  -1.884  1.00 38.48 ? 220 GLU B C     1 
ATOM   4051 O O     . GLU F 2 219 ? 17.063  -0.708  -2.514  1.00 37.42 ? 220 GLU B O     1 
ATOM   4052 C CB    . GLU F 2 219 ? 19.185  -2.993  -3.279  1.00 34.12 ? 220 GLU B CB    1 
ATOM   4053 C CG    . GLU F 2 219 ? 19.206  -4.131  -4.314  1.00 34.95 ? 220 GLU B CG    1 
ATOM   4054 C CD    . GLU F 2 219 ? 20.212  -5.214  -3.992  1.00 36.95 ? 220 GLU B CD    1 
ATOM   4055 O OE1   . GLU F 2 219 ? 20.122  -6.360  -4.410  1.00 36.76 ? 220 GLU B OE1   1 
ATOM   4056 O OE2   . GLU F 2 219 ? 21.181  -4.792  -3.208  1.00 38.69 ? 220 GLU B OE2   1 
ATOM   4057 N N     . TYR F 2 229 ? 15.601  -2.842  -10.054 1.00 32.16 ? 230 TYR B N     1 
ATOM   4058 C CA    . TYR F 2 229 ? 14.189  -2.484  -10.073 1.00 30.14 ? 230 TYR B CA    1 
ATOM   4059 C C     . TYR F 2 229 ? 13.839  -1.512  -8.987  1.00 27.44 ? 230 TYR B C     1 
ATOM   4060 O O     . TYR F 2 229 ? 14.416  -1.536  -7.907  1.00 27.23 ? 230 TYR B O     1 
ATOM   4061 C CB    . TYR F 2 229 ? 13.185  -3.670  -10.086 1.00 29.74 ? 230 TYR B CB    1 
ATOM   4062 C CG    . TYR F 2 229 ? 13.003  -4.458  -8.775  1.00 28.51 ? 230 TYR B CG    1 
ATOM   4063 C CD1   . TYR F 2 229 ? 13.619  -5.707  -8.614  1.00 26.57 ? 230 TYR B CD1   1 
ATOM   4064 C CD2   . TYR F 2 229 ? 12.194  -3.980  -7.740  1.00 27.72 ? 230 TYR B CD2   1 
ATOM   4065 C CE1   . TYR F 2 229 ? 13.433  -6.448  -7.444  1.00 25.35 ? 230 TYR B CE1   1 
ATOM   4066 C CE2   . TYR F 2 229 ? 12.000  -4.712  -6.563  1.00 26.18 ? 230 TYR B CE2   1 
ATOM   4067 C CZ    . TYR F 2 229 ? 12.629  -5.946  -6.429  1.00 25.91 ? 230 TYR B CZ    1 
ATOM   4068 O OH    . TYR F 2 229 ? 12.470  -6.678  -5.284  1.00 27.14 ? 230 TYR B OH    1 
ATOM   4069 N N     . ASN F 2 230 ? 12.891  -0.653  -9.296  1.00 25.68 ? 231 ASN B N     1 
ATOM   4070 C CA    . ASN F 2 230 ? 12.424  0.326   -8.363  1.00 25.31 ? 231 ASN B CA    1 
ATOM   4071 C C     . ASN F 2 230 ? 10.977  0.629   -8.621  1.00 24.78 ? 231 ASN B C     1 
ATOM   4072 O O     . ASN F 2 230 ? 10.497  1.719   -8.434  1.00 26.30 ? 231 ASN B O     1 
ATOM   4073 C CB    . ASN F 2 230 ? 13.285  1.576   -8.248  1.00 27.92 ? 231 ASN B CB    1 
ATOM   4074 C CG    . ASN F 2 230 ? 14.221  1.743   -9.431  1.00 32.62 ? 231 ASN B CG    1 
ATOM   4075 O OD1   . ASN F 2 230 ? 13.774  1.688   -10.588 1.00 35.14 ? 231 ASN B OD1   1 
ATOM   4076 N ND2   . ASN F 2 230 ? 15.519  1.950   -9.154  1.00 32.78 ? 231 ASN B ND2   1 
ATOM   4077 N N     . ASN F 2 231 ? 10.275  -0.382  -9.058  1.00 23.99 ? 232 ASN B N     1 
ATOM   4078 C CA    . ASN F 2 231 ? 8.875   -0.255  -9.315  1.00 25.33 ? 232 ASN B CA    1 
ATOM   4079 C C     . ASN F 2 231 ? 8.281   -1.600  -9.611  1.00 24.82 ? 232 ASN B C     1 
ATOM   4080 O O     . ASN F 2 231 ? 9.014   -2.507  -10.009 1.00 25.22 ? 232 ASN B O     1 
ATOM   4081 C CB    . ASN F 2 231 ? 8.517   0.836   -10.311 1.00 28.34 ? 232 ASN B CB    1 
ATOM   4082 C CG    . ASN F 2 231 ? 8.857   0.478   -11.732 1.00 31.96 ? 232 ASN B CG    1 
ATOM   4083 O OD1   . ASN F 2 231 ? 8.483   -0.621  -12.221 1.00 32.72 ? 232 ASN B OD1   1 
ATOM   4084 N ND2   . ASN F 2 231 ? 9.536   1.409   -12.401 1.00 33.31 ? 232 ASN B ND2   1 
ATOM   4085 N N     . ILE F 2 232 ? 6.967   -1.735  -9.379  1.00 22.84 ? 233 ILE B N     1 
ATOM   4086 C CA    . ILE F 2 232 ? 6.318   -3.017  -9.623  1.00 20.00 ? 233 ILE B CA    1 
ATOM   4087 C C     . ILE F 2 232 ? 6.627   -3.526  -11.006 1.00 22.06 ? 233 ILE B C     1 
ATOM   4088 O O     . ILE F 2 232 ? 6.964   -4.688  -11.166 1.00 22.06 ? 233 ILE B O     1 
ATOM   4089 C CB    . ILE F 2 232 ? 4.834   -3.025  -9.341  1.00 14.98 ? 233 ILE B CB    1 
ATOM   4090 C CG1   . ILE F 2 232 ? 4.318   -4.442  -9.360  1.00 12.02 ? 233 ILE B CG1   1 
ATOM   4091 C CG2   . ILE F 2 232 ? 4.096   -2.197  -10.356 1.00 14.92 ? 233 ILE B CG2   1 
ATOM   4092 C CD1   . ILE F 2 232 ? 4.503   -5.094  -8.010  1.00 11.72 ? 233 ILE B CD1   1 
ATOM   4093 N N     . SER F 2 233 ? 6.529   -2.595  -11.976 1.00 24.00 ? 234 SER B N     1 
ATOM   4094 C CA    . SER F 2 233 ? 6.777   -2.842  -13.384 1.00 25.18 ? 234 SER B CA    1 
ATOM   4095 C C     . SER F 2 233 ? 8.075   -3.566  -13.583 1.00 27.15 ? 234 SER B C     1 
ATOM   4096 O O     . SER F 2 233 ? 8.082   -4.712  -14.059 1.00 29.82 ? 234 SER B O     1 
ATOM   4097 C CB    . SER F 2 233 ? 6.765   -1.560  -14.213 1.00 25.74 ? 234 SER B CB    1 
ATOM   4098 O OG    . SER F 2 233 ? 5.862   -0.613  -13.661 1.00 26.57 ? 234 SER B OG    1 
ATOM   4099 N N     . GLU F 2 234 ? 9.174   -2.889  -13.223 1.00 25.92 ? 235 GLU B N     1 
ATOM   4100 C CA    . GLU F 2 234 ? 10.524  -3.447  -13.358 1.00 25.29 ? 235 GLU B CA    1 
ATOM   4101 C C     . GLU F 2 234 ? 10.759  -4.736  -12.574 1.00 21.98 ? 235 GLU B C     1 
ATOM   4102 O O     . GLU F 2 234 ? 11.499  -5.612  -12.998 1.00 19.76 ? 235 GLU B O     1 
ATOM   4103 C CB    . GLU F 2 234 ? 11.588  -2.404  -13.076 1.00 28.70 ? 235 GLU B CB    1 
ATOM   4104 C CG    . GLU F 2 234 ? 11.289  -1.098  -13.802 1.00 33.10 ? 235 GLU B CG    1 
ATOM   4105 C CD    . GLU F 2 234 ? 12.163  0.008   -13.313 1.00 38.79 ? 235 GLU B CD    1 
ATOM   4106 O OE1   . GLU F 2 234 ? 13.102  -0.183  -12.548 1.00 40.24 ? 235 GLU B OE1   1 
ATOM   4107 O OE2   . GLU F 2 234 ? 11.814  1.178   -13.789 1.00 41.63 ? 235 GLU B OE2   1 
ATOM   4108 N N     . TYR F 2 235 ? 10.133  -4.856  -11.423 1.00 21.84 ? 236 TYR B N     1 
ATOM   4109 C CA    . TYR F 2 235 ? 10.302  -6.058  -10.646 1.00 20.01 ? 236 TYR B CA    1 
ATOM   4110 C C     . TYR F 2 235 ? 9.683   -7.204  -11.404 1.00 22.32 ? 236 TYR B C     1 
ATOM   4111 O O     . TYR F 2 235 ? 10.229  -8.310  -11.475 1.00 24.54 ? 236 TYR B O     1 
ATOM   4112 C CB    . TYR F 2 235 ? 9.695   -5.986  -9.225  1.00 13.64 ? 236 TYR B CB    1 
ATOM   4113 C CG    . TYR F 2 235 ? 9.236   -7.331  -8.749  1.00 8.00  ? 236 TYR B CG    1 
ATOM   4114 C CD1   . TYR F 2 235 ? 7.909   -7.721  -8.916  1.00 6.45  ? 236 TYR B CD1   1 
ATOM   4115 C CD2   . TYR F 2 235 ? 10.128  -8.215  -8.145  1.00 6.84  ? 236 TYR B CD2   1 
ATOM   4116 C CE1   . TYR F 2 235 ? 7.454   -8.963  -8.479  1.00 6.41  ? 236 TYR B CE1   1 
ATOM   4117 C CE2   . TYR F 2 235 ? 9.700   -9.480  -7.708  1.00 6.48  ? 236 TYR B CE2   1 
ATOM   4118 C CZ    . TYR F 2 235 ? 8.361   -9.839  -7.881  1.00 8.27  ? 236 TYR B CZ    1 
ATOM   4119 O OH    . TYR F 2 235 ? 7.931   -11.056 -7.463  1.00 11.34 ? 236 TYR B OH    1 
ATOM   4120 N N     . ARG F 2 236 ? 8.524   -6.909  -11.983 1.00 20.68 ? 237 ARG B N     1 
ATOM   4121 C CA    . ARG F 2 236 ? 7.799   -7.864  -12.754 1.00 19.53 ? 237 ARG B CA    1 
ATOM   4122 C C     . ARG F 2 236 ? 8.583   -8.318  -13.931 1.00 21.23 ? 237 ARG B C     1 
ATOM   4123 O O     . ARG F 2 236 ? 8.535   -9.488  -14.303 1.00 24.34 ? 237 ARG B O     1 
ATOM   4124 C CB    . ARG F 2 236 ? 6.444   -7.363  -13.185 1.00 18.55 ? 237 ARG B CB    1 
ATOM   4125 C CG    . ARG F 2 236 ? 5.488   -7.299  -12.028 1.00 18.97 ? 237 ARG B CG    1 
ATOM   4126 C CD    . ARG F 2 236 ? 4.041   -7.076  -12.420 1.00 19.28 ? 237 ARG B CD    1 
ATOM   4127 N NE    . ARG F 2 236 ? 3.175   -7.220  -11.269 1.00 19.62 ? 237 ARG B NE    1 
ATOM   4128 C CZ    . ARG F 2 236 ? 2.111   -6.495  -11.051 1.00 20.54 ? 237 ARG B CZ    1 
ATOM   4129 N NH1   . ARG F 2 236 ? 1.742   -5.548  -11.899 1.00 19.62 ? 237 ARG B NH1   1 
ATOM   4130 N NH2   . ARG F 2 236 ? 1.402   -6.718  -9.951  1.00 22.11 ? 237 ARG B NH2   1 
ATOM   4131 N N     . ASN F 2 237 ? 9.309   -7.403  -14.541 1.00 20.32 ? 238 ASN B N     1 
ATOM   4132 C CA    . ASN F 2 237 ? 10.066  -7.857  -15.666 1.00 23.52 ? 238 ASN B CA    1 
ATOM   4133 C C     . ASN F 2 237 ? 11.355  -8.485  -15.223 1.00 24.79 ? 238 ASN B C     1 
ATOM   4134 O O     . ASN F 2 237 ? 11.745  -9.528  -15.724 1.00 26.47 ? 238 ASN B O     1 
ATOM   4135 C CB    . ASN F 2 237 ? 10.168  -6.877  -16.856 1.00 27.58 ? 238 ASN B CB    1 
ATOM   4136 C CG    . ASN F 2 237 ? 8.945   -6.965  -17.794 1.00 30.62 ? 238 ASN B CG    1 
ATOM   4137 O OD1   . ASN F 2 237 ? 8.273   -5.946  -18.083 1.00 31.45 ? 238 ASN B OD1   1 
ATOM   4138 N ND2   . ASN F 2 237 ? 8.655   -8.183  -18.263 1.00 30.73 ? 238 ASN B ND2   1 
ATOM   4139 N N     . TRP F 2 238 ? 11.988  -7.857  -14.226 1.00 25.48 ? 239 TRP B N     1 
ATOM   4140 C CA    . TRP F 2 238 ? 13.252  -8.326  -13.628 1.00 24.33 ? 239 TRP B CA    1 
ATOM   4141 C C     . TRP F 2 238 ? 13.201  -9.799  -13.301 1.00 25.41 ? 239 TRP B C     1 
ATOM   4142 O O     . TRP F 2 238 ? 14.188  -10.523 -13.384 1.00 25.40 ? 239 TRP B O     1 
ATOM   4143 C CB    . TRP F 2 238 ? 13.606  -7.506  -12.375 1.00 21.20 ? 239 TRP B CB    1 
ATOM   4144 C CG    . TRP F 2 238 ? 14.613  -8.151  -11.475 1.00 19.66 ? 239 TRP B CG    1 
ATOM   4145 C CD1   . TRP F 2 238 ? 15.965  -8.008  -11.539 1.00 19.06 ? 239 TRP B CD1   1 
ATOM   4146 C CD2   . TRP F 2 238 ? 14.356  -9.003  -10.350 1.00 18.41 ? 239 TRP B CD2   1 
ATOM   4147 N NE1   . TRP F 2 238 ? 16.576  -8.716  -10.536 1.00 18.41 ? 239 TRP B NE1   1 
ATOM   4148 C CE2   . TRP F 2 238 ? 15.614  -9.329  -9.784  1.00 17.86 ? 239 TRP B CE2   1 
ATOM   4149 C CE3   . TRP F 2 238 ? 13.191  -9.504  -9.765  1.00 17.52 ? 239 TRP B CE3   1 
ATOM   4150 C CZ2   . TRP F 2 238 ? 15.722  -10.157 -8.666  1.00 17.16 ? 239 TRP B CZ2   1 
ATOM   4151 C CZ3   . TRP F 2 238 ? 13.306  -10.316 -8.646  1.00 17.85 ? 239 TRP B CZ3   1 
ATOM   4152 C CH2   . TRP F 2 238 ? 14.558  -10.650 -8.113  1.00 17.33 ? 239 TRP B CH2   1 
ATOM   4153 N N     . ILE F 2 239 ? 12.019  -10.221 -12.915 1.00 25.93 ? 240 ILE B N     1 
ATOM   4154 C CA    . ILE F 2 239 ? 11.785  -11.574 -12.593 1.00 26.85 ? 240 ILE B CA    1 
ATOM   4155 C C     . ILE F 2 239 ? 12.328  -12.521 -13.661 1.00 28.39 ? 240 ILE B C     1 
ATOM   4156 O O     . ILE F 2 239 ? 12.596  -13.683 -13.371 1.00 29.55 ? 240 ILE B O     1 
ATOM   4157 C CB    . ILE F 2 239 ? 10.335  -11.789 -12.285 1.00 28.37 ? 240 ILE B CB    1 
ATOM   4158 C CG1   . ILE F 2 239 ? 10.143  -11.550 -10.800 1.00 28.66 ? 240 ILE B CG1   1 
ATOM   4159 C CG2   . ILE F 2 239 ? 9.911   -13.206 -12.658 1.00 29.95 ? 240 ILE B CG2   1 
ATOM   4160 C CD1   . ILE F 2 239 ? 11.230  -12.179 -9.945  1.00 28.30 ? 240 ILE B CD1   1 
ATOM   4161 N N     . TYR F 2 240 ? 12.517  -12.012 -14.895 1.00 28.41 ? 241 TYR B N     1 
ATOM   4162 C CA    . TYR F 2 240 ? 13.079  -12.808 -16.007 1.00 29.42 ? 241 TYR B CA    1 
ATOM   4163 C C     . TYR F 2 240 ? 13.577  -12.004 -17.190 1.00 27.47 ? 241 TYR B C     1 
ATOM   4164 O O     . TYR F 2 240 ? 14.788  -11.709 -17.267 1.00 23.90 ? 241 TYR B O     1 
ATOM   4165 C CB    . TYR F 2 240 ? 12.281  -14.033 -16.470 1.00 32.56 ? 241 TYR B CB    1 
ATOM   4166 C CG    . TYR F 2 240 ? 10.820  -13.795 -16.676 1.00 36.54 ? 241 TYR B CG    1 
ATOM   4167 C CD1   . TYR F 2 240 ? 9.927   -14.861 -16.534 1.00 38.16 ? 241 TYR B CD1   1 
ATOM   4168 C CD2   . TYR F 2 240 ? 10.321  -12.537 -16.997 1.00 39.40 ? 241 TYR B CD2   1 
ATOM   4169 C CE1   . TYR F 2 240 ? 8.554   -14.686 -16.708 1.00 39.83 ? 241 TYR B CE1   1 
ATOM   4170 C CE2   . TYR F 2 240 ? 8.946   -12.346 -17.190 1.00 41.88 ? 241 TYR B CE2   1 
ATOM   4171 C CZ    . TYR F 2 240 ? 8.070   -13.429 -17.036 1.00 42.91 ? 241 TYR B CZ    1 
ATOM   4172 O OH    . TYR F 2 240 ? 6.726   -13.261 -17.216 1.00 46.19 ? 241 TYR B OH    1 
HETATM 4173 O O     . HOH G 3 .   ? 13.027  4.919   18.334  1.00 26.26 ? 9   HOH C O     1 
HETATM 4174 O O     . HOH G 3 .   ? 20.823  6.766   19.498  1.00 50.72 ? 10  HOH C O     1 
HETATM 4175 O O     . HOH G 3 .   ? 17.652  -4.330  26.408  1.00 47.74 ? 11  HOH C O     1 
HETATM 4176 O O     . HOH G 3 .   ? 25.529  -12.640 14.811  1.00 37.27 ? 12  HOH C O     1 
HETATM 4177 O O     . HOH G 3 .   ? 20.291  0.271   25.052  1.00 47.20 ? 13  HOH C O     1 
HETATM 4178 O O     . HOH G 3 .   ? 10.934  -1.003  25.765  1.00 49.73 ? 14  HOH C O     1 
HETATM 4179 O O     . HOH G 3 .   ? 19.118  5.835   9.829   1.00 43.23 ? 15  HOH C O     1 
HETATM 4180 O O     . HOH H 3 .   ? 21.178  4.195   11.160  1.00 53.18 ? 18  HOH D O     1 
HETATM 4181 O O     . HOH H 3 .   ? 21.837  7.490   11.841  1.00 26.34 ? 27  HOH D O     1 
HETATM 4182 O O     . HOH H 3 .   ? 31.913  -0.764  32.502  1.00 52.01 ? 43  HOH D O     1 
HETATM 4183 O O     . HOH H 3 .   ? 23.755  -3.017  27.154  1.00 52.35 ? 50  HOH D O     1 
HETATM 4184 O O     . HOH I 3 .   ? 11.693  28.847  6.994   1.00 58.73 ? 11  HOH E O     1 
HETATM 4185 O O     . HOH I 3 .   ? 8.260   7.992   14.014  1.00 46.04 ? 38  HOH E O     1 
HETATM 4186 O O     . HOH I 3 .   ? 6.075   20.075  6.017   1.00 43.02 ? 55  HOH E O     1 
HETATM 4187 O O     . HOH I 3 .   ? 11.050  15.538  11.121  1.00 43.23 ? 60  HOH E O     1 
HETATM 4188 O O     . HOH I 3 .   ? 14.436  18.817  -5.786  1.00 43.23 ? 61  HOH E O     1 
HETATM 4189 O O     . HOH I 3 .   ? 9.890   14.105  2.919   1.00 43.23 ? 65  HOH E O     1 
HETATM 4190 O O     . HOH J 3 .   ? 19.051  10.030  1.716   1.00 50.95 ? 36  HOH F O     1 
HETATM 4191 O O     . HOH K 3 .   ? 26.543  31.880  14.066  1.00 28.32 ? 246 HOH A O     1 
HETATM 4192 O O     . HOH K 3 .   ? 8.660   29.858  12.362  1.00 32.74 ? 247 HOH A O     1 
HETATM 4193 O O     . HOH K 3 .   ? 22.031  16.525  9.611   1.00 30.38 ? 248 HOH A O     1 
HETATM 4194 O O     . HOH K 3 .   ? 13.116  20.624  21.992  1.00 36.90 ? 249 HOH A O     1 
HETATM 4195 O O     . HOH K 3 .   ? 40.066  11.391  10.781  1.00 48.64 ? 250 HOH A O     1 
HETATM 4196 O O     . HOH K 3 .   ? 24.937  33.639  20.436  1.00 50.44 ? 251 HOH A O     1 
HETATM 4197 O O     . HOH K 3 .   ? 18.888  25.361  37.575  1.00 27.46 ? 252 HOH A O     1 
HETATM 4198 O O     . HOH K 3 .   ? 2.103   23.936  33.904  1.00 33.93 ? 253 HOH A O     1 
HETATM 4199 O O     . HOH K 3 .   ? -19.481 8.605   20.976  1.00 46.51 ? 254 HOH A O     1 
HETATM 4200 O O     . HOH K 3 .   ? 5.434   28.409  38.847  1.00 53.76 ? 255 HOH A O     1 
HETATM 4201 O O     . HOH K 3 .   ? 25.964  19.335  43.958  1.00 41.08 ? 256 HOH A O     1 
HETATM 4202 O O     . HOH K 3 .   ? 25.487  30.749  22.680  1.00 40.27 ? 257 HOH A O     1 
HETATM 4203 O O     . HOH K 3 .   ? 40.380  25.687  32.078  1.00 50.73 ? 258 HOH A O     1 
HETATM 4204 O O     . HOH K 3 .   ? 17.743  5.906   25.103  1.00 48.44 ? 259 HOH A O     1 
HETATM 4205 O O     . HOH K 3 .   ? 19.424  27.080  24.351  1.00 49.03 ? 260 HOH A O     1 
HETATM 4206 O O     . HOH K 3 .   ? -15.206 6.877   25.952  1.00 46.22 ? 261 HOH A O     1 
HETATM 4207 O O     . HOH K 3 .   ? 11.170  11.813  14.683  1.00 34.56 ? 262 HOH A O     1 
HETATM 4208 O O     . HOH K 3 .   ? 24.041  7.610   31.873  1.00 50.43 ? 263 HOH A O     1 
HETATM 4209 O O     . HOH K 3 .   ? 36.962  18.380  14.303  1.00 42.93 ? 264 HOH A O     1 
HETATM 4210 O O     . HOH K 3 .   ? 33.679  26.021  10.073  1.00 42.05 ? 265 HOH A O     1 
HETATM 4211 O O     . HOH K 3 .   ? 22.924  31.617  6.660   1.00 43.23 ? 266 HOH A O     1 
HETATM 4212 O O     . HOH K 3 .   ? 7.680   25.146  20.815  1.00 43.23 ? 267 HOH A O     1 
HETATM 4213 O O     . HOH K 3 .   ? 30.370  17.759  36.244  1.00 43.23 ? 268 HOH A O     1 
HETATM 4214 O O     . HOH L 3 .   ? 5.965   15.052  14.786  1.00 32.80 ? 246 HOH B O     1 
HETATM 4215 O O     . HOH L 3 .   ? 12.591  -13.747 -7.367  1.00 30.08 ? 247 HOH B O     1 
HETATM 4216 O O     . HOH L 3 .   ? -0.602  -3.781  -3.394  1.00 26.05 ? 248 HOH B O     1 
HETATM 4217 O O     . HOH L 3 .   ? 13.949  -2.547  7.804   1.00 26.76 ? 249 HOH B O     1 
HETATM 4218 O O     . HOH L 3 .   ? -9.919  -8.963  26.357  1.00 43.40 ? 250 HOH B O     1 
HETATM 4219 O O     . HOH L 3 .   ? 5.550   -9.170  32.149  1.00 56.64 ? 251 HOH B O     1 
HETATM 4220 O O     . HOH L 3 .   ? 8.918   -20.155 14.651  1.00 37.09 ? 252 HOH B O     1 
HETATM 4221 O O     . HOH L 3 .   ? -13.843 -13.484 28.575  1.00 46.03 ? 253 HOH B O     1 
HETATM 4222 O O     . HOH L 3 .   ? -11.919 -1.512  6.223   1.00 26.82 ? 254 HOH B O     1 
HETATM 4223 O O     . HOH L 3 .   ? 3.379   -14.479 8.653   1.00 26.61 ? 255 HOH B O     1 
HETATM 4224 O O     . HOH L 3 .   ? 15.283  2.611   1.639   1.00 32.17 ? 256 HOH B O     1 
HETATM 4225 O O     . HOH L 3 .   ? 1.546   -1.266  25.013  1.00 39.42 ? 257 HOH B O     1 
HETATM 4226 O O     . HOH L 3 .   ? 15.186  -13.007 -12.844 1.00 29.15 ? 258 HOH B O     1 
HETATM 4227 O O     . HOH L 3 .   ? 6.947   -4.362  7.200   1.00 33.50 ? 259 HOH B O     1 
HETATM 4228 O O     . HOH L 3 .   ? 19.230  -3.112  15.036  1.00 36.03 ? 260 HOH B O     1 
HETATM 4229 O O     . HOH L 3 .   ? -6.826  18.937  23.297  1.00 42.70 ? 261 HOH B O     1 
HETATM 4230 O O     . HOH L 3 .   ? 12.191  1.210   10.073  1.00 36.64 ? 262 HOH B O     1 
HETATM 4231 O O     . HOH L 3 .   ? -14.608 26.730  35.376  1.00 45.97 ? 263 HOH B O     1 
HETATM 4232 O O     . HOH L 3 .   ? -6.750  -17.910 13.969  1.00 51.45 ? 264 HOH B O     1 
HETATM 4233 O O     . HOH L 3 .   ? 4.536   -1.019  10.909  1.00 43.23 ? 265 HOH B O     1 
HETATM 4234 O O     . HOH L 3 .   ? 5.758   -4.760  -16.200 1.00 43.23 ? 266 HOH B O     1 
HETATM 4235 O O     . HOH L 3 .   ? -11.146 -15.848 13.911  1.00 43.23 ? 267 HOH B O     1 
HETATM 4236 O O     . HOH L 3 .   ? 3.446   16.382  10.832  1.00 43.23 ? 268 HOH B O     1 
HETATM 4237 O O     . HOH L 3 .   ? 16.859  -15.196 12.471  1.00 41.72 ? 269 HOH B O     1 
HETATM 4238 O O     . HOH L 3 .   ? -11.460 15.251  19.176  1.00 43.23 ? 270 HOH B O     1 
HETATM 4239 O O     . HOH L 3 .   ? -0.624  -5.039  -11.308 1.00 43.23 ? 271 HOH B O     1 
HETATM 4240 O O     . HOH L 3 .   ? 16.636  2.961   -11.963 1.00 43.23 ? 272 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   C . n 
A 1 2   DG  2   2   2   DG  G   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DG  4   4   4   DG  G   C . n 
A 1 5   DC  5   5   5   DC  C   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DC  7   7   7   DC  C   C . n 
A 1 8   DG  8   8   8   DG  G   C . n 
B 1 1   DC  1   1   1   DC  C   D . n 
B 1 2   DG  2   2   2   DG  G   D . n 
B 1 3   DA  3   3   3   DA  A   D . n 
B 1 4   DG  4   4   4   DG  G   D . n 
B 1 5   DC  5   5   5   DC  C   D . n 
B 1 6   DT  6   6   6   DT  T   D . n 
B 1 7   DC  7   7   7   DC  C   D . n 
B 1 8   DG  8   8   8   DG  G   D . n 
C 1 1   DC  1   1   1   DC  C   E . n 
C 1 2   DG  2   2   2   DG  G   E . n 
C 1 3   DA  3   3   3   DA  A   E . n 
C 1 4   DG  4   4   4   DG  G   E . n 
C 1 5   DC  5   5   5   DC  C   E . n 
C 1 6   DT  6   6   6   DT  T   E . n 
C 1 7   DC  7   7   7   DC  C   E . n 
C 1 8   DG  8   8   8   DG  G   E . n 
D 1 1   DC  1   1   1   DC  C   F . n 
D 1 2   DG  2   2   2   DG  G   F . n 
D 1 3   DA  3   3   3   DA  A   F . n 
D 1 4   DG  4   4   4   DG  G   F . n 
D 1 5   DC  5   5   5   DC  C   F . n 
D 1 6   DT  6   6   6   DT  T   F . n 
D 1 7   DC  7   7   7   DC  C   F . n 
D 1 8   DG  8   8   8   DG  G   F . n 
E 2 1   SER 1   2   2   SER SER A . n 
E 2 2   LEU 2   3   3   LEU LEU A . n 
E 2 3   ARG 3   4   4   ARG ARG A . n 
E 2 4   SER 4   5   5   SER SER A . n 
E 2 5   ASP 5   6   6   ASP ASP A . n 
E 2 6   LEU 6   7   7   LEU LEU A . n 
E 2 7   ILE 7   8   8   ILE ILE A . n 
E 2 8   ASN 8   9   9   ASN ASN A . n 
E 2 9   ALA 9   10  10  ALA ALA A . n 
E 2 10  LEU 10  11  11  LEU LEU A . n 
E 2 11  TYR 11  12  12  TYR TYR A . n 
E 2 12  ASP 12  13  ?   ?   ?   A . n 
E 2 13  GLU 13  14  ?   ?   ?   A . n 
E 2 14  ASN 14  15  ?   ?   ?   A . n 
E 2 15  GLN 15  16  ?   ?   ?   A . n 
E 2 16  LYS 16  17  ?   ?   ?   A . n 
E 2 17  TYR 17  18  18  TYR TYR A . n 
E 2 18  ASP 18  19  19  ASP ASP A . n 
E 2 19  VAL 19  20  20  VAL VAL A . n 
E 2 20  CYS 20  21  21  CYS CYS A . n 
E 2 21  GLY 21  22  22  GLY GLY A . n 
E 2 22  ILE 22  23  23  ILE ILE A . n 
E 2 23  ILE 23  24  24  ILE ILE A . n 
E 2 24  SER 24  25  25  SER SER A . n 
E 2 25  ALA 25  26  26  ALA ALA A . n 
E 2 26  GLU 26  27  27  GLU GLU A . n 
E 2 27  GLY 27  28  28  GLY GLY A . n 
E 2 28  LYS 28  29  29  LYS LYS A . n 
E 2 29  ILE 29  30  30  ILE ILE A . n 
E 2 30  TYR 30  31  31  TYR TYR A . n 
E 2 31  PRO 31  32  32  PRO PRO A . n 
E 2 32  LEU 32  33  33  LEU LEU A . n 
E 2 33  GLY 33  34  34  GLY GLY A . n 
E 2 34  SER 34  35  35  SER SER A . n 
E 2 35  ASP 35  36  36  ASP ASP A . n 
E 2 36  THR 36  37  37  THR THR A . n 
E 2 37  LYS 37  38  38  LYS LYS A . n 
E 2 38  VAL 38  39  39  VAL VAL A . n 
E 2 39  LEU 39  40  40  LEU LEU A . n 
E 2 40  SER 40  41  41  SER SER A . n 
E 2 41  THR 41  42  42  THR THR A . n 
E 2 42  ILE 42  43  43  ILE ILE A . n 
E 2 43  PHE 43  44  44  PHE PHE A . n 
E 2 44  GLU 44  45  45  GLU GLU A . n 
E 2 45  LEU 45  46  46  LEU LEU A . n 
E 2 46  PHE 46  47  47  PHE PHE A . n 
E 2 47  SER 47  48  48  SER SER A . n 
E 2 48  ARG 48  49  49  ARG ARG A . n 
E 2 49  PRO 49  50  50  PRO PRO A . n 
E 2 50  ILE 50  51  51  ILE ILE A . n 
E 2 51  ILE 51  52  52  ILE ILE A . n 
E 2 52  ASN 52  53  53  ASN ASN A . n 
E 2 53  LYS 53  54  54  LYS LYS A . n 
E 2 54  ILE 54  55  55  ILE ILE A . n 
E 2 55  ALA 55  56  56  ALA ALA A . n 
E 2 56  GLU 56  57  57  GLU GLU A . n 
E 2 57  LYS 57  58  58  LYS LYS A . n 
E 2 58  HIS 58  59  59  HIS HIS A . n 
E 2 59  GLY 59  60  60  GLY GLY A . n 
E 2 60  TYR 60  61  61  TYR TYR A . n 
E 2 61  ILE 61  62  62  ILE ILE A . n 
E 2 62  VAL 62  63  63  VAL VAL A . n 
E 2 63  GLU 63  64  64  GLU GLU A . n 
E 2 64  GLU 64  65  65  GLU GLU A . n 
E 2 65  PRO 65  66  66  PRO PRO A . n 
E 2 66  LYS 66  67  67  LYS LYS A . n 
E 2 67  GLN 67  68  68  GLN GLN A . n 
E 2 68  GLN 68  69  69  GLN GLN A . n 
E 2 69  ASN 69  70  70  ASN ASN A . n 
E 2 70  HIS 70  71  71  HIS HIS A . n 
E 2 71  TYR 71  72  72  TYR TYR A . n 
E 2 72  PRO 72  73  73  PRO PRO A . n 
E 2 73  ASP 73  74  74  ASP ASP A . n 
E 2 74  PHE 74  75  75  PHE PHE A . n 
E 2 75  THR 75  76  76  THR THR A . n 
E 2 76  LEU 76  77  77  LEU LEU A . n 
E 2 77  TYR 77  78  78  TYR TYR A . n 
E 2 78  LYS 78  79  79  LYS LYS A . n 
E 2 79  PRO 79  80  80  PRO PRO A . n 
E 2 80  SER 80  81  81  SER SER A . n 
E 2 81  GLU 81  82  82  GLU GLU A . n 
E 2 82  PRO 82  83  83  PRO PRO A . n 
E 2 83  ASN 83  84  84  ASN ASN A . n 
E 2 84  LYS 84  85  85  LYS LYS A . n 
E 2 85  LYS 85  86  86  LYS LYS A . n 
E 2 86  ILE 86  87  87  ILE ILE A . n 
E 2 87  ALA 87  88  88  ALA ALA A . n 
E 2 88  ILE 88  89  89  ILE ILE A . n 
E 2 89  ASP 89  90  90  ASP ASP A . n 
E 2 90  ILE 90  91  91  ILE ILE A . n 
E 2 91  LYS 91  92  92  LYS LYS A . n 
E 2 92  THR 92  93  93  THR THR A . n 
E 2 93  THR 93  94  94  THR THR A . n 
E 2 94  TYR 94  95  95  TYR TYR A . n 
E 2 95  THR 95  96  96  THR THR A . n 
E 2 96  ASN 96  97  97  ASN ASN A . n 
E 2 97  LYS 97  98  98  LYS LYS A . n 
E 2 98  GLU 98  99  99  GLU GLU A . n 
E 2 99  ASN 99  100 100 ASN ASN A . n 
E 2 100 GLU 100 101 101 GLU GLU A . n 
E 2 101 LYS 101 102 102 LYS LYS A . n 
E 2 102 ILE 102 103 103 ILE ILE A . n 
E 2 103 LYS 103 104 104 LYS LYS A . n 
E 2 104 PHE 104 105 105 PHE PHE A . n 
E 2 105 THR 105 106 106 THR THR A . n 
E 2 106 LEU 106 107 107 LEU LEU A . n 
E 2 107 GLY 107 108 108 GLY GLY A . n 
E 2 108 GLY 108 109 109 GLY GLY A . n 
E 2 109 TYR 109 110 110 TYR TYR A . n 
E 2 110 THR 110 111 111 THR THR A . n 
E 2 111 SER 111 112 112 SER SER A . n 
E 2 112 PHE 112 113 113 PHE PHE A . n 
E 2 113 ILE 113 114 114 ILE ILE A . n 
E 2 114 ARG 114 115 115 ARG ARG A . n 
E 2 115 ASN 115 116 116 ASN ASN A . n 
E 2 116 ASN 116 117 117 ASN ASN A . n 
E 2 117 THR 117 118 118 THR THR A . n 
E 2 118 LYS 118 119 119 LYS LYS A . n 
E 2 119 ASN 119 120 120 ASN ASN A . n 
E 2 120 ILE 120 121 121 ILE ILE A . n 
E 2 121 VAL 121 122 122 VAL VAL A . n 
E 2 122 TYR 122 123 123 TYR TYR A . n 
E 2 123 PRO 123 124 124 PRO PRO A . n 
E 2 124 PHE 124 125 125 PHE PHE A . n 
E 2 125 ASP 125 126 126 ASP ASP A . n 
E 2 126 GLN 126 127 127 GLN GLN A . n 
E 2 127 TYR 127 128 128 TYR TYR A . n 
E 2 128 ILE 128 129 129 ILE ILE A . n 
E 2 129 ALA 129 130 130 ALA ALA A . n 
E 2 130 HIS 130 131 131 HIS HIS A . n 
E 2 131 TRP 131 132 132 TRP TRP A . n 
E 2 132 ILE 132 133 133 ILE ILE A . n 
E 2 133 ILE 133 134 134 ILE ILE A . n 
E 2 134 GLY 134 135 135 GLY GLY A . n 
E 2 135 TYR 135 136 136 TYR TYR A . n 
E 2 136 VAL 136 137 137 VAL VAL A . n 
E 2 137 TYR 137 138 138 TYR TYR A . n 
E 2 138 THR 138 139 139 THR THR A . n 
E 2 139 ARG 139 140 140 ARG ARG A . n 
E 2 140 VAL 140 141 ?   ?   ?   A . n 
E 2 141 ALA 141 142 ?   ?   ?   A . n 
E 2 142 THR 142 143 ?   ?   ?   A . n 
E 2 143 ARG 143 144 ?   ?   ?   A . n 
E 2 144 LYS 144 145 ?   ?   ?   A . n 
E 2 145 SER 145 146 ?   ?   ?   A . n 
E 2 146 SER 146 147 ?   ?   ?   A . n 
E 2 147 LEU 147 148 ?   ?   ?   A . n 
E 2 148 LYS 148 149 ?   ?   ?   A . n 
E 2 149 THR 149 150 150 THR THR A . n 
E 2 150 TYR 150 151 151 TYR TYR A . n 
E 2 151 ASN 151 152 152 ASN ASN A . n 
E 2 152 ILE 152 153 153 ILE ILE A . n 
E 2 153 ASN 153 154 154 ASN ASN A . n 
E 2 154 GLU 154 155 155 GLU GLU A . n 
E 2 155 LEU 155 156 156 LEU LEU A . n 
E 2 156 ASN 156 157 157 ASN ASN A . n 
E 2 157 GLU 157 158 158 GLU GLU A . n 
E 2 158 ILE 158 159 159 ILE ILE A . n 
E 2 159 PRO 159 160 160 PRO PRO A . n 
E 2 160 LYS 160 161 161 LYS LYS A . n 
E 2 161 PRO 161 162 162 PRO PRO A . n 
E 2 162 TYR 162 163 163 TYR TYR A . n 
E 2 163 LYS 163 164 164 LYS LYS A . n 
E 2 164 GLY 164 165 165 GLY GLY A . n 
E 2 165 VAL 165 166 166 VAL VAL A . n 
E 2 166 LYS 166 167 167 LYS LYS A . n 
E 2 167 VAL 167 168 168 VAL VAL A . n 
E 2 168 PHE 168 169 169 PHE PHE A . n 
E 2 169 LEU 169 170 170 LEU LEU A . n 
E 2 170 GLN 170 171 171 GLN GLN A . n 
E 2 171 ASP 171 172 172 ASP ASP A . n 
E 2 172 LYS 172 173 173 LYS LYS A . n 
E 2 173 TRP 173 174 174 TRP TRP A . n 
E 2 174 VAL 174 175 175 VAL VAL A . n 
E 2 175 ILE 175 176 176 ILE ILE A . n 
E 2 176 ALA 176 177 177 ALA ALA A . n 
E 2 177 GLY 177 178 178 GLY GLY A . n 
E 2 178 ASP 178 179 179 ASP ASP A . n 
E 2 179 LEU 179 180 180 LEU LEU A . n 
E 2 180 ALA 180 181 181 ALA ALA A . n 
E 2 181 GLY 181 182 182 GLY GLY A . n 
E 2 182 SER 182 183 183 SER SER A . n 
E 2 183 GLY 183 184 ?   ?   ?   A . n 
E 2 184 ASN 184 185 ?   ?   ?   A . n 
E 2 185 THR 185 186 ?   ?   ?   A . n 
E 2 186 THR 186 187 187 THR THR A . n 
E 2 187 ASN 187 188 188 ASN ASN A . n 
E 2 188 ILE 188 189 189 ILE ILE A . n 
E 2 189 GLY 189 190 190 GLY GLY A . n 
E 2 190 SER 190 191 191 SER SER A . n 
E 2 191 ILE 191 192 192 ILE ILE A . n 
E 2 192 HIS 192 193 193 HIS HIS A . n 
E 2 193 ALA 193 194 194 ALA ALA A . n 
E 2 194 HIS 194 195 195 HIS HIS A . n 
E 2 195 TYR 195 196 196 TYR TYR A . n 
E 2 196 LYS 196 197 197 LYS LYS A . n 
E 2 197 ASP 197 198 198 ASP ASP A . n 
E 2 198 PHE 198 199 199 PHE PHE A . n 
E 2 199 VAL 199 200 200 VAL VAL A . n 
E 2 200 GLU 200 201 201 GLU GLU A . n 
E 2 201 GLY 201 202 202 GLY GLY A . n 
E 2 202 LYS 202 203 203 LYS LYS A . n 
E 2 203 GLY 203 204 204 GLY GLY A . n 
E 2 204 ILE 204 205 205 ILE ILE A . n 
E 2 205 PHE 205 206 206 PHE PHE A . n 
E 2 206 ASP 206 207 207 ASP ASP A . n 
E 2 207 SER 207 208 208 SER SER A . n 
E 2 208 GLU 208 209 209 GLU GLU A . n 
E 2 209 ASP 209 210 210 ASP ASP A . n 
E 2 210 GLU 210 211 211 GLU GLU A . n 
E 2 211 PHE 211 212 212 PHE PHE A . n 
E 2 212 LEU 212 213 213 LEU LEU A . n 
E 2 213 ASP 213 214 214 ASP ASP A . n 
E 2 214 TYR 214 215 215 TYR TYR A . n 
E 2 215 TRP 215 216 216 TRP TRP A . n 
E 2 216 ARG 216 217 217 ARG ARG A . n 
E 2 217 ASN 217 218 218 ASN ASN A . n 
E 2 218 TYR 218 219 219 TYR TYR A . n 
E 2 219 GLU 219 220 220 GLU GLU A . n 
E 2 220 ARG 220 221 ?   ?   ?   A . n 
E 2 221 THR 221 222 ?   ?   ?   A . n 
E 2 222 SER 222 223 ?   ?   ?   A . n 
E 2 223 GLN 223 224 ?   ?   ?   A . n 
E 2 224 LEU 224 225 ?   ?   ?   A . n 
E 2 225 ARG 225 226 ?   ?   ?   A . n 
E 2 226 ASN 226 227 ?   ?   ?   A . n 
E 2 227 ASP 227 228 ?   ?   ?   A . n 
E 2 228 LYS 228 229 ?   ?   ?   A . n 
E 2 229 TYR 229 230 230 TYR TYR A . n 
E 2 230 ASN 230 231 231 ASN ASN A . n 
E 2 231 ASN 231 232 232 ASN ASN A . n 
E 2 232 ILE 232 233 233 ILE ILE A . n 
E 2 233 SER 233 234 234 SER SER A . n 
E 2 234 GLU 234 235 235 GLU GLU A . n 
E 2 235 TYR 235 236 236 TYR TYR A . n 
E 2 236 ARG 236 237 237 ARG ARG A . n 
E 2 237 ASN 237 238 238 ASN ASN A . n 
E 2 238 TRP 238 239 239 TRP TRP A . n 
E 2 239 ILE 239 240 240 ILE ILE A . n 
E 2 240 TYR 240 241 ?   ?   ?   A . n 
E 2 241 ARG 241 242 ?   ?   ?   A . n 
E 2 242 GLY 242 243 ?   ?   ?   A . n 
E 2 243 ARG 243 244 ?   ?   ?   A . n 
E 2 244 LYS 244 245 ?   ?   ?   A . n 
F 2 1   SER 1   2   2   SER SER B . n 
F 2 2   LEU 2   3   3   LEU LEU B . n 
F 2 3   ARG 3   4   4   ARG ARG B . n 
F 2 4   SER 4   5   5   SER SER B . n 
F 2 5   ASP 5   6   6   ASP ASP B . n 
F 2 6   LEU 6   7   7   LEU LEU B . n 
F 2 7   ILE 7   8   8   ILE ILE B . n 
F 2 8   ASN 8   9   9   ASN ASN B . n 
F 2 9   ALA 9   10  10  ALA ALA B . n 
F 2 10  LEU 10  11  11  LEU LEU B . n 
F 2 11  TYR 11  12  12  TYR TYR B . n 
F 2 12  ASP 12  13  ?   ?   ?   B . n 
F 2 13  GLU 13  14  ?   ?   ?   B . n 
F 2 14  ASN 14  15  ?   ?   ?   B . n 
F 2 15  GLN 15  16  ?   ?   ?   B . n 
F 2 16  LYS 16  17  ?   ?   ?   B . n 
F 2 17  TYR 17  18  ?   ?   ?   B . n 
F 2 18  ASP 18  19  ?   ?   ?   B . n 
F 2 19  VAL 19  20  20  VAL VAL B . n 
F 2 20  CYS 20  21  21  CYS CYS B . n 
F 2 21  GLY 21  22  22  GLY GLY B . n 
F 2 22  ILE 22  23  23  ILE ILE B . n 
F 2 23  ILE 23  24  24  ILE ILE B . n 
F 2 24  SER 24  25  25  SER SER B . n 
F 2 25  ALA 25  26  26  ALA ALA B . n 
F 2 26  GLU 26  27  27  GLU GLU B . n 
F 2 27  GLY 27  28  28  GLY GLY B . n 
F 2 28  LYS 28  29  29  LYS LYS B . n 
F 2 29  ILE 29  30  30  ILE ILE B . n 
F 2 30  TYR 30  31  31  TYR TYR B . n 
F 2 31  PRO 31  32  32  PRO PRO B . n 
F 2 32  LEU 32  33  33  LEU LEU B . n 
F 2 33  GLY 33  34  34  GLY GLY B . n 
F 2 34  SER 34  35  35  SER SER B . n 
F 2 35  ASP 35  36  36  ASP ASP B . n 
F 2 36  THR 36  37  37  THR THR B . n 
F 2 37  LYS 37  38  38  LYS LYS B . n 
F 2 38  VAL 38  39  39  VAL VAL B . n 
F 2 39  LEU 39  40  40  LEU LEU B . n 
F 2 40  SER 40  41  41  SER SER B . n 
F 2 41  THR 41  42  42  THR THR B . n 
F 2 42  ILE 42  43  43  ILE ILE B . n 
F 2 43  PHE 43  44  44  PHE PHE B . n 
F 2 44  GLU 44  45  45  GLU GLU B . n 
F 2 45  LEU 45  46  46  LEU LEU B . n 
F 2 46  PHE 46  47  47  PHE PHE B . n 
F 2 47  SER 47  48  48  SER SER B . n 
F 2 48  ARG 48  49  49  ARG ARG B . n 
F 2 49  PRO 49  50  50  PRO PRO B . n 
F 2 50  ILE 50  51  51  ILE ILE B . n 
F 2 51  ILE 51  52  52  ILE ILE B . n 
F 2 52  ASN 52  53  53  ASN ASN B . n 
F 2 53  LYS 53  54  54  LYS LYS B . n 
F 2 54  ILE 54  55  55  ILE ILE B . n 
F 2 55  ALA 55  56  56  ALA ALA B . n 
F 2 56  GLU 56  57  57  GLU GLU B . n 
F 2 57  LYS 57  58  58  LYS LYS B . n 
F 2 58  HIS 58  59  59  HIS HIS B . n 
F 2 59  GLY 59  60  60  GLY GLY B . n 
F 2 60  TYR 60  61  61  TYR TYR B . n 
F 2 61  ILE 61  62  62  ILE ILE B . n 
F 2 62  VAL 62  63  63  VAL VAL B . n 
F 2 63  GLU 63  64  64  GLU GLU B . n 
F 2 64  GLU 64  65  65  GLU GLU B . n 
F 2 65  PRO 65  66  66  PRO PRO B . n 
F 2 66  LYS 66  67  67  LYS LYS B . n 
F 2 67  GLN 67  68  68  GLN GLN B . n 
F 2 68  GLN 68  69  69  GLN GLN B . n 
F 2 69  ASN 69  70  70  ASN ASN B . n 
F 2 70  HIS 70  71  71  HIS HIS B . n 
F 2 71  TYR 71  72  72  TYR TYR B . n 
F 2 72  PRO 72  73  73  PRO PRO B . n 
F 2 73  ASP 73  74  74  ASP ASP B . n 
F 2 74  PHE 74  75  75  PHE PHE B . n 
F 2 75  THR 75  76  76  THR THR B . n 
F 2 76  LEU 76  77  77  LEU LEU B . n 
F 2 77  TYR 77  78  78  TYR TYR B . n 
F 2 78  LYS 78  79  79  LYS LYS B . n 
F 2 79  PRO 79  80  80  PRO PRO B . n 
F 2 80  SER 80  81  81  SER SER B . n 
F 2 81  GLU 81  82  82  GLU GLU B . n 
F 2 82  PRO 82  83  83  PRO PRO B . n 
F 2 83  ASN 83  84  84  ASN ASN B . n 
F 2 84  LYS 84  85  85  LYS LYS B . n 
F 2 85  LYS 85  86  86  LYS LYS B . n 
F 2 86  ILE 86  87  87  ILE ILE B . n 
F 2 87  ALA 87  88  88  ALA ALA B . n 
F 2 88  ILE 88  89  89  ILE ILE B . n 
F 2 89  ASP 89  90  90  ASP ASP B . n 
F 2 90  ILE 90  91  91  ILE ILE B . n 
F 2 91  LYS 91  92  92  LYS LYS B . n 
F 2 92  THR 92  93  93  THR THR B . n 
F 2 93  THR 93  94  94  THR THR B . n 
F 2 94  TYR 94  95  95  TYR TYR B . n 
F 2 95  THR 95  96  96  THR THR B . n 
F 2 96  ASN 96  97  97  ASN ASN B . n 
F 2 97  LYS 97  98  98  LYS LYS B . n 
F 2 98  GLU 98  99  99  GLU GLU B . n 
F 2 99  ASN 99  100 100 ASN ASN B . n 
F 2 100 GLU 100 101 101 GLU GLU B . n 
F 2 101 LYS 101 102 102 LYS LYS B . n 
F 2 102 ILE 102 103 103 ILE ILE B . n 
F 2 103 LYS 103 104 104 LYS LYS B . n 
F 2 104 PHE 104 105 105 PHE PHE B . n 
F 2 105 THR 105 106 106 THR THR B . n 
F 2 106 LEU 106 107 107 LEU LEU B . n 
F 2 107 GLY 107 108 108 GLY GLY B . n 
F 2 108 GLY 108 109 109 GLY GLY B . n 
F 2 109 TYR 109 110 110 TYR TYR B . n 
F 2 110 THR 110 111 111 THR THR B . n 
F 2 111 SER 111 112 112 SER SER B . n 
F 2 112 PHE 112 113 113 PHE PHE B . n 
F 2 113 ILE 113 114 114 ILE ILE B . n 
F 2 114 ARG 114 115 115 ARG ARG B . n 
F 2 115 ASN 115 116 116 ASN ASN B . n 
F 2 116 ASN 116 117 117 ASN ASN B . n 
F 2 117 THR 117 118 118 THR THR B . n 
F 2 118 LYS 118 119 119 LYS LYS B . n 
F 2 119 ASN 119 120 120 ASN ASN B . n 
F 2 120 ILE 120 121 121 ILE ILE B . n 
F 2 121 VAL 121 122 122 VAL VAL B . n 
F 2 122 TYR 122 123 123 TYR TYR B . n 
F 2 123 PRO 123 124 124 PRO PRO B . n 
F 2 124 PHE 124 125 125 PHE PHE B . n 
F 2 125 ASP 125 126 126 ASP ASP B . n 
F 2 126 GLN 126 127 127 GLN GLN B . n 
F 2 127 TYR 127 128 128 TYR TYR B . n 
F 2 128 ILE 128 129 129 ILE ILE B . n 
F 2 129 ALA 129 130 130 ALA ALA B . n 
F 2 130 HIS 130 131 131 HIS HIS B . n 
F 2 131 TRP 131 132 132 TRP TRP B . n 
F 2 132 ILE 132 133 133 ILE ILE B . n 
F 2 133 ILE 133 134 134 ILE ILE B . n 
F 2 134 GLY 134 135 135 GLY GLY B . n 
F 2 135 TYR 135 136 136 TYR TYR B . n 
F 2 136 VAL 136 137 137 VAL VAL B . n 
F 2 137 TYR 137 138 138 TYR TYR B . n 
F 2 138 THR 138 139 139 THR THR B . n 
F 2 139 ARG 139 140 140 ARG ARG B . n 
F 2 140 VAL 140 141 ?   ?   ?   B . n 
F 2 141 ALA 141 142 ?   ?   ?   B . n 
F 2 142 THR 142 143 ?   ?   ?   B . n 
F 2 143 ARG 143 144 ?   ?   ?   B . n 
F 2 144 LYS 144 145 ?   ?   ?   B . n 
F 2 145 SER 145 146 ?   ?   ?   B . n 
F 2 146 SER 146 147 ?   ?   ?   B . n 
F 2 147 LEU 147 148 ?   ?   ?   B . n 
F 2 148 LYS 148 149 ?   ?   ?   B . n 
F 2 149 THR 149 150 150 THR THR B . n 
F 2 150 TYR 150 151 151 TYR TYR B . n 
F 2 151 ASN 151 152 152 ASN ASN B . n 
F 2 152 ILE 152 153 153 ILE ILE B . n 
F 2 153 ASN 153 154 154 ASN ASN B . n 
F 2 154 GLU 154 155 155 GLU GLU B . n 
F 2 155 LEU 155 156 156 LEU LEU B . n 
F 2 156 ASN 156 157 157 ASN ASN B . n 
F 2 157 GLU 157 158 158 GLU GLU B . n 
F 2 158 ILE 158 159 159 ILE ILE B . n 
F 2 159 PRO 159 160 160 PRO PRO B . n 
F 2 160 LYS 160 161 161 LYS LYS B . n 
F 2 161 PRO 161 162 162 PRO PRO B . n 
F 2 162 TYR 162 163 163 TYR TYR B . n 
F 2 163 LYS 163 164 164 LYS LYS B . n 
F 2 164 GLY 164 165 165 GLY GLY B . n 
F 2 165 VAL 165 166 166 VAL VAL B . n 
F 2 166 LYS 166 167 167 LYS LYS B . n 
F 2 167 VAL 167 168 168 VAL VAL B . n 
F 2 168 PHE 168 169 169 PHE PHE B . n 
F 2 169 LEU 169 170 170 LEU LEU B . n 
F 2 170 GLN 170 171 171 GLN GLN B . n 
F 2 171 ASP 171 172 172 ASP ASP B . n 
F 2 172 LYS 172 173 173 LYS LYS B . n 
F 2 173 TRP 173 174 174 TRP TRP B . n 
F 2 174 VAL 174 175 175 VAL VAL B . n 
F 2 175 ILE 175 176 176 ILE ILE B . n 
F 2 176 ALA 176 177 177 ALA ALA B . n 
F 2 177 GLY 177 178 178 GLY GLY B . n 
F 2 178 ASP 178 179 179 ASP ASP B . n 
F 2 179 LEU 179 180 180 LEU LEU B . n 
F 2 180 ALA 180 181 181 ALA ALA B . n 
F 2 181 GLY 181 182 182 GLY GLY B . n 
F 2 182 SER 182 183 183 SER SER B . n 
F 2 183 GLY 183 184 ?   ?   ?   B . n 
F 2 184 ASN 184 185 ?   ?   ?   B . n 
F 2 185 THR 185 186 ?   ?   ?   B . n 
F 2 186 THR 186 187 187 THR THR B . n 
F 2 187 ASN 187 188 188 ASN ASN B . n 
F 2 188 ILE 188 189 189 ILE ILE B . n 
F 2 189 GLY 189 190 190 GLY GLY B . n 
F 2 190 SER 190 191 191 SER SER B . n 
F 2 191 ILE 191 192 192 ILE ILE B . n 
F 2 192 HIS 192 193 193 HIS HIS B . n 
F 2 193 ALA 193 194 194 ALA ALA B . n 
F 2 194 HIS 194 195 195 HIS HIS B . n 
F 2 195 TYR 195 196 196 TYR TYR B . n 
F 2 196 LYS 196 197 197 LYS LYS B . n 
F 2 197 ASP 197 198 198 ASP ASP B . n 
F 2 198 PHE 198 199 199 PHE PHE B . n 
F 2 199 VAL 199 200 200 VAL VAL B . n 
F 2 200 GLU 200 201 201 GLU GLU B . n 
F 2 201 GLY 201 202 202 GLY GLY B . n 
F 2 202 LYS 202 203 203 LYS LYS B . n 
F 2 203 GLY 203 204 204 GLY GLY B . n 
F 2 204 ILE 204 205 205 ILE ILE B . n 
F 2 205 PHE 205 206 206 PHE PHE B . n 
F 2 206 ASP 206 207 207 ASP ASP B . n 
F 2 207 SER 207 208 208 SER SER B . n 
F 2 208 GLU 208 209 209 GLU GLU B . n 
F 2 209 ASP 209 210 210 ASP ASP B . n 
F 2 210 GLU 210 211 211 GLU GLU B . n 
F 2 211 PHE 211 212 212 PHE PHE B . n 
F 2 212 LEU 212 213 213 LEU LEU B . n 
F 2 213 ASP 213 214 214 ASP ASP B . n 
F 2 214 TYR 214 215 215 TYR TYR B . n 
F 2 215 TRP 215 216 216 TRP TRP B . n 
F 2 216 ARG 216 217 217 ARG ARG B . n 
F 2 217 ASN 217 218 218 ASN ASN B . n 
F 2 218 TYR 218 219 219 TYR TYR B . n 
F 2 219 GLU 219 220 220 GLU GLU B . n 
F 2 220 ARG 220 221 ?   ?   ?   B . n 
F 2 221 THR 221 222 ?   ?   ?   B . n 
F 2 222 SER 222 223 ?   ?   ?   B . n 
F 2 223 GLN 223 224 ?   ?   ?   B . n 
F 2 224 LEU 224 225 ?   ?   ?   B . n 
F 2 225 ARG 225 226 ?   ?   ?   B . n 
F 2 226 ASN 226 227 ?   ?   ?   B . n 
F 2 227 ASP 227 228 ?   ?   ?   B . n 
F 2 228 LYS 228 229 ?   ?   ?   B . n 
F 2 229 TYR 229 230 230 TYR TYR B . n 
F 2 230 ASN 230 231 231 ASN ASN B . n 
F 2 231 ASN 231 232 232 ASN ASN B . n 
F 2 232 ILE 232 233 233 ILE ILE B . n 
F 2 233 SER 233 234 234 SER SER B . n 
F 2 234 GLU 234 235 235 GLU GLU B . n 
F 2 235 TYR 235 236 236 TYR TYR B . n 
F 2 236 ARG 236 237 237 ARG ARG B . n 
F 2 237 ASN 237 238 238 ASN ASN B . n 
F 2 238 TRP 238 239 239 TRP TRP B . n 
F 2 239 ILE 239 240 240 ILE ILE B . n 
F 2 240 TYR 240 241 241 TYR TYR B . n 
F 2 241 ARG 241 242 ?   ?   ?   B . n 
F 2 242 GLY 242 243 ?   ?   ?   B . n 
F 2 243 ARG 243 244 ?   ?   ?   B . n 
F 2 244 LYS 244 245 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 HOH 1  9   7  HOH HOH C . 
G 3 HOH 2  10  24 HOH HOH C . 
G 3 HOH 3  11  25 HOH HOH C . 
G 3 HOH 4  12  26 HOH HOH C . 
G 3 HOH 5  13  39 HOH HOH C . 
G 3 HOH 6  14  41 HOH HOH C . 
G 3 HOH 7  15  54 HOH HOH C . 
H 3 HOH 1  18  18 HOH HOH D . 
H 3 HOH 2  27  27 HOH HOH D . 
H 3 HOH 3  43  43 HOH HOH D . 
H 3 HOH 4  50  50 HOH HOH D . 
I 3 HOH 1  11  11 HOH HOH E . 
I 3 HOH 2  38  38 HOH HOH E . 
I 3 HOH 3  55  55 HOH HOH E . 
I 3 HOH 4  60  60 HOH HOH E . 
I 3 HOH 5  61  61 HOH HOH E . 
I 3 HOH 6  65  65 HOH HOH E . 
J 3 HOH 1  36  36 HOH HOH F . 
K 3 HOH 1  246 2  HOH HOH A . 
K 3 HOH 2  247 3  HOH HOH A . 
K 3 HOH 3  248 4  HOH HOH A . 
K 3 HOH 4  249 10 HOH HOH A . 
K 3 HOH 5  250 14 HOH HOH A . 
K 3 HOH 6  251 16 HOH HOH A . 
K 3 HOH 7  252 17 HOH HOH A . 
K 3 HOH 8  253 21 HOH HOH A . 
K 3 HOH 9  254 22 HOH HOH A . 
K 3 HOH 10 255 23 HOH HOH A . 
K 3 HOH 11 256 28 HOH HOH A . 
K 3 HOH 12 257 29 HOH HOH A . 
K 3 HOH 13 258 30 HOH HOH A . 
K 3 HOH 14 259 31 HOH HOH A . 
K 3 HOH 15 260 34 HOH HOH A . 
K 3 HOH 16 261 35 HOH HOH A . 
K 3 HOH 17 262 40 HOH HOH A . 
K 3 HOH 18 263 47 HOH HOH A . 
K 3 HOH 19 264 51 HOH HOH A . 
K 3 HOH 20 265 52 HOH HOH A . 
K 3 HOH 21 266 57 HOH HOH A . 
K 3 HOH 22 267 63 HOH HOH A . 
K 3 HOH 23 268 64 HOH HOH A . 
L 3 HOH 1  246 1  HOH HOH B . 
L 3 HOH 2  247 5  HOH HOH B . 
L 3 HOH 3  248 6  HOH HOH B . 
L 3 HOH 4  249 8  HOH HOH B . 
L 3 HOH 5  250 9  HOH HOH B . 
L 3 HOH 6  251 12 HOH HOH B . 
L 3 HOH 7  252 13 HOH HOH B . 
L 3 HOH 8  253 15 HOH HOH B . 
L 3 HOH 9  254 19 HOH HOH B . 
L 3 HOH 10 255 20 HOH HOH B . 
L 3 HOH 11 256 32 HOH HOH B . 
L 3 HOH 12 257 33 HOH HOH B . 
L 3 HOH 13 258 37 HOH HOH B . 
L 3 HOH 14 259 42 HOH HOH B . 
L 3 HOH 15 260 44 HOH HOH B . 
L 3 HOH 16 261 45 HOH HOH B . 
L 3 HOH 17 262 46 HOH HOH B . 
L 3 HOH 18 263 48 HOH HOH B . 
L 3 HOH 19 264 49 HOH HOH B . 
L 3 HOH 20 265 53 HOH HOH B . 
L 3 HOH 21 266 56 HOH HOH B . 
L 3 HOH 22 267 58 HOH HOH B . 
L 3 HOH 23 268 59 HOH HOH B . 
L 3 HOH 24 269 62 HOH HOH B . 
L 3 HOH 25 270 66 HOH HOH B . 
L 3 HOH 26 271 67 HOH HOH B . 
L 3 HOH 27 272 68 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,K 
2 1 C,D,F,I,J,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1992-01-15 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "O3'" C DC  1   ? ? "C3'" C DC  1   ? ? 1.381 1.419 -0.038 0.006 N 
2  1 N1    C DC  1   ? ? C6    C DC  1   ? ? 1.325 1.367 -0.042 0.006 N 
3  1 "O3'" C DA  3   ? ? "C3'" C DA  3   ? ? 1.363 1.419 -0.056 0.006 N 
4  1 "O3'" E DC  1   ? ? "C3'" E DC  1   ? ? 1.362 1.419 -0.057 0.006 N 
5  1 N1    E DC  1   ? ? C6    E DC  1   ? ? 1.327 1.367 -0.040 0.006 N 
6  1 "O3'" E DG  2   ? ? "C3'" E DG  2   ? ? 1.381 1.419 -0.038 0.006 N 
7  1 "O3'" F DC  1   ? ? "C3'" F DC  1   ? ? 1.382 1.419 -0.037 0.006 N 
8  1 N3    F DA  3   ? ? C4    F DA  3   ? ? 1.307 1.344 -0.037 0.006 N 
9  1 "O3'" F DC  5   ? ? "C3'" F DC  5   ? ? 1.367 1.419 -0.052 0.006 N 
10 1 CD    A GLU 27  ? ? OE2   A GLU 27  ? ? 1.321 1.252 0.069  0.011 N 
11 1 CD    A GLU 45  ? ? OE2   A GLU 45  ? ? 1.324 1.252 0.072  0.011 N 
12 1 CD    A GLU 57  ? ? OE2   A GLU 57  ? ? 1.331 1.252 0.079  0.011 N 
13 1 CD    A GLU 82  ? ? OE2   A GLU 82  ? ? 1.319 1.252 0.067  0.011 N 
14 1 CD    A GLU 99  ? ? OE2   A GLU 99  ? ? 1.320 1.252 0.068  0.011 N 
15 1 CD    A GLU 158 ? ? OE2   A GLU 158 ? ? 1.332 1.252 0.080  0.011 N 
16 1 CD    A GLU 201 ? ? OE2   A GLU 201 ? ? 1.322 1.252 0.070  0.011 N 
17 1 CD    B GLU 27  ? ? OE2   B GLU 27  ? ? 1.329 1.252 0.077  0.011 N 
18 1 CD    B GLU 45  ? ? OE2   B GLU 45  ? ? 1.318 1.252 0.066  0.011 N 
19 1 CD    B GLU 57  ? ? OE2   B GLU 57  ? ? 1.323 1.252 0.071  0.011 N 
20 1 CD    B GLU 64  ? ? OE2   B GLU 64  ? ? 1.327 1.252 0.075  0.011 N 
21 1 CD    B GLU 65  ? ? OE2   B GLU 65  ? ? 1.323 1.252 0.071  0.011 N 
22 1 CD    B GLU 101 ? ? OE2   B GLU 101 ? ? 1.322 1.252 0.070  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C6    C DC  1   ? ? N1    C DC  1   ? ? "C1'" C DC  1   ? ? 129.92 120.80 9.12   1.20 N 
2  1 C2    C DC  1   ? ? N1    C DC  1   ? ? "C1'" C DC  1   ? ? 108.06 118.80 -10.74 1.10 N 
3  1 "O4'" C DG  2   ? ? "C1'" C DG  2   ? ? N9    C DG  2   ? ? 111.95 108.30 3.65   0.30 N 
4  1 C2    D DC  1   ? ? N1    D DC  1   ? ? "C1'" D DC  1   ? ? 111.34 118.80 -7.46  1.10 N 
5  1 "O4'" D DG  4   ? ? "C1'" D DG  4   ? ? "C2'" D DG  4   ? ? 100.64 105.90 -5.26  0.80 N 
6  1 "O4'" D DC  7   ? ? "C1'" D DC  7   ? ? N1    D DC  7   ? ? 112.91 108.30 4.61   0.30 N 
7  1 C6    E DC  1   ? ? N1    E DC  1   ? ? "C1'" E DC  1   ? ? 138.28 120.80 17.48  1.20 N 
8  1 C2    E DC  1   ? ? N1    E DC  1   ? ? "C1'" E DC  1   ? ? 99.59  118.80 -19.21 1.10 N 
9  1 C8    E DG  2   ? ? N9    E DG  2   ? ? "C1'" E DG  2   ? ? 139.61 127.00 12.61  1.30 N 
10 1 C4    E DG  2   ? ? N9    E DG  2   ? ? "C1'" E DG  2   ? ? 113.81 126.50 -12.69 1.30 N 
11 1 "O4'" E DC  7   ? ? "C1'" E DC  7   ? ? N1    E DC  7   ? ? 112.54 108.30 4.24   0.30 N 
12 1 C6    F DC  1   ? ? N1    F DC  1   ? ? "C1'" F DC  1   ? ? 134.07 120.80 13.27  1.20 N 
13 1 C2    F DC  1   ? ? N1    F DC  1   ? ? "C1'" F DC  1   ? ? 104.69 118.80 -14.11 1.10 N 
14 1 "O4'" F DG  2   ? ? "C1'" F DG  2   ? ? "C2'" F DG  2   ? ? 100.37 105.90 -5.53  0.80 N 
15 1 P     F DG  4   ? ? "O5'" F DG  4   ? ? "C5'" F DG  4   ? ? 109.99 120.90 -10.91 1.60 N 
16 1 "O4'" F DC  5   ? ? "C1'" F DC  5   ? ? N1    F DC  5   ? ? 110.98 108.30 2.68   0.30 N 
17 1 C6    F DT  6   ? ? N1    F DT  6   ? ? "C1'" F DT  6   ? ? 131.21 120.40 10.81  1.50 N 
18 1 C2    F DT  6   ? ? N1    F DT  6   ? ? "C1'" F DT  6   ? ? 106.99 118.20 -11.21 1.60 N 
19 1 CB    A ASP 6   ? ? CG    A ASP 6   ? ? OD1   A ASP 6   ? ? 124.09 118.30 5.79   0.90 N 
20 1 CB    A ASP 19  ? ? CG    A ASP 19  ? ? OD2   A ASP 19  ? ? 111.90 118.30 -6.40  0.90 N 
21 1 CB    A ASP 126 ? ? CG    A ASP 126 ? ? OD2   A ASP 126 ? ? 112.69 118.30 -5.61  0.90 N 
22 1 NE    A ARG 140 ? ? CZ    A ARG 140 ? ? NH1   A ARG 140 ? ? 123.38 120.30 3.08   0.50 N 
23 1 CB    A ASP 172 ? ? CG    A ASP 172 ? ? OD1   A ASP 172 ? ? 124.00 118.30 5.70   0.90 N 
24 1 CB    A ASP 172 ? ? CG    A ASP 172 ? ? OD2   A ASP 172 ? ? 112.24 118.30 -6.06  0.90 N 
25 1 CB    A ASP 179 ? ? CG    A ASP 179 ? ? OD2   A ASP 179 ? ? 112.63 118.30 -5.67  0.90 N 
26 1 CB    A ASP 198 ? ? CG    A ASP 198 ? ? OD2   A ASP 198 ? ? 111.88 118.30 -6.42  0.90 N 
27 1 CB    A ASP 207 ? ? CG    A ASP 207 ? ? OD1   A ASP 207 ? ? 124.73 118.30 6.43   0.90 N 
28 1 CB    A ASP 207 ? ? CG    A ASP 207 ? ? OD2   A ASP 207 ? ? 112.58 118.30 -5.72  0.90 N 
29 1 CB    A ASP 214 ? ? CG    A ASP 214 ? ? OD2   A ASP 214 ? ? 112.07 118.30 -6.23  0.90 N 
30 1 CB    B ASP 36  ? ? CG    B ASP 36  ? ? OD2   B ASP 36  ? ? 112.54 118.30 -5.76  0.90 N 
31 1 CB    B ASP 74  ? ? CG    B ASP 74  ? ? OD2   B ASP 74  ? ? 112.67 118.30 -5.63  0.90 N 
32 1 CB    B ASP 172 ? ? CG    B ASP 172 ? ? OD1   B ASP 172 ? ? 123.72 118.30 5.42   0.90 N 
33 1 CB    B ASP 198 ? ? CG    B ASP 198 ? ? OD1   B ASP 198 ? ? 123.96 118.30 5.66   0.90 N 
34 1 CB    B ASP 198 ? ? CG    B ASP 198 ? ? OD2   B ASP 198 ? ? 111.81 118.30 -6.49  0.90 N 
35 1 CB    B ASP 207 ? ? CG    B ASP 207 ? ? OD2   B ASP 207 ? ? 112.21 118.30 -6.09  0.90 N 
36 1 CB    B ASP 210 ? ? CG    B ASP 210 ? ? OD2   B ASP 210 ? ? 112.65 118.30 -5.65  0.90 N 
37 1 CB    B ASP 214 ? ? CG    B ASP 214 ? ? OD1   B ASP 214 ? ? 124.00 118.30 5.70   0.90 N 
38 1 CB    B ASP 214 ? ? CG    B ASP 214 ? ? OD2   B ASP 214 ? ? 111.49 118.30 -6.81  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 26  ? ? -39.29  -35.02  
2  1 LEU A 33  ? ? -90.23  -159.60 
3  1 PHE A 44  ? ? -59.30  -9.39   
4  1 HIS A 59  ? ? -148.41 17.66   
5  1 ASN A 70  ? ? 76.16   33.77   
6  1 PRO A 80  ? ? -31.26  -38.59  
7  1 LYS A 98  ? ? -112.81 -162.94 
8  1 LYS A 104 ? ? -171.87 134.68  
9  1 SER A 112 ? ? -73.86  -126.42 
10 1 ASN A 117 ? ? 69.43   -28.72  
11 1 PHE A 125 ? ? -31.33  -36.18  
12 1 GLU A 155 ? ? -68.46  4.26    
13 1 TYR A 163 ? ? 175.02  154.84  
14 1 HIS A 193 ? ? -113.26 70.56   
15 1 ALA A 194 ? ? -117.56 -167.82 
16 1 SER A 208 ? ? 177.21  171.22  
17 1 TRP A 239 ? ? -55.34  3.38    
18 1 ASN B 70  ? ? 74.17   45.96   
19 1 TYR B 78  ? ? -179.90 139.41  
20 1 GLU B 82  ? ? -106.09 66.47   
21 1 LYS B 85  ? ? -118.72 63.09   
22 1 ASN B 100 ? ? 80.63   11.84   
23 1 LYS B 102 ? ? -68.66  98.92   
24 1 LEU B 107 ? ? -115.90 54.41   
25 1 SER B 112 ? ? -88.81  -119.71 
26 1 ASN B 117 ? ? 99.19   -33.10  
27 1 ASP B 126 ? ? -68.28  12.43   
28 1 GLU B 155 ? ? -109.74 43.19   
29 1 ALA B 181 ? ? -57.16  177.06  
30 1 ALA B 194 ? ? -122.68 -168.29 
31 1 ASN B 231 ? ? -149.35 33.05   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 13  ? E ASP 12  
2  1 Y 1 A GLU 14  ? E GLU 13  
3  1 Y 1 A ASN 15  ? E ASN 14  
4  1 Y 1 A GLN 16  ? E GLN 15  
5  1 Y 1 A LYS 17  ? E LYS 16  
6  1 Y 1 A VAL 141 ? E VAL 140 
7  1 Y 1 A ALA 142 ? E ALA 141 
8  1 Y 1 A THR 143 ? E THR 142 
9  1 Y 1 A ARG 144 ? E ARG 143 
10 1 Y 1 A LYS 145 ? E LYS 144 
11 1 Y 1 A SER 146 ? E SER 145 
12 1 Y 1 A SER 147 ? E SER 146 
13 1 Y 1 A LEU 148 ? E LEU 147 
14 1 Y 1 A LYS 149 ? E LYS 148 
15 1 Y 1 A GLY 184 ? E GLY 183 
16 1 Y 1 A ASN 185 ? E ASN 184 
17 1 Y 1 A THR 186 ? E THR 185 
18 1 Y 1 A ARG 221 ? E ARG 220 
19 1 Y 1 A THR 222 ? E THR 221 
20 1 Y 1 A SER 223 ? E SER 222 
21 1 Y 1 A GLN 224 ? E GLN 223 
22 1 Y 1 A LEU 225 ? E LEU 224 
23 1 Y 1 A ARG 226 ? E ARG 225 
24 1 Y 1 A ASN 227 ? E ASN 226 
25 1 Y 1 A ASP 228 ? E ASP 227 
26 1 Y 1 A LYS 229 ? E LYS 228 
27 1 Y 1 A TYR 241 ? E TYR 240 
28 1 Y 1 A ARG 242 ? E ARG 241 
29 1 Y 1 A GLY 243 ? E GLY 242 
30 1 Y 1 A ARG 244 ? E ARG 243 
31 1 Y 1 A LYS 245 ? E LYS 244 
32 1 Y 1 B ASP 13  ? F ASP 12  
33 1 Y 1 B GLU 14  ? F GLU 13  
34 1 Y 1 B ASN 15  ? F ASN 14  
35 1 Y 1 B GLN 16  ? F GLN 15  
36 1 Y 1 B LYS 17  ? F LYS 16  
37 1 Y 1 B TYR 18  ? F TYR 17  
38 1 Y 1 B ASP 19  ? F ASP 18  
39 1 Y 1 B VAL 141 ? F VAL 140 
40 1 Y 1 B ALA 142 ? F ALA 141 
41 1 Y 1 B THR 143 ? F THR 142 
42 1 Y 1 B ARG 144 ? F ARG 143 
43 1 Y 1 B LYS 145 ? F LYS 144 
44 1 Y 1 B SER 146 ? F SER 145 
45 1 Y 1 B SER 147 ? F SER 146 
46 1 Y 1 B LEU 148 ? F LEU 147 
47 1 Y 1 B LYS 149 ? F LYS 148 
48 1 Y 1 B GLY 184 ? F GLY 183 
49 1 Y 1 B ASN 185 ? F ASN 184 
50 1 Y 1 B THR 186 ? F THR 185 
51 1 Y 1 B ARG 221 ? F ARG 220 
52 1 Y 1 B THR 222 ? F THR 221 
53 1 Y 1 B SER 223 ? F SER 222 
54 1 Y 1 B GLN 224 ? F GLN 223 
55 1 Y 1 B LEU 225 ? F LEU 224 
56 1 Y 1 B ARG 226 ? F ARG 225 
57 1 Y 1 B ASN 227 ? F ASN 226 
58 1 Y 1 B ASP 228 ? F ASP 227 
59 1 Y 1 B LYS 229 ? F LYS 228 
60 1 Y 1 B ARG 242 ? F ARG 241 
61 1 Y 1 B GLY 243 ? F GLY 242 
62 1 Y 1 B ARG 244 ? F ARG 243 
63 1 Y 1 B LYS 245 ? F LYS 244 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2RVE 'double helix'        
2RVE 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 A DG 8 1_555 -0.285 -0.324 0.928  -9.613 -2.566  -9.571  1  D_DC1:DG8_C D 1 ? C 8 ? 19 1 
1 B DG 2 1_555 A DC 7 1_555 0.892  -0.394 0.113  1.642  -1.909  -4.082  2  D_DG2:DC7_C D 2 ? C 7 ? 19 1 
1 B DA 3 1_555 A DT 6 1_555 0.055  -0.415 0.315  0.715  -10.605 -9.615  3  D_DA3:DT6_C D 3 ? C 6 ? 20 1 
1 B DG 4 1_555 A DC 5 1_555 0.736  -0.523 0.458  14.717 -8.072  -3.833  4  D_DG4:DC5_C D 4 ? C 5 ? 19 1 
1 B DC 5 1_555 A DG 4 1_555 0.553  -0.181 0.541  -5.930 -3.335  -0.542  5  D_DC5:DG4_C D 5 ? C 4 ? 19 1 
1 B DT 6 1_555 A DA 3 1_555 -0.276 -0.289 0.071  5.765  -7.561  -8.685  6  D_DT6:DA3_C D 6 ? C 3 ? 20 1 
1 B DC 7 1_555 A DG 2 1_555 -0.332 -0.104 -0.722 8.892  -16.090 -13.832 7  D_DC7:DG2_C D 7 ? C 2 ? ?  ? 
1 B DG 8 1_555 A DC 1 1_555 -0.478 -0.344 -0.088 -0.781 -8.355  -6.256  8  D_DG8:DC1_C D 8 ? C 1 ? 19 1 
1 C DC 1 1_555 D DG 8 1_555 0.387  0.014  0.257  -5.083 -12.525 -5.245  9  E_DC1:DG8_F E 1 ? F 8 ? 19 1 
1 C DG 2 1_555 D DC 7 1_555 0.368  -0.333 -0.144 5.804  -10.381 -10.036 10 E_DG2:DC7_F E 2 ? F 7 ? 19 1 
1 C DA 3 1_555 D DT 6 1_555 0.464  -0.066 -0.183 3.251  -12.054 -6.893  11 E_DA3:DT6_F E 3 ? F 6 ? 20 1 
1 C DG 4 1_555 D DC 5 1_555 -0.683 0.001  0.126  1.244  -11.431 -4.126  12 E_DG4:DC5_F E 4 ? F 5 ? 19 1 
1 C DC 5 1_555 D DG 4 1_555 -0.354 -0.019 0.169  3.403  -8.769  5.323   13 E_DC5:DG4_F E 5 ? F 4 ? 19 1 
1 C DT 6 1_555 D DA 3 1_555 0.062  -0.197 -0.219 6.871  -3.285  -10.618 14 E_DT6:DA3_F E 6 ? F 3 ? 20 1 
1 C DC 7 1_555 D DG 2 1_555 -0.023 -0.594 0.410  -4.289 3.717   -0.210  15 E_DC7:DG2_F E 7 ? F 2 ? 19 1 
1 C DG 8 1_555 D DC 1 1_555 -0.062 -0.722 -0.149 12.824 -9.844  1.256   16 E_DG8:DC1_F E 8 ? F 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 A DG 8 1_555 B DG 2 1_555 A DC 7 1_555 0.488  0.973  3.024 8.507  -5.317 40.762 1.870   0.135  2.920 -7.498  
-11.995 41.927 1  DD_DC1DG2:DC7DG8_CC D 1 ? C 8 ? D 2 ? C 7 ? 
1 B DG 2 1_555 A DC 7 1_555 B DA 3 1_555 A DT 6 1_555 -0.587 1.641  3.647 -2.006 1.428  34.451 2.514   0.637  3.737 2.408   3.381 
34.537 2  DD_DG2DA3:DT6DC7_CC D 2 ? C 7 ? D 3 ? C 6 ? 
1 B DA 3 1_555 A DT 6 1_555 B DG 4 1_555 A DC 5 1_555 0.736  -0.023 2.888 -0.747 0.258  37.600 -0.066  -1.228 2.873 0.400   1.159 
37.608 3  DD_DA3DG4:DC5DT6_CC D 3 ? C 6 ? D 4 ? C 5 ? 
1 B DG 4 1_555 A DC 5 1_555 B DC 5 1_555 A DG 4 1_555 -0.226 -0.228 4.006 -1.219 -2.540 34.736 0.093   0.150  4.018 -4.245  2.037 
34.847 4  DD_DG4DC5:DG4DC5_CC D 4 ? C 5 ? D 5 ? C 4 ? 
1 B DC 5 1_555 A DG 4 1_555 B DT 6 1_555 A DA 3 1_555 0.464  0.155  3.072 6.200  -0.500 33.024 0.346   0.164  3.102 -0.870  
-10.789 33.589 5  DD_DC5DT6:DA3DG4_CC D 5 ? C 4 ? D 6 ? C 3 ? 
1 B DT 6 1_555 A DA 3 1_555 B DC 7 1_555 A DG 2 1_555 -0.029 -0.223 3.134 1.826  -0.475 34.273 -0.307  0.323  3.131 -0.805  -3.095 
34.323 6  DD_DT6DC7:DG2DA3_CC D 6 ? C 3 ? D 7 ? C 2 ? 
1 B DC 7 1_555 A DG 2 1_555 B DG 8 1_555 A DC 1 1_555 0.200  -0.921 3.685 -6.298 11.888 38.259 -2.776  -1.054 3.201 17.491  9.267 
40.472 7  DD_DC7DG8:DC1DG2_CC D 7 ? C 2 ? D 8 ? C 1 ? 
1 B DG 8 1_555 A DC 1 1_555 C DC 1 1_555 D DG 8 1_555 0.115  -4.933 3.675 0.430  7.134  -0.101 -28.667 5.040  4.969 -89.033 5.370 
-7.148 8  DE_DG8DC1:DG8DC1_FC D 8 ? C 1 ? E 1 ? F 8 ? 
1 C DC 1 1_555 D DG 8 1_555 C DG 2 1_555 D DC 7 1_555 -0.034 -0.427 3.090 4.944  10.729 32.453 -2.262  0.769  2.779 18.452  -8.503 
34.481 9  EE_DC1DG2:DC7DG8_FF E 1 ? F 8 ? E 2 ? F 7 ? 
1 C DG 2 1_555 D DC 7 1_555 C DA 3 1_555 D DT 6 1_555 -0.188 0.665  3.455 -0.939 -4.721 43.498 1.364   0.158  3.372 -6.348  1.263 
43.751 10 EE_DG2DA3:DT6DC7_FF E 2 ? F 7 ? E 3 ? F 6 ? 
1 C DA 3 1_555 D DT 6 1_555 C DG 4 1_555 D DC 5 1_555 -0.138 -0.435 3.527 -3.700 3.714  26.238 -1.975  -0.733 3.421 8.079   8.048 
26.747 11 EE_DA3DG4:DC5DT6_FF E 3 ? F 6 ? E 4 ? F 5 ? 
1 C DG 4 1_555 D DC 5 1_555 C DC 5 1_555 D DG 4 1_555 0.827  -0.194 3.253 1.395  0.625  38.542 -0.371  -1.080 3.276 0.946   -2.112 
38.571 12 EE_DG4DC5:DG4DC5_FF E 4 ? F 5 ? E 5 ? F 4 ? 
1 C DC 5 1_555 D DG 4 1_555 C DT 6 1_555 D DA 3 1_555 -0.419 -0.002 3.408 4.164  5.668  34.577 -0.873  1.332  3.296 9.416   -6.918 
35.263 13 EE_DC5DT6:DA3DG4_FF E 5 ? F 4 ? E 6 ? F 3 ? 
1 C DT 6 1_555 D DA 3 1_555 C DC 7 1_555 D DG 2 1_555 1.354  -0.262 3.657 0.208  8.077  33.595 -1.832  -2.245 3.509 13.729  -0.353 
34.526 14 EE_DT6DC7:DG2DA3_FF E 6 ? F 3 ? E 7 ? F 2 ? 
1 C DC 7 1_555 D DG 2 1_555 C DG 8 1_555 D DC 1 1_555 -0.540 1.242  3.008 6.118  2.929  31.840 1.746   1.949  2.956 5.264   
-10.995 32.536 15 EE_DC7DG8:DC1DG2_FF E 7 ? F 2 ? E 8 ? F 1 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#