data_2STT
# 
_entry.id   2STT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2STT         
WWPDB D_1000178655 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1997-03-12 
_pdbx_database_PDB_obs_spr.pdb_id           2STT 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1STT 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2STW 
_pdbx_database_related.details        'RESTRAINED REGULARIZED MEAN STRUCTURE' 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2STT 
_pdbx_database_status.recvd_initial_deposition_date   1996-08-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Werner, M.H.'     2 
'Gronenborn, A.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Correction of the NMR structure of the ETS1/DNA complex.' 
_citation.journal_abbrev            J.Biomol.NMR 
_citation.journal_volume            10 
_citation.page_first                317 
_citation.page_last                 328 
_citation.year                      1997 
_citation.journal_id_ASTM           JBNME9 
_citation.country                   NE 
_citation.journal_id_ISSN           0925-2738 
_citation.journal_id_CSD            0800 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9460239 
_citation.pdbx_database_id_DOI      10.1023/A:1018399711996 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Werner, M.H.'     1 
primary 'Clore, G.M.'      2 
primary 'Fisher, C.L.'     3 
primary 'Fisher, R.J.'     4 
primary 'Trinh, L.'        5 
primary 'Shiloach, J.'     6 
primary 'Gronenborn, A.M.' 7 
# 
_cell.entry_id           2STT 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2STT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3')
;
5252.410  1 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3')
;
5163.348  1 ? ? ? ? 
3 polymer nat ETS1                                                                11255.954 1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DG)(DC)(DC)(DG)(DG)(DA)(DA)(DG)(DT)(DT)(DC)(DG)(DA)' TCGAGCCGGAAGTTCGA B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DA)(DC)(DT)(DT)(DC)(DC)(DG)(DG)(DC)(DT)(DC)(DG)(DA)' TCGAACTTCCGGCTCGA C ? 
3 'polypeptide(L)'        no no 
;VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFV
;
;VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFV
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DC  n 
1 3  DG  n 
1 4  DA  n 
1 5  DG  n 
1 6  DC  n 
1 7  DC  n 
1 8  DG  n 
1 9  DG  n 
1 10 DA  n 
1 11 DA  n 
1 12 DG  n 
1 13 DT  n 
1 14 DT  n 
1 15 DC  n 
1 16 DG  n 
1 17 DA  n 
2 1  DT  n 
2 2  DC  n 
2 3  DG  n 
2 4  DA  n 
2 5  DA  n 
2 6  DC  n 
2 7  DT  n 
2 8  DT  n 
2 9  DC  n 
2 10 DC  n 
2 11 DG  n 
2 12 DG  n 
2 13 DC  n 
2 14 DT  n 
2 15 DC  n 
2 16 DG  n 
2 17 DA  n 
3 1  VAL n 
3 2  ILE n 
3 3  PRO n 
3 4  ALA n 
3 5  ALA n 
3 6  ALA n 
3 7  LEU n 
3 8  ALA n 
3 9  GLY n 
3 10 TYR n 
3 11 THR n 
3 12 GLY n 
3 13 SER n 
3 14 GLY n 
3 15 PRO n 
3 16 ILE n 
3 17 GLN n 
3 18 LEU n 
3 19 TRP n 
3 20 GLN n 
3 21 PHE n 
3 22 LEU n 
3 23 LEU n 
3 24 GLU n 
3 25 LEU n 
3 26 LEU n 
3 27 THR n 
3 28 ASP n 
3 29 LYS n 
3 30 SER n 
3 31 CYS n 
3 32 GLN n 
3 33 SER n 
3 34 PHE n 
3 35 ILE n 
3 36 SER n 
3 37 TRP n 
3 38 THR n 
3 39 GLY n 
3 40 ASP n 
3 41 GLY n 
3 42 TRP n 
3 43 GLU n 
3 44 PHE n 
3 45 LYS n 
3 46 LEU n 
3 47 SER n 
3 48 ASP n 
3 49 PRO n 
3 50 ASP n 
3 51 GLU n 
3 52 VAL n 
3 53 ALA n 
3 54 ARG n 
3 55 ARG n 
3 56 TRP n 
3 57 GLY n 
3 58 LYS n 
3 59 ARG n 
3 60 LYS n 
3 61 ASN n 
3 62 LYS n 
3 63 PRO n 
3 64 LYS n 
3 65 MET n 
3 66 ASN n 
3 67 TYR n 
3 68 GLU n 
3 69 LYS n 
3 70 LEU n 
3 71 SER n 
3 72 ARG n 
3 73 GLY n 
3 74 LEU n 
3 75 ARG n 
3 76 TYR n 
3 77 TYR n 
3 78 TYR n 
3 79 ASP n 
3 80 LYS n 
3 81 ASN n 
3 82 ILE n 
3 83 ILE n 
3 84 HIS n 
3 85 LYS n 
3 86 THR n 
3 87 ALA n 
3 88 GLY n 
3 89 LYS n 
3 90 ARG n 
3 91 TYR n 
3 92 VAL n 
3 93 TYR n 
3 94 ARG n 
3 95 PHE n 
3 96 VAL n 
# 
_entity_src_nat.entity_id                  3 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP ETS1_HUMAN P14921 3 320 ? ? 
2 PDB 2STT       2STT   1 ?   ? ? 
3 PDB 2STT       2STT   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2STT A 1 ? 96 ? P14921 320 ? 415 ? 10 105 
2 2 2STT B 1 ? 17 ? 2STT   1   ? 17  ? 1  17  
3 3 2STT C 1 ? 17 ? 2STT   18  ? 34  ? 18 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         305.00 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.80 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AMX500 Bruker 500 
2 AMX600 Bruker 600 
# 
_pdbx_nmr_refine.entry_id           2STT 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE RESTRAINED REGULARIZED MEAN STRUCTURE IS PRESENTED IN
ENTRY 2STW AND 25 STRUCTURES ARE PRESENTED IN ENTRY 2STT.
IN 2STW THE LAST COLUMN REPRESENTS THE RMS OF THE 25
INDIVIDUAL SIMULATED ANNEALING STRUCTURES ABOUT THE MEAN
COORDINATE POSITIONS.  THE LAST COLUMN IN THE INDIVIDUAL SA
STRUCTURES HAS NO MEANING.  BEST FITTING TO GENERATE THE
AVERAGE STRUCTURE IS WITH RESPECT TO RESIDUES 24 - 105 OF
THE PROTEIN AND BASE PAIRS 1 - 17 OF THE DNA (RESIDUES 10 -
24 ARE DISORDERED IN SOLUTION).  RESIDUE 10 CORRESPONDS TO
RESIDUE 320 OF THE NATURAL SEQUENCE.  NOTE THE OCCUPANCY
FIELD HAS NO MEANING.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             2STT 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    25 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' XPLOR ? ? 1 
refinement           XPLOR ? ? 2 
# 
_exptl.entry_id          2STT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2STT 
_struct.title                     'SOLUTION NMR STRUCTURE OF THE HUMAN ETS1/DNA COMPLEX, 25 STRUCTURES' 
_struct.pdbx_descriptor           'ETS1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2STT 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'DEOXYRIBONUCLEIC ACID, COMPLEX (DNA-BINDING PROTEIN-DNA), DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 LEU C 18 ? THR C 27 ? LEU A 27 THR A 36 1 ? 10 
HELX_P HELX_P2 H2 SER C 30 ? GLN C 32 ? SER A 39 GLN A 41 5 ? 3  
HELX_P HELX_P3 H3 ASP C 50 ? LYS C 58 ? ASP A 59 LYS A 67 5 ? 9  
HELX_P HELX_P4 H4 TYR C 67 ? TYR C 76 ? TYR A 76 TYR A 85 5 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 1  N3 ? ? ? 1_555 B DA 17 N1 ? ? B DT 1  C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA 17 N6 ? ? B DT 1  C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 16 N1 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 16 O6 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 16 N2 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 15 N3 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 15 O2 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 15 N4 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA 4  C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA 4  C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC 13 N3 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC 13 O2 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC 13 N4 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 12 N1 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 12 O6 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 12 N2 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 10 N3 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 10 O2 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 10 N4 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 9  N3 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 9  O2 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 9  N4 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 8  N3 ? ? B DA 10 C DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 8  O4 ? ? B DA 10 C DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 7  N3 ? ? B DA 11 C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 7  O4 ? ? B DA 11 C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 6  N3 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 6  O2 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 6  N4 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 13 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 13 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 4  N1 ? ? B DT 14 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 4  N6 ? ? B DT 14 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DC 15 N3 ? ? ? 1_555 B DG 3  N1 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG 3  O6 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DC 15 O2 ? ? ? 1_555 B DG 3  N2 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DG 16 N1 ? ? ? 1_555 B DC 2  N3 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DG 16 N2 ? ? ? 1_555 B DC 2  O2 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DG 16 O6 ? ? ? 1_555 B DC 2  N4 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 1  N3 ? ? B DA 17 C DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 1  O4 ? ? B DA 17 C DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 36 ? THR C 38 ? SER A 45  THR A 47  
A 2 GLU C 43 ? LYS C 45 ? GLU A 52  LYS A 54  
B 1 ILE C 83 ? LYS C 85 ? ILE A 92  LYS A 94  
B 2 TYR C 93 ? PHE C 95 ? TYR A 102 PHE A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 36 ? O SER A 45 N LYS C 45 ? N LYS A 54  
B 1 2 O HIS C 84 ? O HIS A 93 N ARG C 94 ? N ARG A 103 
# 
_database_PDB_matrix.entry_id          2STT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2STT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'"  . DT  A 1 1  ? -70.787  -19.959 -24.210 1.00 1.83 ? 1   DT  B "O5'"  1  
ATOM 2     C "C5'"  . DT  A 1 1  ? -70.347  -20.152 -25.559 1.00 1.89 ? 1   DT  B "C5'"  1  
ATOM 3     C "C4'"  . DT  A 1 1  ? -70.752  -18.984 -26.464 1.00 1.80 ? 1   DT  B "C4'"  1  
ATOM 4     O "O4'"  . DT  A 1 1  ? -72.144  -19.121 -26.828 1.00 1.79 ? 1   DT  B "O4'"  1  
ATOM 5     C "C3'"  . DT  A 1 1  ? -70.571  -17.624 -25.776 1.00 1.66 ? 1   DT  B "C3'"  1  
ATOM 6     O "O3'"  . DT  A 1 1  ? -69.815  -16.729 -26.587 1.00 1.67 ? 1   DT  B "O3'"  1  
ATOM 7     C "C2'"  . DT  A 1 1  ? -71.967  -17.084 -25.578 1.00 1.56 ? 1   DT  B "C2'"  1  
ATOM 8     C "C1'"  . DT  A 1 1  ? -72.914  -18.003 -26.333 1.00 1.64 ? 1   DT  B "C1'"  1  
ATOM 9     N N1     . DT  A 1 1  ? -74.019  -18.448 -25.432 1.00 1.61 ? 1   DT  B N1     1  
ATOM 10    C C2     . DT  A 1 1  ? -75.309  -18.030 -25.727 1.00 1.58 ? 1   DT  B C2     1  
ATOM 11    O O2     . DT  A 1 1  ? -75.557  -17.340 -26.716 1.00 1.58 ? 1   DT  B O2     1  
ATOM 12    N N3     . DT  A 1 1  ? -76.300  -18.443 -24.855 1.00 1.57 ? 1   DT  B N3     1  
ATOM 13    C C4     . DT  A 1 1  ? -76.122  -19.230 -23.726 1.00 1.61 ? 1   DT  B C4     1  
ATOM 14    O O4     . DT  A 1 1  ? -77.078  -19.538 -23.019 1.00 1.63 ? 1   DT  B O4     1  
ATOM 15    C C5     . DT  A 1 1  ? -74.747  -19.624 -23.496 1.00 1.64 ? 1   DT  B C5     1  
ATOM 16    C C7     . DT  A 1 1  ? -74.404  -20.513 -22.300 1.00 1.70 ? 1   DT  B C7     1  
ATOM 17    C C6     . DT  A 1 1  ? -73.760  -19.233 -24.332 1.00 1.64 ? 1   DT  B C6     1  
ATOM 18    H "H5'"  . DT  A 1 1  ? -70.791  -21.067 -25.949 1.00 2.00 ? 1   DT  B "H5'"  1  
ATOM 19    H "H5''" . DT  A 1 1  ? -69.263  -20.250 -25.568 1.00 1.93 ? 1   DT  B "H5''" 1  
ATOM 20    H "H4'"  . DT  A 1 1  ? -70.138  -19.007 -27.364 1.00 1.87 ? 1   DT  B "H4'"  1  
ATOM 21    H "H3'"  . DT  A 1 1  ? -70.071  -17.737 -24.812 1.00 1.66 ? 1   DT  B "H3'"  1  
ATOM 22    H "H2'"  . DT  A 1 1  ? -72.221  -17.088 -24.520 1.00 1.50 ? 1   DT  B "H2'"  1  
ATOM 23    H "H2''" . DT  A 1 1  ? -72.032  -16.070 -25.973 1.00 1.50 ? 1   DT  B "H2''" 1  
ATOM 24    H "H1'"  . DT  A 1 1  ? -73.327  -17.465 -27.192 1.00 1.64 ? 1   DT  B "H1'"  1  
ATOM 25    H H3     . DT  A 1 1  ? -77.243  -18.130 -25.054 1.00 1.57 ? 1   DT  B H3     1  
ATOM 26    H H71    . DT  A 1 1  ? -74.281  -21.540 -22.641 1.00 1.80 ? 1   DT  B H71    1  
ATOM 27    H H72    . DT  A 1 1  ? -75.208  -20.468 -21.560 1.00 2.13 ? 1   DT  B H72    1  
ATOM 28    H H73    . DT  A 1 1  ? -73.477  -20.170 -21.847 1.00 2.05 ? 1   DT  B H73    1  
ATOM 29    H H6     . DT  A 1 1  ? -72.736  -19.542 -24.128 1.00 1.68 ? 1   DT  B H6     1  
ATOM 30    H "HO5'" . DT  A 1 1  ? -70.103  -20.305 -23.634 1.00 1.92 ? 1   DT  B "HO5'" 1  
ATOM 31    P P      . DC  A 1 2  ? -69.403  -15.292 -26.001 1.00 1.58 ? 2   DC  B P      1  
ATOM 32    O OP1    . DC  A 1 2  ? -68.342  -14.729 -26.862 1.00 1.68 ? 2   DC  B OP1    1  
ATOM 33    O OP2    . DC  A 1 2  ? -69.169  -15.441 -24.544 1.00 1.55 ? 2   DC  B OP2    1  
ATOM 34    O "O5'"  . DC  A 1 2  ? -70.746  -14.425 -26.222 1.00 1.47 ? 2   DC  B "O5'"  1  
ATOM 35    C "C5'"  . DC  A 1 2  ? -71.133  -14.033 -27.546 1.00 1.50 ? 2   DC  B "C5'"  1  
ATOM 36    C "C4'"  . DC  A 1 2  ? -72.182  -12.902 -27.548 1.00 1.41 ? 2   DC  B "C4'"  1  
ATOM 37    O "O4'"  . DC  A 1 2  ? -73.479  -13.435 -27.183 1.00 1.38 ? 2   DC  B "O4'"  1  
ATOM 38    C "C3'"  . DC  A 1 2  ? -71.834  -11.773 -26.564 1.00 1.31 ? 2   DC  B "C3'"  1  
ATOM 39    O "O3'"  . DC  A 1 2  ? -71.814  -10.500 -27.232 1.00 1.32 ? 2   DC  B "O3'"  1  
ATOM 40    C "C2'"  . DC  A 1 2  ? -72.943  -11.769 -25.538 1.00 1.21 ? 2   DC  B "C2'"  1  
ATOM 41    C "C1'"  . DC  A 1 2  ? -74.023  -12.737 -26.038 1.00 1.25 ? 2   DC  B "C1'"  1  
ATOM 42    N N1     . DC  A 1 2  ? -74.444  -13.701 -24.966 1.00 1.21 ? 2   DC  B N1     1  
ATOM 43    C C2     . DC  A 1 2  ? -75.809  -13.812 -24.672 1.00 1.17 ? 2   DC  B C2     1  
ATOM 44    O O2     . DC  A 1 2  ? -76.633  -13.140 -25.287 1.00 1.17 ? 2   DC  B O2     1  
ATOM 45    N N3     . DC  A 1 2  ? -76.192  -14.682 -23.698 1.00 1.17 ? 2   DC  B N3     1  
ATOM 46    C C4     . DC  A 1 2  ? -75.291  -15.415 -23.032 1.00 1.21 ? 2   DC  B C4     1  
ATOM 47    N N4     . DC  A 1 2  ? -75.716  -16.265 -22.093 1.00 1.25 ? 2   DC  B N4     1  
ATOM 48    C C5     . DC  A 1 2  ? -73.896  -15.309 -23.323 1.00 1.24 ? 2   DC  B C5     1  
ATOM 49    C C6     . DC  A 1 2  ? -73.520  -14.449 -24.291 1.00 1.24 ? 2   DC  B C6     1  
ATOM 50    H "H5'"  . DC  A 1 2  ? -71.547  -14.897 -28.064 1.00 1.62 ? 2   DC  B "H5'"  1  
ATOM 51    H "H5''" . DC  A 1 2  ? -70.245  -13.696 -28.083 1.00 1.58 ? 2   DC  B "H5''" 1  
ATOM 52    H "H4'"  . DC  A 1 2  ? -72.245  -12.481 -28.553 1.00 1.47 ? 2   DC  B "H4'"  1  
ATOM 53    H "H3'"  . DC  A 1 2  ? -70.871  -11.960 -26.084 1.00 1.33 ? 2   DC  B "H3'"  1  
ATOM 54    H "H2'"  . DC  A 1 2  ? -72.562  -12.075 -24.565 1.00 1.18 ? 2   DC  B "H2'"  1  
ATOM 55    H "H2''" . DC  A 1 2  ? -73.354  -10.764 -25.463 1.00 1.17 ? 2   DC  B "H2''" 1  
ATOM 56    H "H1'"  . DC  A 1 2  ? -74.895  -12.156 -26.371 1.00 1.24 ? 2   DC  B "H1'"  1  
ATOM 57    H H41    . DC  A 1 2  ? -76.703  -16.338 -21.889 1.00 1.24 ? 2   DC  B H41    1  
ATOM 58    H H42    . DC  A 1 2  ? -75.050  -16.835 -21.588 1.00 1.29 ? 2   DC  B H42    1  
ATOM 59    H H5     . DC  A 1 2  ? -73.158  -15.897 -22.776 1.00 1.29 ? 2   DC  B H5     1  
ATOM 60    H H6     . DC  A 1 2  ? -72.464  -14.343 -24.533 1.00 1.28 ? 2   DC  B H6     1  
ATOM 61    P P      . DG  A 1 3  ? -71.492  -9.128  -26.426 1.00 1.27 ? 3   DG  B P      1  
ATOM 62    O OP1    . DG  A 1 3  ? -70.756  -8.224  -27.338 1.00 1.42 ? 3   DG  B OP1    1  
ATOM 63    O OP2    . DG  A 1 3  ? -70.915  -9.476  -25.110 1.00 1.23 ? 3   DG  B OP2    1  
ATOM 64    O "O5'"  . DG  A 1 3  ? -72.959  -8.501  -26.172 1.00 1.15 ? 3   DG  B "O5'"  1  
ATOM 65    C "C5'"  . DG  A 1 3  ? -73.741  -8.035  -27.276 1.00 1.23 ? 3   DG  B "C5'"  1  
ATOM 66    C "C4'"  . DG  A 1 3  ? -75.178  -7.698  -26.870 1.00 1.13 ? 3   DG  B "C4'"  1  
ATOM 67    O "O4'"  . DG  A 1 3  ? -75.727  -8.782  -26.080 1.00 1.06 ? 3   DG  B "O4'"  1  
ATOM 68    C "C3'"  . DG  A 1 3  ? -75.257  -6.410  -26.039 1.00 1.07 ? 3   DG  B "C3'"  1  
ATOM 69    O "O3'"  . DG  A 1 3  ? -76.197  -5.490  -26.613 1.00 1.13 ? 3   DG  B "O3'"  1  
ATOM 70    C "C2'"  . DG  A 1 3  ? -75.747  -6.848  -24.677 1.00 0.93 ? 3   DG  B "C2'"  1  
ATOM 71    C "C1'"  . DG  A 1 3  ? -76.142  -8.309  -24.787 1.00 0.93 ? 3   DG  B "C1'"  1  
ATOM 72    N N9     . DG  A 1 3  ? -75.515  -9.086  -23.708 1.00 0.86 ? 3   DG  B N9     1  
ATOM 73    C C8     . DG  A 1 3  ? -74.192  -9.299  -23.458 1.00 0.87 ? 3   DG  B C8     1  
ATOM 74    N N7     . DG  A 1 3  ? -73.939  -10.029 -22.419 1.00 0.84 ? 3   DG  B N7     1  
ATOM 75    C C5     . DG  A 1 3  ? -75.206  -10.329 -21.929 1.00 0.79 ? 3   DG  B C5     1  
ATOM 76    C C6     . DG  A 1 3  ? -75.579  -11.099 -20.802 1.00 0.76 ? 3   DG  B C6     1  
ATOM 77    O O6     . DG  A 1 3  ? -74.852  -11.678 -20.002 1.00 0.77 ? 3   DG  B O6     1  
ATOM 78    N N1     . DG  A 1 3  ? -76.953  -11.153 -20.654 1.00 0.76 ? 3   DG  B N1     1  
ATOM 79    C C2     . DG  A 1 3  ? -77.862  -10.546 -21.482 1.00 0.79 ? 3   DG  B C2     1  
ATOM 80    N N2     . DG  A 1 3  ? -79.142  -10.711 -21.156 1.00 0.83 ? 3   DG  B N2     1  
ATOM 81    N N3     . DG  A 1 3  ? -77.521  -9.820  -22.553 1.00 0.81 ? 3   DG  B N3     1  
ATOM 82    C C4     . DG  A 1 3  ? -76.178  -9.756  -22.713 1.00 0.80 ? 3   DG  B C4     1  
ATOM 83    H "H5'"  . DG  A 1 3  ? -73.768  -8.812  -28.038 1.00 1.32 ? 3   DG  B "H5'"  1  
ATOM 84    H "H5''" . DG  A 1 3  ? -73.275  -7.143  -27.694 1.00 1.34 ? 3   DG  B "H5''" 1  
ATOM 85    H "H4'"  . DG  A 1 3  ? -75.783  -7.578  -27.766 1.00 1.19 ? 3   DG  B "H4'"  1  
ATOM 86    H "H3'"  . DG  A 1 3  ? -74.277  -5.932  -25.951 1.00 1.13 ? 3   DG  B "H3'"  1  
ATOM 87    H "H2'"  . DG  A 1 3  ? -74.959  -6.733  -23.930 1.00 0.91 ? 3   DG  B "H2'"  1  
ATOM 88    H "H2''" . DG  A 1 3  ? -76.612  -6.254  -24.391 1.00 0.92 ? 3   DG  B "H2''" 1  
ATOM 89    H "H1'"  . DG  A 1 3  ? -77.230  -8.404  -24.711 1.00 0.92 ? 3   DG  B "H1'"  1  
ATOM 90    H H8     . DG  A 1 3  ? -73.403  -8.875  -24.081 1.00 0.94 ? 3   DG  B H8     1  
ATOM 91    H H1     . DG  A 1 3  ? -77.291  -11.690 -19.872 1.00 0.77 ? 3   DG  B H1     1  
ATOM 92    H H21    . DG  A 1 3  ? -79.385  -11.253 -20.341 1.00 0.84 ? 3   DG  B H21    1  
ATOM 93    H H22    . DG  A 1 3  ? -79.867  -10.288 -21.719 1.00 0.87 ? 3   DG  B H22    1  
ATOM 94    P P      . DA  A 1 4  ? -76.496  -4.067  -25.906 1.00 1.15 ? 4   DA  B P      1  
ATOM 95    O OP1    . DA  A 1 4  ? -76.902  -3.097  -26.955 1.00 1.30 ? 4   DA  B OP1    1  
ATOM 96    O OP2    . DA  A 1 4  ? -75.365  -3.750  -25.011 1.00 1.15 ? 4   DA  B OP2    1  
ATOM 97    O "O5'"  . DA  A 1 4  ? -77.783  -4.390  -24.992 1.00 1.04 ? 4   DA  B "O5'"  1  
ATOM 98    C "C5'"  . DA  A 1 4  ? -79.003  -4.818  -25.596 1.00 1.09 ? 4   DA  B "C5'"  1  
ATOM 99    C "C4'"  . DA  A 1 4  ? -80.113  -5.009  -24.567 1.00 1.02 ? 4   DA  B "C4'"  1  
ATOM 100   O "O4'"  . DA  A 1 4  ? -79.769  -6.079  -23.658 1.00 0.95 ? 4   DA  B "O4'"  1  
ATOM 101   C "C3'"  . DA  A 1 4  ? -80.351  -3.736  -23.738 1.00 1.01 ? 4   DA  B "C3'"  1  
ATOM 102   O "O3'"  . DA  A 1 4  ? -81.734  -3.373  -23.748 1.00 1.07 ? 4   DA  B "O3'"  1  
ATOM 103   C "C2'"  . DA  A 1 4  ? -79.934  -4.089  -22.334 1.00 0.92 ? 4   DA  B "C2'"  1  
ATOM 104   C "C1'"  . DA  A 1 4  ? -79.765  -5.601  -22.300 1.00 0.87 ? 4   DA  B "C1'"  1  
ATOM 105   N N9     . DA  A 1 4  ? -78.512  -5.971  -21.617 1.00 0.78 ? 4   DA  B N9     1  
ATOM 106   C C8     . DA  A 1 4  ? -77.240  -5.551  -21.869 1.00 0.79 ? 4   DA  B C8     1  
ATOM 107   N N7     . DA  A 1 4  ? -76.329  -6.067  -21.102 1.00 0.74 ? 4   DA  B N7     1  
ATOM 108   C C5     . DA  A 1 4  ? -77.064  -6.909  -20.263 1.00 0.68 ? 4   DA  B C5     1  
ATOM 109   C C6     . DA  A 1 4  ? -76.698  -7.754  -19.213 1.00 0.65 ? 4   DA  B C6     1  
ATOM 110   N N6     . DA  A 1 4  ? -75.432  -7.928  -18.820 1.00 0.65 ? 4   DA  B N6     1  
ATOM 111   N N1     . DA  A 1 4  ? -77.681  -8.437  -18.596 1.00 0.67 ? 4   DA  B N1     1  
ATOM 112   C C2     . DA  A 1 4  ? -78.949  -8.299  -18.991 1.00 0.73 ? 4   DA  B C2     1  
ATOM 113   N N3     . DA  A 1 4  ? -79.398  -7.527  -19.972 1.00 0.76 ? 4   DA  B N3     1  
ATOM 114   C C4     . DA  A 1 4  ? -78.393  -6.854  -20.569 1.00 0.73 ? 4   DA  B C4     1  
ATOM 115   H "H5'"  . DA  A 1 4  ? -78.831  -5.760  -26.118 1.00 1.15 ? 4   DA  B "H5'"  1  
ATOM 116   H "H5''" . DA  A 1 4  ? -79.324  -4.069  -26.312 1.00 1.22 ? 4   DA  B "H5''" 1  
ATOM 117   H "H4'"  . DA  A 1 4  ? -81.033  -5.271  -25.088 1.00 1.08 ? 4   DA  B "H4'"  1  
ATOM 118   H "H3'"  . DA  A 1 4  ? -79.753  -2.903  -24.113 1.00 1.06 ? 4   DA  B "H3'"  1  
ATOM 119   H "H2'"  . DA  A 1 4  ? -78.989  -3.603  -22.082 1.00 0.92 ? 4   DA  B "H2'"  1  
ATOM 120   H "H2''" . DA  A 1 4  ? -80.707  -3.780  -21.629 1.00 0.95 ? 4   DA  B "H2''" 1  
ATOM 121   H "H1'"  . DA  A 1 4  ? -80.610  -6.049  -21.774 1.00 0.88 ? 4   DA  B "H1'"  1  
ATOM 122   H H8     . DA  A 1 4  ? -77.005  -4.832  -22.652 1.00 0.86 ? 4   DA  B H8     1  
ATOM 123   H H61    . DA  A 1 4  ? -75.226  -8.552  -18.053 1.00 0.65 ? 4   DA  B H61    1  
ATOM 124   H H62    . DA  A 1 4  ? -74.683  -7.436  -19.286 1.00 0.68 ? 4   DA  B H62    1  
ATOM 125   H H2     . DA  A 1 4  ? -79.695  -8.886  -18.450 1.00 0.80 ? 4   DA  B H2     1  
ATOM 126   P P      . DG  A 1 5  ? -82.202  -1.983  -23.086 1.00 1.10 ? 5   DG  B P      1  
ATOM 127   O OP1    . DG  A 1 5  ? -83.426  -1.526  -23.776 1.00 1.25 ? 5   DG  B OP1    1  
ATOM 128   O OP2    . DG  A 1 5  ? -81.023  -1.092  -23.002 1.00 1.13 ? 5   DG  B OP2    1  
ATOM 129   O "O5'"  . DG  A 1 5  ? -82.593  -2.421  -21.586 1.00 1.01 ? 5   DG  B "O5'"  1  
ATOM 130   C "C5'"  . DG  A 1 5  ? -83.873  -2.982  -21.299 1.00 1.03 ? 5   DG  B "C5'"  1  
ATOM 131   C "C4'"  . DG  A 1 5  ? -83.943  -3.516  -19.863 1.00 0.95 ? 5   DG  B "C4'"  1  
ATOM 132   O "O4'"  . DG  A 1 5  ? -82.732  -4.250  -19.545 1.00 0.89 ? 5   DG  B "O4'"  1  
ATOM 133   C "C3'"  . DG  A 1 5  ? -84.095  -2.389  -18.829 1.00 0.96 ? 5   DG  B "C3'"  1  
ATOM 134   O "O3'"  . DG  A 1 5  ? -85.209  -2.657  -17.968 1.00 1.02 ? 5   DG  B "O3'"  1  
ATOM 135   C "C2'"  . DG  A 1 5  ? -82.798  -2.408  -18.042 1.00 0.90 ? 5   DG  B "C2'"  1  
ATOM 136   C "C1'"  . DG  A 1 5  ? -82.142  -3.745  -18.330 1.00 0.84 ? 5   DG  B "C1'"  1  
ATOM 137   N N9     . DG  A 1 5  ? -80.680  -3.600  -18.452 1.00 0.79 ? 5   DG  B N9     1  
ATOM 138   C C8     . DG  A 1 5  ? -79.963  -2.795  -19.286 1.00 0.82 ? 5   DG  B C8     1  
ATOM 139   N N7     . DG  A 1 5  ? -78.673  -2.877  -19.160 1.00 0.79 ? 5   DG  B N7     1  
ATOM 140   C C5     . DG  A 1 5  ? -78.509  -3.821  -18.149 1.00 0.72 ? 5   DG  B C5     1  
ATOM 141   C C6     . DG  A 1 5  ? -77.317  -4.332  -17.569 1.00 0.69 ? 5   DG  B C6     1  
ATOM 142   O O6     . DG  A 1 5  ? -76.155  -4.041  -17.834 1.00 0.70 ? 5   DG  B O6     1  
ATOM 143   N N1     . DG  A 1 5  ? -77.594  -5.269  -16.582 1.00 0.67 ? 5   DG  B N1     1  
ATOM 144   C C2     . DG  A 1 5  ? -78.857  -5.661  -16.200 1.00 0.70 ? 5   DG  B C2     1  
ATOM 145   N N2     . DG  A 1 5  ? -78.920  -6.575  -15.237 1.00 0.73 ? 5   DG  B N2     1  
ATOM 146   N N3     . DG  A 1 5  ? -79.979  -5.182  -16.742 1.00 0.73 ? 5   DG  B N3     1  
ATOM 147   C C4     . DG  A 1 5  ? -79.731  -4.270  -17.710 1.00 0.73 ? 5   DG  B C4     1  
ATOM 148   H "H5'"  . DG  A 1 5  ? -84.067  -3.801  -21.996 1.00 1.09 ? 5   DG  B "H5'"  1  
ATOM 149   H "H5''" . DG  A 1 5  ? -84.636  -2.217  -21.435 1.00 1.10 ? 5   DG  B "H5''" 1  
ATOM 150   H "H4'"  . DG  A 1 5  ? -84.794  -4.190  -19.778 1.00 0.99 ? 5   DG  B "H4'"  1  
ATOM 151   H "H3'"  . DG  A 1 5  ? -84.234  -1.413  -19.307 1.00 1.03 ? 5   DG  B "H3'"  1  
ATOM 152   H "H2'"  . DG  A 1 5  ? -82.143  -1.598  -18.370 1.00 0.93 ? 5   DG  B "H2'"  1  
ATOM 153   H "H2''" . DG  A 1 5  ? -83.002  -2.305  -16.979 1.00 0.93 ? 5   DG  B "H2''" 1  
ATOM 154   H "H1'"  . DG  A 1 5  ? -82.364  -4.441  -17.518 1.00 0.82 ? 5   DG  B "H1'"  1  
ATOM 155   H H8     . DG  A 1 5  ? -80.439  -2.128  -20.005 1.00 0.88 ? 5   DG  B H8     1  
ATOM 156   H H1     . DG  A 1 5  ? -76.797  -5.683  -16.121 1.00 0.66 ? 5   DG  B H1     1  
ATOM 157   H H21    . DG  A 1 5  ? -78.074  -6.938  -14.825 1.00 0.73 ? 5   DG  B H21    1  
ATOM 158   H H22    . DG  A 1 5  ? -79.821  -6.905  -14.920 1.00 0.79 ? 5   DG  B H22    1  
ATOM 159   P P      . DC  A 1 6  ? -85.565  -1.668  -16.746 1.00 1.10 ? 6   DC  B P      1  
ATOM 160   O OP1    . DC  A 1 6  ? -86.921  -2.007  -16.251 1.00 1.23 ? 6   DC  B OP1    1  
ATOM 161   O OP2    . DC  A 1 6  ? -85.257  -0.286  -17.167 1.00 1.16 ? 6   DC  B OP2    1  
ATOM 162   O "O5'"  . DC  A 1 6  ? -84.487  -2.107  -15.632 1.00 1.03 ? 6   DC  B "O5'"  1  
ATOM 163   C "C5'"  . DC  A 1 6  ? -84.483  -3.445  -15.126 1.00 1.10 ? 6   DC  B "C5'"  1  
ATOM 164   C "C4'"  . DC  A 1 6  ? -83.910  -3.517  -13.702 1.00 1.07 ? 6   DC  B "C4'"  1  
ATOM 165   O "O4'"  . DC  A 1 6  ? -82.496  -3.842  -13.754 1.00 1.09 ? 6   DC  B "O4'"  1  
ATOM 166   C "C3'"  . DC  A 1 6  ? -84.059  -2.190  -12.951 1.00 1.06 ? 6   DC  B "C3'"  1  
ATOM 167   O "O3'"  . DC  A 1 6  ? -84.777  -2.386  -11.738 1.00 1.11 ? 6   DC  B "O3'"  1  
ATOM 168   C "C2'"  . DC  A 1 6  ? -82.652  -1.732  -12.633 1.00 1.06 ? 6   DC  B "C2'"  1  
ATOM 169   C "C1'"  . DC  A 1 6  ? -81.725  -2.886  -12.988 1.00 1.04 ? 6   DC  B "C1'"  1  
ATOM 170   N N1     . DC  A 1 6  ? -80.531  -2.412  -13.751 1.00 1.00 ? 6   DC  B N1     1  
ATOM 171   C C2     . DC  A 1 6  ? -79.274  -2.686  -13.224 1.00 0.99 ? 6   DC  B C2     1  
ATOM 172   O O2     . DC  A 1 6  ? -79.182  -3.269  -12.147 1.00 1.02 ? 6   DC  B O2     1  
ATOM 173   N N3     . DC  A 1 6  ? -78.174  -2.285  -13.919 1.00 0.99 ? 6   DC  B N3     1  
ATOM 174   C C4     . DC  A 1 6  ? -78.294  -1.642  -15.081 1.00 1.00 ? 6   DC  B C4     1  
ATOM 175   N N4     . DC  A 1 6  ? -77.193  -1.272  -15.739 1.00 1.03 ? 6   DC  B N4     1  
ATOM 176   C C5     . DC  A 1 6  ? -79.583  -1.351  -15.630 1.00 1.01 ? 6   DC  B C5     1  
ATOM 177   C C6     . DC  A 1 6  ? -80.667  -1.748  -14.939 1.00 1.01 ? 6   DC  B C6     1  
ATOM 178   H "H5'"  . DC  A 1 6  ? -83.884  -4.074  -15.783 1.00 1.21 ? 6   DC  B "H5'"  1  
ATOM 179   H "H5''" . DC  A 1 6  ? -85.508  -3.818  -15.120 1.00 1.26 ? 6   DC  B "H5''" 1  
ATOM 180   H "H4'"  . DC  A 1 6  ? -84.431  -4.298  -13.146 1.00 1.11 ? 6   DC  B "H4'"  1  
ATOM 181   H "H3'"  . DC  A 1 6  ? -84.571  -1.445  -13.566 1.00 1.07 ? 6   DC  B "H3'"  1  
ATOM 182   H "H2'"  . DC  A 1 6  ? -82.399  -0.848  -13.218 1.00 1.07 ? 6   DC  B "H2'"  1  
ATOM 183   H "H2''" . DC  A 1 6  ? -82.577  -1.501  -11.569 1.00 1.11 ? 6   DC  B "H2''" 1  
ATOM 184   H "H1'"  . DC  A 1 6  ? -81.399  -3.373  -12.062 1.00 1.06 ? 6   DC  B "H1'"  1  
ATOM 185   H H41    . DC  A 1 6  ? -76.280  -1.478  -15.352 1.00 1.05 ? 6   DC  B H41    1  
ATOM 186   H H42    . DC  A 1 6  ? -77.266  -0.787  -16.621 1.00 1.05 ? 6   DC  B H42    1  
ATOM 187   H H5     . DC  A 1 6  ? -79.684  -0.824  -16.583 1.00 1.04 ? 6   DC  B H5     1  
ATOM 188   H H6     . DC  A 1 6  ? -81.656  -1.525  -15.322 1.00 1.05 ? 6   DC  B H6     1  
ATOM 189   P P      . DC  A 1 7  ? -85.256  -1.120  -10.878 1.00 1.17 ? 7   DC  B P      1  
ATOM 190   O OP1    . DC  A 1 7  ? -86.272  -1.583  -9.908  1.00 1.38 ? 7   DC  B OP1    1  
ATOM 191   O OP2    . DC  A 1 7  ? -85.579  -0.028  -11.817 1.00 1.32 ? 7   DC  B OP2    1  
ATOM 192   O "O5'"  . DC  A 1 7  ? -83.926  -0.732  -10.058 1.00 0.94 ? 7   DC  B "O5'"  1  
ATOM 193   C "C5'"  . DC  A 1 7  ? -83.547  -1.562  -8.964  1.00 0.92 ? 7   DC  B "C5'"  1  
ATOM 194   C "C4'"  . DC  A 1 7  ? -82.101  -1.330  -8.492  1.00 0.82 ? 7   DC  B "C4'"  1  
ATOM 195   O "O4'"  . DC  A 1 7  ? -81.222  -1.082  -9.621  1.00 0.84 ? 7   DC  B "O4'"  1  
ATOM 196   C "C3'"  . DC  A 1 7  ? -81.960  -0.143  -7.524  1.00 0.82 ? 7   DC  B "C3'"  1  
ATOM 197   O "O3'"  . DC  A 1 7  ? -81.357  -0.576  -6.293  1.00 0.89 ? 7   DC  B "O3'"  1  
ATOM 198   C "C2'"  . DC  A 1 7  ? -81.038  0.831   -8.228  1.00 0.86 ? 7   DC  B "C2'"  1  
ATOM 199   C "C1'"  . DC  A 1 7  ? -80.352  0.037   -9.326  1.00 0.87 ? 7   DC  B "C1'"  1  
ATOM 200   N N1     . DC  A 1 7  ? -80.089  0.877   -10.535 1.00 0.93 ? 7   DC  B N1     1  
ATOM 201   C C2     . DC  A 1 7  ? -78.782  1.325   -10.756 1.00 1.05 ? 7   DC  B C2     1  
ATOM 202   O O2     . DC  A 1 7  ? -77.887  1.034   -9.968  1.00 1.14 ? 7   DC  B O2     1  
ATOM 203   N N3     . DC  A 1 7  ? -78.531  2.083   -11.856 1.00 1.15 ? 7   DC  B N3     1  
ATOM 204   C C4     . DC  A 1 7  ? -79.505  2.392   -12.711 1.00 1.15 ? 7   DC  B C4     1  
ATOM 205   N N4     . DC  A 1 7  ? -79.230  3.146   -13.771 1.00 1.29 ? 7   DC  B N4     1  
ATOM 206   C C5     . DC  A 1 7  ? -80.839  1.941   -12.499 1.00 1.08 ? 7   DC  B C5     1  
ATOM 207   C C6     . DC  A 1 7  ? -81.090  1.191   -11.404 1.00 0.96 ? 7   DC  B C6     1  
ATOM 208   H "H5'"  . DC  A 1 7  ? -83.647  -2.603  -9.274  1.00 1.09 ? 7   DC  B "H5'"  1  
ATOM 209   H "H5''" . DC  A 1 7  ? -84.230  -1.381  -8.134  1.00 0.96 ? 7   DC  B "H5''" 1  
ATOM 210   H "H4'"  . DC  A 1 7  ? -81.764  -2.228  -7.982  1.00 0.89 ? 7   DC  B "H4'"  1  
ATOM 211   H "H3'"  . DC  A 1 7  ? -82.929  0.327   -7.317  1.00 0.86 ? 7   DC  B "H3'"  1  
ATOM 212   H "H2'"  . DC  A 1 7  ? -81.610  1.651   -8.661  1.00 0.92 ? 7   DC  B "H2'"  1  
ATOM 213   H "H2''" . DC  A 1 7  ? -80.302  1.219   -7.522  1.00 0.94 ? 7   DC  B "H2''" 1  
ATOM 214   H "H1'"  . DC  A 1 7  ? -79.409  -0.358  -8.940  1.00 0.95 ? 7   DC  B "H1'"  1  
ATOM 215   H H41    . DC  A 1 7  ? -78.289  3.474   -13.926 1.00 1.39 ? 7   DC  B H41    1  
ATOM 216   H H42    . DC  A 1 7  ? -79.966  3.391   -14.418 1.00 1.35 ? 7   DC  B H42    1  
ATOM 217   H H5     . DC  A 1 7  ? -81.625  2.188   -13.205 1.00 1.17 ? 7   DC  B H5     1  
ATOM 218   H H6     . DC  A 1 7  ? -82.104  0.843   -11.210 1.00 0.96 ? 7   DC  B H6     1  
ATOM 219   P P      . DG  A 1 8  ? -81.319  0.386   -5.001  1.00 0.93 ? 8   DG  B P      1  
ATOM 220   O OP1    . DG  A 1 8  ? -82.159  -0.229  -3.948  1.00 1.16 ? 8   DG  B OP1    1  
ATOM 221   O OP2    . DG  A 1 8  ? -81.593  1.765   -5.449  1.00 1.05 ? 8   DG  B OP2    1  
ATOM 222   O "O5'"  . DG  A 1 8  ? -79.773  0.309   -4.534  1.00 0.77 ? 8   DG  B "O5'"  1  
ATOM 223   C "C5'"  . DG  A 1 8  ? -79.392  -0.460  -3.384  1.00 0.85 ? 8   DG  B "C5'"  1  
ATOM 224   C "C4'"  . DG  A 1 8  ? -78.033  -0.016  -2.818  1.00 0.78 ? 8   DG  B "C4'"  1  
ATOM 225   O "O4'"  . DG  A 1 8  ? -77.069  0.062   -3.885  1.00 0.76 ? 8   DG  B "O4'"  1  
ATOM 226   C "C3'"  . DG  A 1 8  ? -78.104  1.363   -2.139  1.00 0.79 ? 8   DG  B "C3'"  1  
ATOM 227   O "O3'"  . DG  A 1 8  ? -77.596  1.312   -0.805  1.00 0.86 ? 8   DG  B "O3'"  1  
ATOM 228   C "C2'"  . DG  A 1 8  ? -77.231  2.274   -2.967  1.00 0.74 ? 8   DG  B "C2'"  1  
ATOM 229   C "C1'"  . DG  A 1 8  ? -76.587  1.413   -4.040  1.00 0.71 ? 8   DG  B "C1'"  1  
ATOM 230   N N9     . DG  A 1 8  ? -76.921  1.939   -5.371  1.00 0.69 ? 8   DG  B N9     1  
ATOM 231   C C8     . DG  A 1 8  ? -78.150  2.136   -5.930  1.00 0.83 ? 8   DG  B C8     1  
ATOM 232   N N7     . DG  A 1 8  ? -78.137  2.641   -7.126  1.00 0.83 ? 8   DG  B N7     1  
ATOM 233   C C5     . DG  A 1 8  ? -76.774  2.795   -7.388  1.00 0.66 ? 8   DG  B C5     1  
ATOM 234   C C6     . DG  A 1 8  ? -76.117  3.305   -8.542  1.00 0.64 ? 8   DG  B C6     1  
ATOM 235   O O6     . DG  A 1 8  ? -76.616  3.725   -9.582  1.00 0.70 ? 8   DG  B O6     1  
ATOM 236   N N1     . DG  A 1 8  ? -74.739  3.283   -8.393  1.00 0.66 ? 8   DG  B N1     1  
ATOM 237   C C2     . DG  A 1 8  ? -74.065  2.834   -7.277  1.00 0.72 ? 8   DG  B C2     1  
ATOM 238   N N2     . DG  A 1 8  ? -72.729  2.888   -7.341  1.00 0.93 ? 8   DG  B N2     1  
ATOM 239   N N3     . DG  A 1 8  ? -74.674  2.354   -6.189  1.00 0.66 ? 8   DG  B N3     1  
ATOM 240   C C4     . DG  A 1 8  ? -76.023  2.365   -6.315  1.00 0.62 ? 8   DG  B C4     1  
ATOM 241   H "H5'"  . DG  A 1 8  ? -79.329  -1.512  -3.667  1.00 0.98 ? 8   DG  B "H5'"  1  
ATOM 242   H "H5''" . DG  A 1 8  ? -80.153  -0.349  -2.611  1.00 1.03 ? 8   DG  B "H5''" 1  
ATOM 243   H "H4'"  . DG  A 1 8  ? -77.694  -0.752  -2.087  1.00 0.83 ? 8   DG  B "H4'"  1  
ATOM 244   H "H3'"  . DG  A 1 8  ? -79.131  1.736   -2.125  1.00 0.84 ? 8   DG  B "H3'"  1  
ATOM 245   H "H2'"  . DG  A 1 8  ? -77.829  3.063   -3.426  1.00 0.75 ? 8   DG  B "H2'"  1  
ATOM 246   H "H2''" . DG  A 1 8  ? -76.463  2.719   -2.332  1.00 0.78 ? 8   DG  B "H2''" 1  
ATOM 247   H "H1'"  . DG  A 1 8  ? -75.503  1.416   -3.914  1.00 0.75 ? 8   DG  B "H1'"  1  
ATOM 248   H H8     . DG  A 1 8  ? -79.076  1.888   -5.409  1.00 1.00 ? 8   DG  B H8     1  
ATOM 249   H H1     . DG  A 1 8  ? -74.206  3.633   -9.170  1.00 0.73 ? 8   DG  B H1     1  
ATOM 250   H H21    . DG  A 1 8  ? -72.282  3.254   -8.169  1.00 1.01 ? 8   DG  B H21    1  
ATOM 251   H H22    . DG  A 1 8  ? -72.167  2.559   -6.566  1.00 1.04 ? 8   DG  B H22    1  
ATOM 252   P P      . DG  A 1 9  ? -77.578  2.651   0.098   1.00 0.95 ? 9   DG  B P      1  
ATOM 253   O OP1    . DG  A 1 9  ? -77.375  2.258   1.512   1.00 1.13 ? 9   DG  B OP1    1  
ATOM 254   O OP2    . DG  A 1 9  ? -78.754  3.466   -0.279  1.00 0.98 ? 9   DG  B OP2    1  
ATOM 255   O "O5'"  . DG  A 1 9  ? -76.250  3.415   -0.419  1.00 0.87 ? 9   DG  B "O5'"  1  
ATOM 256   C "C5'"  . DG  A 1 9  ? -74.948  2.873   -0.169  1.00 0.94 ? 9   DG  B "C5'"  1  
ATOM 257   C "C4'"  . DG  A 1 9  ? -73.829  3.773   -0.724  1.00 0.87 ? 9   DG  B "C4'"  1  
ATOM 258   O "O4'"  . DG  A 1 9  ? -73.965  3.925   -2.163  1.00 0.82 ? 9   DG  B "O4'"  1  
ATOM 259   C "C3'"  . DG  A 1 9  ? -73.851  5.181   -0.101  1.00 0.85 ? 9   DG  B "C3'"  1  
ATOM 260   O "O3'"  . DG  A 1 9  ? -72.557  5.520   0.428   1.00 0.88 ? 9   DG  B "O3'"  1  
ATOM 261   C "C2'"  . DG  A 1 9  ? -74.211  6.111   -1.242  1.00 0.79 ? 9   DG  B "C2'"  1  
ATOM 262   C "C1'"  . DG  A 1 9  ? -73.986  5.326   -2.520  1.00 0.76 ? 9   DG  B "C1'"  1  
ATOM 263   N N9     . DG  A 1 9  ? -75.035  5.626   -3.516  1.00 0.72 ? 9   DG  B N9     1  
ATOM 264   C C8     . DG  A 1 9  ? -76.386  5.430   -3.440  1.00 0.75 ? 9   DG  B C8     1  
ATOM 265   N N7     . DG  A 1 9  ? -77.057  5.796   -4.489  1.00 0.73 ? 9   DG  B N7     1  
ATOM 266   C C5     . DG  A 1 9  ? -76.068  6.284   -5.346  1.00 0.67 ? 9   DG  B C5     1  
ATOM 267   C C6     . DG  A 1 9  ? -76.181  6.832   -6.655  1.00 0.66 ? 9   DG  B C6     1  
ATOM 268   O O6     . DG  A 1 9  ? -77.188  6.988   -7.338  1.00 0.69 ? 9   DG  B O6     1  
ATOM 269   N N1     . DG  A 1 9  ? -74.943  7.203   -7.159  1.00 0.65 ? 9   DG  B N1     1  
ATOM 270   C C2     . DG  A 1 9  ? -73.742  7.066   -6.497  1.00 0.67 ? 9   DG  B C2     1  
ATOM 271   N N2     . DG  A 1 9  ? -72.662  7.482   -7.160  1.00 0.72 ? 9   DG  B N2     1  
ATOM 272   N N3     . DG  A 1 9  ? -73.628  6.550   -5.267  1.00 0.68 ? 9   DG  B N3     1  
ATOM 273   C C4     . DG  A 1 9  ? -74.829  6.183   -4.756  1.00 0.67 ? 9   DG  B C4     1  
ATOM 274   H "H5'"  . DG  A 1 9  ? -74.879  1.889   -0.635  1.00 1.00 ? 9   DG  B "H5'"  1  
ATOM 275   H "H5''" . DG  A 1 9  ? -74.811  2.764   0.906   1.00 1.08 ? 9   DG  B "H5''" 1  
ATOM 276   H "H4'"  . DG  A 1 9  ? -72.867  3.306   -0.510  1.00 0.91 ? 9   DG  B "H4'"  1  
ATOM 277   H "H3'"  . DG  A 1 9  ? -74.602  5.248   0.691   1.00 0.90 ? 9   DG  B "H3'"  1  
ATOM 278   H "H2'"  . DG  A 1 9  ? -75.259  6.404   -1.174  1.00 0.81 ? 9   DG  B "H2'"  1  
ATOM 279   H "H2''" . DG  A 1 9  ? -73.577  6.997   -1.223  1.00 0.80 ? 9   DG  B "H2''" 1  
ATOM 280   H "H1'"  . DG  A 1 9  ? -73.012  5.593   -2.940  1.00 0.76 ? 9   DG  B "H1'"  1  
ATOM 281   H H8     . DG  A 1 9  ? -76.868  5.010   -2.553  1.00 0.80 ? 9   DG  B H8     1  
ATOM 282   H H1     . DG  A 1 9  ? -74.946  7.613   -8.081  1.00 0.66 ? 9   DG  B H1     1  
ATOM 283   H H21    . DG  A 1 9  ? -72.759  7.869   -8.089  1.00 0.73 ? 9   DG  B H21    1  
ATOM 284   H H22    . DG  A 1 9  ? -71.747  7.408   -6.737  1.00 0.77 ? 9   DG  B H22    1  
ATOM 285   P P      . DA  A 1 10 ? -72.270  6.973   1.081   1.00 0.92 ? 10  DA  B P      1  
ATOM 286   O OP1    . DA  A 1 10 ? -71.022  6.885   1.871   1.00 1.03 ? 10  DA  B OP1    1  
ATOM 287   O OP2    . DA  A 1 10 ? -73.515  7.456   1.720   1.00 0.96 ? 10  DA  B OP2    1  
ATOM 288   O "O5'"  . DA  A 1 10 ? -71.987  7.895   -0.213  1.00 0.84 ? 10  DA  B "O5'"  1  
ATOM 289   C "C5'"  . DA  A 1 10 ? -70.965  7.549   -1.156  1.00 0.84 ? 10  DA  B "C5'"  1  
ATOM 290   C "C4'"  . DA  A 1 10 ? -70.544  8.763   -2.003  1.00 0.80 ? 10  DA  B "C4'"  1  
ATOM 291   O "O4'"  . DA  A 1 10 ? -71.302  8.796   -3.239  1.00 0.75 ? 10  DA  B "O4'"  1  
ATOM 292   C "C3'"  . DA  A 1 10 ? -70.789  10.092  -1.267  1.00 0.83 ? 10  DA  B "C3'"  1  
ATOM 293   O "O3'"  . DA  A 1 10 ? -69.599  10.893  -1.268  1.00 0.87 ? 10  DA  B "O3'"  1  
ATOM 294   C "C2'"  . DA  A 1 10 ? -71.891  10.779  -2.049  1.00 0.78 ? 10  DA  B "C2'"  1  
ATOM 295   C "C1'"  . DA  A 1 10 ? -71.946  10.079  -3.396  1.00 0.74 ? 10  DA  B "C1'"  1  
ATOM 296   N N9     . DA  A 1 10 ? -73.341  9.935   -3.872  1.00 0.70 ? 10  DA  B N9     1  
ATOM 297   C C8     . DA  A 1 10 ? -74.430  9.409   -3.232  1.00 0.71 ? 10  DA  B C8     1  
ATOM 298   N N7     . DA  A 1 10 ? -75.539  9.447   -3.911  1.00 0.69 ? 10  DA  B N7     1  
ATOM 299   C C5     . DA  A 1 10 ? -75.160  10.050  -5.104  1.00 0.65 ? 10  DA  B C5     1  
ATOM 300   C C6     . DA  A 1 10 ? -75.871  10.390  -6.259  1.00 0.64 ? 10  DA  B C6     1  
ATOM 301   N N6     . DA  A 1 10 ? -77.182  10.179  -6.398  1.00 0.63 ? 10  DA  B N6     1  
ATOM 302   N N1     . DA  A 1 10 ? -75.188  10.972  -7.258  1.00 0.65 ? 10  DA  B N1     1  
ATOM 303   C C2     . DA  A 1 10 ? -73.886  11.216  -7.130  1.00 0.67 ? 10  DA  B C2     1  
ATOM 304   N N3     . DA  A 1 10 ? -73.119  10.936  -6.083  1.00 0.68 ? 10  DA  B N3     1  
ATOM 305   C C4     . DA  A 1 10 ? -73.827  10.350  -5.093  1.00 0.67 ? 10  DA  B C4     1  
ATOM 306   H "H5'"  . DA  A 1 10 ? -71.336  6.772   -1.819  1.00 0.87 ? 10  DA  B "H5'"  1  
ATOM 307   H "H5''" . DA  A 1 10 ? -70.098  7.167   -0.613  1.00 0.92 ? 10  DA  B "H5''" 1  
ATOM 308   H "H4'"  . DA  A 1 10 ? -69.480  8.685   -2.242  1.00 0.83 ? 10  DA  B "H4'"  1  
ATOM 309   H "H3'"  . DA  A 1 10 ? -71.111  9.919   -0.238  1.00 0.88 ? 10  DA  B "H3'"  1  
ATOM 310   H "H2'"  . DA  A 1 10 ? -72.849  10.675  -1.533  1.00 0.81 ? 10  DA  B "H2'"  1  
ATOM 311   H "H2''" . DA  A 1 10 ? -71.658  11.836  -2.181  1.00 0.80 ? 10  DA  B "H2''" 1  
ATOM 312   H "H1'"  . DA  A 1 10 ? -71.385  10.666  -4.123  1.00 0.75 ? 10  DA  B "H1'"  1  
ATOM 313   H H8     . DA  A 1 10 ? -74.373  8.985   -2.232  1.00 0.76 ? 10  DA  B H8     1  
ATOM 314   H H61    . DA  A 1 10 ? -77.648  10.442  -7.253  1.00 0.63 ? 10  DA  B H61    1  
ATOM 315   H H62    . DA  A 1 10 ? -77.710  9.760   -5.643  1.00 0.64 ? 10  DA  B H62    1  
ATOM 316   H H2     . DA  A 1 10 ? -73.396  11.689  -7.980  1.00 0.70 ? 10  DA  B H2     1  
ATOM 317   P P      . DA  A 1 11 ? -69.585  12.367  -0.608  1.00 0.93 ? 11  DA  B P      1  
ATOM 318   O OP1    . DA  A 1 11 ? -68.222  12.634  -0.095  1.00 1.04 ? 11  DA  B OP1    1  
ATOM 319   O OP2    . DA  A 1 11 ? -70.752  12.487  0.290   1.00 0.96 ? 11  DA  B OP2    1  
ATOM 320   O "O5'"  . DA  A 1 11 ? -69.835  13.313  -1.884  1.00 0.85 ? 11  DA  B "O5'"  1  
ATOM 321   C "C5'"  . DA  A 1 11 ? -69.150  13.056  -3.110  1.00 0.84 ? 11  DA  B "C5'"  1  
ATOM 322   C "C4'"  . DA  A 1 11 ? -69.386  14.166  -4.138  1.00 0.79 ? 11  DA  B "C4'"  1  
ATOM 323   O "O4'"  . DA  A 1 11 ? -70.592  13.888  -4.895  1.00 0.74 ? 11  DA  B "O4'"  1  
ATOM 324   C "C3'"  . DA  A 1 11 ? -69.546  15.542  -3.485  1.00 0.79 ? 11  DA  B "C3'"  1  
ATOM 325   O "O3'"  . DA  A 1 11 ? -68.631  16.463  -4.077  1.00 0.81 ? 11  DA  B "O3'"  1  
ATOM 326   C "C2'"  . DA  A 1 11 ? -70.968  15.973  -3.773  1.00 0.75 ? 11  DA  B "C2'"  1  
ATOM 327   C "C1'"  . DA  A 1 11 ? -71.521  14.991  -4.801  1.00 0.71 ? 11  DA  B "C1'"  1  
ATOM 328   N N9     . DA  A 1 11 ? -72.875  14.525  -4.420  1.00 0.68 ? 11  DA  B N9     1  
ATOM 329   C C8     . DA  A 1 11 ? -73.319  14.027  -3.227  1.00 0.71 ? 11  DA  B C8     1  
ATOM 330   N N7     . DA  A 1 11 ? -74.585  13.713  -3.196  1.00 0.69 ? 11  DA  B N7     1  
ATOM 331   C C5     . DA  A 1 11 ? -75.020  14.030  -4.484  1.00 0.65 ? 11  DA  B C5     1  
ATOM 332   C C6     . DA  A 1 11 ? -76.272  13.942  -5.119  1.00 0.63 ? 11  DA  B C6     1  
ATOM 333   N N6     . DA  A 1 11 ? -77.377  13.495  -4.520  1.00 0.64 ? 11  DA  B N6     1  
ATOM 334   N N1     . DA  A 1 11 ? -76.344  14.344  -6.401  1.00 0.62 ? 11  DA  B N1     1  
ATOM 335   C C2     . DA  A 1 11 ? -75.266  14.806  -7.026  1.00 0.63 ? 11  DA  B C2     1  
ATOM 336   N N3     . DA  A 1 11 ? -74.043  14.934  -6.522  1.00 0.64 ? 11  DA  B N3     1  
ATOM 337   C C4     . DA  A 1 11 ? -73.988  14.524  -5.234  1.00 0.65 ? 11  DA  B C4     1  
ATOM 338   H "H5'"  . DA  A 1 11 ? -69.501  12.111  -3.525  1.00 0.85 ? 11  DA  B "H5'"  1  
ATOM 339   H "H5''" . DA  A 1 11 ? -68.080  12.978  -2.908  1.00 0.94 ? 11  DA  B "H5''" 1  
ATOM 340   H "H4'"  . DA  A 1 11 ? -68.541  14.201  -4.821  1.00 0.80 ? 11  DA  B "H4'"  1  
ATOM 341   H "H3'"  . DA  A 1 11 ? -69.374  15.490  -2.405  1.00 0.84 ? 11  DA  B "H3'"  1  
ATOM 342   H "H2'"  . DA  A 1 11 ? -71.564  15.937  -2.863  1.00 0.78 ? 11  DA  B "H2'"  1  
ATOM 343   H "H2''" . DA  A 1 11 ? -70.973  16.983  -4.175  1.00 0.76 ? 11  DA  B "H2''" 1  
ATOM 344   H "H1'"  . DA  A 1 11 ? -71.580  15.480  -5.775  1.00 0.70 ? 11  DA  B "H1'"  1  
ATOM 345   H H8     . DA  A 1 11 ? -72.667  13.916  -2.360  1.00 0.76 ? 11  DA  B H8     1  
ATOM 346   H H61    . DA  A 1 11 ? -78.247  13.457  -5.038  1.00 0.64 ? 11  DA  B H61    1  
ATOM 347   H H62    . DA  A 1 11 ? -77.350  13.196  -3.557  1.00 0.67 ? 11  DA  B H62    1  
ATOM 348   H H2     . DA  A 1 11 ? -75.402  15.119  -8.061  1.00 0.65 ? 11  DA  B H2     1  
ATOM 349   P P      . DG  A 1 12 ? -68.559  17.986  -3.575  1.00 0.84 ? 12  DG  B P      1  
ATOM 350   O OP1    . DG  A 1 12 ? -67.199  18.495  -3.858  1.00 0.92 ? 12  DG  B OP1    1  
ATOM 351   O OP2    . DG  A 1 12 ? -69.100  18.048  -2.199  1.00 0.88 ? 12  DG  B OP2    1  
ATOM 352   O "O5'"  . DG  A 1 12 ? -69.599  18.729  -4.559  1.00 0.78 ? 12  DG  B "O5'"  1  
ATOM 353   C "C5'"  . DG  A 1 12 ? -69.594  18.460  -5.968  1.00 0.78 ? 12  DG  B "C5'"  1  
ATOM 354   C "C4'"  . DG  A 1 12 ? -70.637  19.309  -6.715  1.00 0.74 ? 12  DG  B "C4'"  1  
ATOM 355   O "O4'"  . DG  A 1 12 ? -71.937  18.665  -6.679  1.00 0.70 ? 12  DG  B "O4'"  1  
ATOM 356   C "C3'"  . DG  A 1 12 ? -70.790  20.708  -6.097  1.00 0.74 ? 12  DG  B "C3'"  1  
ATOM 357   O "O3'"  . DG  A 1 12 ? -70.678  21.719  -7.105  1.00 0.76 ? 12  DG  B "O3'"  1  
ATOM 358   C "C2'"  . DG  A 1 12 ? -72.177  20.729  -5.499  1.00 0.72 ? 12  DG  B "C2'"  1  
ATOM 359   C "C1'"  . DG  A 1 12 ? -72.926  19.569  -6.138  1.00 0.68 ? 12  DG  B "C1'"  1  
ATOM 360   N N9     . DG  A 1 12 ? -73.810  18.881  -5.166  1.00 0.66 ? 12  DG  B N9     1  
ATOM 361   C C8     . DG  A 1 12 ? -73.535  18.430  -3.904  1.00 0.70 ? 12  DG  B C8     1  
ATOM 362   N N7     . DG  A 1 12 ? -74.532  17.858  -3.295  1.00 0.68 ? 12  DG  B N7     1  
ATOM 363   C C5     . DG  A 1 12 ? -75.567  17.934  -4.228  1.00 0.62 ? 12  DG  B C5     1  
ATOM 364   C C6     . DG  A 1 12 ? -76.916  17.475  -4.137  1.00 0.60 ? 12  DG  B C6     1  
ATOM 365   O O6     . DG  A 1 12 ? -77.468  16.907  -3.197  1.00 0.62 ? 12  DG  B O6     1  
ATOM 366   N N1     . DG  A 1 12 ? -77.625  17.747  -5.304  1.00 0.56 ? 12  DG  B N1     1  
ATOM 367   C C2     . DG  A 1 12 ? -77.111  18.381  -6.414  1.00 0.55 ? 12  DG  B C2     1  
ATOM 368   N N2     . DG  A 1 12 ? -77.950  18.557  -7.434  1.00 0.55 ? 12  DG  B N2     1  
ATOM 369   N N3     . DG  A 1 12 ? -75.844  18.814  -6.502  1.00 0.58 ? 12  DG  B N3     1  
ATOM 370   C C4     . DG  A 1 12 ? -75.134  18.557  -5.377  1.00 0.61 ? 12  DG  B C4     1  
ATOM 371   H "H5'"  . DG  A 1 12 ? -69.810  17.404  -6.133  1.00 0.79 ? 12  DG  B "H5'"  1  
ATOM 372   H "H5''" . DG  A 1 12 ? -68.604  18.683  -6.366  1.00 0.82 ? 12  DG  B "H5''" 1  
ATOM 373   H "H4'"  . DG  A 1 12 ? -70.326  19.417  -7.754  1.00 0.75 ? 12  DG  B "H4'"  1  
ATOM 374   H "H3'"  . DG  A 1 12 ? -70.040  20.877  -5.320  1.00 0.77 ? 12  DG  B "H3'"  1  
ATOM 375   H "H2'"  . DG  A 1 12 ? -72.123  20.590  -4.418  1.00 0.75 ? 12  DG  B "H2'"  1  
ATOM 376   H "H2''" . DG  A 1 12 ? -72.670  21.673  -5.730  1.00 0.73 ? 12  DG  B "H2''" 1  
ATOM 377   H "H1'"  . DG  A 1 12 ? -73.536  19.949  -6.958  1.00 0.66 ? 12  DG  B "H1'"  1  
ATOM 378   H H8     . DG  A 1 12 ? -72.553  18.539  -3.439  1.00 0.75 ? 12  DG  B H8     1  
ATOM 379   H H1     . DG  A 1 12 ? -78.595  17.453  -5.316  1.00 0.56 ? 12  DG  B H1     1  
ATOM 380   H H21    . DG  A 1 12 ? -78.903  18.224  -7.364  1.00 0.55 ? 12  DG  B H21    1  
ATOM 381   H H22    . DG  A 1 12 ? -77.637  19.018  -8.274  1.00 0.57 ? 12  DG  B H22    1  
ATOM 382   P P      . DT  A 1 13 ? -70.765  23.278  -6.715  1.00 0.79 ? 13  DT  B P      1  
ATOM 383   O OP1    . DT  A 1 13 ? -69.769  24.009  -7.530  1.00 0.87 ? 13  DT  B OP1    1  
ATOM 384   O OP2    . DT  A 1 13 ? -70.730  23.387  -5.240  1.00 0.82 ? 13  DT  B OP2    1  
ATOM 385   O "O5'"  . DT  A 1 13 ? -72.245  23.691  -7.222  1.00 0.71 ? 13  DT  B "O5'"  1  
ATOM 386   C "C5'"  . DT  A 1 13 ? -72.455  24.090  -8.580  1.00 0.85 ? 13  DT  B "C5'"  1  
ATOM 387   C "C4'"  . DT  A 1 13 ? -73.945  24.173  -8.962  1.00 0.76 ? 13  DT  B "C4'"  1  
ATOM 388   O "O4'"  . DT  A 1 13 ? -74.683  23.091  -8.337  1.00 0.69 ? 13  DT  B "O4'"  1  
ATOM 389   C "C3'"  . DT  A 1 13 ? -74.597  25.494  -8.538  1.00 0.75 ? 13  DT  B "C3'"  1  
ATOM 390   O "O3'"  . DT  A 1 13 ? -75.200  26.120  -9.674  1.00 0.80 ? 13  DT  B "O3'"  1  
ATOM 391   C "C2'"  . DT  A 1 13 ? -75.665  25.119  -7.532  1.00 0.67 ? 13  DT  B "C2'"  1  
ATOM 392   C "C1'"  . DT  A 1 13 ? -75.802  23.604  -7.576  1.00 0.63 ? 13  DT  B "C1'"  1  
ATOM 393   N N1     . DT  A 1 13 ? -75.827  23.033  -6.198  1.00 0.59 ? 13  DT  B N1     1  
ATOM 394   C C2     . DT  A 1 13 ? -76.940  22.299  -5.812  1.00 0.56 ? 13  DT  B C2     1  
ATOM 395   O O2     . DT  A 1 13 ? -77.891  22.115  -6.569  1.00 0.57 ? 13  DT  B O2     1  
ATOM 396   N N3     . DT  A 1 13 ? -76.916  21.788  -4.529  1.00 0.57 ? 13  DT  B N3     1  
ATOM 397   C C4     . DT  A 1 13 ? -75.893  21.947  -3.607  1.00 0.59 ? 13  DT  B C4     1  
ATOM 398   O O4     . DT  A 1 13 ? -75.974  21.444  -2.492  1.00 0.62 ? 13  DT  B O4     1  
ATOM 399   C C5     . DT  A 1 13 ? -74.778  22.728  -4.093  1.00 0.62 ? 13  DT  B C5     1  
ATOM 400   C C7     . DT  A 1 13 ? -73.590  23.006  -3.171  1.00 0.69 ? 13  DT  B C7     1  
ATOM 401   C C6     . DT  A 1 13 ? -74.778  23.232  -5.338  1.00 0.62 ? 13  DT  B C6     1  
ATOM 402   H "H5'"  . DT  A 1 13 ? -71.973  23.366  -9.232  1.00 0.98 ? 13  DT  B "H5'"  1  
ATOM 403   H "H5''" . DT  A 1 13 ? -71.992  25.064  -8.737  1.00 1.03 ? 13  DT  B "H5''" 1  
ATOM 404   H "H4'"  . DT  A 1 13 ? -74.037  24.082  -10.045 1.00 0.81 ? 13  DT  B "H4'"  1  
ATOM 405   H "H3'"  . DT  A 1 13 ? -73.871  26.174  -8.085  1.00 0.80 ? 13  DT  B "H3'"  1  
ATOM 406   H "H2'"  . DT  A 1 13 ? -75.370  25.442  -6.532  1.00 0.69 ? 13  DT  B "H2'"  1  
ATOM 407   H "H2''" . DT  A 1 13 ? -76.610  25.590  -7.804  1.00 0.68 ? 13  DT  B "H2''" 1  
ATOM 408   H "H1'"  . DT  A 1 13 ? -76.724  23.348  -8.103  1.00 0.62 ? 13  DT  B "H1'"  1  
ATOM 409   H H3     . DT  A 1 13 ? -77.726  21.254  -4.233  1.00 0.57 ? 13  DT  B H3     1  
ATOM 410   H H71    . DT  A 1 13 ? -73.590  22.291  -2.349  1.00 1.29 ? 13  DT  B H71    1  
ATOM 411   H H72    . DT  A 1 13 ? -73.672  24.016  -2.771  1.00 1.19 ? 13  DT  B H72    1  
ATOM 412   H H73    . DT  A 1 13 ? -72.660  22.915  -3.734  1.00 1.26 ? 13  DT  B H73    1  
ATOM 413   H H6     . DT  A 1 13 ? -73.923  23.820  -5.672  1.00 0.66 ? 13  DT  B H6     1  
ATOM 414   P P      . DT  A 1 14 ? -75.961  27.527  -9.540  1.00 0.83 ? 14  DT  B P      1  
ATOM 415   O OP1    . DT  A 1 14 ? -76.022  28.144  -10.883 1.00 0.94 ? 14  DT  B OP1    1  
ATOM 416   O OP2    . DT  A 1 14 ? -75.361  28.268  -8.411  1.00 0.85 ? 14  DT  B OP2    1  
ATOM 417   O "O5'"  . DT  A 1 14 ? -77.451  27.071  -9.126  1.00 0.74 ? 14  DT  B "O5'"  1  
ATOM 418   C "C5'"  . DT  A 1 14 ? -78.316  26.487  -10.105 1.00 0.84 ? 14  DT  B "C5'"  1  
ATOM 419   C "C4'"  . DT  A 1 14 ? -79.693  26.128  -9.532  1.00 0.77 ? 14  DT  B "C4'"  1  
ATOM 420   O "O4'"  . DT  A 1 14 ? -79.535  25.306  -8.350  1.00 0.71 ? 14  DT  B "O4'"  1  
ATOM 421   C "C3'"  . DT  A 1 14 ? -80.496  27.381  -9.133  1.00 0.78 ? 14  DT  B "C3'"  1  
ATOM 422   O "O3'"  . DT  A 1 14 ? -81.794  27.381  -9.745  1.00 0.82 ? 14  DT  B "O3'"  1  
ATOM 423   C "C2'"  . DT  A 1 14 ? -80.650  27.290  -7.633  1.00 0.73 ? 14  DT  B "C2'"  1  
ATOM 424   C "C1'"  . DT  A 1 14 ? -80.301  25.856  -7.259  1.00 0.67 ? 14  DT  B "C1'"  1  
ATOM 425   N N1     . DT  A 1 14 ? -79.551  25.789  -5.969  1.00 0.63 ? 14  DT  B N1     1  
ATOM 426   C C2     . DT  A 1 14 ? -80.101  25.033  -4.941  1.00 0.59 ? 14  DT  B C2     1  
ATOM 427   O O2     . DT  A 1 14 ? -81.166  24.435  -5.072  1.00 0.59 ? 14  DT  B O2     1  
ATOM 428   N N3     . DT  A 1 14 ? -79.391  24.993  -3.758  1.00 0.58 ? 14  DT  B N3     1  
ATOM 429   C C4     . DT  A 1 14 ? -78.190  25.628  -3.510  1.00 0.62 ? 14  DT  B C4     1  
ATOM 430   O O4     . DT  A 1 14 ? -77.641  25.521  -2.418  1.00 0.64 ? 14  DT  B O4     1  
ATOM 431   C C5     . DT  A 1 14 ? -77.685  26.398  -4.628  1.00 0.67 ? 14  DT  B C5     1  
ATOM 432   C C7     . DT  A 1 14 ? -76.376  27.174  -4.460  1.00 0.76 ? 14  DT  B C7     1  
ATOM 433   C C6     . DT  A 1 14 ? -78.363  26.452  -5.800  1.00 0.67 ? 14  DT  B C6     1  
ATOM 434   H "H5'"  . DT  A 1 14 ? -77.850  25.580  -10.493 1.00 0.98 ? 14  DT  B "H5'"  1  
ATOM 435   H "H5''" . DT  A 1 14 ? -78.452  27.192  -10.923 1.00 0.95 ? 14  DT  B "H5''" 1  
ATOM 436   H "H4'"  . DT  A 1 14 ? -80.255  25.571  -10.282 1.00 0.80 ? 14  DT  B "H4'"  1  
ATOM 437   H "H3'"  . DT  A 1 14 ? -79.958  28.294  -9.407  1.00 0.82 ? 14  DT  B "H3'"  1  
ATOM 438   H "H2'"  . DT  A 1 14 ? -79.976  27.991  -7.142  1.00 0.76 ? 14  DT  B "H2'"  1  
ATOM 439   H "H2''" . DT  A 1 14 ? -81.676  27.513  -7.351  1.00 0.77 ? 14  DT  B "H2''" 1  
ATOM 440   H "H1'"  . DT  A 1 14 ? -81.230  25.280  -7.178  1.00 0.67 ? 14  DT  B "H1'"  1  
ATOM 441   H H3     . DT  A 1 14 ? -79.787  24.456  -3.008  1.00 0.57 ? 14  DT  B H3     1  
ATOM 442   H H71    . DT  A 1 14 ? -76.544  28.006  -3.777  1.00 1.13 ? 14  DT  B H71    1  
ATOM 443   H H72    . DT  A 1 14 ? -76.036  27.559  -5.424  1.00 1.27 ? 14  DT  B H72    1  
ATOM 444   H H73    . DT  A 1 14 ? -75.612  26.515  -4.044  1.00 1.35 ? 14  DT  B H73    1  
ATOM 445   H H6     . DT  A 1 14 ? -77.961  27.039  -6.625  1.00 0.73 ? 14  DT  B H6     1  
ATOM 446   P P      . DC  A 1 15 ? -82.805  28.618  -9.506  1.00 0.87 ? 15  DC  B P      1  
ATOM 447   O OP1    . DC  A 1 15 ? -83.318  29.061  -10.822 1.00 1.04 ? 15  DC  B OP1    1  
ATOM 448   O OP2    . DC  A 1 15 ? -82.131  29.587  -8.614  1.00 0.93 ? 15  DC  B OP2    1  
ATOM 449   O "O5'"  . DC  A 1 15 ? -84.025  27.945  -8.688  1.00 0.78 ? 15  DC  B "O5'"  1  
ATOM 450   C "C5'"  . DC  A 1 15 ? -84.622  26.720  -9.134  1.00 0.88 ? 15  DC  B "C5'"  1  
ATOM 451   C "C4'"  . DC  A 1 15 ? -85.808  26.305  -8.259  1.00 0.86 ? 15  DC  B "C4'"  1  
ATOM 452   O "O4'"  . DC  A 1 15 ? -85.329  25.758  -7.014  1.00 0.80 ? 15  DC  B "O4'"  1  
ATOM 453   C "C3'"  . DC  A 1 15 ? -86.736  27.480  -7.942  1.00 0.90 ? 15  DC  B "C3'"  1  
ATOM 454   O "O3'"  . DC  A 1 15 ? -88.085  27.142  -8.267  1.00 1.04 ? 15  DC  B "O3'"  1  
ATOM 455   C "C2'"  . DC  A 1 15 ? -86.604  27.710  -6.455  1.00 0.87 ? 15  DC  B "C2'"  1  
ATOM 456   C "C1'"  . DC  A 1 15 ? -85.787  26.545  -5.896  1.00 0.79 ? 15  DC  B "C1'"  1  
ATOM 457   N N1     . DC  A 1 15 ? -84.625  27.027  -5.098  1.00 0.72 ? 15  DC  B N1     1  
ATOM 458   C C2     . DC  A 1 15 ? -84.499  26.587  -3.781  1.00 0.70 ? 15  DC  B C2     1  
ATOM 459   O O2     . DC  A 1 15 ? -85.367  25.862  -3.293  1.00 0.74 ? 15  DC  B O2     1  
ATOM 460   N N3     . DC  A 1 15 ? -83.420  26.999  -3.057  1.00 0.69 ? 15  DC  B N3     1  
ATOM 461   C C4     . DC  A 1 15 ? -82.492  27.805  -3.598  1.00 0.71 ? 15  DC  B C4     1  
ATOM 462   N N4     . DC  A 1 15 ? -81.440  28.188  -2.864  1.00 0.77 ? 15  DC  B N4     1  
ATOM 463   C C5     . DC  A 1 15 ? -82.617  28.264  -4.949  1.00 0.72 ? 15  DC  B C5     1  
ATOM 464   C C6     . DC  A 1 15 ? -83.686  27.850  -5.657  1.00 0.72 ? 15  DC  B C6     1  
ATOM 465   H "H5'"  . DC  A 1 15 ? -83.873  25.932  -9.101  1.00 0.98 ? 15  DC  B "H5'"  1  
ATOM 466   H "H5''" . DC  A 1 15 ? -84.965  26.843  -10.160 1.00 1.02 ? 15  DC  B "H5''" 1  
ATOM 467   H "H4'"  . DC  A 1 15 ? -86.382  25.540  -8.780  1.00 0.95 ? 15  DC  B "H4'"  1  
ATOM 468   H "H3'"  . DC  A 1 15 ? -86.438  28.377  -8.496  1.00 0.92 ? 15  DC  B "H3'"  1  
ATOM 469   H "H2'"  . DC  A 1 15 ? -86.096  28.655  -6.261  1.00 0.86 ? 15  DC  B "H2'"  1  
ATOM 470   H "H2''" . DC  A 1 15 ? -87.596  27.729  -6.004  1.00 0.96 ? 15  DC  B "H2''" 1  
ATOM 471   H "H1'"  . DC  A 1 15 ? -86.435  25.916  -5.276  1.00 0.84 ? 15  DC  B "H1'"  1  
ATOM 472   H H41    . DC  A 1 15 ? -81.345  27.868  -1.912  1.00 0.79 ? 15  DC  B H41    1  
ATOM 473   H H42    . DC  A 1 15 ? -80.738  28.799  -3.266  1.00 0.82 ? 15  DC  B H42    1  
ATOM 474   H H5     . DC  A 1 15 ? -81.874  28.930  -5.389  1.00 0.76 ? 15  DC  B H5     1  
ATOM 475   H H6     . DC  A 1 15 ? -83.813  28.182  -6.687  1.00 0.75 ? 15  DC  B H6     1  
ATOM 476   P P      . DG  A 1 16 ? -89.247  28.242  -8.137  1.00 1.15 ? 16  DG  B P      1  
ATOM 477   O OP1    . DG  A 1 16 ? -90.375  27.832  -9.004  1.00 1.30 ? 16  DG  B OP1    1  
ATOM 478   O OP2    . DG  A 1 16 ? -88.633  29.577  -8.305  1.00 1.12 ? 16  DG  B OP2    1  
ATOM 479   O "O5'"  . DG  A 1 16 ? -89.710  28.079  -6.608  1.00 1.20 ? 16  DG  B "O5'"  1  
ATOM 480   C "C5'"  . DG  A 1 16 ? -90.835  27.262  -6.288  1.00 1.29 ? 16  DG  B "C5'"  1  
ATOM 481   C "C4'"  . DG  A 1 16 ? -91.278  27.447  -4.840  1.00 1.37 ? 16  DG  B "C4'"  1  
ATOM 482   O "O4'"  . DG  A 1 16 ? -90.124  27.410  -3.974  1.00 1.23 ? 16  DG  B "O4'"  1  
ATOM 483   C "C3'"  . DG  A 1 16 ? -91.999  28.780  -4.611  1.00 1.54 ? 16  DG  B "C3'"  1  
ATOM 484   O "O3'"  . DG  A 1 16 ? -93.256  28.544  -3.974  1.00 1.74 ? 16  DG  B "O3'"  1  
ATOM 485   C "C2'"  . DG  A 1 16 ? -91.098  29.579  -3.698  1.00 1.49 ? 16  DG  B "C2'"  1  
ATOM 486   C "C1'"  . DG  A 1 16 ? -90.027  28.621  -3.200  1.00 1.31 ? 16  DG  B "C1'"  1  
ATOM 487   N N9     . DG  A 1 16 ? -88.682  29.226  -3.313  1.00 1.20 ? 16  DG  B N9     1  
ATOM 488   C C8     . DG  A 1 16 ? -88.075  29.788  -4.402  1.00 1.16 ? 16  DG  B C8     1  
ATOM 489   N N7     . DG  A 1 16 ? -86.874  30.243  -4.193  1.00 1.12 ? 16  DG  B N7     1  
ATOM 490   C C5     . DG  A 1 16 ? -86.658  29.961  -2.846  1.00 1.12 ? 16  DG  B C5     1  
ATOM 491   C C6     . DG  A 1 16 ? -85.522  30.223  -2.030  1.00 1.12 ? 16  DG  B C6     1  
ATOM 492   O O6     . DG  A 1 16 ? -84.466  30.770  -2.343  1.00 1.16 ? 16  DG  B O6     1  
ATOM 493   N N1     . DG  A 1 16 ? -85.721  29.776  -0.725  1.00 1.14 ? 16  DG  B N1     1  
ATOM 494   C C2     . DG  A 1 16 ? -86.868  29.156  -0.262  1.00 1.17 ? 16  DG  B C2     1  
ATOM 495   N N2     . DG  A 1 16 ? -86.881  28.796  1.024   1.00 1.23 ? 16  DG  B N2     1  
ATOM 496   N N3     . DG  A 1 16 ? -87.935  28.911  -1.030  1.00 1.19 ? 16  DG  B N3     1  
ATOM 497   C C4     . DG  A 1 16 ? -87.761  29.339  -2.300  1.00 1.16 ? 16  DG  B C4     1  
ATOM 498   H "H5'"  . DG  A 1 16 ? -90.569  26.215  -6.440  1.00 1.24 ? 16  DG  B "H5'"  1  
ATOM 499   H "H5''" . DG  A 1 16 ? -91.662  27.519  -6.950  1.00 1.40 ? 16  DG  B "H5''" 1  
ATOM 500   H "H4'"  . DG  A 1 16 ? -91.948  26.631  -4.568  1.00 1.46 ? 16  DG  B "H4'"  1  
ATOM 501   H "H3'"  . DG  A 1 16 ? -92.158  29.317  -5.550  1.00 1.57 ? 16  DG  B "H3'"  1  
ATOM 502   H "H2'"  . DG  A 1 16 ? -90.634  30.405  -4.242  1.00 1.48 ? 16  DG  B "H2'"  1  
ATOM 503   H "H2''" . DG  A 1 16 ? -91.674  29.967  -2.862  1.00 1.65 ? 16  DG  B "H2''" 1  
ATOM 504   H "H1'"  . DG  A 1 16 ? -90.221  28.381  -2.154  1.00 1.36 ? 16  DG  B "H1'"  1  
ATOM 505   H H8     . DG  A 1 16 ? -88.562  29.860  -5.374  1.00 1.20 ? 16  DG  B H8     1  
ATOM 506   H H1     . DG  A 1 16 ? -84.959  29.932  -0.089  1.00 1.17 ? 16  DG  B H1     1  
ATOM 507   H H21    . DG  A 1 16 ? -86.079  28.978  1.610   1.00 1.24 ? 16  DG  B H21    1  
ATOM 508   H H22    . DG  A 1 16 ? -87.697  28.341  1.411   1.00 1.29 ? 16  DG  B H22    1  
ATOM 509   P P      . DA  A 1 17 ? -94.249  29.754  -3.610  1.00 1.98 ? 17  DA  B P      1  
ATOM 510   O OP1    . DA  A 1 17 ? -95.632  29.233  -3.655  1.00 2.18 ? 17  DA  B OP1    1  
ATOM 511   O OP2    . DA  A 1 17 ? -93.877  30.935  -4.425  1.00 1.99 ? 17  DA  B OP2    1  
ATOM 512   O "O5'"  . DA  A 1 17 ? -93.872  30.048  -2.074  1.00 1.97 ? 17  DA  B "O5'"  1  
ATOM 513   C "C5'"  . DA  A 1 17 ? -93.589  28.961  -1.182  1.00 1.92 ? 17  DA  B "C5'"  1  
ATOM 514   C "C4'"  . DA  A 1 17 ? -93.249  29.461  0.226   1.00 1.98 ? 17  DA  B "C4'"  1  
ATOM 515   O "O4'"  . DA  A 1 17 ? -91.825  29.710  0.325   1.00 1.81 ? 17  DA  B "O4'"  1  
ATOM 516   C "C3'"  . DA  A 1 17 ? -93.984  30.764  0.575   1.00 2.20 ? 17  DA  B "C3'"  1  
ATOM 517   O "O3'"  . DA  A 1 17 ? -94.694  30.626  1.810   1.00 2.37 ? 17  DA  B "O3'"  1  
ATOM 518   C "C2'"  . DA  A 1 17 ? -92.906  31.812  0.724   1.00 2.16 ? 17  DA  B "C2'"  1  
ATOM 519   C "C1'"  . DA  A 1 17 ? -91.578  31.066  0.762   1.00 1.93 ? 17  DA  B "C1'"  1  
ATOM 520   N N9     . DA  A 1 17 ? -90.559  31.736  -0.075  1.00 1.82 ? 17  DA  B N9     1  
ATOM 521   C C8     . DA  A 1 17 ? -90.644  32.189  -1.365  1.00 1.81 ? 17  DA  B C8     1  
ATOM 522   N N7     . DA  A 1 17 ? -89.576  32.773  -1.815  1.00 1.74 ? 17  DA  B N7     1  
ATOM 523   C C5     . DA  A 1 17 ? -88.698  32.703  -0.735  1.00 1.71 ? 17  DA  B C5     1  
ATOM 524   C C6     . DA  A 1 17 ? -87.386  33.151  -0.553  1.00 1.69 ? 17  DA  B C6     1  
ATOM 525   N N6     . DA  A 1 17 ? -86.700  33.786  -1.497  1.00 1.69 ? 17  DA  B N6     1  
ATOM 526   N N1     . DA  A 1 17 ? -86.815  32.927  0.646   1.00 1.70 ? 17  DA  B N1     1  
ATOM 527   C C2     . DA  A 1 17 ? -87.493  32.294  1.605   1.00 1.73 ? 17  DA  B C2     1  
ATOM 528   N N3     . DA  A 1 17 ? -88.739  31.832  1.536   1.00 1.76 ? 17  DA  B N3     1  
ATOM 529   C C4     . DA  A 1 17 ? -89.288  32.078  0.326   1.00 1.75 ? 17  DA  B C4     1  
ATOM 530   H "H5'"  . DA  A 1 17 ? -92.743  28.391  -1.564  1.00 1.75 ? 17  DA  B "H5'"  1  
ATOM 531   H "H5''" . DA  A 1 17 ? -94.461  28.303  -1.132  1.00 2.01 ? 17  DA  B "H5''" 1  
ATOM 532   H "H4'"  . DA  A 1 17 ? -93.527  28.696  0.955   1.00 2.02 ? 17  DA  B "H4'"  1  
ATOM 533   H "H3'"  . DA  A 1 17 ? -94.684  31.046  -0.218  1.00 2.27 ? 17  DA  B "H3'"  1  
ATOM 534   H "HO3'" . DA  A 1 17 ? -95.414  30.012  1.657   1.00 2.51 ? 17  DA  B "HO3'" 1  
ATOM 535   H "H2'"  . DA  A 1 17 ? -92.926  32.496  -0.125  1.00 2.19 ? 17  DA  B "H2'"  1  
ATOM 536   H "H2''" . DA  A 1 17 ? -93.056  32.365  1.650   1.00 2.30 ? 17  DA  B "H2''" 1  
ATOM 537   H "H1'"  . DA  A 1 17 ? -91.215  31.036  1.790   1.00 1.95 ? 17  DA  B "H1'"  1  
ATOM 538   H H8     . DA  A 1 17 ? -91.545  32.078  -1.969  1.00 1.87 ? 17  DA  B H8     1  
ATOM 539   H H61    . DA  A 1 17 ? -85.755  34.089  -1.321  1.00 1.71 ? 17  DA  B H61    1  
ATOM 540   H H62    . DA  A 1 17 ? -87.127  33.964  -2.388  1.00 1.70 ? 17  DA  B H62    1  
ATOM 541   H H2     . DA  A 1 17 ? -86.966  32.138  2.546   1.00 1.75 ? 17  DA  B H2     1  
ATOM 542   O "O5'"  . DT  B 2 1  ? -78.565  36.088  1.581   1.00 2.31 ? 18  DT  C "O5'"  1  
ATOM 543   C "C5'"  . DT  B 2 1  ? -78.386  36.466  2.947   1.00 2.42 ? 18  DT  C "C5'"  1  
ATOM 544   C "C4'"  . DT  B 2 1  ? -79.324  35.689  3.878   1.00 2.29 ? 18  DT  C "C4'"  1  
ATOM 545   O "O4'"  . DT  B 2 1  ? -80.699  35.961  3.531   1.00 2.25 ? 18  DT  C "O4'"  1  
ATOM 546   C "C3'"  . DT  B 2 1  ? -79.110  34.171  3.792   1.00 2.08 ? 18  DT  C "C3'"  1  
ATOM 547   O "O3'"  . DT  B 2 1  ? -78.971  33.610  5.096   1.00 2.08 ? 18  DT  C "O3'"  1  
ATOM 548   C "C2'"  . DT  B 2 1  ? -80.349  33.631  3.128   1.00 1.90 ? 18  DT  C "C2'"  1  
ATOM 549   C "C1'"  . DT  B 2 1  ? -81.380  34.740  3.177   1.00 2.02 ? 18  DT  C "C1'"  1  
ATOM 550   N N1     . DT  B 2 1  ? -82.059  34.873  1.866   1.00 1.96 ? 18  DT  C N1     1  
ATOM 551   C C2     . DT  B 2 1  ? -83.309  34.294  1.727   1.00 1.85 ? 18  DT  C C2     1  
ATOM 552   O O2     . DT  B 2 1  ? -83.851  33.695  2.643   1.00 1.82 ? 18  DT  C O2     1  
ATOM 553   N N3     . DT  B 2 1  ? -83.913  34.437  0.495   1.00 1.82 ? 18  DT  C N3     1  
ATOM 554   C C4     . DT  B 2 1  ? -83.380  35.097  -0.601  1.00 1.88 ? 18  DT  C C4     1  
ATOM 555   O O4     . DT  B 2 1  ? -84.008  35.173  -1.652  1.00 1.86 ? 18  DT  C O4     1  
ATOM 556   C C5     . DT  B 2 1  ? -82.067  35.663  -0.368  1.00 2.00 ? 18  DT  C C5     1  
ATOM 557   C C7     . DT  B 2 1  ? -81.335  36.370  -1.504  1.00 2.11 ? 18  DT  C C7     1  
ATOM 558   C C6     . DT  B 2 1  ? -81.462  35.540  0.832   1.00 2.04 ? 18  DT  C C6     1  
ATOM 559   H "H5'"  . DT  B 2 1  ? -78.594  37.532  3.046   1.00 2.56 ? 18  DT  C "H5'"  1  
ATOM 560   H "H5''" . DT  B 2 1  ? -77.351  36.278  3.235   1.00 2.50 ? 18  DT  C "H5''" 1  
ATOM 561   H "H4'"  . DT  B 2 1  ? -79.146  36.007  4.908   1.00 2.39 ? 18  DT  C "H4'"  1  
ATOM 562   H "H3'"  . DT  B 2 1  ? -78.224  33.930  3.200   1.00 2.09 ? 18  DT  C "H3'"  1  
ATOM 563   H "H2'"  . DT  B 2 1  ? -80.137  33.370  2.091   1.00 1.83 ? 18  DT  C "H2'"  1  
ATOM 564   H "H2''" . DT  B 2 1  ? -80.710  32.757  3.668   1.00 1.80 ? 18  DT  C "H2''" 1  
ATOM 565   H "H1'"  . DT  B 2 1  ? -82.117  34.518  3.955   1.00 2.01 ? 18  DT  C "H1'"  1  
ATOM 566   H H3     . DT  B 2 1  ? -84.829  34.021  0.384   1.00 1.76 ? 18  DT  C H3     1  
ATOM 567   H H71    . DT  B 2 1  ? -82.056  36.723  -2.240  1.00 2.51 ? 18  DT  C H71    1  
ATOM 568   H H72    . DT  B 2 1  ? -80.652  35.664  -1.975  1.00 2.15 ? 18  DT  C H72    1  
ATOM 569   H H73    . DT  B 2 1  ? -80.766  37.215  -1.110  1.00 2.37 ? 18  DT  C H73    1  
ATOM 570   H H6     . DT  B 2 1  ? -80.478  35.981  0.981   1.00 2.15 ? 18  DT  C H6     1  
ATOM 571   H "HO5'" . DT  B 2 1  ? -78.787  35.153  1.566   1.00 2.54 ? 18  DT  C "HO5'" 1  
ATOM 572   P P      . DC  B 2 2  ? -78.468  32.094  5.279   1.00 1.92 ? 19  DC  C P      1  
ATOM 573   O OP1    . DC  B 2 2  ? -77.725  32.018  6.556   1.00 2.02 ? 19  DC  C OP1    1  
ATOM 574   O OP2    . DC  B 2 2  ? -77.818  31.666  4.019   1.00 1.85 ? 19  DC  C OP2    1  
ATOM 575   O "O5'"  . DC  B 2 2  ? -79.852  31.276  5.437   1.00 1.76 ? 19  DC  C "O5'"  1  
ATOM 576   C "C5'"  . DC  B 2 2  ? -80.678  31.474  6.587   1.00 1.85 ? 19  DC  C "C5'"  1  
ATOM 577   C "C4'"  . DC  B 2 2  ? -81.670  30.316  6.799   1.00 1.66 ? 19  DC  C "C4'"  1  
ATOM 578   O "O4'"  . DC  B 2 2  ? -82.783  30.441  5.884   1.00 1.61 ? 19  DC  C "O4'"  1  
ATOM 579   C "C3'"  . DC  B 2 2  ? -81.016  28.948  6.570   1.00 1.50 ? 19  DC  C "C3'"  1  
ATOM 580   O "O3'"  . DC  B 2 2  ? -81.223  28.084  7.693   1.00 1.49 ? 19  DC  C "O3'"  1  
ATOM 581   C "C2'"  . DC  B 2 2  ? -81.693  28.360  5.358   1.00 1.32 ? 19  DC  C "C2'"  1  
ATOM 582   C "C1'"  . DC  B 2 2  ? -82.834  29.307  4.985   1.00 1.39 ? 19  DC  C "C1'"  1  
ATOM 583   N N1     . DC  B 2 2  ? -82.728  29.758  3.566   1.00 1.34 ? 19  DC  C N1     1  
ATOM 584   C C2     . DC  B 2 2  ? -83.836  29.576  2.740   1.00 1.26 ? 19  DC  C C2     1  
ATOM 585   O O2     . DC  B 2 2  ? -84.853  29.048  3.188   1.00 1.26 ? 19  DC  C O2     1  
ATOM 586   N N3     . DC  B 2 2  ? -83.759  29.994  1.448   1.00 1.23 ? 19  DC  C N3     1  
ATOM 587   C C4     . DC  B 2 2  ? -82.646  30.565  0.973   1.00 1.28 ? 19  DC  C C4     1  
ATOM 588   N N4     . DC  B 2 2  ? -82.620  30.987  -0.297  1.00 1.27 ? 19  DC  C N4     1  
ATOM 589   C C5     . DC  B 2 2  ? -81.502  30.752  1.812   1.00 1.39 ? 19  DC  C C5     1  
ATOM 590   C C6     . DC  B 2 2  ? -81.586  30.333  3.093   1.00 1.41 ? 19  DC  C C6     1  
ATOM 591   H "H5'"  . DC  B 2 2  ? -81.231  32.406  6.471   1.00 2.01 ? 19  DC  C "H5'"  1  
ATOM 592   H "H5''" . DC  B 2 2  ? -80.036  31.550  7.465   1.00 1.98 ? 19  DC  C "H5''" 1  
ATOM 593   H "H4'"  . DC  B 2 2  ? -82.046  30.359  7.824   1.00 1.73 ? 19  DC  C "H4'"  1  
ATOM 594   H "H3'"  . DC  B 2 2  ? -79.947  29.055  6.390   1.00 1.57 ? 19  DC  C "H3'"  1  
ATOM 595   H "H2'"  . DC  B 2 2  ? -80.987  28.267  4.534   1.00 1.28 ? 19  DC  C "H2'"  1  
ATOM 596   H "H2''" . DC  B 2 2  ? -82.092  27.376  5.611   1.00 1.23 ? 19  DC  C "H2''" 1  
ATOM 597   H "H1'"  . DC  B 2 2  ? -83.789  28.789  5.139   1.00 1.35 ? 19  DC  C "H1'"  1  
ATOM 598   H H41    . DC  B 2 2  ? -83.425  30.849  -0.890  1.00 1.22 ? 19  DC  C H41    1  
ATOM 599   H H42    . DC  B 2 2  ? -81.797  31.437  -0.666  1.00 1.35 ? 19  DC  C H42    1  
ATOM 600   H H5     . DC  B 2 2  ? -80.592  31.206  1.424   1.00 1.47 ? 19  DC  C H5     1  
ATOM 601   H H6     . DC  B 2 2  ? -80.735  30.458  3.761   1.00 1.50 ? 19  DC  C H6     1  
ATOM 602   P P      . DG  B 2 3  ? -80.466  26.661  7.764   1.00 1.42 ? 20  DG  C P      1  
ATOM 603   O OP1    . DG  B 2 3  ? -80.399  26.242  9.182   1.00 1.52 ? 20  DG  C OP1    1  
ATOM 604   O OP2    . DG  B 2 3  ? -79.222  26.767  6.969   1.00 1.46 ? 20  DG  C OP2    1  
ATOM 605   O "O5'"  . DG  B 2 3  ? -81.483  25.671  6.980   1.00 1.23 ? 20  DG  C "O5'"  1  
ATOM 606   C "C5'"  . DG  B 2 3  ? -82.606  25.091  7.659   1.00 1.25 ? 20  DG  C "C5'"  1  
ATOM 607   C "C4'"  . DG  B 2 3  ? -83.455  24.197  6.740   1.00 1.10 ? 20  DG  C "C4'"  1  
ATOM 608   O "O4'"  . DG  B 2 3  ? -83.740  24.897  5.510   1.00 1.05 ? 20  DG  C "O4'"  1  
ATOM 609   C "C3'"  . DG  B 2 3  ? -82.762  22.874  6.387   1.00 1.01 ? 20  DG  C "C3'"  1  
ATOM 610   O "O3'"  . DG  B 2 3  ? -83.619  21.766  6.682   1.00 0.98 ? 20  DG  C "O3'"  1  
ATOM 611   C "C2'"  . DG  B 2 3  ? -82.495  22.945  4.893   1.00 0.91 ? 20  DG  C "C2'"  1  
ATOM 612   C "C1'"  . DG  B 2 3  ? -83.246  24.166  4.377   1.00 0.92 ? 20  DG  C "C1'"  1  
ATOM 613   N N9     . DG  B 2 3  ? -82.374  25.022  3.560   1.00 0.91 ? 20  DG  C N9     1  
ATOM 614   C C8     . DG  B 2 3  ? -81.201  25.618  3.899   1.00 1.01 ? 20  DG  C C8     1  
ATOM 615   N N7     . DG  B 2 3  ? -80.656  26.340  2.962   1.00 1.00 ? 20  DG  C N7     1  
ATOM 616   C C5     . DG  B 2 3  ? -81.554  26.211  1.903   1.00 0.88 ? 20  DG  C C5     1  
ATOM 617   C C6     . DG  B 2 3  ? -81.518  26.769  0.591   1.00 0.83 ? 20  DG  C C6     1  
ATOM 618   O O6     . DG  B 2 3  ? -80.674  27.507  0.093   1.00 0.89 ? 20  DG  C O6     1  
ATOM 619   N N1     . DG  B 2 3  ? -82.618  26.379  -0.156  1.00 0.75 ? 20  DG  C N1     1  
ATOM 620   C C2     . DG  B 2 3  ? -83.630  25.564  0.292   1.00 0.73 ? 20  DG  C C2     1  
ATOM 621   N N2     . DG  B 2 3  ? -84.601  25.312  -0.579  1.00 0.72 ? 20  DG  C N2     1  
ATOM 622   N N3     . DG  B 2 3  ? -83.673  25.041  1.517   1.00 0.76 ? 20  DG  C N3     1  
ATOM 623   C C4     . DG  B 2 3  ? -82.606  25.402  2.265   1.00 0.83 ? 20  DG  C C4     1  
ATOM 624   H "H5'"  . DG  B 2 3  ? -83.236  25.893  8.044   1.00 1.34 ? 20  DG  C "H5'"  1  
ATOM 625   H "H5''" . DG  B 2 3  ? -82.243  24.495  8.494   1.00 1.32 ? 20  DG  C "H5''" 1  
ATOM 626   H "H4'"  . DG  B 2 3  ? -84.397  23.974  7.236   1.00 1.13 ? 20  DG  C "H4'"  1  
ATOM 627   H "H3'"  . DG  B 2 3  ? -81.824  22.762  6.935   1.00 1.08 ? 20  DG  C "H3'"  1  
ATOM 628   H "H2'"  . DG  B 2 3  ? -81.426  23.051  4.702   1.00 0.95 ? 20  DG  C "H2'"  1  
ATOM 629   H "H2''" . DG  B 2 3  ? -82.868  22.046  4.395   1.00 0.85 ? 20  DG  C "H2''" 1  
ATOM 630   H "H1'"  . DG  B 2 3  ? -84.096  23.844  3.775   1.00 0.86 ? 20  DG  C "H1'"  1  
ATOM 631   H H8     . DG  B 2 3  ? -80.754  25.499  4.888   1.00 1.10 ? 20  DG  C H8     1  
ATOM 632   H H1     . DG  B 2 3  ? -82.657  26.733  -1.099  1.00 0.73 ? 20  DG  C H1     1  
ATOM 633   H H21    . DG  B 2 3  ? -84.562  25.713  -1.505  1.00 0.71 ? 20  DG  C H21    1  
ATOM 634   H H22    . DG  B 2 3  ? -85.377  24.727  -0.313  1.00 0.74 ? 20  DG  C H22    1  
ATOM 635   P P      . DA  B 2 4  ? -83.187  20.269  6.277   1.00 0.94 ? 21  DA  C P      1  
ATOM 636   O OP1    . DA  B 2 4  ? -83.861  19.324  7.193   1.00 1.02 ? 21  DA  C OP1    1  
ATOM 637   O OP2    . DA  B 2 4  ? -81.715  20.248  6.134   1.00 0.98 ? 21  DA  C OP2    1  
ATOM 638   O "O5'"  . DA  B 2 4  ? -83.853  20.119  4.814   1.00 0.83 ? 21  DA  C "O5'"  1  
ATOM 639   C "C5'"  . DA  B 2 4  ? -85.188  20.589  4.600   1.00 0.73 ? 21  DA  C "C5'"  1  
ATOM 640   C "C4'"  . DA  B 2 4  ? -85.593  20.585  3.125   1.00 0.65 ? 21  DA  C "C4'"  1  
ATOM 641   O "O4'"  . DA  B 2 4  ? -84.836  21.581  2.398   1.00 0.62 ? 21  DA  C "O4'"  1  
ATOM 642   C "C3'"  . DA  B 2 4  ? -85.344  19.225  2.457   1.00 0.62 ? 21  DA  C "C3'"  1  
ATOM 643   O "O3'"  . DA  B 2 4  ? -86.538  18.740  1.839   1.00 0.64 ? 21  DA  C "O3'"  1  
ATOM 644   C "C2'"  . DA  B 2 4  ? -84.297  19.484  1.398   1.00 0.58 ? 21  DA  C "C2'"  1  
ATOM 645   C "C1'"  . DA  B 2 4  ? -84.217  20.989  1.235   1.00 0.57 ? 21  DA  C "C1'"  1  
ATOM 646   N N9     . DA  B 2 4  ? -82.821  21.437  1.075   1.00 0.55 ? 21  DA  C N9     1  
ATOM 647   C C8     . DA  B 2 4  ? -81.744  21.222  1.882   1.00 0.58 ? 21  DA  C C8     1  
ATOM 648   N N7     . DA  B 2 4  ? -80.631  21.752  1.469   1.00 0.58 ? 21  DA  C N7     1  
ATOM 649   C C5     . DA  B 2 4  ? -81.005  22.374  0.279   1.00 0.54 ? 21  DA  C C5     1  
ATOM 650   C C6     . DA  B 2 4  ? -80.294  23.122  -0.665  1.00 0.54 ? 21  DA  C C6     1  
ATOM 651   N N6     . DA  B 2 4  ? -78.997  23.388  -0.558  1.00 0.59 ? 21  DA  C N6     1  
ATOM 652   N N1     . DA  B 2 4  ? -80.981  23.589  -1.727  1.00 0.52 ? 21  DA  C N1     1  
ATOM 653   C C2     . DA  B 2 4  ? -82.283  23.333  -1.849  1.00 0.50 ? 21  DA  C C2     1  
ATOM 654   N N3     . DA  B 2 4  ? -83.044  22.638  -1.012  1.00 0.50 ? 21  DA  C N3     1  
ATOM 655   C C4     . DA  B 2 4  ? -82.334  22.185  0.037   1.00 0.52 ? 21  DA  C C4     1  
ATOM 656   H "H5'"  . DA  B 2 4  ? -85.267  21.606  4.982   1.00 0.76 ? 21  DA  C "H5'"  1  
ATOM 657   H "H5''" . DA  B 2 4  ? -85.875  19.950  5.151   1.00 0.82 ? 21  DA  C "H5''" 1  
ATOM 658   H "H4'"  . DA  B 2 4  ? -86.653  20.827  3.049   1.00 0.69 ? 21  DA  C "H4'"  1  
ATOM 659   H "H3'"  . DA  B 2 4  ? -84.980  18.486  3.177   1.00 0.65 ? 21  DA  C "H3'"  1  
ATOM 660   H "H2'"  . DA  B 2 4  ? -83.330  19.091  1.711   1.00 0.59 ? 21  DA  C "H2'"  1  
ATOM 661   H "H2''" . DA  B 2 4  ? -84.598  19.025  0.459   1.00 0.60 ? 21  DA  C "H2''" 1  
ATOM 662   H "H1'"  . DA  B 2 4  ? -84.786  21.284  0.352   1.00 0.58 ? 21  DA  C "H1'"  1  
ATOM 663   H H8     . DA  B 2 4  ? -81.811  20.650  2.810   1.00 0.62 ? 21  DA  C H8     1  
ATOM 664   H H61    . DA  B 2 4  ? -78.531  23.933  -1.270  1.00 0.60 ? 21  DA  C H61    1  
ATOM 665   H H62    . DA  B 2 4  ? -78.478  23.046  0.239   1.00 0.62 ? 21  DA  C H62    1  
ATOM 666   H H2     . DA  B 2 4  ? -82.779  23.743  -2.728  1.00 0.51 ? 21  DA  C H2     1  
ATOM 667   P P      . DA  B 2 5  ? -86.523  17.315  1.100   1.00 0.68 ? 22  DA  C P      1  
ATOM 668   O OP1    . DA  B 2 5  ? -87.876  16.721  1.193   1.00 0.83 ? 22  DA  C OP1    1  
ATOM 669   O OP2    . DA  B 2 5  ? -85.347  16.566  1.593   1.00 0.67 ? 22  DA  C OP2    1  
ATOM 670   O "O5'"  . DA  B 2 5  ? -86.259  17.735  -0.433  1.00 0.63 ? 22  DA  C "O5'"  1  
ATOM 671   C "C5'"  . DA  B 2 5  ? -87.052  18.764  -1.033  1.00 0.62 ? 22  DA  C "C5'"  1  
ATOM 672   C "C4'"  . DA  B 2 5  ? -86.731  18.948  -2.516  1.00 0.61 ? 22  DA  C "C4'"  1  
ATOM 673   O "O4'"  . DA  B 2 5  ? -85.566  19.793  -2.666  1.00 0.58 ? 22  DA  C "O4'"  1  
ATOM 674   C "C3'"  . DA  B 2 5  ? -86.444  17.620  -3.221  1.00 0.64 ? 22  DA  C "C3'"  1  
ATOM 675   O "O3'"  . DA  B 2 5  ? -87.259  17.492  -4.385  1.00 0.72 ? 22  DA  C "O3'"  1  
ATOM 676   C "C2'"  . DA  B 2 5  ? -84.991  17.682  -3.630  1.00 0.61 ? 22  DA  C "C2'"  1  
ATOM 677   C "C1'"  . DA  B 2 5  ? -84.556  19.127  -3.450  1.00 0.57 ? 22  DA  C "C1'"  1  
ATOM 678   N N9     . DA  B 2 5  ? -83.229  19.220  -2.805  1.00 0.53 ? 22  DA  C N9     1  
ATOM 679   C C8     . DA  B 2 5  ? -82.768  18.623  -1.668  1.00 0.51 ? 22  DA  C C8     1  
ATOM 680   N N7     . DA  B 2 5  ? -81.552  18.939  -1.335  1.00 0.50 ? 22  DA  C N7     1  
ATOM 681   C C5     . DA  B 2 5  ? -81.168  19.820  -2.346  1.00 0.51 ? 22  DA  C C5     1  
ATOM 682   C C6     . DA  B 2 5  ? -79.984  20.530  -2.596  1.00 0.53 ? 22  DA  C C6     1  
ATOM 683   N N6     . DA  B 2 5  ? -78.919  20.489  -1.793  1.00 0.55 ? 22  DA  C N6     1  
ATOM 684   N N1     . DA  B 2 5  ? -79.952  21.305  -3.693  1.00 0.57 ? 22  DA  C N1     1  
ATOM 685   C C2     . DA  B 2 5  ? -81.014  21.385  -4.494  1.00 0.59 ? 22  DA  C C2     1  
ATOM 686   N N3     . DA  B 2 5  ? -82.176  20.764  -4.347  1.00 0.57 ? 22  DA  C N3     1  
ATOM 687   C C4     . DA  B 2 5  ? -82.182  19.992  -3.243  1.00 0.53 ? 22  DA  C C4     1  
ATOM 688   H "H5'"  . DA  B 2 5  ? -86.867  19.705  -0.511  1.00 0.71 ? 22  DA  C "H5'"  1  
ATOM 689   H "H5''" . DA  B 2 5  ? -88.104  18.503  -0.928  1.00 0.73 ? 22  DA  C "H5''" 1  
ATOM 690   H "H4'"  . DA  B 2 5  ? -87.579  19.427  -3.006  1.00 0.65 ? 22  DA  C "H4'"  1  
ATOM 691   H "H3'"  . DA  B 2 5  ? -86.613  16.767  -2.554  1.00 0.66 ? 22  DA  C "H3'"  1  
ATOM 692   H "H2'"  . DA  B 2 5  ? -84.388  17.025  -3.004  1.00 0.59 ? 22  DA  C "H2'"  1  
ATOM 693   H "H2''" . DA  B 2 5  ? -84.894  17.387  -4.675  1.00 0.66 ? 22  DA  C "H2''" 1  
ATOM 694   H "H1'"  . DA  B 2 5  ? -84.504  19.611  -4.428  1.00 0.60 ? 22  DA  C "H1'"  1  
ATOM 695   H H8     . DA  B 2 5  ? -83.366  17.920  -1.095  1.00 0.53 ? 22  DA  C H8     1  
ATOM 696   H H61    . DA  B 2 5  ? -78.094  21.020  -2.026  1.00 0.59 ? 22  DA  C H61    1  
ATOM 697   H H62    . DA  B 2 5  ? -78.940  19.934  -0.948  1.00 0.54 ? 22  DA  C H62    1  
ATOM 698   H H2     . DA  B 2 5  ? -80.914  22.022  -5.371  1.00 0.64 ? 22  DA  C H2     1  
ATOM 699   P P      . DC  B 2 6  ? -87.299  16.108  -5.195  1.00 0.73 ? 23  DC  C P      1  
ATOM 700   O OP1    . DC  B 2 6  ? -88.653  15.956  -5.772  1.00 0.79 ? 23  DC  C OP1    1  
ATOM 701   O OP2    . DC  B 2 6  ? -86.742  15.057  -4.320  1.00 0.77 ? 23  DC  C OP2    1  
ATOM 702   O "O5'"  . DC  B 2 6  ? -86.250  16.361  -6.388  1.00 0.68 ? 23  DC  C "O5'"  1  
ATOM 703   C "C5'"  . DC  B 2 6  ? -86.670  16.975  -7.607  1.00 0.69 ? 23  DC  C "C5'"  1  
ATOM 704   C "C4'"  . DC  B 2 6  ? -85.577  16.907  -8.689  1.00 0.67 ? 23  DC  C "C4'"  1  
ATOM 705   O "O4'"  . DC  B 2 6  ? -84.328  17.398  -8.137  1.00 0.69 ? 23  DC  C "O4'"  1  
ATOM 706   C "C3'"  . DC  B 2 6  ? -85.341  15.471  -9.202  1.00 0.63 ? 23  DC  C "C3'"  1  
ATOM 707   O "O3'"  . DC  B 2 6  ? -85.412  15.417  -10.645 1.00 0.62 ? 23  DC  C "O3'"  1  
ATOM 708   C "C2'"  . DC  B 2 6  ? -83.949  15.105  -8.717  1.00 0.63 ? 23  DC  C "C2'"  1  
ATOM 709   C "C1'"  . DC  B 2 6  ? -83.289  16.397  -8.252  1.00 0.66 ? 23  DC  C "C1'"  1  
ATOM 710   N N1     . DC  B 2 6  ? -82.556  16.201  -6.961  1.00 0.67 ? 23  DC  C N1     1  
ATOM 711   C C2     . DC  B 2 6  ? -81.190  16.492  -6.941  1.00 0.69 ? 23  DC  C C2     1  
ATOM 712   O O2     . DC  B 2 6  ? -80.641  16.903  -7.956  1.00 0.70 ? 23  DC  C O2     1  
ATOM 713   N N3     . DC  B 2 6  ? -80.497  16.307  -5.785  1.00 0.70 ? 23  DC  C N3     1  
ATOM 714   C C4     . DC  B 2 6  ? -81.099  15.855  -4.683  1.00 0.70 ? 23  DC  C C4     1  
ATOM 715   N N4     . DC  B 2 6  ? -80.363  15.683  -3.580  1.00 0.73 ? 23  DC  C N4     1  
ATOM 716   C C5     . DC  B 2 6  ? -82.504  15.554  -4.683  1.00 0.68 ? 23  DC  C C5     1  
ATOM 717   C C6     . DC  B 2 6  ? -83.189  15.737  -5.835  1.00 0.67 ? 23  DC  C C6     1  
ATOM 718   H "H5'"  . DC  B 2 6  ? -86.912  18.021  -7.412  1.00 0.78 ? 23  DC  C "H5'"  1  
ATOM 719   H "H5''" . DC  B 2 6  ? -87.567  16.470  -7.970  1.00 0.71 ? 23  DC  C "H5''" 1  
ATOM 720   H "H4'"  . DC  B 2 6  ? -85.875  17.537  -9.525  1.00 0.68 ? 23  DC  C "H4'"  1  
ATOM 721   H "H3'"  . DC  B 2 6  ? -86.085  14.785  -8.782  1.00 0.62 ? 23  DC  C "H3'"  1  
ATOM 722   H "H2'"  . DC  B 2 6  ? -84.013  14.394  -7.895  1.00 0.64 ? 23  DC  C "H2'"  1  
ATOM 723   H "H2''" . DC  B 2 6  ? -83.371  14.671  -9.522  1.00 0.63 ? 23  DC  C "H2''" 1  
ATOM 724   H "H1'"  . DC  B 2 6  ? -82.582  16.728  -9.024  1.00 0.67 ? 23  DC  C "H1'"  1  
ATOM 725   H H41    . DC  B 2 6  ? -79.374  15.903  -3.598  1.00 0.75 ? 23  DC  C H41    1  
ATOM 726   H H42    . DC  B 2 6  ? -80.786  15.335  -2.733  1.00 0.74 ? 23  DC  C H42    1  
ATOM 727   H H5     . DC  B 2 6  ? -83.001  15.181  -3.782  1.00 0.70 ? 23  DC  C H5     1  
ATOM 728   H H6     . DC  B 2 6  ? -84.253  15.514  -5.868  1.00 0.66 ? 23  DC  C H6     1  
ATOM 729   P P      . DT  B 2 7  ? -84.953  14.091  -11.459 1.00 0.60 ? 24  DT  C P      1  
ATOM 730   O OP1    . DT  B 2 7  ? -85.847  13.905  -12.633 1.00 0.63 ? 24  DT  C OP1    1  
ATOM 731   O OP2    . DT  B 2 7  ? -84.782  12.994  -10.483 1.00 0.59 ? 24  DT  C OP2    1  
ATOM 732   O "O5'"  . DT  B 2 7  ? -83.493  14.518  -11.999 1.00 0.61 ? 24  DT  C "O5'"  1  
ATOM 733   C "C5'"  . DT  B 2 7  ? -83.204  15.896  -12.223 1.00 0.64 ? 24  DT  C "C5'"  1  
ATOM 734   C "C4'"  . DT  B 2 7  ? -81.747  16.147  -12.633 1.00 0.66 ? 24  DT  C "C4'"  1  
ATOM 735   O "O4'"  . DT  B 2 7  ? -80.950  16.359  -11.448 1.00 0.67 ? 24  DT  C "O4'"  1  
ATOM 736   C "C3'"  . DT  B 2 7  ? -81.140  14.973  -13.411 1.00 0.66 ? 24  DT  C "C3'"  1  
ATOM 737   O "O3'"  . DT  B 2 7  ? -80.667  15.399  -14.686 1.00 0.74 ? 24  DT  C "O3'"  1  
ATOM 738   C "C2'"  . DT  B 2 7  ? -79.955  14.505  -12.601 1.00 0.65 ? 24  DT  C "C2'"  1  
ATOM 739   C "C1'"  . DT  B 2 7  ? -79.819  15.466  -11.419 1.00 0.64 ? 24  DT  C "C1'"  1  
ATOM 740   N N1     . DT  B 2 7  ? -79.761  14.731  -10.119 1.00 0.60 ? 24  DT  C N1     1  
ATOM 741   C C2     . DT  B 2 7  ? -78.697  14.997  -9.270  1.00 0.60 ? 24  DT  C C2     1  
ATOM 742   O O2     . DT  B 2 7  ? -77.819  15.805  -9.562  1.00 0.64 ? 24  DT  C O2     1  
ATOM 743   N N3     . DT  B 2 7  ? -78.680  14.300  -8.071  1.00 0.59 ? 24  DT  C N3     1  
ATOM 744   C C4     . DT  B 2 7  ? -79.615  13.377  -7.653  1.00 0.58 ? 24  DT  C C4     1  
ATOM 745   O O4     . DT  B 2 7  ? -79.489  12.813  -6.573  1.00 0.61 ? 24  DT  C O4     1  
ATOM 746   C C5     . DT  B 2 7  ? -80.692  13.159  -8.593  1.00 0.58 ? 24  DT  C C5     1  
ATOM 747   C C7     . DT  B 2 7  ? -81.804  12.164  -8.247  1.00 0.61 ? 24  DT  C C7     1  
ATOM 748   C C6     . DT  B 2 7  ? -80.733  13.829  -9.769  1.00 0.58 ? 24  DT  C C6     1  
ATOM 749   H "H5'"  . DT  B 2 7  ? -83.412  16.448  -11.311 1.00 0.67 ? 24  DT  C "H5'"  1  
ATOM 750   H "H5''" . DT  B 2 7  ? -83.859  16.261  -13.014 1.00 0.67 ? 24  DT  C "H5''" 1  
ATOM 751   H "H4'"  . DT  B 2 7  ? -81.697  17.042  -13.252 1.00 0.71 ? 24  DT  C "H4'"  1  
ATOM 752   H "H3'"  . DT  B 2 7  ? -81.861  14.163  -13.533 1.00 0.65 ? 24  DT  C "H3'"  1  
ATOM 753   H "H2'"  . DT  B 2 7  ? -80.109  13.489  -12.257 1.00 0.62 ? 24  DT  C "H2'"  1  
ATOM 754   H "H2''" . DT  B 2 7  ? -79.056  14.544  -13.221 1.00 0.69 ? 24  DT  C "H2''" 1  
ATOM 755   H "H1'"  . DT  B 2 7  ? -78.910  16.066  -11.552 1.00 0.68 ? 24  DT  C "H1'"  1  
ATOM 756   H H3     . DT  B 2 7  ? -77.913  14.488  -7.446  1.00 0.60 ? 24  DT  C H3     1  
ATOM 757   H H71    . DT  B 2 7  ? -82.508  12.633  -7.560  1.00 1.12 ? 24  DT  C H71    1  
ATOM 758   H H72    . DT  B 2 7  ? -81.368  11.283  -7.774  1.00 1.24 ? 24  DT  C H72    1  
ATOM 759   H H73    . DT  B 2 7  ? -82.332  11.861  -9.153  1.00 1.12 ? 24  DT  C H73    1  
ATOM 760   H H6     . DT  B 2 7  ? -81.555  13.640  -10.456 1.00 0.60 ? 24  DT  C H6     1  
ATOM 761   P P      . DT  B 2 8  ? -80.018  14.327  -15.696 1.00 0.79 ? 25  DT  C P      1  
ATOM 762   O OP1    . DT  B 2 8  ? -79.948  14.946  -17.036 1.00 0.92 ? 25  DT  C OP1    1  
ATOM 763   O OP2    . DT  B 2 8  ? -80.711  13.036  -15.507 1.00 0.79 ? 25  DT  C OP2    1  
ATOM 764   O "O5'"  . DT  B 2 8  ? -78.526  14.162  -15.130 1.00 0.78 ? 25  DT  C "O5'"  1  
ATOM 765   C "C5'"  . DT  B 2 8  ? -77.530  15.125  -15.444 1.00 0.86 ? 25  DT  C "C5'"  1  
ATOM 766   C "C4'"  . DT  B 2 8  ? -76.196  14.809  -14.762 1.00 0.83 ? 25  DT  C "C4'"  1  
ATOM 767   O "O4'"  . DT  B 2 8  ? -76.404  14.567  -13.342 1.00 0.77 ? 25  DT  C "O4'"  1  
ATOM 768   C "C3'"  . DT  B 2 8  ? -75.512  13.561  -15.350 1.00 0.82 ? 25  DT  C "C3'"  1  
ATOM 769   O "O3'"  . DT  B 2 8  ? -74.159  13.858  -15.724 1.00 0.87 ? 25  DT  C "O3'"  1  
ATOM 770   C "C2'"  . DT  B 2 8  ? -75.506  12.550  -14.226 1.00 0.75 ? 25  DT  C "C2'"  1  
ATOM 771   C "C1'"  . DT  B 2 8  ? -75.755  13.340  -12.945 1.00 0.72 ? 25  DT  C "C1'"  1  
ATOM 772   N N1     . DT  B 2 8  ? -76.570  12.556  -11.956 1.00 0.66 ? 25  DT  C N1     1  
ATOM 773   C C2     . DT  B 2 8  ? -76.005  12.290  -10.707 1.00 0.64 ? 25  DT  C C2     1  
ATOM 774   O O2     . DT  B 2 8  ? -74.887  12.687  -10.400 1.00 0.67 ? 25  DT  C O2     1  
ATOM 775   N N3     . DT  B 2 8  ? -76.774  11.550  -9.831  1.00 0.61 ? 25  DT  C N3     1  
ATOM 776   C C4     . DT  B 2 8  ? -78.043  11.058  -10.072 1.00 0.59 ? 25  DT  C C4     1  
ATOM 777   O O4     . DT  B 2 8  ? -78.632  10.401  -9.210  1.00 0.59 ? 25  DT  C O4     1  
ATOM 778   C C5     . DT  B 2 8  ? -78.561  11.381  -11.389 1.00 0.61 ? 25  DT  C C5     1  
ATOM 779   C C7     . DT  B 2 8  ? -79.966  10.902  -11.775 1.00 0.62 ? 25  DT  C C7     1  
ATOM 780   C C6     . DT  B 2 8  ? -77.826  12.105  -12.271 1.00 0.65 ? 25  DT  C C6     1  
ATOM 781   H "H5'"  . DT  B 2 8  ? -77.871  16.105  -15.107 1.00 0.92 ? 25  DT  C "H5'"  1  
ATOM 782   H "H5''" . DT  B 2 8  ? -77.383  15.151  -16.522 1.00 0.98 ? 25  DT  C "H5''" 1  
ATOM 783   H "H4'"  . DT  B 2 8  ? -75.534  15.662  -14.883 1.00 0.88 ? 25  DT  C "H4'"  1  
ATOM 784   H "H3'"  . DT  B 2 8  ? -76.062  13.173  -16.211 1.00 0.85 ? 25  DT  C "H3'"  1  
ATOM 785   H "H2'"  . DT  B 2 8  ? -76.290  11.805  -14.378 1.00 0.75 ? 25  DT  C "H2'"  1  
ATOM 786   H "H2''" . DT  B 2 8  ? -74.542  12.061  -14.179 1.00 0.77 ? 25  DT  C "H2''" 1  
ATOM 787   H "H1'"  . DT  B 2 8  ? -74.787  13.599  -12.505 1.00 0.73 ? 25  DT  C "H1'"  1  
ATOM 788   H H3     . DT  B 2 8  ? -76.377  11.350  -8.925  1.00 0.62 ? 25  DT  C H3     1  
ATOM 789   H H71    . DT  B 2 8  ? -80.706  11.490  -11.235 1.00 1.22 ? 25  DT  C H71    1  
ATOM 790   H H72    . DT  B 2 8  ? -80.081  9.850   -11.513 1.00 1.15 ? 25  DT  C H72    1  
ATOM 791   H H73    . DT  B 2 8  ? -80.119  11.026  -12.848 1.00 1.14 ? 25  DT  C H73    1  
ATOM 792   H H6     . DT  B 2 8  ? -78.242  12.340  -13.251 1.00 0.68 ? 25  DT  C H6     1  
ATOM 793   P P      . DC  B 2 9  ? -73.189  12.713  -16.331 1.00 0.90 ? 26  DC  C P      1  
ATOM 794   O OP1    . DC  B 2 9  ? -72.076  13.388  -17.036 1.00 1.02 ? 26  DC  C OP1    1  
ATOM 795   O OP2    . DC  B 2 9  ? -74.024  11.723  -17.048 1.00 0.93 ? 26  DC  C OP2    1  
ATOM 796   O "O5'"  . DC  B 2 9  ? -72.593  12.006  -15.006 1.00 0.82 ? 26  DC  C "O5'"  1  
ATOM 797   C "C5'"  . DC  B 2 9  ? -71.806  12.768  -14.092 1.00 1.02 ? 26  DC  C "C5'"  1  
ATOM 798   C "C4'"  . DC  B 2 9  ? -70.862  11.898  -13.251 1.00 0.93 ? 26  DC  C "C4'"  1  
ATOM 799   O "O4'"  . DC  B 2 9  ? -71.498  11.601  -11.984 1.00 0.84 ? 26  DC  C "O4'"  1  
ATOM 800   C "C3'"  . DC  B 2 9  ? -70.519  10.569  -13.936 1.00 0.92 ? 26  DC  C "C3'"  1  
ATOM 801   O "O3'"  . DC  B 2 9  ? -69.105  10.393  -14.056 1.00 0.99 ? 26  DC  C "O3'"  1  
ATOM 802   C "C2'"  . DC  B 2 9  ? -71.066  9.495   -13.029 1.00 0.82 ? 26  DC  C "C2'"  1  
ATOM 803   C "C1'"  . DC  B 2 9  ? -71.500  10.179  -11.738 1.00 0.76 ? 26  DC  C "C1'"  1  
ATOM 804   N N1     . DC  B 2 9  ? -72.849  9.698   -11.297 1.00 0.70 ? 26  DC  C N1     1  
ATOM 805   C C2     . DC  B 2 9  ? -72.962  9.125   -10.030 1.00 0.67 ? 26  DC  C C2     1  
ATOM 806   O O2     . DC  B 2 9  ? -71.963  8.993   -9.320  1.00 0.70 ? 26  DC  C O2     1  
ATOM 807   N N3     . DC  B 2 9  ? -74.187  8.707   -9.615  1.00 0.64 ? 26  DC  C N3     1  
ATOM 808   C C4     . DC  B 2 9  ? -75.262  8.839   -10.398 1.00 0.64 ? 26  DC  C C4     1  
ATOM 809   N N4     . DC  B 2 9  ? -76.446  8.413   -9.953  1.00 0.64 ? 26  DC  C N4     1  
ATOM 810   C C5     . DC  B 2 9  ? -75.156  9.428   -11.698 1.00 0.69 ? 26  DC  C C5     1  
ATOM 811   C C6     . DC  B 2 9  ? -73.939  9.838   -12.101 1.00 0.72 ? 26  DC  C C6     1  
ATOM 812   H "H5'"  . DC  B 2 9  ? -72.472  13.313  -13.426 1.00 1.22 ? 26  DC  C "H5'"  1  
ATOM 813   H "H5''" . DC  B 2 9  ? -71.214  13.481  -14.661 1.00 1.27 ? 26  DC  C "H5''" 1  
ATOM 814   H "H4'"  . DC  B 2 9  ? -69.937  12.449  -13.064 1.00 0.98 ? 26  DC  C "H4'"  1  
ATOM 815   H "H3'"  . DC  B 2 9  ? -70.987  10.510  -14.927 1.00 0.99 ? 26  DC  C "H3'"  1  
ATOM 816   H "H2'"  . DC  B 2 9  ? -71.911  8.994   -13.503 1.00 0.83 ? 26  DC  C "H2'"  1  
ATOM 817   H "H2''" . DC  B 2 9  ? -70.282  8.773   -12.817 1.00 0.84 ? 26  DC  C "H2''" 1  
ATOM 818   H "H1'"  . DC  B 2 9  ? -70.762  9.976   -10.964 1.00 0.77 ? 26  DC  C "H1'"  1  
ATOM 819   H H41    . DC  B 2 9  ? -76.521  7.997   -9.037  1.00 0.64 ? 26  DC  C H41    1  
ATOM 820   H H42    . DC  B 2 9  ? -77.268  8.499   -10.538 1.00 0.67 ? 26  DC  C H42    1  
ATOM 821   H H5     . DC  B 2 9  ? -76.029  9.546   -12.338 1.00 0.74 ? 26  DC  C H5     1  
ATOM 822   H H6     . DC  B 2 9  ? -73.818  10.262  -13.089 1.00 0.79 ? 26  DC  C H6     1  
ATOM 823   P P      . DC  B 2 10 ? -68.514  9.068   -14.767 1.00 1.07 ? 27  DC  C P      1  
ATOM 824   O OP1    . DC  B 2 10 ? -67.089  9.300   -15.078 1.00 1.20 ? 27  DC  C OP1    1  
ATOM 825   O OP2    . DC  B 2 10 ? -69.452  8.667   -15.838 1.00 1.12 ? 27  DC  C OP2    1  
ATOM 826   O "O5'"  . DC  B 2 10 ? -68.589  7.966   -13.590 1.00 0.98 ? 27  DC  C "O5'"  1  
ATOM 827   C "C5'"  . DC  B 2 10 ? -67.724  8.064   -12.453 1.00 0.97 ? 27  DC  C "C5'"  1  
ATOM 828   C "C4'"  . DC  B 2 10 ? -67.347  6.683   -11.898 1.00 0.96 ? 27  DC  C "C4'"  1  
ATOM 829   O "O4'"  . DC  B 2 10 ? -68.285  6.318   -10.858 1.00 0.87 ? 27  DC  C "O4'"  1  
ATOM 830   C "C3'"  . DC  B 2 10 ? -67.387  5.590   -12.972 1.00 1.06 ? 27  DC  C "C3'"  1  
ATOM 831   O "O3'"  . DC  B 2 10 ? -66.145  4.893   -13.028 1.00 1.19 ? 27  DC  C "O3'"  1  
ATOM 832   C "C2'"  . DC  B 2 10 ? -68.489  4.633   -12.557 1.00 1.00 ? 27  DC  C "C2'"  1  
ATOM 833   C "C1'"  . DC  B 2 10 ? -68.950  5.073   -11.167 1.00 0.88 ? 27  DC  C "C1'"  1  
ATOM 834   N N1     . DC  B 2 10 ? -70.438  5.234   -11.101 1.00 0.79 ? 27  DC  C N1     1  
ATOM 835   C C2     . DC  B 2 10 ? -71.117  4.582   -10.073 1.00 0.77 ? 27  DC  C C2     1  
ATOM 836   O O2     . DC  B 2 10 ? -70.501  3.888   -9.270  1.00 0.85 ? 27  DC  C O2     1  
ATOM 837   N N3     . DC  B 2 10 ? -72.464  4.740   -9.989  1.00 0.71 ? 27  DC  C N3     1  
ATOM 838   C C4     . DC  B 2 10 ? -73.127  5.498   -10.864 1.00 0.69 ? 27  DC  C C4     1  
ATOM 839   N N4     . DC  B 2 10 ? -74.444  5.641   -10.723 1.00 0.68 ? 27  DC  C N4     1  
ATOM 840   C C5     . DC  B 2 10 ? -72.444  6.170   -11.925 1.00 0.74 ? 27  DC  C C5     1  
ATOM 841   C C6     . DC  B 2 10 ? -71.108  6.014   -12.005 1.00 0.78 ? 27  DC  C C6     1  
ATOM 842   H "H5'"  . DC  B 2 10 ? -68.232  8.630   -11.675 1.00 0.93 ? 27  DC  C "H5'"  1  
ATOM 843   H "H5''" . DC  B 2 10 ? -66.814  8.594   -12.742 1.00 1.09 ? 27  DC  C "H5''" 1  
ATOM 844   H "H4'"  . DC  B 2 10 ? -66.345  6.725   -11.469 1.00 1.01 ? 27  DC  C "H4'"  1  
ATOM 845   H "H3'"  . DC  B 2 10 ? -67.610  6.016   -13.955 1.00 1.12 ? 27  DC  C "H3'"  1  
ATOM 846   H "H2'"  . DC  B 2 10 ? -69.312  4.671   -13.266 1.00 0.99 ? 27  DC  C "H2'"  1  
ATOM 847   H "H2''" . DC  B 2 10 ? -68.104  3.614   -12.513 1.00 1.08 ? 27  DC  C "H2''" 1  
ATOM 848   H "H1'"  . DC  B 2 10 ? -68.628  4.327   -10.436 1.00 0.93 ? 27  DC  C "H1'"  1  
ATOM 849   H H41    . DC  B 2 10 ? -74.922  5.166   -9.969  1.00 0.67 ? 27  DC  C H41    1  
ATOM 850   H H42    . DC  B 2 10 ? -74.963  6.221   -11.363 1.00 0.72 ? 27  DC  C H42    1  
ATOM 851   H H5     . DC  B 2 10 ? -72.984  6.785   -12.644 1.00 0.79 ? 27  DC  C H5     1  
ATOM 852   H H6     . DC  B 2 10 ? -70.560  6.509   -12.803 1.00 0.85 ? 27  DC  C H6     1  
ATOM 853   P P      . DG  B 2 11 ? -65.952  3.672   -14.052 1.00 1.36 ? 28  DG  C P      1  
ATOM 854   O OP1    . DG  B 2 11 ? -64.505  3.384   -14.162 1.00 1.57 ? 28  DG  C OP1    1  
ATOM 855   O OP2    . DG  B 2 11 ? -66.741  3.968   -15.271 1.00 1.38 ? 28  DG  C OP2    1  
ATOM 856   O "O5'"  . DG  B 2 11 ? -66.656  2.451   -13.271 1.00 1.30 ? 28  DG  C "O5'"  1  
ATOM 857   C "C5'"  . DG  B 2 11 ? -66.072  1.931   -12.071 1.00 1.31 ? 28  DG  C "C5'"  1  
ATOM 858   C "C4'"  . DG  B 2 11 ? -67.031  1.011   -11.312 1.00 1.27 ? 28  DG  C "C4'"  1  
ATOM 859   O "O4'"  . DG  B 2 11 ? -68.331  1.628   -11.214 1.00 1.22 ? 28  DG  C "O4'"  1  
ATOM 860   C "C3'"  . DG  B 2 11 ? -67.198  -0.350  -11.997 1.00 1.26 ? 28  DG  C "C3'"  1  
ATOM 861   O "O3'"  . DG  B 2 11 ? -66.965  -1.404  -11.060 1.00 1.31 ? 28  DG  C "O3'"  1  
ATOM 862   C "C2'"  . DG  B 2 11 ? -68.631  -0.385  -12.475 1.00 1.20 ? 28  DG  C "C2'"  1  
ATOM 863   C "C1'"  . DG  B 2 11 ? -69.340  0.780   -11.799 1.00 1.17 ? 28  DG  C "C1'"  1  
ATOM 864   N N9     . DG  B 2 11 ? -70.163  1.530   -12.770 1.00 1.13 ? 28  DG  C N9     1  
ATOM 865   C C8     . DG  B 2 11 ? -69.785  2.139   -13.936 1.00 1.15 ? 28  DG  C C8     1  
ATOM 866   N N7     . DG  B 2 11 ? -70.744  2.721   -14.588 1.00 1.15 ? 28  DG  C N7     1  
ATOM 867   C C5     . DG  B 2 11 ? -71.862  2.482   -13.791 1.00 1.10 ? 28  DG  C C5     1  
ATOM 868   C C6     . DG  B 2 11 ? -73.213  2.878   -13.982 1.00 1.10 ? 28  DG  C C6     1  
ATOM 869   O O6     . DG  B 2 11 ? -73.691  3.526   -14.908 1.00 1.13 ? 28  DG  C O6     1  
ATOM 870   N N1     . DG  B 2 11 ? -74.027  2.439   -12.946 1.00 1.07 ? 28  DG  C N1     1  
ATOM 871   C C2     . DG  B 2 11 ? -73.596  1.710   -11.859 1.00 1.06 ? 28  DG  C C2     1  
ATOM 872   N N2     . DG  B 2 11 ? -74.526  1.374   -10.964 1.00 1.06 ? 28  DG  C N2     1  
ATOM 873   N N3     . DG  B 2 11 ? -72.325  1.337   -11.674 1.00 1.08 ? 28  DG  C N3     1  
ATOM 874   C C4     . DG  B 2 11 ? -71.516  1.759   -12.673 1.00 1.09 ? 28  DG  C C4     1  
ATOM 875   H "H5'"  . DG  B 2 11 ? -65.800  2.759   -11.421 1.00 1.39 ? 28  DG  C "H5'"  1  
ATOM 876   H "H5''" . DG  B 2 11 ? -65.174  1.371   -12.326 1.00 1.33 ? 28  DG  C "H5''" 1  
ATOM 877   H "H4'"  . DG  B 2 11 ? -66.641  0.852   -10.307 1.00 1.32 ? 28  DG  C "H4'"  1  
ATOM 878   H "H3'"  . DG  B 2 11 ? -66.514  -0.455  -12.848 1.00 1.29 ? 28  DG  C "H3'"  1  
ATOM 879   H "H2'"  . DG  B 2 11 ? -68.673  -0.263  -13.559 1.00 1.20 ? 28  DG  C "H2'"  1  
ATOM 880   H "H2''" . DG  B 2 11 ? -69.090  -1.334  -12.190 1.00 1.20 ? 28  DG  C "H2''" 1  
ATOM 881   H "H1'"  . DG  B 2 11 ? -69.984  0.399   -11.002 1.00 1.16 ? 28  DG  C "H1'"  1  
ATOM 882   H H8     . DG  B 2 11 ? -68.754  2.143   -14.290 1.00 1.19 ? 28  DG  C H8     1  
ATOM 883   H H1     . DG  B 2 11 ? -75.010  2.679   -13.016 1.00 1.07 ? 28  DG  C H1     1  
ATOM 884   H H21    . DG  B 2 11 ? -75.486  1.653   -11.100 1.00 1.06 ? 28  DG  C H21    1  
ATOM 885   H H22    . DG  B 2 11 ? -74.268  0.832   -10.150 1.00 1.08 ? 28  DG  C H22    1  
ATOM 886   P P      . DG  B 2 12 ? -66.767  -2.920  -11.562 1.00 1.33 ? 29  DG  C P      1  
ATOM 887   O OP1    . DG  B 2 12 ? -65.574  -3.476  -10.885 1.00 1.52 ? 29  DG  C OP1    1  
ATOM 888   O OP2    . DG  B 2 12 ? -66.851  -2.931  -13.038 1.00 1.36 ? 29  DG  C OP2    1  
ATOM 889   O "O5'"  . DG  B 2 12 ? -68.073  -3.660  -10.977 1.00 1.18 ? 29  DG  C "O5'"  1  
ATOM 890   C "C5'"  . DG  B 2 12 ? -68.168  -3.974  -9.582  1.00 1.24 ? 29  DG  C "C5'"  1  
ATOM 891   C "C4'"  . DG  B 2 12 ? -69.488  -4.679  -9.256  1.00 1.15 ? 29  DG  C "C4'"  1  
ATOM 892   O "O4'"  . DG  B 2 12 ? -70.598  -3.871  -9.717  1.00 1.12 ? 29  DG  C "O4'"  1  
ATOM 893   C "C3'"  . DG  B 2 12 ? -69.592  -6.058  -9.935  1.00 1.05 ? 29  DG  C "C3'"  1  
ATOM 894   O "O3'"  . DG  B 2 12 ? -69.944  -7.074  -8.979  1.00 1.07 ? 29  DG  C "O3'"  1  
ATOM 895   C "C2'"  . DG  B 2 12 ? -70.685  -5.902  -10.967 1.00 0.97 ? 29  DG  C "C2'"  1  
ATOM 896   C "C1'"  . DG  B 2 12 ? -71.441  -4.639  -10.603 1.00 1.00 ? 29  DG  C "C1'"  1  
ATOM 897   N N9     . DG  B 2 12 ? -71.806  -3.881  -11.816 1.00 0.97 ? 29  DG  C N9     1  
ATOM 898   C C8     . DG  B 2 12 ? -70.999  -3.351  -12.781 1.00 1.00 ? 29  DG  C C8     1  
ATOM 899   N N7     . DG  B 2 12 ? -71.619  -2.746  -13.749 1.00 0.99 ? 29  DG  C N7     1  
ATOM 900   C C5     . DG  B 2 12 ? -72.960  -2.883  -13.400 1.00 0.96 ? 29  DG  C C5     1  
ATOM 901   C C6     . DG  B 2 12 ? -74.128  -2.428  -14.067 1.00 0.97 ? 29  DG  C C6     1  
ATOM 902   O O6     . DG  B 2 12 ? -74.214  -1.795  -15.119 1.00 1.00 ? 29  DG  C O6     1  
ATOM 903   N N1     . DG  B 2 12 ? -75.276  -2.780  -13.373 1.00 0.97 ? 29  DG  C N1     1  
ATOM 904   C C2     . DG  B 2 12 ? -75.301  -3.480  -12.189 1.00 0.96 ? 29  DG  C C2     1  
ATOM 905   N N2     . DG  B 2 12 ? -76.501  -3.719  -11.677 1.00 1.00 ? 29  DG  C N2     1  
ATOM 906   N N3     . DG  B 2 12 ? -74.207  -3.909  -11.557 1.00 0.95 ? 29  DG  C N3     1  
ATOM 907   C C4     . DG  B 2 12 ? -73.078  -3.576  -12.216 1.00 0.95 ? 29  DG  C C4     1  
ATOM 908   H "H5'"  . DG  B 2 12 ? -68.106  -3.051  -9.006  1.00 1.28 ? 29  DG  C "H5'"  1  
ATOM 909   H "H5''" . DG  B 2 12 ? -67.339  -4.623  -9.304  1.00 1.42 ? 29  DG  C "H5''" 1  
ATOM 910   H "H4'"  . DG  B 2 12 ? -69.567  -4.806  -8.174  1.00 1.22 ? 29  DG  C "H4'"  1  
ATOM 911   H "H3'"  . DG  B 2 12 ? -68.648  -6.328  -10.424 1.00 1.07 ? 29  DG  C "H3'"  1  
ATOM 912   H "H2'"  . DG  B 2 12 ? -70.253  -5.797  -11.964 1.00 0.97 ? 29  DG  C "H2'"  1  
ATOM 913   H "H2''" . DG  B 2 12 ? -71.346  -6.761  -10.944 1.00 0.94 ? 29  DG  C "H2''" 1  
ATOM 914   H "H1'"  . DG  B 2 12 ? -72.353  -4.906  -10.067 1.00 1.00 ? 29  DG  C "H1'"  1  
ATOM 915   H H8     . DG  B 2 12 ? -69.915  -3.439  -12.748 1.00 1.05 ? 29  DG  C H8     1  
ATOM 916   H H1     . DG  B 2 12 ? -76.149  -2.499  -13.788 1.00 1.00 ? 29  DG  C H1     1  
ATOM 917   H H21    . DG  B 2 12 ? -77.323  -3.390  -12.159 1.00 1.04 ? 29  DG  C H21    1  
ATOM 918   H H22    . DG  B 2 12 ? -76.591  -4.228  -10.812 1.00 1.02 ? 29  DG  C H22    1  
ATOM 919   P P      . DC  B 2 13 ? -70.202  -8.606  -9.433  1.00 1.01 ? 30  DC  C P      1  
ATOM 920   O OP1    . DC  B 2 13 ? -70.064  -9.476  -8.245  1.00 1.13 ? 30  DC  C OP1    1  
ATOM 921   O OP2    . DC  B 2 13 ? -69.392  -8.869  -10.641 1.00 1.02 ? 30  DC  C OP2    1  
ATOM 922   O "O5'"  . DC  B 2 13 ? -71.760  -8.597  -9.860  1.00 0.88 ? 30  DC  C "O5'"  1  
ATOM 923   C "C5'"  . DC  B 2 13 ? -72.741  -8.049  -8.976  1.00 0.93 ? 30  DC  C "C5'"  1  
ATOM 924   C "C4'"  . DC  B 2 13 ? -74.156  -8.584  -9.254  1.00 0.88 ? 30  DC  C "C4'"  1  
ATOM 925   O "O4'"  . DC  B 2 13 ? -74.855  -7.659  -10.123 1.00 0.83 ? 30  DC  C "O4'"  1  
ATOM 926   C "C3'"  . DC  B 2 13 ? -74.148  -9.963  -9.933  1.00 0.82 ? 30  DC  C "C3'"  1  
ATOM 927   O "O3'"  . DC  B 2 13 ? -74.924  -10.899 -9.184  1.00 0.91 ? 30  DC  C "O3'"  1  
ATOM 928   C "C2'"  . DC  B 2 13 ? -74.793  -9.751  -11.282 1.00 0.73 ? 30  DC  C "C2'"  1  
ATOM 929   C "C1'"  . DC  B 2 13 ? -75.384  -8.347  -11.275 1.00 0.73 ? 30  DC  C "C1'"  1  
ATOM 930   N N1     . DC  B 2 13 ? -75.049  -7.619  -12.535 1.00 0.66 ? 30  DC  C N1     1  
ATOM 931   C C2     . DC  B 2 13 ? -76.102  -7.192  -13.339 1.00 0.64 ? 30  DC  C C2     1  
ATOM 932   O O2     . DC  B 2 13 ? -77.263  -7.411  -12.994 1.00 0.69 ? 30  DC  C O2     1  
ATOM 933   N N3     . DC  B 2 13 ? -75.814  -6.533  -14.494 1.00 0.62 ? 30  DC  C N3     1  
ATOM 934   C C4     . DC  B 2 13 ? -74.544  -6.303  -14.852 1.00 0.62 ? 30  DC  C C4     1  
ATOM 935   N N4     . DC  B 2 13 ? -74.291  -5.668  -16.002 1.00 0.65 ? 30  DC  C N4     1  
ATOM 936   C C5     . DC  B 2 13 ? -73.455  -6.738  -14.028 1.00 0.63 ? 30  DC  C C5     1  
ATOM 937   C C6     . DC  B 2 13 ? -73.753  -7.391  -12.890 1.00 0.65 ? 30  DC  C C6     1  
ATOM 938   H "H5'"  . DC  B 2 13 ? -72.748  -6.969  -9.091  1.00 0.96 ? 30  DC  C "H5'"  1  
ATOM 939   H "H5''" . DC  B 2 13 ? -72.461  -8.294  -7.950  1.00 1.02 ? 30  DC  C "H5''" 1  
ATOM 940   H "H4'"  . DC  B 2 13 ? -74.701  -8.663  -8.313  1.00 0.97 ? 30  DC  C "H4'"  1  
ATOM 941   H "H3'"  . DC  B 2 13 ? -73.125  -10.340 -10.051 1.00 0.82 ? 30  DC  C "H3'"  1  
ATOM 942   H "H2'"  . DC  B 2 13 ? -74.051  -9.841  -12.074 1.00 0.69 ? 30  DC  C "H2'"  1  
ATOM 943   H "H2''" . DC  B 2 13 ? -75.579  -10.488 -11.431 1.00 0.75 ? 30  DC  C "H2''" 1  
ATOM 944   H "H1'"  . DC  B 2 13 ? -76.471  -8.419  -11.164 1.00 0.77 ? 30  DC  C "H1'"  1  
ATOM 945   H H41    . DC  B 2 13 ? -75.049  -5.355  -16.587 1.00 0.67 ? 30  DC  C H41    1  
ATOM 946   H H42    . DC  B 2 13 ? -73.336  -5.500  -16.282 1.00 0.67 ? 30  DC  C H42    1  
ATOM 947   H H5     . DC  B 2 13 ? -72.421  -6.548  -14.313 1.00 0.66 ? 30  DC  C H5     1  
ATOM 948   H H6     . DC  B 2 13 ? -72.954  -7.745  -12.248 1.00 0.69 ? 30  DC  C H6     1  
ATOM 949   P P      . DT  B 2 14 ? -75.038  -12.445 -9.634  1.00 0.94 ? 31  DT  C P      1  
ATOM 950   O OP1    . DT  B 2 14 ? -75.406  -13.241 -8.439  1.00 1.09 ? 31  DT  C OP1    1  
ATOM 951   O OP2    . DT  B 2 14 ? -73.831  -12.801 -10.411 1.00 0.91 ? 31  DT  C OP2    1  
ATOM 952   O "O5'"  . DT  B 2 14 ? -76.297  -12.442 -10.643 1.00 0.88 ? 31  DT  C "O5'"  1  
ATOM 953   C "C5'"  . DT  B 2 14 ? -77.610  -12.180 -10.151 1.00 0.99 ? 31  DT  C "C5'"  1  
ATOM 954   C "C4'"  . DT  B 2 14 ? -78.660  -12.157 -11.269 1.00 0.96 ? 31  DT  C "C4'"  1  
ATOM 955   O "O4'"  . DT  B 2 14 ? -78.337  -11.116 -12.222 1.00 0.86 ? 31  DT  C "O4'"  1  
ATOM 956   C "C3'"  . DT  B 2 14 ? -78.732  -13.489 -12.038 1.00 0.98 ? 31  DT  C "C3'"  1  
ATOM 957   O "O3'"  . DT  B 2 14 ? -80.074  -13.988 -12.044 1.00 1.07 ? 31  DT  C "O3'"  1  
ATOM 958   C "C2'"  . DT  B 2 14 ? -78.310  -13.159 -13.456 1.00 0.91 ? 31  DT  C "C2'"  1  
ATOM 959   C "C1'"  . DT  B 2 14 ? -78.350  -11.639 -13.564 1.00 0.82 ? 31  DT  C "C1'"  1  
ATOM 960   N N1     . DT  B 2 14 ? -77.212  -11.102 -14.362 1.00 0.73 ? 31  DT  C N1     1  
ATOM 961   C C2     . DT  B 2 14 ? -77.510  -10.302 -15.457 1.00 0.70 ? 31  DT  C C2     1  
ATOM 962   O O2     . DT  B 2 14 ? -78.666  -10.043 -15.783 1.00 0.76 ? 31  DT  C O2     1  
ATOM 963   N N3     . DT  B 2 14 ? -76.431  -9.812  -16.166 1.00 0.66 ? 31  DT  C N3     1  
ATOM 964   C C4     . DT  B 2 14 ? -75.097  -10.040 -15.882 1.00 0.64 ? 31  DT  C C4     1  
ATOM 965   O O4     . DT  B 2 14 ? -74.219  -9.546  -16.579 1.00 0.64 ? 31  DT  C O4     1  
ATOM 966   C C5     . DT  B 2 14 ? -74.874  -10.879 -14.731 1.00 0.68 ? 31  DT  C C5     1  
ATOM 967   C C7     . DT  B 2 14 ? -73.433  -11.203 -14.316 1.00 0.72 ? 31  DT  C C7     1  
ATOM 968   C C6     . DT  B 2 14 ? -75.913  -11.374 -14.017 1.00 0.72 ? 31  DT  C C6     1  
ATOM 969   H "H5'"  . DT  B 2 14 ? -77.609  -11.214 -9.647  1.00 1.08 ? 31  DT  C "H5'"  1  
ATOM 970   H "H5''" . DT  B 2 14 ? -77.876  -12.953 -9.430  1.00 1.13 ? 31  DT  C "H5''" 1  
ATOM 971   H "H4'"  . DT  B 2 14 ? -79.633  -11.948 -10.833 1.00 1.02 ? 31  DT  C "H4'"  1  
ATOM 972   H "H3'"  . DT  B 2 14 ? -78.060  -14.235 -11.605 1.00 1.02 ? 31  DT  C "H3'"  1  
ATOM 973   H "H2'"  . DT  B 2 14 ? -77.308  -13.535 -13.653 1.00 0.90 ? 31  DT  C "H2'"  1  
ATOM 974   H "H2''" . DT  B 2 14 ? -79.009  -13.601 -14.162 1.00 0.97 ? 31  DT  C "H2''" 1  
ATOM 975   H "H1'"  . DT  B 2 14 ? -79.297  -11.345 -14.029 1.00 0.85 ? 31  DT  C "H1'"  1  
ATOM 976   H H3     . DT  B 2 14 ? -76.636  -9.230  -16.965 1.00 0.67 ? 31  DT  C H3     1  
ATOM 977   H H71    . DT  B 2 14 ? -72.911  -11.657 -15.157 1.00 1.28 ? 31  DT  C H71    1  
ATOM 978   H H72    . DT  B 2 14 ? -73.428  -11.895 -13.472 1.00 1.20 ? 31  DT  C H72    1  
ATOM 979   H H73    . DT  B 2 14 ? -72.926  -10.283 -14.032 1.00 1.26 ? 31  DT  C H73    1  
ATOM 980   H H6     . DT  B 2 14 ? -75.712  -12.007 -13.155 1.00 0.78 ? 31  DT  C H6     1  
ATOM 981   P P      . DC  B 2 15 ? -80.427  -15.376 -12.782 1.00 1.17 ? 32  DC  C P      1  
ATOM 982   O OP1    . DC  B 2 15 ? -81.275  -16.185 -11.876 1.00 1.31 ? 32  DC  C OP1    1  
ATOM 983   O OP2    . DC  B 2 15 ? -79.160  -15.942 -13.298 1.00 1.18 ? 32  DC  C OP2    1  
ATOM 984   O "O5'"  . DC  B 2 15 ? -81.326  -14.898 -14.044 1.00 1.11 ? 32  DC  C "O5'"  1  
ATOM 985   C "C5'"  . DC  B 2 15 ? -82.555  -14.176 -13.849 1.00 1.12 ? 32  DC  C "C5'"  1  
ATOM 986   C "C4'"  . DC  B 2 15 ? -83.223  -13.791 -15.178 1.00 1.09 ? 32  DC  C "C4'"  1  
ATOM 987   O "O4'"  . DC  B 2 15 ? -82.359  -12.908 -15.932 1.00 0.97 ? 32  DC  C "O4'"  1  
ATOM 988   C "C3'"  . DC  B 2 15 ? -83.537  -15.014 -16.047 1.00 1.18 ? 32  DC  C "C3'"  1  
ATOM 989   O "O3'"  . DC  B 2 15 ? -84.910  -14.993 -16.467 1.00 1.29 ? 32  DC  C "O3'"  1  
ATOM 990   C "C2'"  . DC  B 2 15 ? -82.614  -14.901 -17.243 1.00 1.14 ? 32  DC  C "C2'"  1  
ATOM 991   C "C1'"  . DC  B 2 15 ? -82.025  -13.485 -17.215 1.00 1.00 ? 32  DC  C "C1'"  1  
ATOM 992   N N1     . DC  B 2 15 ? -80.537  -13.485 -17.419 1.00 0.92 ? 32  DC  C N1     1  
ATOM 993   C C2     . DC  B 2 15 ? -80.007  -12.707 -18.457 1.00 0.87 ? 32  DC  C C2     1  
ATOM 994   O O2     . DC  B 2 15 ? -80.757  -12.072 -19.196 1.00 0.89 ? 32  DC  C O2     1  
ATOM 995   N N3     . DC  B 2 15 ? -78.655  -12.678 -18.625 1.00 0.83 ? 32  DC  C N3     1  
ATOM 996   C C4     . DC  B 2 15 ? -77.846  -13.377 -17.819 1.00 0.84 ? 32  DC  C C4     1  
ATOM 997   N N4     . DC  B 2 15 ? -76.523  -13.331 -18.011 1.00 0.83 ? 32  DC  C N4     1  
ATOM 998   C C5     . DC  B 2 15 ? -78.377  -14.176 -16.761 1.00 0.91 ? 32  DC  C C5     1  
ATOM 999   C C6     . DC  B 2 15 ? -79.717  -14.202 -16.597 1.00 0.94 ? 32  DC  C C6     1  
ATOM 1000  H "H5'"  . DC  B 2 15 ? -82.346  -13.266 -13.285 1.00 1.19 ? 32  DC  C "H5'"  1  
ATOM 1001  H "H5''" . DC  B 2 15 ? -83.244  -14.797 -13.277 1.00 1.24 ? 32  DC  C "H5''" 1  
ATOM 1002  H "H4'"  . DC  B 2 15 ? -84.156  -13.271 -14.961 1.00 1.13 ? 32  DC  C "H4'"  1  
ATOM 1003  H "H3'"  . DC  B 2 15 ? -83.338  -15.942 -15.500 1.00 1.25 ? 32  DC  C "H3'"  1  
ATOM 1004  H "H2'"  . DC  B 2 15 ? -81.818  -15.645 -17.179 1.00 1.16 ? 32  DC  C "H2'"  1  
ATOM 1005  H "H2''" . DC  B 2 15 ? -83.183  -15.052 -18.159 1.00 1.22 ? 32  DC  C "H2''" 1  
ATOM 1006  H "H1'"  . DC  B 2 15 ? -82.506  -12.885 -17.996 1.00 1.01 ? 32  DC  C "H1'"  1  
ATOM 1007  H H41    . DC  B 2 15 ? -76.138  -12.769 -18.757 1.00 0.81 ? 32  DC  C H41    1  
ATOM 1008  H H42    . DC  B 2 15 ? -75.906  -13.861 -17.409 1.00 0.87 ? 32  DC  C H42    1  
ATOM 1009  H H5     . DC  B 2 15 ? -77.719  -14.748 -16.106 1.00 0.95 ? 32  DC  C H5     1  
ATOM 1010  H H6     . DC  B 2 15 ? -80.150  -14.806 -15.802 1.00 1.01 ? 32  DC  C H6     1  
ATOM 1011  P P      . DG  B 2 16 ? -85.498  -16.141 -17.442 1.00 1.44 ? 33  DG  C P      1  
ATOM 1012  O OP1    . DG  B 2 16 ? -86.947  -16.285 -17.176 1.00 1.57 ? 33  DG  C OP1    1  
ATOM 1013  O OP2    . DG  B 2 16 ? -84.611  -17.322 -17.342 1.00 1.48 ? 33  DG  C OP2    1  
ATOM 1014  O "O5'"  . DG  B 2 16 ? -85.314  -15.488 -18.911 1.00 1.39 ? 33  DG  C "O5'"  1  
ATOM 1015  C "C5'"  . DG  B 2 16 ? -85.973  -14.262 -19.253 1.00 1.37 ? 33  DG  C "C5'"  1  
ATOM 1016  C "C4'"  . DG  B 2 16 ? -85.788  -13.894 -20.732 1.00 1.33 ? 33  DG  C "C4'"  1  
ATOM 1017  O "O4'"  . DG  B 2 16 ? -84.394  -13.635 -21.011 1.00 1.27 ? 33  DG  C "O4'"  1  
ATOM 1018  C "C3'"  . DG  B 2 16 ? -86.261  -15.011 -21.667 1.00 1.41 ? 33  DG  C "C3'"  1  
ATOM 1019  O "O3'"  . DG  B 2 16 ? -87.169  -14.493 -22.644 1.00 1.45 ? 33  DG  C "O3'"  1  
ATOM 1020  C "C2'"  . DG  B 2 16 ? -85.017  -15.527 -22.345 1.00 1.40 ? 33  DG  C "C2'"  1  
ATOM 1021  C "C1'"  . DG  B 2 16 ? -83.897  -14.556 -22.003 1.00 1.29 ? 33  DG  C "C1'"  1  
ATOM 1022  N N9     . DG  B 2 16 ? -82.716  -15.276 -21.494 1.00 1.26 ? 33  DG  C N9     1  
ATOM 1023  C C8     . DG  B 2 16 ? -82.623  -16.193 -20.488 1.00 1.31 ? 33  DG  C C8     1  
ATOM 1024  N N7     . DG  B 2 16 ? -81.423  -16.643 -20.258 1.00 1.30 ? 33  DG  C N7     1  
ATOM 1025  C C5     . DG  B 2 16 ? -80.646  -15.969 -21.191 1.00 1.23 ? 33  DG  C C5     1  
ATOM 1026  C C6     . DG  B 2 16 ? -79.249  -16.038 -21.437 1.00 1.21 ? 33  DG  C C6     1  
ATOM 1027  O O6     . DG  B 2 16 ? -78.409  -16.717 -20.863 1.00 1.25 ? 33  DG  C O6     1  
ATOM 1028  N N1     . DG  B 2 16 ? -78.873  -15.191 -22.472 1.00 1.17 ? 33  DG  C N1     1  
ATOM 1029  C C2     . DG  B 2 16 ? -79.727  -14.379 -23.183 1.00 1.16 ? 33  DG  C C2     1  
ATOM 1030  N N2     . DG  B 2 16 ? -79.172  -13.633 -24.135 1.00 1.15 ? 33  DG  C N2     1  
ATOM 1031  N N3     . DG  B 2 16 ? -81.042  -14.314 -22.961 1.00 1.18 ? 33  DG  C N3     1  
ATOM 1032  C C4     . DG  B 2 16 ? -81.429  -15.132 -21.956 1.00 1.21 ? 33  DG  C C4     1  
ATOM 1033  H "H5'"  . DG  B 2 16 ? -85.569  -13.459 -18.637 1.00 1.36 ? 33  DG  C "H5'"  1  
ATOM 1034  H "H5''" . DG  B 2 16 ? -87.037  -14.366 -19.047 1.00 1.43 ? 33  DG  C "H5''" 1  
ATOM 1035  H "H4'"  . DG  B 2 16 ? -86.362  -12.990 -20.944 1.00 1.32 ? 33  DG  C "H4'"  1  
ATOM 1036  H "H3'"  . DG  B 2 16 ? -86.744  -15.812 -21.107 1.00 1.48 ? 33  DG  C "H3'"  1  
ATOM 1037  H "H2'"  . DG  B 2 16 ? -84.770  -16.521 -21.975 1.00 1.45 ? 33  DG  C "H2'"  1  
ATOM 1038  H "H2''" . DG  B 2 16 ? -85.173  -15.561 -23.422 1.00 1.44 ? 33  DG  C "H2''" 1  
ATOM 1039  H "H1'"  . DG  B 2 16 ? -83.616  -13.994 -22.898 1.00 1.27 ? 33  DG  C "H1'"  1  
ATOM 1040  H H8     . DG  B 2 16 ? -83.494  -16.534 -19.923 1.00 1.38 ? 33  DG  C H8     1  
ATOM 1041  H H1     . DG  B 2 16 ? -77.895  -15.182 -22.706 1.00 1.18 ? 33  DG  C H1     1  
ATOM 1042  H H21    . DG  B 2 16 ? -78.179  -13.685 -24.301 1.00 1.16 ? 33  DG  C H21    1  
ATOM 1043  H H22    . DG  B 2 16 ? -79.745  -13.012 -24.688 1.00 1.16 ? 33  DG  C H22    1  
ATOM 1044  P P      . DA  B 2 17 ? -87.840  -15.467 -23.740 1.00 1.56 ? 34  DA  C P      1  
ATOM 1045  O OP1    . DA  B 2 17 ? -89.087  -14.835 -24.220 1.00 1.62 ? 34  DA  C OP1    1  
ATOM 1046  O OP2    . DA  B 2 17 ? -87.871  -16.836 -23.177 1.00 1.64 ? 34  DA  C OP2    1  
ATOM 1047  O "O5'"  . DA  B 2 17 ? -86.770  -15.439 -24.942 1.00 1.55 ? 34  DA  C "O5'"  1  
ATOM 1048  C "C5'"  . DA  B 2 17 ? -86.340  -14.193 -25.494 1.00 1.50 ? 34  DA  C "C5'"  1  
ATOM 1049  C "C4'"  . DA  B 2 17 ? -85.676  -14.376 -26.865 1.00 1.56 ? 34  DA  C "C4'"  1  
ATOM 1050  O "O4'"  . DA  B 2 17 ? -84.252  -14.547 -26.688 1.00 1.51 ? 34  DA  C "O4'"  1  
ATOM 1051  C "C3'"  . DA  B 2 17 ? -86.213  -15.601 -27.618 1.00 1.70 ? 34  DA  C "C3'"  1  
ATOM 1052  O "O3'"  . DA  B 2 17 ? -86.640  -15.236 -28.934 1.00 1.79 ? 34  DA  C "O3'"  1  
ATOM 1053  C "C2'"  . DA  B 2 17 ? -85.051  -16.567 -27.710 1.00 1.72 ? 34  DA  C "C2'"  1  
ATOM 1054  C "C1'"  . DA  B 2 17 ? -83.817  -15.812 -27.228 1.00 1.60 ? 34  DA  C "C1'"  1  
ATOM 1055  N N9     . DA  B 2 17 ? -83.056  -16.584 -26.216 1.00 1.57 ? 34  DA  C N9     1  
ATOM 1056  C C8     . DA  B 2 17 ? -83.497  -17.255 -25.105 1.00 1.59 ? 34  DA  C C8     1  
ATOM 1057  N N7     . DA  B 2 17 ? -82.558  -17.829 -24.403 1.00 1.58 ? 34  DA  C N7     1  
ATOM 1058  C C5     . DA  B 2 17 ? -81.396  -17.509 -25.111 1.00 1.55 ? 34  DA  C C5     1  
ATOM 1059  C C6     . DA  B 2 17 ? -80.043  -17.810 -24.907 1.00 1.55 ? 34  DA  C C6     1  
ATOM 1060  N N6     . DA  B 2 17 ? -79.597  -18.521 -23.877 1.00 1.57 ? 34  DA  C N6     1  
ATOM 1061  N N1     . DA  B 2 17 ? -79.159  -17.340 -25.802 1.00 1.55 ? 34  DA  C N1     1  
ATOM 1062  C C2     . DA  B 2 17 ? -79.574  -16.611 -26.836 1.00 1.55 ? 34  DA  C C2     1  
ATOM 1063  N N3     . DA  B 2 17 ? -80.824  -16.269 -27.121 1.00 1.56 ? 34  DA  C N3     1  
ATOM 1064  C C4     . DA  B 2 17 ? -81.692  -16.758 -26.209 1.00 1.55 ? 34  DA  C C4     1  
ATOM 1065  H "H5'"  . DA  B 2 17 ? -85.621  -13.737 -24.816 1.00 1.41 ? 34  DA  C "H5'"  1  
ATOM 1066  H "H5''" . DA  B 2 17 ? -87.202  -13.533 -25.595 1.00 1.52 ? 34  DA  C "H5''" 1  
ATOM 1067  H "H4'"  . DA  B 2 17 ? -85.851  -13.486 -27.470 1.00 1.57 ? 34  DA  C "H4'"  1  
ATOM 1068  H "H3'"  . DA  B 2 17 ? -87.046  -16.065 -27.078 1.00 1.73 ? 34  DA  C "H3'"  1  
ATOM 1069  H "HO3'" . DA  B 2 17 ? -87.394  -14.664 -28.837 1.00 2.00 ? 34  DA  C "HO3'" 1  
ATOM 1070  H "H2'"  . DA  B 2 17 ? -85.226  -17.439 -27.076 1.00 1.75 ? 34  DA  C "H2'"  1  
ATOM 1071  H "H2''" . DA  B 2 17 ? -84.923  -16.885 -28.746 1.00 1.81 ? 34  DA  C "H2''" 1  
ATOM 1072  H "H1'"  . DA  B 2 17 ? -83.164  -15.614 -28.082 1.00 1.62 ? 34  DA  C "H1'"  1  
ATOM 1073  H H8     . DA  B 2 17 ? -84.549  -17.310 -24.832 1.00 1.62 ? 34  DA  C H8     1  
ATOM 1074  H H61    . DA  B 2 17 ? -78.609  -18.708 -23.781 1.00 1.58 ? 34  DA  C H61    1  
ATOM 1075  H H62    . DA  B 2 17 ? -80.246  -18.875 -23.190 1.00 1.59 ? 34  DA  C H62    1  
ATOM 1076  H H2     . DA  B 2 17 ? -78.807  -16.258 -27.524 1.00 1.57 ? 34  DA  C H2     1  
ATOM 1077  N N      . VAL C 3 1  ? -103.538 16.138  -29.095 1.00 2.88 ? 10  VAL A N      1  
ATOM 1078  C CA     . VAL C 3 1  ? -102.903 14.883  -28.604 1.00 2.54 ? 10  VAL A CA     1  
ATOM 1079  C C      . VAL C 3 1  ? -101.985 15.221  -27.431 1.00 2.47 ? 10  VAL A C      1  
ATOM 1080  O O      . VAL C 3 1  ? -101.279 14.377  -26.915 1.00 2.82 ? 10  VAL A O      1  
ATOM 1081  C CB     . VAL C 3 1  ? -102.096 14.241  -29.742 1.00 2.80 ? 10  VAL A CB     1  
ATOM 1082  C CG1    . VAL C 3 1  ? -100.892 15.126  -30.102 1.00 3.34 ? 10  VAL A CG1    1  
ATOM 1083  C CG2    . VAL C 3 1  ? -101.599 12.853  -29.315 1.00 2.97 ? 10  VAL A CG2    1  
ATOM 1084  H H      . VAL C 3 1  ? -103.004 16.959  -29.176 1.00 3.33 ? 10  VAL A H      1  
ATOM 1085  H HA     . VAL C 3 1  ? -103.672 14.198  -28.271 1.00 2.70 ? 10  VAL A HA     1  
ATOM 1086  H HB     . VAL C 3 1  ? -102.734 14.144  -30.610 1.00 3.12 ? 10  VAL A HB     1  
ATOM 1087  H HG11   . VAL C 3 1  ? -101.192 16.164  -30.121 1.00 3.84 ? 10  VAL A HG11   1  
ATOM 1088  H HG12   . VAL C 3 1  ? -100.112 14.992  -29.367 1.00 3.62 ? 10  VAL A HG12   1  
ATOM 1089  H HG13   . VAL C 3 1  ? -100.521 14.841  -31.076 1.00 3.57 ? 10  VAL A HG13   1  
ATOM 1090  H HG21   . VAL C 3 1  ? -102.378 12.334  -28.778 1.00 3.26 ? 10  VAL A HG21   1  
ATOM 1091  H HG22   . VAL C 3 1  ? -101.330 12.286  -30.192 1.00 3.06 ? 10  VAL A HG22   1  
ATOM 1092  H HG23   . VAL C 3 1  ? -100.733 12.960  -28.677 1.00 3.34 ? 10  VAL A HG23   1  
ATOM 1093  N N      . ILE C 3 2  ? -102.008 16.460  -26.998 1.00 2.30 ? 11  ILE A N      1  
ATOM 1094  C CA     . ILE C 3 2  ? -101.158 16.902  -25.850 1.00 2.34 ? 11  ILE A CA     1  
ATOM 1095  C C      . ILE C 3 2  ? -102.051 17.560  -24.780 1.00 2.16 ? 11  ILE A C      1  
ATOM 1096  O O      . ILE C 3 2  ? -102.104 18.771  -24.692 1.00 2.18 ? 11  ILE A O      1  
ATOM 1097  C CB     . ILE C 3 2  ? -100.144 17.944  -26.338 1.00 2.83 ? 11  ILE A CB     1  
ATOM 1098  C CG1    . ILE C 3 2  ? -99.268  17.352  -27.453 1.00 3.26 ? 11  ILE A CG1    1  
ATOM 1099  C CG2    . ILE C 3 2  ? -99.260  18.406  -25.172 1.00 2.95 ? 11  ILE A CG2    1  
ATOM 1100  C CD1    . ILE C 3 2  ? -98.515  16.096  -26.963 1.00 3.52 ? 11  ILE A CD1    1  
ATOM 1101  H H      . ILE C 3 2  ? -102.599 17.107  -27.427 1.00 2.35 ? 11  ILE A H      1  
ATOM 1102  H HA     . ILE C 3 2  ? -100.627 16.063  -25.432 1.00 2.58 ? 11  ILE A HA     1  
ATOM 1103  H HB     . ILE C 3 2  ? -100.682 18.795  -26.728 1.00 3.23 ? 11  ILE A HB     1  
ATOM 1104  H HG12   . ILE C 3 2  ? -99.897  17.091  -28.292 1.00 3.70 ? 11  ILE A HG12   1  
ATOM 1105  H HG13   . ILE C 3 2  ? -98.552  18.098  -27.769 1.00 3.50 ? 11  ILE A HG13   1  
ATOM 1106  H HG21   . ILE C 3 2  ? -98.992  17.556  -24.563 1.00 3.09 ? 11  ILE A HG21   1  
ATOM 1107  H HG22   . ILE C 3 2  ? -98.361  18.868  -25.558 1.00 3.20 ? 11  ILE A HG22   1  
ATOM 1108  H HG23   . ILE C 3 2  ? -99.801  19.121  -24.576 1.00 3.25 ? 11  ILE A HG23   1  
ATOM 1109  H HD11   . ILE C 3 2  ? -98.328  16.156  -25.900 1.00 3.88 ? 11  ILE A HD11   1  
ATOM 1110  H HD12   . ILE C 3 2  ? -99.107  15.219  -27.170 1.00 3.51 ? 11  ILE A HD12   1  
ATOM 1111  H HD13   . ILE C 3 2  ? -97.572  16.020  -27.486 1.00 3.94 ? 11  ILE A HD13   1  
ATOM 1112  N N      . PRO C 3 3  ? -102.728 16.757  -23.989 1.00 2.45 ? 12  PRO A N      1  
ATOM 1113  C CA     . PRO C 3 3  ? -103.596 17.283  -22.918 1.00 2.83 ? 12  PRO A CA     1  
ATOM 1114  C C      . PRO C 3 3  ? -102.715 17.938  -21.837 1.00 2.73 ? 12  PRO A C      1  
ATOM 1115  O O      . PRO C 3 3  ? -103.191 18.351  -20.795 1.00 3.20 ? 12  PRO A O      1  
ATOM 1116  C CB     . PRO C 3 3  ? -104.325 16.043  -22.352 1.00 3.56 ? 12  PRO A CB     1  
ATOM 1117  C CG     . PRO C 3 3  ? -103.708 14.796  -23.038 1.00 3.55 ? 12  PRO A CG     1  
ATOM 1118  C CD     . PRO C 3 3  ? -102.707 15.285  -24.104 1.00 2.86 ? 12  PRO A CD     1  
ATOM 1119  H HA     . PRO C 3 3  ? -104.308 17.985  -23.319 1.00 2.97 ? 12  PRO A HA     1  
ATOM 1120  H HB2    . PRO C 3 3  ? -104.182 15.979  -21.279 1.00 3.91 ? 12  PRO A HB2    1  
ATOM 1121  H HB3    . PRO C 3 3  ? -105.383 16.095  -22.571 1.00 3.95 ? 12  PRO A HB3    1  
ATOM 1122  H HG2    . PRO C 3 3  ? -103.190 14.215  -22.299 1.00 3.96 ? 12  PRO A HG2    1  
ATOM 1123  H HG3    . PRO C 3 3  ? -104.480 14.198  -23.504 1.00 3.84 ? 12  PRO A HG3    1  
ATOM 1124  H HD2    . PRO C 3 3  ? -101.719 14.897  -23.891 1.00 3.03 ? 12  PRO A HD2    1  
ATOM 1125  H HD3    . PRO C 3 3  ? -103.024 14.986  -25.092 1.00 2.81 ? 12  PRO A HD3    1  
ATOM 1126  N N      . ALA C 3 4  ? -101.434 18.005  -22.072 1.00 2.41 ? 13  ALA A N      1  
ATOM 1127  C CA     . ALA C 3 4  ? -100.518 18.597  -21.064 1.00 2.65 ? 13  ALA A CA     1  
ATOM 1128  C C      . ALA C 3 4  ? -100.722 20.111  -20.999 1.00 2.45 ? 13  ALA A C      1  
ATOM 1129  O O      . ALA C 3 4  ? -101.548 20.610  -20.258 1.00 2.41 ? 13  ALA A O      1  
ATOM 1130  C CB     . ALA C 3 4  ? -99.076  18.281  -21.477 1.00 2.93 ? 13  ALA A CB     1  
ATOM 1131  H H      . ALA C 3 4  ? -101.070 17.648  -22.904 1.00 2.29 ? 13  ALA A H      1  
ATOM 1132  H HA     . ALA C 3 4  ? -100.714 18.167  -20.093 1.00 3.12 ? 13  ALA A HA     1  
ATOM 1133  H HB1    . ALA C 3 4  ? -98.905  18.637  -22.483 1.00 3.13 ? 13  ALA A HB1    1  
ATOM 1134  H HB2    . ALA C 3 4  ? -98.387  18.766  -20.802 1.00 3.43 ? 13  ALA A HB2    1  
ATOM 1135  H HB3    . ALA C 3 4  ? -98.925  17.212  -21.449 1.00 3.08 ? 13  ALA A HB3    1  
ATOM 1136  N N      . ALA C 3 5  ? -99.969  20.837  -21.765 1.00 2.64 ? 14  ALA A N      1  
ATOM 1137  C CA     . ALA C 3 5  ? -100.089 22.319  -21.766 1.00 2.80 ? 14  ALA A CA     1  
ATOM 1138  C C      . ALA C 3 5  ? -101.463 22.737  -22.296 1.00 2.70 ? 14  ALA A C      1  
ATOM 1139  O O      . ALA C 3 5  ? -101.798 23.902  -22.315 1.00 2.87 ? 14  ALA A O      1  
ATOM 1140  C CB     . ALA C 3 5  ? -98.991  22.899  -22.659 1.00 3.29 ? 14  ALA A CB     1  
ATOM 1141  H H      . ALA C 3 5  ? -99.312  20.404  -22.348 1.00 2.86 ? 14  ALA A H      1  
ATOM 1142  H HA     . ALA C 3 5  ? -99.966  22.691  -20.760 1.00 2.86 ? 14  ALA A HA     1  
ATOM 1143  H HB1    . ALA C 3 5  ? -98.033  22.514  -22.341 1.00 3.56 ? 14  ALA A HB1    1  
ATOM 1144  H HB2    . ALA C 3 5  ? -99.172  22.610  -23.684 1.00 3.60 ? 14  ALA A HB2    1  
ATOM 1145  H HB3    . ALA C 3 5  ? -98.990  23.977  -22.582 1.00 3.55 ? 14  ALA A HB3    1  
ATOM 1146  N N      . ALA C 3 6  ? -102.262 21.811  -22.746 1.00 2.63 ? 15  ALA A N      1  
ATOM 1147  C CA     . ALA C 3 6  ? -103.601 22.192  -23.286 1.00 2.72 ? 15  ALA A CA     1  
ATOM 1148  C C      . ALA C 3 6  ? -104.628 22.260  -22.149 1.00 2.61 ? 15  ALA A C      1  
ATOM 1149  O O      . ALA C 3 6  ? -105.536 23.060  -22.172 1.00 2.73 ? 15  ALA A O      1  
ATOM 1150  C CB     . ALA C 3 6  ? -104.036 21.158  -24.325 1.00 2.93 ? 15  ALA A CB     1  
ATOM 1151  H H      . ALA C 3 6  ? -101.982 20.873  -22.739 1.00 2.65 ? 15  ALA A H      1  
ATOM 1152  H HA     . ALA C 3 6  ? -103.535 23.160  -23.757 1.00 2.88 ? 15  ALA A HA     1  
ATOM 1153  H HB1    . ALA C 3 6  ? -103.205 20.942  -24.982 1.00 3.26 ? 15  ALA A HB1    1  
ATOM 1154  H HB2    . ALA C 3 6  ? -104.345 20.251  -23.827 1.00 3.28 ? 15  ALA A HB2    1  
ATOM 1155  H HB3    . ALA C 3 6  ? -104.856 21.553  -24.902 1.00 2.95 ? 15  ALA A HB3    1  
ATOM 1156  N N      . LEU C 3 7  ? -104.488 21.415  -21.162 1.00 2.52 ? 16  LEU A N      1  
ATOM 1157  C CA     . LEU C 3 7  ? -105.454 21.411  -20.023 1.00 2.60 ? 16  LEU A CA     1  
ATOM 1158  C C      . LEU C 3 7  ? -105.022 22.416  -18.947 1.00 2.60 ? 16  LEU A C      1  
ATOM 1159  O O      . LEU C 3 7  ? -105.735 23.354  -18.636 1.00 2.88 ? 16  LEU A O      1  
ATOM 1160  C CB     . LEU C 3 7  ? -105.496 20.006  -19.399 1.00 2.69 ? 16  LEU A CB     1  
ATOM 1161  C CG     . LEU C 3 7  ? -105.997 18.970  -20.414 1.00 2.71 ? 16  LEU A CG     1  
ATOM 1162  C CD1    . LEU C 3 7  ? -105.946 17.571  -19.777 1.00 3.23 ? 16  LEU A CD1    1  
ATOM 1163  C CD2    . LEU C 3 7  ? -107.441 19.293  -20.828 1.00 2.88 ? 16  LEU A CD2    1  
ATOM 1164  H H      . LEU C 3 7  ? -103.748 20.773  -21.173 1.00 2.49 ? 16  LEU A H      1  
ATOM 1165  H HA     . LEU C 3 7  ? -106.439 21.679  -20.377 1.00 2.75 ? 16  LEU A HA     1  
ATOM 1166  H HB2    . LEU C 3 7  ? -104.504 19.731  -19.078 1.00 2.80 ? 16  LEU A HB2    1  
ATOM 1167  H HB3    . LEU C 3 7  ? -106.157 20.012  -18.544 1.00 3.11 ? 16  LEU A HB3    1  
ATOM 1168  H HG     . LEU C 3 7  ? -105.362 18.994  -21.290 1.00 3.07 ? 16  LEU A HG     1  
ATOM 1169  H HD11   . LEU C 3 7  ? -106.529 17.570  -18.868 1.00 3.53 ? 16  LEU A HD11   1  
ATOM 1170  H HD12   . LEU C 3 7  ? -106.355 16.842  -20.463 1.00 3.48 ? 16  LEU A HD12   1  
ATOM 1171  H HD13   . LEU C 3 7  ? -104.922 17.314  -19.545 1.00 3.69 ? 16  LEU A HD13   1  
ATOM 1172  H HD21   . LEU C 3 7  ? -107.987 19.672  -19.977 1.00 3.05 ? 16  LEU A HD21   1  
ATOM 1173  H HD22   . LEU C 3 7  ? -107.434 20.032  -21.615 1.00 3.17 ? 16  LEU A HD22   1  
ATOM 1174  H HD23   . LEU C 3 7  ? -107.921 18.396  -21.192 1.00 3.26 ? 16  LEU A HD23   1  
ATOM 1175  N N      . ALA C 3 8  ? -103.878 22.205  -18.359 1.00 2.45 ? 17  ALA A N      1  
ATOM 1176  C CA     . ALA C 3 8  ? -103.404 23.112  -17.277 1.00 2.61 ? 17  ALA A CA     1  
ATOM 1177  C C      . ALA C 3 8  ? -102.752 24.368  -17.858 1.00 2.87 ? 17  ALA A C      1  
ATOM 1178  O O      . ALA C 3 8  ? -102.334 25.244  -17.125 1.00 3.32 ? 17  ALA A O      1  
ATOM 1179  C CB     . ALA C 3 8  ? -102.391 22.360  -16.411 1.00 2.59 ? 17  ALA A CB     1  
ATOM 1180  H H      . ALA C 3 8  ? -103.339 21.430  -18.613 1.00 2.38 ? 17  ALA A H      1  
ATOM 1181  H HA     . ALA C 3 8  ? -104.242 23.404  -16.661 1.00 2.74 ? 17  ALA A HA     1  
ATOM 1182  H HB1    . ALA C 3 8  ? -102.828 21.428  -16.079 1.00 2.61 ? 17  ALA A HB1    1  
ATOM 1183  H HB2    . ALA C 3 8  ? -101.501 22.157  -16.986 1.00 2.93 ? 17  ALA A HB2    1  
ATOM 1184  H HB3    . ALA C 3 8  ? -102.134 22.961  -15.552 1.00 2.79 ? 17  ALA A HB3    1  
ATOM 1185  N N      . GLY C 3 9  ? -102.647 24.478  -19.155 1.00 2.87 ? 18  GLY A N      1  
ATOM 1186  C CA     . GLY C 3 9  ? -102.005 25.699  -19.729 1.00 3.24 ? 18  GLY A CA     1  
ATOM 1187  C C      . GLY C 3 9  ? -100.624 25.853  -19.102 1.00 2.97 ? 18  GLY A C      1  
ATOM 1188  O O      . GLY C 3 9  ? -100.407 26.663  -18.220 1.00 3.34 ? 18  GLY A O      1  
ATOM 1189  H H      . GLY C 3 9  ? -102.978 23.770  -19.745 1.00 2.82 ? 18  GLY A H      1  
ATOM 1190  H HA2    . GLY C 3 9  ? -101.908 25.591  -20.798 1.00 3.48 ? 18  GLY A HA2    1  
ATOM 1191  H HA3    . GLY C 3 9  ? -102.603 26.567  -19.506 1.00 3.70 ? 18  GLY A HA3    1  
ATOM 1192  N N      . TYR C 3 10 ? -99.699  25.055  -19.540 1.00 2.61 ? 19  TYR A N      1  
ATOM 1193  C CA     . TYR C 3 10 ? -98.329  25.102  -18.976 1.00 2.84 ? 19  TYR A CA     1  
ATOM 1194  C C      . TYR C 3 10 ? -97.619  26.385  -19.421 1.00 3.02 ? 19  TYR A C      1  
ATOM 1195  O O      . TYR C 3 10 ? -97.660  26.757  -20.576 1.00 3.28 ? 19  TYR A O      1  
ATOM 1196  C CB     . TYR C 3 10 ? -97.565  23.885  -19.496 1.00 2.96 ? 19  TYR A CB     1  
ATOM 1197  C CG     . TYR C 3 10 ? -96.222  23.790  -18.820 1.00 2.45 ? 19  TYR A CG     1  
ATOM 1198  C CD1    . TYR C 3 10 ? -95.130  24.514  -19.311 1.00 2.56 ? 19  TYR A CD1    1  
ATOM 1199  C CD2    . TYR C 3 10 ? -96.070  22.970  -17.696 1.00 2.68 ? 19  TYR A CD2    1  
ATOM 1200  C CE1    . TYR C 3 10 ? -93.886  24.417  -18.675 1.00 2.80 ? 19  TYR A CE1    1  
ATOM 1201  C CE2    . TYR C 3 10 ? -94.828  22.870  -17.066 1.00 2.90 ? 19  TYR A CE2    1  
ATOM 1202  C CZ     . TYR C 3 10 ? -93.736  23.593  -17.553 1.00 2.92 ? 19  TYR A CZ     1  
ATOM 1203  O OH     . TYR C 3 10 ? -92.506  23.487  -16.932 1.00 3.66 ? 19  TYR A OH     1  
ATOM 1204  H H      . TYR C 3 10 ? -99.914  24.406  -20.233 1.00 2.43 ? 19  TYR A H      1  
ATOM 1205  H HA     . TYR C 3 10 ? -98.377  25.066  -17.896 1.00 3.20 ? 19  TYR A HA     1  
ATOM 1206  H HB2    . TYR C 3 10 ? -98.135  22.992  -19.288 1.00 3.48 ? 19  TYR A HB2    1  
ATOM 1207  H HB3    . TYR C 3 10 ? -97.425  23.981  -20.561 1.00 3.39 ? 19  TYR A HB3    1  
ATOM 1208  H HD1    . TYR C 3 10 ? -95.245  25.146  -20.178 1.00 3.01 ? 19  TYR A HD1    1  
ATOM 1209  H HD2    . TYR C 3 10 ? -96.911  22.410  -17.320 1.00 3.20 ? 19  TYR A HD2    1  
ATOM 1210  H HE1    . TYR C 3 10 ? -93.042  24.976  -19.051 1.00 3.38 ? 19  TYR A HE1    1  
ATOM 1211  H HE2    . TYR C 3 10 ? -94.716  22.239  -16.197 1.00 3.51 ? 19  TYR A HE2    1  
ATOM 1212  H HH     . TYR C 3 10 ? -92.078  22.694  -17.262 1.00 4.08 ? 19  TYR A HH     1  
ATOM 1213  N N      . THR C 3 11 ? -96.960  27.055  -18.511 1.00 3.30 ? 20  THR A N      1  
ATOM 1214  C CA     . THR C 3 11 ? -96.229  28.310  -18.879 1.00 3.67 ? 20  THR A CA     1  
ATOM 1215  C C      . THR C 3 11 ? -94.771  27.971  -19.200 1.00 3.82 ? 20  THR A C      1  
ATOM 1216  O O      . THR C 3 11 ? -94.214  27.026  -18.679 1.00 4.07 ? 20  THR A O      1  
ATOM 1217  C CB     . THR C 3 11 ? -96.273  29.311  -17.717 1.00 4.26 ? 20  THR A CB     1  
ATOM 1218  O OG1    . THR C 3 11 ? -95.387  30.387  -17.995 1.00 4.68 ? 20  THR A OG1    1  
ATOM 1219  C CG2    . THR C 3 11 ? -95.858  28.622  -16.412 1.00 4.79 ? 20  THR A CG2    1  
ATOM 1220  H H      . THR C 3 11 ? -96.936  26.727  -17.589 1.00 3.51 ? 20  THR A H      1  
ATOM 1221  H HA     . THR C 3 11 ? -96.688  28.755  -19.752 1.00 3.87 ? 20  THR A HA     1  
ATOM 1222  H HB     . THR C 3 11 ? -97.274  29.694  -17.611 1.00 4.50 ? 20  THR A HB     1  
ATOM 1223  H HG1    . THR C 3 11 ? -95.285  30.907  -17.194 1.00 4.92 ? 20  THR A HG1    1  
ATOM 1224  H HG21   . THR C 3 11 ? -95.011  27.977  -16.591 1.00 5.03 ? 20  THR A HG21   1  
ATOM 1225  H HG22   . THR C 3 11 ? -95.592  29.372  -15.677 1.00 5.16 ? 20  THR A HG22   1  
ATOM 1226  H HG23   . THR C 3 11 ? -96.683  28.036  -16.042 1.00 5.01 ? 20  THR A HG23   1  
ATOM 1227  N N      . GLY C 3 12 ? -94.152  28.735  -20.060 1.00 4.13 ? 21  GLY A N      1  
ATOM 1228  C CA     . GLY C 3 12 ? -92.726  28.460  -20.424 1.00 4.78 ? 21  GLY A CA     1  
ATOM 1229  C C      . GLY C 3 12 ? -91.789  28.874  -19.277 1.00 4.66 ? 21  GLY A C      1  
ATOM 1230  O O      . GLY C 3 12 ? -90.595  28.648  -19.339 1.00 5.20 ? 21  GLY A O      1  
ATOM 1231  H H      . GLY C 3 12 ? -94.627  29.489  -20.472 1.00 4.20 ? 21  GLY A H      1  
ATOM 1232  H HA2    . GLY C 3 12 ? -92.604  27.403  -20.616 1.00 5.11 ? 21  GLY A HA2    1  
ATOM 1233  H HA3    . GLY C 3 12 ? -92.468  29.015  -21.315 1.00 5.28 ? 21  GLY A HA3    1  
ATOM 1234  N N      . SER C 3 13 ? -92.308  29.468  -18.227 1.00 4.13 ? 22  SER A N      1  
ATOM 1235  C CA     . SER C 3 13 ? -91.435  29.880  -17.071 1.00 4.18 ? 22  SER A CA     1  
ATOM 1236  C C      . SER C 3 13 ? -92.004  29.301  -15.783 1.00 3.70 ? 22  SER A C      1  
ATOM 1237  O O      . SER C 3 13 ? -93.203  29.175  -15.630 1.00 3.61 ? 22  SER A O      1  
ATOM 1238  C CB     . SER C 3 13 ? -91.409  31.399  -16.971 1.00 4.44 ? 22  SER A CB     1  
ATOM 1239  O OG     . SER C 3 13 ? -92.687  31.861  -16.552 1.00 4.83 ? 22  SER A OG     1  
ATOM 1240  H H      . SER C 3 13 ? -93.272  29.638  -18.193 1.00 3.82 ? 22  SER A H      1  
ATOM 1241  H HA     . SER C 3 13 ? -90.428  29.515  -17.206 1.00 4.60 ? 22  SER A HA     1  
ATOM 1242  H HB2    . SER C 3 13 ? -90.668  31.707  -16.253 1.00 4.64 ? 22  SER A HB2    1  
ATOM 1243  H HB3    . SER C 3 13 ? -91.163  31.815  -17.941 1.00 4.59 ? 22  SER A HB3    1  
ATOM 1244  H HG     . SER C 3 13 ? -92.974  31.317  -15.820 1.00 4.97 ? 22  SER A HG     1  
ATOM 1245  N N      . GLY C 3 14 ? -91.164  28.947  -14.850 1.00 3.71 ? 23  GLY A N      1  
ATOM 1246  C CA     . GLY C 3 14 ? -91.680  28.375  -13.574 1.00 3.61 ? 23  GLY A CA     1  
ATOM 1247  C C      . GLY C 3 14 ? -91.976  26.882  -13.772 1.00 3.02 ? 23  GLY A C      1  
ATOM 1248  O O      . GLY C 3 14 ? -93.126  26.510  -13.914 1.00 2.92 ? 23  GLY A O      1  
ATOM 1249  H H      . GLY C 3 14 ? -90.198  29.054  -14.985 1.00 4.01 ? 23  GLY A H      1  
ATOM 1250  H HA2    . GLY C 3 14 ? -90.951  28.508  -12.788 1.00 4.02 ? 23  GLY A HA2    1  
ATOM 1251  H HA3    . GLY C 3 14 ? -92.598  28.879  -13.302 1.00 3.82 ? 23  GLY A HA3    1  
ATOM 1252  N N      . PRO C 3 15 ? -90.942  26.055  -13.787 1.00 2.85 ? 24  PRO A N      1  
ATOM 1253  C CA     . PRO C 3 15 ? -91.130  24.603  -13.981 1.00 2.53 ? 24  PRO A CA     1  
ATOM 1254  C C      . PRO C 3 15 ? -92.065  24.051  -12.903 1.00 2.15 ? 24  PRO A C      1  
ATOM 1255  O O      . PRO C 3 15 ? -91.972  24.398  -11.744 1.00 2.13 ? 24  PRO A O      1  
ATOM 1256  C CB     . PRO C 3 15 ? -89.719  23.993  -13.864 1.00 2.78 ? 24  PRO A CB     1  
ATOM 1257  C CG     . PRO C 3 15 ? -88.715  25.182  -13.822 1.00 3.20 ? 24  PRO A CG     1  
ATOM 1258  C CD     . PRO C 3 15 ? -89.534  26.480  -13.620 1.00 3.25 ? 24  PRO A CD     1  
ATOM 1259  H HA     . PRO C 3 15 ? -91.539  24.406  -14.967 1.00 2.64 ? 24  PRO A HA     1  
ATOM 1260  H HB2    . PRO C 3 15 ? -89.639  23.403  -12.956 1.00 2.68 ? 24  PRO A HB2    1  
ATOM 1261  H HB3    . PRO C 3 15 ? -89.511  23.369  -14.722 1.00 2.97 ? 24  PRO A HB3    1  
ATOM 1262  H HG2    . PRO C 3 15 ? -88.018  25.047  -13.004 1.00 3.31 ? 24  PRO A HG2    1  
ATOM 1263  H HG3    . PRO C 3 15 ? -88.172  25.237  -14.758 1.00 3.56 ? 24  PRO A HG3    1  
ATOM 1264  H HD2    . PRO C 3 15 ? -89.371  26.872  -12.625 1.00 3.41 ? 24  PRO A HD2    1  
ATOM 1265  H HD3    . PRO C 3 15 ? -89.275  27.222  -14.365 1.00 3.58 ? 24  PRO A HD3    1  
ATOM 1266  N N      . ILE C 3 16 ? -92.962  23.200  -13.290 1.00 1.96 ? 25  ILE A N      1  
ATOM 1267  C CA     . ILE C 3 16 ? -93.931  22.609  -12.327 1.00 1.70 ? 25  ILE A CA     1  
ATOM 1268  C C      . ILE C 3 16 ? -93.237  21.549  -11.454 1.00 1.47 ? 25  ILE A C      1  
ATOM 1269  O O      . ILE C 3 16 ? -92.063  21.288  -11.584 1.00 1.48 ? 25  ILE A O      1  
ATOM 1270  C CB     . ILE C 3 16 ? -95.081  21.990  -13.141 1.00 1.67 ? 25  ILE A CB     1  
ATOM 1271  C CG1    . ILE C 3 16 ? -96.324  21.778  -12.262 1.00 2.29 ? 25  ILE A CG1    1  
ATOM 1272  C CG2    . ILE C 3 16 ? -94.639  20.642  -13.722 1.00 2.10 ? 25  ILE A CG2    1  
ATOM 1273  C CD1    . ILE C 3 16 ? -97.530  21.514  -13.167 1.00 2.80 ? 25  ILE A CD1    1  
ATOM 1274  H H      . ILE C 3 16 ? -93.009  22.947  -14.234 1.00 2.07 ? 25  ILE A H      1  
ATOM 1275  H HA     . ILE C 3 16 ? -94.324  23.389  -11.690 1.00 1.84 ? 25  ILE A HA     1  
ATOM 1276  H HB     . ILE C 3 16 ? -95.327  22.658  -13.954 1.00 1.81 ? 25  ILE A HB     1  
ATOM 1277  H HG12   . ILE C 3 16 ? -96.170  20.927  -11.619 1.00 2.68 ? 25  ILE A HG12   1  
ATOM 1278  H HG13   . ILE C 3 16 ? -96.510  22.658  -11.665 1.00 2.71 ? 25  ILE A HG13   1  
ATOM 1279  H HG21   . ILE C 3 16 ? -93.659  20.747  -14.165 1.00 2.43 ? 25  ILE A HG21   1  
ATOM 1280  H HG22   . ILE C 3 16 ? -94.601  19.905  -12.934 1.00 2.57 ? 25  ILE A HG22   1  
ATOM 1281  H HG23   . ILE C 3 16 ? -95.343  20.326  -14.477 1.00 2.53 ? 25  ILE A HG23   1  
ATOM 1282  H HD11   . ILE C 3 16 ? -97.633  22.326  -13.873 1.00 3.17 ? 25  ILE A HD11   1  
ATOM 1283  H HD12   . ILE C 3 16 ? -97.381  20.588  -13.702 1.00 3.15 ? 25  ILE A HD12   1  
ATOM 1284  H HD13   . ILE C 3 16 ? -98.425  21.442  -12.571 1.00 3.05 ? 25  ILE A HD13   1  
ATOM 1285  N N      . GLN C 3 17 ? -93.972  20.949  -10.561 1.00 1.36 ? 26  GLN A N      1  
ATOM 1286  C CA     . GLN C 3 17 ? -93.394  19.917  -9.660  1.00 1.23 ? 26  GLN A CA     1  
ATOM 1287  C C      . GLN C 3 17 ? -93.225  18.582  -10.431 1.00 1.07 ? 26  GLN A C      1  
ATOM 1288  O O      . GLN C 3 17 ? -94.054  18.201  -11.235 1.00 1.13 ? 26  GLN A O      1  
ATOM 1289  C CB     . GLN C 3 17 ? -94.354  19.808  -8.444  1.00 1.35 ? 26  GLN A CB     1  
ATOM 1290  C CG     . GLN C 3 17 ? -94.278  18.452  -7.730  1.00 1.13 ? 26  GLN A CG     1  
ATOM 1291  C CD     . GLN C 3 17 ? -92.852  17.916  -7.715  1.00 1.20 ? 26  GLN A CD     1  
ATOM 1292  O OE1    . GLN C 3 17 ? -92.629  16.813  -8.148  1.00 1.42 ? 26  GLN A OE1    1  
ATOM 1293  N NE2    . GLN C 3 17 ? -91.876  18.661  -7.256  1.00 1.66 ? 26  GLN A NE2    1  
ATOM 1294  H H      . GLN C 3 17 ? -94.918  21.188  -10.472 1.00 1.45 ? 26  GLN A H      1  
ATOM 1295  H HA     . GLN C 3 17 ? -92.428  20.253  -9.319  1.00 1.28 ? 26  GLN A HA     1  
ATOM 1296  H HB2    . GLN C 3 17 ? -94.100  20.584  -7.735  1.00 1.82 ? 26  GLN A HB2    1  
ATOM 1297  H HB3    . GLN C 3 17 ? -95.367  19.975  -8.779  1.00 1.77 ? 26  GLN A HB3    1  
ATOM 1298  H HG2    . GLN C 3 17 ? -94.625  18.567  -6.712  1.00 1.34 ? 26  GLN A HG2    1  
ATOM 1299  H HG3    . GLN C 3 17 ? -94.913  17.750  -8.237  1.00 1.52 ? 26  GLN A HG3    1  
ATOM 1300  H HE21   . GLN C 3 17 ? -92.064  19.564  -6.921  1.00 1.92 ? 26  GLN A HE21   1  
ATOM 1301  H HE22   . GLN C 3 17 ? -90.958  18.318  -7.249  1.00 1.99 ? 26  GLN A HE22   1  
ATOM 1302  N N      . LEU C 3 18 ? -92.115  17.904  -10.212 1.00 0.97 ? 27  LEU A N      1  
ATOM 1303  C CA     . LEU C 3 18 ? -91.819  16.623  -10.940 1.00 0.86 ? 27  LEU A CA     1  
ATOM 1304  C C      . LEU C 3 18 ? -92.990  15.643  -10.844 1.00 0.75 ? 27  LEU A C      1  
ATOM 1305  O O      . LEU C 3 18 ? -93.572  15.282  -11.846 1.00 0.73 ? 27  LEU A O      1  
ATOM 1306  C CB     . LEU C 3 18 ? -90.553  15.977  -10.322 1.00 0.86 ? 27  LEU A CB     1  
ATOM 1307  C CG     . LEU C 3 18 ? -90.075  14.729  -11.114 1.00 0.84 ? 27  LEU A CG     1  
ATOM 1308  C CD1    . LEU C 3 18 ? -91.061  13.554  -10.975 1.00 1.54 ? 27  LEU A CD1    1  
ATOM 1309  C CD2    . LEU C 3 18 ? -89.892  15.084  -12.597 1.00 1.54 ? 27  LEU A CD2    1  
ATOM 1310  H H      . LEU C 3 18 ? -91.452  18.260  -9.585  1.00 1.05 ? 27  LEU A H      1  
ATOM 1311  H HA     . LEU C 3 18 ? -91.638  16.850  -11.976 1.00 0.89 ? 27  LEU A HA     1  
ATOM 1312  H HB2    . LEU C 3 18 ? -89.755  16.705  -10.322 1.00 0.97 ? 27  LEU A HB2    1  
ATOM 1313  H HB3    . LEU C 3 18 ? -90.763  15.688  -9.302  1.00 0.86 ? 27  LEU A HB3    1  
ATOM 1314  H HG     . LEU C 3 18 ? -89.122  14.413  -10.716 1.00 1.37 ? 27  LEU A HG     1  
ATOM 1315  H HD11   . LEU C 3 18 ? -91.535  13.585  -10.006 1.00 2.10 ? 27  LEU A HD11   1  
ATOM 1316  H HD12   . LEU C 3 18 ? -91.813  13.610  -11.748 1.00 1.92 ? 27  LEU A HD12   1  
ATOM 1317  H HD13   . LEU C 3 18 ? -90.522  12.623  -11.078 1.00 2.17 ? 27  LEU A HD13   1  
ATOM 1318  H HD21   . LEU C 3 18 ? -89.548  16.101  -12.690 1.00 2.10 ? 27  LEU A HD21   1  
ATOM 1319  H HD22   . LEU C 3 18 ? -89.161  14.422  -13.029 1.00 1.99 ? 27  LEU A HD22   1  
ATOM 1320  H HD23   . LEU C 3 18 ? -90.833  14.972  -13.119 1.00 2.11 ? 27  LEU A HD23   1  
ATOM 1321  N N      . TRP C 3 19 ? -93.337  15.177  -9.673  1.00 0.75 ? 28  TRP A N      1  
ATOM 1322  C CA     . TRP C 3 19 ? -94.456  14.198  -9.599  1.00 0.70 ? 28  TRP A CA     1  
ATOM 1323  C C      . TRP C 3 19 ? -95.737  14.855  -10.099 1.00 0.73 ? 28  TRP A C      1  
ATOM 1324  O O      . TRP C 3 19 ? -96.614  14.198  -10.617 1.00 0.75 ? 28  TRP A O      1  
ATOM 1325  C CB     . TRP C 3 19 ? -94.621  13.666  -8.167  1.00 0.73 ? 28  TRP A CB     1  
ATOM 1326  C CG     . TRP C 3 19 ? -95.051  14.748  -7.250  1.00 0.83 ? 28  TRP A CG     1  
ATOM 1327  C CD1    . TRP C 3 19 ? -94.234  15.486  -6.477  1.00 0.92 ? 28  TRP A CD1    1  
ATOM 1328  C CD2    . TRP C 3 19 ? -96.398  15.207  -6.982  1.00 0.90 ? 28  TRP A CD2    1  
ATOM 1329  N NE1    . TRP C 3 19 ? -94.994  16.385  -5.759  1.00 1.02 ? 28  TRP A NE1    1  
ATOM 1330  C CE2    . TRP C 3 19 ? -96.342  16.249  -6.034  1.00 1.02 ? 28  TRP A CE2    1  
ATOM 1331  C CE3    . TRP C 3 19 ? -97.650  14.816  -7.470  1.00 0.93 ? 28  TRP A CE3    1  
ATOM 1332  C CZ2    . TRP C 3 19 ? -97.495  16.892  -5.585  1.00 1.14 ? 28  TRP A CZ2    1  
ATOM 1333  C CZ3    . TRP C 3 19 ? -98.814  15.456  -7.020  1.00 1.07 ? 28  TRP A CZ3    1  
ATOM 1334  C CH2    . TRP C 3 19 ? -98.738  16.493  -6.081  1.00 1.16 ? 28  TRP A CH2    1  
ATOM 1335  H H      . TRP C 3 19 ? -92.856  15.453  -8.858  1.00 0.82 ? 28  TRP A H      1  
ATOM 1336  H HA     . TRP C 3 19 ? -94.232  13.370  -10.248 1.00 0.67 ? 28  TRP A HA     1  
ATOM 1337  H HB2    . TRP C 3 19 ? -95.363  12.887  -8.162  1.00 0.72 ? 28  TRP A HB2    1  
ATOM 1338  H HB3    . TRP C 3 19 ? -93.676  13.263  -7.825  1.00 0.74 ? 28  TRP A HB3    1  
ATOM 1339  H HD1    . TRP C 3 19 ? -93.162  15.390  -6.430  1.00 0.95 ? 28  TRP A HD1    1  
ATOM 1340  H HE1    . TRP C 3 19 ? -94.643  17.039  -5.125  1.00 1.12 ? 28  TRP A HE1    1  
ATOM 1341  H HE3    . TRP C 3 19 ? -97.716  14.016  -8.193  1.00 0.88 ? 28  TRP A HE3    1  
ATOM 1342  H HZ2    . TRP C 3 19 ? -97.428  17.690  -4.861  1.00 1.23 ? 28  TRP A HZ2    1  
ATOM 1343  H HZ3    . TRP C 3 19 ? -99.775  15.146  -7.397  1.00 1.14 ? 28  TRP A HZ3    1  
ATOM 1344  H HH2    . TRP C 3 19 ? -99.639  16.980  -5.739  1.00 1.28 ? 28  TRP A HH2    1  
ATOM 1345  N N      . GLN C 3 20 ? -95.846  16.152  -9.988  1.00 0.83 ? 29  GLN A N      1  
ATOM 1346  C CA     . GLN C 3 20 ? -97.079  16.822  -10.514 1.00 0.90 ? 29  GLN A CA     1  
ATOM 1347  C C      . GLN C 3 20 ? -97.066  16.730  -12.038 1.00 0.84 ? 29  GLN A C      1  
ATOM 1348  O O      . GLN C 3 20 ? -98.084  16.538  -12.675 1.00 0.89 ? 29  GLN A O      1  
ATOM 1349  C CB     . GLN C 3 20 ? -97.107  18.294  -10.099 1.00 1.03 ? 29  GLN A CB     1  
ATOM 1350  C CG     . GLN C 3 20 ? -98.422  18.931  -10.551 1.00 1.42 ? 29  GLN A CG     1  
ATOM 1351  C CD     . GLN C 3 20 ? -98.501  20.364  -10.022 1.00 1.81 ? 29  GLN A CD     1  
ATOM 1352  O OE1    . GLN C 3 20 ? -97.678  20.777  -9.230  1.00 2.34 ? 29  GLN A OE1    1  
ATOM 1353  N NE2    . GLN C 3 20 ? -99.465  21.146  -10.422 1.00 2.29 ? 29  GLN A NE2    1  
ATOM 1354  H H      . GLN C 3 20 ? -95.116  16.680  -9.596  1.00 0.91 ? 29  GLN A H      1  
ATOM 1355  H HA     . GLN C 3 20 ? -97.956  16.321  -10.132 1.00 0.93 ? 29  GLN A HA     1  
ATOM 1356  H HB2    . GLN C 3 20 ? -97.024  18.364  -9.026  1.00 1.31 ? 29  GLN A HB2    1  
ATOM 1357  H HB3    . GLN C 3 20 ? -96.282  18.811  -10.563 1.00 1.14 ? 29  GLN A HB3    1  
ATOM 1358  H HG2    . GLN C 3 20 ? -98.467  18.940  -11.632 1.00 1.78 ? 29  GLN A HG2    1  
ATOM 1359  H HG3    . GLN C 3 20 ? -99.252  18.361  -10.162 1.00 2.06 ? 29  GLN A HG3    1  
ATOM 1360  H HE21   . GLN C 3 20 ? -100.134 20.815  -11.059 1.00 2.35 ? 29  GLN A HE21   1  
ATOM 1361  H HE22   . GLN C 3 20 ? -99.522  22.066  -10.088 1.00 2.89 ? 29  GLN A HE22   1  
ATOM 1362  N N      . PHE C 3 21 ? -95.907  16.865  -12.617 1.00 0.80 ? 30  PHE A N      1  
ATOM 1363  C CA     . PHE C 3 21 ? -95.789  16.785  -14.095 1.00 0.77 ? 30  PHE A CA     1  
ATOM 1364  C C      . PHE C 3 21 ? -96.178  15.379  -14.559 1.00 0.68 ? 30  PHE A C      1  
ATOM 1365  O O      . PHE C 3 21 ? -96.958  15.212  -15.479 1.00 0.69 ? 30  PHE A O      1  
ATOM 1366  C CB     . PHE C 3 21 ? -94.333  17.098  -14.507 1.00 0.80 ? 30  PHE A CB     1  
ATOM 1367  C CG     . PHE C 3 21 ? -94.052  16.493  -15.861 1.00 0.77 ? 30  PHE A CG     1  
ATOM 1368  C CD1    . PHE C 3 21 ? -94.350  17.200  -17.029 1.00 0.85 ? 30  PHE A CD1    1  
ATOM 1369  C CD2    . PHE C 3 21 ? -93.540  15.191  -15.933 1.00 0.75 ? 30  PHE A CD2    1  
ATOM 1370  C CE1    . PHE C 3 21 ? -94.138  16.602  -18.274 1.00 0.86 ? 30  PHE A CE1    1  
ATOM 1371  C CE2    . PHE C 3 21 ? -93.316  14.597  -17.175 1.00 0.78 ? 30  PHE A CE2    1  
ATOM 1372  C CZ     . PHE C 3 21 ? -93.619  15.299  -18.345 1.00 0.80 ? 30  PHE A CZ     1  
ATOM 1373  H H      . PHE C 3 21 ? -95.108  17.013  -12.074 1.00 0.83 ? 30  PHE A H      1  
ATOM 1374  H HA     . PHE C 3 21 ? -96.453  17.504  -14.550 1.00 0.83 ? 30  PHE A HA     1  
ATOM 1375  H HB2    . PHE C 3 21 ? -94.199  18.167  -14.559 1.00 0.90 ? 30  PHE A HB2    1  
ATOM 1376  H HB3    . PHE C 3 21 ? -93.651  16.683  -13.781 1.00 0.79 ? 30  PHE A HB3    1  
ATOM 1377  H HD1    . PHE C 3 21 ? -94.740  18.207  -16.973 1.00 0.94 ? 30  PHE A HD1    1  
ATOM 1378  H HD2    . PHE C 3 21 ? -93.309  14.651  -15.027 1.00 0.78 ? 30  PHE A HD2    1  
ATOM 1379  H HE1    . PHE C 3 21 ? -94.374  17.142  -19.180 1.00 0.95 ? 30  PHE A HE1    1  
ATOM 1380  H HE2    . PHE C 3 21 ? -92.913  13.596  -17.231 1.00 0.83 ? 30  PHE A HE2    1  
ATOM 1381  H HZ     . PHE C 3 21 ? -93.462  14.831  -19.301 1.00 0.85 ? 30  PHE A HZ     1  
ATOM 1382  N N      . LEU C 3 22 ? -95.631  14.373  -13.944 1.00 0.65 ? 31  LEU A N      1  
ATOM 1383  C CA     . LEU C 3 22 ? -95.955  12.988  -14.362 1.00 0.60 ? 31  LEU A CA     1  
ATOM 1384  C C      . LEU C 3 22 ? -97.444  12.754  -14.113 1.00 0.60 ? 31  LEU A C      1  
ATOM 1385  O O      . LEU C 3 22 ? -98.169  12.261  -14.955 1.00 0.61 ? 31  LEU A O      1  
ATOM 1386  C CB     . LEU C 3 22 ? -95.105  12.012  -13.532 1.00 0.62 ? 31  LEU A CB     1  
ATOM 1387  C CG     . LEU C 3 22 ? -94.955  10.675  -14.268 1.00 0.79 ? 31  LEU A CG     1  
ATOM 1388  C CD1    . LEU C 3 22 ? -93.924  9.812   -13.536 1.00 1.52 ? 31  LEU A CD1    1  
ATOM 1389  C CD2    . LEU C 3 22 ? -96.298  9.936   -14.331 1.00 1.42 ? 31  LEU A CD2    1  
ATOM 1390  H H      . LEU C 3 22 ? -94.999  14.530  -13.212 1.00 0.69 ? 31  LEU A H      1  
ATOM 1391  H HA     . LEU C 3 22 ? -95.741  12.867  -15.411 1.00 0.60 ? 31  LEU A HA     1  
ATOM 1392  H HB2    . LEU C 3 22 ? -94.125  12.445  -13.375 1.00 0.80 ? 31  LEU A HB2    1  
ATOM 1393  H HB3    . LEU C 3 22 ? -95.574  11.843  -12.571 1.00 0.79 ? 31  LEU A HB3    1  
ATOM 1394  H HG     . LEU C 3 22 ? -94.599  10.859  -15.266 1.00 1.44 ? 31  LEU A HG     1  
ATOM 1395  H HD11   . LEU C 3 22 ? -94.086  9.876   -12.469 1.00 2.08 ? 31  LEU A HD11   1  
ATOM 1396  H HD12   . LEU C 3 22 ? -94.020  8.786   -13.856 1.00 2.05 ? 31  LEU A HD12   1  
ATOM 1397  H HD13   . LEU C 3 22 ? -92.931  10.170  -13.771 1.00 1.96 ? 31  LEU A HD13   1  
ATOM 1398  H HD21   . LEU C 3 22 ? -96.842  10.090  -13.412 1.00 2.02 ? 31  LEU A HD21   1  
ATOM 1399  H HD22   . LEU C 3 22 ? -96.872  10.317  -15.161 1.00 2.02 ? 31  LEU A HD22   1  
ATOM 1400  H HD23   . LEU C 3 22 ? -96.122  8.880   -14.474 1.00 1.85 ? 31  LEU A HD23   1  
ATOM 1401  N N      . LEU C 3 23 ? -97.902  13.135  -12.960 1.00 0.67 ? 32  LEU A N      1  
ATOM 1402  C CA     . LEU C 3 23 ? -99.337  12.969  -12.637 1.00 0.74 ? 32  LEU A CA     1  
ATOM 1403  C C      . LEU C 3 23 ? -100.166 13.770  -13.634 1.00 0.76 ? 32  LEU A C      1  
ATOM 1404  O O      . LEU C 3 23 ? -101.201 13.325  -14.093 1.00 0.78 ? 32  LEU A O      1  
ATOM 1405  C CB     . LEU C 3 23 ? -99.586  13.482  -11.214 1.00 0.89 ? 32  LEU A CB     1  
ATOM 1406  C CG     . LEU C 3 23 ? -101.059 13.303  -10.805 1.00 1.17 ? 32  LEU A CG     1  
ATOM 1407  C CD1    . LEU C 3 23 ? -101.488 11.836  -10.955 1.00 1.42 ? 32  LEU A CD1    1  
ATOM 1408  C CD2    . LEU C 3 23 ? -101.214 13.729  -9.341  1.00 1.91 ? 32  LEU A CD2    1  
ATOM 1409  H H      . LEU C 3 23 ? -97.302  13.547  -12.308 1.00 0.71 ? 32  LEU A H      1  
ATOM 1410  H HA     . LEU C 3 23 ? -99.597  11.929  -12.700 1.00 0.75 ? 32  LEU A HA     1  
ATOM 1411  H HB2    . LEU C 3 23 ? -98.957  12.935  -10.529 1.00 0.98 ? 32  LEU A HB2    1  
ATOM 1412  H HB3    . LEU C 3 23 ? -99.334  14.532  -11.169 1.00 1.37 ? 32  LEU A HB3    1  
ATOM 1413  H HG     . LEU C 3 23 ? -101.686 13.922  -11.427 1.00 1.80 ? 32  LEU A HG     1  
ATOM 1414  H HD11   . LEU C 3 23 ? -100.672 11.185  -10.675 1.00 1.86 ? 32  LEU A HD11   1  
ATOM 1415  H HD12   . LEU C 3 23 ? -102.339 11.637  -10.318 1.00 1.89 ? 32  LEU A HD12   1  
ATOM 1416  H HD13   . LEU C 3 23 ? -101.764 11.647  -11.982 1.00 1.93 ? 32  LEU A HD13   1  
ATOM 1417  H HD21   . LEU C 3 23 ? -100.471 13.223  -8.736  1.00 2.36 ? 32  LEU A HD21   1  
ATOM 1418  H HD22   . LEU C 3 23 ? -101.073 14.794  -9.266  1.00 2.46 ? 32  LEU A HD22   1  
ATOM 1419  H HD23   . LEU C 3 23 ? -102.202 13.467  -8.991  1.00 2.28 ? 32  LEU A HD23   1  
ATOM 1420  N N      . GLU C 3 24 ? -99.720  14.946  -13.981 1.00 0.81 ? 33  GLU A N      1  
ATOM 1421  C CA     . GLU C 3 24 ? -100.494 15.757  -14.952 1.00 0.89 ? 33  GLU A CA     1  
ATOM 1422  C C      . GLU C 3 24 ? -100.580 14.999  -16.274 1.00 0.87 ? 33  GLU A C      1  
ATOM 1423  O O      . GLU C 3 24 ? -101.645 14.845  -16.838 1.00 0.94 ? 33  GLU A O      1  
ATOM 1424  C CB     . GLU C 3 24 ? -99.809  17.110  -15.153 1.00 0.99 ? 33  GLU A CB     1  
ATOM 1425  C CG     . GLU C 3 24 ? -100.697 18.008  -16.011 1.00 1.21 ? 33  GLU A CG     1  
ATOM 1426  C CD     . GLU C 3 24 ? -101.947 18.385  -15.213 1.00 1.80 ? 33  GLU A CD     1  
ATOM 1427  O OE1    . GLU C 3 24 ? -101.815 18.642  -14.026 1.00 2.46 ? 33  GLU A OE1    1  
ATOM 1428  O OE2    . GLU C 3 24 ? -103.014 18.404  -15.800 1.00 2.40 ? 33  GLU A OE2    1  
ATOM 1429  H H      . GLU C 3 24 ? -98.882  15.290  -13.611 1.00 0.82 ? 33  GLU A H      1  
ATOM 1430  H HA     . GLU C 3 24 ? -101.490 15.911  -14.569 1.00 0.95 ? 33  GLU A HA     1  
ATOM 1431  H HB2    . GLU C 3 24 ? -99.651  17.576  -14.191 1.00 1.19 ? 33  GLU A HB2    1  
ATOM 1432  H HB3    . GLU C 3 24 ? -98.859  16.970  -15.646 1.00 1.34 ? 33  GLU A HB3    1  
ATOM 1433  H HG2    . GLU C 3 24 ? -100.152 18.902  -16.278 1.00 1.68 ? 33  GLU A HG2    1  
ATOM 1434  H HG3    . GLU C 3 24 ? -100.990 17.482  -16.904 1.00 1.81 ? 33  GLU A HG3    1  
ATOM 1435  N N      . LEU C 3 25 ? -99.477  14.506  -16.770 1.00 0.84 ? 34  LEU A N      1  
ATOM 1436  C CA     . LEU C 3 25 ? -99.525  13.739  -18.049 1.00 0.90 ? 34  LEU A CA     1  
ATOM 1437  C C      . LEU C 3 25 ? -100.221 12.395  -17.798 1.00 0.87 ? 34  LEU A C      1  
ATOM 1438  O O      . LEU C 3 25 ? -100.835 11.826  -18.671 1.00 0.94 ? 34  LEU A O      1  
ATOM 1439  C CB     . LEU C 3 25 ? -98.096  13.502  -18.571 1.00 1.01 ? 34  LEU A CB     1  
ATOM 1440  C CG     . LEU C 3 25 ? -98.126  12.757  -19.925 1.00 1.09 ? 34  LEU A CG     1  
ATOM 1441  C CD1    . LEU C 3 25 ? -98.623  13.688  -21.046 1.00 1.47 ? 34  LEU A CD1    1  
ATOM 1442  C CD2    . LEU C 3 25 ? -96.713  12.263  -20.258 1.00 1.54 ? 34  LEU A CD2    1  
ATOM 1443  H H      . LEU C 3 25 ? -98.625  14.628  -16.297 1.00 0.83 ? 34  LEU A H      1  
ATOM 1444  H HA     . LEU C 3 25 ? -100.085 14.302  -18.774 1.00 0.99 ? 34  LEU A HA     1  
ATOM 1445  H HB2    . LEU C 3 25 ? -97.602  14.456  -18.695 1.00 1.31 ? 34  LEU A HB2    1  
ATOM 1446  H HB3    . LEU C 3 25 ? -97.546  12.910  -17.853 1.00 1.54 ? 34  LEU A HB3    1  
ATOM 1447  H HG     . LEU C 3 25 ? -98.789  11.908  -19.858 1.00 1.71 ? 34  LEU A HG     1  
ATOM 1448  H HD11   . LEU C 3 25 ? -98.167  14.660  -20.941 1.00 2.10 ? 34  LEU A HD11   1  
ATOM 1449  H HD12   . LEU C 3 25 ? -98.358  13.270  -22.008 1.00 1.85 ? 34  LEU A HD12   1  
ATOM 1450  H HD13   . LEU C 3 25 ? -99.698  13.787  -20.986 1.00 1.86 ? 34  LEU A HD13   1  
ATOM 1451  H HD21   . LEU C 3 25 ? -96.005  13.061  -20.094 1.00 2.05 ? 34  LEU A HD21   1  
ATOM 1452  H HD22   . LEU C 3 25 ? -96.467  11.423  -19.621 1.00 1.91 ? 34  LEU A HD22   1  
ATOM 1453  H HD23   . LEU C 3 25 ? -96.671  11.952  -21.294 1.00 2.01 ? 34  LEU A HD23   1  
ATOM 1454  N N      . LEU C 3 26 ? -100.107 11.868  -16.615 1.00 0.83 ? 35  LEU A N      1  
ATOM 1455  C CA     . LEU C 3 26 ? -100.732 10.545  -16.320 1.00 0.88 ? 35  LEU A CA     1  
ATOM 1456  C C      . LEU C 3 26 ? -102.202 10.536  -16.768 1.00 0.97 ? 35  LEU A C      1  
ATOM 1457  O O      . LEU C 3 26 ? -102.647 9.612   -17.417 1.00 1.12 ? 35  LEU A O      1  
ATOM 1458  C CB     . LEU C 3 26 ? -100.658 10.287  -14.811 1.00 0.86 ? 35  LEU A CB     1  
ATOM 1459  C CG     . LEU C 3 26 ? -101.064 8.833   -14.488 1.00 0.95 ? 35  LEU A CG     1  
ATOM 1460  C CD1    . LEU C 3 26 ? -99.872  7.891   -14.677 1.00 1.23 ? 35  LEU A CD1    1  
ATOM 1461  C CD2    . LEU C 3 26 ? -101.545 8.736   -13.032 1.00 1.45 ? 35  LEU A CD2    1  
ATOM 1462  H H      . LEU C 3 26 ? -99.585  12.328  -15.923 1.00 0.81 ? 35  LEU A H      1  
ATOM 1463  H HA     . LEU C 3 26 ? -100.190 9.773   -16.843 1.00 0.95 ? 35  LEU A HA     1  
ATOM 1464  H HB2    . LEU C 3 26 ? -99.649  10.466  -14.472 1.00 1.13 ? 35  LEU A HB2    1  
ATOM 1465  H HB3    . LEU C 3 26 ? -101.328 10.968  -14.304 1.00 0.99 ? 35  LEU A HB3    1  
ATOM 1466  H HG     . LEU C 3 26 ? -101.864 8.531   -15.149 1.00 1.60 ? 35  LEU A HG     1  
ATOM 1467  H HD11   . LEU C 3 26 ? -99.017  8.276   -14.139 1.00 1.64 ? 35  LEU A HD11   1  
ATOM 1468  H HD12   . LEU C 3 26 ? -100.128 6.920   -14.288 1.00 1.79 ? 35  LEU A HD12   1  
ATOM 1469  H HD13   . LEU C 3 26 ? -99.632  7.808   -15.726 1.00 1.75 ? 35  LEU A HD13   1  
ATOM 1470  H HD21   . LEU C 3 26 ? -100.787 9.136   -12.371 1.00 1.97 ? 35  LEU A HD21   1  
ATOM 1471  H HD22   . LEU C 3 26 ? -102.457 9.301   -12.914 1.00 1.94 ? 35  LEU A HD22   1  
ATOM 1472  H HD23   . LEU C 3 26 ? -101.728 7.700   -12.783 1.00 1.91 ? 35  LEU A HD23   1  
ATOM 1473  N N      . THR C 3 27 ? -102.957 11.552  -16.447 1.00 0.97 ? 36  THR A N      1  
ATOM 1474  C CA     . THR C 3 27 ? -104.380 11.574  -16.880 1.00 1.14 ? 36  THR A CA     1  
ATOM 1475  C C      . THR C 3 27 ? -104.423 12.068  -18.327 1.00 1.22 ? 36  THR A C      1  
ATOM 1476  O O      . THR C 3 27 ? -105.073 13.042  -18.647 1.00 1.57 ? 36  THR A O      1  
ATOM 1477  C CB     . THR C 3 27 ? -105.179 12.501  -15.957 1.00 1.24 ? 36  THR A CB     1  
ATOM 1478  O OG1    . THR C 3 27 ? -104.685 13.831  -16.071 1.00 1.68 ? 36  THR A OG1    1  
ATOM 1479  C CG2    . THR C 3 27 ? -105.040 12.014  -14.507 1.00 1.12 ? 36  THR A CG2    1  
ATOM 1480  H H      . THR C 3 27 ? -102.589 12.300  -15.936 1.00 0.94 ? 36  THR A H      1  
ATOM 1481  H HA     . THR C 3 27 ? -104.793 10.570  -16.829 1.00 1.28 ? 36  THR A HA     1  
ATOM 1482  H HB     . THR C 3 27 ? -106.221 12.479  -16.241 1.00 1.66 ? 36  THR A HB     1  
ATOM 1483  H HG1    . THR C 3 27 ? -105.435 14.411  -16.258 1.00 2.13 ? 36  THR A HG1    1  
ATOM 1484  H HG21   . THR C 3 27 ? -105.146 10.936  -14.478 1.00 1.44 ? 36  THR A HG21   1  
ATOM 1485  H HG22   . THR C 3 27 ? -104.070 12.289  -14.124 1.00 1.54 ? 36  THR A HG22   1  
ATOM 1486  H HG23   . THR C 3 27 ? -105.809 12.467  -13.899 1.00 1.67 ? 36  THR A HG23   1  
ATOM 1487  N N      . ASP C 3 28 ? -103.715 11.383  -19.205 1.00 1.13 ? 37  ASP A N      1  
ATOM 1488  C CA     . ASP C 3 28 ? -103.676 11.774  -20.650 1.00 1.32 ? 37  ASP A CA     1  
ATOM 1489  C C      . ASP C 3 28 ? -104.579 10.847  -21.451 1.00 1.23 ? 37  ASP A C      1  
ATOM 1490  O O      . ASP C 3 28 ? -104.545 9.644   -21.313 1.00 1.40 ? 37  ASP A O      1  
ATOM 1491  C CB     . ASP C 3 28 ? -102.233 11.695  -21.197 1.00 1.71 ? 37  ASP A CB     1  
ATOM 1492  C CG     . ASP C 3 28 ? -102.212 11.945  -22.714 1.00 2.39 ? 37  ASP A CG     1  
ATOM 1493  O OD1    . ASP C 3 28 ? -103.276 12.088  -23.292 1.00 3.08 ? 37  ASP A OD1    1  
ATOM 1494  O OD2    . ASP C 3 28 ? -101.125 12.012  -23.271 1.00 2.90 ? 37  ASP A OD2    1  
ATOM 1495  H H      . ASP C 3 28 ? -103.204 10.599  -18.903 1.00 1.13 ? 37  ASP A H      1  
ATOM 1496  H HA     . ASP C 3 28 ? -104.036 12.788  -20.748 1.00 1.55 ? 37  ASP A HA     1  
ATOM 1497  H HB2    . ASP C 3 28 ? -101.628 12.451  -20.719 1.00 2.12 ? 37  ASP A HB2    1  
ATOM 1498  H HB3    . ASP C 3 28 ? -101.819 10.724  -20.990 1.00 2.03 ? 37  ASP A HB3    1  
ATOM 1499  N N      . LYS C 3 29 ? -105.397 11.418  -22.278 1.00 1.35 ? 38  LYS A N      1  
ATOM 1500  C CA     . LYS C 3 29 ? -106.331 10.618  -23.105 1.00 1.54 ? 38  LYS A CA     1  
ATOM 1501  C C      . LYS C 3 29 ? -105.552 9.812   -24.151 1.00 1.38 ? 38  LYS A C      1  
ATOM 1502  O O      . LYS C 3 29 ? -105.860 8.669   -24.430 1.00 1.52 ? 38  LYS A O      1  
ATOM 1503  C CB     . LYS C 3 29 ? -107.263 11.604  -23.802 1.00 1.99 ? 38  LYS A CB     1  
ATOM 1504  C CG     . LYS C 3 29 ? -108.072 12.365  -22.737 1.00 2.26 ? 38  LYS A CG     1  
ATOM 1505  C CD     . LYS C 3 29 ? -109.127 11.434  -22.064 1.00 2.62 ? 38  LYS A CD     1  
ATOM 1506  C CE     . LYS C 3 29 ? -108.766 11.155  -20.593 1.00 2.90 ? 38  LYS A CE     1  
ATOM 1507  N NZ     . LYS C 3 29 ? -109.628 10.054  -20.075 1.00 3.33 ? 38  LYS A NZ     1  
ATOM 1508  H H      . LYS C 3 29 ? -105.401 12.394  -22.353 1.00 1.53 ? 38  LYS A H      1  
ATOM 1509  H HA     . LYS C 3 29 ? -106.903 9.954   -22.483 1.00 1.79 ? 38  LYS A HA     1  
ATOM 1510  H HB2    . LYS C 3 29 ? -106.673 12.308  -24.379 1.00 2.39 ? 38  LYS A HB2    1  
ATOM 1511  H HB3    . LYS C 3 29 ? -107.932 11.074  -24.458 1.00 2.33 ? 38  LYS A HB3    1  
ATOM 1512  H HG2    . LYS C 3 29 ? -107.383 12.747  -21.991 1.00 2.66 ? 38  LYS A HG2    1  
ATOM 1513  H HG3    . LYS C 3 29 ? -108.573 13.198  -23.211 1.00 2.59 ? 38  LYS A HG3    1  
ATOM 1514  H HD2    . LYS C 3 29 ? -110.097 11.915  -22.093 1.00 2.95 ? 38  LYS A HD2    1  
ATOM 1515  H HD3    . LYS C 3 29 ? -109.187 10.496  -22.594 1.00 2.89 ? 38  LYS A HD3    1  
ATOM 1516  H HE2    . LYS C 3 29 ? -107.730 10.866  -20.521 1.00 2.93 ? 38  LYS A HE2    1  
ATOM 1517  H HE3    . LYS C 3 29 ? -108.933 12.046  -20.007 1.00 3.19 ? 38  LYS A HE3    1  
ATOM 1518  H HZ1    . LYS C 3 29 ? -110.588 10.149  -20.464 1.00 3.68 ? 38  LYS A HZ1    1  
ATOM 1519  H HZ2    . LYS C 3 29 ? -109.228 9.136   -20.357 1.00 3.54 ? 38  LYS A HZ2    1  
ATOM 1520  H HZ3    . LYS C 3 29 ? -109.671 10.109  -19.038 1.00 3.57 ? 38  LYS A HZ3    1  
ATOM 1521  N N      . SER C 3 30 ? -104.552 10.409  -24.734 1.00 1.47 ? 39  SER A N      1  
ATOM 1522  C CA     . SER C 3 30 ? -103.749 9.705   -25.777 1.00 1.66 ? 39  SER A CA     1  
ATOM 1523  C C      . SER C 3 30 ? -102.781 8.709   -25.144 1.00 1.51 ? 39  SER A C      1  
ATOM 1524  O O      . SER C 3 30 ? -102.172 7.911   -25.828 1.00 2.21 ? 39  SER A O      1  
ATOM 1525  C CB     . SER C 3 30 ? -102.957 10.733  -26.587 1.00 2.14 ? 39  SER A CB     1  
ATOM 1526  O OG     . SER C 3 30 ? -101.975 11.347  -25.754 1.00 2.66 ? 39  SER A OG     1  
ATOM 1527  H H      . SER C 3 30 ? -104.334 11.333  -24.493 1.00 1.64 ? 39  SER A H      1  
ATOM 1528  H HA     . SER C 3 30 ? -104.416 9.174   -26.440 1.00 1.84 ? 39  SER A HA     1  
ATOM 1529  H HB2    . SER C 3 30 ? -102.462 10.241  -27.407 1.00 2.27 ? 39  SER A HB2    1  
ATOM 1530  H HB3    . SER C 3 30 ? -103.636 11.480  -26.978 1.00 2.50 ? 39  SER A HB3    1  
ATOM 1531  H HG     . SER C 3 30 ? -102.065 10.988  -24.868 1.00 2.78 ? 39  SER A HG     1  
ATOM 1532  N N      . CYS C 3 31 ? -102.615 8.746   -23.854 1.00 1.29 ? 40  CYS A N      1  
ATOM 1533  C CA     . CYS C 3 31 ? -101.656 7.787   -23.225 1.00 1.29 ? 40  CYS A CA     1  
ATOM 1534  C C      . CYS C 3 31 ? -101.984 6.358   -23.687 1.00 1.22 ? 40  CYS A C      1  
ATOM 1535  O O      . CYS C 3 31 ? -101.126 5.512   -23.760 1.00 1.43 ? 40  CYS A O      1  
ATOM 1536  C CB     . CYS C 3 31 ? -101.732 7.891   -21.678 1.00 1.49 ? 40  CYS A CB     1  
ATOM 1537  S SG     . CYS C 3 31 ? -100.201 8.618   -21.025 1.00 2.22 ? 40  CYS A SG     1  
ATOM 1538  H H      . CYS C 3 31 ? -103.107 9.406   -23.309 1.00 1.74 ? 40  CYS A H      1  
ATOM 1539  H HA     . CYS C 3 31 ? -100.661 8.034   -23.554 1.00 1.44 ? 40  CYS A HA     1  
ATOM 1540  H HB2    . CYS C 3 31 ? -102.561 8.517   -21.403 1.00 2.08 ? 40  CYS A HB2    1  
ATOM 1541  H HB3    . CYS C 3 31 ? -101.874 6.912   -21.243 1.00 1.69 ? 40  CYS A HB3    1  
ATOM 1542  H HG     . CYS C 3 31 ? -100.331 9.564   -20.950 1.00 2.54 ? 40  CYS A HG     1  
ATOM 1543  N N      . GLN C 3 32 ? -103.213 6.079   -24.003 1.00 1.22 ? 41  GLN A N      1  
ATOM 1544  C CA     . GLN C 3 32 ? -103.562 4.705   -24.453 1.00 1.29 ? 41  GLN A CA     1  
ATOM 1545  C C      . GLN C 3 32 ? -102.807 4.363   -25.751 1.00 1.34 ? 41  GLN A C      1  
ATOM 1546  O O      . GLN C 3 32 ? -102.440 3.229   -25.980 1.00 1.87 ? 41  GLN A O      1  
ATOM 1547  C CB     . GLN C 3 32 ? -105.075 4.618   -24.680 1.00 1.53 ? 41  GLN A CB     1  
ATOM 1548  C CG     . GLN C 3 32 ? -105.455 3.180   -25.049 1.00 1.82 ? 41  GLN A CG     1  
ATOM 1549  C CD     . GLN C 3 32 ? -106.958 3.084   -25.329 1.00 2.46 ? 41  GLN A CD     1  
ATOM 1550  O OE1    . GLN C 3 32 ? -107.576 4.049   -25.735 1.00 3.09 ? 41  GLN A OE1    1  
ATOM 1551  N NE2    . GLN C 3 32 ? -107.568 1.946   -25.137 1.00 3.04 ? 41  GLN A NE2    1  
ATOM 1552  H H      . GLN C 3 32 ? -103.910 6.769   -23.947 1.00 1.38 ? 41  GLN A H      1  
ATOM 1553  H HA     . GLN C 3 32 ? -103.280 4.001   -23.684 1.00 1.32 ? 41  GLN A HA     1  
ATOM 1554  H HB2    . GLN C 3 32 ? -105.590 4.905   -23.771 1.00 1.80 ? 41  GLN A HB2    1  
ATOM 1555  H HB3    . GLN C 3 32 ? -105.360 5.286   -25.477 1.00 1.71 ? 41  GLN A HB3    1  
ATOM 1556  H HG2    . GLN C 3 32 ? -104.908 2.880   -25.929 1.00 2.21 ? 41  GLN A HG2    1  
ATOM 1557  H HG3    . GLN C 3 32 ? -105.201 2.523   -24.231 1.00 2.11 ? 41  GLN A HG3    1  
ATOM 1558  H HE21   . GLN C 3 32 ? -107.058 1.167   -24.818 1.00 3.14 ? 41  GLN A HE21   1  
ATOM 1559  H HE22   . GLN C 3 32 ? -108.527 1.866   -25.311 1.00 3.73 ? 41  GLN A HE22   1  
ATOM 1560  N N      . SER C 3 33 ? -102.588 5.324   -26.614 1.00 1.34 ? 42  SER A N      1  
ATOM 1561  C CA     . SER C 3 33 ? -101.874 5.025   -27.895 1.00 1.48 ? 42  SER A CA     1  
ATOM 1562  C C      . SER C 3 33 ? -100.357 5.026   -27.691 1.00 1.27 ? 42  SER A C      1  
ATOM 1563  O O      . SER C 3 33 ? -99.620  4.544   -28.530 1.00 1.35 ? 42  SER A O      1  
ATOM 1564  C CB     . SER C 3 33 ? -102.222 6.083   -28.940 1.00 1.80 ? 42  SER A CB     1  
ATOM 1565  O OG     . SER C 3 33 ? -101.672 7.334   -28.543 1.00 2.41 ? 42  SER A OG     1  
ATOM 1566  H H      . SER C 3 33 ? -102.898 6.235   -26.423 1.00 1.65 ? 42  SER A H      1  
ATOM 1567  H HA     . SER C 3 33 ? -102.181 4.056   -28.258 1.00 1.66 ? 42  SER A HA     1  
ATOM 1568  H HB2    . SER C 3 33 ? -101.801 5.800   -29.892 1.00 2.13 ? 42  SER A HB2    1  
ATOM 1569  H HB3    . SER C 3 33 ? -103.297 6.157   -29.033 1.00 2.05 ? 42  SER A HB3    1  
ATOM 1570  H HG     . SER C 3 33 ? -102.132 8.026   -29.021 1.00 2.79 ? 42  SER A HG     1  
ATOM 1571  N N      . PHE C 3 34 ? -99.885  5.568   -26.595 1.00 1.12 ? 43  PHE A N      1  
ATOM 1572  C CA     . PHE C 3 34 ? -98.402  5.613   -26.335 1.00 1.04 ? 43  PHE A CA     1  
ATOM 1573  C C      . PHE C 3 34 ? -98.070  4.841   -25.057 1.00 0.94 ? 43  PHE A C      1  
ATOM 1574  O O      . PHE C 3 34 ? -96.919  4.617   -24.740 1.00 0.91 ? 43  PHE A O      1  
ATOM 1575  C CB     . PHE C 3 34 ? -97.950  7.078   -26.204 1.00 1.12 ? 43  PHE A CB     1  
ATOM 1576  C CG     . PHE C 3 34 ? -98.174  7.784   -27.520 1.00 1.19 ? 43  PHE A CG     1  
ATOM 1577  C CD1    . PHE C 3 34 ? -99.401  8.404   -27.769 1.00 1.35 ? 43  PHE A CD1    1  
ATOM 1578  C CD2    . PHE C 3 34 ? -97.166  7.815   -28.498 1.00 1.41 ? 43  PHE A CD2    1  
ATOM 1579  C CE1    . PHE C 3 34 ? -99.630  9.050   -28.991 1.00 1.53 ? 43  PHE A CE1    1  
ATOM 1580  C CE2    . PHE C 3 34 ? -97.393  8.466   -29.721 1.00 1.56 ? 43  PHE A CE2    1  
ATOM 1581  C CZ     . PHE C 3 34 ? -98.625  9.085   -29.965 1.00 1.54 ? 43  PHE A CZ     1  
ATOM 1582  H H      . PHE C 3 34 ? -100.506 5.955   -25.945 1.00 1.16 ? 43  PHE A H      1  
ATOM 1583  H HA     . PHE C 3 34 ? -97.870  5.158   -27.159 1.00 1.15 ? 43  PHE A HA     1  
ATOM 1584  H HB2    . PHE C 3 34 ? -98.525  7.569   -25.430 1.00 1.21 ? 43  PHE A HB2    1  
ATOM 1585  H HB3    . PHE C 3 34 ? -96.902  7.112   -25.953 1.00 1.28 ? 43  PHE A HB3    1  
ATOM 1586  H HD1    . PHE C 3 34 ? -100.178 8.377   -27.019 1.00 1.52 ? 43  PHE A HD1    1  
ATOM 1587  H HD2    . PHE C 3 34 ? -96.213  7.343   -28.311 1.00 1.63 ? 43  PHE A HD2    1  
ATOM 1588  H HE1    . PHE C 3 34 ? -100.580 9.527   -29.179 1.00 1.81 ? 43  PHE A HE1    1  
ATOM 1589  H HE2    . PHE C 3 34 ? -96.618  8.492   -30.471 1.00 1.84 ? 43  PHE A HE2    1  
ATOM 1590  H HZ     . PHE C 3 34 ? -98.802  9.584   -30.903 1.00 1.73 ? 43  PHE A HZ     1  
ATOM 1591  N N      . ILE C 3 35 ? -99.066  4.420   -24.323 1.00 0.93 ? 44  ILE A N      1  
ATOM 1592  C CA     . ILE C 3 35 ? -98.802  3.651   -23.066 1.00 0.88 ? 44  ILE A CA     1  
ATOM 1593  C C      . ILE C 3 35 ? -100.076 2.909   -22.639 1.00 0.92 ? 44  ILE A C      1  
ATOM 1594  O O      . ILE C 3 35 ? -101.069 2.948   -23.343 1.00 1.02 ? 44  ILE A O      1  
ATOM 1595  C CB     . ILE C 3 35 ? -98.320  4.630   -21.997 1.00 0.83 ? 44  ILE A CB     1  
ATOM 1596  C CG1    . ILE C 3 35 ? -97.922  3.878   -20.718 1.00 1.11 ? 44  ILE A CG1    1  
ATOM 1597  C CG2    . ILE C 3 35 ? -99.404  5.669   -21.679 1.00 0.85 ? 44  ILE A CG2    1  
ATOM 1598  C CD1    . ILE C 3 35 ? -96.920  4.728   -19.923 1.00 1.14 ? 44  ILE A CD1    1  
ATOM 1599  H H      . ILE C 3 35 ? -99.985  4.608   -24.598 1.00 0.99 ? 44  ILE A H      1  
ATOM 1600  H HA     . ILE C 3 35 ? -98.025  2.924   -23.256 1.00 0.93 ? 44  ILE A HA     1  
ATOM 1601  H HB     . ILE C 3 35 ? -97.450  5.147   -22.388 1.00 1.08 ? 44  ILE A HB     1  
ATOM 1602  H HG12   . ILE C 3 35 ? -98.799  3.697   -20.114 1.00 1.23 ? 44  ILE A HG12   1  
ATOM 1603  H HG13   . ILE C 3 35 ? -97.463  2.935   -20.979 1.00 1.52 ? 44  ILE A HG13   1  
ATOM 1604  H HG21   . ILE C 3 35 ? -100.366 5.190   -21.613 1.00 1.24 ? 44  ILE A HG21   1  
ATOM 1605  H HG22   . ILE C 3 35 ? -99.179  6.145   -20.738 1.00 1.50 ? 44  ILE A HG22   1  
ATOM 1606  H HG23   . ILE C 3 35 ? -99.422  6.413   -22.459 1.00 1.37 ? 44  ILE A HG23   1  
ATOM 1607  H HD11   . ILE C 3 35 ? -97.137  5.777   -20.060 1.00 1.39 ? 44  ILE A HD11   1  
ATOM 1608  H HD12   . ILE C 3 35 ? -96.988  4.483   -18.874 1.00 1.56 ? 44  ILE A HD12   1  
ATOM 1609  H HD13   . ILE C 3 35 ? -95.919  4.522   -20.278 1.00 1.68 ? 44  ILE A HD13   1  
ATOM 1610  N N      . SER C 3 36 ? -100.063 2.212   -21.516 1.00 0.88 ? 45  SER A N      1  
ATOM 1611  C CA     . SER C 3 36 ? -101.283 1.443   -21.090 1.00 0.95 ? 45  SER A CA     1  
ATOM 1612  C C      . SER C 3 36 ? -101.888 2.038   -19.815 1.00 0.90 ? 45  SER A C      1  
ATOM 1613  O O      . SER C 3 36 ? -101.299 2.015   -18.753 1.00 0.88 ? 45  SER A O      1  
ATOM 1614  C CB     . SER C 3 36 ? -100.870 -0.005  -20.831 1.00 1.05 ? 45  SER A CB     1  
ATOM 1615  O OG     . SER C 3 36 ? -100.445 -0.599  -22.054 1.00 1.71 ? 45  SER A OG     1  
ATOM 1616  H H      . SER C 3 36 ? -99.252  2.174   -20.968 1.00 0.85 ? 45  SER A H      1  
ATOM 1617  H HA     . SER C 3 36 ? -102.028 1.459   -21.873 1.00 1.03 ? 45  SER A HA     1  
ATOM 1618  H HB2    . SER C 3 36 ? -100.053 -0.024  -20.129 1.00 1.42 ? 45  SER A HB2    1  
ATOM 1619  H HB3    . SER C 3 36 ? -101.706 -0.556  -20.424 1.00 1.48 ? 45  SER A HB3    1  
ATOM 1620  H HG     . SER C 3 36 ? -99.706  -0.079  -22.398 1.00 2.19 ? 45  SER A HG     1  
ATOM 1621  N N      . TRP C 3 37 ? -103.080 2.554   -19.927 1.00 0.95 ? 46  TRP A N      1  
ATOM 1622  C CA     . TRP C 3 37 ? -103.792 3.144   -18.754 1.00 0.94 ? 46  TRP A CA     1  
ATOM 1623  C C      . TRP C 3 37 ? -105.063 2.311   -18.531 1.00 1.08 ? 46  TRP A C      1  
ATOM 1624  O O      . TRP C 3 37 ? -106.057 2.506   -19.204 1.00 1.46 ? 46  TRP A O      1  
ATOM 1625  C CB     . TRP C 3 37 ? -104.161 4.599   -19.120 1.00 0.98 ? 46  TRP A CB     1  
ATOM 1626  C CG     . TRP C 3 37 ? -103.946 5.542   -17.978 1.00 0.93 ? 46  TRP A CG     1  
ATOM 1627  C CD1    . TRP C 3 37 ? -103.509 6.809   -18.125 1.00 0.93 ? 46  TRP A CD1    1  
ATOM 1628  C CD2    . TRP C 3 37 ? -104.149 5.349   -16.542 1.00 0.95 ? 46  TRP A CD2    1  
ATOM 1629  N NE1    . TRP C 3 37 ? -103.451 7.413   -16.887 1.00 0.92 ? 46  TRP A NE1    1  
ATOM 1630  C CE2    . TRP C 3 37 ? -103.828 6.556   -15.881 1.00 0.93 ? 46  TRP A CE2    1  
ATOM 1631  C CE3    . TRP C 3 37 ? -104.576 4.266   -15.757 1.00 1.06 ? 46  TRP A CE3    1  
ATOM 1632  C CZ2    . TRP C 3 37 ? -103.932 6.687   -14.503 1.00 0.99 ? 46  TRP A CZ2    1  
ATOM 1633  C CZ3    . TRP C 3 37 ? -104.679 4.394   -14.362 1.00 1.14 ? 46  TRP A CZ3    1  
ATOM 1634  C CH2    . TRP C 3 37 ? -104.357 5.608   -13.738 1.00 1.10 ? 46  TRP A CH2    1  
ATOM 1635  H H      . TRP C 3 37 ? -103.529 2.543   -20.799 1.00 1.03 ? 46  TRP A H      1  
ATOM 1636  H HA     . TRP C 3 37 ? -103.163 3.118   -17.865 1.00 0.89 ? 46  TRP A HA     1  
ATOM 1637  H HB2    . TRP C 3 37 ? -103.546 4.913   -19.947 1.00 0.99 ? 46  TRP A HB2    1  
ATOM 1638  H HB3    . TRP C 3 37 ? -105.197 4.653   -19.428 1.00 1.09 ? 46  TRP A HB3    1  
ATOM 1639  H HD1    . TRP C 3 37 ? -103.254 7.279   -19.064 1.00 0.98 ? 46  TRP A HD1    1  
ATOM 1640  H HE1    . TRP C 3 37 ? -103.176 8.336   -16.723 1.00 0.95 ? 46  TRP A HE1    1  
ATOM 1641  H HE3    . TRP C 3 37 ? -104.821 3.337   -16.222 1.00 1.12 ? 46  TRP A HE3    1  
ATOM 1642  H HZ2    . TRP C 3 37 ? -103.685 7.619   -14.028 1.00 1.00 ? 46  TRP A HZ2    1  
ATOM 1643  H HZ3    . TRP C 3 37 ? -105.010 3.555   -13.768 1.00 1.27 ? 46  TRP A HZ3    1  
ATOM 1644  H HH2    . TRP C 3 37 ? -104.438 5.708   -12.665 1.00 1.19 ? 46  TRP A HH2    1  
ATOM 1645  N N      . THR C 3 38 ? -105.053 1.383   -17.617 1.00 1.02 ? 47  THR A N      1  
ATOM 1646  C CA     . THR C 3 38 ? -106.284 0.567   -17.412 1.00 1.19 ? 47  THR A CA     1  
ATOM 1647  C C      . THR C 3 38 ? -107.402 1.432   -16.822 1.00 1.21 ? 47  THR A C      1  
ATOM 1648  O O      . THR C 3 38 ? -107.178 2.309   -16.004 1.00 1.40 ? 47  THR A O      1  
ATOM 1649  C CB     . THR C 3 38 ? -105.994 -0.639  -16.506 1.00 1.42 ? 47  THR A CB     1  
ATOM 1650  O OG1    . THR C 3 38 ? -107.193 -1.379  -16.335 1.00 2.04 ? 47  THR A OG1    1  
ATOM 1651  C CG2    . THR C 3 38 ? -105.469 -0.186  -15.136 1.00 1.85 ? 47  THR A CG2    1  
ATOM 1652  H H      . THR C 3 38 ? -104.250 1.218   -17.081 1.00 1.07 ? 47  THR A H      1  
ATOM 1653  H HA     . THR C 3 38 ? -106.616 0.205   -18.375 1.00 1.47 ? 47  THR A HA     1  
ATOM 1654  H HB     . THR C 3 38 ? -105.254 -1.271  -16.979 1.00 1.84 ? 47  THR A HB     1  
ATOM 1655  H HG1    . THR C 3 38 ? -107.792 -0.847  -15.811 1.00 2.47 ? 47  THR A HG1    1  
ATOM 1656  H HG21   . THR C 3 38 ? -105.994 0.696   -14.814 1.00 2.22 ? 47  THR A HG21   1  
ATOM 1657  H HG22   . THR C 3 38 ? -105.622 -0.975  -14.413 1.00 2.33 ? 47  THR A HG22   1  
ATOM 1658  H HG23   . THR C 3 38 ? -104.414 0.031   -15.209 1.00 2.30 ? 47  THR A HG23   1  
ATOM 1659  N N      . GLY C 3 39 ? -108.612 1.193   -17.249 1.00 1.49 ? 48  GLY A N      1  
ATOM 1660  C CA     . GLY C 3 39 ? -109.771 1.988   -16.739 1.00 1.74 ? 48  GLY A CA     1  
ATOM 1661  C C      . GLY C 3 39 ? -110.460 1.232   -15.599 1.00 1.64 ? 48  GLY A C      1  
ATOM 1662  O O      . GLY C 3 39 ? -111.665 1.061   -15.600 1.00 1.95 ? 48  GLY A O      1  
ATOM 1663  H H      . GLY C 3 39 ? -108.760 0.489   -17.914 1.00 1.75 ? 48  GLY A H      1  
ATOM 1664  H HA2    . GLY C 3 39 ? -109.428 2.946   -16.377 1.00 1.91 ? 48  GLY A HA2    1  
ATOM 1665  H HA3    . GLY C 3 39 ? -110.481 2.145   -17.541 1.00 2.13 ? 48  GLY A HA3    1  
ATOM 1666  N N      . ASP C 3 40 ? -109.705 0.779   -14.624 1.00 1.50 ? 49  ASP A N      1  
ATOM 1667  C CA     . ASP C 3 40 ? -110.295 0.032   -13.466 1.00 1.64 ? 49  ASP A CA     1  
ATOM 1668  C C      . ASP C 3 40 ? -110.071 0.844   -12.183 1.00 1.38 ? 49  ASP A C      1  
ATOM 1669  O O      . ASP C 3 40 ? -110.627 1.910   -12.005 1.00 1.37 ? 49  ASP A O      1  
ATOM 1670  C CB     . ASP C 3 40 ? -109.588 -1.323  -13.354 1.00 2.11 ? 49  ASP A CB     1  
ATOM 1671  C CG     . ASP C 3 40 ? -110.304 -2.204  -12.329 1.00 2.89 ? 49  ASP A CG     1  
ATOM 1672  O OD1    . ASP C 3 40 ? -111.131 -1.681  -11.603 1.00 3.35 ? 49  ASP A OD1    1  
ATOM 1673  O OD2    . ASP C 3 40 ? -110.010 -3.389  -12.286 1.00 3.56 ? 49  ASP A OD2    1  
ATOM 1674  H H      . ASP C 3 40 ? -108.736 0.932   -14.652 1.00 1.54 ? 49  ASP A H      1  
ATOM 1675  H HA     . ASP C 3 40 ? -111.354 -0.122  -13.615 1.00 1.89 ? 49  ASP A HA     1  
ATOM 1676  H HB2    . ASP C 3 40 ? -109.591 -1.812  -14.316 1.00 2.24 ? 49  ASP A HB2    1  
ATOM 1677  H HB3    . ASP C 3 40 ? -108.568 -1.170  -13.039 1.00 2.45 ? 49  ASP A HB3    1  
ATOM 1678  N N      . GLY C 3 41 ? -109.251 0.360   -11.286 1.00 1.32 ? 50  GLY A N      1  
ATOM 1679  C CA     . GLY C 3 41 ? -108.986 1.118   -10.032 1.00 1.25 ? 50  GLY A CA     1  
ATOM 1680  C C      . GLY C 3 41 ? -107.898 2.156   -10.303 1.00 1.14 ? 50  GLY A C      1  
ATOM 1681  O O      . GLY C 3 41 ? -108.144 3.190   -10.901 1.00 1.18 ? 50  GLY A O      1  
ATOM 1682  H H      . GLY C 3 41 ? -108.804 -0.497  -11.443 1.00 1.46 ? 50  GLY A H      1  
ATOM 1683  H HA2    . GLY C 3 41 ? -109.892 1.612   -9.707  1.00 1.28 ? 50  GLY A HA2    1  
ATOM 1684  H HA3    . GLY C 3 41 ? -108.647 0.440   -9.266  1.00 1.37 ? 50  GLY A HA3    1  
ATOM 1685  N N      . TRP C 3 42 ? -106.687 1.893   -9.878  1.00 1.06 ? 51  TRP A N      1  
ATOM 1686  C CA     . TRP C 3 42 ? -105.583 2.864   -10.121 1.00 0.97 ? 51  TRP A CA     1  
ATOM 1687  C C      . TRP C 3 42 ? -104.283 2.114   -10.387 1.00 0.93 ? 51  TRP A C      1  
ATOM 1688  O O      . TRP C 3 42 ? -103.460 1.952   -9.510  1.00 0.98 ? 51  TRP A O      1  
ATOM 1689  C CB     . TRP C 3 42 ? -105.404 3.756   -8.891  1.00 0.99 ? 51  TRP A CB     1  
ATOM 1690  C CG     . TRP C 3 42 ? -104.500 4.889   -9.245  1.00 0.94 ? 51  TRP A CG     1  
ATOM 1691  C CD1    . TRP C 3 42 ? -103.153 4.855   -9.184  1.00 1.03 ? 51  TRP A CD1    1  
ATOM 1692  C CD2    . TRP C 3 42 ? -104.857 6.217   -9.721  1.00 0.88 ? 51  TRP A CD2    1  
ATOM 1693  N NE1    . TRP C 3 42 ? -102.657 6.073   -9.603  1.00 0.97 ? 51  TRP A NE1    1  
ATOM 1694  C CE2    . TRP C 3 42 ? -103.671 6.949   -9.939  1.00 0.87 ? 51  TRP A CE2    1  
ATOM 1695  C CE3    . TRP C 3 42 ? -106.088 6.845   -9.982  1.00 0.97 ? 51  TRP A CE3    1  
ATOM 1696  C CZ2    . TRP C 3 42 ? -103.703 8.268   -10.403 1.00 0.86 ? 51  TRP A CZ2    1  
ATOM 1697  C CZ3    . TRP C 3 42 ? -106.125 8.169   -10.448 1.00 1.05 ? 51  TRP A CZ3    1  
ATOM 1698  C CH2    . TRP C 3 42 ? -104.936 8.880   -10.658 1.00 0.97 ? 51  TRP A CH2    1  
ATOM 1699  H H      . TRP C 3 42 ? -106.508 1.055   -9.406  1.00 1.09 ? 51  TRP A H      1  
ATOM 1700  H HA     . TRP C 3 42 ? -105.816 3.480   -10.980 1.00 0.96 ? 51  TRP A HA     1  
ATOM 1701  H HB2    . TRP C 3 42 ? -106.364 4.139   -8.573  1.00 1.05 ? 51  TRP A HB2    1  
ATOM 1702  H HB3    . TRP C 3 42 ? -104.963 3.179   -8.091  1.00 1.03 ? 51  TRP A HB3    1  
ATOM 1703  H HD1    . TRP C 3 42 ? -102.557 4.008   -8.868  1.00 1.18 ? 51  TRP A HD1    1  
ATOM 1704  H HE1    . TRP C 3 42 ? -101.706 6.309   -9.654  1.00 1.05 ? 51  TRP A HE1    1  
ATOM 1705  H HE3    . TRP C 3 42 ? -107.009 6.304   -9.823  1.00 1.05 ? 51  TRP A HE3    1  
ATOM 1706  H HZ2    . TRP C 3 42 ? -102.779 8.812   -10.561 1.00 0.87 ? 51  TRP A HZ2    1  
ATOM 1707  H HZ3    . TRP C 3 42 ? -107.077 8.640   -10.646 1.00 1.22 ? 51  TRP A HZ3    1  
ATOM 1708  H HH2    . TRP C 3 42 ? -104.970 9.898   -11.018 1.00 1.05 ? 51  TRP A HH2    1  
ATOM 1709  N N      . GLU C 3 43 ? -104.087 1.671   -11.599 1.00 0.91 ? 52  GLU A N      1  
ATOM 1710  C CA     . GLU C 3 43 ? -102.831 0.948   -11.950 1.00 0.89 ? 52  GLU A CA     1  
ATOM 1711  C C      . GLU C 3 43 ? -102.274 1.545   -13.239 1.00 0.85 ? 52  GLU A C      1  
ATOM 1712  O O      . GLU C 3 43 ? -102.988 1.736   -14.203 1.00 0.98 ? 52  GLU A O      1  
ATOM 1713  C CB     . GLU C 3 43 ? -103.123 -0.533  -12.154 1.00 0.97 ? 52  GLU A CB     1  
ATOM 1714  C CG     . GLU C 3 43 ? -103.516 -1.166  -10.820 1.00 1.48 ? 52  GLU A CG     1  
ATOM 1715  C CD     . GLU C 3 43 ? -103.700 -2.667  -11.030 1.00 1.81 ? 52  GLU A CD     1  
ATOM 1716  O OE1    . GLU C 3 43 ? -102.736 -3.309  -11.414 1.00 2.50 ? 52  GLU A OE1    1  
ATOM 1717  O OE2    . GLU C 3 43 ? -104.801 -3.148  -10.820 1.00 2.20 ? 52  GLU A OE2    1  
ATOM 1718  H H      . GLU C 3 43 ? -104.769 1.830   -12.291 1.00 0.97 ? 52  GLU A H      1  
ATOM 1719  H HA     . GLU C 3 43 ? -102.101 1.066   -11.166 1.00 0.88 ? 52  GLU A HA     1  
ATOM 1720  H HB2    . GLU C 3 43 ? -103.930 -0.647  -12.861 1.00 1.28 ? 52  GLU A HB2    1  
ATOM 1721  H HB3    . GLU C 3 43 ? -102.241 -1.021  -12.536 1.00 1.29 ? 52  GLU A HB3    1  
ATOM 1722  H HG2    . GLU C 3 43 ? -102.732 -0.989  -10.096 1.00 2.17 ? 52  GLU A HG2    1  
ATOM 1723  H HG3    . GLU C 3 43 ? -104.442 -0.733  -10.469 1.00 1.98 ? 52  GLU A HG3    1  
ATOM 1724  N N      . PHE C 3 44 ? -101.010 1.859   -13.253 1.00 0.74 ? 53  PHE A N      1  
ATOM 1725  C CA     . PHE C 3 44 ? -100.393 2.473   -14.465 1.00 0.72 ? 53  PHE A CA     1  
ATOM 1726  C C      . PHE C 3 44 ? -99.233  1.605   -14.950 1.00 0.72 ? 53  PHE A C      1  
ATOM 1727  O O      . PHE C 3 44 ? -98.264  1.402   -14.245 1.00 0.76 ? 53  PHE A O      1  
ATOM 1728  C CB     . PHE C 3 44 ? -99.887  3.856   -14.071 1.00 0.69 ? 53  PHE A CB     1  
ATOM 1729  C CG     . PHE C 3 44 ? -99.472  4.623   -15.299 1.00 0.71 ? 53  PHE A CG     1  
ATOM 1730  C CD1    . PHE C 3 44 ? -100.447 5.051   -16.202 1.00 0.77 ? 53  PHE A CD1    1  
ATOM 1731  C CD2    . PHE C 3 44 ? -98.124  4.928   -15.523 1.00 0.70 ? 53  PHE A CD2    1  
ATOM 1732  C CE1    . PHE C 3 44 ? -100.083 5.783   -17.328 1.00 0.82 ? 53  PHE A CE1    1  
ATOM 1733  C CE2    . PHE C 3 44 ? -97.753  5.659   -16.655 1.00 0.75 ? 53  PHE A CE2    1  
ATOM 1734  C CZ     . PHE C 3 44 ? -98.738  6.085   -17.559 1.00 0.80 ? 53  PHE A CZ     1  
ATOM 1735  H H      . PHE C 3 44 ? -100.465 1.707   -12.458 1.00 0.73 ? 53  PHE A H      1  
ATOM 1736  H HA     . PHE C 3 44 ? -101.124 2.570   -15.258 1.00 0.75 ? 53  PHE A HA     1  
ATOM 1737  H HB2    . PHE C 3 44 ? -100.680 4.390   -13.562 1.00 0.70 ? 53  PHE A HB2    1  
ATOM 1738  H HB3    . PHE C 3 44 ? -99.043  3.752   -13.404 1.00 0.68 ? 53  PHE A HB3    1  
ATOM 1739  H HD1    . PHE C 3 44 ? -101.488 4.816   -16.028 1.00 0.80 ? 53  PHE A HD1    1  
ATOM 1740  H HD2    . PHE C 3 44 ? -97.373  4.598   -14.821 1.00 0.70 ? 53  PHE A HD2    1  
ATOM 1741  H HE1    . PHE C 3 44 ? -100.841 6.113   -18.025 1.00 0.89 ? 53  PHE A HE1    1  
ATOM 1742  H HE2    . PHE C 3 44 ? -96.709  5.890   -16.837 1.00 0.77 ? 53  PHE A HE2    1  
ATOM 1743  H HZ     . PHE C 3 44 ? -98.459  6.657   -18.434 1.00 0.86 ? 53  PHE A HZ     1  
ATOM 1744  N N      . LYS C 3 45 ? -99.324  1.089   -16.155 1.00 0.75 ? 54  LYS A N      1  
ATOM 1745  C CA     . LYS C 3 45 ? -98.224  0.223   -16.702 1.00 0.80 ? 54  LYS A CA     1  
ATOM 1746  C C      . LYS C 3 45 ? -97.504  0.954   -17.840 1.00 0.79 ? 54  LYS A C      1  
ATOM 1747  O O      . LYS C 3 45 ? -98.123  1.546   -18.705 1.00 0.82 ? 54  LYS A O      1  
ATOM 1748  C CB     . LYS C 3 45 ? -98.813  -1.080  -17.246 1.00 0.91 ? 54  LYS A CB     1  
ATOM 1749  C CG     . LYS C 3 45 ? -99.539  -1.830  -16.130 1.00 1.53 ? 54  LYS A CG     1  
ATOM 1750  C CD     . LYS C 3 45 ? -99.980  -3.195  -16.656 1.00 1.63 ? 54  LYS A CD     1  
ATOM 1751  C CE     . LYS C 3 45 ? -100.621 -4.010  -15.529 1.00 1.85 ? 54  LYS A CE     1  
ATOM 1752  N NZ     . LYS C 3 45 ? -101.037 -5.339  -16.058 1.00 2.34 ? 54  LYS A NZ     1  
ATOM 1753  H H      . LYS C 3 45 ? -100.116 1.270   -16.701 1.00 0.78 ? 54  LYS A H      1  
ATOM 1754  H HA     . LYS C 3 45 ? -97.511  -0.009  -15.922 1.00 0.81 ? 54  LYS A HA     1  
ATOM 1755  H HB2    . LYS C 3 45 ? -99.502  -0.864  -18.045 1.00 1.36 ? 54  LYS A HB2    1  
ATOM 1756  H HB3    . LYS C 3 45 ? -98.011  -1.699  -17.621 1.00 1.53 ? 54  LYS A HB3    1  
ATOM 1757  H HG2    . LYS C 3 45 ? -98.870  -1.963  -15.291 1.00 2.22 ? 54  LYS A HG2    1  
ATOM 1758  H HG3    . LYS C 3 45 ? -100.406 -1.267  -15.817 1.00 2.07 ? 54  LYS A HG3    1  
ATOM 1759  H HD2    . LYS C 3 45 ? -100.698 -3.059  -17.451 1.00 2.26 ? 54  LYS A HD2    1  
ATOM 1760  H HD3    . LYS C 3 45 ? -99.119  -3.723  -17.034 1.00 1.90 ? 54  LYS A HD3    1  
ATOM 1761  H HE2    . LYS C 3 45 ? -99.907  -4.150  -14.730 1.00 2.32 ? 54  LYS A HE2    1  
ATOM 1762  H HE3    . LYS C 3 45 ? -101.485 -3.487  -15.153 1.00 2.34 ? 54  LYS A HE3    1  
ATOM 1763  H HZ1    . LYS C 3 45 ? -101.028 -5.318  -17.100 1.00 2.82 ? 54  LYS A HZ1    1  
ATOM 1764  H HZ2    . LYS C 3 45 ? -100.377 -6.067  -15.718 1.00 2.78 ? 54  LYS A HZ2    1  
ATOM 1765  H HZ3    . LYS C 3 45 ? -101.995 -5.558  -15.726 1.00 2.58 ? 54  LYS A HZ3    1  
ATOM 1766  N N      . LEU C 3 46 ? -96.189  0.908   -17.841 1.00 0.80 ? 55  LEU A N      1  
ATOM 1767  C CA     . LEU C 3 46 ? -95.391  1.586   -18.912 1.00 0.82 ? 55  LEU A CA     1  
ATOM 1768  C C      . LEU C 3 46 ? -95.056  0.591   -20.040 1.00 0.90 ? 55  LEU A C      1  
ATOM 1769  O O      . LEU C 3 46 ? -94.130  -0.192  -19.933 1.00 0.98 ? 55  LEU A O      1  
ATOM 1770  C CB     . LEU C 3 46 ? -94.084  2.126   -18.299 1.00 0.85 ? 55  LEU A CB     1  
ATOM 1771  C CG     . LEU C 3 46 ? -94.331  3.480   -17.614 1.00 0.78 ? 55  LEU A CG     1  
ATOM 1772  C CD1    . LEU C 3 46 ? -95.299  3.305   -16.450 1.00 1.30 ? 55  LEU A CD1    1  
ATOM 1773  C CD2    . LEU C 3 46 ? -93.007  4.016   -17.080 1.00 1.25 ? 55  LEU A CD2    1  
ATOM 1774  H H      . LEU C 3 46 ? -95.726  0.417   -17.129 1.00 0.82 ? 55  LEU A H      1  
ATOM 1775  H HA     . LEU C 3 46 ? -95.955  2.400   -19.320 1.00 0.81 ? 55  LEU A HA     1  
ATOM 1776  H HB2    . LEU C 3 46 ? -93.719  1.419   -17.568 1.00 0.89 ? 55  LEU A HB2    1  
ATOM 1777  H HB3    . LEU C 3 46 ? -93.346  2.249   -19.072 1.00 0.94 ? 55  LEU A HB3    1  
ATOM 1778  H HG     . LEU C 3 46 ? -94.745  4.174   -18.323 1.00 1.16 ? 55  LEU A HG     1  
ATOM 1779  H HD11   . LEU C 3 46 ? -94.965  2.491   -15.824 1.00 1.76 ? 55  LEU A HD11   1  
ATOM 1780  H HD12   . LEU C 3 46 ? -95.329  4.217   -15.874 1.00 1.90 ? 55  LEU A HD12   1  
ATOM 1781  H HD13   . LEU C 3 46 ? -96.287  3.087   -16.829 1.00 1.77 ? 55  LEU A HD13   1  
ATOM 1782  H HD21   . LEU C 3 46 ? -92.259  3.960   -17.852 1.00 1.79 ? 55  LEU A HD21   1  
ATOM 1783  H HD22   . LEU C 3 46 ? -93.131  5.042   -16.770 1.00 1.81 ? 55  LEU A HD22   1  
ATOM 1784  H HD23   . LEU C 3 46 ? -92.703  3.417   -16.237 1.00 1.70 ? 55  LEU A HD23   1  
ATOM 1785  N N      . SER C 3 47 ? -95.785  0.631   -21.123 1.00 0.91 ? 56  SER A N      1  
ATOM 1786  C CA     . SER C 3 47 ? -95.484  -0.297  -22.253 1.00 1.02 ? 56  SER A CA     1  
ATOM 1787  C C      . SER C 3 47 ? -94.307  0.253   -23.070 1.00 1.01 ? 56  SER A C      1  
ATOM 1788  O O      . SER C 3 47 ? -93.260  -0.357  -23.153 1.00 1.08 ? 56  SER A O      1  
ATOM 1789  C CB     . SER C 3 47 ? -96.716  -0.412  -23.148 1.00 1.09 ? 56  SER A CB     1  
ATOM 1790  O OG     . SER C 3 47 ? -96.930  0.829   -23.815 1.00 1.60 ? 56  SER A OG     1  
ATOM 1791  H H      . SER C 3 47 ? -96.515  1.275   -21.203 1.00 0.90 ? 56  SER A H      1  
ATOM 1792  H HA     . SER C 3 47 ? -95.227  -1.273  -21.868 1.00 1.09 ? 56  SER A HA     1  
ATOM 1793  H HB2    . SER C 3 47 ? -96.562  -1.187  -23.881 1.00 1.39 ? 56  SER A HB2    1  
ATOM 1794  H HB3    . SER C 3 47 ? -97.576  -0.661  -22.539 1.00 1.65 ? 56  SER A HB3    1  
ATOM 1795  H HG     . SER C 3 47 ? -97.793  0.796   -24.242 1.00 1.97 ? 56  SER A HG     1  
ATOM 1796  N N      . ASP C 3 48 ? -94.470  1.407   -23.675 1.00 0.98 ? 57  ASP A N      1  
ATOM 1797  C CA     . ASP C 3 48 ? -93.362  2.002   -24.492 1.00 1.02 ? 57  ASP A CA     1  
ATOM 1798  C C      . ASP C 3 48 ? -93.287  3.524   -24.271 1.00 0.91 ? 57  ASP A C      1  
ATOM 1799  O O      . ASP C 3 48 ? -93.773  4.274   -25.098 1.00 1.09 ? 57  ASP A O      1  
ATOM 1800  C CB     . ASP C 3 48 ? -93.643  1.728   -25.970 1.00 1.30 ? 57  ASP A CB     1  
ATOM 1801  C CG     . ASP C 3 48 ? -93.612  0.220   -26.229 1.00 1.93 ? 57  ASP A CG     1  
ATOM 1802  O OD1    . ASP C 3 48 ? -92.908  -0.474  -25.513 1.00 2.54 ? 57  ASP A OD1    1  
ATOM 1803  O OD2    . ASP C 3 48 ? -94.291  -0.215  -27.145 1.00 2.54 ? 57  ASP A OD2    1  
ATOM 1804  H H      . ASP C 3 48 ? -95.326  1.883   -23.593 1.00 0.98 ? 57  ASP A H      1  
ATOM 1805  H HA     . ASP C 3 48 ? -92.422  1.550   -24.225 1.00 1.02 ? 57  ASP A HA     1  
ATOM 1806  H HB2    . ASP C 3 48 ? -94.617  2.112   -26.229 1.00 1.58 ? 57  ASP A HB2    1  
ATOM 1807  H HB3    . ASP C 3 48 ? -92.892  2.211   -26.575 1.00 1.71 ? 57  ASP A HB3    1  
ATOM 1808  N N      . PRO C 3 49 ? -92.675  3.956   -23.180 1.00 0.73 ? 58  PRO A N      1  
ATOM 1809  C CA     . PRO C 3 49 ? -92.548  5.399   -22.894 1.00 0.78 ? 58  PRO A CA     1  
ATOM 1810  C C      . PRO C 3 49 ? -91.492  5.999   -23.828 1.00 0.88 ? 58  PRO A C      1  
ATOM 1811  O O      . PRO C 3 49 ? -90.504  6.564   -23.400 1.00 1.09 ? 58  PRO A O      1  
ATOM 1812  C CB     . PRO C 3 49 ? -92.087  5.456   -21.424 1.00 0.79 ? 58  PRO A CB     1  
ATOM 1813  C CG     . PRO C 3 49 ? -91.560  4.041   -21.065 1.00 0.82 ? 58  PRO A CG     1  
ATOM 1814  C CD     . PRO C 3 49 ? -92.079  3.071   -22.153 1.00 0.72 ? 58  PRO A CD     1  
ATOM 1815  H HA     . PRO C 3 49 ? -93.496  5.901   -23.016 1.00 0.89 ? 58  PRO A HA     1  
ATOM 1816  H HB2    . PRO C 3 49 ? -91.302  6.193   -21.293 1.00 0.85 ? 58  PRO A HB2    1  
ATOM 1817  H HB3    . PRO C 3 49 ? -92.922  5.702   -20.787 1.00 0.89 ? 58  PRO A HB3    1  
ATOM 1818  H HG2    . PRO C 3 49 ? -90.475  4.045   -21.054 1.00 0.96 ? 58  PRO A HG2    1  
ATOM 1819  H HG3    . PRO C 3 49 ? -91.932  3.744   -20.106 1.00 0.99 ? 58  PRO A HG3    1  
ATOM 1820  H HD2    . PRO C 3 49 ? -91.257  2.500   -22.565 1.00 0.83 ? 58  PRO A HD2    1  
ATOM 1821  H HD3    . PRO C 3 49 ? -92.835  2.412   -21.749 1.00 0.73 ? 58  PRO A HD3    1  
ATOM 1822  N N      . ASP C 3 50 ? -91.688  5.866   -25.102 1.00 1.08 ? 59  ASP A N      1  
ATOM 1823  C CA     . ASP C 3 50 ? -90.692  6.411   -26.069 1.00 1.21 ? 59  ASP A CA     1  
ATOM 1824  C C      . ASP C 3 50 ? -90.755  7.936   -26.065 1.00 0.99 ? 59  ASP A C      1  
ATOM 1825  O O      . ASP C 3 50 ? -89.746  8.609   -26.111 1.00 0.93 ? 59  ASP A O      1  
ATOM 1826  C CB     . ASP C 3 50 ? -91.030  5.904   -27.468 1.00 1.59 ? 59  ASP A CB     1  
ATOM 1827  C CG     . ASP C 3 50 ? -90.737  4.406   -27.566 1.00 2.29 ? 59  ASP A CG     1  
ATOM 1828  O OD1    . ASP C 3 50 ? -90.006  3.905   -26.726 1.00 2.89 ? 59  ASP A OD1    1  
ATOM 1829  O OD2    . ASP C 3 50 ? -91.257  3.781   -28.475 1.00 2.85 ? 59  ASP A OD2    1  
ATOM 1830  H H      . ASP C 3 50 ? -92.483  5.400   -25.428 1.00 1.31 ? 59  ASP A H      1  
ATOM 1831  H HA     . ASP C 3 50 ? -89.702  6.086   -25.792 1.00 1.33 ? 59  ASP A HA     1  
ATOM 1832  H HB2    . ASP C 3 50 ? -92.076  6.082   -27.668 1.00 1.90 ? 59  ASP A HB2    1  
ATOM 1833  H HB3    . ASP C 3 50 ? -90.431  6.431   -28.194 1.00 1.83 ? 59  ASP A HB3    1  
ATOM 1834  N N      . GLU C 3 51 ? -91.938  8.482   -26.015 1.00 1.03 ? 60  GLU A N      1  
ATOM 1835  C CA     . GLU C 3 51 ? -92.077  9.966   -26.013 1.00 1.01 ? 60  GLU A CA     1  
ATOM 1836  C C      . GLU C 3 51 ? -92.018  10.467  -24.576 1.00 0.85 ? 60  GLU A C      1  
ATOM 1837  O O      . GLU C 3 51 ? -91.534  11.544  -24.303 1.00 0.89 ? 60  GLU A O      1  
ATOM 1838  C CB     . GLU C 3 51 ? -93.416  10.362  -26.642 1.00 1.29 ? 60  GLU A CB     1  
ATOM 1839  C CG     . GLU C 3 51 ? -93.433  9.951   -28.114 1.00 1.82 ? 60  GLU A CG     1  
ATOM 1840  C CD     . GLU C 3 51 ? -94.817  10.225  -28.707 1.00 2.52 ? 60  GLU A CD     1  
ATOM 1841  O OE1    . GLU C 3 51 ? -95.791  10.095  -27.981 1.00 3.05 ? 60  GLU A OE1    1  
ATOM 1842  O OE2    . GLU C 3 51 ? -94.881  10.566  -29.876 1.00 3.15 ? 60  GLU A OE2    1  
ATOM 1843  H H      . GLU C 3 51 ? -92.734  7.916   -25.975 1.00 1.18 ? 60  GLU A H      1  
ATOM 1844  H HA     . GLU C 3 51 ? -91.269  10.405  -26.578 1.00 1.06 ? 60  GLU A HA     1  
ATOM 1845  H HB2    . GLU C 3 51 ? -94.226  9.869   -26.118 1.00 1.71 ? 60  GLU A HB2    1  
ATOM 1846  H HB3    . GLU C 3 51 ? -93.541  11.431  -26.571 1.00 1.56 ? 60  GLU A HB3    1  
ATOM 1847  H HG2    . GLU C 3 51 ? -92.695  10.528  -28.651 1.00 2.24 ? 60  GLU A HG2    1  
ATOM 1848  H HG3    . GLU C 3 51 ? -93.202  8.899   -28.201 1.00 2.29 ? 60  GLU A HG3    1  
ATOM 1849  N N      . VAL C 3 52 ? -92.495  9.692   -23.652 1.00 0.74 ? 61  VAL A N      1  
ATOM 1850  C CA     . VAL C 3 52 ? -92.450  10.134  -22.236 1.00 0.68 ? 61  VAL A CA     1  
ATOM 1851  C C      . VAL C 3 52 ? -90.990  10.252  -21.798 1.00 0.65 ? 61  VAL A C      1  
ATOM 1852  O O      . VAL C 3 52 ? -90.607  11.193  -21.138 1.00 0.72 ? 61  VAL A O      1  
ATOM 1853  C CB     . VAL C 3 52 ? -93.155  9.102   -21.370 1.00 0.69 ? 61  VAL A CB     1  
ATOM 1854  C CG1    . VAL C 3 52 ? -93.148  9.548   -19.905 1.00 0.76 ? 61  VAL A CG1    1  
ATOM 1855  C CG2    . VAL C 3 52 ? -94.589  8.931   -21.869 1.00 0.80 ? 61  VAL A CG2    1  
ATOM 1856  H H      . VAL C 3 52 ? -92.877  8.818   -23.882 1.00 0.78 ? 61  VAL A H      1  
ATOM 1857  H HA     . VAL C 3 52 ? -92.942  11.093  -22.140 1.00 0.74 ? 61  VAL A HA     1  
ATOM 1858  H HB     . VAL C 3 52 ? -92.633  8.167   -21.457 1.00 0.68 ? 61  VAL A HB     1  
ATOM 1859  H HG11   . VAL C 3 52 ? -93.510  10.565  -19.833 1.00 1.23 ? 61  VAL A HG11   1  
ATOM 1860  H HG12   . VAL C 3 52 ? -93.784  8.896   -19.327 1.00 1.28 ? 61  VAL A HG12   1  
ATOM 1861  H HG13   . VAL C 3 52 ? -92.141  9.497   -19.524 1.00 1.34 ? 61  VAL A HG13   1  
ATOM 1862  H HG21   . VAL C 3 52 ? -95.109  9.878   -21.817 1.00 1.29 ? 61  VAL A HG21   1  
ATOM 1863  H HG22   . VAL C 3 52 ? -94.570  8.590   -22.896 1.00 1.26 ? 61  VAL A HG22   1  
ATOM 1864  H HG23   . VAL C 3 52 ? -95.099  8.205   -21.259 1.00 1.35 ? 61  VAL A HG23   1  
ATOM 1865  N N      . ALA C 3 53 ? -90.169  9.300   -22.154 1.00 0.66 ? 62  ALA A N      1  
ATOM 1866  C CA     . ALA C 3 53 ? -88.738  9.374   -21.743 1.00 0.72 ? 62  ALA A CA     1  
ATOM 1867  C C      . ALA C 3 53 ? -88.051  10.529  -22.464 1.00 0.78 ? 62  ALA A C      1  
ATOM 1868  O O      . ALA C 3 53 ? -87.308  11.288  -21.867 1.00 0.84 ? 62  ALA A O      1  
ATOM 1869  C CB     . ALA C 3 53 ? -88.039  8.068   -22.112 1.00 0.80 ? 62  ALA A CB     1  
ATOM 1870  H H      . ALA C 3 53 ? -90.488  8.539   -22.689 1.00 0.71 ? 62  ALA A H      1  
ATOM 1871  H HA     . ALA C 3 53 ? -88.677  9.524   -20.675 1.00 0.73 ? 62  ALA A HA     1  
ATOM 1872  H HB1    . ALA C 3 53 ? -88.611  7.238   -21.729 1.00 1.24 ? 62  ALA A HB1    1  
ATOM 1873  H HB2    . ALA C 3 53 ? -87.968  7.993   -23.185 1.00 1.26 ? 62  ALA A HB2    1  
ATOM 1874  H HB3    . ALA C 3 53 ? -87.046  8.051   -21.682 1.00 1.40 ? 62  ALA A HB3    1  
ATOM 1875  N N      . ARG C 3 54 ? -88.281  10.669  -23.740 1.00 0.82 ? 63  ARG A N      1  
ATOM 1876  C CA     . ARG C 3 54 ? -87.629  11.776  -24.480 1.00 0.93 ? 63  ARG A CA     1  
ATOM 1877  C C      . ARG C 3 54 ? -88.065  13.102  -23.861 1.00 0.93 ? 63  ARG A C      1  
ATOM 1878  O O      . ARG C 3 54 ? -87.264  13.980  -23.610 1.00 1.02 ? 63  ARG A O      1  
ATOM 1879  C CB     . ARG C 3 54 ? -88.053  11.727  -25.945 1.00 1.04 ? 63  ARG A CB     1  
ATOM 1880  C CG     . ARG C 3 54 ? -87.384  10.532  -26.637 1.00 1.39 ? 63  ARG A CG     1  
ATOM 1881  C CD     . ARG C 3 54 ? -87.863  10.426  -28.099 1.00 1.86 ? 63  ARG A CD     1  
ATOM 1882  N NE     . ARG C 3 54 ? -88.008  8.981   -28.480 1.00 2.35 ? 63  ARG A NE     1  
ATOM 1883  C CZ     . ARG C 3 54 ? -87.057  8.123   -28.237 1.00 2.86 ? 63  ARG A CZ     1  
ATOM 1884  N NH1    . ARG C 3 54 ? -85.883  8.540   -27.869 1.00 3.05 ? 63  ARG A NH1    1  
ATOM 1885  N NH2    . ARG C 3 54 ? -87.261  6.849   -28.436 1.00 3.69 ? 63  ARG A NH2    1  
ATOM 1886  H H      . ARG C 3 54 ? -88.881  10.048  -24.204 1.00 0.82 ? 63  ARG A H      1  
ATOM 1887  H HA     . ARG C 3 54 ? -86.556  11.674  -24.407 1.00 0.99 ? 63  ARG A HA     1  
ATOM 1888  H HB2    . ARG C 3 54 ? -89.128  11.620  -26.002 1.00 1.35 ? 63  ARG A HB2    1  
ATOM 1889  H HB3    . ARG C 3 54 ? -87.756  12.639  -26.439 1.00 1.35 ? 63  ARG A HB3    1  
ATOM 1890  H HG2    . ARG C 3 54 ? -86.314  10.664  -26.610 1.00 1.83 ? 63  ARG A HG2    1  
ATOM 1891  H HG3    . ARG C 3 54 ? -87.644  9.627   -26.109 1.00 1.81 ? 63  ARG A HG3    1  
ATOM 1892  H HD2    . ARG C 3 54 ? -88.829  10.891  -28.205 1.00 2.39 ? 63  ARG A HD2    1  
ATOM 1893  H HD3    . ARG C 3 54 ? -87.155  10.929  -28.750 1.00 2.26 ? 63  ARG A HD3    1  
ATOM 1894  H HE     . ARG C 3 54 ? -88.856  8.665   -28.860 1.00 2.78 ? 63  ARG A HE     1  
ATOM 1895  H HH11   . ARG C 3 54 ? -85.709  9.517   -27.780 1.00 2.90 ? 63  ARG A HH11   1  
ATOM 1896  H HH12   . ARG C 3 54 ? -85.157  7.882   -27.676 1.00 3.72 ? 63  ARG A HH12   1  
ATOM 1897  H HH21   . ARG C 3 54 ? -88.144  6.532   -28.782 1.00 4.05 ? 63  ARG A HH21   1  
ATOM 1898  H HH22   . ARG C 3 54 ? -86.537  6.190   -28.232 1.00 4.21 ? 63  ARG A HH22   1  
ATOM 1899  N N      . ARG C 3 55 ? -89.333  13.237  -23.591 1.00 0.88 ? 64  ARG A N      1  
ATOM 1900  C CA     . ARG C 3 55 ? -89.831  14.486  -22.963 1.00 0.94 ? 64  ARG A CA     1  
ATOM 1901  C C      . ARG C 3 55 ? -89.206  14.622  -21.573 1.00 0.88 ? 64  ARG A C      1  
ATOM 1902  O O      . ARG C 3 55 ? -88.832  15.697  -21.148 1.00 0.99 ? 64  ARG A O      1  
ATOM 1903  C CB     . ARG C 3 55 ? -91.361  14.440  -22.872 1.00 0.96 ? 64  ARG A CB     1  
ATOM 1904  C CG     . ARG C 3 55 ? -91.965  14.640  -24.269 1.00 1.39 ? 64  ARG A CG     1  
ATOM 1905  C CD     . ARG C 3 55 ? -93.483  14.763  -24.157 1.00 1.63 ? 64  ARG A CD     1  
ATOM 1906  N NE     . ARG C 3 55 ? -93.841  16.114  -23.642 1.00 2.14 ? 64  ARG A NE     1  
ATOM 1907  C CZ     . ARG C 3 55 ? -95.070  16.533  -23.734 1.00 2.59 ? 64  ARG A CZ     1  
ATOM 1908  N NH1    . ARG C 3 55 ? -95.970  15.786  -24.318 1.00 2.81 ? 64  ARG A NH1    1  
ATOM 1909  N NH2    . ARG C 3 55 ? -95.400  17.691  -23.241 1.00 3.46 ? 64  ARG A NH2    1  
ATOM 1910  H H      . ARG C 3 55 ? -89.957  12.503  -23.785 1.00 0.85 ? 64  ARG A H      1  
ATOM 1911  H HA     . ARG C 3 55 ? -89.532  15.329  -23.566 1.00 1.03 ? 64  ARG A HA     1  
ATOM 1912  H HB2    . ARG C 3 55 ? -91.669  13.481  -22.483 1.00 1.10 ? 64  ARG A HB2    1  
ATOM 1913  H HB3    . ARG C 3 55 ? -91.709  15.225  -22.219 1.00 1.35 ? 64  ARG A HB3    1  
ATOM 1914  H HG2    . ARG C 3 55 ? -91.566  15.543  -24.707 1.00 2.06 ? 64  ARG A HG2    1  
ATOM 1915  H HG3    . ARG C 3 55 ? -91.722  13.797  -24.901 1.00 1.99 ? 64  ARG A HG3    1  
ATOM 1916  H HD2    . ARG C 3 55 ? -93.927  14.622  -25.129 1.00 2.13 ? 64  ARG A HD2    1  
ATOM 1917  H HD3    . ARG C 3 55 ? -93.856  14.010  -23.479 1.00 2.13 ? 64  ARG A HD3    1  
ATOM 1918  H HE     . ARG C 3 55 ? -93.158  16.680  -23.217 1.00 2.69 ? 64  ARG A HE     1  
ATOM 1919  H HH11   . ARG C 3 55 ? -95.715  14.896  -24.691 1.00 2.64 ? 64  ARG A HH11   1  
ATOM 1920  H HH12   . ARG C 3 55 ? -96.916  16.107  -24.392 1.00 3.55 ? 64  ARG A HH12   1  
ATOM 1921  H HH21   . ARG C 3 55 ? -94.709  18.257  -22.793 1.00 3.83 ? 64  ARG A HH21   1  
ATOM 1922  H HH22   . ARG C 3 55 ? -96.345  18.011  -23.304 1.00 4.01 ? 64  ARG A HH22   1  
ATOM 1923  N N      . TRP C 3 56 ? -89.075  13.535  -20.859 1.00 0.77 ? 65  TRP A N      1  
ATOM 1924  C CA     . TRP C 3 56 ? -88.463  13.605  -19.502 1.00 0.74 ? 65  TRP A CA     1  
ATOM 1925  C C      . TRP C 3 56 ? -87.054  14.185  -19.632 1.00 0.80 ? 65  TRP A C      1  
ATOM 1926  O O      . TRP C 3 56 ? -86.626  14.997  -18.837 1.00 0.89 ? 65  TRP A O      1  
ATOM 1927  C CB     . TRP C 3 56 ? -88.377  12.185  -18.936 1.00 0.67 ? 65  TRP A CB     1  
ATOM 1928  C CG     . TRP C 3 56 ? -88.201  12.208  -17.447 1.00 0.67 ? 65  TRP A CG     1  
ATOM 1929  C CD1    . TRP C 3 56 ? -87.017  12.289  -16.790 1.00 0.65 ? 65  TRP A CD1    1  
ATOM 1930  C CD2    . TRP C 3 56 ? -89.232  12.101  -16.427 1.00 0.77 ? 65  TRP A CD2    1  
ATOM 1931  N NE1    . TRP C 3 56 ? -87.263  12.244  -15.425 1.00 0.70 ? 65  TRP A NE1    1  
ATOM 1932  C CE2    . TRP C 3 56 ? -88.613  12.129  -15.155 1.00 0.79 ? 65  TRP A CE2    1  
ATOM 1933  C CE3    . TRP C 3 56 ? -90.632  11.991  -16.484 1.00 0.91 ? 65  TRP A CE3    1  
ATOM 1934  C CZ2    . TRP C 3 56 ? -89.359  12.040  -13.978 1.00 0.93 ? 65  TRP A CZ2    1  
ATOM 1935  C CZ3    . TRP C 3 56 ? -91.388  11.901  -15.306 1.00 1.08 ? 65  TRP A CZ3    1  
ATOM 1936  C CH2    . TRP C 3 56 ? -90.752  11.924  -14.053 1.00 1.08 ? 65  TRP A CH2    1  
ATOM 1937  H H      . TRP C 3 56 ? -89.373  12.671  -21.213 1.00 0.75 ? 65  TRP A H      1  
ATOM 1938  H HA     . TRP C 3 56 ? -89.061  14.226  -18.852 1.00 0.80 ? 65  TRP A HA     1  
ATOM 1939  H HB2    . TRP C 3 56 ? -89.286  11.659  -19.169 1.00 0.70 ? 65  TRP A HB2    1  
ATOM 1940  H HB3    . TRP C 3 56 ? -87.542  11.665  -19.387 1.00 0.66 ? 65  TRP A HB3    1  
ATOM 1941  H HD1    . TRP C 3 56 ? -86.044  12.373  -17.251 1.00 0.68 ? 65  TRP A HD1    1  
ATOM 1942  H HE1    . TRP C 3 56 ? -86.583  12.287  -14.722 1.00 0.73 ? 65  TRP A HE1    1  
ATOM 1943  H HE3    . TRP C 3 56 ? -91.127  11.979  -17.441 1.00 0.94 ? 65  TRP A HE3    1  
ATOM 1944  H HZ2    . TRP C 3 56 ? -88.867  12.056  -13.021 1.00 0.97 ? 65  TRP A HZ2    1  
ATOM 1945  H HZ3    . TRP C 3 56 ? -92.463  11.814  -15.366 1.00 1.23 ? 65  TRP A HZ3    1  
ATOM 1946  H HH2    . TRP C 3 56 ? -91.339  11.846  -13.149 1.00 1.23 ? 65  TRP A HH2    1  
ATOM 1947  N N      . GLY C 3 57 ? -86.331  13.762  -20.633 1.00 0.87 ? 66  GLY A N      1  
ATOM 1948  C CA     . GLY C 3 57 ? -84.945  14.268  -20.830 1.00 1.00 ? 66  GLY A CA     1  
ATOM 1949  C C      . GLY C 3 57 ? -84.964  15.599  -21.587 1.00 1.06 ? 66  GLY A C      1  
ATOM 1950  O O      . GLY C 3 57 ? -83.993  16.333  -21.587 1.00 1.09 ? 66  GLY A O      1  
ATOM 1951  H H      . GLY C 3 57 ? -86.703  13.102  -21.257 1.00 0.90 ? 66  GLY A H      1  
ATOM 1952  H HA2    . GLY C 3 57 ? -84.471  14.403  -19.869 1.00 1.01 ? 66  GLY A HA2    1  
ATOM 1953  H HA3    . GLY C 3 57 ? -84.388  13.547  -21.404 1.00 1.11 ? 66  GLY A HA3    1  
ATOM 1954  N N      . LYS C 3 58 ? -86.047  15.912  -22.243 1.00 1.15 ? 67  LYS A N      1  
ATOM 1955  C CA     . LYS C 3 58 ? -86.110  17.188  -23.004 1.00 1.31 ? 67  LYS A CA     1  
ATOM 1956  C C      . LYS C 3 58 ? -86.064  18.366  -22.031 1.00 1.29 ? 67  LYS A C      1  
ATOM 1957  O O      . LYS C 3 58 ? -85.352  19.327  -22.232 1.00 1.36 ? 67  LYS A O      1  
ATOM 1958  C CB     . LYS C 3 58 ? -87.421  17.237  -23.785 1.00 1.50 ? 67  LYS A CB     1  
ATOM 1959  C CG     . LYS C 3 58 ? -87.420  18.469  -24.694 1.00 1.98 ? 67  LYS A CG     1  
ATOM 1960  C CD     . LYS C 3 58 ? -88.717  18.513  -25.505 1.00 2.17 ? 67  LYS A CD     1  
ATOM 1961  C CE     . LYS C 3 58 ? -88.687  19.695  -26.481 1.00 2.32 ? 67  LYS A CE     1  
ATOM 1962  N NZ     . LYS C 3 58 ? -88.772  20.977  -25.730 1.00 2.71 ? 67  LYS A NZ     1  
ATOM 1963  H H      . LYS C 3 58 ? -86.813  15.305  -22.238 1.00 1.15 ? 67  LYS A H      1  
ATOM 1964  H HA     . LYS C 3 58 ? -85.279  17.248  -23.691 1.00 1.39 ? 67  LYS A HA     1  
ATOM 1965  H HB2    . LYS C 3 58 ? -87.518  16.339  -24.377 1.00 1.51 ? 67  LYS A HB2    1  
ATOM 1966  H HB3    . LYS C 3 58 ? -88.248  17.301  -23.091 1.00 1.70 ? 67  LYS A HB3    1  
ATOM 1967  H HG2    . LYS C 3 58 ? -87.351  19.360  -24.087 1.00 2.34 ? 67  LYS A HG2    1  
ATOM 1968  H HG3    . LYS C 3 58 ? -86.578  18.424  -25.366 1.00 2.33 ? 67  LYS A HG3    1  
ATOM 1969  H HD2    . LYS C 3 58 ? -88.824  17.592  -26.063 1.00 2.56 ? 67  LYS A HD2    1  
ATOM 1970  H HD3    . LYS C 3 58 ? -89.554  18.628  -24.835 1.00 2.44 ? 67  LYS A HD3    1  
ATOM 1971  H HE2    . LYS C 3 58 ? -87.770  19.674  -27.050 1.00 2.57 ? 67  LYS A HE2    1  
ATOM 1972  H HE3    . LYS C 3 58 ? -89.528  19.620  -27.153 1.00 2.74 ? 67  LYS A HE3    1  
ATOM 1973  H HZ1    . LYS C 3 58 ? -88.700  20.792  -24.708 1.00 3.04 ? 67  LYS A HZ1    1  
ATOM 1974  H HZ2    . LYS C 3 58 ? -87.997  21.603  -26.027 1.00 2.91 ? 67  LYS A HZ2    1  
ATOM 1975  H HZ3    . LYS C 3 58 ? -89.681  21.435  -25.938 1.00 3.18 ? 67  LYS A HZ3    1  
ATOM 1976  N N      . ARG C 3 59 ? -86.817  18.288  -20.971 1.00 1.28 ? 68  ARG A N      1  
ATOM 1977  C CA     . ARG C 3 59 ? -86.822  19.387  -19.971 1.00 1.36 ? 68  ARG A CA     1  
ATOM 1978  C C      . ARG C 3 59 ? -85.415  19.525  -19.375 1.00 1.32 ? 68  ARG A C      1  
ATOM 1979  O O      . ARG C 3 59 ? -85.045  20.560  -18.852 1.00 1.49 ? 68  ARG A O      1  
ATOM 1980  C CB     . ARG C 3 59 ? -87.843  19.052  -18.876 1.00 1.44 ? 68  ARG A CB     1  
ATOM 1981  C CG     . ARG C 3 59 ? -87.998  20.247  -17.935 1.00 1.80 ? 68  ARG A CG     1  
ATOM 1982  C CD     . ARG C 3 59 ? -89.273  20.086  -17.108 1.00 2.04 ? 68  ARG A CD     1  
ATOM 1983  N NE     . ARG C 3 59 ? -89.147  18.897  -16.220 1.00 2.47 ? 68  ARG A NE     1  
ATOM 1984  C CZ     . ARG C 3 59 ? -89.955  18.764  -15.209 1.00 3.08 ? 68  ARG A CZ     1  
ATOM 1985  N NH1    . ARG C 3 59 ? -90.810  19.704  -14.942 1.00 3.41 ? 68  ARG A NH1    1  
ATOM 1986  N NH2    . ARG C 3 59 ? -89.910  17.693  -14.467 1.00 3.88 ? 68  ARG A NH2    1  
ATOM 1987  H H      . ARG C 3 59 ? -87.381  17.497  -20.829 1.00 1.27 ? 68  ARG A H      1  
ATOM 1988  H HA     . ARG C 3 59 ? -87.100  20.311  -20.455 1.00 1.49 ? 68  ARG A HA     1  
ATOM 1989  H HB2    . ARG C 3 59 ? -88.797  18.822  -19.331 1.00 1.69 ? 68  ARG A HB2    1  
ATOM 1990  H HB3    . ARG C 3 59 ? -87.499  18.196  -18.313 1.00 1.59 ? 68  ARG A HB3    1  
ATOM 1991  H HG2    . ARG C 3 59 ? -87.147  20.290  -17.273 1.00 2.29 ? 68  ARG A HG2    1  
ATOM 1992  H HG3    . ARG C 3 59 ? -88.058  21.158  -18.509 1.00 2.33 ? 68  ARG A HG3    1  
ATOM 1993  H HD2    . ARG C 3 59 ? -89.427  20.975  -16.509 1.00 2.35 ? 68  ARG A HD2    1  
ATOM 1994  H HD3    . ARG C 3 59 ? -90.119  19.946  -17.766 1.00 2.55 ? 68  ARG A HD3    1  
ATOM 1995  H HE     . ARG C 3 59 ? -88.478  18.207  -16.410 1.00 2.79 ? 68  ARG A HE     1  
ATOM 1996  H HH11   . ARG C 3 59 ? -90.846  20.518  -15.515 1.00 3.26 ? 68  ARG A HH11   1  
ATOM 1997  H HH12   . ARG C 3 59 ? -91.423  19.616  -14.159 1.00 4.13 ? 68  ARG A HH12   1  
ATOM 1998  H HH21   . ARG C 3 59 ? -89.255  16.967  -14.678 1.00 4.13 ? 68  ARG A HH21   1  
ATOM 1999  H HH22   . ARG C 3 59 ? -90.532  17.597  -13.691 1.00 4.48 ? 68  ARG A HH22   1  
ATOM 2000  N N      . LYS C 3 60 ? -84.627  18.480  -19.454 1.00 1.21 ? 69  LYS A N      1  
ATOM 2001  C CA     . LYS C 3 60 ? -83.232  18.524  -18.895 1.00 1.26 ? 69  LYS A CA     1  
ATOM 2002  C C      . LYS C 3 60 ? -82.249  18.964  -19.999 1.00 1.29 ? 69  LYS A C      1  
ATOM 2003  O O      . LYS C 3 60 ? -81.047  18.971  -19.806 1.00 1.45 ? 69  LYS A O      1  
ATOM 2004  C CB     . LYS C 3 60 ? -82.860  17.111  -18.357 1.00 1.24 ? 69  LYS A CB     1  
ATOM 2005  C CG     . LYS C 3 60 ? -82.540  17.166  -16.847 1.00 1.34 ? 69  LYS A CG     1  
ATOM 2006  C CD     . LYS C 3 60 ? -83.812  17.454  -16.023 1.00 1.61 ? 69  LYS A CD     1  
ATOM 2007  C CE     . LYS C 3 60 ? -84.559  16.151  -15.690 1.00 1.89 ? 69  LYS A CE     1  
ATOM 2008  N NZ     . LYS C 3 60 ? -85.279  15.658  -16.896 1.00 2.56 ? 69  LYS A NZ     1  
ATOM 2009  H H      . LYS C 3 60 ? -84.952  17.661  -19.881 1.00 1.18 ? 69  LYS A H      1  
ATOM 2010  H HA     . LYS C 3 60 ? -83.191  19.249  -18.094 1.00 1.47 ? 69  LYS A HA     1  
ATOM 2011  H HB2    . LYS C 3 60 ? -83.690  16.441  -18.522 1.00 1.61 ? 69  LYS A HB2    1  
ATOM 2012  H HB3    . LYS C 3 60 ? -81.995  16.730  -18.882 1.00 1.55 ? 69  LYS A HB3    1  
ATOM 2013  H HG2    . LYS C 3 60 ? -82.112  16.224  -16.538 1.00 1.87 ? 69  LYS A HG2    1  
ATOM 2014  H HG3    . LYS C 3 60 ? -81.822  17.952  -16.668 1.00 1.90 ? 69  LYS A HG3    1  
ATOM 2015  H HD2    . LYS C 3 60 ? -83.533  17.945  -15.097 1.00 2.11 ? 69  LYS A HD2    1  
ATOM 2016  H HD3    . LYS C 3 60 ? -84.467  18.102  -16.577 1.00 2.12 ? 69  LYS A HD3    1  
ATOM 2017  H HE2    . LYS C 3 60 ? -83.861  15.400  -15.354 1.00 2.35 ? 69  LYS A HE2    1  
ATOM 2018  H HE3    . LYS C 3 60 ? -85.273  16.348  -14.904 1.00 2.07 ? 69  LYS A HE3    1  
ATOM 2019  H HZ1    . LYS C 3 60 ? -85.445  16.448  -17.553 1.00 2.93 ? 69  LYS A HZ1    1  
ATOM 2020  H HZ2    . LYS C 3 60 ? -84.709  14.927  -17.364 1.00 3.03 ? 69  LYS A HZ2    1  
ATOM 2021  H HZ3    . LYS C 3 60 ? -86.189  15.252  -16.605 1.00 2.92 ? 69  LYS A HZ3    1  
ATOM 2022  N N      . ASN C 3 61 ? -82.755  19.336  -21.143 1.00 1.49 ? 70  ASN A N      1  
ATOM 2023  C CA     . ASN C 3 61 ? -81.872  19.785  -22.266 1.00 1.75 ? 70  ASN A CA     1  
ATOM 2024  C C      . ASN C 3 61 ? -80.856  18.703  -22.615 1.00 1.60 ? 70  ASN A C      1  
ATOM 2025  O O      . ASN C 3 61 ? -79.662  18.930  -22.572 1.00 1.74 ? 70  ASN A O      1  
ATOM 2026  C CB     . ASN C 3 61 ? -81.121  21.076  -21.902 1.00 2.11 ? 70  ASN A CB     1  
ATOM 2027  C CG     . ASN C 3 61 ? -82.103  22.251  -21.842 1.00 2.80 ? 70  ASN A CG     1  
ATOM 2028  O OD1    . ASN C 3 61 ? -83.110  22.249  -22.525 1.00 3.49 ? 70  ASN A OD1    1  
ATOM 2029  N ND2    . ASN C 3 61 ? -81.848  23.267  -21.063 1.00 3.17 ? 70  ASN A ND2    1  
ATOM 2030  H H      . ASN C 3 61 ? -83.725  19.322  -21.269 1.00 1.66 ? 70  ASN A H      1  
ATOM 2031  H HA     . ASN C 3 61 ? -82.483  19.969  -23.133 1.00 1.96 ? 70  ASN A HA     1  
ATOM 2032  H HB2    . ASN C 3 61 ? -80.637  20.960  -20.945 1.00 2.33 ? 70  ASN A HB2    1  
ATOM 2033  H HB3    . ASN C 3 61 ? -80.377  21.275  -22.659 1.00 2.23 ? 70  ASN A HB3    1  
ATOM 2034  H HD21   . ASN C 3 61 ? -81.031  23.281  -20.523 1.00 3.12 ? 70  ASN A HD21   1  
ATOM 2035  H HD22   . ASN C 3 61 ? -82.482  24.015  -21.010 1.00 3.80 ? 70  ASN A HD22   1  
ATOM 2036  N N      . LYS C 3 62 ? -81.317  17.536  -22.983 1.00 1.48 ? 71  LYS A N      1  
ATOM 2037  C CA     . LYS C 3 62 ? -80.385  16.431  -23.369 1.00 1.47 ? 71  LYS A CA     1  
ATOM 2038  C C      . LYS C 3 62 ? -80.896  15.835  -24.699 1.00 1.58 ? 71  LYS A C      1  
ATOM 2039  O O      . LYS C 3 62 ? -82.097  15.786  -24.902 1.00 1.78 ? 71  LYS A O      1  
ATOM 2040  C CB     . LYS C 3 62 ? -80.415  15.343  -22.288 1.00 1.51 ? 71  LYS A CB     1  
ATOM 2041  C CG     . LYS C 3 62 ? -79.992  15.925  -20.930 1.00 1.55 ? 71  LYS A CG     1  
ATOM 2042  C CD     . LYS C 3 62 ? -78.464  16.014  -20.840 1.00 1.66 ? 71  LYS A CD     1  
ATOM 2043  C CE     . LYS C 3 62 ? -78.064  16.475  -19.430 1.00 1.66 ? 71  LYS A CE     1  
ATOM 2044  N NZ     . LYS C 3 62 ? -78.679  17.807  -19.151 1.00 2.35 ? 71  LYS A NZ     1  
ATOM 2045  H H      . LYS C 3 62 ? -82.284  17.388  -23.022 1.00 1.50 ? 71  LYS A H      1  
ATOM 2046  H HA     . LYS C 3 62 ? -79.386  16.815  -23.480 1.00 1.55 ? 71  LYS A HA     1  
ATOM 2047  H HB2    . LYS C 3 62 ? -81.418  14.950  -22.211 1.00 1.66 ? 71  LYS A HB2    1  
ATOM 2048  H HB3    . LYS C 3 62 ? -79.741  14.545  -22.562 1.00 1.69 ? 71  LYS A HB3    1  
ATOM 2049  H HG2    . LYS C 3 62 ? -80.417  16.909  -20.808 1.00 1.80 ? 71  LYS A HG2    1  
ATOM 2050  H HG3    . LYS C 3 62 ? -80.353  15.287  -20.142 1.00 1.99 ? 71  LYS A HG3    1  
ATOM 2051  H HD2    . LYS C 3 62 ? -78.035  15.042  -21.037 1.00 2.22 ? 71  LYS A HD2    1  
ATOM 2052  H HD3    . LYS C 3 62 ? -78.096  16.723  -21.563 1.00 1.96 ? 71  LYS A HD3    1  
ATOM 2053  H HE2    . LYS C 3 62 ? -78.411  15.755  -18.702 1.00 1.96 ? 71  LYS A HE2    1  
ATOM 2054  H HE3    . LYS C 3 62 ? -76.985  16.557  -19.367 1.00 1.85 ? 71  LYS A HE3    1  
ATOM 2055  H HZ1    . LYS C 3 62 ? -79.110  18.177  -20.022 1.00 2.60 ? 71  LYS A HZ1    1  
ATOM 2056  H HZ2    . LYS C 3 62 ? -79.409  17.707  -18.415 1.00 2.82 ? 71  LYS A HZ2    1  
ATOM 2057  H HZ3    . LYS C 3 62 ? -77.947  18.468  -18.821 1.00 2.86 ? 71  LYS A HZ3    1  
ATOM 2058  N N      . PRO C 3 63 ? -80.008  15.387  -25.575 1.00 1.85 ? 72  PRO A N      1  
ATOM 2059  C CA     . PRO C 3 63 ? -80.431  14.793  -26.862 1.00 2.09 ? 72  PRO A CA     1  
ATOM 2060  C C      . PRO C 3 63 ? -81.317  13.557  -26.610 1.00 1.70 ? 72  PRO A C      1  
ATOM 2061  O O      . PRO C 3 63 ? -82.489  13.536  -26.933 1.00 2.05 ? 72  PRO A O      1  
ATOM 2062  C CB     . PRO C 3 63 ? -79.111  14.387  -27.566 1.00 2.68 ? 72  PRO A CB     1  
ATOM 2063  C CG     . PRO C 3 63 ? -77.943  14.718  -26.593 1.00 2.96 ? 72  PRO A CG     1  
ATOM 2064  C CD     . PRO C 3 63 ? -78.546  15.441  -25.375 1.00 2.30 ? 72  PRO A CD     1  
ATOM 2065  H HA     . PRO C 3 63 ? -80.958  15.523  -27.457 1.00 2.46 ? 72  PRO A HA     1  
ATOM 2066  H HB2    . PRO C 3 63 ? -79.112  13.324  -27.790 1.00 2.64 ? 72  PRO A HB2    1  
ATOM 2067  H HB3    . PRO C 3 63 ? -78.989  14.947  -28.481 1.00 3.17 ? 72  PRO A HB3    1  
ATOM 2068  H HG2    . PRO C 3 63 ? -77.456  13.803  -26.276 1.00 3.22 ? 72  PRO A HG2    1  
ATOM 2069  H HG3    . PRO C 3 63 ? -77.224  15.363  -27.080 1.00 3.55 ? 72  PRO A HG3    1  
ATOM 2070  H HD2    . PRO C 3 63 ? -78.273  14.937  -24.456 1.00 2.26 ? 72  PRO A HD2    1  
ATOM 2071  H HD3    . PRO C 3 63 ? -78.215  16.469  -25.354 1.00 2.48 ? 72  PRO A HD3    1  
ATOM 2072  N N      . LYS C 3 64 ? -80.743  12.533  -26.026 1.00 1.44 ? 73  LYS A N      1  
ATOM 2073  C CA     . LYS C 3 64 ? -81.506  11.280  -25.723 1.00 1.53 ? 73  LYS A CA     1  
ATOM 2074  C C      . LYS C 3 64 ? -81.212  10.875  -24.277 1.00 1.33 ? 73  LYS A C      1  
ATOM 2075  O O      . LYS C 3 64 ? -80.072  10.850  -23.861 1.00 1.66 ? 73  LYS A O      1  
ATOM 2076  C CB     . LYS C 3 64 ? -81.047  10.161  -26.664 1.00 2.19 ? 73  LYS A CB     1  
ATOM 2077  C CG     . LYS C 3 64 ? -81.865  8.897   -26.394 1.00 2.95 ? 73  LYS A CG     1  
ATOM 2078  C CD     . LYS C 3 64 ? -81.443  7.802   -27.375 1.00 3.72 ? 73  LYS A CD     1  
ATOM 2079  C CE     . LYS C 3 64 ? -82.297  6.552   -27.150 1.00 4.37 ? 73  LYS A CE     1  
ATOM 2080  N NZ     . LYS C 3 64 ? -83.664  6.781   -27.690 1.00 5.24 ? 73  LYS A NZ     1  
ATOM 2081  H H      . LYS C 3 64 ? -79.798  12.596  -25.779 1.00 1.60 ? 73  LYS A H      1  
ATOM 2082  H HA     . LYS C 3 64 ? -82.569  11.450  -25.846 1.00 1.77 ? 73  LYS A HA     1  
ATOM 2083  H HB2    . LYS C 3 64 ? -81.194  10.467  -27.691 1.00 2.47 ? 73  LYS A HB2    1  
ATOM 2084  H HB3    . LYS C 3 64 ? -80.001  9.953   -26.496 1.00 2.56 ? 73  LYS A HB3    1  
ATOM 2085  H HG2    . LYS C 3 64 ? -81.689  8.562   -25.381 1.00 3.22 ? 73  LYS A HG2    1  
ATOM 2086  H HG3    . LYS C 3 64 ? -82.913  9.111   -26.526 1.00 3.26 ? 73  LYS A HG3    1  
ATOM 2087  H HD2    . LYS C 3 64 ? -81.579  8.154   -28.388 1.00 4.03 ? 73  LYS A HD2    1  
ATOM 2088  H HD3    . LYS C 3 64 ? -80.403  7.555   -27.219 1.00 3.96 ? 73  LYS A HD3    1  
ATOM 2089  H HE2    . LYS C 3 64 ? -81.847  5.710   -27.656 1.00 4.55 ? 73  LYS A HE2    1  
ATOM 2090  H HE3    . LYS C 3 64 ? -82.360  6.345   -26.093 1.00 4.50 ? 73  LYS A HE3    1  
ATOM 2091  H HZ1    . LYS C 3 64 ? -83.608  7.411   -28.518 1.00 5.57 ? 73  LYS A HZ1    1  
ATOM 2092  H HZ2    . LYS C 3 64 ? -84.081  5.872   -27.973 1.00 5.62 ? 73  LYS A HZ2    1  
ATOM 2093  H HZ3    . LYS C 3 64 ? -84.254  7.219   -26.958 1.00 5.48 ? 73  LYS A HZ3    1  
ATOM 2094  N N      . MET C 3 65 ? -82.230  10.565  -23.506 1.00 1.17 ? 74  MET A N      1  
ATOM 2095  C CA     . MET C 3 65 ? -82.007  10.167  -22.076 1.00 1.15 ? 74  MET A CA     1  
ATOM 2096  C C      . MET C 3 65 ? -82.426  8.716   -21.871 1.00 0.99 ? 74  MET A C      1  
ATOM 2097  O O      . MET C 3 65 ? -83.514  8.308   -22.217 1.00 1.00 ? 74  MET A O      1  
ATOM 2098  C CB     . MET C 3 65 ? -82.836  11.070  -21.161 1.00 1.47 ? 74  MET A CB     1  
ATOM 2099  C CG     . MET C 3 65 ? -82.528  10.758  -19.691 1.00 2.01 ? 74  MET A CG     1  
ATOM 2100  S SD     . MET C 3 65 ? -80.805  11.172  -19.320 1.00 2.41 ? 74  MET A SD     1  
ATOM 2101  C CE     . MET C 3 65 ? -81.068  12.918  -18.924 1.00 2.27 ? 74  MET A CE     1  
ATOM 2102  H H      . MET C 3 65 ? -83.140  10.598  -23.865 1.00 1.36 ? 74  MET A H      1  
ATOM 2103  H HA     . MET C 3 65 ? -80.961  10.264  -21.821 1.00 1.29 ? 74  MET A HA     1  
ATOM 2104  H HB2    . MET C 3 65 ? -82.592  12.098  -21.370 1.00 1.42 ? 74  MET A HB2    1  
ATOM 2105  H HB3    . MET C 3 65 ? -83.886  10.905  -21.349 1.00 1.94 ? 74  MET A HB3    1  
ATOM 2106  H HG2    . MET C 3 65 ? -83.176  11.344  -19.059 1.00 2.66 ? 74  MET A HG2    1  
ATOM 2107  H HG3    . MET C 3 65 ? -82.693  9.709   -19.498 1.00 2.34 ? 74  MET A HG3    1  
ATOM 2108  H HE1    . MET C 3 65 ? -81.596  13.397  -19.735 1.00 2.52 ? 74  MET A HE1    1  
ATOM 2109  H HE2    . MET C 3 65 ? -81.646  13.000  -18.013 1.00 2.60 ? 74  MET A HE2    1  
ATOM 2110  H HE3    . MET C 3 65 ? -80.114  13.396  -18.790 1.00 2.59 ? 74  MET A HE3    1  
ATOM 2111  N N      . ASN C 3 66 ? -81.557  7.942   -21.299 1.00 0.97 ? 75  ASN A N      1  
ATOM 2112  C CA     . ASN C 3 66 ? -81.874  6.516   -21.052 1.00 0.94 ? 75  ASN A CA     1  
ATOM 2113  C C      . ASN C 3 66 ? -82.983  6.405   -20.004 1.00 0.89 ? 75  ASN A C      1  
ATOM 2114  O O      . ASN C 3 66 ? -83.045  7.163   -19.053 1.00 0.90 ? 75  ASN A O      1  
ATOM 2115  C CB     . ASN C 3 66 ? -80.622  5.811   -20.539 1.00 1.07 ? 75  ASN A CB     1  
ATOM 2116  C CG     . ASN C 3 66 ? -80.126  6.534   -19.289 1.00 1.11 ? 75  ASN A CG     1  
ATOM 2117  O OD1    . ASN C 3 66 ? -80.156  5.989   -18.206 1.00 1.08 ? 75  ASN A OD1    1  
ATOM 2118  N ND2    . ASN C 3 66 ? -79.674  7.750   -19.392 1.00 1.48 ? 75  ASN A ND2    1  
ATOM 2119  H H      . ASN C 3 66 ? -80.687  8.307   -21.027 1.00 1.05 ? 75  ASN A H      1  
ATOM 2120  H HA     . ASN C 3 66 ? -82.198  6.051   -21.969 1.00 0.97 ? 75  ASN A HA     1  
ATOM 2121  H HB2    . ASN C 3 66 ? -80.861  4.786   -20.293 1.00 1.25 ? 75  ASN A HB2    1  
ATOM 2122  H HB3    . ASN C 3 66 ? -79.854  5.832   -21.297 1.00 1.21 ? 75  ASN A HB3    1  
ATOM 2123  H HD21   . ASN C 3 66 ? -79.652  8.192   -20.267 1.00 1.68 ? 75  ASN A HD21   1  
ATOM 2124  H HD22   . ASN C 3 66 ? -79.358  8.222   -18.595 1.00 1.66 ? 75  ASN A HD22   1  
ATOM 2125  N N      . TYR C 3 67 ? -83.854  5.449   -20.171 1.00 0.88 ? 76  TYR A N      1  
ATOM 2126  C CA     . TYR C 3 67 ? -84.962  5.253   -19.198 1.00 0.87 ? 76  TYR A CA     1  
ATOM 2127  C C      . TYR C 3 67 ? -84.370  4.810   -17.857 1.00 0.84 ? 76  TYR A C      1  
ATOM 2128  O O      . TYR C 3 67 ? -84.971  4.989   -16.820 1.00 0.83 ? 76  TYR A O      1  
ATOM 2129  C CB     . TYR C 3 67 ? -85.923  4.166   -19.706 1.00 0.95 ? 76  TYR A CB     1  
ATOM 2130  C CG     . TYR C 3 67 ? -87.128  4.082   -18.790 1.00 0.71 ? 76  TYR A CG     1  
ATOM 2131  C CD1    . TYR C 3 67 ? -88.080  5.112   -18.800 1.00 0.71 ? 76  TYR A CD1    1  
ATOM 2132  C CD2    . TYR C 3 67 ? -87.303  2.983   -17.932 1.00 0.79 ? 76  TYR A CD2    1  
ATOM 2133  C CE1    . TYR C 3 67 ? -89.199  5.044   -17.960 1.00 0.75 ? 76  TYR A CE1    1  
ATOM 2134  C CE2    . TYR C 3 67 ? -88.421  2.918   -17.093 1.00 0.85 ? 76  TYR A CE2    1  
ATOM 2135  C CZ     . TYR C 3 67 ? -89.367  3.950   -17.107 1.00 0.80 ? 76  TYR A CZ     1  
ATOM 2136  O OH     . TYR C 3 67 ? -90.467  3.882   -16.282 1.00 1.07 ? 76  TYR A OH     1  
ATOM 2137  H H      . TYR C 3 67 ? -83.774  4.850   -20.931 1.00 0.91 ? 76  TYR A H      1  
ATOM 2138  H HA     . TYR C 3 67 ? -85.500  6.182   -19.073 1.00 0.87 ? 76  TYR A HA     1  
ATOM 2139  H HB2    . TYR C 3 67 ? -86.251  4.407   -20.709 1.00 1.15 ? 76  TYR A HB2    1  
ATOM 2140  H HB3    . TYR C 3 67 ? -85.414  3.213   -19.714 1.00 1.13 ? 76  TYR A HB3    1  
ATOM 2141  H HD1    . TYR C 3 67 ? -87.948  5.958   -19.456 1.00 0.92 ? 76  TYR A HD1    1  
ATOM 2142  H HD2    . TYR C 3 67 ? -86.578  2.182   -17.918 1.00 1.01 ? 76  TYR A HD2    1  
ATOM 2143  H HE1    . TYR C 3 67 ? -89.933  5.843   -17.968 1.00 0.95 ? 76  TYR A HE1    1  
ATOM 2144  H HE2    . TYR C 3 67 ? -88.551  2.074   -16.432 1.00 1.10 ? 76  TYR A HE2    1  
ATOM 2145  H HH     . TYR C 3 67 ? -90.681  2.956   -16.149 1.00 1.51 ? 76  TYR A HH     1  
ATOM 2146  N N      . GLU C 3 68 ? -83.193  4.228   -17.873 1.00 0.85 ? 77  GLU A N      1  
ATOM 2147  C CA     . GLU C 3 68 ? -82.578  3.772   -16.603 1.00 0.86 ? 77  GLU A CA     1  
ATOM 2148  C C      . GLU C 3 68 ? -82.437  4.994   -15.706 1.00 0.84 ? 77  GLU A C      1  
ATOM 2149  O O      . GLU C 3 68 ? -82.491  4.909   -14.491 1.00 0.83 ? 77  GLU A O      1  
ATOM 2150  C CB     . GLU C 3 68 ? -81.203  3.154   -16.879 1.00 0.92 ? 77  GLU A CB     1  
ATOM 2151  C CG     . GLU C 3 68 ? -81.325  2.055   -17.944 1.00 1.49 ? 77  GLU A CG     1  
ATOM 2152  C CD     . GLU C 3 68 ? -82.312  0.983   -17.482 1.00 1.97 ? 77  GLU A CD     1  
ATOM 2153  O OE1    . GLU C 3 68 ? -82.275  0.632   -16.314 1.00 2.43 ? 77  GLU A OE1    1  
ATOM 2154  O OE2    . GLU C 3 68 ? -83.089  0.533   -18.306 1.00 2.53 ? 77  GLU A OE2    1  
ATOM 2155  H H      . GLU C 3 68 ? -82.721  4.091   -18.721 1.00 0.88 ? 77  GLU A H      1  
ATOM 2156  H HA     . GLU C 3 68 ? -83.221  3.046   -16.133 1.00 0.88 ? 77  GLU A HA     1  
ATOM 2157  H HB2    . GLU C 3 68 ? -80.526  3.917   -17.224 1.00 1.21 ? 77  GLU A HB2    1  
ATOM 2158  H HB3    . GLU C 3 68 ? -80.820  2.721   -15.967 1.00 1.32 ? 77  GLU A HB3    1  
ATOM 2159  H HG2    . GLU C 3 68 ? -81.676  2.487   -18.870 1.00 2.02 ? 77  GLU A HG2    1  
ATOM 2160  H HG3    . GLU C 3 68 ? -80.358  1.602   -18.104 1.00 1.92 ? 77  GLU A HG3    1  
ATOM 2161  N N      . LYS C 3 69 ? -82.301  6.145   -16.304 1.00 0.86 ? 78  LYS A N      1  
ATOM 2162  C CA     . LYS C 3 69 ? -82.205  7.395   -15.511 1.00 0.90 ? 78  LYS A CA     1  
ATOM 2163  C C      . LYS C 3 69 ? -83.444  7.490   -14.635 1.00 0.86 ? 78  LYS A C      1  
ATOM 2164  O O      . LYS C 3 69 ? -83.374  7.888   -13.490 1.00 0.90 ? 78  LYS A O      1  
ATOM 2165  C CB     . LYS C 3 69 ? -82.163  8.590   -16.471 1.00 0.96 ? 78  LYS A CB     1  
ATOM 2166  C CG     . LYS C 3 69 ? -82.028  9.926   -15.691 1.00 1.82 ? 78  LYS A CG     1  
ATOM 2167  C CD     . LYS C 3 69 ? -83.414  10.567  -15.460 1.00 2.38 ? 78  LYS A CD     1  
ATOM 2168  C CE     . LYS C 3 69 ? -83.258  11.969  -14.858 1.00 3.44 ? 78  LYS A CE     1  
ATOM 2169  N NZ     . LYS C 3 69 ? -84.542  12.381  -14.204 1.00 4.23 ? 78  LYS A NZ     1  
ATOM 2170  H H      . LYS C 3 69 ? -82.290  6.188   -17.281 1.00 0.89 ? 78  LYS A H      1  
ATOM 2171  H HA     . LYS C 3 69 ? -81.317  7.382   -14.895 1.00 0.95 ? 78  LYS A HA     1  
ATOM 2172  H HB2    . LYS C 3 69 ? -81.315  8.471   -17.134 1.00 1.32 ? 78  LYS A HB2    1  
ATOM 2173  H HB3    . LYS C 3 69 ? -83.067  8.596   -17.058 1.00 1.28 ? 78  LYS A HB3    1  
ATOM 2174  H HG2    . LYS C 3 69 ? -81.556  9.743   -14.736 1.00 2.37 ? 78  LYS A HG2    1  
ATOM 2175  H HG3    . LYS C 3 69 ? -81.415  10.608  -16.263 1.00 2.41 ? 78  LYS A HG3    1  
ATOM 2176  H HD2    . LYS C 3 69 ? -83.938  10.644  -16.401 1.00 2.64 ? 78  LYS A HD2    1  
ATOM 2177  H HD3    . LYS C 3 69 ? -83.987  9.960   -14.783 1.00 2.58 ? 78  LYS A HD3    1  
ATOM 2178  H HE2    . LYS C 3 69 ? -82.463  11.964  -14.127 1.00 3.82 ? 78  LYS A HE2    1  
ATOM 2179  H HE3    . LYS C 3 69 ? -83.020  12.668  -15.645 1.00 3.76 ? 78  LYS A HE3    1  
ATOM 2180  H HZ1    . LYS C 3 69 ? -85.070  11.535  -13.906 1.00 4.61 ? 78  LYS A HZ1    1  
ATOM 2181  H HZ2    . LYS C 3 69 ? -84.338  12.971  -13.372 1.00 4.55 ? 78  LYS A HZ2    1  
ATOM 2182  H HZ3    . LYS C 3 69 ? -85.117  12.927  -14.879 1.00 4.52 ? 78  LYS A HZ3    1  
ATOM 2183  N N      . LEU C 3 70 ? -84.585  7.126   -15.165 1.00 0.80 ? 79  LEU A N      1  
ATOM 2184  C CA     . LEU C 3 70 ? -85.824  7.198   -14.349 1.00 0.79 ? 79  LEU A CA     1  
ATOM 2185  C C      . LEU C 3 70 ? -85.706  6.177   -13.222 1.00 0.79 ? 79  LEU A C      1  
ATOM 2186  O O      . LEU C 3 70 ? -85.940  6.483   -12.073 1.00 0.86 ? 79  LEU A O      1  
ATOM 2187  C CB     . LEU C 3 70 ? -87.062  6.888   -15.231 1.00 0.77 ? 79  LEU A CB     1  
ATOM 2188  C CG     . LEU C 3 70 ? -87.732  8.192   -15.716 1.00 0.76 ? 79  LEU A CG     1  
ATOM 2189  C CD1    . LEU C 3 70 ? -88.469  8.884   -14.555 1.00 1.17 ? 79  LEU A CD1    1  
ATOM 2190  C CD2    . LEU C 3 70 ? -86.678  9.139   -16.320 1.00 1.13 ? 79  LEU A CD2    1  
ATOM 2191  H H      . LEU C 3 70 ? -84.619  6.807   -16.089 1.00 0.79 ? 79  LEU A H      1  
ATOM 2192  H HA     . LEU C 3 70 ? -85.910  8.178   -13.917 1.00 0.85 ? 79  LEU A HA     1  
ATOM 2193  H HB2    . LEU C 3 70 ? -86.746  6.314   -16.093 1.00 0.84 ? 79  LEU A HB2    1  
ATOM 2194  H HB3    . LEU C 3 70 ? -87.781  6.307   -14.669 1.00 0.81 ? 79  LEU A HB3    1  
ATOM 2195  H HG     . LEU C 3 70 ? -88.452  7.945   -16.480 1.00 1.08 ? 79  LEU A HG     1  
ATOM 2196  H HD11   . LEU C 3 70 ? -88.932  8.143   -13.920 1.00 1.72 ? 79  LEU A HD11   1  
ATOM 2197  H HD12   . LEU C 3 70 ? -87.774  9.474   -13.974 1.00 1.58 ? 79  LEU A HD12   1  
ATOM 2198  H HD13   . LEU C 3 70 ? -89.232  9.531   -14.959 1.00 1.65 ? 79  LEU A HD13   1  
ATOM 2199  H HD21   . LEU C 3 70 ? -85.882  8.564   -16.776 1.00 1.54 ? 79  LEU A HD21   1  
ATOM 2200  H HD22   . LEU C 3 70 ? -87.146  9.744   -17.079 1.00 1.55 ? 79  LEU A HD22   1  
ATOM 2201  H HD23   . LEU C 3 70 ? -86.268  9.779   -15.550 1.00 1.76 ? 79  LEU A HD23   1  
ATOM 2202  N N      . SER C 3 71 ? -85.316  4.976   -13.522 1.00 0.78 ? 80  SER A N      1  
ATOM 2203  C CA     . SER C 3 71 ? -85.179  3.990   -12.427 1.00 0.81 ? 80  SER A CA     1  
ATOM 2204  C C      . SER C 3 71 ? -84.146  4.511   -11.420 1.00 0.85 ? 80  SER A C      1  
ATOM 2205  O O      . SER C 3 71 ? -84.346  4.454   -10.227 1.00 1.01 ? 80  SER A O      1  
ATOM 2206  C CB     . SER C 3 71 ? -84.698  2.653   -12.997 1.00 0.88 ? 80  SER A CB     1  
ATOM 2207  O OG     . SER C 3 71 ? -85.710  2.097   -13.828 1.00 1.39 ? 80  SER A OG     1  
ATOM 2208  H H      . SER C 3 71 ? -85.107  4.731   -14.447 1.00 0.81 ? 80  SER A H      1  
ATOM 2209  H HA     . SER C 3 71 ? -86.131  3.854   -11.939 1.00 0.81 ? 80  SER A HA     1  
ATOM 2210  H HB2    . SER C 3 71 ? -83.811  2.811   -13.583 1.00 1.25 ? 80  SER A HB2    1  
ATOM 2211  H HB3    . SER C 3 71 ? -84.469  1.982   -12.181 1.00 1.13 ? 80  SER A HB3    1  
ATOM 2212  H HG     . SER C 3 71 ? -85.604  1.141   -13.828 1.00 1.86 ? 80  SER A HG     1  
ATOM 2213  N N      . ARG C 3 72 ? -83.044  5.026   -11.891 1.00 0.83 ? 81  ARG A N      1  
ATOM 2214  C CA     . ARG C 3 72 ? -81.998  5.547   -10.958 1.00 0.93 ? 81  ARG A CA     1  
ATOM 2215  C C      . ARG C 3 72 ? -82.483  6.805   -10.224 1.00 0.84 ? 81  ARG A C      1  
ATOM 2216  O O      . ARG C 3 72 ? -82.251  6.972   -9.044  1.00 0.87 ? 81  ARG A O      1  
ATOM 2217  C CB     . ARG C 3 72 ? -80.748  5.896   -11.770 1.00 1.06 ? 81  ARG A CB     1  
ATOM 2218  C CG     . ARG C 3 72 ? -79.613  6.340   -10.836 1.00 1.43 ? 81  ARG A CG     1  
ATOM 2219  C CD     . ARG C 3 72 ? -78.282  6.233   -11.581 1.00 2.09 ? 81  ARG A CD     1  
ATOM 2220  N NE     . ARG C 3 72 ? -78.286  7.191   -12.724 1.00 2.90 ? 81  ARG A NE     1  
ATOM 2221  C CZ     . ARG C 3 72 ? -77.179  7.428   -13.375 1.00 3.72 ? 81  ARG A CZ     1  
ATOM 2222  N NH1    . ARG C 3 72 ? -76.089  6.790   -13.045 1.00 3.91 ? 81  ARG A NH1    1  
ATOM 2223  N NH2    . ARG C 3 72 ? -77.158  8.294   -14.356 1.00 4.74 ? 81  ARG A NH2    1  
ATOM 2224  H H      . ARG C 3 72 ? -82.895  5.066   -12.861 1.00 0.83 ? 81  ARG A H      1  
ATOM 2225  H HA     . ARG C 3 72 ? -81.750  4.781   -10.239 1.00 1.02 ? 81  ARG A HA     1  
ATOM 2226  H HB2    . ARG C 3 72 ? -80.437  5.033   -12.338 1.00 1.28 ? 81  ARG A HB2    1  
ATOM 2227  H HB3    . ARG C 3 72 ? -80.980  6.706   -12.448 1.00 1.34 ? 81  ARG A HB3    1  
ATOM 2228  H HG2    . ARG C 3 72 ? -79.776  7.364   -10.530 1.00 1.77 ? 81  ARG A HG2    1  
ATOM 2229  H HG3    . ARG C 3 72 ? -79.588  5.704   -9.963  1.00 1.89 ? 81  ARG A HG3    1  
ATOM 2230  H HD2    . ARG C 3 72 ? -77.474  6.480   -10.918 1.00 2.52 ? 81  ARG A HD2    1  
ATOM 2231  H HD3    . ARG C 3 72 ? -78.150  5.226   -11.944 1.00 2.49 ? 81  ARG A HD3    1  
ATOM 2232  H HE     . ARG C 3 72 ? -79.115  7.654   -12.973 1.00 3.22 ? 81  ARG A HE     1  
ATOM 2233  H HH11   . ARG C 3 72 ? -76.109  6.125   -12.296 1.00 3.50 ? 81  ARG A HH11   1  
ATOM 2234  H HH12   . ARG C 3 72 ? -75.234  6.962   -13.539 1.00 4.74 ? 81  ARG A HH12   1  
ATOM 2235  H HH21   . ARG C 3 72 ? -77.991  8.785   -14.610 1.00 4.98 ? 81  ARG A HH21   1  
ATOM 2236  H HH22   . ARG C 3 72 ? -76.306  8.466   -14.855 1.00 5.47 ? 81  ARG A HH22   1  
ATOM 2237  N N      . GLY C 3 73 ? -83.120  7.704   -10.917 1.00 0.80 ? 82  GLY A N      1  
ATOM 2238  C CA     . GLY C 3 73 ? -83.577  8.966   -10.265 1.00 0.79 ? 82  GLY A CA     1  
ATOM 2239  C C      . GLY C 3 73 ? -84.960  8.789   -9.639  1.00 0.75 ? 82  GLY A C      1  
ATOM 2240  O O      . GLY C 3 73 ? -85.200  9.176   -8.513  1.00 0.80 ? 82  GLY A O      1  
ATOM 2241  H H      . GLY C 3 73 ? -83.277  7.562   -11.877 1.00 0.83 ? 82  GLY A H      1  
ATOM 2242  H HA2    . GLY C 3 73 ? -82.868  9.251   -9.499  1.00 0.85 ? 82  GLY A HA2    1  
ATOM 2243  H HA3    . GLY C 3 73 ? -83.624  9.745   -11.010 1.00 0.81 ? 82  GLY A HA3    1  
ATOM 2244  N N      . LEU C 3 74 ? -85.875  8.234   -10.373 1.00 0.73 ? 83  LEU A N      1  
ATOM 2245  C CA     . LEU C 3 74 ? -87.253  8.057   -9.843  1.00 0.76 ? 83  LEU A CA     1  
ATOM 2246  C C      . LEU C 3 74 ? -87.213  7.160   -8.592  1.00 0.78 ? 83  LEU A C      1  
ATOM 2247  O O      . LEU C 3 74 ? -87.809  7.462   -7.578  1.00 0.80 ? 83  LEU A O      1  
ATOM 2248  C CB     . LEU C 3 74 ? -88.121  7.424   -10.933 1.00 0.82 ? 83  LEU A CB     1  
ATOM 2249  C CG     . LEU C 3 74 ? -89.619  7.722   -10.711 1.00 0.85 ? 83  LEU A CG     1  
ATOM 2250  C CD1    . LEU C 3 74 ? -90.054  7.347   -9.289  1.00 1.57 ? 83  LEU A CD1    1  
ATOM 2251  C CD2    . LEU C 3 74 ? -89.935  9.211   -10.970 1.00 1.39 ? 83  LEU A CD2    1  
ATOM 2252  H H      . LEU C 3 74 ? -85.661  7.948   -11.285 1.00 0.75 ? 83  LEU A H      1  
ATOM 2253  H HA     . LEU C 3 74 ? -87.656  9.021   -9.585  1.00 0.78 ? 83  LEU A HA     1  
ATOM 2254  H HB2    . LEU C 3 74 ? -87.823  7.824   -11.890 1.00 0.94 ? 83  LEU A HB2    1  
ATOM 2255  H HB3    . LEU C 3 74 ? -87.972  6.356   -10.934 1.00 1.02 ? 83  LEU A HB3    1  
ATOM 2256  H HG     . LEU C 3 74 ? -90.187  7.128   -11.403 1.00 1.66 ? 83  LEU A HG     1  
ATOM 2257  H HD11   . LEU C 3 74 ? -89.603  6.414   -8.997  1.00 2.12 ? 83  LEU A HD11   1  
ATOM 2258  H HD12   . LEU C 3 74 ? -89.762  8.128   -8.606  1.00 2.03 ? 83  LEU A HD12   1  
ATOM 2259  H HD13   . LEU C 3 74 ? -91.125  7.243   -9.269  1.00 2.17 ? 83  LEU A HD13   1  
ATOM 2260  H HD21   . LEU C 3 74 ? -89.245  9.616   -11.694 1.00 1.97 ? 83  LEU A HD21   1  
ATOM 2261  H HD22   . LEU C 3 74 ? -90.941  9.295   -11.357 1.00 1.79 ? 83  LEU A HD22   1  
ATOM 2262  H HD23   . LEU C 3 74 ? -89.861  9.774   -10.048 1.00 2.04 ? 83  LEU A HD23   1  
ATOM 2263  N N      . ARG C 3 75 ? -86.520  6.059   -8.644  1.00 0.83 ? 84  ARG A N      1  
ATOM 2264  C CA     . ARG C 3 75 ? -86.473  5.175   -7.444  1.00 0.89 ? 84  ARG A CA     1  
ATOM 2265  C C      . ARG C 3 75 ? -86.016  6.015   -6.251  1.00 0.88 ? 84  ARG A C      1  
ATOM 2266  O O      . ARG C 3 75 ? -86.624  6.011   -5.201  1.00 0.97 ? 84  ARG A O      1  
ATOM 2267  C CB     . ARG C 3 75 ? -85.478  4.028   -7.698  1.00 1.03 ? 84  ARG A CB     1  
ATOM 2268  C CG     . ARG C 3 75 ? -85.512  3.001   -6.540  1.00 1.38 ? 84  ARG A CG     1  
ATOM 2269  C CD     . ARG C 3 75 ? -84.512  3.369   -5.429  1.00 1.27 ? 84  ARG A CD     1  
ATOM 2270  N NE     . ARG C 3 75 ? -83.185  3.700   -6.022  1.00 1.42 ? 84  ARG A NE     1  
ATOM 2271  C CZ     . ARG C 3 75 ? -82.270  4.318   -5.313  1.00 1.55 ? 84  ARG A CZ     1  
ATOM 2272  N NH1    . ARG C 3 75 ? -82.502  4.644   -4.071  1.00 1.74 ? 84  ARG A NH1    1  
ATOM 2273  N NH2    . ARG C 3 75 ? -81.117  4.604   -5.856  1.00 2.34 ? 84  ARG A NH2    1  
ATOM 2274  H H      . ARG C 3 75 ? -86.040  5.813   -9.460  1.00 0.86 ? 84  ARG A H      1  
ATOM 2275  H HA     . ARG C 3 75 ? -87.457  4.772   -7.249  1.00 0.91 ? 84  ARG A HA     1  
ATOM 2276  H HB2    . ARG C 3 75 ? -85.750  3.529   -8.618  1.00 1.12 ? 84  ARG A HB2    1  
ATOM 2277  H HB3    . ARG C 3 75 ? -84.486  4.436   -7.801  1.00 1.54 ? 84  ARG A HB3    1  
ATOM 2278  H HG2    . ARG C 3 75 ? -86.505  2.968   -6.118  1.00 2.07 ? 84  ARG A HG2    1  
ATOM 2279  H HG3    . ARG C 3 75 ? -85.263  2.023   -6.924  1.00 1.84 ? 84  ARG A HG3    1  
ATOM 2280  H HD2    . ARG C 3 75 ? -84.883  4.212   -4.868  1.00 1.63 ? 84  ARG A HD2    1  
ATOM 2281  H HD3    . ARG C 3 75 ? -84.402  2.526   -4.763  1.00 1.85 ? 84  ARG A HD3    1  
ATOM 2282  H HE     . ARG C 3 75 ? -82.996  3.460   -6.949  1.00 2.08 ? 84  ARG A HE     1  
ATOM 2283  H HH11   . ARG C 3 75 ? -83.379  4.418   -3.648  1.00 1.92 ? 84  ARG A HH11   1  
ATOM 2284  H HH12   . ARG C 3 75 ? -81.802  5.123   -3.544  1.00 2.25 ? 84  ARG A HH12   1  
ATOM 2285  H HH21   . ARG C 3 75 ? -80.939  4.351   -6.807  1.00 2.92 ? 84  ARG A HH21   1  
ATOM 2286  H HH22   . ARG C 3 75 ? -80.410  5.064   -5.318  1.00 2.64 ? 84  ARG A HH22   1  
ATOM 2287  N N      . TYR C 3 76 ? -84.960  6.751   -6.412  1.00 0.90 ? 85  TYR A N      1  
ATOM 2288  C CA     . TYR C 3 76 ? -84.463  7.606   -5.306  1.00 0.92 ? 85  TYR A CA     1  
ATOM 2289  C C      . TYR C 3 76 ? -85.522  8.660   -4.945  1.00 0.84 ? 85  TYR A C      1  
ATOM 2290  O O      . TYR C 3 76 ? -85.364  9.427   -4.016  1.00 0.88 ? 85  TYR A O      1  
ATOM 2291  C CB     . TYR C 3 76 ? -83.177  8.289   -5.772  1.00 1.04 ? 85  TYR A CB     1  
ATOM 2292  C CG     . TYR C 3 76 ? -82.599  9.093   -4.642  1.00 1.07 ? 85  TYR A CG     1  
ATOM 2293  C CD1    . TYR C 3 76 ? -81.784  8.472   -3.696  1.00 1.31 ? 85  TYR A CD1    1  
ATOM 2294  C CD2    . TYR C 3 76 ? -82.886  10.457  -4.536  1.00 1.01 ? 85  TYR A CD2    1  
ATOM 2295  C CE1    . TYR C 3 76 ? -81.253  9.216   -2.637  1.00 1.39 ? 85  TYR A CE1    1  
ATOM 2296  C CE2    . TYR C 3 76 ? -82.357  11.204  -3.478  1.00 1.09 ? 85  TYR A CE2    1  
ATOM 2297  C CZ     . TYR C 3 76 ? -81.544  10.585  -2.528  1.00 1.24 ? 85  TYR A CZ     1  
ATOM 2298  O OH     . TYR C 3 76 ? -81.019  11.319  -1.483  1.00 1.36 ? 85  TYR A OH     1  
ATOM 2299  H H      . TYR C 3 76 ? -84.488  6.751   -7.276  1.00 0.98 ? 85  TYR A H      1  
ATOM 2300  H HA     . TYR C 3 76 ? -84.251  6.994   -4.443  1.00 0.97 ? 85  TYR A HA     1  
ATOM 2301  H HB2    . TYR C 3 76 ? -82.465  7.538   -6.078  1.00 1.20 ? 85  TYR A HB2    1  
ATOM 2302  H HB3    . TYR C 3 76 ? -83.395  8.939   -6.608  1.00 1.03 ? 85  TYR A HB3    1  
ATOM 2303  H HD1    . TYR C 3 76 ? -81.562  7.419   -3.783  1.00 1.51 ? 85  TYR A HD1    1  
ATOM 2304  H HD2    . TYR C 3 76 ? -83.519  10.935  -5.271  1.00 1.04 ? 85  TYR A HD2    1  
ATOM 2305  H HE1    . TYR C 3 76 ? -80.619  8.734   -1.905  1.00 1.64 ? 85  TYR A HE1    1  
ATOM 2306  H HE2    . TYR C 3 76 ? -82.583  12.251  -3.393  1.00 1.16 ? 85  TYR A HE2    1  
ATOM 2307  H HH     . TYR C 3 76 ? -81.646  11.294  -0.757  1.00 1.43 ? 85  TYR A HH     1  
ATOM 2308  N N      . TYR C 3 77 ? -86.590  8.725   -5.694  1.00 0.79 ? 86  TYR A N      1  
ATOM 2309  C CA     . TYR C 3 77 ? -87.629  9.753   -5.414  1.00 0.79 ? 86  TYR A CA     1  
ATOM 2310  C C      . TYR C 3 77 ? -88.423  9.413   -4.149  1.00 0.84 ? 86  TYR A C      1  
ATOM 2311  O O      . TYR C 3 77 ? -89.337  10.125  -3.779  1.00 1.27 ? 86  TYR A O      1  
ATOM 2312  C CB     . TYR C 3 77 ? -88.579  9.856   -6.609  1.00 0.76 ? 86  TYR A CB     1  
ATOM 2313  C CG     . TYR C 3 77 ? -89.225  11.207  -6.612  1.00 0.77 ? 86  TYR A CG     1  
ATOM 2314  C CD1    . TYR C 3 77 ? -88.507  12.284  -7.112  1.00 0.82 ? 86  TYR A CD1    1  
ATOM 2315  C CD2    . TYR C 3 77 ? -90.509  11.390  -6.098  1.00 0.82 ? 86  TYR A CD2    1  
ATOM 2316  C CE1    . TYR C 3 77 ? -89.067  13.556  -7.110  1.00 0.87 ? 86  TYR A CE1    1  
ATOM 2317  C CE2    . TYR C 3 77 ? -91.082  12.669  -6.099  1.00 0.87 ? 86  TYR A CE2    1  
ATOM 2318  C CZ     . TYR C 3 77 ? -90.355  13.754  -6.603  1.00 0.89 ? 86  TYR A CZ     1  
ATOM 2319  O OH     . TYR C 3 77 ? -90.896  15.020  -6.597  1.00 0.98 ? 86  TYR A OH     1  
ATOM 2320  H H      . TYR C 3 77 ? -86.695  8.114   -6.455  1.00 0.79 ? 86  TYR A H      1  
ATOM 2321  H HA     . TYR C 3 77 ? -87.138  10.705  -5.269  1.00 0.85 ? 86  TYR A HA     1  
ATOM 2322  H HB2    . TYR C 3 77 ? -88.017  9.743   -7.513  1.00 0.78 ? 86  TYR A HB2    1  
ATOM 2323  H HB3    . TYR C 3 77 ? -89.338  9.089   -6.551  1.00 0.76 ? 86  TYR A HB3    1  
ATOM 2324  H HD1    . TYR C 3 77 ? -87.513  12.131  -7.510  1.00 0.85 ? 86  TYR A HD1    1  
ATOM 2325  H HD2    . TYR C 3 77 ? -91.062  10.543  -5.710  1.00 0.85 ? 86  TYR A HD2    1  
ATOM 2326  H HE1    . TYR C 3 77 ? -88.506  14.386  -7.503  1.00 0.95 ? 86  TYR A HE1    1  
ATOM 2327  H HE2    . TYR C 3 77 ? -92.075  12.821  -5.709  1.00 0.94 ? 86  TYR A HE2    1  
ATOM 2328  H HH     . TYR C 3 77 ? -91.131  15.239  -5.692  1.00 0.66 ? 86  TYR A HH     1  
ATOM 2329  N N      . TYR C 3 78 ? -88.080  8.360   -3.461  1.00 0.84 ? 87  TYR A N      1  
ATOM 2330  C CA     . TYR C 3 78 ? -88.821  8.040   -2.213  1.00 0.91 ? 87  TYR A CA     1  
ATOM 2331  C C      . TYR C 3 78 ? -88.441  9.097   -1.162  1.00 1.01 ? 87  TYR A C      1  
ATOM 2332  O O      . TYR C 3 78 ? -87.907  8.787   -0.116  1.00 1.20 ? 87  TYR A O      1  
ATOM 2333  C CB     . TYR C 3 78 ? -88.432  6.631   -1.716  1.00 1.01 ? 87  TYR A CB     1  
ATOM 2334  C CG     . TYR C 3 78 ? -89.292  5.567   -2.379  1.00 0.90 ? 87  TYR A CG     1  
ATOM 2335  C CD1    . TYR C 3 78 ? -90.657  5.495   -2.086  1.00 1.48 ? 87  TYR A CD1    1  
ATOM 2336  C CD2    . TYR C 3 78 ? -88.723  4.647   -3.273  1.00 1.01 ? 87  TYR A CD2    1  
ATOM 2337  C CE1    . TYR C 3 78 ? -91.452  4.511   -2.683  1.00 1.65 ? 87  TYR A CE1    1  
ATOM 2338  C CE2    . TYR C 3 78 ? -89.519  3.660   -3.867  1.00 1.15 ? 87  TYR A CE2    1  
ATOM 2339  C CZ     . TYR C 3 78 ? -90.883  3.592   -3.570  1.00 1.28 ? 87  TYR A CZ     1  
ATOM 2340  O OH     . TYR C 3 78 ? -91.666  2.619   -4.148  1.00 1.62 ? 87  TYR A OH     1  
ATOM 2341  H H      . TYR C 3 78 ? -87.327  7.801   -3.753  1.00 1.12 ? 87  TYR A H      1  
ATOM 2342  H HA     . TYR C 3 78 ? -89.884  8.083   -2.403  1.00 0.93 ? 87  TYR A HA     1  
ATOM 2343  H HB2    . TYR C 3 78 ? -87.396  6.444   -1.954  1.00 1.13 ? 87  TYR A HB2    1  
ATOM 2344  H HB3    . TYR C 3 78 ? -88.568  6.574   -0.646  1.00 1.32 ? 87  TYR A HB3    1  
ATOM 2345  H HD1    . TYR C 3 78 ? -91.099  6.203   -1.403  1.00 2.02 ? 87  TYR A HD1    1  
ATOM 2346  H HD2    . TYR C 3 78 ? -87.668  4.696   -3.497  1.00 1.47 ? 87  TYR A HD2    1  
ATOM 2347  H HE1    . TYR C 3 78 ? -92.501  4.456   -2.455  1.00 2.28 ? 87  TYR A HE1    1  
ATOM 2348  H HE2    . TYR C 3 78 ? -89.080  2.953   -4.560  1.00 1.59 ? 87  TYR A HE2    1  
ATOM 2349  H HH     . TYR C 3 78 ? -91.631  1.840   -3.583  1.00 2.01 ? 87  TYR A HH     1  
ATOM 2350  N N      . ASP C 3 79 ? -88.694  10.351  -1.450  1.00 1.01 ? 88  ASP A N      1  
ATOM 2351  C CA     . ASP C 3 79 ? -88.325  11.431  -0.482  1.00 1.13 ? 88  ASP A CA     1  
ATOM 2352  C C      . ASP C 3 79 ? -89.369  11.543  0.614   1.00 1.03 ? 88  ASP A C      1  
ATOM 2353  O O      . ASP C 3 79 ? -89.049  11.606  1.784   1.00 1.14 ? 88  ASP A O      1  
ATOM 2354  C CB     . ASP C 3 79 ? -88.220  12.766  -1.222  1.00 1.30 ? 88  ASP A CB     1  
ATOM 2355  C CG     . ASP C 3 79 ? -87.067  12.707  -2.221  1.00 1.93 ? 88  ASP A CG     1  
ATOM 2356  O OD1    . ASP C 3 79 ? -85.958  12.412  -1.803  1.00 2.30 ? 88  ASP A OD1    1  
ATOM 2357  O OD2    . ASP C 3 79 ? -87.314  12.944  -3.389  1.00 2.74 ? 88  ASP A OD2    1  
ATOM 2358  H H      . ASP C 3 79 ? -89.111  10.584  -2.307  1.00 1.02 ? 88  ASP A H      1  
ATOM 2359  H HA     . ASP C 3 79 ? -87.386  11.198  -0.036  1.00 1.31 ? 88  ASP A HA     1  
ATOM 2360  H HB2    . ASP C 3 79 ? -89.142  12.956  -1.750  1.00 1.70 ? 88  ASP A HB2    1  
ATOM 2361  H HB3    . ASP C 3 79 ? -88.038  13.557  -0.513  1.00 1.42 ? 88  ASP A HB3    1  
ATOM 2362  N N      . LYS C 3 80 ? -90.615  11.577  0.244   1.00 0.99 ? 89  LYS A N      1  
ATOM 2363  C CA     . LYS C 3 80 ? -91.703  11.696  1.257   1.00 1.08 ? 89  LYS A CA     1  
ATOM 2364  C C      . LYS C 3 80 ? -92.711  10.563  1.065   1.00 1.10 ? 89  LYS A C      1  
ATOM 2365  O O      . LYS C 3 80 ? -92.566  9.480   1.596   1.00 1.59 ? 89  LYS A O      1  
ATOM 2366  C CB     . LYS C 3 80 ? -92.413  13.042  1.073   1.00 1.23 ? 89  LYS A CB     1  
ATOM 2367  C CG     . LYS C 3 80 ? -91.469  14.191  1.458   1.00 1.31 ? 89  LYS A CG     1  
ATOM 2368  C CD     . LYS C 3 80 ? -92.130  15.546  1.161   1.00 1.31 ? 89  LYS A CD     1  
ATOM 2369  C CE     . LYS C 3 80 ? -93.101  15.917  2.282   1.00 1.90 ? 89  LYS A CE     1  
ATOM 2370  N NZ     . LYS C 3 80 ? -93.758  17.217  1.960   1.00 2.52 ? 89  LYS A NZ     1  
ATOM 2371  H H      . LYS C 3 80 ? -90.838  11.537  -0.715  1.00 1.03 ? 89  LYS A H      1  
ATOM 2372  H HA     . LYS C 3 80 ? -91.300  11.638  2.258   1.00 1.16 ? 89  LYS A HA     1  
ATOM 2373  H HB2    . LYS C 3 80 ? -92.709  13.152  0.040   1.00 1.35 ? 89  LYS A HB2    1  
ATOM 2374  H HB3    . LYS C 3 80 ? -93.286  13.064  1.702   1.00 1.62 ? 89  LYS A HB3    1  
ATOM 2375  H HG2    . LYS C 3 80 ? -91.236  14.127  2.510   1.00 1.90 ? 89  LYS A HG2    1  
ATOM 2376  H HG3    . LYS C 3 80 ? -90.558  14.108  0.886   1.00 1.61 ? 89  LYS A HG3    1  
ATOM 2377  H HD2    . LYS C 3 80 ? -91.365  16.304  1.096   1.00 1.79 ? 89  LYS A HD2    1  
ATOM 2378  H HD3    . LYS C 3 80 ? -92.665  15.495  0.223   1.00 1.60 ? 89  LYS A HD3    1  
ATOM 2379  H HE2    . LYS C 3 80 ? -93.855  15.153  2.384   1.00 2.47 ? 89  LYS A HE2    1  
ATOM 2380  H HE3    . LYS C 3 80 ? -92.555  16.011  3.206   1.00 2.29 ? 89  LYS A HE3    1  
ATOM 2381  H HZ1    . LYS C 3 80 ? -93.043  17.896  1.632   1.00 3.00 ? 89  LYS A HZ1    1  
ATOM 2382  H HZ2    . LYS C 3 80 ? -94.467  17.072  1.211   1.00 2.97 ? 89  LYS A HZ2    1  
ATOM 2383  H HZ3    . LYS C 3 80 ? -94.222  17.591  2.810   1.00 2.78 ? 89  LYS A HZ3    1  
ATOM 2384  N N      . ASN C 3 81 ? -93.734  10.818  0.319   1.00 1.03 ? 90  ASN A N      1  
ATOM 2385  C CA     . ASN C 3 81 ? -94.777  9.782   0.087   1.00 1.02 ? 90  ASN A CA     1  
ATOM 2386  C C      . ASN C 3 81 ? -95.547  10.171  -1.155  1.00 1.01 ? 90  ASN A C      1  
ATOM 2387  O O      . ASN C 3 81 ? -96.486  10.944  -1.097  1.00 1.12 ? 90  ASN A O      1  
ATOM 2388  C CB     . ASN C 3 81 ? -95.722  9.735   1.295   1.00 1.15 ? 90  ASN A CB     1  
ATOM 2389  C CG     . ASN C 3 81 ? -96.632  8.498   1.203   1.00 1.97 ? 90  ASN A CG     1  
ATOM 2390  O OD1    . ASN C 3 81 ? -97.404  8.230   2.102   1.00 2.80 ? 90  ASN A OD1    1  
ATOM 2391  N ND2    . ASN C 3 81 ? -96.575  7.736   0.148   1.00 2.45 ? 90  ASN A ND2    1  
ATOM 2392  H H      . ASN C 3 81 ? -93.813  11.699  -0.097  1.00 1.34 ? 90  ASN A H      1  
ATOM 2393  H HA     . ASN C 3 81 ? -94.315  8.820   -0.060  1.00 0.99 ? 90  ASN A HA     1  
ATOM 2394  H HB2    . ASN C 3 81 ? -95.137  9.689   2.204   1.00 1.58 ? 90  ASN A HB2    1  
ATOM 2395  H HB3    . ASN C 3 81 ? -96.329  10.628  1.305   1.00 1.40 ? 90  ASN A HB3    1  
ATOM 2396  H HD21   . ASN C 3 81 ? -95.955  7.950   -0.582  1.00 2.39 ? 90  ASN A HD21   1  
ATOM 2397  H HD22   . ASN C 3 81 ? -97.155  6.950   0.081   1.00 3.23 ? 90  ASN A HD22   1  
ATOM 2398  N N      . ILE C 3 82 ? -95.145  9.675   -2.288  1.00 0.95 ? 91  ILE A N      1  
ATOM 2399  C CA     . ILE C 3 82 ? -95.839  10.047  -3.550  1.00 1.00 ? 91  ILE A CA     1  
ATOM 2400  C C      . ILE C 3 82 ? -95.876  8.864   -4.525  1.00 0.94 ? 91  ILE A C      1  
ATOM 2401  O O      . ILE C 3 82 ? -96.797  8.076   -4.493  1.00 1.01 ? 91  ILE A O      1  
ATOM 2402  C CB     . ILE C 3 82 ? -95.119  11.272  -4.142  1.00 1.10 ? 91  ILE A CB     1  
ATOM 2403  C CG1    . ILE C 3 82 ? -95.655  11.603  -5.539  1.00 1.28 ? 91  ILE A CG1    1  
ATOM 2404  C CG2    . ILE C 3 82 ? -93.584  11.044  -4.212  1.00 1.09 ? 91  ILE A CG2    1  
ATOM 2405  C CD1    . ILE C 3 82 ? -97.181  11.569  -5.544  1.00 0.84 ? 91  ILE A CD1    1  
ATOM 2406  H H      . ILE C 3 82 ? -94.371  9.077   -2.312  1.00 0.92 ? 91  ILE A H      1  
ATOM 2407  H HA     . ILE C 3 82 ? -96.857  10.320  -3.318  1.00 1.08 ? 91  ILE A HA     1  
ATOM 2408  H HB     . ILE C 3 82 ? -95.310  12.115  -3.491  1.00 1.17 ? 91  ILE A HB     1  
ATOM 2409  H HG12   . ILE C 3 82 ? -95.321  12.593  -5.810  1.00 1.93 ? 91  ILE A HG12   1  
ATOM 2410  H HG13   . ILE C 3 82 ? -95.273  10.891  -6.253  1.00 1.75 ? 91  ILE A HG13   1  
ATOM 2411  H HG21   . ILE C 3 82 ? -93.298  10.186  -3.623  1.00 1.46 ? 91  ILE A HG21   1  
ATOM 2412  H HG22   . ILE C 3 82 ? -93.284  10.886  -5.233  1.00 1.56 ? 91  ILE A HG22   1  
ATOM 2413  H HG23   . ILE C 3 82 ? -93.075  11.918  -3.826  1.00 1.46 ? 91  ILE A HG23   1  
ATOM 2414  H HD11   . ILE C 3 82 ? -97.552  12.056  -4.653  1.00 1.12 ? 91  ILE A HD11   1  
ATOM 2415  H HD12   . ILE C 3 82 ? -97.542  12.083  -6.416  1.00 1.34 ? 91  ILE A HD12   1  
ATOM 2416  H HD13   . ILE C 3 82 ? -97.519  10.544  -5.564  1.00 1.53 ? 91  ILE A HD13   1  
ATOM 2417  N N      . ILE C 3 83 ? -94.912  8.723   -5.404  1.00 0.89 ? 92  ILE A N      1  
ATOM 2418  C CA     . ILE C 3 83 ? -94.955  7.578   -6.366  1.00 0.84 ? 92  ILE A CA     1  
ATOM 2419  C C      . ILE C 3 83 ? -94.158  6.399   -5.818  1.00 0.81 ? 92  ILE A C      1  
ATOM 2420  O O      . ILE C 3 83 ? -92.974  6.486   -5.565  1.00 0.84 ? 92  ILE A O      1  
ATOM 2421  C CB     . ILE C 3 83 ? -94.394  7.994   -7.737  1.00 0.86 ? 92  ILE A CB     1  
ATOM 2422  C CG1    . ILE C 3 83 ? -94.387  6.768   -8.676  1.00 1.02 ? 92  ILE A CG1    1  
ATOM 2423  C CG2    . ILE C 3 83 ? -92.981  8.546   -7.596  1.00 0.85 ? 92  ILE A CG2    1  
ATOM 2424  C CD1    . ILE C 3 83 ? -93.989  7.166   -10.110 1.00 1.09 ? 92  ILE A CD1    1  
ATOM 2425  H H      . ILE C 3 83 ? -94.177  9.367   -5.437  1.00 0.95 ? 92  ILE A H      1  
ATOM 2426  H HA     . ILE C 3 83 ? -95.978  7.266   -6.499  1.00 0.83 ? 92  ILE A HA     1  
ATOM 2427  H HB     . ILE C 3 83 ? -95.030  8.757   -8.159  1.00 1.07 ? 92  ILE A HB     1  
ATOM 2428  H HG12   . ILE C 3 83 ? -93.679  6.037   -8.306  1.00 1.14 ? 92  ILE A HG12   1  
ATOM 2429  H HG13   . ILE C 3 83 ? -95.372  6.331   -8.691  1.00 1.34 ? 92  ILE A HG13   1  
ATOM 2430  H HG21   . ILE C 3 83 ? -92.950  9.257   -6.790  1.00 1.35 ? 92  ILE A HG21   1  
ATOM 2431  H HG22   . ILE C 3 83 ? -92.302  7.738   -7.389  1.00 1.32 ? 92  ILE A HG22   1  
ATOM 2432  H HG23   . ILE C 3 83 ? -92.692  9.034   -8.516  1.00 1.29 ? 92  ILE A HG23   1  
ATOM 2433  H HD11   . ILE C 3 83 ? -93.832  8.234   -10.180 1.00 1.67 ? 92  ILE A HD11   1  
ATOM 2434  H HD12   . ILE C 3 83 ? -93.078  6.654   -10.381 1.00 1.45 ? 92  ILE A HD12   1  
ATOM 2435  H HD13   . ILE C 3 83 ? -94.775  6.877   -10.794 1.00 1.44 ? 92  ILE A HD13   1  
ATOM 2436  N N      . HIS C 3 84 ? -94.817  5.279   -5.640  1.00 0.83 ? 93  HIS A N      1  
ATOM 2437  C CA     . HIS C 3 84 ? -94.124  4.061   -5.123  1.00 0.85 ? 93  HIS A CA     1  
ATOM 2438  C C      . HIS C 3 84 ? -93.926  3.079   -6.292  1.00 0.85 ? 93  HIS A C      1  
ATOM 2439  O O      . HIS C 3 84 ? -94.701  3.046   -7.229  1.00 0.91 ? 93  HIS A O      1  
ATOM 2440  C CB     . HIS C 3 84 ? -94.977  3.369   -4.046  1.00 0.88 ? 93  HIS A CB     1  
ATOM 2441  C CG     . HIS C 3 84 ? -95.157  4.244   -2.831  1.00 1.01 ? 93  HIS A CG     1  
ATOM 2442  N ND1    . HIS C 3 84 ? -95.664  3.735   -1.644  1.00 1.59 ? 93  HIS A ND1    1  
ATOM 2443  C CD2    . HIS C 3 84 ? -94.920  5.578   -2.597  1.00 1.02 ? 93  HIS A CD2    1  
ATOM 2444  C CE1    . HIS C 3 84 ? -95.715  4.744   -0.758  1.00 1.79 ? 93  HIS A CE1    1  
ATOM 2445  N NE2    . HIS C 3 84 ? -95.271  5.893   -1.288  1.00 1.41 ? 93  HIS A NE2    1  
ATOM 2446  H H      . HIS C 3 84 ? -95.774  5.241   -5.853  1.00 0.89 ? 93  HIS A H      1  
ATOM 2447  H HA     . HIS C 3 84 ? -93.163  4.325   -4.708  1.00 0.88 ? 93  HIS A HA     1  
ATOM 2448  H HB2    . HIS C 3 84 ? -95.947  3.128   -4.452  1.00 0.97 ? 93  HIS A HB2    1  
ATOM 2449  H HB3    . HIS C 3 84 ? -94.482  2.459   -3.746  1.00 0.99 ? 93  HIS A HB3    1  
ATOM 2450  H HD1    . HIS C 3 84 ? -95.931  2.810   -1.482  1.00 1.93 ? 93  HIS A HD1    1  
ATOM 2451  H HD2    . HIS C 3 84 ? -94.522  6.276   -3.311  1.00 1.12 ? 93  HIS A HD2    1  
ATOM 2452  H HE1    . HIS C 3 84 ? -96.063  4.640   0.257   1.00 2.31 ? 93  HIS A HE1    1  
ATOM 2453  N N      . LYS C 3 85 ? -92.892  2.284   -6.253  1.00 0.92 ? 94  LYS A N      1  
ATOM 2454  C CA     . LYS C 3 85 ? -92.644  1.317   -7.364  1.00 0.96 ? 94  LYS A CA     1  
ATOM 2455  C C      . LYS C 3 85 ? -93.357  -0.007  -7.066  1.00 0.95 ? 94  LYS A C      1  
ATOM 2456  O O      . LYS C 3 85 ? -93.383  -0.460  -5.938  1.00 1.10 ? 94  LYS A O      1  
ATOM 2457  C CB     . LYS C 3 85 ? -91.144  1.077   -7.464  1.00 1.20 ? 94  LYS A CB     1  
ATOM 2458  C CG     . LYS C 3 85 ? -90.847  0.181   -8.657  1.00 1.61 ? 94  LYS A CG     1  
ATOM 2459  C CD     . LYS C 3 85 ? -89.346  0.222   -8.957  1.00 1.86 ? 94  LYS A CD     1  
ATOM 2460  C CE     . LYS C 3 85 ? -88.555  -0.373  -7.778  1.00 2.16 ? 94  LYS A CE     1  
ATOM 2461  N NZ     . LYS C 3 85 ? -88.431  0.640   -6.687  1.00 2.83 ? 94  LYS A NZ     1  
ATOM 2462  H H      . LYS C 3 85 ? -92.270  2.326   -5.496  1.00 1.03 ? 94  LYS A H      1  
ATOM 2463  H HA     . LYS C 3 85 ? -93.007  1.724   -8.296  1.00 0.96 ? 94  LYS A HA     1  
ATOM 2464  H HB2    . LYS C 3 85 ? -90.634  2.023   -7.584  1.00 1.72 ? 94  LYS A HB2    1  
ATOM 2465  H HB3    . LYS C 3 85 ? -90.800  0.595   -6.562  1.00 1.74 ? 94  LYS A HB3    1  
ATOM 2466  H HG2    . LYS C 3 85 ? -91.144  -0.832  -8.427  1.00 2.19 ? 94  LYS A HG2    1  
ATOM 2467  H HG3    . LYS C 3 85 ? -91.396  0.532   -9.518  1.00 2.14 ? 94  LYS A HG3    1  
ATOM 2468  H HD2    . LYS C 3 85 ? -89.145  -0.347  -9.853  1.00 2.20 ? 94  LYS A HD2    1  
ATOM 2469  H HD3    . LYS C 3 85 ? -89.040  1.248   -9.109  1.00 2.28 ? 94  LYS A HD3    1  
ATOM 2470  H HE2    . LYS C 3 85 ? -89.070  -1.244  -7.399  1.00 2.48 ? 94  LYS A HE2    1  
ATOM 2471  H HE3    . LYS C 3 85 ? -87.567  -0.659  -8.114  1.00 2.52 ? 94  LYS A HE3    1  
ATOM 2472  H HZ1    . LYS C 3 85 ? -88.720  1.572   -7.044  1.00 3.25 ? 94  LYS A HZ1    1  
ATOM 2473  H HZ2    . LYS C 3 85 ? -89.046  0.372   -5.893  1.00 3.11 ? 94  LYS A HZ2    1  
ATOM 2474  H HZ3    . LYS C 3 85 ? -87.442  0.684   -6.359  1.00 3.29 ? 94  LYS A HZ3    1  
ATOM 2475  N N      . THR C 3 86 ? -93.947  -0.631  -8.059  1.00 0.91 ? 95  THR A N      1  
ATOM 2476  C CA     . THR C 3 86 ? -94.667  -1.918  -7.808  1.00 1.04 ? 95  THR A CA     1  
ATOM 2477  C C      . THR C 3 86 ? -93.701  -3.103  -7.947  1.00 1.20 ? 95  THR A C      1  
ATOM 2478  O O      . THR C 3 86 ? -92.947  -3.197  -8.893  1.00 1.24 ? 95  THR A O      1  
ATOM 2479  C CB     . THR C 3 86 ? -95.809  -2.057  -8.813  1.00 1.05 ? 95  THR A CB     1  
ATOM 2480  O OG1    . THR C 3 86 ? -96.609  -0.891  -8.741  1.00 1.22 ? 95  THR A OG1    1  
ATOM 2481  C CG2    . THR C 3 86 ? -96.665  -3.271  -8.450  1.00 1.21 ? 95  THR A CG2    1  
ATOM 2482  H H      . THR C 3 86 ? -93.925  -0.248  -8.969  1.00 0.87 ? 95  THR A H      1  
ATOM 2483  H HA     . THR C 3 86 ? -95.079  -1.909  -6.808  1.00 1.18 ? 95  THR A HA     1  
ATOM 2484  H HB     . THR C 3 86 ? -95.415  -2.177  -9.809  1.00 1.06 ? 95  THR A HB     1  
ATOM 2485  H HG1    . THR C 3 86 ? -96.389  -0.440  -7.923  1.00 1.56 ? 95  THR A HG1    1  
ATOM 2486  H HG21   . THR C 3 86 ? -96.924  -3.225  -7.402  1.00 1.62 ? 95  THR A HG21   1  
ATOM 2487  H HG22   . THR C 3 86 ? -97.569  -3.267  -9.042  1.00 1.62 ? 95  THR A HG22   1  
ATOM 2488  H HG23   . THR C 3 86 ? -96.112  -4.177  -8.645  1.00 1.57 ? 95  THR A HG23   1  
ATOM 2489  N N      . ALA C 3 87 ? -93.718  -4.006  -7.000  1.00 1.58 ? 96  ALA A N      1  
ATOM 2490  C CA     . ALA C 3 87 ? -92.793  -5.177  -7.070  1.00 1.85 ? 96  ALA A CA     1  
ATOM 2491  C C      . ALA C 3 87 ? -93.330  -6.204  -8.070  1.00 1.77 ? 96  ALA A C      1  
ATOM 2492  O O      . ALA C 3 87 ? -92.961  -7.361  -8.043  1.00 2.10 ? 96  ALA A O      1  
ATOM 2493  C CB     . ALA C 3 87 ? -92.675  -5.820  -5.687  1.00 2.47 ? 96  ALA A CB     1  
ATOM 2494  H H      . ALA C 3 87 ? -94.329  -3.914  -6.242  1.00 1.82 ? 96  ALA A H      1  
ATOM 2495  H HA     . ALA C 3 87 ? -91.819  -4.842  -7.391  1.00 1.89 ? 96  ALA A HA     1  
ATOM 2496  H HB1    . ALA C 3 87 ? -92.507  -5.054  -4.945  1.00 2.87 ? 96  ALA A HB1    1  
ATOM 2497  H HB2    . ALA C 3 87 ? -93.587  -6.353  -5.455  1.00 2.72 ? 96  ALA A HB2    1  
ATOM 2498  H HB3    . ALA C 3 87 ? -91.844  -6.510  -5.684  1.00 2.84 ? 96  ALA A HB3    1  
ATOM 2499  N N      . GLY C 3 88 ? -94.193  -5.793  -8.952  1.00 1.65 ? 97  GLY A N      1  
ATOM 2500  C CA     . GLY C 3 88 ? -94.744  -6.749  -9.947  1.00 1.96 ? 97  GLY A CA     1  
ATOM 2501  C C      . GLY C 3 88 ? -93.703  -6.982  -11.038 1.00 1.94 ? 97  GLY A C      1  
ATOM 2502  O O      . GLY C 3 88 ? -92.848  -7.842  -10.920 1.00 2.32 ? 97  GLY A O      1  
ATOM 2503  H H      . GLY C 3 88 ? -94.476  -4.856  -8.962  1.00 1.59 ? 97  GLY A H      1  
ATOM 2504  H HA2    . GLY C 3 88 ? -94.976  -7.687  -9.459  1.00 2.24 ? 97  GLY A HA2    1  
ATOM 2505  H HA3    . GLY C 3 88 ? -95.634  -6.337  -10.388 1.00 2.17 ? 97  GLY A HA3    1  
ATOM 2506  N N      . LYS C 3 89 ? -93.759  -6.219  -12.097 1.00 1.64 ? 98  LYS A N      1  
ATOM 2507  C CA     . LYS C 3 89 ? -92.768  -6.383  -13.205 1.00 1.72 ? 98  LYS A CA     1  
ATOM 2508  C C      . LYS C 3 89 ? -91.743  -5.249  -13.122 1.00 1.44 ? 98  LYS A C      1  
ATOM 2509  O O      . LYS C 3 89 ? -91.745  -4.456  -12.200 1.00 1.85 ? 98  LYS A O      1  
ATOM 2510  C CB     . LYS C 3 89 ? -93.492  -6.317  -14.556 1.00 2.09 ? 98  LYS A CB     1  
ATOM 2511  C CG     . LYS C 3 89 ? -94.597  -7.382  -14.616 1.00 2.01 ? 98  LYS A CG     1  
ATOM 2512  C CD     . LYS C 3 89 ? -93.989  -8.775  -14.826 1.00 2.78 ? 98  LYS A CD     1  
ATOM 2513  C CE     . LYS C 3 89 ? -95.115  -9.768  -15.105 1.00 3.22 ? 98  LYS A CE     1  
ATOM 2514  N NZ     . LYS C 3 89 ? -95.741  -9.472  -16.417 1.00 3.60 ? 98  LYS A NZ     1  
ATOM 2515  H H      . LYS C 3 89 ? -94.451  -5.532  -12.164 1.00 1.50 ? 98  LYS A H      1  
ATOM 2516  H HA     . LYS C 3 89 ? -92.258  -7.329  -13.115 1.00 2.08 ? 98  LYS A HA     1  
ATOM 2517  H HB2    . LYS C 3 89 ? -93.935  -5.336  -14.677 1.00 2.74 ? 98  LYS A HB2    1  
ATOM 2518  H HB3    . LYS C 3 89 ? -92.785  -6.488  -15.352 1.00 2.38 ? 98  LYS A HB3    1  
ATOM 2519  H HG2    . LYS C 3 89 ? -95.152  -7.371  -13.690 1.00 2.19 ? 98  LYS A HG2    1  
ATOM 2520  H HG3    . LYS C 3 89 ? -95.262  -7.157  -15.435 1.00 2.14 ? 98  LYS A HG3    1  
ATOM 2521  H HD2    . LYS C 3 89 ? -93.308  -8.750  -15.664 1.00 3.13 ? 98  LYS A HD2    1  
ATOM 2522  H HD3    . LYS C 3 89 ? -93.461  -9.081  -13.938 1.00 3.29 ? 98  LYS A HD3    1  
ATOM 2523  H HE2    . LYS C 3 89 ? -94.718  -10.770 -15.115 1.00 3.55 ? 98  LYS A HE2    1  
ATOM 2524  H HE3    . LYS C 3 89 ? -95.861  -9.683  -14.329 1.00 3.59 ? 98  LYS A HE3    1  
ATOM 2525  H HZ1    . LYS C 3 89 ? -95.570  -8.478  -16.670 1.00 3.80 ? 98  LYS A HZ1    1  
ATOM 2526  H HZ2    . LYS C 3 89 ? -95.330  -10.090 -17.145 1.00 3.82 ? 98  LYS A HZ2    1  
ATOM 2527  H HZ3    . LYS C 3 89 ? -96.765  -9.644  -16.352 1.00 3.99 ? 98  LYS A HZ3    1  
ATOM 2528  N N      . ARG C 3 90 ? -90.856  -5.168  -14.062 1.00 1.21 ? 99  ARG A N      1  
ATOM 2529  C CA     . ARG C 3 90 ? -89.836  -4.084  -14.023 1.00 1.48 ? 99  ARG A CA     1  
ATOM 2530  C C      . ARG C 3 90 ? -90.413  -2.818  -14.669 1.00 1.11 ? 99  ARG A C      1  
ATOM 2531  O O      . ARG C 3 90 ? -89.855  -1.747  -14.563 1.00 1.22 ? 99  ARG A O      1  
ATOM 2532  C CB     . ARG C 3 90 ? -88.608  -4.545  -14.815 1.00 2.00 ? 99  ARG A CB     1  
ATOM 2533  C CG     . ARG C 3 90 ? -88.044  -5.814  -14.167 1.00 2.76 ? 99  ARG A CG     1  
ATOM 2534  C CD     . ARG C 3 90 ? -86.746  -6.269  -14.873 1.00 3.58 ? 99  ARG A CD     1  
ATOM 2535  N NE     . ARG C 3 90 ? -86.792  -7.753  -15.083 1.00 4.24 ? 99  ARG A NE     1  
ATOM 2536  C CZ     . ARG C 3 90 ? -87.133  -8.562  -14.111 1.00 4.91 ? 99  ARG A CZ     1  
ATOM 2537  N NH1    . ARG C 3 90 ? -87.345  -8.087  -12.913 1.00 5.13 ? 99  ARG A NH1    1  
ATOM 2538  N NH2    . ARG C 3 90 ? -87.234  -9.849  -14.330 1.00 5.66 ? 99  ARG A NH2    1  
ATOM 2539  H H      . ARG C 3 90 ? -90.857  -5.819  -14.794 1.00 1.29 ? 99  ARG A H      1  
ATOM 2540  H HA     . ARG C 3 90 ? -89.553  -3.877  -13.000 1.00 2.02 ? 99  ARG A HA     1  
ATOM 2541  H HB2    . ARG C 3 90 ? -88.898  -4.757  -15.835 1.00 2.35 ? 99  ARG A HB2    1  
ATOM 2542  H HB3    . ARG C 3 90 ? -87.858  -3.770  -14.805 1.00 2.27 ? 99  ARG A HB3    1  
ATOM 2543  H HG2    . ARG C 3 90 ? -87.842  -5.611  -13.128 1.00 3.10 ? 99  ARG A HG2    1  
ATOM 2544  H HG3    . ARG C 3 90 ? -88.782  -6.599  -14.241 1.00 3.02 ? 99  ARG A HG3    1  
ATOM 2545  H HD2    . ARG C 3 90 ? -86.661  -5.800  -15.839 1.00 3.70 ? 99  ARG A HD2    1  
ATOM 2546  H HD3    . ARG C 3 90 ? -85.885  -5.993  -14.269 1.00 4.02 ? 99  ARG A HD3    1  
ATOM 2547  H HE     . ARG C 3 90 ? -86.600  -8.122  -15.971 1.00 4.43 ? 99  ARG A HE     1  
ATOM 2548  H HH11   . ARG C 3 90 ? -87.243  -7.114  -12.737 1.00 4.79 ? 99  ARG A HH11   1  
ATOM 2549  H HH12   . ARG C 3 90 ? -87.612  -8.701  -12.171 1.00 5.82 ? 99  ARG A HH12   1  
ATOM 2550  H HH21   . ARG C 3 90 ? -87.050  -10.218 -15.239 1.00 5.80 ? 99  ARG A HH21   1  
ATOM 2551  H HH22   . ARG C 3 90 ? -87.503  -10.465 -13.586 1.00 6.26 ? 99  ARG A HH22   1  
ATOM 2552  N N      . TYR C 3 91 ? -91.522  -2.936  -15.364 1.00 0.92 ? 100 TYR A N      1  
ATOM 2553  C CA     . TYR C 3 91 ? -92.126  -1.746  -16.046 1.00 0.77 ? 100 TYR A CA     1  
ATOM 2554  C C      . TYR C 3 91 ? -93.417  -1.296  -15.339 1.00 0.76 ? 100 TYR A C      1  
ATOM 2555  O O      . TYR C 3 91 ? -94.152  -0.483  -15.861 1.00 0.77 ? 100 TYR A O      1  
ATOM 2556  C CB     . TYR C 3 91 ? -92.474  -2.137  -17.484 1.00 0.94 ? 100 TYR A CB     1  
ATOM 2557  C CG     . TYR C 3 91 ? -91.261  -2.740  -18.166 1.00 0.87 ? 100 TYR A CG     1  
ATOM 2558  C CD1    . TYR C 3 91 ? -90.232  -1.917  -18.649 1.00 0.87 ? 100 TYR A CD1    1  
ATOM 2559  C CD2    . TYR C 3 91 ? -91.178  -4.127  -18.324 1.00 1.18 ? 100 TYR A CD2    1  
ATOM 2560  C CE1    . TYR C 3 91 ? -89.118  -2.493  -19.288 1.00 0.87 ? 100 TYR A CE1    1  
ATOM 2561  C CE2    . TYR C 3 91 ? -90.071  -4.699  -18.961 1.00 1.27 ? 100 TYR A CE2    1  
ATOM 2562  C CZ     . TYR C 3 91 ? -89.041  -3.888  -19.444 1.00 1.00 ? 100 TYR A CZ     1  
ATOM 2563  O OH     . TYR C 3 91 ? -87.948  -4.474  -20.062 1.00 1.16 ? 100 TYR A OH     1  
ATOM 2564  H H      . TYR C 3 91 ? -91.953  -3.816  -15.449 1.00 1.08 ? 100 TYR A H      1  
ATOM 2565  H HA     . TYR C 3 91 ? -91.422  -0.927  -16.065 1.00 0.82 ? 100 TYR A HA     1  
ATOM 2566  H HB2    . TYR C 3 91 ? -93.278  -2.858  -17.475 1.00 1.17 ? 100 TYR A HB2    1  
ATOM 2567  H HB3    . TYR C 3 91 ? -92.789  -1.259  -18.027 1.00 1.13 ? 100 TYR A HB3    1  
ATOM 2568  H HD1    . TYR C 3 91 ? -90.292  -0.846  -18.528 1.00 1.11 ? 100 TYR A HD1    1  
ATOM 2569  H HD2    . TYR C 3 91 ? -91.970  -4.761  -17.950 1.00 1.48 ? 100 TYR A HD2    1  
ATOM 2570  H HE1    . TYR C 3 91 ? -88.325  -1.861  -19.663 1.00 1.04 ? 100 TYR A HE1    1  
ATOM 2571  H HE2    . TYR C 3 91 ? -90.017  -5.771  -19.081 1.00 1.66 ? 100 TYR A HE2    1  
ATOM 2572  H HH     . TYR C 3 91 ? -87.464  -3.793  -20.529 1.00 1.55 ? 100 TYR A HH     1  
ATOM 2573  N N      . VAL C 3 92 ? -93.729  -1.822  -14.176 1.00 0.77 ? 101 VAL A N      1  
ATOM 2574  C CA     . VAL C 3 92 ? -95.005  -1.409  -13.496 1.00 0.79 ? 101 VAL A CA     1  
ATOM 2575  C C      . VAL C 3 92 ? -94.770  -0.225  -12.552 1.00 0.73 ? 101 VAL A C      1  
ATOM 2576  O O      . VAL C 3 92 ? -93.991  -0.284  -11.615 1.00 0.76 ? 101 VAL A O      1  
ATOM 2577  C CB     . VAL C 3 92 ? -95.592  -2.597  -12.713 1.00 0.90 ? 101 VAL A CB     1  
ATOM 2578  C CG1    . VAL C 3 92 ? -96.280  -3.567  -13.689 1.00 1.07 ? 101 VAL A CG1    1  
ATOM 2579  C CG2    . VAL C 3 92 ? -94.465  -3.328  -11.985 1.00 1.14 ? 101 VAL A CG2    1  
ATOM 2580  H H      . VAL C 3 92 ? -93.144  -2.491  -13.761 1.00 0.80 ? 101 VAL A H      1  
ATOM 2581  H HA     . VAL C 3 92 ? -95.724  -1.103  -14.246 1.00 0.79 ? 101 VAL A HA     1  
ATOM 2582  H HB     . VAL C 3 92 ? -96.318  -2.240  -11.994 1.00 1.17 ? 101 VAL A HB     1  
ATOM 2583  H HG11   . VAL C 3 92 ? -95.669  -3.685  -14.571 1.00 1.48 ? 101 VAL A HG11   1  
ATOM 2584  H HG12   . VAL C 3 92 ? -96.416  -4.530  -13.215 1.00 1.63 ? 101 VAL A HG12   1  
ATOM 2585  H HG13   . VAL C 3 92 ? -97.243  -3.166  -13.971 1.00 1.49 ? 101 VAL A HG13   1  
ATOM 2586  H HG21   . VAL C 3 92 ? -93.829  -2.610  -11.490 1.00 1.56 ? 101 VAL A HG21   1  
ATOM 2587  H HG22   . VAL C 3 92 ? -94.880  -4.008  -11.254 1.00 1.63 ? 101 VAL A HG22   1  
ATOM 2588  H HG23   . VAL C 3 92 ? -93.890  -3.882  -12.704 1.00 1.56 ? 101 VAL A HG23   1  
ATOM 2589  N N      . TYR C 3 93 ? -95.478  0.852   -12.794 1.00 0.69 ? 102 TYR A N      1  
ATOM 2590  C CA     . TYR C 3 93 ? -95.363  2.073   -11.931 1.00 0.67 ? 102 TYR A CA     1  
ATOM 2591  C C      . TYR C 3 93 ? -96.702  2.273   -11.212 1.00 0.68 ? 102 TYR A C      1  
ATOM 2592  O O      . TYR C 3 93 ? -97.747  1.939   -11.743 1.00 0.73 ? 102 TYR A O      1  
ATOM 2593  C CB     . TYR C 3 93 ? -95.061  3.308   -12.815 1.00 0.69 ? 102 TYR A CB     1  
ATOM 2594  C CG     . TYR C 3 93 ? -93.575  3.371   -13.149 1.00 0.76 ? 102 TYR A CG     1  
ATOM 2595  C CD1    . TYR C 3 93 ? -92.958  2.323   -13.841 1.00 0.84 ? 102 TYR A CD1    1  
ATOM 2596  C CD2    . TYR C 3 93 ? -92.817  4.484   -12.750 1.00 1.09 ? 102 TYR A CD2    1  
ATOM 2597  C CE1    . TYR C 3 93 ? -91.578  2.384   -14.128 1.00 0.91 ? 102 TYR A CE1    1  
ATOM 2598  C CE2    . TYR C 3 93 ? -91.447  4.547   -13.040 1.00 1.23 ? 102 TYR A CE2    1  
ATOM 2599  C CZ     . TYR C 3 93 ? -90.826  3.501   -13.722 1.00 1.01 ? 102 TYR A CZ     1  
ATOM 2600  O OH     . TYR C 3 93 ? -89.473  3.568   -14.001 1.00 1.16 ? 102 TYR A OH     1  
ATOM 2601  H H      . TYR C 3 93 ? -96.109  0.850   -13.546 1.00 0.71 ? 102 TYR A H      1  
ATOM 2602  H HA     . TYR C 3 93 ? -94.576  1.944   -11.205 1.00 0.70 ? 102 TYR A HA     1  
ATOM 2603  H HB2    . TYR C 3 93 ? -95.629  3.235   -13.731 1.00 0.71 ? 102 TYR A HB2    1  
ATOM 2604  H HB3    . TYR C 3 93 ? -95.352  4.204   -12.291 1.00 0.71 ? 102 TYR A HB3    1  
ATOM 2605  H HD1    . TYR C 3 93 ? -93.544  1.465   -14.150 1.00 1.08 ? 102 TYR A HD1    1  
ATOM 2606  H HD2    . TYR C 3 93 ? -93.296  5.302   -12.234 1.00 1.37 ? 102 TYR A HD2    1  
ATOM 2607  H HE1    . TYR C 3 93 ? -91.093  1.575   -14.661 1.00 1.11 ? 102 TYR A HE1    1  
ATOM 2608  H HE2    . TYR C 3 93 ? -90.871  5.405   -12.733 1.00 1.60 ? 102 TYR A HE2    1  
ATOM 2609  H HH     . TYR C 3 93 ? -89.276  4.446   -14.341 1.00 1.41 ? 102 TYR A HH     1  
ATOM 2610  N N      . ARG C 3 94 ? -96.692  2.811   -10.019 1.00 0.68 ? 103 ARG A N      1  
ATOM 2611  C CA     . ARG C 3 94 ? -97.983  3.024   -9.290  1.00 0.73 ? 103 ARG A CA     1  
ATOM 2612  C C      . ARG C 3 94 ? -97.850  4.220   -8.355  1.00 0.74 ? 103 ARG A C      1  
ATOM 2613  O O      . ARG C 3 94 ? -96.766  4.597   -7.960  1.00 0.75 ? 103 ARG A O      1  
ATOM 2614  C CB     . ARG C 3 94 ? -98.347  1.775   -8.482  1.00 0.80 ? 103 ARG A CB     1  
ATOM 2615  C CG     . ARG C 3 94 ? -99.781  1.893   -7.957  1.00 1.30 ? 103 ARG A CG     1  
ATOM 2616  C CD     . ARG C 3 94 ? -100.177 0.585   -7.272  1.00 1.34 ? 103 ARG A CD     1  
ATOM 2617  N NE     . ARG C 3 94 ? -101.556 0.703   -6.725  1.00 1.78 ? 103 ARG A NE     1  
ATOM 2618  C CZ     . ARG C 3 94 ? -102.212 -0.366  -6.385  1.00 2.11 ? 103 ARG A CZ     1  
ATOM 2619  N NH1    . ARG C 3 94 ? -101.686 -1.547  -6.571  1.00 2.17 ? 103 ARG A NH1    1  
ATOM 2620  N NH2    . ARG C 3 94 ? -103.394 -0.251  -5.844  1.00 2.90 ? 103 ARG A NH2    1  
ATOM 2621  H H      . ARG C 3 94 ? -95.843  3.078   -9.604  1.00 0.66 ? 103 ARG A H      1  
ATOM 2622  H HA     . ARG C 3 94 ? -98.769  3.228   -10.006 1.00 0.76 ? 103 ARG A HA     1  
ATOM 2623  H HB2    . ARG C 3 94 ? -98.267  0.905   -9.115  1.00 1.08 ? 103 ARG A HB2    1  
ATOM 2624  H HB3    . ARG C 3 94 ? -97.669  1.678   -7.649  1.00 1.12 ? 103 ARG A HB3    1  
ATOM 2625  H HG2    . ARG C 3 94 ? -99.844  2.705   -7.246  1.00 1.92 ? 103 ARG A HG2    1  
ATOM 2626  H HG3    . ARG C 3 94 ? -100.454 2.084   -8.781  1.00 1.77 ? 103 ARG A HG3    1  
ATOM 2627  H HD2    . ARG C 3 94 ? -100.137 -0.224  -7.988  1.00 1.66 ? 103 ARG A HD2    1  
ATOM 2628  H HD3    . ARG C 3 94 ? -99.493  0.382   -6.463  1.00 1.81 ? 103 ARG A HD3    1  
ATOM 2629  H HE     . ARG C 3 94 ? -101.960 1.585   -6.591  1.00 2.29 ? 103 ARG A HE     1  
ATOM 2630  H HH11   . ARG C 3 94 ? -100.775 -1.631  -6.974  1.00 2.12 ? 103 ARG A HH11   1  
ATOM 2631  H HH12   . ARG C 3 94 ? -102.195 -2.369  -6.312  1.00 2.68 ? 103 ARG A HH12   1  
ATOM 2632  H HH21   . ARG C 3 94 ? -103.786 0.654   -5.692  1.00 3.34 ? 103 ARG A HH21   1  
ATOM 2633  H HH22   . ARG C 3 94 ? -103.900 -1.070  -5.573  1.00 3.25 ? 103 ARG A HH22   1  
ATOM 2634  N N      . PHE C 3 95 ? -98.956  4.822   -8.003  1.00 0.82 ? 104 PHE A N      1  
ATOM 2635  C CA     . PHE C 3 95 ? -98.932  6.007   -7.101  1.00 0.85 ? 104 PHE A CA     1  
ATOM 2636  C C      . PHE C 3 95 ? -99.838  5.724   -5.899  1.00 0.96 ? 104 PHE A C      1  
ATOM 2637  O O      . PHE C 3 95 ? -100.701 4.866   -5.954  1.00 1.16 ? 104 PHE A O      1  
ATOM 2638  C CB     . PHE C 3 95 ? -99.455  7.223   -7.880  1.00 0.89 ? 104 PHE A CB     1  
ATOM 2639  C CG     . PHE C 3 95 ? -98.668  7.383   -9.176  1.00 0.87 ? 104 PHE A CG     1  
ATOM 2640  C CD1    . PHE C 3 95 ? -99.014  6.623   -10.304 1.00 0.88 ? 104 PHE A CD1    1  
ATOM 2641  C CD2    . PHE C 3 95 ? -97.596  8.285   -9.248  1.00 0.97 ? 104 PHE A CD2    1  
ATOM 2642  C CE1    . PHE C 3 95 ? -98.294  6.765   -11.497 1.00 0.97 ? 104 PHE A CE1    1  
ATOM 2643  C CE2    . PHE C 3 95 ? -96.872  8.422   -10.451 1.00 1.07 ? 104 PHE A CE2    1  
ATOM 2644  C CZ     . PHE C 3 95 ? -97.224  7.659   -11.570 1.00 1.06 ? 104 PHE A CZ     1  
ATOM 2645  H H      . PHE C 3 95 ? -99.813  4.492   -8.341  1.00 0.88 ? 104 PHE A H      1  
ATOM 2646  H HA     . PHE C 3 95 ? -97.934  6.197   -6.754  1.00 0.82 ? 104 PHE A HA     1  
ATOM 2647  H HB2    . PHE C 3 95 ? -100.502 7.078   -8.111  1.00 0.95 ? 104 PHE A HB2    1  
ATOM 2648  H HB3    . PHE C 3 95 ? -99.336  8.111   -7.277  1.00 0.95 ? 104 PHE A HB3    1  
ATOM 2649  H HD1    . PHE C 3 95 ? -99.839  5.929   -10.256 1.00 0.90 ? 104 PHE A HD1    1  
ATOM 2650  H HD2    . PHE C 3 95 ? -97.328  8.876   -8.385  1.00 1.04 ? 104 PHE A HD2    1  
ATOM 2651  H HE1    . PHE C 3 95 ? -98.565  6.178   -12.363 1.00 1.05 ? 104 PHE A HE1    1  
ATOM 2652  H HE2    . PHE C 3 95 ? -96.038  9.110   -10.512 1.00 1.21 ? 104 PHE A HE2    1  
ATOM 2653  H HZ     . PHE C 3 95 ? -96.670  7.766   -12.493 1.00 1.18 ? 104 PHE A HZ     1  
ATOM 2654  N N      . VAL C 3 96 ? -99.637  6.427   -4.810  1.00 0.95 ? 105 VAL A N      1  
ATOM 2655  C CA     . VAL C 3 96 ? -100.467 6.209   -3.587  1.00 1.08 ? 105 VAL A CA     1  
ATOM 2656  C C      . VAL C 3 96 ? -101.059 7.547   -3.126  1.00 1.23 ? 105 VAL A C      1  
ATOM 2657  O O      . VAL C 3 96 ? -102.187 7.546   -2.663  1.00 1.69 ? 105 VAL A O      1  
ATOM 2658  C CB     . VAL C 3 96 ? -99.575  5.625   -2.488  1.00 1.25 ? 105 VAL A CB     1  
ATOM 2659  C CG1    . VAL C 3 96 ? -98.608  6.694   -1.960  1.00 1.20 ? 105 VAL A CG1    1  
ATOM 2660  C CG2    . VAL C 3 96 ? -100.449 5.105   -1.351  1.00 1.98 ? 105 VAL A CG2    1  
ATOM 2661  O OXT    . VAL C 3 96 ? -100.370 8.546   -3.251  1.00 1.75 ? 105 VAL A OXT    1  
ATOM 2662  H H      . VAL C 3 96 ? -98.928  7.098   -4.798  1.00 0.95 ? 105 VAL A H      1  
ATOM 2663  H HA     . VAL C 3 96 ? -101.273 5.518   -3.794  1.00 1.15 ? 105 VAL A HA     1  
ATOM 2664  H HB     . VAL C 3 96 ? -99.002  4.805   -2.897  1.00 1.77 ? 105 VAL A HB     1  
ATOM 2665  H HG11   . VAL C 3 96 ? -98.140  7.198   -2.790  1.00 1.63 ? 105 VAL A HG11   1  
ATOM 2666  H HG12   . VAL C 3 96 ? -99.149  7.413   -1.361  1.00 1.63 ? 105 VAL A HG12   1  
ATOM 2667  H HG13   . VAL C 3 96 ? -97.848  6.221   -1.356  1.00 1.68 ? 105 VAL A HG13   1  
ATOM 2668  H HG21   . VAL C 3 96 ? -101.122 4.353   -1.734  1.00 2.56 ? 105 VAL A HG21   1  
ATOM 2669  H HG22   . VAL C 3 96 ? -99.823  4.668   -0.587  1.00 2.44 ? 105 VAL A HG22   1  
ATOM 2670  H HG23   . VAL C 3 96 ? -101.019 5.921   -0.930  1.00 2.31 ? 105 VAL A HG23   1  
ATOM 2671  O "O5'"  . DT  A 1 1  ? -69.721  -19.655 -21.571 1.00 1.83 ? 1   DT  B "O5'"  2  
ATOM 2672  C "C5'"  . DT  A 1 1  ? -68.919  -19.859 -22.738 1.00 1.89 ? 1   DT  B "C5'"  2  
ATOM 2673  C "C4'"  . DT  A 1 1  ? -69.294  -18.879 -23.855 1.00 1.80 ? 1   DT  B "C4'"  2  
ATOM 2674  O "O4'"  . DT  A 1 1  ? -70.615  -19.203 -24.348 1.00 1.79 ? 1   DT  B "O4'"  2  
ATOM 2675  C "C3'"  . DT  A 1 1  ? -69.311  -17.423 -23.365 1.00 1.66 ? 1   DT  B "C3'"  2  
ATOM 2676  O "O3'"  . DT  A 1 1  ? -68.522  -16.575 -24.202 1.00 1.67 ? 1   DT  B "O3'"  2  
ATOM 2677  C "C2'"  . DT  A 1 1  ? -70.754  -16.991 -23.429 1.00 1.56 ? 1   DT  B "C2'"  2  
ATOM 2678  C "C1'"  . DT  A 1 1  ? -71.523  -18.104 -24.134 1.00 1.64 ? 1   DT  B "C1'"  2  
ATOM 2679  N N1     . DT  A 1 1  ? -72.681  -18.520 -23.300 1.00 1.61 ? 1   DT  B N1     2  
ATOM 2680  C C2     . DT  A 1 1  ? -73.960  -18.279 -23.783 1.00 1.58 ? 1   DT  B C2     2  
ATOM 2681  O O2     . DT  A 1 1  ? -74.155  -17.774 -24.886 1.00 1.58 ? 1   DT  B O2     2  
ATOM 2682  N N3     . DT  A 1 1  ? -75.001  -18.644 -22.955 1.00 1.57 ? 1   DT  B N3     2  
ATOM 2683  C C4     . DT  A 1 1  ? -74.884  -19.223 -21.704 1.00 1.61 ? 1   DT  B C4     2  
ATOM 2684  O O4     . DT  A 1 1  ? -75.883  -19.508 -21.049 1.00 1.63 ? 1   DT  B O4     2  
ATOM 2685  C C5     . DT  A 1 1  ? -73.517  -19.440 -21.283 1.00 1.64 ? 1   DT  B C5     2  
ATOM 2686  C C7     . DT  A 1 1  ? -73.243  -20.065 -19.916 1.00 1.70 ? 1   DT  B C7     2  
ATOM 2687  C C6     . DT  A 1 1  ? -72.481  -19.093 -22.072 1.00 1.64 ? 1   DT  B C6     2  
ATOM 2688  H "H5'"  . DT  A 1 1  ? -69.065  -20.876 -23.096 1.00 2.00 ? 1   DT  B "H5'"  2  
ATOM 2689  H "H5''" . DT  A 1 1  ? -67.870  -19.719 -22.477 1.00 1.93 ? 1   DT  B "H5''" 2  
ATOM 2690  H "H4'"  . DT  A 1 1  ? -68.577  -18.976 -24.671 1.00 1.87 ? 1   DT  B "H4'"  2  
ATOM 2691  H "H3'"  . DT  A 1 1  ? -68.945  -17.355 -22.338 1.00 1.66 ? 1   DT  B "H3'"  2  
ATOM 2692  H "H2'"  . DT  A 1 1  ? -71.149  -16.849 -22.422 1.00 1.50 ? 1   DT  B "H2'"  2  
ATOM 2693  H "H2''" . DT  A 1 1  ? -70.835  -16.059 -23.990 1.00 1.50 ? 1   DT  B "H2''" 2  
ATOM 2694  H "H1'"  . DT  A 1 1  ? -71.867  -17.745 -25.108 1.00 1.64 ? 1   DT  B "H1'"  2  
ATOM 2695  H H3     . DT  A 1 1  ? -75.935  -18.475 -23.295 1.00 1.57 ? 1   DT  B H3     2  
ATOM 2696  H H71    . DT  A 1 1  ? -72.394  -19.561 -19.451 1.00 1.80 ? 1   DT  B H71    2  
ATOM 2697  H H72    . DT  A 1 1  ? -73.013  -21.123 -20.038 1.00 2.13 ? 1   DT  B H72    2  
ATOM 2698  H H73    . DT  A 1 1  ? -74.122  -19.956 -19.279 1.00 2.05 ? 1   DT  B H73    2  
ATOM 2699  H H6     . DT  A 1 1  ? -71.462  -19.269 -21.725 1.00 1.68 ? 1   DT  B H6     2  
ATOM 2700  H "HO5'" . DT  A 1 1  ? -69.191  -19.910 -20.813 1.00 1.92 ? 1   DT  B "HO5'" 2  
ATOM 2701  P P      . DC  A 1 2  ? -68.307  -15.028 -23.796 1.00 1.58 ? 2   DC  B P      2  
ATOM 2702  O OP1    . DC  A 1 2  ? -67.127  -14.515 -24.528 1.00 1.68 ? 2   DC  B OP1    2  
ATOM 2703  O OP2    . DC  A 1 2  ? -68.361  -14.927 -22.320 1.00 1.55 ? 2   DC  B OP2    2  
ATOM 2704  O "O5'"  . DC  A 1 2  ? -69.624  -14.311 -24.394 1.00 1.47 ? 2   DC  B "O5'"  2  
ATOM 2705  C "C5'"  . DC  A 1 2  ? -69.594  -13.720 -25.697 1.00 1.50 ? 2   DC  B "C5'"  2  
ATOM 2706  C "C4'"  . DC  A 1 2  ? -70.824  -12.846 -25.968 1.00 1.41 ? 2   DC  B "C4'"  2  
ATOM 2707  O "O4'"  . DC  A 1 2  ? -72.029  -13.579 -25.631 1.00 1.38 ? 2   DC  B "O4'"  2  
ATOM 2708  C "C3'"  . DC  A 1 2  ? -70.812  -11.551 -25.141 1.00 1.31 ? 2   DC  B "C3'"  2  
ATOM 2709  O "O3'"  . DC  A 1 2  ? -70.934  -10.402 -25.987 1.00 1.32 ? 2   DC  B "O3'"  2  
ATOM 2710  C "C2'"  . DC  A 1 2  ? -72.026  -11.632 -24.242 1.00 1.21 ? 2   DC  B "C2'"  2  
ATOM 2711  C "C1'"  . DC  A 1 2  ? -72.865  -12.804 -24.744 1.00 1.25 ? 2   DC  B "C1'"  2  
ATOM 2712  N N1     . DC  A 1 2  ? -73.378  -13.640 -23.614 1.00 1.21 ? 2   DC  B N1     2  
ATOM 2713  C C2     . DC  A 1 2  ? -74.759  -13.806 -23.494 1.00 1.17 ? 2   DC  B C2     2  
ATOM 2714  O O2     . DC  A 1 2  ? -75.516  -13.270 -24.302 1.00 1.17 ? 2   DC  B O2     2  
ATOM 2715  N N3     . DC  A 1 2  ? -75.238  -14.570 -22.473 1.00 1.17 ? 2   DC  B N3     2  
ATOM 2716  C C4     . DC  A 1 2  ? -74.406  -15.152 -21.599 1.00 1.21 ? 2   DC  B C4     2  
ATOM 2717  N N4     . DC  A 1 2  ? -74.908  -15.897 -20.613 1.00 1.25 ? 2   DC  B N4     2  
ATOM 2718  C C5     . DC  A 1 2  ? -72.992  -14.986 -21.711 1.00 1.24 ? 2   DC  B C5     2  
ATOM 2719  C C6     . DC  A 1 2  ? -72.522  -14.230 -22.726 1.00 1.24 ? 2   DC  B C6     2  
ATOM 2720  H "H5'"  . DC  A 1 2  ? -69.555  -14.511 -26.444 1.00 1.62 ? 2   DC  B "H5'"  2  
ATOM 2721  H "H5''" . DC  A 1 2  ? -68.698  -13.104 -25.788 1.00 1.58 ? 2   DC  B "H5''" 2  
ATOM 2722  H "H4'"  . DC  A 1 2  ? -70.851  -12.590 -27.028 1.00 1.47 ? 2   DC  B "H4'"  2  
ATOM 2723  H "H3'"  . DC  A 1 2  ? -69.898  -11.470 -24.541 1.00 1.33 ? 2   DC  B "H3'"  2  
ATOM 2724  H "H2'"  . DC  A 1 2  ? -71.726  -11.792 -23.206 1.00 1.18 ? 2   DC  B "H2'"  2  
ATOM 2725  H "H2''" . DC  A 1 2  ? -72.595  -10.707 -24.321 1.00 1.17 ? 2   DC  B "H2''" 2  
ATOM 2726  H "H1'"  . DC  A 1 2  ? -73.706  -12.413 -25.326 1.00 1.24 ? 2   DC  B "H1'"  2  
ATOM 2727  H H41    . DC  A 1 2  ? -75.907  -16.020 -20.529 1.00 1.24 ? 2   DC  B H41    2  
ATOM 2728  H H42    . DC  A 1 2  ? -74.286  -16.338 -19.949 1.00 1.29 ? 2   DC  B H42    2  
ATOM 2729  H H5     . DC  A 1 2  ? -72.316  -15.450 -20.994 1.00 1.29 ? 2   DC  B H5     2  
ATOM 2730  H H6     . DC  A 1 2  ? -71.449  -14.087 -22.839 1.00 1.28 ? 2   DC  B H6     2  
ATOM 2731  P P      . DG  A 1 3  ? -70.646  -8.927  -25.401 1.00 1.27 ? 3   DG  B P      2  
ATOM 2732  O OP1    . DG  A 1 3  ? -69.902  -8.158  -26.426 1.00 1.42 ? 3   DG  B OP1    2  
ATOM 2733  O OP2    . DG  A 1 3  ? -70.088  -9.070  -24.038 1.00 1.23 ? 3   DG  B OP2    2  
ATOM 2734  O "O5'"  . DG  A 1 3  ? -72.127  -8.303  -25.279 1.00 1.15 ? 3   DG  B "O5'"  2  
ATOM 2735  C "C5'"  . DG  A 1 3  ? -72.851  -7.947  -26.458 1.00 1.23 ? 3   DG  B "C5'"  2  
ATOM 2736  C "C4'"  . DG  A 1 3  ? -74.335  -7.675  -26.169 1.00 1.13 ? 3   DG  B "C4'"  2  
ATOM 2737  O "O4'"  . DG  A 1 3  ? -74.882  -8.741  -25.353 1.00 1.06 ? 3   DG  B "O4'"  2  
ATOM 2738  C "C3'"  . DG  A 1 3  ? -74.554  -6.348  -25.427 1.00 1.07 ? 3   DG  B "C3'"  2  
ATOM 2739  O "O3'"  . DG  A 1 3  ? -75.521  -5.542  -26.109 1.00 1.13 ? 3   DG  B "O3'"  2  
ATOM 2740  C "C2'"  . DG  A 1 3  ? -75.079  -6.731  -24.065 1.00 0.93 ? 3   DG  B "C2'"  2  
ATOM 2741  C "C1'"  . DG  A 1 3  ? -75.437  -8.208  -24.132 1.00 0.93 ? 3   DG  B "C1'"  2  
ATOM 2742  N N9     . DG  A 1 3  ? -74.915  -8.923  -22.950 1.00 0.86 ? 3   DG  B N9     2  
ATOM 2743  C C8     . DG  A 1 3  ? -73.624  -9.091  -22.549 1.00 0.87 ? 3   DG  B C8     2  
ATOM 2744  N N7     . DG  A 1 3  ? -73.469  -9.764  -21.449 1.00 0.84 ? 3   DG  B N7     2  
ATOM 2745  C C5     . DG  A 1 3  ? -74.774  -10.076 -21.078 1.00 0.79 ? 3   DG  B C5     2  
ATOM 2746  C C6     . DG  A 1 3  ? -75.253  -10.802 -19.955 1.00 0.76 ? 3   DG  B C6     2  
ATOM 2747  O O6     . DG  A 1 3  ? -74.602  -11.320 -19.050 1.00 0.77 ? 3   DG  B O6     2  
ATOM 2748  N N1     . DG  A 1 3  ? -76.640  -10.884 -19.958 1.00 0.76 ? 3   DG  B N1     2  
ATOM 2749  C C2     . DG  A 1 3  ? -77.466  -10.340 -20.919 1.00 0.79 ? 3   DG  B C2     2  
ATOM 2750  N N2     . DG  A 1 3  ? -78.774  -10.519 -20.743 1.00 0.83 ? 3   DG  B N2     2  
ATOM 2751  N N3     . DG  A 1 3  ? -77.018  -9.657  -21.977 1.00 0.81 ? 3   DG  B N3     2  
ATOM 2752  C C4     . DG  A 1 3  ? -75.668  -9.565  -21.994 1.00 0.80 ? 3   DG  B C4     2  
ATOM 2753  H "H5'"  . DG  A 1 3  ? -72.775  -8.760  -27.179 1.00 1.32 ? 3   DG  B "H5'"  2  
ATOM 2754  H "H5''" . DG  A 1 3  ? -72.406  -7.050  -26.889 1.00 1.34 ? 3   DG  B "H5''" 2  
ATOM 2755  H "H4'"  . DG  A 1 3  ? -74.877  -7.644  -27.115 1.00 1.19 ? 3   DG  B "H4'"  2  
ATOM 2756  H "H3'"  . DG  A 1 3  ? -73.618  -5.793  -25.330 1.00 1.13 ? 3   DG  B "H3'"  2  
ATOM 2757  H "H2'"  . DG  A 1 3  ? -74.313  -6.574  -23.302 1.00 0.91 ? 3   DG  B "H2'"  2  
ATOM 2758  H "H2''" . DG  A 1 3  ? -75.963  -6.137  -23.831 1.00 0.92 ? 3   DG  B "H2''" 2  
ATOM 2759  H "H1'"  . DG  A 1 3  ? -76.523  -8.319  -24.164 1.00 0.92 ? 3   DG  B "H1'"  2  
ATOM 2760  H H8     . DG  A 1 3  ? -72.782  -8.688  -23.107 1.00 0.94 ? 3   DG  B H8     2  
ATOM 2761  H H1     . DG  A 1 3  ? -77.055  -11.379 -19.189 1.00 0.77 ? 3   DG  B H1     2  
ATOM 2762  H H21    . DG  A 1 3  ? -79.113  -11.036 -19.942 1.00 0.84 ? 3   DG  B H21    2  
ATOM 2763  H H22    . DG  A 1 3  ? -79.429  -10.139 -21.411 1.00 0.87 ? 3   DG  B H22    2  
ATOM 2764  P P      . DA  A 1 4  ? -75.907  -4.069  -25.570 1.00 1.15 ? 4   DA  B P      2  
ATOM 2765  O OP1    . DA  A 1 4  ? -76.394  -3.271  -26.717 1.00 1.30 ? 4   DA  B OP1    2  
ATOM 2766  O OP2    . DA  A 1 4  ? -74.784  -3.570  -24.747 1.00 1.15 ? 4   DA  B OP2    2  
ATOM 2767  O "O5'"  . DA  A 1 4  ? -77.157  -4.358  -24.590 1.00 1.04 ? 4   DA  B "O5'"  2  
ATOM 2768  C "C5'"  . DA  A 1 4  ? -78.303  -5.070  -25.065 1.00 1.09 ? 4   DA  B "C5'"  2  
ATOM 2769  C "C4'"  . DA  A 1 4  ? -79.338  -5.296  -23.956 1.00 1.02 ? 4   DA  B "C4'"  2  
ATOM 2770  O "O4'"  . DA  A 1 4  ? -78.852  -6.296  -23.024 1.00 0.95 ? 4   DA  B "O4'"  2  
ATOM 2771  C "C3'"  . DA  A 1 4  ? -79.630  -4.013  -23.157 1.00 1.01 ? 4   DA  B "C3'"  2  
ATOM 2772  O "O3'"  . DA  A 1 4  ? -81.039  -3.752  -23.091 1.00 1.07 ? 4   DA  B "O3'"  2  
ATOM 2773  C "C2'"  . DA  A 1 4  ? -79.107  -4.286  -21.773 1.00 0.92 ? 4   DA  B "C2'"  2  
ATOM 2774  C "C1'"  . DA  A 1 4  ? -78.941  -5.793  -21.674 1.00 0.87 ? 4   DA  B "C1'"  2  
ATOM 2775  N N9     . DA  A 1 4  ? -77.751  -6.144  -20.861 1.00 0.78 ? 4   DA  B N9     2  
ATOM 2776  C C8     . DA  A 1 4  ? -76.456  -5.729  -20.998 1.00 0.79 ? 4   DA  B C8     2  
ATOM 2777  N N7     . DA  A 1 4  ? -75.631  -6.186  -20.101 1.00 0.74 ? 4   DA  B N7     2  
ATOM 2778  C C5     . DA  A 1 4  ? -76.447  -6.976  -19.293 1.00 0.68 ? 4   DA  B C5     2  
ATOM 2779  C C6     . DA  A 1 4  ? -76.193  -7.747  -18.153 1.00 0.65 ? 4   DA  B C6     2  
ATOM 2780  N N6     . DA  A 1 4  ? -74.984  -7.860  -17.600 1.00 0.65 ? 4   DA  B N6     2  
ATOM 2781  N N1     . DA  A 1 4  ? -77.231  -8.402  -17.601 1.00 0.67 ? 4   DA  B N1     2  
ATOM 2782  C C2     . DA  A 1 4  ? -78.448  -8.305  -18.138 1.00 0.73 ? 4   DA  B C2     2  
ATOM 2783  N N3     . DA  A 1 4  ? -78.796  -7.605  -19.213 1.00 0.76 ? 4   DA  B N3     2  
ATOM 2784  C C4     . DA  A 1 4  ? -77.737  -6.958  -19.747 1.00 0.73 ? 4   DA  B C4     2  
ATOM 2785  H "H5'"  . DA  A 1 4  ? -77.982  -6.036  -25.453 1.00 1.15 ? 4   DA  B "H5'"  2  
ATOM 2786  H "H5''" . DA  A 1 4  ? -78.764  -4.502  -25.869 1.00 1.22 ? 4   DA  B "H5''" 2  
ATOM 2787  H "H4'"  . DA  A 1 4  ? -80.268  -5.651  -24.407 1.00 1.08 ? 4   DA  B "H4'"  2  
ATOM 2788  H "H3'"  . DA  A 1 4  ? -79.117  -3.151  -23.595 1.00 1.06 ? 4   DA  B "H3'"  2  
ATOM 2789  H "H2'"  . DA  A 1 4  ? -78.144  -3.792  -21.623 1.00 0.92 ? 4   DA  B "H2'"  2  
ATOM 2790  H "H2''" . DA  A 1 4  ? -79.823  -3.934  -21.037 1.00 0.95 ? 4   DA  B "H2''" 2  
ATOM 2791  H "H1'"  . DA  A 1 4  ? -79.827  -6.219  -21.204 1.00 0.88 ? 4   DA  B "H1'"  2  
ATOM 2792  H H8     . DA  A 1 4  ? -76.137  -5.060  -21.796 1.00 0.86 ? 4   DA  B H8     2  
ATOM 2793  H H61    . DA  A 1 4  ? -74.858  -8.425  -16.774 1.00 0.65 ? 4   DA  B H61    2  
ATOM 2794  H H62    . DA  A 1 4  ? -74.197  -7.376  -18.006 1.00 0.68 ? 4   DA  B H62    2  
ATOM 2795  H H2     . DA  A 1 4  ? -79.242  -8.857  -17.638 1.00 0.80 ? 4   DA  B H2     2  
ATOM 2796  P P      . DG  A 1 5  ? -81.587  -2.389  -22.418 1.00 1.10 ? 5   DG  B P      2  
ATOM 2797  O OP1    . DG  A 1 5  ? -82.617  -1.818  -23.313 1.00 1.25 ? 5   DG  B OP1    2  
ATOM 2798  O OP2    . DG  A 1 5  ? -80.421  -1.567  -22.026 1.00 1.13 ? 5   DG  B OP2    2  
ATOM 2799  O "O5'"  . DG  A 1 5  ? -82.319  -2.902  -21.067 1.00 1.01 ? 5   DG  B "O5'"  2  
ATOM 2800  C "C5'"  . DG  A 1 5  ? -83.741  -3.103  -21.033 1.00 1.03 ? 5   DG  B "C5'"  2  
ATOM 2801  C "C4'"  . DG  A 1 5  ? -84.275  -3.291  -19.600 1.00 0.95 ? 5   DG  B "C4'"  2  
ATOM 2802  O "O4'"  . DG  A 1 5  ? -83.456  -4.250  -18.890 1.00 0.89 ? 5   DG  B "O4'"  2  
ATOM 2803  C "C3'"  . DG  A 1 5  ? -84.273  -1.977  -18.800 1.00 0.96 ? 5   DG  B "C3'"  2  
ATOM 2804  O "O3'"  . DG  A 1 5  ? -85.551  -1.727  -18.214 1.00 1.02 ? 5   DG  B "O3'"  2  
ATOM 2805  C "C2'"  . DG  A 1 5  ? -83.243  -2.169  -17.710 1.00 0.90 ? 5   DG  B "C2'"  2  
ATOM 2806  C "C1'"  . DG  A 1 5  ? -82.832  -3.640  -17.740 1.00 0.84 ? 5   DG  B "C1'"  2  
ATOM 2807  N N9     . DG  A 1 5  ? -81.362  -3.776  -17.809 1.00 0.79 ? 5   DG  B N9     2  
ATOM 2808  C C8     . DG  A 1 5  ? -80.486  -3.159  -18.651 1.00 0.82 ? 5   DG  B C8     2  
ATOM 2809  N N7     . DG  A 1 5  ? -79.238  -3.473  -18.482 1.00 0.79 ? 5   DG  B N7     2  
ATOM 2810  C C5     . DG  A 1 5  ? -79.278  -4.381  -17.429 1.00 0.72 ? 5   DG  B C5     2  
ATOM 2811  C C6     . DG  A 1 5  ? -78.216  -5.077  -16.791 1.00 0.69 ? 5   DG  B C6     2  
ATOM 2812  O O6     . DG  A 1 5  ? -77.013  -5.021  -17.038 1.00 0.70 ? 5   DG  B O6     2  
ATOM 2813  N N1     . DG  A 1 5  ? -78.683  -5.899  -15.774 1.00 0.67 ? 5   DG  B N1     2  
ATOM 2814  C C2     . DG  A 1 5  ? -80.007  -6.038  -15.413 1.00 0.70 ? 5   DG  B C2     2  
ATOM 2815  N N2     . DG  A 1 5  ? -80.256  -6.878  -14.408 1.00 0.73 ? 5   DG  B N2     2  
ATOM 2816  N N3     . DG  A 1 5  ? -81.011  -5.385  -16.011 1.00 0.73 ? 5   DG  B N3     2  
ATOM 2817  C C4     . DG  A 1 5  ? -80.575  -4.576  -17.008 1.00 0.73 ? 5   DG  B C4     2  
ATOM 2818  H "H5'"  . DG  A 1 5  ? -83.980  -3.991  -21.616 1.00 1.09 ? 5   DG  B "H5'"  2  
ATOM 2819  H "H5''" . DG  A 1 5  ? -84.233  -2.241  -21.484 1.00 1.10 ? 5   DG  B "H5''" 2  
ATOM 2820  H "H4'"  . DG  A 1 5  ? -85.297  -3.670  -19.653 1.00 0.99 ? 5   DG  B "H4'"  2  
ATOM 2821  H "H3'"  . DG  A 1 5  ? -84.003  -1.130  -19.437 1.00 1.03 ? 5   DG  B "H3'"  2  
ATOM 2822  H "H2'"  . DG  A 1 5  ? -82.374  -1.536  -17.897 1.00 0.93 ? 5   DG  B "H2'"  2  
ATOM 2823  H "H2''" . DG  A 1 5  ? -83.679  -1.917  -16.742 1.00 0.93 ? 5   DG  B "H2''" 2  
ATOM 2824  H "H1'"  . DG  A 1 5  ? -83.191  -4.138  -16.836 1.00 0.82 ? 5   DG  B "H1'"  2  
ATOM 2825  H H8     . DG  A 1 5  ? -80.813  -2.455  -19.416 1.00 0.88 ? 5   DG  B H8     2  
ATOM 2826  H H1     . DG  A 1 5  ? -77.982  -6.427  -15.272 1.00 0.66 ? 5   DG  B H1     2  
ATOM 2827  H H21    . DG  A 1 5  ? -79.495  -7.369  -13.960 1.00 0.73 ? 5   DG  B H21    2  
ATOM 2828  H H22    . DG  A 1 5  ? -81.205  -7.025  -14.094 1.00 0.79 ? 5   DG  B H22    2  
ATOM 2829  P P      . DC  A 1 6  ? -85.820  -0.349  -17.426 1.00 1.10 ? 6   DC  B P      2  
ATOM 2830  O OP1    . DC  A 1 6  ? -87.283  -0.137  -17.347 1.00 1.23 ? 6   DC  B OP1    2  
ATOM 2831  O OP2    . DC  A 1 6  ? -84.957  0.696   -18.015 1.00 1.16 ? 6   DC  B OP2    2  
ATOM 2832  O "O5'"  . DC  A 1 6  ? -85.277  -0.677  -15.944 1.00 1.03 ? 6   DC  B "O5'"  2  
ATOM 2833  C "C5'"  . DC  A 1 6  ? -85.843  -1.760  -15.208 1.00 1.10 ? 6   DC  B "C5'"  2  
ATOM 2834  C "C4'"  . DC  A 1 6  ? -85.169  -1.957  -13.848 1.00 1.07 ? 6   DC  B "C4'"  2  
ATOM 2835  O "O4'"  . DC  A 1 6  ? -83.847  -2.519  -14.041 1.00 1.09 ? 6   DC  B "O4'"  2  
ATOM 2836  C "C3'"  . DC  A 1 6  ? -85.016  -0.638  -13.070 1.00 1.06 ? 6   DC  B "C3'"  2  
ATOM 2837  O "O3'"  . DC  A 1 6  ? -85.683  -0.720  -11.807 1.00 1.11 ? 6   DC  B "O3'"  2  
ATOM 2838  C "C2'"  . DC  A 1 6  ? -83.525  -0.475  -12.848 1.00 1.06 ? 6   DC  B "C2'"  2  
ATOM 2839  C "C1'"  . DC  A 1 6  ? -82.872  -1.784  -13.280 1.00 1.04 ? 6   DC  B "C1'"  2  
ATOM 2840  N N1     . DC  A 1 6  ? -81.620  -1.553  -14.070 1.00 1.00 ? 6   DC  B N1     2  
ATOM 2841  C C2     . DC  A 1 6  ? -80.457  -2.192  -13.639 1.00 0.99 ? 6   DC  B C2     2  
ATOM 2842  O O2     . DC  A 1 6  ? -80.488  -2.918  -12.647 1.00 1.02 ? 6   DC  B O2     2  
ATOM 2843  N N3     . DC  A 1 6  ? -79.307  -1.989  -14.338 1.00 0.99 ? 6   DC  B N3     2  
ATOM 2844  C C4     . DC  A 1 6  ? -79.288  -1.198  -15.415 1.00 1.00 ? 6   DC  B C4     2  
ATOM 2845  N N4     . DC  A 1 6  ? -78.147  -1.030  -16.084 1.00 1.03 ? 6   DC  B N4     2  
ATOM 2846  C C5     . DC  A 1 6  ? -80.473  -0.538  -15.865 1.00 1.01 ? 6   DC  B C5     2  
ATOM 2847  C C6     . DC  A 1 6  ? -81.608  -0.742  -15.174 1.00 1.01 ? 6   DC  B C6     2  
ATOM 2848  H "H5'"  . DC  A 1 6  ? -85.739  -2.675  -15.789 1.00 1.21 ? 6   DC  B "H5'"  2  
ATOM 2849  H "H5''" . DC  A 1 6  ? -86.903  -1.560  -15.049 1.00 1.26 ? 6   DC  B "H5''" 2  
ATOM 2850  H "H4'"  . DC  A 1 6  ? -85.763  -2.649  -13.254 1.00 1.11 ? 6   DC  B "H4'"  2  
ATOM 2851  H "H3'"  . DC  A 1 6  ? -85.410  0.206   -13.643 1.00 1.07 ? 6   DC  B "H3'"  2  
ATOM 2852  H "H2'"  . DC  A 1 6  ? -83.146  0.354   -13.435 1.00 1.07 ? 6   DC  B "H2'"  2  
ATOM 2853  H "H2''" . DC  A 1 6  ? -83.323  -0.289  -11.797 1.00 1.11 ? 6   DC  B "H2''" 2  
ATOM 2854  H "H1'"  . DC  A 1 6  ? -82.636  -2.367  -12.383 1.00 1.06 ? 6   DC  B "H1'"  2  
ATOM 2855  H H41    . DC  A 1 6  ? -77.305  -1.491  -15.771 1.00 1.05 ? 6   DC  B H41    2  
ATOM 2856  H H42    . DC  A 1 6  ? -78.123  -0.440  -16.902 1.00 1.05 ? 6   DC  B H42    2  
ATOM 2857  H H5     . DC  A 1 6  ? -80.453  0.121   -16.733 1.00 1.04 ? 6   DC  B H5     2  
ATOM 2858  H H6     . DC  A 1 6  ? -82.527  -0.261  -15.505 1.00 1.05 ? 6   DC  B H6     2  
ATOM 2859  P P      . DC  A 1 7  ? -85.611  0.506   -10.763 1.00 1.17 ? 7   DC  B P      2  
ATOM 2860  O OP1    . DC  A 1 7  ? -86.637  0.298   -9.727  1.00 1.38 ? 7   DC  B OP1    2  
ATOM 2861  O OP2    . DC  A 1 7  ? -85.590  1.769   -11.524 1.00 1.32 ? 7   DC  B OP2    2  
ATOM 2862  O "O5'"  . DC  A 1 7  ? -84.166  0.285   -10.092 1.00 0.94 ? 7   DC  B "O5'"  2  
ATOM 2863  C "C5'"  . DC  A 1 7  ? -83.934  -0.882  -9.302  1.00 0.92 ? 7   DC  B "C5'"  2  
ATOM 2864  C "C4'"  . DC  A 1 7  ? -82.441  -1.188  -9.131  1.00 0.82 ? 7   DC  B "C4'"  2  
ATOM 2865  O "O4'"  . DC  A 1 7  ? -81.726  -0.947  -10.367 1.00 0.84 ? 7   DC  B "O4'"  2  
ATOM 2866  C "C3'"  . DC  A 1 7  ? -81.788  -0.323  -8.040  1.00 0.82 ? 7   DC  B "C3'"  2  
ATOM 2867  O "O3'"  . DC  A 1 7  ? -81.169  -1.145  -7.043  1.00 0.89 ? 7   DC  B "O3'"  2  
ATOM 2868  C "C2'"  . DC  A 1 7  ? -80.725  0.477   -8.756  1.00 0.86 ? 7   DC  B "C2'"  2  
ATOM 2869  C "C1'"  . DC  A 1 7  ? -80.517  -0.215  -10.090 1.00 0.87 ? 7   DC  B "C1'"  2  
ATOM 2870  N N1     . DC  A 1 7  ? -80.215  0.765   -11.163 1.00 0.93 ? 7   DC  B N1     2  
ATOM 2871  C C2     . DC  A 1 7  ? -78.937  0.768   -11.715 1.00 1.05 ? 7   DC  B C2     2  
ATOM 2872  O O2     . DC  A 1 7  ? -78.091  -0.029  -11.313 1.00 1.14 ? 7   DC  B O2     2  
ATOM 2873  N N3     . DC  A 1 7  ? -78.657  1.663   -12.697 1.00 1.15 ? 7   DC  B N3     2  
ATOM 2874  C C4     . DC  A 1 7  ? -79.586  2.521   -13.127 1.00 1.15 ? 7   DC  B C4     2  
ATOM 2875  N N4     . DC  A 1 7  ? -79.276  3.390   -14.089 1.00 1.29 ? 7   DC  B N4     2  
ATOM 2876  C C5     . DC  A 1 7  ? -80.899  2.525   -12.566 1.00 1.08 ? 7   DC  B C5     2  
ATOM 2877  C C6     . DC  A 1 7  ? -81.171  1.636   -11.591 1.00 0.96 ? 7   DC  B C6     2  
ATOM 2878  H "H5'"  . DC  A 1 7  ? -84.415  -1.733  -9.786  1.00 1.09 ? 7   DC  B "H5'"  2  
ATOM 2879  H "H5''" . DC  A 1 7  ? -84.388  -0.737  -8.321  1.00 0.96 ? 7   DC  B "H5''" 2  
ATOM 2880  H "H4'"  . DC  A 1 7  ? -82.328  -2.232  -8.867  1.00 0.89 ? 7   DC  B "H4'"  2  
ATOM 2881  H "H3'"  . DC  A 1 7  ? -82.520  0.344   -7.572  1.00 0.86 ? 7   DC  B "H3'"  2  
ATOM 2882  H "H2'"  . DC  A 1 7  ? -81.063  1.505   -8.915  1.00 0.92 ? 7   DC  B "H2'"  2  
ATOM 2883  H "H2''" . DC  A 1 7  ? -79.802  0.472   -8.180  1.00 0.94 ? 7   DC  B "H2''" 2  
ATOM 2884  H "H1'"  . DC  A 1 7  ? -79.696  -0.932  -9.997  1.00 0.95 ? 7   DC  B "H1'"  2  
ATOM 2885  H H41    . DC  A 1 7  ? -78.347  3.392   -14.485 1.00 1.39 ? 7   DC  B H41    2  
ATOM 2886  H H42    . DC  A 1 7  ? -79.969  4.046   -14.419 1.00 1.35 ? 7   DC  B H42    2  
ATOM 2887  H H5     . DC  A 1 7  ? -81.652  3.223   -12.919 1.00 1.17 ? 7   DC  B H5     2  
ATOM 2888  H H6     . DC  A 1 7  ? -82.161  1.618   -11.135 1.00 0.96 ? 7   DC  B H6     2  
ATOM 2889  P P      . DG  A 1 8  ? -81.147  -0.683  -5.501  1.00 0.93 ? 8   DG  B P      2  
ATOM 2890  O OP1    . DG  A 1 8  ? -81.515  -1.849  -4.666  1.00 1.16 ? 8   DG  B OP1    2  
ATOM 2891  O OP2    . DG  A 1 8  ? -81.916  0.574   -5.390  1.00 1.05 ? 8   DG  B OP2    2  
ATOM 2892  O "O5'"  . DG  A 1 8  ? -79.588  -0.344  -5.245  1.00 0.77 ? 8   DG  B "O5'"  2  
ATOM 2893  C "C5'"  . DG  A 1 8  ? -78.789  -1.167  -4.388  1.00 0.85 ? 8   DG  B "C5'"  2  
ATOM 2894  C "C4'"  . DG  A 1 8  ? -77.483  -0.465  -3.978  1.00 0.78 ? 8   DG  B "C4'"  2  
ATOM 2895  O "O4'"  . DG  A 1 8  ? -76.746  -0.069  -5.159  1.00 0.76 ? 8   DG  B "O4'"  2  
ATOM 2896  C "C3'"  . DG  A 1 8  ? -77.741  0.800   -3.135  1.00 0.79 ? 8   DG  B "C3'"  2  
ATOM 2897  O "O3'"  . DG  A 1 8  ? -76.983  0.776   -1.917  1.00 0.86 ? 8   DG  B "O3'"  2  
ATOM 2898  C "C2'"  . DG  A 1 8  ? -77.281  1.950   -3.997  1.00 0.74 ? 8   DG  B "C2'"  2  
ATOM 2899  C "C1'"  . DG  A 1 8  ? -76.468  1.347   -5.128  1.00 0.71 ? 8   DG  B "C1'"  2  
ATOM 2900  N N9     . DG  A 1 8  ? -76.806  1.989   -6.408  1.00 0.69 ? 8   DG  B N9     2  
ATOM 2901  C C8     . DG  A 1 8  ? -78.024  2.145   -6.995  1.00 0.83 ? 8   DG  B C8     2  
ATOM 2902  N N7     . DG  A 1 8  ? -78.011  2.761   -8.133  1.00 0.83 ? 8   DG  B N7     2  
ATOM 2903  C C5     . DG  A 1 8  ? -76.663  3.047   -8.328  1.00 0.66 ? 8   DG  B C5     2  
ATOM 2904  C C6     . DG  A 1 8  ? -76.020  3.715   -9.404  1.00 0.64 ? 8   DG  B C6     2  
ATOM 2905  O O6     . DG  A 1 8  ? -76.527  4.194   -10.420 1.00 0.70 ? 8   DG  B O6     2  
ATOM 2906  N N1     . DG  A 1 8  ? -74.648  3.794   -9.206  1.00 0.66 ? 8   DG  B N1     2  
ATOM 2907  C C2     . DG  A 1 8  ? -73.977  3.294   -8.111  1.00 0.72 ? 8   DG  B C2     2  
ATOM 2908  N N2     . DG  A 1 8  ? -72.659  3.476   -8.097  1.00 0.93 ? 8   DG  B N2     2  
ATOM 2909  N N3     . DG  A 1 8  ? -74.579  2.663   -7.098  1.00 0.66 ? 8   DG  B N3     2  
ATOM 2910  C C4     . DG  A 1 8  ? -75.917  2.578   -7.274  1.00 0.62 ? 8   DG  B C4     2  
ATOM 2911  H "H5'"  . DG  A 1 8  ? -78.547  -2.096  -4.908  1.00 0.98 ? 8   DG  B "H5'"  2  
ATOM 2912  H "H5''" . DG  A 1 8  ? -79.360  -1.403  -3.490  1.00 1.03 ? 8   DG  B "H5''" 2  
ATOM 2913  H "H4'"  . DG  A 1 8  ? -76.874  -1.159  -3.400  1.00 0.83 ? 8   DG  B "H4'"  2  
ATOM 2914  H "H3'"  . DG  A 1 8  ? -78.804  0.904   -2.902  1.00 0.84 ? 8   DG  B "H3'"  2  
ATOM 2915  H "H2'"  . DG  A 1 8  ? -78.142  2.488   -4.398  1.00 0.75 ? 8   DG  B "H2'"  2  
ATOM 2916  H "H2''" . DG  A 1 8  ? -76.665  2.627   -3.416  1.00 0.78 ? 8   DG  B "H2''" 2  
ATOM 2917  H "H1'"  . DG  A 1 8  ? -75.401  1.491   -4.927  1.00 0.75 ? 8   DG  B "H1'"  2  
ATOM 2918  H H8     . DG  A 1 8  ? -78.942  1.789   -6.530  1.00 1.00 ? 8   DG  B H8     2  
ATOM 2919  H H1     . DG  A 1 8  ? -74.121  4.258   -9.932  1.00 0.73 ? 8   DG  B H1     2  
ATOM 2920  H H21    . DG  A 1 8  ? -72.208  3.954   -8.866  1.00 1.01 ? 8   DG  B H21    2  
ATOM 2921  H H22    . DG  A 1 8  ? -72.113  3.140   -7.319  1.00 1.04 ? 8   DG  B H22    2  
ATOM 2922  P P      . DG  A 1 9  ? -77.029  2.027   -0.892  1.00 0.95 ? 9   DG  B P      2  
ATOM 2923  O OP1    . DG  A 1 9  ? -76.394  1.613   0.377   1.00 1.13 ? 9   DG  B OP1    2  
ATOM 2924  O OP2    . DG  A 1 9  ? -78.408  2.568   -0.885  1.00 0.98 ? 9   DG  B OP2    2  
ATOM 2925  O "O5'"  . DG  A 1 9  ? -76.065  3.112   -1.605  1.00 0.87 ? 9   DG  B "O5'"  2  
ATOM 2926  C "C5'"  . DG  A 1 9  ? -74.663  2.850   -1.737  1.00 0.94 ? 9   DG  B "C5'"  2  
ATOM 2927  C "C4'"  . DG  A 1 9  ? -73.849  4.117   -2.039  1.00 0.87 ? 9   DG  B "C4'"  2  
ATOM 2928  O "O4'"  . DG  A 1 9  ? -73.852  4.376   -3.467  1.00 0.82 ? 9   DG  B "O4'"  2  
ATOM 2929  C "C3'"  . DG  A 1 9  ? -74.409  5.361   -1.334  1.00 0.85 ? 9   DG  B "C3'"  2  
ATOM 2930  O "O3'"  . DG  A 1 9  ? -73.378  6.001   -0.568  1.00 0.88 ? 9   DG  B "O3'"  2  
ATOM 2931  C "C2'"  . DG  A 1 9  ? -74.871  6.275   -2.447  1.00 0.79 ? 9   DG  B "C2'"  2  
ATOM 2932  C "C1'"  . DG  A 1 9  ? -74.248  5.736   -3.725  1.00 0.76 ? 9   DG  B "C1'"  2  
ATOM 2933  N N9     . DG  A 1 9  ? -75.193  5.832   -4.862  1.00 0.72 ? 9   DG  B N9     2  
ATOM 2934  C C8     . DG  A 1 9  ? -76.454  5.326   -4.995  1.00 0.75 ? 9   DG  B C8     2  
ATOM 2935  N N7     . DG  A 1 9  ? -77.048  5.603   -6.119  1.00 0.73 ? 9   DG  B N7     2  
ATOM 2936  C C5     . DG  A 1 9  ? -76.103  6.363   -6.801  1.00 0.67 ? 9   DG  B C5     2  
ATOM 2937  C C6     . DG  A 1 9  ? -76.166  6.964   -8.089  1.00 0.66 ? 9   DG  B C6     2  
ATOM 2938  O O6     . DG  A 1 9  ? -77.091  6.941   -8.899  1.00 0.69 ? 9   DG  B O6     2  
ATOM 2939  N N1     . DG  A 1 9  ? -74.993  7.642   -8.389  1.00 0.65 ? 9   DG  B N1     2  
ATOM 2940  C C2     . DG  A 1 9  ? -73.895  7.735   -7.560  1.00 0.67 ? 9   DG  B C2     2  
ATOM 2941  N N2     . DG  A 1 9  ? -72.862  8.436   -8.025  1.00 0.72 ? 9   DG  B N2     2  
ATOM 2942  N N3     . DG  A 1 9  ? -73.831  7.176   -6.354  1.00 0.68 ? 9   DG  B N3     2  
ATOM 2943  C C4     . DG  A 1 9  ? -74.964  6.508   -6.038  1.00 0.67 ? 9   DG  B C4     2  
ATOM 2944  H "H5'"  . DG  A 1 9  ? -74.515  2.136   -2.548  1.00 1.00 ? 9   DG  B "H5'"  2  
ATOM 2945  H "H5''" . DG  A 1 9  ? -74.301  2.409   -0.809  1.00 1.08 ? 9   DG  B "H5''" 2  
ATOM 2946  H "H4'"  . DG  A 1 9  ? -72.819  3.963   -1.712  1.00 0.91 ? 9   DG  B "H4'"  2  
ATOM 2947  H "H3'"  . DG  A 1 9  ? -75.245  5.101   -0.681  1.00 0.90 ? 9   DG  B "H3'"  2  
ATOM 2948  H "H2'"  . DG  A 1 9  ? -75.960  6.253   -2.530  1.00 0.81 ? 9   DG  B "H2'"  2  
ATOM 2949  H "H2''" . DG  A 1 9  ? -74.533  7.295   -2.263  1.00 0.80 ? 9   DG  B "H2''" 2  
ATOM 2950  H "H1'"  . DG  A 1 9  ? -73.351  6.317   -3.962  1.00 0.76 ? 9   DG  B "H1'"  2  
ATOM 2951  H H8     . DG  A 1 9  ? -76.933  4.741   -4.215  1.00 0.80 ? 9   DG  B H8     2  
ATOM 2952  H H1     . DG  A 1 9  ? -74.965  8.102   -9.290  1.00 0.66 ? 9   DG  B H1     2  
ATOM 2953  H H21    . DG  A 1 9  ? -72.910  8.861   -8.940  1.00 0.73 ? 9   DG  B H21    2  
ATOM 2954  H H22    . DG  A 1 9  ? -72.031  8.541   -7.463  1.00 0.77 ? 9   DG  B H22    2  
ATOM 2955  P P      . DA  A 1 10 ? -73.672  7.352   0.262   1.00 0.92 ? 10  DA  B P      2  
ATOM 2956  O OP1    . DA  A 1 10 ? -72.882  7.309   1.513   1.00 1.03 ? 10  DA  B OP1    2  
ATOM 2957  O OP2    . DA  A 1 10 ? -75.137  7.552   0.320   1.00 0.96 ? 10  DA  B OP2    2  
ATOM 2958  O "O5'"  . DA  A 1 10 ? -73.040  8.484   -0.692  1.00 0.84 ? 10  DA  B "O5'"  2  
ATOM 2959  C "C5'"  . DA  A 1 10 ? -71.914  8.176   -1.515  1.00 0.84 ? 10  DA  B "C5'"  2  
ATOM 2960  C "C4'"  . DA  A 1 10 ? -71.514  9.352   -2.417  1.00 0.80 ? 10  DA  B "C4'"  2  
ATOM 2961  O "O4'"  . DA  A 1 10 ? -72.256  9.288   -3.662  1.00 0.75 ? 10  DA  B "O4'"  2  
ATOM 2962  C "C3'"  . DA  A 1 10 ? -71.798  10.718  -1.766  1.00 0.83 ? 10  DA  B "C3'"  2  
ATOM 2963  O "O3'"  . DA  A 1 10 ? -70.629  11.553  -1.803  1.00 0.87 ? 10  DA  B "O3'"  2  
ATOM 2964  C "C2'"  . DA  A 1 10 ? -72.902  11.327  -2.602  1.00 0.78 ? 10  DA  B "C2'"  2  
ATOM 2965  C "C1'"  . DA  A 1 10 ? -72.929  10.541  -3.907  1.00 0.74 ? 10  DA  B "C1'"  2  
ATOM 2966  N N9     . DA  A 1 10 ? -74.317  10.339  -4.392  1.00 0.70 ? 10  DA  B N9     2  
ATOM 2967  C C8     . DA  A 1 10 ? -75.394  9.804   -3.743  1.00 0.71 ? 10  DA  B C8     2  
ATOM 2968  N N7     . DA  A 1 10 ? -76.499  9.774   -4.431  1.00 0.69 ? 10  DA  B N7     2  
ATOM 2969  C C5     . DA  A 1 10 ? -76.128  10.340  -5.649  1.00 0.65 ? 10  DA  B C5     2  
ATOM 2970  C C6     . DA  A 1 10 ? -76.843  10.604  -6.826  1.00 0.64 ? 10  DA  B C6     2  
ATOM 2971  N N6     . DA  A 1 10 ? -78.140  10.329  -6.970  1.00 0.63 ? 10  DA  B N6     2  
ATOM 2972  N N1     . DA  A 1 10 ? -76.172  11.171  -7.842  1.00 0.65 ? 10  DA  B N1     2  
ATOM 2973  C C2     . DA  A 1 10 ? -74.879  11.464  -7.714  1.00 0.67 ? 10  DA  B C2     2  
ATOM 2974  N N3     . DA  A 1 10 ? -74.109  11.258  -6.646  1.00 0.68 ? 10  DA  B N3     2  
ATOM 2975  C C4     . DA  A 1 10 ? -74.806  10.687  -5.639  1.00 0.67 ? 10  DA  B C4     2  
ATOM 2976  H "H5'"  . DA  A 1 10 ? -72.161  7.321   -2.144  1.00 0.87 ? 10  DA  B "H5'"  2  
ATOM 2977  H "H5''" . DA  A 1 10 ? -71.070  7.910   -0.874  1.00 0.92 ? 10  DA  B "H5''" 2  
ATOM 2978  H "H4'"  . DA  A 1 10 ? -70.449  9.283   -2.633  1.00 0.83 ? 10  DA  B "H4'"  2  
ATOM 2979  H "H3'"  . DA  A 1 10 ? -72.127  10.596  -0.731  1.00 0.88 ? 10  DA  B "H3'"  2  
ATOM 2980  H "H2'"  . DA  A 1 10 ? -73.861  11.227  -2.089  1.00 0.81 ? 10  DA  B "H2'"  2  
ATOM 2981  H "H2''" . DA  A 1 10 ? -72.690  12.377  -2.794  1.00 0.80 ? 10  DA  B "H2''" 2  
ATOM 2982  H "H1'"  . DA  A 1 10 ? -72.371  11.091  -4.666  1.00 0.75 ? 10  DA  B "H1'"  2  
ATOM 2983  H H8     . DA  A 1 10 ? -75.336  9.432   -2.721  1.00 0.76 ? 10  DA  B H8     2  
ATOM 2984  H H61    . DA  A 1 10 ? -78.610  10.539  -7.839  1.00 0.63 ? 10  DA  B H61    2  
ATOM 2985  H H62    . DA  A 1 10 ? -78.655  9.909   -6.207  1.00 0.64 ? 10  DA  B H62    2  
ATOM 2986  H H2     . DA  A 1 10 ? -74.397  11.919  -8.581  1.00 0.70 ? 10  DA  B H2     2  
ATOM 2987  P P      . DA  A 1 11 ? -70.657  13.050  -1.199  1.00 0.93 ? 11  DA  B P      2  
ATOM 2988  O OP1    . DA  A 1 11 ? -69.397  13.277  -0.454  1.00 1.04 ? 11  DA  B OP1    2  
ATOM 2989  O OP2    . DA  A 1 11 ? -71.957  13.254  -0.523  1.00 0.96 ? 11  DA  B OP2    2  
ATOM 2990  O "O5'"  . DA  A 1 11 ? -70.630  13.970  -2.525  1.00 0.85 ? 11  DA  B "O5'"  2  
ATOM 2991  C "C5'"  . DA  A 1 11 ? -69.933  13.535  -3.694  1.00 0.84 ? 11  DA  B "C5'"  2  
ATOM 2992  C "C4'"  . DA  A 1 11 ? -70.046  14.551  -4.841  1.00 0.79 ? 11  DA  B "C4'"  2  
ATOM 2993  O "O4'"  . DA  A 1 11 ? -71.216  14.252  -5.638  1.00 0.74 ? 11  DA  B "O4'"  2  
ATOM 2994  C "C3'"  . DA  A 1 11 ? -70.173  15.995  -4.328  1.00 0.79 ? 11  DA  B "C3'"  2  
ATOM 2995  O "O3'"  . DA  A 1 11 ? -69.195  16.842  -4.943  1.00 0.81 ? 11  DA  B "O3'"  2  
ATOM 2996  C "C2'"  . DA  A 1 11 ? -71.562  16.443  -4.728  1.00 0.75 ? 11  DA  B "C2'"  2  
ATOM 2997  C "C1'"  . DA  A 1 11 ? -72.119  15.378  -5.667  1.00 0.71 ? 11  DA  B "C1'"  2  
ATOM 2998  N N9     . DA  A 1 11 ? -73.486  14.974  -5.268  1.00 0.68 ? 11  DA  B N9     2  
ATOM 2999  C C8     . DA  A 1 11 ? -73.957  14.601  -4.042  1.00 0.71 ? 11  DA  B C8     2  
ATOM 3000  N N7     . DA  A 1 11 ? -75.219  14.292  -4.008  1.00 0.69 ? 11  DA  B N7     2  
ATOM 3001  C C5     . DA  A 1 11 ? -75.625  14.474  -5.330  1.00 0.65 ? 11  DA  B C5     2  
ATOM 3002  C C6     . DA  A 1 11 ? -76.857  14.314  -5.976  1.00 0.63 ? 11  DA  B C6     2  
ATOM 3003  N N6     . DA  A 1 11 ? -77.967  13.922  -5.351  1.00 0.64 ? 11  DA  B N6     2  
ATOM 3004  N N1     . DA  A 1 11 ? -76.906  14.581  -7.291  1.00 0.62 ? 11  DA  B N1     2  
ATOM 3005  C C2     . DA  A 1 11 ? -75.812  14.979  -7.936  1.00 0.63 ? 11  DA  B C2     2  
ATOM 3006  N N3     . DA  A 1 11 ? -74.598  15.162  -7.423  1.00 0.64 ? 11  DA  B N3     2  
ATOM 3007  C C4     . DA  A 1 11 ? -74.577  14.888  -6.102  1.00 0.65 ? 11  DA  B C4     2  
ATOM 3008  H "H5'"  . DA  A 1 11 ? -70.350  12.583  -4.020  1.00 0.85 ? 11  DA  B "H5'"  2  
ATOM 3009  H "H5''" . DA  A 1 11 ? -68.881  13.397  -3.444  1.00 0.94 ? 11  DA  B "H5''" 2  
ATOM 3010  H "H4'"  . DA  A 1 11 ? -69.160  14.476  -5.475  1.00 0.80 ? 11  DA  B "H4'"  2  
ATOM 3011  H "H3'"  . DA  A 1 11 ? -70.059  16.036  -3.240  1.00 0.84 ? 11  DA  B "H3'"  2  
ATOM 3012  H "H2'"  . DA  A 1 11 ? -72.200  16.537  -3.847  1.00 0.78 ? 11  DA  B "H2'"  2  
ATOM 3013  H "H2''" . DA  A 1 11 ? -71.502  17.401  -5.242  1.00 0.76 ? 11  DA  B "H2''" 2  
ATOM 3014  H "H1'"  . DA  A 1 11 ? -72.151  15.773  -6.685  1.00 0.70 ? 11  DA  B "H1'"  2  
ATOM 3015  H H8     . DA  A 1 11 ? -73.325  14.575  -3.156  1.00 0.76 ? 11  DA  B H8     2  
ATOM 3016  H H61    . DA  A 1 11 ? -78.829  13.824  -5.869  1.00 0.64 ? 11  DA  B H61    2  
ATOM 3017  H H62    . DA  A 1 11 ? -77.946  13.721  -4.362  1.00 0.67 ? 11  DA  B H62    2  
ATOM 3018  H H2     . DA  A 1 11 ? -75.923  15.173  -9.002  1.00 0.65 ? 11  DA  B H2     2  
ATOM 3019  P P      . DG  A 1 12 ? -69.106  18.413  -4.575  1.00 0.84 ? 12  DG  B P      2  
ATOM 3020  O OP1    . DG  A 1 12 ? -67.771  18.905  -4.987  1.00 0.92 ? 12  DG  B OP1    2  
ATOM 3021  O OP2    . DG  A 1 12 ? -69.557  18.588  -3.175  1.00 0.88 ? 12  DG  B OP2    2  
ATOM 3022  O "O5'"  . DG  A 1 12 ? -70.210  19.076  -5.551  1.00 0.78 ? 12  DG  B "O5'"  2  
ATOM 3023  C "C5'"  . DG  A 1 12 ? -70.113  18.884  -6.966  1.00 0.78 ? 12  DG  B "C5'"  2  
ATOM 3024  C "C4'"  . DG  A 1 12 ? -71.127  19.733  -7.749  1.00 0.74 ? 12  DG  B "C4'"  2  
ATOM 3025  O "O4'"  . DG  A 1 12 ? -72.422  19.082  -7.738  1.00 0.70 ? 12  DG  B "O4'"  2  
ATOM 3026  C "C3'"  . DG  A 1 12 ? -71.302  21.146  -7.165  1.00 0.74 ? 12  DG  B "C3'"  2  
ATOM 3027  O "O3'"  . DG  A 1 12 ? -71.121  22.142  -8.183  1.00 0.76 ? 12  DG  B "O3'"  2  
ATOM 3028  C "C2'"  . DG  A 1 12 ? -72.725  21.196  -6.653  1.00 0.72 ? 12  DG  B "C2'"  2  
ATOM 3029  C "C1'"  . DG  A 1 12 ? -73.436  19.970  -7.215  1.00 0.68 ? 12  DG  B "C1'"  2  
ATOM 3030  N N9     . DG  A 1 12 ? -74.257  19.299  -6.179  1.00 0.66 ? 12  DG  B N9     2  
ATOM 3031  C C8     . DG  A 1 12 ? -73.906  18.896  -4.922  1.00 0.70 ? 12  DG  B C8     2  
ATOM 3032  N N7     . DG  A 1 12 ? -74.852  18.318  -4.241  1.00 0.68 ? 12  DG  B N7     2  
ATOM 3033  C C5     . DG  A 1 12 ? -75.936  18.340  -5.117  1.00 0.62 ? 12  DG  B C5     2  
ATOM 3034  C C6     . DG  A 1 12 ? -77.263  17.853  -4.942  1.00 0.60 ? 12  DG  B C6     2  
ATOM 3035  O O6     . DG  A 1 12 ? -77.749  17.292  -3.960  1.00 0.62 ? 12  DG  B O6     2  
ATOM 3036  N N1     . DG  A 1 12 ? -78.040  18.077  -6.071  1.00 0.56 ? 12  DG  B N1     2  
ATOM 3037  C C2     . DG  A 1 12 ? -77.599  18.690  -7.226  1.00 0.55 ? 12  DG  B C2     2  
ATOM 3038  N N2     . DG  A 1 12 ? -78.495  18.829  -8.204  1.00 0.55 ? 12  DG  B N2     2  
ATOM 3039  N N3     . DG  A 1 12 ? -76.354  19.146  -7.396  1.00 0.58 ? 12  DG  B N3     2  
ATOM 3040  C C4     . DG  A 1 12 ? -75.580  18.939  -6.306  1.00 0.61 ? 12  DG  B C4     2  
ATOM 3041  H "H5'"  . DG  A 1 12 ? -70.285  17.831  -7.191  1.00 0.79 ? 12  DG  B "H5'"  2  
ATOM 3042  H "H5''" . DG  A 1 12 ? -69.106  19.152  -7.288  1.00 0.82 ? 12  DG  B "H5''" 2  
ATOM 3043  H "H4'"  . DG  A 1 12 ? -70.786  19.821  -8.781  1.00 0.75 ? 12  DG  B "H4'"  2  
ATOM 3044  H "H3'"  . DG  A 1 12 ? -70.596  21.322  -6.348  1.00 0.77 ? 12  DG  B "H3'"  2  
ATOM 3045  H "H2'"  . DG  A 1 12 ? -72.738  21.169  -5.562  1.00 0.75 ? 12  DG  B "H2'"  2  
ATOM 3046  H "H2''" . DG  A 1 12 ? -73.208  22.107  -7.008  1.00 0.73 ? 12  DG  B "H2''" 2  
ATOM 3047  H "H1'"  . DG  A 1 12 ? -74.086  20.274  -8.036  1.00 0.66 ? 12  DG  B "H1'"  2  
ATOM 3048  H H8     . DG  A 1 12 ? -72.910  19.057  -4.514  1.00 0.75 ? 12  DG  B H8     2  
ATOM 3049  H H1     . DG  A 1 12 ? -78.998  17.761  -6.023  1.00 0.56 ? 12  DG  B H1     2  
ATOM 3050  H H21    . DG  A 1 12 ? -79.436  18.487  -8.079  1.00 0.55 ? 12  DG  B H21    2  
ATOM 3051  H H22    . DG  A 1 12 ? -78.229  19.279  -9.069  1.00 0.57 ? 12  DG  B H22    2  
ATOM 3052  P P      . DT  A 1 13 ? -71.119  23.715  -7.814  1.00 0.79 ? 13  DT  B P      2  
ATOM 3053  O OP1    . DT  A 1 13 ? -70.360  24.436  -8.863  1.00 0.87 ? 13  DT  B OP1    2  
ATOM 3054  O OP2    . DT  A 1 13 ? -70.729  23.860  -6.394  1.00 0.82 ? 13  DT  B OP2    2  
ATOM 3055  O "O5'"  . DT  A 1 13 ? -72.672  24.123  -7.952  1.00 0.71 ? 13  DT  B "O5'"  2  
ATOM 3056  C "C5'"  . DT  A 1 13 ? -73.178  24.607  -9.202  1.00 0.85 ? 13  DT  B "C5'"  2  
ATOM 3057  C "C4'"  . DT  A 1 13 ? -74.712  24.671  -9.216  1.00 0.76 ? 13  DT  B "C4'"  2  
ATOM 3058  O "O4'"  . DT  A 1 13 ? -75.254  23.526  -8.507  1.00 0.69 ? 13  DT  B "O4'"  2  
ATOM 3059  C "C3'"  . DT  A 1 13 ? -75.257  25.944  -8.534  1.00 0.75 ? 13  DT  B "C3'"  2  
ATOM 3060  O "O3'"  . DT  A 1 13 ? -76.114  26.672  -9.416  1.00 0.80 ? 13  DT  B "O3'"  2  
ATOM 3061  C "C2'"  . DT  A 1 13 ? -76.061  25.446  -7.352  1.00 0.67 ? 13  DT  B "C2'"  2  
ATOM 3062  C "C1'"  . DT  A 1 13 ? -76.269  23.956  -7.575  1.00 0.63 ? 13  DT  B "C1'"  2  
ATOM 3063  N N1     . DT  A 1 13 ? -76.208  23.192  -6.290  1.00 0.59 ? 13  DT  B N1     2  
ATOM 3064  C C2     . DT  A 1 13 ? -77.330  22.461  -5.917  1.00 0.56 ? 13  DT  B C2     2  
ATOM 3065  O O2     . DT  A 1 13 ? -78.343  22.426  -6.610  1.00 0.57 ? 13  DT  B O2     2  
ATOM 3066  N N3     . DT  A 1 13 ? -77.241  21.768  -4.726  1.00 0.57 ? 13  DT  B N3     2  
ATOM 3067  C C4     . DT  A 1 13 ? -76.150  21.735  -3.883  1.00 0.59 ? 13  DT  B C4     2  
ATOM 3068  O O4     . DT  A 1 13 ? -76.180  21.076  -2.845  1.00 0.62 ? 13  DT  B O4     2  
ATOM 3069  C C5     . DT  A 1 13 ? -75.027  22.518  -4.342  1.00 0.62 ? 13  DT  B C5     2  
ATOM 3070  C C7     . DT  A 1 13 ? -73.758  22.557  -3.487  1.00 0.69 ? 13  DT  B C7     2  
ATOM 3071  C C6     . DT  A 1 13 ? -75.084  23.211  -5.503  1.00 0.62 ? 13  DT  B C6     2  
ATOM 3072  H "H5'"  . DT  A 1 13 ? -72.846  23.938  -9.997  1.00 0.98 ? 13  DT  B "H5'"  2  
ATOM 3073  H "H5''" . DT  A 1 13 ? -72.774  25.601  -9.391  1.00 1.03 ? 13  DT  B "H5''" 2  
ATOM 3074  H "H4'"  . DT  A 1 13 ? -75.061  24.642  -10.250 1.00 0.81 ? 13  DT  B "H4'"  2  
ATOM 3075  H "H3'"  . DT  A 1 13 ? -74.445  26.594  -8.194  1.00 0.80 ? 13  DT  B "H3'"  2  
ATOM 3076  H "H2'"  . DT  A 1 13 ? -75.515  25.616  -6.426  1.00 0.69 ? 13  DT  B "H2'"  2  
ATOM 3077  H "H2''" . DT  A 1 13 ? -77.025  25.958  -7.310  1.00 0.68 ? 13  DT  B "H2''" 2  
ATOM 3078  H "H1'"  . DT  A 1 13 ? -77.247  23.805  -8.047  1.00 0.62 ? 13  DT  B "H1'"  2  
ATOM 3079  H H3     . DT  A 1 13 ? -78.056  21.243  -4.439  1.00 0.57 ? 13  DT  B H3     2  
ATOM 3080  H H71    . DT  A 1 13 ? -73.929  23.187  -2.612  1.00 1.29 ? 13  DT  B H71    2  
ATOM 3081  H H72    . DT  A 1 13 ? -72.927  22.961  -4.066  1.00 1.19 ? 13  DT  B H72    2  
ATOM 3082  H H73    . DT  A 1 13 ? -73.517  21.546  -3.161  1.00 1.26 ? 13  DT  B H73    2  
ATOM 3083  H H6     . DT  A 1 13 ? -74.219  23.801  -5.816  1.00 0.66 ? 13  DT  B H6     2  
ATOM 3084  P P      . DT  A 1 14 ? -76.782  28.055  -8.928  1.00 0.83 ? 14  DT  B P      2  
ATOM 3085  O OP1    . DT  A 1 14 ? -76.880  28.961  -10.094 1.00 0.94 ? 14  DT  B OP1    2  
ATOM 3086  O OP2    . DT  A 1 14 ? -76.078  28.500  -7.704  1.00 0.85 ? 14  DT  B OP2    2  
ATOM 3087  O "O5'"  . DT  A 1 14 ? -78.267  27.596  -8.518  1.00 0.74 ? 14  DT  B "O5'"  2  
ATOM 3088  C "C5'"  . DT  A 1 14 ? -79.166  27.145  -9.529  1.00 0.84 ? 14  DT  B "C5'"  2  
ATOM 3089  C "C4'"  . DT  A 1 14 ? -80.538  26.767  -8.966  1.00 0.77 ? 14  DT  B "C4'"  2  
ATOM 3090  O "O4'"  . DT  A 1 14 ? -80.388  25.774  -7.924  1.00 0.71 ? 14  DT  B "O4'"  2  
ATOM 3091  C "C3'"  . DT  A 1 14 ? -81.277  27.976  -8.366  1.00 0.78 ? 14  DT  B "C3'"  2  
ATOM 3092  O "O3'"  . DT  A 1 14 ? -82.590  28.091  -8.931  1.00 0.82 ? 14  DT  B "O3'"  2  
ATOM 3093  C "C2'"  . DT  A 1 14 ? -81.379  27.681  -6.889  1.00 0.73 ? 14  DT  B "C2'"  2  
ATOM 3094  C "C1'"  . DT  A 1 14 ? -81.088  26.193  -6.738  1.00 0.67 ? 14  DT  B "C1'"  2  
ATOM 3095  N N1     . DT  A 1 14 ? -80.291  25.904  -5.514  1.00 0.63 ? 14  DT  B N1     2  
ATOM 3096  C C2     . DT  A 1 14 ? -80.838  25.041  -4.570  1.00 0.59 ? 14  DT  B C2     2  
ATOM 3097  O O2     . DT  A 1 14 ? -81.947  24.534  -4.718  1.00 0.59 ? 14  DT  B O2     2  
ATOM 3098  N N3     . DT  A 1 14 ? -80.066  24.792  -3.450  1.00 0.58 ? 14  DT  B N3     2  
ATOM 3099  C C4     . DT  A 1 14 ? -78.815  25.320  -3.190  1.00 0.62 ? 14  DT  B C4     2  
ATOM 3100  O O4     . DT  A 1 14 ? -78.217  25.025  -2.158  1.00 0.64 ? 14  DT  B O4     2  
ATOM 3101  C C5     . DT  A 1 14 ? -78.324  26.209  -4.222  1.00 0.67 ? 14  DT  B C5     2  
ATOM 3102  C C7     . DT  A 1 14 ? -76.963  26.884  -4.050  1.00 0.76 ? 14  DT  B C7     2  
ATOM 3103  C C6     . DT  A 1 14 ? -79.056  26.465  -5.326  1.00 0.67 ? 14  DT  B C6     2  
ATOM 3104  H "H5'"  . DT  A 1 14 ? -78.733  26.271  -10.017 1.00 0.98 ? 14  DT  B "H5'"  2  
ATOM 3105  H "H5''" . DT  A 1 14 ? -79.292  27.936  -10.264 1.00 0.95 ? 14  DT  B "H5''" 2  
ATOM 3106  H "H4'"  . DT  A 1 14 ? -81.143  26.346  -9.769  1.00 0.80 ? 14  DT  B "H4'"  2  
ATOM 3107  H "H3'"  . DT  A 1 14 ? -80.720  28.902  -8.531  1.00 0.82 ? 14  DT  B "H3'"  2  
ATOM 3108  H "H2'"  . DT  A 1 14 ? -80.651  28.274  -6.334  1.00 0.76 ? 14  DT  B "H2'"  2  
ATOM 3109  H "H2''" . DT  A 1 14 ? -82.381  27.905  -6.532  1.00 0.77 ? 14  DT  B "H2''" 2  
ATOM 3110  H "H1'"  . DT  A 1 14 ? -82.038  25.653  -6.698  1.00 0.67 ? 14  DT  B "H1'"  2  
ATOM 3111  H H3     . DT  A 1 14 ? -80.447  24.160  -2.762  1.00 0.57 ? 14  DT  B H3     2  
ATOM 3112  H H71    . DT  A 1 14 ? -76.549  27.142  -5.026  1.00 1.13 ? 14  DT  B H71    2  
ATOM 3113  H H72    . DT  A 1 14 ? -76.283  26.207  -3.536  1.00 1.27 ? 14  DT  B H72    2  
ATOM 3114  H H73    . DT  A 1 14 ? -77.083  27.793  -3.460  1.00 1.35 ? 14  DT  B H73    2  
ATOM 3115  H H6     . DT  A 1 14 ? -78.651  27.130  -6.088  1.00 0.73 ? 14  DT  B H6     2  
ATOM 3116  P P      . DC  A 1 15 ? -83.587  29.273  -8.473  1.00 0.87 ? 15  DC  B P      2  
ATOM 3117  O OP1    . DC  A 1 15 ? -84.413  29.655  -9.640  1.00 1.04 ? 15  DC  B OP1    2  
ATOM 3118  O OP2    . DC  A 1 15 ? -82.791  30.299  -7.766  1.00 0.93 ? 15  DC  B OP2    2  
ATOM 3119  O "O5'"  . DC  A 1 15 ? -84.540  28.538  -7.397  1.00 0.78 ? 15  DC  B "O5'"  2  
ATOM 3120  C "C5'"  . DC  A 1 15 ? -85.325  27.408  -7.786  1.00 0.88 ? 15  DC  B "C5'"  2  
ATOM 3121  C "C4'"  . DC  A 1 15 ? -86.560  27.216  -6.891  1.00 0.86 ? 15  DC  B "C4'"  2  
ATOM 3122  O "O4'"  . DC  A 1 15 ? -86.189  26.484  -5.701  1.00 0.80 ? 15  DC  B "O4'"  2  
ATOM 3123  C "C3'"  . DC  A 1 15 ? -87.179  28.550  -6.451  1.00 0.90 ? 15  DC  B "C3'"  2  
ATOM 3124  O "O3'"  . DC  A 1 15 ? -88.578  28.592  -6.752  1.00 1.04 ? 15  DC  B "O3'"  2  
ATOM 3125  C "C2'"  . DC  A 1 15 ? -86.979  28.623  -4.953  1.00 0.87 ? 15  DC  B "C2'"  2  
ATOM 3126  C "C1'"  . DC  A 1 15 ? -86.335  27.306  -4.523  1.00 0.79 ? 15  DC  B "C1'"  2  
ATOM 3127  N N1     . DC  A 1 15 ? -85.004  27.532  -3.887  1.00 0.72 ? 15  DC  B N1     2  
ATOM 3128  C C2     . DC  A 1 15 ? -84.757  26.944  -2.649  1.00 0.70 ? 15  DC  B C2     2  
ATOM 3129  O O2     . DC  A 1 15 ? -85.633  26.284  -2.096  1.00 0.74 ? 15  DC  B O2     2  
ATOM 3130  N N3     . DC  A 1 15 ? -83.536  27.124  -2.078  1.00 0.69 ? 15  DC  B N3     2  
ATOM 3131  C C4     . DC  A 1 15 ? -82.589  27.848  -2.686  1.00 0.71 ? 15  DC  B C4     2  
ATOM 3132  N N4     . DC  A 1 15 ? -81.400  27.990  -2.095  1.00 0.77 ? 15  DC  B N4     2  
ATOM 3133  C C5     . DC  A 1 15 ? -82.833  28.458  -3.957  1.00 0.72 ? 15  DC  B C5     2  
ATOM 3134  C C6     . DC  A 1 15 ? -84.046  28.276  -4.519  1.00 0.72 ? 15  DC  B C6     2  
ATOM 3135  H "H5'"  . DC  A 1 15 ? -84.707  26.512  -7.731  1.00 0.98 ? 15  DC  B "H5'"  2  
ATOM 3136  H "H5''" . DC  A 1 15 ? -85.652  27.548  -8.817  1.00 1.02 ? 15  DC  B "H5''" 2  
ATOM 3137  H "H4'"  . DC  A 1 15 ? -87.308  26.641  -7.438  1.00 0.95 ? 15  DC  B "H4'"  2  
ATOM 3138  H "H3'"  . DC  A 1 15 ? -86.677  29.390  -6.936  1.00 0.92 ? 15  DC  B "H3'"  2  
ATOM 3139  H "H2'"  . DC  A 1 15 ? -86.336  29.463  -4.696  1.00 0.86 ? 15  DC  B "H2'"  2  
ATOM 3140  H "H2''" . DC  A 1 15 ? -87.949  28.745  -4.463  1.00 0.96 ? 15  DC  B "H2''" 2  
ATOM 3141  H "H1'"  . DC  A 1 15 ? -87.000  26.795  -3.821  1.00 0.84 ? 15  DC  B "H1'"  2  
ATOM 3142  H H41    . DC  A 1 15 ? -81.226  27.558  -1.198  1.00 0.79 ? 15  DC  B H41    2  
ATOM 3143  H H42    . DC  A 1 15 ? -80.673  28.529  -2.545  1.00 0.82 ? 15  DC  B H42    2  
ATOM 3144  H H5     . DC  A 1 15 ? -82.067  29.051  -4.456  1.00 0.76 ? 15  DC  B H5     2  
ATOM 3145  H H6     . DC  A 1 15 ? -84.269  28.731  -5.483  1.00 0.75 ? 15  DC  B H6     2  
ATOM 3146  P P      . DG  A 1 16 ? -89.455  29.889  -6.360  1.00 1.15 ? 16  DG  B P      2  
ATOM 3147  O OP1    . DG  A 1 16 ? -90.755  29.799  -7.063  1.00 1.30 ? 16  DG  B OP1    2  
ATOM 3148  O OP2    . DG  A 1 16 ? -88.607  31.089  -6.533  1.00 1.12 ? 16  DG  B OP2    2  
ATOM 3149  O "O5'"  . DG  A 1 16 ? -89.715  29.678  -4.782  1.00 1.20 ? 16  DG  B "O5'"  2  
ATOM 3150  C "C5'"  . DG  A 1 16 ? -90.833  28.911  -4.322  1.00 1.29 ? 16  DG  B "C5'"  2  
ATOM 3151  C "C4'"  . DG  A 1 16 ? -90.959  28.942  -2.792  1.00 1.37 ? 16  DG  B "C4'"  2  
ATOM 3152  O "O4'"  . DG  A 1 16 ? -89.677  28.653  -2.183  1.00 1.23 ? 16  DG  B "O4'"  2  
ATOM 3153  C "C3'"  . DG  A 1 16 ? -91.427  30.314  -2.276  1.00 1.54 ? 16  DG  B "C3'"  2  
ATOM 3154  O "O3'"  . DG  A 1 16 ? -92.543  30.172  -1.388  1.00 1.74 ? 16  DG  B "O3'"  2  
ATOM 3155  C "C2'"  . DG  A 1 16 ? -90.237  30.885  -1.539  1.00 1.49 ? 16  DG  B "C2'"  2  
ATOM 3156  C "C1'"  . DG  A 1 16 ? -89.293  29.721  -1.289  1.00 1.31 ? 16  DG  B "C1'"  2  
ATOM 3157  N N9     . DG  A 1 16 ? -87.890  30.125  -1.499  1.00 1.20 ? 16  DG  B N9     2  
ATOM 3158  C C8     . DG  A 1 16 ? -87.309  30.693  -2.596  1.00 1.16 ? 16  DG  B C8     2  
ATOM 3159  N N7     . DG  A 1 16 ? -86.041  30.957  -2.475  1.00 1.12 ? 16  DG  B N7     2  
ATOM 3160  C C5     . DG  A 1 16 ? -85.748  30.526  -1.183  1.00 1.12 ? 16  DG  B C5     2  
ATOM 3161  C C6     . DG  A 1 16 ? -84.517  30.550  -0.471  1.00 1.12 ? 16  DG  B C6     2  
ATOM 3162  O O6     . DG  A 1 16 ? -83.424  30.965  -0.849  1.00 1.16 ? 16  DG  B O6     2  
ATOM 3163  N N1     . DG  A 1 16 ? -84.659  30.017  0.806   1.00 1.14 ? 16  DG  B N1     2  
ATOM 3164  C C2     . DG  A 1 16 ? -85.836  29.524  1.333   1.00 1.17 ? 16  DG  B C2     2  
ATOM 3165  N N2     . DG  A 1 16 ? -85.778  29.062  2.584   1.00 1.23 ? 16  DG  B N2     2  
ATOM 3166  N N3     . DG  A 1 16 ? -86.991  29.500  0.666   1.00 1.19 ? 16  DG  B N3     2  
ATOM 3167  C C4     . DG  A 1 16 ? -86.874  30.014  -0.580  1.00 1.16 ? 16  DG  B C4     2  
ATOM 3168  H "H5'"  . DG  A 1 16 ? -90.712  27.877  -4.649  1.00 1.24 ? 16  DG  B "H5'"  2  
ATOM 3169  H "H5''" . DG  A 1 16 ? -91.745  29.316  -4.762  1.00 1.40 ? 16  DG  B "H5''" 2  
ATOM 3170  H "H4'"  . DG  A 1 16 ? -91.677  28.182  -2.482  1.00 1.46 ? 16  DG  B "H4'"  2  
ATOM 3171  H "H3'"  . DG  A 1 16 ? -91.706  30.970  -3.104  1.00 1.57 ? 16  DG  B "H3'"  2  
ATOM 3172  H "H2'"  . DG  A 1 16 ? -89.739  31.638  -2.153  1.00 1.48 ? 16  DG  B "H2'"  2  
ATOM 3173  H "H2''" . DG  A 1 16 ? -90.552  31.329  -0.594  1.00 1.65 ? 16  DG  B "H2''" 2  
ATOM 3174  H "H1'"  . DG  A 1 16 ? -89.412  29.377  -0.260  1.00 1.36 ? 16  DG  B "H1'"  2  
ATOM 3175  H H8     . DG  A 1 16 ? -87.865  30.905  -3.509  1.00 1.20 ? 16  DG  B H8     2  
ATOM 3176  H H1     . DG  A 1 16 ? -83.826  30.003  1.381   1.00 1.17 ? 16  DG  B H1     2  
ATOM 3177  H H21    . DG  A 1 16 ? -84.904  29.079  3.092   1.00 1.24 ? 16  DG  B H21    2  
ATOM 3178  H H22    . DG  A 1 16 ? -86.610  28.699  3.027   1.00 1.29 ? 16  DG  B H22    2  
ATOM 3179  P P      . DA  A 1 17 ? -93.197  31.467  -0.680  1.00 1.98 ? 17  DA  B P      2  
ATOM 3180  O OP1    . DA  A 1 17 ? -94.644  31.219  -0.495  1.00 2.18 ? 17  DA  B OP1    2  
ATOM 3181  O OP2    . DA  A 1 17 ? -92.740  32.670  -1.410  1.00 1.99 ? 17  DA  B OP2    2  
ATOM 3182  O "O5'"  . DA  A 1 17 ? -92.496  31.459  0.771   1.00 1.97 ? 17  DA  B "O5'"  2  
ATOM 3183  C "C5'"  . DA  A 1 17 ? -92.209  30.215  1.413   1.00 1.92 ? 17  DA  B "C5'"  2  
ATOM 3184  C "C4'"  . DA  A 1 17 ? -91.649  30.403  2.830   1.00 1.98 ? 17  DA  B "C4'"  2  
ATOM 3185  O "O4'"  . DA  A 1 17 ? -90.206  30.449  2.780   1.00 1.81 ? 17  DA  B "O4'"  2  
ATOM 3186  C "C3'"  . DA  A 1 17 ? -92.144  31.700  3.487   1.00 2.20 ? 17  DA  B "C3'"  2  
ATOM 3187  O "O3'"  . DA  A 1 17 ? -92.713  31.426  4.772   1.00 2.37 ? 17  DA  B "O3'"  2  
ATOM 3188  C "C2'"  . DA  A 1 17 ? -90.916  32.568  3.639   1.00 2.16 ? 17  DA  B "C2'"  2  
ATOM 3189  C "C1'"  . DA  A 1 17 ? -89.718  31.660  3.392   1.00 1.93 ? 17  DA  B "C1'"  2  
ATOM 3190  N N9     . DA  A 1 17 ? -88.709  32.324  2.540   1.00 1.82 ? 17  DA  B N9     2  
ATOM 3191  C C8     . DA  A 1 17 ? -88.862  32.959  1.338   1.00 1.81 ? 17  DA  B C8     2  
ATOM 3192  N N7     . DA  A 1 17 ? -87.772  33.469  0.845   1.00 1.74 ? 17  DA  B N7     2  
ATOM 3193  C C5     . DA  A 1 17 ? -86.812  33.144  1.803   1.00 1.71 ? 17  DA  B C5     2  
ATOM 3194  C C6     . DA  A 1 17 ? -85.436  33.391  1.899   1.00 1.69 ? 17  DA  B C6     2  
ATOM 3195  N N6     . DA  A 1 17 ? -84.750  34.064  0.977   1.00 1.69 ? 17  DA  B N6     2  
ATOM 3196  N N1     . DA  A 1 17 ? -84.799  32.928  2.986   1.00 1.70 ? 17  DA  B N1     2  
ATOM 3197  C C2     . DA  A 1 17 ? -85.467  32.256  3.924   1.00 1.73 ? 17  DA  B C2     2  
ATOM 3198  N N3     . DA  A 1 17 ? -86.763  31.969  3.931   1.00 1.76 ? 17  DA  B N3     2  
ATOM 3199  C C4     . DA  A 1 17 ? -87.377  32.448  2.834   1.00 1.75 ? 17  DA  B C4     2  
ATOM 3200  H "H5'"  . DA  A 1 17 ? -91.477  29.672  0.813   1.00 1.75 ? 17  DA  B "H5'"  2  
ATOM 3201  H "H5''" . DA  A 1 17 ? -93.127  29.630  1.464   1.00 2.01 ? 17  DA  B "H5''" 2  
ATOM 3202  H "H4'"  . DA  A 1 17 ? -91.952  29.557  3.450   1.00 2.02 ? 17  DA  B "H4'"  2  
ATOM 3203  H "H3'"  . DA  A 1 17 ? -92.886  32.203  2.858   1.00 2.27 ? 17  DA  B "H3'"  2  
ATOM 3204  H "HO3'" . DA  A 1 17 ? -92.551  30.502  4.964   1.00 2.51 ? 17  DA  B "HO3'" 2  
ATOM 3205  H "H2'"  . DA  A 1 17 ? -90.930  33.375  2.904   1.00 2.19 ? 17  DA  B "H2'"  2  
ATOM 3206  H "H2''" . DA  A 1 17 ? -90.876  32.986  4.647   1.00 2.30 ? 17  DA  B "H2''" 2  
ATOM 3207  H "H1'"  . DA  A 1 17 ? -89.259  31.403  4.347   1.00 1.95 ? 17  DA  B "H1'"  2  
ATOM 3208  H H8     . DA  A 1 17 ? -89.825  33.036  0.833   1.00 1.87 ? 17  DA  B H8     2  
ATOM 3209  H H61    . DA  A 1 17 ? -83.759  34.213  1.095   1.00 1.71 ? 17  DA  B H61    2  
ATOM 3210  H H62    . DA  A 1 17 ? -85.221  34.425  0.162   1.00 1.70 ? 17  DA  B H62    2  
ATOM 3211  H H2     . DA  A 1 17 ? -84.888  31.902  4.774   1.00 1.75 ? 17  DA  B H2     2  
ATOM 3212  O "O5'"  . DT  B 2 1  ? -75.986  34.033  4.014   1.00 2.31 ? 18  DT  C "O5'"  2  
ATOM 3213  C "C5'"  . DT  B 2 1  ? -75.960  34.429  5.389   1.00 2.42 ? 18  DT  C "C5'"  2  
ATOM 3214  C "C4'"  . DT  B 2 1  ? -77.003  33.668  6.211   1.00 2.29 ? 18  DT  C "C4'"  2  
ATOM 3215  O "O4'"  . DT  B 2 1  ? -78.310  34.253  6.002   1.00 2.25 ? 18  DT  C "O4'"  2  
ATOM 3216  C "C3'"  . DT  B 2 1  ? -77.075  32.188  5.810   1.00 2.08 ? 18  DT  C "C3'"  2  
ATOM 3217  O "O3'"  . DT  B 2 1  ? -76.970  31.334  6.952   1.00 2.08 ? 18  DT  C "O3'"  2  
ATOM 3218  C "C2'"  . DT  B 2 1  ? -78.425  32.015  5.160   1.00 1.90 ? 18  DT  C "C2'"  2  
ATOM 3219  C "C1'"  . DT  B 2 1  ? -79.223  33.275  5.458   1.00 2.02 ? 18  DT  C "C1'"  2  
ATOM 3220  N N1     . DT  B 2 1  ? -79.878  33.775  4.219   1.00 1.96 ? 18  DT  C N1     2  
ATOM 3221  C C2     . DT  B 2 1  ? -81.214  33.457  4.016   1.00 1.85 ? 18  DT  C C2     2  
ATOM 3222  O O2     . DT  B 2 1  ? -81.859  32.801  4.831   1.00 1.82 ? 18  DT  C O2     2  
ATOM 3223  N N3     . DT  B 2 1  ? -81.781  33.921  2.844   1.00 1.82 ? 18  DT  C N3     2  
ATOM 3224  C C4     . DT  B 2 1  ? -81.140  34.660  1.871   1.00 1.88 ? 18  DT  C C4     2  
ATOM 3225  O O4     . DT  B 2 1  ? -81.739  35.012  0.855   1.00 1.86 ? 18  DT  C O4     2  
ATOM 3226  C C5     . DT  B 2 1  ? -79.752  34.948  2.164   1.00 2.00 ? 18  DT  C C5     2  
ATOM 3227  C C7     . DT  B 2 1  ? -78.929  35.763  1.171   1.00 2.11 ? 18  DT  C C7     2  
ATOM 3228  C C6     . DT  B 2 1  ? -79.174  34.509  3.303   1.00 2.04 ? 18  DT  C C6     2  
ATOM 3229  H "H5'"  . DT  B 2 1  ? -76.164  35.498  5.455   1.00 2.56 ? 18  DT  C "H5'"  2  
ATOM 3230  H "H5''" . DT  B 2 1  ? -74.970  34.228  5.801   1.00 2.50 ? 18  DT  C "H5''" 2  
ATOM 3231  H "H4'"  . DT  B 2 1  ? -76.745  33.738  7.267   1.00 2.39 ? 18  DT  C "H4'"  2  
ATOM 3232  H "H3'"  . DT  B 2 1  ? -76.278  31.937  5.102   1.00 2.09 ? 18  DT  C "H3'"  2  
ATOM 3233  H "H2'"  . DT  B 2 1  ? -78.312  31.897  4.081   1.00 1.83 ? 18  DT  C "H2'"  2  
ATOM 3234  H "H2''" . DT  B 2 1  ? -78.927  31.144  5.577   1.00 1.80 ? 18  DT  C "H2''" 2  
ATOM 3235  H "H1'"  . DT  B 2 1  ? -79.981  33.052  6.216   1.00 2.01 ? 18  DT  C "H1'"  2  
ATOM 3236  H H3     . DT  B 2 1  ? -82.757  33.710  2.691   1.00 1.76 ? 18  DT  C H3     2  
ATOM 3237  H H71    . DT  B 2 1  ? -79.423  35.758  0.198   1.00 2.51 ? 18  DT  C H71    2  
ATOM 3238  H H72    . DT  B 2 1  ? -77.935  35.328  1.076   1.00 2.15 ? 18  DT  C H72    2  
ATOM 3239  H H73    . DT  B 2 1  ? -78.844  36.790  1.526   1.00 2.37 ? 18  DT  C H73    2  
ATOM 3240  H H6     . DT  B 2 1  ? -78.129  34.752  3.498   1.00 2.15 ? 18  DT  C H6     2  
ATOM 3241  H "HO5'" . DT  B 2 1  ? -75.628  34.759  3.500   1.00 2.54 ? 18  DT  C "HO5'" 2  
ATOM 3242  P P      . DC  B 2 2  ? -76.742  29.750  6.756   1.00 1.92 ? 19  DC  C P      2  
ATOM 3243  O OP1    . DC  B 2 2  ? -75.967  29.248  7.912   1.00 2.02 ? 19  DC  C OP1    2  
ATOM 3244  O OP2    . DC  B 2 2  ? -76.242  29.524  5.382   1.00 1.85 ? 19  DC  C OP2    2  
ATOM 3245  O "O5'"  . DC  B 2 2  ? -78.238  29.159  6.859   1.00 1.76 ? 19  DC  C "O5'"  2  
ATOM 3246  C "C5'"  . DC  B 2 2  ? -78.952  29.253  8.091   1.00 1.85 ? 19  DC  C "C5'"  2  
ATOM 3247  C "C4'"  . DC  B 2 2  ? -80.193  28.352  8.126   1.00 1.66 ? 19  DC  C "C4'"  2  
ATOM 3248  O "O4'"  . DC  B 2 2  ? -81.245  28.937  7.325   1.00 1.61 ? 19  DC  C "O4'"  2  
ATOM 3249  C "C3'"  . DC  B 2 2  ? -79.907  26.946  7.589   1.00 1.50 ? 19  DC  C "C3'"  2  
ATOM 3250  O "O3'"  . DC  B 2 2  ? -80.297  25.961  8.544   1.00 1.49 ? 19  DC  C "O3'"  2  
ATOM 3251  C "C2'"  . DC  B 2 2  ? -80.749  26.805  6.339   1.00 1.32 ? 19  DC  C "C2'"  2  
ATOM 3252  C "C1'"  . DC  B 2 2  ? -81.642  28.042  6.264   1.00 1.39 ? 19  DC  C "C1'"  2  
ATOM 3253  N N1     . DC  B 2 2  ? -81.520  28.717  4.938   1.00 1.34 ? 19  DC  C N1     2  
ATOM 3254  C C2     . DC  B 2 2  ? -82.676  28.902  4.187   1.00 1.26 ? 19  DC  C C2     2  
ATOM 3255  O O2     . DC  B 2 2  ? -83.757  28.515  4.623   1.00 1.26 ? 19  DC  C O2     2  
ATOM 3256  N N3     . DC  B 2 2  ? -82.575  29.513  2.978   1.00 1.23 ? 19  DC  C N3     2  
ATOM 3257  C C4     . DC  B 2 2  ? -81.389  29.932  2.515   1.00 1.28 ? 19  DC  C C4     2  
ATOM 3258  N N4     . DC  B 2 2  ? -81.330  30.534  1.326   1.00 1.27 ? 19  DC  C N4     2  
ATOM 3259  C C5     . DC  B 2 2  ? -80.193  29.748  3.279   1.00 1.39 ? 19  DC  C C5     2  
ATOM 3260  C C6     . DC  B 2 2  ? -80.303  29.138  4.476   1.00 1.41 ? 19  DC  C C6     2  
ATOM 3261  H "H5'"  . DC  B 2 2  ? -79.261  30.288  8.241   1.00 2.01 ? 19  DC  C "H5'"  2  
ATOM 3262  H "H5''" . DC  B 2 2  ? -78.287  28.962  8.904   1.00 1.98 ? 19  DC  C "H5''" 2  
ATOM 3263  H "H4'"  . DC  B 2 2  ? -80.537  28.271  9.155   1.00 1.73 ? 19  DC  C "H4'"  2  
ATOM 3264  H "H3'"  . DC  B 2 2  ? -78.845  26.823  7.350   1.00 1.57 ? 19  DC  C "H3'"  2  
ATOM 3265  H "H2'"  . DC  B 2 2  ? -80.109  26.747  5.459   1.00 1.28 ? 19  DC  C "H2'"  2  
ATOM 3266  H "H2''" . DC  B 2 2  ? -81.360  25.903  6.407   1.00 1.23 ? 19  DC  C "H2''" 2  
ATOM 3267  H "H1'"  . DC  B 2 2  ? -82.682  27.744  6.436   1.00 1.35 ? 19  DC  C "H1'"  2  
ATOM 3268  H H41    . DC  B 2 2  ? -82.174  30.664  0.786   1.00 1.22 ? 19  DC  C H41    2  
ATOM 3269  H H42    . DC  B 2 2  ? -80.447  30.859  0.968   1.00 1.35 ? 19  DC  C H42    2  
ATOM 3270  H H5     . DC  B 2 2  ? -79.229  30.090  2.907   1.00 1.47 ? 19  DC  C H5     2  
ATOM 3271  H H6     . DC  B 2 2  ? -79.413  28.969  5.079   1.00 1.50 ? 19  DC  C H6     2  
ATOM 3272  P P      . DG  B 2 3  ? -79.815  24.438  8.377   1.00 1.42 ? 20  DG  C P      2  
ATOM 3273  O OP1    . DG  B 2 3  ? -79.870  23.786  9.704   1.00 1.52 ? 20  DG  C OP1    2  
ATOM 3274  O OP2    . DG  B 2 3  ? -78.557  24.430  7.603   1.00 1.46 ? 20  DG  C OP2    2  
ATOM 3275  O "O5'"  . DG  B 2 3  ? -80.975  23.804  7.464   1.00 1.23 ? 20  DG  C "O5'"  2  
ATOM 3276  C "C5'"  . DG  B 2 3  ? -82.126  23.236  8.082   1.00 1.25 ? 20  DG  C "C5'"  2  
ATOM 3277  C "C4'"  . DG  B 2 3  ? -83.093  22.640  7.059   1.00 1.10 ? 20  DG  C "C4'"  2  
ATOM 3278  O "O4'"  . DG  B 2 3  ? -83.337  23.602  6.006   1.00 1.05 ? 20  DG  C "O4'"  2  
ATOM 3279  C "C3'"  . DG  B 2 3  ? -82.545  21.357  6.418   1.00 1.01 ? 20  DG  C "C3'"  2  
ATOM 3280  O "O3'"  . DG  B 2 3  ? -83.492  20.292  6.562   1.00 0.98 ? 20  DG  C "O3'"  2  
ATOM 3281  C "C2'"  . DG  B 2 3  ? -82.357  21.685  4.950   1.00 0.91 ? 20  DG  C "C2'"  2  
ATOM 3282  C "C1'"  . DG  B 2 3  ? -83.009  23.044  4.717   1.00 0.92 ? 20  DG  C "C1'"  2  
ATOM 3283  N N9     . DG  B 2 3  ? -82.105  23.938  3.960   1.00 0.91 ? 20  DG  C N9     2  
ATOM 3284  C C8     . DG  B 2 3  ? -80.815  24.293  4.235   1.00 1.01 ? 20  DG  C C8     2  
ATOM 3285  N N7     . DG  B 2 3  ? -80.265  25.095  3.369   1.00 1.00 ? 20  DG  C N7     2  
ATOM 3286  C C5     . DG  B 2 3  ? -81.276  25.296  2.429   1.00 0.88 ? 20  DG  C C5     2  
ATOM 3287  C C6     . DG  B 2 3  ? -81.279  26.080  1.238   1.00 0.83 ? 20  DG  C C6     2  
ATOM 3288  O O6     . DG  B 2 3  ? -80.372  26.763  0.765   1.00 0.89 ? 20  DG  C O6     2  
ATOM 3289  N N1     . DG  B 2 3  ? -82.499  26.005  0.584   1.00 0.75 ? 20  DG  C N1     2  
ATOM 3290  C C2     . DG  B 2 3  ? -83.585  25.270  1.013   1.00 0.73 ? 20  DG  C C2     2  
ATOM 3291  N N2     . DG  B 2 3  ? -84.671  25.324  0.242   1.00 0.72 ? 20  DG  C N2     2  
ATOM 3292  N N3     . DG  B 2 3  ? -83.589  24.532  2.127   1.00 0.76 ? 20  DG  C N3     2  
ATOM 3293  C C4     . DG  B 2 3  ? -82.407  24.590  2.784   1.00 0.83 ? 20  DG  C C4     2  
ATOM 3294  H "H5'"  . DG  B 2 3  ? -82.643  24.013  8.647   1.00 1.34 ? 20  DG  C "H5'"  2  
ATOM 3295  H "H5''" . DG  B 2 3  ? -81.808  22.452  8.768   1.00 1.32 ? 20  DG  C "H5''" 2  
ATOM 3296  H "H4'"  . DG  B 2 3  ? -84.034  22.410  7.557   1.00 1.13 ? 20  DG  C "H4'"  2  
ATOM 3297  H "H3'"  . DG  B 2 3  ? -81.592  21.066  6.868   1.00 1.08 ? 20  DG  C "H3'"  2  
ATOM 3298  H "H2'"  . DG  B 2 3  ? -81.295  21.735  4.704   1.00 0.95 ? 20  DG  C "H2'"  2  
ATOM 3299  H "H2''" . DG  B 2 3  ? -82.841  20.928  4.335   1.00 0.85 ? 20  DG  C "H2''" 2  
ATOM 3300  H "H1'"  . DG  B 2 3  ? -83.931  22.912  4.150   1.00 0.86 ? 20  DG  C "H1'"  2  
ATOM 3301  H H8     . DG  B 2 3  ? -80.284  23.931  5.114   1.00 1.10 ? 20  DG  C H8     2  
ATOM 3302  H H1     . DG  B 2 3  ? -82.575  26.537  -0.271  1.00 0.73 ? 20  DG  C H1     2  
ATOM 3303  H H21    . DG  B 2 3  ? -84.664  25.883  -0.599  1.00 0.71 ? 20  DG  C H21    2  
ATOM 3304  H H22    . DG  B 2 3  ? -85.497  24.805  0.498   1.00 0.74 ? 20  DG  C H22    2  
ATOM 3305  P P      . DA  B 2 4  ? -83.205  18.836  5.934   1.00 0.94 ? 21  DA  C P      2  
ATOM 3306  O OP1    . DA  B 2 4  ? -83.911  17.832  6.760   1.00 1.02 ? 21  DA  C OP1    2  
ATOM 3307  O OP2    . DA  B 2 4  ? -81.750  18.706  5.699   1.00 0.98 ? 21  DA  C OP2    2  
ATOM 3308  O "O5'"  . DA  B 2 4  ? -83.946  18.924  4.504   1.00 0.83 ? 21  DA  C "O5'"  2  
ATOM 3309  C "C5'"  . DA  B 2 4  ? -85.371  18.872  4.434   1.00 0.73 ? 21  DA  C "C5'"  2  
ATOM 3310  C "C4'"  . DA  B 2 4  ? -85.899  19.134  3.016   1.00 0.65 ? 21  DA  C "C4'"  2  
ATOM 3311  O "O4'"  . DA  B 2 4  ? -85.239  20.294  2.445   1.00 0.62 ? 21  DA  C "O4'"  2  
ATOM 3312  C "C3'"  . DA  B 2 4  ? -85.660  17.941  2.074   1.00 0.62 ? 21  DA  C "C3'"  2  
ATOM 3313  O "O3'"  . DA  B 2 4  ? -86.886  17.540  1.445   1.00 0.64 ? 21  DA  C "O3'"  2  
ATOM 3314  C "C2'"  . DA  B 2 4  ? -84.684  18.452  1.034   1.00 0.58 ? 21  DA  C "C2'"  2  
ATOM 3315  C "C1'"  . DA  B 2 4  ? -84.657  19.965  1.164   1.00 0.57 ? 21  DA  C "C1'"  2  
ATOM 3316  N N9     . DA  B 2 4  ? -83.274  20.475  1.033   1.00 0.55 ? 21  DA  C N9     2  
ATOM 3317  C C8     . DA  B 2 4  ? -82.166  20.175  1.773   1.00 0.58 ? 21  DA  C C8     2  
ATOM 3318  N N7     . DA  B 2 4  ? -81.073  20.775  1.399   1.00 0.58 ? 21  DA  C N7     2  
ATOM 3319  C C5     . DA  B 2 4  ? -81.487  21.542  0.313   1.00 0.54 ? 21  DA  C C5     2  
ATOM 3320  C C6     . DA  B 2 4  ? -80.811  22.418  -0.548  1.00 0.54 ? 21  DA  C C6     2  
ATOM 3321  N N6     . DA  B 2 4  ? -79.505  22.677  -0.450  1.00 0.59 ? 21  DA  C N6     2  
ATOM 3322  N N1     . DA  B 2 4  ? -81.529  23.011  -1.519  1.00 0.52 ? 21  DA  C N1     2  
ATOM 3323  C C2     . DA  B 2 4  ? -82.833  22.757  -1.639  1.00 0.50 ? 21  DA  C C2     2  
ATOM 3324  N N3     . DA  B 2 4  ? -83.567  21.947  -0.883  1.00 0.50 ? 21  DA  C N3     2  
ATOM 3325  C C4     . DA  B 2 4  ? -82.824  21.367  0.082   1.00 0.52 ? 21  DA  C C4     2  
ATOM 3326  H "H5'"  . DA  B 2 4  ? -85.784  19.624  5.108   1.00 0.76 ? 21  DA  C "H5'"  2  
ATOM 3327  H "H5''" . DA  B 2 4  ? -85.704  17.886  4.760   1.00 0.82 ? 21  DA  C "H5''" 2  
ATOM 3328  H "H4'"  . DA  B 2 4  ? -86.972  19.327  3.070   1.00 0.69 ? 21  DA  C "H4'"  2  
ATOM 3329  H "H3'"  . DA  B 2 4  ? -85.231  17.090  2.614   1.00 0.65 ? 21  DA  C "H3'"  2  
ATOM 3330  H "H2'"  . DA  B 2 4  ? -83.686  18.051  1.219   1.00 0.59 ? 21  DA  C "H2'"  2  
ATOM 3331  H "H2''" . DA  B 2 4  ? -85.019  18.172  0.042   1.00 0.60 ? 21  DA  C "H2''" 2  
ATOM 3332  H "H1'"  . DA  B 2 4  ? -85.272  20.406  0.376   1.00 0.58 ? 21  DA  C "H1'"  2  
ATOM 3333  H H8     . DA  B 2 4  ? -82.195  19.480  2.612   1.00 0.62 ? 21  DA  C H8     2  
ATOM 3334  H H61    . DA  B 2 4  ? -79.067  23.317  -1.098  1.00 0.60 ? 21  DA  C H61    2  
ATOM 3335  H H62    . DA  B 2 4  ? -78.954  22.231  0.268   1.00 0.62 ? 21  DA  C H62    2  
ATOM 3336  H H2     . DA  B 2 4  ? -83.354  23.272  -2.447  1.00 0.51 ? 21  DA  C H2     2  
ATOM 3337  P P      . DA  B 2 5  ? -86.909  16.388  0.311   1.00 0.68 ? 22  DA  C P      2  
ATOM 3338  O OP1    . DA  B 2 5  ? -88.292  15.874  0.193   1.00 0.83 ? 22  DA  C OP1    2  
ATOM 3339  O OP2    . DA  B 2 5  ? -85.793  15.454  0.569   1.00 0.67 ? 22  DA  C OP2    2  
ATOM 3340  O "O5'"  . DA  B 2 5  ? -86.572  17.218  -1.026  1.00 0.63 ? 22  DA  C "O5'"  2  
ATOM 3341  C "C5'"  . DA  B 2 5  ? -87.380  18.334  -1.400  1.00 0.62 ? 22  DA  C "C5'"  2  
ATOM 3342  C "C4'"  . DA  B 2 5  ? -87.007  18.869  -2.781  1.00 0.61 ? 22  DA  C "C4'"  2  
ATOM 3343  O "O4'"  . DA  B 2 5  ? -85.805  19.680  -2.699  1.00 0.58 ? 22  DA  C "O4'"  2  
ATOM 3344  C "C3'"  . DA  B 2 5  ? -86.742  17.737  -3.785  1.00 0.64 ? 22  DA  C "C3'"  2  
ATOM 3345  O "O3'"  . DA  B 2 5  ? -87.502  17.942  -4.986  1.00 0.72 ? 22  DA  C "O3'"  2  
ATOM 3346  C "C2'"  . DA  B 2 5  ? -85.264  17.816  -4.082  1.00 0.61 ? 22  DA  C "C2'"  2  
ATOM 3347  C "C1'"  . DA  B 2 5  ? -84.812  19.193  -3.633  1.00 0.57 ? 22  DA  C "C1'"  2  
ATOM 3348  N N9     . DA  B 2 5  ? -83.461  19.147  -3.030  1.00 0.53 ? 22  DA  C N9     2  
ATOM 3349  C C8     . DA  B 2 5  ? -82.972  18.345  -2.033  1.00 0.51 ? 22  DA  C C8     2  
ATOM 3350  N N7     . DA  B 2 5  ? -81.731  18.557  -1.712  1.00 0.50 ? 22  DA  C N7     2  
ATOM 3351  C C5     . DA  B 2 5  ? -81.359  19.587  -2.570  1.00 0.51 ? 22  DA  C C5     2  
ATOM 3352  C C6     . DA  B 2 5  ? -80.159  20.281  -2.746  1.00 0.53 ? 22  DA  C C6     2  
ATOM 3353  N N6     . DA  B 2 5  ? -79.071  20.043  -2.016  1.00 0.55 ? 22  DA  C N6     2  
ATOM 3354  N N1     . DA  B 2 5  ? -80.129  21.240  -3.686  1.00 0.57 ? 22  DA  C N1     2  
ATOM 3355  C C2     . DA  B 2 5  ? -81.214  21.502  -4.411  1.00 0.59 ? 22  DA  C C2     2  
ATOM 3356  N N3     . DA  B 2 5  ? -82.401  20.908  -4.324  1.00 0.57 ? 22  DA  C N3     2  
ATOM 3357  C C4     . DA  B 2 5  ? -82.401  19.951  -3.374  1.00 0.53 ? 22  DA  C C4     2  
ATOM 3358  H "H5'"  . DA  B 2 5  ? -87.252  19.130  -0.664  1.00 0.71 ? 22  DA  C "H5'"  2  
ATOM 3359  H "H5''" . DA  B 2 5  ? -88.427  18.025  -1.411  1.00 0.73 ? 22  DA  C "H5''" 2  
ATOM 3360  H "H4'"  . DA  B 2 5  ? -87.832  19.483  -3.146  1.00 0.65 ? 22  DA  C "H4'"  2  
ATOM 3361  H "H3'"  . DA  B 2 5  ? -86.991  16.763  -3.355  1.00 0.66 ? 22  DA  C "H3'"  2  
ATOM 3362  H "H2'"  . DA  B 2 5  ? -84.727  17.051  -3.520  1.00 0.59 ? 22  DA  C "H2'"  2  
ATOM 3363  H "H2''" . DA  B 2 5  ? -85.091  17.687  -5.147  1.00 0.66 ? 22  DA  C "H2''" 2  
ATOM 3364  H "H1'"  . DA  B 2 5  ? -84.788  19.863  -4.495  1.00 0.60 ? 22  DA  C "H1'"  2  
ATOM 3365  H H8     . DA  B 2 5  ? -83.570  17.573  -1.560  1.00 0.53 ? 22  DA  C H8     2  
ATOM 3366  H H61    . DA  B 2 5  ? -78.226  20.571  -2.181  1.00 0.59 ? 22  DA  C H61    2  
ATOM 3367  H H62    . DA  B 2 5  ? -79.093  19.336  -1.295  1.00 0.54 ? 22  DA  C H62    2  
ATOM 3368  H H2     . DA  B 2 5  ? -81.118  22.286  -5.163  1.00 0.64 ? 22  DA  C H2     2  
ATOM 3369  P P      . DC  B 2 6  ? -87.656  16.774  -6.091  1.00 0.73 ? 23  DC  C P      2  
ATOM 3370  O OP1    . DC  B 2 6  ? -89.012  16.873  -6.677  1.00 0.79 ? 23  DC  C OP1    2  
ATOM 3371  O OP2    . DC  B 2 6  ? -87.210  15.498  -5.484  1.00 0.77 ? 23  DC  C OP2    2  
ATOM 3372  O "O5'"  . DC  B 2 6  ? -86.579  17.193  -7.225  1.00 0.68 ? 23  DC  C "O5'"  2  
ATOM 3373  C "C5'"  . DC  B 2 6  ? -87.001  17.743  -8.482  1.00 0.69 ? 23  DC  C "C5'"  2  
ATOM 3374  C "C4'"  . DC  B 2 6  ? -85.919  17.617  -9.566  1.00 0.67 ? 23  DC  C "C4'"  2  
ATOM 3375  O "O4'"  . DC  B 2 6  ? -84.649  18.061  -9.027  1.00 0.69 ? 23  DC  C "O4'"  2  
ATOM 3376  C "C3'"  . DC  B 2 6  ? -85.748  16.168  -10.068 1.00 0.63 ? 23  DC  C "C3'"  2  
ATOM 3377  O "O3'"  . DC  B 2 6  ? -85.876  16.104  -11.506 1.00 0.62 ? 23  DC  C "O3'"  2  
ATOM 3378  C "C2'"  . DC  B 2 6  ? -84.345  15.769  -9.647  1.00 0.63 ? 23  DC  C "C2'"  2  
ATOM 3379  C "C1'"  . DC  B 2 6  ? -83.641  17.044  -9.191  1.00 0.66 ? 23  DC  C "C1'"  2  
ATOM 3380  N N1     . DC  B 2 6  ? -82.881  16.820  -7.926  1.00 0.67 ? 23  DC  C N1     2  
ATOM 3381  C C2     . DC  B 2 6  ? -81.512  17.086  -7.935  1.00 0.69 ? 23  DC  C C2     2  
ATOM 3382  O O2     . DC  B 2 6  ? -80.973  17.494  -8.962  1.00 0.70 ? 23  DC  C O2     2  
ATOM 3383  N N3     . DC  B 2 6  ? -80.804  16.881  -6.793  1.00 0.70 ? 23  DC  C N3     2  
ATOM 3384  C C4     . DC  B 2 6  ? -81.400  16.435  -5.685  1.00 0.70 ? 23  DC  C C4     2  
ATOM 3385  N N4     . DC  B 2 6  ? -80.671  16.254  -4.582  1.00 0.73 ? 23  DC  C N4     2  
ATOM 3386  C C5     . DC  B 2 6  ? -82.802  16.158  -5.661  1.00 0.68 ? 23  DC  C C5     2  
ATOM 3387  C C6     . DC  B 2 6  ? -83.501  16.364  -6.795  1.00 0.67 ? 23  DC  C C6     2  
ATOM 3388  H "H5'"  . DC  B 2 6  ? -87.234  18.798  -8.341  1.00 0.78 ? 23  DC  C "H5'"  2  
ATOM 3389  H "H5''" . DC  B 2 6  ? -87.898  17.226  -8.816  1.00 0.71 ? 23  DC  C "H5''" 2  
ATOM 3390  H "H4'"  . DC  B 2 6  ? -86.186  18.255  -10.411 1.00 0.68 ? 23  DC  C "H4'"  2  
ATOM 3391  H "H3'"  . DC  B 2 6  ? -86.484  15.504  -9.603  1.00 0.62 ? 23  DC  C "H3'"  2  
ATOM 3392  H "H2'"  . DC  B 2 6  ? -84.388  15.049  -8.833  1.00 0.64 ? 23  DC  C "H2'"  2  
ATOM 3393  H "H2''" . DC  B 2 6  ? -83.811  15.335  -10.484 1.00 0.63 ? 23  DC  C "H2''" 2  
ATOM 3394  H "H1'"  . DC  B 2 6  ? -82.954  17.371  -9.980  1.00 0.67 ? 23  DC  C "H1'"  2  
ATOM 3395  H H41    . DC  B 2 6  ? -79.680  16.448  -4.596  1.00 0.75 ? 23  DC  C H41    2  
ATOM 3396  H H42    . DC  B 2 6  ? -81.109  15.927  -3.732  1.00 0.74 ? 23  DC  C H42    2  
ATOM 3397  H H5     . DC  B 2 6  ? -83.284  15.781  -4.761  1.00 0.70 ? 23  DC  C H5     2  
ATOM 3398  H H6     . DC  B 2 6  ? -84.573  16.164  -6.812  1.00 0.66 ? 23  DC  C H6     2  
ATOM 3399  P P      . DT  B 2 7  ? -85.528  14.753  -12.333 1.00 0.60 ? 24  DT  C P      2  
ATOM 3400  O OP1    . DT  B 2 7  ? -86.338  14.732  -13.577 1.00 0.63 ? 24  DT  C OP1    2  
ATOM 3401  O OP2    . DT  B 2 7  ? -85.585  13.607  -11.400 1.00 0.59 ? 24  DT  C OP2    2  
ATOM 3402  O "O5'"  . DT  B 2 7  ? -83.987  14.995  -12.743 1.00 0.61 ? 24  DT  C "O5'"  2  
ATOM 3403  C "C5'"  . DT  B 2 7  ? -83.556  16.301  -13.134 1.00 0.64 ? 24  DT  C "C5'"  2  
ATOM 3404  C "C4'"  . DT  B 2 7  ? -82.118  16.308  -13.679 1.00 0.66 ? 24  DT  C "C4'"  2  
ATOM 3405  O "O4'"  . DT  B 2 7  ? -81.199  16.545  -12.585 1.00 0.67 ? 24  DT  C "O4'"  2  
ATOM 3406  C "C3'"  . DT  B 2 7  ? -81.735  14.978  -14.347 1.00 0.66 ? 24  DT  C "C3'"  2  
ATOM 3407  O "O3'"  . DT  B 2 7  ? -81.322  15.176  -15.701 1.00 0.74 ? 24  DT  C "O3'"  2  
ATOM 3408  C "C2'"  . DT  B 2 7  ? -80.558  14.445  -13.556 1.00 0.65 ? 24  DT  C "C2'"  2  
ATOM 3409  C "C1'"  . DT  B 2 7  ? -80.236  15.475  -12.473 1.00 0.64 ? 24  DT  C "C1'"  2  
ATOM 3410  N N1     . DT  B 2 7  ? -80.273  14.857  -11.111 1.00 0.60 ? 24  DT  C N1     2  
ATOM 3411  C C2     . DT  B 2 7  ? -79.173  15.035  -10.280 1.00 0.60 ? 24  DT  C C2     2  
ATOM 3412  O O2     . DT  B 2 7  ? -78.190  15.687  -10.628 1.00 0.64 ? 24  DT  C O2     2  
ATOM 3413  N N3     . DT  B 2 7  ? -79.246  14.439  -9.032  1.00 0.59 ? 24  DT  C N3     2  
ATOM 3414  C C4     . DT  B 2 7  ? -80.302  13.694  -8.547  1.00 0.58 ? 24  DT  C C4     2  
ATOM 3415  O O4     . DT  B 2 7  ? -80.255  13.201  -7.421  1.00 0.61 ? 24  DT  C O4     2  
ATOM 3416  C C5     . DT  B 2 7  ? -81.404  13.561  -9.473  1.00 0.58 ? 24  DT  C C5     2  
ATOM 3417  C C7     . DT  B 2 7  ? -82.640  12.769  -9.050  1.00 0.61 ? 24  DT  C C7     2  
ATOM 3418  C C6     . DT  B 2 7  ? -81.359  14.129  -10.696 1.00 0.58 ? 24  DT  C C6     2  
ATOM 3419  H "H5'"  . DT  B 2 7  ? -83.610  16.965  -12.270 1.00 0.67 ? 24  DT  C "H5'"  2  
ATOM 3420  H "H5''" . DT  B 2 7  ? -84.230  16.675  -13.907 1.00 0.67 ? 24  DT  C "H5''" 2  
ATOM 3421  H "H4'"  . DT  B 2 7  ? -82.016  17.114  -14.409 1.00 0.71 ? 24  DT  C "H4'"  2  
ATOM 3422  H "H3'"  . DT  B 2 7  ? -82.570  14.269  -14.315 1.00 0.65 ? 24  DT  C "H3'"  2  
ATOM 3423  H "H2'"  . DT  B 2 7  ? -80.802  13.484  -13.116 1.00 0.62 ? 24  DT  C "H2'"  2  
ATOM 3424  H "H2''" . DT  B 2 7  ? -79.698  14.328  -14.216 1.00 0.69 ? 24  DT  C "H2''" 2  
ATOM 3425  H "H1'"  . DT  B 2 7  ? -79.239  15.893  -12.661 1.00 0.68 ? 24  DT  C "H1'"  2  
ATOM 3426  H H3     . DT  B 2 7  ? -78.456  14.560  -8.414  1.00 0.60 ? 24  DT  C H3     2  
ATOM 3427  H H71    . DT  B 2 7  ? -83.497  13.072  -9.651  1.00 1.12 ? 24  DT  C H71    2  
ATOM 3428  H H72    . DT  B 2 7  ? -82.849  12.966  -7.999  1.00 1.24 ? 24  DT  C H72    2  
ATOM 3429  H H73    . DT  B 2 7  ? -82.457  11.705  -9.191  1.00 1.12 ? 24  DT  C H73    2  
ATOM 3430  H H6     . DT  B 2 7  ? -82.201  14.000  -11.374 1.00 0.60 ? 24  DT  C H6     2  
ATOM 3431  P P      . DT  B 2 8  ? -80.796  13.932  -16.583 1.00 0.79 ? 25  DT  C P      2  
ATOM 3432  O OP1    . DT  B 2 8  ? -80.708  14.371  -17.993 1.00 0.92 ? 25  DT  C OP1    2  
ATOM 3433  O OP2    . DT  B 2 8  ? -81.595  12.737  -16.226 1.00 0.79 ? 25  DT  C OP2    2  
ATOM 3434  O "O5'"  . DT  B 2 8  ? -79.298  13.714  -16.022 1.00 0.78 ? 25  DT  C "O5'"  2  
ATOM 3435  C "C5'"  . DT  B 2 8  ? -78.229  14.564  -16.448 1.00 0.86 ? 25  DT  C "C5'"  2  
ATOM 3436  C "C4'"  . DT  B 2 8  ? -76.909  14.233  -15.737 1.00 0.83 ? 25  DT  C "C4'"  2  
ATOM 3437  O "O4'"  . DT  B 2 8  ? -77.125  14.138  -14.305 1.00 0.77 ? 25  DT  C "O4'"  2  
ATOM 3438  C "C3'"  . DT  B 2 8  ? -76.314  12.892  -16.208 1.00 0.82 ? 25  DT  C "C3'"  2  
ATOM 3439  O "O3'"  . DT  B 2 8  ? -74.956  13.057  -16.633 1.00 0.87 ? 25  DT  C "O3'"  2  
ATOM 3440  C "C2'"  . DT  B 2 8  ? -76.350  11.995  -14.994 1.00 0.75 ? 25  DT  C "C2'"  2  
ATOM 3441  C "C1'"  . DT  B 2 8  ? -76.552  12.911  -13.798 1.00 0.72 ? 25  DT  C "C1'"  2  
ATOM 3442  N N1     . DT  B 2 8  ? -77.419  12.281  -12.757 1.00 0.66 ? 25  DT  C N1     2  
ATOM 3443  C C2     . DT  B 2 8  ? -76.874  12.085  -11.496 1.00 0.64 ? 25  DT  C C2     2  
ATOM 3444  O O2     . DT  B 2 8  ? -75.713  12.391  -11.235 1.00 0.67 ? 25  DT  C O2     2  
ATOM 3445  N N3     . DT  B 2 8  ? -77.703  11.518  -10.550 1.00 0.61 ? 25  DT  C N3     2  
ATOM 3446  C C4     . DT  B 2 8  ? -79.013  11.127  -10.740 1.00 0.59 ? 25  DT  C C4     2  
ATOM 3447  O O4     . DT  B 2 8  ? -79.659  10.634  -9.814  1.00 0.59 ? 25  DT  C O4     2  
ATOM 3448  C C5     . DT  B 2 8  ? -79.509  11.359  -12.079 1.00 0.61 ? 25  DT  C C5     2  
ATOM 3449  C C7     . DT  B 2 8  ? -80.952  10.965  -12.409 1.00 0.62 ? 25  DT  C C7     2  
ATOM 3450  C C6     . DT  B 2 8  ? -78.715  11.916  -13.032 1.00 0.65 ? 25  DT  C C6     2  
ATOM 3451  H "H5'"  . DT  B 2 8  ? -78.496  15.599  -16.234 1.00 0.92 ? 25  DT  C "H5'"  2  
ATOM 3452  H "H5''" . DT  B 2 8  ? -78.093  14.450  -17.523 1.00 0.98 ? 25  DT  C "H5''" 2  
ATOM 3453  H "H4'"  . DT  B 2 8  ? -76.193  15.031  -15.933 1.00 0.88 ? 25  DT  C "H4'"  2  
ATOM 3454  H "H3'"  . DT  B 2 8  ? -76.907  12.460  -17.021 1.00 0.85 ? 25  DT  C "H3'"  2  
ATOM 3455  H "H2'"  . DT  B 2 8  ? -77.174  11.283  -15.070 1.00 0.75 ? 25  DT  C "H2'"  2  
ATOM 3456  H "H2''" . DT  B 2 8  ? -75.408  11.464  -14.905 1.00 0.77 ? 25  DT  C "H2''" 2  
ATOM 3457  H "H1'"  . DT  B 2 8  ? -75.573  13.147  -13.369 1.00 0.73 ? 25  DT  C "H1'"  2  
ATOM 3458  H H3     . DT  B 2 8  ? -77.310  11.376  -9.627  1.00 0.62 ? 25  DT  C H3     2  
ATOM 3459  H H71    . DT  B 2 8  ? -81.137  9.947   -12.065 1.00 1.22 ? 25  DT  C H71    2  
ATOM 3460  H H72    . DT  B 2 8  ? -81.121  11.021  -13.485 1.00 1.15 ? 25  DT  C H72    2  
ATOM 3461  H H73    . DT  B 2 8  ? -81.637  11.648  -11.899 1.00 1.14 ? 25  DT  C H73    2  
ATOM 3462  H H6     . DT  B 2 8  ? -79.115  12.078  -14.038 1.00 0.68 ? 25  DT  C H6     2  
ATOM 3463  P P      . DC  B 2 9  ? -74.125  11.808  -17.234 1.00 0.90 ? 26  DC  C P      2  
ATOM 3464  O OP1    . DC  B 2 9  ? -73.409  12.270  -18.443 1.00 1.02 ? 26  DC  C OP1    2  
ATOM 3465  O OP2    . DC  B 2 9  ? -75.038  10.645  -17.318 1.00 0.93 ? 26  DC  C OP2    2  
ATOM 3466  O "O5'"  . DC  B 2 9  ? -73.028  11.503  -16.086 1.00 0.82 ? 26  DC  C "O5'"  2  
ATOM 3467  C "C5'"  . DC  B 2 9  ? -71.679  11.966  -16.238 1.00 1.02 ? 26  DC  C "C5'"  2  
ATOM 3468  C "C4'"  . DC  B 2 9  ? -70.721  11.328  -15.224 1.00 0.93 ? 26  DC  C "C4'"  2  
ATOM 3469  O "O4'"  . DC  B 2 9  ? -71.316  11.351  -13.906 1.00 0.84 ? 26  DC  C "O4'"  2  
ATOM 3470  C "C3'"  . DC  B 2 9  ? -70.382  9.868   -15.570 1.00 0.92 ? 26  DC  C "C3'"  2  
ATOM 3471  O "O3'"  . DC  B 2 9  ? -68.962  9.674   -15.602 1.00 0.99 ? 26  DC  C "O3'"  2  
ATOM 3472  C "C2'"  . DC  B 2 9  ? -70.979  9.044   -14.455 1.00 0.82 ? 26  DC  C "C2'"  2  
ATOM 3473  C "C1'"  . DC  B 2 9  ? -71.387  10.022  -13.356 1.00 0.76 ? 26  DC  C "C1'"  2  
ATOM 3474  N N1     . DC  B 2 9  ? -72.762  9.731   -12.846 1.00 0.70 ? 26  DC  C N1     2  
ATOM 3475  C C2     . DC  B 2 9  ? -72.911  9.461   -11.487 1.00 0.67 ? 26  DC  C C2     2  
ATOM 3476  O O2     . DC  B 2 9  ? -71.931  9.480   -10.748 1.00 0.70 ? 26  DC  C O2     2  
ATOM 3477  N N3     . DC  B 2 9  ? -74.154  9.178   -11.011 1.00 0.64 ? 26  DC  C N3     2  
ATOM 3478  C C4     . DC  B 2 9  ? -75.216  9.164   -11.826 1.00 0.64 ? 26  DC  C C4     2  
ATOM 3479  N N4     . DC  B 2 9  ? -76.417  8.874   -11.323 1.00 0.64 ? 26  DC  C N4     2  
ATOM 3480  C C5     . DC  B 2 9  ? -75.076  9.443   -13.223 1.00 0.69 ? 26  DC  C C5     2  
ATOM 3481  C C6     . DC  B 2 9  ? -73.837  9.719   -13.688 1.00 0.72 ? 26  DC  C C6     2  
ATOM 3482  H "H5'"  . DC  B 2 9  ? -71.662  13.045  -16.098 1.00 1.22 ? 26  DC  C "H5'"  2  
ATOM 3483  H "H5''" . DC  B 2 9  ? -71.334  11.737  -17.244 1.00 1.27 ? 26  DC  C "H5''" 2  
ATOM 3484  H "H4'"  . DC  B 2 9  ? -69.796  11.909  -15.201 1.00 0.98 ? 26  DC  C "H4'"  2  
ATOM 3485  H "H3'"  . DC  B 2 9  ? -70.815  9.578   -16.532 1.00 0.99 ? 26  DC  C "H3'"  2  
ATOM 3486  H "H2'"  . DC  B 2 9  ? -71.849  8.492   -14.816 1.00 0.83 ? 26  DC  C "H2'"  2  
ATOM 3487  H "H2''" . DC  B 2 9  ? -70.230  8.347   -14.080 1.00 0.84 ? 26  DC  C "H2''" 2  
ATOM 3488  H "H1'"  . DC  B 2 9  ? -70.667  9.953   -12.537 1.00 0.77 ? 26  DC  C "H1'"  2  
ATOM 3489  H H41    . DC  B 2 9  ? -76.514  8.671   -10.337 1.00 0.64 ? 26  DC  C H41    2  
ATOM 3490  H H42    . DC  B 2 9  ? -77.225  8.852   -11.926 1.00 0.67 ? 26  DC  C H42    2  
ATOM 3491  H H5     . DC  B 2 9  ? -75.939  9.434   -13.886 1.00 0.74 ? 26  DC  C H5     2  
ATOM 3492  H H6     . DC  B 2 9  ? -73.691  9.931   -14.747 1.00 0.79 ? 26  DC  C H6     2  
ATOM 3493  P P      . DC  B 2 10 ? -68.334  8.243   -15.997 1.00 1.07 ? 27  DC  C P      2  
ATOM 3494  O OP1    . DC  B 2 10 ? -66.896  8.440   -16.292 1.00 1.20 ? 27  DC  C OP1    2  
ATOM 3495  O OP2    . DC  B 2 10 ? -69.214  7.612   -17.004 1.00 1.12 ? 27  DC  C OP2    2  
ATOM 3496  O "O5'"  . DC  B 2 10 ? -68.454  7.406   -14.626 1.00 0.98 ? 27  DC  C "O5'"  2  
ATOM 3497  C "C5'"  . DC  B 2 10 ? -67.463  7.557   -13.610 1.00 0.97 ? 27  DC  C "C5'"  2  
ATOM 3498  C "C4'"  . DC  B 2 10 ? -67.443  6.375   -12.637 1.00 0.96 ? 27  DC  C "C4'"  2  
ATOM 3499  O "O4'"  . DC  B 2 10 ? -68.644  6.385   -11.824 1.00 0.87 ? 27  DC  C "O4'"  2  
ATOM 3500  C "C3'"  . DC  B 2 10 ? -67.369  5.020   -13.355 1.00 1.06 ? 27  DC  C "C3'"  2  
ATOM 3501  O "O3'"  . DC  B 2 10 ? -66.252  4.266   -12.873 1.00 1.19 ? 27  DC  C "O3'"  2  
ATOM 3502  C "C2'"  . DC  B 2 10 ? -68.653  4.297   -12.998 1.00 1.00 ? 27  DC  C "C2'"  2  
ATOM 3503  C "C1'"  . DC  B 2 10 ? -69.300  5.101   -11.867 1.00 0.88 ? 27  DC  C "C1'"  2  
ATOM 3504  N N1     . DC  B 2 10 ? -70.780  5.266   -12.055 1.00 0.79 ? 27  DC  C N1     2  
ATOM 3505  C C2     . DC  B 2 10 ? -71.620  4.864   -11.015 1.00 0.77 ? 27  DC  C C2     2  
ATOM 3506  O O2     . DC  B 2 10 ? -71.139  4.391   -9.989  1.00 0.85 ? 27  DC  C O2     2  
ATOM 3507  N N3     . DC  B 2 10 ? -72.967  5.011   -11.168 1.00 0.71 ? 27  DC  C N3     2  
ATOM 3508  C C4     . DC  B 2 10 ? -73.478  5.530   -12.290 1.00 0.69 ? 27  DC  C C4     2  
ATOM 3509  N N4     . DC  B 2 10 ? -74.799  5.663   -12.415 1.00 0.68 ? 27  DC  C N4     2  
ATOM 3510  C C5     . DC  B 2 10 ? -72.626  5.945   -13.360 1.00 0.74 ? 27  DC  C C5     2  
ATOM 3511  C C6     . DC  B 2 10 ? -71.295  5.796   -13.204 1.00 0.78 ? 27  DC  C C6     2  
ATOM 3512  H "H5'"  . DC  B 2 10 ? -67.670  8.466   -13.047 1.00 0.93 ? 27  DC  C "H5'"  2  
ATOM 3513  H "H5''" . DC  B 2 10 ? -66.483  7.649   -14.082 1.00 1.09 ? 27  DC  C "H5''" 2  
ATOM 3514  H "H4'"  . DC  B 2 10 ? -66.577  6.476   -11.985 1.00 1.01 ? 27  DC  C "H4'"  2  
ATOM 3515  H "H3'"  . DC  B 2 10 ? -67.289  5.151   -14.438 1.00 1.12 ? 27  DC  C "H3'"  2  
ATOM 3516  H "H2'"  . DC  B 2 10 ? -69.315  4.244   -13.863 1.00 0.99 ? 27  DC  C "H2'"  2  
ATOM 3517  H "H2''" . DC  B 2 10 ? -68.422  3.289   -12.657 1.00 1.08 ? 27  DC  C "H2''" 2  
ATOM 3518  H "H1'"  . DC  B 2 10 ? -69.106  4.587   -10.917 1.00 0.93 ? 27  DC  C "H1'"  2  
ATOM 3519  H H41    . DC  B 2 10 ? -75.411  5.369   -11.668 1.00 0.67 ? 27  DC  C H41    2  
ATOM 3520  H H42    . DC  B 2 10 ? -75.187  6.053   -13.262 1.00 0.72 ? 27  DC  C H42    2  
ATOM 3521  H H5     . DC  B 2 10 ? -73.040  6.368   -14.276 1.00 0.79 ? 27  DC  C H5     2  
ATOM 3522  H H6     . DC  B 2 10 ? -70.627  6.101   -14.008 1.00 0.85 ? 27  DC  C H6     2  
ATOM 3523  P P      . DG  B 2 11 ? -65.895  2.827   -13.500 1.00 1.36 ? 28  DG  C P      2  
ATOM 3524  O OP1    . DG  B 2 11 ? -64.477  2.535   -13.198 1.00 1.57 ? 28  DG  C OP1    2  
ATOM 3525  O OP2    . DG  B 2 11 ? -66.371  2.797   -14.902 1.00 1.38 ? 28  DG  C OP2    2  
ATOM 3526  O "O5'"  . DG  B 2 11 ? -66.806  1.826   -12.630 1.00 1.30 ? 28  DG  C "O5'"  2  
ATOM 3527  C "C5'"  . DG  B 2 11 ? -66.547  1.646   -11.236 1.00 1.31 ? 28  DG  C "C5'"  2  
ATOM 3528  C "C4'"  . DG  B 2 11 ? -67.624  0.788   -10.567 1.00 1.27 ? 28  DG  C "C4'"  2  
ATOM 3529  O "O4'"  . DG  B 2 11 ? -68.934  1.354   -10.808 1.00 1.22 ? 28  DG  C "O4'"  2  
ATOM 3530  C "C3'"  . DG  B 2 11 ? -67.626  -0.652  -11.093 1.00 1.26 ? 28  DG  C "C3'"  2  
ATOM 3531  O "O3'"  . DG  B 2 11 ? -67.618  -1.572  -9.996  1.00 1.31 ? 28  DG  C "O3'"  2  
ATOM 3532  C "C2'"  . DG  B 2 11 ? -68.907  -0.777  -11.890 1.00 1.20 ? 28  DG  C "C2'"  2  
ATOM 3533  C "C1'"  . DG  B 2 11 ? -69.781  0.394   -11.473 1.00 1.17 ? 28  DG  C "C1'"  2  
ATOM 3534  N N9     . DG  B 2 11 ? -70.455  0.992   -12.641 1.00 1.13 ? 28  DG  C N9     2  
ATOM 3535  C C8     . DG  B 2 11 ? -69.915  1.450   -13.810 1.00 1.15 ? 28  DG  C C8     2  
ATOM 3536  N N7     . DG  B 2 11 ? -70.770  1.929   -14.663 1.00 1.15 ? 28  DG  C N7     2  
ATOM 3537  C C5     . DG  B 2 11 ? -71.991  1.776   -14.007 1.00 1.10 ? 28  DG  C C5     2  
ATOM 3538  C C6     . DG  B 2 11 ? -73.302  2.117   -14.437 1.00 1.10 ? 28  DG  C C6     2  
ATOM 3539  O O6     . DG  B 2 11 ? -73.643  2.630   -15.502 1.00 1.13 ? 28  DG  C O6     2  
ATOM 3540  N N1     . DG  B 2 11 ? -74.254  1.796   -13.477 1.00 1.07 ? 28  DG  C N1     2  
ATOM 3541  C C2     . DG  B 2 11 ? -73.981  1.219   -12.254 1.00 1.06 ? 28  DG  C C2     2  
ATOM 3542  N N2     . DG  B 2 11 ? -75.029  0.979   -11.462 1.00 1.06 ? 28  DG  C N2     2  
ATOM 3543  N N3     . DG  B 2 11 ? -72.749  0.897   -11.846 1.00 1.08 ? 28  DG  C N3     2  
ATOM 3544  C C4     . DG  B 2 11 ? -71.806  1.204   -12.771 1.00 1.09 ? 28  DG  C C4     2  
ATOM 3545  H "H5'"  . DG  B 2 11 ? -66.520  2.622   -10.753 1.00 1.39 ? 28  DG  C "H5'"  2  
ATOM 3546  H "H5''" . DG  B 2 11 ? -65.579  1.162   -11.113 1.00 1.33 ? 28  DG  C "H5''" 2  
ATOM 3547  H "H4'"  . DG  B 2 11 ? -67.437  0.768   -9.492  1.00 1.32 ? 28  DG  C "H4'"  2  
ATOM 3548  H "H3'"  . DG  B 2 11 ? -66.757  -0.837  -11.735 1.00 1.29 ? 28  DG  C "H3'"  2  
ATOM 3549  H "H2'"  . DG  B 2 11 ? -68.692  -0.715  -12.958 1.00 1.20 ? 28  DG  C "H2'"  2  
ATOM 3550  H "H2''" . DG  B 2 11 ? -69.406  -1.719  -11.670 1.00 1.20 ? 28  DG  C "H2''" 2  
ATOM 3551  H "H1'"  . DG  B 2 11 ? -70.538  0.044   -10.765 1.00 1.16 ? 28  DG  C "H1'"  2  
ATOM 3552  H H8     . DG  B 2 11 ? -68.844  1.414   -14.012 1.00 1.19 ? 28  DG  C H8     2  
ATOM 3553  H H1     . DG  B 2 11 ? -75.212  2.011   -13.711 1.00 1.07 ? 28  DG  C H1     2  
ATOM 3554  H H21    . DG  B 2 11 ? -75.958  1.222   -11.769 1.00 1.06 ? 28  DG  C H21    2  
ATOM 3555  H H22    . DG  B 2 11 ? -74.891  0.552   -10.556 1.00 1.08 ? 28  DG  C H22    2  
ATOM 3556  P P      . DG  B 2 12 ? -67.735  -3.156  -10.244 1.00 1.33 ? 29  DG  C P      2  
ATOM 3557  O OP1    . DG  B 2 12 ? -67.094  -3.852  -9.108  1.00 1.52 ? 29  DG  C OP1    2  
ATOM 3558  O OP2    . DG  B 2 12 ? -67.294  -3.440  -11.629 1.00 1.36 ? 29  DG  C OP2    2  
ATOM 3559  O "O5'"  . DG  B 2 12 ? -69.327  -3.409  -10.166 1.00 1.18 ? 29  DG  C "O5'"  2  
ATOM 3560  C "C5'"  . DG  B 2 12 ? -70.061  -3.097  -8.978  1.00 1.24 ? 29  DG  C "C5'"  2  
ATOM 3561  C "C4'"  . DG  B 2 12 ? -71.371  -3.892  -8.897  1.00 1.15 ? 29  DG  C "C4'"  2  
ATOM 3562  O "O4'"  . DG  B 2 12 ? -72.400  -3.238  -9.689  1.00 1.12 ? 29  DG  C "O4'"  2  
ATOM 3563  C "C3'"  . DG  B 2 12 ? -71.216  -5.326  -9.430  1.00 1.05 ? 29  DG  C "C3'"  2  
ATOM 3564  O "O3'"  . DG  B 2 12 ? -71.701  -6.270  -8.462  1.00 1.07 ? 29  DG  C "O3'"  2  
ATOM 3565  C "C2'"  . DG  B 2 12 ? -72.062  -5.374  -10.681 1.00 0.97 ? 29  DG  C "C2'"  2  
ATOM 3566  C "C1'"  . DG  B 2 12 ? -73.004  -4.190  -10.593 1.00 1.00 ? 29  DG  C "C1'"  2  
ATOM 3567  N N9     . DG  B 2 12 ? -73.256  -3.615  -11.930 1.00 0.97 ? 29  DG  C N9     2  
ATOM 3568  C C8     . DG  B 2 12 ? -72.369  -3.102  -12.834 1.00 1.00 ? 29  DG  C C8     2  
ATOM 3569  N N7     . DG  B 2 12 ? -72.893  -2.688  -13.950 1.00 0.99 ? 29  DG  C N7     2  
ATOM 3570  C C5     . DG  B 2 12 ? -74.250  -2.948  -13.782 1.00 0.96 ? 29  DG  C C5     2  
ATOM 3571  C C6     . DG  B 2 12 ? -75.338  -2.716  -14.668 1.00 0.97 ? 29  DG  C C6     2  
ATOM 3572  O O6     . DG  B 2 12 ? -75.315  -2.227  -15.795 1.00 1.00 ? 29  DG  C O6     2  
ATOM 3573  N N1     . DG  B 2 12 ? -76.545  -3.124  -14.109 1.00 0.97 ? 29  DG  C N1     2  
ATOM 3574  C C2     . DG  B 2 12 ? -76.691  -3.684  -12.858 1.00 0.96 ? 29  DG  C C2     2  
ATOM 3575  N N2     . DG  B 2 12 ? -77.932  -4.010  -12.497 1.00 1.00 ? 29  DG  C N2     2  
ATOM 3576  N N3     . DG  B 2 12 ? -75.670  -3.905  -12.023 1.00 0.95 ? 29  DG  C N3     2  
ATOM 3577  C C4     . DG  B 2 12 ? -74.483  -3.514  -12.549 1.00 0.95 ? 29  DG  C C4     2  
ATOM 3578  H "H5'"  . DG  B 2 12 ? -70.292  -2.032  -8.969  1.00 1.28 ? 29  DG  C "H5'"  2  
ATOM 3579  H "H5''" . DG  B 2 12 ? -69.445  -3.334  -8.108  1.00 1.42 ? 29  DG  C "H5''" 2  
ATOM 3580  H "H4'"  . DG  B 2 12 ? -71.697  -3.936  -7.858  1.00 1.22 ? 29  DG  C "H4'"  2  
ATOM 3581  H "H3'"  . DG  B 2 12 ? -70.173  -5.544  -9.672  1.00 1.07 ? 29  DG  C "H3'"  2  
ATOM 3582  H "H2'"  . DG  B 2 12 ? -71.435  -5.278  -11.568 1.00 0.97 ? 29  DG  C "H2'"  2  
ATOM 3583  H "H2''" . DG  B 2 12 ? -72.624  -6.304  -10.726 1.00 0.94 ? 29  DG  C "H2''" 2  
ATOM 3584  H "H1'"  . DG  B 2 12 ? -73.954  -4.518  -10.166 1.00 1.00 ? 29  DG  C "H1'"  2  
ATOM 3585  H H8     . DG  B 2 12 ? -71.299  -3.046  -12.634 1.00 1.05 ? 29  DG  C H8     2  
ATOM 3586  H H1     . DG  B 2 12 ? -77.367  -2.995  -14.682 1.00 1.00 ? 29  DG  C H1     2  
ATOM 3587  H H21    . DG  B 2 12 ? -78.703  -3.842  -13.129 1.00 1.04 ? 29  DG  C H21    2  
ATOM 3588  H H22    . DG  B 2 12 ? -78.103  -4.425  -11.593 1.00 1.02 ? 29  DG  C H22    2  
ATOM 3589  P P      . DC  B 2 13 ? -71.731  -7.857  -8.764  1.00 1.01 ? 30  DC  C P      2  
ATOM 3590  O OP1    . DC  B 2 13 ? -71.282  -8.566  -7.543  1.00 1.13 ? 30  DC  C OP1    2  
ATOM 3591  O OP2    . DC  B 2 13 ? -71.044  -8.098  -10.052 1.00 1.02 ? 30  DC  C OP2    2  
ATOM 3592  O "O5'"  . DC  B 2 13 ? -73.307  -8.152  -8.967  1.00 0.88 ? 30  DC  C "O5'"  2  
ATOM 3593  C "C5'"  . DC  B 2 13 ? -74.250  -7.781  -7.956  1.00 0.93 ? 30  DC  C "C5'"  2  
ATOM 3594  C "C4'"  . DC  B 2 13 ? -75.616  -8.465  -8.148  1.00 0.88 ? 30  DC  C "C4'"  2  
ATOM 3595  O "O4'"  . DC  B 2 13 ? -76.440  -7.661  -9.020  1.00 0.83 ? 30  DC  C "O4'"  2  
ATOM 3596  C "C3'"  . DC  B 2 13 ? -75.498  -9.867  -8.764  1.00 0.82 ? 30  DC  C "C3'"  2  
ATOM 3597  O "O3'"  . DC  B 2 13 ? -76.182  -10.838 -7.965  1.00 0.91 ? 30  DC  C "O3'"  2  
ATOM 3598  C "C2'"  . DC  B 2 13 ? -76.162  -9.778  -10.119 1.00 0.73 ? 30  DC  C "C2'"  2  
ATOM 3599  C "C1'"  . DC  B 2 13 ? -76.819  -8.401  -10.199 1.00 0.73 ? 30  DC  C "C1'"  2  
ATOM 3600  N N1     . DC  B 2 13 ? -76.387  -7.679  -11.428 1.00 0.66 ? 30  DC  C N1     2  
ATOM 3601  C C2     . DC  B 2 13 ? -77.370  -7.229  -12.301 1.00 0.64 ? 30  DC  C C2     2  
ATOM 3602  O O2     . DC  B 2 13 ? -78.554  -7.433  -12.048 1.00 0.69 ? 30  DC  C O2     2  
ATOM 3603  N N3     . DC  B 2 13 ? -76.983  -6.566  -13.425 1.00 0.62 ? 30  DC  C N3     2  
ATOM 3604  C C4     . DC  B 2 13 ? -75.688  -6.352  -13.684 1.00 0.62 ? 30  DC  C C4     2  
ATOM 3605  N N4     . DC  B 2 13 ? -75.343  -5.699  -14.791 1.00 0.65 ? 30  DC  C N4     2  
ATOM 3606  C C5     . DC  B 2 13 ? -74.673  -6.811  -12.792 1.00 0.63 ? 30  DC  C C5     2  
ATOM 3607  C C6     . DC  B 2 13 ? -75.063  -7.466  -11.685 1.00 0.65 ? 30  DC  C C6     2  
ATOM 3608  H "H5'"  . DC  B 2 13 ? -74.392  -6.701  -7.985  1.00 0.96 ? 30  DC  C "H5'"  2  
ATOM 3609  H "H5''" . DC  B 2 13 ? -73.848  -8.059  -6.982  1.00 1.02 ? 30  DC  C "H5''" 2  
ATOM 3610  H "H4'"  . DC  B 2 13 ? -76.109  -8.547  -7.180  1.00 0.97 ? 30  DC  C "H4'"  2  
ATOM 3611  H "H3'"  . DC  B 2 13 ? -74.447  -10.154 -8.872  1.00 0.82 ? 30  DC  C "H3'"  2  
ATOM 3612  H "H2'"  . DC  B 2 13 ? -75.421  -9.890  -10.908 1.00 0.69 ? 30  DC  C "H2'"  2  
ATOM 3613  H "H2''" . DC  B 2 13 ? -76.918  -10.562 -10.211 1.00 0.75 ? 30  DC  C "H2''" 2  
ATOM 3614  H "H1'"  . DC  B 2 13 ? -77.908  -8.520  -10.198 1.00 0.77 ? 30  DC  C "H1'"  2  
ATOM 3615  H H41    . DC  B 2 13 ? -76.055  -5.370  -15.426 1.00 0.67 ? 30  DC  C H41    2  
ATOM 3616  H H42    . DC  B 2 13 ? -74.368  -5.531  -14.994 1.00 0.67 ? 30  DC  C H42    2  
ATOM 3617  H H5     . DC  B 2 13 ? -73.616  -6.640  -13.004 1.00 0.66 ? 30  DC  C H5     2  
ATOM 3618  H H6     . DC  B 2 13 ? -74.313  -7.835  -10.988 1.00 0.69 ? 30  DC  C H6     2  
ATOM 3619  P P      . DT  B 2 14 ? -76.194  -12.396 -8.392  1.00 0.94 ? 31  DT  C P      2  
ATOM 3620  O OP1    . DT  B 2 14 ? -76.724  -13.179 -7.252  1.00 1.09 ? 31  DT  C OP1    2  
ATOM 3621  O OP2    . DT  B 2 14 ? -74.866  -12.727 -8.956  1.00 0.91 ? 31  DT  C OP2    2  
ATOM 3622  O "O5'"  . DT  B 2 14 ? -77.282  -12.446 -9.591  1.00 0.88 ? 31  DT  C "O5'"  2  
ATOM 3623  C "C5'"  . DT  B 2 14 ? -78.686  -12.501 -9.306  1.00 0.99 ? 31  DT  C "C5'"  2  
ATOM 3624  C "C4'"  . DT  B 2 14 ? -79.555  -12.303 -10.560 1.00 0.96 ? 31  DT  C "C4'"  2  
ATOM 3625  O "O4'"  . DT  B 2 14 ? -79.026  -11.211 -11.353 1.00 0.86 ? 31  DT  C "O4'"  2  
ATOM 3626  C "C3'"  . DT  B 2 14 ? -79.614  -13.552 -11.459 1.00 0.98 ? 31  DT  C "C3'"  2  
ATOM 3627  O "O3'"  . DT  B 2 14 ? -80.984  -13.929 -11.688 1.00 1.07 ? 31  DT  C "O3'"  2  
ATOM 3628  C "C2'"  . DT  B 2 14 ? -78.967  -13.129 -12.766 1.00 0.91 ? 31  DT  C "C2'"  2  
ATOM 3629  C "C1'"  . DT  B 2 14 ? -78.901  -11.610 -12.731 1.00 0.82 ? 31  DT  C "C1'"  2  
ATOM 3630  N N1     . DT  B 2 14 ? -77.634  -11.100 -13.338 1.00 0.73 ? 31  DT  C N1     2  
ATOM 3631  C C2     . DT  B 2 14 ? -77.736  -10.258 -14.438 1.00 0.70 ? 31  DT  C C2     2  
ATOM 3632  O O2     . DT  B 2 14 ? -78.823  -9.940  -14.918 1.00 0.76 ? 31  DT  C O2     2  
ATOM 3633  N N3     . DT  B 2 14 ? -76.549  -9.798  -14.971 1.00 0.66 ? 31  DT  C N3     2  
ATOM 3634  C C4     . DT  B 2 14 ? -75.280  -10.094 -14.511 1.00 0.64 ? 31  DT  C C4     2  
ATOM 3635  O O4     . DT  B 2 14 ? -74.287  -9.618  -15.063 1.00 0.64 ? 31  DT  C O4     2  
ATOM 3636  C C5     . DT  B 2 14 ? -75.259  -10.977 -13.367 1.00 0.68 ? 31  DT  C C5     2  
ATOM 3637  C C7     . DT  B 2 14 ? -73.910  -11.387 -12.774 1.00 0.72 ? 31  DT  C C7     2  
ATOM 3638  C C6     . DT  B 2 14 ? -76.409  -11.445 -12.823 1.00 0.72 ? 31  DT  C C6     2  
ATOM 3639  H "H5'"  . DT  B 2 14 ? -78.926  -11.716 -8.589  1.00 1.08 ? 31  DT  C "H5'"  2  
ATOM 3640  H "H5''" . DT  B 2 14 ? -78.923  -13.467 -8.862  1.00 1.13 ? 31  DT  C "H5''" 2  
ATOM 3641  H "H4'"  . DT  B 2 14 ? -80.569  -12.055 -10.249 1.00 1.02 ? 31  DT  C "H4'"  2  
ATOM 3642  H "H3'"  . DT  B 2 14 ? -79.066  -14.386 -11.012 1.00 1.02 ? 31  DT  C "H3'"  2  
ATOM 3643  H "H2'"  . DT  B 2 14 ? -77.967  -13.548 -12.848 1.00 0.90 ? 31  DT  C "H2'"  2  
ATOM 3644  H "H2''" . DT  B 2 14 ? -79.571  -13.456 -13.607 1.00 0.97 ? 31  DT  C "H2''" 2  
ATOM 3645  H "H1'"  . DT  B 2 14 ? -79.759  -11.208 -13.279 1.00 0.85 ? 31  DT  C "H1'"  2  
ATOM 3646  H H3     . DT  B 2 14 ? -76.614  -9.190  -15.774 1.00 0.67 ? 31  DT  C H3     2  
ATOM 3647  H H71    . DT  B 2 14 ? -74.022  -12.312 -12.205 1.00 1.28 ? 31  DT  C H71    2  
ATOM 3648  H H72    . DT  B 2 14 ? -73.546  -10.598 -12.116 1.00 1.20 ? 31  DT  C H72    2  
ATOM 3649  H H73    . DT  B 2 14 ? -73.194  -11.544 -13.581 1.00 1.26 ? 31  DT  C H73    2  
ATOM 3650  H H6     . DT  B 2 14 ? -76.359  -12.115 -11.966 1.00 0.78 ? 31  DT  C H6     2  
ATOM 3651  P P      . DC  B 2 15 ? -81.380  -15.134 -12.692 1.00 1.17 ? 32  DC  C P      2  
ATOM 3652  O OP1    . DC  B 2 15 ? -82.591  -15.799 -12.165 1.00 1.31 ? 32  DC  C OP1    2  
ATOM 3653  O OP2    . DC  B 2 15 ? -80.164  -15.931 -12.972 1.00 1.18 ? 32  DC  C OP2    2  
ATOM 3654  O "O5'"  . DC  B 2 15 ? -81.792  -14.343 -14.036 1.00 1.11 ? 32  DC  C "O5'"  2  
ATOM 3655  C "C5'"  . DC  B 2 15 ? -82.931  -13.476 -14.038 1.00 1.12 ? 32  DC  C "C5'"  2  
ATOM 3656  C "C4'"  . DC  B 2 15 ? -83.515  -13.285 -15.443 1.00 1.09 ? 32  DC  C "C4'"  2  
ATOM 3657  O "O4'"  . DC  B 2 15 ? -82.669  -12.397 -16.206 1.00 0.97 ? 32  DC  C "O4'"  2  
ATOM 3658  C "C3'"  . DC  B 2 15 ? -83.631  -14.606 -16.213 1.00 1.18 ? 32  DC  C "C3'"  2  
ATOM 3659  O "O3'"  . DC  B 2 15 ? -84.958  -14.774 -16.723 1.00 1.29 ? 32  DC  C "O3'"  2  
ATOM 3660  C "C2'"  . DC  B 2 15 ? -82.654  -14.502 -17.363 1.00 1.14 ? 32  DC  C "C2'"  2  
ATOM 3661  C "C1'"  . DC  B 2 15 ? -82.117  -13.072 -17.357 1.00 1.00 ? 32  DC  C "C1'"  2  
ATOM 3662  N N1     . DC  B 2 15 ? -80.627  -13.049 -17.301 1.00 0.92 ? 32  DC  C N1     2  
ATOM 3663  C C2     . DC  B 2 15 ? -79.940  -12.349 -18.291 1.00 0.87 ? 32  DC  C C2     2  
ATOM 3664  O O2     . DC  B 2 15 ? -80.563  -11.791 -19.192 1.00 0.89 ? 32  DC  C O2     2  
ATOM 3665  N N3     . DC  B 2 15 ? -78.580  -12.305 -18.230 1.00 0.83 ? 32  DC  C N3     2  
ATOM 3666  C C4     . DC  B 2 15 ? -77.915  -12.921 -17.243 1.00 0.84 ? 32  DC  C C4     2  
ATOM 3667  N N4     . DC  B 2 15 ? -76.583  -12.846 -17.206 1.00 0.83 ? 32  DC  C N4     2  
ATOM 3668  C C5     . DC  B 2 15 ? -78.611  -13.644 -16.227 1.00 0.91 ? 32  DC  C C5     2  
ATOM 3669  C C6     . DC  B 2 15 ? -79.957  -13.683 -16.293 1.00 0.94 ? 32  DC  C C6     2  
ATOM 3670  H "H5'"  . DC  B 2 15 ? -82.636  -12.502 -13.645 1.00 1.19 ? 32  DC  C "H5'"  2  
ATOM 3671  H "H5''" . DC  B 2 15 ? -83.698  -13.901 -13.391 1.00 1.24 ? 32  DC  C "H5''" 2  
ATOM 3672  H "H4'"  . DC  B 2 15 ? -84.507  -12.839 -15.355 1.00 1.13 ? 32  DC  C "H4'"  2  
ATOM 3673  H "H3'"  . DC  B 2 15 ? -83.375  -15.454 -15.577 1.00 1.25 ? 32  DC  C "H3'"  2  
ATOM 3674  H "H2'"  . DC  B 2 15 ? -81.837  -15.215 -17.234 1.00 1.16 ? 32  DC  C "H2'"  2  
ATOM 3675  H "H2''" . DC  B 2 15 ? -83.173  -14.707 -18.302 1.00 1.22 ? 32  DC  C "H2''" 2  
ATOM 3676  H "H1'"  . DC  B 2 15 ? -82.466  -12.557 -18.257 1.00 1.01 ? 32  DC  C "H1'"  2  
ATOM 3677  H H41    . DC  B 2 15 ? -76.084  -12.337 -17.921 1.00 0.81 ? 32  DC  C H41    2  
ATOM 3678  H H42    . DC  B 2 15 ? -76.073  -13.296 -16.460 1.00 0.87 ? 32  DC  C H42    2  
ATOM 3679  H H5     . DC  B 2 15 ? -78.070  -14.149 -15.427 1.00 0.95 ? 32  DC  C H5     2  
ATOM 3680  H H6     . DC  B 2 15 ? -80.520  -14.236 -15.541 1.00 1.01 ? 32  DC  C H6     2  
ATOM 3681  P P      . DG  B 2 16 ? -85.386  -16.148 -17.446 1.00 1.44 ? 33  DG  C P      2  
ATOM 3682  O OP1    . DG  B 2 16 ? -86.827  -16.374 -17.191 1.00 1.57 ? 33  DG  C OP1    2  
ATOM 3683  O OP2    . DG  B 2 16 ? -84.401  -17.190 -17.083 1.00 1.48 ? 33  DG  C OP2    2  
ATOM 3684  O "O5'"  . DG  B 2 16 ? -85.195  -15.798 -19.007 1.00 1.39 ? 33  DG  C "O5'"  2  
ATOM 3685  C "C5'"  . DG  B 2 16 ? -85.645  -14.545 -19.526 1.00 1.37 ? 33  DG  C "C5'"  2  
ATOM 3686  C "C4'"  . DG  B 2 16 ? -85.239  -14.354 -20.992 1.00 1.33 ? 33  DG  C "C4'"  2  
ATOM 3687  O "O4'"  . DG  B 2 16 ? -83.835  -14.012 -21.079 1.00 1.27 ? 33  DG  C "O4'"  2  
ATOM 3688  C "C3'"  . DG  B 2 16 ? -85.468  -15.623 -21.824 1.00 1.41 ? 33  DG  C "C3'"  2  
ATOM 3689  O "O3'"  . DG  B 2 16 ? -86.243  -15.327 -22.989 1.00 1.45 ? 33  DG  C "O3'"  2  
ATOM 3690  C "C2'"  . DG  B 2 16 ? -84.092  -16.100 -22.230 1.00 1.40 ? 33  DG  C "C2'"  2  
ATOM 3691  C "C1'"  . DG  B 2 16 ? -83.124  -14.975 -21.886 1.00 1.29 ? 33  DG  C "C1'"  2  
ATOM 3692  N N9     . DG  B 2 16 ? -81.943  -15.495 -21.169 1.00 1.26 ? 33  DG  C N9     2  
ATOM 3693  C C8     . DG  B 2 16 ? -81.887  -16.290 -20.059 1.00 1.31 ? 33  DG  C C8     2  
ATOM 3694  N N7     . DG  B 2 16 ? -80.690  -16.583 -19.649 1.00 1.30 ? 33  DG  C N7     2  
ATOM 3695  C C5     . DG  B 2 16 ? -79.871  -15.927 -20.567 1.00 1.23 ? 33  DG  C C5     2  
ATOM 3696  C C6     . DG  B 2 16 ? -78.450  -15.870 -20.645 1.00 1.21 ? 33  DG  C C6     2  
ATOM 3697  O O6     . DG  B 2 16 ? -77.624  -16.400 -19.903 1.00 1.25 ? 33  DG  C O6     2  
ATOM 3698  N N1     . DG  B 2 16 ? -78.030  -15.100 -21.724 1.00 1.17 ? 33  DG  C N1     2  
ATOM 3699  C C2     . DG  B 2 16 ? -78.867  -14.461 -22.616 1.00 1.16 ? 33  DG  C C2     2  
ATOM 3700  N N2     . DG  B 2 16 ? -78.275  -13.765 -23.588 1.00 1.15 ? 33  DG  C N2     2  
ATOM 3701  N N3     . DG  B 2 16 ? -80.201  -14.514 -22.546 1.00 1.18 ? 33  DG  C N3     2  
ATOM 3702  C C4     . DG  B 2 16 ? -80.630  -15.260 -21.500 1.00 1.21 ? 33  DG  C C4     2  
ATOM 3703  H "H5'"  . DG  B 2 16 ? -85.218  -13.740 -18.930 1.00 1.36 ? 33  DG  C "H5'"  2  
ATOM 3704  H "H5''" . DG  B 2 16 ? -86.732  -14.503 -19.454 1.00 1.43 ? 33  DG  C "H5''" 2  
ATOM 3705  H "H4'"  . DG  B 2 16 ? -85.826  -13.542 -21.419 1.00 1.32 ? 33  DG  C "H4'"  2  
ATOM 3706  H "H3'"  . DG  B 2 16 ? -85.975  -16.392 -21.233 1.00 1.48 ? 33  DG  C "H3'"  2  
ATOM 3707  H "H2'"  . DG  B 2 16 ? -83.825  -17.002 -21.678 1.00 1.45 ? 33  DG  C "H2'"  2  
ATOM 3708  H "H2''" . DG  B 2 16 ? -84.072  -16.308 -23.299 1.00 1.44 ? 33  DG  C "H2''" 2  
ATOM 3709  H "H1'"  . DG  B 2 16 ? -82.795  -14.485 -22.807 1.00 1.27 ? 33  DG  C "H1'"  2  
ATOM 3710  H H8     . DG  B 2 16 ? -82.784  -16.656 -19.556 1.00 1.38 ? 33  DG  C H8     2  
ATOM 3711  H H1     . DG  B 2 16 ? -77.033  -15.014 -21.842 1.00 1.18 ? 33  DG  C H1     2  
ATOM 3712  H H21    . DG  B 2 16 ? -77.267  -13.729 -23.637 1.00 1.16 ? 33  DG  C H21    2  
ATOM 3713  H H22    . DG  B 2 16 ? -78.834  -13.274 -24.272 1.00 1.16 ? 33  DG  C H22    2  
ATOM 3714  P P      . DA  B 2 17 ? -86.664  -16.498 -24.010 1.00 1.56 ? 34  DA  C P      2  
ATOM 3715  O OP1    . DA  B 2 17 ? -87.814  -16.022 -24.810 1.00 1.62 ? 34  DA  C OP1    2  
ATOM 3716  O OP2    . DA  B 2 17 ? -86.768  -17.764 -23.250 1.00 1.64 ? 34  DA  C OP2    2  
ATOM 3717  O "O5'"  . DA  B 2 17 ? -85.380  -16.602 -24.980 1.00 1.55 ? 34  DA  C "O5'"  2  
ATOM 3718  C "C5'"  . DA  B 2 17 ? -84.917  -15.459 -25.702 1.00 1.50 ? 34  DA  C "C5'"  2  
ATOM 3719  C "C4'"  . DA  B 2 17 ? -83.999  -15.856 -26.869 1.00 1.56 ? 34  DA  C "C4'"  2  
ATOM 3720  O "O4'"  . DA  B 2 17 ? -82.621  -15.870 -26.422 1.00 1.51 ? 34  DA  C "O4'"  2  
ATOM 3721  C "C3'"  . DA  B 2 17 ? -84.332  -17.250 -27.424 1.00 1.70 ? 34  DA  C "C3'"  2  
ATOM 3722  O "O3'"  . DA  B 2 17 ? -84.535  -17.195 -28.839 1.00 1.79 ? 34  DA  C "O3'"  2  
ATOM 3723  C "C2'"  . DA  B 2 17 ? -83.125  -18.113 -27.122 1.00 1.72 ? 34  DA  C "C2'"  2  
ATOM 3724  C "C1'"  . DA  B 2 17 ? -82.029  -17.173 -26.616 1.00 1.60 ? 34  DA  C "C1'"  2  
ATOM 3725  N N9     . DA  B 2 17 ? -81.419  -17.670 -25.361 1.00 1.57 ? 34  DA  C N9     2  
ATOM 3726  C C8     . DA  B 2 17 ? -82.020  -18.182 -24.242 1.00 1.59 ? 34  DA  C C8     2  
ATOM 3727  N N7     . DA  B 2 17 ? -81.206  -18.552 -23.299 1.00 1.58 ? 34  DA  C N7     2  
ATOM 3728  C C5     . DA  B 2 17 ? -79.953  -18.262 -23.833 1.00 1.55 ? 34  DA  C C5     2  
ATOM 3729  C C6     . DA  B 2 17 ? -78.653  -18.417 -23.335 1.00 1.55 ? 34  DA  C C6     2  
ATOM 3730  N N6     . DA  B 2 17 ? -78.388  -18.917 -22.126 1.00 1.57 ? 34  DA  C N6     2  
ATOM 3731  N N1     . DA  B 2 17 ? -77.638  -18.031 -24.124 1.00 1.55 ? 34  DA  C N1     2  
ATOM 3732  C C2     . DA  B 2 17 ? -77.881  -17.516 -25.328 1.00 1.55 ? 34  DA  C C2     2  
ATOM 3733  N N3     . DA  B 2 17 ? -79.070  -17.325 -25.895 1.00 1.56 ? 34  DA  C N3     2  
ATOM 3734  C C4     . DA  B 2 17 ? -80.071  -17.725 -25.084 1.00 1.55 ? 34  DA  C C4     2  
ATOM 3735  H "H5'"  . DA  B 2 17 ? -84.367  -14.806 -25.023 1.00 1.41 ? 34  DA  C "H5'"  2  
ATOM 3736  H "H5''" . DA  B 2 17 ? -85.778  -14.915 -26.092 1.00 1.52 ? 34  DA  C "H5''" 2  
ATOM 3737  H "H4'"  . DA  B 2 17 ? -84.102  -15.123 -27.669 1.00 1.57 ? 34  DA  C "H4'"  2  
ATOM 3738  H "H3'"  . DA  B 2 17 ? -85.223  -17.662 -26.942 1.00 1.73 ? 34  DA  C "H3'"  2  
ATOM 3739  H "HO3'" . DA  B 2 17 ? -85.097  -16.440 -29.019 1.00 2.00 ? 34  DA  C "HO3'" 2  
ATOM 3740  H "H2'"  . DA  B 2 17 ? -83.372  -18.856 -26.362 1.00 1.75 ? 34  DA  C "H2'"  2  
ATOM 3741  H "H2''" . DA  B 2 17 ? -82.799  -18.618 -28.032 1.00 1.81 ? 34  DA  C "H2''" 2  
ATOM 3742  H "H1'"  . DA  B 2 17 ? -81.248  -17.091 -27.375 1.00 1.62 ? 34  DA  C "H1'"  2  
ATOM 3743  H H8     . DA  B 2 17 ? -83.102  -18.270 -24.143 1.00 1.62 ? 34  DA  C H8     2  
ATOM 3744  H H61    . DA  B 2 17 ? -77.430  -19.007 -21.815 1.00 1.58 ? 34  DA  C H61    2  
ATOM 3745  H H62    . DA  B 2 17 ? -79.144  -19.207 -21.523 1.00 1.59 ? 34  DA  C H62    2  
ATOM 3746  H H2     . DA  B 2 17 ? -77.011  -17.215 -25.911 1.00 1.57 ? 34  DA  C H2     2  
ATOM 3747  N N      . VAL C 3 1  ? -100.181 15.315  -29.002 1.00 2.88 ? 10  VAL A N      2  
ATOM 3748  C CA     . VAL C 3 1  ? -100.365 14.266  -27.959 1.00 2.54 ? 10  VAL A CA     2  
ATOM 3749  C C      . VAL C 3 1  ? -99.968  14.820  -26.589 1.00 2.47 ? 10  VAL A C      2  
ATOM 3750  O O      . VAL C 3 1  ? -99.540  14.087  -25.721 1.00 2.82 ? 10  VAL A O      2  
ATOM 3751  C CB     . VAL C 3 1  ? -99.488  13.053  -28.284 1.00 2.80 ? 10  VAL A CB     2  
ATOM 3752  C CG1    . VAL C 3 1  ? -99.976  12.401  -29.578 1.00 3.34 ? 10  VAL A CG1    2  
ATOM 3753  C CG2    . VAL C 3 1  ? -98.033  13.501  -28.456 1.00 2.97 ? 10  VAL A CG2    2  
ATOM 3754  H H      . VAL C 3 1  ? -100.793 16.078  -29.045 1.00 3.33 ? 10  VAL A H      2  
ATOM 3755  H HA     . VAL C 3 1  ? -101.399 13.960  -27.936 1.00 2.70 ? 10  VAL A HA     2  
ATOM 3756  H HB     . VAL C 3 1  ? -99.554  12.338  -27.476 1.00 3.12 ? 10  VAL A HB     2  
ATOM 3757  H HG11   . VAL C 3 1  ? -100.009 13.139  -30.364 1.00 3.84 ? 10  VAL A HG11   2  
ATOM 3758  H HG12   . VAL C 3 1  ? -99.301  11.607  -29.857 1.00 3.62 ? 10  VAL A HG12   2  
ATOM 3759  H HG13   . VAL C 3 1  ? -100.965 11.994  -29.423 1.00 3.57 ? 10  VAL A HG13   2  
ATOM 3760  H HG21   . VAL C 3 1  ? -97.991  14.359  -29.109 1.00 3.34 ? 10  VAL A HG21   2  
ATOM 3761  H HG22   . VAL C 3 1  ? -97.620  13.762  -27.493 1.00 3.26 ? 10  VAL A HG22   2  
ATOM 3762  H HG23   . VAL C 3 1  ? -97.456  12.695  -28.887 1.00 3.06 ? 10  VAL A HG23   2  
ATOM 3763  N N      . ILE C 3 2  ? -100.115 16.104  -26.380 1.00 2.30 ? 11  ILE A N      2  
ATOM 3764  C CA     . ILE C 3 2  ? -99.759  16.705  -25.064 1.00 2.34 ? 11  ILE A CA     2  
ATOM 3765  C C      . ILE C 3 2  ? -100.819 17.756  -24.687 1.00 2.16 ? 11  ILE A C      2  
ATOM 3766  O O      . ILE C 3 2  ? -100.521 18.926  -24.581 1.00 2.18 ? 11  ILE A O      2  
ATOM 3767  C CB     . ILE C 3 2  ? -98.357  17.339  -25.174 1.00 2.83 ? 11  ILE A CB     2  
ATOM 3768  C CG1    . ILE C 3 2  ? -97.896  17.886  -23.804 1.00 3.26 ? 11  ILE A CG1    2  
ATOM 3769  C CG2    . ILE C 3 2  ? -98.360  18.473  -26.224 1.00 2.95 ? 11  ILE A CG2    2  
ATOM 3770  C CD1    . ILE C 3 2  ? -97.822  16.753  -22.772 1.00 3.52 ? 11  ILE A CD1    2  
ATOM 3771  H H      . ILE C 3 2  ? -100.470 16.676  -27.087 1.00 2.35 ? 11  ILE A H      2  
ATOM 3772  H HA     . ILE C 3 2  ? -99.744  15.934  -24.307 1.00 2.58 ? 11  ILE A HA     2  
ATOM 3773  H HB     . ILE C 3 2  ? -97.662  16.572  -25.496 1.00 3.23 ? 11  ILE A HB     2  
ATOM 3774  H HG12   . ILE C 3 2  ? -96.917  18.327  -23.914 1.00 3.70 ? 11  ILE A HG12   2  
ATOM 3775  H HG13   . ILE C 3 2  ? -98.583  18.638  -23.457 1.00 3.50 ? 11  ILE A HG13   2  
ATOM 3776  H HG21   . ILE C 3 2  ? -99.111  18.273  -26.977 1.00 3.20 ? 11  ILE A HG21   2  
ATOM 3777  H HG22   . ILE C 3 2  ? -98.576  19.416  -25.747 1.00 3.25 ? 11  ILE A HG22   2  
ATOM 3778  H HG23   . ILE C 3 2  ? -97.389  18.528  -26.699 1.00 3.09 ? 11  ILE A HG23   2  
ATOM 3779  H HD11   . ILE C 3 2  ? -97.525  15.834  -23.256 1.00 3.88 ? 11  ILE A HD11   2  
ATOM 3780  H HD12   . ILE C 3 2  ? -97.099  17.008  -22.011 1.00 3.51 ? 11  ILE A HD12   2  
ATOM 3781  H HD13   . ILE C 3 2  ? -98.792  16.624  -22.313 1.00 3.94 ? 11  ILE A HD13   2  
ATOM 3782  N N      . PRO C 3 3  ? -102.040 17.306  -24.477 1.00 2.45 ? 12  PRO A N      2  
ATOM 3783  C CA     . PRO C 3 3  ? -103.129 18.212  -24.087 1.00 2.83 ? 12  PRO A CA     2  
ATOM 3784  C C      . PRO C 3 3  ? -102.874 18.668  -22.646 1.00 2.73 ? 12  PRO A C      2  
ATOM 3785  O O      . PRO C 3 3  ? -103.596 19.473  -22.094 1.00 3.20 ? 12  PRO A O      2  
ATOM 3786  C CB     . PRO C 3 3  ? -104.408 17.355  -24.202 1.00 3.56 ? 12  PRO A CB     2  
ATOM 3787  C CG     . PRO C 3 3  ? -103.952 15.873  -24.297 1.00 3.55 ? 12  PRO A CG     2  
ATOM 3788  C CD     . PRO C 3 3  ? -102.439 15.884  -24.615 1.00 2.86 ? 12  PRO A CD     2  
ATOM 3789  H HA     . PRO C 3 3  ? -103.177 19.058  -24.753 1.00 2.97 ? 12  PRO A HA     2  
ATOM 3790  H HB2    . PRO C 3 3  ? -105.044 17.502  -23.338 1.00 3.91 ? 12  PRO A HB2    2  
ATOM 3791  H HB3    . PRO C 3 3  ? -104.946 17.622  -25.100 1.00 3.95 ? 12  PRO A HB3    2  
ATOM 3792  H HG2    . PRO C 3 3  ? -104.131 15.375  -23.352 1.00 3.96 ? 12  PRO A HG2    2  
ATOM 3793  H HG3    . PRO C 3 3  ? -104.489 15.363  -25.087 1.00 3.84 ? 12  PRO A HG3    2  
ATOM 3794  H HD2    . PRO C 3 3  ? -101.901 15.263  -23.910 1.00 3.03 ? 12  PRO A HD2    2  
ATOM 3795  H HD3    . PRO C 3 3  ? -102.267 15.547  -25.625 1.00 2.81 ? 12  PRO A HD3    2  
ATOM 3796  N N      . ALA C 3 4  ? -101.841 18.142  -22.042 1.00 2.41 ? 13  ALA A N      2  
ATOM 3797  C CA     . ALA C 3 4  ? -101.508 18.518  -20.642 1.00 2.65 ? 13  ALA A CA     2  
ATOM 3798  C C      . ALA C 3 4  ? -101.040 19.976  -20.588 1.00 2.45 ? 13  ALA A C      2  
ATOM 3799  O O      . ALA C 3 4  ? -101.530 20.767  -19.808 1.00 2.41 ? 13  ALA A O      2  
ATOM 3800  C CB     . ALA C 3 4  ? -100.391 17.599  -20.143 1.00 2.93 ? 13  ALA A CB     2  
ATOM 3801  H H      . ALA C 3 4  ? -101.281 17.493  -22.516 1.00 2.29 ? 13  ALA A H      2  
ATOM 3802  H HA     . ALA C 3 4  ? -102.379 18.398  -20.019 1.00 3.12 ? 13  ALA A HA     2  
ATOM 3803  H HB1    . ALA C 3 4  ? -100.563 16.598  -20.511 1.00 3.08 ? 13  ALA A HB1    2  
ATOM 3804  H HB2    . ALA C 3 4  ? -99.436  17.955  -20.507 1.00 3.13 ? 13  ALA A HB2    2  
ATOM 3805  H HB3    . ALA C 3 4  ? -100.387 17.593  -19.063 1.00 3.43 ? 13  ALA A HB3    2  
ATOM 3806  N N      . ALA C 3 5  ? -100.096 20.335  -21.414 1.00 2.64 ? 14  ALA A N      2  
ATOM 3807  C CA     . ALA C 3 5  ? -99.599  21.741  -21.408 1.00 2.80 ? 14  ALA A CA     2  
ATOM 3808  C C      . ALA C 3 5  ? -100.740 22.669  -21.825 1.00 2.70 ? 14  ALA A C      2  
ATOM 3809  O O      . ALA C 3 5  ? -100.756 23.841  -21.498 1.00 2.87 ? 14  ALA A O      2  
ATOM 3810  C CB     . ALA C 3 5  ? -98.425  21.879  -22.386 1.00 3.29 ? 14  ALA A CB     2  
ATOM 3811  H H      . ALA C 3 5  ? -99.717  19.680  -22.037 1.00 2.86 ? 14  ALA A H      2  
ATOM 3812  H HA     . ALA C 3 5  ? -99.269  22.001  -20.413 1.00 2.86 ? 14  ALA A HA     2  
ATOM 3813  H HB1    . ALA C 3 5  ? -97.695  21.108  -22.186 1.00 3.55 ? 14  ALA A HB1    2  
ATOM 3814  H HB2    . ALA C 3 5  ? -98.784  21.780  -23.401 1.00 3.56 ? 14  ALA A HB2    2  
ATOM 3815  H HB3    . ALA C 3 5  ? -97.966  22.847  -22.261 1.00 3.60 ? 14  ALA A HB3    2  
ATOM 3816  N N      . ALA C 3 6  ? -101.690 22.146  -22.552 1.00 2.63 ? 15  ALA A N      2  
ATOM 3817  C CA     . ALA C 3 6  ? -102.842 22.970  -23.020 1.00 2.72 ? 15  ALA A CA     2  
ATOM 3818  C C      . ALA C 3 6  ? -103.911 23.076  -21.923 1.00 2.61 ? 15  ALA A C      2  
ATOM 3819  O O      . ALA C 3 6  ? -104.593 24.079  -21.805 1.00 2.73 ? 15  ALA A O      2  
ATOM 3820  C CB     . ALA C 3 6  ? -103.458 22.293  -24.243 1.00 2.93 ? 15  ALA A CB     2  
ATOM 3821  H H      . ALA C 3 6  ? -101.640 21.199  -22.800 1.00 2.65 ? 15  ALA A H      2  
ATOM 3822  H HA     . ALA C 3 6  ? -102.499 23.958  -23.290 1.00 2.88 ? 15  ALA A HA     2  
ATOM 3823  H HB1    . ALA C 3 6  ? -102.684 22.087  -24.967 1.00 2.95 ? 15  ALA A HB1    2  
ATOM 3824  H HB2    . ALA C 3 6  ? -103.921 21.366  -23.937 1.00 3.26 ? 15  ALA A HB2    2  
ATOM 3825  H HB3    . ALA C 3 6  ? -104.202 22.942  -24.681 1.00 3.28 ? 15  ALA A HB3    2  
ATOM 3826  N N      . LEU C 3 7  ? -104.078 22.049  -21.133 1.00 2.52 ? 16  LEU A N      2  
ATOM 3827  C CA     . LEU C 3 7  ? -105.119 22.097  -20.060 1.00 2.60 ? 16  LEU A CA     2  
ATOM 3828  C C      . LEU C 3 7  ? -104.606 22.928  -18.888 1.00 2.60 ? 16  LEU A C      2  
ATOM 3829  O O      . LEU C 3 7  ? -105.342 23.679  -18.277 1.00 2.88 ? 16  LEU A O      2  
ATOM 3830  C CB     . LEU C 3 7  ? -105.420 20.673  -19.572 1.00 2.69 ? 16  LEU A CB     2  
ATOM 3831  C CG     . LEU C 3 7  ? -106.164 19.878  -20.666 1.00 2.71 ? 16  LEU A CG     2  
ATOM 3832  C CD1    . LEU C 3 7  ? -105.926 18.375  -20.475 1.00 3.23 ? 16  LEU A CD1    2  
ATOM 3833  C CD2    . LEU C 3 7  ? -107.674 20.160  -20.593 1.00 2.88 ? 16  LEU A CD2    2  
ATOM 3834  H H      . LEU C 3 7  ? -103.529 21.247  -21.251 1.00 2.49 ? 16  LEU A H      2  
ATOM 3835  H HA     . LEU C 3 7  ? -106.021 22.543  -20.450 1.00 2.75 ? 16  LEU A HA     2  
ATOM 3836  H HB2    . LEU C 3 7  ? -104.486 20.179  -19.334 1.00 2.80 ? 16  LEU A HB2    2  
ATOM 3837  H HB3    . LEU C 3 7  ? -106.029 20.724  -18.679 1.00 3.11 ? 16  LEU A HB3    2  
ATOM 3838  H HG     . LEU C 3 7  ? -105.793 20.175  -21.637 1.00 3.07 ? 16  LEU A HG     2  
ATOM 3839  H HD11   . LEU C 3 7  ? -104.865 18.169  -20.517 1.00 3.69 ? 16  LEU A HD11   2  
ATOM 3840  H HD12   . LEU C 3 7  ? -106.314 18.066  -19.517 1.00 3.53 ? 16  LEU A HD12   2  
ATOM 3841  H HD13   . LEU C 3 7  ? -106.428 17.827  -21.261 1.00 3.48 ? 16  LEU A HD13   2  
ATOM 3842  H HD21   . LEU C 3 7  ? -108.027 20.011  -19.583 1.00 3.05 ? 16  LEU A HD21   2  
ATOM 3843  H HD22   . LEU C 3 7  ? -107.865 21.180  -20.896 1.00 3.17 ? 16  LEU A HD22   2  
ATOM 3844  H HD23   . LEU C 3 7  ? -108.198 19.489  -21.256 1.00 3.26 ? 16  LEU A HD23   2  
ATOM 3845  N N      . ALA C 3 8  ? -103.353 22.796  -18.562 1.00 2.45 ? 17  ALA A N      2  
ATOM 3846  C CA     . ALA C 3 8  ? -102.798 23.576  -17.423 1.00 2.61 ? 17  ALA A CA     2  
ATOM 3847  C C      . ALA C 3 8  ? -102.393 24.973  -17.896 1.00 2.87 ? 17  ALA A C      2  
ATOM 3848  O O      . ALA C 3 8  ? -102.175 25.864  -17.102 1.00 3.32 ? 17  ALA A O      2  
ATOM 3849  C CB     . ALA C 3 8  ? -101.572 22.852  -16.868 1.00 2.59 ? 17  ALA A CB     2  
ATOM 3850  H H      . ALA C 3 8  ? -102.778 22.180  -19.061 1.00 2.38 ? 17  ALA A H      2  
ATOM 3851  H HA     . ALA C 3 8  ? -103.543 23.663  -16.649 1.00 2.74 ? 17  ALA A HA     2  
ATOM 3852  H HB1    . ALA C 3 8  ? -100.921 22.563  -17.680 1.00 2.93 ? 17  ALA A HB1    2  
ATOM 3853  H HB2    . ALA C 3 8  ? -101.038 23.509  -16.197 1.00 2.79 ? 17  ALA A HB2    2  
ATOM 3854  H HB3    . ALA C 3 8  ? -101.889 21.971  -16.330 1.00 2.61 ? 17  ALA A HB3    2  
ATOM 3855  N N      . GLY C 3 9  ? -102.282 25.177  -19.181 1.00 2.87 ? 18  GLY A N      2  
ATOM 3856  C CA     . GLY C 3 9  ? -101.878 26.524  -19.681 1.00 3.24 ? 18  GLY A CA     2  
ATOM 3857  C C      . GLY C 3 9  ? -100.393 26.731  -19.384 1.00 2.97 ? 18  GLY A C      2  
ATOM 3858  O O      . GLY C 3 9  ? -99.788  27.699  -19.802 1.00 3.34 ? 18  GLY A O      2  
ATOM 3859  H H      . GLY C 3 9  ? -102.453 24.448  -19.811 1.00 2.82 ? 18  GLY A H      2  
ATOM 3860  H HA2    . GLY C 3 9  ? -102.053 26.584  -20.750 1.00 3.48 ? 18  GLY A HA2    2  
ATOM 3861  H HA3    . GLY C 3 9  ? -102.453 27.283  -19.177 1.00 3.70 ? 18  GLY A HA3    2  
ATOM 3862  N N      . TYR C 3 10 ? -99.812  25.815  -18.656 1.00 2.61 ? 19  TYR A N      2  
ATOM 3863  C CA     . TYR C 3 10 ? -98.370  25.916  -18.297 1.00 2.84 ? 19  TYR A CA     2  
ATOM 3864  C C      . TYR C 3 10 ? -97.506  25.637  -19.535 1.00 3.02 ? 19  TYR A C      2  
ATOM 3865  O O      . TYR C 3 10 ? -97.572  24.581  -20.130 1.00 3.28 ? 19  TYR A O      2  
ATOM 3866  C CB     . TYR C 3 10 ? -98.085  24.896  -17.166 1.00 2.96 ? 19  TYR A CB     2  
ATOM 3867  C CG     . TYR C 3 10 ? -96.679  24.333  -17.263 1.00 2.45 ? 19  TYR A CG     2  
ATOM 3868  C CD1    . TYR C 3 10 ? -95.574  25.149  -17.003 1.00 2.68 ? 19  TYR A CD1    2  
ATOM 3869  C CD2    . TYR C 3 10 ? -96.488  22.990  -17.622 1.00 2.56 ? 19  TYR A CD2    2  
ATOM 3870  C CE1    . TYR C 3 10 ? -94.278  24.626  -17.104 1.00 2.90 ? 19  TYR A CE1    2  
ATOM 3871  C CE2    . TYR C 3 10 ? -95.197  22.468  -17.720 1.00 2.80 ? 19  TYR A CE2    2  
ATOM 3872  C CZ     . TYR C 3 10 ? -94.091  23.286  -17.463 1.00 2.92 ? 19  TYR A CZ     2  
ATOM 3873  O OH     . TYR C 3 10 ? -92.815  22.771  -17.571 1.00 3.66 ? 19  TYR A OH     2  
ATOM 3874  H H      . TYR C 3 10 ? -100.336 25.053  -18.334 1.00 2.43 ? 19  TYR A H      2  
ATOM 3875  H HA     . TYR C 3 10 ? -98.159  26.917  -17.940 1.00 3.20 ? 19  TYR A HA     2  
ATOM 3876  H HB2    . TYR C 3 10 ? -98.209  25.381  -16.207 1.00 3.48 ? 19  TYR A HB2    2  
ATOM 3877  H HB3    . TYR C 3 10 ? -98.799  24.089  -17.243 1.00 3.39 ? 19  TYR A HB3    2  
ATOM 3878  H HD1    . TYR C 3 10 ? -95.721  26.187  -16.726 1.00 3.20 ? 19  TYR A HD1    2  
ATOM 3879  H HD2    . TYR C 3 10 ? -97.339  22.358  -17.821 1.00 3.01 ? 19  TYR A HD2    2  
ATOM 3880  H HE1    . TYR C 3 10 ? -93.425  25.254  -16.903 1.00 3.51 ? 19  TYR A HE1    2  
ATOM 3881  H HE2    . TYR C 3 10 ? -95.056  21.430  -17.992 1.00 3.38 ? 19  TYR A HE2    2  
ATOM 3882  H HH     . TYR C 3 10 ? -92.710  22.426  -18.461 1.00 4.08 ? 19  TYR A HH     2  
ATOM 3883  N N      . THR C 3 11 ? -96.688  26.592  -19.904 1.00 3.30 ? 20  THR A N      2  
ATOM 3884  C CA     . THR C 3 11 ? -95.789  26.428  -21.087 1.00 3.67 ? 20  THR A CA     2  
ATOM 3885  C C      . THR C 3 11 ? -94.350  26.719  -20.655 1.00 3.82 ? 20  THR A C      2  
ATOM 3886  O O      . THR C 3 11 ? -93.764  25.980  -19.892 1.00 4.07 ? 20  THR A O      2  
ATOM 3887  C CB     . THR C 3 11 ? -96.219  27.417  -22.169 1.00 4.26 ? 20  THR A CB     2  
ATOM 3888  O OG1    . THR C 3 11 ? -97.607  27.251  -22.414 1.00 4.68 ? 20  THR A OG1    2  
ATOM 3889  C CG2    . THR C 3 11 ? -95.440  27.154  -23.464 1.00 4.79 ? 20  THR A CG2    2  
ATOM 3890  H H      . THR C 3 11 ? -96.660  27.426  -19.391 1.00 3.51 ? 20  THR A H      2  
ATOM 3891  H HA     . THR C 3 11 ? -95.853  25.419  -21.474 1.00 3.87 ? 20  THR A HA     2  
ATOM 3892  H HB     . THR C 3 11 ? -96.032  28.424  -21.834 1.00 4.50 ? 20  THR A HB     2  
ATOM 3893  H HG1    . THR C 3 11 ? -97.994  26.822  -21.647 1.00 4.92 ? 20  THR A HG1    2  
ATOM 3894  H HG21   . THR C 3 11 ? -94.396  27.009  -23.239 1.00 5.16 ? 20  THR A HG21   2  
ATOM 3895  H HG22   . THR C 3 11 ? -95.828  26.270  -23.942 1.00 5.01 ? 20  THR A HG22   2  
ATOM 3896  H HG23   . THR C 3 11 ? -95.551  27.998  -24.126 1.00 5.03 ? 20  THR A HG23   2  
ATOM 3897  N N      . GLY C 3 12 ? -93.774  27.790  -21.134 1.00 4.13 ? 21  GLY A N      2  
ATOM 3898  C CA     . GLY C 3 12 ? -92.374  28.130  -20.752 1.00 4.78 ? 21  GLY A CA     2  
ATOM 3899  C C      . GLY C 3 12 ? -92.380  29.030  -19.514 1.00 4.66 ? 21  GLY A C      2  
ATOM 3900  O O      . GLY C 3 12 ? -91.860  30.125  -19.537 1.00 5.20 ? 21  GLY A O      2  
ATOM 3901  H H      . GLY C 3 12 ? -94.266  28.372  -21.748 1.00 4.20 ? 21  GLY A H      2  
ATOM 3902  H HA2    . GLY C 3 12 ? -91.826  27.221  -20.538 1.00 5.11 ? 21  GLY A HA2    2  
ATOM 3903  H HA3    . GLY C 3 12 ? -91.896  28.650  -21.568 1.00 5.28 ? 21  GLY A HA3    2  
ATOM 3904  N N      . SER C 3 13 ? -92.970  28.578  -18.433 1.00 4.13 ? 22  SER A N      2  
ATOM 3905  C CA     . SER C 3 13 ? -93.019  29.411  -17.186 1.00 4.18 ? 22  SER A CA     2  
ATOM 3906  C C      . SER C 3 13 ? -92.050  28.832  -16.152 1.00 3.70 ? 22  SER A C      2  
ATOM 3907  O O      . SER C 3 13 ? -92.348  28.759  -14.975 1.00 3.61 ? 22  SER A O      2  
ATOM 3908  C CB     . SER C 3 13 ? -94.438  29.385  -16.615 1.00 4.44 ? 22  SER A CB     2  
ATOM 3909  O OG     . SER C 3 13 ? -94.517  30.285  -15.518 1.00 4.83 ? 22  SER A OG     2  
ATOM 3910  H H      . SER C 3 13 ? -93.387  27.692  -18.441 1.00 3.82 ? 22  SER A H      2  
ATOM 3911  H HA     . SER C 3 13 ? -92.739  30.431  -17.406 1.00 4.60 ? 22  SER A HA     2  
ATOM 3912  H HB2    . SER C 3 13 ? -95.139  29.686  -17.374 1.00 4.64 ? 22  SER A HB2    2  
ATOM 3913  H HB3    . SER C 3 13 ? -94.676  28.380  -16.287 1.00 4.59 ? 22  SER A HB3    2  
ATOM 3914  H HG     . SER C 3 13 ? -94.384  31.176  -15.853 1.00 4.97 ? 22  SER A HG     2  
ATOM 3915  N N      . GLY C 3 14 ? -90.893  28.408  -16.583 1.00 3.71 ? 23  GLY A N      2  
ATOM 3916  C CA     . GLY C 3 14 ? -89.906  27.822  -15.632 1.00 3.61 ? 23  GLY A CA     2  
ATOM 3917  C C      . GLY C 3 14 ? -90.224  26.334  -15.476 1.00 3.02 ? 23  GLY A C      2  
ATOM 3918  O O      . GLY C 3 14 ? -91.245  25.885  -15.952 1.00 2.92 ? 23  GLY A O      2  
ATOM 3919  H H      . GLY C 3 14 ? -90.673  28.469  -17.536 1.00 4.01 ? 23  GLY A H      2  
ATOM 3920  H HA2    . GLY C 3 14 ? -88.911  27.951  -16.031 1.00 4.02 ? 23  GLY A HA2    2  
ATOM 3921  H HA3    . GLY C 3 14 ? -89.981  28.309  -14.673 1.00 3.82 ? 23  GLY A HA3    2  
ATOM 3922  N N      . PRO C 3 15 ? -89.353  25.599  -14.828 1.00 2.85 ? 24  PRO A N      2  
ATOM 3923  C CA     . PRO C 3 15 ? -89.580  24.156  -14.638 1.00 2.53 ? 24  PRO A CA     2  
ATOM 3924  C C      . PRO C 3 15 ? -90.758  23.911  -13.671 1.00 2.15 ? 24  PRO A C      2  
ATOM 3925  O O      . PRO C 3 15 ? -90.809  24.449  -12.584 1.00 2.13 ? 24  PRO A O      2  
ATOM 3926  C CB     . PRO C 3 15 ? -88.250  23.635  -14.053 1.00 2.78 ? 24  PRO A CB     2  
ATOM 3927  C CG     . PRO C 3 15 ? -87.430  24.879  -13.604 1.00 3.20 ? 24  PRO A CG     2  
ATOM 3928  C CD     . PRO C 3 15 ? -88.096  26.117  -14.243 1.00 3.25 ? 24  PRO A CD     2  
ATOM 3929  H HA     . PRO C 3 15 ? -89.777  23.686  -15.590 1.00 2.64 ? 24  PRO A HA     2  
ATOM 3930  H HB2    . PRO C 3 15 ? -88.436  22.981  -13.209 1.00 2.68 ? 24  PRO A HB2    2  
ATOM 3931  H HB3    . PRO C 3 15 ? -87.700  23.098  -14.815 1.00 2.97 ? 24  PRO A HB3    2  
ATOM 3932  H HG2    . PRO C 3 15 ? -87.449  24.960  -12.523 1.00 3.31 ? 24  PRO A HG2    2  
ATOM 3933  H HG3    . PRO C 3 15 ? -86.408  24.794  -13.944 1.00 3.56 ? 24  PRO A HG3    2  
ATOM 3934  H HD2    . PRO C 3 15 ? -88.303  26.870  -13.493 1.00 3.41 ? 24  PRO A HD2    2  
ATOM 3935  H HD3    . PRO C 3 15 ? -87.464  26.523  -15.019 1.00 3.58 ? 24  PRO A HD3    2  
ATOM 3936  N N      . ILE C 3 16 ? -91.692  23.079  -14.068 1.00 1.96 ? 25  ILE A N      2  
ATOM 3937  C CA     . ILE C 3 16 ? -92.865  22.749  -13.198 1.00 1.70 ? 25  ILE A CA     2  
ATOM 3938  C C      . ILE C 3 16 ? -92.452  21.627  -12.232 1.00 1.47 ? 25  ILE A C      2  
ATOM 3939  O O      . ILE C 3 16 ? -91.308  21.216  -12.214 1.00 1.48 ? 25  ILE A O      2  
ATOM 3940  C CB     . ILE C 3 16 ? -94.028  22.310  -14.102 1.00 1.67 ? 25  ILE A CB     2  
ATOM 3941  C CG1    . ILE C 3 16 ? -95.338  22.178  -13.303 1.00 2.29 ? 25  ILE A CG1    2  
ATOM 3942  C CG2    . ILE C 3 16 ? -93.693  20.972  -14.754 1.00 2.10 ? 25  ILE A CG2    2  
ATOM 3943  C CD1    . ILE C 3 16 ? -96.528  22.213  -14.270 1.00 2.80 ? 25  ILE A CD1    2  
ATOM 3944  H H      . ILE C 3 16 ? -91.612  22.651  -14.944 1.00 2.07 ? 25  ILE A H      2  
ATOM 3945  H HA     . ILE C 3 16 ? -93.153  23.624  -12.632 1.00 1.84 ? 25  ILE A HA     2  
ATOM 3946  H HB     . ILE C 3 16 ? -94.155  23.052  -14.876 1.00 1.81 ? 25  ILE A HB     2  
ATOM 3947  H HG12   . ILE C 3 16 ? -95.345  21.240  -12.766 1.00 2.68 ? 25  ILE A HG12   2  
ATOM 3948  H HG13   . ILE C 3 16 ? -95.420  22.996  -12.604 1.00 2.71 ? 25  ILE A HG13   2  
ATOM 3949  H HG21   . ILE C 3 16 ? -92.705  21.021  -15.187 1.00 2.57 ? 25  ILE A HG21   2  
ATOM 3950  H HG22   . ILE C 3 16 ? -93.722  20.191  -14.009 1.00 2.53 ? 25  ILE A HG22   2  
ATOM 3951  H HG23   . ILE C 3 16 ? -94.416  20.763  -15.528 1.00 2.43 ? 25  ILE A HG23   2  
ATOM 3952  H HD11   . ILE C 3 16 ? -96.511  23.138  -14.830 1.00 3.15 ? 25  ILE A HD11   2  
ATOM 3953  H HD12   . ILE C 3 16 ? -96.461  21.381  -14.955 1.00 3.05 ? 25  ILE A HD12   2  
ATOM 3954  H HD13   . ILE C 3 16 ? -97.451  22.147  -13.713 1.00 3.17 ? 25  ILE A HD13   2  
ATOM 3955  N N      . GLN C 3 17 ? -93.351  21.123  -11.426 1.00 1.36 ? 26  GLN A N      2  
ATOM 3956  C CA     . GLN C 3 17 ? -92.955  20.038  -10.482 1.00 1.23 ? 26  GLN A CA     2  
ATOM 3957  C C      . GLN C 3 17 ? -92.813  18.730  -11.268 1.00 1.07 ? 26  GLN A C      2  
ATOM 3958  O O      . GLN C 3 17 ? -93.565  18.449  -12.180 1.00 1.13 ? 26  GLN A O      2  
ATOM 3959  C CB     . GLN C 3 17 ? -94.027  19.886  -9.383  1.00 1.35 ? 26  GLN A CB     2  
ATOM 3960  C CG     . GLN C 3 17 ? -93.370  19.483  -8.056  1.00 1.13 ? 26  GLN A CG     2  
ATOM 3961  C CD     . GLN C 3 17 ? -92.547  18.209  -8.257  1.00 1.20 ? 26  GLN A CD     2  
ATOM 3962  O OE1    . GLN C 3 17 ? -92.975  17.294  -8.930  1.00 1.42 ? 26  GLN A OE1    2  
ATOM 3963  N NE2    . GLN C 3 17 ? -91.373  18.110  -7.694  1.00 1.66 ? 26  GLN A NE2    2  
ATOM 3964  H H      . GLN C 3 17 ? -94.268  21.460  -11.435 1.00 1.45 ? 26  GLN A H      2  
ATOM 3965  H HA     . GLN C 3 17 ? -92.003  20.290  -10.035 1.00 1.28 ? 26  GLN A HA     2  
ATOM 3966  H HB2    . GLN C 3 17 ? -94.539  20.828  -9.259  1.00 1.82 ? 26  GLN A HB2    2  
ATOM 3967  H HB3    . GLN C 3 17 ? -94.742  19.129  -9.668  1.00 1.77 ? 26  GLN A HB3    2  
ATOM 3968  H HG2    . GLN C 3 17 ? -92.723  20.279  -7.717  1.00 1.34 ? 26  GLN A HG2    2  
ATOM 3969  H HG3    . GLN C 3 17 ? -94.134  19.300  -7.315  1.00 1.52 ? 26  GLN A HG3    2  
ATOM 3970  H HE21   . GLN C 3 17 ? -91.027  18.847  -7.150  1.00 1.92 ? 26  GLN A HE21   2  
ATOM 3971  H HE22   . GLN C 3 17 ? -90.841  17.296  -7.814  1.00 1.99 ? 26  GLN A HE22   2  
ATOM 3972  N N      . LEU C 3 18 ? -91.826  17.948  -10.936 1.00 0.97 ? 27  LEU A N      2  
ATOM 3973  C CA     . LEU C 3 18 ? -91.585  16.677  -11.672 1.00 0.86 ? 27  LEU A CA     2  
ATOM 3974  C C      . LEU C 3 18 ? -92.810  15.759  -11.613 1.00 0.75 ? 27  LEU A C      2  
ATOM 3975  O O      . LEU C 3 18 ? -93.304  15.317  -12.631 1.00 0.73 ? 27  LEU A O      2  
ATOM 3976  C CB     . LEU C 3 18 ? -90.377  15.972  -11.021 1.00 0.86 ? 27  LEU A CB     2  
ATOM 3977  C CG     . LEU C 3 18 ? -89.879  14.765  -11.856 1.00 0.84 ? 27  LEU A CG     2  
ATOM 3978  C CD1    . LEU C 3 18 ? -90.919  13.625  -11.854 1.00 1.54 ? 27  LEU A CD1    2  
ATOM 3979  C CD2    . LEU C 3 18 ? -89.564  15.203  -13.303 1.00 1.54 ? 27  LEU A CD2    2  
ATOM 3980  H H      . LEU C 3 18 ? -91.220  18.213  -10.215 1.00 1.05 ? 27  LEU A H      2  
ATOM 3981  H HA     . LEU C 3 18 ? -91.364  16.906  -12.696 1.00 0.89 ? 27  LEU A HA     2  
ATOM 3982  H HB2    . LEU C 3 18 ? -89.570  16.682  -10.921 1.00 0.97 ? 27  LEU A HB2    2  
ATOM 3983  H HB3    . LEU C 3 18 ? -90.658  15.624  -10.037 1.00 0.86 ? 27  LEU A HB3    2  
ATOM 3984  H HG     . LEU C 3 18 ? -88.969  14.391  -11.405 1.00 1.37 ? 27  LEU A HG     2  
ATOM 3985  H HD11   . LEU C 3 18 ? -91.474  13.632  -10.928 1.00 2.17 ? 27  LEU A HD11   2  
ATOM 3986  H HD12   . LEU C 3 18 ? -91.600  13.746  -12.684 1.00 2.10 ? 27  LEU A HD12   2  
ATOM 3987  H HD13   . LEU C 3 18 ? -90.405  12.679  -11.952 1.00 1.92 ? 27  LEU A HD13   2  
ATOM 3988  H HD21   . LEU C 3 18 ? -89.263  16.241  -13.315 1.00 1.99 ? 27  LEU A HD21   2  
ATOM 3989  H HD22   . LEU C 3 18 ? -88.756  14.603  -13.689 1.00 2.11 ? 27  LEU A HD22   2  
ATOM 3990  H HD23   . LEU C 3 18 ? -90.439  15.074  -13.926 1.00 2.10 ? 27  LEU A HD23   2  
ATOM 3991  N N      . TRP C 3 19 ? -93.296  15.438  -10.446 1.00 0.75 ? 28  TRP A N      2  
ATOM 3992  C CA     . TRP C 3 19 ? -94.459  14.508  -10.378 1.00 0.70 ? 28  TRP A CA     2  
ATOM 3993  C C      . TRP C 3 19 ? -95.762  15.183  -10.826 1.00 0.73 ? 28  TRP A C      2  
ATOM 3994  O O      . TRP C 3 19 ? -96.613  14.547  -11.413 1.00 0.75 ? 28  TRP A O      2  
ATOM 3995  C CB     . TRP C 3 19 ? -94.610  13.953  -8.962  1.00 0.73 ? 28  TRP A CB     2  
ATOM 3996  C CG     . TRP C 3 19 ? -94.964  15.041  -8.000  1.00 0.83 ? 28  TRP A CG     2  
ATOM 3997  C CD1    . TRP C 3 19 ? -94.090  15.681  -7.191  1.00 0.92 ? 28  TRP A CD1    2  
ATOM 3998  C CD2    . TRP C 3 19 ? -96.266  15.616  -7.727  1.00 0.90 ? 28  TRP A CD2    2  
ATOM 3999  N NE1    . TRP C 3 19 ? -94.776  16.615  -6.440  1.00 1.02 ? 28  TRP A NE1    2  
ATOM 4000  C CE2    . TRP C 3 19 ? -96.124  16.616  -6.737  1.00 1.02 ? 28  TRP A CE2    2  
ATOM 4001  C CE3    . TRP C 3 19 ? -97.543  15.367  -8.243  1.00 0.93 ? 28  TRP A CE3    2  
ATOM 4002  C CZ2    . TRP C 3 19 ? -97.220  17.347  -6.277  1.00 1.14 ? 28  TRP A CZ2    2  
ATOM 4003  C CZ3    . TRP C 3 19 ? -98.650  16.102  -7.782  1.00 1.07 ? 28  TRP A CZ3    2  
ATOM 4004  C CH2    . TRP C 3 19 ? -98.489  17.090  -6.803  1.00 1.16 ? 28  TRP A CH2    2  
ATOM 4005  H H      . TRP C 3 19 ? -92.881  15.778  -9.624  1.00 0.82 ? 28  TRP A H      2  
ATOM 4006  H HA     . TRP C 3 19 ? -94.264  13.682  -11.045 1.00 0.67 ? 28  TRP A HA     2  
ATOM 4007  H HB2    . TRP C 3 19 ? -95.389  13.208  -8.953  1.00 0.72 ? 28  TRP A HB2    2  
ATOM 4008  H HB3    . TRP C 3 19 ? -93.677  13.496  -8.659  1.00 0.74 ? 28  TRP A HB3    2  
ATOM 4009  H HD1    . TRP C 3 19 ? -93.034  15.490  -7.138  1.00 0.95 ? 28  TRP A HD1    2  
ATOM 4010  H HE1    . TRP C 3 19 ? -94.374  17.210  -5.776  1.00 1.12 ? 28  TRP A HE1    2  
ATOM 4011  H HE3    . TRP C 3 19 ? -97.670  14.600  -8.996  1.00 0.88 ? 28  TRP A HE3    2  
ATOM 4012  H HZ2    . TRP C 3 19 ? -97.090  18.106  -5.522  1.00 1.23 ? 28  TRP A HZ2    2  
ATOM 4013  H HZ3    . TRP C 3 19 ? -99.632  15.910  -8.187  1.00 1.14 ? 28  TRP A HZ3    2  
ATOM 4014  H HH2    . TRP C 3 19 ? -99.346  17.650  -6.454  1.00 1.28 ? 28  TRP A HH2    2  
ATOM 4015  N N      . GLN C 3 20 ? -95.949  16.448  -10.565 1.00 0.83 ? 29  GLN A N      2  
ATOM 4016  C CA     . GLN C 3 20 ? -97.224  17.076  -11.006 1.00 0.90 ? 29  GLN A CA     2  
ATOM 4017  C C      . GLN C 3 20 ? -97.326  16.937  -12.524 1.00 0.84 ? 29  GLN A C      2  
ATOM 4018  O O      . GLN C 3 20 ? -98.345  16.556  -13.058 1.00 0.89 ? 29  GLN A O      2  
ATOM 4019  C CB     . GLN C 3 20 ? -97.236  18.553  -10.621 1.00 1.03 ? 29  GLN A CB     2  
ATOM 4020  C CG     . GLN C 3 20 ? -98.621  19.143  -10.896 1.00 1.42 ? 29  GLN A CG     2  
ATOM 4021  C CD     . GLN C 3 20 ? -98.666  20.577  -10.366 1.00 1.81 ? 29  GLN A CD     2  
ATOM 4022  O OE1    . GLN C 3 20 ? -98.428  20.813  -9.197  1.00 2.34 ? 29  GLN A OE1    2  
ATOM 4023  N NE2    . GLN C 3 20 ? -98.957  21.556  -11.178 1.00 2.29 ? 29  GLN A NE2    2  
ATOM 4024  H H      . GLN C 3 20 ? -95.271  16.968  -10.088 1.00 0.91 ? 29  GLN A H      2  
ATOM 4025  H HA     . GLN C 3 20 ? -98.054  16.570  -10.538 1.00 0.93 ? 29  GLN A HA     2  
ATOM 4026  H HB2    . GLN C 3 20 ? -97.006  18.652  -9.572  1.00 1.31 ? 29  GLN A HB2    2  
ATOM 4027  H HB3    . GLN C 3 20 ? -96.499  19.085  -11.207 1.00 1.14 ? 29  GLN A HB3    2  
ATOM 4028  H HG2    . GLN C 3 20 ? -98.812  19.139  -11.960 1.00 1.78 ? 29  GLN A HG2    2  
ATOM 4029  H HG3    . GLN C 3 20 ? -99.370  18.551  -10.391 1.00 2.06 ? 29  GLN A HG3    2  
ATOM 4030  H HE21   . GLN C 3 20 ? -99.145  21.373  -12.122 1.00 2.35 ? 29  GLN A HE21   2  
ATOM 4031  H HE22   . GLN C 3 20 ? -98.988  22.476  -10.841 1.00 2.89 ? 29  GLN A HE22   2  
ATOM 4032  N N      . PHE C 3 21 ? -96.260  17.198  -13.222 1.00 0.80 ? 30  PHE A N      2  
ATOM 4033  C CA     . PHE C 3 21 ? -96.280  17.042  -14.701 1.00 0.77 ? 30  PHE A CA     2  
ATOM 4034  C C      . PHE C 3 21 ? -96.606  15.583  -15.038 1.00 0.68 ? 30  PHE A C      2  
ATOM 4035  O O      . PHE C 3 21 ? -97.378  15.296  -15.932 1.00 0.69 ? 30  PHE A O      2  
ATOM 4036  C CB     . PHE C 3 21 ? -94.896  17.417  -15.256 1.00 0.80 ? 30  PHE A CB     2  
ATOM 4037  C CG     . PHE C 3 21 ? -94.738  16.860  -16.652 1.00 0.77 ? 30  PHE A CG     2  
ATOM 4038  C CD1    . PHE C 3 21 ? -95.149  17.599  -17.767 1.00 0.85 ? 30  PHE A CD1    2  
ATOM 4039  C CD2    . PHE C 3 21 ? -94.193  15.583  -16.815 1.00 0.75 ? 30  PHE A CD2    2  
ATOM 4040  C CE1    . PHE C 3 21 ? -95.014  17.054  -19.050 1.00 0.86 ? 30  PHE A CE1    2  
ATOM 4041  C CE2    . PHE C 3 21 ? -94.055  15.040  -18.094 1.00 0.78 ? 30  PHE A CE2    2  
ATOM 4042  C CZ     . PHE C 3 21 ? -94.464  15.773  -19.211 1.00 0.80 ? 30  PHE A CZ     2  
ATOM 4043  H H      . PHE C 3 21 ? -95.435  17.474  -12.772 1.00 0.83 ? 30  PHE A H      2  
ATOM 4044  H HA     . PHE C 3 21 ? -97.031  17.694  -15.126 1.00 0.83 ? 30  PHE A HA     2  
ATOM 4045  H HB2    . PHE C 3 21 ? -94.802  18.491  -15.284 1.00 0.90 ? 30  PHE A HB2    2  
ATOM 4046  H HB3    . PHE C 3 21 ? -94.127  17.008  -14.616 1.00 0.79 ? 30  PHE A HB3    2  
ATOM 4047  H HD1    . PHE C 3 21 ? -95.569  18.585  -17.638 1.00 0.94 ? 30  PHE A HD1    2  
ATOM 4048  H HD2    . PHE C 3 21 ? -93.878  15.017  -15.950 1.00 0.78 ? 30  PHE A HD2    2  
ATOM 4049  H HE1    . PHE C 3 21 ? -95.331  17.618  -19.914 1.00 0.95 ? 30  PHE A HE1    2  
ATOM 4050  H HE2    . PHE C 3 21 ? -93.633  14.055  -18.218 1.00 0.83 ? 30  PHE A HE2    2  
ATOM 4051  H HZ     . PHE C 3 21 ? -94.359  15.350  -20.200 1.00 0.85 ? 30  PHE A HZ     2  
ATOM 4052  N N      . LEU C 3 22 ? -96.000  14.666  -14.341 1.00 0.65 ? 31  LEU A N      2  
ATOM 4053  C CA     . LEU C 3 22 ? -96.244  13.225  -14.621 1.00 0.60 ? 31  LEU A CA     2  
ATOM 4054  C C      . LEU C 3 22 ? -97.706  12.865  -14.343 1.00 0.60 ? 31  LEU A C      2  
ATOM 4055  O O      . LEU C 3 22 ? -98.358  12.244  -15.156 1.00 0.61 ? 31  LEU A O      2  
ATOM 4056  C CB     . LEU C 3 22 ? -95.327  12.391  -13.721 1.00 0.62 ? 31  LEU A CB     2  
ATOM 4057  C CG     . LEU C 3 22 ? -95.542  10.883  -13.940 1.00 0.79 ? 31  LEU A CG     2  
ATOM 4058  C CD1    . LEU C 3 22 ? -95.541  10.527  -15.435 1.00 1.52 ? 31  LEU A CD1    2  
ATOM 4059  C CD2    . LEU C 3 22 ? -94.405  10.130  -13.245 1.00 1.42 ? 31  LEU A CD2    2  
ATOM 4060  H H      . LEU C 3 22 ? -95.370  14.926  -13.636 1.00 0.69 ? 31  LEU A H      2  
ATOM 4061  H HA     . LEU C 3 22 ? -96.013  13.030  -15.653 1.00 0.60 ? 31  LEU A HA     2  
ATOM 4062  H HB2    . LEU C 3 22 ? -94.298  12.641  -13.931 1.00 0.80 ? 31  LEU A HB2    2  
ATOM 4063  H HB3    . LEU C 3 22 ? -95.545  12.629  -12.692 1.00 0.79 ? 31  LEU A HB3    2  
ATOM 4064  H HG     . LEU C 3 22 ? -96.481  10.588  -13.504 1.00 1.44 ? 31  LEU A HG     2  
ATOM 4065  H HD11   . LEU C 3 22 ? -94.763  11.076  -15.936 1.00 2.05 ? 31  LEU A HD11   2  
ATOM 4066  H HD12   . LEU C 3 22 ? -95.367  9.467   -15.555 1.00 1.96 ? 31  LEU A HD12   2  
ATOM 4067  H HD13   . LEU C 3 22 ? -96.497  10.780  -15.867 1.00 2.08 ? 31  LEU A HD13   2  
ATOM 4068  H HD21   . LEU C 3 22 ? -94.341  10.450  -12.214 1.00 1.85 ? 31  LEU A HD21   2  
ATOM 4069  H HD22   . LEU C 3 22 ? -94.598  9.072   -13.283 1.00 2.02 ? 31  LEU A HD22   2  
ATOM 4070  H HD23   . LEU C 3 22 ? -93.474  10.346  -13.745 1.00 2.02 ? 31  LEU A HD23   2  
ATOM 4071  N N      . LEU C 3 23 ? -98.230  13.251  -13.206 1.00 0.67 ? 32  LEU A N      2  
ATOM 4072  C CA     . LEU C 3 23 ? -99.652  12.919  -12.904 1.00 0.74 ? 32  LEU A CA     2  
ATOM 4073  C C      . LEU C 3 23 ? -100.573 13.658  -13.884 1.00 0.76 ? 32  LEU A C      2  
ATOM 4074  O O      . LEU C 3 23 ? -101.594 13.138  -14.292 1.00 0.78 ? 32  LEU A O      2  
ATOM 4075  C CB     . LEU C 3 23 ? -100.009 13.301  -11.449 1.00 0.89 ? 32  LEU A CB     2  
ATOM 4076  C CG     . LEU C 3 23 ? -99.424  12.295  -10.424 1.00 1.17 ? 32  LEU A CG     2  
ATOM 4077  C CD1    . LEU C 3 23 ? -99.889  12.690  -9.011  1.00 1.42 ? 32  LEU A CD1    2  
ATOM 4078  C CD2    . LEU C 3 23 ? -99.903  10.853  -10.719 1.00 1.91 ? 32  LEU A CD2    2  
ATOM 4079  H H      . LEU C 3 23 ? -97.693  13.754  -12.561 1.00 0.71 ? 32  LEU A H      2  
ATOM 4080  H HA     . LEU C 3 23 ? -99.795  11.863  -13.042 1.00 0.75 ? 32  LEU A HA     2  
ATOM 4081  H HB2    . LEU C 3 23 ? -99.608  14.282  -11.239 1.00 0.98 ? 32  LEU A HB2    2  
ATOM 4082  H HB3    . LEU C 3 23 ? -101.083 13.331  -11.343 1.00 1.37 ? 32  LEU A HB3    2  
ATOM 4083  H HG     . LEU C 3 23 ? -98.344  12.335  -10.464 1.00 1.80 ? 32  LEU A HG     2  
ATOM 4084  H HD11   . LEU C 3 23 ? -99.858  13.759  -8.905  1.00 1.86 ? 32  LEU A HD11   2  
ATOM 4085  H HD12   . LEU C 3 23 ? -100.903 12.344  -8.852  1.00 1.89 ? 32  LEU A HD12   2  
ATOM 4086  H HD13   . LEU C 3 23 ? -99.242  12.238  -8.277  1.00 1.93 ? 32  LEU A HD13   2  
ATOM 4087  H HD21   . LEU C 3 23 ? -100.885 10.881  -11.172 1.00 2.36 ? 32  LEU A HD21   2  
ATOM 4088  H HD22   . LEU C 3 23 ? -99.210  10.374  -11.394 1.00 2.46 ? 32  LEU A HD22   2  
ATOM 4089  H HD23   . LEU C 3 23 ? -99.947  10.282  -9.800  1.00 2.28 ? 32  LEU A HD23   2  
ATOM 4090  N N      . GLU C 3 24 ? -100.229 14.858  -14.280 1.00 0.81 ? 33  GLU A N      2  
ATOM 4091  C CA     . GLU C 3 24 ? -101.111 15.592  -15.239 1.00 0.89 ? 33  GLU A CA     2  
ATOM 4092  C C      . GLU C 3 24 ? -101.244 14.778  -16.530 1.00 0.87 ? 33  GLU A C      2  
ATOM 4093  O O      . GLU C 3 24 ? -102.316 14.642  -17.077 1.00 0.94 ? 33  GLU A O      2  
ATOM 4094  C CB     . GLU C 3 24 ? -100.518 16.972  -15.562 1.00 0.99 ? 33  GLU A CB     2  
ATOM 4095  C CG     . GLU C 3 24 ? -100.722 17.909  -14.368 1.00 1.21 ? 33  GLU A CG     2  
ATOM 4096  C CD     . GLU C 3 24 ? -102.191 18.323  -14.292 1.00 1.80 ? 33  GLU A CD     2  
ATOM 4097  O OE1    . GLU C 3 24 ? -102.785 18.517  -15.339 1.00 2.46 ? 33  GLU A OE1    2  
ATOM 4098  O OE2    . GLU C 3 24 ? -102.697 18.433  -13.189 1.00 2.40 ? 33  GLU A OE2    2  
ATOM 4099  H H      . GLU C 3 24 ? -99.399  15.269  -13.953 1.00 0.82 ? 33  GLU A H      2  
ATOM 4100  H HA     . GLU C 3 24 ? -102.089 15.719  -14.796 1.00 0.95 ? 33  GLU A HA     2  
ATOM 4101  H HB2    . GLU C 3 24 ? -99.459  16.874  -15.767 1.00 1.19 ? 33  GLU A HB2    2  
ATOM 4102  H HB3    . GLU C 3 24 ? -101.013 17.385  -16.429 1.00 1.34 ? 33  GLU A HB3    2  
ATOM 4103  H HG2    . GLU C 3 24 ? -100.450 17.401  -13.459 1.00 1.68 ? 33  GLU A HG2    2  
ATOM 4104  H HG3    . GLU C 3 24 ? -100.107 18.788  -14.490 1.00 1.81 ? 33  GLU A HG3    2  
ATOM 4105  N N      . LEU C 3 25 ? -100.169 14.230  -17.018 1.00 0.84 ? 34  LEU A N      2  
ATOM 4106  C CA     . LEU C 3 25 ? -100.249 13.418  -18.267 1.00 0.90 ? 34  LEU A CA     2  
ATOM 4107  C C      . LEU C 3 25 ? -100.866 12.049  -17.946 1.00 0.87 ? 34  LEU A C      2  
ATOM 4108  O O      . LEU C 3 25 ? -101.521 11.440  -18.766 1.00 0.94 ? 34  LEU A O      2  
ATOM 4109  C CB     . LEU C 3 25 ? -98.839  13.237  -18.844 1.00 1.01 ? 34  LEU A CB     2  
ATOM 4110  C CG     . LEU C 3 25 ? -98.905  12.534  -20.212 1.00 1.09 ? 34  LEU A CG     2  
ATOM 4111  C CD1    . LEU C 3 25 ? -99.404  13.503  -21.302 1.00 1.47 ? 34  LEU A CD1    2  
ATOM 4112  C CD2    . LEU C 3 25 ? -97.504  12.035  -20.575 1.00 1.54 ? 34  LEU A CD2    2  
ATOM 4113  H H      . LEU C 3 25 ? -99.308  14.342  -16.560 1.00 0.83 ? 34  LEU A H      2  
ATOM 4114  H HA     . LEU C 3 25 ? -100.869 13.931  -18.981 1.00 0.99 ? 34  LEU A HA     2  
ATOM 4115  H HB2    . LEU C 3 25 ? -98.370  14.203  -18.953 1.00 1.31 ? 34  LEU A HB2    2  
ATOM 4116  H HB3    . LEU C 3 25 ? -98.255  12.634  -18.162 1.00 1.54 ? 34  LEU A HB3    2  
ATOM 4117  H HG     . LEU C 3 25 ? -99.577  11.691  -20.154 1.00 1.71 ? 34  LEU A HG     2  
ATOM 4118  H HD11   . LEU C 3 25 ? -98.942  14.472  -21.176 1.00 2.10 ? 34  LEU A HD11   2  
ATOM 4119  H HD12   . LEU C 3 25 ? -99.149  13.111  -22.276 1.00 1.85 ? 34  LEU A HD12   2  
ATOM 4120  H HD13   . LEU C 3 25 ? -100.477 13.603  -21.233 1.00 1.86 ? 34  LEU A HD13   2  
ATOM 4121  H HD21   . LEU C 3 25 ? -97.161  11.351  -19.812 1.00 2.05 ? 34  LEU A HD21   2  
ATOM 4122  H HD22   . LEU C 3 25 ? -97.536  11.526  -21.526 1.00 1.91 ? 34  LEU A HD22   2  
ATOM 4123  H HD23   . LEU C 3 25 ? -96.825  12.873  -20.635 1.00 2.01 ? 34  LEU A HD23   2  
ATOM 4124  N N      . LEU C 3 26 ? -100.628 11.553  -16.762 1.00 0.83 ? 35  LEU A N      2  
ATOM 4125  C CA     . LEU C 3 26 ? -101.159 10.214  -16.366 1.00 0.88 ? 35  LEU A CA     2  
ATOM 4126  C C      . LEU C 3 26 ? -102.704 10.207  -16.411 1.00 0.97 ? 35  LEU A C      2  
ATOM 4127  O O      . LEU C 3 26 ? -103.309 9.296   -16.940 1.00 1.12 ? 35  LEU A O      2  
ATOM 4128  C CB     . LEU C 3 26 ? -100.662 9.909   -14.936 1.00 0.86 ? 35  LEU A CB     2  
ATOM 4129  C CG     . LEU C 3 26 ? -100.530 8.397   -14.713 1.00 0.95 ? 35  LEU A CG     2  
ATOM 4130  C CD1    . LEU C 3 26 ? -100.159 8.118   -13.256 1.00 1.23 ? 35  LEU A CD1    2  
ATOM 4131  C CD2    . LEU C 3 26 ? -101.850 7.706   -15.041 1.00 1.45 ? 35  LEU A CD2    2  
ATOM 4132  H H      . LEU C 3 26 ? -100.077 12.058  -16.130 1.00 0.81 ? 35  LEU A H      2  
ATOM 4133  H HA     . LEU C 3 26 ? -100.780 9.465   -17.046 1.00 0.95 ? 35  LEU A HA     2  
ATOM 4134  H HB2    . LEU C 3 26 ? -99.696  10.363  -14.798 1.00 1.13 ? 35  LEU A HB2    2  
ATOM 4135  H HB3    . LEU C 3 26 ? -101.354 10.315  -14.213 1.00 0.99 ? 35  LEU A HB3    2  
ATOM 4136  H HG     . LEU C 3 26 ? -99.752  8.017   -15.352 1.00 1.60 ? 35  LEU A HG     2  
ATOM 4137  H HD11   . LEU C 3 26 ? -100.841 8.639   -12.601 1.00 1.64 ? 35  LEU A HD11   2  
ATOM 4138  H HD12   . LEU C 3 26 ? -100.221 7.056   -13.068 1.00 1.79 ? 35  LEU A HD12   2  
ATOM 4139  H HD13   . LEU C 3 26 ? -99.151  8.458   -13.073 1.00 1.75 ? 35  LEU A HD13   2  
ATOM 4140  H HD21   . LEU C 3 26 ? -102.666 8.295   -14.653 1.00 1.91 ? 35  LEU A HD21   2  
ATOM 4141  H HD22   . LEU C 3 26 ? -101.950 7.606   -16.109 1.00 1.97 ? 35  LEU A HD22   2  
ATOM 4142  H HD23   . LEU C 3 26 ? -101.866 6.726   -14.587 1.00 1.94 ? 35  LEU A HD23   2  
ATOM 4143  N N      . THR C 3 27 ? -103.350 11.196  -15.837 1.00 0.97 ? 36  THR A N      2  
ATOM 4144  C CA     . THR C 3 27 ? -104.857 11.213  -15.823 1.00 1.14 ? 36  THR A CA     2  
ATOM 4145  C C      . THR C 3 27 ? -105.434 12.080  -16.950 1.00 1.22 ? 36  THR A C      2  
ATOM 4146  O O      . THR C 3 27 ? -106.628 12.306  -16.999 1.00 1.57 ? 36  THR A O      2  
ATOM 4147  C CB     . THR C 3 27 ? -105.335 11.773  -14.483 1.00 1.24 ? 36  THR A CB     2  
ATOM 4148  O OG1    . THR C 3 27 ? -105.031 13.160  -14.422 1.00 1.68 ? 36  THR A OG1    2  
ATOM 4149  C CG2    . THR C 3 27 ? -104.631 11.041  -13.341 1.00 1.12 ? 36  THR A CG2    2  
ATOM 4150  H H      . THR C 3 27 ? -102.851 11.914  -15.396 1.00 0.94 ? 36  THR A H      2  
ATOM 4151  H HA     . THR C 3 27 ? -105.231 10.204  -15.931 1.00 1.28 ? 36  THR A HA     2  
ATOM 4152  H HB     . THR C 3 27 ? -106.400 11.632  -14.391 1.00 1.66 ? 36  THR A HB     2  
ATOM 4153  H HG1    . THR C 3 27 ? -105.369 13.576  -15.221 1.00 2.13 ? 36  THR A HG1    2  
ATOM 4154  H HG21   . THR C 3 27 ? -104.789 9.978   -13.445 1.00 1.44 ? 36  THR A HG21   2  
ATOM 4155  H HG22   . THR C 3 27 ? -103.572 11.252  -13.375 1.00 1.54 ? 36  THR A HG22   2  
ATOM 4156  H HG23   . THR C 3 27 ? -105.037 11.373  -12.396 1.00 1.67 ? 36  THR A HG23   2  
ATOM 4157  N N      . ASP C 3 28 ? -104.618 12.573  -17.844 1.00 1.13 ? 37  ASP A N      2  
ATOM 4158  C CA     . ASP C 3 28 ? -105.136 13.436  -18.959 1.00 1.32 ? 37  ASP A CA     2  
ATOM 4159  C C      . ASP C 3 28 ? -105.122 12.668  -20.281 1.00 1.23 ? 37  ASP A C      2  
ATOM 4160  O O      . ASP C 3 28 ? -106.111 12.099  -20.696 1.00 1.40 ? 37  ASP A O      2  
ATOM 4161  C CB     . ASP C 3 28 ? -104.237 14.666  -19.090 1.00 1.71 ? 37  ASP A CB     2  
ATOM 4162  C CG     . ASP C 3 28 ? -104.702 15.522  -20.269 1.00 2.39 ? 37  ASP A CG     2  
ATOM 4163  O OD1    . ASP C 3 28 ? -105.903 15.655  -20.444 1.00 2.90 ? 37  ASP A OD1    2  
ATOM 4164  O OD2    . ASP C 3 28 ? -103.849 16.035  -20.974 1.00 3.08 ? 37  ASP A OD2    2  
ATOM 4165  H H      . ASP C 3 28 ? -103.659 12.383  -17.783 1.00 1.13 ? 37  ASP A H      2  
ATOM 4166  H HA     . ASP C 3 28 ? -106.146 13.760  -18.745 1.00 1.55 ? 37  ASP A HA     2  
ATOM 4167  H HB2    . ASP C 3 28 ? -104.293 15.247  -18.181 1.00 2.12 ? 37  ASP A HB2    2  
ATOM 4168  H HB3    . ASP C 3 28 ? -103.219 14.351  -19.255 1.00 2.03 ? 37  ASP A HB3    2  
ATOM 4169  N N      . LYS C 3 29 ? -104.004 12.660  -20.949 1.00 1.35 ? 38  LYS A N      2  
ATOM 4170  C CA     . LYS C 3 29 ? -103.903 11.949  -22.254 1.00 1.54 ? 38  LYS A CA     2  
ATOM 4171  C C      . LYS C 3 29 ? -104.286 10.468  -22.082 1.00 1.38 ? 38  LYS A C      2  
ATOM 4172  O O      . LYS C 3 29 ? -104.233 9.922   -20.995 1.00 1.52 ? 38  LYS A O      2  
ATOM 4173  C CB     . LYS C 3 29 ? -102.468 12.099  -22.788 1.00 1.99 ? 38  LYS A CB     2  
ATOM 4174  C CG     . LYS C 3 29 ? -102.346 11.497  -24.221 1.00 2.26 ? 38  LYS A CG     2  
ATOM 4175  C CD     . LYS C 3 29 ? -101.354 10.320  -24.230 1.00 2.62 ? 38  LYS A CD     2  
ATOM 4176  C CE     . LYS C 3 29 ? -101.563 9.472   -25.485 1.00 2.90 ? 38  LYS A CE     2  
ATOM 4177  N NZ     . LYS C 3 29 ? -101.235 10.275  -26.695 1.00 3.33 ? 38  LYS A NZ     2  
ATOM 4178  H H      . LYS C 3 29 ? -103.224 13.135  -20.592 1.00 1.53 ? 38  LYS A H      2  
ATOM 4179  H HA     . LYS C 3 29 ? -104.588 12.405  -22.951 1.00 1.79 ? 38  LYS A HA     2  
ATOM 4180  H HB2    . LYS C 3 29 ? -102.223 13.156  -22.820 1.00 2.39 ? 38  LYS A HB2    2  
ATOM 4181  H HB3    . LYS C 3 29 ? -101.786 11.603  -22.112 1.00 2.33 ? 38  LYS A HB3    2  
ATOM 4182  H HG2    . LYS C 3 29 ? -103.310 11.152  -24.564 1.00 2.66 ? 38  LYS A HG2    2  
ATOM 4183  H HG3    . LYS C 3 29 ? -101.987 12.258  -24.901 1.00 2.59 ? 38  LYS A HG3    2  
ATOM 4184  H HD2    . LYS C 3 29 ? -100.345 10.702  -24.220 1.00 2.95 ? 38  LYS A HD2    2  
ATOM 4185  H HD3    . LYS C 3 29 ? -101.512 9.707   -23.361 1.00 2.89 ? 38  LYS A HD3    2  
ATOM 4186  H HE2    . LYS C 3 29 ? -100.919 8.611   -25.439 1.00 2.93 ? 38  LYS A HE2    2  
ATOM 4187  H HE3    . LYS C 3 29 ? -102.592 9.148   -25.534 1.00 3.19 ? 38  LYS A HE3    2  
ATOM 4188  H HZ1    . LYS C 3 29 ? -100.919 11.222  -26.404 1.00 3.54 ? 38  LYS A HZ1    2  
ATOM 4189  H HZ2    . LYS C 3 29 ? -100.479 9.805   -27.232 1.00 3.57 ? 38  LYS A HZ2    2  
ATOM 4190  H HZ3    . LYS C 3 29 ? -102.080 10.360  -27.295 1.00 3.68 ? 38  LYS A HZ3    2  
ATOM 4191  N N      . SER C 3 30 ? -104.709 9.833   -23.148 1.00 1.47 ? 39  SER A N      2  
ATOM 4192  C CA     . SER C 3 30 ? -105.146 8.401   -23.080 1.00 1.66 ? 39  SER A CA     2  
ATOM 4193  C C      . SER C 3 30 ? -103.976 7.478   -22.732 1.00 1.51 ? 39  SER A C      2  
ATOM 4194  O O      . SER C 3 30 ? -104.131 6.538   -21.984 1.00 2.21 ? 39  SER A O      2  
ATOM 4195  C CB     . SER C 3 30 ? -105.684 7.995   -24.450 1.00 2.14 ? 39  SER A CB     2  
ATOM 4196  O OG     . SER C 3 30 ? -106.293 6.717   -24.357 1.00 2.66 ? 39  SER A OG     2  
ATOM 4197  H H      . SER C 3 30 ? -104.768 10.311  -23.999 1.00 1.64 ? 39  SER A H      2  
ATOM 4198  H HA     . SER C 3 30 ? -105.927 8.294   -22.342 1.00 1.84 ? 39  SER A HA     2  
ATOM 4199  H HB2    . SER C 3 30 ? -106.415 8.713   -24.781 1.00 2.27 ? 39  SER A HB2    2  
ATOM 4200  H HB3    . SER C 3 30 ? -104.863 7.964   -25.162 1.00 2.50 ? 39  SER A HB3    2  
ATOM 4201  H HG     . SER C 3 30 ? -107.150 6.764   -24.785 1.00 2.78 ? 39  SER A HG     2  
ATOM 4202  N N      . CYS C 3 31 ? -102.819 7.732   -23.280 1.00 1.29 ? 40  CYS A N      2  
ATOM 4203  C CA     . CYS C 3 31 ? -101.632 6.871   -22.992 1.00 1.29 ? 40  CYS A CA     2  
ATOM 4204  C C      . CYS C 3 31 ? -101.931 5.415   -23.370 1.00 1.22 ? 40  CYS A C      2  
ATOM 4205  O O      . CYS C 3 31 ? -101.457 4.494   -22.734 1.00 1.43 ? 40  CYS A O      2  
ATOM 4206  C CB     . CYS C 3 31 ? -101.283 6.962   -21.497 1.00 1.49 ? 40  CYS A CB     2  
ATOM 4207  S SG     . CYS C 3 31 ? -100.580 8.590   -21.124 1.00 2.22 ? 40  CYS A SG     2  
ATOM 4208  H H      . CYS C 3 31 ? -102.729 8.493   -23.890 1.00 1.74 ? 40  CYS A H      2  
ATOM 4209  H HA     . CYS C 3 31 ? -100.793 7.219   -23.573 1.00 1.44 ? 40  CYS A HA     2  
ATOM 4210  H HB2    . CYS C 3 31 ? -102.171 6.820   -20.906 1.00 2.08 ? 40  CYS A HB2    2  
ATOM 4211  H HB3    . CYS C 3 31 ? -100.570 6.196   -21.250 1.00 1.69 ? 40  CYS A HB3    2  
ATOM 4212  H HG     . CYS C 3 31 ? -99.810  8.715   -21.681 1.00 2.54 ? 40  CYS A HG     2  
ATOM 4213  N N      . GLN C 3 32 ? -102.722 5.196   -24.395 1.00 1.22 ? 41  GLN A N      2  
ATOM 4214  C CA     . GLN C 3 32 ? -103.057 3.794   -24.809 1.00 1.29 ? 41  GLN A CA     2  
ATOM 4215  C C      . GLN C 3 32 ? -102.182 3.342   -25.982 1.00 1.34 ? 41  GLN A C      2  
ATOM 4216  O O      . GLN C 3 32 ? -101.698 2.228   -26.013 1.00 1.87 ? 41  GLN A O      2  
ATOM 4217  C CB     . GLN C 3 32 ? -104.523 3.743   -25.231 1.00 1.53 ? 41  GLN A CB     2  
ATOM 4218  C CG     . GLN C 3 32 ? -105.405 3.928   -24.001 1.00 1.82 ? 41  GLN A CG     2  
ATOM 4219  C CD     . GLN C 3 32 ? -106.865 4.024   -24.430 1.00 2.46 ? 41  GLN A CD     2  
ATOM 4220  O OE1    . GLN C 3 32 ? -107.156 4.182   -25.599 1.00 3.09 ? 41  GLN A OE1    2  
ATOM 4221  N NE2    . GLN C 3 32 ? -107.800 3.947   -23.529 1.00 3.04 ? 41  GLN A NE2    2  
ATOM 4222  H H      . GLN C 3 32 ? -103.095 5.953   -24.894 1.00 1.38 ? 41  GLN A H      2  
ATOM 4223  H HA     . GLN C 3 32 ? -102.908 3.121   -23.977 1.00 1.32 ? 41  GLN A HA     2  
ATOM 4224  H HB2    . GLN C 3 32 ? -104.723 4.530   -25.943 1.00 1.80 ? 41  GLN A HB2    2  
ATOM 4225  H HB3    . GLN C 3 32 ? -104.735 2.785   -25.684 1.00 1.71 ? 41  GLN A HB3    2  
ATOM 4226  H HG2    . GLN C 3 32 ? -105.278 3.084   -23.339 1.00 2.21 ? 41  GLN A HG2    2  
ATOM 4227  H HG3    . GLN C 3 32 ? -105.121 4.835   -23.488 1.00 2.11 ? 41  GLN A HG3    2  
ATOM 4228  H HE21   . GLN C 3 32 ? -107.561 3.829   -22.585 1.00 3.14 ? 41  GLN A HE21   2  
ATOM 4229  H HE22   . GLN C 3 32 ? -108.741 4.000   -23.793 1.00 3.73 ? 41  GLN A HE22   2  
ATOM 4230  N N      . SER C 3 33 ? -102.005 4.182   -26.966 1.00 1.34 ? 42  SER A N      2  
ATOM 4231  C CA     . SER C 3 33 ? -101.191 3.779   -28.155 1.00 1.48 ? 42  SER A CA     2  
ATOM 4232  C C      . SER C 3 33 ? -99.689  3.906   -27.877 1.00 1.27 ? 42  SER A C      2  
ATOM 4233  O O      . SER C 3 33 ? -98.886  3.311   -28.566 1.00 1.35 ? 42  SER A O      2  
ATOM 4234  C CB     . SER C 3 33 ? -101.550 4.667   -29.347 1.00 1.80 ? 42  SER A CB     2  
ATOM 4235  O OG     . SER C 3 33 ? -102.843 4.322   -29.826 1.00 2.41 ? 42  SER A OG     2  
ATOM 4236  H H      . SER C 3 33 ? -102.425 5.067   -26.937 1.00 1.65 ? 42  SER A H      2  
ATOM 4237  H HA     . SER C 3 33 ? -101.419 2.754   -28.403 1.00 1.66 ? 42  SER A HA     2  
ATOM 4238  H HB2    . SER C 3 33 ? -101.551 5.700   -29.043 1.00 2.13 ? 42  SER A HB2    2  
ATOM 4239  H HB3    . SER C 3 33 ? -100.815 4.526   -30.131 1.00 2.05 ? 42  SER A HB3    2  
ATOM 4240  H HG     . SER C 3 33 ? -103.093 3.486   -29.427 1.00 2.79 ? 42  SER A HG     2  
ATOM 4241  N N      . PHE C 3 34 ? -99.294  4.686   -26.902 1.00 1.12 ? 43  PHE A N      2  
ATOM 4242  C CA     . PHE C 3 34 ? -97.830  4.863   -26.617 1.00 1.04 ? 43  PHE A CA     2  
ATOM 4243  C C      . PHE C 3 34 ? -97.475  4.181   -25.297 1.00 0.94 ? 43  PHE A C      2  
ATOM 4244  O O      . PHE C 3 34 ? -96.327  4.104   -24.911 1.00 0.91 ? 43  PHE A O      2  
ATOM 4245  C CB     . PHE C 3 34 ? -97.538  6.362   -26.491 1.00 1.12 ? 43  PHE A CB     2  
ATOM 4246  C CG     . PHE C 3 34 ? -98.092  7.092   -27.690 1.00 1.19 ? 43  PHE A CG     2  
ATOM 4247  C CD1    . PHE C 3 34 ? -99.458  7.379   -27.746 1.00 1.35 ? 43  PHE A CD1    2  
ATOM 4248  C CD2    . PHE C 3 34 ? -97.248  7.494   -28.734 1.00 1.41 ? 43  PHE A CD2    2  
ATOM 4249  C CE1    . PHE C 3 34 ? -99.991  8.062   -28.842 1.00 1.53 ? 43  PHE A CE1    2  
ATOM 4250  C CE2    . PHE C 3 34 ? -97.780  8.178   -29.837 1.00 1.56 ? 43  PHE A CE2    2  
ATOM 4251  C CZ     . PHE C 3 34 ? -99.154  8.460   -29.891 1.00 1.54 ? 43  PHE A CZ     2  
ATOM 4252  H H      . PHE C 3 34 ? -99.958  5.172   -26.365 1.00 1.16 ? 43  PHE A H      2  
ATOM 4253  H HA     . PHE C 3 34 ? -97.232  4.448   -27.414 1.00 1.15 ? 43  PHE A HA     2  
ATOM 4254  H HB2    . PHE C 3 34 ? -98.006  6.745   -25.598 1.00 1.21 ? 43  PHE A HB2    2  
ATOM 4255  H HB3    . PHE C 3 34 ? -96.472  6.520   -26.434 1.00 1.28 ? 43  PHE A HB3    2  
ATOM 4256  H HD1    . PHE C 3 34 ? -100.102 7.067   -26.941 1.00 1.52 ? 43  PHE A HD1    2  
ATOM 4257  H HD2    . PHE C 3 34 ? -96.190  7.276   -28.689 1.00 1.63 ? 43  PHE A HD2    2  
ATOM 4258  H HE1    . PHE C 3 34 ? -101.051 8.280   -28.878 1.00 1.81 ? 43  PHE A HE1    2  
ATOM 4259  H HE2    . PHE C 3 34 ? -97.134  8.484   -30.646 1.00 1.84 ? 43  PHE A HE2    2  
ATOM 4260  H HZ     . PHE C 3 34 ? -99.563  8.987   -30.739 1.00 1.73 ? 43  PHE A HZ     2  
ATOM 4261  N N      . ILE C 3 35 ? -98.461  3.718   -24.587 1.00 0.93 ? 44  ILE A N      2  
ATOM 4262  C CA     . ILE C 3 35 ? -98.206  3.072   -23.267 1.00 0.88 ? 44  ILE A CA     2  
ATOM 4263  C C      . ILE C 3 35 ? -99.495  2.342   -22.836 1.00 0.92 ? 44  ILE A C      2  
ATOM 4264  O O      . ILE C 3 35 ? -100.513 2.462   -23.487 1.00 1.02 ? 44  ILE A O      2  
ATOM 4265  C CB     . ILE C 3 35 ? -97.772  4.187   -22.263 1.00 0.83 ? 44  ILE A CB     2  
ATOM 4266  C CG1    . ILE C 3 35 ? -98.263  3.878   -20.837 1.00 1.11 ? 44  ILE A CG1    2  
ATOM 4267  C CG2    . ILE C 3 35 ? -98.314  5.558   -22.722 1.00 0.85 ? 44  ILE A CG2    2  
ATOM 4268  C CD1    . ILE C 3 35 ? -97.724  4.920   -19.854 1.00 1.14 ? 44  ILE A CD1    2  
ATOM 4269  H H      . ILE C 3 35 ? -99.381  3.817   -24.912 1.00 0.99 ? 44  ILE A H      2  
ATOM 4270  H HA     . ILE C 3 35 ? -97.408  2.346   -23.373 1.00 0.93 ? 44  ILE A HA     2  
ATOM 4271  H HB     . ILE C 3 35 ? -96.689  4.235   -22.254 1.00 1.08 ? 44  ILE A HB     2  
ATOM 4272  H HG12   . ILE C 3 35 ? -99.344  3.895   -20.812 1.00 1.23 ? 44  ILE A HG12   2  
ATOM 4273  H HG13   . ILE C 3 35 ? -97.912  2.909   -20.548 1.00 1.52 ? 44  ILE A HG13   2  
ATOM 4274  H HG21   . ILE C 3 35 ? -99.298  5.436   -23.146 1.00 1.37 ? 44  ILE A HG21   2  
ATOM 4275  H HG22   . ILE C 3 35 ? -98.364  6.242   -21.889 1.00 1.24 ? 44  ILE A HG22   2  
ATOM 4276  H HG23   . ILE C 3 35 ? -97.653  5.970   -23.465 1.00 1.50 ? 44  ILE A HG23   2  
ATOM 4277  H HD11   . ILE C 3 35 ? -96.710  5.186   -20.120 1.00 1.39 ? 44  ILE A HD11   2  
ATOM 4278  H HD12   . ILE C 3 35 ? -98.348  5.800   -19.894 1.00 1.56 ? 44  ILE A HD12   2  
ATOM 4279  H HD13   . ILE C 3 35 ? -97.742  4.511   -18.856 1.00 1.68 ? 44  ILE A HD13   2  
ATOM 4280  N N      . SER C 3 36 ? -99.466  1.582   -21.758 1.00 0.88 ? 45  SER A N      2  
ATOM 4281  C CA     . SER C 3 36 ? -100.702 0.847   -21.316 1.00 0.95 ? 45  SER A CA     2  
ATOM 4282  C C      . SER C 3 36 ? -101.232 1.448   -20.011 1.00 0.90 ? 45  SER A C      2  
ATOM 4283  O O      . SER C 3 36 ? -100.594 1.402   -18.973 1.00 0.88 ? 45  SER A O      2  
ATOM 4284  C CB     . SER C 3 36 ? -100.361 -0.633  -21.103 1.00 1.05 ? 45  SER A CB     2  
ATOM 4285  O OG     . SER C 3 36 ? -100.160 -1.255  -22.366 1.00 1.71 ? 45  SER A OG     2  
ATOM 4286  H H      . SER C 3 36 ? -98.631  1.487   -21.243 1.00 0.85 ? 45  SER A H      2  
ATOM 4287  H HA     . SER C 3 36 ? -101.471 0.922   -22.073 1.00 1.03 ? 45  SER A HA     2  
ATOM 4288  H HB2    . SER C 3 36 ? -99.456  -0.717  -20.525 1.00 1.42 ? 45  SER A HB2    2  
ATOM 4289  H HB3    . SER C 3 36 ? -101.170 -1.116  -20.571 1.00 1.48 ? 45  SER A HB3    2  
ATOM 4290  H HG     . SER C 3 36 ? -99.338  -1.745  -22.326 1.00 2.19 ? 45  SER A HG     2  
ATOM 4291  N N      . TRP C 3 37 ? -102.408 2.020   -20.074 1.00 0.95 ? 46  TRP A N      2  
ATOM 4292  C CA     . TRP C 3 37 ? -103.041 2.655   -18.882 1.00 0.94 ? 46  TRP A CA     2  
ATOM 4293  C C      . TRP C 3 37 ? -104.318 1.874   -18.542 1.00 1.08 ? 46  TRP A C      2  
ATOM 4294  O O      . TRP C 3 37 ? -105.358 2.093   -19.131 1.00 1.46 ? 46  TRP A O      2  
ATOM 4295  C CB     . TRP C 3 37 ? -103.406 4.079   -19.295 1.00 0.98 ? 46  TRP A CB     2  
ATOM 4296  C CG     . TRP C 3 37 ? -103.721 4.995   -18.141 1.00 0.93 ? 46  TRP A CG     2  
ATOM 4297  C CD1    . TRP C 3 37 ? -103.932 6.314   -18.331 1.00 0.93 ? 46  TRP A CD1    2  
ATOM 4298  C CD2    . TRP C 3 37 ? -103.873 4.765   -16.683 1.00 0.95 ? 46  TRP A CD2    2  
ATOM 4299  N NE1    . TRP C 3 37 ? -104.188 6.919   -17.122 1.00 0.92 ? 46  TRP A NE1    2  
ATOM 4300  C CE2    . TRP C 3 37 ? -104.170 6.017   -16.080 1.00 0.93 ? 46  TRP A CE2    2  
ATOM 4301  C CE3    . TRP C 3 37 ? -103.789 3.641   -15.819 1.00 1.06 ? 46  TRP A CE3    2  
ATOM 4302  C CZ2    . TRP C 3 37 ? -104.370 6.147   -14.708 1.00 0.99 ? 46  TRP A CZ2    2  
ATOM 4303  C CZ3    . TRP C 3 37 ? -103.993 3.780   -14.436 1.00 1.14 ? 46  TRP A CZ3    2  
ATOM 4304  C CH2    . TRP C 3 37 ? -104.282 5.030   -13.884 1.00 1.10 ? 46  TRP A CH2    2  
ATOM 4305  H H      . TRP C 3 37 ? -102.882 2.043   -20.929 1.00 1.03 ? 46  TRP A H      2  
ATOM 4306  H HA     . TRP C 3 37 ? -102.354 2.670   -18.051 1.00 0.89 ? 46  TRP A HA     2  
ATOM 4307  H HB2    . TRP C 3 37 ? -102.577 4.499   -19.841 1.00 0.99 ? 46  TRP A HB2    2  
ATOM 4308  H HB3    . TRP C 3 37 ? -104.264 4.040   -19.954 1.00 1.09 ? 46  TRP A HB3    2  
ATOM 4309  H HD1    . TRP C 3 37 ? -103.894 6.816   -19.290 1.00 0.98 ? 46  TRP A HD1    2  
ATOM 4310  H HE1    . TRP C 3 37 ? -104.368 7.874   -16.998 1.00 0.95 ? 46  TRP A HE1    2  
ATOM 4311  H HE3    . TRP C 3 37 ? -103.571 2.674   -16.208 1.00 1.12 ? 46  TRP A HE3    2  
ATOM 4312  H HZ2    . TRP C 3 37 ? -104.588 7.112   -14.286 1.00 1.00 ? 46  TRP A HZ2    2  
ATOM 4313  H HZ3    . TRP C 3 37 ? -103.924 2.915   -13.793 1.00 1.27 ? 46  TRP A HZ3    2  
ATOM 4314  H HH2    . TRP C 3 37 ? -104.438 5.130   -12.820 1.00 1.19 ? 46  TRP A HH2    2  
ATOM 4315  N N      . THR C 3 38 ? -104.258 0.968   -17.607 1.00 1.02 ? 47  THR A N      2  
ATOM 4316  C CA     . THR C 3 38 ? -105.474 0.184   -17.254 1.00 1.19 ? 47  THR A CA     2  
ATOM 4317  C C      . THR C 3 38 ? -106.626 1.138   -16.925 1.00 1.21 ? 47  THR A C      2  
ATOM 4318  O O      . THR C 3 38 ? -106.416 2.260   -16.505 1.00 1.40 ? 47  THR A O      2  
ATOM 4319  C CB     . THR C 3 38 ? -105.185 -0.687  -16.033 1.00 1.42 ? 47  THR A CB     2  
ATOM 4320  O OG1    . THR C 3 38 ? -104.959 0.148   -14.905 1.00 2.04 ? 47  THR A OG1    2  
ATOM 4321  C CG2    . THR C 3 38 ? -103.942 -1.537  -16.296 1.00 1.85 ? 47  THR A CG2    2  
ATOM 4322  H H      . THR C 3 38 ? -103.411 0.800   -17.140 1.00 1.07 ? 47  THR A H      2  
ATOM 4323  H HA     . THR C 3 38 ? -105.753 -0.445  -18.086 1.00 1.47 ? 47  THR A HA     2  
ATOM 4324  H HB     . THR C 3 38 ? -106.027 -1.334  -15.844 1.00 1.84 ? 47  THR A HB     2  
ATOM 4325  H HG1    . THR C 3 38 ? -104.663 1.005   -15.224 1.00 2.47 ? 47  THR A HG1    2  
ATOM 4326  H HG21   . THR C 3 38 ? -104.017 -1.990  -17.272 1.00 2.22 ? 47  THR A HG21   2  
ATOM 4327  H HG22   . THR C 3 38 ? -103.064 -0.910  -16.257 1.00 2.33 ? 47  THR A HG22   2  
ATOM 4328  H HG23   . THR C 3 38 ? -103.866 -2.311  -15.544 1.00 2.30 ? 47  THR A HG23   2  
ATOM 4329  N N      . GLY C 3 39 ? -107.842 0.690   -17.118 1.00 1.49 ? 48  GLY A N      2  
ATOM 4330  C CA     . GLY C 3 39 ? -109.035 1.544   -16.823 1.00 1.74 ? 48  GLY A CA     2  
ATOM 4331  C C      . GLY C 3 39 ? -109.817 0.934   -15.659 1.00 1.64 ? 48  GLY A C      2  
ATOM 4332  O O      . GLY C 3 39 ? -111.026 1.040   -15.591 1.00 1.95 ? 48  GLY A O      2  
ATOM 4333  H H      . GLY C 3 39 ? -107.970 -0.219  -17.457 1.00 1.75 ? 48  GLY A H      2  
ATOM 4334  H HA2    . GLY C 3 39 ? -108.726 2.549   -16.566 1.00 1.91 ? 48  GLY A HA2    2  
ATOM 4335  H HA3    . GLY C 3 39 ? -109.672 1.577   -17.694 1.00 2.13 ? 48  GLY A HA3    2  
ATOM 4336  N N      . ASP C 3 40 ? -109.137 0.290   -14.740 1.00 1.50 ? 49  ASP A N      2  
ATOM 4337  C CA     . ASP C 3 40 ? -109.838 -0.341  -13.576 1.00 1.64 ? 49  ASP A CA     2  
ATOM 4338  C C      . ASP C 3 40 ? -109.553 0.473   -12.314 1.00 1.38 ? 49  ASP A C      2  
ATOM 4339  O O      . ASP C 3 40 ? -110.031 1.579   -12.156 1.00 1.37 ? 49  ASP A O      2  
ATOM 4340  C CB     . ASP C 3 40 ? -109.302 -1.761  -13.381 1.00 2.11 ? 49  ASP A CB     2  
ATOM 4341  C CG     . ASP C 3 40 ? -109.612 -2.604  -14.616 1.00 2.89 ? 49  ASP A CG     2  
ATOM 4342  O OD1    . ASP C 3 40 ? -110.663 -2.400  -15.201 1.00 3.56 ? 49  ASP A OD1    2  
ATOM 4343  O OD2    . ASP C 3 40 ? -108.791 -3.439  -14.960 1.00 3.35 ? 49  ASP A OD2    2  
ATOM 4344  H H      . ASP C 3 40 ? -108.163 0.214   -14.817 1.00 1.54 ? 49  ASP A H      2  
ATOM 4345  H HA     . ASP C 3 40 ? -110.903 -0.380  -13.752 1.00 1.89 ? 49  ASP A HA     2  
ATOM 4346  H HB2    . ASP C 3 40 ? -108.233 -1.721  -13.232 1.00 2.24 ? 49  ASP A HB2    2  
ATOM 4347  H HB3    . ASP C 3 40 ? -109.769 -2.207  -12.514 1.00 2.45 ? 49  ASP A HB3    2  
ATOM 4348  N N      . GLY C 3 41 ? -108.761 -0.058  -11.424 1.00 1.32 ? 50  GLY A N      2  
ATOM 4349  C CA     . GLY C 3 41 ? -108.429 0.693   -10.183 1.00 1.25 ? 50  GLY A CA     2  
ATOM 4350  C C      . GLY C 3 41 ? -107.316 1.680   -10.516 1.00 1.14 ? 50  GLY A C      2  
ATOM 4351  O O      . GLY C 3 41 ? -107.546 2.690   -11.150 1.00 1.18 ? 50  GLY A O      2  
ATOM 4352  H H      . GLY C 3 41 ? -108.376 -0.947  -11.578 1.00 1.46 ? 50  GLY A H      2  
ATOM 4353  H HA2    . GLY C 3 41 ? -109.303 1.225   -9.831  1.00 1.28 ? 50  GLY A HA2    2  
ATOM 4354  H HA3    . GLY C 3 41 ? -108.086 0.008   -9.422  1.00 1.37 ? 50  GLY A HA3    2  
ATOM 4355  N N      . TRP C 3 42 ? -106.104 1.393   -10.119 1.00 1.06 ? 51  TRP A N      2  
ATOM 4356  C CA     . TRP C 3 42 ? -104.976 2.316   -10.440 1.00 0.97 ? 51  TRP A CA     2  
ATOM 4357  C C      . TRP C 3 42 ? -103.721 1.504   -10.761 1.00 0.93 ? 51  TRP A C      2  
ATOM 4358  O O      . TRP C 3 42 ? -102.909 1.241   -9.895  1.00 0.98 ? 51  TRP A O      2  
ATOM 4359  C CB     . TRP C 3 42 ? -104.692 3.237   -9.246  1.00 0.99 ? 51  TRP A CB     2  
ATOM 4360  C CG     . TRP C 3 42 ? -103.833 4.389   -9.687  1.00 0.94 ? 51  TRP A CG     2  
ATOM 4361  C CD1    . TRP C 3 42 ? -102.573 4.286   -10.181 1.00 1.03 ? 51  TRP A CD1    2  
ATOM 4362  C CD2    . TRP C 3 42 ? -104.149 5.813   -9.681  1.00 0.88 ? 51  TRP A CD2    2  
ATOM 4363  N NE1    . TRP C 3 42 ? -102.107 5.551   -10.486 1.00 0.97 ? 51  TRP A NE1    2  
ATOM 4364  C CE2    . TRP C 3 42 ? -103.036 6.524   -10.193 1.00 0.87 ? 51  TRP A CE2    2  
ATOM 4365  C CE3    . TRP C 3 42 ? -105.277 6.554   -9.289  1.00 0.97 ? 51  TRP A CE3    2  
ATOM 4366  C CZ2    . TRP C 3 42 ? -103.042 7.912   -10.309 1.00 0.86 ? 51  TRP A CZ2    2  
ATOM 4367  C CZ3    . TRP C 3 42 ? -105.286 7.952   -9.404  1.00 1.05 ? 51  TRP A CZ3    2  
ATOM 4368  C CH2    . TRP C 3 42 ? -104.171 8.630   -9.913  1.00 0.97 ? 51  TRP A CH2    2  
ATOM 4369  H H      . TRP C 3 42 ? -105.934 0.564   -9.622  1.00 1.09 ? 51  TRP A H      2  
ATOM 4370  H HA     . TRP C 3 42 ? -105.231 2.918   -11.302 1.00 0.96 ? 51  TRP A HA     2  
ATOM 4371  H HB2    . TRP C 3 42 ? -105.627 3.614   -8.854  1.00 1.05 ? 51  TRP A HB2    2  
ATOM 4372  H HB3    . TRP C 3 42 ? -104.179 2.681   -8.475  1.00 1.03 ? 51  TRP A HB3    2  
ATOM 4373  H HD1    . TRP C 3 42 ? -102.021 3.371   -10.321 1.00 1.18 ? 51  TRP A HD1    2  
ATOM 4374  H HE1    . TRP C 3 42 ? -101.228 5.750   -10.861 1.00 1.05 ? 51  TRP A HE1    2  
ATOM 4375  H HE3    . TRP C 3 42 ? -106.139 6.046   -8.896  1.00 1.05 ? 51  TRP A HE3    2  
ATOM 4376  H HZ2    . TRP C 3 42 ? -102.179 8.427   -10.699 1.00 0.87 ? 51  TRP A HZ2    2  
ATOM 4377  H HZ3    . TRP C 3 42 ? -106.155 8.512   -9.098  1.00 1.22 ? 51  TRP A HZ3    2  
ATOM 4378  H HH2    . TRP C 3 42 ? -104.186 9.708   -9.998  1.00 1.05 ? 51  TRP A HH2    2  
ATOM 4379  N N      . GLU C 3 43 ? -103.539 1.138   -12.004 1.00 0.91 ? 52  GLU A N      2  
ATOM 4380  C CA     . GLU C 3 43 ? -102.314 0.378   -12.411 1.00 0.89 ? 52  GLU A CA     2  
ATOM 4381  C C      . GLU C 3 43 ? -101.683 1.121   -13.585 1.00 0.85 ? 52  GLU A C      2  
ATOM 4382  O O      . GLU C 3 43 ? -102.314 1.336   -14.603 1.00 0.98 ? 52  GLU A O      2  
ATOM 4383  C CB     . GLU C 3 43 ? -102.689 -1.045  -12.835 1.00 0.97 ? 52  GLU A CB     2  
ATOM 4384  C CG     . GLU C 3 43 ? -103.336 -1.791  -11.658 1.00 1.48 ? 52  GLU A CG     2  
ATOM 4385  C CD     . GLU C 3 43 ? -104.818 -1.414  -11.560 1.00 1.81 ? 52  GLU A CD     2  
ATOM 4386  O OE1    . GLU C 3 43 ? -105.462 -1.349  -12.593 1.00 2.20 ? 52  GLU A OE1    2  
ATOM 4387  O OE2    . GLU C 3 43 ? -105.281 -1.197  -10.452 1.00 2.50 ? 52  GLU A OE2    2  
ATOM 4388  H H      . GLU C 3 43 ? -104.199 1.387   -12.684 1.00 0.97 ? 52  GLU A H      2  
ATOM 4389  H HA     . GLU C 3 43 ? -101.604 0.339   -11.591 1.00 0.88 ? 52  GLU A HA     2  
ATOM 4390  H HB2    . GLU C 3 43 ? -103.380 -1.004  -13.663 1.00 1.28 ? 52  GLU A HB2    2  
ATOM 4391  H HB3    . GLU C 3 43 ? -101.798 -1.572  -13.143 1.00 1.29 ? 52  GLU A HB3    2  
ATOM 4392  H HG2    . GLU C 3 43 ? -103.246 -2.857  -11.816 1.00 2.17 ? 52  GLU A HG2    2  
ATOM 4393  H HG3    . GLU C 3 43 ? -102.837 -1.522  -10.738 1.00 1.98 ? 52  GLU A HG3    2  
ATOM 4394  N N      . PHE C 3 44 ? -100.452 1.538   -13.445 1.00 0.74 ? 53  PHE A N      2  
ATOM 4395  C CA     . PHE C 3 44 ? -99.769  2.301   -14.534 1.00 0.72 ? 53  PHE A CA     2  
ATOM 4396  C C      . PHE C 3 44 ? -98.516  1.541   -14.963 1.00 0.72 ? 53  PHE A C      2  
ATOM 4397  O O      . PHE C 3 44 ? -97.703  1.171   -14.141 1.00 0.76 ? 53  PHE A O      2  
ATOM 4398  C CB     . PHE C 3 44 ? -99.374  3.667   -13.973 1.00 0.69 ? 53  PHE A CB     2  
ATOM 4399  C CG     . PHE C 3 44 ? -99.022  4.607   -15.097 1.00 0.71 ? 53  PHE A CG     2  
ATOM 4400  C CD1    . PHE C 3 44 ? -100.041 5.127   -15.897 1.00 0.77 ? 53  PHE A CD1    2  
ATOM 4401  C CD2    . PHE C 3 44 ? -97.690  4.971   -15.325 1.00 0.70 ? 53  PHE A CD2    2  
ATOM 4402  C CE1    . PHE C 3 44 ? -99.736  6.012   -16.929 1.00 0.82 ? 53  PHE A CE1    2  
ATOM 4403  C CE2    . PHE C 3 44 ? -97.379  5.857   -16.361 1.00 0.75 ? 53  PHE A CE2    2  
ATOM 4404  C CZ     . PHE C 3 44 ? -98.402  6.380   -17.164 1.00 0.80 ? 53  PHE A CZ     2  
ATOM 4405  H H      . PHE C 3 44 ? -99.979  1.367   -12.608 1.00 0.73 ? 53  PHE A H      2  
ATOM 4406  H HA     . PHE C 3 44 ? -100.426 2.430   -15.384 1.00 0.75 ? 53  PHE A HA     2  
ATOM 4407  H HB2    . PHE C 3 44 ? -100.204 4.074   -13.414 1.00 0.70 ? 53  PHE A HB2    2  
ATOM 4408  H HB3    . PHE C 3 44 ? -98.523  3.554   -13.316 1.00 0.68 ? 53  PHE A HB3    2  
ATOM 4409  H HD1    . PHE C 3 44 ? -101.066 4.843   -15.716 1.00 0.80 ? 53  PHE A HD1    2  
ATOM 4410  H HD2    . PHE C 3 44 ? -96.904  4.564   -14.705 1.00 0.70 ? 53  PHE A HD2    2  
ATOM 4411  H HE1    . PHE C 3 44 ? -100.530 6.415   -17.542 1.00 0.89 ? 53  PHE A HE1    2  
ATOM 4412  H HE2    . PHE C 3 44 ? -96.351  6.137   -16.540 1.00 0.77 ? 53  PHE A HE2    2  
ATOM 4413  H HZ     . PHE C 3 44 ? -98.163  7.070   -17.962 1.00 0.86 ? 53  PHE A HZ     2  
ATOM 4414  N N      . LYS C 3 45 ? -98.355  1.294   -16.238 1.00 0.75 ? 54  LYS A N      2  
ATOM 4415  C CA     . LYS C 3 45 ? -97.148  0.543   -16.705 1.00 0.80 ? 54  LYS A CA     2  
ATOM 4416  C C      . LYS C 3 45 ? -96.602  1.160   -17.993 1.00 0.79 ? 54  LYS A C      2  
ATOM 4417  O O      . LYS C 3 45 ? -97.332  1.426   -18.928 1.00 0.82 ? 54  LYS A O      2  
ATOM 4418  C CB     . LYS C 3 45 ? -97.547  -0.921  -16.929 1.00 0.91 ? 54  LYS A CB     2  
ATOM 4419  C CG     . LYS C 3 45 ? -98.936  -0.981  -17.576 1.00 1.53 ? 54  LYS A CG     2  
ATOM 4420  C CD     . LYS C 3 45 ? -99.146  -2.347  -18.238 1.00 1.63 ? 54  LYS A CD     2  
ATOM 4421  C CE     . LYS C 3 45 ? -99.154  -3.437  -17.163 1.00 1.85 ? 54  LYS A CE     2  
ATOM 4422  N NZ     . LYS C 3 45 ? -99.619  -4.727  -17.752 1.00 2.34 ? 54  LYS A NZ     2  
ATOM 4423  H H      . LYS C 3 45 ? -99.030  1.594   -16.888 1.00 0.78 ? 54  LYS A H      2  
ATOM 4424  H HA     . LYS C 3 45 ? -96.376  0.586   -15.950 1.00 0.81 ? 54  LYS A HA     2  
ATOM 4425  H HB2    . LYS C 3 45 ? -96.821  -1.396  -17.573 1.00 1.36 ? 54  LYS A HB2    2  
ATOM 4426  H HB3    . LYS C 3 45 ? -97.575  -1.433  -15.978 1.00 1.53 ? 54  LYS A HB3    2  
ATOM 4427  H HG2    . LYS C 3 45 ? -99.689  -0.834  -16.815 1.00 2.22 ? 54  LYS A HG2    2  
ATOM 4428  H HG3    . LYS C 3 45 ? -99.025  -0.205  -18.319 1.00 2.07 ? 54  LYS A HG3    2  
ATOM 4429  H HD2    . LYS C 3 45 ? -100.090 -2.352  -18.763 1.00 2.26 ? 54  LYS A HD2    2  
ATOM 4430  H HD3    . LYS C 3 45 ? -98.345  -2.537  -18.936 1.00 1.90 ? 54  LYS A HD3    2  
ATOM 4431  H HE2    . LYS C 3 45 ? -98.155  -3.565  -16.771 1.00 2.32 ? 54  LYS A HE2    2  
ATOM 4432  H HE3    . LYS C 3 45 ? -99.818  -3.146  -16.363 1.00 2.34 ? 54  LYS A HE3    2  
ATOM 4433  H HZ1    . LYS C 3 45 ? -100.415 -4.548  -18.398 1.00 2.78 ? 54  LYS A HZ1    2  
ATOM 4434  H HZ2    . LYS C 3 45 ? -98.840  -5.170  -18.276 1.00 2.58 ? 54  LYS A HZ2    2  
ATOM 4435  H HZ3    . LYS C 3 45 ? -99.929  -5.364  -16.990 1.00 2.82 ? 54  LYS A HZ3    2  
ATOM 4436  N N      . LEU C 3 46 ? -95.310  1.385   -18.035 1.00 0.80 ? 55  LEU A N      2  
ATOM 4437  C CA     . LEU C 3 46 ? -94.683  1.985   -19.246 1.00 0.82 ? 55  LEU A CA     2  
ATOM 4438  C C      . LEU C 3 46 ? -94.375  0.873   -20.248 1.00 0.90 ? 55  LEU A C      2  
ATOM 4439  O O      . LEU C 3 46 ? -93.329  0.257   -20.196 1.00 0.98 ? 55  LEU A O      2  
ATOM 4440  C CB     . LEU C 3 46 ? -93.354  2.659   -18.869 1.00 0.85 ? 55  LEU A CB     2  
ATOM 4441  C CG     . LEU C 3 46 ? -93.564  3.836   -17.893 1.00 0.78 ? 55  LEU A CG     2  
ATOM 4442  C CD1    . LEU C 3 46 ? -94.539  4.868   -18.485 1.00 1.30 ? 55  LEU A CD1    2  
ATOM 4443  C CD2    . LEU C 3 46 ? -94.098  3.316   -16.541 1.00 1.25 ? 55  LEU A CD2    2  
ATOM 4444  H H      . LEU C 3 46 ? -94.753  1.154   -17.264 1.00 0.82 ? 55  LEU A H      2  
ATOM 4445  H HA     . LEU C 3 46 ? -95.351  2.706   -19.691 1.00 0.81 ? 55  LEU A HA     2  
ATOM 4446  H HB2    . LEU C 3 46 ? -92.706  1.929   -18.409 1.00 0.89 ? 55  LEU A HB2    2  
ATOM 4447  H HB3    . LEU C 3 46 ? -92.886  3.029   -19.767 1.00 0.94 ? 55  LEU A HB3    2  
ATOM 4448  H HG     . LEU C 3 46 ? -92.612  4.321   -17.732 1.00 1.16 ? 55  LEU A HG     2  
ATOM 4449  H HD11   . LEU C 3 46 ? -94.465  4.866   -19.563 1.00 1.77 ? 55  LEU A HD11   2  
ATOM 4450  H HD12   . LEU C 3 46 ? -95.548  4.626   -18.191 1.00 1.76 ? 55  LEU A HD12   2  
ATOM 4451  H HD13   . LEU C 3 46 ? -94.286  5.851   -18.112 1.00 1.90 ? 55  LEU A HD13   2  
ATOM 4452  H HD21   . LEU C 3 46 ? -93.706  2.329   -16.342 1.00 1.70 ? 55  LEU A HD21   2  
ATOM 4453  H HD22   . LEU C 3 46 ? -93.783  3.989   -15.756 1.00 1.79 ? 55  LEU A HD22   2  
ATOM 4454  H HD23   . LEU C 3 46 ? -95.177  3.276   -16.566 1.00 1.81 ? 55  LEU A HD23   2  
ATOM 4455  N N      . SER C 3 47 ? -95.263  0.606   -21.160 1.00 0.91 ? 56  SER A N      2  
ATOM 4456  C CA     . SER C 3 47 ? -94.991  -0.465  -22.155 1.00 1.02 ? 56  SER A CA     2  
ATOM 4457  C C      . SER C 3 47 ? -94.003  0.042   -23.213 1.00 1.01 ? 56  SER A C      2  
ATOM 4458  O O      . SER C 3 47 ? -93.030  -0.611  -23.528 1.00 1.08 ? 56  SER A O      2  
ATOM 4459  C CB     . SER C 3 47 ? -96.297  -0.883  -22.827 1.00 1.09 ? 56  SER A CB     2  
ATOM 4460  O OG     . SER C 3 47 ? -96.033  -1.923  -23.760 1.00 1.60 ? 56  SER A OG     2  
ATOM 4461  H H      . SER C 3 47 ? -96.103  1.111   -21.195 1.00 0.90 ? 56  SER A H      2  
ATOM 4462  H HA     . SER C 3 47 ? -94.563  -1.319  -21.647 1.00 1.09 ? 56  SER A HA     2  
ATOM 4463  H HB2    . SER C 3 47 ? -96.991  -1.241  -22.082 1.00 1.39 ? 56  SER A HB2    2  
ATOM 4464  H HB3    . SER C 3 47 ? -96.727  -0.031  -23.335 1.00 1.65 ? 56  SER A HB3    2  
ATOM 4465  H HG     . SER C 3 47 ? -95.129  -1.827  -24.068 1.00 1.97 ? 56  SER A HG     2  
ATOM 4466  N N      . ASP C 3 48 ? -94.255  1.201   -23.773 1.00 0.98 ? 57  ASP A N      2  
ATOM 4467  C CA     . ASP C 3 48 ? -93.341  1.757   -24.825 1.00 1.02 ? 57  ASP A CA     2  
ATOM 4468  C C      . ASP C 3 48 ? -93.201  3.280   -24.634 1.00 0.91 ? 57  ASP A C      2  
ATOM 4469  O O      . ASP C 3 48 ? -93.880  4.032   -25.303 1.00 1.09 ? 57  ASP A O      2  
ATOM 4470  C CB     . ASP C 3 48 ? -93.960  1.483   -26.200 1.00 1.30 ? 57  ASP A CB     2  
ATOM 4471  C CG     . ASP C 3 48 ? -92.937  1.761   -27.306 1.00 1.93 ? 57  ASP A CG     2  
ATOM 4472  O OD1    . ASP C 3 48 ? -91.811  2.095   -26.979 1.00 2.54 ? 57  ASP A OD1    2  
ATOM 4473  O OD2    . ASP C 3 48 ? -93.298  1.624   -28.466 1.00 2.54 ? 57  ASP A OD2    2  
ATOM 4474  H H      . ASP C 3 48 ? -95.052  1.705   -23.507 1.00 0.98 ? 57  ASP A H      2  
ATOM 4475  H HA     . ASP C 3 48 ? -92.374  1.283   -24.770 1.00 1.02 ? 57  ASP A HA     2  
ATOM 4476  H HB2    . ASP C 3 48 ? -94.275  0.451   -26.253 1.00 1.58 ? 57  ASP A HB2    2  
ATOM 4477  H HB3    . ASP C 3 48 ? -94.815  2.127   -26.340 1.00 1.71 ? 57  ASP A HB3    2  
ATOM 4478  N N      . PRO C 3 49 ? -92.341  3.708   -23.736 1.00 0.73 ? 58  PRO A N      2  
ATOM 4479  C CA     . PRO C 3 49 ? -92.154  5.152   -23.488 1.00 0.78 ? 58  PRO A CA     2  
ATOM 4480  C C      . PRO C 3 49 ? -91.321  5.774   -24.627 1.00 0.88 ? 58  PRO A C      2  
ATOM 4481  O O      . PRO C 3 49 ? -90.283  6.366   -24.405 1.00 1.09 ? 58  PRO A O      2  
ATOM 4482  C CB     . PRO C 3 49 ? -91.391  5.194   -22.142 1.00 0.79 ? 58  PRO A CB     2  
ATOM 4483  C CG     . PRO C 3 49 ? -90.770  3.783   -21.933 1.00 0.82 ? 58  PRO A CG     2  
ATOM 4484  C CD     . PRO C 3 49 ? -91.502  2.821   -22.897 1.00 0.72 ? 58  PRO A CD     2  
ATOM 4485  H HA     . PRO C 3 49 ? -93.108  5.649   -23.397 1.00 0.89 ? 58  PRO A HA     2  
ATOM 4486  H HB2    . PRO C 3 49 ? -90.616  5.949   -22.161 1.00 0.85 ? 58  PRO A HB2    2  
ATOM 4487  H HB3    . PRO C 3 49 ? -92.081  5.403   -21.336 1.00 0.89 ? 58  PRO A HB3    2  
ATOM 4488  H HG2    . PRO C 3 49 ? -89.712  3.812   -22.162 1.00 0.96 ? 58  PRO A HG2    2  
ATOM 4489  H HG3    . PRO C 3 49 ? -90.911  3.459   -20.912 1.00 0.99 ? 58  PRO A HG3    2  
ATOM 4490  H HD2    . PRO C 3 49 ? -90.784  2.283   -23.504 1.00 0.83 ? 58  PRO A HD2    2  
ATOM 4491  H HD3    . PRO C 3 49 ? -92.126  2.127   -22.348 1.00 0.73 ? 58  PRO A HD3    2  
ATOM 4492  N N      . ASP C 3 50 ? -91.768  5.638   -25.848 1.00 1.08 ? 59  ASP A N      2  
ATOM 4493  C CA     . ASP C 3 50 ? -90.999  6.213   -26.995 1.00 1.21 ? 59  ASP A CA     2  
ATOM 4494  C C      . ASP C 3 50 ? -91.085  7.748   -26.996 1.00 0.99 ? 59  ASP A C      2  
ATOM 4495  O O      . ASP C 3 50 ? -90.097  8.436   -27.178 1.00 0.93 ? 59  ASP A O      2  
ATOM 4496  C CB     . ASP C 3 50 ? -91.575  5.678   -28.313 1.00 1.59 ? 59  ASP A CB     2  
ATOM 4497  C CG     . ASP C 3 50 ? -91.214  4.198   -28.476 1.00 2.29 ? 59  ASP A CG     2  
ATOM 4498  O OD1    . ASP C 3 50 ? -90.262  3.767   -27.848 1.00 2.85 ? 59  ASP A OD1    2  
ATOM 4499  O OD2    . ASP C 3 50 ? -91.899  3.522   -29.225 1.00 2.89 ? 59  ASP A OD2    2  
ATOM 4500  H H      . ASP C 3 50 ? -92.606  5.152   -26.011 1.00 1.31 ? 59  ASP A H      2  
ATOM 4501  H HA     . ASP C 3 50 ? -89.966  5.913   -26.913 1.00 1.33 ? 59  ASP A HA     2  
ATOM 4502  H HB2    . ASP C 3 50 ? -92.650  5.786   -28.308 1.00 1.90 ? 59  ASP A HB2    2  
ATOM 4503  H HB3    . ASP C 3 50 ? -91.161  6.238   -29.138 1.00 1.83 ? 59  ASP A HB3    2  
ATOM 4504  N N      . GLU C 3 51 ? -92.258  8.300   -26.803 1.00 1.03 ? 60  GLU A N      2  
ATOM 4505  C CA     . GLU C 3 51 ? -92.397  9.790   -26.808 1.00 1.01 ? 60  GLU A CA     2  
ATOM 4506  C C      . GLU C 3 51 ? -92.208  10.329  -25.400 1.00 0.85 ? 60  GLU A C      2  
ATOM 4507  O O      . GLU C 3 51 ? -91.732  11.428  -25.201 1.00 0.89 ? 60  GLU A O      2  
ATOM 4508  C CB     . GLU C 3 51 ? -93.794  10.170  -27.304 1.00 1.29 ? 60  GLU A CB     2  
ATOM 4509  C CG     . GLU C 3 51 ? -93.971  9.699   -28.749 1.00 1.82 ? 60  GLU A CG     2  
ATOM 4510  C CD     . GLU C 3 51 ? -93.016  10.469  -29.665 1.00 2.52 ? 60  GLU A CD     2  
ATOM 4511  O OE1    . GLU C 3 51 ? -93.142  11.681  -29.735 1.00 3.05 ? 60  GLU A OE1    2  
ATOM 4512  O OE2    . GLU C 3 51 ? -92.176  9.832   -30.275 1.00 3.15 ? 60  GLU A OE2    2  
ATOM 4513  H H      . GLU C 3 51 ? -93.048  7.737   -26.657 1.00 1.18 ? 60  GLU A H      2  
ATOM 4514  H HA     . GLU C 3 51 ? -91.654  10.227  -27.458 1.00 1.06 ? 60  GLU A HA     2  
ATOM 4515  H HB2    . GLU C 3 51 ? -94.538  9.704   -26.677 1.00 1.71 ? 60  GLU A HB2    2  
ATOM 4516  H HB3    . GLU C 3 51 ? -93.909  11.243  -27.263 1.00 1.56 ? 60  GLU A HB3    2  
ATOM 4517  H HG2    . GLU C 3 51 ? -93.754  8.643   -28.808 1.00 2.24 ? 60  GLU A HG2    2  
ATOM 4518  H HG3    . GLU C 3 51 ? -94.987  9.878   -29.063 1.00 2.29 ? 60  GLU A HG3    2  
ATOM 4519  N N      . VAL C 3 52 ? -92.579  9.569   -24.416 1.00 0.74 ? 61  VAL A N      2  
ATOM 4520  C CA     . VAL C 3 52 ? -92.419  10.052  -23.028 1.00 0.68 ? 61  VAL A CA     2  
ATOM 4521  C C      . VAL C 3 52 ? -90.929  10.194  -22.724 1.00 0.65 ? 61  VAL A C      2  
ATOM 4522  O O      . VAL C 3 52 ? -90.493  11.182  -22.172 1.00 0.72 ? 61  VAL A O      2  
ATOM 4523  C CB     . VAL C 3 52 ? -93.043  9.052   -22.059 1.00 0.69 ? 61  VAL A CB     2  
ATOM 4524  C CG1    . VAL C 3 52 ? -92.802  9.519   -20.631 1.00 0.76 ? 61  VAL A CG1    2  
ATOM 4525  C CG2    . VAL C 3 52 ? -94.549  8.952   -22.307 1.00 0.80 ? 61  VAL A CG2    2  
ATOM 4526  H H      . VAL C 3 52 ? -92.963  8.685   -24.592 1.00 0.78 ? 61  VAL A H      2  
ATOM 4527  H HA     . VAL C 3 52 ? -92.904  11.010  -22.922 1.00 0.74 ? 61  VAL A HA     2  
ATOM 4528  H HB     . VAL C 3 52 ? -92.587  8.084   -22.203 1.00 0.68 ? 61  VAL A HB     2  
ATOM 4529  H HG11   . VAL C 3 52 ? -93.092  10.555  -20.540 1.00 1.34 ? 61  VAL A HG11   2  
ATOM 4530  H HG12   . VAL C 3 52 ? -93.394  8.918   -19.957 1.00 1.23 ? 61  VAL A HG12   2  
ATOM 4531  H HG13   . VAL C 3 52 ? -91.756  9.412   -20.387 1.00 1.28 ? 61  VAL A HG13   2  
ATOM 4532  H HG21   . VAL C 3 52 ? -94.728  8.627   -23.320 1.00 1.26 ? 61  VAL A HG21   2  
ATOM 4533  H HG22   . VAL C 3 52 ? -94.980  8.240   -21.617 1.00 1.35 ? 61  VAL A HG22   2  
ATOM 4534  H HG23   . VAL C 3 52 ? -95.000  9.920   -22.153 1.00 1.29 ? 61  VAL A HG23   2  
ATOM 4535  N N      . ALA C 3 53 ? -90.142  9.214   -23.087 1.00 0.66 ? 62  ALA A N      2  
ATOM 4536  C CA     . ALA C 3 53 ? -88.680  9.300   -22.821 1.00 0.72 ? 62  ALA A CA     2  
ATOM 4537  C C      . ALA C 3 53 ? -88.102  10.470  -23.612 1.00 0.78 ? 62  ALA A C      2  
ATOM 4538  O O      . ALA C 3 53 ? -87.360  11.277  -23.092 1.00 0.84 ? 62  ALA A O      2  
ATOM 4539  C CB     . ALA C 3 53 ? -87.999  7.999   -23.250 1.00 0.80 ? 62  ALA A CB     2  
ATOM 4540  H H      . ALA C 3 53 ? -90.514  8.425   -23.535 1.00 0.71 ? 62  ALA A H      2  
ATOM 4541  H HA     . ALA C 3 53 ? -88.516  9.464   -21.766 1.00 0.73 ? 62  ALA A HA     2  
ATOM 4542  H HB1    . ALA C 3 53 ? -88.505  7.162   -22.790 1.00 1.26 ? 62  ALA A HB1    2  
ATOM 4543  H HB2    . ALA C 3 53 ? -88.045  7.902   -24.325 1.00 1.40 ? 62  ALA A HB2    2  
ATOM 4544  H HB3    . ALA C 3 53 ? -86.966  8.013   -22.932 1.00 1.24 ? 62  ALA A HB3    2  
ATOM 4545  N N      . ARG C 3 54 ? -88.449  10.579  -24.866 1.00 0.82 ? 63  ARG A N      2  
ATOM 4546  C CA     . ARG C 3 54 ? -87.927  11.711  -25.675 1.00 0.93 ? 63  ARG A CA     2  
ATOM 4547  C C      . ARG C 3 54 ? -88.404  13.028  -25.051 1.00 0.93 ? 63  ARG A C      2  
ATOM 4548  O O      . ARG C 3 54 ? -87.632  13.945  -24.850 1.00 1.02 ? 63  ARG A O      2  
ATOM 4549  C CB     . ARG C 3 54 ? -88.461  11.574  -27.108 1.00 1.04 ? 63  ARG A CB     2  
ATOM 4550  C CG     . ARG C 3 54 ? -88.015  12.762  -27.971 1.00 1.39 ? 63  ARG A CG     2  
ATOM 4551  C CD     . ARG C 3 54 ? -86.485  12.823  -28.036 1.00 1.86 ? 63  ARG A CD     2  
ATOM 4552  N NE     . ARG C 3 54 ? -86.053  13.651  -29.215 1.00 2.35 ? 63  ARG A NE     2  
ATOM 4553  C CZ     . ARG C 3 54 ? -86.356  13.320  -30.445 1.00 2.86 ? 63  ARG A CZ     2  
ATOM 4554  N NH1    . ARG C 3 54 ? -86.963  12.194  -30.702 1.00 3.05 ? 63  ARG A NH1    2  
ATOM 4555  N NH2    . ARG C 3 54 ? -86.020  14.112  -31.426 1.00 3.69 ? 63  ARG A NH2    2  
ATOM 4556  H H      . ARG C 3 54 ? -89.059  9.922   -25.270 1.00 0.82 ? 63  ARG A H      2  
ATOM 4557  H HA     . ARG C 3 54 ? -86.848  11.684  -25.682 1.00 0.99 ? 63  ARG A HA     2  
ATOM 4558  H HB2    . ARG C 3 54 ? -88.080  10.659  -27.537 1.00 1.35 ? 63  ARG A HB2    2  
ATOM 4559  H HB3    . ARG C 3 54 ? -89.540  11.534  -27.084 1.00 1.35 ? 63  ARG A HB3    2  
ATOM 4560  H HG2    . ARG C 3 54 ? -88.419  12.647  -28.962 1.00 1.83 ? 63  ARG A HG2    2  
ATOM 4561  H HG3    . ARG C 3 54 ? -88.392  13.677  -27.544 1.00 1.81 ? 63  ARG A HG3    2  
ATOM 4562  H HD2    . ARG C 3 54 ? -86.114  13.312  -27.158 1.00 2.39 ? 63  ARG A HD2    2  
ATOM 4563  H HD3    . ARG C 3 54 ? -86.081  11.810  -28.072 1.00 2.26 ? 63  ARG A HD3    2  
ATOM 4564  H HE     . ARG C 3 54 ? -85.554  14.479  -29.056 1.00 2.78 ? 63  ARG A HE     2  
ATOM 4565  H HH11   . ARG C 3 54 ? -87.206  11.571  -29.957 1.00 2.90 ? 63  ARG A HH11   2  
ATOM 4566  H HH12   . ARG C 3 54 ? -87.185  11.951  -31.647 1.00 3.72 ? 63  ARG A HH12   2  
ATOM 4567  H HH21   . ARG C 3 54 ? -85.535  14.966  -31.235 1.00 4.05 ? 63  ARG A HH21   2  
ATOM 4568  H HH22   . ARG C 3 54 ? -86.247  13.867  -32.370 1.00 4.21 ? 63  ARG A HH22   2  
ATOM 4569  N N      . ARG C 3 55 ? -89.667  13.115  -24.734 1.00 0.88 ? 64  ARG A N      2  
ATOM 4570  C CA     . ARG C 3 55 ? -90.212  14.359  -24.112 1.00 0.94 ? 64  ARG A CA     2  
ATOM 4571  C C      . ARG C 3 55 ? -89.532  14.630  -22.765 1.00 0.88 ? 64  ARG A C      2  
ATOM 4572  O O      . ARG C 3 55 ? -89.297  15.762  -22.392 1.00 0.99 ? 64  ARG A O      2  
ATOM 4573  C CB     . ARG C 3 55 ? -91.721  14.197  -23.900 1.00 0.96 ? 64  ARG A CB     2  
ATOM 4574  C CG     . ARG C 3 55 ? -92.454  14.284  -25.251 1.00 1.39 ? 64  ARG A CG     2  
ATOM 4575  C CD     . ARG C 3 55 ? -92.447  15.733  -25.793 1.00 1.63 ? 64  ARG A CD     2  
ATOM 4576  N NE     . ARG C 3 55 ? -91.283  15.923  -26.708 1.00 2.14 ? 64  ARG A NE     2  
ATOM 4577  C CZ     . ARG C 3 55 ? -91.230  16.964  -27.503 1.00 2.59 ? 64  ARG A CZ     2  
ATOM 4578  N NH1    . ARG C 3 55 ? -92.208  17.832  -27.519 1.00 2.81 ? 64  ARG A NH1    2  
ATOM 4579  N NH2    . ARG C 3 55 ? -90.201  17.135  -28.286 1.00 3.46 ? 64  ARG A NH2    2  
ATOM 4580  H H      . ARG C 3 55 ? -90.264  12.354  -24.900 1.00 0.85 ? 64  ARG A H      2  
ATOM 4581  H HA     . ARG C 3 55 ? -90.038  15.194  -24.772 1.00 1.03 ? 64  ARG A HA     2  
ATOM 4582  H HB2    . ARG C 3 55 ? -91.911  13.231  -23.454 1.00 1.10 ? 64  ARG A HB2    2  
ATOM 4583  H HB3    . ARG C 3 55 ? -92.084  14.970  -23.238 1.00 1.35 ? 64  ARG A HB3    2  
ATOM 4584  H HG2    . ARG C 3 55 ? -91.962  13.638  -25.965 1.00 2.06 ? 64  ARG A HG2    2  
ATOM 4585  H HG3    . ARG C 3 55 ? -93.476  13.956  -25.120 1.00 1.99 ? 64  ARG A HG3    2  
ATOM 4586  H HD2    . ARG C 3 55 ? -93.360  15.917  -26.339 1.00 2.13 ? 64  ARG A HD2    2  
ATOM 4587  H HD3    . ARG C 3 55 ? -92.380  16.437  -24.974 1.00 2.13 ? 64  ARG A HD3    2  
ATOM 4588  H HE     . ARG C 3 55 ? -90.551  15.271  -26.711 1.00 2.69 ? 64  ARG A HE     2  
ATOM 4589  H HH11   . ARG C 3 55 ? -93.000  17.707  -26.926 1.00 2.64 ? 64  ARG A HH11   2  
ATOM 4590  H HH12   . ARG C 3 55 ? -92.161  18.625  -28.130 1.00 3.55 ? 64  ARG A HH12   2  
ATOM 4591  H HH21   . ARG C 3 55 ? -89.454  16.473  -28.283 1.00 3.83 ? 64  ARG A HH21   2  
ATOM 4592  H HH22   . ARG C 3 55 ? -90.157  17.935  -28.887 1.00 4.01 ? 64  ARG A HH22   2  
ATOM 4593  N N      . TRP C 3 56 ? -89.250  13.601  -22.013 1.00 0.77 ? 65  TRP A N      2  
ATOM 4594  C CA     . TRP C 3 56 ? -88.625  13.797  -20.668 1.00 0.74 ? 65  TRP A CA     2  
ATOM 4595  C C      . TRP C 3 56 ? -87.275  14.517  -20.789 1.00 0.80 ? 65  TRP A C      2  
ATOM 4596  O O      . TRP C 3 56 ? -86.960  15.397  -20.009 1.00 0.89 ? 65  TRP A O      2  
ATOM 4597  C CB     . TRP C 3 56 ? -88.412  12.423  -20.004 1.00 0.67 ? 65  TRP A CB     2  
ATOM 4598  C CG     . TRP C 3 56 ? -88.452  12.553  -18.512 1.00 0.67 ? 65  TRP A CG     2  
ATOM 4599  C CD1    . TRP C 3 56 ? -87.404  12.856  -17.709 1.00 0.65 ? 65  TRP A CD1    2  
ATOM 4600  C CD2    . TRP C 3 56 ? -89.594  12.381  -17.640 1.00 0.77 ? 65  TRP A CD2    2  
ATOM 4601  N NE1    . TRP C 3 56 ? -87.840  12.881  -16.392 1.00 0.70 ? 65  TRP A NE1    2  
ATOM 4602  C CE2    . TRP C 3 56 ? -89.188  12.587  -16.301 1.00 0.79 ? 65  TRP A CE2    2  
ATOM 4603  C CE3    . TRP C 3 56 ? -90.936  12.065  -17.885 1.00 0.91 ? 65  TRP A CE3    2  
ATOM 4604  C CZ2    . TRP C 3 56 ? -90.090  12.480  -15.243 1.00 0.93 ? 65  TRP A CZ2    2  
ATOM 4605  C CZ3    . TRP C 3 56 ? -91.845  11.958  -16.826 1.00 1.08 ? 65  TRP A CZ3    2  
ATOM 4606  C CH2    . TRP C 3 56 ? -91.425  12.164  -15.507 1.00 1.08 ? 65  TRP A CH2    2  
ATOM 4607  H H      . TRP C 3 56 ? -89.475  12.698  -22.319 1.00 0.75 ? 65  TRP A H      2  
ATOM 4608  H HA     . TRP C 3 56 ? -89.289  14.392  -20.059 1.00 0.80 ? 65  TRP A HA     2  
ATOM 4609  H HB2    . TRP C 3 56 ? -89.195  11.752  -20.318 1.00 0.70 ? 65  TRP A HB2    2  
ATOM 4610  H HB3    . TRP C 3 56 ? -87.456  12.012  -20.304 1.00 0.66 ? 65  TRP A HB3    2  
ATOM 4611  H HD1    . TRP C 3 56 ? -86.402  13.053  -18.042 1.00 0.68 ? 65  TRP A HD1    2  
ATOM 4612  H HE1    . TRP C 3 56 ? -87.276  13.080  -15.606 1.00 0.73 ? 65  TRP A HE1    2  
ATOM 4613  H HE3    . TRP C 3 56 ? -91.274  11.905  -18.899 1.00 0.94 ? 65  TRP A HE3    2  
ATOM 4614  H HZ2    . TRP C 3 56 ? -89.761  12.632  -14.231 1.00 0.97 ? 65  TRP A HZ2    2  
ATOM 4615  H HZ3    . TRP C 3 56 ? -92.873  11.717  -17.032 1.00 1.23 ? 65  TRP A HZ3    2  
ATOM 4616  H HH2    . TRP C 3 56 ? -92.133  12.081  -14.695 1.00 1.23 ? 65  TRP A HH2    2  
ATOM 4617  N N      . GLY C 3 57 ? -86.461  14.127  -21.733 1.00 0.87 ? 66  GLY A N      2  
ATOM 4618  C CA     . GLY C 3 57 ? -85.116  14.765  -21.876 1.00 1.00 ? 66  GLY A CA     2  
ATOM 4619  C C      . GLY C 3 57 ? -85.193  16.003  -22.768 1.00 1.06 ? 66  GLY A C      2  
ATOM 4620  O O      . GLY C 3 57 ? -84.374  16.895  -22.668 1.00 1.09 ? 66  GLY A O      2  
ATOM 4621  H H      . GLY C 3 57 ? -86.726  13.401  -22.334 1.00 0.90 ? 66  GLY A H      2  
ATOM 4622  H HA2    . GLY C 3 57 ? -84.750  15.056  -20.900 1.00 1.01 ? 66  GLY A HA2    2  
ATOM 4623  H HA3    . GLY C 3 57 ? -84.431  14.059  -22.315 1.00 1.11 ? 66  GLY A HA3    2  
ATOM 4624  N N      . LYS C 3 58 ? -86.155  16.080  -23.644 1.00 1.15 ? 67  LYS A N      2  
ATOM 4625  C CA     . LYS C 3 58 ? -86.225  17.280  -24.520 1.00 1.31 ? 67  LYS A CA     2  
ATOM 4626  C C      . LYS C 3 58 ? -86.395  18.515  -23.626 1.00 1.29 ? 67  LYS A C      2  
ATOM 4627  O O      . LYS C 3 58 ? -85.750  19.528  -23.816 1.00 1.36 ? 67  LYS A O      2  
ATOM 4628  C CB     . LYS C 3 58 ? -87.416  17.150  -25.493 1.00 1.50 ? 67  LYS A CB     2  
ATOM 4629  C CG     . LYS C 3 58 ? -87.106  17.866  -26.815 1.00 1.98 ? 67  LYS A CG     2  
ATOM 4630  C CD     . LYS C 3 58 ? -86.744  19.329  -26.552 1.00 2.17 ? 67  LYS A CD     2  
ATOM 4631  C CE     . LYS C 3 58 ? -86.753  20.090  -27.876 1.00 2.32 ? 67  LYS A CE     2  
ATOM 4632  N NZ     . LYS C 3 58 ? -86.491  21.535  -27.627 1.00 2.71 ? 67  LYS A NZ     2  
ATOM 4633  H H      . LYS C 3 58 ? -86.810  15.360  -23.729 1.00 1.15 ? 67  LYS A H      2  
ATOM 4634  H HA     . LYS C 3 58 ? -85.299  17.361  -25.078 1.00 1.39 ? 67  LYS A HA     2  
ATOM 4635  H HB2    . LYS C 3 58 ? -87.597  16.107  -25.695 1.00 1.51 ? 67  LYS A HB2    2  
ATOM 4636  H HB3    . LYS C 3 58 ? -88.301  17.586  -25.053 1.00 1.70 ? 67  LYS A HB3    2  
ATOM 4637  H HG2    . LYS C 3 58 ? -86.275  17.373  -27.298 1.00 2.34 ? 67  LYS A HG2    2  
ATOM 4638  H HG3    . LYS C 3 58 ? -87.973  17.821  -27.458 1.00 2.33 ? 67  LYS A HG3    2  
ATOM 4639  H HD2    . LYS C 3 58 ? -87.462  19.765  -25.872 1.00 2.56 ? 67  LYS A HD2    2  
ATOM 4640  H HD3    . LYS C 3 58 ? -85.756  19.385  -26.120 1.00 2.44 ? 67  LYS A HD3    2  
ATOM 4641  H HE2    . LYS C 3 58 ? -85.986  19.692  -28.525 1.00 2.57 ? 67  LYS A HE2    2  
ATOM 4642  H HE3    . LYS C 3 58 ? -87.717  19.976  -28.349 1.00 2.74 ? 67  LYS A HE3    2  
ATOM 4643  H HZ1    . LYS C 3 58 ? -85.807  21.637  -26.850 1.00 3.18 ? 67  LYS A HZ1    2  
ATOM 4644  H HZ2    . LYS C 3 58 ? -86.103  21.969  -28.490 1.00 3.04 ? 67  LYS A HZ2    2  
ATOM 4645  H HZ3    . LYS C 3 58 ? -87.378  22.010  -27.369 1.00 2.91 ? 67  LYS A HZ3    2  
ATOM 4646  N N      . ARG C 3 59 ? -87.245  18.433  -22.638 1.00 1.28 ? 68  ARG A N      2  
ATOM 4647  C CA     . ARG C 3 59 ? -87.439  19.597  -21.726 1.00 1.36 ? 68  ARG A CA     2  
ATOM 4648  C C      . ARG C 3 59 ? -86.117  19.933  -21.036 1.00 1.32 ? 68  ARG A C      2  
ATOM 4649  O O      . ARG C 3 59 ? -85.896  21.046  -20.604 1.00 1.49 ? 68  ARG A O      2  
ATOM 4650  C CB     . ARG C 3 59 ? -88.490  19.260  -20.665 1.00 1.44 ? 68  ARG A CB     2  
ATOM 4651  C CG     . ARG C 3 59 ? -89.860  19.047  -21.326 1.00 1.80 ? 68  ARG A CG     2  
ATOM 4652  C CD     . ARG C 3 59 ? -90.349  20.353  -21.975 1.00 2.04 ? 68  ARG A CD     2  
ATOM 4653  N NE     . ARG C 3 59 ? -91.839  20.361  -22.024 1.00 2.47 ? 68  ARG A NE     2  
ATOM 4654  C CZ     . ARG C 3 59 ? -92.477  21.478  -22.249 1.00 3.08 ? 68  ARG A CZ     2  
ATOM 4655  N NH1    . ARG C 3 59 ? -91.807  22.588  -22.415 1.00 3.41 ? 68  ARG A NH1    2  
ATOM 4656  N NH2    . ARG C 3 59 ? -93.778  21.486  -22.305 1.00 3.88 ? 68  ARG A NH2    2  
ATOM 4657  H H      . ARG C 3 59 ? -87.748  17.603  -22.490 1.00 1.27 ? 68  ARG A H      2  
ATOM 4658  H HA     . ARG C 3 59 ? -87.764  20.450  -22.299 1.00 1.49 ? 68  ARG A HA     2  
ATOM 4659  H HB2    . ARG C 3 59 ? -88.198  18.358  -20.147 1.00 1.69 ? 68  ARG A HB2    2  
ATOM 4660  H HB3    . ARG C 3 59 ? -88.558  20.073  -19.958 1.00 1.59 ? 68  ARG A HB3    2  
ATOM 4661  H HG2    . ARG C 3 59 ? -89.776  18.277  -22.081 1.00 2.29 ? 68  ARG A HG2    2  
ATOM 4662  H HG3    . ARG C 3 59 ? -90.573  18.733  -20.577 1.00 2.33 ? 68  ARG A HG3    2  
ATOM 4663  H HD2    . ARG C 3 59 ? -90.006  21.200  -21.399 1.00 2.35 ? 68  ARG A HD2    2  
ATOM 4664  H HD3    . ARG C 3 59 ? -89.962  20.424  -22.982 1.00 2.55 ? 68  ARG A HD3    2  
ATOM 4665  H HE     . ARG C 3 59 ? -92.337  19.529  -21.894 1.00 2.79 ? 68  ARG A HE     2  
ATOM 4666  H HH11   . ARG C 3 59 ? -90.807  22.582  -22.372 1.00 3.26 ? 68  ARG A HH11   2  
ATOM 4667  H HH12   . ARG C 3 59 ? -92.294  23.446  -22.583 1.00 4.13 ? 68  ARG A HH12   2  
ATOM 4668  H HH21   . ARG C 3 59 ? -94.291  20.637  -22.174 1.00 4.13 ? 68  ARG A HH21   2  
ATOM 4669  H HH22   . ARG C 3 59 ? -94.264  22.342  -22.483 1.00 4.48 ? 68  ARG A HH22   2  
ATOM 4670  N N      . LYS C 3 60 ? -85.235  18.976  -20.924 1.00 1.21 ? 69  LYS A N      2  
ATOM 4671  C CA     . LYS C 3 60 ? -83.926  19.231  -20.258 1.00 1.26 ? 69  LYS A CA     2  
ATOM 4672  C C      . LYS C 3 60 ? -82.912  19.689  -21.314 1.00 1.29 ? 69  LYS A C      2  
ATOM 4673  O O      . LYS C 3 60 ? -81.715  19.587  -21.132 1.00 1.45 ? 69  LYS A O      2  
ATOM 4674  C CB     . LYS C 3 60 ? -83.438  17.932  -19.596 1.00 1.24 ? 69  LYS A CB     2  
ATOM 4675  C CG     . LYS C 3 60 ? -82.324  18.234  -18.568 1.00 1.34 ? 69  LYS A CG     2  
ATOM 4676  C CD     . LYS C 3 60 ? -82.932  18.451  -17.174 1.00 1.61 ? 69  LYS A CD     2  
ATOM 4677  C CE     . LYS C 3 60 ? -81.939  19.210  -16.294 1.00 1.89 ? 69  LYS A CE     2  
ATOM 4678  N NZ     . LYS C 3 60 ? -81.683  20.549  -16.891 1.00 2.56 ? 69  LYS A NZ     2  
ATOM 4679  H H      . LYS C 3 60 ? -85.436  18.084  -21.277 1.00 1.18 ? 69  LYS A H      2  
ATOM 4680  H HA     . LYS C 3 60 ? -84.037  20.000  -19.506 1.00 1.47 ? 69  LYS A HA     2  
ATOM 4681  H HB2    . LYS C 3 60 ? -84.272  17.452  -19.103 1.00 1.61 ? 69  LYS A HB2    2  
ATOM 4682  H HB3    . LYS C 3 60 ? -83.051  17.269  -20.358 1.00 1.55 ? 69  LYS A HB3    2  
ATOM 4683  H HG2    . LYS C 3 60 ? -81.639  17.398  -18.528 1.00 1.87 ? 69  LYS A HG2    2  
ATOM 4684  H HG3    . LYS C 3 60 ? -81.781  19.121  -18.864 1.00 1.90 ? 69  LYS A HG3    2  
ATOM 4685  H HD2    . LYS C 3 60 ? -83.843  19.024  -17.262 1.00 2.11 ? 69  LYS A HD2    2  
ATOM 4686  H HD3    . LYS C 3 60 ? -83.150  17.493  -16.723 1.00 2.12 ? 69  LYS A HD3    2  
ATOM 4687  H HE2    . LYS C 3 60 ? -82.352  19.330  -15.304 1.00 2.35 ? 69  LYS A HE2    2  
ATOM 4688  H HE3    . LYS C 3 60 ? -81.013  18.657  -16.235 1.00 2.07 ? 69  LYS A HE3    2  
ATOM 4689  H HZ1    . LYS C 3 60 ? -82.332  20.703  -17.688 1.00 2.93 ? 69  LYS A HZ1    2  
ATOM 4690  H HZ2    . LYS C 3 60 ? -81.833  21.288  -16.172 1.00 3.03 ? 69  LYS A HZ2    2  
ATOM 4691  H HZ3    . LYS C 3 60 ? -80.703  20.593  -17.234 1.00 2.92 ? 69  LYS A HZ3    2  
ATOM 4692  N N      . ASN C 3 61 ? -83.386  20.194  -22.422 1.00 1.49 ? 70  ASN A N      2  
ATOM 4693  C CA     . ASN C 3 61 ? -82.458  20.662  -23.495 1.00 1.75 ? 70  ASN A CA     2  
ATOM 4694  C C      . ASN C 3 61 ? -81.539  19.519  -23.941 1.00 1.60 ? 70  ASN A C      2  
ATOM 4695  O O      . ASN C 3 61 ? -80.349  19.701  -24.088 1.00 1.74 ? 70  ASN A O      2  
ATOM 4696  C CB     . ASN C 3 61 ? -81.597  21.816  -22.965 1.00 2.11 ? 70  ASN A CB     2  
ATOM 4697  C CG     . ASN C 3 61 ? -80.920  22.531  -24.139 1.00 2.80 ? 70  ASN A CG     2  
ATOM 4698  O OD1    . ASN C 3 61 ? -81.174  22.219  -25.284 1.00 3.49 ? 70  ASN A OD1    2  
ATOM 4699  N ND2    . ASN C 3 61 ? -80.055  23.479  -23.897 1.00 3.17 ? 70  ASN A ND2    2  
ATOM 4700  H H      . ASN C 3 61 ? -84.356  20.267  -22.550 1.00 1.66 ? 70  ASN A H      2  
ATOM 4701  H HA     . ASN C 3 61 ? -83.035  21.008  -24.340 1.00 1.96 ? 70  ASN A HA     2  
ATOM 4702  H HB2    . ASN C 3 61 ? -82.224  22.514  -22.429 1.00 2.33 ? 70  ASN A HB2    2  
ATOM 4703  H HB3    . ASN C 3 61 ? -80.840  21.427  -22.302 1.00 2.23 ? 70  ASN A HB3    2  
ATOM 4704  H HD21   . ASN C 3 61 ? -79.846  23.725  -22.971 1.00 3.12 ? 70  ASN A HD21   2  
ATOM 4705  H HD22   . ASN C 3 61 ? -79.617  23.945  -24.638 1.00 3.80 ? 70  ASN A HD22   2  
ATOM 4706  N N      . LYS C 3 62 ? -82.084  18.348  -24.178 1.00 1.48 ? 71  LYS A N      2  
ATOM 4707  C CA     . LYS C 3 62 ? -81.244  17.191  -24.642 1.00 1.47 ? 71  LYS A CA     2  
ATOM 4708  C C      . LYS C 3 62 ? -81.943  16.519  -25.838 1.00 1.58 ? 71  LYS A C      2  
ATOM 4709  O O      . LYS C 3 62 ? -83.156  16.525  -25.901 1.00 1.78 ? 71  LYS A O      2  
ATOM 4710  C CB     . LYS C 3 62 ? -81.092  16.168  -23.512 1.00 1.51 ? 71  LYS A CB     2  
ATOM 4711  C CG     . LYS C 3 62 ? -80.183  16.738  -22.426 1.00 1.55 ? 71  LYS A CG     2  
ATOM 4712  C CD     . LYS C 3 62 ? -80.106  15.745  -21.269 1.00 1.66 ? 71  LYS A CD     2  
ATOM 4713  C CE     . LYS C 3 62 ? -79.195  16.301  -20.175 1.00 1.66 ? 71  LYS A CE     2  
ATOM 4714  N NZ     . LYS C 3 62 ? -77.822  16.510  -20.722 1.00 2.35 ? 71  LYS A NZ     2  
ATOM 4715  H H      . LYS C 3 62 ? -83.052  18.233  -24.066 1.00 1.50 ? 71  LYS A H      2  
ATOM 4716  H HA     . LYS C 3 62 ? -80.272  17.552  -24.930 1.00 1.55 ? 71  LYS A HA     2  
ATOM 4717  H HB2    . LYS C 3 62 ? -82.063  15.950  -23.090 1.00 1.66 ? 71  LYS A HB2    2  
ATOM 4718  H HB3    . LYS C 3 62 ? -80.659  15.259  -23.897 1.00 1.69 ? 71  LYS A HB3    2  
ATOM 4719  H HG2    . LYS C 3 62 ? -79.194  16.901  -22.832 1.00 1.80 ? 71  LYS A HG2    2  
ATOM 4720  H HG3    . LYS C 3 62 ? -80.586  17.674  -22.069 1.00 1.99 ? 71  LYS A HG3    2  
ATOM 4721  H HD2    . LYS C 3 62 ? -81.095  15.591  -20.868 1.00 2.22 ? 71  LYS A HD2    2  
ATOM 4722  H HD3    . LYS C 3 62 ? -79.707  14.806  -21.625 1.00 1.96 ? 71  LYS A HD3    2  
ATOM 4723  H HE2    . LYS C 3 62 ? -79.589  17.244  -19.826 1.00 1.96 ? 71  LYS A HE2    2  
ATOM 4724  H HE3    . LYS C 3 62 ? -79.154  15.600  -19.354 1.00 1.85 ? 71  LYS A HE3    2  
ATOM 4725  H HZ1    . LYS C 3 62 ? -77.807  16.258  -21.730 1.00 2.82 ? 71  LYS A HZ1    2  
ATOM 4726  H HZ2    . LYS C 3 62 ? -77.553  17.507  -20.612 1.00 2.86 ? 71  LYS A HZ2    2  
ATOM 4727  H HZ3    . LYS C 3 62 ? -77.146  15.909  -20.204 1.00 2.60 ? 71  LYS A HZ3    2  
ATOM 4728  N N      . PRO C 3 63 ? -81.178  15.952  -26.755 1.00 1.85 ? 72  PRO A N      2  
ATOM 4729  C CA     . PRO C 3 63 ? -81.771  15.284  -27.925 1.00 2.09 ? 72  PRO A CA     2  
ATOM 4730  C C      . PRO C 3 63 ? -82.737  14.181  -27.459 1.00 1.70 ? 72  PRO A C      2  
ATOM 4731  O O      . PRO C 3 63 ? -83.922  14.402  -27.326 1.00 2.05 ? 72  PRO A O      2  
ATOM 4732  C CB     . PRO C 3 63 ? -80.562  14.707  -28.707 1.00 2.68 ? 72  PRO A CB     2  
ATOM 4733  C CG     . PRO C 3 63 ? -79.290  14.967  -27.849 1.00 2.96 ? 72  PRO A CG     2  
ATOM 4734  C CD     . PRO C 3 63 ? -79.698  15.923  -26.711 1.00 2.30 ? 72  PRO A CD     2  
ATOM 4735  H HA     . PRO C 3 63 ? -82.298  16.001  -28.533 1.00 2.46 ? 72  PRO A HA     2  
ATOM 4736  H HB2    . PRO C 3 63 ? -80.685  13.645  -28.879 1.00 2.64 ? 72  PRO A HB2    2  
ATOM 4737  H HB3    . PRO C 3 63 ? -80.462  15.216  -29.656 1.00 3.17 ? 72  PRO A HB3    2  
ATOM 4738  H HG2    . PRO C 3 63 ? -78.928  14.031  -27.437 1.00 3.22 ? 72  PRO A HG2    2  
ATOM 4739  H HG3    . PRO C 3 63 ? -78.516  15.422  -28.453 1.00 3.55 ? 72  PRO A HG3    2  
ATOM 4740  H HD2    . PRO C 3 63 ? -79.347  15.553  -25.758 1.00 2.26 ? 72  PRO A HD2    2  
ATOM 4741  H HD3    . PRO C 3 63 ? -79.306  16.914  -26.897 1.00 2.48 ? 72  PRO A HD3    2  
ATOM 4742  N N      . LYS C 3 64 ? -82.237  12.997  -27.214 1.00 1.44 ? 73  LYS A N      2  
ATOM 4743  C CA     . LYS C 3 64 ? -83.114  11.875  -26.757 1.00 1.53 ? 73  LYS A CA     2  
ATOM 4744  C C      . LYS C 3 64 ? -82.415  11.123  -25.618 1.00 1.33 ? 73  LYS A C      2  
ATOM 4745  O O      . LYS C 3 64 ? -81.247  10.797  -25.707 1.00 1.66 ? 73  LYS A O      2  
ATOM 4746  C CB     . LYS C 3 64 ? -83.367  10.931  -27.943 1.00 2.19 ? 73  LYS A CB     2  
ATOM 4747  C CG     . LYS C 3 64 ? -84.384  9.826   -27.560 1.00 2.95 ? 73  LYS A CG     2  
ATOM 4748  C CD     . LYS C 3 64 ? -83.649  8.520   -27.229 1.00 3.72 ? 73  LYS A CD     2  
ATOM 4749  C CE     . LYS C 3 64 ? -84.667  7.440   -26.859 1.00 4.37 ? 73  LYS A CE     2  
ATOM 4750  N NZ     . LYS C 3 64 ? -83.960  6.142   -26.662 1.00 5.24 ? 73  LYS A NZ     2  
ATOM 4751  H H      . LYS C 3 64 ? -81.275  12.841  -27.331 1.00 1.60 ? 73  LYS A H      2  
ATOM 4752  H HA     . LYS C 3 64 ? -84.055  12.264  -26.396 1.00 1.77 ? 73  LYS A HA     2  
ATOM 4753  H HB2    . LYS C 3 64 ? -83.759  11.509  -28.770 1.00 2.47 ? 73  LYS A HB2    2  
ATOM 4754  H HB3    . LYS C 3 64 ? -82.431  10.481  -28.242 1.00 2.56 ? 73  LYS A HB3    2  
ATOM 4755  H HG2    . LYS C 3 64 ? -84.963  10.137  -26.700 1.00 3.22 ? 73  LYS A HG2    2  
ATOM 4756  H HG3    . LYS C 3 64 ? -85.053  9.651   -28.390 1.00 3.26 ? 73  LYS A HG3    2  
ATOM 4757  H HD2    . LYS C 3 64 ? -83.081  8.202   -28.090 1.00 4.03 ? 73  LYS A HD2    2  
ATOM 4758  H HD3    . LYS C 3 64 ? -82.982  8.686   -26.397 1.00 3.96 ? 73  LYS A HD3    2  
ATOM 4759  H HE2    . LYS C 3 64 ? -85.172  7.718   -25.945 1.00 4.55 ? 73  LYS A HE2    2  
ATOM 4760  H HE3    . LYS C 3 64 ? -85.389  7.340   -27.655 1.00 4.50 ? 73  LYS A HE3    2  
ATOM 4761  H HZ1    . LYS C 3 64 ? -83.442  5.897   -27.528 1.00 5.48 ? 73  LYS A HZ1    2  
ATOM 4762  H HZ2    . LYS C 3 64 ? -83.291  6.232   -25.870 1.00 5.57 ? 73  LYS A HZ2    2  
ATOM 4763  H HZ3    . LYS C 3 64 ? -84.652  5.396   -26.450 1.00 5.62 ? 73  LYS A HZ3    2  
ATOM 4764  N N      . MET C 3 65 ? -83.121  10.850  -24.542 1.00 1.17 ? 74  MET A N      2  
ATOM 4765  C CA     . MET C 3 65 ? -82.509  10.121  -23.382 1.00 1.15 ? 74  MET A CA     2  
ATOM 4766  C C      . MET C 3 65 ? -83.194  8.769   -23.212 1.00 0.99 ? 74  MET A C      2  
ATOM 4767  O O      . MET C 3 65 ? -84.380  8.633   -23.433 1.00 1.00 ? 74  MET A O      2  
ATOM 4768  C CB     . MET C 3 65 ? -82.714  10.936  -22.109 1.00 1.47 ? 74  MET A CB     2  
ATOM 4769  C CG     . MET C 3 65 ? -81.973  12.264  -22.231 1.00 2.01 ? 74  MET A CG     2  
ATOM 4770  S SD     . MET C 3 65 ? -81.910  13.061  -20.609 1.00 2.41 ? 74  MET A SD     2  
ATOM 4771  C CE     . MET C 3 65 ? -80.393  12.263  -20.029 1.00 2.27 ? 74  MET A CE     2  
ATOM 4772  H H      . MET C 3 65 ? -84.059  11.129  -24.494 1.00 1.36 ? 74  MET A H      2  
ATOM 4773  H HA     . MET C 3 65 ? -81.450  9.972   -23.546 1.00 1.29 ? 74  MET A HA     2  
ATOM 4774  H HB2    . MET C 3 65 ? -83.771  11.122  -21.971 1.00 1.42 ? 74  MET A HB2    2  
ATOM 4775  H HB3    . MET C 3 65 ? -82.332  10.386  -21.262 1.00 1.94 ? 74  MET A HB3    2  
ATOM 4776  H HG2    . MET C 3 65 ? -80.970  12.088  -22.586 1.00 2.66 ? 74  MET A HG2    2  
ATOM 4777  H HG3    . MET C 3 65 ? -82.495  12.904  -22.928 1.00 2.34 ? 74  MET A HG3    2  
ATOM 4778  H HE1    . MET C 3 65 ? -80.339  11.258  -20.423 1.00 2.52 ? 74  MET A HE1    2  
ATOM 4779  H HE2    . MET C 3 65 ? -79.538  12.833  -20.366 1.00 2.60 ? 74  MET A HE2    2  
ATOM 4780  H HE3    . MET C 3 65 ? -80.394  12.225  -18.952 1.00 2.59 ? 74  MET A HE3    2  
ATOM 4781  N N      . ASN C 3 66 ? -82.459  7.764   -22.819 1.00 0.97 ? 75  ASN A N      2  
ATOM 4782  C CA     . ASN C 3 66 ? -83.075  6.422   -22.640 1.00 0.94 ? 75  ASN A CA     2  
ATOM 4783  C C      . ASN C 3 66 ? -83.997  6.410   -21.413 1.00 0.89 ? 75  ASN A C      2  
ATOM 4784  O O      . ASN C 3 66 ? -83.927  7.265   -20.553 1.00 0.90 ? 75  ASN A O      2  
ATOM 4785  C CB     . ASN C 3 66 ? -81.978  5.369   -22.468 1.00 1.07 ? 75  ASN A CB     2  
ATOM 4786  C CG     . ASN C 3 66 ? -81.147  5.677   -21.220 1.00 1.11 ? 75  ASN A CG     2  
ATOM 4787  O OD1    . ASN C 3 66 ? -81.592  6.382   -20.335 1.00 1.08 ? 75  ASN A OD1    2  
ATOM 4788  N ND2    . ASN C 3 66 ? -79.948  5.171   -21.112 1.00 1.48 ? 75  ASN A ND2    2  
ATOM 4789  H H      . ASN C 3 66 ? -81.501  7.895   -22.645 1.00 1.05 ? 75  ASN A H      2  
ATOM 4790  H HA     . ASN C 3 66 ? -83.656  6.182   -23.521 1.00 0.97 ? 75  ASN A HA     2  
ATOM 4791  H HB2    . ASN C 3 66 ? -82.432  4.394   -22.362 1.00 1.25 ? 75  ASN A HB2    2  
ATOM 4792  H HB3    . ASN C 3 66 ? -81.336  5.374   -23.334 1.00 1.21 ? 75  ASN A HB3    2  
ATOM 4793  H HD21   . ASN C 3 66 ? -79.589  4.601   -21.823 1.00 1.68 ? 75  ASN A HD21   2  
ATOM 4794  H HD22   . ASN C 3 66 ? -79.405  5.364   -20.317 1.00 1.66 ? 75  ASN A HD22   2  
ATOM 4795  N N      . TYR C 3 67 ? -84.848  5.422   -21.333 1.00 0.88 ? 76  TYR A N      2  
ATOM 4796  C CA     . TYR C 3 67 ? -85.782  5.283   -20.184 1.00 0.87 ? 76  TYR A CA     2  
ATOM 4797  C C      . TYR C 3 67 ? -84.969  4.993   -18.932 1.00 0.84 ? 76  TYR A C      2  
ATOM 4798  O O      . TYR C 3 67 ? -85.432  5.158   -17.820 1.00 0.83 ? 76  TYR A O      2  
ATOM 4799  C CB     . TYR C 3 67 ? -86.737  4.117   -20.474 1.00 0.95 ? 76  TYR A CB     2  
ATOM 4800  C CG     . TYR C 3 67 ? -87.766  3.972   -19.372 1.00 0.71 ? 76  TYR A CG     2  
ATOM 4801  C CD1    . TYR C 3 67 ? -88.818  4.892   -19.268 1.00 0.71 ? 76  TYR A CD1    2  
ATOM 4802  C CD2    . TYR C 3 67 ? -87.680  2.907   -18.462 1.00 0.79 ? 76  TYR A CD2    2  
ATOM 4803  C CE1    . TYR C 3 67 ? -89.779  4.748   -18.260 1.00 0.75 ? 76  TYR A CE1    2  
ATOM 4804  C CE2    . TYR C 3 67 ? -88.640  2.766   -17.454 1.00 0.85 ? 76  TYR A CE2    2  
ATOM 4805  C CZ     . TYR C 3 67 ? -89.690  3.687   -17.354 1.00 0.80 ? 76  TYR A CZ     2  
ATOM 4806  O OH     . TYR C 3 67 ? -90.641  3.551   -16.364 1.00 1.07 ? 76  TYR A OH     2  
ATOM 4807  H H      . TYR C 3 67 ? -84.862  4.746   -22.033 1.00 0.91 ? 76  TYR A H      2  
ATOM 4808  H HA     . TYR C 3 67 ? -86.344  6.196   -20.053 1.00 0.87 ? 76  TYR A HA     2  
ATOM 4809  H HB2    . TYR C 3 67 ? -87.242  4.299   -21.412 1.00 1.15 ? 76  TYR A HB2    2  
ATOM 4810  H HB3    . TYR C 3 67 ? -86.165  3.203   -20.551 1.00 1.13 ? 76  TYR A HB3    2  
ATOM 4811  H HD1    . TYR C 3 67 ? -88.889  5.713   -19.964 1.00 0.92 ? 76  TYR A HD1    2  
ATOM 4812  H HD2    . TYR C 3 67 ? -86.872  2.197   -18.537 1.00 1.01 ? 76  TYR A HD2    2  
ATOM 4813  H HE1    . TYR C 3 67 ? -90.590  5.457   -18.183 1.00 0.95 ? 76  TYR A HE1    2  
ATOM 4814  H HE2    . TYR C 3 67 ? -88.569  1.946   -16.755 1.00 1.10 ? 76  TYR A HE2    2  
ATOM 4815  H HH     . TYR C 3 67 ? -90.872  2.621   -16.296 1.00 1.51 ? 76  TYR A HH     2  
ATOM 4816  N N      . GLU C 3 68 ? -83.761  4.540   -19.105 1.00 0.85 ? 77  GLU A N      2  
ATOM 4817  C CA     . GLU C 3 68 ? -82.922  4.219   -17.927 1.00 0.86 ? 77  GLU A CA     2  
ATOM 4818  C C      . GLU C 3 68 ? -82.745  5.483   -17.083 1.00 0.84 ? 77  GLU A C      2  
ATOM 4819  O O      . GLU C 3 68 ? -82.595  5.415   -15.881 1.00 0.83 ? 77  GLU A O      2  
ATOM 4820  C CB     . GLU C 3 68 ? -81.540  3.746   -18.384 1.00 0.92 ? 77  GLU A CB     2  
ATOM 4821  C CG     . GLU C 3 68 ? -81.673  2.612   -19.405 1.00 1.49 ? 77  GLU A CG     2  
ATOM 4822  C CD     . GLU C 3 68 ? -82.080  1.316   -18.704 1.00 1.97 ? 77  GLU A CD     2  
ATOM 4823  O OE1    . GLU C 3 68 ? -82.305  1.357   -17.508 1.00 2.43 ? 77  GLU A OE1    2  
ATOM 4824  O OE2    . GLU C 3 68 ? -82.149  0.300   -19.378 1.00 2.53 ? 77  GLU A OE2    2  
ATOM 4825  H H      . GLU C 3 68 ? -83.412  4.402   -20.011 1.00 0.88 ? 77  GLU A H      2  
ATOM 4826  H HA     . GLU C 3 68 ? -83.397  3.448   -17.343 1.00 0.88 ? 77  GLU A HA     2  
ATOM 4827  H HB2    . GLU C 3 68 ? -81.008  4.573   -18.831 1.00 1.21 ? 77  GLU A HB2    2  
ATOM 4828  H HB3    . GLU C 3 68 ? -80.988  3.389   -17.528 1.00 1.32 ? 77  GLU A HB3    2  
ATOM 4829  H HG2    . GLU C 3 68 ? -82.420  2.872   -20.138 1.00 2.02 ? 77  GLU A HG2    2  
ATOM 4830  H HG3    . GLU C 3 68 ? -80.726  2.466   -19.900 1.00 1.92 ? 77  GLU A HG3    2  
ATOM 4831  N N      . LYS C 3 69 ? -82.754  6.640   -17.697 1.00 0.86 ? 78  LYS A N      2  
ATOM 4832  C CA     . LYS C 3 69 ? -82.581  7.886   -16.901 1.00 0.90 ? 78  LYS A CA     2  
ATOM 4833  C C      . LYS C 3 69 ? -83.704  7.977   -15.872 1.00 0.86 ? 78  LYS A C      2  
ATOM 4834  O O      . LYS C 3 69 ? -83.511  8.442   -14.766 1.00 0.90 ? 78  LYS A O      2  
ATOM 4835  C CB     . LYS C 3 69 ? -82.579  9.124   -17.821 1.00 0.96 ? 78  LYS A CB     2  
ATOM 4836  C CG     . LYS C 3 69 ? -83.981  9.372   -18.452 1.00 1.82 ? 78  LYS A CG     2  
ATOM 4837  C CD     . LYS C 3 69 ? -84.662  10.584  -17.787 1.00 2.38 ? 78  LYS A CD     2  
ATOM 4838  C CE     . LYS C 3 69 ? -84.064  11.891  -18.337 1.00 3.44 ? 78  LYS A CE     2  
ATOM 4839  N NZ     . LYS C 3 69 ? -84.761  12.266  -19.603 1.00 4.23 ? 78  LYS A NZ     2  
ATOM 4840  H H      . LYS C 3 69 ? -82.876  6.684   -18.668 1.00 0.89 ? 78  LYS A H      2  
ATOM 4841  H HA     . LYS C 3 69 ? -81.635  7.831   -16.379 1.00 0.95 ? 78  LYS A HA     2  
ATOM 4842  H HB2    . LYS C 3 69 ? -82.280  9.984   -17.237 1.00 1.32 ? 78  LYS A HB2    2  
ATOM 4843  H HB3    . LYS C 3 69 ? -81.854  8.970   -18.609 1.00 1.28 ? 78  LYS A HB3    2  
ATOM 4844  H HG2    . LYS C 3 69 ? -83.866  9.573   -19.508 1.00 2.37 ? 78  LYS A HG2    2  
ATOM 4845  H HG3    . LYS C 3 69 ? -84.605  8.501   -18.330 1.00 2.41 ? 78  LYS A HG3    2  
ATOM 4846  H HD2    . LYS C 3 69 ? -85.721  10.557  -17.998 1.00 2.64 ? 78  LYS A HD2    2  
ATOM 4847  H HD3    . LYS C 3 69 ? -84.508  10.541  -16.719 1.00 2.58 ? 78  LYS A HD3    2  
ATOM 4848  H HE2    . LYS C 3 69 ? -84.188  12.680  -17.609 1.00 3.82 ? 78  LYS A HE2    2  
ATOM 4849  H HE3    . LYS C 3 69 ? -83.012  11.756  -18.535 1.00 3.76 ? 78  LYS A HE3    2  
ATOM 4850  H HZ1    . LYS C 3 69 ? -85.543  11.601  -19.780 1.00 4.61 ? 78  LYS A HZ1    2  
ATOM 4851  H HZ2    . LYS C 3 69 ? -85.139  13.231  -19.521 1.00 4.55 ? 78  LYS A HZ2    2  
ATOM 4852  H HZ3    . LYS C 3 69 ? -84.087  12.227  -20.394 1.00 4.52 ? 78  LYS A HZ3    2  
ATOM 4853  N N      . LEU C 3 70 ? -84.871  7.514   -16.216 1.00 0.80 ? 79  LEU A N      2  
ATOM 4854  C CA     . LEU C 3 70 ? -85.991  7.552   -15.247 1.00 0.79 ? 79  LEU A CA     2  
ATOM 4855  C C      . LEU C 3 70 ? -85.701  6.544   -14.124 1.00 0.79 ? 79  LEU A C      2  
ATOM 4856  O O      . LEU C 3 70 ? -85.900  6.829   -12.963 1.00 0.86 ? 79  LEU A O      2  
ATOM 4857  C CB     . LEU C 3 70 ? -87.304  7.205   -15.981 1.00 0.77 ? 79  LEU A CB     2  
ATOM 4858  C CG     . LEU C 3 70 ? -88.009  8.488   -16.470 1.00 0.76 ? 79  LEU A CG     2  
ATOM 4859  C CD1    . LEU C 3 70 ? -89.025  8.129   -17.558 1.00 1.17 ? 79  LEU A CD1    2  
ATOM 4860  C CD2    . LEU C 3 70 ? -88.749  9.174   -15.304 1.00 1.13 ? 79  LEU A CD2    2  
ATOM 4861  H H      . LEU C 3 70 ? -85.005  7.128   -17.107 1.00 0.79 ? 79  LEU A H      2  
ATOM 4862  H HA     . LEU C 3 70 ? -86.057  8.543   -14.822 1.00 0.85 ? 79  LEU A HA     2  
ATOM 4863  H HB2    . LEU C 3 70 ? -87.062  6.587   -16.840 1.00 0.84 ? 79  LEU A HB2    2  
ATOM 4864  H HB3    . LEU C 3 70 ? -87.962  6.656   -15.326 1.00 0.81 ? 79  LEU A HB3    2  
ATOM 4865  H HG     . LEU C 3 70 ? -87.273  9.166   -16.881 1.00 1.08 ? 79  LEU A HG     2  
ATOM 4866  H HD11   . LEU C 3 70 ? -88.529  7.586   -18.348 1.00 1.58 ? 79  LEU A HD11   2  
ATOM 4867  H HD12   . LEU C 3 70 ? -89.804  7.513   -17.132 1.00 1.65 ? 79  LEU A HD12   2  
ATOM 4868  H HD13   . LEU C 3 70 ? -89.460  9.033   -17.959 1.00 1.72 ? 79  LEU A HD13   2  
ATOM 4869  H HD21   . LEU C 3 70 ? -89.285  8.436   -14.725 1.00 1.76 ? 79  LEU A HD21   2  
ATOM 4870  H HD22   . LEU C 3 70 ? -88.041  9.685   -14.668 1.00 1.54 ? 79  LEU A HD22   2  
ATOM 4871  H HD23   . LEU C 3 70 ? -89.452  9.895   -15.697 1.00 1.55 ? 79  LEU A HD23   2  
ATOM 4872  N N      . SER C 3 71 ? -85.214  5.377   -14.451 1.00 0.78 ? 80  SER A N      2  
ATOM 4873  C CA     . SER C 3 71 ? -84.903  4.390   -13.379 1.00 0.81 ? 80  SER A CA     2  
ATOM 4874  C C      . SER C 3 71 ? -83.845  4.978   -12.450 1.00 0.85 ? 80  SER A C      2  
ATOM 4875  O O      . SER C 3 71 ? -83.864  4.769   -11.252 1.00 1.01 ? 80  SER A O      2  
ATOM 4876  C CB     . SER C 3 71 ? -84.366  3.091   -13.991 1.00 0.88 ? 80  SER A CB     2  
ATOM 4877  O OG     . SER C 3 71 ? -83.179  3.361   -14.725 1.00 1.39 ? 80  SER A OG     2  
ATOM 4878  H H      . SER C 3 71 ? -85.041  5.160   -15.390 1.00 0.81 ? 80  SER A H      2  
ATOM 4879  H HA     . SER C 3 71 ? -85.801  4.180   -12.815 1.00 0.81 ? 80  SER A HA     2  
ATOM 4880  H HB2    . SER C 3 71 ? -84.132  2.396   -13.203 1.00 1.25 ? 80  SER A HB2    2  
ATOM 4881  H HB3    . SER C 3 71 ? -85.116  2.658   -14.639 1.00 1.13 ? 80  SER A HB3    2  
ATOM 4882  H HG     . SER C 3 71 ? -83.236  4.258   -15.060 1.00 1.86 ? 80  SER A HG     2  
ATOM 4883  N N      . ARG C 3 72 ? -82.906  5.698   -12.995 1.00 0.83 ? 81  ARG A N      2  
ATOM 4884  C CA     . ARG C 3 72 ? -81.833  6.284   -12.149 1.00 0.93 ? 81  ARG A CA     2  
ATOM 4885  C C      . ARG C 3 72 ? -82.382  7.440   -11.304 1.00 0.84 ? 81  ARG A C      2  
ATOM 4886  O O      . ARG C 3 72 ? -82.061  7.576   -10.139 1.00 0.87 ? 81  ARG A O      2  
ATOM 4887  C CB     . ARG C 3 72 ? -80.707  6.796   -13.052 1.00 1.06 ? 81  ARG A CB     2  
ATOM 4888  C CG     . ARG C 3 72 ? -79.464  7.148   -12.216 1.00 1.43 ? 81  ARG A CG     2  
ATOM 4889  C CD     . ARG C 3 72 ? -78.879  5.878   -11.566 1.00 2.09 ? 81  ARG A CD     2  
ATOM 4890  N NE     . ARG C 3 72 ? -79.486  5.668   -10.220 1.00 2.90 ? 81  ARG A NE     2  
ATOM 4891  C CZ     . ARG C 3 72 ? -79.474  4.480   -9.682  1.00 3.72 ? 81  ARG A CZ     2  
ATOM 4892  N NH1    . ARG C 3 72 ? -78.930  3.481   -10.324 1.00 3.91 ? 81  ARG A NH1    2  
ATOM 4893  N NH2    . ARG C 3 72 ? -80.015  4.285   -8.510  1.00 4.74 ? 81  ARG A NH2    2  
ATOM 4894  H H      . ARG C 3 72 ? -82.900  5.843   -13.963 1.00 0.83 ? 81  ARG A H      2  
ATOM 4895  H HA     . ARG C 3 72 ? -81.449  5.518   -11.497 1.00 1.02 ? 81  ARG A HA     2  
ATOM 4896  H HB2    . ARG C 3 72 ? -80.452  6.034   -13.773 1.00 1.28 ? 81  ARG A HB2    2  
ATOM 4897  H HB3    . ARG C 3 72 ? -81.047  7.678   -13.572 1.00 1.34 ? 81  ARG A HB3    2  
ATOM 4898  H HG2    . ARG C 3 72 ? -78.718  7.599   -12.858 1.00 1.77 ? 81  ARG A HG2    2  
ATOM 4899  H HG3    . ARG C 3 72 ? -79.740  7.849   -11.444 1.00 1.89 ? 81  ARG A HG3    2  
ATOM 4900  H HD2    . ARG C 3 72 ? -79.081  5.016   -12.198 1.00 2.52 ? 81  ARG A HD2    2  
ATOM 4901  H HD3    . ARG C 3 72 ? -77.817  5.993   -11.445 1.00 2.49 ? 81  ARG A HD3    2  
ATOM 4902  H HE     . ARG C 3 72 ? -79.892  6.421   -9.743  1.00 3.22 ? 81  ARG A HE     2  
ATOM 4903  H HH11   . ARG C 3 72 ? -78.524  3.627   -11.226 1.00 3.50 ? 81  ARG A HH11   2  
ATOM 4904  H HH12   . ARG C 3 72 ? -78.923  2.571   -9.914  1.00 4.74 ? 81  ARG A HH12   2  
ATOM 4905  H HH21   . ARG C 3 72 ? -80.442  5.046   -8.022  1.00 4.98 ? 81  ARG A HH21   2  
ATOM 4906  H HH22   . ARG C 3 72 ? -80.002  3.372   -8.100  1.00 5.47 ? 81  ARG A HH22   2  
ATOM 4907  N N      . GLY C 3 73 ? -83.186  8.292   -11.885 1.00 0.80 ? 82  GLY A N      2  
ATOM 4908  C CA     . GLY C 3 73 ? -83.729  9.458   -11.118 1.00 0.79 ? 82  GLY A CA     2  
ATOM 4909  C C      . GLY C 3 73 ? -85.099  9.137   -10.523 1.00 0.75 ? 82  GLY A C      2  
ATOM 4910  O O      . GLY C 3 73 ? -85.363  9.427   -9.376  1.00 0.80 ? 82  GLY A O      2  
ATOM 4911  H H      . GLY C 3 73 ? -83.419  8.178   -12.830 1.00 0.83 ? 82  GLY A H      2  
ATOM 4912  H HA2    . GLY C 3 73 ? -83.048  9.718   -10.321 1.00 0.85 ? 82  GLY A HA2    2  
ATOM 4913  H HA3    . GLY C 3 73 ? -83.828  10.299  -11.787 1.00 0.81 ? 82  GLY A HA3    2  
ATOM 4914  N N      . LEU C 3 74 ? -85.978  8.565   -11.294 1.00 0.73 ? 83  LEU A N      2  
ATOM 4915  C CA     . LEU C 3 74 ? -87.335  8.259   -10.767 1.00 0.76 ? 83  LEU A CA     2  
ATOM 4916  C C      . LEU C 3 74 ? -87.218  7.311   -9.567  1.00 0.78 ? 83  LEU A C      2  
ATOM 4917  O O      . LEU C 3 74 ? -87.860  7.494   -8.556  1.00 0.80 ? 83  LEU A O      2  
ATOM 4918  C CB     . LEU C 3 74 ? -88.177  7.627   -11.884 1.00 0.82 ? 83  LEU A CB     2  
ATOM 4919  C CG     . LEU C 3 74 ? -89.682  7.897   -11.661 1.00 0.85 ? 83  LEU A CG     2  
ATOM 4920  C CD1    . LEU C 3 74 ? -90.120  7.411   -10.270 1.00 1.57 ? 83  LEU A CD1    2  
ATOM 4921  C CD2    . LEU C 3 74 ? -89.991  9.406   -11.805 1.00 1.39 ? 83  LEU A CD2    2  
ATOM 4922  H H      . LEU C 3 74 ? -85.753  8.352   -12.225 1.00 0.75 ? 83  LEU A H      2  
ATOM 4923  H HA     . LEU C 3 74 ? -87.795  9.175   -10.449 1.00 0.78 ? 83  LEU A HA     2  
ATOM 4924  H HB2    . LEU C 3 74 ? -87.880  8.057   -12.829 1.00 0.94 ? 83  LEU A HB2    2  
ATOM 4925  H HB3    . LEU C 3 74 ? -88.003  6.561   -11.911 1.00 1.02 ? 83  LEU A HB3    2  
ATOM 4926  H HG     . LEU C 3 74 ? -90.241  7.353   -12.408 1.00 1.66 ? 83  LEU A HG     2  
ATOM 4927  H HD11   . LEU C 3 74 ? -89.637  6.473   -10.045 1.00 2.12 ? 83  LEU A HD11   2  
ATOM 4928  H HD12   . LEU C 3 74 ? -89.854  8.146   -9.525  1.00 2.03 ? 83  LEU A HD12   2  
ATOM 4929  H HD13   . LEU C 3 74 ? -91.190  7.273   -10.267 1.00 2.17 ? 83  LEU A HD13   2  
ATOM 4930  H HD21   . LEU C 3 74 ? -89.269  9.875   -12.461 1.00 1.79 ? 83  LEU A HD21   2  
ATOM 4931  H HD22   . LEU C 3 74 ? -90.980  9.525   -12.224 1.00 2.04 ? 83  LEU A HD22   2  
ATOM 4932  H HD23   . LEU C 3 74 ? -89.956  9.886   -10.836 1.00 1.97 ? 83  LEU A HD23   2  
ATOM 4933  N N      . ARG C 3 75 ? -86.402  6.303   -9.658  1.00 0.83 ? 84  ARG A N      2  
ATOM 4934  C CA     . ARG C 3 75 ? -86.275  5.378   -8.502  1.00 0.89 ? 84  ARG A CA     2  
ATOM 4935  C C      . ARG C 3 75 ? -85.795  6.171   -7.285  1.00 0.88 ? 84  ARG A C      2  
ATOM 4936  O O      . ARG C 3 75 ? -86.360  6.091   -6.221  1.00 0.97 ? 84  ARG A O      2  
ATOM 4937  C CB     . ARG C 3 75 ? -85.252  4.280   -8.818  1.00 1.03 ? 84  ARG A CB     2  
ATOM 4938  C CG     . ARG C 3 75 ? -85.194  3.248   -7.657  1.00 1.38 ? 84  ARG A CG     2  
ATOM 4939  C CD     . ARG C 3 75 ? -83.739  2.941   -7.293  1.00 1.27 ? 84  ARG A CD     2  
ATOM 4940  N NE     . ARG C 3 75 ? -83.117  4.161   -6.697  1.00 1.42 ? 84  ARG A NE     2  
ATOM 4941  C CZ     . ARG C 3 75 ? -81.965  4.082   -6.092  1.00 1.55 ? 84  ARG A CZ     2  
ATOM 4942  N NH1    . ARG C 3 75 ? -81.354  2.933   -5.998  1.00 1.74 ? 84  ARG A NH1    2  
ATOM 4943  N NH2    . ARG C 3 75 ? -81.422  5.155   -5.586  1.00 2.34 ? 84  ARG A NH2    2  
ATOM 4944  H H      . ARG C 3 75 ? -85.876  6.158   -10.474 1.00 0.86 ? 84  ARG A H      2  
ATOM 4945  H HA     . ARG C 3 75 ? -87.235  4.930   -8.289  1.00 0.91 ? 84  ARG A HA     2  
ATOM 4946  H HB2    . ARG C 3 75 ? -85.538  3.783   -9.735  1.00 1.12 ? 84  ARG A HB2    2  
ATOM 4947  H HB3    . ARG C 3 75 ? -84.282  4.738   -8.949  1.00 1.54 ? 84  ARG A HB3    2  
ATOM 4948  H HG2    . ARG C 3 75 ? -85.697  3.641   -6.786  1.00 2.07 ? 84  ARG A HG2    2  
ATOM 4949  H HG3    . ARG C 3 75 ? -85.683  2.334   -7.960  1.00 1.84 ? 84  ARG A HG3    2  
ATOM 4950  H HD2    . ARG C 3 75 ? -83.705  2.134   -6.580  1.00 1.63 ? 84  ARG A HD2    2  
ATOM 4951  H HD3    . ARG C 3 75 ? -83.202  2.656   -8.187  1.00 1.85 ? 84  ARG A HD3    2  
ATOM 4952  H HE     . ARG C 3 75 ? -83.576  5.024   -6.762  1.00 2.08 ? 84  ARG A HE     2  
ATOM 4953  H HH11   . ARG C 3 75 ? -81.769  2.113   -6.390  1.00 1.92 ? 84  ARG A HH11   2  
ATOM 4954  H HH12   . ARG C 3 75 ? -80.469  2.873   -5.534  1.00 2.25 ? 84  ARG A HH12   2  
ATOM 4955  H HH21   . ARG C 3 75 ? -81.888  6.037   -5.664  1.00 2.92 ? 84  ARG A HH21   2  
ATOM 4956  H HH22   . ARG C 3 75 ? -80.540  5.097   -5.120  1.00 2.64 ? 84  ARG A HH22   2  
ATOM 4957  N N      . TYR C 3 76 ? -84.760  6.943   -7.432  1.00 0.90 ? 85  TYR A N      2  
ATOM 4958  C CA     . TYR C 3 76 ? -84.258  7.732   -6.272  1.00 0.92 ? 85  TYR A CA     2  
ATOM 4959  C C      . TYR C 3 76 ? -85.218  8.886   -5.970  1.00 0.84 ? 85  TYR A C      2  
ATOM 4960  O O      . TYR C 3 76 ? -85.081  9.579   -4.983  1.00 0.88 ? 85  TYR A O      2  
ATOM 4961  C CB     . TYR C 3 76 ? -82.873  8.296   -6.594  1.00 1.04 ? 85  TYR A CB     2  
ATOM 4962  C CG     . TYR C 3 76 ? -82.349  9.052   -5.396  1.00 1.07 ? 85  TYR A CG     2  
ATOM 4963  C CD1    . TYR C 3 76 ? -82.623  10.417  -5.259  1.00 1.01 ? 85  TYR A CD1    2  
ATOM 4964  C CD2    . TYR C 3 76 ? -81.594  8.389   -4.421  1.00 1.31 ? 85  TYR A CD2    2  
ATOM 4965  C CE1    . TYR C 3 76 ? -82.142  11.122  -4.153  1.00 1.09 ? 85  TYR A CE1    2  
ATOM 4966  C CE2    . TYR C 3 76 ? -81.110  9.096   -3.312  1.00 1.39 ? 85  TYR A CE2    2  
ATOM 4967  C CZ     . TYR C 3 76 ? -81.384  10.462  -3.178  1.00 1.24 ? 85  TYR A CZ     2  
ATOM 4968  O OH     . TYR C 3 76 ? -80.907  11.157  -2.085  1.00 1.36 ? 85  TYR A OH     2  
ATOM 4969  H H      . TYR C 3 76 ? -84.308  7.003   -8.301  1.00 0.98 ? 85  TYR A H      2  
ATOM 4970  H HA     . TYR C 3 76 ? -84.189  7.090   -5.407  1.00 0.97 ? 85  TYR A HA     2  
ATOM 4971  H HB2    . TYR C 3 76 ? -82.199  7.484   -6.833  1.00 1.20 ? 85  TYR A HB2    2  
ATOM 4972  H HB3    . TYR C 3 76 ? -82.940  8.966   -7.438  1.00 1.03 ? 85  TYR A HB3    2  
ATOM 4973  H HD1    . TYR C 3 76 ? -83.210  10.923  -6.008  1.00 1.04 ? 85  TYR A HD1    2  
ATOM 4974  H HD2    . TYR C 3 76 ? -81.382  7.334   -4.526  1.00 1.51 ? 85  TYR A HD2    2  
ATOM 4975  H HE1    . TYR C 3 76 ? -82.354  12.176  -4.049  1.00 1.16 ? 85  TYR A HE1    2  
ATOM 4976  H HE2    . TYR C 3 76 ? -80.527  8.587   -2.561  1.00 1.64 ? 85  TYR A HE2    2  
ATOM 4977  H HH     . TYR C 3 76 ? -81.477  10.962  -1.338  1.00 1.43 ? 85  TYR A HH     2  
ATOM 4978  N N      . TYR C 3 77 ? -86.166  9.124   -6.831  1.00 0.79 ? 86  TYR A N      2  
ATOM 4979  C CA     . TYR C 3 77 ? -87.107  10.264  -6.619  1.00 0.79 ? 86  TYR A CA     2  
ATOM 4980  C C      . TYR C 3 77 ? -88.050  10.031  -5.436  1.00 0.84 ? 86  TYR A C      2  
ATOM 4981  O O      . TYR C 3 77 ? -88.952  10.815  -5.214  1.00 1.27 ? 86  TYR A O      2  
ATOM 4982  C CB     . TYR C 3 77 ? -87.949  10.457  -7.874  1.00 0.76 ? 86  TYR A CB     2  
ATOM 4983  C CG     . TYR C 3 77 ? -88.718  11.739  -7.757  1.00 0.77 ? 86  TYR A CG     2  
ATOM 4984  C CD1    . TYR C 3 77 ? -88.061  12.941  -7.994  1.00 0.82 ? 86  TYR A CD1    2  
ATOM 4985  C CD2    . TYR C 3 77 ? -90.077  11.733  -7.414  1.00 0.82 ? 86  TYR A CD2    2  
ATOM 4986  C CE1    . TYR C 3 77 ? -88.748  14.146  -7.891  1.00 0.87 ? 86  TYR A CE1    2  
ATOM 4987  C CE2    . TYR C 3 77 ? -90.769  12.947  -7.312  1.00 0.87 ? 86  TYR A CE2    2  
ATOM 4988  C CZ     . TYR C 3 77 ? -90.100  14.152  -7.552  1.00 0.89 ? 86  TYR A CZ     2  
ATOM 4989  O OH     . TYR C 3 77 ? -90.771  15.350  -7.445  1.00 0.98 ? 86  TYR A OH     2  
ATOM 4990  H H      . TYR C 3 77 ? -86.243  8.571   -7.637  1.00 0.79 ? 86  TYR A H      2  
ATOM 4991  H HA     . TYR C 3 77 ? -86.539  11.164  -6.441  1.00 0.85 ? 86  TYR A HA     2  
ATOM 4992  H HB2    . TYR C 3 77 ? -87.299  10.518  -8.727  1.00 0.78 ? 86  TYR A HB2    2  
ATOM 4993  H HB3    . TYR C 3 77 ? -88.632  9.631   -7.988  1.00 0.76 ? 86  TYR A HB3    2  
ATOM 4994  H HD1    . TYR C 3 77 ? -87.014  12.938  -8.254  1.00 0.85 ? 86  TYR A HD1    2  
ATOM 4995  H HD2    . TYR C 3 77 ? -90.589  10.798  -7.231  1.00 0.85 ? 86  TYR A HD2    2  
ATOM 4996  H HE1    . TYR C 3 77 ? -88.236  15.072  -8.078  1.00 0.95 ? 86  TYR A HE1    2  
ATOM 4997  H HE2    . TYR C 3 77 ? -91.819  12.955  -7.051  1.00 0.94 ? 86  TYR A HE2    2  
ATOM 4998  H HH     . TYR C 3 77 ? -91.152  15.397  -6.566  1.00 0.66 ? 86  TYR A HH     2  
ATOM 4999  N N      . TYR C 3 78 ? -87.876  8.993   -4.665  1.00 0.84 ? 87  TYR A N      2  
ATOM 5000  C CA     . TYR C 3 78 ? -88.814  8.818   -3.520  1.00 0.91 ? 87  TYR A CA     2  
ATOM 5001  C C      . TYR C 3 78 ? -88.642  10.027  -2.595  1.00 1.01 ? 87  TYR A C      2  
ATOM 5002  O O      . TYR C 3 78 ? -87.723  10.080  -1.805  1.00 1.20 ? 87  TYR A O      2  
ATOM 5003  C CB     . TYR C 3 78 ? -88.490  7.547   -2.728  1.00 1.01 ? 87  TYR A CB     2  
ATOM 5004  C CG     . TYR C 3 78 ? -88.467  6.330   -3.632  1.00 0.90 ? 87  TYR A CG     2  
ATOM 5005  C CD1    . TYR C 3 78 ? -89.600  5.979   -4.377  1.00 1.48 ? 87  TYR A CD1    2  
ATOM 5006  C CD2    . TYR C 3 78 ? -87.307  5.547   -3.717  1.00 1.01 ? 87  TYR A CD2    2  
ATOM 5007  C CE1    . TYR C 3 78 ? -89.570  4.848   -5.205  1.00 1.65 ? 87  TYR A CE1    2  
ATOM 5008  C CE2    . TYR C 3 78 ? -87.279  4.418   -4.541  1.00 1.15 ? 87  TYR A CE2    2  
ATOM 5009  C CZ     . TYR C 3 78 ? -88.408  4.070   -5.287  1.00 1.28 ? 87  TYR A CZ     2  
ATOM 5010  O OH     . TYR C 3 78 ? -88.377  2.959   -6.105  1.00 1.62 ? 87  TYR A OH     2  
ATOM 5011  H H      . TYR C 3 78 ? -87.146  8.358   -4.829  1.00 1.12 ? 87  TYR A H      2  
ATOM 5012  H HA     . TYR C 3 78 ? -89.829  8.776   -3.884  1.00 0.93 ? 87  TYR A HA     2  
ATOM 5013  H HB2    . TYR C 3 78 ? -87.527  7.664   -2.258  1.00 1.13 ? 87  TYR A HB2    2  
ATOM 5014  H HB3    . TYR C 3 78 ? -89.242  7.409   -1.968  1.00 1.32 ? 87  TYR A HB3    2  
ATOM 5015  H HD1    . TYR C 3 78 ? -90.498  6.578   -4.314  1.00 2.02 ? 87  TYR A HD1    2  
ATOM 5016  H HD2    . TYR C 3 78 ? -86.432  5.818   -3.144  1.00 1.47 ? 87  TYR A HD2    2  
ATOM 5017  H HE1    . TYR C 3 78 ? -90.440  4.580   -5.782  1.00 2.28 ? 87  TYR A HE1    2  
ATOM 5018  H HE2    . TYR C 3 78 ? -86.383  3.818   -4.600  1.00 1.59 ? 87  TYR A HE2    2  
ATOM 5019  H HH     . TYR C 3 78 ? -87.597  2.446   -5.882  1.00 2.01 ? 87  TYR A HH     2  
ATOM 5020  N N      . ASP C 3 79 ? -89.493  11.014  -2.698  1.00 1.01 ? 88  ASP A N      2  
ATOM 5021  C CA     . ASP C 3 79 ? -89.338  12.222  -1.827  1.00 1.13 ? 88  ASP A CA     2  
ATOM 5022  C C      . ASP C 3 79 ? -90.056  12.013  -0.493  1.00 1.03 ? 88  ASP A C      2  
ATOM 5023  O O      . ASP C 3 79 ? -89.439  11.746  0.519   1.00 1.14 ? 88  ASP A O      2  
ATOM 5024  C CB     . ASP C 3 79 ? -89.931  13.441  -2.536  1.00 1.30 ? 88  ASP A CB     2  
ATOM 5025  C CG     . ASP C 3 79 ? -89.134  13.726  -3.811  1.00 1.93 ? 88  ASP A CG     2  
ATOM 5026  O OD1    . ASP C 3 79 ? -87.980  13.330  -3.866  1.00 2.30 ? 88  ASP A OD1    2  
ATOM 5027  O OD2    . ASP C 3 79 ? -89.691  14.335  -4.709  1.00 2.74 ? 88  ASP A OD2    2  
ATOM 5028  H H      . ASP C 3 79 ? -90.221  10.969  -3.354  1.00 1.02 ? 88  ASP A H      2  
ATOM 5029  H HA     . ASP C 3 79 ? -88.291  12.399  -1.641  1.00 1.31 ? 88  ASP A HA     2  
ATOM 5030  H HB2    . ASP C 3 79 ? -90.963  13.245  -2.787  1.00 1.70 ? 88  ASP A HB2    2  
ATOM 5031  H HB3    . ASP C 3 79 ? -89.878  14.301  -1.882  1.00 1.42 ? 88  ASP A HB3    2  
ATOM 5032  N N      . LYS C 3 80 ? -91.358  12.144  -0.485  1.00 0.99 ? 89  LYS A N      2  
ATOM 5033  C CA     . LYS C 3 80 ? -92.146  11.968  0.779   1.00 1.08 ? 89  LYS A CA     2  
ATOM 5034  C C      . LYS C 3 80 ? -93.259  10.943  0.536   1.00 1.10 ? 89  LYS A C      2  
ATOM 5035  O O      . LYS C 3 80 ? -93.251  9.859   1.083   1.00 1.59 ? 89  LYS A O      2  
ATOM 5036  C CB     . LYS C 3 80 ? -92.765  13.317  1.169   1.00 1.23 ? 89  LYS A CB     2  
ATOM 5037  C CG     . LYS C 3 80 ? -91.661  14.294  1.624   1.00 1.31 ? 89  LYS A CG     2  
ATOM 5038  C CD     . LYS C 3 80 ? -92.130  15.745  1.421   1.00 1.31 ? 89  LYS A CD     2  
ATOM 5039  C CE     . LYS C 3 80 ? -91.320  16.694  2.307   1.00 1.90 ? 89  LYS A CE     2  
ATOM 5040  N NZ     . LYS C 3 80 ? -89.902  16.698  1.856   1.00 2.52 ? 89  LYS A NZ     2  
ATOM 5041  H H      . LYS C 3 80 ? -91.823  12.369  -1.322  1.00 1.03 ? 89  LYS A H      2  
ATOM 5042  H HA     . LYS C 3 80 ? -91.506  11.618  1.580   1.00 1.16 ? 89  LYS A HA     2  
ATOM 5043  H HB2    . LYS C 3 80 ? -93.283  13.728  0.314   1.00 1.35 ? 89  LYS A HB2    2  
ATOM 5044  H HB3    . LYS C 3 80 ? -93.466  13.171  1.976   1.00 1.62 ? 89  LYS A HB3    2  
ATOM 5045  H HG2    . LYS C 3 80 ? -91.445  14.127  2.669   1.00 1.90 ? 89  LYS A HG2    2  
ATOM 5046  H HG3    . LYS C 3 80 ? -90.764  14.127  1.041   1.00 1.61 ? 89  LYS A HG3    2  
ATOM 5047  H HD2    . LYS C 3 80 ? -91.991  16.026  0.384   1.00 1.79 ? 89  LYS A HD2    2  
ATOM 5048  H HD3    . LYS C 3 80 ? -93.176  15.827  1.677   1.00 1.60 ? 89  LYS A HD3    2  
ATOM 5049  H HE2    . LYS C 3 80 ? -91.726  17.694  2.226   1.00 2.47 ? 89  LYS A HE2    2  
ATOM 5050  H HE3    . LYS C 3 80 ? -91.372  16.368  3.336   1.00 2.29 ? 89  LYS A HE3    2  
ATOM 5051  H HZ1    . LYS C 3 80 ? -89.680  15.785  1.402   1.00 2.97 ? 89  LYS A HZ1    2  
ATOM 5052  H HZ2    . LYS C 3 80 ? -89.756  17.471  1.177   1.00 2.78 ? 89  LYS A HZ2    2  
ATOM 5053  H HZ3    . LYS C 3 80 ? -89.279  16.840  2.675   1.00 3.00 ? 89  LYS A HZ3    2  
ATOM 5054  N N      . ASN C 3 81 ? -94.206  11.279  -0.296  1.00 1.03 ? 90  ASN A N      2  
ATOM 5055  C CA     . ASN C 3 81 ? -95.319  10.329  -0.601  1.00 1.02 ? 90  ASN A CA     2  
ATOM 5056  C C      . ASN C 3 81 ? -95.884  10.649  -1.976  1.00 1.01 ? 90  ASN A C      2  
ATOM 5057  O O      . ASN C 3 81 ? -96.845  11.378  -2.103  1.00 1.12 ? 90  ASN A O      2  
ATOM 5058  C CB     . ASN C 3 81 ? -96.420  10.463  0.450   1.00 1.15 ? 90  ASN A CB     2  
ATOM 5059  C CG     . ASN C 3 81 ? -96.991  11.882  0.442   1.00 1.97 ? 90  ASN A CG     2  
ATOM 5060  O OD1    . ASN C 3 81 ? -96.475  12.761  -0.221  1.00 2.80 ? 90  ASN A OD1    2  
ATOM 5061  N ND2    . ASN C 3 81 ? -98.049  12.138  1.158   1.00 2.45 ? 90  ASN A ND2    2  
ATOM 5062  H H      . ASN C 3 81 ? -94.183  12.156  -0.735  1.00 1.34 ? 90  ASN A H      2  
ATOM 5063  H HA     . ASN C 3 81 ? -94.943  9.320   -0.602  1.00 0.99 ? 90  ASN A HA     2  
ATOM 5064  H HB2    . ASN C 3 81 ? -97.211  9.760   0.231   1.00 1.58 ? 90  ASN A HB2    2  
ATOM 5065  H HB3    . ASN C 3 81 ? -96.012  10.251  1.426   1.00 1.40 ? 90  ASN A HB3    2  
ATOM 5066  H HD21   . ASN C 3 81 ? -98.464  11.426  1.690   1.00 2.39 ? 90  ASN A HD21   2  
ATOM 5067  H HD22   . ASN C 3 81 ? -98.428  13.040  1.168   1.00 3.23 ? 90  ASN A HD22   2  
ATOM 5068  N N      . ILE C 3 82 ? -95.287  10.123  -3.015  1.00 0.95 ? 91  ILE A N      2  
ATOM 5069  C CA     . ILE C 3 82 ? -95.790  10.425  -4.387  1.00 1.00 ? 91  ILE A CA     2  
ATOM 5070  C C      . ILE C 3 82 ? -95.768  9.173   -5.279  1.00 0.94 ? 91  ILE A C      2  
ATOM 5071  O O      . ILE C 3 82 ? -96.656  8.346   -5.215  1.00 1.01 ? 91  ILE A O      2  
ATOM 5072  C CB     . ILE C 3 82 ? -94.924  11.562  -4.964  1.00 1.10 ? 91  ILE A CB     2  
ATOM 5073  C CG1    . ILE C 3 82 ? -95.304  11.859  -6.427  1.00 1.28 ? 91  ILE A CG1    2  
ATOM 5074  C CG2    . ILE C 3 82 ? -93.411  11.219  -4.863  1.00 1.09 ? 91  ILE A CG2    2  
ATOM 5075  C CD1    . ILE C 3 82 ? -96.822  11.899  -6.603  1.00 0.84 ? 91  ILE A CD1    2  
ATOM 5076  H H      . ILE C 3 82 ? -94.505  9.545   -2.894  1.00 0.92 ? 91  ILE A H      2  
ATOM 5077  H HA     . ILE C 3 82 ? -96.808  10.766  -4.316  1.00 1.08 ? 91  ILE A HA     2  
ATOM 5078  H HB     . ILE C 3 82 ? -95.115  12.452  -4.375  1.00 1.17 ? 91  ILE A HB     2  
ATOM 5079  H HG12   . ILE C 3 82 ? -94.897  12.815  -6.693  1.00 1.93 ? 91  ILE A HG12   2  
ATOM 5080  H HG13   . ILE C 3 82 ? -94.887  11.110  -7.076  1.00 1.75 ? 91  ILE A HG13   2  
ATOM 5081  H HG21   . ILE C 3 82 ? -93.280  10.192  -4.556  1.00 1.46 ? 91  ILE A HG21   2  
ATOM 5082  H HG22   . ILE C 3 82 ? -92.932  11.361  -5.820  1.00 1.56 ? 91  ILE A HG22   2  
ATOM 5083  H HG23   . ILE C 3 82 ? -92.938  11.868  -4.135  1.00 1.46 ? 91  ILE A HG23   2  
ATOM 5084  H HD11   . ILE C 3 82 ? -97.264  12.466  -5.797  1.00 1.12 ? 91  ILE A HD11   2  
ATOM 5085  H HD12   . ILE C 3 82 ? -97.055  12.371  -7.544  1.00 1.34 ? 91  ILE A HD12   2  
ATOM 5086  H HD13   . ILE C 3 82 ? -97.215  10.895  -6.597  1.00 1.53 ? 91  ILE A HD13   2  
ATOM 5087  N N      . ILE C 3 83 ? -94.791  9.032   -6.132  1.00 0.89 ? 92  ILE A N      2  
ATOM 5088  C CA     . ILE C 3 83 ? -94.750  7.848   -7.041  1.00 0.84 ? 92  ILE A CA     2  
ATOM 5089  C C      . ILE C 3 83 ? -93.906  6.748   -6.402  1.00 0.81 ? 92  ILE A C      2  
ATOM 5090  O O      . ILE C 3 83 ? -92.750  6.943   -6.083  1.00 0.84 ? 92  ILE A O      2  
ATOM 5091  C CB     . ILE C 3 83 ? -94.181  8.304   -8.398  1.00 0.86 ? 92  ILE A CB     2  
ATOM 5092  C CG1    . ILE C 3 83 ? -94.175  7.146   -9.430  1.00 1.02 ? 92  ILE A CG1    2  
ATOM 5093  C CG2    . ILE C 3 83 ? -92.786  8.898   -8.220  1.00 0.85 ? 92  ILE A CG2    2  
ATOM 5094  C CD1    . ILE C 3 83 ? -93.185  6.024   -9.062  1.00 1.09 ? 92  ILE A CD1    2  
ATOM 5095  H H      . ILE C 3 83 ? -94.096  9.716   -6.189  1.00 0.95 ? 92  ILE A H      2  
ATOM 5096  H HA     . ILE C 3 83 ? -95.747  7.478   -7.192  1.00 0.83 ? 92  ILE A HA     2  
ATOM 5097  H HB     . ILE C 3 83 ? -94.826  9.086   -8.773  1.00 1.07 ? 92  ILE A HB     2  
ATOM 5098  H HG12   . ILE C 3 83 ? -95.167  6.727   -9.490  1.00 1.14 ? 92  ILE A HG12   2  
ATOM 5099  H HG13   . ILE C 3 83 ? -93.907  7.546   -10.399 1.00 1.34 ? 92  ILE A HG13   2  
ATOM 5100  H HG21   . ILE C 3 83 ? -92.806  9.623   -7.419  1.00 1.35 ? 92  ILE A HG21   2  
ATOM 5101  H HG22   . ILE C 3 83 ? -92.085  8.117   -7.983  1.00 1.32 ? 92  ILE A HG22   2  
ATOM 5102  H HG23   . ILE C 3 83 ? -92.487  9.388   -9.135  1.00 1.29 ? 92  ILE A HG23   2  
ATOM 5103  H HD11   . ILE C 3 83 ? -92.380  6.412   -8.462  1.00 1.45 ? 92  ILE A HD11   2  
ATOM 5104  H HD12   . ILE C 3 83 ? -93.706  5.254   -8.512  1.00 1.44 ? 92  ILE A HD12   2  
ATOM 5105  H HD13   . ILE C 3 83 ? -92.782  5.599   -9.971  1.00 1.67 ? 92  ILE A HD13   2  
ATOM 5106  N N      . HIS C 3 84 ? -94.495  5.590   -6.201  1.00 0.83 ? 93  HIS A N      2  
ATOM 5107  C CA     . HIS C 3 84 ? -93.756  4.450   -5.571  1.00 0.85 ? 93  HIS A CA     2  
ATOM 5108  C C      . HIS C 3 84 ? -93.554  3.327   -6.596  1.00 0.85 ? 93  HIS A C      2  
ATOM 5109  O O      . HIS C 3 84 ? -94.324  3.160   -7.520  1.00 0.91 ? 93  HIS A O      2  
ATOM 5110  C CB     . HIS C 3 84 ? -94.561  3.916   -4.381  1.00 0.88 ? 93  HIS A CB     2  
ATOM 5111  C CG     . HIS C 3 84 ? -94.489  4.894   -3.234  1.00 1.01 ? 93  HIS A CG     2  
ATOM 5112  N ND1    . HIS C 3 84 ? -94.052  4.517   -1.971  1.00 1.59 ? 93  HIS A ND1    2  
ATOM 5113  C CD2    . HIS C 3 84 ? -94.781  6.232   -3.145  1.00 1.02 ? 93  HIS A CD2    2  
ATOM 5114  C CE1    . HIS C 3 84 ? -94.091  5.611   -1.186  1.00 1.79 ? 93  HIS A CE1    2  
ATOM 5115  N NE2    . HIS C 3 84 ? -94.528  6.683   -1.850  1.00 1.41 ? 93  HIS A NE2    2  
ATOM 5116  H H      . HIS C 3 84 ? -95.435  5.475   -6.457  1.00 0.89 ? 93  HIS A H      2  
ATOM 5117  H HA     . HIS C 3 84 ? -92.788  4.784   -5.223  1.00 0.88 ? 93  HIS A HA     2  
ATOM 5118  H HB2    . HIS C 3 84 ? -95.591  3.783   -4.673  1.00 0.97 ? 93  HIS A HB2    2  
ATOM 5119  H HB3    . HIS C 3 84 ? -94.150  2.970   -4.068  1.00 0.99 ? 93  HIS A HB3    2  
ATOM 5120  H HD1    . HIS C 3 84 ? -93.774  3.618   -1.700  1.00 1.93 ? 93  HIS A HD1    2  
ATOM 5121  H HD2    . HIS C 3 84 ? -95.149  6.843   -3.954  1.00 1.12 ? 93  HIS A HD2    2  
ATOM 5122  H HE1    . HIS C 3 84 ? -93.802  5.622   -0.144  1.00 2.31 ? 93  HIS A HE1    2  
ATOM 5123  N N      . LYS C 3 85 ? -92.504  2.571   -6.427  1.00 0.92 ? 94  LYS A N      2  
ATOM 5124  C CA     . LYS C 3 85 ? -92.195  1.449   -7.363  1.00 0.96 ? 94  LYS A CA     2  
ATOM 5125  C C      . LYS C 3 85 ? -93.126  0.267   -7.085  1.00 0.95 ? 94  LYS A C      2  
ATOM 5126  O O      . LYS C 3 85 ? -93.421  -0.051  -5.951  1.00 1.10 ? 94  LYS A O      2  
ATOM 5127  C CB     . LYS C 3 85 ? -90.742  1.023   -7.138  1.00 1.20 ? 94  LYS A CB     2  
ATOM 5128  C CG     . LYS C 3 85 ? -90.337  -0.071  -8.128  1.00 1.61 ? 94  LYS A CG     2  
ATOM 5129  C CD     . LYS C 3 85 ? -88.870  -0.439  -7.880  1.00 1.86 ? 94  LYS A CD     2  
ATOM 5130  C CE     . LYS C 3 85 ? -88.434  -1.528  -8.861  1.00 2.16 ? 94  LYS A CE     2  
ATOM 5131  N NZ     . LYS C 3 85 ? -88.759  -1.098  -10.252 1.00 2.83 ? 94  LYS A NZ     2  
ATOM 5132  H H      . LYS C 3 85 ? -91.906  2.744   -5.672  1.00 1.03 ? 94  LYS A H      2  
ATOM 5133  H HA     . LYS C 3 85 ? -92.325  1.779   -8.381  1.00 0.96 ? 94  LYS A HA     2  
ATOM 5134  H HB2    . LYS C 3 85 ? -90.098  1.879   -7.272  1.00 1.72 ? 94  LYS A HB2    2  
ATOM 5135  H HB3    . LYS C 3 85 ? -90.633  0.650   -6.129  1.00 1.74 ? 94  LYS A HB3    2  
ATOM 5136  H HG2    . LYS C 3 85 ? -90.961  -0.941  -7.981  1.00 2.19 ? 94  LYS A HG2    2  
ATOM 5137  H HG3    . LYS C 3 85 ? -90.450  0.291   -9.138  1.00 2.14 ? 94  LYS A HG3    2  
ATOM 5138  H HD2    . LYS C 3 85 ? -88.257  0.439   -8.015  1.00 2.20 ? 94  LYS A HD2    2  
ATOM 5139  H HD3    . LYS C 3 85 ? -88.756  -0.800  -6.869  1.00 2.28 ? 94  LYS A HD3    2  
ATOM 5140  H HE2    . LYS C 3 85 ? -87.368  -1.694  -8.766  1.00 2.48 ? 94  LYS A HE2    2  
ATOM 5141  H HE3    . LYS C 3 85 ? -88.959  -2.444  -8.636  1.00 2.52 ? 94  LYS A HE3    2  
ATOM 5142  H HZ1    . LYS C 3 85 ? -88.918  -0.069  -10.267 1.00 3.29 ? 94  LYS A HZ1    2  
ATOM 5143  H HZ2    . LYS C 3 85 ? -87.970  -1.337  -10.883 1.00 3.25 ? 94  LYS A HZ2    2  
ATOM 5144  H HZ3    . LYS C 3 85 ? -89.618  -1.587  -10.576 1.00 3.11 ? 94  LYS A HZ3    2  
ATOM 5145  N N      . THR C 3 86 ? -93.593  -0.394  -8.115  1.00 0.91 ? 95  THR A N      2  
ATOM 5146  C CA     . THR C 3 86 ? -94.503  -1.561  -7.909  1.00 1.04 ? 95  THR A CA     2  
ATOM 5147  C C      . THR C 3 86 ? -93.653  -2.830  -7.764  1.00 1.20 ? 95  THR A C      2  
ATOM 5148  O O      . THR C 3 86 ? -92.758  -3.083  -8.547  1.00 1.24 ? 95  THR A O      2  
ATOM 5149  C CB     . THR C 3 86 ? -95.440  -1.689  -9.114  1.00 1.05 ? 95  THR A CB     2  
ATOM 5150  O OG1    . THR C 3 86 ? -96.132  -0.461  -9.299  1.00 1.22 ? 95  THR A OG1    2  
ATOM 5151  C CG2    . THR C 3 86 ? -96.455  -2.803  -8.858  1.00 1.21 ? 95  THR A CG2    2  
ATOM 5152  H H      . THR C 3 86 ? -93.342  -0.125  -9.029  1.00 0.87 ? 95  THR A H      2  
ATOM 5153  H HA     . THR C 3 86 ? -95.087  -1.414  -7.011  1.00 1.18 ? 95  THR A HA     2  
ATOM 5154  H HB     . THR C 3 86 ? -94.867  -1.922  -10.000 1.00 1.06 ? 95  THR A HB     2  
ATOM 5155  H HG1    . THR C 3 86 ? -97.035  -0.665  -9.550  1.00 1.56 ? 95  THR A HG1    2  
ATOM 5156  H HG21   . THR C 3 86 ? -96.940  -2.634  -7.908  1.00 1.62 ? 95  THR A HG21   2  
ATOM 5157  H HG22   . THR C 3 86 ? -97.194  -2.801  -9.643  1.00 1.62 ? 95  THR A HG22   2  
ATOM 5158  H HG23   . THR C 3 86 ? -95.950  -3.757  -8.841  1.00 1.57 ? 95  THR A HG23   2  
ATOM 5159  N N      . ALA C 3 87 ? -93.909  -3.614  -6.750  1.00 1.58 ? 96  ALA A N      2  
ATOM 5160  C CA     . ALA C 3 87 ? -93.097  -4.851  -6.534  1.00 1.85 ? 96  ALA A CA     2  
ATOM 5161  C C      . ALA C 3 87 ? -93.513  -5.959  -7.514  1.00 1.77 ? 96  ALA A C      2  
ATOM 5162  O O      . ALA C 3 87 ? -93.206  -7.118  -7.313  1.00 2.10 ? 96  ALA A O      2  
ATOM 5163  C CB     . ALA C 3 87 ? -93.284  -5.341  -5.093  1.00 2.47 ? 96  ALA A CB     2  
ATOM 5164  H H      . ALA C 3 87 ? -94.619  -3.380  -6.116  1.00 1.82 ? 96  ALA A H      2  
ATOM 5165  H HA     . ALA C 3 87 ? -92.055  -4.619  -6.694  1.00 1.89 ? 96  ALA A HA     2  
ATOM 5166  H HB1    . ALA C 3 87 ? -93.136  -4.516  -4.411  1.00 2.84 ? 96  ALA A HB1    2  
ATOM 5167  H HB2    . ALA C 3 87 ? -94.284  -5.735  -4.969  1.00 2.87 ? 96  ALA A HB2    2  
ATOM 5168  H HB3    . ALA C 3 87 ? -92.564  -6.118  -4.878  1.00 2.72 ? 96  ALA A HB3    2  
ATOM 5169  N N      . GLY C 3 88 ? -94.200  -5.623  -8.574  1.00 1.65 ? 97  GLY A N      2  
ATOM 5170  C CA     . GLY C 3 88 ? -94.615  -6.675  -9.559  1.00 1.96 ? 97  GLY A CA     2  
ATOM 5171  C C      . GLY C 3 88 ? -93.459  -6.963  -10.530 1.00 1.94 ? 97  GLY A C      2  
ATOM 5172  O O      . GLY C 3 88 ? -92.571  -7.737  -10.239 1.00 2.32 ? 97  GLY A O      2  
ATOM 5173  H H      . GLY C 3 88 ? -94.437  -4.686  -8.729  1.00 1.59 ? 97  GLY A H      2  
ATOM 5174  H HA2    . GLY C 3 88 ? -94.876  -7.583  -9.030  1.00 2.24 ? 97  GLY A HA2    2  
ATOM 5175  H HA3    . GLY C 3 88 ? -95.471  -6.328  -10.115 1.00 2.17 ? 97  GLY A HA3    2  
ATOM 5176  N N      . LYS C 3 89 ? -93.471  -6.340  -11.683 1.00 1.64 ? 98  LYS A N      2  
ATOM 5177  C CA     . LYS C 3 89 ? -92.379  -6.554  -12.692 1.00 1.72 ? 98  LYS A CA     2  
ATOM 5178  C C      . LYS C 3 89 ? -91.460  -5.324  -12.697 1.00 1.44 ? 98  LYS A C      2  
ATOM 5179  O O      . LYS C 3 89 ? -91.633  -4.403  -11.923 1.00 1.85 ? 98  LYS A O      2  
ATOM 5180  C CB     . LYS C 3 89 ? -92.977  -6.730  -14.097 1.00 2.09 ? 98  LYS A CB     2  
ATOM 5181  C CG     . LYS C 3 89 ? -94.001  -7.874  -14.107 1.00 2.01 ? 98  LYS A CG     2  
ATOM 5182  C CD     . LYS C 3 89 ? -93.343  -9.198  -13.690 1.00 2.78 ? 98  LYS A CD     2  
ATOM 5183  C CE     . LYS C 3 89 ? -94.224  -10.370 -14.143 1.00 3.22 ? 98  LYS A CE     2  
ATOM 5184  N NZ     . LYS C 3 89 ? -93.686  -11.646 -13.591 1.00 3.60 ? 98  LYS A NZ     2  
ATOM 5185  H H      . LYS C 3 89 ? -94.204  -5.724  -11.887 1.00 1.50 ? 98  LYS A H      2  
ATOM 5186  H HA     . LYS C 3 89 ? -91.798  -7.428  -12.434 1.00 2.08 ? 98  LYS A HA     2  
ATOM 5187  H HB2    . LYS C 3 89 ? -93.465  -5.816  -14.398 1.00 2.74 ? 98  LYS A HB2    2  
ATOM 5188  H HB3    . LYS C 3 89 ? -92.186  -6.956  -14.795 1.00 2.38 ? 98  LYS A HB3    2  
ATOM 5189  H HG2    . LYS C 3 89 ? -94.801  -7.639  -13.422 1.00 2.19 ? 98  LYS A HG2    2  
ATOM 5190  H HG3    . LYS C 3 89 ? -94.404  -7.976  -15.105 1.00 2.14 ? 98  LYS A HG3    2  
ATOM 5191  H HD2    . LYS C 3 89 ? -92.368  -9.280  -14.148 1.00 3.13 ? 98  LYS A HD2    2  
ATOM 5192  H HD3    . LYS C 3 89 ? -93.242  -9.227  -12.615 1.00 3.29 ? 98  LYS A HD3    2  
ATOM 5193  H HE2    . LYS C 3 89 ? -95.231  -10.220 -13.786 1.00 3.55 ? 98  LYS A HE2    2  
ATOM 5194  H HE3    . LYS C 3 89 ? -94.230  -10.421 -15.222 1.00 3.59 ? 98  LYS A HE3    2  
ATOM 5195  H HZ1    . LYS C 3 89 ? -93.572  -11.558 -12.561 1.00 3.82 ? 98  LYS A HZ1    2  
ATOM 5196  H HZ2    . LYS C 3 89 ? -94.349  -12.422 -13.802 1.00 3.99 ? 98  LYS A HZ2    2  
ATOM 5197  H HZ3    . LYS C 3 89 ? -92.763  -11.850 -14.024 1.00 3.80 ? 98  LYS A HZ3    2  
ATOM 5198  N N      . ARG C 3 90 ? -90.473  -5.308  -13.551 1.00 1.21 ? 99  ARG A N      2  
ATOM 5199  C CA     . ARG C 3 90 ? -89.536  -4.146  -13.589 1.00 1.48 ? 99  ARG A CA     2  
ATOM 5200  C C      . ARG C 3 90 ? -90.133  -2.986  -14.404 1.00 1.11 ? 99  ARG A C      2  
ATOM 5201  O O      . ARG C 3 90 ? -89.615  -1.884  -14.389 1.00 1.22 ? 99  ARG A O      2  
ATOM 5202  C CB     . ARG C 3 90 ? -88.229  -4.578  -14.257 1.00 2.00 ? 99  ARG A CB     2  
ATOM 5203  C CG     . ARG C 3 90 ? -87.611  -5.755  -13.493 1.00 2.76 ? 99  ARG A CG     2  
ATOM 5204  C CD     . ARG C 3 90 ? -86.234  -6.081  -14.089 1.00 3.58 ? 99  ARG A CD     2  
ATOM 5205  N NE     . ARG C 3 90 ? -85.664  -7.282  -13.408 1.00 4.24 ? 99  ARG A NE     2  
ATOM 5206  C CZ     . ARG C 3 90 ? -84.616  -7.885  -13.910 1.00 4.91 ? 99  ARG A CZ     2  
ATOM 5207  N NH1    . ARG C 3 90 ? -84.039  -7.409  -14.980 1.00 5.13 ? 99  ARG A NH1    2  
ATOM 5208  N NH2    . ARG C 3 90 ? -84.134  -8.954  -13.332 1.00 5.66 ? 99  ARG A NH2    2  
ATOM 5209  H H      . ARG C 3 90 ? -90.336  -6.065  -14.159 1.00 1.29 ? 99  ARG A H      2  
ATOM 5210  H HA     . ARG C 3 90 ? -89.331  -3.814  -12.585 1.00 2.02 ? 99  ARG A HA     2  
ATOM 5211  H HB2    . ARG C 3 90 ? -88.429  -4.874  -15.275 1.00 2.35 ? 99  ARG A HB2    2  
ATOM 5212  H HB3    . ARG C 3 90 ? -87.537  -3.750  -14.256 1.00 2.27 ? 99  ARG A HB3    2  
ATOM 5213  H HG2    . ARG C 3 90 ? -87.502  -5.494  -12.449 1.00 3.10 ? 99  ARG A HG2    2  
ATOM 5214  H HG3    . ARG C 3 90 ? -88.253  -6.618  -13.583 1.00 3.02 ? 99  ARG A HG3    2  
ATOM 5215  H HD2    . ARG C 3 90 ? -86.335  -6.286  -15.142 1.00 3.70 ? 99  ARG A HD2    2  
ATOM 5216  H HD3    . ARG C 3 90 ? -85.575  -5.233  -13.952 1.00 4.02 ? 99  ARG A HD3    2  
ATOM 5217  H HE     . ARG C 3 90 ? -86.079  -7.625  -12.588 1.00 4.43 ? 99  ARG A HE     2  
ATOM 5218  H HH11   . ARG C 3 90 ? -84.396  -6.581  -15.414 1.00 4.79 ? 99  ARG A HH11   2  
ATOM 5219  H HH12   . ARG C 3 90 ? -83.240  -7.871  -15.366 1.00 5.82 ? 99  ARG A HH12   2  
ATOM 5220  H HH21   . ARG C 3 90 ? -84.564  -9.312  -12.504 1.00 5.80 ? 99  ARG A HH21   2  
ATOM 5221  H HH22   . ARG C 3 90 ? -83.336  -9.416  -13.721 1.00 6.26 ? 99  ARG A HH22   2  
ATOM 5222  N N      . TYR C 3 91 ? -91.194  -3.225  -15.138 1.00 0.92 ? 100 TYR A N      2  
ATOM 5223  C CA     . TYR C 3 91 ? -91.801  -2.139  -15.982 1.00 0.77 ? 100 TYR A CA     2  
ATOM 5224  C C      . TYR C 3 91 ? -93.101  -1.612  -15.351 1.00 0.76 ? 100 TYR A C      2  
ATOM 5225  O O      . TYR C 3 91 ? -93.797  -0.812  -15.946 1.00 0.77 ? 100 TYR A O      2  
ATOM 5226  C CB     . TYR C 3 91 ? -92.136  -2.720  -17.361 1.00 0.94 ? 100 TYR A CB     2  
ATOM 5227  C CG     . TYR C 3 91 ? -90.880  -3.251  -18.016 1.00 0.87 ? 100 TYR A CG     2  
ATOM 5228  C CD1    . TYR C 3 91 ? -89.970  -2.368  -18.606 1.00 0.87 ? 100 TYR A CD1    2  
ATOM 5229  C CD2    . TYR C 3 91 ? -90.628  -4.631  -18.029 1.00 1.18 ? 100 TYR A CD2    2  
ATOM 5230  C CE1    . TYR C 3 91 ? -88.807  -2.862  -19.209 1.00 0.87 ? 100 TYR A CE1    2  
ATOM 5231  C CE2    . TYR C 3 91 ? -89.466  -5.123  -18.632 1.00 1.27 ? 100 TYR A CE2    2  
ATOM 5232  C CZ     . TYR C 3 91 ? -88.554  -4.238  -19.223 1.00 1.00 ? 100 TYR A CZ     2  
ATOM 5233  O OH     . TYR C 3 91 ? -87.408  -4.721  -19.817 1.00 1.16 ? 100 TYR A OH     2  
ATOM 5234  H H      . TYR C 3 91 ? -91.580  -4.124  -15.152 1.00 1.08 ? 100 TYR A H      2  
ATOM 5235  H HA     . TYR C 3 91 ? -91.099  -1.322  -16.103 1.00 0.82 ? 100 TYR A HA     2  
ATOM 5236  H HB2    . TYR C 3 91 ? -92.850  -3.522  -17.249 1.00 1.17 ? 100 TYR A HB2    2  
ATOM 5237  H HB3    . TYR C 3 91 ? -92.563  -1.945  -17.984 1.00 1.13 ? 100 TYR A HB3    2  
ATOM 5238  H HD1    . TYR C 3 91 ? -90.161  -1.308  -18.597 1.00 1.11 ? 100 TYR A HD1    2  
ATOM 5239  H HD2    . TYR C 3 91 ? -91.331  -5.313  -17.575 1.00 1.48 ? 100 TYR A HD2    2  
ATOM 5240  H HE1    . TYR C 3 91 ? -88.105  -2.181  -19.665 1.00 1.04 ? 100 TYR A HE1    2  
ATOM 5241  H HE2    . TYR C 3 91 ? -89.273  -6.184  -18.642 1.00 1.66 ? 100 TYR A HE2    2  
ATOM 5242  H HH     . TYR C 3 91 ? -87.085  -4.052  -20.427 1.00 1.55 ? 100 TYR A HH     2  
ATOM 5243  N N      . VAL C 3 92 ? -93.456  -2.069  -14.176 1.00 0.77 ? 101 VAL A N      2  
ATOM 5244  C CA     . VAL C 3 92 ? -94.740  -1.606  -13.545 1.00 0.79 ? 101 VAL A CA     2  
ATOM 5245  C C      . VAL C 3 92 ? -94.509  -0.430  -12.584 1.00 0.73 ? 101 VAL A C      2  
ATOM 5246  O O      . VAL C 3 92 ? -93.813  -0.532  -11.589 1.00 0.76 ? 101 VAL A O      2  
ATOM 5247  C CB     . VAL C 3 92 ? -95.376  -2.775  -12.778 1.00 0.90 ? 101 VAL A CB     2  
ATOM 5248  C CG1    . VAL C 3 92 ? -96.102  -3.710  -13.762 1.00 1.07 ? 101 VAL A CG1    2  
ATOM 5249  C CG2    . VAL C 3 92 ? -94.272  -3.553  -12.054 1.00 1.14 ? 101 VAL A CG2    2  
ATOM 5250  H H      . VAL C 3 92 ? -92.895  -2.730  -13.721 1.00 0.80 ? 101 VAL A H      2  
ATOM 5251  H HA     . VAL C 3 92 ? -95.426  -1.284  -14.320 1.00 0.79 ? 101 VAL A HA     2  
ATOM 5252  H HB     . VAL C 3 92 ? -96.086  -2.397  -12.056 1.00 1.17 ? 101 VAL A HB     2  
ATOM 5253  H HG11   . VAL C 3 92 ? -95.434  -3.978  -14.567 1.00 1.49 ? 101 VAL A HG11   2  
ATOM 5254  H HG12   . VAL C 3 92 ? -96.419  -4.604  -13.243 1.00 1.48 ? 101 VAL A HG12   2  
ATOM 5255  H HG13   . VAL C 3 92 ? -96.965  -3.204  -14.166 1.00 1.63 ? 101 VAL A HG13   2  
ATOM 5256  H HG21   . VAL C 3 92 ? -93.526  -2.867  -11.672 1.00 1.63 ? 101 VAL A HG21   2  
ATOM 5257  H HG22   . VAL C 3 92 ? -94.700  -4.110  -11.234 1.00 1.56 ? 101 VAL A HG22   2  
ATOM 5258  H HG23   . VAL C 3 92 ? -93.808  -4.233  -12.747 1.00 1.56 ? 101 VAL A HG23   2  
ATOM 5259  N N      . TYR C 3 93 ? -95.136  0.680   -12.879 1.00 0.69 ? 102 TYR A N      2  
ATOM 5260  C CA     . TYR C 3 93 ? -95.029  1.894   -12.019 1.00 0.67 ? 102 TYR A CA     2  
ATOM 5261  C C      . TYR C 3 93 ? -96.368  2.111   -11.311 1.00 0.68 ? 102 TYR A C      2  
ATOM 5262  O O      . TYR C 3 93 ? -97.395  1.643   -11.759 1.00 0.73 ? 102 TYR A O      2  
ATOM 5263  C CB     . TYR C 3 93 ? -94.721  3.099   -12.918 1.00 0.69 ? 102 TYR A CB     2  
ATOM 5264  C CG     . TYR C 3 93 ? -93.243  3.128   -13.238 1.00 0.76 ? 102 TYR A CG     2  
ATOM 5265  C CD1    . TYR C 3 93 ? -92.659  2.083   -13.959 1.00 0.84 ? 102 TYR A CD1    2  
ATOM 5266  C CD2    . TYR C 3 93 ? -92.461  4.203   -12.802 1.00 1.09 ? 102 TYR A CD2    2  
ATOM 5267  C CE1    . TYR C 3 93 ? -91.287  2.111   -14.243 1.00 0.91 ? 102 TYR A CE1    2  
ATOM 5268  C CE2    . TYR C 3 93 ? -91.095  4.233   -13.088 1.00 1.23 ? 102 TYR A CE2    2  
ATOM 5269  C CZ     . TYR C 3 93 ? -90.506  3.188   -13.806 1.00 1.01 ? 102 TYR A CZ     2  
ATOM 5270  O OH     . TYR C 3 93 ? -89.154  3.215   -14.086 1.00 1.16 ? 102 TYR A OH     2  
ATOM 5271  H H      . TYR C 3 93 ? -95.705  0.710   -13.675 1.00 0.71 ? 102 TYR A H      2  
ATOM 5272  H HA     . TYR C 3 93 ? -94.242  1.769   -11.285 1.00 0.70 ? 102 TYR A HA     2  
ATOM 5273  H HB2    . TYR C 3 93 ? -95.284  3.004   -13.837 1.00 0.71 ? 102 TYR A HB2    2  
ATOM 5274  H HB3    . TYR C 3 93 ? -95.007  4.012   -12.417 1.00 0.71 ? 102 TYR A HB3    2  
ATOM 5275  H HD1    . TYR C 3 93 ? -93.264  1.252   -14.296 1.00 1.08 ? 102 TYR A HD1    2  
ATOM 5276  H HD2    . TYR C 3 93 ? -92.915  5.012   -12.252 1.00 1.37 ? 102 TYR A HD2    2  
ATOM 5277  H HE1    . TYR C 3 93 ? -90.831  1.303   -14.802 1.00 1.11 ? 102 TYR A HE1    2  
ATOM 5278  H HE2    . TYR C 3 93 ? -90.496  5.060   -12.752 1.00 1.60 ? 102 TYR A HE2    2  
ATOM 5279  H HH     . TYR C 3 93 ? -88.677  3.140   -13.256 1.00 1.41 ? 102 TYR A HH     2  
ATOM 5280  N N      . ARG C 3 94 ? -96.378  2.820   -10.213 1.00 0.68 ? 103 ARG A N      2  
ATOM 5281  C CA     . ARG C 3 94 ? -97.669  3.056   -9.504  1.00 0.73 ? 103 ARG A CA     2  
ATOM 5282  C C      . ARG C 3 94 ? -97.585  4.342   -8.696  1.00 0.74 ? 103 ARG A C      2  
ATOM 5283  O O      . ARG C 3 94 ? -96.514  4.814   -8.365  1.00 0.75 ? 103 ARG A O      2  
ATOM 5284  C CB     . ARG C 3 94 ? -97.985  1.881   -8.576  1.00 0.80 ? 103 ARG A CB     2  
ATOM 5285  C CG     . ARG C 3 94 ? -99.356  2.106   -7.922  1.00 1.30 ? 103 ARG A CG     2  
ATOM 5286  C CD     . ARG C 3 94 ? -99.897  0.779   -7.376  1.00 1.34 ? 103 ARG A CD     2  
ATOM 5287  N NE     . ARG C 3 94 ? -101.246 1.004   -6.778  1.00 1.78 ? 103 ARG A NE     2  
ATOM 5288  C CZ     . ARG C 3 94 ? -102.049 -0.005  -6.543  1.00 2.11 ? 103 ARG A CZ     2  
ATOM 5289  N NH1    . ARG C 3 94 ? -101.670 -1.230  -6.795  1.00 2.17 ? 103 ARG A NH1    2  
ATOM 5290  N NH2    . ARG C 3 94 ? -103.233 0.216   -6.040  1.00 2.90 ? 103 ARG A NH2    2  
ATOM 5291  H H      . ARG C 3 94 ? -95.541  3.203   -9.862  1.00 0.66 ? 103 ARG A H      2  
ATOM 5292  H HA     . ARG C 3 94 ? -98.461  3.157   -10.232 1.00 0.76 ? 103 ARG A HA     2  
ATOM 5293  H HB2    . ARG C 3 94 ? -98.000  0.967   -9.151  1.00 1.08 ? 103 ARG A HB2    2  
ATOM 5294  H HB3    . ARG C 3 94 ? -97.229  1.813   -7.809  1.00 1.12 ? 103 ARG A HB3    2  
ATOM 5295  H HG2    . ARG C 3 94 ? -99.253  2.814   -7.114  1.00 1.92 ? 103 ARG A HG2    2  
ATOM 5296  H HG3    . ARG C 3 94 ? -100.048 2.496   -8.655  1.00 1.77 ? 103 ARG A HG3    2  
ATOM 5297  H HD2    . ARG C 3 94 ? -99.971  0.065   -8.184  1.00 1.66 ? 103 ARG A HD2    2  
ATOM 5298  H HD3    . ARG C 3 94 ? -99.229  0.401   -6.618  1.00 1.81 ? 103 ARG A HD3    2  
ATOM 5299  H HE     . ARG C 3 94 ? -101.538 1.916   -6.567  1.00 2.29 ? 103 ARG A HE     2  
ATOM 5300  H HH11   . ARG C 3 94 ? -100.762 -1.408  -7.167  1.00 2.12 ? 103 ARG A HH11   2  
ATOM 5301  H HH12   . ARG C 3 94 ? -102.295 -1.993  -6.612  1.00 2.68 ? 103 ARG A HH12   2  
ATOM 5302  H HH21   . ARG C 3 94 ? -103.521 1.151   -5.833  1.00 3.34 ? 103 ARG A HH21   2  
ATOM 5303  H HH22   . ARG C 3 94 ? -103.853 -0.549  -5.863  1.00 3.25 ? 103 ARG A HH22   2  
ATOM 5304  N N      . PHE C 3 95 ? -98.716  4.924   -8.391  1.00 0.82 ? 104 PHE A N      2  
ATOM 5305  C CA     . PHE C 3 95 ? -98.734  6.202   -7.620  1.00 0.85 ? 104 PHE A CA     2  
ATOM 5306  C C      . PHE C 3 95 ? -99.607  6.044   -6.376  1.00 0.96 ? 104 PHE A C      2  
ATOM 5307  O O      . PHE C 3 95 ? -100.568 5.300   -6.368  1.00 1.16 ? 104 PHE A O      2  
ATOM 5308  C CB     . PHE C 3 95 ? -99.288  7.290   -8.533  1.00 0.89 ? 104 PHE A CB     2  
ATOM 5309  C CG     . PHE C 3 95 ? -98.428  7.337   -9.776  1.00 0.87 ? 104 PHE A CG     2  
ATOM 5310  C CD1    . PHE C 3 95 ? -98.688  6.460   -10.838 1.00 0.88 ? 104 PHE A CD1    2  
ATOM 5311  C CD2    . PHE C 3 95 ? -97.373  8.252   -9.869  1.00 0.97 ? 104 PHE A CD2    2  
ATOM 5312  C CE1    . PHE C 3 95 ? -97.895  6.496   -11.990 1.00 0.97 ? 104 PHE A CE1    2  
ATOM 5313  C CE2    . PHE C 3 95 ? -96.580  8.289   -11.024 1.00 1.07 ? 104 PHE A CE2    2  
ATOM 5314  C CZ     . PHE C 3 95 ? -96.842  7.412   -12.084 1.00 1.06 ? 104 PHE A CZ     2  
ATOM 5315  H H      . PHE C 3 95 ? -99.559  4.524   -8.689  1.00 0.88 ? 104 PHE A H      2  
ATOM 5316  H HA     . PHE C 3 95 ? -97.741  6.465   -7.312  1.00 0.82 ? 104 PHE A HA     2  
ATOM 5317  H HB2    . PHE C 3 95 ? -100.308 7.056   -8.801  1.00 0.95 ? 104 PHE A HB2    2  
ATOM 5318  H HB3    . PHE C 3 95 ? -99.249  8.244   -8.030  1.00 0.95 ? 104 PHE A HB3    2  
ATOM 5319  H HD1    . PHE C 3 95 ? -99.497  5.753   -10.766 1.00 0.90 ? 104 PHE A HD1    2  
ATOM 5320  H HD2    . PHE C 3 95 ? -97.166  8.929   -9.051  1.00 1.04 ? 104 PHE A HD2    2  
ATOM 5321  H HE1    . PHE C 3 95 ? -98.095  5.819   -12.807 1.00 1.05 ? 104 PHE A HE1    2  
ATOM 5322  H HE2    . PHE C 3 95 ? -95.767  8.990   -11.096 1.00 1.21 ? 104 PHE A HE2    2  
ATOM 5323  H HZ     . PHE C 3 95 ? -96.233  7.442   -12.974 1.00 1.18 ? 104 PHE A HZ     2  
ATOM 5324  N N      . VAL C 3 96 ? -99.257  6.731   -5.315  1.00 0.95 ? 105 VAL A N      2  
ATOM 5325  C CA     . VAL C 3 96 ? -100.027 6.625   -4.038  1.00 1.08 ? 105 VAL A CA     2  
ATOM 5326  C C      . VAL C 3 96 ? -100.704 7.967   -3.727  1.00 1.23 ? 105 VAL A C      2  
ATOM 5327  O O      . VAL C 3 96 ? -101.529 7.996   -2.828  1.00 1.69 ? 105 VAL A O      2  
ATOM 5328  C CB     . VAL C 3 96 ? -99.043  6.246   -2.919  1.00 1.25 ? 105 VAL A CB     2  
ATOM 5329  C CG1    . VAL C 3 96 ? -98.230  7.472   -2.473  1.00 1.20 ? 105 VAL A CG1    2  
ATOM 5330  C CG2    . VAL C 3 96 ? -99.812  5.680   -1.727  1.00 1.98 ? 105 VAL A CG2    2  
ATOM 5331  O OXT    . VAL C 3 96 ? -100.387 8.939   -4.392  1.00 1.75 ? 105 VAL A OXT    2  
ATOM 5332  H H      . VAL C 3 96 ? -98.467  7.308   -5.354  1.00 0.95 ? 105 VAL A H      2  
ATOM 5333  H HA     . VAL C 3 96 ? -100.783 5.857   -4.123  1.00 1.15 ? 105 VAL A HA     2  
ATOM 5334  H HB     . VAL C 3 96 ? -98.363  5.493   -3.293  1.00 1.77 ? 105 VAL A HB     2  
ATOM 5335  H HG11   . VAL C 3 96 ? -97.977  8.070   -3.333  1.00 1.68 ? 105 VAL A HG11   2  
ATOM 5336  H HG12   . VAL C 3 96 ? -98.816  8.065   -1.786  1.00 1.63 ? 105 VAL A HG12   2  
ATOM 5337  H HG13   . VAL C 3 96 ? -97.325  7.143   -1.986  1.00 1.63 ? 105 VAL A HG13   2  
ATOM 5338  H HG21   . VAL C 3 96 ? -100.550 6.397   -1.404  1.00 2.56 ? 105 VAL A HG21   2  
ATOM 5339  H HG22   . VAL C 3 96 ? -100.302 4.765   -2.022  1.00 2.44 ? 105 VAL A HG22   2  
ATOM 5340  H HG23   . VAL C 3 96 ? -99.125  5.479   -0.919  1.00 2.31 ? 105 VAL A HG23   2  
ATOM 5341  O "O5'"  . DT  A 1 1  ? -70.277  -19.797 -20.850 1.00 1.83 ? 1   DT  B "O5'"  3  
ATOM 5342  C "C5'"  . DT  A 1 1  ? -69.649  -20.131 -22.089 1.00 1.89 ? 1   DT  B "C5'"  3  
ATOM 5343  C "C4'"  . DT  A 1 1  ? -70.111  -19.211 -23.223 1.00 1.80 ? 1   DT  B "C4'"  3  
ATOM 5344  O "O4'"  . DT  A 1 1  ? -71.442  -19.588 -23.652 1.00 1.79 ? 1   DT  B "O4'"  3  
ATOM 5345  C "C3'"  . DT  A 1 1  ? -70.152  -17.740 -22.790 1.00 1.66 ? 1   DT  B "C3'"  3  
ATOM 5346  O "O3'"  . DT  A 1 1  ? -69.429  -16.915 -23.708 1.00 1.67 ? 1   DT  B "O3'"  3  
ATOM 5347  C "C2'"  . DT  A 1 1  ? -71.615  -17.360 -22.792 1.00 1.56 ? 1   DT  B "C2'"  3  
ATOM 5348  C "C1'"  . DT  A 1 1  ? -72.375  -18.504 -23.449 1.00 1.64 ? 1   DT  B "C1'"  3  
ATOM 5349  N N1     . DT  A 1 1  ? -73.502  -18.932 -22.578 1.00 1.61 ? 1   DT  B N1     3  
ATOM 5350  C C2     . DT  A 1 1  ? -74.803  -18.686 -23.002 1.00 1.58 ? 1   DT  B C2     3  
ATOM 5351  O O2     . DT  A 1 1  ? -75.048  -18.129 -24.070 1.00 1.58 ? 1   DT  B O2     3  
ATOM 5352  N N3     . DT  A 1 1  ? -75.807  -19.096 -22.147 1.00 1.57 ? 1   DT  B N3     3  
ATOM 5353  C C4     . DT  A 1 1  ? -75.634  -19.720 -20.925 1.00 1.61 ? 1   DT  B C4     3  
ATOM 5354  O O4     . DT  A 1 1  ? -76.603  -20.051 -20.247 1.00 1.63 ? 1   DT  B O4     3  
ATOM 5355  C C5     . DT  A 1 1  ? -74.249  -19.934 -20.564 1.00 1.64 ? 1   DT  B C5     3  
ATOM 5356  C C7     . DT  A 1 1  ? -73.909  -20.598 -19.230 1.00 1.70 ? 1   DT  B C7     3  
ATOM 5357  C C6     . DT  A 1 1  ? -73.250  -19.544 -21.382 1.00 1.64 ? 1   DT  B C6     3  
ATOM 5358  H "H5'"  . DT  A 1 1  ? -69.895  -21.161 -22.343 1.00 2.00 ? 1   DT  B "H5'"  3  
ATOM 5359  H "H5''" . DT  A 1 1  ? -68.569  -20.043 -21.978 1.00 1.93 ? 1   DT  B "H5''" 3  
ATOM 5360  H "H4'"  . DT  A 1 1  ? -69.424  -19.314 -24.065 1.00 1.87 ? 1   DT  B "H4'"  3  
ATOM 5361  H "H3'"  . DT  A 1 1  ? -69.734  -17.616 -21.787 1.00 1.66 ? 1   DT  B "H3'"  3  
ATOM 5362  H "H2'"  . DT  A 1 1  ? -71.971  -17.225 -21.767 1.00 1.50 ? 1   DT  B "H2'"  3  
ATOM 5363  H "H2''" . DT  A 1 1  ? -71.756  -16.441 -23.357 1.00 1.50 ? 1   DT  B "H2''" 3  
ATOM 5364  H "H1'"  . DT  A 1 1  ? -72.754  -18.179 -24.423 1.00 1.64 ? 1   DT  B "H1'"  3  
ATOM 5365  H H3     . DT  A 1 1  ? -76.759  -18.919 -22.439 1.00 1.57 ? 1   DT  B H3     3  
ATOM 5366  H H71    . DT  A 1 1  ? -73.321  -19.908 -18.623 1.00 1.80 ? 1   DT  B H71    3  
ATOM 5367  H H72    . DT  A 1 1  ? -73.329  -21.504 -19.411 1.00 2.13 ? 1   DT  B H72    3  
ATOM 5368  H H73    . DT  A 1 1  ? -74.827  -20.855 -18.699 1.00 2.05 ? 1   DT  B H73    3  
ATOM 5369  H H6     . DT  A 1 1  ? -72.216  -19.718 -21.085 1.00 1.68 ? 1   DT  B H6     3  
ATOM 5370  H "HO5'" . DT  A 1 1  ? -70.074  -20.502 -20.228 1.00 1.92 ? 1   DT  B "HO5'" 3  
ATOM 5371  P P      . DC  A 1 2  ? -69.287  -15.330 -23.435 1.00 1.58 ? 2   DC  B P      3  
ATOM 5372  O OP1    . DC  A 1 2  ? -68.300  -14.780 -24.393 1.00 1.68 ? 2   DC  B OP1    3  
ATOM 5373  O OP2    . DC  A 1 2  ? -69.096  -15.128 -21.982 1.00 1.55 ? 2   DC  B OP2    3  
ATOM 5374  O "O5'"  . DC  A 1 2  ? -70.743  -14.774 -23.837 1.00 1.47 ? 2   DC  B "O5'"  3  
ATOM 5375  C "C5'"  . DC  A 1 2  ? -71.129  -14.686 -25.214 1.00 1.50 ? 2   DC  B "C5'"  3  
ATOM 5376  C "C4'"  . DC  A 1 2  ? -72.226  -13.638 -25.440 1.00 1.41 ? 2   DC  B "C4'"  3  
ATOM 5377  O "O4'"  . DC  A 1 2  ? -73.504  -14.191 -25.056 1.00 1.38 ? 2   DC  B "O4'"  3  
ATOM 5378  C "C3'"  . DC  A 1 2  ? -71.995  -12.360 -24.618 1.00 1.31 ? 2   DC  B "C3'"  3  
ATOM 5379  O "O3'"  . DC  A 1 2  ? -71.968  -11.212 -25.470 1.00 1.32 ? 2   DC  B "O3'"  3  
ATOM 5380  C "C2'"  . DC  A 1 2  ? -73.182  -12.252 -23.681 1.00 1.21 ? 2   DC  B "C2'"  3  
ATOM 5381  C "C1'"  . DC  A 1 2  ? -74.165  -13.348 -24.090 1.00 1.25 ? 2   DC  B "C1'"  3  
ATOM 5382  N N1     . DC  A 1 2  ? -74.623  -14.159 -22.925 1.00 1.21 ? 2   DC  B N1     3  
ATOM 5383  C C2     . DC  A 1 2  ? -75.996  -14.311 -22.734 1.00 1.17 ? 2   DC  B C2     3  
ATOM 5384  O O2     . DC  A 1 2  ? -76.787  -13.759 -23.496 1.00 1.17 ? 2   DC  B O2     3  
ATOM 5385  N N3     . DC  A 1 2  ? -76.424  -15.076 -21.696 1.00 1.17 ? 2   DC  B N3     3  
ATOM 5386  C C4     . DC  A 1 2  ? -75.548  -15.670 -20.875 1.00 1.21 ? 2   DC  B C4     3  
ATOM 5387  N N4     . DC  A 1 2  ? -75.993  -16.434 -19.883 1.00 1.25 ? 2   DC  B N4     3  
ATOM 5388  C C5     . DC  A 1 2  ? -74.143  -15.518 -21.060 1.00 1.24 ? 2   DC  B C5     3  
ATOM 5389  C C6     . DC  A 1 2  ? -73.725  -14.760 -22.088 1.00 1.24 ? 2   DC  B C6     3  
ATOM 5390  H "H5'"  . DC  A 1 2  ? -71.492  -15.660 -25.545 1.00 1.62 ? 2   DC  B "H5'"  3  
ATOM 5391  H "H5''" . DC  A 1 2  ? -70.258  -14.416 -25.808 1.00 1.58 ? 2   DC  B "H5''" 3  
ATOM 5392  H "H4'"  . DC  A 1 2  ? -72.261  -13.382 -26.499 1.00 1.47 ? 2   DC  B "H4'"  3  
ATOM 5393  H "H3'"  . DC  A 1 2  ? -71.063  -12.422 -24.048 1.00 1.33 ? 2   DC  B "H3'"  3  
ATOM 5394  H "H2'"  . DC  A 1 2  ? -72.865  -12.380 -22.645 1.00 1.18 ? 2   DC  B "H2'"  3  
ATOM 5395  H "H2''" . DC  A 1 2  ? -73.649  -11.274 -23.798 1.00 1.17 ? 2   DC  B "H2''" 3  
ATOM 5396  H "H1'"  . DC  A 1 2  ? -75.030  -12.883 -24.578 1.00 1.24 ? 2   DC  B "H1'"  3  
ATOM 5397  H H41    . DC  A 1 2  ? -76.987  -16.548 -19.742 1.00 1.24 ? 2   DC  B H41    3  
ATOM 5398  H H42    . DC  A 1 2  ? -75.338  -16.902 -19.273 1.00 1.29 ? 2   DC  B H42    3  
ATOM 5399  H H5     . DC  A 1 2  ? -73.432  -15.997 -20.386 1.00 1.29 ? 2   DC  B H5     3  
ATOM 5400  H H6     . DC  A 1 2  ? -72.659  -14.620 -22.249 1.00 1.28 ? 2   DC  B H6     3  
ATOM 5401  P P      . DG  A 1 3  ? -71.756  -9.742  -24.839 1.00 1.27 ? 3   DG  B P      3  
ATOM 5402  O OP1    . DG  A 1 3  ? -70.893  -8.962  -25.752 1.00 1.42 ? 3   DG  B OP1    3  
ATOM 5403  O OP2    . DG  A 1 3  ? -71.375  -9.903  -23.418 1.00 1.23 ? 3   DG  B OP2    3  
ATOM 5404  O "O5'"  . DG  A 1 3  ? -73.243  -9.119  -24.890 1.00 1.15 ? 3   DG  B "O5'"  3  
ATOM 5405  C "C5'"  . DG  A 1 3  ? -73.885  -8.870  -26.144 1.00 1.23 ? 3   DG  B "C5'"  3  
ATOM 5406  C "C4'"  . DG  A 1 3  ? -75.344  -8.431  -25.961 1.00 1.13 ? 3   DG  B "C4'"  3  
ATOM 5407  O "O4'"  . DG  A 1 3  ? -76.025  -9.364  -25.094 1.00 1.06 ? 3   DG  B "O4'"  3  
ATOM 5408  C "C3'"  . DG  A 1 3  ? -75.459  -7.030  -25.336 1.00 1.07 ? 3   DG  B "C3'"  3  
ATOM 5409  O "O3'"  . DG  A 1 3  ? -76.292  -6.186  -26.139 1.00 1.13 ? 3   DG  B "O3'"  3  
ATOM 5410  C "C2'"  . DG  A 1 3  ? -76.104  -7.238  -23.983 1.00 0.93 ? 3   DG  B "C2'"  3  
ATOM 5411  C "C1'"  . DG  A 1 3  ? -76.536  -8.696  -23.920 1.00 0.93 ? 3   DG  B "C1'"  3  
ATOM 5412  N N9     . DG  A 1 3  ? -76.031  -9.331  -22.690 1.00 0.86 ? 3   DG  B N9     3  
ATOM 5413  C C8     . DG  A 1 3  ? -74.746  -9.448  -22.246 1.00 0.87 ? 3   DG  B C8     3  
ATOM 5414  N N7     . DG  A 1 3  ? -74.608  -10.070 -21.112 1.00 0.84 ? 3   DG  B N7     3  
ATOM 5415  C C5     . DG  A 1 3  ? -75.921  -10.397 -20.768 1.00 0.79 ? 3   DG  B C5     3  
ATOM 5416  C C6     . DG  A 1 3  ? -76.424  -11.088 -19.630 1.00 0.76 ? 3   DG  B C6     3  
ATOM 5417  O O6     . DG  A 1 3  ? -75.797  -11.558 -18.684 1.00 0.77 ? 3   DG  B O6     3  
ATOM 5418  N N1     . DG  A 1 3  ? -77.808  -11.203 -19.672 1.00 0.76 ? 3   DG  B N1     3  
ATOM 5419  C C2     . DG  A 1 3  ? -78.614  -10.717 -20.678 1.00 0.79 ? 3   DG  B C2     3  
ATOM 5420  N N2     . DG  A 1 3  ? -79.923  -10.916 -20.525 1.00 0.83 ? 3   DG  B N2     3  
ATOM 5421  N N3     . DG  A 1 3  ? -78.148  -10.072 -21.751 1.00 0.81 ? 3   DG  B N3     3  
ATOM 5422  C C4     . DG  A 1 3  ? -76.798  -9.947  -21.730 1.00 0.80 ? 3   DG  B C4     3  
ATOM 5423  H "H5'"  . DG  A 1 3  ? -73.864  -9.785  -26.740 1.00 1.32 ? 3   DG  B "H5'"  3  
ATOM 5424  H "H5''" . DG  A 1 3  ? -73.341  -8.088  -26.674 1.00 1.34 ? 3   DG  B "H5''" 3  
ATOM 5425  H "H4'"  . DG  A 1 3  ? -75.838  -8.428  -26.931 1.00 1.19 ? 3   DG  B "H4'"  3  
ATOM 5426  H "H3'"  . DG  A 1 3  ? -74.474  -6.569  -25.221 1.00 1.13 ? 3   DG  B "H3'"  3  
ATOM 5427  H "H2'"  . DG  A 1 3  ? -75.390  -7.025  -23.185 1.00 0.91 ? 3   DG  B "H2'"  3  
ATOM 5428  H "H2''" . DG  A 1 3  ? -76.971  -6.585  -23.881 1.00 0.92 ? 3   DG  B "H2''" 3  
ATOM 5429  H "H1'"  . DG  A 1 3  ? -77.626  -8.757  -23.929 1.00 0.92 ? 3   DG  B "H1'"  3  
ATOM 5430  H H8     . DG  A 1 3  ? -73.897  -9.046  -22.802 1.00 0.94 ? 3   DG  B H8     3  
ATOM 5431  H H1     . DG  A 1 3  ? -78.236  -11.688 -18.897 1.00 0.77 ? 3   DG  B H1     3  
ATOM 5432  H H21    . DG  A 1 3  ? -80.266  -11.405 -19.707 1.00 0.84 ? 3   DG  B H21    3  
ATOM 5433  H H22    . DG  A 1 3  ? -80.571  -10.578 -21.222 1.00 0.87 ? 3   DG  B H22    3  
ATOM 5434  P P      . DA  A 1 4  ? -76.578  -4.658  -25.701 1.00 1.15 ? 4   DA  B P      3  
ATOM 5435  O OP1    . DA  A 1 4  ? -76.940  -3.888  -26.913 1.00 1.30 ? 4   DA  B OP1    3  
ATOM 5436  O OP2    . DA  A 1 4  ? -75.460  -4.203  -24.845 1.00 1.15 ? 4   DA  B OP2    3  
ATOM 5437  O "O5'"  . DA  A 1 4  ? -77.897  -4.788  -24.780 1.00 1.04 ? 4   DA  B "O5'"  3  
ATOM 5438  C "C5'"  . DA  A 1 4  ? -79.184  -4.919  -25.390 1.00 1.09 ? 4   DA  B "C5'"  3  
ATOM 5439  C "C4'"  . DA  A 1 4  ? -80.327  -4.626  -24.410 1.00 1.02 ? 4   DA  B "C4'"  3  
ATOM 5440  O "O4'"  . DA  A 1 4  ? -80.303  -5.581  -23.323 1.00 0.95 ? 4   DA  B "O4'"  3  
ATOM 5441  C "C3'"  . DA  A 1 4  ? -80.229  -3.216  -23.807 1.00 1.01 ? 4   DA  B "C3'"  3  
ATOM 5442  O "O3'"  . DA  A 1 4  ? -81.463  -2.510  -23.965 1.00 1.07 ? 4   DA  B "O3'"  3  
ATOM 5443  C "C2'"  . DA  A 1 4  ? -79.936  -3.418  -22.335 1.00 0.92 ? 4   DA  B "C2'"  3  
ATOM 5444  C "C1'"  . DA  A 1 4  ? -80.108  -4.912  -22.056 1.00 0.87 ? 4   DA  B "C1'"  3  
ATOM 5445  N N9     . DA  A 1 4  ? -78.935  -5.484  -21.348 1.00 0.78 ? 4   DA  B N9     3  
ATOM 5446  C C8     . DA  A 1 4  ? -77.607  -5.337  -21.627 1.00 0.79 ? 4   DA  B C8     3  
ATOM 5447  N N7     . DA  A 1 4  ? -76.802  -5.997  -20.850 1.00 0.74 ? 4   DA  B N7     3  
ATOM 5448  C C5     . DA  A 1 4  ? -77.665  -6.643  -19.970 1.00 0.68 ? 4   DA  B C5     3  
ATOM 5449  C C6     . DA  A 1 4  ? -77.441  -7.509  -18.892 1.00 0.65 ? 4   DA  B C6     3  
ATOM 5450  N N6     . DA  A 1 4  ? -76.223  -7.897  -18.511 1.00 0.65 ? 4   DA  B N6     3  
ATOM 5451  N N1     . DA  A 1 4  ? -78.518  -7.965  -18.231 1.00 0.67 ? 4   DA  B N1     3  
ATOM 5452  C C2     . DA  A 1 4  ? -79.744  -7.596  -18.608 1.00 0.73 ? 4   DA  B C2     3  
ATOM 5453  N N3     . DA  A 1 4  ? -80.068  -6.783  -19.616 1.00 0.76 ? 4   DA  B N3     3  
ATOM 5454  C C4     . DA  A 1 4  ? -78.969  -6.339  -20.261 1.00 0.73 ? 4   DA  B C4     3  
ATOM 5455  H "H5'"  . DA  A 1 4  ? -79.292  -5.934  -25.771 1.00 1.15 ? 4   DA  B "H5'"  3  
ATOM 5456  H "H5''" . DA  A 1 4  ? -79.248  -4.222  -26.219 1.00 1.22 ? 4   DA  B "H5''" 3  
ATOM 5457  H "H4'"  . DA  A 1 4  ? -81.275  -4.719  -24.939 1.00 1.08 ? 4   DA  B "H4'"  3  
ATOM 5458  H "H3'"  . DA  A 1 4  ? -79.425  -2.645  -24.278 1.00 1.06 ? 4   DA  B "H3'"  3  
ATOM 5459  H "H2'"  . DA  A 1 4  ? -78.916  -3.107  -22.104 1.00 0.92 ? 4   DA  B "H2'"  3  
ATOM 5460  H "H2''" . DA  A 1 4  ? -80.646  -2.837  -21.737 1.00 0.95 ? 4   DA  B "H2''" 3  
ATOM 5461  H "H1'"  . DA  A 1 4  ? -80.997  -5.062  -21.445 1.00 0.88 ? 4   DA  B "H1'"  3  
ATOM 5462  H H8     . DA  A 1 4  ? -77.245  -4.713  -22.444 1.00 0.86 ? 4   DA  B H8     3  
ATOM 5463  H H61    . DA  A 1 4  ? -76.116  -8.522  -17.725 1.00 0.65 ? 4   DA  B H61    3  
ATOM 5464  H H62    . DA  A 1 4  ? -75.408  -7.566  -19.008 1.00 0.68 ? 4   DA  B H62    3  
ATOM 5465  H H2     . DA  A 1 4  ? -80.570  -8.005  -18.027 1.00 0.80 ? 4   DA  B H2     3  
ATOM 5466  P P      . DG  A 1 5  ? -81.560  -0.951  -23.568 1.00 1.10 ? 5   DG  B P      3  
ATOM 5467  O OP1    . DG  A 1 5  ? -82.625  -0.328  -24.390 1.00 1.25 ? 5   DG  B OP1    3  
ATOM 5468  O OP2    . DG  A 1 5  ? -80.190  -0.388  -23.582 1.00 1.13 ? 5   DG  B OP2    3  
ATOM 5469  O "O5'"  . DG  A 1 5  ? -82.069  -1.008  -22.043 1.00 1.01 ? 5   DG  B "O5'"  3  
ATOM 5470  C "C5'"  . DG  A 1 5  ? -83.416  -1.373  -21.752 1.00 1.03 ? 5   DG  B "C5'"  3  
ATOM 5471  C "C4'"  . DG  A 1 5  ? -83.584  -1.820  -20.297 1.00 0.95 ? 5   DG  B "C4'"  3  
ATOM 5472  O "O4'"  . DG  A 1 5  ? -82.519  -2.732  -19.928 1.00 0.89 ? 5   DG  B "O4'"  3  
ATOM 5473  C "C3'"  . DG  A 1 5  ? -83.551  -0.635  -19.318 1.00 0.96 ? 5   DG  B "C3'"  3  
ATOM 5474  O "O3'"  . DG  A 1 5  ? -84.701  -0.658  -18.463 1.00 1.02 ? 5   DG  B "O3'"  3  
ATOM 5475  C "C2'"  . DG  A 1 5  ? -82.292  -0.839  -18.505 1.00 0.90 ? 5   DG  B "C2'"  3  
ATOM 5476  C "C1'"  . DG  A 1 5  ? -81.884  -2.285  -18.715 1.00 0.84 ? 5   DG  B "C1'"  3  
ATOM 5477  N N9     . DG  A 1 5  ? -80.415  -2.428  -18.783 1.00 0.79 ? 5   DG  B N9     3  
ATOM 5478  C C8     . DG  A 1 5  ? -79.514  -1.768  -19.573 1.00 0.82 ? 5   DG  B C8     3  
ATOM 5479  N N7     . DG  A 1 5  ? -78.275  -2.121  -19.407 1.00 0.79 ? 5   DG  B N7     3  
ATOM 5480  C C5     . DG  A 1 5  ? -78.351  -3.104  -18.421 1.00 0.72 ? 5   DG  B C5     3  
ATOM 5481  C C6     . DG  A 1 5  ? -77.317  -3.867  -17.821 1.00 0.69 ? 5   DG  B C6     3  
ATOM 5482  O O6     . DG  A 1 5  ? -76.110  -3.823  -18.043 1.00 0.70 ? 5   DG  B O6     3  
ATOM 5483  N N1     . DG  A 1 5  ? -77.821  -4.747  -16.872 1.00 0.67 ? 5   DG  B N1     3  
ATOM 5484  C C2     . DG  A 1 5  ? -79.149  -4.880  -16.539 1.00 0.70 ? 5   DG  B C2     3  
ATOM 5485  N N2     . DG  A 1 5  ? -79.429  -5.784  -15.598 1.00 0.73 ? 5   DG  B N2     3  
ATOM 5486  N N3     . DG  A 1 5  ? -80.127  -4.163  -17.104 1.00 0.73 ? 5   DG  B N3     3  
ATOM 5487  C C4     . DG  A 1 5  ? -79.656  -3.298  -18.033 1.00 0.73 ? 5   DG  B C4     3  
ATOM 5488  H "H5'"  . DG  A 1 5  ? -83.711  -2.190  -22.410 1.00 1.09 ? 5   DG  B "H5'"  3  
ATOM 5489  H "H5''" . DG  A 1 5  ? -84.064  -0.517  -21.940 1.00 1.10 ? 5   DG  B "H5''" 3  
ATOM 5490  H "H4'"  . DG  A 1 5  ? -84.535  -2.333  -20.193 1.00 0.99 ? 5   DG  B "H4'"  3  
ATOM 5491  H "H3'"  . DG  A 1 5  ? -83.511  0.320   -19.847 1.00 1.03 ? 5   DG  B "H3'"  3  
ATOM 5492  H "H2'"  . DG  A 1 5  ? -81.500  -0.174  -18.858 1.00 0.93 ? 5   DG  B "H2'"  3  
ATOM 5493  H "H2''" . DG  A 1 5  ? -82.488  -0.653  -17.455 1.00 0.93 ? 5   DG  B "H2''" 3  
ATOM 5494  H "H1'"  . DG  A 1 5  ? -82.256  -2.887  -17.886 1.00 0.82 ? 5   DG  B "H1'"  3  
ATOM 5495  H H8     . DG  A 1 5  ? -79.811  -0.995  -20.284 1.00 0.88 ? 5   DG  B H8     3  
ATOM 5496  H H1     . DG  A 1 5  ? -77.145  -5.330  -16.406 1.00 0.66 ? 5   DG  B H1     3  
ATOM 5497  H H21    . DG  A 1 5  ? -78.682  -6.323  -15.178 1.00 0.73 ? 5   DG  B H21    3  
ATOM 5498  H H22    . DG  A 1 5  ? -80.385  -5.930  -15.302 1.00 0.79 ? 5   DG  B H22    3  
ATOM 5499  P P      . DC  A 1 6  ? -84.872  0.425   -17.278 1.00 1.10 ? 6   DC  B P      3  
ATOM 5500  O OP1    . DC  A 1 6  ? -86.309  0.513   -16.937 1.00 1.23 ? 6   DC  B OP1    3  
ATOM 5501  O OP2    . DC  A 1 6  ? -84.119  1.644   -17.647 1.00 1.16 ? 6   DC  B OP2    3  
ATOM 5502  O "O5'"  . DC  A 1 6  ? -84.112  -0.289  -16.051 1.00 1.03 ? 6   DC  B "O5'"  3  
ATOM 5503  C "C5'"  . DC  A 1 6  ? -84.445  -1.630  -15.702 1.00 1.10 ? 6   DC  B "C5'"  3  
ATOM 5504  C "C4'"  . DC  A 1 6  ? -84.147  -1.936  -14.230 1.00 1.07 ? 6   DC  B "C4'"  3  
ATOM 5505  O "O4'"  . DC  A 1 6  ? -82.818  -2.486  -14.102 1.00 1.09 ? 6   DC  B "O4'"  3  
ATOM 5506  C "C3'"  . DC  A 1 6  ? -84.243  -0.689  -13.344 1.00 1.06 ? 6   DC  B "C3'"  3  
ATOM 5507  O "O3'"  . DC  A 1 6  ? -85.167  -0.935  -12.277 1.00 1.11 ? 6   DC  B "O3'"  3  
ATOM 5508  C "C2'"  . DC  A 1 6  ? -82.841  -0.464  -12.806 1.00 1.06 ? 6   DC  B "C2'"  3  
ATOM 5509  C "C1'"  . DC  A 1 6  ? -82.003  -1.674  -13.230 1.00 1.04 ? 6   DC  B "C1'"  3  
ATOM 5510  N N1     . DC  A 1 6  ? -80.746  -1.263  -13.931 1.00 1.00 ? 6   DC  B N1     3  
ATOM 5511  C C2     . DC  A 1 6  ? -79.532  -1.743  -13.444 1.00 0.99 ? 6   DC  B C2     3  
ATOM 5512  O O2     . DC  A 1 6  ? -79.510  -2.475  -12.459 1.00 1.02 ? 6   DC  B O2     3  
ATOM 5513  N N3     . DC  A 1 6  ? -78.389  -1.386  -14.088 1.00 0.99 ? 6   DC  B N3     3  
ATOM 5514  C C4     . DC  A 1 6  ? -78.423  -0.593  -15.163 1.00 1.00 ? 6   DC  B C4     3  
ATOM 5515  N N4     . DC  A 1 6  ? -77.280  -0.260  -15.761 1.00 1.03 ? 6   DC  B N4     3  
ATOM 5516  C C5     . DC  A 1 6  ? -79.662  -0.093  -15.670 1.00 1.01 ? 6   DC  B C5     3  
ATOM 5517  C C6     . DC  A 1 6  ? -80.792  -0.451  -15.027 1.00 1.01 ? 6   DC  B C6     3  
ATOM 5518  H "H5'"  . DC  A 1 6  ? -83.873  -2.312  -16.323 1.00 1.21 ? 6   DC  B "H5'"  3  
ATOM 5519  H "H5''" . DC  A 1 6  ? -85.508  -1.785  -15.893 1.00 1.26 ? 6   DC  B "H5''" 3  
ATOM 5520  H "H4'"  . DC  A 1 6  ? -84.864  -2.676  -13.869 1.00 1.11 ? 6   DC  B "H4'"  3  
ATOM 5521  H "H3'"  . DC  A 1 6  ? -84.571  0.180   -13.923 1.00 1.07 ? 6   DC  B "H3'"  3  
ATOM 5522  H "H2'"  . DC  A 1 6  ? -82.418  0.450   -13.220 1.00 1.07 ? 6   DC  B "H2'"  3  
ATOM 5523  H "H2''" . DC  A 1 6  ? -82.872  -0.389  -11.718 1.00 1.11 ? 6   DC  B "H2''" 3  
ATOM 5524  H "H1'"  . DC  A 1 6  ? -81.755  -2.263  -12.345 1.00 1.06 ? 6   DC  B "H1'"  3  
ATOM 5525  H H41    . DC  A 1 6  ? -76.403  -0.612  -15.404 1.00 1.05 ? 6   DC  B H41    3  
ATOM 5526  H H42    . DC  A 1 6  ? -77.290  0.343   -16.571 1.00 1.05 ? 6   DC  B H42    3  
ATOM 5527  H H5     . DC  A 1 6  ? -79.693  0.555   -16.545 1.00 1.04 ? 6   DC  B H5     3  
ATOM 5528  H H6     . DC  A 1 6  ? -81.749  -0.084  -15.381 1.00 1.05 ? 6   DC  B H6     3  
ATOM 5529  P P      . DC  A 1 7  ? -85.434  0.150   -11.121 1.00 1.17 ? 7   DC  B P      3  
ATOM 5530  O OP1    . DC  A 1 7  ? -86.555  -0.343  -10.288 1.00 1.38 ? 7   DC  B OP1    3  
ATOM 5531  O OP2    . DC  A 1 7  ? -85.515  1.491   -11.739 1.00 1.32 ? 7   DC  B OP2    3  
ATOM 5532  O "O5'"  . DC  A 1 7  ? -84.086  0.055   -10.249 1.00 0.94 ? 7   DC  B "O5'"  3  
ATOM 5533  C "C5'"  . DC  A 1 7  ? -83.926  -1.029  -9.333  1.00 0.92 ? 7   DC  B "C5'"  3  
ATOM 5534  C "C4'"  . DC  A 1 7  ? -82.453  -1.315  -8.984  1.00 0.82 ? 7   DC  B "C4'"  3  
ATOM 5535  O "O4'"  . DC  A 1 7  ? -81.600  -1.124  -10.145 1.00 0.84 ? 7   DC  B "O4'"  3  
ATOM 5536  C "C3'"  . DC  A 1 7  ? -81.920  -0.401  -7.863  1.00 0.82 ? 7   DC  B "C3'"  3  
ATOM 5537  O "O3'"  . DC  A 1 7  ? -81.426  -1.193  -6.772  1.00 0.89 ? 7   DC  B "O3'"  3  
ATOM 5538  C "C2'"  . DC  A 1 7  ? -80.785  0.373   -8.497  1.00 0.86 ? 7   DC  B "C2'"  3  
ATOM 5539  C "C1'"  . DC  A 1 7  ? -80.422  -0.385  -9.764  1.00 0.87 ? 7   DC  B "C1'"  3  
ATOM 5540  N N1     . DC  A 1 7  ? -79.970  0.537   -10.842 1.00 0.93 ? 7   DC  B N1     3  
ATOM 5541  C C2     . DC  A 1 7  ? -78.661  0.407   -11.310 1.00 1.05 ? 7   DC  B C2     3  
ATOM 5542  O O2     . DC  A 1 7  ? -77.927  -0.462  -10.845 1.00 1.14 ? 7   DC  B O2     3  
ATOM 5543  N N3     . DC  A 1 7  ? -78.233  1.251   -12.287 1.00 1.15 ? 7   DC  B N3     3  
ATOM 5544  C C4     . DC  A 1 7  ? -79.047  2.186   -12.791 1.00 1.15 ? 7   DC  B C4     3  
ATOM 5545  N N4     . DC  A 1 7  ? -78.600  2.994   -13.754 1.00 1.29 ? 7   DC  B N4     3  
ATOM 5546  C C5     . DC  A 1 7  ? -80.388  2.329   -12.316 1.00 1.08 ? 7   DC  B C5     3  
ATOM 5547  C C6     . DC  A 1 7  ? -80.806  1.489   -11.349 1.00 0.96 ? 7   DC  B C6     3  
ATOM 5548  H "H5'"  . DC  A 1 7  ? -84.359  -1.924  -9.779  1.00 1.09 ? 7   DC  B "H5'"  3  
ATOM 5549  H "H5''" . DC  A 1 7  ? -84.474  -0.799  -8.420  1.00 0.96 ? 7   DC  B "H5''" 3  
ATOM 5550  H "H4'"  . DC  A 1 7  ? -82.366  -2.349  -8.661  1.00 0.89 ? 7   DC  B "H4'"  3  
ATOM 5551  H "H3'"  . DC  A 1 7  ? -82.690  0.284   -7.506  1.00 0.86 ? 7   DC  B "H3'"  3  
ATOM 5552  H "H2'"  . DC  A 1 7  ? -81.107  1.386   -8.743  1.00 0.92 ? 7   DC  B "H2'"  3  
ATOM 5553  H "H2''" . DC  A 1 7  ? -79.935  0.411   -7.824  1.00 0.94 ? 7   DC  B "H2''" 3  
ATOM 5554  H "H1'"  . DC  A 1 7  ? -79.629  -1.102  -9.529  1.00 0.95 ? 7   DC  B "H1'"  3  
ATOM 5555  H H41    . DC  A 1 7  ? -77.652  2.902   -14.092 1.00 1.39 ? 7   DC  B H41    3  
ATOM 5556  H H42    . DC  A 1 7  ? -79.209  3.698   -14.144 1.00 1.35 ? 7   DC  B H42    3  
ATOM 5557  H H5     . DC  A 1 7  ? -81.049  3.096   -12.721 1.00 1.17 ? 7   DC  B H5     3  
ATOM 5558  H H6     . DC  A 1 7  ? -81.824  1.570   -10.969 1.00 0.96 ? 7   DC  B H6     3  
ATOM 5559  P P      . DG  A 1 8  ? -80.702  -0.502  -5.509  1.00 0.93 ? 8   DG  B P      3  
ATOM 5560  O OP1    . DG  A 1 8  ? -80.594  -1.504  -4.425  1.00 1.16 ? 8   DG  B OP1    3  
ATOM 5561  O OP2    . DG  A 1 8  ? -81.358  0.798   -5.250  1.00 1.05 ? 8   DG  B OP2    3  
ATOM 5562  O "O5'"  . DG  A 1 8  ? -79.223  -0.210  -6.085  1.00 0.77 ? 8   DG  B "O5'"  3  
ATOM 5563  C "C5'"  . DG  A 1 8  ? -78.264  -1.263  -6.222  1.00 0.85 ? 8   DG  B "C5'"  3  
ATOM 5564  C "C4'"  . DG  A 1 8  ? -76.839  -0.774  -5.898  1.00 0.78 ? 8   DG  B "C4'"  3  
ATOM 5565  O "O4'"  . DG  A 1 8  ? -76.141  -0.400  -7.115  1.00 0.76 ? 8   DG  B "O4'"  3  
ATOM 5566  C "C3'"  . DG  A 1 8  ? -76.848  0.449   -4.967  1.00 0.79 ? 8   DG  B "C3'"  3  
ATOM 5567  O "O3'"  . DG  A 1 8  ? -75.994  0.219   -3.841  1.00 0.86 ? 8   DG  B "O3'"  3  
ATOM 5568  C "C2'"  . DG  A 1 8  ? -76.314  1.595   -5.800  1.00 0.74 ? 8   DG  B "C2'"  3  
ATOM 5569  C "C1'"  . DG  A 1 8  ? -75.677  0.969   -7.034  1.00 0.71 ? 8   DG  B "C1'"  3  
ATOM 5570  N N9     . DG  A 1 8  ? -76.036  1.721   -8.256  1.00 0.69 ? 8   DG  B N9     3  
ATOM 5571  C C8     . DG  A 1 8  ? -77.171  1.642   -9.005  1.00 0.83 ? 8   DG  B C8     3  
ATOM 5572  N N7     . DG  A 1 8  ? -77.224  2.441   -10.023 1.00 0.83 ? 8   DG  B N7     3  
ATOM 5573  C C5     . DG  A 1 8  ? -76.011  3.120   -9.960  1.00 0.66 ? 8   DG  B C5     3  
ATOM 5574  C C6     . DG  A 1 8  ? -75.489  4.129   -10.815 1.00 0.64 ? 8   DG  B C6     3  
ATOM 5575  O O6     . DG  A 1 8  ? -76.010  4.632   -11.809 1.00 0.70 ? 8   DG  B O6     3  
ATOM 5576  N N1     . DG  A 1 8  ? -74.233  4.547   -10.400 1.00 0.66 ? 8   DG  B N1     3  
ATOM 5577  C C2     . DG  A 1 8  ? -73.558  4.058   -9.299  1.00 0.72 ? 8   DG  B C2     3  
ATOM 5578  N N2     . DG  A 1 8  ? -72.361  4.592   -9.058  1.00 0.93 ? 8   DG  B N2     3  
ATOM 5579  N N3     . DG  A 1 8  ? -74.046  3.108   -8.492  1.00 0.66 ? 8   DG  B N3     3  
ATOM 5580  C C4     . DG  A 1 8  ? -75.272  2.687   -8.880  1.00 0.62 ? 8   DG  B C4     3  
ATOM 5581  H "H5'"  . DG  A 1 8  ? -78.288  -1.636  -7.247  1.00 0.98 ? 8   DG  B "H5'"  3  
ATOM 5582  H "H5''" . DG  A 1 8  ? -78.531  -2.078  -5.544  1.00 1.03 ? 8   DG  B "H5''" 3  
ATOM 5583  H "H4'"  . DG  A 1 8  ? -76.288  -1.583  -5.410  1.00 0.83 ? 8   DG  B "H4'"  3  
ATOM 5584  H "H3'"  . DG  A 1 8  ? -77.863  0.672   -4.619  1.00 0.84 ? 8   DG  B "H3'"  3  
ATOM 5585  H "H2'"  . DG  A 1 8  ? -77.127  2.258   -6.099  1.00 0.75 ? 8   DG  B "H2'"  3  
ATOM 5586  H "H2''" . DG  A 1 8  ? -75.574  2.156   -5.231  1.00 0.78 ? 8   DG  B "H2''" 3  
ATOM 5587  H "H1'"  . DG  A 1 8  ? -74.592  0.970   -6.923  1.00 0.75 ? 8   DG  B "H1'"  3  
ATOM 5588  H H8     . DG  A 1 8  ? -77.969  0.948   -8.771  1.00 1.00 ? 8   DG  B H8     3  
ATOM 5589  H H1     . DG  A 1 8  ? -73.796  5.264   -10.964 1.00 0.73 ? 8   DG  B H1     3  
ATOM 5590  H H21    . DG  A 1 8  ? -71.995  5.309   -9.668  1.00 1.01 ? 8   DG  B H21    3  
ATOM 5591  H H22    . DG  A 1 8  ? -71.822  4.282   -8.262  1.00 1.04 ? 8   DG  B H22    3  
ATOM 5592  P P      . DG  A 1 9  ? -75.896  1.294   -2.646  1.00 0.95 ? 9   DG  B P      3  
ATOM 5593  O OP1    . DG  A 1 9  ? -75.225  0.650   -1.493  1.00 1.13 ? 9   DG  B OP1    3  
ATOM 5594  O OP2    . DG  A 1 9  ? -77.228  1.915   -2.472  1.00 0.98 ? 9   DG  B OP2    3  
ATOM 5595  O "O5'"  . DG  A 1 9  ? -74.903  2.410   -3.253  1.00 0.87 ? 9   DG  B "O5'"  3  
ATOM 5596  C "C5'"  . DG  A 1 9  ? -73.497  2.175   -3.330  1.00 0.94 ? 9   DG  B "C5'"  3  
ATOM 5597  C "C4'"  . DG  A 1 9  ? -72.699  3.482   -3.229  1.00 0.87 ? 9   DG  B "C4'"  3  
ATOM 5598  O "O4'"  . DG  A 1 9  ? -72.598  4.095   -4.535  1.00 0.82 ? 9   DG  B "O4'"  3  
ATOM 5599  C "C3'"  . DG  A 1 9  ? -73.355  4.496   -2.277  1.00 0.85 ? 9   DG  B "C3'"  3  
ATOM 5600  O "O3'"  . DG  A 1 9  ? -72.400  4.947   -1.295  1.00 0.88 ? 9   DG  B "O3'"  3  
ATOM 5601  C "C2'"  . DG  A 1 9  ? -73.797  5.646   -3.165  1.00 0.79 ? 9   DG  B "C2'"  3  
ATOM 5602  C "C1'"  . DG  A 1 9  ? -73.093  5.448   -4.500  1.00 0.76 ? 9   DG  B "C1'"  3  
ATOM 5603  N N9     . DG  A 1 9  ? -74.001  5.718   -5.638  1.00 0.72 ? 9   DG  B N9     3  
ATOM 5604  C C8     . DG  A 1 9  ? -75.248  5.221   -5.890  1.00 0.75 ? 9   DG  B C8     3  
ATOM 5605  N N7     . DG  A 1 9  ? -75.802  5.649   -6.985  1.00 0.73 ? 9   DG  B N7     3  
ATOM 5606  C C5     . DG  A 1 9  ? -74.840  6.508   -7.516  1.00 0.67 ? 9   DG  B C5     3  
ATOM 5607  C C6     . DG  A 1 9  ? -74.864  7.279   -8.710  1.00 0.66 ? 9   DG  B C6     3  
ATOM 5608  O O6     . DG  A 1 9  ? -75.758  7.353   -9.548  1.00 0.69 ? 9   DG  B O6     3  
ATOM 5609  N N1     . DG  A 1 9  ? -73.691  8.009   -8.873  1.00 0.65 ? 9   DG  B N1     3  
ATOM 5610  C C2     . DG  A 1 9  ? -72.624  7.997   -7.996  1.00 0.67 ? 9   DG  B C2     3  
ATOM 5611  N N2     . DG  A 1 9  ? -71.577  8.758   -8.316  1.00 0.72 ? 9   DG  B N2     3  
ATOM 5612  N N3     . DG  A 1 9  ? -72.600  7.273   -6.873  1.00 0.68 ? 9   DG  B N3     3  
ATOM 5613  C C4     . DG  A 1 9  ? -73.734  6.558   -6.698  1.00 0.67 ? 9   DG  B C4     3  
ATOM 5614  H "H5'"  . DG  A 1 9  ? -73.270  1.694   -4.283  1.00 1.00 ? 9   DG  B "H5'"  3  
ATOM 5615  H "H5''" . DG  A 1 9  ? -73.198  1.511   -2.518  1.00 1.08 ? 9   DG  B "H5''" 3  
ATOM 5616  H "H4'"  . DG  A 1 9  ? -71.695  3.260   -2.871  1.00 0.91 ? 9   DG  B "H4'"  3  
ATOM 5617  H "H3'"  . DG  A 1 9  ? -74.220  4.055   -1.769  1.00 0.90 ? 9   DG  B "H3'"  3  
ATOM 5618  H "H2'"  . DG  A 1 9  ? -74.881  5.620   -3.308  1.00 0.81 ? 9   DG  B "H2'"  3  
ATOM 5619  H "H2''" . DG  A 1 9  ? -73.509  6.602   -2.726  1.00 0.80 ? 9   DG  B "H2''" 3  
ATOM 5620  H "H1'"  . DG  A 1 9  ? -72.243  6.132   -4.562  1.00 0.76 ? 9   DG  B "H1'"  3  
ATOM 5621  H H8     . DG  A 1 9  ? -75.740  4.513   -5.220  1.00 0.80 ? 9   DG  B H8     3  
ATOM 5622  H H1     . DG  A 1 9  ? -73.635  8.582   -9.703  1.00 0.66 ? 9   DG  B H1     3  
ATOM 5623  H H21    . DG  A 1 9  ? -71.590  9.307   -9.163  1.00 0.73 ? 9   DG  B H21    3  
ATOM 5624  H H22    . DG  A 1 9  ? -70.768  8.783   -7.708  1.00 0.77 ? 9   DG  B H22    3  
ATOM 5625  P P      . DA  A 1 10 ? -72.757  6.141   -0.265  1.00 0.92 ? 10  DA  B P      3  
ATOM 5626  O OP1    . DA  A 1 10 ? -72.013  5.909   0.995   1.00 1.03 ? 10  DA  B OP1    3  
ATOM 5627  O OP2    . DA  A 1 10 ? -74.227  6.299   -0.238  1.00 0.96 ? 10  DA  B OP2    3  
ATOM 5628  O "O5'"  . DA  A 1 10 ? -72.116  7.430   -0.999  1.00 0.84 ? 10  DA  B "O5'"  3  
ATOM 5629  C "C5'"  . DA  A 1 10 ? -70.889  7.298   -1.725  1.00 0.84 ? 10  DA  B "C5'"  3  
ATOM 5630  C "C4'"  . DA  A 1 10 ? -70.493  8.587   -2.456  1.00 0.80 ? 10  DA  B "C4'"  3  
ATOM 5631  O "O4'"  . DA  A 1 10 ? -71.242  8.692   -3.689  1.00 0.75 ? 10  DA  B "O4'"  3  
ATOM 5632  C "C3'"  . DA  A 1 10 ? -70.765  9.855   -1.626  1.00 0.83 ? 10  DA  B "C3'"  3  
ATOM 5633  O "O3'"  . DA  A 1 10 ? -69.588  10.670  -1.548  1.00 0.87 ? 10  DA  B "O3'"  3  
ATOM 5634  C "C2'"  . DA  A 1 10 ? -71.857  10.592  -2.373  1.00 0.78 ? 10  DA  B "C2'"  3  
ATOM 5635  C "C1'"  . DA  A 1 10 ? -71.927  9.957   -3.755  1.00 0.74 ? 10  DA  B "C1'"  3  
ATOM 5636  N N9     . DA  A 1 10 ? -73.326  9.798   -4.195  1.00 0.70 ? 10  DA  B N9     3  
ATOM 5637  C C8     . DA  A 1 10 ? -74.388  9.240   -3.541  1.00 0.71 ? 10  DA  B C8     3  
ATOM 5638  N N7     . DA  A 1 10 ? -75.513  9.281   -4.189  1.00 0.69 ? 10  DA  B N7     3  
ATOM 5639  C C5     . DA  A 1 10 ? -75.170  9.922   -5.378  1.00 0.65 ? 10  DA  B C5     3  
ATOM 5640  C C6     . DA  A 1 10 ? -75.908  10.285  -6.508  1.00 0.64 ? 10  DA  B C6     3  
ATOM 5641  N N6     . DA  A 1 10 ? -77.217  10.064  -6.623  1.00 0.63 ? 10  DA  B N6     3  
ATOM 5642  N N1     . DA  A 1 10 ? -75.251  10.904  -7.506  1.00 0.65 ? 10  DA  B N1     3  
ATOM 5643  C C2     . DA  A 1 10 ? -73.946  11.155  -7.395  1.00 0.67 ? 10  DA  B C2     3  
ATOM 5644  N N3     . DA  A 1 10 ? -73.159  10.857  -6.369  1.00 0.68 ? 10  DA  B N3     3  
ATOM 5645  C C4     . DA  A 1 10 ? -73.844  10.236  -5.389  1.00 0.67 ? 10  DA  B C4     3  
ATOM 5646  H "H5'"  . DA  A 1 10 ? -71.002  6.500   -2.460  1.00 0.87 ? 10  DA  B "H5'"  3  
ATOM 5647  H "H5''" . DA  A 1 10 ? -70.095  7.024   -1.032  1.00 0.92 ? 10  DA  B "H5''" 3  
ATOM 5648  H "H4'"  . DA  A 1 10 ? -69.431  8.546   -2.692  1.00 0.83 ? 10  DA  B "H4'"  3  
ATOM 5649  H "H3'"  . DA  A 1 10 ? -71.101  9.597   -0.617  1.00 0.88 ? 10  DA  B "H3'"  3  
ATOM 5650  H "H2'"  . DA  A 1 10 ? -72.810  10.477  -1.857  1.00 0.81 ? 10  DA  B "H2'"  3  
ATOM 5651  H "H2''" . DA  A 1 10 ? -71.612  11.650  -2.459  1.00 0.80 ? 10  DA  B "H2''" 3  
ATOM 5652  H "H1'"  . DA  A 1 10 ? -71.404  10.599  -4.470  1.00 0.75 ? 10  DA  B "H1'"  3  
ATOM 5653  H H8     . DA  A 1 10 ? -74.298  8.793   -2.550  1.00 0.76 ? 10  DA  B H8     3  
ATOM 5654  H H61    . DA  A 1 10 ? -77.704  10.344  -7.463  1.00 0.63 ? 10  DA  B H61    3  
ATOM 5655  H H62    . DA  A 1 10 ? -77.722  9.617   -5.869  1.00 0.64 ? 10  DA  B H62    3  
ATOM 5656  H H2     . DA  A 1 10 ? -73.474  11.659  -8.237  1.00 0.70 ? 10  DA  B H2     3  
ATOM 5657  P P      . DA  A 1 11 ? -69.629  12.108  -0.815  1.00 0.93 ? 11  DA  B P      3  
ATOM 5658  O OP1    . DA  A 1 11 ? -68.287  12.379  -0.254  1.00 1.04 ? 11  DA  B OP1    3  
ATOM 5659  O OP2    . DA  A 1 11 ? -70.820  12.144  0.065   1.00 0.96 ? 11  DA  B OP2    3  
ATOM 5660  O "O5'"  . DA  A 1 11 ? -69.882  13.125  -2.043  1.00 0.85 ? 11  DA  B "O5'"  3  
ATOM 5661  C "C5'"  . DA  A 1 11 ? -69.138  12.990  -3.257  1.00 0.84 ? 11  DA  B "C5'"  3  
ATOM 5662  C "C4'"  . DA  A 1 11 ? -69.482  14.088  -4.271  1.00 0.79 ? 11  DA  B "C4'"  3  
ATOM 5663  O "O4'"  . DA  A 1 11 ? -70.749  13.792  -4.913  1.00 0.74 ? 11  DA  B "O4'"  3  
ATOM 5664  C "C3'"  . DA  A 1 11 ? -69.594  15.473  -3.616  1.00 0.79 ? 11  DA  B "C3'"  3  
ATOM 5665  O "O3'"  . DA  A 1 11 ? -68.776  16.429  -4.310  1.00 0.81 ? 11  DA  B "O3'"  3  
ATOM 5666  C "C2'"  . DA  A 1 11 ? -71.061  15.846  -3.728  1.00 0.75 ? 11  DA  B "C2'"  3  
ATOM 5667  C "C1'"  . DA  A 1 11 ? -71.671  14.891  -4.743  1.00 0.71 ? 11  DA  B "C1'"  3  
ATOM 5668  N N9     . DA  A 1 11 ? -73.011  14.417  -4.321  1.00 0.68 ? 11  DA  B N9     3  
ATOM 5669  C C8     . DA  A 1 11 ? -73.421  13.878  -3.130  1.00 0.71 ? 11  DA  B C8     3  
ATOM 5670  N N7     . DA  A 1 11 ? -74.680  13.555  -3.080  1.00 0.69 ? 11  DA  B N7     3  
ATOM 5671  C C5     . DA  A 1 11 ? -75.150  13.907  -4.343  1.00 0.65 ? 11  DA  B C5     3  
ATOM 5672  C C6     . DA  A 1 11 ? -76.411  13.823  -4.945  1.00 0.63 ? 11  DA  B C6     3  
ATOM 5673  N N6     . DA  A 1 11 ? -77.484  13.331  -4.325  1.00 0.64 ? 11  DA  B N6     3  
ATOM 5674  N N1     . DA  A 1 11 ? -76.523  14.264  -6.212  1.00 0.62 ? 11  DA  B N1     3  
ATOM 5675  C C2     . DA  A 1 11 ? -75.460  14.757  -6.847  1.00 0.63 ? 11  DA  B C2     3  
ATOM 5676  N N3     . DA  A 1 11 ? -74.229  14.879  -6.371  1.00 0.64 ? 11  DA  B N3     3  
ATOM 5677  C C4     . DA  A 1 11 ? -74.144  14.432  -5.103  1.00 0.65 ? 11  DA  B C4     3  
ATOM 5678  H "H5'"  . DA  A 1 11 ? -69.355  12.017  -3.698  1.00 0.85 ? 11  DA  B "H5'"  3  
ATOM 5679  H "H5''" . DA  A 1 11 ? -68.074  13.045  -3.026  1.00 0.94 ? 11  DA  B "H5''" 3  
ATOM 5680  H "H4'"  . DA  A 1 11 ? -68.701  14.120  -5.032  1.00 0.80 ? 11  DA  B "H4'"  3  
ATOM 5681  H "H3'"  . DA  A 1 11 ? -69.293  15.434  -2.564  1.00 0.84 ? 11  DA  B "H3'"  3  
ATOM 5682  H "H2'"  . DA  A 1 11 ? -71.557  15.726  -2.764  1.00 0.78 ? 11  DA  B "H2'"  3  
ATOM 5683  H "H2''" . DA  A 1 11 ? -71.163  16.874  -4.069  1.00 0.76 ? 11  DA  B "H2''" 3  
ATOM 5684  H "H1'"  . DA  A 1 11 ? -71.776  15.406  -5.700  1.00 0.70 ? 11  DA  B "H1'"  3  
ATOM 5685  H H8     . DA  A 1 11 ? -72.745  13.732  -2.286  1.00 0.76 ? 11  DA  B H8     3  
ATOM 5686  H H61    . DA  A 1 11 ? -78.372  13.294  -4.804  1.00 0.64 ? 11  DA  B H61    3  
ATOM 5687  H H62    . DA  A 1 11 ? -77.409  12.993  -3.378  1.00 0.67 ? 11  DA  B H62    3  
ATOM 5688  H H2     . DA  A 1 11 ? -75.619  15.093  -7.874  1.00 0.65 ? 11  DA  B H2     3  
ATOM 5689  P P      . DG  A 1 12 ? -68.802  17.991  -3.900  1.00 0.84 ? 12  DG  B P      3  
ATOM 5690  O OP1    . DG  A 1 12 ? -67.554  18.630  -4.383  1.00 0.92 ? 12  DG  B OP1    3  
ATOM 5691  O OP2    . DG  A 1 12 ? -69.173  18.086  -2.471  1.00 0.88 ? 12  DG  B OP2    3  
ATOM 5692  O "O5'"  . DG  A 1 12 ? -70.030  18.553  -4.779  1.00 0.78 ? 12  DG  B "O5'"  3  
ATOM 5693  C "C5'"  . DG  A 1 12 ? -70.134  18.215  -6.166  1.00 0.78 ? 12  DG  B "C5'"  3  
ATOM 5694  C "C4'"  . DG  A 1 12 ? -71.218  19.039  -6.882  1.00 0.74 ? 12  DG  B "C4'"  3  
ATOM 5695  O "O4'"  . DG  A 1 12 ? -72.480  18.318  -6.843  1.00 0.70 ? 12  DG  B "O4'"  3  
ATOM 5696  C "C3'"  . DG  A 1 12 ? -71.440  20.411  -6.221  1.00 0.74 ? 12  DG  B "C3'"  3  
ATOM 5697  O "O3'"  . DG  A 1 12 ? -71.303  21.474  -7.170  1.00 0.76 ? 12  DG  B "O3'"  3  
ATOM 5698  C "C2'"  . DG  A 1 12 ? -72.865  20.390  -5.710  1.00 0.72 ? 12  DG  B "C2'"  3  
ATOM 5699  C "C1'"  . DG  A 1 12 ? -73.528  19.164  -6.319  1.00 0.68 ? 12  DG  B "C1'"  3  
ATOM 5700  N N9     . DG  A 1 12 ? -74.362  18.464  -5.313  1.00 0.66 ? 12  DG  B N9     3  
ATOM 5701  C C8     . DG  A 1 12 ? -74.027  18.009  -4.066  1.00 0.70 ? 12  DG  B C8     3  
ATOM 5702  N N7     . DG  A 1 12 ? -74.996  17.451  -3.401  1.00 0.68 ? 12  DG  B N7     3  
ATOM 5703  C C5     . DG  A 1 12 ? -76.078  17.541  -4.276  1.00 0.62 ? 12  DG  B C5     3  
ATOM 5704  C C6     . DG  A 1 12 ? -77.423  17.109  -4.112  1.00 0.60 ? 12  DG  B C6     3  
ATOM 5705  O O6     . DG  A 1 12 ? -77.932  16.534  -3.149  1.00 0.62 ? 12  DG  B O6     3  
ATOM 5706  N N1     . DG  A 1 12 ? -78.189  17.400  -5.231  1.00 0.56 ? 12  DG  B N1     3  
ATOM 5707  C C2     . DG  A 1 12 ? -77.729  18.022  -6.368  1.00 0.55 ? 12  DG  B C2     3  
ATOM 5708  N N2     . DG  A 1 12 ? -78.626  18.207  -7.335  1.00 0.55 ? 12  DG  B N2     3  
ATOM 5709  N N3     . DG  A 1 12 ? -76.466  18.432  -6.531  1.00 0.58 ? 12  DG  B N3     3  
ATOM 5710  C C4     . DG  A 1 12 ? -75.698  18.160  -5.447  1.00 0.61 ? 12  DG  B C4     3  
ATOM 5711  H "H5'"  . DG  A 1 12 ? -70.376  17.159  -6.258  1.00 0.79 ? 12  DG  B "H5'"  3  
ATOM 5712  H "H5''" . DG  A 1 12 ? -69.169  18.398  -6.644  1.00 0.82 ? 12  DG  B "H5''" 3  
ATOM 5713  H "H4'"  . DG  A 1 12 ? -70.926  19.189  -7.922  1.00 0.75 ? 12  DG  B "H4'"  3  
ATOM 5714  H "H3'"  . DG  A 1 12 ? -70.741  20.565  -5.390  1.00 0.77 ? 12  DG  B "H3'"  3  
ATOM 5715  H "H2'"  . DG  A 1 12 ? -72.877  20.318  -4.623  1.00 0.75 ? 12  DG  B "H2'"  3  
ATOM 5716  H "H2''" . DG  A 1 12 ? -73.388  21.295  -6.024  1.00 0.73 ? 12  DG  B "H2''" 3  
ATOM 5717  H "H1'"  . DG  A 1 12 ? -74.168  19.476  -7.147  1.00 0.66 ? 12  DG  B "H1'"  3  
ATOM 5718  H H8     . DG  A 1 12 ? -73.028  18.122  -3.654  1.00 0.75 ? 12  DG  B H8     3  
ATOM 5719  H H1     . DG  A 1 12 ? -79.163  17.139  -5.184  1.00 0.56 ? 12  DG  B H1     3  
ATOM 5720  H H21    . DG  A 1 12 ? -79.577  17.894  -7.207  1.00 0.55 ? 12  DG  B H21    3  
ATOM 5721  H H22    . DG  A 1 12 ? -78.355  18.653  -8.198  1.00 0.57 ? 12  DG  B H22    3  
ATOM 5722  P P      . DT  A 1 13 ? -71.458  23.009  -6.693  1.00 0.79 ? 13  DT  B P      3  
ATOM 5723  O OP1    . DT  A 1 13 ? -70.477  23.830  -7.440  1.00 0.87 ? 13  DT  B OP1    3  
ATOM 5724  O OP2    . DT  A 1 13 ? -71.457  23.030  -5.213  1.00 0.82 ? 13  DT  B OP2    3  
ATOM 5725  O "O5'"  . DT  A 1 13 ? -72.947  23.395  -7.199  1.00 0.71 ? 13  DT  B "O5'"  3  
ATOM 5726  C "C5'"  . DT  A 1 13 ? -73.189  23.740  -8.565  1.00 0.85 ? 13  DT  B "C5'"  3  
ATOM 5727  C "C4'"  . DT  A 1 13 ? -74.689  23.918  -8.862  1.00 0.76 ? 13  DT  B "C4'"  3  
ATOM 5728  O "O4'"  . DT  A 1 13 ? -75.456  22.869  -8.220  1.00 0.69 ? 13  DT  B "O4'"  3  
ATOM 5729  C "C3'"  . DT  A 1 13 ? -75.231  25.266  -8.362  1.00 0.75 ? 13  DT  B "C3'"  3  
ATOM 5730  O "O3'"  . DT  A 1 13 ? -75.878  25.970  -9.420  1.00 0.80 ? 13  DT  B "O3'"  3  
ATOM 5731  C "C2'"  . DT  A 1 13 ? -76.241  24.928  -7.291  1.00 0.67 ? 13  DT  B "C2'"  3  
ATOM 5732  C "C1'"  . DT  A 1 13 ? -76.505  23.435  -7.404  1.00 0.63 ? 13  DT  B "C1'"  3  
ATOM 5733  N N1     . DT  A 1 13 ? -76.550  22.796  -6.056  1.00 0.59 ? 13  DT  B N1     3  
ATOM 5734  C C2     . DT  A 1 13 ? -77.736  22.186  -5.669  1.00 0.56 ? 13  DT  B C2     3  
ATOM 5735  O O2     . DT  A 1 13 ? -78.730  22.178  -6.392  1.00 0.57 ? 13  DT  B O2     3  
ATOM 5736  N N3     . DT  A 1 13 ? -77.740  21.592  -4.421  1.00 0.57 ? 13  DT  B N3     3  
ATOM 5737  C C4     . DT  A 1 13 ? -76.681  21.555  -3.530  1.00 0.59 ? 13  DT  B C4     3  
ATOM 5738  O O4     . DT  A 1 13 ? -76.793  20.994  -2.442  1.00 0.62 ? 13  DT  B O4     3  
ATOM 5739  C C5     . DT  A 1 13 ? -75.485  22.213  -4.009  1.00 0.62 ? 13  DT  B C5     3  
ATOM 5740  C C7     . DT  A 1 13 ? -74.247  22.245  -3.107  1.00 0.69 ? 13  DT  B C7     3  
ATOM 5741  C C6     . DT  A 1 13 ? -75.452  22.802  -5.227  1.00 0.62 ? 13  DT  B C6     3  
ATOM 5742  H "H5'"  . DT  A 1 13 ? -72.793  22.953  -9.203  1.00 0.98 ? 13  DT  B "H5'"  3  
ATOM 5743  H "H5''" . DT  A 1 13 ? -72.670  24.668  -8.795  1.00 1.03 ? 13  DT  B "H5''" 3  
ATOM 5744  H "H4'"  . DT  A 1 13 ? -74.842  23.856  -9.940  1.00 0.81 ? 13  DT  B "H4'"  3  
ATOM 5745  H "H3'"  . DT  A 1 13 ? -74.433  25.885  -7.945  1.00 0.80 ? 13  DT  B "H3'"  3  
ATOM 5746  H "H2'"  . DT  A 1 13 ? -75.839  25.164  -6.303  1.00 0.69 ? 13  DT  B "H2'"  3  
ATOM 5747  H "H2''" . DT  A 1 13 ? -77.163  25.491  -7.461  1.00 0.68 ? 13  DT  B "H2''" 3  
ATOM 5748  H "H1'"  . DT  A 1 13 ? -77.459  23.283  -7.918  1.00 0.62 ? 13  DT  B "H1'"  3  
ATOM 5749  H H3     . DT  A 1 13 ? -78.596  21.138  -4.132  1.00 0.57 ? 13  DT  B H3     3  
ATOM 5750  H H71    . DT  A 1 13 ? -73.353  22.427  -3.707  1.00 1.29 ? 13  DT  B H71    3  
ATOM 5751  H H72    . DT  A 1 13 ? -74.149  21.287  -2.595  1.00 1.19 ? 13  DT  B H72    3  
ATOM 5752  H H73    . DT  A 1 13 ? -74.356  23.040  -2.368  1.00 1.26 ? 13  DT  B H73    3  
ATOM 5753  H H6     . DT  A 1 13 ? -74.536  23.291  -5.558  1.00 0.66 ? 13  DT  B H6     3  
ATOM 5754  P P      . DT  A 1 14 ? -76.457  27.447  -9.162  1.00 0.83 ? 14  DT  B P      3  
ATOM 5755  O OP1    . DT  A 1 14 ? -76.414  28.191  -10.440 1.00 0.94 ? 14  DT  B OP1    3  
ATOM 5756  O OP2    . DT  A 1 14 ? -75.786  27.998  -7.966  1.00 0.85 ? 14  DT  B OP2    3  
ATOM 5757  O "O5'"  . DT  A 1 14 ? -77.998  27.165  -8.784  1.00 0.74 ? 14  DT  B "O5'"  3  
ATOM 5758  C "C5'"  . DT  A 1 14 ? -78.929  26.759  -9.785  1.00 0.84 ? 14  DT  B "C5'"  3  
ATOM 5759  C "C4'"  . DT  A 1 14 ? -80.300  26.417  -9.195  1.00 0.77 ? 14  DT  B "C4'"  3  
ATOM 5760  O "O4'"  . DT  A 1 14 ? -80.152  25.550  -8.044  1.00 0.71 ? 14  DT  B "O4'"  3  
ATOM 5761  C "C3'"  . DT  A 1 14 ? -81.066  27.669  -8.742  1.00 0.78 ? 14  DT  B "C3'"  3  
ATOM 5762  O "O3'"  . DT  A 1 14 ? -82.350  27.714  -9.369  1.00 0.82 ? 14  DT  B "O3'"  3  
ATOM 5763  C "C2'"  . DT  A 1 14 ? -81.241  27.510  -7.244  1.00 0.73 ? 14  DT  B "C2'"  3  
ATOM 5764  C "C1'"  . DT  A 1 14 ? -80.935  26.052  -6.943  1.00 0.67 ? 14  DT  B "C1'"  3  
ATOM 5765  N N1     . DT  A 1 14 ? -80.207  25.892  -5.652  1.00 0.63 ? 14  DT  B N1     3  
ATOM 5766  C C2     . DT  A 1 14 ? -80.806  25.132  -4.656  1.00 0.59 ? 14  DT  B C2     3  
ATOM 5767  O O2     . DT  A 1 14 ? -81.919  24.632  -4.796  1.00 0.59 ? 14  DT  B O2     3  
ATOM 5768  N N3     . DT  A 1 14 ? -80.082  24.976  -3.490  1.00 0.58 ? 14  DT  B N3     3  
ATOM 5769  C C4     . DT  A 1 14 ? -78.831  25.505  -3.231  1.00 0.62 ? 14  DT  B C4     3  
ATOM 5770  O O4     . DT  A 1 14 ? -78.273  25.295  -2.155  1.00 0.64 ? 14  DT  B O4     3  
ATOM 5771  C C5     . DT  A 1 14 ? -78.286  26.288  -4.320  1.00 0.67 ? 14  DT  B C5     3  
ATOM 5772  C C7     . DT  A 1 14 ? -76.917  26.951  -4.162  1.00 0.76 ? 14  DT  B C7     3  
ATOM 5773  C C6     . DT  A 1 14 ? -78.974  26.453  -5.469  1.00 0.67 ? 14  DT  B C6     3  
ATOM 5774  H "H5'"  . DT  A 1 14 ? -78.539  25.883  -10.303 1.00 0.98 ? 14  DT  B "H5'"  3  
ATOM 5775  H "H5''" . DT  A 1 14 ? -79.051  27.567  -10.505 1.00 0.95 ? 14  DT  B "H5''" 3  
ATOM 5776  H "H4'"  . DT  A 1 14 ? -80.891  25.896  -9.950  1.00 0.80 ? 14  DT  B "H4'"  3  
ATOM 5777  H "H3'"  . DT  A 1 14 ? -80.505  28.583  -8.965  1.00 0.82 ? 14  DT  B "H3'"  3  
ATOM 5778  H "H2'"  . DT  A 1 14 ? -80.549  28.159  -6.707  1.00 0.76 ? 14  DT  B "H2'"  3  
ATOM 5779  H "H2''" . DT  A 1 14 ? -82.265  27.745  -6.960  1.00 0.77 ? 14  DT  B "H2''" 3  
ATOM 5780  H "H1'"  . DT  A 1 14 ? -81.874  25.491  -6.912  1.00 0.67 ? 14  DT  B "H1'"  3  
ATOM 5781  H H3     . DT  A 1 14 ? -80.503  24.417  -2.761  1.00 0.57 ? 14  DT  B H3     3  
ATOM 5782  H H71    . DT  A 1 14 ? -77.037  27.918  -3.675  1.00 1.13 ? 14  DT  B H71    3  
ATOM 5783  H H72    . DT  A 1 14 ? -76.461  27.095  -5.141  1.00 1.27 ? 14  DT  B H72    3  
ATOM 5784  H H73    . DT  A 1 14 ? -76.274  26.315  -3.551  1.00 1.35 ? 14  DT  B H73    3  
ATOM 5785  H H6     . DT  A 1 14 ? -78.536  27.048  -6.270  1.00 0.73 ? 14  DT  B H6     3  
ATOM 5786  P P      . DC  A 1 15 ? -83.365  28.929  -9.082  1.00 0.87 ? 15  DC  B P      3  
ATOM 5787  O OP1    . DC  A 1 15 ? -84.063  29.262  -10.346 1.00 1.04 ? 15  DC  B OP1    3  
ATOM 5788  O OP2    . DC  A 1 15 ? -82.626  29.981  -8.348  1.00 0.93 ? 15  DC  B OP2    3  
ATOM 5789  O "O5'"  . DC  A 1 15 ? -84.431  28.263  -8.067  1.00 0.78 ? 15  DC  B "O5'"  3  
ATOM 5790  C "C5'"  . DC  A 1 15 ? -85.195  27.113  -8.448  1.00 0.88 ? 15  DC  B "C5'"  3  
ATOM 5791  C "C4'"  . DC  A 1 15 ? -86.397  26.881  -7.515  1.00 0.86 ? 15  DC  B "C4'"  3  
ATOM 5792  O "O4'"  . DC  A 1 15 ? -85.945  26.307  -6.266  1.00 0.80 ? 15  DC  B "O4'"  3  
ATOM 5793  C "C3'"  . DC  A 1 15 ? -87.144  28.185  -7.195  1.00 0.90 ? 15  DC  B "C3'"  3  
ATOM 5794  O "O3'"  . DC  A 1 15 ? -88.539  28.061  -7.504  1.00 1.04 ? 15  DC  B "O3'"  3  
ATOM 5795  C "C2'"  . DC  A 1 15 ? -86.967  28.408  -5.707  1.00 0.87 ? 15  DC  B "C2'"  3  
ATOM 5796  C "C1'"  . DC  A 1 15 ? -86.264  27.170  -5.150  1.00 0.79 ? 15  DC  B "C1'"  3  
ATOM 5797  N N1     . DC  A 1 15 ? -85.019  27.534  -4.414  1.00 0.72 ? 15  DC  B N1     3  
ATOM 5798  C C2     . DC  A 1 15 ? -84.861  27.068  -3.107  1.00 0.70 ? 15  DC  B C2     3  
ATOM 5799  O O2     . DC  A 1 15 ? -85.752  26.406  -2.579  1.00 0.74 ? 15  DC  B O2     3  
ATOM 5800  N N3     . DC  A 1 15 ? -83.710  27.370  -2.446  1.00 0.69 ? 15  DC  B N3     3  
ATOM 5801  C C4     . DC  A 1 15 ? -82.747  28.095  -3.033  1.00 0.71 ? 15  DC  B C4     3  
ATOM 5802  N N4     . DC  A 1 15 ? -81.629  28.359  -2.354  1.00 0.77 ? 15  DC  B N4     3  
ATOM 5803  C C5     . DC  A 1 15 ? -82.903  28.577  -4.370  1.00 0.72 ? 15  DC  B C5     3  
ATOM 5804  C C6     . DC  A 1 15 ? -84.045  28.277  -5.019  1.00 0.72 ? 15  DC  B C6     3  
ATOM 5805  H "H5'"  . DC  A 1 15 ? -84.551  26.234  -8.426  1.00 0.98 ? 15  DC  B "H5'"  3  
ATOM 5806  H "H5''" . DC  A 1 15 ? -85.562  27.252  -9.464  1.00 1.02 ? 15  DC  B "H5''" 3  
ATOM 5807  H "H4'"  . DC  A 1 15 ? -87.086  26.183  -7.990  1.00 0.95 ? 15  DC  B "H4'"  3  
ATOM 5808  H "H3'"  . DC  A 1 15 ? -86.722  29.023  -7.754  1.00 0.92 ? 15  DC  B "H3'"  3  
ATOM 5809  H "H2'"  . DC  A 1 15 ? -86.363  29.293  -5.530  1.00 0.86 ? 15  DC  B "H2'"  3  
ATOM 5810  H "H2''" . DC  A 1 15 ? -87.944  28.532  -5.235  1.00 0.96 ? 15  DC  B "H2''" 3  
ATOM 5811  H "H1'"  . DC  A 1 15 ? -86.950  26.635  -4.485  1.00 0.84 ? 15  DC  B "H1'"  3  
ATOM 5812  H H41    . DC  A 1 15 ? -81.518  28.017  -1.409  1.00 0.79 ? 15  DC  B H41    3  
ATOM 5813  H H42    . DC  A 1 15 ? -80.892  28.902  -2.781  1.00 0.82 ? 15  DC  B H42    3  
ATOM 5814  H H5     . DC  A 1 15 ? -82.124  29.172  -4.850  1.00 0.76 ? 15  DC  B H5     3  
ATOM 5815  H H6     . DC  A 1 15 ? -84.195  28.633  -6.038  1.00 0.75 ? 15  DC  B H6     3  
ATOM 5816  P P      . DG  A 1 16 ? -89.498  29.358  -7.478  1.00 1.15 ? 16  DG  B P      3  
ATOM 5817  O OP1    . DG  A 1 16 ? -90.719  29.054  -8.260  1.00 1.30 ? 16  DG  B OP1    3  
ATOM 5818  O OP2    . DG  A 1 16 ? -88.685  30.546  -7.813  1.00 1.12 ? 16  DG  B OP2    3  
ATOM 5819  O "O5'"  . DG  A 1 16 ? -89.912  29.445  -5.924  1.00 1.20 ? 16  DG  B "O5'"  3  
ATOM 5820  C "C5'"  . DG  A 1 16 ? -90.689  28.397  -5.336  1.00 1.29 ? 16  DG  B "C5'"  3  
ATOM 5821  C "C4'"  . DG  A 1 16 ? -90.945  28.635  -3.844  1.00 1.37 ? 16  DG  B "C4'"  3  
ATOM 5822  O "O4'"  . DG  A 1 16 ? -89.705  28.544  -3.102  1.00 1.23 ? 16  DG  B "O4'"  3  
ATOM 5823  C "C3'"  . DG  A 1 16 ? -91.557  30.017  -3.578  1.00 1.54 ? 16  DG  B "C3'"  3  
ATOM 5824  O "O3'"  . DG  A 1 16 ? -92.736  29.893  -2.773  1.00 1.74 ? 16  DG  B "O3'"  3  
ATOM 5825  C "C2'"  . DG  A 1 16 ? -90.489  30.786  -2.834  1.00 1.49 ? 16  DG  B "C2'"  3  
ATOM 5826  C "C1'"  . DG  A 1 16 ? -89.472  29.762  -2.357  1.00 1.31 ? 16  DG  B "C1'"  3  
ATOM 5827  N N9     . DG  A 1 16 ? -88.093  30.252  -2.553  1.00 1.20 ? 16  DG  B N9     3  
ATOM 5828  C C8     . DG  A 1 16 ? -87.502  30.718  -3.689  1.00 1.16 ? 16  DG  B C8     3  
ATOM 5829  N N7     . DG  A 1 16 ? -86.258  31.061  -3.566  1.00 1.12 ? 16  DG  B N7     3  
ATOM 5830  C C5     . DG  A 1 16 ? -85.988  30.806  -2.226  1.00 1.12 ? 16  DG  B C5     3  
ATOM 5831  C C6     . DG  A 1 16 ? -84.784  30.982  -1.492  1.00 1.12 ? 16  DG  B C6     3  
ATOM 5832  O O6     . DG  A 1 16 ? -83.703  31.407  -1.893  1.00 1.16 ? 16  DG  B O6     3  
ATOM 5833  N N1     . DG  A 1 16 ? -84.938  30.604  -0.166  1.00 1.14 ? 16  DG  B N1     3  
ATOM 5834  C C2     . DG  A 1 16 ? -86.103  30.118  0.389   1.00 1.17 ? 16  DG  B C2     3  
ATOM 5835  N N2     . DG  A 1 16 ? -86.066  29.833  1.691   1.00 1.23 ? 16  DG  B N2     3  
ATOM 5836  N N3     . DG  A 1 16 ? -87.235  29.948  -0.297  1.00 1.19 ? 16  DG  B N3     3  
ATOM 5837  C C4     . DG  A 1 16 ? -87.106  30.311  -1.595  1.00 1.16 ? 16  DG  B C4     3  
ATOM 5838  H "H5'"  . DG  A 1 16 ? -90.159  27.451  -5.461  1.00 1.24 ? 16  DG  B "H5'"  3  
ATOM 5839  H "H5''" . DG  A 1 16 ? -91.649  28.339  -5.853  1.00 1.40 ? 16  DG  B "H5''" 3  
ATOM 5840  H "H4'"  . DG  A 1 16 ? -91.631  27.869  -3.482  1.00 1.46 ? 16  DG  B "H4'"  3  
ATOM 5841  H "H3'"  . DG  A 1 16 ? -91.805  30.522  -4.516  1.00 1.57 ? 16  DG  B "H3'"  3  
ATOM 5842  H "H2'"  . DG  A 1 16 ? -90.008  31.504  -3.499  1.00 1.48 ? 16  DG  B "H2'"  3  
ATOM 5843  H "H2''" . DG  A 1 16 ? -90.927  31.305  -1.986  1.00 1.65 ? 16  DG  B "H2''" 3  
ATOM 5844  H "H1'"  . DG  A 1 16 ? -89.629  29.559  -1.296  1.00 1.36 ? 16  DG  B "H1'"  3  
ATOM 5845  H H8     . DG  A 1 16 ? -88.036  30.798  -4.634  1.00 1.20 ? 16  DG  B H8     3  
ATOM 5846  H H1     . DG  A 1 16 ? -84.119  30.693  0.417   1.00 1.17 ? 16  DG  B H1     3  
ATOM 5847  H H21    . DG  A 1 16 ? -85.212  29.960  2.211   1.00 1.24 ? 16  DG  B H21    3  
ATOM 5848  H H22    . DG  A 1 16 ? -86.894  29.492  2.158   1.00 1.29 ? 16  DG  B H22    3  
ATOM 5849  P P      . DA  A 1 17 ? -93.558  31.195  -2.287  1.00 1.98 ? 17  DA  B P      3  
ATOM 5850  O OP1    . DA  A 1 17 ? -94.938  30.773  -1.974  1.00 2.18 ? 17  DA  B OP1    3  
ATOM 5851  O OP2    . DA  A 1 17 ? -93.323  32.281  -3.265  1.00 1.99 ? 17  DA  B OP2    3  
ATOM 5852  O "O5'"  . DA  A 1 17 ? -92.820  31.581  -0.903  1.00 1.97 ? 17  DA  B "O5'"  3  
ATOM 5853  C "C5'"  . DA  A 1 17 ? -92.564  30.567  0.077   1.00 1.92 ? 17  DA  B "C5'"  3  
ATOM 5854  C "C4'"  . DA  A 1 17 ? -92.136  31.148  1.436   1.00 1.98 ? 17  DA  B "C4'"  3  
ATOM 5855  O "O4'"  . DA  A 1 17 ? -90.693  31.203  1.499   1.00 1.81 ? 17  DA  B "O4'"  3  
ATOM 5856  C "C3'"  . DA  A 1 17 ? -92.679  32.565  1.665   1.00 2.20 ? 17  DA  B "C3'"  3  
ATOM 5857  O "O3'"  . DA  A 1 17 ? -93.415  32.627  2.888   1.00 2.37 ? 17  DA  B "O3'"  3  
ATOM 5858  C "C2'"  . DA  A 1 17 ? -91.459  33.457  1.758   1.00 2.16 ? 17  DA  B "C2'"  3  
ATOM 5859  C "C1'"  . DA  A 1 17 ? -90.245  32.534  1.813   1.00 1.93 ? 17  DA  B "C1'"  3  
ATOM 5860  N N9     . DA  A 1 17 ? -89.193  32.982  0.875   1.00 1.82 ? 17  DA  B N9     3  
ATOM 5861  C C8     . DA  A 1 17 ? -89.296  33.327  -0.443  1.00 1.81 ? 17  DA  B C8     3  
ATOM 5862  N N7     . DA  A 1 17 ? -88.192  33.725  -0.998  1.00 1.74 ? 17  DA  B N7     3  
ATOM 5863  C C5     . DA  A 1 17 ? -87.269  33.638  0.044   1.00 1.71 ? 17  DA  B C5     3  
ATOM 5864  C C6     . DA  A 1 17 ? -85.900  33.920  0.125   1.00 1.69 ? 17  DA  B C6     3  
ATOM 5865  N N6     . DA  A 1 17 ? -85.185  34.368  -0.910  1.00 1.69 ? 17  DA  B N6     3  
ATOM 5866  N N1     . DA  A 1 17 ? -85.297  33.721  1.311   1.00 1.70 ? 17  DA  B N1     3  
ATOM 5867  C C2     . DA  A 1 17 ? -85.994  33.269  2.354   1.00 1.73 ? 17  DA  B C2     3  
ATOM 5868  N N3     . DA  A 1 17 ? -87.289  32.975  2.384   1.00 1.76 ? 17  DA  B N3     3  
ATOM 5869  C C4     . DA  A 1 17 ? -87.870  33.185  1.184   1.00 1.75 ? 17  DA  B C4     3  
ATOM 5870  H "H5'"  . DA  A 1 17 ? -91.774  29.916  -0.291  1.00 1.75 ? 17  DA  B "H5'"  3  
ATOM 5871  H "H5''" . DA  A 1 17 ? -93.471  29.978  0.213   1.00 2.01 ? 17  DA  B "H5''" 3  
ATOM 5872  H "H4'"  . DA  A 1 17 ? -92.495  30.497  2.235   1.00 2.02 ? 17  DA  B "H4'"  3  
ATOM 5873  H "H3'"  . DA  A 1 17 ? -93.317  32.880  0.833   1.00 2.27 ? 17  DA  B "H3'"  3  
ATOM 5874  H "HO3'" . DA  A 1 17 ? -94.163  32.033  2.801   1.00 2.51 ? 17  DA  B "HO3'" 3  
ATOM 5875  H "H2'"  . DA  A 1 17 ? -91.398  34.102  0.881   1.00 2.19 ? 17  DA  B "H2'"  3  
ATOM 5876  H "H2''" . DA  A 1 17 ? -91.514  34.067  2.661   1.00 2.30 ? 17  DA  B "H2''" 3  
ATOM 5877  H "H1'"  . DA  A 1 17 ? -89.836  32.533  2.827   1.00 1.95 ? 17  DA  B "H1'"  3  
ATOM 5878  H H8     . DA  A 1 17 ? -90.237  33.278  -0.988  1.00 1.87 ? 17  DA  B H8     3  
ATOM 5879  H H61    . DA  A 1 17 ? -84.200  34.556  -0.804  1.00 1.71 ? 17  DA  B H61    3  
ATOM 5880  H H62    . DA  A 1 17 ? -85.633  34.522  -1.803  1.00 1.70 ? 17  DA  B H62    3  
ATOM 5881  H H2     . DA  A 1 17 ? -85.444  33.124  3.283   1.00 1.75 ? 17  DA  B H2     3  
ATOM 5882  O "O5'"  . DT  B 2 1  ? -77.288  35.997  2.452   1.00 2.31 ? 18  DT  C "O5'"  3  
ATOM 5883  C "C5'"  . DT  B 2 1  ? -77.036  36.208  3.845   1.00 2.42 ? 18  DT  C "C5'"  3  
ATOM 5884  C "C4'"  . DT  B 2 1  ? -78.007  35.410  4.725   1.00 2.29 ? 18  DT  C "C4'"  3  
ATOM 5885  O "O4'"  . DT  B 2 1  ? -79.371  35.766  4.389   1.00 2.25 ? 18  DT  C "O4'"  3  
ATOM 5886  C "C3'"  . DT  B 2 1  ? -77.849  33.895  4.526   1.00 2.08 ? 18  DT  C "C3'"  3  
ATOM 5887  O "O3'"  . DT  B 2 1  ? -77.664  33.216  5.770   1.00 2.08 ? 18  DT  C "O3'"  3  
ATOM 5888  C "C2'"  . DT  B 2 1  ? -79.139  33.432  3.889   1.00 1.90 ? 18  DT  C "C2'"  3  
ATOM 5889  C "C1'"  . DT  B 2 1  ? -80.106  34.611  3.925   1.00 2.02 ? 18  DT  C "C1'"  3  
ATOM 5890  N N1     . DT  B 2 1  ? -80.669  34.851  2.571   1.00 1.96 ? 18  DT  C N1     3  
ATOM 5891  C C2     . DT  B 2 1  ? -81.992  34.494  2.328   1.00 1.85 ? 18  DT  C C2     3  
ATOM 5892  O O2     . DT  B 2 1  ? -82.711  34.003  3.198   1.00 1.82 ? 18  DT  C O2     3  
ATOM 5893  N N3     . DT  B 2 1  ? -82.454  34.717  1.046   1.00 1.82 ? 18  DT  C N3     3  
ATOM 5894  C C4     . DT  B 2 1  ? -81.730  35.258  -0.001  1.00 1.88 ? 18  DT  C C4     3  
ATOM 5895  O O4     . DT  B 2 1  ? -82.245  35.410  -1.107  1.00 1.86 ? 18  DT  C O4     3  
ATOM 5896  C C5     . DT  B 2 1  ? -80.372  35.607  0.344   1.00 2.00 ? 18  DT  C C5     3  
ATOM 5897  C C7     . DT  B 2 1  ? -79.469  36.245  -0.708  1.00 2.11 ? 18  DT  C C7     3  
ATOM 5898  C C6     . DT  B 2 1  ? -79.892  35.398  1.586   1.00 2.04 ? 18  DT  C C6     3  
ATOM 5899  H "H5'"  . DT  B 2 1  ? -77.142  37.269  4.069   1.00 2.56 ? 18  DT  C "H5'"  3  
ATOM 5900  H "H5''" . DT  B 2 1  ? -76.017  35.898  4.073   1.00 2.50 ? 18  DT  C "H5''" 3  
ATOM 5901  H "H4'"  . DT  B 2 1  ? -77.823  35.655  5.769   1.00 2.39 ? 18  DT  C "H4'"  3  
ATOM 5902  H "H3'"  . DT  B 2 1  ? -77.004  33.675  3.867   1.00 2.09 ? 18  DT  C "H3'"  3  
ATOM 5903  H "H2'"  . DT  B 2 1  ? -78.963  33.130  2.854   1.00 1.83 ? 18  DT  C "H2'"  3  
ATOM 5904  H "H2''" . DT  B 2 1  ? -79.546  32.590  4.454   1.00 1.80 ? 18  DT  C "H2''" 3  
ATOM 5905  H "H1'"  . DT  B 2 1  ? -80.913  34.402  4.636   1.00 2.01 ? 18  DT  C "H1'"  3  
ATOM 5906  H H3     . DT  B 2 1  ? -83.412  34.467  0.859   1.00 1.76 ? 18  DT  C H3     3  
ATOM 5907  H H71    . DT  B 2 1  ? -79.404  37.319  -0.526  1.00 2.51 ? 18  DT  C H71    3  
ATOM 5908  H H72    . DT  B 2 1  ? -79.881  36.071  -1.700  1.00 2.15 ? 18  DT  C H72    3  
ATOM 5909  H H73    . DT  B 2 1  ? -78.473  35.807  -0.650  1.00 2.37 ? 18  DT  C H73    3  
ATOM 5910  H H6     . DT  B 2 1  ? -78.860  35.665  1.811   1.00 2.15 ? 18  DT  C H6     3  
ATOM 5911  H "HO5'" . DT  B 2 1  ? -77.247  36.854  2.020   1.00 2.54 ? 18  DT  C "HO5'" 3  
ATOM 5912  P P      . DC  B 2 2  ? -77.388  31.629  5.768   1.00 1.92 ? 19  DC  C P      3  
ATOM 5913  O OP1    . DC  B 2 2  ? -76.533  31.300  6.933   1.00 2.02 ? 19  DC  C OP1    3  
ATOM 5914  O OP2    . DC  B 2 2  ? -76.952  31.247  4.409   1.00 1.85 ? 19  DC  C OP2    3  
ATOM 5915  O "O5'"  . DC  B 2 2  ? -78.853  31.004  6.016   1.00 1.76 ? 19  DC  C "O5'"  3  
ATOM 5916  C "C5'"  . DC  B 2 2  ? -79.412  30.968  7.331   1.00 1.85 ? 19  DC  C "C5'"  3  
ATOM 5917  C "C4'"  . DC  B 2 2  ? -80.643  30.047  7.418   1.00 1.66 ? 19  DC  C "C4'"  3  
ATOM 5918  O "O4'"  . DC  B 2 2  ? -81.653  30.498  6.483   1.00 1.61 ? 19  DC  C "O4'"  3  
ATOM 5919  C "C3'"  . DC  B 2 2  ? -80.314  28.580  7.091   1.00 1.50 ? 19  DC  C "C3'"  3  
ATOM 5920  O "O3'"  . DC  B 2 2  ? -80.725  27.716  8.159   1.00 1.49 ? 19  DC  C "O3'"  3  
ATOM 5921  C "C2'"  . DC  B 2 2  ? -81.114  28.249  5.847   1.00 1.32 ? 19  DC  C "C2'"  3  
ATOM 5922  C "C1'"  . DC  B 2 2  ? -82.017  29.446  5.561   1.00 1.39 ? 19  DC  C "C1'"  3  
ATOM 5923  N N1     . DC  B 2 2  ? -81.869  29.905  4.146   1.00 1.34 ? 19  DC  C N1     3  
ATOM 5924  C C2     . DC  B 2 2  ? -83.006  29.940  3.338   1.00 1.26 ? 19  DC  C C2     3  
ATOM 5925  O O2     . DC  B 2 2  ? -84.092  29.580  3.788   1.00 1.26 ? 19  DC  C O2     3  
ATOM 5926  N N3     . DC  B 2 2  ? -82.879  30.376  2.055   1.00 1.23 ? 19  DC  C N3     3  
ATOM 5927  C C4     . DC  B 2 2  ? -81.690  30.764  1.577   1.00 1.28 ? 19  DC  C C4     3  
ATOM 5928  N N4     . DC  B 2 2  ? -81.599  31.202  0.322   1.00 1.27 ? 19  DC  C N4     3  
ATOM 5929  C C5     . DC  B 2 2  ? -80.519  30.727  2.395   1.00 1.39 ? 19  DC  C C5     3  
ATOM 5930  C C6     . DC  B 2 2  ? -80.652  30.295  3.663   1.00 1.41 ? 19  DC  C C6     3  
ATOM 5931  H "H5'"  . DC  B 2 2  ? -79.710  31.979  7.615   1.00 2.01 ? 19  DC  C "H5'"  3  
ATOM 5932  H "H5''" . DC  B 2 2  ? -78.653  30.615  8.031   1.00 1.98 ? 19  DC  C "H5''" 3  
ATOM 5933  H "H4'"  . DC  B 2 2  ? -81.047  30.098  8.429   1.00 1.73 ? 19  DC  C "H4'"  3  
ATOM 5934  H "H3'"  . DC  B 2 2  ? -79.245  28.450  6.901   1.00 1.57 ? 19  DC  C "H3'"  3  
ATOM 5935  H "H2'"  . DC  B 2 2  ? -80.446  28.070  5.002   1.00 1.28 ? 19  DC  C "H2'"  3  
ATOM 5936  H "H2''" . DC  B 2 2  ? -81.716  27.357  6.028   1.00 1.23 ? 19  DC  C "H2''" 3  
ATOM 5937  H "H1'"  . DC  B 2 2  ? -83.057  29.164  5.757   1.00 1.35 ? 19  DC  C "H1'"  3  
ATOM 5938  H H41    . DC  B 2 2  ? -82.420  31.235  -0.262  1.00 1.22 ? 19  DC  C H41    3  
ATOM 5939  H H42    . DC  B 2 2  ? -80.708  31.504  -0.043  1.00 1.35 ? 19  DC  C H42    3  
ATOM 5940  H H5     . DC  B 2 2  ? -79.548  31.030  2.001   1.00 1.47 ? 19  DC  C H5     3  
ATOM 5941  H H6     . DC  B 2 2  ? -79.776  30.252  4.311   1.00 1.50 ? 19  DC  C H6     3  
ATOM 5942  P P      . DG  B 2 3  ? -80.097  26.236  8.310   1.00 1.42 ? 20  DG  C P      3  
ATOM 5943  O OP1    . DG  B 2 3  ? -80.188  25.840  9.735   1.00 1.52 ? 20  DG  C OP1    3  
ATOM 5944  O OP2    . DG  B 2 3  ? -78.788  26.210  7.624   1.00 1.46 ? 20  DG  C OP2    3  
ATOM 5945  O "O5'"  . DG  B 2 3  ? -81.126  25.322  7.469   1.00 1.23 ? 20  DG  C "O5'"  3  
ATOM 5946  C "C5'"  . DG  B 2 3  ? -82.270  24.758  8.108   1.00 1.25 ? 20  DG  C "C5'"  3  
ATOM 5947  C "C4'"  . DG  B 2 3  ? -83.184  24.030  7.117   1.00 1.10 ? 20  DG  C "C4'"  3  
ATOM 5948  O "O4'"  . DG  B 2 3  ? -83.413  24.861  5.953   1.00 1.05 ? 20  DG  C "O4'"  3  
ATOM 5949  C "C3'"  . DG  B 2 3  ? -82.585  22.699  6.637   1.00 1.01 ? 20  DG  C "C3'"  3  
ATOM 5950  O "O3'"  . DG  B 2 3  ? -83.511  21.630  6.837   1.00 0.98 ? 20  DG  C "O3'"  3  
ATOM 5951  C "C2'"  . DG  B 2 3  ? -82.331  22.883  5.156   1.00 0.91 ? 20  DG  C "C2'"  3  
ATOM 5952  C "C1'"  . DG  B 2 3  ? -83.053  24.157  4.747   1.00 0.92 ? 20  DG  C "C1'"  3  
ATOM 5953  N N9     . DG  B 2 3  ? -82.204  24.987  3.865   1.00 0.91 ? 20  DG  C N9     3  
ATOM 5954  C C8     . DG  B 2 3  ? -80.943  25.468  4.081   1.00 1.01 ? 20  DG  C C8     3  
ATOM 5955  N N7     . DG  B 2 3  ? -80.450  26.183  3.113   1.00 1.00 ? 20  DG  C N7     3  
ATOM 5956  C C5     . DG  B 2 3  ? -81.471  26.181  2.162   1.00 0.88 ? 20  DG  C C5     3  
ATOM 5957  C C6     . DG  B 2 3  ? -81.525  26.797  0.881   1.00 0.83 ? 20  DG  C C6     3  
ATOM 5958  O O6     . DG  B 2 3  ? -80.668  27.479  0.323   1.00 0.89 ? 20  DG  C O6     3  
ATOM 5959  N N1     . DG  B 2 3  ? -82.734  26.547  0.246   1.00 0.75 ? 20  DG  C N1     3  
ATOM 5960  C C2     . DG  B 2 3  ? -83.765  25.799  0.769   1.00 0.73 ? 20  DG  C C2     3  
ATOM 5961  N N2     . DG  B 2 3  ? -84.841  25.661  -0.009  1.00 0.72 ? 20  DG  C N2     3  
ATOM 5962  N N3     . DG  B 2 3  ? -83.722  25.219  1.974   1.00 0.76 ? 20  DG  C N3     3  
ATOM 5963  C C4     . DG  B 2 3  ? -82.549  25.450  2.613   1.00 0.83 ? 20  DG  C C4     3  
ATOM 5964  H "H5'"  . DG  B 2 3  ? -82.837  25.559  8.584   1.00 1.34 ? 20  DG  C "H5'"  3  
ATOM 5965  H "H5''" . DG  B 2 3  ? -81.942  24.054  8.874   1.00 1.32 ? 20  DG  C "H5''" 3  
ATOM 5966  H "H4'"  . DG  B 2 3  ? -84.140  23.831  7.603   1.00 1.13 ? 20  DG  C "H4'"  3  
ATOM 5967  H "H3'"  . DG  B 2 3  ? -81.650  22.473  7.160   1.00 1.08 ? 20  DG  C "H3'"  3  
ATOM 5968  H "H2'"  . DG  B 2 3  ? -81.261  22.985  4.965   1.00 0.95 ? 20  DG  C "H2'"  3  
ATOM 5969  H "H2''" . DG  B 2 3  ? -82.723  22.029  4.603   1.00 0.85 ? 20  DG  C "H2''" 3  
ATOM 5970  H "H1'"  . DG  B 2 3  ? -83.969  23.896  4.212   1.00 0.86 ? 20  DG  C "H1'"  3  
ATOM 5971  H H8     . DG  B 2 3  ? -80.384  25.258  4.993   1.00 1.10 ? 20  DG  C H8     3  
ATOM 5972  H H1     . DG  B 2 3  ? -82.846  26.956  -0.667  1.00 0.73 ? 20  DG  C H1     3  
ATOM 5973  H H21    . DG  B 2 3  ? -84.866  26.103  -0.917  1.00 0.71 ? 20  DG  C H21    3  
ATOM 5974  H H22    . DG  B 2 3  ? -85.629  25.115  0.309   1.00 0.74 ? 20  DG  C H22    3  
ATOM 5975  P P      . DA  B 2 4  ? -83.122  20.120  6.429   1.00 0.94 ? 21  DA  C P      3  
ATOM 5976  O OP1    . DA  B 2 4  ? -83.685  19.206  7.449   1.00 1.02 ? 21  DA  C OP1    3  
ATOM 5977  O OP2    . DA  B 2 4  ? -81.680  20.080  6.114   1.00 0.98 ? 21  DA  C OP2    3  
ATOM 5978  O "O5'"  . DA  B 2 4  ? -83.933  19.910  5.059   1.00 0.83 ? 21  DA  C "O5'"  3  
ATOM 5979  C "C5'"  . DA  B 2 4  ? -85.360  19.949  5.050   1.00 0.73 ? 21  DA  C "C5'"  3  
ATOM 5980  C "C4'"  . DA  B 2 4  ? -85.916  20.037  3.624   1.00 0.65 ? 21  DA  C "C4'"  3  
ATOM 5981  O "O4'"  . DA  B 2 4  ? -85.260  21.103  2.884   1.00 0.62 ? 21  DA  C "O4'"  3  
ATOM 5982  C "C3'"  . DA  B 2 4  ? -85.705  18.732  2.848   1.00 0.62 ? 21  DA  C "C3'"  3  
ATOM 5983  O "O3'"  . DA  B 2 4  ? -86.939  18.292  2.275   1.00 0.64 ? 21  DA  C "O3'"  3  
ATOM 5984  C "C2'"  . DA  B 2 4  ? -84.705  19.072  1.762   1.00 0.58 ? 21  DA  C "C2'"  3  
ATOM 5985  C "C1'"  . DA  B 2 4  ? -84.679  20.586  1.665   1.00 0.57 ? 21  DA  C "C1'"  3  
ATOM 5986  N N9     . DA  B 2 4  ? -83.297  21.072  1.467   1.00 0.55 ? 21  DA  C N9     3  
ATOM 5987  C C8     . DA  B 2 4  ? -82.190  20.868  2.240   1.00 0.58 ? 21  DA  C C8     3  
ATOM 5988  N N7     . DA  B 2 4  ? -81.100  21.416  1.796   1.00 0.58 ? 21  DA  C N7     3  
ATOM 5989  C C5     . DA  B 2 4  ? -81.516  22.043  0.622   1.00 0.54 ? 21  DA  C C5     3  
ATOM 5990  C C6     . DA  B 2 4  ? -80.840  22.806  -0.336  1.00 0.54 ? 21  DA  C C6     3  
ATOM 5991  N N6     . DA  B 2 4  ? -79.540  23.071  -0.262  1.00 0.59 ? 21  DA  C N6     3  
ATOM 5992  N N1     . DA  B 2 4  ? -81.553  23.275  -1.374  1.00 0.52 ? 21  DA  C N1     3  
ATOM 5993  C C2     . DA  B 2 4  ? -82.856  23.007  -1.469  1.00 0.50 ? 21  DA  C C2     3  
ATOM 5994  N N3     . DA  B 2 4  ? -83.591  22.296  -0.620  1.00 0.50 ? 21  DA  C N3     3  
ATOM 5995  C C4     . DA  B 2 4  ? -82.849  21.841  0.412   1.00 0.52 ? 21  DA  C C4     3  
ATOM 5996  H "H5'"  . DA  B 2 4  ? -85.697  20.817  5.618   1.00 0.76 ? 21  DA  C "H5'"  3  
ATOM 5997  H "H5''" . DA  B 2 4  ? -85.742  19.044  5.522   1.00 0.82 ? 21  DA  C "H5''" 3  
ATOM 5998  H "H4'"  . DA  B 2 4  ? -86.984  20.249  3.679   1.00 0.69 ? 21  DA  C "H4'"  3  
ATOM 5999  H "H3'"  . DA  B 2 4  ? -85.303  17.947  3.499   1.00 0.65 ? 21  DA  C "H3'"  3  
ATOM 6000  H "H2'"  . DA  B 2 4  ? -83.712  18.704  2.035   1.00 0.59 ? 21  DA  C "H2'"  3  
ATOM 6001  H "H2''" . DA  B 2 4  ? -85.011  18.635  0.811   1.00 0.60 ? 21  DA  C "H2''" 3  
ATOM 6002  H "H1'"  . DA  B 2 4  ? -85.290  20.905  0.818   1.00 0.58 ? 21  DA  C "H1'"  3  
ATOM 6003  H H8     . DA  B 2 4  ? -82.219  20.280  3.156   1.00 0.62 ? 21  DA  C H8     3  
ATOM 6004  H H61    . DA  B 2 4  ? -79.096  23.626  -0.979  1.00 0.60 ? 21  DA  C H61    3  
ATOM 6005  H H62    . DA  B 2 4  ? -78.996  22.715  0.509   1.00 0.62 ? 21  DA  C H62    3  
ATOM 6006  H H2     . DA  B 2 4  ? -83.372  23.417  -2.335  1.00 0.51 ? 21  DA  C H2     3  
ATOM 6007  P P      . DA  B 2 5  ? -86.988  16.981  1.345   1.00 0.68 ? 22  DA  C P      3  
ATOM 6008  O OP1    . DA  B 2 5  ? -88.395  16.533  1.248   1.00 0.83 ? 22  DA  C OP1    3  
ATOM 6009  O OP2    . DA  B 2 5  ? -85.943  16.045  1.816   1.00 0.67 ? 22  DA  C OP2    3  
ATOM 6010  O "O5'"  . DA  B 2 5  ? -86.541  17.566  -0.092  1.00 0.63 ? 22  DA  C "O5'"  3  
ATOM 6011  C "C5'"  . DA  B 2 5  ? -87.297  18.621  -0.695  1.00 0.62 ? 22  DA  C "C5'"  3  
ATOM 6012  C "C4'"  . DA  B 2 5  ? -87.038  18.742  -2.208  1.00 0.61 ? 22  DA  C "C4'"  3  
ATOM 6013  O "O4'"  . DA  B 2 5  ? -85.871  19.563  -2.449  1.00 0.58 ? 22  DA  C "O4'"  3  
ATOM 6014  C "C3'"  . DA  B 2 5  ? -86.799  17.377  -2.867  1.00 0.64 ? 22  DA  C "C3'"  3  
ATOM 6015  O "O3'"  . DA  B 2 5  ? -87.667  17.194  -3.990  1.00 0.72 ? 22  DA  C "O3'"  3  
ATOM 6016  C "C2'"  . DA  B 2 5  ? -85.359  17.395  -3.334  1.00 0.61 ? 22  DA  C "C2'"  3  
ATOM 6017  C "C1'"  . DA  B 2 5  ? -84.878  18.837  -3.209  1.00 0.57 ? 22  DA  C "C1'"  3  
ATOM 6018  N N9     . DA  B 2 5  ? -83.550  18.930  -2.555  1.00 0.53 ? 22  DA  C N9     3  
ATOM 6019  C C8     . DA  B 2 5  ? -83.086  18.318  -1.420  1.00 0.51 ? 22  DA  C C8     3  
ATOM 6020  N N7     . DA  B 2 5  ? -81.869  18.630  -1.084  1.00 0.50 ? 22  DA  C N7     3  
ATOM 6021  C C5     . DA  B 2 5  ? -81.485  19.526  -2.079  1.00 0.51 ? 22  DA  C C5     3  
ATOM 6022  C C6     . DA  B 2 5  ? -80.302  20.238  -2.315  1.00 0.53 ? 22  DA  C C6     3  
ATOM 6023  N N6     . DA  B 2 5  ? -79.226  20.158  -1.530  1.00 0.55 ? 22  DA  C N6     3  
ATOM 6024  N N1     . DA  B 2 5  ? -80.267  21.036  -3.395  1.00 0.57 ? 22  DA  C N1     3  
ATOM 6025  C C2     . DA  B 2 5  ? -81.326  21.132  -4.197  1.00 0.59 ? 22  DA  C C2     3  
ATOM 6026  N N3     . DA  B 2 5  ? -82.490  20.505  -4.066  1.00 0.57 ? 22  DA  C N3     3  
ATOM 6027  C C4     . DA  B 2 5  ? -82.501  19.713  -2.977  1.00 0.53 ? 22  DA  C C4     3  
ATOM 6028  H "H5'"  . DA  B 2 5  ? -87.037  19.561  -0.214  1.00 0.71 ? 22  DA  C "H5'"  3  
ATOM 6029  H "H5''" . DA  B 2 5  ? -88.356  18.425  -0.536  1.00 0.73 ? 22  DA  C "H5''" 3  
ATOM 6030  H "H4'"  . DA  B 2 5  ? -87.902  19.215  -2.677  1.00 0.65 ? 22  DA  C "H4'"  3  
ATOM 6031  H "H3'"  . DA  B 2 5  ? -86.953  16.566  -2.153  1.00 0.66 ? 22  DA  C "H3'"  3  
ATOM 6032  H "H2'"  . DA  B 2 5  ? -84.751  16.741  -2.710  1.00 0.59 ? 22  DA  C "H2'"  3  
ATOM 6033  H "H2''" . DA  B 2 5  ? -85.306  17.067  -4.373  1.00 0.66 ? 22  DA  C "H2''" 3  
ATOM 6034  H "H1'"  . DA  B 2 5  ? -84.808  19.282  -4.206  1.00 0.60 ? 22  DA  C "H1'"  3  
ATOM 6035  H H8     . DA  B 2 5  ? -83.689  17.621  -0.839  1.00 0.53 ? 22  DA  C H8     3  
ATOM 6036  H H61    . DA  B 2 5  ? -78.398  20.698  -1.749  1.00 0.59 ? 22  DA  C H61    3  
ATOM 6037  H H62    . DA  B 2 5  ? -79.238  19.563  -0.717  1.00 0.54 ? 22  DA  C H62    3  
ATOM 6038  H H2     . DA  B 2 5  ? -81.227  21.792  -5.056  1.00 0.64 ? 22  DA  C H2     3  
ATOM 6039  P P      . DC  B 2 6  ? -87.898  15.718  -4.592  1.00 0.73 ? 23  DC  C P      3  
ATOM 6040  O OP1    . DC  B 2 6  ? -89.288  15.632  -5.099  1.00 0.79 ? 23  DC  C OP1    3  
ATOM 6041  O OP2    . DC  B 2 6  ? -87.420  14.743  -3.587  1.00 0.77 ? 23  DC  C OP2    3  
ATOM 6042  O "O5'"  . DC  B 2 6  ? -86.888  15.678  -5.854  1.00 0.68 ? 23  DC  C "O5'"  3  
ATOM 6043  C "C5'"  . DC  B 2 6  ? -87.218  16.326  -7.092  1.00 0.69 ? 23  DC  C "C5'"  3  
ATOM 6044  C "C4'"  . DC  B 2 6  ? -85.975  16.564  -7.960  1.00 0.67 ? 23  DC  C "C4'"  3  
ATOM 6045  O "O4'"  . DC  B 2 6  ? -84.888  17.009  -7.112  1.00 0.69 ? 23  DC  C "O4'"  3  
ATOM 6046  C "C3'"  . DC  B 2 6  ? -85.511  15.286  -8.695  1.00 0.63 ? 23  DC  C "C3'"  3  
ATOM 6047  O "O3'"  . DC  B 2 6  ? -85.428  15.505  -10.114 1.00 0.62 ? 23  DC  C "O3'"  3  
ATOM 6048  C "C2'"  . DC  B 2 6  ? -84.129  15.003  -8.146  1.00 0.63 ? 23  DC  C "C2'"  3  
ATOM 6049  C "C1'"  . DC  B 2 6  ? -83.697  16.261  -7.411  1.00 0.66 ? 23  DC  C "C1'"  3  
ATOM 6050  N N1     . DC  B 2 6  ? -82.922  15.922  -6.182  1.00 0.67 ? 23  DC  C N1     3  
ATOM 6051  C C2     . DC  B 2 6  ? -81.588  16.316  -6.138  1.00 0.69 ? 23  DC  C C2     3  
ATOM 6052  O O2     . DC  B 2 6  ? -81.103  16.932  -7.082  1.00 0.70 ? 23  DC  C O2     3  
ATOM 6053  N N3     . DC  B 2 6  ? -80.853  16.003  -5.039  1.00 0.70 ? 23  DC  C N3     3  
ATOM 6054  C C4     . DC  B 2 6  ? -81.393  15.328  -4.019  1.00 0.70 ? 23  DC  C C4     3  
ATOM 6055  N N4     . DC  B 2 6  ? -80.631  15.031  -2.966  1.00 0.73 ? 23  DC  C N4     3  
ATOM 6056  C C5     . DC  B 2 6  ? -82.766  14.918  -4.050  1.00 0.68 ? 23  DC  C C5     3  
ATOM 6057  C C6     . DC  B 2 6  ? -83.492  15.235  -5.145  1.00 0.67 ? 23  DC  C C6     3  
ATOM 6058  H "H5'"  . DC  B 2 6  ? -87.686  17.287  -6.878  1.00 0.78 ? 23  DC  C "H5'"  3  
ATOM 6059  H "H5''" . DC  B 2 6  ? -87.924  15.706  -7.645  1.00 0.71 ? 23  DC  C "H5''" 3  
ATOM 6060  H "H4'"  . DC  B 2 6  ? -86.189  17.342  -8.694  1.00 0.68 ? 23  DC  C "H4'"  3  
ATOM 6061  H "H3'"  . DC  B 2 6  ? -86.177  14.446  -8.490  1.00 0.62 ? 23  DC  C "H3'"  3  
ATOM 6062  H "H2'"  . DC  B 2 6  ? -84.158  14.161  -7.453  1.00 0.64 ? 23  DC  C "H2'"  3  
ATOM 6063  H "H2''" . DC  B 2 6  ? -83.437  14.790  -8.958  1.00 0.63 ? 23  DC  C "H2''" 3  
ATOM 6064  H "H1'"  . DC  B 2 6  ? -83.079  16.868  -8.082  1.00 0.67 ? 23  DC  C "H1'"  3  
ATOM 6065  H H41    . DC  B 2 6  ? -79.663  15.321  -2.947  1.00 0.75 ? 23  DC  C H41    3  
ATOM 6066  H H42    . DC  B 2 6  ? -81.018  14.515  -2.189  1.00 0.74 ? 23  DC  C H42    3  
ATOM 6067  H H5     . DC  B 2 6  ? -83.211  14.371  -3.218  1.00 0.70 ? 23  DC  C H5     3  
ATOM 6068  H H6     . DC  B 2 6  ? -84.542  14.937  -5.204  1.00 0.66 ? 23  DC  C H6     3  
ATOM 6069  P P      . DT  B 2 7  ? -84.917  14.334  -11.110 1.00 0.60 ? 24  DT  C P      3  
ATOM 6070  O OP1    . DT  B 2 7  ? -85.737  14.366  -12.351 1.00 0.63 ? 24  DT  C OP1    3  
ATOM 6071  O OP2    . DT  B 2 7  ? -84.803  13.074  -10.335 1.00 0.59 ? 24  DT  C OP2    3  
ATOM 6072  O "O5'"  . DT  B 2 7  ? -83.432  14.834  -11.476 1.00 0.61 ? 24  DT  C "O5'"  3  
ATOM 6073  C "C5'"  . DT  B 2 7  ? -83.153  16.236  -11.500 1.00 0.64 ? 24  DT  C "C5'"  3  
ATOM 6074  C "C4'"  . DT  B 2 7  ? -81.727  16.547  -11.982 1.00 0.66 ? 24  DT  C "C4'"  3  
ATOM 6075  O "O4'"  . DT  B 2 7  ? -80.853  16.696  -10.839 1.00 0.67 ? 24  DT  C "O4'"  3  
ATOM 6076  C "C3'"  . DT  B 2 7  ? -81.158  15.438  -12.880 1.00 0.66 ? 24  DT  C "C3'"  3  
ATOM 6077  O "O3'"  . DT  B 2 7  ? -80.723  15.975  -14.134 1.00 0.74 ? 24  DT  C "O3'"  3  
ATOM 6078  C "C2'"  . DT  B 2 7  ? -79.972  14.869  -12.128 1.00 0.65 ? 24  DT  C "C2'"  3  
ATOM 6079  C "C1'"  . DT  B 2 7  ? -79.794  15.714  -10.861 1.00 0.64 ? 24  DT  C "C1'"  3  
ATOM 6080  N N1     . DT  B 2 7  ? -79.837  14.869  -9.626  1.00 0.60 ? 24  DT  C N1     3  
ATOM 6081  C C2     . DT  B 2 7  ? -78.806  15.004  -8.703  1.00 0.60 ? 24  DT  C C2     3  
ATOM 6082  O O2     . DT  B 2 7  ? -77.874  15.788  -8.877  1.00 0.64 ? 24  DT  C O2     3  
ATOM 6083  N N3     . DT  B 2 7  ? -78.887  14.208  -7.575  1.00 0.59 ? 24  DT  C N3     3  
ATOM 6084  C C4     . DT  B 2 7  ? -79.888  13.299  -7.289  1.00 0.58 ? 24  DT  C C4     3  
ATOM 6085  O O4     . DT  B 2 7  ? -79.856  12.638  -6.253  1.00 0.61 ? 24  DT  C O4     3  
ATOM 6086  C C5     . DT  B 2 7  ? -80.919  13.220  -8.302  1.00 0.58 ? 24  DT  C C5     3  
ATOM 6087  C C7     . DT  B 2 7  ? -82.079  12.239  -8.116  1.00 0.61 ? 24  DT  C C7     3  
ATOM 6088  C C6     . DT  B 2 7  ? -80.866  13.989  -9.411  1.00 0.58 ? 24  DT  C C6     3  
ATOM 6089  H "H5'"  . DT  B 2 7  ? -83.279  16.631  -10.494 1.00 0.67 ? 24  DT  C "H5'"  3  
ATOM 6090  H "H5''" . DT  B 2 7  ? -83.869  16.721  -12.163 1.00 0.67 ? 24  DT  C "H5''" 3  
ATOM 6091  H "H4'"  . DT  B 2 7  ? -81.732  17.484  -12.542 1.00 0.71 ? 24  DT  C "H4'"  3  
ATOM 6092  H "H3'"  . DT  B 2 7  ? -81.905  14.657  -13.057 1.00 0.65 ? 24  DT  C "H3'"  3  
ATOM 6093  H "H2'"  . DT  B 2 7  ? -80.154  13.834  -11.872 1.00 0.62 ? 24  DT  C "H2'"  3  
ATOM 6094  H "H2''" . DT  B 2 7  ? -79.080  14.933  -12.749 1.00 0.69 ? 24  DT  C "H2''" 3  
ATOM 6095  H "H1'"  . DT  B 2 7  ? -78.837  16.239  -10.915 1.00 0.68 ? 24  DT  C "H1'"  3  
ATOM 6096  H H3     . DT  B 2 7  ? -78.145  14.301  -6.898  1.00 0.60 ? 24  DT  C H3     3  
ATOM 6097  H H71    . DT  B 2 7  ? -81.727  11.225  -8.310  1.00 1.12 ? 24  DT  C H71    3  
ATOM 6098  H H72    . DT  B 2 7  ? -82.889  12.476  -8.809  1.00 1.24 ? 24  DT  C H72    3  
ATOM 6099  H H73    . DT  B 2 7  ? -82.449  12.305  -7.094  1.00 1.12 ? 24  DT  C H73    3  
ATOM 6100  H H6     . DT  B 2 7  ? -81.659  13.905  -10.152 1.00 0.60 ? 24  DT  C H6     3  
ATOM 6101  P P      . DT  B 2 8  ? -80.185  14.991  -15.292 1.00 0.79 ? 25  DT  C P      3  
ATOM 6102  O OP1    . DT  B 2 8  ? -80.155  15.735  -16.572 1.00 0.92 ? 25  DT  C OP1    3  
ATOM 6103  O OP2    . DT  B 2 8  ? -80.933  13.715  -15.202 1.00 0.79 ? 25  DT  C OP2    3  
ATOM 6104  O "O5'"  . DT  B 2 8  ? -78.669  14.719  -14.833 1.00 0.78 ? 25  DT  C "O5'"  3  
ATOM 6105  C "C5'"  . DT  B 2 8  ? -77.685  15.746  -14.959 1.00 0.86 ? 25  DT  C "C5'"  3  
ATOM 6106  C "C4'"  . DT  B 2 8  ? -76.321  15.297  -14.423 1.00 0.83 ? 25  DT  C "C4'"  3  
ATOM 6107  O "O4'"  . DT  B 2 8  ? -76.440  14.910  -13.029 1.00 0.77 ? 25  DT  C "O4'"  3  
ATOM 6108  C "C3'"  . DT  B 2 8  ? -75.772  14.092  -15.202 1.00 0.82 ? 25  DT  C "C3'"  3  
ATOM 6109  O "O3'"  . DT  B 2 8  ? -74.448  14.346  -15.682 1.00 0.87 ? 25  DT  C "O3'"  3  
ATOM 6110  C "C2'"  . DT  B 2 8  ? -75.729  12.964  -14.205 1.00 0.75 ? 25  DT  C "C2'"  3  
ATOM 6111  C "C1'"  . DT  B 2 8  ? -75.866  13.602  -12.829 1.00 0.72 ? 25  DT  C "C1'"  3  
ATOM 6112  N N1     . DT  B 2 8  ? -76.695  12.763  -11.904 1.00 0.66 ? 25  DT  C N1     3  
ATOM 6113  C C2     . DT  B 2 8  ? -76.119  12.365  -10.703 1.00 0.64 ? 25  DT  C C2     3  
ATOM 6114  O O2     . DT  B 2 8  ? -74.967  12.670  -10.399 1.00 0.67 ? 25  DT  C O2     3  
ATOM 6115  N N3     . DT  B 2 8  ? -76.910  11.603  -9.866  1.00 0.61 ? 25  DT  C N3     3  
ATOM 6116  C C4     . DT  B 2 8  ? -78.208  11.199  -10.112 1.00 0.59 ? 25  DT  C C4     3  
ATOM 6117  O O4     . DT  B 2 8  ? -78.821  10.526  -9.286  1.00 0.59 ? 25  DT  C O4     3  
ATOM 6118  C C5     . DT  B 2 8  ? -78.737  11.646  -11.379 1.00 0.61 ? 25  DT  C C5     3  
ATOM 6119  C C7     . DT  B 2 8  ? -80.166  11.234  -11.770 1.00 0.62 ? 25  DT  C C7     3  
ATOM 6120  C C6     . DT  B 2 8  ? -77.985  12.400  -12.222 1.00 0.65 ? 25  DT  C C6     3  
ATOM 6121  H "H5'"  . DT  B 2 8  ? -78.018  16.626  -14.405 1.00 0.92 ? 25  DT  C "H5'"  3  
ATOM 6122  H "H5''" . DT  B 2 8  ? -77.584  16.010  -16.015 1.00 0.98 ? 25  DT  C "H5''" 3  
ATOM 6123  H "H4'"  . DT  B 2 8  ? -75.619  16.126  -14.504 1.00 0.88 ? 25  DT  C "H4'"  3  
ATOM 6124  H "H3'"  . DT  B 2 8  ? -76.421  13.832  -16.042 1.00 0.85 ? 25  DT  C "H3'"  3  
ATOM 6125  H "H2'"  . DT  B 2 8  ? -76.544  12.263  -14.387 1.00 0.75 ? 25  DT  C "H2'"  3  
ATOM 6126  H "H2''" . DT  B 2 8  ? -74.780  12.448  -14.289 1.00 0.77 ? 25  DT  C "H2''" 3  
ATOM 6127  H "H1'"  . DT  B 2 8  ? -74.863  13.733  -12.405 1.00 0.73 ? 25  DT  C "H1'"  3  
ATOM 6128  H H3     . DT  B 2 8  ? -76.498  11.309  -8.992  1.00 0.62 ? 25  DT  C H3     3  
ATOM 6129  H H71    . DT  B 2 8  ? -80.874  11.668  -11.066 1.00 1.22 ? 25  DT  C H71    3  
ATOM 6130  H H72    . DT  B 2 8  ? -80.249  10.147  -11.737 1.00 1.15 ? 25  DT  C H72    3  
ATOM 6131  H H73    . DT  B 2 8  ? -80.399  11.584  -12.777 1.00 1.14 ? 25  DT  C H73    3  
ATOM 6132  H H6     . DT  B 2 8  ? -78.416  12.730  -13.167 1.00 0.68 ? 25  DT  C H6     3  
ATOM 6133  P P      . DC  B 2 9  ? -73.756  13.337  -16.734 1.00 0.90 ? 26  DC  C P      3  
ATOM 6134  O OP1    . DC  B 2 9  ? -73.131  14.150  -17.798 1.00 1.02 ? 26  DC  C OP1    3  
ATOM 6135  O OP2    . DC  B 2 9  ? -74.740  12.291  -17.090 1.00 0.93 ? 26  DC  C OP2    3  
ATOM 6136  O "O5'"  . DC  B 2 9  ? -72.581  12.655  -15.869 1.00 0.82 ? 26  DC  C "O5'"  3  
ATOM 6137  C "C5'"  . DC  B 2 9  ? -71.232  13.087  -16.048 1.00 1.02 ? 26  DC  C "C5'"  3  
ATOM 6138  C "C4'"  . DC  B 2 9  ? -70.235  12.285  -15.200 1.00 0.93 ? 26  DC  C "C4'"  3  
ATOM 6139  O "O4'"  . DC  B 2 9  ? -70.790  12.083  -13.878 1.00 0.84 ? 26  DC  C "O4'"  3  
ATOM 6140  C "C3'"  . DC  B 2 9  ? -69.921  10.900  -15.802 1.00 0.92 ? 26  DC  C "C3'"  3  
ATOM 6141  O "O3'"  . DC  B 2 9  ? -68.516  10.699  -15.962 1.00 0.99 ? 26  DC  C "O3'"  3  
ATOM 6142  C "C2'"  . DC  B 2 9  ? -70.439  9.901   -14.799 1.00 0.82 ? 26  DC  C "C2'"  3  
ATOM 6143  C "C1'"  . DC  B 2 9  ? -70.809  10.682  -13.545 1.00 0.76 ? 26  DC  C "C1'"  3  
ATOM 6144  N N1     . DC  B 2 9  ? -72.148  10.254  -13.047 1.00 0.70 ? 26  DC  C N1     3  
ATOM 6145  C C2     . DC  B 2 9  ? -72.228  9.692   -11.776 1.00 0.67 ? 26  DC  C C2     3  
ATOM 6146  O O2     . DC  B 2 9  ? -71.215  9.564   -11.095 1.00 0.70 ? 26  DC  C O2     3  
ATOM 6147  N N3     . DC  B 2 9  ? -73.443  9.286   -11.324 1.00 0.64 ? 26  DC  C N3     3  
ATOM 6148  C C4     . DC  B 2 9  ? -74.541  9.426   -12.077 1.00 0.64 ? 26  DC  C C4     3  
ATOM 6149  N N4     . DC  B 2 9  ? -75.717  9.005   -11.602 1.00 0.64 ? 26  DC  C N4     3  
ATOM 6150  C C5     . DC  B 2 9  ? -74.470  10.009  -13.377 1.00 0.69 ? 26  DC  C C5     3  
ATOM 6151  C C6     . DC  B 2 9  ? -73.260  10.408  -13.819 1.00 0.72 ? 26  DC  C C6     3  
ATOM 6152  H "H5'"  . DC  B 2 9  ? -71.162  14.138  -15.768 1.00 1.22 ? 26  DC  C "H5'"  3  
ATOM 6153  H "H5''" . DC  B 2 9  ? -70.968  12.988  -17.100 1.00 1.27 ? 26  DC  C "H5''" 3  
ATOM 6154  H "H4'"  . DC  B 2 9  ? -69.308  12.852  -15.116 1.00 0.98 ? 26  DC  C "H4'"  3  
ATOM 6155  H "H3'"  . DC  B 2 9  ? -70.423  10.765  -16.767 1.00 0.99 ? 26  DC  C "H3'"  3  
ATOM 6156  H "H2'"  . DC  B 2 9  ? -71.315  9.386   -15.195 1.00 0.83 ? 26  DC  C "H2'"  3  
ATOM 6157  H "H2''" . DC  B 2 9  ? -69.660  9.178   -14.572 1.00 0.84 ? 26  DC  C "H2''" 3  
ATOM 6158  H "H1'"  . DC  B 2 9  ? -70.051  10.504  -12.777 1.00 0.77 ? 26  DC  C "H1'"  3  
ATOM 6159  H H41    . DC  B 2 9  ? -75.769  8.589   -10.679 1.00 0.64 ? 26  DC  C H41    3  
ATOM 6160  H H42    . DC  B 2 9  ? -76.553  9.095   -12.162 1.00 0.67 ? 26  DC  C H42    3  
ATOM 6161  H H5     . DC  B 2 9  ? -75.364  10.136  -13.990 1.00 0.74 ? 26  DC  C H5     3  
ATOM 6162  H H6     . DC  B 2 9  ? -73.168  10.851  -14.811 1.00 0.79 ? 26  DC  C H6     3  
ATOM 6163  P P      . DC  B 2 10 ? -67.968  9.344   -16.650 1.00 1.07 ? 27  DC  C P      3  
ATOM 6164  O OP1    . DC  B 2 10 ? -66.551  9.562   -17.027 1.00 1.20 ? 27  DC  C OP1    3  
ATOM 6165  O OP2    . DC  B 2 10 ? -68.945  8.920   -17.681 1.00 1.12 ? 27  DC  C OP2    3  
ATOM 6166  O "O5'"  . DC  B 2 10 ? -68.007  8.270   -15.437 1.00 0.98 ? 27  DC  C "O5'"  3  
ATOM 6167  C "C5'"  . DC  B 2 10 ? -67.085  8.397   -14.348 1.00 0.97 ? 27  DC  C "C5'"  3  
ATOM 6168  C "C4'"  . DC  B 2 10 ? -67.001  7.139   -13.460 1.00 0.96 ? 27  DC  C "C4'"  3  
ATOM 6169  O "O4'"  . DC  B 2 10 ? -68.188  7.028   -12.640 1.00 0.87 ? 27  DC  C "O4'"  3  
ATOM 6170  C "C3'"  . DC  B 2 10 ? -66.858  5.842   -14.270 1.00 1.06 ? 27  DC  C "C3'"  3  
ATOM 6171  O "O3'"  . DC  B 2 10 ? -65.721  5.091   -13.826 1.00 1.19 ? 27  DC  C "O3'"  3  
ATOM 6172  C "C2'"  . DC  B 2 10 ? -68.122  5.052   -13.999 1.00 1.00 ? 27  DC  C "C2'"  3  
ATOM 6173  C "C1'"  . DC  B 2 10 ? -68.833  5.755   -12.841 1.00 0.88 ? 27  DC  C "C1'"  3  
ATOM 6174  N N1     . DC  B 2 10 ? -70.284  5.948   -13.114 1.00 0.79 ? 27  DC  C N1     3  
ATOM 6175  C C2     . DC  B 2 10 ? -71.194  5.461   -12.180 1.00 0.77 ? 27  DC  C C2     3  
ATOM 6176  O O2     . DC  B 2 10 ? -70.791  4.878   -11.178 1.00 0.85 ? 27  DC  C O2     3  
ATOM 6177  N N3     . DC  B 2 10 ? -72.520  5.648   -12.409 1.00 0.71 ? 27  DC  C N3     3  
ATOM 6178  C C4     . DC  B 2 10 ? -72.943  6.284   -13.505 1.00 0.69 ? 27  DC  C C4     3  
ATOM 6179  N N4     . DC  B 2 10 ? -74.248  6.461   -13.687 1.00 0.68 ? 27  DC  C N4     3  
ATOM 6180  C C5     . DC  B 2 10 ? -72.019  6.788   -14.470 1.00 0.74 ? 27  DC  C C5     3  
ATOM 6181  C C6     . DC  B 2 10 ? -70.709  6.600   -14.238 1.00 0.78 ? 27  DC  C C6     3  
ATOM 6182  H "H5'"  . DC  B 2 10 ? -67.394  9.240   -13.730 1.00 0.93 ? 27  DC  C "H5'"  3  
ATOM 6183  H "H5''" . DC  B 2 10 ? -66.099  8.603   -14.753 1.00 1.09 ? 27  DC  C "H5''" 3  
ATOM 6184  H "H4'"  . DC  B 2 10 ? -66.136  7.238   -12.807 1.00 1.01 ? 27  DC  C "H4'"  3  
ATOM 6185  H "H3'"  . DC  B 2 10 ? -66.763  6.057   -15.337 1.00 1.12 ? 27  DC  C "H3'"  3  
ATOM 6186  H "H2'"  . DC  B 2 10 ? -68.753  5.030   -14.886 1.00 0.99 ? 27  DC  C "H2'"  3  
ATOM 6187  H "H2''" . DC  B 2 10 ? -67.864  4.028   -13.715 1.00 1.08 ? 27  DC  C "H2''" 3  
ATOM 6188  H "H1'"  . DC  B 2 10 ? -68.702  5.154   -11.931 1.00 0.93 ? 27  DC  C "H1'"  3  
ATOM 6189  H H41    . DC  B 2 10 ? -74.903  6.111   -13.007 1.00 0.67 ? 27  DC  C H41    3  
ATOM 6190  H H42    . DC  B 2 10 ? -74.581  6.949   -14.505 1.00 0.72 ? 27  DC  C H42    3  
ATOM 6191  H H5     . DC  B 2 10 ? -72.364  7.301   -15.364 1.00 0.79 ? 27  DC  C H5     3  
ATOM 6192  H H6     . DC  B 2 10 ? -69.978  6.962   -14.961 1.00 0.85 ? 27  DC  C H6     3  
ATOM 6193  P P      . DG  B 2 11 ? -65.359  3.682   -14.520 1.00 1.36 ? 28  DG  C P      3  
ATOM 6194  O OP1    . DG  B 2 11 ? -63.967  3.327   -14.163 1.00 1.57 ? 28  DG  C OP1    3  
ATOM 6195  O OP2    . DG  B 2 11 ? -65.757  3.768   -15.943 1.00 1.38 ? 28  DG  C OP2    3  
ATOM 6196  O "O5'"  . DG  B 2 11 ? -66.359  2.649   -13.779 1.00 1.30 ? 28  DG  C "O5'"  3  
ATOM 6197  C "C5'"  . DG  B 2 11 ? -66.053  2.110   -12.487 1.00 1.31 ? 28  DG  C "C5'"  3  
ATOM 6198  C "C4'"  . DG  B 2 11 ? -67.201  1.248   -11.940 1.00 1.27 ? 28  DG  C "C4'"  3  
ATOM 6199  O "O4'"  . DG  B 2 11 ? -68.464  1.939   -12.110 1.00 1.22 ? 28  DG  C "O4'"  3  
ATOM 6200  C "C3'"  . DG  B 2 11 ? -67.308  -0.109  -12.654 1.00 1.26 ? 28  DG  C "C3'"  3  
ATOM 6201  O "O3'"  . DG  B 2 11 ? -67.297  -1.168  -11.693 1.00 1.31 ? 28  DG  C "O3'"  3  
ATOM 6202  C "C2'"  . DG  B 2 11 ? -68.640  -0.085  -13.371 1.00 1.20 ? 28  DG  C "C2'"  3  
ATOM 6203  C "C1'"  . DG  B 2 11 ? -69.404  1.104   -12.819 1.00 1.17 ? 28  DG  C "C1'"  3  
ATOM 6204  N N9     . DG  B 2 11 ? -70.082  1.854   -13.899 1.00 1.13 ? 28  DG  C N9     3  
ATOM 6205  C C8     . DG  B 2 11 ? -69.564  2.386   -15.049 1.00 1.15 ? 28  DG  C C8     3  
ATOM 6206  N N7     . DG  B 2 11 ? -70.420  3.022   -15.796 1.00 1.15 ? 28  DG  C N7     3  
ATOM 6207  C C5     . DG  B 2 11 ? -71.615  2.905   -15.084 1.00 1.10 ? 28  DG  C C5     3  
ATOM 6208  C C6     . DG  B 2 11 ? -72.915  3.396   -15.390 1.00 1.10 ? 28  DG  C C6     3  
ATOM 6209  O O6     . DG  B 2 11 ? -73.271  4.052   -16.367 1.00 1.13 ? 28  DG  C O6     3  
ATOM 6210  N N1     . DG  B 2 11 ? -73.836  3.052   -14.406 1.00 1.07 ? 28  DG  C N1     3  
ATOM 6211  C C2     . DG  B 2 11 ? -73.546  2.326   -13.269 1.00 1.06 ? 28  DG  C C2     3  
ATOM 6212  N N2     . DG  B 2 11 ? -74.562  2.092   -12.436 1.00 1.06 ? 28  DG  C N2     3  
ATOM 6213  N N3     . DG  B 2 11 ? -72.328  1.865   -12.978 1.00 1.08 ? 28  DG  C N3     3  
ATOM 6214  C C4     . DG  B 2 11 ? -71.415  2.189   -13.924 1.00 1.09 ? 28  DG  C C4     3  
ATOM 6215  H "H5'"  . DG  B 2 11 ? -65.868  2.932   -11.793 1.00 1.39 ? 28  DG  C "H5'"  3  
ATOM 6216  H "H5''" . DG  B 2 11 ? -65.153  1.498   -12.558 1.00 1.33 ? 28  DG  C "H5''" 3  
ATOM 6217  H "H4'"  . DG  B 2 11 ? -67.035  1.073   -10.877 1.00 1.32 ? 28  DG  C "H4'"  3  
ATOM 6218  H "H3'"  . DG  B 2 11 ? -66.491  -0.245  -13.370 1.00 1.29 ? 28  DG  C "H3'"  3  
ATOM 6219  H "H2'"  . DG  B 2 11 ? -68.494  0.038   -14.445 1.00 1.20 ? 28  DG  C "H2'"  3  
ATOM 6220  H "H2''" . DG  B 2 11 ? -69.182  -1.011  -13.175 1.00 1.20 ? 28  DG  C "H2''" 3  
ATOM 6221  H "H1'"  . DG  B 2 11 ? -70.157  0.750   -12.109 1.00 1.16 ? 28  DG  C "H1'"  3  
ATOM 6222  H H8     . DG  B 2 11 ? -68.515  2.280   -15.325 1.00 1.19 ? 28  DG  C H8     3  
ATOM 6223  H H1     . DG  B 2 11 ? -74.785  3.368   -14.554 1.00 1.07 ? 28  DG  C H1     3  
ATOM 6224  H H21    . DG  B 2 11 ? -75.485  2.439   -12.655 1.00 1.06 ? 28  DG  C H21    3  
ATOM 6225  H H22    . DG  B 2 11 ? -74.409  1.564   -11.587 1.00 1.08 ? 28  DG  C H22    3  
ATOM 6226  P P      . DG  B 2 12 ? -67.369  -2.710  -12.155 1.00 1.33 ? 29  DG  C P      3  
ATOM 6227  O OP1    . DG  B 2 12 ? -66.299  -3.450  -11.450 1.00 1.52 ? 29  DG  C OP1    3  
ATOM 6228  O OP2    . DG  B 2 12 ? -67.444  -2.751  -13.634 1.00 1.36 ? 29  DG  C OP2    3  
ATOM 6229  O "O5'"  . DG  B 2 12 ? -68.785  -3.192  -11.562 1.00 1.18 ? 29  DG  C "O5'"  3  
ATOM 6230  C "C5'"  . DG  B 2 12 ? -68.962  -3.368  -10.154 1.00 1.24 ? 29  DG  C "C5'"  3  
ATOM 6231  C "C4'"  . DG  B 2 12 ? -70.321  -3.993  -9.830  1.00 1.15 ? 29  DG  C "C4'"  3  
ATOM 6232  O "O4'"  . DG  B 2 12 ? -71.388  -3.231  -10.447 1.00 1.12 ? 29  DG  C "O4'"  3  
ATOM 6233  C "C3'"  . DG  B 2 12 ? -70.422  -5.437  -10.337 1.00 1.05 ? 29  DG  C "C3'"  3  
ATOM 6234  O "O3'"  . DG  B 2 12 ? -70.912  -6.290  -9.291  1.00 1.07 ? 29  DG  C "O3'"  3  
ATOM 6235  C "C2'"  . DG  B 2 12 ? -71.392  -5.369  -11.489 1.00 0.97 ? 29  DG  C "C2'"  3  
ATOM 6236  C "C1'"  . DG  B 2 12 ? -72.174  -4.089  -11.296 1.00 1.00 ? 29  DG  C "C1'"  3  
ATOM 6237  N N9     . DG  B 2 12 ? -72.453  -3.464  -12.597 1.00 0.97 ? 29  DG  C N9     3  
ATOM 6238  C C8     . DG  B 2 12 ? -71.580  -2.971  -13.522 1.00 1.00 ? 29  DG  C C8     3  
ATOM 6239  N N7     . DG  B 2 12 ? -72.130  -2.490  -14.595 1.00 0.99 ? 29  DG  C N7     3  
ATOM 6240  C C5     . DG  B 2 12 ? -73.491  -2.681  -14.366 1.00 0.96 ? 29  DG  C C5     3  
ATOM 6241  C C6     . DG  B 2 12 ? -74.605  -2.357  -15.182 1.00 0.97 ? 29  DG  C C6     3  
ATOM 6242  O O6     . DG  B 2 12 ? -74.608  -1.820  -16.287 1.00 1.00 ? 29  DG  C O6     3  
ATOM 6243  N N1     . DG  B 2 12 ? -75.801  -2.720  -14.576 1.00 0.97 ? 29  DG  C N1     3  
ATOM 6244  C C2     . DG  B 2 12 ? -75.915  -3.317  -13.335 1.00 0.96 ? 29  DG  C C2     3  
ATOM 6245  N N2     . DG  B 2 12 ? -77.153  -3.579  -12.908 1.00 1.00 ? 29  DG  C N2     3  
ATOM 6246  N N3     . DG  B 2 12 ? -74.868  -3.623  -12.567 1.00 0.95 ? 29  DG  C N3     3  
ATOM 6247  C C4     . DG  B 2 12 ? -73.695  -3.278  -13.144 1.00 0.95 ? 29  DG  C C4     3  
ATOM 6248  H "H5'"  . DG  B 2 12 ? -68.891  -2.397  -9.664  1.00 1.28 ? 29  DG  C "H5'"  3  
ATOM 6249  H "H5''" . DG  B 2 12 ? -68.174  -4.018  -9.773  1.00 1.42 ? 29  DG  C "H5''" 3  
ATOM 6250  H "H4'"  . DG  B 2 12 ? -70.464  -3.988  -8.746  1.00 1.22 ? 29  DG  C "H4'"  3  
ATOM 6251  H "H3'"  . DG  B 2 12 ? -69.450  -5.803  -10.683 1.00 1.07 ? 29  DG  C "H3'"  3  
ATOM 6252  H "H2'"  . DG  B 2 12 ? -70.852  -5.327  -12.438 1.00 0.97 ? 29  DG  C "H2'"  3  
ATOM 6253  H "H2''" . DG  B 2 12 ? -72.055  -6.225  -11.482 1.00 0.94 ? 29  DG  C "H2''" 3  
ATOM 6254  H "H1'"  . DG  B 2 12 ? -73.118  -4.314  -10.796 1.00 1.00 ? 29  DG  C "H1'"  3  
ATOM 6255  H H8     . DG  B 2 12 ? -70.500  -2.985  -13.369 1.00 1.05 ? 29  DG  C H8     3  
ATOM 6256  H H1     . DG  B 2 12 ? -76.639  -2.527  -15.101 1.00 1.00 ? 29  DG  C H1     3  
ATOM 6257  H H21    . DG  B 2 12 ? -77.949  -3.350  -13.488 1.00 1.04 ? 29  DG  C H21    3  
ATOM 6258  H H22    . DG  B 2 12 ? -77.294  -4.007  -12.003 1.00 1.02 ? 29  DG  C H22    3  
ATOM 6259  P P      . DC  B 2 13 ? -71.264  -7.842  -9.559  1.00 1.01 ? 30  DC  C P      3  
ATOM 6260  O OP1    . DC  B 2 13 ? -71.055  -8.582  -8.295  1.00 1.13 ? 30  DC  C OP1    3  
ATOM 6261  O OP2    . DC  B 2 13 ? -70.574  -8.275  -10.796 1.00 1.02 ? 30  DC  C OP2    3  
ATOM 6262  O "O5'"  . DC  B 2 13 ? -72.846  -7.787  -9.854  1.00 0.88 ? 30  DC  C "O5'"  3  
ATOM 6263  C "C5'"  . DC  B 2 13 ? -73.721  -7.075  -8.973  1.00 0.93 ? 30  DC  C "C5'"  3  
ATOM 6264  C "C4'"  . DC  B 2 13 ? -75.170  -7.576  -9.080  1.00 0.88 ? 30  DC  C "C4'"  3  
ATOM 6265  O "O4'"  . DC  B 2 13 ? -75.895  -6.752  -10.025 1.00 0.83 ? 30  DC  C "O4'"  3  
ATOM 6266  C "C3'"  . DC  B 2 13 ? -75.233  -9.030  -9.566  1.00 0.82 ? 30  DC  C "C3'"  3  
ATOM 6267  O "O3'"  . DC  B 2 13 ? -75.974  -9.850  -8.658  1.00 0.91 ? 30  DC  C "O3'"  3  
ATOM 6268  C "C2'"  . DC  B 2 13 ? -75.944  -8.984  -10.900 1.00 0.73 ? 30  DC  C "C2'"  3  
ATOM 6269  C "C1'"  . DC  B 2 13 ? -76.402  -7.545  -11.120 1.00 0.73 ? 30  DC  C "C1'"  3  
ATOM 6270  N N1     . DC  B 2 13 ? -75.911  -7.018  -12.427 1.00 0.66 ? 30  DC  C N1     3  
ATOM 6271  C C2     . DC  B 2 13 ? -76.844  -6.516  -13.331 1.00 0.64 ? 30  DC  C C2     3  
ATOM 6272  O O2     . DC  B 2 13 ? -78.038  -6.515  -13.041 1.00 0.69 ? 30  DC  C O2     3  
ATOM 6273  N N3     . DC  B 2 13 ? -76.397  -6.034  -14.524 1.00 0.62 ? 30  DC  C N3     3  
ATOM 6274  C C4     . DC  B 2 13 ? -75.090  -6.048  -14.820 1.00 0.62 ? 30  DC  C C4     3  
ATOM 6275  N N4     . DC  B 2 13 ? -74.669  -5.586  -15.998 1.00 0.65 ? 30  DC  C N4     3  
ATOM 6276  C C5     . DC  B 2 13 ? -74.132  -6.562  -13.899 1.00 0.63 ? 30  DC  C C5     3  
ATOM 6277  C C6     . DC  B 2 13 ? -74.581  -7.033  -12.726 1.00 0.65 ? 30  DC  C C6     3  
ATOM 6278  H "H5'"  . DC  B 2 13 ? -73.692  -6.014  -9.225  1.00 0.96 ? 30  DC  C "H5'"  3  
ATOM 6279  H "H5''" . DC  B 2 13 ? -73.371  -7.205  -7.948  1.00 1.02 ? 30  DC  C "H5''" 3  
ATOM 6280  H "H4'"  . DC  B 2 13 ? -75.651  -7.504  -8.104  1.00 0.97 ? 30  DC  C "H4'"  3  
ATOM 6281  H "H3'"  . DC  B 2 13 ? -74.227  -9.445  -9.687  1.00 0.82 ? 30  DC  C "H3'"  3  
ATOM 6282  H "H2'"  . DC  B 2 13 ? -75.271  -9.289  -11.695 1.00 0.69 ? 30  DC  C "H2'"  3  
ATOM 6283  H "H2''" . DC  B 2 13 ? -76.808  -9.647  -10.878 1.00 0.75 ? 30  DC  C "H2''" 3  
ATOM 6284  H "H1'"  . DC  B 2 13 ? -77.496  -7.509  -11.097 1.00 0.77 ? 30  DC  C "H1'"  3  
ATOM 6285  H H41    . DC  B 2 13 ? -75.327  -5.222  -16.665 1.00 0.67 ? 30  DC  C H41    3  
ATOM 6286  H H42    . DC  B 2 13 ? -73.684  -5.605  -16.221 1.00 0.67 ? 30  DC  C H42    3  
ATOM 6287  H H5     . DC  B 2 13 ? -73.069  -6.564  -14.136 1.00 0.66 ? 30  DC  C H5     3  
ATOM 6288  H H6     . DC  B 2 13 ? -73.879  -7.446  -12.006 1.00 0.69 ? 30  DC  C H6     3  
ATOM 6289  P P      . DT  B 2 14 ? -76.196  -11.415 -8.988  1.00 0.94 ? 31  DT  C P      3  
ATOM 6290  O OP1    . DT  B 2 14 ? -76.585  -12.108 -7.741  1.00 1.09 ? 31  DT  C OP1    3  
ATOM 6291  O OP2    . DT  B 2 14 ? -75.031  -11.891 -9.765  1.00 0.91 ? 31  DT  C OP2    3  
ATOM 6292  O "O5'"  . DT  B 2 14 ? -77.474  -11.384 -9.965  1.00 0.88 ? 31  DT  C "O5'"  3  
ATOM 6293  C "C5'"  . DT  B 2 14 ? -78.784  -11.248 -9.411  1.00 0.99 ? 31  DT  C "C5'"  3  
ATOM 6294  C "C4'"  . DT  B 2 14 ? -79.865  -11.151 -10.495 1.00 0.96 ? 31  DT  C "C4'"  3  
ATOM 6295  O "O4'"  . DT  B 2 14 ? -79.459  -10.181 -11.493 1.00 0.86 ? 31  DT  C "O4'"  3  
ATOM 6296  C "C3'"  . DT  B 2 14 ? -80.103  -12.497 -11.211 1.00 0.98 ? 31  DT  C "C3'"  3  
ATOM 6297  O "O3'"  . DT  B 2 14 ? -81.487  -12.871 -11.177 1.00 1.07 ? 31  DT  C "O3'"  3  
ATOM 6298  C "C2'"  . DT  B 2 14 ? -79.689  -12.262 -12.648 1.00 0.91 ? 31  DT  C "C2'"  3  
ATOM 6299  C "C1'"  . DT  B 2 14 ? -79.531  -10.752 -12.813 1.00 0.82 ? 31  DT  C "C1'"  3  
ATOM 6300  N N1     . DT  B 2 14 ? -78.323  -10.402 -13.623 1.00 0.73 ? 31  DT  C N1     3  
ATOM 6301  C C2     . DT  B 2 14 ? -78.517  -9.641  -14.772 1.00 0.70 ? 31  DT  C C2     3  
ATOM 6302  O O2     . DT  B 2 14 ? -79.632  -9.259  -15.119 1.00 0.76 ? 31  DT  C O2     3  
ATOM 6303  N N3     . DT  B 2 14 ? -77.385  -9.333  -15.501 1.00 0.66 ? 31  DT  C N3     3  
ATOM 6304  C C4     . DT  B 2 14 ? -76.089  -9.709  -15.195 1.00 0.64 ? 31  DT  C C4     3  
ATOM 6305  O O4     . DT  B 2 14 ? -75.153  -9.379  -15.922 1.00 0.64 ? 31  DT  C O4     3  
ATOM 6306  C C5     . DT  B 2 14 ? -75.970  -10.497 -13.985 1.00 0.68 ? 31  DT  C C5     3  
ATOM 6307  C C7     . DT  B 2 14 ? -74.578  -10.970 -13.540 1.00 0.72 ? 31  DT  C C7     3  
ATOM 6308  C C6     . DT  B 2 14 ? -77.065  -10.816 -13.249 1.00 0.72 ? 31  DT  C C6     3  
ATOM 6309  H "H5'"  . DT  B 2 14 ? -78.817  -10.345 -8.799  1.00 1.08 ? 31  DT  C "H5'"  3  
ATOM 6310  H "H5''" . DT  B 2 14 ? -78.991  -12.111 -8.780  1.00 1.13 ? 31  DT  C "H5''" 3  
ATOM 6311  H "H4'"  . DT  B 2 14 ? -80.797  -10.819 -10.035 1.00 1.02 ? 31  DT  C "H4'"  3  
ATOM 6312  H "H3'"  . DT  B 2 14 ? -79.496  -13.292 -10.765 1.00 1.02 ? 31  DT  C "H3'"  3  
ATOM 6313  H "H2'"  . DT  B 2 14 ? -78.749  -12.773 -12.860 1.00 0.90 ? 31  DT  C "H2'"  3  
ATOM 6314  H "H2''" . DT  B 2 14 ? -80.464  -12.633 -13.319 1.00 0.97 ? 31  DT  C "H2''" 3  
ATOM 6315  H "H1'"  . DT  B 2 14 ? -80.429  -10.359 -13.300 1.00 0.85 ? 31  DT  C "H1'"  3  
ATOM 6316  H H3     . DT  B 2 14 ? -77.519  -8.780  -16.340 1.00 0.67 ? 31  DT  C H3     3  
ATOM 6317  H H71    . DT  B 2 14 ? -74.633  -11.424 -12.549 1.00 1.28 ? 31  DT  C H71    3  
ATOM 6318  H H72    . DT  B 2 14 ? -73.902  -10.115 -13.506 1.00 1.20 ? 31  DT  C H72    3  
ATOM 6319  H H73    . DT  B 2 14 ? -74.198  -11.701 -14.249 1.00 1.26 ? 31  DT  C H73    3  
ATOM 6320  H H6     . DT  B 2 14 ? -76.947  -11.416 -12.347 1.00 0.78 ? 31  DT  C H6     3  
ATOM 6321  P P      . DC  B 2 15 ? -81.975  -14.262 -11.845 1.00 1.17 ? 32  DC  C P      3  
ATOM 6322  O OP1    . DC  B 2 15 ? -83.069  -14.823 -11.016 1.00 1.31 ? 32  DC  C OP1    3  
ATOM 6323  O OP2    . DC  B 2 15 ? -80.776  -15.083 -12.135 1.00 1.18 ? 32  DC  C OP2    3  
ATOM 6324  O "O5'"  . DC  B 2 15 ? -82.605  -13.788 -13.252 1.00 1.11 ? 32  DC  C "O5'"  3  
ATOM 6325  C "C5'"  . DC  B 2 15 ? -83.946  -13.301 -13.314 1.00 1.12 ? 32  DC  C "C5'"  3  
ATOM 6326  C "C4'"  . DC  B 2 15 ? -84.546  -13.425 -14.723 1.00 1.09 ? 32  DC  C "C4'"  3  
ATOM 6327  O "O4'"  . DC  B 2 15 ? -83.760  -12.642 -15.648 1.00 0.97 ? 32  DC  C "O4'"  3  
ATOM 6328  C "C3'"  . DC  B 2 15 ? -84.579  -14.877 -15.231 1.00 1.18 ? 32  DC  C "C3'"  3  
ATOM 6329  O "O3'"  . DC  B 2 15 ? -85.905  -15.237 -15.636 1.00 1.29 ? 32  DC  C "O3'"  3  
ATOM 6330  C "C2'"  . DC  B 2 15 ? -83.659  -14.912 -16.433 1.00 1.14 ? 32  DC  C "C2'"  3  
ATOM 6331  C "C1'"  . DC  B 2 15 ? -83.193  -13.476 -16.680 1.00 1.00 ? 32  DC  C "C1'"  3  
ATOM 6332  N N1     . DC  B 2 15 ? -81.703  -13.378 -16.664 1.00 0.92 ? 32  DC  C N1     3  
ATOM 6333  C C2     . DC  B 2 15 ? -81.070  -12.800 -17.762 1.00 0.87 ? 32  DC  C C2     3  
ATOM 6334  O O2     . DC  B 2 15 ? -81.739  -12.382 -18.704 1.00 0.89 ? 32  DC  C O2     3  
ATOM 6335  N N3     . DC  B 2 15 ? -79.712  -12.707 -17.755 1.00 0.83 ? 32  DC  C N3     3  
ATOM 6336  C C4     . DC  B 2 15 ? -78.995  -13.160 -16.716 1.00 0.84 ? 32  DC  C C4     3  
ATOM 6337  N N4     . DC  B 2 15 ? -77.662  -13.051 -16.737 1.00 0.83 ? 32  DC  C N4     3  
ATOM 6338  C C5     . DC  B 2 15 ? -79.640  -13.756 -15.585 1.00 0.91 ? 32  DC  C C5     3  
ATOM 6339  C C6     . DC  B 2 15 ? -80.986  -13.843 -15.601 1.00 0.94 ? 32  DC  C C6     3  
ATOM 6340  H "H5'"  . DC  B 2 15 ? -83.948  -12.249 -13.022 1.00 1.19 ? 32  DC  C "H5'"  3  
ATOM 6341  H "H5''" . DC  B 2 15 ? -84.563  -13.863 -12.613 1.00 1.24 ? 32  DC  C "H5''" 3  
ATOM 6342  H "H4'"  . DC  B 2 15 ? -85.562  -13.032 -14.709 1.00 1.13 ? 32  DC  C "H4'"  3  
ATOM 6343  H "H3'"  . DC  B 2 15 ? -84.225  -15.569 -14.461 1.00 1.25 ? 32  DC  C "H3'"  3  
ATOM 6344  H "H2'"  . DC  B 2 15 ? -82.804  -15.565 -16.244 1.00 1.16 ? 32  DC  C "H2'"  3  
ATOM 6345  H "H2''" . DC  B 2 15 ? -84.211  -15.279 -17.301 1.00 1.22 ? 32  DC  C "H2''" 3  
ATOM 6346  H "H1'"  . DC  B 2 15 ? -83.576  -13.136 -17.646 1.00 1.01 ? 32  DC  C "H1'"  3  
ATOM 6347  H H41    . DC  B 2 15 ? -77.200  -12.633 -17.532 1.00 0.81 ? 32  DC  C H41    3  
ATOM 6348  H H42    . DC  B 2 15 ? -77.114  -13.388 -15.955 1.00 0.87 ? 32  DC  C H42    3  
ATOM 6349  H H5     . DC  B 2 15 ? -79.065  -14.130 -14.739 1.00 0.95 ? 32  DC  C H5     3  
ATOM 6350  H H6     . DC  B 2 15 ? -81.509  -14.284 -14.754 1.00 1.01 ? 32  DC  C H6     3  
ATOM 6351  P P      . DG  B 2 16 ? -86.223  -16.705 -16.231 1.00 1.44 ? 33  DG  C P      3  
ATOM 6352  O OP1    . DG  B 2 16 ? -87.585  -17.090 -15.805 1.00 1.57 ? 33  DG  C OP1    3  
ATOM 6353  O OP2    . DG  B 2 16 ? -85.077  -17.592 -15.927 1.00 1.48 ? 33  DG  C OP2    3  
ATOM 6354  O "O5'"  . DG  B 2 16 ? -86.249  -16.439 -17.819 1.00 1.39 ? 33  DG  C "O5'"  3  
ATOM 6355  C "C5'"  . DG  B 2 16 ? -86.817  -15.235 -18.342 1.00 1.37 ? 33  DG  C "C5'"  3  
ATOM 6356  C "C4'"  . DG  B 2 16 ? -86.381  -14.984 -19.783 1.00 1.33 ? 33  DG  C "C4'"  3  
ATOM 6357  O "O4'"  . DG  B 2 16 ? -84.970  -14.668 -19.814 1.00 1.27 ? 33  DG  C "O4'"  3  
ATOM 6358  C "C3'"  . DG  B 2 16 ? -86.614  -16.204 -20.683 1.00 1.41 ? 33  DG  C "C3'"  3  
ATOM 6359  O "O3'"  . DG  B 2 16 ? -87.355  -15.820 -21.844 1.00 1.45 ? 33  DG  C "O3'"  3  
ATOM 6360  C "C2'"  . DG  B 2 16 ? -85.232  -16.682 -21.073 1.00 1.40 ? 33  DG  C "C2'"  3  
ATOM 6361  C "C1'"  . DG  B 2 16 ? -84.274  -15.560 -20.705 1.00 1.29 ? 33  DG  C "C1'"  3  
ATOM 6362  N N9     . DG  B 2 16 ? -83.041  -16.087 -20.082 1.00 1.26 ? 33  DG  C N9     3  
ATOM 6363  C C8     . DG  B 2 16 ? -82.902  -16.891 -18.986 1.00 1.31 ? 33  DG  C C8     3  
ATOM 6364  N N7     . DG  B 2 16 ? -81.674  -17.182 -18.667 1.00 1.30 ? 33  DG  C N7     3  
ATOM 6365  C C5     . DG  B 2 16 ? -80.925  -16.514 -19.635 1.00 1.23 ? 33  DG  C C5     3  
ATOM 6366  C C6     . DG  B 2 16 ? -79.514  -16.450 -19.814 1.00 1.21 ? 33  DG  C C6     3  
ATOM 6367  O O6     . DG  B 2 16 ? -78.635  -16.983 -19.143 1.00 1.25 ? 33  DG  C O6     3  
ATOM 6368  N N1     . DG  B 2 16 ? -79.173  -15.669 -20.911 1.00 1.17 ? 33  DG  C N1     3  
ATOM 6369  C C2     . DG  B 2 16 ? -80.070  -15.029 -21.737 1.00 1.16 ? 33  DG  C C2     3  
ATOM 6370  N N2     . DG  B 2 16 ? -79.542  -14.338 -22.749 1.00 1.15 ? 33  DG  C N2     3  
ATOM 6371  N N3     . DG  B 2 16 ? -81.398  -15.085 -21.573 1.00 1.18 ? 33  DG  C N3     3  
ATOM 6372  C C4     . DG  B 2 16 ? -81.753  -15.841 -20.506 1.00 1.21 ? 33  DG  C C4     3  
ATOM 6373  H "H5'"  . DG  B 2 16 ? -86.494  -14.398 -17.727 1.00 1.36 ? 33  DG  C "H5'"  3  
ATOM 6374  H "H5''" . DG  B 2 16 ? -87.905  -15.305 -18.307 1.00 1.43 ? 33  DG  C "H5''" 3  
ATOM 6375  H "H4'"  . DG  B 2 16 ? -86.941  -14.141 -20.181 1.00 1.32 ? 33  DG  C "H4'"  3  
ATOM 6376  H "H3'"  . DG  B 2 16 ? -87.153  -16.994 -20.150 1.00 1.48 ? 33  DG  C "H3'"  3  
ATOM 6377  H "H2'"  . DG  B 2 16 ? -84.973  -17.589 -20.522 1.00 1.45 ? 33  DG  C "H2'"  3  
ATOM 6378  H "H2''" . DG  B 2 16 ? -85.193  -16.878 -22.143 1.00 1.44 ? 33  DG  C "H2''" 3  
ATOM 6379  H "H1'"  . DG  B 2 16 ? -84.005  -15.005 -21.605 1.00 1.27 ? 33  DG  C "H1'"  3  
ATOM 6380  H H8     . DG  B 2 16 ? -83.758  -17.268 -18.422 1.00 1.38 ? 33  DG  C H8     3  
ATOM 6381  H H1     . DG  B 2 16 ? -78.185  -15.577 -21.099 1.00 1.18 ? 33  DG  C H1     3  
ATOM 6382  H H21    . DG  B 2 16 ? -78.537  -14.300 -22.864 1.00 1.16 ? 33  DG  C H21    3  
ATOM 6383  H H22    . DG  B 2 16 ? -80.145  -13.854 -23.400 1.00 1.16 ? 33  DG  C H22    3  
ATOM 6384  P P      . DA  B 2 17 ? -87.712  -16.887 -22.992 1.00 1.56 ? 34  DA  C P      3  
ATOM 6385  O OP1    . DA  B 2 17 ? -88.775  -16.308 -23.839 1.00 1.62 ? 34  DA  C OP1    3  
ATOM 6386  O OP2    . DA  B 2 17 ? -87.909  -18.212 -22.358 1.00 1.64 ? 34  DA  C OP2    3  
ATOM 6387  O "O5'"  . DA  B 2 17 ? -86.352  -16.932 -23.853 1.00 1.55 ? 34  DA  C "O5'"  3  
ATOM 6388  C "C5'"  . DA  B 2 17 ? -85.859  -15.735 -24.462 1.00 1.50 ? 34  DA  C "C5'"  3  
ATOM 6389  C "C4'"  . DA  B 2 17 ? -84.983  -16.030 -25.686 1.00 1.56 ? 34  DA  C "C4'"  3  
ATOM 6390  O "O4'"  . DA  B 2 17 ? -83.591  -16.058 -25.287 1.00 1.51 ? 34  DA  C "O4'"  3  
ATOM 6391  C "C3'"  . DA  B 2 17 ? -85.325  -17.381 -26.326 1.00 1.70 ? 34  DA  C "C3'"  3  
ATOM 6392  O "O3'"  . DA  B 2 17 ? -85.594  -17.222 -27.723 1.00 1.79 ? 34  DA  C "O3'"  3  
ATOM 6393  C "C2'"  . DA  B 2 17 ? -84.097  -18.248 -26.133 1.00 1.72 ? 34  DA  C "C2'"  3  
ATOM 6394  C "C1'"  . DA  B 2 17 ? -82.994  -17.332 -25.601 1.00 1.60 ? 34  DA  C "C1'"  3  
ATOM 6395  N N9     . DA  B 2 17 ? -82.325  -17.913 -24.413 1.00 1.57 ? 34  DA  C N9     3  
ATOM 6396  C C8     . DA  B 2 17 ? -82.867  -18.474 -23.289 1.00 1.59 ? 34  DA  C C8     3  
ATOM 6397  N N7     . DA  B 2 17 ? -82.001  -18.905 -22.418 1.00 1.58 ? 34  DA  C N7     3  
ATOM 6398  C C5     . DA  B 2 17 ? -80.778  -18.606 -23.015 1.00 1.55 ? 34  DA  C C5     3  
ATOM 6399  C C6     . DA  B 2 17 ? -79.452  -18.806 -22.611 1.00 1.55 ? 34  DA  C C6     3  
ATOM 6400  N N6     . DA  B 2 17 ? -79.124  -19.376 -21.451 1.00 1.57 ? 34  DA  C N6     3  
ATOM 6401  N N1     . DA  B 2 17 ? -78.482  -18.391 -23.447 1.00 1.55 ? 34  DA  C N1     3  
ATOM 6402  C C2     . DA  B 2 17 ? -78.796  -17.812 -24.606 1.00 1.55 ? 34  DA  C C2     3  
ATOM 6403  N N3     . DA  B 2 17 ? -80.017  -17.576 -25.079 1.00 1.56 ? 34  DA  C N3     3  
ATOM 6404  C C4     . DA  B 2 17 ? -80.967  -18.003 -24.225 1.00 1.55 ? 34  DA  C C4     3  
ATOM 6405  H "H5'"  . DA  B 2 17 ? -85.271  -15.180 -23.732 1.00 1.41 ? 34  DA  C "H5'"  3  
ATOM 6406  H "H5''" . DA  B 2 17 ? -86.709  -15.125 -24.769 1.00 1.52 ? 34  DA  C "H5''" 3  
ATOM 6407  H "H4'"  . DA  B 2 17 ? -85.124  -15.242 -26.428 1.00 1.57 ? 34  DA  C "H4'"  3  
ATOM 6408  H "H3'"  . DA  B 2 17 ? -86.193  -17.839 -25.839 1.00 1.73 ? 34  DA  C "H3'"  3  
ATOM 6409  H "HO3'" . DA  B 2 17 ? -84.844  -16.763 -28.109 1.00 2.00 ? 34  DA  C "HO3'" 3  
ATOM 6410  H "H2'"  . DA  B 2 17 ? -84.303  -19.044 -25.415 1.00 1.75 ? 34  DA  C "H2'"  3  
ATOM 6411  H "H2''" . DA  B 2 17 ? -83.801  -18.683 -27.091 1.00 1.81 ? 34  DA  C "H2''" 3  
ATOM 6412  H "H1'"  . DA  B 2 17 ? -82.247  -17.183 -26.384 1.00 1.62 ? 34  DA  C "H1'"  3  
ATOM 6413  H H8     . DA  B 2 17 ? -83.941  -18.558 -23.137 1.00 1.62 ? 34  DA  C H8     3  
ATOM 6414  H H61    . DA  B 2 17 ? -78.152  -19.499 -21.204 1.00 1.58 ? 34  DA  C H61    3  
ATOM 6415  H H62    . DA  B 2 17 ? -79.848  -19.681 -20.816 1.00 1.59 ? 34  DA  C H62    3  
ATOM 6416  H H2     . DA  B 2 17 ? -77.963  -17.496 -25.235 1.00 1.57 ? 34  DA  C H2     3  
ATOM 6417  N N      . VAL C 3 1  ? -101.569 11.836  -27.381 1.00 2.88 ? 10  VAL A N      3  
ATOM 6418  C CA     . VAL C 3 1  ? -101.303 12.408  -28.732 1.00 2.54 ? 10  VAL A CA     3  
ATOM 6419  C C      . VAL C 3 1  ? -99.991  13.191  -28.706 1.00 2.47 ? 10  VAL A C      3  
ATOM 6420  O O      . VAL C 3 1  ? -99.167  13.068  -29.588 1.00 2.82 ? 10  VAL A O      3  
ATOM 6421  C CB     . VAL C 3 1  ? -102.449 13.340  -29.130 1.00 2.80 ? 10  VAL A CB     3  
ATOM 6422  C CG1    . VAL C 3 1  ? -102.188 13.906  -30.530 1.00 3.34 ? 10  VAL A CG1    3  
ATOM 6423  C CG2    . VAL C 3 1  ? -103.755 12.546  -29.135 1.00 2.97 ? 10  VAL A CG2    3  
ATOM 6424  H H      . VAL C 3 1  ? -101.517 10.867  -27.240 1.00 3.33 ? 10  VAL A H      3  
ATOM 6425  H HA     . VAL C 3 1  ? -101.228 11.607  -29.450 1.00 2.70 ? 10  VAL A HA     3  
ATOM 6426  H HB     . VAL C 3 1  ? -102.519 14.153  -28.419 1.00 3.12 ? 10  VAL A HB     3  
ATOM 6427  H HG11   . VAL C 3 1  ? -101.868 13.111  -31.186 1.00 3.84 ? 10  VAL A HG11   3  
ATOM 6428  H HG12   . VAL C 3 1  ? -103.096 14.348  -30.915 1.00 3.62 ? 10  VAL A HG12   3  
ATOM 6429  H HG13   . VAL C 3 1  ? -101.417 14.660  -30.478 1.00 3.57 ? 10  VAL A HG13   3  
ATOM 6430  H HG21   . VAL C 3 1  ? -103.844 11.996  -28.208 1.00 3.06 ? 10  VAL A HG21   3  
ATOM 6431  H HG22   . VAL C 3 1  ? -104.589 13.225  -29.235 1.00 3.34 ? 10  VAL A HG22   3  
ATOM 6432  H HG23   . VAL C 3 1  ? -103.751 11.854  -29.964 1.00 3.26 ? 10  VAL A HG23   3  
ATOM 6433  N N      . ILE C 3 2  ? -99.793  14.001  -27.704 1.00 2.30 ? 11  ILE A N      3  
ATOM 6434  C CA     . ILE C 3 2  ? -98.539  14.802  -27.609 1.00 2.34 ? 11  ILE A CA     3  
ATOM 6435  C C      . ILE C 3 2  ? -98.114  14.883  -26.129 1.00 2.16 ? 11  ILE A C      3  
ATOM 6436  O O      . ILE C 3 2  ? -98.070  15.955  -25.576 1.00 2.18 ? 11  ILE A O      3  
ATOM 6437  C CB     . ILE C 3 2  ? -98.807  16.226  -28.172 1.00 2.83 ? 11  ILE A CB     3  
ATOM 6438  C CG1    . ILE C 3 2  ? -100.282 16.623  -27.947 1.00 3.26 ? 11  ILE A CG1    3  
ATOM 6439  C CG2    . ILE C 3 2  ? -98.509  16.267  -29.680 1.00 2.95 ? 11  ILE A CG2    3  
ATOM 6440  C CD1    . ILE C 3 2  ? -100.625 16.616  -26.449 1.00 3.52 ? 11  ILE A CD1    3  
ATOM 6441  H H      . ILE C 3 2  ? -100.471 14.085  -27.006 1.00 2.35 ? 11  ILE A H      3  
ATOM 6442  H HA     . ILE C 3 2  ? -97.754  14.327  -28.180 1.00 2.58 ? 11  ILE A HA     3  
ATOM 6443  H HB     . ILE C 3 2  ? -98.168  16.937  -27.677 1.00 3.23 ? 11  ILE A HB     3  
ATOM 6444  H HG12   . ILE C 3 2  ? -100.441 17.617  -28.340 1.00 3.70 ? 11  ILE A HG12   3  
ATOM 6445  H HG13   . ILE C 3 2  ? -100.928 15.932  -28.468 1.00 3.50 ? 11  ILE A HG13   3  
ATOM 6446  H HG21   . ILE C 3 2  ? -98.956  15.411  -30.164 1.00 3.20 ? 11  ILE A HG21   3  
ATOM 6447  H HG22   . ILE C 3 2  ? -98.917  17.173  -30.104 1.00 3.25 ? 11  ILE A HG22   3  
ATOM 6448  H HG23   . ILE C 3 2  ? -97.439  16.249  -29.838 1.00 3.09 ? 11  ILE A HG23   3  
ATOM 6449  H HD11   . ILE C 3 2  ? -99.946  17.268  -25.919 1.00 3.94 ? 11  ILE A HD11   3  
ATOM 6450  H HD12   . ILE C 3 2  ? -101.636 16.966  -26.311 1.00 3.88 ? 11  ILE A HD12   3  
ATOM 6451  H HD13   . ILE C 3 2  ? -100.541 15.612  -26.058 1.00 3.51 ? 11  ILE A HD13   3  
ATOM 6452  N N      . PRO C 3 3  ? -97.833  13.752  -25.511 1.00 2.45 ? 12  PRO A N      3  
ATOM 6453  C CA     . PRO C 3 3  ? -97.445  13.721  -24.079 1.00 2.83 ? 12  PRO A CA     3  
ATOM 6454  C C      . PRO C 3 3  ? -96.159  14.524  -23.833 1.00 2.73 ? 12  PRO A C      3  
ATOM 6455  O O      . PRO C 3 3  ? -95.394  14.221  -22.939 1.00 3.20 ? 12  PRO A O      3  
ATOM 6456  C CB     . PRO C 3 3  ? -97.239  12.223  -23.757 1.00 3.56 ? 12  PRO A CB     3  
ATOM 6457  C CG     . PRO C 3 3  ? -97.381  11.436  -25.092 1.00 3.55 ? 12  PRO A CG     3  
ATOM 6458  C CD     . PRO C 3 3  ? -97.860  12.431  -26.174 1.00 2.86 ? 12  PRO A CD     3  
ATOM 6459  H HA     . PRO C 3 3  ? -98.245  14.118  -23.474 1.00 2.97 ? 12  PRO A HA     3  
ATOM 6460  H HB2    . PRO C 3 3  ? -96.253  12.055  -23.332 1.00 3.91 ? 12  PRO A HB2    3  
ATOM 6461  H HB3    . PRO C 3 3  ? -97.995  11.889  -23.058 1.00 3.95 ? 12  PRO A HB3    3  
ATOM 6462  H HG2    . PRO C 3 3  ? -96.421  11.015  -25.373 1.00 3.96 ? 12  PRO A HG2    3  
ATOM 6463  H HG3    . PRO C 3 3  ? -98.103  10.640  -24.980 1.00 3.84 ? 12  PRO A HG3    3  
ATOM 6464  H HD2    . PRO C 3 3  ? -97.190  12.419  -27.022 1.00 3.03 ? 12  PRO A HD2    3  
ATOM 6465  H HD3    . PRO C 3 3  ? -98.866  12.194  -26.485 1.00 2.81 ? 12  PRO A HD3    3  
ATOM 6466  N N      . ALA C 3 4  ? -95.914  15.537  -24.621 1.00 2.41 ? 13  ALA A N      3  
ATOM 6467  C CA     . ALA C 3 4  ? -94.683  16.360  -24.454 1.00 2.65 ? 13  ALA A CA     3  
ATOM 6468  C C      . ALA C 3 4  ? -95.012  17.705  -23.781 1.00 2.45 ? 13  ALA A C      3  
ATOM 6469  O O      . ALA C 3 4  ? -96.106  17.930  -23.298 1.00 2.41 ? 13  ALA A O      3  
ATOM 6470  C CB     . ALA C 3 4  ? -94.094  16.616  -25.838 1.00 2.93 ? 13  ALA A CB     3  
ATOM 6471  H H      . ALA C 3 4  ? -96.540  15.754  -25.338 1.00 2.29 ? 13  ALA A H      3  
ATOM 6472  H HA     . ALA C 3 4  ? -93.966  15.825  -23.853 1.00 3.12 ? 13  ALA A HA     3  
ATOM 6473  H HB1    . ALA C 3 4  ? -94.903  16.742  -26.544 1.00 3.43 ? 13  ALA A HB1    3  
ATOM 6474  H HB2    . ALA C 3 4  ? -93.485  17.506  -25.823 1.00 3.08 ? 13  ALA A HB2    3  
ATOM 6475  H HB3    . ALA C 3 4  ? -93.492  15.770  -26.132 1.00 3.13 ? 13  ALA A HB3    3  
ATOM 6476  N N      . ALA C 3 5  ? -94.053  18.602  -23.769 1.00 2.64 ? 14  ALA A N      3  
ATOM 6477  C CA     . ALA C 3 5  ? -94.269  19.945  -23.155 1.00 2.80 ? 14  ALA A CA     3  
ATOM 6478  C C      . ALA C 3 5  ? -95.340  20.703  -23.942 1.00 2.70 ? 14  ALA A C      3  
ATOM 6479  O O      . ALA C 3 5  ? -95.824  21.734  -23.514 1.00 2.87 ? 14  ALA A O      3  
ATOM 6480  C CB     . ALA C 3 5  ? -92.957  20.737  -23.186 1.00 3.29 ? 14  ALA A CB     3  
ATOM 6481  H H      . ALA C 3 5  ? -93.187  18.390  -24.174 1.00 2.86 ? 14  ALA A H      3  
ATOM 6482  H HA     . ALA C 3 5  ? -94.590  19.826  -22.133 1.00 2.86 ? 14  ALA A HA     3  
ATOM 6483  H HB1    . ALA C 3 5  ? -92.480  20.603  -24.142 1.00 3.55 ? 14  ALA A HB1    3  
ATOM 6484  H HB2    . ALA C 3 5  ? -93.160  21.787  -23.034 1.00 3.56 ? 14  ALA A HB2    3  
ATOM 6485  H HB3    . ALA C 3 5  ? -92.302  20.381  -22.404 1.00 3.60 ? 14  ALA A HB3    3  
ATOM 6486  N N      . ALA C 3 6  ? -95.725  20.200  -25.083 1.00 2.63 ? 15  ALA A N      3  
ATOM 6487  C CA     . ALA C 3 6  ? -96.770  20.895  -25.881 1.00 2.72 ? 15  ALA A CA     3  
ATOM 6488  C C      . ALA C 3 6  ? -98.114  20.586  -25.246 1.00 2.61 ? 15  ALA A C      3  
ATOM 6489  O O      . ALA C 3 6  ? -99.118  21.198  -25.541 1.00 2.73 ? 15  ALA A O      3  
ATOM 6490  C CB     . ALA C 3 6  ? -96.739  20.392  -27.334 1.00 2.93 ? 15  ALA A CB     3  
ATOM 6491  H H      . ALA C 3 6  ? -95.331  19.366  -25.411 1.00 2.65 ? 15  ALA A H      3  
ATOM 6492  H HA     . ALA C 3 6  ? -96.601  21.957  -25.853 1.00 2.88 ? 15  ALA A HA     3  
ATOM 6493  H HB1    . ALA C 3 6  ? -95.724  20.165  -27.611 1.00 2.95 ? 15  ALA A HB1    3  
ATOM 6494  H HB2    . ALA C 3 6  ? -97.343  19.499  -27.429 1.00 3.26 ? 15  ALA A HB2    3  
ATOM 6495  H HB3    . ALA C 3 6  ? -97.127  21.155  -27.988 1.00 3.28 ? 15  ALA A HB3    3  
ATOM 6496  N N      . LEU C 3 7  ? -98.124  19.647  -24.348 1.00 2.52 ? 16  LEU A N      3  
ATOM 6497  C CA     . LEU C 3 7  ? -99.381  19.297  -23.653 1.00 2.60 ? 16  LEU A CA     3  
ATOM 6498  C C      . LEU C 3 7  ? -99.543  20.262  -22.476 1.00 2.60 ? 16  LEU A C      3  
ATOM 6499  O O      . LEU C 3 7  ? -100.428 21.094  -22.457 1.00 2.88 ? 16  LEU A O      3  
ATOM 6500  C CB     . LEU C 3 7  ? -99.277  17.853  -23.153 1.00 2.69 ? 16  LEU A CB     3  
ATOM 6501  C CG     . LEU C 3 7  ? -100.670 17.250  -22.956 1.00 2.71 ? 16  LEU A CG     3  
ATOM 6502  C CD1    . LEU C 3 7  ? -100.536 15.743  -22.729 1.00 3.23 ? 16  LEU A CD1    3  
ATOM 6503  C CD2    . LEU C 3 7  ? -101.350 17.908  -21.751 1.00 2.88 ? 16  LEU A CD2    3  
ATOM 6504  H H      . LEU C 3 7  ? -97.290  19.184  -24.116 1.00 2.49 ? 16  LEU A H      3  
ATOM 6505  H HA     . LEU C 3 7  ? -100.217 19.402  -24.331 1.00 2.75 ? 16  LEU A HA     3  
ATOM 6506  H HB2    . LEU C 3 7  ? -98.742  17.273  -23.879 1.00 2.80 ? 16  LEU A HB2    3  
ATOM 6507  H HB3    . LEU C 3 7  ? -98.739  17.827  -22.217 1.00 3.11 ? 16  LEU A HB3    3  
ATOM 6508  H HG     . LEU C 3 7  ? -101.266 17.418  -23.841 1.00 3.07 ? 16  LEU A HG     3  
ATOM 6509  H HD11   . LEU C 3 7  ? -99.719  15.550  -22.054 1.00 3.48 ? 16  LEU A HD11   3  
ATOM 6510  H HD12   . LEU C 3 7  ? -101.451 15.356  -22.309 1.00 3.69 ? 16  LEU A HD12   3  
ATOM 6511  H HD13   . LEU C 3 7  ? -100.337 15.255  -23.672 1.00 3.53 ? 16  LEU A HD13   3  
ATOM 6512  H HD21   . LEU C 3 7  ? -100.647 17.998  -20.937 1.00 3.05 ? 16  LEU A HD21   3  
ATOM 6513  H HD22   . LEU C 3 7  ? -101.701 18.889  -22.033 1.00 3.17 ? 16  LEU A HD22   3  
ATOM 6514  H HD23   . LEU C 3 7  ? -102.185 17.304  -21.439 1.00 3.26 ? 16  LEU A HD23   3  
ATOM 6515  N N      . ALA C 3 8  ? -98.675  20.166  -21.505 1.00 2.45 ? 17  ALA A N      3  
ATOM 6516  C CA     . ALA C 3 8  ? -98.753  21.089  -20.337 1.00 2.61 ? 17  ALA A CA     3  
ATOM 6517  C C      . ALA C 3 8  ? -98.141  22.435  -20.745 1.00 2.87 ? 17  ALA A C      3  
ATOM 6518  O O      . ALA C 3 8  ? -98.820  23.435  -20.850 1.00 3.32 ? 17  ALA A O      3  
ATOM 6519  C CB     . ALA C 3 8  ? -97.968  20.490  -19.162 1.00 2.59 ? 17  ALA A CB     3  
ATOM 6520  H H      . ALA C 3 8  ? -97.960  19.498  -21.552 1.00 2.38 ? 17  ALA A H      3  
ATOM 6521  H HA     . ALA C 3 8  ? -99.785  21.229  -20.055 1.00 2.74 ? 17  ALA A HA     3  
ATOM 6522  H HB1    . ALA C 3 8  ? -98.175  19.431  -19.092 1.00 2.93 ? 17  ALA A HB1    3  
ATOM 6523  H HB2    . ALA C 3 8  ? -96.910  20.639  -19.321 1.00 2.79 ? 17  ALA A HB2    3  
ATOM 6524  H HB3    . ALA C 3 8  ? -98.262  20.977  -18.244 1.00 2.61 ? 17  ALA A HB3    3  
ATOM 6525  N N      . GLY C 3 9  ? -96.861  22.446  -20.999 1.00 2.87 ? 18  GLY A N      3  
ATOM 6526  C CA     . GLY C 3 9  ? -96.178  23.700  -21.432 1.00 3.24 ? 18  GLY A CA     3  
ATOM 6527  C C      . GLY C 3 9  ? -96.173  24.732  -20.302 1.00 2.97 ? 18  GLY A C      3  
ATOM 6528  O O      . GLY C 3 9  ? -96.122  25.924  -20.539 1.00 3.34 ? 18  GLY A O      3  
ATOM 6529  H H      . GLY C 3 9  ? -96.350  21.615  -20.923 1.00 2.82 ? 18  GLY A H      3  
ATOM 6530  H HA2    . GLY C 3 9  ? -95.157  23.470  -21.702 1.00 3.48 ? 18  GLY A HA2    3  
ATOM 6531  H HA3    . GLY C 3 9  ? -96.690  24.112  -22.287 1.00 3.70 ? 18  GLY A HA3    3  
ATOM 6532  N N      . TYR C 3 10 ? -96.215  24.294  -19.078 1.00 2.61 ? 19  TYR A N      3  
ATOM 6533  C CA     . TYR C 3 10 ? -96.206  25.262  -17.948 1.00 2.84 ? 19  TYR A CA     3  
ATOM 6534  C C      . TYR C 3 10 ? -94.799  25.846  -17.784 1.00 3.02 ? 19  TYR A C      3  
ATOM 6535  O O      . TYR C 3 10 ? -93.817  25.133  -17.801 1.00 3.28 ? 19  TYR A O      3  
ATOM 6536  C CB     . TYR C 3 10 ? -96.627  24.538  -16.671 1.00 2.96 ? 19  TYR A CB     3  
ATOM 6537  C CG     . TYR C 3 10 ? -95.548  23.573  -16.226 1.00 2.45 ? 19  TYR A CG     3  
ATOM 6538  C CD1    . TYR C 3 10 ? -95.441  22.309  -16.820 1.00 2.56 ? 19  TYR A CD1    3  
ATOM 6539  C CD2    . TYR C 3 10 ? -94.671  23.940  -15.201 1.00 2.68 ? 19  TYR A CD2    3  
ATOM 6540  C CE1    . TYR C 3 10 ? -94.453  21.417  -16.391 1.00 2.80 ? 19  TYR A CE1    3  
ATOM 6541  C CE2    . TYR C 3 10 ? -93.687  23.047  -14.768 1.00 2.90 ? 19  TYR A CE2    3  
ATOM 6542  C CZ     . TYR C 3 10 ? -93.578  21.783  -15.364 1.00 2.92 ? 19  TYR A CZ     3  
ATOM 6543  O OH     . TYR C 3 10 ? -92.614  20.893  -14.938 1.00 3.66 ? 19  TYR A OH     3  
ATOM 6544  H H      . TYR C 3 10 ? -96.252  23.330  -18.903 1.00 2.43 ? 19  TYR A H      3  
ATOM 6545  H HA     . TYR C 3 10 ? -96.904  26.061  -18.153 1.00 3.20 ? 19  TYR A HA     3  
ATOM 6546  H HB2    . TYR C 3 10 ? -96.801  25.264  -15.891 1.00 3.48 ? 19  TYR A HB2    3  
ATOM 6547  H HB3    . TYR C 3 10 ? -97.537  23.989  -16.859 1.00 3.39 ? 19  TYR A HB3    3  
ATOM 6548  H HD1    . TYR C 3 10 ? -96.115  22.026  -17.614 1.00 3.01 ? 19  TYR A HD1    3  
ATOM 6549  H HD2    . TYR C 3 10 ? -94.753  24.914  -14.743 1.00 3.20 ? 19  TYR A HD2    3  
ATOM 6550  H HE1    . TYR C 3 10 ? -94.371  20.443  -16.850 1.00 3.38 ? 19  TYR A HE1    3  
ATOM 6551  H HE2    . TYR C 3 10 ? -93.014  23.330  -13.970 1.00 3.51 ? 19  TYR A HE2    3  
ATOM 6552  H HH     . TYR C 3 10 ? -92.881  20.014  -15.216 1.00 4.08 ? 19  TYR A HH     3  
ATOM 6553  N N      . THR C 3 11 ? -94.695  27.140  -17.633 1.00 3.30 ? 20  THR A N      3  
ATOM 6554  C CA     . THR C 3 11 ? -93.354  27.785  -17.477 1.00 3.67 ? 20  THR A CA     3  
ATOM 6555  C C      . THR C 3 11 ? -93.023  27.957  -15.992 1.00 3.82 ? 20  THR A C      3  
ATOM 6556  O O      . THR C 3 11 ? -93.550  27.267  -15.142 1.00 4.07 ? 20  THR A O      3  
ATOM 6557  C CB     . THR C 3 11 ? -93.375  29.154  -18.159 1.00 4.26 ? 20  THR A CB     3  
ATOM 6558  O OG1    . THR C 3 11 ? -94.312  29.992  -17.503 1.00 4.68 ? 20  THR A OG1    3  
ATOM 6559  C CG2    . THR C 3 11 ? -93.780  28.982  -19.625 1.00 4.79 ? 20  THR A CG2    3  
ATOM 6560  H H      . THR C 3 11 ? -95.502  27.696  -17.628 1.00 3.51 ? 20  THR A H      3  
ATOM 6561  H HA     . THR C 3 11 ? -92.599  27.167  -17.944 1.00 3.87 ? 20  THR A HA     3  
ATOM 6562  H HB     . THR C 3 11 ? -92.394  29.596  -18.110 1.00 4.50 ? 20  THR A HB     3  
ATOM 6563  H HG1    . THR C 3 11 ? -94.785  30.491  -18.172 1.00 4.92 ? 20  THR A HG1    3  
ATOM 6564  H HG21   . THR C 3 11 ? -93.097  28.295  -20.110 1.00 5.01 ? 20  THR A HG21   3  
ATOM 6565  H HG22   . THR C 3 11 ? -94.781  28.585  -19.677 1.00 5.03 ? 20  THR A HG22   3  
ATOM 6566  H HG23   . THR C 3 11 ? -93.742  29.938  -20.124 1.00 5.16 ? 20  THR A HG23   3  
ATOM 6567  N N      . GLY C 3 12 ? -92.138  28.864  -15.675 1.00 4.13 ? 21  GLY A N      3  
ATOM 6568  C CA     . GLY C 3 12 ? -91.754  29.079  -14.251 1.00 4.78 ? 21  GLY A CA     3  
ATOM 6569  C C      . GLY C 3 12 ? -92.968  29.524  -13.429 1.00 4.66 ? 21  GLY A C      3  
ATOM 6570  O O      . GLY C 3 12 ? -92.840  29.877  -12.273 1.00 5.20 ? 21  GLY A O      3  
ATOM 6571  H H      . GLY C 3 12 ? -91.717  29.401  -16.379 1.00 4.20 ? 21  GLY A H      3  
ATOM 6572  H HA2    . GLY C 3 12 ? -91.368  28.150  -13.844 1.00 5.11 ? 21  GLY A HA2    3  
ATOM 6573  H HA3    . GLY C 3 12 ? -90.988  29.837  -14.193 1.00 5.28 ? 21  GLY A HA3    3  
ATOM 6574  N N      . SER C 3 13 ? -94.146  29.494  -14.000 1.00 4.13 ? 22  SER A N      3  
ATOM 6575  C CA     . SER C 3 13 ? -95.365  29.899  -13.230 1.00 4.18 ? 22  SER A CA     3  
ATOM 6576  C C      . SER C 3 13 ? -96.046  28.631  -12.720 1.00 3.70 ? 22  SER A C      3  
ATOM 6577  O O      . SER C 3 13 ? -96.240  27.682  -13.454 1.00 3.61 ? 22  SER A O      3  
ATOM 6578  C CB     . SER C 3 13 ? -96.327  30.676  -14.137 1.00 4.44 ? 22  SER A CB     3  
ATOM 6579  O OG     . SER C 3 13 ? -95.781  31.962  -14.408 1.00 4.83 ? 22  SER A OG     3  
ATOM 6580  H H      . SER C 3 13 ? -94.234  29.194  -14.925 1.00 3.82 ? 22  SER A H      3  
ATOM 6581  H HA     . SER C 3 13 ? -95.086  30.519  -12.387 1.00 4.60 ? 22  SER A HA     3  
ATOM 6582  H HB2    . SER C 3 13 ? -96.463  30.146  -15.064 1.00 4.64 ? 22  SER A HB2    3  
ATOM 6583  H HB3    . SER C 3 13 ? -97.283  30.779  -13.640 1.00 4.59 ? 22  SER A HB3    3  
ATOM 6584  H HG     . SER C 3 13 ? -96.443  32.620  -14.182 1.00 4.97 ? 22  SER A HG     3  
ATOM 6585  N N      . GLY C 3 14 ? -96.384  28.598  -11.458 1.00 3.71 ? 23  GLY A N      3  
ATOM 6586  C CA     . GLY C 3 14 ? -97.028  27.381  -10.889 1.00 3.61 ? 23  GLY A CA     3  
ATOM 6587  C C      . GLY C 3 14 ? -96.170  26.153  -11.214 1.00 3.02 ? 23  GLY A C      3  
ATOM 6588  O O      . GLY C 3 14 ? -96.610  25.283  -11.938 1.00 2.92 ? 23  GLY A O      3  
ATOM 6589  H H      . GLY C 3 14 ? -96.202  29.368  -10.883 1.00 4.01 ? 23  GLY A H      3  
ATOM 6590  H HA2    . GLY C 3 14 ? -97.123  27.486  -9.819  1.00 4.02 ? 23  GLY A HA2    3  
ATOM 6591  H HA3    . GLY C 3 14 ? -98.006  27.250  -11.325 1.00 3.82 ? 23  GLY A HA3    3  
ATOM 6592  N N      . PRO C 3 15 ? -94.963  26.105  -10.689 1.00 2.85 ? 24  PRO A N      3  
ATOM 6593  C CA     . PRO C 3 15 ? -94.068  24.966  -10.960 1.00 2.53 ? 24  PRO A CA     3  
ATOM 6594  C C      . PRO C 3 15 ? -94.740  23.657  -10.520 1.00 2.15 ? 24  PRO A C      3  
ATOM 6595  O O      . PRO C 3 15 ? -95.091  23.483  -9.370  1.00 2.13 ? 24  PRO A O      3  
ATOM 6596  C CB     . PRO C 3 15 ? -92.795  25.252  -10.124 1.00 2.78 ? 24  PRO A CB     3  
ATOM 6597  C CG     . PRO C 3 15 ? -92.996  26.626  -9.418  1.00 3.20 ? 24  PRO A CG     3  
ATOM 6598  C CD     . PRO C 3 15 ? -94.402  27.149  -9.801  1.00 3.25 ? 24  PRO A CD     3  
ATOM 6599  H HA     . PRO C 3 15 ? -93.823  24.929  -12.012 1.00 2.64 ? 24  PRO A HA     3  
ATOM 6600  H HB2    . PRO C 3 15 ? -92.644  24.471  -9.382  1.00 2.68 ? 24  PRO A HB2    3  
ATOM 6601  H HB3    . PRO C 3 15 ? -91.928  25.302  -10.772 1.00 2.97 ? 24  PRO A HB3    3  
ATOM 6602  H HG2    . PRO C 3 15 ? -92.923  26.498  -8.340  1.00 3.31 ? 24  PRO A HG2    3  
ATOM 6603  H HG3    . PRO C 3 15 ? -92.240  27.329  -9.749  1.00 3.56 ? 24  PRO A HG3    3  
ATOM 6604  H HD2    . PRO C 3 15 ? -95.010  27.266  -8.916  1.00 3.41 ? 24  PRO A HD2    3  
ATOM 6605  H HD3    . PRO C 3 15 ? -94.328  28.086  -10.333 1.00 3.58 ? 24  PRO A HD3    3  
ATOM 6606  N N      . ILE C 3 16 ? -94.905  22.733  -11.424 1.00 1.96 ? 25  ILE A N      3  
ATOM 6607  C CA     . ILE C 3 16 ? -95.534  21.442  -11.063 1.00 1.70 ? 25  ILE A CA     3  
ATOM 6608  C C      . ILE C 3 16 ? -94.511  20.571  -10.331 1.00 1.47 ? 25  ILE A C      3  
ATOM 6609  O O      . ILE C 3 16 ? -93.322  20.702  -10.530 1.00 1.48 ? 25  ILE A O      3  
ATOM 6610  C CB     . ILE C 3 16 ? -95.987  20.740  -12.332 1.00 1.67 ? 25  ILE A CB     3  
ATOM 6611  C CG1    . ILE C 3 16 ? -96.999  21.630  -13.054 1.00 2.29 ? 25  ILE A CG1    3  
ATOM 6612  C CG2    . ILE C 3 16 ? -96.639  19.413  -11.955 1.00 2.10 ? 25  ILE A CG2    3  
ATOM 6613  C CD1    . ILE C 3 16 ? -97.371  21.007  -14.399 1.00 2.80 ? 25  ILE A CD1    3  
ATOM 6614  H H      . ILE C 3 16 ? -94.611  22.884  -12.344 1.00 2.07 ? 25  ILE A H      3  
ATOM 6615  H HA     . ILE C 3 16 ? -96.386  21.619  -10.425 1.00 1.84 ? 25  ILE A HA     3  
ATOM 6616  H HB     . ILE C 3 16 ? -95.133  20.559  -12.969 1.00 1.81 ? 25  ILE A HB     3  
ATOM 6617  H HG12   . ILE C 3 16 ? -97.883  21.732  -12.444 1.00 2.68 ? 25  ILE A HG12   3  
ATOM 6618  H HG13   . ILE C 3 16 ? -96.563  22.604  -13.221 1.00 2.71 ? 25  ILE A HG13   3  
ATOM 6619  H HG21   . ILE C 3 16 ? -97.308  19.571  -11.124 1.00 2.43 ? 25  ILE A HG21   3  
ATOM 6620  H HG22   . ILE C 3 16 ? -97.191  19.027  -12.794 1.00 2.57 ? 25  ILE A HG22   3  
ATOM 6621  H HG23   . ILE C 3 16 ? -95.872  18.710  -11.673 1.00 2.53 ? 25  ILE A HG23   3  
ATOM 6622  H HD11   . ILE C 3 16 ? -96.473  20.719  -14.923 1.00 3.15 ? 25  ILE A HD11   3  
ATOM 6623  H HD12   . ILE C 3 16 ? -97.983  20.134  -14.229 1.00 3.05 ? 25  ILE A HD12   3  
ATOM 6624  H HD13   . ILE C 3 16 ? -97.920  21.722  -14.988 1.00 3.17 ? 25  ILE A HD13   3  
ATOM 6625  N N      . GLN C 3 17 ? -94.963  19.688  -9.480  1.00 1.36 ? 26  GLN A N      3  
ATOM 6626  C CA     . GLN C 3 17 ? -94.015  18.813  -8.724  1.00 1.23 ? 26  GLN A CA     3  
ATOM 6627  C C      . GLN C 3 17 ? -93.655  17.588  -9.587  1.00 1.07 ? 26  GLN A C      3  
ATOM 6628  O O      . GLN C 3 17 ? -94.390  17.203  -10.473 1.00 1.13 ? 26  GLN A O      3  
ATOM 6629  C CB     . GLN C 3 17 ? -94.693  18.379  -7.410  1.00 1.35 ? 26  GLN A CB     3  
ATOM 6630  C CG     . GLN C 3 17 ? -93.644  18.013  -6.351  1.00 1.13 ? 26  GLN A CG     3  
ATOM 6631  C CD     . GLN C 3 17 ? -92.970  16.703  -6.747  1.00 1.20 ? 26  GLN A CD     3  
ATOM 6632  O OE1    . GLN C 3 17 ? -93.522  15.941  -7.513  1.00 1.42 ? 26  GLN A OE1    3  
ATOM 6633  N NE2    . GLN C 3 17 ? -91.796  16.402  -6.257  1.00 1.66 ? 26  GLN A NE2    3  
ATOM 6634  H H      . GLN C 3 17 ? -95.928  19.605  -9.329  1.00 1.45 ? 26  GLN A H      3  
ATOM 6635  H HA     . GLN C 3 17 ? -93.117  19.371  -8.502  1.00 1.28 ? 26  GLN A HA     3  
ATOM 6636  H HB2    . GLN C 3 17 ? -95.303  19.192  -7.043  1.00 1.82 ? 26  GLN A HB2    3  
ATOM 6637  H HB3    . GLN C 3 17 ? -95.321  17.523  -7.598  1.00 1.77 ? 26  GLN A HB3    3  
ATOM 6638  H HG2    . GLN C 3 17 ? -92.906  18.798  -6.280  1.00 1.34 ? 26  GLN A HG2    3  
ATOM 6639  H HG3    . GLN C 3 17 ? -94.129  17.892  -5.395  1.00 1.52 ? 26  GLN A HG3    3  
ATOM 6640  H HE21   . GLN C 3 17 ? -91.353  17.013  -5.632  1.00 1.92 ? 26  GLN A HE21   3  
ATOM 6641  H HE22   . GLN C 3 17 ? -91.355  15.568  -6.522  1.00 1.99 ? 26  GLN A HE22   3  
ATOM 6642  N N      . LEU C 3 18 ? -92.514  16.992  -9.353  1.00 0.97 ? 27  LEU A N      3  
ATOM 6643  C CA     . LEU C 3 18 ? -92.088  15.819  -10.181 1.00 0.86 ? 27  LEU A CA     3  
ATOM 6644  C C      . LEU C 3 18 ? -93.226  14.814  -10.373 1.00 0.75 ? 27  LEU A C      3  
ATOM 6645  O O      . LEU C 3 18 ? -93.659  14.570  -11.482 1.00 0.73 ? 27  LEU A O      3  
ATOM 6646  C CB     . LEU C 3 18 ? -90.919  15.100  -9.493  1.00 0.86 ? 27  LEU A CB     3  
ATOM 6647  C CG     . LEU C 3 18 ? -90.390  13.966  -10.399 1.00 0.84 ? 27  LEU A CG     3  
ATOM 6648  C CD1    . LEU C 3 18 ? -88.955  13.612  -9.989  1.00 1.54 ? 27  LEU A CD1    3  
ATOM 6649  C CD2    . LEU C 3 18 ? -91.292  12.699  -10.329 1.00 1.54 ? 27  LEU A CD2    3  
ATOM 6650  H H      . LEU C 3 18 ? -91.922  17.329  -8.648  1.00 1.05 ? 27  LEU A H      3  
ATOM 6651  H HA     . LEU C 3 18 ? -91.763  16.171  -11.146 1.00 0.89 ? 27  LEU A HA     3  
ATOM 6652  H HB2    . LEU C 3 18 ? -90.129  15.815  -9.315  1.00 0.97 ? 27  LEU A HB2    3  
ATOM 6653  H HB3    . LEU C 3 18 ? -91.247  14.692  -8.550  1.00 0.86 ? 27  LEU A HB3    3  
ATOM 6654  H HG     . LEU C 3 18 ? -90.375  14.321  -11.407 1.00 1.37 ? 27  LEU A HG     3  
ATOM 6655  H HD11   . LEU C 3 18 ? -88.329  14.488  -10.086 1.00 2.10 ? 27  LEU A HD11   3  
ATOM 6656  H HD12   . LEU C 3 18 ? -88.944  13.276  -8.966  1.00 1.92 ? 27  LEU A HD12   3  
ATOM 6657  H HD13   . LEU C 3 18 ? -88.578  12.827  -10.629 1.00 2.17 ? 27  LEU A HD13   3  
ATOM 6658  H HD21   . LEU C 3 18 ? -91.851  12.682  -9.408  1.00 1.99 ? 27  LEU A HD21   3  
ATOM 6659  H HD22   . LEU C 3 18 ? -91.983  12.702  -11.165 1.00 2.11 ? 27  LEU A HD22   3  
ATOM 6660  H HD23   . LEU C 3 18 ? -90.680  11.805  -10.387 1.00 2.10 ? 27  LEU A HD23   3  
ATOM 6661  N N      . TRP C 3 19 ? -93.696  14.196  -9.325  1.00 0.75 ? 28  TRP A N      3  
ATOM 6662  C CA     . TRP C 3 19 ? -94.772  13.181  -9.518  1.00 0.70 ? 28  TRP A CA     3  
ATOM 6663  C C      . TRP C 3 19 ? -96.045  13.865  -9.985  1.00 0.73 ? 28  TRP A C      3  
ATOM 6664  O O      . TRP C 3 19 ? -96.809  13.311  -10.747 1.00 0.75 ? 28  TRP A O      3  
ATOM 6665  C CB     . TRP C 3 19 ? -95.045  12.418  -8.217  1.00 0.73 ? 28  TRP A CB     3  
ATOM 6666  C CG     . TRP C 3 19 ? -95.571  13.349  -7.176  1.00 0.83 ? 28  TRP A CG     3  
ATOM 6667  C CD1    . TRP C 3 19 ? -94.805  14.037  -6.308  1.00 0.92 ? 28  TRP A CD1    3  
ATOM 6668  C CD2    . TRP C 3 19 ? -96.957  13.691  -6.864  1.00 0.90 ? 28  TRP A CD2    3  
ATOM 6669  N NE1    . TRP C 3 19 ? -95.624  14.790  -5.485  1.00 1.02 ? 28  TRP A NE1    3  
ATOM 6670  C CE2    . TRP C 3 19 ? -96.958  14.611  -5.789  1.00 1.02 ? 28  TRP A CE2    3  
ATOM 6671  C CE3    . TRP C 3 19 ? -98.196  13.303  -7.403  1.00 0.93 ? 28  TRP A CE3    3  
ATOM 6672  C CZ2    . TRP C 3 19 ? -98.146  15.124  -5.267  1.00 1.14 ? 28  TRP A CZ2    3  
ATOM 6673  C CZ3    . TRP C 3 19 ? -99.395  13.818  -6.881  1.00 1.07 ? 28  TRP A CZ3    3  
ATOM 6674  C CH2    . TRP C 3 19 ? -99.369  14.729  -5.817  1.00 1.16 ? 28  TRP A CH2    3  
ATOM 6675  H H      . TRP C 3 19 ? -93.324  14.373  -8.431  1.00 0.82 ? 28  TRP A H      3  
ATOM 6676  H HA     . TRP C 3 19 ? -94.454  12.484  -10.280 1.00 0.67 ? 28  TRP A HA     3  
ATOM 6677  H HB2    . TRP C 3 19 ? -95.773  11.644  -8.401  1.00 0.72 ? 28  TRP A HB2    3  
ATOM 6678  H HB3    . TRP C 3 19 ? -94.129  11.972  -7.865  1.00 0.74 ? 28  TRP A HB3    3  
ATOM 6679  H HD1    . TRP C 3 19 ? -93.726  14.005  -6.270  1.00 0.95 ? 28  TRP A HD1    3  
ATOM 6680  H HE1    . TRP C 3 19 ? -95.315  15.383  -4.768  1.00 1.12 ? 28  TRP A HE1    3  
ATOM 6681  H HE3    . TRP C 3 19 ? -98.223  12.597  -8.221  1.00 0.88 ? 28  TRP A HE3    3  
ATOM 6682  H HZ2    . TRP C 3 19 ? -98.121  15.826  -4.447  1.00 1.23 ? 28  TRP A HZ2    3  
ATOM 6683  H HZ3    . TRP C 3 19 ? -100.343 13.515  -7.303  1.00 1.14 ? 28  TRP A HZ3    3  
ATOM 6684  H HH2    . TRP C 3 19 ? -100.293 15.121  -5.419  1.00 1.28 ? 28  TRP A HH2    3  
ATOM 6685  N N      . GLN C 3 20 ? -96.277  15.067  -9.557  1.00 0.83 ? 29  GLN A N      3  
ATOM 6686  C CA     . GLN C 3 20 ? -97.504  15.772  -10.002 1.00 0.90 ? 29  GLN A CA     3  
ATOM 6687  C C      . GLN C 3 20 ? -97.454  15.889  -11.523 1.00 0.84 ? 29  GLN A C      3  
ATOM 6688  O O      . GLN C 3 20 ? -98.440  15.700  -12.210 1.00 0.89 ? 29  GLN A O      3  
ATOM 6689  C CB     . GLN C 3 20 ? -97.554  17.157  -9.361  1.00 1.03 ? 29  GLN A CB     3  
ATOM 6690  C CG     . GLN C 3 20 ? -98.871  17.840  -9.721  1.00 1.42 ? 29  GLN A CG     3  
ATOM 6691  C CD     . GLN C 3 20 ? -98.949  19.210  -9.038  1.00 1.81 ? 29  GLN A CD     3  
ATOM 6692  O OE1    . GLN C 3 20 ? -99.627  20.097  -9.514  1.00 2.34 ? 29  GLN A OE1    3  
ATOM 6693  N NE2    . GLN C 3 20 ? -98.274  19.426  -7.938  1.00 2.29 ? 29  GLN A NE2    3  
ATOM 6694  H H      . GLN C 3 20 ? -95.645  15.508  -8.955  1.00 0.91 ? 29  GLN A H      3  
ATOM 6695  H HA     . GLN C 3 20 ? -98.371  15.201  -9.712  1.00 0.93 ? 29  GLN A HA     3  
ATOM 6696  H HB2    . GLN C 3 20 ? -97.485  17.053  -8.288  1.00 1.31 ? 29  GLN A HB2    3  
ATOM 6697  H HB3    . GLN C 3 20 ? -96.729  17.752  -9.718  1.00 1.14 ? 29  GLN A HB3    3  
ATOM 6698  H HG2    . GLN C 3 20 ? -98.933  17.963  -10.793 1.00 1.78 ? 29  GLN A HG2    3  
ATOM 6699  H HG3    . GLN C 3 20 ? -99.692  17.226  -9.382  1.00 2.06 ? 29  GLN A HG3    3  
ATOM 6700  H HE21   . GLN C 3 20 ? -97.717  18.715  -7.557  1.00 2.35 ? 29  GLN A HE21   3  
ATOM 6701  H HE22   . GLN C 3 20 ? -98.334  20.297  -7.489  1.00 2.89 ? 29  GLN A HE22   3  
ATOM 6702  N N      . PHE C 3 21 ? -96.296  16.170  -12.054 1.00 0.80 ? 30  PHE A N      3  
ATOM 6703  C CA     . PHE C 3 21 ? -96.147  16.268  -13.530 1.00 0.77 ? 30  PHE A CA     3  
ATOM 6704  C C      . PHE C 3 21 ? -96.497  14.915  -14.158 1.00 0.68 ? 30  PHE A C      3  
ATOM 6705  O O      . PHE C 3 21 ? -97.304  14.833  -15.062 1.00 0.69 ? 30  PHE A O      3  
ATOM 6706  C CB     . PHE C 3 21 ? -94.698  16.663  -13.856 1.00 0.80 ? 30  PHE A CB     3  
ATOM 6707  C CG     . PHE C 3 21 ? -94.389  16.394  -15.315 1.00 0.77 ? 30  PHE A CG     3  
ATOM 6708  C CD1    . PHE C 3 21 ? -94.899  17.230  -16.317 1.00 0.85 ? 30  PHE A CD1    3  
ATOM 6709  C CD2    . PHE C 3 21 ? -93.594  15.295  -15.657 1.00 0.75 ? 30  PHE A CD2    3  
ATOM 6710  C CE1    . PHE C 3 21 ? -94.613  16.960  -17.663 1.00 0.86 ? 30  PHE A CE1    3  
ATOM 6711  C CE2    . PHE C 3 21 ? -93.308  15.028  -17.001 1.00 0.78 ? 30  PHE A CE2    3  
ATOM 6712  C CZ     . PHE C 3 21 ? -93.818  15.860  -18.003 1.00 0.80 ? 30  PHE A CZ     3  
ATOM 6713  H H      . PHE C 3 21 ? -95.513  16.288  -11.477 1.00 0.83 ? 30  PHE A H      3  
ATOM 6714  H HA     . PHE C 3 21 ? -96.822  17.021  -13.910 1.00 0.83 ? 30  PHE A HA     3  
ATOM 6715  H HB2    . PHE C 3 21 ? -94.568  17.716  -13.654 1.00 0.90 ? 30  PHE A HB2    3  
ATOM 6716  H HB3    . PHE C 3 21 ? -94.024  16.096  -13.233 1.00 0.79 ? 30  PHE A HB3    3  
ATOM 6717  H HD1    . PHE C 3 21 ? -95.511  18.078  -16.052 1.00 0.94 ? 30  PHE A HD1    3  
ATOM 6718  H HD2    . PHE C 3 21 ? -93.199  14.650  -14.880 1.00 0.78 ? 30  PHE A HD2    3  
ATOM 6719  H HE1    . PHE C 3 21 ? -95.005  17.603  -18.438 1.00 0.95 ? 30  PHE A HE1    3  
ATOM 6720  H HE2    . PHE C 3 21 ? -92.695  14.181  -17.264 1.00 0.83 ? 30  PHE A HE2    3  
ATOM 6721  H HZ     . PHE C 3 21 ? -93.601  15.651  -19.041 1.00 0.85 ? 30  PHE A HZ     3  
ATOM 6722  N N      . LEU C 3 22 ? -95.921  13.848  -13.675 1.00 0.65 ? 31  LEU A N      3  
ATOM 6723  C CA     . LEU C 3 22 ? -96.258  12.519  -14.250 1.00 0.60 ? 31  LEU A CA     3  
ATOM 6724  C C      . LEU C 3 22 ? -97.738  12.244  -13.978 1.00 0.60 ? 31  LEU A C      3  
ATOM 6725  O O      . LEU C 3 22 ? -98.453  11.750  -14.823 1.00 0.61 ? 31  LEU A O      3  
ATOM 6726  C CB     . LEU C 3 22 ? -95.401  11.433  -13.589 1.00 0.62 ? 31  LEU A CB     3  
ATOM 6727  C CG     . LEU C 3 22 ? -93.953  11.505  -14.094 1.00 0.79 ? 31  LEU A CG     3  
ATOM 6728  C CD1    . LEU C 3 22 ? -93.099  10.559  -13.249 1.00 1.52 ? 31  LEU A CD1    3  
ATOM 6729  C CD2    . LEU C 3 22 ? -93.865  11.082  -15.583 1.00 1.42 ? 31  LEU A CD2    3  
ATOM 6730  H H      . LEU C 3 22 ? -95.285  13.920  -12.934 1.00 0.69 ? 31  LEU A H      3  
ATOM 6731  H HA     . LEU C 3 22 ? -96.079  12.529  -15.314 1.00 0.60 ? 31  LEU A HA     3  
ATOM 6732  H HB2    . LEU C 3 22 ? -95.401  11.586  -12.520 1.00 0.80 ? 31  LEU A HB2    3  
ATOM 6733  H HB3    . LEU C 3 22 ? -95.811  10.464  -13.813 1.00 0.79 ? 31  LEU A HB3    3  
ATOM 6734  H HG     . LEU C 3 22 ? -93.590  12.513  -13.978 1.00 1.44 ? 31  LEU A HG     3  
ATOM 6735  H HD11   . LEU C 3 22 ? -93.214  10.803  -12.203 1.00 1.96 ? 31  LEU A HD11   3  
ATOM 6736  H HD12   . LEU C 3 22 ? -93.423  9.541   -13.419 1.00 2.08 ? 31  LEU A HD12   3  
ATOM 6737  H HD13   . LEU C 3 22 ? -92.062  10.660  -13.534 1.00 2.05 ? 31  LEU A HD13   3  
ATOM 6738  H HD21   . LEU C 3 22 ? -94.658  10.392  -15.822 1.00 2.02 ? 31  LEU A HD21   3  
ATOM 6739  H HD22   . LEU C 3 22 ? -93.951  11.956  -16.215 1.00 2.02 ? 31  LEU A HD22   3  
ATOM 6740  H HD23   . LEU C 3 22 ? -92.911  10.601  -15.772 1.00 1.85 ? 31  LEU A HD23   3  
ATOM 6741  N N      . LEU C 3 23 ? -98.198  12.581  -12.800 1.00 0.67 ? 32  LEU A N      3  
ATOM 6742  C CA     . LEU C 3 23 ? -99.631  12.358  -12.448 1.00 0.74 ? 32  LEU A CA     3  
ATOM 6743  C C      . LEU C 3 23 ? -100.499 13.190  -13.389 1.00 0.76 ? 32  LEU A C      3  
ATOM 6744  O O      . LEU C 3 23 ? -101.466 12.713  -13.950 1.00 0.78 ? 32  LEU A O      3  
ATOM 6745  C CB     . LEU C 3 23 ? -99.856  12.799  -10.987 1.00 0.89 ? 32  LEU A CB     3  
ATOM 6746  C CG     . LEU C 3 23 ? -101.093 12.121  -10.358 1.00 1.17 ? 32  LEU A CG     3  
ATOM 6747  C CD1    . LEU C 3 23 ? -102.337 12.345  -11.221 1.00 1.42 ? 32  LEU A CD1    3  
ATOM 6748  C CD2    . LEU C 3 23 ? -100.847 10.611  -10.178 1.00 1.91 ? 32  LEU A CD2    3  
ATOM 6749  H H      . LEU C 3 23 ? -97.599  12.987  -12.145 1.00 0.71 ? 32  LEU A H      3  
ATOM 6750  H HA     . LEU C 3 23 ? -99.873  11.324  -12.561 1.00 0.75 ? 32  LEU A HA     3  
ATOM 6751  H HB2    . LEU C 3 23 ? -98.985  12.542  -10.410 1.00 0.98 ? 32  LEU A HB2    3  
ATOM 6752  H HB3    . LEU C 3 23 ? -99.988  13.874  -10.955 1.00 1.37 ? 32  LEU A HB3    3  
ATOM 6753  H HG     . LEU C 3 23 ? -101.266 12.563  -9.386  1.00 1.80 ? 32  LEU A HG     3  
ATOM 6754  H HD11   . LEU C 3 23 ? -102.349 13.363  -11.582 1.00 1.86 ? 32  LEU A HD11   3  
ATOM 6755  H HD12   . LEU C 3 23 ? -102.327 11.663  -12.058 1.00 1.89 ? 32  LEU A HD12   3  
ATOM 6756  H HD13   . LEU C 3 23 ? -103.221 12.168  -10.625 1.00 1.93 ? 32  LEU A HD13   3  
ATOM 6757  H HD21   . LEU C 3 23 ? -99.817  10.439  -9.903  1.00 2.46 ? 32  LEU A HD21   3  
ATOM 6758  H HD22   . LEU C 3 23 ? -101.492 10.239  -9.396  1.00 2.28 ? 32  LEU A HD22   3  
ATOM 6759  H HD23   . LEU C 3 23 ? -101.065 10.087  -11.096 1.00 2.36 ? 32  LEU A HD23   3  
ATOM 6760  N N      . GLU C 3 24 ? -100.159 14.433  -13.569 1.00 0.81 ? 33  GLU A N      3  
ATOM 6761  C CA     . GLU C 3 24 ? -100.972 15.286  -14.471 1.00 0.89 ? 33  GLU A CA     3  
ATOM 6762  C C      . GLU C 3 24 ? -101.000 14.671  -15.873 1.00 0.87 ? 33  GLU A C      3  
ATOM 6763  O O      . GLU C 3 24 ? -102.016 14.666  -16.530 1.00 0.94 ? 33  GLU A O      3  
ATOM 6764  C CB     . GLU C 3 24 ? -100.363 16.692  -14.545 1.00 0.99 ? 33  GLU A CB     3  
ATOM 6765  C CG     . GLU C 3 24 ? -101.287 17.605  -15.358 1.00 1.21 ? 33  GLU A CG     3  
ATOM 6766  C CD     . GLU C 3 24 ? -100.737 19.033  -15.358 1.00 1.80 ? 33  GLU A CD     3  
ATOM 6767  O OE1    . GLU C 3 24 ? -99.725  19.256  -16.001 1.00 2.46 ? 33  GLU A OE1    3  
ATOM 6768  O OE2    . GLU C 3 24 ? -101.340 19.881  -14.721 1.00 2.40 ? 33  GLU A OE2    3  
ATOM 6769  H H      . GLU C 3 24 ? -99.375  14.802  -13.111 1.00 0.82 ? 33  GLU A H      3  
ATOM 6770  H HA     . GLU C 3 24 ? -101.979 15.350  -14.088 1.00 0.95 ? 33  GLU A HA     3  
ATOM 6771  H HB2    . GLU C 3 24 ? -100.248 17.090  -13.549 1.00 1.19 ? 33  GLU A HB2    3  
ATOM 6772  H HB3    . GLU C 3 24 ? -99.398  16.642  -15.026 1.00 1.34 ? 33  GLU A HB3    3  
ATOM 6773  H HG2    . GLU C 3 24 ? -101.338 17.243  -16.371 1.00 1.68 ? 33  GLU A HG2    3  
ATOM 6774  H HG3    . GLU C 3 24 ? -102.277 17.603  -14.923 1.00 1.81 ? 33  GLU A HG3    3  
ATOM 6775  N N      . LEU C 3 25 ? -99.895  14.157  -16.342 1.00 0.84 ? 34  LEU A N      3  
ATOM 6776  C CA     . LEU C 3 25 ? -99.878  13.565  -17.712 1.00 0.90 ? 34  LEU A CA     3  
ATOM 6777  C C      . LEU C 3 25 ? -100.635 12.225  -17.724 1.00 0.87 ? 34  LEU A C      3  
ATOM 6778  O O      . LEU C 3 25 ? -101.104 11.784  -18.755 1.00 0.94 ? 34  LEU A O      3  
ATOM 6779  C CB     . LEU C 3 25 ? -98.410  13.362  -18.162 1.00 1.01 ? 34  LEU A CB     3  
ATOM 6780  C CG     . LEU C 3 25 ? -98.283  13.563  -19.699 1.00 1.09 ? 34  LEU A CG     3  
ATOM 6781  C CD1    . LEU C 3 25 ? -97.990  15.037  -20.015 1.00 1.47 ? 34  LEU A CD1    3  
ATOM 6782  C CD2    . LEU C 3 25 ? -97.146  12.701  -20.270 1.00 1.54 ? 34  LEU A CD2    3  
ATOM 6783  H H      . LEU C 3 25 ? -99.078  14.173  -15.803 1.00 0.83 ? 34  LEU A H      3  
ATOM 6784  H HA     . LEU C 3 25 ? -100.370 14.248  -18.390 1.00 0.99 ? 34  LEU A HA     3  
ATOM 6785  H HB2    . LEU C 3 25 ? -97.788  14.079  -17.643 1.00 1.31 ? 34  LEU A HB2    3  
ATOM 6786  H HB3    . LEU C 3 25 ? -98.086  12.365  -17.899 1.00 1.54 ? 34  LEU A HB3    3  
ATOM 6787  H HG     . LEU C 3 25 ? -99.213  13.282  -20.175 1.00 1.71 ? 34  LEU A HG     3  
ATOM 6788  H HD11   . LEU C 3 25 ? -97.176  15.387  -19.397 1.00 1.86 ? 34  LEU A HD11   3  
ATOM 6789  H HD12   . LEU C 3 25 ? -97.712  15.131  -21.051 1.00 2.10 ? 34  LEU A HD12   3  
ATOM 6790  H HD13   . LEU C 3 25 ? -98.871  15.628  -19.822 1.00 1.85 ? 34  LEU A HD13   3  
ATOM 6791  H HD21   . LEU C 3 25 ? -96.266  12.806  -19.652 1.00 2.05 ? 34  LEU A HD21   3  
ATOM 6792  H HD22   . LEU C 3 25 ? -97.454  11.664  -20.290 1.00 1.91 ? 34  LEU A HD22   3  
ATOM 6793  H HD23   . LEU C 3 25 ? -96.919  13.030  -21.280 1.00 2.01 ? 34  LEU A HD23   3  
ATOM 6794  N N      . LEU C 3 26 ? -100.761 11.569  -16.596 1.00 0.83 ? 35  LEU A N      3  
ATOM 6795  C CA     . LEU C 3 26 ? -101.489 10.262  -16.579 1.00 0.88 ? 35  LEU A CA     3  
ATOM 6796  C C      . LEU C 3 26 ? -102.969 10.458  -16.939 1.00 0.97 ? 35  LEU A C      3  
ATOM 6797  O O      . LEU C 3 26 ? -103.541 9.666   -17.659 1.00 1.12 ? 35  LEU A O      3  
ATOM 6798  C CB     . LEU C 3 26 ? -101.411 9.617   -15.179 1.00 0.86 ? 35  LEU A CB     3  
ATOM 6799  C CG     . LEU C 3 26 ? -100.066 8.905   -14.951 1.00 0.95 ? 35  LEU A CG     3  
ATOM 6800  C CD1    . LEU C 3 26 ? -100.054 8.303   -13.533 1.00 1.23 ? 35  LEU A CD1    3  
ATOM 6801  C CD2    . LEU C 3 26 ? -99.859  7.780   -15.990 1.00 1.45 ? 35  LEU A CD2    3  
ATOM 6802  H H      . LEU C 3 26 ? -100.377 11.928  -15.770 1.00 0.81 ? 35  LEU A H      3  
ATOM 6803  H HA     . LEU C 3 26 ? -101.045 9.604   -17.305 1.00 0.95 ? 35  LEU A HA     3  
ATOM 6804  H HB2    . LEU C 3 26 ? -101.530 10.387  -14.431 1.00 1.13 ? 35  LEU A HB2    3  
ATOM 6805  H HB3    . LEU C 3 26 ? -102.207 8.900   -15.072 1.00 0.99 ? 35  LEU A HB3    3  
ATOM 6806  H HG     . LEU C 3 26 ? -99.268  9.621   -15.040 1.00 1.60 ? 35  LEU A HG     3  
ATOM 6807  H HD11   . LEU C 3 26 ? -101.023 7.878   -13.306 1.00 1.64 ? 35  LEU A HD11   3  
ATOM 6808  H HD12   . LEU C 3 26 ? -99.307  7.528   -13.477 1.00 1.79 ? 35  LEU A HD12   3  
ATOM 6809  H HD13   . LEU C 3 26 ? -99.824  9.070   -12.817 1.00 1.75 ? 35  LEU A HD13   3  
ATOM 6810  H HD21   . LEU C 3 26 ? -100.817 7.421   -16.341 1.00 1.97 ? 35  LEU A HD21   3  
ATOM 6811  H HD22   . LEU C 3 26 ? -99.290  8.166   -16.826 1.00 1.94 ? 35  LEU A HD22   3  
ATOM 6812  H HD23   . LEU C 3 26 ? -99.314  6.961   -15.542 1.00 1.91 ? 35  LEU A HD23   3  
ATOM 6813  N N      . THR C 3 27 ? -103.603 11.485  -16.422 1.00 0.97 ? 36  THR A N      3  
ATOM 6814  C CA     . THR C 3 27 ? -105.063 11.700  -16.714 1.00 1.14 ? 36  THR A CA     3  
ATOM 6815  C C      . THR C 3 27 ? -105.263 12.895  -17.649 1.00 1.22 ? 36  THR A C      3  
ATOM 6816  O O      . THR C 3 27 ? -106.034 13.786  -17.356 1.00 1.57 ? 36  THR A O      3  
ATOM 6817  C CB     . THR C 3 27 ? -105.808 11.967  -15.404 1.00 1.24 ? 36  THR A CB     3  
ATOM 6818  O OG1    . THR C 3 27 ? -105.292 13.145  -14.796 1.00 1.68 ? 36  THR A OG1    3  
ATOM 6819  C CG2    . THR C 3 27 ? -105.637 10.768  -14.462 1.00 1.12 ? 36  THR A CG2    3  
ATOM 6820  H H      . THR C 3 27 ? -103.128 12.100  -15.820 1.00 0.94 ? 36  THR A H      3  
ATOM 6821  H HA     . THR C 3 27 ? -105.482 10.816  -17.177 1.00 1.28 ? 36  THR A HA     3  
ATOM 6822  H HB     . THR C 3 27 ? -106.858 12.105  -15.612 1.00 1.66 ? 36  THR A HB     3  
ATOM 6823  H HG1    . THR C 3 27 ? -104.671 12.884  -14.114 1.00 2.13 ? 36  THR A HG1    3  
ATOM 6824  H HG21   . THR C 3 27 ? -105.911 9.861   -14.983 1.00 1.54 ? 36  THR A HG21   3  
ATOM 6825  H HG22   . THR C 3 27 ? -104.608 10.701  -14.143 1.00 1.67 ? 36  THR A HG22   3  
ATOM 6826  H HG23   . THR C 3 27 ? -106.275 10.893  -13.599 1.00 1.44 ? 36  THR A HG23   3  
ATOM 6827  N N      . ASP C 3 28 ? -104.585 12.925  -18.770 1.00 1.13 ? 37  ASP A N      3  
ATOM 6828  C CA     . ASP C 3 28 ? -104.751 14.069  -19.728 1.00 1.32 ? 37  ASP A CA     3  
ATOM 6829  C C      . ASP C 3 28 ? -105.045 13.542  -21.132 1.00 1.23 ? 37  ASP A C      3  
ATOM 6830  O O      . ASP C 3 28 ? -106.175 13.519  -21.576 1.00 1.40 ? 37  ASP A O      3  
ATOM 6831  C CB     . ASP C 3 28 ? -103.466 14.900  -19.753 1.00 1.71 ? 37  ASP A CB     3  
ATOM 6832  C CG     . ASP C 3 28 ? -103.354 15.724  -18.470 1.00 2.39 ? 37  ASP A CG     3  
ATOM 6833  O OD1    . ASP C 3 28 ? -104.316 15.761  -17.721 1.00 2.90 ? 37  ASP A OD1    3  
ATOM 6834  O OD2    . ASP C 3 28 ? -102.300 16.300  -18.255 1.00 3.08 ? 37  ASP A OD2    3  
ATOM 6835  H H      . ASP C 3 28 ? -103.974 12.189  -18.993 1.00 1.13 ? 37  ASP A H      3  
ATOM 6836  H HA     . ASP C 3 28 ? -105.572 14.699  -19.419 1.00 1.55 ? 37  ASP A HA     3  
ATOM 6837  H HB2    . ASP C 3 28 ? -102.614 14.241  -19.828 1.00 2.12 ? 37  ASP A HB2    3  
ATOM 6838  H HB3    . ASP C 3 28 ? -103.482 15.562  -20.602 1.00 2.03 ? 37  ASP A HB3    3  
ATOM 6839  N N      . LYS C 3 29 ? -104.039 13.126  -21.836 1.00 1.35 ? 38  LYS A N      3  
ATOM 6840  C CA     . LYS C 3 29 ? -104.258 12.612  -23.213 1.00 1.54 ? 38  LYS A CA     3  
ATOM 6841  C C      . LYS C 3 29 ? -104.829 11.200  -23.153 1.00 1.38 ? 38  LYS A C      3  
ATOM 6842  O O      . LYS C 3 29 ? -105.202 10.705  -22.106 1.00 1.52 ? 38  LYS A O      3  
ATOM 6843  C CB     . LYS C 3 29 ? -102.919 12.574  -23.967 1.00 1.99 ? 38  LYS A CB     3  
ATOM 6844  C CG     . LYS C 3 29 ? -101.946 11.536  -23.320 1.00 2.26 ? 38  LYS A CG     3  
ATOM 6845  C CD     . LYS C 3 29 ? -101.624 10.384  -24.293 1.00 2.62 ? 38  LYS A CD     3  
ATOM 6846  C CE     . LYS C 3 29 ? -100.781 9.334   -23.559 1.00 2.90 ? 38  LYS A CE     3  
ATOM 6847  N NZ     . LYS C 3 29 ? -99.569  9.981   -22.982 1.00 3.33 ? 38  LYS A NZ     3  
ATOM 6848  H H      . LYS C 3 29 ? -103.133 13.160  -21.464 1.00 1.53 ? 38  LYS A H      3  
ATOM 6849  H HA     . LYS C 3 29 ? -104.947 13.259  -23.733 1.00 1.79 ? 38  LYS A HA     3  
ATOM 6850  H HB2    . LYS C 3 29 ? -103.105 12.318  -25.000 1.00 2.39 ? 38  LYS A HB2    3  
ATOM 6851  H HB3    . LYS C 3 29 ? -102.474 13.560  -23.926 1.00 2.33 ? 38  LYS A HB3    3  
ATOM 6852  H HG2    . LYS C 3 29 ? -101.022 12.032  -23.059 1.00 2.66 ? 38  LYS A HG2    3  
ATOM 6853  H HG3    . LYS C 3 29 ? -102.379 11.119  -22.421 1.00 2.59 ? 38  LYS A HG3    3  
ATOM 6854  H HD2    . LYS C 3 29 ? -102.542 9.928   -24.645 1.00 2.95 ? 38  LYS A HD2    3  
ATOM 6855  H HD3    . LYS C 3 29 ? -101.065 10.764  -25.135 1.00 2.89 ? 38  LYS A HD3    3  
ATOM 6856  H HE2    . LYS C 3 29 ? -101.364 8.898   -22.761 1.00 2.93 ? 38  LYS A HE2    3  
ATOM 6857  H HE3    . LYS C 3 29 ? -100.479 8.562   -24.251 1.00 3.19 ? 38  LYS A HE3    3  
ATOM 6858  H HZ1    . LYS C 3 29 ? -99.542  10.982  -23.269 1.00 3.54 ? 38  LYS A HZ1    3  
ATOM 6859  H HZ2    . LYS C 3 29 ? -99.604  9.919   -21.943 1.00 3.57 ? 38  LYS A HZ2    3  
ATOM 6860  H HZ3    . LYS C 3 29 ? -98.716  9.496   -23.326 1.00 3.68 ? 38  LYS A HZ3    3  
ATOM 6861  N N      . SER C 3 30 ? -104.864 10.549  -24.277 1.00 1.47 ? 39  SER A N      3  
ATOM 6862  C CA     . SER C 3 30 ? -105.364 9.155   -24.325 1.00 1.66 ? 39  SER A CA     3  
ATOM 6863  C C      . SER C 3 30 ? -104.289 8.255   -23.713 1.00 1.51 ? 39  SER A C      3  
ATOM 6864  O O      . SER C 3 30 ? -103.768 8.542   -22.657 1.00 2.21 ? 39  SER A O      3  
ATOM 6865  C CB     . SER C 3 30 ? -105.593 8.748   -25.783 1.00 2.14 ? 39  SER A CB     3  
ATOM 6866  O OG     . SER C 3 30 ? -106.576 9.597   -26.358 1.00 2.66 ? 39  SER A OG     3  
ATOM 6867  H H      . SER C 3 30 ? -104.533 10.976  -25.094 1.00 1.64 ? 39  SER A H      3  
ATOM 6868  H HA     . SER C 3 30 ? -106.285 9.067   -23.766 1.00 1.84 ? 39  SER A HA     3  
ATOM 6869  H HB2    . SER C 3 30 ? -104.671 8.845   -26.334 1.00 2.27 ? 39  SER A HB2    3  
ATOM 6870  H HB3    . SER C 3 30 ? -105.924 7.719   -25.820 1.00 2.50 ? 39  SER A HB3    3  
ATOM 6871  H HG     . SER C 3 30 ? -107.309 9.049   -26.646 1.00 2.78 ? 39  SER A HG     3  
ATOM 6872  N N      . CYS C 3 31 ? -103.943 7.181   -24.369 1.00 1.29 ? 40  CYS A N      3  
ATOM 6873  C CA     . CYS C 3 31 ? -102.892 6.277   -23.819 1.00 1.29 ? 40  CYS A CA     3  
ATOM 6874  C C      . CYS C 3 31 ? -102.581 5.176   -24.834 1.00 1.22 ? 40  CYS A C      3  
ATOM 6875  O O      . CYS C 3 31 ? -101.439 4.844   -25.086 1.00 1.43 ? 40  CYS A O      3  
ATOM 6876  C CB     . CYS C 3 31 ? -103.405 5.637   -22.528 1.00 1.49 ? 40  CYS A CB     3  
ATOM 6877  S SG     . CYS C 3 31 ? -104.896 4.679   -22.899 1.00 2.22 ? 40  CYS A SG     3  
ATOM 6878  H H      . CYS C 3 31 ? -104.367 6.975   -25.227 1.00 1.74 ? 40  CYS A H      3  
ATOM 6879  H HA     . CYS C 3 31 ? -101.998 6.839   -23.612 1.00 1.44 ? 40  CYS A HA     3  
ATOM 6880  H HB2    . CYS C 3 31 ? -102.648 4.983   -22.122 1.00 2.08 ? 40  CYS A HB2    3  
ATOM 6881  H HB3    . CYS C 3 31 ? -103.638 6.402   -21.807 1.00 1.69 ? 40  CYS A HB3    3  
ATOM 6882  H HG     . CYS C 3 31 ? -104.624 3.794   -23.148 1.00 2.54 ? 40  CYS A HG     3  
ATOM 6883  N N      . GLN C 3 32 ? -103.598 4.608   -25.401 1.00 1.22 ? 41  GLN A N      3  
ATOM 6884  C CA     . GLN C 3 32 ? -103.413 3.513   -26.393 1.00 1.29 ? 41  GLN A CA     3  
ATOM 6885  C C      . GLN C 3 32 ? -102.519 3.963   -27.549 1.00 1.34 ? 41  GLN A C      3  
ATOM 6886  O O      . GLN C 3 32 ? -102.112 3.167   -28.371 1.00 1.87 ? 41  GLN A O      3  
ATOM 6887  C CB     . GLN C 3 32 ? -104.784 3.136   -26.937 1.00 1.53 ? 41  GLN A CB     3  
ATOM 6888  C CG     . GLN C 3 32 ? -105.574 2.438   -25.834 1.00 1.82 ? 41  GLN A CG     3  
ATOM 6889  C CD     . GLN C 3 32 ? -107.001 2.174   -26.310 1.00 2.46 ? 41  GLN A CD     3  
ATOM 6890  O OE1    . GLN C 3 32 ? -107.443 2.741   -27.287 1.00 3.09 ? 41  GLN A OE1    3  
ATOM 6891  N NE2    . GLN C 3 32 ? -107.746 1.330   -25.650 1.00 3.04 ? 41  GLN A NE2    3  
ATOM 6892  H H      . GLN C 3 32 ? -104.504 4.898   -25.166 1.00 1.38 ? 41  GLN A H      3  
ATOM 6893  H HA     . GLN C 3 32 ? -102.976 2.656   -25.909 1.00 1.32 ? 41  GLN A HA     3  
ATOM 6894  H HB2    . GLN C 3 32 ? -105.304 4.038   -27.246 1.00 1.80 ? 41  GLN A HB2    3  
ATOM 6895  H HB3    . GLN C 3 32 ? -104.672 2.472   -27.781 1.00 1.71 ? 41  GLN A HB3    3  
ATOM 6896  H HG2    . GLN C 3 32 ? -105.096 1.500   -25.590 1.00 2.21 ? 41  GLN A HG2    3  
ATOM 6897  H HG3    . GLN C 3 32 ? -105.600 3.067   -24.959 1.00 2.11 ? 41  GLN A HG3    3  
ATOM 6898  H HE21   . GLN C 3 32 ? -107.388 0.873   -24.861 1.00 3.14 ? 41  GLN A HE21   3  
ATOM 6899  H HE22   . GLN C 3 32 ? -108.664 1.158   -25.938 1.00 3.73 ? 41  GLN A HE22   3  
ATOM 6900  N N      . SER C 3 33 ? -102.233 5.229   -27.644 1.00 1.34 ? 42  SER A N      3  
ATOM 6901  C CA     . SER C 3 33 ? -101.391 5.711   -28.777 1.00 1.48 ? 42  SER A CA     3  
ATOM 6902  C C      . SER C 3 33 ? -99.906  5.358   -28.578 1.00 1.27 ? 42  SER A C      3  
ATOM 6903  O O      . SER C 3 33 ? -99.252  4.908   -29.498 1.00 1.35 ? 42  SER A O      3  
ATOM 6904  C CB     . SER C 3 33 ? -101.551 7.227   -28.895 1.00 1.80 ? 42  SER A CB     3  
ATOM 6905  O OG     . SER C 3 33 ? -101.128 7.846   -27.686 1.00 2.41 ? 42  SER A OG     3  
ATOM 6906  H H      . SER C 3 33 ? -102.584 5.863   -26.987 1.00 1.65 ? 42  SER A H      3  
ATOM 6907  H HA     . SER C 3 33 ? -101.739 5.252   -29.690 1.00 1.66 ? 42  SER A HA     3  
ATOM 6908  H HB2    . SER C 3 33 ? -100.948 7.593   -29.708 1.00 2.13 ? 42  SER A HB2    3  
ATOM 6909  H HB3    . SER C 3 33 ? -102.590 7.462   -29.087 1.00 2.05 ? 42  SER A HB3    3  
ATOM 6910  H HG     . SER C 3 33 ? -101.398 7.290   -26.954 1.00 2.79 ? 42  SER A HG     3  
ATOM 6911  N N      . PHE C 3 34 ? -99.357  5.571   -27.403 1.00 1.12 ? 43  PHE A N      3  
ATOM 6912  C CA     . PHE C 3 34 ? -97.902  5.261   -27.173 1.00 1.04 ? 43  PHE A CA     3  
ATOM 6913  C C      . PHE C 3 34 ? -97.734  4.457   -25.880 1.00 0.94 ? 43  PHE A C      3  
ATOM 6914  O O      . PHE C 3 34 ? -96.635  4.239   -25.410 1.00 0.91 ? 43  PHE A O      3  
ATOM 6915  C CB     . PHE C 3 34 ? -97.132  6.582   -27.045 1.00 1.12 ? 43  PHE A CB     3  
ATOM 6916  C CG     . PHE C 3 34 ? -97.697  7.580   -28.026 1.00 1.19 ? 43  PHE A CG     3  
ATOM 6917  C CD1    . PHE C 3 34 ? -97.306  7.546   -29.371 1.00 1.41 ? 43  PHE A CD1    3  
ATOM 6918  C CD2    . PHE C 3 34 ? -98.623  8.535   -27.590 1.00 1.35 ? 43  PHE A CD2    3  
ATOM 6919  C CE1    . PHE C 3 34 ? -97.841  8.473   -30.277 1.00 1.56 ? 43  PHE A CE1    3  
ATOM 6920  C CE2    . PHE C 3 34 ? -99.159  9.457   -28.494 1.00 1.53 ? 43  PHE A CE2    3  
ATOM 6921  C CZ     . PHE C 3 34 ? -98.768  9.428   -29.838 1.00 1.54 ? 43  PHE A CZ     3  
ATOM 6922  H H      . PHE C 3 34 ? -99.895  5.948   -26.676 1.00 1.16 ? 43  PHE A H      3  
ATOM 6923  H HA     . PHE C 3 34 ? -97.503  4.691   -28.000 1.00 1.15 ? 43  PHE A HA     3  
ATOM 6924  H HB2    . PHE C 3 34 ? -97.230  6.970   -26.041 1.00 1.21 ? 43  PHE A HB2    3  
ATOM 6925  H HB3    . PHE C 3 34 ? -96.088  6.414   -27.263 1.00 1.28 ? 43  PHE A HB3    3  
ATOM 6926  H HD1    . PHE C 3 34 ? -96.595  6.809   -29.709 1.00 1.63 ? 43  PHE A HD1    3  
ATOM 6927  H HD2    . PHE C 3 34 ? -98.925  8.558   -26.553 1.00 1.52 ? 43  PHE A HD2    3  
ATOM 6928  H HE1    . PHE C 3 34 ? -97.541  8.451   -31.314 1.00 1.84 ? 43  PHE A HE1    3  
ATOM 6929  H HE2    . PHE C 3 34 ? -99.877  10.191  -28.153 1.00 1.81 ? 43  PHE A HE2    3  
ATOM 6930  H HZ     . PHE C 3 34 ? -99.181  10.140  -30.535 1.00 1.73 ? 43  PHE A HZ     3  
ATOM 6931  N N      . ILE C 3 35 ? -98.810  4.038   -25.285 1.00 0.93 ? 44  ILE A N      3  
ATOM 6932  C CA     . ILE C 3 35 ? -98.694  3.289   -24.011 1.00 0.88 ? 44  ILE A CA     3  
ATOM 6933  C C      . ILE C 3 35 ? -100.018 2.577   -23.729 1.00 0.92 ? 44  ILE A C      3  
ATOM 6934  O O      . ILE C 3 35 ? -100.912 2.582   -24.551 1.00 1.02 ? 44  ILE A O      3  
ATOM 6935  C CB     . ILE C 3 35 ? -98.345  4.300   -22.907 1.00 0.83 ? 44  ILE A CB     3  
ATOM 6936  C CG1    . ILE C 3 35 ? -97.929  3.574   -21.616 1.00 1.11 ? 44  ILE A CG1    3  
ATOM 6937  C CG2    . ILE C 3 35 ? -99.541  5.216   -22.617 1.00 0.85 ? 44  ILE A CG2    3  
ATOM 6938  C CD1    . ILE C 3 35 ? -97.105  4.520   -20.742 1.00 1.14 ? 44  ILE A CD1    3  
ATOM 6939  H H      . ILE C 3 35 ? -99.691  4.238   -25.661 1.00 0.99 ? 44  ILE A H      3  
ATOM 6940  H HA     . ILE C 3 35 ? -97.907  2.558   -24.095 1.00 0.93 ? 44  ILE A HA     3  
ATOM 6941  H HB     . ILE C 3 35 ? -97.521  4.910   -23.253 1.00 1.08 ? 44  ILE A HB     3  
ATOM 6942  H HG12   . ILE C 3 35 ? -98.808  3.269   -21.071 1.00 1.23 ? 44  ILE A HG12   3  
ATOM 6943  H HG13   . ILE C 3 35 ? -97.336  2.709   -21.861 1.00 1.52 ? 44  ILE A HG13   3  
ATOM 6944  H HG21   . ILE C 3 35 ? -99.872  5.683   -23.533 1.00 1.37 ? 44  ILE A HG21   3  
ATOM 6945  H HG22   . ILE C 3 35 ? -100.349 4.639   -22.198 1.00 1.24 ? 44  ILE A HG22   3  
ATOM 6946  H HG23   . ILE C 3 35 ? -99.245  5.981   -21.913 1.00 1.50 ? 44  ILE A HG23   3  
ATOM 6947  H HD11   . ILE C 3 35 ? -97.562  5.496   -20.747 1.00 1.39 ? 44  ILE A HD11   3  
ATOM 6948  H HD12   . ILE C 3 35 ? -97.070  4.141   -19.731 1.00 1.56 ? 44  ILE A HD12   3  
ATOM 6949  H HD13   . ILE C 3 35 ? -96.100  4.594   -21.132 1.00 1.68 ? 44  ILE A HD13   3  
ATOM 6950  N N      . SER C 3 36 ? -100.156 1.964   -22.582 1.00 0.88 ? 45  SER A N      3  
ATOM 6951  C CA     . SER C 3 36 ? -101.421 1.252   -22.251 1.00 0.95 ? 45  SER A CA     3  
ATOM 6952  C C      . SER C 3 36 ? -101.809 1.612   -20.819 1.00 0.90 ? 45  SER A C      3  
ATOM 6953  O O      . SER C 3 36 ? -101.032 1.475   -19.896 1.00 0.88 ? 45  SER A O      3  
ATOM 6954  C CB     . SER C 3 36 ? -101.194 -0.252  -22.389 1.00 1.05 ? 45  SER A CB     3  
ATOM 6955  O OG     . SER C 3 36 ? -100.096 -0.635  -21.577 1.00 1.71 ? 45  SER A OG     3  
ATOM 6956  H H      . SER C 3 36 ? -99.426  1.969   -21.931 1.00 0.85 ? 45  SER A H      3  
ATOM 6957  H HA     . SER C 3 36 ? -102.212 1.561   -22.920 1.00 1.03 ? 45  SER A HA     3  
ATOM 6958  H HB2    . SER C 3 36 ? -102.073 -0.783  -22.076 1.00 1.42 ? 45  SER A HB2    3  
ATOM 6959  H HB3    . SER C 3 36 ? -100.988 -0.488  -23.423 1.00 1.48 ? 45  SER A HB3    3  
ATOM 6960  H HG     . SER C 3 36 ? -100.182 -0.187  -20.734 1.00 2.19 ? 45  SER A HG     3  
ATOM 6961  N N      . TRP C 3 37 ? -103.005 2.105   -20.640 1.00 0.95 ? 46  TRP A N      3  
ATOM 6962  C CA     . TRP C 3 37 ? -103.470 2.528   -19.284 1.00 0.94 ? 46  TRP A CA     3  
ATOM 6963  C C      . TRP C 3 37 ? -104.281 1.393   -18.635 1.00 1.08 ? 46  TRP A C      3  
ATOM 6964  O O      . TRP C 3 37 ? -104.286 0.271   -19.099 1.00 1.46 ? 46  TRP A O      3  
ATOM 6965  C CB     . TRP C 3 37 ? -104.353 3.774   -19.462 1.00 0.98 ? 46  TRP A CB     3  
ATOM 6966  C CG     . TRP C 3 37 ? -104.192 4.784   -18.348 1.00 0.93 ? 46  TRP A CG     3  
ATOM 6967  C CD1    . TRP C 3 37 ? -104.513 6.095   -18.494 1.00 0.93 ? 46  TRP A CD1    3  
ATOM 6968  C CD2    . TRP C 3 37 ? -103.709 4.640   -16.960 1.00 0.95 ? 46  TRP A CD2    3  
ATOM 6969  N NE1    . TRP C 3 37 ? -104.269 6.759   -17.309 1.00 0.92 ? 46  TRP A NE1    3  
ATOM 6970  C CE2    . TRP C 3 37 ? -103.771 5.915   -16.338 1.00 0.93 ? 46  TRP A CE2    3  
ATOM 6971  C CE3    . TRP C 3 37 ? -103.226 3.562   -16.176 1.00 1.06 ? 46  TRP A CE3    3  
ATOM 6972  C CZ2    . TRP C 3 37 ? -103.377 6.107   -15.012 1.00 0.99 ? 46  TRP A CZ2    3  
ATOM 6973  C CZ3    . TRP C 3 37 ? -102.832 3.768   -14.846 1.00 1.14 ? 46  TRP A CZ3    3  
ATOM 6974  C CH2    . TRP C 3 37 ? -102.907 5.034   -14.270 1.00 1.10 ? 46  TRP A CH2    3  
ATOM 6975  H H      . TRP C 3 37 ? -103.598 2.223   -21.412 1.00 1.03 ? 46  TRP A H      3  
ATOM 6976  H HA     . TRP C 3 37 ? -102.613 2.772   -18.679 1.00 0.89 ? 46  TRP A HA     3  
ATOM 6977  H HB2    . TRP C 3 37 ? -104.071 4.246   -20.389 1.00 0.99 ? 46  TRP A HB2    3  
ATOM 6978  H HB3    . TRP C 3 37 ? -105.389 3.477   -19.526 1.00 1.09 ? 46  TRP A HB3    3  
ATOM 6979  H HD1    . TRP C 3 37 ? -104.904 6.548   -19.394 1.00 0.98 ? 46  TRP A HD1    3  
ATOM 6980  H HE1    . TRP C 3 37 ? -104.423 7.716   -17.157 1.00 0.95 ? 46  TRP A HE1    3  
ATOM 6981  H HE3    . TRP C 3 37 ? -103.151 2.579   -16.586 1.00 1.12 ? 46  TRP A HE3    3  
ATOM 6982  H HZ2    . TRP C 3 37 ? -103.439 7.082   -14.566 1.00 1.00 ? 46  TRP A HZ2    3  
ATOM 6983  H HZ3    . TRP C 3 37 ? -102.466 2.944   -14.262 1.00 1.27 ? 46  TRP A HZ3    3  
ATOM 6984  H HH2    . TRP C 3 37 ? -102.596 5.179   -13.251 1.00 1.19 ? 46  TRP A HH2    3  
ATOM 6985  N N      . THR C 3 38 ? -104.970 1.687   -17.560 1.00 1.02 ? 47  THR A N      3  
ATOM 6986  C CA     . THR C 3 38 ? -105.790 0.654   -16.871 1.00 1.19 ? 47  THR A CA     3  
ATOM 6987  C C      . THR C 3 38 ? -107.235 0.772   -17.357 1.00 1.21 ? 47  THR A C      3  
ATOM 6988  O O      . THR C 3 38 ? -107.641 1.798   -17.865 1.00 1.40 ? 47  THR A O      3  
ATOM 6989  C CB     . THR C 3 38 ? -105.727 0.871   -15.349 1.00 1.42 ? 47  THR A CB     3  
ATOM 6990  O OG1    . THR C 3 38 ? -104.439 1.362   -14.999 1.00 2.04 ? 47  THR A OG1    3  
ATOM 6991  C CG2    . THR C 3 38 ? -105.964 -0.459  -14.639 1.00 1.85 ? 47  THR A CG2    3  
ATOM 6992  H H      . THR C 3 38 ? -104.951 2.603   -17.210 1.00 1.07 ? 47  THR A H      3  
ATOM 6993  H HA     . THR C 3 38 ? -105.411 -0.330  -17.116 1.00 1.47 ? 47  THR A HA     3  
ATOM 6994  H HB     . THR C 3 38 ? -106.481 1.582   -15.041 1.00 1.84 ? 47  THR A HB     3  
ATOM 6995  H HG1    . THR C 3 38 ? -104.462 2.318   -15.049 1.00 2.47 ? 47  THR A HG1    3  
ATOM 6996  H HG21   . THR C 3 38 ? -106.851 -0.926  -15.037 1.00 2.33 ? 47  THR A HG21   3  
ATOM 6997  H HG22   . THR C 3 38 ? -105.113 -1.104  -14.802 1.00 2.30 ? 47  THR A HG22   3  
ATOM 6998  H HG23   . THR C 3 38 ? -106.087 -0.290  -13.585 1.00 2.22 ? 47  THR A HG23   3  
ATOM 6999  N N      . GLY C 3 39 ? -108.013 -0.266  -17.208 1.00 1.49 ? 48  GLY A N      3  
ATOM 7000  C CA     . GLY C 3 39 ? -109.436 -0.216  -17.666 1.00 1.74 ? 48  GLY A CA     3  
ATOM 7001  C C      . GLY C 3 39 ? -110.373 -0.041  -16.465 1.00 1.64 ? 48  GLY A C      3  
ATOM 7002  O O      . GLY C 3 39 ? -111.447 0.515   -16.592 1.00 1.95 ? 48  GLY A O      3  
ATOM 7003  H H      . GLY C 3 39 ? -107.662 -1.084  -16.798 1.00 1.75 ? 48  GLY A H      3  
ATOM 7004  H HA2    . GLY C 3 39 ? -109.578 0.606   -18.354 1.00 1.91 ? 48  GLY A HA2    3  
ATOM 7005  H HA3    . GLY C 3 39 ? -109.678 -1.141  -18.167 1.00 2.13 ? 48  GLY A HA3    3  
ATOM 7006  N N      . ASP C 3 40 ? -109.989 -0.520  -15.302 1.00 1.50 ? 49  ASP A N      3  
ATOM 7007  C CA     . ASP C 3 40 ? -110.879 -0.387  -14.100 1.00 1.64 ? 49  ASP A CA     3  
ATOM 7008  C C      . ASP C 3 40 ? -110.086 -0.004  -12.845 1.00 1.38 ? 49  ASP A C      3  
ATOM 7009  O O      . ASP C 3 40 ? -110.505 0.838   -12.074 1.00 1.37 ? 49  ASP A O      3  
ATOM 7010  C CB     . ASP C 3 40 ? -111.565 -1.724  -13.850 1.00 2.11 ? 49  ASP A CB     3  
ATOM 7011  C CG     . ASP C 3 40 ? -110.501 -2.802  -13.647 1.00 2.89 ? 49  ASP A CG     3  
ATOM 7012  O OD1    . ASP C 3 40 ? -109.469 -2.717  -14.295 1.00 3.56 ? 49  ASP A OD1    3  
ATOM 7013  O OD2    . ASP C 3 40 ? -110.733 -3.694  -12.849 1.00 3.35 ? 49  ASP A OD2    3  
ATOM 7014  H H      . ASP C 3 40 ? -109.125 -0.974  -15.221 1.00 1.54 ? 49  ASP A H      3  
ATOM 7015  H HA     . ASP C 3 40 ? -111.631 0.365   -14.278 1.00 1.89 ? 49  ASP A HA     3  
ATOM 7016  H HB2    . ASP C 3 40 ? -112.181 -1.653  -12.965 1.00 2.24 ? 49  ASP A HB2    3  
ATOM 7017  H HB3    . ASP C 3 40 ? -112.178 -1.983  -14.700 1.00 2.45 ? 49  ASP A HB3    3  
ATOM 7018  N N      . GLY C 3 41 ? -108.969 -0.637  -12.603 1.00 1.32 ? 50  GLY A N      3  
ATOM 7019  C CA     . GLY C 3 41 ? -108.191 -0.326  -11.373 1.00 1.25 ? 50  GLY A CA     3  
ATOM 7020  C C      . GLY C 3 41 ? -107.294 0.884   -11.603 1.00 1.14 ? 50  GLY A C      3  
ATOM 7021  O O      . GLY C 3 41 ? -107.752 1.966   -11.906 1.00 1.18 ? 50  GLY A O      3  
ATOM 7022  H H      . GLY C 3 41 ? -108.653 -1.331  -13.214 1.00 1.46 ? 50  GLY A H      3  
ATOM 7023  H HA2    . GLY C 3 41 ? -108.872 -0.120  -10.559 1.00 1.28 ? 50  GLY A HA2    3  
ATOM 7024  H HA3    . GLY C 3 41 ? -107.579 -1.178  -11.118 1.00 1.37 ? 50  GLY A HA3    3  
ATOM 7025  N N      . TRP C 3 42 ? -106.017 0.706   -11.452 1.00 1.06 ? 51  TRP A N      3  
ATOM 7026  C CA     . TRP C 3 42 ? -105.084 1.846   -11.647 1.00 0.97 ? 51  TRP A CA     3  
ATOM 7027  C C      . TRP C 3 42 ? -103.674 1.308   -11.922 1.00 0.93 ? 51  TRP A C      3  
ATOM 7028  O O      . TRP C 3 42 ? -102.710 1.726   -11.309 1.00 0.98 ? 51  TRP A O      3  
ATOM 7029  C CB     . TRP C 3 42 ? -105.090 2.687   -10.368 1.00 0.99 ? 51  TRP A CB     3  
ATOM 7030  C CG     . TRP C 3 42 ? -104.276 3.931   -10.542 1.00 0.94 ? 51  TRP A CG     3  
ATOM 7031  C CD1    . TRP C 3 42 ? -103.000 4.093   -10.115 1.00 1.03 ? 51  TRP A CD1    3  
ATOM 7032  C CD2    . TRP C 3 42 ? -104.664 5.198   -11.155 1.00 0.88 ? 51  TRP A CD2    3  
ATOM 7033  N NE1    . TRP C 3 42 ? -102.584 5.371   -10.431 1.00 0.97 ? 51  TRP A NE1    3  
ATOM 7034  C CE2    . TRP C 3 42 ? -103.571 6.090   -11.069 1.00 0.87 ? 51  TRP A CE2    3  
ATOM 7035  C CE3    . TRP C 3 42 ? -105.844 5.658   -11.773 1.00 0.97 ? 51  TRP A CE3    3  
ATOM 7036  C CZ2    . TRP C 3 42 ? -103.643 7.387   -11.574 1.00 0.86 ? 51  TRP A CZ2    3  
ATOM 7037  C CZ3    . TRP C 3 42 ? -105.918 6.965   -12.284 1.00 1.05 ? 51  TRP A CZ3    3  
ATOM 7038  C CH2    . TRP C 3 42 ? -104.820 7.826   -12.183 1.00 0.97 ? 51  TRP A CH2    3  
ATOM 7039  H H      . TRP C 3 42 ? -105.675 -0.178  -11.205 1.00 1.09 ? 51  TRP A H      3  
ATOM 7040  H HA     . TRP C 3 42 ? -105.412 2.449   -12.481 1.00 0.96 ? 51  TRP A HA     3  
ATOM 7041  H HB2    . TRP C 3 42 ? -106.108 2.962   -10.133 1.00 1.05 ? 51  TRP A HB2    3  
ATOM 7042  H HB3    . TRP C 3 42 ? -104.684 2.105   -9.556  1.00 1.03 ? 51  TRP A HB3    3  
ATOM 7043  H HD1    . TRP C 3 42 ? -102.404 3.347   -9.614  1.00 1.18 ? 51  TRP A HD1    3  
ATOM 7044  H HE1    . TRP C 3 42 ? -101.698 5.740   -10.231 1.00 1.05 ? 51  TRP A HE1    3  
ATOM 7045  H HE3    . TRP C 3 42 ? -106.693 5.004   -11.859 1.00 1.05 ? 51  TRP A HE3    3  
ATOM 7046  H HZ2    . TRP C 3 42 ? -102.795 8.046   -11.495 1.00 0.87 ? 51  TRP A HZ2    3  
ATOM 7047  H HZ3    . TRP C 3 42 ? -106.828 7.307   -12.756 1.00 1.22 ? 51  TRP A HZ3    3  
ATOM 7048  H HH2    . TRP C 3 42 ? -104.883 8.828   -12.579 1.00 1.05 ? 51  TRP A HH2    3  
ATOM 7049  N N      . GLU C 3 43 ? -103.543 0.390   -12.852 1.00 0.91 ? 52  GLU A N      3  
ATOM 7050  C CA     . GLU C 3 43 ? -102.192 -0.171  -13.178 1.00 0.89 ? 52  GLU A CA     3  
ATOM 7051  C C      . GLU C 3 43 ? -101.670 0.529   -14.432 1.00 0.85 ? 52  GLU A C      3  
ATOM 7052  O O      . GLU C 3 43 ? -102.264 0.466   -15.489 1.00 0.98 ? 52  GLU A O      3  
ATOM 7053  C CB     . GLU C 3 43 ? -102.301 -1.675  -13.437 1.00 0.97 ? 52  GLU A CB     3  
ATOM 7054  C CG     . GLU C 3 43 ? -100.896 -2.268  -13.599 1.00 1.48 ? 52  GLU A CG     3  
ATOM 7055  C CD     . GLU C 3 43 ? -100.999 -3.774  -13.861 1.00 1.81 ? 52  GLU A CD     3  
ATOM 7056  O OE1    . GLU C 3 43 ? -101.562 -4.142  -14.877 1.00 2.50 ? 52  GLU A OE1    3  
ATOM 7057  O OE2    . GLU C 3 43 ? -100.510 -4.534  -13.041 1.00 2.20 ? 52  GLU A OE2    3  
ATOM 7058  H H      . GLU C 3 43 ? -104.332 0.075   -13.341 1.00 0.97 ? 52  GLU A H      3  
ATOM 7059  H HA     . GLU C 3 43 ? -101.508 0.008   -12.357 1.00 0.88 ? 52  GLU A HA     3  
ATOM 7060  H HB2    . GLU C 3 43 ? -102.800 -2.147  -12.603 1.00 1.28 ? 52  GLU A HB2    3  
ATOM 7061  H HB3    . GLU C 3 43 ? -102.866 -1.845  -14.341 1.00 1.29 ? 52  GLU A HB3    3  
ATOM 7062  H HG2    . GLU C 3 43 ? -100.396 -1.792  -14.431 1.00 2.17 ? 52  GLU A HG2    3  
ATOM 7063  H HG3    . GLU C 3 43 ? -100.328 -2.100  -12.696 1.00 1.98 ? 52  GLU A HG3    3  
ATOM 7064  N N      . PHE C 3 44 ? -100.571 1.215   -14.304 1.00 0.74 ? 53  PHE A N      3  
ATOM 7065  C CA     . PHE C 3 44 ? -99.992  1.964   -15.457 1.00 0.72 ? 53  PHE A CA     3  
ATOM 7066  C C      . PHE C 3 44 ? -98.859  1.139   -16.067 1.00 0.72 ? 53  PHE A C      3  
ATOM 7067  O O      . PHE C 3 44 ? -97.898  0.806   -15.400 1.00 0.76 ? 53  PHE A O      3  
ATOM 7068  C CB     . PHE C 3 44 ? -99.453  3.289   -14.913 1.00 0.69 ? 53  PHE A CB     3  
ATOM 7069  C CG     . PHE C 3 44 ? -98.983  4.201   -16.027 1.00 0.71 ? 53  PHE A CG     3  
ATOM 7070  C CD1    . PHE C 3 44 ? -99.911  4.817   -16.876 1.00 0.77 ? 53  PHE A CD1    3  
ATOM 7071  C CD2    . PHE C 3 44 ? -97.616  4.463   -16.184 1.00 0.70 ? 53  PHE A CD2    3  
ATOM 7072  C CE1    . PHE C 3 44 ? -99.472  5.693   -17.878 1.00 0.82 ? 53  PHE A CE1    3  
ATOM 7073  C CE2    . PHE C 3 44 ? -97.178  5.330   -17.190 1.00 0.75 ? 53  PHE A CE2    3  
ATOM 7074  C CZ     . PHE C 3 44 ? -98.105  5.946   -18.034 1.00 0.80 ? 53  PHE A CZ     3  
ATOM 7075  H H      . PHE C 3 44 ? -100.131 1.257   -13.433 1.00 0.73 ? 53  PHE A H      3  
ATOM 7076  H HA     . PHE C 3 44 ? -100.754 2.154   -16.199 1.00 0.75 ? 53  PHE A HA     3  
ATOM 7077  H HB2    . PHE C 3 44 ? -100.237 3.787   -14.362 1.00 0.70 ? 53  PHE A HB2    3  
ATOM 7078  H HB3    . PHE C 3 44 ? -98.631  3.084   -14.243 1.00 0.68 ? 53  PHE A HB3    3  
ATOM 7079  H HD1    . PHE C 3 44 ? -100.964 4.621   -16.758 1.00 0.80 ? 53  PHE A HD1    3  
ATOM 7080  H HD2    . PHE C 3 44 ? -96.900  3.987   -15.534 1.00 0.70 ? 53  PHE A HD2    3  
ATOM 7081  H HE1    . PHE C 3 44 ? -100.189 6.173   -18.529 1.00 0.89 ? 53  PHE A HE1    3  
ATOM 7082  H HE2    . PHE C 3 44 ? -96.123  5.528   -17.315 1.00 0.77 ? 53  PHE A HE2    3  
ATOM 7083  H HZ     . PHE C 3 44 ? -97.767  6.627   -18.799 1.00 0.86 ? 53  PHE A HZ     3  
ATOM 7084  N N      . LYS C 3 45 ? -98.972  0.790   -17.330 1.00 0.75 ? 54  LYS A N      3  
ATOM 7085  C CA     . LYS C 3 45 ? -97.910  -0.036  -17.996 1.00 0.80 ? 54  LYS A CA     3  
ATOM 7086  C C      . LYS C 3 45 ? -97.187  0.774   -19.072 1.00 0.79 ? 54  LYS A C      3  
ATOM 7087  O O      . LYS C 3 45 ? -97.802  1.389   -19.931 1.00 0.82 ? 54  LYS A O      3  
ATOM 7088  C CB     . LYS C 3 45 ? -98.556  -1.256  -18.655 1.00 0.91 ? 54  LYS A CB     3  
ATOM 7089  C CG     . LYS C 3 45 ? -97.461  -2.141  -19.266 1.00 1.53 ? 54  LYS A CG     3  
ATOM 7090  C CD     . LYS C 3 45 ? -98.033  -3.510  -19.679 1.00 1.63 ? 54  LYS A CD     3  
ATOM 7091  C CE     . LYS C 3 45 ? -98.968  -3.364  -20.888 1.00 1.85 ? 54  LYS A CE     3  
ATOM 7092  N NZ     . LYS C 3 45 ? -98.301  -2.560  -21.949 1.00 2.34 ? 54  LYS A NZ     3  
ATOM 7093  H H      . LYS C 3 45 ? -99.763  1.064   -17.838 1.00 0.78 ? 54  LYS A H      3  
ATOM 7094  H HA     . LYS C 3 45 ? -97.191  -0.372  -17.260 1.00 0.81 ? 54  LYS A HA     3  
ATOM 7095  H HB2    . LYS C 3 45 ? -99.110  -1.814  -17.914 1.00 1.36 ? 54  LYS A HB2    3  
ATOM 7096  H HB3    . LYS C 3 45 ? -99.225  -0.925  -19.428 1.00 1.53 ? 54  LYS A HB3    3  
ATOM 7097  H HG2    . LYS C 3 45 ? -97.047  -1.646  -20.134 1.00 2.22 ? 54  LYS A HG2    3  
ATOM 7098  H HG3    . LYS C 3 45 ? -96.678  -2.289  -18.536 1.00 2.07 ? 54  LYS A HG3    3  
ATOM 7099  H HD2    . LYS C 3 45 ? -97.220  -4.172  -19.940 1.00 2.26 ? 54  LYS A HD2    3  
ATOM 7100  H HD3    . LYS C 3 45 ? -98.585  -3.931  -18.852 1.00 1.90 ? 54  LYS A HD3    3  
ATOM 7101  H HE2    . LYS C 3 45 ? -99.203  -4.345  -21.277 1.00 2.32 ? 54  LYS A HE2    3  
ATOM 7102  H HE3    . LYS C 3 45 ? -99.879  -2.873  -20.583 1.00 2.34 ? 54  LYS A HE3    3  
ATOM 7103  H HZ1    . LYS C 3 45 ? -97.277  -2.534  -21.772 1.00 2.82 ? 54  LYS A HZ1    3  
ATOM 7104  H HZ2    . LYS C 3 45 ? -98.485  -2.993  -22.877 1.00 2.78 ? 54  LYS A HZ2    3  
ATOM 7105  H HZ3    . LYS C 3 45 ? -98.678  -1.592  -21.938 1.00 2.58 ? 54  LYS A HZ3    3  
ATOM 7106  N N      . LEU C 3 46 ? -95.880  0.759   -19.030 1.00 0.80 ? 55  LEU A N      3  
ATOM 7107  C CA     . LEU C 3 46 ? -95.064  1.508   -20.031 1.00 0.82 ? 55  LEU A CA     3  
ATOM 7108  C C      . LEU C 3 46 ? -94.720  0.610   -21.226 1.00 0.90 ? 55  LEU A C      3  
ATOM 7109  O O      . LEU C 3 46 ? -93.788  -0.172  -21.174 1.00 0.98 ? 55  LEU A O      3  
ATOM 7110  C CB     . LEU C 3 46 ? -93.762  1.939   -19.361 1.00 0.85 ? 55  LEU A CB     3  
ATOM 7111  C CG     . LEU C 3 46 ? -93.983  3.193   -18.518 1.00 0.78 ? 55  LEU A CG     3  
ATOM 7112  C CD1    . LEU C 3 46 ? -95.018  2.905   -17.418 1.00 1.30 ? 55  LEU A CD1    3  
ATOM 7113  C CD2    . LEU C 3 46 ? -92.644  3.598   -17.890 1.00 1.25 ? 55  LEU A CD2    3  
ATOM 7114  H H      . LEU C 3 46 ? -95.426  0.246   -18.328 1.00 0.82 ? 55  LEU A H      3  
ATOM 7115  H HA     . LEU C 3 46 ? -95.600  2.379   -20.371 1.00 0.81 ? 55  LEU A HA     3  
ATOM 7116  H HB2    . LEU C 3 46 ? -93.418  1.144   -18.720 1.00 0.89 ? 55  LEU A HB2    3  
ATOM 7117  H HB3    . LEU C 3 46 ? -93.017  2.141   -20.111 1.00 0.94 ? 55  LEU A HB3    3  
ATOM 7118  H HG     . LEU C 3 46 ? -94.344  3.993   -19.150 1.00 1.16 ? 55  LEU A HG     3  
ATOM 7119  H HD11   . LEU C 3 46 ? -94.899  1.892   -17.060 1.00 1.90 ? 55  LEU A HD11   3  
ATOM 7120  H HD12   . LEU C 3 46 ? -94.877  3.594   -16.599 1.00 1.77 ? 55  LEU A HD12   3  
ATOM 7121  H HD13   . LEU C 3 46 ? -96.014  3.028   -17.822 1.00 1.76 ? 55  LEU A HD13   3  
ATOM 7122  H HD21   . LEU C 3 46 ? -91.869  3.571   -18.639 1.00 1.81 ? 55  LEU A HD21   3  
ATOM 7123  H HD22   . LEU C 3 46 ? -92.716  4.593   -17.490 1.00 1.70 ? 55  LEU A HD22   3  
ATOM 7124  H HD23   . LEU C 3 46 ? -92.398  2.906   -17.100 1.00 1.79 ? 55  LEU A HD23   3  
ATOM 7125  N N      . SER C 3 47 ? -95.434  0.734   -22.307 1.00 0.91 ? 56  SER A N      3  
ATOM 7126  C CA     . SER C 3 47 ? -95.114  -0.099  -23.499 1.00 1.02 ? 56  SER A CA     3  
ATOM 7127  C C      . SER C 3 47 ? -93.905  0.501   -24.236 1.00 1.01 ? 56  SER A C      3  
ATOM 7128  O O      . SER C 3 47 ? -92.887  -0.142  -24.400 1.00 1.08 ? 56  SER A O      3  
ATOM 7129  C CB     . SER C 3 47 ? -96.320  -0.135  -24.441 1.00 1.09 ? 56  SER A CB     3  
ATOM 7130  O OG     . SER C 3 47 ? -96.415  1.100   -25.140 1.00 1.60 ? 56  SER A OG     3  
ATOM 7131  H H      . SER C 3 47 ? -96.166  1.383   -22.341 1.00 0.90 ? 56  SER A H      3  
ATOM 7132  H HA     . SER C 3 47 ? -94.875  -1.105  -23.184 1.00 1.09 ? 56  SER A HA     3  
ATOM 7133  H HB2    . SER C 3 47 ? -96.203  -0.933  -25.152 1.00 1.39 ? 56  SER A HB2    3  
ATOM 7134  H HB3    . SER C 3 47 ? -97.220  -0.300  -23.862 1.00 1.65 ? 56  SER A HB3    3  
ATOM 7135  H HG     . SER C 3 47 ? -96.694  0.909   -26.040 1.00 1.97 ? 56  SER A HG     3  
ATOM 7136  N N      . ASP C 3 48 ? -94.014  1.733   -24.686 1.00 0.98 ? 57  ASP A N      3  
ATOM 7137  C CA     . ASP C 3 48 ? -92.872  2.379   -25.416 1.00 1.02 ? 57  ASP A CA     3  
ATOM 7138  C C      . ASP C 3 48 ? -92.861  3.903   -25.164 1.00 0.91 ? 57  ASP A C      3  
ATOM 7139  O O      . ASP C 3 48 ? -93.247  4.661   -26.034 1.00 1.09 ? 57  ASP A O      3  
ATOM 7140  C CB     . ASP C 3 48 ? -93.031  2.107   -26.915 1.00 1.30 ? 57  ASP A CB     3  
ATOM 7141  C CG     . ASP C 3 48 ? -91.792  2.593   -27.672 1.00 1.93 ? 57  ASP A CG     3  
ATOM 7142  O OD1    . ASP C 3 48 ? -90.907  3.144   -27.038 1.00 2.54 ? 57  ASP A OD1    3  
ATOM 7143  O OD2    . ASP C 3 48 ? -91.750  2.405   -28.878 1.00 2.54 ? 57  ASP A OD2    3  
ATOM 7144  H H      . ASP C 3 48 ? -94.846  2.230   -24.544 1.00 0.98 ? 57  ASP A H      3  
ATOM 7145  H HA     . ASP C 3 48 ? -91.941  1.953   -25.084 1.00 1.02 ? 57  ASP A HA     3  
ATOM 7146  H HB2    . ASP C 3 48 ? -93.152  1.046   -27.070 1.00 1.58 ? 57  ASP A HB2    3  
ATOM 7147  H HB3    . ASP C 3 48 ? -93.903  2.624   -27.285 1.00 1.71 ? 57  ASP A HB3    3  
ATOM 7148  N N      . PRO C 3 49 ? -92.416  4.325   -23.996 1.00 0.73 ? 58  PRO A N      3  
ATOM 7149  C CA     . PRO C 3 49 ? -92.358  5.768   -23.667 1.00 0.78 ? 58  PRO A CA     3  
ATOM 7150  C C      . PRO C 3 49 ? -91.299  6.454   -24.551 1.00 0.88 ? 58  PRO A C      3  
ATOM 7151  O O      . PRO C 3 49 ? -90.359  7.061   -24.071 1.00 1.09 ? 58  PRO A O      3  
ATOM 7152  C CB     . PRO C 3 49 ? -91.965  5.810   -22.168 1.00 0.79 ? 58  PRO A CB     3  
ATOM 7153  C CG     . PRO C 3 49 ? -91.582  4.363   -21.751 1.00 0.82 ? 58  PRO A CG     3  
ATOM 7154  C CD     . PRO C 3 49 ? -91.953  3.423   -22.920 1.00 0.72 ? 58  PRO A CD     3  
ATOM 7155  H HA     . PRO C 3 49 ? -93.324  6.227   -23.811 1.00 0.89 ? 58  PRO A HA     3  
ATOM 7156  H HB2    . PRO C 3 49 ? -91.127  6.477   -22.006 1.00 0.85 ? 58  PRO A HB2    3  
ATOM 7157  H HB3    . PRO C 3 49 ? -92.806  6.142   -21.576 1.00 0.89 ? 58  PRO A HB3    3  
ATOM 7158  H HG2    . PRO C 3 49 ? -90.517  4.307   -21.553 1.00 0.96 ? 58  PRO A HG2    3  
ATOM 7159  H HG3    . PRO C 3 49 ? -92.126  4.082   -20.870 1.00 0.99 ? 58  PRO A HG3    3  
ATOM 7160  H HD2    . PRO C 3 49 ? -91.082  2.865   -23.237 1.00 0.83 ? 58  PRO A HD2    3  
ATOM 7161  H HD3    . PRO C 3 49 ? -92.748  2.751   -22.633 1.00 0.73 ? 58  PRO A HD3    3  
ATOM 7162  N N      . ASP C 3 50 ? -91.442  6.355   -25.843 1.00 1.08 ? 59  ASP A N      3  
ATOM 7163  C CA     . ASP C 3 50 ? -90.442  6.984   -26.754 1.00 1.21 ? 59  ASP A CA     3  
ATOM 7164  C C      . ASP C 3 50 ? -90.536  8.504   -26.667 1.00 0.99 ? 59  ASP A C      3  
ATOM 7165  O O      . ASP C 3 50 ? -89.546  9.202   -26.765 1.00 0.93 ? 59  ASP A O      3  
ATOM 7166  C CB     . ASP C 3 50 ? -90.729  6.552   -28.192 1.00 1.59 ? 59  ASP A CB     3  
ATOM 7167  C CG     . ASP C 3 50 ? -89.553  6.941   -29.088 1.00 2.29 ? 59  ASP A CG     3  
ATOM 7168  O OD1    . ASP C 3 50 ? -88.798  7.813   -28.697 1.00 2.89 ? 59  ASP A OD1    3  
ATOM 7169  O OD2    . ASP C 3 50 ? -89.430  6.363   -30.155 1.00 2.85 ? 59  ASP A OD2    3  
ATOM 7170  H H      . ASP C 3 50 ? -92.203  5.859   -26.216 1.00 1.31 ? 59  ASP A H      3  
ATOM 7171  H HA     . ASP C 3 50 ? -89.448  6.669   -26.475 1.00 1.33 ? 59  ASP A HA     3  
ATOM 7172  H HB2    . ASP C 3 50 ? -90.870  5.481   -28.225 1.00 1.90 ? 59  ASP A HB2    3  
ATOM 7173  H HB3    . ASP C 3 50 ? -91.624  7.044   -28.544 1.00 1.83 ? 59  ASP A HB3    3  
ATOM 7174  N N      . GLU C 3 51 ? -91.714  9.028   -26.498 1.00 1.03 ? 60  GLU A N      3  
ATOM 7175  C CA     . GLU C 3 51 ? -91.863  10.506  -26.419 1.00 1.01 ? 60  GLU A CA     3  
ATOM 7176  C C      . GLU C 3 51 ? -91.717  10.971  -24.974 1.00 0.85 ? 60  GLU A C      3  
ATOM 7177  O O      . GLU C 3 51 ? -91.176  12.025  -24.707 1.00 0.89 ? 60  GLU A O      3  
ATOM 7178  C CB     . GLU C 3 51 ? -93.243  10.885  -26.957 1.00 1.29 ? 60  GLU A CB     3  
ATOM 7179  C CG     . GLU C 3 51 ? -93.319  10.558  -28.451 1.00 1.82 ? 60  GLU A CG     3  
ATOM 7180  C CD     . GLU C 3 51 ? -92.332  11.436  -29.222 1.00 2.52 ? 60  GLU A CD     3  
ATOM 7181  O OE1    . GLU C 3 51 ? -92.577  12.627  -29.318 1.00 3.15 ? 60  GLU A OE1    3  
ATOM 7182  O OE2    . GLU C 3 51 ? -91.340  10.904  -29.695 1.00 3.05 ? 60  GLU A OE2    3  
ATOM 7183  H H      . GLU C 3 51 ? -92.504  8.451   -26.424 1.00 1.18 ? 60  GLU A H      3  
ATOM 7184  H HA     . GLU C 3 51 ? -91.102  10.982  -27.018 1.00 1.06 ? 60  GLU A HA     3  
ATOM 7185  H HB2    . GLU C 3 51 ? -93.998  10.320  -26.429 1.00 1.71 ? 60  GLU A HB2    3  
ATOM 7186  H HB3    . GLU C 3 51 ? -93.415  11.940  -26.810 1.00 1.56 ? 60  GLU A HB3    3  
ATOM 7187  H HG2    . GLU C 3 51 ? -93.074  9.518   -28.604 1.00 2.24 ? 60  GLU A HG2    3  
ATOM 7188  H HG3    . GLU C 3 51 ? -94.320  10.748  -28.807 1.00 2.29 ? 60  GLU A HG3    3  
ATOM 7189  N N      . VAL C 3 52 ? -92.182  10.201  -24.039 1.00 0.74 ? 61  VAL A N      3  
ATOM 7190  C CA     . VAL C 3 52 ? -92.048  10.620  -22.622 1.00 0.68 ? 61  VAL A CA     3  
ATOM 7191  C C      . VAL C 3 52 ? -90.565  10.584  -22.223 1.00 0.65 ? 61  VAL A C      3  
ATOM 7192  O O      . VAL C 3 52 ? -90.072  11.470  -21.551 1.00 0.72 ? 61  VAL A O      3  
ATOM 7193  C CB     . VAL C 3 52 ? -92.838  9.661   -21.739 1.00 0.69 ? 61  VAL A CB     3  
ATOM 7194  C CG1    . VAL C 3 52 ? -92.651  10.048  -20.272 1.00 0.76 ? 61  VAL A CG1    3  
ATOM 7195  C CG2    . VAL C 3 52 ? -94.328  9.719   -22.116 1.00 0.80 ? 61  VAL A CG2    3  
ATOM 7196  H H      . VAL C 3 52 ? -92.614  9.352   -24.267 1.00 0.78 ? 61  VAL A H      3  
ATOM 7197  H HA     . VAL C 3 52 ? -92.433  11.624  -22.504 1.00 0.74 ? 61  VAL A HA     3  
ATOM 7198  H HB     . VAL C 3 52 ? -92.463  8.665   -21.891 1.00 0.68 ? 61  VAL A HB     3  
ATOM 7199  H HG11   . VAL C 3 52 ? -92.760  11.117  -20.164 1.00 1.34 ? 61  VAL A HG11   3  
ATOM 7200  H HG12   . VAL C 3 52 ? -93.394  9.546   -19.670 1.00 1.23 ? 61  VAL A HG12   3  
ATOM 7201  H HG13   . VAL C 3 52 ? -91.664  9.753   -19.950 1.00 1.28 ? 61  VAL A HG13   3  
ATOM 7202  H HG21   . VAL C 3 52 ? -94.682  10.738  -22.046 1.00 1.26 ? 61  VAL A HG21   3  
ATOM 7203  H HG22   . VAL C 3 52 ? -94.458  9.363   -23.128 1.00 1.35 ? 61  VAL A HG22   3  
ATOM 7204  H HG23   . VAL C 3 52 ? -94.898  9.095   -21.443 1.00 1.29 ? 61  VAL A HG23   3  
ATOM 7205  N N      . ALA C 3 53 ? -89.853  9.561   -22.632 1.00 0.66 ? 62  ALA A N      3  
ATOM 7206  C CA     . ALA C 3 53 ? -88.406  9.466   -22.274 1.00 0.72 ? 62  ALA A CA     3  
ATOM 7207  C C      . ALA C 3 53 ? -87.638  10.612  -22.932 1.00 0.78 ? 62  ALA A C      3  
ATOM 7208  O O      . ALA C 3 53 ? -86.827  11.263  -22.305 1.00 0.84 ? 62  ALA A O      3  
ATOM 7209  C CB     . ALA C 3 53 ? -87.835  8.125   -22.757 1.00 0.80 ? 62  ALA A CB     3  
ATOM 7210  H H      . ALA C 3 53 ? -90.271  8.858   -23.172 1.00 0.71 ? 62  ALA A H      3  
ATOM 7211  H HA     . ALA C 3 53 ? -88.297  9.533   -21.201 1.00 0.73 ? 62  ALA A HA     3  
ATOM 7212  H HB1    . ALA C 3 53 ? -88.018  8.010   -23.815 1.00 1.24 ? 62  ALA A HB1    3  
ATOM 7213  H HB2    . ALA C 3 53 ? -86.768  8.099   -22.574 1.00 1.26 ? 62  ALA A HB2    3  
ATOM 7214  H HB3    . ALA C 3 53 ? -88.308  7.317   -22.222 1.00 1.40 ? 62  ALA A HB3    3  
ATOM 7215  N N      . ARG C 3 54 ? -87.884  10.872  -24.189 1.00 0.82 ? 63  ARG A N      3  
ATOM 7216  C CA     . ARG C 3 54 ? -87.168  11.992  -24.866 1.00 0.93 ? 63  ARG A CA     3  
ATOM 7217  C C      . ARG C 3 54 ? -87.554  13.302  -24.188 1.00 0.93 ? 63  ARG A C      3  
ATOM 7218  O O      . ARG C 3 54 ? -86.727  14.157  -23.940 1.00 1.02 ? 63  ARG A O      3  
ATOM 7219  C CB     . ARG C 3 54 ? -87.581  12.058  -26.342 1.00 1.04 ? 63  ARG A CB     3  
ATOM 7220  C CG     . ARG C 3 54 ? -86.993  10.866  -27.122 1.00 1.39 ? 63  ARG A CG     3  
ATOM 7221  C CD     . ARG C 3 54 ? -85.581  11.196  -27.635 1.00 1.86 ? 63  ARG A CD     3  
ATOM 7222  N NE     . ARG C 3 54 ? -85.683  12.129  -28.797 1.00 2.35 ? 63  ARG A NE     3  
ATOM 7223  C CZ     . ARG C 3 54 ? -84.622  12.742  -29.257 1.00 2.86 ? 63  ARG A CZ     3  
ATOM 7224  N NH1    . ARG C 3 54 ? -83.455  12.565  -28.696 1.00 3.05 ? 63  ARG A NH1    3  
ATOM 7225  N NH2    . ARG C 3 54 ? -84.733  13.538  -30.281 1.00 3.69 ? 63  ARG A NH2    3  
ATOM 7226  H H      . ARG C 3 54 ? -88.549  10.342  -24.684 1.00 0.82 ? 63  ARG A H      3  
ATOM 7227  H HA     . ARG C 3 54 ? -86.100  11.840  -24.790 1.00 0.99 ? 63  ARG A HA     3  
ATOM 7228  H HB2    . ARG C 3 54 ? -88.660  12.028  -26.404 1.00 1.35 ? 63  ARG A HB2    3  
ATOM 7229  H HB3    . ARG C 3 54 ? -87.227  12.984  -26.770 1.00 1.35 ? 63  ARG A HB3    3  
ATOM 7230  H HG2    . ARG C 3 54 ? -86.943  10.001  -26.476 1.00 1.83 ? 63  ARG A HG2    3  
ATOM 7231  H HG3    . ARG C 3 54 ? -87.630  10.641  -27.962 1.00 1.81 ? 63  ARG A HG3    3  
ATOM 7232  H HD2    . ARG C 3 54 ? -85.006  11.660  -26.852 1.00 2.39 ? 63  ARG A HD2    3  
ATOM 7233  H HD3    . ARG C 3 54 ? -85.093  10.283  -27.945 1.00 2.26 ? 63  ARG A HD3    3  
ATOM 7234  H HE     . ARG C 3 54 ? -86.551  12.280  -29.225 1.00 2.78 ? 63  ARG A HE     3  
ATOM 7235  H HH11   . ARG C 3 54 ? -83.367  11.957  -27.905 1.00 2.90 ? 63  ARG A HH11   3  
ATOM 7236  H HH12   . ARG C 3 54 ? -82.651  13.039  -29.056 1.00 3.72 ? 63  ARG A HH12   3  
ATOM 7237  H HH21   . ARG C 3 54 ? -85.626  13.682  -30.706 1.00 4.05 ? 63  ARG A HH21   3  
ATOM 7238  H HH22   . ARG C 3 54 ? -83.925  14.001  -30.644 1.00 4.21 ? 63  ARG A HH22   3  
ATOM 7239  N N      . ARG C 3 55 ? -88.816  13.466  -23.897 1.00 0.88 ? 64  ARG A N      3  
ATOM 7240  C CA     . ARG C 3 55 ? -89.278  14.723  -23.250 1.00 0.94 ? 64  ARG A CA     3  
ATOM 7241  C C      . ARG C 3 55 ? -88.593  14.924  -21.894 1.00 0.88 ? 64  ARG A C      3  
ATOM 7242  O O      . ARG C 3 55 ? -88.179  16.016  -21.561 1.00 0.99 ? 64  ARG A O      3  
ATOM 7243  C CB     . ARG C 3 55 ? -90.798  14.672  -23.032 1.00 0.96 ? 64  ARG A CB     3  
ATOM 7244  C CG     . ARG C 3 55 ? -91.264  15.921  -22.256 1.00 1.39 ? 64  ARG A CG     3  
ATOM 7245  C CD     . ARG C 3 55 ? -90.781  17.195  -22.958 1.00 1.63 ? 64  ARG A CD     3  
ATOM 7246  N NE     . ARG C 3 55 ? -90.940  17.032  -24.430 1.00 2.14 ? 64  ARG A NE     3  
ATOM 7247  C CZ     . ARG C 3 55 ? -90.854  18.064  -25.219 1.00 2.59 ? 64  ARG A CZ     3  
ATOM 7248  N NH1    . ARG C 3 55 ? -90.622  19.248  -24.731 1.00 2.81 ? 64  ARG A NH1    3  
ATOM 7249  N NH2    . ARG C 3 55 ? -91.010  17.914  -26.503 1.00 3.46 ? 64  ARG A NH2    3  
ATOM 7250  H H      . ARG C 3 55 ? -89.461  12.759  -24.114 1.00 0.85 ? 64  ARG A H      3  
ATOM 7251  H HA     . ARG C 3 55 ? -89.039  15.547  -23.901 1.00 1.03 ? 64  ARG A HA     3  
ATOM 7252  H HB2    . ARG C 3 55 ? -91.300  14.631  -23.988 1.00 1.10 ? 64  ARG A HB2    3  
ATOM 7253  H HB3    . ARG C 3 55 ? -91.048  13.790  -22.460 1.00 1.35 ? 64  ARG A HB3    3  
ATOM 7254  H HG2    . ARG C 3 55 ? -92.342  15.930  -22.205 1.00 2.06 ? 64  ARG A HG2    3  
ATOM 7255  H HG3    . ARG C 3 55 ? -90.867  15.895  -21.253 1.00 1.99 ? 64  ARG A HG3    3  
ATOM 7256  H HD2    . ARG C 3 55 ? -91.369  18.035  -22.623 1.00 2.13 ? 64  ARG A HD2    3  
ATOM 7257  H HD3    . ARG C 3 55 ? -89.743  17.373  -22.716 1.00 2.13 ? 64  ARG A HD3    3  
ATOM 7258  H HE     . ARG C 3 55 ? -91.114  16.147  -24.806 1.00 2.69 ? 64  ARG A HE     3  
ATOM 7259  H HH11   . ARG C 3 55 ? -90.511  19.371  -23.745 1.00 2.64 ? 64  ARG A HH11   3  
ATOM 7260  H HH12   . ARG C 3 55 ? -90.555  20.034  -25.345 1.00 3.55 ? 64  ARG A HH12   3  
ATOM 7261  H HH21   . ARG C 3 55 ? -91.198  17.010  -26.882 1.00 3.83 ? 64  ARG A HH21   3  
ATOM 7262  H HH22   . ARG C 3 55 ? -90.938  18.704  -27.109 1.00 4.01 ? 64  ARG A HH22   3  
ATOM 7263  N N      . TRP C 3 56 ? -88.498  13.894  -21.099 1.00 0.77 ? 65  TRP A N      3  
ATOM 7264  C CA     . TRP C 3 56 ? -87.869  14.057  -19.756 1.00 0.74 ? 65  TRP A CA     3  
ATOM 7265  C C      . TRP C 3 56 ? -86.454  14.612  -19.931 1.00 0.80 ? 65  TRP A C      3  
ATOM 7266  O O      . TRP C 3 56 ? -85.991  15.421  -19.152 1.00 0.89 ? 65  TRP A O      3  
ATOM 7267  C CB     . TRP C 3 56 ? -87.813  12.690  -19.060 1.00 0.67 ? 65  TRP A CB     3  
ATOM 7268  C CG     . TRP C 3 56 ? -87.646  12.856  -17.582 1.00 0.67 ? 65  TRP A CG     3  
ATOM 7269  C CD1    . TRP C 3 56 ? -86.467  12.981  -16.927 1.00 0.65 ? 65  TRP A CD1    3  
ATOM 7270  C CD2    . TRP C 3 56 ? -88.683  12.890  -16.564 1.00 0.77 ? 65  TRP A CD2    3  
ATOM 7271  N NE1    . TRP C 3 56 ? -86.720  13.106  -15.568 1.00 0.70 ? 65  TRP A NE1    3  
ATOM 7272  C CE2    . TRP C 3 56 ? -88.075  13.049  -15.297 1.00 0.79 ? 65  TRP A CE2    3  
ATOM 7273  C CE3    . TRP C 3 56 ? -90.086  12.802  -16.620 1.00 0.91 ? 65  TRP A CE3    3  
ATOM 7274  C CZ2    . TRP C 3 56 ? -88.832  13.114  -14.128 1.00 0.93 ? 65  TRP A CZ2    3  
ATOM 7275  C CZ3    . TRP C 3 56 ? -90.845  12.866  -15.448 1.00 1.08 ? 65  TRP A CZ3    3  
ATOM 7276  C CH2    . TRP C 3 56 ? -90.225  13.022  -14.205 1.00 1.08 ? 65  TRP A CH2    3  
ATOM 7277  H H      . TRP C 3 56 ? -88.861  13.021  -21.372 1.00 0.75 ? 65  TRP A H      3  
ATOM 7278  H HA     . TRP C 3 56 ? -88.454  14.744  -19.165 1.00 0.80 ? 65  TRP A HA     3  
ATOM 7279  H HB2    . TRP C 3 56 ? -88.733  12.157  -19.251 1.00 0.70 ? 65  TRP A HB2    3  
ATOM 7280  H HB3    . TRP C 3 56 ? -86.983  12.121  -19.452 1.00 0.66 ? 65  TRP A HB3    3  
ATOM 7281  H HD1    . TRP C 3 56 ? -85.491  12.992  -17.391 1.00 0.68 ? 65  TRP A HD1    3  
ATOM 7282  H HE1    . TRP C 3 56 ? -86.038  13.220  -14.865 1.00 0.73 ? 65  TRP A HE1    3  
ATOM 7283  H HE3    . TRP C 3 56 ? -90.587  12.680  -17.570 1.00 0.94 ? 65  TRP A HE3    3  
ATOM 7284  H HZ2    . TRP C 3 56 ? -88.348  13.233  -13.171 1.00 0.97 ? 65  TRP A HZ2    3  
ATOM 7285  H HZ3    . TRP C 3 56 ? -91.913  12.797  -15.507 1.00 1.23 ? 65  TRP A HZ3    3  
ATOM 7286  H HH2    . TRP C 3 56 ? -90.823  13.065  -13.306 1.00 1.23 ? 65  TRP A HH2    3  
ATOM 7287  N N      . GLY C 3 57 ? -85.767  14.186  -20.951 1.00 0.87 ? 66  GLY A N      3  
ATOM 7288  C CA     . GLY C 3 57 ? -84.383  14.690  -21.175 1.00 1.00 ? 66  GLY A CA     3  
ATOM 7289  C C      . GLY C 3 57 ? -84.425  16.078  -21.818 1.00 1.06 ? 66  GLY A C      3  
ATOM 7290  O O      . GLY C 3 57 ? -83.544  16.887  -21.616 1.00 1.09 ? 66  GLY A O      3  
ATOM 7291  H H      . GLY C 3 57 ? -86.160  13.534  -21.571 1.00 0.90 ? 66  GLY A H      3  
ATOM 7292  H HA2    . GLY C 3 57 ? -83.869  14.754  -20.227 1.00 1.01 ? 66  GLY A HA2    3  
ATOM 7293  H HA3    . GLY C 3 57 ? -83.853  14.014  -21.826 1.00 1.11 ? 66  GLY A HA3    3  
ATOM 7294  N N      . LYS C 3 58 ? -85.431  16.366  -22.599 1.00 1.15 ? 67  LYS A N      3  
ATOM 7295  C CA     . LYS C 3 58 ? -85.492  17.709  -23.247 1.00 1.31 ? 67  LYS A CA     3  
ATOM 7296  C C      . LYS C 3 58 ? -85.689  18.796  -22.195 1.00 1.29 ? 67  LYS A C      3  
ATOM 7297  O O      . LYS C 3 58 ? -85.169  19.886  -22.317 1.00 1.36 ? 67  LYS A O      3  
ATOM 7298  C CB     . LYS C 3 58 ? -86.636  17.760  -24.258 1.00 1.50 ? 67  LYS A CB     3  
ATOM 7299  C CG     . LYS C 3 58 ? -86.240  16.970  -25.505 1.00 1.98 ? 67  LYS A CG     3  
ATOM 7300  C CD     . LYS C 3 58 ? -87.411  16.915  -26.484 1.00 2.17 ? 67  LYS A CD     3  
ATOM 7301  C CE     . LYS C 3 58 ? -86.984  16.171  -27.754 1.00 2.32 ? 67  LYS A CE     3  
ATOM 7302  N NZ     . LYS C 3 58 ? -85.883  16.914  -28.429 1.00 2.71 ? 67  LYS A NZ     3  
ATOM 7303  H H      . LYS C 3 58 ? -86.137  15.704  -22.761 1.00 1.15 ? 67  LYS A H      3  
ATOM 7304  H HA     . LYS C 3 58 ? -84.559  17.889  -23.758 1.00 1.39 ? 67  LYS A HA     3  
ATOM 7305  H HB2    . LYS C 3 58 ? -87.525  17.329  -23.821 1.00 1.51 ? 67  LYS A HB2    3  
ATOM 7306  H HB3    . LYS C 3 58 ? -86.829  18.786  -24.533 1.00 1.70 ? 67  LYS A HB3    3  
ATOM 7307  H HG2    . LYS C 3 58 ? -85.404  17.458  -25.978 1.00 2.34 ? 67  LYS A HG2    3  
ATOM 7308  H HG3    . LYS C 3 58 ? -85.957  15.966  -25.224 1.00 2.33 ? 67  LYS A HG3    3  
ATOM 7309  H HD2    . LYS C 3 58 ? -88.239  16.396  -26.022 1.00 2.56 ? 67  LYS A HD2    3  
ATOM 7310  H HD3    . LYS C 3 58 ? -87.712  17.918  -26.740 1.00 2.44 ? 67  LYS A HD3    3  
ATOM 7311  H HE2    . LYS C 3 58 ? -86.640  15.181  -27.493 1.00 2.57 ? 67  LYS A HE2    3  
ATOM 7312  H HE3    . LYS C 3 58 ? -87.829  16.095  -28.425 1.00 2.74 ? 67  LYS A HE3    3  
ATOM 7313  H HZ1    . LYS C 3 58 ? -85.839  17.885  -28.053 1.00 3.04 ? 67  LYS A HZ1    3  
ATOM 7314  H HZ2    . LYS C 3 58 ? -84.980  16.431  -28.250 1.00 2.91 ? 67  LYS A HZ2    3  
ATOM 7315  H HZ3    . LYS C 3 58 ? -86.063  16.945  -29.453 1.00 3.18 ? 67  LYS A HZ3    3  
ATOM 7316  N N      . ARG C 3 59 ? -86.439  18.524  -21.169 1.00 1.28 ? 68  ARG A N      3  
ATOM 7317  C CA     . ARG C 3 59 ? -86.662  19.563  -20.131 1.00 1.36 ? 68  ARG A CA     3  
ATOM 7318  C C      . ARG C 3 59 ? -85.315  20.065  -19.613 1.00 1.32 ? 68  ARG A C      3  
ATOM 7319  O O      . ARG C 3 59 ? -85.180  21.206  -19.221 1.00 1.49 ? 68  ARG A O      3  
ATOM 7320  C CB     . ARG C 3 59 ? -87.427  18.963  -18.957 1.00 1.44 ? 68  ARG A CB     3  
ATOM 7321  C CG     . ARG C 3 59 ? -88.868  18.656  -19.352 1.00 1.80 ? 68  ARG A CG     3  
ATOM 7322  C CD     . ARG C 3 59 ? -89.558  17.964  -18.176 1.00 2.04 ? 68  ARG A CD     3  
ATOM 7323  N NE     . ARG C 3 59 ? -89.553  18.886  -17.003 1.00 2.47 ? 68  ARG A NE     3  
ATOM 7324  C CZ     . ARG C 3 59 ? -90.282  18.619  -15.951 1.00 3.08 ? 68  ARG A CZ     3  
ATOM 7325  N NH1    . ARG C 3 59 ? -90.988  17.520  -15.905 1.00 3.41 ? 68  ARG A NH1    3  
ATOM 7326  N NH2    . ARG C 3 59 ? -90.301  19.450  -14.943 1.00 3.88 ? 68  ARG A NH2    3  
ATOM 7327  H H      . ARG C 3 59 ? -86.858  17.642  -21.085 1.00 1.27 ? 68  ARG A H      3  
ATOM 7328  H HA     . ARG C 3 59 ? -87.223  20.383  -20.552 1.00 1.49 ? 68  ARG A HA     3  
ATOM 7329  H HB2    . ARG C 3 59 ? -86.939  18.050  -18.645 1.00 1.69 ? 68  ARG A HB2    3  
ATOM 7330  H HB3    . ARG C 3 59 ? -87.426  19.666  -18.138 1.00 1.59 ? 68  ARG A HB3    3  
ATOM 7331  H HG2    . ARG C 3 59 ? -89.382  19.580  -19.585 1.00 2.29 ? 68  ARG A HG2    3  
ATOM 7332  H HG3    . ARG C 3 59 ? -88.881  18.006  -20.213 1.00 2.33 ? 68  ARG A HG3    3  
ATOM 7333  H HD2    . ARG C 3 59 ? -90.575  17.724  -18.441 1.00 2.35 ? 68  ARG A HD2    3  
ATOM 7334  H HD3    . ARG C 3 59 ? -89.027  17.054  -17.931 1.00 2.55 ? 68  ARG A HD3    3  
ATOM 7335  H HE     . ARG C 3 59 ? -89.010  19.701  -17.025 1.00 2.79 ? 68  ARG A HE     3  
ATOM 7336  H HH11   . ARG C 3 59 ? -90.971  16.882  -16.674 1.00 3.26 ? 68  ARG A HH11   3  
ATOM 7337  H HH12   . ARG C 3 59 ? -91.544  17.316  -15.102 1.00 4.13 ? 68  ARG A HH12   3  
ATOM 7338  H HH21   . ARG C 3 59 ? -89.760  20.290  -14.978 1.00 4.13 ? 68  ARG A HH21   3  
ATOM 7339  H HH22   . ARG C 3 59 ? -90.855  19.246  -14.137 1.00 4.48 ? 68  ARG A HH22   3  
ATOM 7340  N N      . LYS C 3 60 ? -84.322  19.217  -19.588 1.00 1.21 ? 69  LYS A N      3  
ATOM 7341  C CA     . LYS C 3 60 ? -82.982  19.636  -19.079 1.00 1.26 ? 69  LYS A CA     3  
ATOM 7342  C C      . LYS C 3 60 ? -82.076  19.971  -20.259 1.00 1.29 ? 69  LYS A C      3  
ATOM 7343  O O      . LYS C 3 60 ? -80.883  20.128  -20.110 1.00 1.45 ? 69  LYS A O      3  
ATOM 7344  C CB     . LYS C 3 60 ? -82.380  18.492  -18.265 1.00 1.24 ? 69  LYS A CB     3  
ATOM 7345  C CG     . LYS C 3 60 ? -83.269  18.236  -17.053 1.00 1.34 ? 69  LYS A CG     3  
ATOM 7346  C CD     . LYS C 3 60 ? -82.687  17.095  -16.223 1.00 1.61 ? 69  LYS A CD     3  
ATOM 7347  C CE     . LYS C 3 60 ? -83.628  16.783  -15.063 1.00 1.89 ? 69  LYS A CE     3  
ATOM 7348  N NZ     . LYS C 3 60 ? -83.780  17.999  -14.219 1.00 2.56 ? 69  LYS A NZ     3  
ATOM 7349  H H      . LYS C 3 60 ? -84.460  18.298  -19.902 1.00 1.18 ? 69  LYS A H      3  
ATOM 7350  H HA     . LYS C 3 60 ? -83.085  20.507  -18.444 1.00 1.47 ? 69  LYS A HA     3  
ATOM 7351  H HB2    . LYS C 3 60 ? -82.327  17.598  -18.873 1.00 1.61 ? 69  LYS A HB2    3  
ATOM 7352  H HB3    . LYS C 3 60 ? -81.389  18.766  -17.931 1.00 1.55 ? 69  LYS A HB3    3  
ATOM 7353  H HG2    . LYS C 3 60 ? -83.320  19.132  -16.455 1.00 1.87 ? 69  LYS A HG2    3  
ATOM 7354  H HG3    . LYS C 3 60 ? -84.261  17.970  -17.384 1.00 1.90 ? 69  LYS A HG3    3  
ATOM 7355  H HD2    . LYS C 3 60 ? -82.572  16.217  -16.845 1.00 2.11 ? 69  LYS A HD2    3  
ATOM 7356  H HD3    . LYS C 3 60 ? -81.724  17.387  -15.833 1.00 2.12 ? 69  LYS A HD3    3  
ATOM 7357  H HE2    . LYS C 3 60 ? -84.592  16.484  -15.449 1.00 2.35 ? 69  LYS A HE2    3  
ATOM 7358  H HE3    . LYS C 3 60 ? -83.215  15.982  -14.469 1.00 2.07 ? 69  LYS A HE3    3  
ATOM 7359  H HZ1    . LYS C 3 60 ? -83.940  18.824  -14.830 1.00 2.92 ? 69  LYS A HZ1    3  
ATOM 7360  H HZ2    . LYS C 3 60 ? -84.590  17.881  -13.580 1.00 2.93 ? 69  LYS A HZ2    3  
ATOM 7361  H HZ3    . LYS C 3 60 ? -82.915  18.144  -13.664 1.00 3.03 ? 69  LYS A HZ3    3  
ATOM 7362  N N      . ASN C 3 61 ? -82.649  20.081  -21.429 1.00 1.49 ? 70  ASN A N      3  
ATOM 7363  C CA     . ASN C 3 61 ? -81.852  20.402  -22.651 1.00 1.75 ? 70  ASN A CA     3  
ATOM 7364  C C      . ASN C 3 61 ? -80.923  19.233  -22.987 1.00 1.60 ? 70  ASN A C      3  
ATOM 7365  O O      . ASN C 3 61 ? -79.843  19.415  -23.512 1.00 1.74 ? 70  ASN A O      3  
ATOM 7366  C CB     . ASN C 3 61 ? -81.021  21.672  -22.412 1.00 2.11 ? 70  ASN A CB     3  
ATOM 7367  C CG     . ASN C 3 61 ? -80.610  22.283  -23.755 1.00 2.80 ? 70  ASN A CG     3  
ATOM 7368  O OD1    . ASN C 3 61 ? -79.859  21.686  -24.499 1.00 3.49 ? 70  ASN A OD1    3  
ATOM 7369  N ND2    . ASN C 3 61 ? -81.078  23.452  -24.098 1.00 3.17 ? 70  ASN A ND2    3  
ATOM 7370  H H      . ASN C 3 61 ? -83.616  19.948  -21.504 1.00 1.66 ? 70  ASN A H      3  
ATOM 7371  H HA     . ASN C 3 61 ? -82.529  20.568  -23.476 1.00 1.96 ? 70  ASN A HA     3  
ATOM 7372  H HB2    . ASN C 3 61 ? -81.610  22.385  -21.856 1.00 2.33 ? 70  ASN A HB2    3  
ATOM 7373  H HB3    . ASN C 3 61 ? -80.135  21.425  -21.846 1.00 2.23 ? 70  ASN A HB3    3  
ATOM 7374  H HD21   . ASN C 3 61 ? -81.687  23.930  -23.499 1.00 3.12 ? 70  ASN A HD21   3  
ATOM 7375  H HD22   . ASN C 3 61 ? -80.820  23.849  -24.955 1.00 3.80 ? 70  ASN A HD22   3  
ATOM 7376  N N      . LYS C 3 62 ? -81.347  18.032  -22.694 1.00 1.48 ? 71  LYS A N      3  
ATOM 7377  C CA     . LYS C 3 62 ? -80.510  16.825  -22.996 1.00 1.47 ? 71  LYS A CA     3  
ATOM 7378  C C      . LYS C 3 62 ? -81.426  15.698  -23.509 1.00 1.58 ? 71  LYS A C      3  
ATOM 7379  O O      . LYS C 3 62 ? -81.677  14.746  -22.797 1.00 1.78 ? 71  LYS A O      3  
ATOM 7380  C CB     . LYS C 3 62 ? -79.800  16.377  -21.705 1.00 1.51 ? 71  LYS A CB     3  
ATOM 7381  C CG     . LYS C 3 62 ? -78.531  17.247  -21.445 1.00 1.55 ? 71  LYS A CG     3  
ATOM 7382  C CD     . LYS C 3 62 ? -78.540  17.825  -20.023 1.00 1.66 ? 71  LYS A CD     3  
ATOM 7383  C CE     . LYS C 3 62 ? -78.298  16.717  -19.002 1.00 1.66 ? 71  LYS A CE     3  
ATOM 7384  N NZ     . LYS C 3 62 ? -76.926  16.168  -19.190 1.00 2.35 ? 71  LYS A NZ     3  
ATOM 7385  H H      . LYS C 3 62 ? -82.228  17.919  -22.276 1.00 1.50 ? 71  LYS A H      3  
ATOM 7386  H HA     . LYS C 3 62 ? -79.775  17.063  -23.749 1.00 1.55 ? 71  LYS A HA     3  
ATOM 7387  H HB2    . LYS C 3 62 ? -80.492  16.470  -20.878 1.00 1.66 ? 71  LYS A HB2    3  
ATOM 7388  H HB3    . LYS C 3 62 ? -79.510  15.339  -21.803 1.00 1.69 ? 71  LYS A HB3    3  
ATOM 7389  H HG2    . LYS C 3 62 ? -77.646  16.635  -21.565 1.00 1.80 ? 71  LYS A HG2    3  
ATOM 7390  H HG3    . LYS C 3 62 ? -78.486  18.064  -22.151 1.00 1.99 ? 71  LYS A HG3    3  
ATOM 7391  H HD2    . LYS C 3 62 ? -77.760  18.565  -19.937 1.00 2.22 ? 71  LYS A HD2    3  
ATOM 7392  H HD3    . LYS C 3 62 ? -79.492  18.286  -19.827 1.00 1.96 ? 71  LYS A HD3    3  
ATOM 7393  H HE2    . LYS C 3 62 ? -78.390  17.124  -18.006 1.00 1.96 ? 71  LYS A HE2    3  
ATOM 7394  H HE3    . LYS C 3 62 ? -79.027  15.932  -19.141 1.00 1.85 ? 71  LYS A HE3    3  
ATOM 7395  H HZ1    . LYS C 3 62 ? -76.276  16.938  -19.446 1.00 2.82 ? 71  LYS A HZ1    3  
ATOM 7396  H HZ2    . LYS C 3 62 ? -76.606  15.726  -18.305 1.00 2.86 ? 71  LYS A HZ2    3  
ATOM 7397  H HZ3    . LYS C 3 62 ? -76.939  15.457  -19.949 1.00 2.60 ? 71  LYS A HZ3    3  
ATOM 7398  N N      . PRO C 3 63 ? -81.915  15.847  -24.726 1.00 1.85 ? 72  PRO A N      3  
ATOM 7399  C CA     . PRO C 3 63 ? -82.826  14.852  -25.334 1.00 2.09 ? 72  PRO A CA     3  
ATOM 7400  C C      . PRO C 3 63 ? -82.153  13.471  -25.444 1.00 1.70 ? 72  PRO A C      3  
ATOM 7401  O O      . PRO C 3 63 ? -82.781  12.494  -25.801 1.00 2.05 ? 72  PRO A O      3  
ATOM 7402  C CB     . PRO C 3 63 ? -83.159  15.426  -26.733 1.00 2.68 ? 72  PRO A CB     3  
ATOM 7403  C CG     . PRO C 3 63 ? -82.520  16.844  -26.818 1.00 2.96 ? 72  PRO A CG     3  
ATOM 7404  C CD     . PRO C 3 63 ? -81.608  17.014  -25.586 1.00 2.30 ? 72  PRO A CD     3  
ATOM 7405  H HA     . PRO C 3 63 ? -83.728  14.773  -24.748 1.00 2.46 ? 72  PRO A HA     3  
ATOM 7406  H HB2    . PRO C 3 63 ? -82.749  14.787  -27.509 1.00 2.64 ? 72  PRO A HB2    3  
ATOM 7407  H HB3    . PRO C 3 63 ? -84.233  15.503  -26.856 1.00 3.17 ? 72  PRO A HB3    3  
ATOM 7408  H HG2    . PRO C 3 63 ? -81.939  16.932  -27.731 1.00 3.22 ? 72  PRO A HG2    3  
ATOM 7409  H HG3    . PRO C 3 63 ? -83.288  17.601  -26.810 1.00 3.55 ? 72  PRO A HG3    3  
ATOM 7410  H HD2    . PRO C 3 63 ? -80.569  16.997  -25.893 1.00 2.26 ? 72  PRO A HD2    3  
ATOM 7411  H HD3    . PRO C 3 63 ? -81.834  17.932  -25.063 1.00 2.48 ? 72  PRO A HD3    3  
ATOM 7412  N N      . LYS C 3 64 ? -80.888  13.382  -25.148 1.00 1.44 ? 73  LYS A N      3  
ATOM 7413  C CA     . LYS C 3 64 ? -80.179  12.073  -25.250 1.00 1.53 ? 73  LYS A CA     3  
ATOM 7414  C C      . LYS C 3 64 ? -80.195  11.378  -23.892 1.00 1.33 ? 73  LYS A C      3  
ATOM 7415  O O      . LYS C 3 64 ? -79.500  10.407  -23.668 1.00 1.66 ? 73  LYS A O      3  
ATOM 7416  C CB     . LYS C 3 64 ? -78.738  12.315  -25.692 1.00 2.19 ? 73  LYS A CB     3  
ATOM 7417  C CG     . LYS C 3 64 ? -78.034  13.212  -24.674 1.00 2.95 ? 73  LYS A CG     3  
ATOM 7418  C CD     . LYS C 3 64 ? -76.607  13.476  -25.138 1.00 3.72 ? 73  LYS A CD     3  
ATOM 7419  C CE     . LYS C 3 64 ? -75.927  14.421  -24.156 1.00 4.37 ? 73  LYS A CE     3  
ATOM 7420  N NZ     . LYS C 3 64 ? -74.497  14.579  -24.538 1.00 5.24 ? 73  LYS A NZ     3  
ATOM 7421  H H      . LYS C 3 64 ? -80.396  14.183  -24.868 1.00 1.60 ? 73  LYS A H      3  
ATOM 7422  H HA     . LYS C 3 64 ? -80.672  11.441  -25.976 1.00 1.77 ? 73  LYS A HA     3  
ATOM 7423  H HB2    . LYS C 3 64 ? -78.217  11.371  -25.759 1.00 2.47 ? 73  LYS A HB2    3  
ATOM 7424  H HB3    . LYS C 3 64 ? -78.735  12.798  -26.657 1.00 2.56 ? 73  LYS A HB3    3  
ATOM 7425  H HG2    . LYS C 3 64 ? -78.566  14.151  -24.592 1.00 3.22 ? 73  LYS A HG2    3  
ATOM 7426  H HG3    . LYS C 3 64 ? -78.010  12.726  -23.711 1.00 3.26 ? 73  LYS A HG3    3  
ATOM 7427  H HD2    . LYS C 3 64 ? -76.064  12.540  -25.175 1.00 4.03 ? 73  LYS A HD2    3  
ATOM 7428  H HD3    . LYS C 3 64 ? -76.621  13.925  -26.120 1.00 3.96 ? 73  LYS A HD3    3  
ATOM 7429  H HE2    . LYS C 3 64 ? -76.418  15.384  -24.181 1.00 4.55 ? 73  LYS A HE2    3  
ATOM 7430  H HE3    . LYS C 3 64 ? -75.992  14.010  -23.160 1.00 4.50 ? 73  LYS A HE3    3  
ATOM 7431  H HZ1    . LYS C 3 64 ? -74.131  13.667  -24.880 1.00 5.57 ? 73  LYS A HZ1    3  
ATOM 7432  H HZ2    . LYS C 3 64 ? -74.415  15.291  -25.289 1.00 5.62 ? 73  LYS A HZ2    3  
ATOM 7433  H HZ3    . LYS C 3 64 ? -73.947  14.883  -23.711 1.00 5.48 ? 73  LYS A HZ3    3  
ATOM 7434  N N      . MET C 3 65 ? -80.989  11.863  -22.985 1.00 1.17 ? 74  MET A N      3  
ATOM 7435  C CA     . MET C 3 65 ? -81.051  11.218  -21.654 1.00 1.15 ? 74  MET A CA     3  
ATOM 7436  C C      . MET C 3 65 ? -81.805  9.894   -21.791 1.00 0.99 ? 74  MET A C      3  
ATOM 7437  O O      . MET C 3 65 ? -82.960  9.865   -22.162 1.00 1.00 ? 74  MET A O      3  
ATOM 7438  C CB     . MET C 3 65 ? -81.800  12.129  -20.673 1.00 1.47 ? 74  MET A CB     3  
ATOM 7439  C CG     . MET C 3 65 ? -81.460  11.734  -19.221 1.00 2.01 ? 74  MET A CG     3  
ATOM 7440  S SD     . MET C 3 65 ? -80.076  12.749  -18.624 1.00 2.41 ? 74  MET A SD     3  
ATOM 7441  C CE     . MET C 3 65 ? -78.847  11.435  -18.422 1.00 2.27 ? 74  MET A CE     3  
ATOM 7442  H H      . MET C 3 65 ? -81.547  12.645  -23.183 1.00 1.36 ? 74  MET A H      3  
ATOM 7443  H HA     . MET C 3 65 ? -80.048  11.035  -21.292 1.00 1.29 ? 74  MET A HA     3  
ATOM 7444  H HB2    . MET C 3 65 ? -81.508  13.155  -20.846 1.00 1.42 ? 74  MET A HB2    3  
ATOM 7445  H HB3    . MET C 3 65 ? -82.864  12.032  -20.833 1.00 1.94 ? 74  MET A HB3    3  
ATOM 7446  H HG2    . MET C 3 65 ? -82.323  11.905  -18.592 1.00 2.66 ? 74  MET A HG2    3  
ATOM 7447  H HG3    . MET C 3 65 ? -81.191  10.687  -19.176 1.00 2.34 ? 74  MET A HG3    3  
ATOM 7448  H HE1    . MET C 3 65 ? -78.798  10.844  -19.327 1.00 2.60 ? 74  MET A HE1    3  
ATOM 7449  H HE2    . MET C 3 65 ? -77.881  11.872  -18.228 1.00 2.59 ? 74  MET A HE2    3  
ATOM 7450  H HE3    . MET C 3 65 ? -79.128  10.806  -17.589 1.00 2.52 ? 74  MET A HE3    3  
ATOM 7451  N N      . ASN C 3 66 ? -81.157  8.804   -21.502 1.00 0.97 ? 75  ASN A N      3  
ATOM 7452  C CA     . ASN C 3 66 ? -81.828  7.473   -21.615 1.00 0.94 ? 75  ASN A CA     3  
ATOM 7453  C C      . ASN C 3 66 ? -82.877  7.287   -20.503 1.00 0.89 ? 75  ASN A C      3  
ATOM 7454  O O      . ASN C 3 66 ? -82.926  8.035   -19.547 1.00 0.90 ? 75  ASN A O      3  
ATOM 7455  C CB     . ASN C 3 66 ? -80.766  6.378   -21.506 1.00 1.07 ? 75  ASN A CB     3  
ATOM 7456  C CG     . ASN C 3 66 ? -80.055  6.496   -20.156 1.00 1.11 ? 75  ASN A CG     3  
ATOM 7457  O OD1    . ASN C 3 66 ? -80.630  6.960   -19.192 1.00 1.08 ? 75  ASN A OD1    3  
ATOM 7458  N ND2    . ASN C 3 66 ? -78.818  6.093   -20.043 1.00 1.48 ? 75  ASN A ND2    3  
ATOM 7459  H H      . ASN C 3 66 ? -80.223  8.854   -21.209 1.00 1.05 ? 75  ASN A H      3  
ATOM 7460  H HA     . ASN C 3 66 ? -82.314  7.402   -22.577 1.00 0.97 ? 75  ASN A HA     3  
ATOM 7461  H HB2    . ASN C 3 66 ? -81.241  5.411   -21.584 1.00 1.25 ? 75  ASN A HB2    3  
ATOM 7462  H HB3    . ASN C 3 66 ? -80.047  6.492   -22.304 1.00 1.21 ? 75  ASN A HB3    3  
ATOM 7463  H HD21   . ASN C 3 66 ? -78.352  5.713   -20.816 1.00 1.68 ? 75  ASN A HD21   3  
ATOM 7464  H HD22   . ASN C 3 66 ? -78.351  6.180   -19.184 1.00 1.66 ? 75  ASN A HD22   3  
ATOM 7465  N N      . TYR C 3 67 ? -83.703  6.275   -20.626 1.00 0.88 ? 76  TYR A N      3  
ATOM 7466  C CA     . TYR C 3 67 ? -84.743  5.993   -19.596 1.00 0.87 ? 76  TYR A CA     3  
ATOM 7467  C C      . TYR C 3 67 ? -84.053  5.501   -18.321 1.00 0.84 ? 76  TYR A C      3  
ATOM 7468  O O      . TYR C 3 67 ? -84.620  5.516   -17.248 1.00 0.83 ? 76  TYR A O      3  
ATOM 7469  C CB     . TYR C 3 67 ? -85.691  4.909   -20.126 1.00 0.95 ? 76  TYR A CB     3  
ATOM 7470  C CG     . TYR C 3 67 ? -86.902  4.795   -19.234 1.00 0.71 ? 76  TYR A CG     3  
ATOM 7471  C CD1    . TYR C 3 67 ? -87.949  5.710   -19.374 1.00 0.71 ? 76  TYR A CD1    3  
ATOM 7472  C CD2    . TYR C 3 67 ? -86.993  3.767   -18.289 1.00 0.79 ? 76  TYR A CD2    3  
ATOM 7473  C CE1    . TYR C 3 67 ? -89.086  5.601   -18.572 1.00 0.75 ? 76  TYR A CE1    3  
ATOM 7474  C CE2    . TYR C 3 67 ? -88.131  3.659   -17.483 1.00 0.85 ? 76  TYR A CE2    3  
ATOM 7475  C CZ     . TYR C 3 67 ? -89.179  4.576   -17.626 1.00 0.80 ? 76  TYR A CZ     3  
ATOM 7476  O OH     . TYR C 3 67 ? -90.306  4.470   -16.837 1.00 1.07 ? 76  TYR A OH     3  
ATOM 7477  H H      . TYR C 3 67 ? -83.630  5.683   -21.393 1.00 0.91 ? 76  TYR A H      3  
ATOM 7478  H HA     . TYR C 3 67 ? -85.303  6.891   -19.383 1.00 0.87 ? 76  TYR A HA     3  
ATOM 7479  H HB2    . TYR C 3 67 ? -86.008  5.170   -21.124 1.00 1.15 ? 76  TYR A HB2    3  
ATOM 7480  H HB3    . TYR C 3 67 ? -85.179  3.960   -20.152 1.00 1.13 ? 76  TYR A HB3    3  
ATOM 7481  H HD1    . TYR C 3 67 ? -87.876  6.504   -20.097 1.00 0.92 ? 76  TYR A HD1    3  
ATOM 7482  H HD2    . TYR C 3 67 ? -86.188  3.060   -18.178 1.00 1.01 ? 76  TYR A HD2    3  
ATOM 7483  H HE1    . TYR C 3 67 ? -89.894  6.308   -18.684 1.00 0.95 ? 76  TYR A HE1    3  
ATOM 7484  H HE2    . TYR C 3 67 ? -88.200  2.865   -16.754 1.00 1.10 ? 76  TYR A HE2    3  
ATOM 7485  H HH     . TYR C 3 67 ? -90.817  5.277   -16.945 1.00 1.51 ? 76  TYR A HH     3  
ATOM 7486  N N      . GLU C 3 68 ? -82.828  5.054   -18.434 1.00 0.85 ? 77  GLU A N      3  
ATOM 7487  C CA     . GLU C 3 68 ? -82.111  4.552   -17.225 1.00 0.86 ? 77  GLU A CA     3  
ATOM 7488  C C      . GLU C 3 68 ? -81.996  5.678   -16.200 1.00 0.84 ? 77  GLU A C      3  
ATOM 7489  O O      . GLU C 3 68 ? -81.989  5.446   -15.007 1.00 0.83 ? 77  GLU A O      3  
ATOM 7490  C CB     . GLU C 3 68 ? -80.706  4.067   -17.601 1.00 0.92 ? 77  GLU A CB     3  
ATOM 7491  C CG     . GLU C 3 68 ? -80.806  2.853   -18.528 1.00 1.49 ? 77  GLU A CG     3  
ATOM 7492  C CD     . GLU C 3 68 ? -79.399  2.423   -18.952 1.00 1.97 ? 77  GLU A CD     3  
ATOM 7493  O OE1    . GLU C 3 68 ? -78.458  3.117   -18.604 1.00 2.53 ? 77  GLU A OE1    3  
ATOM 7494  O OE2    . GLU C 3 68 ? -79.287  1.407   -19.617 1.00 2.43 ? 77  GLU A OE2    3  
ATOM 7495  H H      . GLU C 3 68 ? -82.390  5.040   -19.310 1.00 0.88 ? 77  GLU A H      3  
ATOM 7496  H HA     . GLU C 3 68 ? -82.669  3.737   -16.798 1.00 0.88 ? 77  GLU A HA     3  
ATOM 7497  H HB2    . GLU C 3 68 ? -80.168  4.859   -18.099 1.00 1.21 ? 77  GLU A HB2    3  
ATOM 7498  H HB3    . GLU C 3 68 ? -80.176  3.785   -16.701 1.00 1.32 ? 77  GLU A HB3    3  
ATOM 7499  H HG2    . GLU C 3 68 ? -81.289  2.041   -18.004 1.00 2.02 ? 77  GLU A HG2    3  
ATOM 7500  H HG3    . GLU C 3 68 ? -81.380  3.113   -19.403 1.00 1.92 ? 77  GLU A HG3    3  
ATOM 7501  N N      . LYS C 3 69 ? -81.922  6.897   -16.651 1.00 0.86 ? 78  LYS A N      3  
ATOM 7502  C CA     . LYS C 3 69 ? -81.820  8.035   -15.705 1.00 0.90 ? 78  LYS A CA     3  
ATOM 7503  C C      . LYS C 3 69 ? -83.046  8.026   -14.798 1.00 0.86 ? 78  LYS A C      3  
ATOM 7504  O O      . LYS C 3 69 ? -82.969  8.332   -13.623 1.00 0.90 ? 78  LYS A O      3  
ATOM 7505  C CB     . LYS C 3 69 ? -81.759  9.343   -16.503 1.00 0.96 ? 78  LYS A CB     3  
ATOM 7506  C CG     . LYS C 3 69 ? -81.674  10.553  -15.546 1.00 1.82 ? 78  LYS A CG     3  
ATOM 7507  C CD     . LYS C 3 69 ? -83.086  11.146  -15.297 1.00 2.38 ? 78  LYS A CD     3  
ATOM 7508  C CE     . LYS C 3 69 ? -83.173  11.713  -13.883 1.00 3.44 ? 78  LYS A CE     3  
ATOM 7509  N NZ     . LYS C 3 69 ? -84.530  12.291  -13.668 1.00 4.23 ? 78  LYS A NZ     3  
ATOM 7510  H H      . LYS C 3 69 ? -81.937  7.066   -17.617 1.00 0.89 ? 78  LYS A H      3  
ATOM 7511  H HA     . LYS C 3 69 ? -80.929  7.934   -15.105 1.00 0.95 ? 78  LYS A HA     3  
ATOM 7512  H HB2    . LYS C 3 69 ? -80.879  9.320   -17.134 1.00 1.32 ? 78  LYS A HB2    3  
ATOM 7513  H HB3    . LYS C 3 69 ? -82.640  9.424   -17.127 1.00 1.28 ? 78  LYS A HB3    3  
ATOM 7514  H HG2    . LYS C 3 69 ? -81.236  10.240  -14.606 1.00 2.37 ? 78  LYS A HG2    3  
ATOM 7515  H HG3    . LYS C 3 69 ? -81.044  11.313  -15.988 1.00 2.41 ? 78  LYS A HG3    3  
ATOM 7516  H HD2    . LYS C 3 69 ? -83.275  11.935  -16.008 1.00 2.64 ? 78  LYS A HD2    3  
ATOM 7517  H HD3    . LYS C 3 69 ? -83.839  10.383  -15.415 1.00 2.58 ? 78  LYS A HD3    3  
ATOM 7518  H HE2    . LYS C 3 69 ? -83.001  10.921  -13.168 1.00 3.82 ? 78  LYS A HE2    3  
ATOM 7519  H HE3    . LYS C 3 69 ? -82.428  12.481  -13.754 1.00 3.76 ? 78  LYS A HE3    3  
ATOM 7520  H HZ1    . LYS C 3 69 ? -84.931  12.585  -14.580 1.00 4.55 ? 78  LYS A HZ1    3  
ATOM 7521  H HZ2    . LYS C 3 69 ? -85.148  11.572  -13.237 1.00 4.52 ? 78  LYS A HZ2    3  
ATOM 7522  H HZ3    . LYS C 3 69 ? -84.462  13.115  -13.038 1.00 4.61 ? 78  LYS A HZ3    3  
ATOM 7523  N N      . LEU C 3 70 ? -84.173  7.664   -15.334 1.00 0.80 ? 79  LEU A N      3  
ATOM 7524  C CA     . LEU C 3 70 ? -85.400  7.623   -14.497 1.00 0.79 ? 79  LEU A CA     3  
ATOM 7525  C C      . LEU C 3 70 ? -85.237  6.521   -13.451 1.00 0.79 ? 79  LEU A C      3  
ATOM 7526  O O      . LEU C 3 70 ? -85.588  6.687   -12.306 1.00 0.86 ? 79  LEU A O      3  
ATOM 7527  C CB     . LEU C 3 70 ? -86.632  7.334   -15.381 1.00 0.77 ? 79  LEU A CB     3  
ATOM 7528  C CG     . LEU C 3 70 ? -87.153  8.639   -16.023 1.00 0.76 ? 79  LEU A CG     3  
ATOM 7529  C CD1    . LEU C 3 70 ? -88.019  8.311   -17.246 1.00 1.17 ? 79  LEU A CD1    3  
ATOM 7530  C CD2    . LEU C 3 70 ? -88.018  9.425   -15.020 1.00 1.13 ? 79  LEU A CD2    3  
ATOM 7531  H H      . LEU C 3 70 ? -84.211  7.414   -16.279 1.00 0.79 ? 79  LEU A H      3  
ATOM 7532  H HA     . LEU C 3 70 ? -85.520  8.571   -14.001 1.00 0.85 ? 79  LEU A HA     3  
ATOM 7533  H HB2    . LEU C 3 70 ? -86.351  6.640   -16.168 1.00 0.84 ? 79  LEU A HB2    3  
ATOM 7534  H HB3    . LEU C 3 70 ? -87.411  6.891   -14.779 1.00 0.81 ? 79  LEU A HB3    3  
ATOM 7535  H HG     . LEU C 3 70 ? -86.315  9.246   -16.333 1.00 1.08 ? 79  LEU A HG     3  
ATOM 7536  H HD11   . LEU C 3 70 ? -88.763  7.580   -16.972 1.00 1.72 ? 79  LEU A HD11   3  
ATOM 7537  H HD12   . LEU C 3 70 ? -88.511  9.211   -17.587 1.00 1.58 ? 79  LEU A HD12   3  
ATOM 7538  H HD13   . LEU C 3 70 ? -87.399  7.918   -18.040 1.00 1.65 ? 79  LEU A HD13   3  
ATOM 7539  H HD21   . LEU C 3 70 ? -88.725  8.759   -14.547 1.00 1.54 ? 79  LEU A HD21   3  
ATOM 7540  H HD22   . LEU C 3 70 ? -87.389  9.874   -14.271 1.00 1.55 ? 79  LEU A HD22   3  
ATOM 7541  H HD23   . LEU C 3 70 ? -88.556  10.201  -15.545 1.00 1.76 ? 79  LEU A HD23   3  
ATOM 7542  N N      . SER C 3 71 ? -84.695  5.400   -13.826 1.00 0.78 ? 80  SER A N      3  
ATOM 7543  C CA     . SER C 3 71 ? -84.511  4.312   -12.830 1.00 0.81 ? 80  SER A CA     3  
ATOM 7544  C C      . SER C 3 71 ? -83.592  4.804   -11.714 1.00 0.85 ? 80  SER A C      3  
ATOM 7545  O O      . SER C 3 71 ? -83.828  4.562   -10.554 1.00 1.01 ? 80  SER A O      3  
ATOM 7546  C CB     . SER C 3 71 ? -83.884  3.098   -13.512 1.00 0.88 ? 80  SER A CB     3  
ATOM 7547  O OG     . SER C 3 71 ? -84.831  2.519   -14.403 1.00 1.39 ? 80  SER A OG     3  
ATOM 7548  H H      . SER C 3 71 ? -84.404  5.275   -14.753 1.00 0.81 ? 80  SER A H      3  
ATOM 7549  H HA     . SER C 3 71 ? -85.469  4.038   -12.412 1.00 0.81 ? 80  SER A HA     3  
ATOM 7550  H HB2    . SER C 3 71 ? -83.013  3.405   -14.066 1.00 1.25 ? 80  SER A HB2    3  
ATOM 7551  H HB3    . SER C 3 71 ? -83.592  2.379   -12.760 1.00 1.13 ? 80  SER A HB3    3  
ATOM 7552  H HG     . SER C 3 71 ? -84.363  2.244   -15.193 1.00 1.86 ? 80  SER A HG     3  
ATOM 7553  N N      . ARG C 3 72 ? -82.538  5.494   -12.062 1.00 0.83 ? 81  ARG A N      3  
ATOM 7554  C CA     . ARG C 3 72 ? -81.595  6.000   -11.023 1.00 0.93 ? 81  ARG A CA     3  
ATOM 7555  C C      . ARG C 3 72 ? -82.302  7.010   -10.114 1.00 0.84 ? 81  ARG A C      3  
ATOM 7556  O O      . ARG C 3 72 ? -82.121  7.006   -8.914  1.00 0.87 ? 81  ARG A O      3  
ATOM 7557  C CB     . ARG C 3 72 ? -80.398  6.668   -11.717 1.00 1.06 ? 81  ARG A CB     3  
ATOM 7558  C CG     . ARG C 3 72 ? -79.369  7.178   -10.687 1.00 1.43 ? 81  ARG A CG     3  
ATOM 7559  C CD     . ARG C 3 72 ? -78.483  6.017   -10.180 1.00 2.09 ? 81  ARG A CD     3  
ATOM 7560  N NE     . ARG C 3 72 ? -78.393  6.063   -8.689  1.00 2.90 ? 81  ARG A NE     3  
ATOM 7561  C CZ     . ARG C 3 72 ? -78.114  7.169   -8.056  1.00 3.72 ? 81  ARG A CZ     3  
ATOM 7562  N NH1    . ARG C 3 72 ? -77.871  8.269   -8.716  1.00 3.91 ? 81  ARG A NH1    3  
ATOM 7563  N NH2    . ARG C 3 72 ? -78.075  7.168   -6.754  1.00 4.74 ? 81  ARG A NH2    3  
ATOM 7564  H H      . ARG C 3 72 ? -82.365  5.678   -13.009 1.00 0.83 ? 81  ARG A H      3  
ATOM 7565  H HA     . ARG C 3 72 ? -81.245  5.170   -10.425 1.00 1.02 ? 81  ARG A HA     3  
ATOM 7566  H HB2    . ARG C 3 72 ? -79.919  5.949   -12.366 1.00 1.28 ? 81  ARG A HB2    3  
ATOM 7567  H HB3    . ARG C 3 72 ? -80.749  7.497   -12.310 1.00 1.34 ? 81  ARG A HB3    3  
ATOM 7568  H HG2    . ARG C 3 72 ? -78.746  7.923   -11.165 1.00 1.77 ? 81  ARG A HG2    3  
ATOM 7569  H HG3    . ARG C 3 72 ? -79.880  7.632   -9.856  1.00 1.89 ? 81  ARG A HG3    3  
ATOM 7570  H HD2    . ARG C 3 72 ? -78.919  5.071   -10.450 1.00 2.52 ? 81  ARG A HD2    3  
ATOM 7571  H HD3    . ARG C 3 72 ? -77.497  6.088   -10.628 1.00 2.49 ? 81  ARG A HD3    3  
ATOM 7572  H HE     . ARG C 3 72 ? -78.561  5.245   -8.173  1.00 3.22 ? 81  ARG A HE     3  
ATOM 7573  H HH11   . ARG C 3 72 ? -77.896  8.270   -9.712  1.00 3.50 ? 81  ARG A HH11   3  
ATOM 7574  H HH12   . ARG C 3 72 ? -77.662  9.112   -8.223  1.00 4.74 ? 81  ARG A HH12   3  
ATOM 7575  H HH21   . ARG C 3 72 ? -78.262  6.324   -6.251  1.00 4.98 ? 81  ARG A HH21   3  
ATOM 7576  H HH22   . ARG C 3 72 ? -77.854  8.008   -6.259  1.00 5.47 ? 81  ARG A HH22   3  
ATOM 7577  N N      . GLY C 3 73 ? -83.085  7.895   -10.672 1.00 0.80 ? 82  GLY A N      3  
ATOM 7578  C CA     . GLY C 3 73 ? -83.773  8.921   -9.827  1.00 0.79 ? 82  GLY A CA     3  
ATOM 7579  C C      . GLY C 3 73 ? -85.161  8.439   -9.395  1.00 0.75 ? 82  GLY A C      3  
ATOM 7580  O O      . GLY C 3 73 ? -85.540  8.580   -8.250  1.00 0.80 ? 82  GLY A O      3  
ATOM 7581  H H      . GLY C 3 73 ? -83.204  7.899   -11.646 1.00 0.83 ? 82  GLY A H      3  
ATOM 7582  H HA2    . GLY C 3 73 ? -83.179  9.118   -8.945  1.00 0.85 ? 82  GLY A HA2    3  
ATOM 7583  H HA3    . GLY C 3 73 ? -83.877  9.835   -10.391 1.00 0.81 ? 82  GLY A HA3    3  
ATOM 7584  N N      . LEU C 3 74 ? -85.929  7.884   -10.288 1.00 0.73 ? 83  LEU A N      3  
ATOM 7585  C CA     . LEU C 3 74 ? -87.293  7.423   -9.898  1.00 0.76 ? 83  LEU A CA     3  
ATOM 7586  C C      . LEU C 3 74 ? -87.155  6.400   -8.769  1.00 0.78 ? 83  LEU A C      3  
ATOM 7587  O O      . LEU C 3 74 ? -87.916  6.397   -7.823  1.00 0.80 ? 83  LEU A O      3  
ATOM 7588  C CB     . LEU C 3 74 ? -87.989  6.788   -11.117 1.00 0.82 ? 83  LEU A CB     3  
ATOM 7589  C CG     . LEU C 3 74 ? -89.524  6.693   -10.927 1.00 0.85 ? 83  LEU A CG     3  
ATOM 7590  C CD1    . LEU C 3 74 ? -89.886  5.752   -9.762  1.00 1.57 ? 83  LEU A CD1    3  
ATOM 7591  C CD2    . LEU C 3 74 ? -90.129  8.097   -10.690 1.00 1.39 ? 83  LEU A CD2    3  
ATOM 7592  H H      . LEU C 3 74 ? -85.619  7.782   -11.214 1.00 0.75 ? 83  LEU A H      3  
ATOM 7593  H HA     . LEU C 3 74 ? -87.861  8.268   -9.549  1.00 0.78 ? 83  LEU A HA     3  
ATOM 7594  H HB2    . LEU C 3 74 ? -87.787  7.389   -11.989 1.00 0.94 ? 83  LEU A HB2    3  
ATOM 7595  H HB3    . LEU C 3 74 ? -87.590  5.795   -11.272 1.00 1.02 ? 83  LEU A HB3    3  
ATOM 7596  H HG     . LEU C 3 74 ? -89.949  6.290   -11.830 1.00 1.66 ? 83  LEU A HG     3  
ATOM 7597  H HD11   . LEU C 3 74 ? -89.144  4.972   -9.675  1.00 2.03 ? 83  LEU A HD11   3  
ATOM 7598  H HD12   . LEU C 3 74 ? -89.938  6.309   -8.840  1.00 2.17 ? 83  LEU A HD12   3  
ATOM 7599  H HD13   . LEU C 3 74 ? -90.847  5.302   -9.956  1.00 2.12 ? 83  LEU A HD13   3  
ATOM 7600  H HD21   . LEU C 3 74 ? -89.503  8.851   -11.151 1.00 1.79 ? 83  LEU A HD21   3  
ATOM 7601  H HD22   . LEU C 3 74 ? -91.117  8.137   -11.131 1.00 2.04 ? 83  LEU A HD22   3  
ATOM 7602  H HD23   . LEU C 3 74 ? -90.203  8.293   -9.629  1.00 1.97 ? 83  LEU A HD23   3  
ATOM 7603  N N      . ARG C 3 75 ? -86.184  5.532   -8.839  1.00 0.83 ? 84  ARG A N      3  
ATOM 7604  C CA     . ARG C 3 75 ? -86.031  4.537   -7.743  1.00 0.89 ? 84  ARG A CA     3  
ATOM 7605  C C      . ARG C 3 75 ? -85.614  5.250   -6.443  1.00 0.88 ? 84  ARG A C      3  
ATOM 7606  O O      . ARG C 3 75 ? -86.089  4.928   -5.383  1.00 0.97 ? 84  ARG A O      3  
ATOM 7607  C CB     . ARG C 3 75 ? -85.014  3.448   -8.142  1.00 1.03 ? 84  ARG A CB     3  
ATOM 7608  C CG     . ARG C 3 75 ? -83.551  3.927   -7.967  1.00 1.38 ? 84  ARG A CG     3  
ATOM 7609  C CD     . ARG C 3 75 ? -83.002  3.478   -6.604  1.00 1.27 ? 84  ARG A CD     3  
ATOM 7610  N NE     . ARG C 3 75 ? -81.917  4.413   -6.151  1.00 1.42 ? 84  ARG A NE     3  
ATOM 7611  C CZ     . ARG C 3 75 ? -80.867  4.661   -6.895  1.00 1.55 ? 84  ARG A CZ     3  
ATOM 7612  N NH1    . ARG C 3 75 ? -80.716  4.071   -8.051  1.00 1.74 ? 84  ARG A NH1    3  
ATOM 7613  N NH2    . ARG C 3 75 ? -79.944  5.481   -6.468  1.00 2.34 ? 84  ARG A NH2    3  
ATOM 7614  H H      . ARG C 3 75 ? -85.555  5.544   -9.593  1.00 0.86 ? 84  ARG A H      3  
ATOM 7615  H HA     . ARG C 3 75 ? -86.989  4.069   -7.582  1.00 0.91 ? 84  ARG A HA     3  
ATOM 7616  H HB2    . ARG C 3 75 ? -85.183  2.571   -7.535  1.00 1.12 ? 84  ARG A HB2    3  
ATOM 7617  H HB3    . ARG C 3 75 ? -85.179  3.187   -9.181  1.00 1.54 ? 84  ARG A HB3    3  
ATOM 7618  H HG2    . ARG C 3 75 ? -82.950  3.493   -8.747  1.00 2.07 ? 84  ARG A HG2    3  
ATOM 7619  H HG3    . ARG C 3 75 ? -83.501  5.001   -8.044  1.00 1.84 ? 84  ARG A HG3    3  
ATOM 7620  H HD2    . ARG C 3 75 ? -83.784  3.507   -5.870  1.00 1.63 ? 84  ARG A HD2    3  
ATOM 7621  H HD3    . ARG C 3 75 ? -82.640  2.456   -6.686  1.00 1.85 ? 84  ARG A HD3    3  
ATOM 7622  H HE     . ARG C 3 75 ? -82.001  4.853   -5.276  1.00 2.08 ? 84  ARG A HE     3  
ATOM 7623  H HH11   . ARG C 3 75 ? -81.398  3.424   -8.374  1.00 1.92 ? 84  ARG A HH11   3  
ATOM 7624  H HH12   . ARG C 3 75 ? -79.917  4.273   -8.614  1.00 2.25 ? 84  ARG A HH12   3  
ATOM 7625  H HH21   . ARG C 3 75 ? -80.038  5.927   -5.579  1.00 2.92 ? 84  ARG A HH21   3  
ATOM 7626  H HH22   . ARG C 3 75 ? -79.134  5.655   -7.029  1.00 2.64 ? 84  ARG A HH22   3  
ATOM 7627  N N      . TYR C 3 76 ? -84.751  6.227   -6.507  1.00 0.90 ? 85  TYR A N      3  
ATOM 7628  C CA     . TYR C 3 76 ? -84.345  6.950   -5.256  1.00 0.92 ? 85  TYR A CA     3  
ATOM 7629  C C      . TYR C 3 76 ? -85.517  7.823   -4.790  1.00 0.84 ? 85  TYR A C      3  
ATOM 7630  O O      . TYR C 3 76 ? -85.528  8.354   -3.696  1.00 0.88 ? 85  TYR A O      3  
ATOM 7631  C CB     . TYR C 3 76 ? -83.128  7.833   -5.555  1.00 1.04 ? 85  TYR A CB     3  
ATOM 7632  C CG     . TYR C 3 76 ? -82.746  8.647   -4.336  1.00 1.07 ? 85  TYR A CG     3  
ATOM 7633  C CD1    . TYR C 3 76 ? -82.049  8.048   -3.275  1.00 1.31 ? 85  TYR A CD1    3  
ATOM 7634  C CD2    . TYR C 3 76 ? -83.069  10.008  -4.274  1.00 1.01 ? 85  TYR A CD2    3  
ATOM 7635  C CE1    . TYR C 3 76 ? -81.681  8.810   -2.158  1.00 1.39 ? 85  TYR A CE1    3  
ATOM 7636  C CE2    . TYR C 3 76 ? -82.703  10.769  -3.156  1.00 1.09 ? 85  TYR A CE2    3  
ATOM 7637  C CZ     . TYR C 3 76 ? -82.008  10.172  -2.098  1.00 1.24 ? 85  TYR A CZ     3  
ATOM 7638  O OH     . TYR C 3 76 ? -81.647  10.922  -0.993  1.00 1.36 ? 85  TYR A OH     3  
ATOM 7639  H H      . TYR C 3 76 ? -84.376  6.494   -7.371  1.00 0.98 ? 85  TYR A H      3  
ATOM 7640  H HA     . TYR C 3 76 ? -84.097  6.233   -4.485  1.00 0.97 ? 85  TYR A HA     3  
ATOM 7641  H HB2    . TYR C 3 76 ? -82.295  7.208   -5.841  1.00 1.20 ? 85  TYR A HB2    3  
ATOM 7642  H HB3    . TYR C 3 76 ? -83.367  8.502   -6.370  1.00 1.03 ? 85  TYR A HB3    3  
ATOM 7643  H HD1    . TYR C 3 76 ? -81.800  6.999   -3.321  1.00 1.51 ? 85  TYR A HD1    3  
ATOM 7644  H HD2    . TYR C 3 76 ? -83.606  10.469  -5.087  1.00 1.04 ? 85  TYR A HD2    3  
ATOM 7645  H HE1    . TYR C 3 76 ? -81.144  8.348   -1.342  1.00 1.64 ? 85  TYR A HE1    3  
ATOM 7646  H HE2    . TYR C 3 76 ? -82.955  11.819  -3.112  1.00 1.16 ? 85  TYR A HE2    3  
ATOM 7647  H HH     . TYR C 3 76 ? -80.923  11.500  -1.245  1.00 1.43 ? 85  TYR A HH     3  
ATOM 7648  N N      . TYR C 3 77 ? -86.482  7.998   -5.646  1.00 0.79 ? 86  TYR A N      3  
ATOM 7649  C CA     . TYR C 3 77 ? -87.657  8.863   -5.332  1.00 0.79 ? 86  TYR A CA     3  
ATOM 7650  C C      . TYR C 3 77 ? -88.604  8.214   -4.304  1.00 0.84 ? 86  TYR A C      3  
ATOM 7651  O O      . TYR C 3 77 ? -89.692  8.707   -4.078  1.00 1.27 ? 86  TYR A O      3  
ATOM 7652  C CB     . TYR C 3 77 ? -88.419  9.106   -6.642  1.00 0.76 ? 86  TYR A CB     3  
ATOM 7653  C CG     . TYR C 3 77 ? -89.230  10.367  -6.539  1.00 0.77 ? 86  TYR A CG     3  
ATOM 7654  C CD1    . TYR C 3 77 ? -88.571  11.596  -6.535  1.00 0.82 ? 86  TYR A CD1    3  
ATOM 7655  C CD2    . TYR C 3 77 ? -90.625  10.315  -6.459  1.00 0.82 ? 86  TYR A CD2    3  
ATOM 7656  C CE1    . TYR C 3 77 ? -89.299  12.777  -6.449  1.00 0.87 ? 86  TYR A CE1    3  
ATOM 7657  C CE2    . TYR C 3 77 ? -91.357  11.502  -6.376  1.00 0.87 ? 86  TYR A CE2    3  
ATOM 7658  C CZ     . TYR C 3 77 ? -90.690  12.733  -6.371  1.00 0.89 ? 86  TYR A CZ     3  
ATOM 7659  O OH     . TYR C 3 77 ? -91.404  13.902  -6.284  1.00 0.98 ? 86  TYR A OH     3  
ATOM 7660  H H      . TYR C 3 77 ? -86.422  7.576   -6.527  1.00 0.79 ? 86  TYR A H      3  
ATOM 7661  H HA     . TYR C 3 77 ? -87.307  9.810   -4.946  1.00 0.85 ? 86  TYR A HA     3  
ATOM 7662  H HB2    . TYR C 3 77 ? -87.712  9.210   -7.447  1.00 0.78 ? 86  TYR A HB2    3  
ATOM 7663  H HB3    . TYR C 3 77 ? -89.074  8.271   -6.845  1.00 0.76 ? 86  TYR A HB3    3  
ATOM 7664  H HD1    . TYR C 3 77 ? -87.495  11.629  -6.600  1.00 0.85 ? 86  TYR A HD1    3  
ATOM 7665  H HD2    . TYR C 3 77 ? -91.133  9.362   -6.461  1.00 0.85 ? 86  TYR A HD2    3  
ATOM 7666  H HE1    . TYR C 3 77 ? -88.788  13.728  -6.447  1.00 0.95 ? 86  TYR A HE1    3  
ATOM 7667  H HE2    . TYR C 3 77 ? -92.431  11.470  -6.323  1.00 0.94 ? 86  TYR A HE2    3  
ATOM 7668  H HH     . TYR C 3 77 ? -91.381  14.187  -5.373  1.00 0.66 ? 86  TYR A HH     3  
ATOM 7669  N N      . TYR C 3 78 ? -88.229  7.127   -3.668  1.00 0.84 ? 87  TYR A N      3  
ATOM 7670  C CA     . TYR C 3 78 ? -89.168  6.514   -2.669  1.00 0.91 ? 87  TYR A CA     3  
ATOM 7671  C C      . TYR C 3 78 ? -89.006  7.218   -1.327  1.00 1.01 ? 87  TYR A C      3  
ATOM 7672  O O      . TYR C 3 78 ? -89.356  6.688   -0.292  1.00 1.20 ? 87  TYR A O      3  
ATOM 7673  C CB     . TYR C 3 78 ? -88.907  5.020   -2.466  1.00 1.01 ? 87  TYR A CB     3  
ATOM 7674  C CG     . TYR C 3 78 ? -88.918  4.285   -3.788  1.00 0.90 ? 87  TYR A CG     3  
ATOM 7675  C CD1    . TYR C 3 78 ? -90.038  4.348   -4.634  1.00 1.48 ? 87  TYR A CD1    3  
ATOM 7676  C CD2    . TYR C 3 78 ? -87.800  3.541   -4.171  1.00 1.01 ? 87  TYR A CD2    3  
ATOM 7677  C CE1    . TYR C 3 78 ? -90.026  3.663   -5.857  1.00 1.65 ? 87  TYR A CE1    3  
ATOM 7678  C CE2    . TYR C 3 78 ? -87.789  2.860   -5.386  1.00 1.15 ? 87  TYR A CE2    3  
ATOM 7679  C CZ     . TYR C 3 78 ? -88.898  2.919   -6.230  1.00 1.28 ? 87  TYR A CZ     3  
ATOM 7680  O OH     . TYR C 3 78 ? -88.872  2.241   -7.429  1.00 1.62 ? 87  TYR A OH     3  
ATOM 7681  H H      . TYR C 3 78 ? -87.352  6.727   -3.840  1.00 1.12 ? 87  TYR A H      3  
ATOM 7682  H HA     . TYR C 3 78 ? -90.186  6.652   -3.006  1.00 0.93 ? 87  TYR A HA     3  
ATOM 7683  H HB2    . TYR C 3 78 ? -87.951  4.888   -1.984  1.00 1.13 ? 87  TYR A HB2    3  
ATOM 7684  H HB3    . TYR C 3 78 ? -89.681  4.610   -1.831  1.00 1.32 ? 87  TYR A HB3    3  
ATOM 7685  H HD1    . TYR C 3 78 ? -90.906  4.922   -4.347  1.00 2.02 ? 87  TYR A HD1    3  
ATOM 7686  H HD2    . TYR C 3 78 ? -86.936  3.493   -3.524  1.00 1.47 ? 87  TYR A HD2    3  
ATOM 7687  H HE1    . TYR C 3 78 ? -90.883  3.710   -6.513  1.00 2.28 ? 87  TYR A HE1    3  
ATOM 7688  H HE2    . TYR C 3 78 ? -86.923  2.286   -5.673  1.00 1.59 ? 87  TYR A HE2    3  
ATOM 7689  H HH     . TYR C 3 78 ? -88.011  1.820   -7.506  1.00 2.01 ? 87  TYR A HH     3  
ATOM 7690  N N      . ASP C 3 79 ? -88.488  8.414   -1.333  1.00 1.01 ? 88  ASP A N      3  
ATOM 7691  C CA     . ASP C 3 79 ? -88.326  9.153   -0.050  1.00 1.13 ? 88  ASP A CA     3  
ATOM 7692  C C      . ASP C 3 79 ? -89.694  9.603   0.423   1.00 1.03 ? 88  ASP A C      3  
ATOM 7693  O O      . ASP C 3 79 ? -89.992  9.604   1.600   1.00 1.14 ? 88  ASP A O      3  
ATOM 7694  C CB     . ASP C 3 79 ? -87.429  10.375  -0.256  1.00 1.30 ? 88  ASP A CB     3  
ATOM 7695  C CG     . ASP C 3 79 ? -85.986  9.910   -0.433  1.00 1.93 ? 88  ASP A CG     3  
ATOM 7696  O OD1    . ASP C 3 79 ? -85.566  9.047   0.325   1.00 2.30 ? 88  ASP A OD1    3  
ATOM 7697  O OD2    . ASP C 3 79 ? -85.322  10.415  -1.320  1.00 2.74 ? 88  ASP A OD2    3  
ATOM 7698  H H      . ASP C 3 79 ? -88.223  8.830   -2.179  1.00 1.02 ? 88  ASP A H      3  
ATOM 7699  H HA     . ASP C 3 79 ? -87.891  8.498   0.689   1.00 1.31 ? 88  ASP A HA     3  
ATOM 7700  H HB2    . ASP C 3 79 ? -87.750  10.919  -1.139  1.00 1.70 ? 88  ASP A HB2    3  
ATOM 7701  H HB3    . ASP C 3 79 ? -87.495  11.019  0.607   1.00 1.42 ? 88  ASP A HB3    3  
ATOM 7702  N N      . LYS C 3 80 ? -90.535  9.965   -0.499  1.00 0.99 ? 89  LYS A N      3  
ATOM 7703  C CA     . LYS C 3 80 ? -91.912  10.402  -0.146  1.00 1.08 ? 89  LYS A CA     3  
ATOM 7704  C C      . LYS C 3 80 ? -92.875  9.288   -0.542  1.00 1.10 ? 89  LYS A C      3  
ATOM 7705  O O      . LYS C 3 80 ? -92.746  8.695   -1.594  1.00 1.59 ? 89  LYS A O      3  
ATOM 7706  C CB     . LYS C 3 80 ? -92.243  11.679  -0.923  1.00 1.23 ? 89  LYS A CB     3  
ATOM 7707  C CG     . LYS C 3 80 ? -91.333  12.816  -0.450  1.00 1.31 ? 89  LYS A CG     3  
ATOM 7708  C CD     . LYS C 3 80 ? -91.721  14.106  -1.175  1.00 1.31 ? 89  LYS A CD     3  
ATOM 7709  C CE     . LYS C 3 80 ? -90.818  15.259  -0.720  1.00 1.90 ? 89  LYS A CE     3  
ATOM 7710  N NZ     . LYS C 3 80 ? -91.059  16.458  -1.576  1.00 2.52 ? 89  LYS A NZ     3  
ATOM 7711  H H      . LYS C 3 80 ? -90.264  9.935   -1.441  1.00 1.03 ? 89  LYS A H      3  
ATOM 7712  H HA     . LYS C 3 80 ? -91.991  10.593  0.915   1.00 1.16 ? 89  LYS A HA     3  
ATOM 7713  H HB2    . LYS C 3 80 ? -92.087  11.509  -1.978  1.00 1.35 ? 89  LYS A HB2    3  
ATOM 7714  H HB3    . LYS C 3 80 ? -93.272  11.949  -0.749  1.00 1.62 ? 89  LYS A HB3    3  
ATOM 7715  H HG2    . LYS C 3 80 ? -91.450  12.947  0.617   1.00 1.90 ? 89  LYS A HG2    3  
ATOM 7716  H HG3    . LYS C 3 80 ? -90.304  12.574  -0.671  1.00 1.61 ? 89  LYS A HG3    3  
ATOM 7717  H HD2    . LYS C 3 80 ? -91.616  13.963  -2.242  1.00 1.79 ? 89  LYS A HD2    3  
ATOM 7718  H HD3    . LYS C 3 80 ? -92.747  14.345  -0.945  1.00 1.60 ? 89  LYS A HD3    3  
ATOM 7719  H HE2    . LYS C 3 80 ? -91.042  15.505  0.309   1.00 2.47 ? 89  LYS A HE2    3  
ATOM 7720  H HE3    . LYS C 3 80 ? -89.781  14.961  -0.800  1.00 2.29 ? 89  LYS A HE3    3  
ATOM 7721  H HZ1    . LYS C 3 80 ? -91.232  16.156  -2.556  1.00 2.97 ? 89  LYS A HZ1    3  
ATOM 7722  H HZ2    . LYS C 3 80 ? -91.889  16.979  -1.220  1.00 2.78 ? 89  LYS A HZ2    3  
ATOM 7723  H HZ3    . LYS C 3 80 ? -90.226  17.079  -1.546  1.00 3.00 ? 89  LYS A HZ3    3  
ATOM 7724  N N      . ASN C 3 81 ? -93.837  8.989   0.287   1.00 1.03 ? 90  ASN A N      3  
ATOM 7725  C CA     . ASN C 3 81 ? -94.793  7.902   -0.067  1.00 1.02 ? 90  ASN A CA     3  
ATOM 7726  C C      . ASN C 3 81 ? -95.768  8.457   -1.073  1.00 1.01 ? 90  ASN A C      3  
ATOM 7727  O O      . ASN C 3 81 ? -96.811  8.986   -0.742  1.00 1.12 ? 90  ASN A O      3  
ATOM 7728  C CB     . ASN C 3 81 ? -95.553  7.428   1.173   1.00 1.15 ? 90  ASN A CB     3  
ATOM 7729  C CG     . ASN C 3 81 ? -94.562  6.870   2.190   1.00 1.97 ? 90  ASN A CG     3  
ATOM 7730  O OD1    . ASN C 3 81 ? -94.690  7.108   3.374   1.00 2.80 ? 90  ASN A OD1    3  
ATOM 7731  N ND2    . ASN C 3 81 ? -93.571  6.130   1.775   1.00 2.45 ? 90  ASN A ND2    3  
ATOM 7732  H H      . ASN C 3 81 ? -93.923  9.472   1.134   1.00 1.34 ? 90  ASN A H      3  
ATOM 7733  H HA     . ASN C 3 81 ? -94.260  7.076   -0.513  1.00 0.99 ? 90  ASN A HA     3  
ATOM 7734  H HB2    . ASN C 3 81 ? -96.091  8.258   1.604   1.00 1.58 ? 90  ASN A HB2    3  
ATOM 7735  H HB3    . ASN C 3 81 ? -96.251  6.655   0.891   1.00 1.40 ? 90  ASN A HB3    3  
ATOM 7736  H HD21   . ASN C 3 81 ? -93.473  5.933   0.820   1.00 2.39 ? 90  ASN A HD21   3  
ATOM 7737  H HD22   . ASN C 3 81 ? -92.918  5.782   2.416   1.00 3.23 ? 90  ASN A HD22   3  
ATOM 7738  N N      . ILE C 3 82 ? -95.400  8.357   -2.313  1.00 0.95 ? 91  ILE A N      3  
ATOM 7739  C CA     . ILE C 3 82 ? -96.239  8.890   -3.410  1.00 1.00 ? 91  ILE A CA     3  
ATOM 7740  C C      . ILE C 3 82 ? -96.289  7.857   -4.551  1.00 0.94 ? 91  ILE A C      3  
ATOM 7741  O O      . ILE C 3 82 ? -97.344  7.512   -5.046  1.00 1.01 ? 91  ILE A O      3  
ATOM 7742  C CB     . ILE C 3 82 ? -95.584  10.209  -3.852  1.00 1.10 ? 91  ILE A CB     3  
ATOM 7743  C CG1    . ILE C 3 82 ? -96.533  11.056  -4.715  1.00 1.28 ? 91  ILE A CG1    3  
ATOM 7744  C CG2    . ILE C 3 82 ? -94.297  9.928   -4.612  1.00 1.09 ? 91  ILE A CG2    3  
ATOM 7745  C CD1    . ILE C 3 82 ? -97.016  10.278  -5.941  1.00 0.84 ? 91  ILE A CD1    3  
ATOM 7746  H H      . ILE C 3 82 ? -94.538  7.941   -2.524  1.00 0.92 ? 91  ILE A H      3  
ATOM 7747  H HA     . ILE C 3 82 ? -97.237  9.088   -3.058  1.00 1.08 ? 91  ILE A HA     3  
ATOM 7748  H HB     . ILE C 3 82 ? -95.331  10.772  -2.964  1.00 1.17 ? 91  ILE A HB     3  
ATOM 7749  H HG12   . ILE C 3 82 ? -97.386  11.346  -4.121  1.00 1.93 ? 91  ILE A HG12   3  
ATOM 7750  H HG13   . ILE C 3 82 ? -96.010  11.942  -5.040  1.00 1.75 ? 91  ILE A HG13   3  
ATOM 7751  H HG21   . ILE C 3 82 ? -93.712  9.196   -4.073  1.00 1.46 ? 91  ILE A HG21   3  
ATOM 7752  H HG22   . ILE C 3 82 ? -94.530  9.561   -5.599  1.00 1.56 ? 91  ILE A HG22   3  
ATOM 7753  H HG23   . ILE C 3 82 ? -93.737  10.840  -4.688  1.00 1.46 ? 91  ILE A HG23   3  
ATOM 7754  H HD11   . ILE C 3 82 ? -96.207  9.690   -6.346  1.00 1.53 ? 91  ILE A HD11   3  
ATOM 7755  H HD12   . ILE C 3 82 ? -97.829  9.633   -5.657  1.00 1.12 ? 91  ILE A HD12   3  
ATOM 7756  H HD13   . ILE C 3 82 ? -97.360  10.971  -6.690  1.00 1.34 ? 91  ILE A HD13   3  
ATOM 7757  N N      . ILE C 3 83 ? -95.151  7.354   -4.963  1.00 0.89 ? 92  ILE A N      3  
ATOM 7758  C CA     . ILE C 3 83 ? -95.100  6.351   -6.071  1.00 0.84 ? 92  ILE A CA     3  
ATOM 7759  C C      . ILE C 3 83 ? -94.209  5.170   -5.677  1.00 0.81 ? 92  ILE A C      3  
ATOM 7760  O O      . ILE C 3 83 ? -93.173  5.331   -5.060  1.00 0.84 ? 92  ILE A O      3  
ATOM 7761  C CB     . ILE C 3 83 ? -94.531  7.035   -7.322  1.00 0.86 ? 92  ILE A CB     3  
ATOM 7762  C CG1    . ILE C 3 83 ? -94.576  6.063   -8.509  1.00 1.02 ? 92  ILE A CG1    3  
ATOM 7763  C CG2    . ILE C 3 83 ? -93.085  7.482   -7.071  1.00 0.85 ? 92  ILE A CG2    3  
ATOM 7764  C CD1    . ILE C 3 83 ? -93.853  6.674   -9.713  1.00 1.09 ? 92  ILE A CD1    3  
ATOM 7765  H H      . ILE C 3 83 ? -94.325  7.640   -4.547  1.00 0.95 ? 92  ILE A H      3  
ATOM 7766  H HA     . ILE C 3 83 ? -96.089  5.984   -6.285  1.00 0.83 ? 92  ILE A HA     3  
ATOM 7767  H HB     . ILE C 3 83 ? -95.131  7.906   -7.554  1.00 1.07 ? 92  ILE A HB     3  
ATOM 7768  H HG12   . ILE C 3 83 ? -94.091  5.136   -8.239  1.00 1.14 ? 92  ILE A HG12   3  
ATOM 7769  H HG13   . ILE C 3 83 ? -95.602  5.871   -8.772  1.00 1.34 ? 92  ILE A HG13   3  
ATOM 7770  H HG21   . ILE C 3 83 ? -92.998  7.881   -6.071  1.00 1.29 ? 92  ILE A HG21   3  
ATOM 7771  H HG22   . ILE C 3 83 ? -92.420  6.638   -7.184  1.00 1.35 ? 92  ILE A HG22   3  
ATOM 7772  H HG23   . ILE C 3 83 ? -92.818  8.250   -7.787  1.00 1.32 ? 92  ILE A HG23   3  
ATOM 7773  H HD11   . ILE C 3 83 ? -94.005  7.739   -9.731  1.00 1.45 ? 92  ILE A HD11   3  
ATOM 7774  H HD12   . ILE C 3 83 ? -92.799  6.469   -9.637  1.00 1.44 ? 92  ILE A HD12   3  
ATOM 7775  H HD13   . ILE C 3 83 ? -94.240  6.239   -10.622 1.00 1.67 ? 92  ILE A HD13   3  
ATOM 7776  N N      . HIS C 3 84 ? -94.623  3.975   -6.036  1.00 0.83 ? 93  HIS A N      3  
ATOM 7777  C CA     . HIS C 3 84 ? -93.832  2.744   -5.707  1.00 0.85 ? 93  HIS A CA     3  
ATOM 7778  C C      . HIS C 3 84 ? -93.670  1.886   -6.967  1.00 0.85 ? 93  HIS A C      3  
ATOM 7779  O O      . HIS C 3 84 ? -94.313  2.124   -7.973  1.00 0.91 ? 93  HIS A O      3  
ATOM 7780  C CB     . HIS C 3 84 ? -94.564  1.949   -4.633  1.00 0.88 ? 93  HIS A CB     3  
ATOM 7781  C CG     . HIS C 3 84 ? -94.530  2.723   -3.349  1.00 1.01 ? 93  HIS A CG     3  
ATOM 7782  N ND1    . HIS C 3 84 ? -93.835  2.282   -2.238  1.00 1.59 ? 93  HIS A ND1    3  
ATOM 7783  C CD2    . HIS C 3 84 ? -95.101  3.914   -2.989  1.00 1.02 ? 93  HIS A CD2    3  
ATOM 7784  C CE1    . HIS C 3 84 ? -94.011  3.192   -1.264  1.00 1.79 ? 93  HIS A CE1    3  
ATOM 7785  N NE2    . HIS C 3 84 ? -94.775  4.211   -1.670  1.00 1.41 ? 93  HIS A NE2    3  
ATOM 7786  H H      . HIS C 3 84 ? -95.469  3.887   -6.525  1.00 0.89 ? 93  HIS A H      3  
ATOM 7787  H HA     . HIS C 3 84 ? -92.854  3.022   -5.339  1.00 0.88 ? 93  HIS A HA     3  
ATOM 7788  H HB2    . HIS C 3 84 ? -95.589  1.790   -4.932  1.00 0.97 ? 93  HIS A HB2    3  
ATOM 7789  H HB3    . HIS C 3 84 ? -94.076  0.995   -4.490  1.00 0.99 ? 93  HIS A HB3    3  
ATOM 7790  H HD1    . HIS C 3 84 ? -93.298  1.465   -2.178  1.00 1.93 ? 93  HIS A HD1    3  
ATOM 7791  H HD2    . HIS C 3 84 ? -95.687  4.540   -3.643  1.00 1.12 ? 93  HIS A HD2    3  
ATOM 7792  H HE1    . HIS C 3 84 ? -93.591  3.110   -0.273  1.00 2.31 ? 93  HIS A HE1    3  
ATOM 7793  N N      . LYS C 3 85 ? -92.805  0.900   -6.931  1.00 0.92 ? 94  LYS A N      3  
ATOM 7794  C CA     . LYS C 3 85 ? -92.585  0.037   -8.140  1.00 0.96 ? 94  LYS A CA     3  
ATOM 7795  C C      . LYS C 3 85 ? -93.386  -1.267  -8.017  1.00 0.95 ? 94  LYS A C      3  
ATOM 7796  O O      . LYS C 3 85 ? -93.586  -1.778  -6.932  1.00 1.10 ? 94  LYS A O      3  
ATOM 7797  C CB     . LYS C 3 85 ? -91.094  -0.298  -8.251  1.00 1.20 ? 94  LYS A CB     3  
ATOM 7798  C CG     . LYS C 3 85 ? -90.658  -1.153  -7.052  1.00 1.61 ? 94  LYS A CG     3  
ATOM 7799  C CD     . LYS C 3 85 ? -89.127  -1.145  -6.928  1.00 1.86 ? 94  LYS A CD     3  
ATOM 7800  C CE     . LYS C 3 85 ? -88.499  -1.855  -8.131  1.00 2.16 ? 94  LYS A CE     3  
ATOM 7801  N NZ     . LYS C 3 85 ? -89.064  -3.226  -8.250  1.00 2.83 ? 94  LYS A NZ     3  
ATOM 7802  H H      . LYS C 3 85 ? -92.291  0.733   -6.112  1.00 1.03 ? 94  LYS A H      3  
ATOM 7803  H HA     . LYS C 3 85 ? -92.897  0.566   -9.030  1.00 0.96 ? 94  LYS A HA     3  
ATOM 7804  H HB2    . LYS C 3 85 ? -90.930  -0.847  -9.162  1.00 1.72 ? 94  LYS A HB2    3  
ATOM 7805  H HB3    . LYS C 3 85 ? -90.519  0.614   -8.271  1.00 1.74 ? 94  LYS A HB3    3  
ATOM 7806  H HG2    . LYS C 3 85 ? -91.096  -0.750  -6.148  1.00 2.19 ? 94  LYS A HG2    3  
ATOM 7807  H HG3    . LYS C 3 85 ? -90.997  -2.169  -7.195  1.00 2.14 ? 94  LYS A HG3    3  
ATOM 7808  H HD2    . LYS C 3 85 ? -88.775  -0.125  -6.894  1.00 2.20 ? 94  LYS A HD2    3  
ATOM 7809  H HD3    . LYS C 3 85 ? -88.839  -1.656  -6.021  1.00 2.28 ? 94  LYS A HD3    3  
ATOM 7810  H HE2    . LYS C 3 85 ? -88.705  -1.299  -9.031  1.00 2.48 ? 94  LYS A HE2    3  
ATOM 7811  H HE3    . LYS C 3 85 ? -87.429  -1.922  -7.989  1.00 2.52 ? 94  LYS A HE3    3  
ATOM 7812  H HZ1    . LYS C 3 85 ? -89.590  -3.463  -7.381  1.00 3.29 ? 94  LYS A HZ1    3  
ATOM 7813  H HZ2    . LYS C 3 85 ? -89.707  -3.264  -9.066  1.00 3.25 ? 94  LYS A HZ2    3  
ATOM 7814  H HZ3    . LYS C 3 85 ? -88.292  -3.910  -8.386  1.00 3.11 ? 94  LYS A HZ3    3  
ATOM 7815  N N      . THR C 3 86 ? -93.845  -1.819  -9.120  1.00 0.91 ? 95  THR A N      3  
ATOM 7816  C CA     . THR C 3 86 ? -94.629  -3.094  -9.042  1.00 1.04 ? 95  THR A CA     3  
ATOM 7817  C C      . THR C 3 86 ? -93.668  -4.285  -9.140  1.00 1.20 ? 95  THR A C      3  
ATOM 7818  O O      . THR C 3 86 ? -92.757  -4.298  -9.942  1.00 1.24 ? 95  THR A O      3  
ATOM 7819  C CB     . THR C 3 86 ? -95.646  -3.162  -10.193 1.00 1.05 ? 95  THR A CB     3  
ATOM 7820  O OG1    . THR C 3 86 ? -96.473  -2.009  -10.162 1.00 1.22 ? 95  THR A OG1    3  
ATOM 7821  C CG2    . THR C 3 86 ? -96.524  -4.417  -10.051 1.00 1.21 ? 95  THR A CG2    3  
ATOM 7822  H H      . THR C 3 86 ? -93.673  -1.397  -9.993  1.00 0.87 ? 95  THR A H      3  
ATOM 7823  H HA     . THR C 3 86 ? -95.154  -3.138  -8.097  1.00 1.18 ? 95  THR A HA     3  
ATOM 7824  H HB     . THR C 3 86 ? -95.122  -3.201  -11.129 1.00 1.06 ? 95  THR A HB     3  
ATOM 7825  H HG1    . THR C 3 86 ? -96.343  -1.570  -9.319  1.00 1.56 ? 95  THR A HG1    3  
ATOM 7826  H HG21   . THR C 3 86 ? -96.707  -4.623  -9.005  1.00 1.62 ? 95  THR A HG21   3  
ATOM 7827  H HG22   . THR C 3 86 ? -97.468  -4.253  -10.553 1.00 1.62 ? 95  THR A HG22   3  
ATOM 7828  H HG23   . THR C 3 86 ? -96.026  -5.265  -10.500 1.00 1.57 ? 95  THR A HG23   3  
ATOM 7829  N N      . ALA C 3 87 ? -93.858  -5.278  -8.318  1.00 1.58 ? 96  ALA A N      3  
ATOM 7830  C CA     . ALA C 3 87 ? -92.951  -6.462  -8.343  1.00 1.85 ? 96  ALA A CA     3  
ATOM 7831  C C      . ALA C 3 87 ? -93.143  -7.262  -9.637  1.00 1.77 ? 96  ALA A C      3  
ATOM 7832  O O      . ALA C 3 87 ? -92.579  -8.327  -9.798  1.00 2.10 ? 96  ALA A O      3  
ATOM 7833  C CB     . ALA C 3 87 ? -93.261  -7.362  -7.152  1.00 2.47 ? 96  ALA A CB     3  
ATOM 7834  H H      . ALA C 3 87 ? -94.591  -5.238  -7.670  1.00 1.82 ? 96  ALA A H      3  
ATOM 7835  H HA     . ALA C 3 87 ? -91.926  -6.130  -8.279  1.00 1.89 ? 96  ALA A HA     3  
ATOM 7836  H HB1    . ALA C 3 87 ? -94.320  -7.574  -7.128  1.00 2.87 ? 96  ALA A HB1    3  
ATOM 7837  H HB2    . ALA C 3 87 ? -92.711  -8.288  -7.250  1.00 2.72 ? 96  ALA A HB2    3  
ATOM 7838  H HB3    . ALA C 3 87 ? -92.971  -6.863  -6.240  1.00 2.84 ? 96  ALA A HB3    3  
ATOM 7839  N N      . GLY C 3 88 ? -93.922  -6.767  -10.559 1.00 1.65 ? 97  GLY A N      3  
ATOM 7840  C CA     . GLY C 3 88 ? -94.129  -7.515  -11.833 1.00 1.96 ? 97  GLY A CA     3  
ATOM 7841  C C      . GLY C 3 88 ? -92.893  -7.358  -12.718 1.00 1.94 ? 97  GLY A C      3  
ATOM 7842  O O      . GLY C 3 88 ? -91.900  -8.030  -12.524 1.00 2.32 ? 97  GLY A O      3  
ATOM 7843  H H      . GLY C 3 88 ? -94.367  -5.906  -10.416 1.00 1.59 ? 97  GLY A H      3  
ATOM 7844  H HA2    . GLY C 3 88 ? -94.290  -8.564  -11.619 1.00 2.24 ? 97  GLY A HA2    3  
ATOM 7845  H HA3    . GLY C 3 88 ? -94.990  -7.119  -12.351 1.00 2.17 ? 97  GLY A HA3    3  
ATOM 7846  N N      . LYS C 3 89 ? -92.940  -6.480  -13.689 1.00 1.64 ? 98  LYS A N      3  
ATOM 7847  C CA     . LYS C 3 89 ? -91.760  -6.284  -14.594 1.00 1.72 ? 98  LYS A CA     3  
ATOM 7848  C C      . LYS C 3 89 ? -91.057  -4.976  -14.227 1.00 1.44 ? 98  LYS A C      3  
ATOM 7849  O O      . LYS C 3 89 ? -91.534  -4.205  -13.419 1.00 1.85 ? 98  LYS A O      3  
ATOM 7850  C CB     . LYS C 3 89 ? -92.233  -6.218  -16.051 1.00 2.09 ? 98  LYS A CB     3  
ATOM 7851  C CG     . LYS C 3 89 ? -92.954  -7.519  -16.409 1.00 2.01 ? 98  LYS A CG     3  
ATOM 7852  C CD     . LYS C 3 89 ? -93.455  -7.465  -17.865 1.00 2.78 ? 98  LYS A CD     3  
ATOM 7853  C CE     . LYS C 3 89 ? -92.338  -7.874  -18.833 1.00 3.22 ? 98  LYS A CE     3  
ATOM 7854  N NZ     . LYS C 3 89 ? -91.861  -9.242  -18.495 1.00 3.60 ? 98  LYS A NZ     3  
ATOM 7855  H H      . LYS C 3 89 ? -93.753  -5.952  -13.827 1.00 1.50 ? 98  LYS A H      3  
ATOM 7856  H HA     . LYS C 3 89 ? -91.065  -7.104  -14.482 1.00 2.08 ? 98  LYS A HA     3  
ATOM 7857  H HB2    . LYS C 3 89 ? -92.910  -5.386  -16.175 1.00 2.74 ? 98  LYS A HB2    3  
ATOM 7858  H HB3    . LYS C 3 89 ? -91.382  -6.090  -16.698 1.00 2.38 ? 98  LYS A HB3    3  
ATOM 7859  H HG2    . LYS C 3 89 ? -92.273  -8.350  -16.285 1.00 2.19 ? 98  LYS A HG2    3  
ATOM 7860  H HG3    . LYS C 3 89 ? -93.801  -7.648  -15.748 1.00 2.14 ? 98  LYS A HG3    3  
ATOM 7861  H HD2    . LYS C 3 89 ? -94.290  -8.141  -17.981 1.00 3.13 ? 98  LYS A HD2    3  
ATOM 7862  H HD3    . LYS C 3 89 ? -93.779  -6.462  -18.098 1.00 3.29 ? 98  LYS A HD3    3  
ATOM 7863  H HE2    . LYS C 3 89 ? -92.721  -7.873  -19.843 1.00 3.55 ? 98  LYS A HE2    3  
ATOM 7864  H HE3    . LYS C 3 89 ? -91.516  -7.177  -18.760 1.00 3.59 ? 98  LYS A HE3    3  
ATOM 7865  H HZ1    . LYS C 3 89 ? -92.652  -9.804  -18.123 1.00 3.82 ? 98  LYS A HZ1    3  
ATOM 7866  H HZ2    . LYS C 3 89 ? -91.485  -9.698  -19.353 1.00 3.99 ? 98  LYS A HZ2    3  
ATOM 7867  H HZ3    . LYS C 3 89 ? -91.113  -9.180  -17.776 1.00 3.80 ? 98  LYS A HZ3    3  
ATOM 7868  N N      . ARG C 3 90 ? -89.920  -4.719  -14.806 1.00 1.21 ? 99  ARG A N      3  
ATOM 7869  C CA     . ARG C 3 90 ? -89.195  -3.463  -14.479 1.00 1.48 ? 99  ARG A CA     3  
ATOM 7870  C C      . ARG C 3 90 ? -89.837  -2.298  -15.241 1.00 1.11 ? 99  ARG A C      3  
ATOM 7871  O O      . ARG C 3 90 ? -89.456  -1.156  -15.079 1.00 1.22 ? 99  ARG A O      3  
ATOM 7872  C CB     . ARG C 3 90 ? -87.730  -3.600  -14.902 1.00 2.00 ? 99  ARG A CB     3  
ATOM 7873  C CG     . ARG C 3 90 ? -87.106  -4.852  -14.276 1.00 2.76 ? 99  ARG A CG     3  
ATOM 7874  C CD     . ARG C 3 90 ? -87.268  -4.828  -12.753 1.00 3.58 ? 99  ARG A CD     3  
ATOM 7875  N NE     . ARG C 3 90 ? -86.306  -5.791  -12.148 1.00 4.24 ? 99  ARG A NE     3  
ATOM 7876  C CZ     . ARG C 3 90 ? -86.023  -5.733  -10.874 1.00 4.91 ? 99  ARG A CZ     3  
ATOM 7877  N NH1    . ARG C 3 90 ? -86.577  -4.825  -10.117 1.00 5.13 ? 99  ARG A NH1    3  
ATOM 7878  N NH2    . ARG C 3 90 ? -85.189  -6.592  -10.354 1.00 5.66 ? 99  ARG A NH2    3  
ATOM 7879  H H      . ARG C 3 90 ? -89.538  -5.355  -15.450 1.00 1.29 ? 99  ARG A H      3  
ATOM 7880  H HA     . ARG C 3 90 ? -89.251  -3.270  -13.419 1.00 2.02 ? 99  ARG A HA     3  
ATOM 7881  H HB2    . ARG C 3 90 ? -87.678  -3.678  -15.977 1.00 2.35 ? 99  ARG A HB2    3  
ATOM 7882  H HB3    . ARG C 3 90 ? -87.184  -2.730  -14.578 1.00 2.27 ? 99  ARG A HB3    3  
ATOM 7883  H HG2    . ARG C 3 90 ? -87.590  -5.733  -14.673 1.00 3.10 ? 99  ARG A HG2    3  
ATOM 7884  H HG3    . ARG C 3 90 ? -86.054  -4.883  -14.519 1.00 3.02 ? 99  ARG A HG3    3  
ATOM 7885  H HD2    . ARG C 3 90 ? -87.076  -3.831  -12.382 1.00 3.70 ? 99  ARG A HD2    3  
ATOM 7886  H HD3    . ARG C 3 90 ? -88.273  -5.127  -12.492 1.00 4.02 ? 99  ARG A HD3    3  
ATOM 7887  H HE     . ARG C 3 90 ? -85.887  -6.476  -12.710 1.00 4.43 ? 99  ARG A HE     3  
ATOM 7888  H HH11   . ARG C 3 90 ? -87.217  -4.166  -10.512 1.00 4.79 ? 99  ARG A HH11   3  
ATOM 7889  H HH12   . ARG C 3 90 ? -86.363  -4.793  -9.138  1.00 5.82 ? 99  ARG A HH12   3  
ATOM 7890  H HH21   . ARG C 3 90 ? -84.768  -7.293  -10.932 1.00 5.80 ? 99  ARG A HH21   3  
ATOM 7891  H HH22   . ARG C 3 90 ? -84.966  -6.547  -9.381  1.00 6.26 ? 99  ARG A HH22   3  
ATOM 7892  N N      . TYR C 3 91 ? -90.794  -2.582  -16.090 1.00 0.92 ? 100 TYR A N      3  
ATOM 7893  C CA     . TYR C 3 91 ? -91.452  -1.502  -16.893 1.00 0.77 ? 100 TYR A CA     3  
ATOM 7894  C C      . TYR C 3 91 ? -92.831  -1.147  -16.318 1.00 0.76 ? 100 TYR A C      3  
ATOM 7895  O O      . TYR C 3 91 ? -93.485  -0.238  -16.790 1.00 0.77 ? 100 TYR A O      3  
ATOM 7896  C CB     . TYR C 3 91 ? -91.614  -2.011  -18.321 1.00 0.94 ? 100 TYR A CB     3  
ATOM 7897  C CG     . TYR C 3 91 ? -90.260  -2.428  -18.829 1.00 0.87 ? 100 TYR A CG     3  
ATOM 7898  C CD1    . TYR C 3 91 ? -89.322  -1.456  -19.184 1.00 0.87 ? 100 TYR A CD1    3  
ATOM 7899  C CD2    . TYR C 3 91 ? -89.939  -3.786  -18.937 1.00 1.18 ? 100 TYR A CD2    3  
ATOM 7900  C CE1    . TYR C 3 91 ? -88.062  -1.839  -19.650 1.00 0.87 ? 100 TYR A CE1    3  
ATOM 7901  C CE2    . TYR C 3 91 ? -88.678  -4.171  -19.402 1.00 1.27 ? 100 TYR A CE2    3  
ATOM 7902  C CZ     . TYR C 3 91 ? -87.738  -3.196  -19.759 1.00 1.00 ? 100 TYR A CZ     3  
ATOM 7903  O OH     . TYR C 3 91 ? -86.494  -3.570  -20.220 1.00 1.16 ? 100 TYR A OH     3  
ATOM 7904  H H      . TYR C 3 91 ? -91.070  -3.515  -16.216 1.00 1.08 ? 100 TYR A H      3  
ATOM 7905  H HA     . TYR C 3 91 ? -90.832  -0.617  -16.905 1.00 0.82 ? 100 TYR A HA     3  
ATOM 7906  H HB2    . TYR C 3 91 ? -92.287  -2.859  -18.330 1.00 1.17 ? 100 TYR A HB2    3  
ATOM 7907  H HB3    . TYR C 3 91 ? -92.009  -1.224  -18.947 1.00 1.13 ? 100 TYR A HB3    3  
ATOM 7908  H HD1    . TYR C 3 91 ? -89.570  -0.409  -19.097 1.00 1.11 ? 100 TYR A HD1    3  
ATOM 7909  H HD2    . TYR C 3 91 ? -90.667  -4.536  -18.660 1.00 1.48 ? 100 TYR A HD2    3  
ATOM 7910  H HE1    . TYR C 3 91 ? -87.337  -1.087  -19.923 1.00 1.04 ? 100 TYR A HE1    3  
ATOM 7911  H HE2    . TYR C 3 91 ? -88.430  -5.217  -19.484 1.00 1.66 ? 100 TYR A HE2    3  
ATOM 7912  H HH     . TYR C 3 91 ? -86.536  -4.493  -20.477 1.00 1.55 ? 100 TYR A HH     3  
ATOM 7913  N N      . VAL C 3 92 ? -93.285  -1.851  -15.311 1.00 0.77 ? 101 VAL A N      3  
ATOM 7914  C CA     . VAL C 3 92 ? -94.630  -1.540  -14.723 1.00 0.79 ? 101 VAL A CA     3  
ATOM 7915  C C      . VAL C 3 92 ? -94.483  -0.587  -13.528 1.00 0.73 ? 101 VAL A C      3  
ATOM 7916  O O      . VAL C 3 92 ? -93.785  -0.856  -12.564 1.00 0.76 ? 101 VAL A O      3  
ATOM 7917  C CB     . VAL C 3 92 ? -95.311  -2.841  -14.279 1.00 0.90 ? 101 VAL A CB     3  
ATOM 7918  C CG1    . VAL C 3 92 ? -95.874  -3.570  -15.507 1.00 1.07 ? 101 VAL A CG1    3  
ATOM 7919  C CG2    . VAL C 3 92 ? -94.285  -3.748  -13.591 1.00 1.14 ? 101 VAL A CG2    3  
ATOM 7920  H H      . VAL C 3 92 ? -92.748  -2.584  -14.943 1.00 0.80 ? 101 VAL A H      3  
ATOM 7921  H HA     . VAL C 3 92 ? -95.249  -1.059  -15.472 1.00 0.79 ? 101 VAL A HA     3  
ATOM 7922  H HB     . VAL C 3 92 ? -96.116  -2.616  -13.594 1.00 1.17 ? 101 VAL A HB     3  
ATOM 7923  H HG11   . VAL C 3 92 ? -95.082  -3.726  -16.223 1.00 1.49 ? 101 VAL A HG11   3  
ATOM 7924  H HG12   . VAL C 3 92 ? -96.278  -4.526  -15.206 1.00 1.48 ? 101 VAL A HG12   3  
ATOM 7925  H HG13   . VAL C 3 92 ? -96.656  -2.975  -15.957 1.00 1.63 ? 101 VAL A HG13   3  
ATOM 7926  H HG21   . VAL C 3 92 ? -93.650  -3.159  -12.946 1.00 1.63 ? 101 VAL A HG21   3  
ATOM 7927  H HG22   . VAL C 3 92 ? -94.799  -4.498  -13.007 1.00 1.56 ? 101 VAL A HG22   3  
ATOM 7928  H HG23   . VAL C 3 92 ? -93.679  -4.232  -14.340 1.00 1.56 ? 101 VAL A HG23   3  
ATOM 7929  N N      . TYR C 3 93 ? -95.154  0.533   -13.603 1.00 0.69 ? 102 TYR A N      3  
ATOM 7930  C CA     . TYR C 3 93 ? -95.103  1.555   -12.516 1.00 0.67 ? 102 TYR A CA     3  
ATOM 7931  C C      . TYR C 3 93 ? -96.498  1.749   -11.924 1.00 0.68 ? 102 TYR A C      3  
ATOM 7932  O O      . TYR C 3 93 ? -97.498  1.516   -12.572 1.00 0.73 ? 102 TYR A O      3  
ATOM 7933  C CB     . TYR C 3 93 ? -94.655  2.888   -13.115 1.00 0.69 ? 102 TYR A CB     3  
ATOM 7934  C CG     . TYR C 3 93 ? -93.175  2.871   -13.403 1.00 0.76 ? 102 TYR A CG     3  
ATOM 7935  C CD1    . TYR C 3 93 ? -92.670  2.239   -14.551 1.00 0.84 ? 102 TYR A CD1    3  
ATOM 7936  C CD2    . TYR C 3 93 ? -92.304  3.519   -12.524 1.00 1.09 ? 102 TYR A CD2    3  
ATOM 7937  C CE1    . TYR C 3 93 ? -91.290  2.264   -14.808 1.00 0.91 ? 102 TYR A CE1    3  
ATOM 7938  C CE2    . TYR C 3 93 ? -90.937  3.537   -12.779 1.00 1.23 ? 102 TYR A CE2    3  
ATOM 7939  C CZ     . TYR C 3 93 ? -90.426  2.914   -13.918 1.00 1.01 ? 102 TYR A CZ     3  
ATOM 7940  O OH     . TYR C 3 93 ? -89.072  2.945   -14.163 1.00 1.16 ? 102 TYR A OH     3  
ATOM 7941  H H      . TYR C 3 93 ? -95.703  0.708   -14.395 1.00 0.71 ? 102 TYR A H      3  
ATOM 7942  H HA     . TYR C 3 93 ? -94.410  1.254   -11.741 1.00 0.70 ? 102 TYR A HA     3  
ATOM 7943  H HB2    . TYR C 3 93 ? -95.192  3.058   -14.036 1.00 0.71 ? 102 TYR A HB2    3  
ATOM 7944  H HB3    . TYR C 3 93 ? -94.877  3.688   -12.420 1.00 0.71 ? 102 TYR A HB3    3  
ATOM 7945  H HD1    . TYR C 3 93 ? -93.339  1.733   -15.232 1.00 1.08 ? 102 TYR A HD1    3  
ATOM 7946  H HD2    . TYR C 3 93 ? -92.694  4.001   -11.640 1.00 1.37 ? 102 TYR A HD2    3  
ATOM 7947  H HE1    . TYR C 3 93 ? -90.891  1.781   -15.691 1.00 1.11 ? 102 TYR A HE1    3  
ATOM 7948  H HE2    . TYR C 3 93 ? -90.272  4.034   -12.095 1.00 1.60 ? 102 TYR A HE2    3  
ATOM 7949  H HH     . TYR C 3 93 ? -88.657  3.413   -13.434 1.00 1.41 ? 102 TYR A HH     3  
ATOM 7950  N N      . ARG C 3 94 ? -96.574  2.210   -10.708 1.00 0.68 ? 103 ARG A N      3  
ATOM 7951  C CA     . ARG C 3 94 ? -97.904  2.460   -10.082 1.00 0.73 ? 103 ARG A CA     3  
ATOM 7952  C C      . ARG C 3 94 ? -97.765  3.635   -9.135  1.00 0.74 ? 103 ARG A C      3  
ATOM 7953  O O      . ARG C 3 94 ? -96.716  3.850   -8.563  1.00 0.75 ? 103 ARG A O      3  
ATOM 7954  C CB     . ARG C 3 94 ? -98.374  1.233   -9.303  1.00 0.80 ? 103 ARG A CB     3  
ATOM 7955  C CG     . ARG C 3 94 ? -98.736  0.112   -10.274 1.00 1.30 ? 103 ARG A CG     3  
ATOM 7956  C CD     . ARG C 3 94 ? -99.329  -1.059  -9.486  1.00 1.34 ? 103 ARG A CD     3  
ATOM 7957  N NE     . ARG C 3 94 ? -98.350  -1.513  -8.454  1.00 1.78 ? 103 ARG A NE     3  
ATOM 7958  C CZ     . ARG C 3 94 ? -98.734  -2.325  -7.507  1.00 2.11 ? 103 ARG A CZ     3  
ATOM 7959  N NH1    . ARG C 3 94 ? -99.956  -2.784  -7.503  1.00 2.17 ? 103 ARG A NH1    3  
ATOM 7960  N NH2    . ARG C 3 94 ? -97.891  -2.693  -6.578  1.00 2.90 ? 103 ARG A NH2    3  
ATOM 7961  H H      . ARG C 3 94 ? -95.754  2.419   -10.209 1.00 0.66 ? 103 ARG A H      3  
ATOM 7962  H HA     . ARG C 3 94 ? -98.627  2.708   -10.844 1.00 0.76 ? 103 ARG A HA     3  
ATOM 7963  H HB2    . ARG C 3 94 ? -97.586  0.900   -8.643  1.00 1.08 ? 103 ARG A HB2    3  
ATOM 7964  H HB3    . ARG C 3 94 ? -99.245  1.494   -8.719  1.00 1.12 ? 103 ARG A HB3    3  
ATOM 7965  H HG2    . ARG C 3 94 ? -99.462  0.473   -10.986 1.00 1.92 ? 103 ARG A HG2    3  
ATOM 7966  H HG3    . ARG C 3 94 ? -97.850  -0.217  -10.797 1.00 1.77 ? 103 ARG A HG3    3  
ATOM 7967  H HD2    . ARG C 3 94 ? -100.235 -0.742  -9.000  1.00 1.66 ? 103 ARG A HD2    3  
ATOM 7968  H HD3    . ARG C 3 94 ? -99.552  -1.872  -10.163 1.00 1.81 ? 103 ARG A HD3    3  
ATOM 7969  H HE     . ARG C 3 94 ? -97.426  -1.186  -8.477  1.00 2.29 ? 103 ARG A HE     3  
ATOM 7970  H HH11   . ARG C 3 94 ? -100.593 -2.514  -8.222  1.00 2.12 ? 103 ARG A HH11   3  
ATOM 7971  H HH12   . ARG C 3 94 ? -100.255 -3.410  -6.780  1.00 2.68 ? 103 ARG A HH12   3  
ATOM 7972  H HH21   . ARG C 3 94 ? -96.950  -2.354  -6.592  1.00 3.34 ? 103 ARG A HH21   3  
ATOM 7973  H HH22   . ARG C 3 94 ? -98.187  -3.314  -5.850  1.00 3.25 ? 103 ARG A HH22   3  
ATOM 7974  N N      . PHE C 3 95 ? -98.809  4.407   -8.972  1.00 0.82 ? 104 PHE A N      3  
ATOM 7975  C CA     . PHE C 3 95 ? -98.743  5.590   -8.067  1.00 0.85 ? 104 PHE A CA     3  
ATOM 7976  C C      . PHE C 3 95 ? -99.735  5.394   -6.924  1.00 0.96 ? 104 PHE A C      3  
ATOM 7977  O O      . PHE C 3 95 ? -100.866 4.999   -7.130  1.00 1.16 ? 104 PHE A O      3  
ATOM 7978  C CB     . PHE C 3 95 ? -99.099  6.852   -8.854  1.00 0.89 ? 104 PHE A CB     3  
ATOM 7979  C CG     . PHE C 3 95 ? -98.129  7.015   -10.010 1.00 0.87 ? 104 PHE A CG     3  
ATOM 7980  C CD1    . PHE C 3 95 ? -98.216  6.166   -11.123 1.00 0.88 ? 104 PHE A CD1    3  
ATOM 7981  C CD2    . PHE C 3 95 ? -97.137  8.006   -9.969  1.00 0.97 ? 104 PHE A CD2    3  
ATOM 7982  C CE1    . PHE C 3 95 ? -97.314  6.305   -12.185 1.00 0.97 ? 104 PHE A CE1    3  
ATOM 7983  C CE2    . PHE C 3 95 ? -96.241  8.147   -11.036 1.00 1.07 ? 104 PHE A CE2    3  
ATOM 7984  C CZ     . PHE C 3 95 ? -96.328  7.295   -12.141 1.00 1.06 ? 104 PHE A CZ     3  
ATOM 7985  H H      . PHE C 3 95 ? -99.637  4.209   -9.453  1.00 0.88 ? 104 PHE A H      3  
ATOM 7986  H HA     . PHE C 3 95 ? -97.755  5.696   -7.665  1.00 0.82 ? 104 PHE A HA     3  
ATOM 7987  H HB2    . PHE C 3 95 ? -100.105 6.772   -9.231  1.00 0.95 ? 104 PHE A HB2    3  
ATOM 7988  H HB3    . PHE C 3 95 ? -99.023  7.706   -8.197  1.00 0.95 ? 104 PHE A HB3    3  
ATOM 7989  H HD1    . PHE C 3 95 ? -98.979  5.402   -11.161 1.00 0.90 ? 104 PHE A HD1    3  
ATOM 7990  H HD2    . PHE C 3 95 ? -97.071  8.666   -9.116  1.00 1.04 ? 104 PHE A HD2    3  
ATOM 7991  H HE1    . PHE C 3 95 ? -97.378  5.650   -13.041 1.00 1.05 ? 104 PHE A HE1    3  
ATOM 7992  H HE2    . PHE C 3 95 ? -95.481  8.915   -11.007 1.00 1.21 ? 104 PHE A HE2    3  
ATOM 7993  H HZ     . PHE C 3 95 ? -95.630  7.401   -12.959 1.00 1.18 ? 104 PHE A HZ     3  
ATOM 7994  N N      . VAL C 3 96 ? -99.303  5.643   -5.712  1.00 0.95 ? 105 VAL A N      3  
ATOM 7995  C CA     . VAL C 3 96 ? -100.188 5.458   -4.522  1.00 1.08 ? 105 VAL A CA     3  
ATOM 7996  C C      . VAL C 3 96 ? -100.385 6.797   -3.807  1.00 1.23 ? 105 VAL A C      3  
ATOM 7997  O O      . VAL C 3 96 ? -99.449  7.584   -3.801  1.00 1.69 ? 105 VAL A O      3  
ATOM 7998  C CB     . VAL C 3 96 ? -99.519  4.457   -3.578  1.00 1.25 ? 105 VAL A CB     3  
ATOM 7999  C CG1    . VAL C 3 96 ? -98.281  5.089   -2.940  1.00 1.20 ? 105 VAL A CG1    3  
ATOM 8000  C CG2    . VAL C 3 96 ? -100.500 4.055   -2.486  1.00 1.98 ? 105 VAL A CG2    3  
ATOM 8001  O OXT    . VAL C 3 96 ? -101.466 7.013   -3.282  1.00 1.75 ? 105 VAL A OXT    3  
ATOM 8002  H H      . VAL C 3 96 ? -98.380  5.940   -5.582  1.00 0.95 ? 105 VAL A H      3  
ATOM 8003  H HA     . VAL C 3 96 ? -101.151 5.069   -4.825  1.00 1.15 ? 105 VAL A HA     3  
ATOM 8004  H HB     . VAL C 3 96 ? -99.221  3.580   -4.137  1.00 1.77 ? 105 VAL A HB     3  
ATOM 8005  H HG11   . VAL C 3 96 ? -97.715  5.609   -3.696  1.00 1.68 ? 105 VAL A HG11   3  
ATOM 8006  H HG12   . VAL C 3 96 ? -98.583  5.789   -2.175  1.00 1.63 ? 105 VAL A HG12   3  
ATOM 8007  H HG13   . VAL C 3 96 ? -97.671  4.316   -2.500  1.00 1.63 ? 105 VAL A HG13   3  
ATOM 8008  H HG21   . VAL C 3 96 ? -100.819 4.934   -1.949  1.00 2.31 ? 105 VAL A HG21   3  
ATOM 8009  H HG22   . VAL C 3 96 ? -101.354 3.574   -2.936  1.00 2.56 ? 105 VAL A HG22   3  
ATOM 8010  H HG23   . VAL C 3 96 ? -100.014 3.371   -1.804  1.00 2.44 ? 105 VAL A HG23   3  
ATOM 8011  O "O5'"  . DT  A 1 1  ? -71.715  -19.419 -21.311 1.00 1.83 ? 1   DT  B "O5'"  4  
ATOM 8012  C "C5'"  . DT  A 1 1  ? -71.304  -19.965 -22.567 1.00 1.89 ? 1   DT  B "C5'"  4  
ATOM 8013  C "C4'"  . DT  A 1 1  ? -71.787  -19.112 -23.744 1.00 1.80 ? 1   DT  B "C4'"  4  
ATOM 8014  O "O4'"  . DT  A 1 1  ? -73.176  -19.408 -24.022 1.00 1.79 ? 1   DT  B "O4'"  4  
ATOM 8015  C "C3'"  . DT  A 1 1  ? -71.671  -17.610 -23.457 1.00 1.66 ? 1   DT  B "C3'"  4  
ATOM 8016  O "O3'"  . DT  A 1 1  ? -70.941  -16.952 -24.496 1.00 1.67 ? 1   DT  B "O3'"  4  
ATOM 8017  C "C2'"  . DT  A 1 1  ? -73.088  -17.089 -23.424 1.00 1.56 ? 1   DT  B "C2'"  4  
ATOM 8018  C "C1'"  . DT  A 1 1  ? -73.999  -18.238 -23.841 1.00 1.64 ? 1   DT  B "C1'"  4  
ATOM 8019  N N1     . DT  A 1 1  ? -75.041  -18.480 -22.801 1.00 1.61 ? 1   DT  B N1     4  
ATOM 8020  C C2     . DT  A 1 1  ? -76.373  -18.307 -23.157 1.00 1.58 ? 1   DT  B C2     4  
ATOM 8021  O O2     . DT  A 1 1  ? -76.706  -17.973 -24.292 1.00 1.58 ? 1   DT  B O2     4  
ATOM 8022  N N3     . DT  A 1 1  ? -77.304  -18.538 -22.163 1.00 1.57 ? 1   DT  B N3     4  
ATOM 8023  C C4     . DT  A 1 1  ? -77.033  -18.921 -20.860 1.00 1.61 ? 1   DT  B C4     4  
ATOM 8024  O O4     . DT  A 1 1  ? -77.944  -19.094 -20.055 1.00 1.63 ? 1   DT  B O4     4  
ATOM 8025  C C5     . DT  A 1 1  ? -75.622  -19.077 -20.575 1.00 1.64 ? 1   DT  B C5     4  
ATOM 8026  C C7     . DT  A 1 1  ? -75.184  -19.491 -19.168 1.00 1.70 ? 1   DT  B C7     4  
ATOM 8027  C C6     . DT  A 1 1  ? -74.690  -18.857 -21.529 1.00 1.64 ? 1   DT  B C6     4  
ATOM 8028  H "H5'"  . DT  A 1 1  ? -71.709  -20.972 -22.667 1.00 2.00 ? 1   DT  B "H5'"  4  
ATOM 8029  H "H5''" . DT  A 1 1  ? -70.216  -20.016 -22.590 1.00 1.93 ? 1   DT  B "H5''" 4  
ATOM 8030  H "H4'"  . DT  A 1 1  ? -71.190  -19.351 -24.623 1.00 1.87 ? 1   DT  B "H4'"  4  
ATOM 8031  H "H3'"  . DT  A 1 1  ? -71.181  -17.433 -22.495 1.00 1.66 ? 1   DT  B "H3'"  4  
ATOM 8032  H "H2'"  . DT  A 1 1  ? -73.347  -16.762 -22.418 1.00 1.50 ? 1   DT  B "H2'"  4  
ATOM 8033  H "H2''" . DT  A 1 1  ? -73.188  -16.253 -24.122 1.00 1.50 ? 1   DT  B "H2''" 4  
ATOM 8034  H "H1'"  . DT  A 1 1  ? -74.472  -17.994 -24.797 1.00 1.64 ? 1   DT  B "H1'"  4  
ATOM 8035  H H3     . DT  A 1 1  ? -78.276  -18.419 -22.411 1.00 1.57 ? 1   DT  B H3     4  
ATOM 8036  H H71    . DT  A 1 1  ? -75.972  -19.246 -18.454 1.00 1.80 ? 1   DT  B H71    4  
ATOM 8037  H H72    . DT  A 1 1  ? -74.272  -18.959 -18.899 1.00 2.13 ? 1   DT  B H72    4  
ATOM 8038  H H73    . DT  A 1 1  ? -74.997  -20.565 -19.147 1.00 2.05 ? 1   DT  B H73    4  
ATOM 8039  H H6     . DT  A 1 1  ? -73.636  -18.982 -21.284 1.00 1.68 ? 1   DT  B H6     4  
ATOM 8040  H "HO5'" . DT  A 1 1  ? -71.120  -19.768 -20.641 1.00 1.92 ? 1   DT  B "HO5'" 4  
ATOM 8041  P P      . DC  A 1 2  ? -70.635  -15.373 -24.405 1.00 1.58 ? 2   DC  B P      4  
ATOM 8042  O OP1    . DC  A 1 2  ? -69.555  -15.059 -25.368 1.00 1.68 ? 2   DC  B OP1    4  
ATOM 8043  O OP2    . DC  A 1 2  ? -70.475  -15.014 -22.978 1.00 1.55 ? 2   DC  B OP2    4  
ATOM 8044  O "O5'"  . DC  A 1 2  ? -72.006  -14.711 -24.944 1.00 1.47 ? 2   DC  B "O5'"  4  
ATOM 8045  C "C5'"  . DC  A 1 2  ? -72.178  -14.455 -26.341 1.00 1.50 ? 2   DC  B "C5'"  4  
ATOM 8046  C "C4'"  . DC  A 1 2  ? -73.364  -13.523 -26.634 1.00 1.41 ? 2   DC  B "C4'"  4  
ATOM 8047  O "O4'"  . DC  A 1 2  ? -74.575  -14.095 -26.083 1.00 1.38 ? 2   DC  B "O4'"  4  
ATOM 8048  C "C3'"  . DC  A 1 2  ? -73.184  -12.121 -26.028 1.00 1.31 ? 2   DC  B "C3'"  4  
ATOM 8049  O "O3'"  . DC  A 1 2  ? -73.320  -11.106 -27.026 1.00 1.32 ? 2   DC  B "O3'"  4  
ATOM 8050  C "C2'"  . DC  A 1 2  ? -74.303  -11.963 -25.023 1.00 1.21 ? 2   DC  B "C2'"  4  
ATOM 8051  C "C1'"  . DC  A 1 2  ? -75.259  -13.135 -25.251 1.00 1.25 ? 2   DC  B "C1'"  4  
ATOM 8052  N N1     . DC  A 1 2  ? -75.698  -13.759 -23.963 1.00 1.21 ? 2   DC  B N1     4  
ATOM 8053  C C2     . DC  A 1 2  ? -77.067  -13.851 -23.715 1.00 1.17 ? 2   DC  B C2     4  
ATOM 8054  O O2     . DC  A 1 2  ? -77.871  -13.418 -24.539 1.00 1.17 ? 2   DC  B O2     4  
ATOM 8055  N N3     . DC  A 1 2  ? -77.480  -14.428 -22.552 1.00 1.17 ? 2   DC  B N3     4  
ATOM 8056  C C4     . DC  A 1 2  ? -76.594  -14.896 -21.664 1.00 1.21 ? 2   DC  B C4     4  
ATOM 8057  N N4     . DC  A 1 2  ? -77.024  -15.460 -20.535 1.00 1.25 ? 2   DC  B N4     4  
ATOM 8058  C C5     . DC  A 1 2  ? -75.192  -14.802 -21.907 1.00 1.24 ? 2   DC  B C5     4  
ATOM 8059  C C6     . DC  A 1 2  ? -74.788  -14.234 -23.059 1.00 1.24 ? 2   DC  B C6     4  
ATOM 8060  H "H5'"  . DC  A 1 2  ? -72.346  -15.404 -26.852 1.00 1.62 ? 2   DC  B "H5'"  4  
ATOM 8061  H "H5''" . DC  A 1 2  ? -71.267  -14.000 -26.731 1.00 1.58 ? 2   DC  B "H5''" 4  
ATOM 8062  H "H4'"  . DC  A 1 2  ? -73.479  -13.428 -27.713 1.00 1.47 ? 2   DC  B "H4'"  4  
ATOM 8063  H "H3'"  . DC  A 1 2  ? -72.211  -12.025 -25.538 1.00 1.33 ? 2   DC  B "H3'"  4  
ATOM 8064  H "H2'"  . DC  A 1 2  ? -73.906  -11.981 -24.007 1.00 1.18 ? 2   DC  B "H2'"  4  
ATOM 8065  H "H2''" . DC  A 1 2  ? -74.819  -11.017 -25.196 1.00 1.17 ? 2   DC  B "H2''" 4  
ATOM 8066  H "H1'"  . DC  A 1 2  ? -76.135  -12.772 -25.801 1.00 1.24 ? 2   DC  B "H1'"  4  
ATOM 8067  H H41    . DC  A 1 2  ? -78.016  -15.534 -20.350 1.00 1.24 ? 2   DC  B H41    4  
ATOM 8068  H H42    . DC  A 1 2  ? -76.359  -15.811 -19.862 1.00 1.29 ? 2   DC  B H42    4  
ATOM 8069  H H5     . DC  A 1 2  ? -74.472  -15.174 -21.179 1.00 1.29 ? 2   DC  B H5     4  
ATOM 8070  H H6     . DC  A 1 2  ? -73.723  -14.151 -23.271 1.00 1.28 ? 2   DC  B H6     4  
ATOM 8071  P P      . DG  A 1 3  ? -73.049  -9.568  -26.634 1.00 1.27 ? 3   DG  B P      4  
ATOM 8072  O OP1    . DG  A 1 3  ? -72.367  -8.909  -27.769 1.00 1.42 ? 3   DG  B OP1    4  
ATOM 8073  O OP2    . DG  A 1 3  ? -72.433  -9.547  -25.289 1.00 1.23 ? 3   DG  B OP2    4  
ATOM 8074  O "O5'"  . DG  A 1 3  ? -74.536  -8.957  -26.516 1.00 1.15 ? 3   DG  B "O5'"  4  
ATOM 8075  C "C5'"  . DG  A 1 3  ? -75.246  -8.535  -27.684 1.00 1.23 ? 3   DG  B "C5'"  4  
ATOM 8076  C "C4'"  . DG  A 1 3  ? -76.598  -7.898  -27.329 1.00 1.13 ? 3   DG  B "C4'"  4  
ATOM 8077  O "O4'"  . DG  A 1 3  ? -77.256  -8.694  -26.318 1.00 1.06 ? 3   DG  B "O4'"  4  
ATOM 8078  C "C3'"  . DG  A 1 3  ? -76.450  -6.464  -26.782 1.00 1.07 ? 3   DG  B "C3'"  4  
ATOM 8079  O "O3'"  . DG  A 1 3  ? -77.321  -5.553  -27.467 1.00 1.13 ? 3   DG  B "O3'"  4  
ATOM 8080  C "C2'"  . DG  A 1 3  ? -76.830  -6.551  -25.319 1.00 0.93 ? 3   DG  B "C2'"  4  
ATOM 8081  C "C1'"  . DG  A 1 3  ? -77.435  -7.934  -25.103 1.00 0.93 ? 3   DG  B "C1'"  4  
ATOM 8082  N N9     . DG  A 1 3  ? -76.795  -8.619  -23.959 1.00 0.86 ? 3   DG  B N9     4  
ATOM 8083  C C8     . DG  A 1 3  ? -75.470  -8.866  -23.735 1.00 0.87 ? 3   DG  B C8     4  
ATOM 8084  N N7     . DG  A 1 3  ? -75.205  -9.494  -22.626 1.00 0.84 ? 3   DG  B N7     4  
ATOM 8085  C C5     . DG  A 1 3  ? -76.464  -9.683  -22.058 1.00 0.79 ? 3   DG  B C5     4  
ATOM 8086  C C6     . DG  A 1 3  ? -76.828  -10.313 -20.833 1.00 0.76 ? 3   DG  B C6     4  
ATOM 8087  O O6     . DG  A 1 3  ? -76.096  -10.830 -19.991 1.00 0.77 ? 3   DG  B O6     4  
ATOM 8088  N N1     . DG  A 1 3  ? -78.203  -10.289 -20.640 1.00 0.76 ? 3   DG  B N1     4  
ATOM 8089  C C2     . DG  A 1 3  ? -79.116  -9.729  -21.508 1.00 0.79 ? 3   DG  B C2     4  
ATOM 8090  N N2     . DG  A 1 3  ? -80.395  -9.794  -21.140 1.00 0.83 ? 3   DG  B N2     4  
ATOM 8091  N N3     . DG  A 1 3  ? -78.780  -9.137  -22.657 1.00 0.81 ? 3   DG  B N3     4  
ATOM 8092  C C4     . DG  A 1 3  ? -77.443  -9.149  -22.867 1.00 0.80 ? 3   DG  B C4     4  
ATOM 8093  H "H5'"  . DG  A 1 3  ? -75.418  -9.402  -28.322 1.00 1.32 ? 3   DG  B "H5'"  4  
ATOM 8094  H "H5''" . DG  A 1 3  ? -74.638  -7.812  -28.229 1.00 1.34 ? 3   DG  B "H5''" 4  
ATOM 8095  H "H4'"  . DG  A 1 3  ? -77.225  -7.878  -28.222 1.00 1.19 ? 3   DG  B "H4'"  4  
ATOM 8096  H "H3'"  . DG  A 1 3  ? -75.420  -6.113  -26.881 1.00 1.13 ? 3   DG  B "H3'"  4  
ATOM 8097  H "H2'"  . DG  A 1 3  ? -75.944  -6.434  -24.689 1.00 0.91 ? 3   DG  B "H2'"  4  
ATOM 8098  H "H2''" . DG  A 1 3  ? -77.559  -5.773  -25.078 1.00 0.92 ? 3   DG  B "H2''" 4  
ATOM 8099  H "H1'"  . DG  A 1 3  ? -78.506  -7.837  -24.905 1.00 0.92 ? 3   DG  B "H1'"  4  
ATOM 8100  H H8     . DG  A 1 3  ? -74.692  -8.564  -24.434 1.00 0.94 ? 3   DG  B H8     4  
ATOM 8101  H H1     . DG  A 1 3  ? -78.539  -10.722 -19.792 1.00 0.77 ? 3   DG  B H1     4  
ATOM 8102  H H21    . DG  A 1 3  ? -80.649  -10.242 -20.271 1.00 0.84 ? 3   DG  B H21    4  
ATOM 8103  H H22    . DG  A 1 3  ? -81.112  -9.396  -21.730 1.00 0.87 ? 3   DG  B H22    4  
ATOM 8104  P P      . DA  A 1 4  ? -77.316  -3.979  -27.099 1.00 1.15 ? 4   DA  B P      4  
ATOM 8105  O OP1    . DA  A 1 4  ? -77.901  -3.234  -28.238 1.00 1.30 ? 4   DA  B OP1    4  
ATOM 8106  O OP2    . DA  A 1 4  ? -75.971  -3.622  -26.597 1.00 1.15 ? 4   DA  B OP2    4  
ATOM 8107  O "O5'"  . DA  A 1 4  ? -78.352  -3.898  -25.869 1.00 1.04 ? 4   DA  B "O5'"  4  
ATOM 8108  C "C5'"  . DA  A 1 4  ? -79.684  -4.381  -26.036 1.00 1.09 ? 4   DA  B "C5'"  4  
ATOM 8109  C "C4'"  . DA  A 1 4  ? -80.578  -4.052  -24.840 1.00 1.02 ? 4   DA  B "C4'"  4  
ATOM 8110  O "O4'"  . DA  A 1 4  ? -80.337  -5.004  -23.784 1.00 0.95 ? 4   DA  B "O4'"  4  
ATOM 8111  C "C3'"  . DA  A 1 4  ? -80.323  -2.644  -24.280 1.00 1.01 ? 4   DA  B "C3'"  4  
ATOM 8112  O "O3'"  . DA  A 1 4  ? -81.545  -1.907  -24.186 1.00 1.07 ? 4   DA  B "O3'"  4  
ATOM 8113  C "C2'"  . DA  A 1 4  ? -79.764  -2.857  -22.894 1.00 0.92 ? 4   DA  B "C2'"  4  
ATOM 8114  C "C1'"  . DA  A 1 4  ? -79.986  -4.326  -22.563 1.00 0.87 ? 4   DA  B "C1'"  4  
ATOM 8115  N N9     . DA  A 1 4  ? -78.786  -4.932  -21.950 1.00 0.78 ? 4   DA  B N9     4  
ATOM 8116  C C8     . DA  A 1 4  ? -77.483  -4.892  -22.359 1.00 0.79 ? 4   DA  B C8     4  
ATOM 8117  N N7     . DA  A 1 4  ? -76.647  -5.538  -21.600 1.00 0.74 ? 4   DA  B N7     4  
ATOM 8118  C C5     . DA  A 1 4  ? -77.466  -6.052  -20.596 1.00 0.68 ? 4   DA  B C5     4  
ATOM 8119  C C6     . DA  A 1 4  ? -77.205  -6.839  -19.463 1.00 0.65 ? 4   DA  B C6     4  
ATOM 8120  N N6     . DA  A 1 4  ? -75.984  -7.259  -19.128 1.00 0.65 ? 4   DA  B N6     4  
ATOM 8121  N N1     . DA  A 1 4  ? -78.250  -7.166  -18.685 1.00 0.67 ? 4   DA  B N1     4  
ATOM 8122  C C2     . DA  A 1 4  ? -79.476  -6.747  -18.996 1.00 0.73 ? 4   DA  B C2     4  
ATOM 8123  N N3     . DA  A 1 4  ? -79.831  -6.002  -20.036 1.00 0.76 ? 4   DA  B N3     4  
ATOM 8124  C C4     . DA  A 1 4  ? -78.766  -5.689  -20.801 1.00 0.73 ? 4   DA  B C4     4  
ATOM 8125  H "H5'"  . DA  A 1 4  ? -79.652  -5.462  -26.169 1.00 1.15 ? 4   DA  B "H5'"  4  
ATOM 8126  H "H5''" . DA  A 1 4  ? -80.111  -3.930  -26.928 1.00 1.22 ? 4   DA  B "H5''" 4  
ATOM 8127  H "H4'"  . DA  A 1 4  ? -81.620  -4.127  -25.149 1.00 1.08 ? 4   DA  B "H4'"  4  
ATOM 8128  H "H3'"  . DA  A 1 4  ? -79.608  -2.094  -24.900 1.00 1.06 ? 4   DA  B "H3'"  4  
ATOM 8129  H "H2'"  . DA  A 1 4  ? -78.698  -2.619  -22.869 1.00 0.92 ? 4   DA  B "H2'"  4  
ATOM 8130  H "H2''" . DA  A 1 4  ? -80.298  -2.227  -22.182 1.00 0.95 ? 4   DA  B "H2''" 4  
ATOM 8131  H "H1'"  . DA  A 1 4  ? -80.822  -4.415  -21.870 1.00 0.88 ? 4   DA  B "H1'"  4  
ATOM 8132  H H8     . DA  A 1 4  ? -77.168  -4.358  -23.255 1.00 0.86 ? 4   DA  B H8     4  
ATOM 8133  H H61    . DA  A 1 4  ? -75.856  -7.821  -18.297 1.00 0.65 ? 4   DA  B H61    4  
ATOM 8134  H H62    . DA  A 1 4  ? -75.188  -7.014  -19.699 1.00 0.68 ? 4   DA  B H62    4  
ATOM 8135  H H2     . DA  A 1 4  ? -80.276  -7.049  -18.320 1.00 0.80 ? 4   DA  B H2     4  
ATOM 8136  P P      . DG  A 1 5  ? -81.541  -0.387  -23.649 1.00 1.10 ? 5   DG  B P      4  
ATOM 8137  O OP1    . DG  A 1 5  ? -82.545  0.377   -24.421 1.00 1.25 ? 5   DG  B OP1    4  
ATOM 8138  O OP2    . DG  A 1 5  ? -80.136  0.078   -23.603 1.00 1.13 ? 5   DG  B OP2    4  
ATOM 8139  O "O5'"  . DG  A 1 5  ? -82.066  -0.534  -22.128 1.00 1.01 ? 5   DG  B "O5'"  4  
ATOM 8140  C "C5'"  . DG  A 1 5  ? -83.417  -0.915  -21.857 1.00 1.03 ? 5   DG  B "C5'"  4  
ATOM 8141  C "C4'"  . DG  A 1 5  ? -83.571  -1.544  -20.465 1.00 0.95 ? 5   DG  B "C4'"  4  
ATOM 8142  O "O4'"  . DG  A 1 5  ? -82.466  -2.450  -20.215 1.00 0.89 ? 5   DG  B "O4'"  4  
ATOM 8143  C "C3'"  . DG  A 1 5  ? -83.589  -0.500  -19.332 1.00 0.96 ? 5   DG  B "C3'"  4  
ATOM 8144  O "O3'"  . DG  A 1 5  ? -84.738  -0.686  -18.497 1.00 1.02 ? 5   DG  B "O3'"  4  
ATOM 8145  C "C2'"  . DG  A 1 5  ? -82.332  -0.769  -18.535 1.00 0.90 ? 5   DG  B "C2'"  4  
ATOM 8146  C "C1'"  . DG  A 1 5  ? -81.851  -2.144  -18.948 1.00 0.84 ? 5   DG  B "C1'"  4  
ATOM 8147  N N9     . DG  A 1 5  ? -80.376  -2.180  -19.020 1.00 0.79 ? 5   DG  B N9     4  
ATOM 8148  C C8     . DG  A 1 5  ? -79.527  -1.438  -19.789 1.00 0.82 ? 5   DG  B C8     4  
ATOM 8149  N N7     . DG  A 1 5  ? -78.262  -1.694  -19.621 1.00 0.79 ? 5   DG  B N7     4  
ATOM 8150  C C5     . DG  A 1 5  ? -78.267  -2.698  -18.652 1.00 0.72 ? 5   DG  B C5     4  
ATOM 8151  C C6     . DG  A 1 5  ? -77.182  -3.393  -18.047 1.00 0.69 ? 5   DG  B C6     4  
ATOM 8152  O O6     . DG  A 1 5  ? -75.978  -3.259  -18.256 1.00 0.70 ? 5   DG  B O6     4  
ATOM 8153  N N1     . DG  A 1 5  ? -77.630  -4.325  -17.116 1.00 0.67 ? 5   DG  B N1     4  
ATOM 8154  C C2     . DG  A 1 5  ? -78.953  -4.562  -16.805 1.00 0.70 ? 5   DG  B C2     4  
ATOM 8155  N N2     . DG  A 1 5  ? -79.190  -5.500  -15.888 1.00 0.73 ? 5   DG  B N2     4  
ATOM 8156  N N3     . DG  A 1 5  ? -79.970  -3.911  -17.371 1.00 0.73 ? 5   DG  B N3     4  
ATOM 8157  C C4     . DG  A 1 5  ? -79.557  -2.999  -18.280 1.00 0.73 ? 5   DG  B C4     4  
ATOM 8158  H "H5'"  . DG  A 1 5  ? -83.731  -1.643  -22.605 1.00 1.09 ? 5   DG  B "H5'"  4  
ATOM 8159  H "H5''" . DG  A 1 5  ? -84.060  -0.037  -21.928 1.00 1.10 ? 5   DG  B "H5''" 4  
ATOM 8160  H "H4'"  . DG  A 1 5  ? -84.505  -2.106  -20.436 1.00 0.99 ? 5   DG  B "H4'"  4  
ATOM 8161  H "H3'"  . DG  A 1 5  ? -83.581  0.521   -19.724 1.00 1.03 ? 5   DG  B "H3'"  4  
ATOM 8162  H "H2'"  . DG  A 1 5  ? -81.569  -0.024  -18.765 1.00 0.93 ? 5   DG  B "H2'"  4  
ATOM 8163  H "H2''" . DG  A 1 5  ? -82.553  -0.757  -17.477 1.00 0.93 ? 5   DG  B "H2''" 4  
ATOM 8164  H "H1'"  . DG  A 1 5  ? -82.186  -2.881  -18.213 1.00 0.82 ? 5   DG  B "H1'"  4  
ATOM 8165  H H8     . DG  A 1 5  ? -79.883  -0.680  -20.487 1.00 0.88 ? 5   DG  B H8     4  
ATOM 8166  H H1     . DG  A 1 5  ? -76.919  -4.860  -16.643 1.00 0.66 ? 5   DG  B H1     4  
ATOM 8167  H H21    . DG  A 1 5  ? -78.422  -5.994  -15.457 1.00 0.73 ? 5   DG  B H21    4  
ATOM 8168  H H22    . DG  A 1 5  ? -80.142  -5.717  -15.624 1.00 0.79 ? 5   DG  B H22    4  
ATOM 8169  P P      . DC  A 1 6  ? -84.982  0.234   -17.192 1.00 1.10 ? 6   DC  B P      4  
ATOM 8170  O OP1    . DC  A 1 6  ? -86.437  0.286   -16.925 1.00 1.23 ? 6   DC  B OP1    4  
ATOM 8171  O OP2    . DC  A 1 6  ? -84.213  1.486   -17.355 1.00 1.16 ? 6   DC  B OP2    4  
ATOM 8172  O "O5'"  . DC  A 1 6  ? -84.280  -0.621  -16.020 1.00 1.03 ? 6   DC  B "O5'"  4  
ATOM 8173  C "C5'"  . DC  A 1 6  ? -84.530  -2.022  -15.891 1.00 1.10 ? 6   DC  B "C5'"  4  
ATOM 8174  C "C4'"  . DC  A 1 6  ? -84.187  -2.533  -14.482 1.00 1.07 ? 6   DC  B "C4'"  4  
ATOM 8175  O "O4'"  . DC  A 1 6  ? -82.862  -3.101  -14.472 1.00 1.09 ? 6   DC  B "O4'"  4  
ATOM 8176  C "C3'"  . DC  A 1 6  ? -84.237  -1.420  -13.429 1.00 1.06 ? 6   DC  B "C3'"  4  
ATOM 8177  O "O3'"  . DC  A 1 6  ? -85.124  -1.788  -12.375 1.00 1.11 ? 6   DC  B "O3'"  4  
ATOM 8178  C "C2'"  . DC  A 1 6  ? -82.826  -1.290  -12.892 1.00 1.06 ? 6   DC  B "C2'"  4  
ATOM 8179  C "C1'"  . DC  A 1 6  ? -81.997  -2.385  -13.566 1.00 1.04 ? 6   DC  B "C1'"  4  
ATOM 8180  N N1     . DC  A 1 6  ? -80.832  -1.831  -14.318 1.00 1.00 ? 6   DC  B N1     4  
ATOM 8181  C C2     . DC  A 1 6  ? -79.585  -2.408  -14.099 1.00 0.99 ? 6   DC  B C2     4  
ATOM 8182  O O2     . DC  A 1 6  ? -79.468  -3.322  -13.289 1.00 1.02 ? 6   DC  B O2     4  
ATOM 8183  N N3     . DC  A 1 6  ? -78.520  -1.941  -14.800 1.00 0.99 ? 6   DC  B N3     4  
ATOM 8184  C C4     . DC  A 1 6  ? -78.658  -0.948  -15.682 1.00 1.00 ? 6   DC  B C4     4  
ATOM 8185  N N4     . DC  A 1 6  ? -77.584  -0.511  -16.340 1.00 1.03 ? 6   DC  B N4     4  
ATOM 8186  C C5     . DC  A 1 6  ? -79.935  -0.344  -15.917 1.00 1.01 ? 6   DC  B C5     4  
ATOM 8187  C C6     . DC  A 1 6  ? -80.988  -0.811  -15.215 1.00 1.01 ? 6   DC  B C6     4  
ATOM 8188  H "H5'"  . DC  A 1 6  ? -83.921  -2.558  -16.619 1.00 1.21 ? 6   DC  B "H5'"  4  
ATOM 8189  H "H5''" . DC  A 1 6  ? -85.584  -2.214  -16.101 1.00 1.26 ? 6   DC  B "H5''" 4  
ATOM 8190  H "H4'"  . DC  A 1 6  ? -84.901  -3.309  -14.202 1.00 1.11 ? 6   DC  B "H4'"  4  
ATOM 8191  H "H3'"  . DC  A 1 6  ? -84.563  -0.474  -13.870 1.00 1.07 ? 6   DC  B "H3'"  4  
ATOM 8192  H "H2'"  . DC  A 1 6  ? -82.421  -0.306  -13.114 1.00 1.07 ? 6   DC  B "H2'"  4  
ATOM 8193  H "H2''" . DC  A 1 6  ? -82.836  -1.438  -11.809 1.00 1.11 ? 6   DC  B "H2''" 4  
ATOM 8194  H "H1'"  . DC  A 1 6  ? -81.644  -3.085  -12.802 1.00 1.06 ? 6   DC  B "H1'"  4  
ATOM 8195  H H41    . DC  A 1 6  ? -76.685  -0.939  -16.175 1.00 1.05 ? 6   DC  B H41    4  
ATOM 8196  H H42    . DC  A 1 6  ? -77.671  0.244   -17.004 1.00 1.05 ? 6   DC  B H42    4  
ATOM 8197  H H5     . DC  A 1 6  ? -80.055  0.455   -16.646 1.00 1.04 ? 6   DC  B H5     4  
ATOM 8198  H H6     . DC  A 1 6  ? -81.969  -0.362  -15.353 1.00 1.05 ? 6   DC  B H6     4  
ATOM 8199  P P      . DC  A 1 7  ? -85.653  -0.695  -11.324 1.00 1.17 ? 7   DC  B P      4  
ATOM 8200  O OP1    . DC  A 1 7  ? -86.712  -1.325  -10.508 1.00 1.38 ? 7   DC  B OP1    4  
ATOM 8201  O OP2    . DC  A 1 7  ? -85.938  0.557   -12.053 1.00 1.32 ? 7   DC  B OP2    4  
ATOM 8202  O "O5'"  . DC  A 1 7  ? -84.373  -0.468  -10.374 1.00 0.94 ? 7   DC  B "O5'"  4  
ATOM 8203  C "C5'"  . DC  A 1 7  ? -84.336  -1.130  -9.111  1.00 0.92 ? 7   DC  B "C5'"  4  
ATOM 8204  C "C4'"  . DC  A 1 7  ? -82.907  -1.256  -8.533  1.00 0.82 ? 7   DC  B "C4'"  4  
ATOM 8205  O "O4'"  . DC  A 1 7  ? -81.929  -1.237  -9.605  1.00 0.84 ? 7   DC  B "O4'"  4  
ATOM 8206  C "C3'"  . DC  A 1 7  ? -82.536  -0.121  -7.548  1.00 0.82 ? 7   DC  B "C3'"  4  
ATOM 8207  O "O3'"  . DC  A 1 7  ? -82.164  -0.659  -6.266  1.00 0.89 ? 7   DC  B "O3'"  4  
ATOM 8208  C "C2'"  . DC  A 1 7  ? -81.339  0.559   -8.178  1.00 0.86 ? 7   DC  B "C2'"  4  
ATOM 8209  C "C1'"  . DC  A 1 7  ? -80.813  -0.412  -9.220  1.00 0.87 ? 7   DC  B "C1'"  4  
ATOM 8210  N N1     . DC  A 1 7  ? -80.223  0.310   -10.383 1.00 0.93 ? 7   DC  B N1     4  
ATOM 8211  C C2     . DC  A 1 7  ? -78.835  0.310   -10.520 1.00 1.05 ? 7   DC  B C2     4  
ATOM 8212  O O2     . DC  A 1 7  ? -78.135  -0.292  -9.709  1.00 1.14 ? 7   DC  B O2     4  
ATOM 8213  N N3     . DC  A 1 7  ? -78.285  0.983   -11.567 1.00 1.15 ? 7   DC  B N3     4  
ATOM 8214  C C4     . DC  A 1 7  ? -79.052  1.630   -12.449 1.00 1.15 ? 7   DC  B C4     4  
ATOM 8215  N N4     . DC  A 1 7  ? -78.478  2.272   -13.466 1.00 1.29 ? 7   DC  B N4     4  
ATOM 8216  C C5     . DC  A 1 7  ? -80.476  1.637   -12.319 1.00 1.08 ? 7   DC  B C5     4  
ATOM 8217  C C6     . DC  A 1 7  ? -81.019  0.967   -11.278 1.00 0.96 ? 7   DC  B C6     4  
ATOM 8218  H "H5'"  . DC  A 1 7  ? -84.749  -2.133  -9.244  1.00 1.09 ? 7   DC  B "H5'"  4  
ATOM 8219  H "H5''" . DC  A 1 7  ? -84.973  -0.589  -8.413  1.00 0.96 ? 7   DC  B "H5''" 4  
ATOM 8220  H "H4'"  . DC  A 1 7  ? -82.824  -2.207  -8.015  1.00 0.89 ? 7   DC  B "H4'"  4  
ATOM 8221  H "H3'"  . DC  A 1 7  ? -83.354  0.592   -7.428  1.00 0.86 ? 7   DC  B "H3'"  4  
ATOM 8222  H "H2'"  . DC  A 1 7  ? -81.642  1.490   -8.660  1.00 0.92 ? 7   DC  B "H2'"  4  
ATOM 8223  H "H2''" . DC  A 1 7  ? -80.575  0.760   -7.426  1.00 0.94 ? 7   DC  B "H2''" 4  
ATOM 8224  H "H1'"  . DC  A 1 7  ? -80.057  -1.054  -8.757  1.00 0.95 ? 7   DC  B "H1'"  4  
ATOM 8225  H H41    . DC  A 1 7  ? -77.471  2.272   -13.558 1.00 1.39 ? 7   DC  B H41    4  
ATOM 8226  H H42    . DC  A 1 7  ? -79.046  2.761   -14.144 1.00 1.35 ? 7   DC  B H42    4  
ATOM 8227  H H5     . DC  A 1 7  ? -81.099  2.169   -13.036 1.00 1.17 ? 7   DC  B H5     4  
ATOM 8228  H H6     . DC  A 1 7  ? -82.102  0.946   -11.153 1.00 0.96 ? 7   DC  B H6     4  
ATOM 8229  P P      . DG  A 1 8  ? -81.697  0.311   -5.057  1.00 0.93 ? 8   DG  B P      4  
ATOM 8230  O OP1    . DG  A 1 8  ? -81.901  -0.406  -3.776  1.00 1.16 ? 8   DG  B OP1    4  
ATOM 8231  O OP2    . DG  A 1 8  ? -82.316  1.641   -5.260  1.00 1.05 ? 8   DG  B OP2    4  
ATOM 8232  O "O5'"  . DG  A 1 8  ? -80.108  0.454   -5.309  1.00 0.77 ? 8   DG  B "O5'"  4  
ATOM 8233  C "C5'"  . DG  A 1 8  ? -79.218  -0.650  -5.087  1.00 0.85 ? 8   DG  B "C5'"  4  
ATOM 8234  C "C4'"  . DG  A 1 8  ? -77.919  -0.202  -4.400  1.00 0.78 ? 8   DG  B "C4'"  4  
ATOM 8235  O "O4'"  . DG  A 1 8  ? -76.901  0.062   -5.396  1.00 0.76 ? 8   DG  B "O4'"  4  
ATOM 8236  C "C3'"  . DG  A 1 8  ? -78.123  1.079   -3.578  1.00 0.79 ? 8   DG  B "C3'"  4  
ATOM 8237  O "O3'"  . DG  A 1 8  ? -77.652  0.903   -2.237  1.00 0.86 ? 8   DG  B "O3'"  4  
ATOM 8238  C "C2'"  . DG  A 1 8  ? -77.310  2.145   -4.277  1.00 0.74 ? 8   DG  B "C2'"  4  
ATOM 8239  C "C1'"  . DG  A 1 8  ? -76.479  1.442   -5.345  1.00 0.71 ? 8   DG  B "C1'"  4  
ATOM 8240  N N9     . DG  A 1 8  ? -76.650  2.100   -6.658  1.00 0.69 ? 8   DG  B N9     4  
ATOM 8241  C C8     . DG  A 1 8  ? -77.801  2.412   -7.325  1.00 0.83 ? 8   DG  B C8     4  
ATOM 8242  N N7     . DG  A 1 8  ? -77.637  3.008   -8.466  1.00 0.83 ? 8   DG  B N7     4  
ATOM 8243  C C5     . DG  A 1 8  ? -76.251  3.106   -8.576  1.00 0.66 ? 8   DG  B C5     4  
ATOM 8244  C C6     . DG  A 1 8  ? -75.461  3.667   -9.611  1.00 0.64 ? 8   DG  B C6     4  
ATOM 8245  O O6     . DG  A 1 8  ? -75.837  4.198   -10.654 1.00 0.70 ? 8   DG  B O6     4  
ATOM 8246  N N1     . DG  A 1 8  ? -74.106  3.562   -9.330  1.00 0.66 ? 8   DG  B N1     4  
ATOM 8247  C C2     . DG  A 1 8  ? -73.574  2.991   -8.195  1.00 0.72 ? 8   DG  B C2     4  
ATOM 8248  N N2     . DG  A 1 8  ? -72.247  3.003   -8.097  1.00 0.93 ? 8   DG  B N2     4  
ATOM 8249  N N3     . DG  A 1 8  ? -74.314  2.460   -7.218  1.00 0.66 ? 8   DG  B N3     4  
ATOM 8250  C C4     . DG  A 1 8  ? -75.639  2.552   -7.474  1.00 0.62 ? 8   DG  B C4     4  
ATOM 8251  H "H5'"  . DG  A 1 8  ? -78.972  -1.106  -6.046  1.00 0.98 ? 8   DG  B "H5'"  4  
ATOM 8252  H "H5''" . DG  A 1 8  ? -79.718  -1.390  -4.460  1.00 1.03 ? 8   DG  B "H5''" 4  
ATOM 8253  H "H4'"  . DG  A 1 8  ? -77.567  -0.994  -3.736  1.00 0.83 ? 8   DG  B "H4'"  4  
ATOM 8254  H "H3'"  . DG  A 1 8  ? -79.179  1.364   -3.558  1.00 0.84 ? 8   DG  B "H3'"  4  
ATOM 8255  H "H2'"  . DG  A 1 8  ? -77.970  2.878   -4.743  1.00 0.75 ? 8   DG  B "H2'"  4  
ATOM 8256  H "H2''" . DG  A 1 8  ? -76.660  2.640   -3.556  1.00 0.78 ? 8   DG  B "H2''" 4  
ATOM 8257  H "H1'"  . DG  A 1 8  ? -75.424  1.478   -5.067  1.00 0.75 ? 8   DG  B "H1'"  4  
ATOM 8258  H H8     . DG  A 1 8  ? -78.787  2.183   -6.924  1.00 1.00 ? 8   DG  B H8     4  
ATOM 8259  H H1     . DG  A 1 8  ? -73.480  3.936   -10.026 1.00 0.73 ? 8   DG  B H1     4  
ATOM 8260  H H21    . DG  A 1 8  ? -71.690  3.405   -8.836  1.00 1.01 ? 8   DG  B H21    4  
ATOM 8261  H H22    . DG  A 1 8  ? -71.798  2.612   -7.281  1.00 1.04 ? 8   DG  B H22    4  
ATOM 8262  P P      . DG  A 1 9  ? -77.786  2.086   -1.150  1.00 0.95 ? 9   DG  B P      4  
ATOM 8263  O OP1    . DG  A 1 9  ? -77.586  1.501   0.195   1.00 1.13 ? 9   DG  B OP1    4  
ATOM 8264  O OP2    . DG  A 1 9  ? -79.016  2.858   -1.440  1.00 0.98 ? 9   DG  B OP2    4  
ATOM 8265  O "O5'"  . DG  A 1 9  ? -76.519  3.020   -1.485  1.00 0.87 ? 9   DG  B "O5'"  4  
ATOM 8266  C "C5'"  . DG  A 1 9  ? -75.188  2.511   -1.367  1.00 0.94 ? 9   DG  B "C5'"  4  
ATOM 8267  C "C4'"  . DG  A 1 9  ? -74.146  3.615   -1.587  1.00 0.87 ? 9   DG  B "C4'"  4  
ATOM 8268  O "O4'"  . DG  A 1 9  ? -74.092  3.979   -2.989  1.00 0.82 ? 9   DG  B "O4'"  4  
ATOM 8269  C "C3'"  . DG  A 1 9  ? -74.486  4.884   -0.783  1.00 0.85 ? 9   DG  B "C3'"  4  
ATOM 8270  O "O3'"  . DG  A 1 9  ? -73.363  5.311   0.004   1.00 0.88 ? 9   DG  B "O3'"  4  
ATOM 8271  C "C2'"  . DG  A 1 9  ? -74.831  5.925   -1.831  1.00 0.79 ? 9   DG  B "C2'"  4  
ATOM 8272  C "C1'"  . DG  A 1 9  ? -74.276  5.403   -3.143  1.00 0.76 ? 9   DG  B "C1'"  4  
ATOM 8273  N N9     . DG  A 1 9  ? -75.179  5.713   -4.267  1.00 0.72 ? 9   DG  B N9     4  
ATOM 8274  C C8     . DG  A 1 9  ? -76.507  5.435   -4.402  1.00 0.75 ? 9   DG  B C8     4  
ATOM 8275  N N7     . DG  A 1 9  ? -77.043  5.826   -5.521  1.00 0.73 ? 9   DG  B N7     4  
ATOM 8276  C C5     . DG  A 1 9  ? -75.977  6.424   -6.195  1.00 0.67 ? 9   DG  B C5     4  
ATOM 8277  C C6     . DG  A 1 9  ? -75.940  7.043   -7.476  1.00 0.66 ? 9   DG  B C6     4  
ATOM 8278  O O6     . DG  A 1 9  ? -76.857  7.185   -8.284  1.00 0.69 ? 9   DG  B O6     4  
ATOM 8279  N N1     . DG  A 1 9  ? -74.669  7.518   -7.776  1.00 0.65 ? 9   DG  B N1     4  
ATOM 8280  C C2     . DG  A 1 9  ? -73.568  7.415   -6.952  1.00 0.67 ? 9   DG  B C2     4  
ATOM 8281  N N2     . DG  A 1 9  ? -72.434  7.946   -7.416  1.00 0.72 ? 9   DG  B N2     4  
ATOM 8282  N N3     . DG  A 1 9  ? -73.598  6.831   -5.747  1.00 0.68 ? 9   DG  B N3     4  
ATOM 8283  C C4     . DG  A 1 9  ? -74.831  6.361   -5.434  1.00 0.67 ? 9   DG  B C4     4  
ATOM 8284  H "H5'"  . DG  A 1 9  ? -75.042  1.723   -2.105  1.00 1.00 ? 9   DG  B "H5'"  4  
ATOM 8285  H "H5''" . DG  A 1 9  ? -75.058  2.093   -0.368  1.00 1.08 ? 9   DG  B "H5''" 4  
ATOM 8286  H "H4'"  . DG  A 1 9  ? -73.167  3.247   -1.280  1.00 0.91 ? 9   DG  B "H4'"  4  
ATOM 8287  H "H3'"  . DG  A 1 9  ? -75.344  4.711   -0.126  1.00 0.90 ? 9   DG  B "H3'"  4  
ATOM 8288  H "H2'"  . DG  A 1 9  ? -75.914  6.037   -1.904  1.00 0.81 ? 9   DG  B "H2'"  4  
ATOM 8289  H "H2''" . DG  A 1 9  ? -74.378  6.881   -1.589  1.00 0.80 ? 9   DG  B "H2''" 4  
ATOM 8290  H "H1'"  . DG  A 1 9  ? -73.304  5.863   -3.332  1.00 0.76 ? 9   DG  B "H1'"  4  
ATOM 8291  H H8     . DG  A 1 9  ? -77.079  4.930   -3.624  1.00 0.80 ? 9   DG  B H8     4  
ATOM 8292  H H1     . DG  A 1 9  ? -74.565  7.972   -8.673  1.00 0.66 ? 9   DG  B H1     4  
ATOM 8293  H H21    . DG  A 1 9  ? -72.417  8.384   -8.326  1.00 0.73 ? 9   DG  B H21    4  
ATOM 8294  H H22    . DG  A 1 9  ? -71.594  7.914   -6.857  1.00 0.77 ? 9   DG  B H22    4  
ATOM 8295  P P      . DA  A 1 10 ? -73.385  6.728   0.780   1.00 0.92 ? 10  DA  B P      4  
ATOM 8296  O OP1    . DA  A 1 10 ? -72.436  6.658   1.913   1.00 1.03 ? 10  DA  B OP1    4  
ATOM 8297  O OP2    . DA  A 1 10 ? -74.797  7.100   1.021   1.00 0.96 ? 10  DA  B OP2    4  
ATOM 8298  O "O5'"  . DA  A 1 10 ? -72.779  7.733   -0.330  1.00 0.84 ? 10  DA  B "O5'"  4  
ATOM 8299  C "C5'"  . DA  A 1 10 ? -71.561  7.402   -1.006  1.00 0.84 ? 10  DA  B "C5'"  4  
ATOM 8300  C "C4'"  . DA  A 1 10 ? -71.032  8.553   -1.877  1.00 0.80 ? 10  DA  B "C4'"  4  
ATOM 8301  O "O4'"  . DA  A 1 10 ? -71.758  8.611   -3.131  1.00 0.75 ? 10  DA  B "O4'"  4  
ATOM 8302  C "C3'"  . DA  A 1 10 ? -71.170  9.919   -1.190  1.00 0.83 ? 10  DA  B "C3'"  4  
ATOM 8303  O "O3'"  . DA  A 1 10 ? -69.908  10.590  -1.168  1.00 0.87 ? 10  DA  B "O3'"  4  
ATOM 8304  C "C2'"  . DA  A 1 10 ? -72.158  10.701  -2.035  1.00 0.78 ? 10  DA  B "C2'"  4  
ATOM 8305  C "C1'"  . DA  A 1 10 ? -72.317  9.929   -3.336  1.00 0.74 ? 10  DA  B "C1'"  4  
ATOM 8306  N N9     . DA  A 1 10 ? -73.738  9.859   -3.735  1.00 0.70 ? 10  DA  B N9     4  
ATOM 8307  C C8     . DA  A 1 10 ? -74.823  9.454   -3.008  1.00 0.71 ? 10  DA  B C8     4  
ATOM 8308  N N7     . DA  A 1 10 ? -75.957  9.506   -3.635  1.00 0.69 ? 10  DA  B N7     4  
ATOM 8309  C C5     . DA  A 1 10 ? -75.601  9.989   -4.891  1.00 0.65 ? 10  DA  B C5     4  
ATOM 8310  C C6     . DA  A 1 10 ? -76.348  10.278  -6.039  1.00 0.64 ? 10  DA  B C6     4  
ATOM 8311  N N6     . DA  A 1 10 ? -77.667  10.124  -6.105  1.00 0.63 ? 10  DA  B N6     4  
ATOM 8312  N N1     . DA  A 1 10 ? -75.683  10.741  -7.109  1.00 0.65 ? 10  DA  B N1     4  
ATOM 8313  C C2     . DA  A 1 10 ? -74.364  10.914  -7.060  1.00 0.67 ? 10  DA  B C2     4  
ATOM 8314  N N3     . DA  A 1 10 ? -73.561  10.672  -6.026  1.00 0.68 ? 10  DA  B N3     4  
ATOM 8315  C C4     . DA  A 1 10 ? -74.255  10.207  -4.964  1.00 0.67 ? 10  DA  B C4     4  
ATOM 8316  H "H5'"  . DA  A 1 10 ? -71.730  6.530   -1.637  1.00 0.87 ? 10  DA  B "H5'"  4  
ATOM 8317  H "H5''" . DA  A 1 10 ? -70.807  7.154   -0.259  1.00 0.92 ? 10  DA  B "H5''" 4  
ATOM 8318  H "H4'"  . DA  A 1 10 ? -69.978  8.374   -2.089  1.00 0.83 ? 10  DA  B "H4'"  4  
ATOM 8319  H "H3'"  . DA  A 1 10 ? -71.547  9.810   -0.170  1.00 0.88 ? 10  DA  B "H3'"  4  
ATOM 8320  H "H2'"  . DA  A 1 10 ? -73.120  10.768  -1.524  1.00 0.81 ? 10  DA  B "H2'"  4  
ATOM 8321  H "H2''" . DA  A 1 10 ? -71.780  11.704  -2.234  1.00 0.80 ? 10  DA  B "H2''" 4  
ATOM 8322  H "H1'"  . DA  A 1 10 ? -71.752  10.431  -4.125  1.00 0.75 ? 10  DA  B "H1'"  4  
ATOM 8323  H H8     . DA  A 1 10 ? -74.742  9.123   -1.974  1.00 0.76 ? 10  DA  B H8     4  
ATOM 8324  H H61    . DA  A 1 10 ? -78.159  10.346  -6.960  1.00 0.63 ? 10  DA  B H61    4  
ATOM 8325  H H62    . DA  A 1 10 ? -78.176  9.785   -5.302  1.00 0.64 ? 10  DA  B H62    4  
ATOM 8326  H H2     . DA  A 1 10 ? -73.891  11.293  -7.966  1.00 0.70 ? 10  DA  B H2     4  
ATOM 8327  P P      . DA  A 1 11 ? -69.778  12.069  -0.549  1.00 0.93 ? 11  DA  B P      4  
ATOM 8328  O OP1    . DA  A 1 11 ? -68.374  12.275  -0.133  1.00 1.04 ? 11  DA  B OP1    4  
ATOM 8329  O OP2    . DA  A 1 11 ? -70.875  12.259  0.425   1.00 0.96 ? 11  DA  B OP2    4  
ATOM 8330  O "O5'"  . DA  A 1 11 ? -70.065  12.995  -1.834  1.00 0.85 ? 11  DA  B "O5'"  4  
ATOM 8331  C "C5'"  . DA  A 1 11 ? -69.430  12.695  -3.081  1.00 0.84 ? 11  DA  B "C5'"  4  
ATOM 8332  C "C4'"  . DA  A 1 11 ? -69.671  13.784  -4.134  1.00 0.79 ? 11  DA  B "C4'"  4  
ATOM 8333  O "O4'"  . DA  A 1 11 ? -70.936  13.546  -4.796  1.00 0.74 ? 11  DA  B "O4'"  4  
ATOM 8334  C "C3'"  . DA  A 1 11 ? -69.713  15.192  -3.520  1.00 0.79 ? 11  DA  B "C3'"  4  
ATOM 8335  O "O3'"  . DA  A 1 11 ? -68.795  16.064  -4.191  1.00 0.81 ? 11  DA  B "O3'"  4  
ATOM 8336  C "C2'"  . DA  A 1 11 ? -71.135  15.680  -3.727  1.00 0.75 ? 11  DA  B "C2'"  4  
ATOM 8337  C "C1'"  . DA  A 1 11 ? -71.792  14.704  -4.693  1.00 0.71 ? 11  DA  B "C1'"  4  
ATOM 8338  N N9     . DA  A 1 11 ? -73.154  14.328  -4.247  1.00 0.68 ? 11  DA  B N9     4  
ATOM 8339  C C8     . DA  A 1 11 ? -73.591  13.893  -3.026  1.00 0.71 ? 11  DA  B C8     4  
ATOM 8340  N N7     . DA  A 1 11 ? -74.866  13.633  -2.959  1.00 0.69 ? 11  DA  B N7     4  
ATOM 8341  C C5     . DA  A 1 11 ? -75.313  13.921  -4.247  1.00 0.65 ? 11  DA  B C5     4  
ATOM 8342  C C6     . DA  A 1 11 ? -76.574  13.860  -4.855  1.00 0.63 ? 11  DA  B C6     4  
ATOM 8343  N N6     . DA  A 1 11 ? -77.676  13.461  -4.220  1.00 0.64 ? 11  DA  B N6     4  
ATOM 8344  N N1     . DA  A 1 11 ? -76.655  14.220  -6.146  1.00 0.62 ? 11  DA  B N1     4  
ATOM 8345  C C2     . DA  A 1 11 ? -75.566  14.617  -6.803  1.00 0.63 ? 11  DA  B C2     4  
ATOM 8346  N N3     . DA  A 1 11 ? -74.334  14.710  -6.326  1.00 0.64 ? 11  DA  B N3     4  
ATOM 8347  C C4     . DA  A 1 11 ? -74.280  14.345  -5.032  1.00 0.65 ? 11  DA  B C4     4  
ATOM 8348  H "H5'"  . DA  A 1 11 ? -69.815  11.747  -3.457  1.00 0.85 ? 11  DA  B "H5'"  4  
ATOM 8349  H "H5''" . DA  A 1 11 ? -68.357  12.595  -2.911  1.00 0.94 ? 11  DA  B "H5''" 4  
ATOM 8350  H "H4'"  . DA  A 1 11 ? -68.871  13.743  -4.875  1.00 0.80 ? 11  DA  B "H4'"  4  
ATOM 8351  H "H3'"  . DA  A 1 11 ? -69.474  15.163  -2.454  1.00 0.84 ? 11  DA  B "H3'"  4  
ATOM 8352  H "H2'"  . DA  A 1 11 ? -71.674  15.688  -2.779  1.00 0.78 ? 11  DA  B "H2'"  4  
ATOM 8353  H "H2''" . DA  A 1 11 ? -71.128  16.682  -4.156  1.00 0.76 ? 11  DA  B "H2''" 4  
ATOM 8354  H "H1'"  . DA  A 1 11 ? -71.864  15.170  -5.679  1.00 0.70 ? 11  DA  B "H1'"  4  
ATOM 8355  H H8     . DA  A 1 11 ? -72.924  13.774  -2.173  1.00 0.76 ? 11  DA  B H8     4  
ATOM 8356  H H61    . DA  A 1 11 ? -78.559  13.438  -4.710  1.00 0.64 ? 11  DA  B H61    4  
ATOM 8357  H H62    . DA  A 1 11 ? -77.628  13.180  -3.251  1.00 0.67 ? 11  DA  B H62    4  
ATOM 8358  H H2     . DA  A 1 11 ? -75.702  14.893  -7.847  1.00 0.65 ? 11  DA  B H2     4  
ATOM 8359  P P      . DG  A 1 12 ? -68.676  17.614  -3.761  1.00 0.84 ? 12  DG  B P      4  
ATOM 8360  O OP1    . DG  A 1 12 ? -67.377  18.137  -4.244  1.00 0.92 ? 12  DG  B OP1    4  
ATOM 8361  O OP2    . DG  A 1 12 ? -69.041  17.731  -2.331  1.00 0.88 ? 12  DG  B OP2    4  
ATOM 8362  O "O5'"  . DG  A 1 12 ? -69.840  18.291  -4.639  1.00 0.78 ? 12  DG  B "O5'"  4  
ATOM 8363  C "C5'"  . DG  A 1 12 ? -69.853  18.089  -6.050  1.00 0.78 ? 12  DG  B "C5'"  4  
ATOM 8364  C "C4'"  . DG  A 1 12 ? -70.888  18.971  -6.746  1.00 0.74 ? 12  DG  B "C4'"  4  
ATOM 8365  O "O4'"  . DG  A 1 12 ? -72.194  18.350  -6.664  1.00 0.70 ? 12  DG  B "O4'"  4  
ATOM 8366  C "C3'"  . DG  A 1 12 ? -70.986  20.366  -6.112  1.00 0.74 ? 12  DG  B "C3'"  4  
ATOM 8367  O "O3'"  . DG  A 1 12 ? -70.826  21.382  -7.105  1.00 0.76 ? 12  DG  B "O3'"  4  
ATOM 8368  C "C2'"  . DG  A 1 12 ? -72.375  20.444  -5.532  1.00 0.72 ? 12  DG  B "C2'"  4  
ATOM 8369  C "C1'"  . DG  A 1 12 ? -73.153  19.277  -6.120  1.00 0.68 ? 12  DG  B "C1'"  4  
ATOM 8370  N N9     . DG  A 1 12 ? -74.006  18.642  -5.096  1.00 0.66 ? 12  DG  B N9     4  
ATOM 8371  C C8     . DG  A 1 12 ? -73.677  18.196  -3.847  1.00 0.70 ? 12  DG  B C8     4  
ATOM 8372  N N7     . DG  A 1 12 ? -74.661  17.694  -3.164  1.00 0.68 ? 12  DG  B N7     4  
ATOM 8373  C C5     . DG  A 1 12 ? -75.747  17.814  -4.030  1.00 0.62 ? 12  DG  B C5     4  
ATOM 8374  C C6     . DG  A 1 12 ? -77.105  17.438  -3.846  1.00 0.60 ? 12  DG  B C6     4  
ATOM 8375  O O6     . DG  A 1 12 ? -77.627  16.920  -2.862  1.00 0.62 ? 12  DG  B O6     4  
ATOM 8376  N N1     . DG  A 1 12 ? -77.872  17.731  -4.965  1.00 0.56 ? 12  DG  B N1     4  
ATOM 8377  C C2     . DG  A 1 12 ? -77.400  18.316  -6.121  1.00 0.55 ? 12  DG  B C2     4  
ATOM 8378  N N2     . DG  A 1 12 ? -78.304  18.521  -7.082  1.00 0.55 ? 12  DG  B N2     4  
ATOM 8379  N N3     . DG  A 1 12 ? -76.123  18.673  -6.300  1.00 0.58 ? 12  DG  B N3     4  
ATOM 8380  C C4     . DG  A 1 12 ? -75.355  18.392  -5.217  1.00 0.61 ? 12  DG  B C4     4  
ATOM 8381  H "H5'"  . DG  A 1 12 ? -70.080  17.043  -6.257  1.00 0.79 ? 12  DG  B "H5'"  4  
ATOM 8382  H "H5''" . DG  A 1 12 ? -68.864  18.324  -6.445  1.00 0.82 ? 12  DG  B "H5''" 4  
ATOM 8383  H "H4'"  . DG  A 1 12 ? -70.614  19.079  -7.797  1.00 0.75 ? 12  DG  B "H4'"  4  
ATOM 8384  H "H3'"  . DG  A 1 12 ? -70.236  20.497  -5.324  1.00 0.77 ? 12  DG  B "H3'"  4  
ATOM 8385  H "H2'"  . DG  A 1 12 ? -72.339  20.362  -4.445  1.00 0.75 ? 12  DG  B "H2'"  4  
ATOM 8386  H "H2''" . DG  A 1 12 ? -72.837  21.384  -5.815  1.00 0.73 ? 12  DG  B "H2''" 4  
ATOM 8387  H "H1'"  . DG  A 1 12 ? -73.786  19.638  -6.932  1.00 0.66 ? 12  DG  B "H1'"  4  
ATOM 8388  H H8     . DG  A 1 12 ? -72.664  18.266  -3.449  1.00 0.75 ? 12  DG  B H8     4  
ATOM 8389  H H1     . DG  A 1 12 ? -78.850  17.486  -4.910  1.00 0.56 ? 12  DG  B H1     4  
ATOM 8390  H H21    . DG  A 1 12 ? -79.266  18.250  -6.934  1.00 0.55 ? 12  DG  B H21    4  
ATOM 8391  H H22    . DG  A 1 12 ? -78.029  18.949  -7.955  1.00 0.57 ? 12  DG  B H22    4  
ATOM 8392  P P      . DT  A 1 13 ? -70.855  22.943  -6.706  1.00 0.79 ? 13  DT  B P      4  
ATOM 8393  O OP1    . DT  A 1 13 ? -69.845  23.644  -7.527  1.00 0.87 ? 13  DT  B OP1    4  
ATOM 8394  O OP2    . DT  A 1 13 ? -70.807  23.049  -5.230  1.00 0.82 ? 13  DT  B OP2    4  
ATOM 8395  O "O5'"  . DT  A 1 13 ? -72.319  23.412  -7.196  1.00 0.71 ? 13  DT  B "O5'"  4  
ATOM 8396  C "C5'"  . DT  A 1 13 ? -72.541  23.797  -8.557  1.00 0.85 ? 13  DT  B "C5'"  4  
ATOM 8397  C "C4'"  . DT  A 1 13 ? -74.039  23.888  -8.892  1.00 0.76 ? 13  DT  B "C4'"  4  
ATOM 8398  O "O4'"  . DT  A 1 13 ? -74.751  22.821  -8.214  1.00 0.69 ? 13  DT  B "O4'"  4  
ATOM 8399  C "C3'"  . DT  A 1 13 ? -74.669  25.226  -8.457  1.00 0.75 ? 13  DT  B "C3'"  4  
ATOM 8400  O "O3'"  . DT  A 1 13 ? -75.327  25.867  -9.556  1.00 0.80 ? 13  DT  B "O3'"  4  
ATOM 8401  C "C2'"  . DT  A 1 13 ? -75.689  24.863  -7.405  1.00 0.67 ? 13  DT  B "C2'"  4  
ATOM 8402  C "C1'"  . DT  A 1 13 ? -75.865  23.354  -7.468  1.00 0.63 ? 13  DT  B "C1'"  4  
ATOM 8403  N N1     . DT  A 1 13 ? -75.934  22.781  -6.095  1.00 0.59 ? 13  DT  B N1     4  
ATOM 8404  C C2     . DT  A 1 13 ? -77.102  22.140  -5.708  1.00 0.56 ? 13  DT  B C2     4  
ATOM 8405  O O2     . DT  A 1 13 ? -78.066  22.026  -6.464  1.00 0.57 ? 13  DT  B O2     4  
ATOM 8406  N N3     . DT  A 1 13 ? -77.123  21.637  -4.420  1.00 0.57 ? 13  DT  B N3     4  
ATOM 8407  C C4     . DT  A 1 13 ? -76.093  21.718  -3.497  1.00 0.59 ? 13  DT  B C4     4  
ATOM 8408  O O4     . DT  A 1 13 ? -76.218  21.232  -2.376  1.00 0.62 ? 13  DT  B O4     4  
ATOM 8409  C C5     . DT  A 1 13 ? -74.919  22.405  -3.988  1.00 0.62 ? 13  DT  B C5     4  
ATOM 8410  C C7     . DT  A 1 13 ? -73.713  22.591  -3.070  1.00 0.69 ? 13  DT  B C7     4  
ATOM 8411  C C6     . DT  A 1 13 ? -74.875  22.901  -5.239  1.00 0.62 ? 13  DT  B C6     4  
ATOM 8412  H "H5'"  . DT  A 1 13 ? -72.078  23.059  -9.212  1.00 0.98 ? 13  DT  B "H5'"  4  
ATOM 8413  H "H5''" . DT  A 1 13 ? -72.072  24.764  -8.734  1.00 1.03 ? 13  DT  B "H5''" 4  
ATOM 8414  H "H4'"  . DT  A 1 13 ? -74.171  23.771  -9.969  1.00 0.81 ? 13  DT  B "H4'"  4  
ATOM 8415  H "H3'"  . DT  A 1 13 ? -73.917  25.900  -8.036  1.00 0.80 ? 13  DT  B "H3'"  4  
ATOM 8416  H "H2'"  . DT  A 1 13 ? -75.335  25.162  -6.417  1.00 0.69 ? 13  DT  B "H2'"  4  
ATOM 8417  H "H2''" . DT  A 1 13 ? -76.632  25.355  -7.622  1.00 0.68 ? 13  DT  B "H2''" 4  
ATOM 8418  H "H1'"  . DT  A 1 13 ? -76.784  23.122  -8.015  1.00 0.62 ? 13  DT  B "H1'"  4  
ATOM 8419  H H3     . DT  A 1 13 ? -77.969  21.170  -4.125  1.00 0.57 ? 13  DT  B H3     4  
ATOM 8420  H H71    . DT  A 1 13 ? -72.795  22.514  -3.652  1.00 1.29 ? 13  DT  B H71    4  
ATOM 8421  H H72    . DT  A 1 13 ? -73.720  21.821  -2.298  1.00 1.19 ? 13  DT  B H72    4  
ATOM 8422  H H73    . DT  A 1 13 ? -73.764  23.574  -2.604  1.00 1.26 ? 13  DT  B H73    4  
ATOM 8423  H H6     . DT  A 1 13 ? -73.973  23.410  -5.578  1.00 0.66 ? 13  DT  B H6     4  
ATOM 8424  P P      . DT  A 1 14 ? -76.080  27.283  -9.350  1.00 0.83 ? 14  DT  B P      4  
ATOM 8425  O OP1    . DT  A 1 14 ? -76.101  27.994  -10.649 1.00 0.94 ? 14  DT  B OP1    4  
ATOM 8426  O OP2    . DT  A 1 14 ? -75.504  27.943  -8.157  1.00 0.85 ? 14  DT  B OP2    4  
ATOM 8427  O "O5'"  . DT  A 1 14 ? -77.591  26.840  -8.994  1.00 0.74 ? 14  DT  B "O5'"  4  
ATOM 8428  C "C5'"  . DT  A 1 14 ? -78.418  26.215  -9.980  1.00 0.84 ? 14  DT  B "C5'"  4  
ATOM 8429  C "C4'"  . DT  A 1 14 ? -79.847  26.001  -9.473  1.00 0.77 ? 14  DT  B "C4'"  4  
ATOM 8430  O "O4'"  . DT  A 1 14 ? -79.817  25.172  -8.286  1.00 0.71 ? 14  DT  B "O4'"  4  
ATOM 8431  C "C3'"  . DT  A 1 14 ? -80.541  27.325  -9.115  1.00 0.78 ? 14  DT  B "C3'"  4  
ATOM 8432  O "O3'"  . DT  A 1 14 ? -81.806  27.436  -9.787  1.00 0.82 ? 14  DT  B "O3'"  4  
ATOM 8433  C "C2'"  . DT  A 1 14 ? -80.755  27.265  -7.618  1.00 0.73 ? 14  DT  B "C2'"  4  
ATOM 8434  C "C1'"  . DT  A 1 14 ? -80.519  25.815  -7.204  1.00 0.67 ? 14  DT  B "C1'"  4  
ATOM 8435  N N1     . DT  A 1 14 ? -79.753  25.710  -5.921  1.00 0.63 ? 14  DT  B N1     4  
ATOM 8436  C C2     . DT  A 1 14 ? -80.344  25.017  -4.867  1.00 0.59 ? 14  DT  B C2     4  
ATOM 8437  O O2     . DT  A 1 14 ? -81.459  24.512  -4.966  1.00 0.59 ? 14  DT  B O2     4  
ATOM 8438  N N3     . DT  A 1 14 ? -79.607  24.928  -3.700  1.00 0.58 ? 14  DT  B N3     4  
ATOM 8439  C C4     . DT  A 1 14 ? -78.353  25.461  -3.486  1.00 0.62 ? 14  DT  B C4     4  
ATOM 8440  O O4     . DT  A 1 14 ? -77.793  25.331  -2.399  1.00 0.64 ? 14  DT  B O4     4  
ATOM 8441  C C5     . DT  A 1 14 ? -77.809  26.163  -4.623  1.00 0.67 ? 14  DT  B C5     4  
ATOM 8442  C C7     . DT  A 1 14 ? -76.418  26.783  -4.492  1.00 0.76 ? 14  DT  B C7     4  
ATOM 8443  C C6     . DT  A 1 14 ? -78.506  26.269  -5.784  1.00 0.67 ? 14  DT  B C6     4  
ATOM 8444  H "H5'"  . DT  A 1 14 ? -77.988  25.249  -10.244 1.00 0.98 ? 14  DT  B "H5'"  4  
ATOM 8445  H "H5''" . DT  A 1 14 ? -78.451  26.844  -10.868 1.00 0.95 ? 14  DT  B "H5''" 4  
ATOM 8446  H "H4'"  . DT  A 1 14 ? -80.427  25.494  -10.245 1.00 0.80 ? 14  DT  B "H4'"  4  
ATOM 8447  H "H3'"  . DT  A 1 14 ? -79.911  28.181  -9.376  1.00 0.82 ? 14  DT  B "H3'"  4  
ATOM 8448  H "H2'"  . DT  A 1 14 ? -80.056  27.927  -7.106  1.00 0.76 ? 14  DT  B "H2'"  4  
ATOM 8449  H "H2''" . DT  A 1 14 ? -81.771  27.555  -7.383  1.00 0.77 ? 14  DT  B "H2''" 4  
ATOM 8450  H "H1'"  . DT  A 1 14 ? -81.488  25.321  -7.095  1.00 0.67 ? 14  DT  B "H1'"  4  
ATOM 8451  H H3     . DT  A 1 14 ? -80.025  24.423  -2.931  1.00 0.57 ? 14  DT  B H3     4  
ATOM 8452  H H71    . DT  A 1 14 ? -76.445  27.564  -3.730  1.00 1.13 ? 14  DT  B H71    4  
ATOM 8453  H H72    . DT  A 1 14 ? -76.104  27.215  -5.443  1.00 1.27 ? 14  DT  B H72    4  
ATOM 8454  H H73    . DT  A 1 14 ? -75.708  26.012  -4.193  1.00 1.35 ? 14  DT  B H73    4  
ATOM 8455  H H6     . DT  A 1 14 ? -78.072  26.813  -6.621  1.00 0.73 ? 14  DT  B H6     4  
ATOM 8456  P P      . DC  A 1 15 ? -82.769  28.712  -9.548  1.00 0.87 ? 15  DC  B P      4  
ATOM 8457  O OP1    . DC  A 1 15 ? -83.401  29.067  -10.837 1.00 1.04 ? 15  DC  B OP1    4  
ATOM 8458  O OP2    . DC  A 1 15 ? -82.012  29.733  -8.791  1.00 0.93 ? 15  DC  B OP2    4  
ATOM 8459  O "O5'"  . DC  A 1 15 ? -83.910  28.110  -8.584  1.00 0.78 ? 15  DC  B "O5'"  4  
ATOM 8460  C "C5'"  . DC  A 1 15 ? -84.935  27.279  -9.130  1.00 0.88 ? 15  DC  B "C5'"  4  
ATOM 8461  C "C4'"  . DC  A 1 15 ? -86.028  26.968  -8.109  1.00 0.86 ? 15  DC  B "C4'"  4  
ATOM 8462  O "O4'"  . DC  A 1 15 ? -85.433  26.402  -6.923  1.00 0.80 ? 15  DC  B "O4'"  4  
ATOM 8463  C "C3'"  . DC  A 1 15 ? -86.809  28.222  -7.704  1.00 0.90 ? 15  DC  B "C3'"  4  
ATOM 8464  O "O3'"  . DC  A 1 15 ? -88.209  28.016  -7.890  1.00 1.04 ? 15  DC  B "O3'"  4  
ATOM 8465  C "C2'"  . DC  A 1 15 ? -86.509  28.433  -6.235  1.00 0.87 ? 15  DC  B "C2'"  4  
ATOM 8466  C "C1'"  . DC  A 1 15 ? -85.741  27.200  -5.764  1.00 0.79 ? 15  DC  B "C1'"  4  
ATOM 8467  N N1     . DC  A 1 15 ? -84.489  27.578  -5.045  1.00 0.72 ? 15  DC  B N1     4  
ATOM 8468  C C2     . DC  A 1 15 ? -84.321  27.118  -3.743  1.00 0.70 ? 15  DC  B C2     4  
ATOM 8469  O O2     . DC  A 1 15 ? -85.198  26.438  -3.218  1.00 0.74 ? 15  DC  B O2     4  
ATOM 8470  N N3     . DC  A 1 15 ? -83.176  27.436  -3.085  1.00 0.69 ? 15  DC  B N3     4  
ATOM 8471  C C4     . DC  A 1 15 ? -82.228  28.176  -3.670  1.00 0.71 ? 15  DC  B C4     4  
ATOM 8472  N N4     . DC  A 1 15 ? -81.116  28.461  -2.994  1.00 0.77 ? 15  DC  B N4     4  
ATOM 8473  C C5     . DC  A 1 15 ? -82.390  28.657  -5.008  1.00 0.72 ? 15  DC  B C5     4  
ATOM 8474  C C6     . DC  A 1 15 ? -83.531  28.336  -5.655  1.00 0.72 ? 15  DC  B C6     4  
ATOM 8475  H "H5'"  . DC  A 1 15 ? -84.492  26.344  -9.469  1.00 0.98 ? 15  DC  B "H5'"  4  
ATOM 8476  H "H5''" . DC  A 1 15 ? -85.385  27.788  -9.982  1.00 1.02 ? 15  DC  B "H5''" 4  
ATOM 8477  H "H4'"  . DC  A 1 15 ? -86.719  26.243  -8.538  1.00 0.95 ? 15  DC  B "H4'"  4  
ATOM 8478  H "H3'"  . DC  A 1 15 ? -86.489  29.092  -8.284  1.00 0.92 ? 15  DC  B "H3'"  4  
ATOM 8479  H "H2'"  . DC  A 1 15 ? -85.905  29.329  -6.093  1.00 0.86 ? 15  DC  B "H2'"  4  
ATOM 8480  H "H2''" . DC  A 1 15 ? -87.443  28.529  -5.680  1.00 0.96 ? 15  DC  B "H2''" 4  
ATOM 8481  H "H1'"  . DC  A 1 15 ? -86.383  26.610  -5.104  1.00 0.84 ? 15  DC  B "H1'"  4  
ATOM 8482  H H41    . DC  A 1 15 ? -80.996  28.122  -2.052  1.00 0.79 ? 15  DC  B H41    4  
ATOM 8483  H H42    . DC  A 1 15 ? -80.392  29.015  -3.428  1.00 0.82 ? 15  DC  B H42    4  
ATOM 8484  H H5     . DC  A 1 15 ? -81.620  29.262  -5.487  1.00 0.76 ? 15  DC  B H5     4  
ATOM 8485  H H6     . DC  A 1 15 ? -83.686  28.686  -6.677  1.00 0.75 ? 15  DC  B H6     4  
ATOM 8486  P P      . DG  A 1 16 ? -89.250  29.209  -7.616  1.00 1.15 ? 16  DG  B P      4  
ATOM 8487  O OP1    . DG  A 1 16 ? -90.468  28.953  -8.417  1.00 1.30 ? 16  DG  B OP1    4  
ATOM 8488  O OP2    . DG  A 1 16 ? -88.531  30.494  -7.752  1.00 1.12 ? 16  DG  B OP2    4  
ATOM 8489  O "O5'"  . DG  A 1 16 ? -89.614  28.992  -6.062  1.00 1.20 ? 16  DG  B "O5'"  4  
ATOM 8490  C "C5'"  . DG  A 1 16 ? -90.405  27.873  -5.657  1.00 1.29 ? 16  DG  B "C5'"  4  
ATOM 8491  C "C4'"  . DG  A 1 16 ? -90.723  27.908  -4.157  1.00 1.37 ? 16  DG  B "C4'"  4  
ATOM 8492  O "O4'"  . DG  A 1 16 ? -89.489  27.897  -3.400  1.00 1.23 ? 16  DG  B "O4'"  4  
ATOM 8493  C "C3'"  . DG  A 1 16 ? -91.517  29.163  -3.756  1.00 1.54 ? 16  DG  B "C3'"  4  
ATOM 8494  O "O3'"  . DG  A 1 16 ? -92.702  28.804  -3.031  1.00 1.74 ? 16  DG  B "O3'"  4  
ATOM 8495  C "C2'"  . DG  A 1 16 ? -90.584  29.959  -2.867  1.00 1.49 ? 16  DG  B "C2'"  4  
ATOM 8496  C "C1'"  . DG  A 1 16 ? -89.406  29.056  -2.542  1.00 1.31 ? 16  DG  B "C1'"  4  
ATOM 8497  N N9     . DG  A 1 16 ? -88.124  29.771  -2.726  1.00 1.20 ? 16  DG  B N9     4  
ATOM 8498  C C8     . DG  A 1 16 ? -87.644  30.429  -3.825  1.00 1.16 ? 16  DG  B C8     4  
ATOM 8499  N N7     . DG  A 1 16 ? -86.462  30.953  -3.680  1.00 1.12 ? 16  DG  B N7     4  
ATOM 8500  C C5     . DG  A 1 16 ? -86.122  30.618  -2.371  1.00 1.12 ? 16  DG  B C5     4  
ATOM 8501  C C6     . DG  A 1 16 ? -84.946  30.910  -1.631  1.00 1.12 ? 16  DG  B C6     4  
ATOM 8502  O O6     . DG  A 1 16 ? -83.955  31.541  -1.992  1.00 1.16 ? 16  DG  B O6     4  
ATOM 8503  N N1     . DG  A 1 16 ? -85.008  30.384  -0.346  1.00 1.14 ? 16  DG  B N1     4  
ATOM 8504  C C2     . DG  A 1 16 ? -86.067  29.670  0.169   1.00 1.17 ? 16  DG  B C2     4  
ATOM 8505  N N2     . DG  A 1 16 ? -85.939  29.252  1.431   1.00 1.23 ? 16  DG  B N2     4  
ATOM 8506  N N3     . DG  A 1 16 ? -87.176  29.394  -0.522  1.00 1.19 ? 16  DG  B N3     4  
ATOM 8507  C C4     . DG  A 1 16 ? -87.135  29.895  -1.780  1.00 1.16 ? 16  DG  B C4     4  
ATOM 8508  H "H5'"  . DG  A 1 16 ? -89.863  26.954  -5.882  1.00 1.24 ? 16  DG  B "H5'"  4  
ATOM 8509  H "H5''" . DG  A 1 16 ? -91.339  27.879  -6.219  1.00 1.40 ? 16  DG  B "H5''" 4  
ATOM 8510  H "H4'"  . DG  A 1 16 ? -91.307  27.023  -3.898  1.00 1.46 ? 16  DG  B "H4'"  4  
ATOM 8511  H "H3'"  . DG  A 1 16 ? -91.792  29.749  -4.637  1.00 1.57 ? 16  DG  B "H3'"  4  
ATOM 8512  H "H2'"  . DG  A 1 16 ? -90.232  30.850  -3.388  1.00 1.48 ? 16  DG  B "H2'"  4  
ATOM 8513  H "H2''" . DG  A 1 16 ? -91.098  30.249  -1.950  1.00 1.65 ? 16  DG  B "H2''" 4  
ATOM 8514  H "H1'"  . DG  A 1 16 ? -89.478  28.725  -1.504  1.00 1.36 ? 16  DG  B "H1'"  4  
ATOM 8515  H H8     . DG  A 1 16 ? -88.209  30.513  -4.753  1.00 1.20 ? 16  DG  B H8     4  
ATOM 8516  H H1     . DG  A 1 16 ? -84.202  30.542  0.237   1.00 1.17 ? 16  DG  B H1     4  
ATOM 8517  H H21    . DG  A 1 16 ? -85.099  29.464  1.950   1.00 1.24 ? 16  DG  B H21    4  
ATOM 8518  H H22    . DG  A 1 16 ? -86.683  28.728  1.868   1.00 1.29 ? 16  DG  B H22    4  
ATOM 8519  P P      . DA  A 1 17 ? -93.685  29.934  -2.427  1.00 1.98 ? 17  DA  B P      4  
ATOM 8520  O OP1    . DA  A 1 17 ? -95.001  29.313  -2.167  1.00 2.18 ? 17  DA  B OP1    4  
ATOM 8521  O OP2    . DA  A 1 17 ? -93.592  31.142  -3.278  1.00 1.99 ? 17  DA  B OP2    4  
ATOM 8522  O "O5'"  . DA  A 1 17 ? -92.997  30.262  -1.007  1.00 1.97 ? 17  DA  B "O5'"  4  
ATOM 8523  C "C5'"  . DA  A 1 17 ? -92.706  29.202  -0.094  1.00 1.92 ? 17  DA  B "C5'"  4  
ATOM 8524  C "C4'"  . DA  A 1 17 ? -92.273  29.725  1.283   1.00 1.98 ? 17  DA  B "C4'"  4  
ATOM 8525  O "O4'"  . DA  A 1 17 ? -90.846  29.994  1.284   1.00 1.81 ? 17  DA  B "O4'"  4  
ATOM 8526  C "C3'"  . DA  A 1 17 ? -93.000  31.025  1.668   1.00 2.20 ? 17  DA  B "C3'"  4  
ATOM 8527  O "O3'"  . DA  A 1 17 ? -93.647  30.887  2.935   1.00 2.37 ? 17  DA  B "O3'"  4  
ATOM 8528  C "C2'"  . DA  A 1 17 ? -91.920  32.080  1.772   1.00 2.16 ? 17  DA  B "C2'"  4  
ATOM 8529  C "C1'"  . DA  A 1 17 ? -90.585  31.343  1.728   1.00 1.93 ? 17  DA  B "C1'"  4  
ATOM 8530  N N9     . DA  A 1 17 ? -89.618  32.036  0.840   1.00 1.82 ? 17  DA  B N9     4  
ATOM 8531  C C8     . DA  A 1 17 ? -89.787  32.492  -0.436  1.00 1.81 ? 17  DA  B C8     4  
ATOM 8532  N N7     . DA  A 1 17 ? -88.758  33.106  -0.943  1.00 1.74 ? 17  DA  B N7     4  
ATOM 8533  C C5     . DA  A 1 17 ? -87.819  33.052  0.083   1.00 1.71 ? 17  DA  B C5     4  
ATOM 8534  C C6     . DA  A 1 17 ? -86.504  33.525  0.194   1.00 1.69 ? 17  DA  B C6     4  
ATOM 8535  N N6     . DA  A 1 17 ? -85.877  34.184  -0.787  1.00 1.69 ? 17  DA  B N6     4  
ATOM 8536  N N1     . DA  A 1 17 ? -85.863  33.299  1.355   1.00 1.70 ? 17  DA  B N1     4  
ATOM 8537  C C2     . DA  A 1 17 ? -86.474  32.645  2.345   1.00 1.73 ? 17  DA  B C2     4  
ATOM 8538  N N3     . DA  A 1 17 ? -87.711  32.159  2.342   1.00 1.76 ? 17  DA  B N3     4  
ATOM 8539  C C4     . DA  A 1 17 ? -88.331  32.401  1.171   1.00 1.75 ? 17  DA  B C4     4  
ATOM 8540  H "H5'"  . DA  A 1 17 ? -91.908  28.586  -0.508  1.00 1.75 ? 17  DA  B "H5'"  4  
ATOM 8541  H "H5''" . DA  A 1 17 ? -93.600  28.587  0.024   1.00 2.01 ? 17  DA  B "H5''" 4  
ATOM 8542  H "H4'"  . DA  A 1 17 ? -92.489  28.964  2.035   1.00 2.02 ? 17  DA  B "H4'"  4  
ATOM 8543  H "H3'"  . DA  A 1 17 ? -93.736  31.305  0.908   1.00 2.27 ? 17  DA  B "H3'"  4  
ATOM 8544  H "HO3'" . DA  A 1 17 ? -94.010  30.000  2.977   1.00 2.51 ? 17  DA  B "HO3'" 4  
ATOM 8545  H "H2'"  . DA  A 1 17 ? -91.992  32.780  0.937   1.00 2.19 ? 17  DA  B "H2'"  4  
ATOM 8546  H "H2''" . DA  A 1 17 ? -92.025  32.621  2.715   1.00 2.30 ? 17  DA  B "H2''" 4  
ATOM 8547  H "H1'"  . DA  A 1 17 ? -90.164  31.304  2.735   1.00 1.95 ? 17  DA  B "H1'"  4  
ATOM 8548  H H8     . DA  A 1 17 ? -90.714  32.351  -0.989  1.00 1.87 ? 17  DA  B H8     4  
ATOM 8549  H H61    . DA  A 1 17 ? -84.929  34.505  -0.657  1.00 1.71 ? 17  DA  B H61    4  
ATOM 8550  H H62    . DA  A 1 17 ? -86.353  34.363  -1.660  1.00 1.70 ? 17  DA  B H62    4  
ATOM 8551  H H2     . DA  A 1 17 ? -85.893  32.484  3.254   1.00 1.75 ? 17  DA  B H2     4  
ATOM 8552  O "O5'"  . DT  B 2 1  ? -78.146  36.624  2.643   1.00 2.31 ? 18  DT  C "O5'"  4  
ATOM 8553  C "C5'"  . DT  B 2 1  ? -77.942  36.799  4.046   1.00 2.42 ? 18  DT  C "C5'"  4  
ATOM 8554  C "C4'"  . DT  B 2 1  ? -78.743  35.779  4.862   1.00 2.29 ? 18  DT  C "C4'"  4  
ATOM 8555  O "O4'"  . DT  B 2 1  ? -80.151  35.924  4.563   1.00 2.25 ? 18  DT  C "O4'"  4  
ATOM 8556  C "C3'"  . DT  B 2 1  ? -78.335  34.330  4.546   1.00 2.08 ? 18  DT  C "C3'"  4  
ATOM 8557  O "O3'"  . DT  B 2 1  ? -78.014  33.611  5.743   1.00 2.08 ? 18  DT  C "O3'"  4  
ATOM 8558  C "C2'"  . DT  B 2 1  ? -79.545  33.702  3.890   1.00 1.90 ? 18  DT  C "C2'"  4  
ATOM 8559  C "C1'"  . DT  B 2 1  ? -80.688  34.707  4.002   1.00 2.02 ? 18  DT  C "C1'"  4  
ATOM 8560  N N1     . DT  B 2 1  ? -81.298  34.963  2.664   1.00 1.96 ? 18  DT  C N1     4  
ATOM 8561  C C2     . DT  B 2 1  ? -82.559  34.442  2.410   1.00 1.85 ? 18  DT  C C2     4  
ATOM 8562  O O2     . DT  B 2 1  ? -83.172  33.786  3.248   1.00 1.82 ? 18  DT  C O2     4  
ATOM 8563  N N3     . DT  B 2 1  ? -83.090  34.702  1.160   1.00 1.82 ? 18  DT  C N3     4  
ATOM 8564  C C4     . DT  B 2 1  ? -82.481  35.419  0.149   1.00 1.88 ? 18  DT  C C4     4  
ATOM 8565  O O4     . DT  B 2 1  ? -83.046  35.586  -0.931  1.00 1.86 ? 18  DT  C O4     4  
ATOM 8566  C C5     . DT  B 2 1  ? -81.171  35.924  0.498   1.00 2.00 ? 18  DT  C C5     4  
ATOM 8567  C C7     . DT  B 2 1  ? -80.377  36.728  -0.526  1.00 2.11 ? 18  DT  C C7     4  
ATOM 8568  C C6     . DT  B 2 1  ? -80.631  35.691  1.713   1.00 2.04 ? 18  DT  C C6     4  
ATOM 8569  H "H5'"  . DT  B 2 1  ? -78.254  37.806  4.328   1.00 2.56 ? 18  DT  C "H5'"  4  
ATOM 8570  H "H5''" . DT  B 2 1  ? -76.881  36.680  4.267   1.00 2.50 ? 18  DT  C "H5''" 4  
ATOM 8571  H "H4'"  . DT  B 2 1  ? -78.584  35.971  5.923   1.00 2.39 ? 18  DT  C "H4'"  4  
ATOM 8572  H "H3'"  . DT  B 2 1  ? -77.479  34.304  3.864   1.00 2.09 ? 18  DT  C "H3'"  4  
ATOM 8573  H "H2'"  . DT  B 2 1  ? -79.340  33.489  2.841   1.00 1.83 ? 18  DT  C "H2'"  4  
ATOM 8574  H "H2''" . DT  B 2 1  ? -79.802  32.778  4.411   1.00 1.80 ? 18  DT  C "H2''" 4  
ATOM 8575  H "H1'"  . DT  B 2 1  ? -81.446  34.316  4.687   1.00 2.01 ? 18  DT  C "H1'"  4  
ATOM 8576  H H3     . DT  B 2 1  ? -84.014  34.342  0.972   1.00 1.76 ? 18  DT  C H3     4  
ATOM 8577  H H71    . DT  B 2 1  ? -79.664  36.070  -1.024  1.00 2.51 ? 18  DT  C H71    4  
ATOM 8578  H H72    . DT  B 2 1  ? -79.840  37.530  -0.020  1.00 2.15 ? 18  DT  C H72    4  
ATOM 8579  H H73    . DT  B 2 1  ? -81.055  37.154  -1.264  1.00 2.37 ? 18  DT  C H73    4  
ATOM 8580  H H6     . DT  B 2 1  ? -79.646  36.095  1.945   1.00 2.15 ? 18  DT  C H6     4  
ATOM 8581  H "HO5'" . DT  B 2 1  ? -77.672  35.831  2.385   1.00 2.54 ? 18  DT  C "HO5'" 4  
ATOM 8582  P P      . DC  B 2 2  ? -77.417  32.111  5.666   1.00 1.92 ? 19  DC  C P      4  
ATOM 8583  O OP1    . DC  B 2 2  ? -76.580  31.888  6.865   1.00 2.02 ? 19  DC  C OP1    4  
ATOM 8584  O OP2    . DC  B 2 2  ? -76.840  31.909  4.319   1.00 1.85 ? 19  DC  C OP2    4  
ATOM 8585  O "O5'"  . DC  B 2 2  ? -78.734  31.188  5.796   1.00 1.76 ? 19  DC  C "O5'"  4  
ATOM 8586  C "C5'"  . DC  B 2 2  ? -79.564  31.287  6.954   1.00 1.85 ? 19  DC  C "C5'"  4  
ATOM 8587  C "C4'"  . DC  B 2 2  ? -80.488  30.070  7.125   1.00 1.66 ? 19  DC  C "C4'"  4  
ATOM 8588  O "O4'"  . DC  B 2 2  ? -81.675  30.254  6.321   1.00 1.61 ? 19  DC  C "O4'"  4  
ATOM 8589  C "C3'"  . DC  B 2 2  ? -79.823  28.750  6.701   1.00 1.50 ? 19  DC  C "C3'"  4  
ATOM 8590  O "O3'"  . DC  B 2 2  ? -79.891  27.786  7.759   1.00 1.49 ? 19  DC  C "O3'"  4  
ATOM 8591  C "C2'"  . DC  B 2 2  ? -80.625  28.248  5.520   1.00 1.32 ? 19  DC  C "C2'"  4  
ATOM 8592  C "C1'"  . DC  B 2 2  ? -81.789  29.220  5.322   1.00 1.39 ? 19  DC  C "C1'"  4  
ATOM 8593  N N1     . DC  B 2 2  ? -81.769  29.814  3.954   1.00 1.34 ? 19  DC  C N1     4  
ATOM 8594  C C2     . DC  B 2 2  ? -82.927  29.731  3.185   1.00 1.26 ? 19  DC  C C2     4  
ATOM 8595  O O2     . DC  B 2 2  ? -83.927  29.181  3.642   1.00 1.26 ? 19  DC  C O2     4  
ATOM 8596  N N3     . DC  B 2 2  ? -82.917  30.273  1.934   1.00 1.23 ? 19  DC  C N3     4  
ATOM 8597  C C4     . DC  B 2 2  ? -81.818  30.871  1.455   1.00 1.28 ? 19  DC  C C4     4  
ATOM 8598  N N4     . DC  B 2 2  ? -81.832  31.399  0.228   1.00 1.27 ? 19  DC  C N4     4  
ATOM 8599  C C5     . DC  B 2 2  ? -80.628  30.958  2.238   1.00 1.39 ? 19  DC  C C5     4  
ATOM 8600  C C6     . DC  B 2 2  ? -80.645  30.422  3.472   1.00 1.41 ? 19  DC  C C6     4  
ATOM 8601  H "H5'"  . DC  B 2 2  ? -80.176  32.185  6.870   1.00 2.01 ? 19  DC  C "H5'"  4  
ATOM 8602  H "H5''" . DC  B 2 2  ? -78.927  31.375  7.836   1.00 1.98 ? 19  DC  C "H5''" 4  
ATOM 8603  H "H4'"  . DC  B 2 2  ? -80.782  29.995  8.171   1.00 1.73 ? 19  DC  C "H4'"  4  
ATOM 8604  H "H3'"  . DC  B 2 2  ? -78.782  28.912  6.412   1.00 1.57 ? 19  DC  C "H3'"  4  
ATOM 8605  H "H2'"  . DC  B 2 2  ? -80.004  28.208  4.626   1.00 1.28 ? 19  DC  C "H2'"  4  
ATOM 8606  H "H2''" . DC  B 2 2  ? -81.006  27.249  5.742   1.00 1.23 ? 19  DC  C "H2''" 4  
ATOM 8607  H "H1'"  . DC  B 2 2  ? -82.731  28.688  5.484   1.00 1.35 ? 19  DC  C "H1'"  4  
ATOM 8608  H H41    . DC  B 2 2  ? -82.663  31.344  -0.340  1.00 1.22 ? 19  DC  C H41    4  
ATOM 8609  H H42    . DC  B 2 2  ? -81.006  31.853  -0.133  1.00 1.35 ? 19  DC  C H42    4  
ATOM 8610  H H5     . DC  B 2 2  ? -79.733  31.435  1.846   1.00 1.47 ? 19  DC  C H5     4  
ATOM 8611  H H6     . DC  B 2 2  ? -79.751  30.470  4.092   1.00 1.50 ? 19  DC  C H6     4  
ATOM 8612  P P      . DG  B 2 3  ? -79.255  26.314  7.580   1.00 1.42 ? 20  DG  C P      4  
ATOM 8613  O OP1    . DG  B 2 3  ? -79.068  25.725  8.926   1.00 1.52 ? 20  DG  C OP1    4  
ATOM 8614  O OP2    . DG  B 2 3  ? -78.104  26.411  6.655   1.00 1.46 ? 20  DG  C OP2    4  
ATOM 8615  O "O5'"  . DG  B 2 3  ? -80.435  25.501  6.839   1.00 1.23 ? 20  DG  C "O5'"  4  
ATOM 8616  C "C5'"  . DG  B 2 3  ? -81.500  24.932  7.604   1.00 1.25 ? 20  DG  C "C5'"  4  
ATOM 8617  C "C4'"  . DG  B 2 3  ? -82.536  24.212  6.724   1.00 1.10 ? 20  DG  C "C4'"  4  
ATOM 8618  O "O4'"  . DG  B 2 3  ? -82.890  25.041  5.590   1.00 1.05 ? 20  DG  C "O4'"  4  
ATOM 8619  C "C3'"  . DG  B 2 3  ? -82.010  22.873  6.183   1.00 1.01 ? 20  DG  C "C3'"  4  
ATOM 8620  O "O3'"  . DG  B 2 3  ? -82.920  21.809  6.477   1.00 0.98 ? 20  DG  C "O3'"  4  
ATOM 8621  C "C2'"  . DG  B 2 3  ? -81.903  23.051  4.686   1.00 0.91 ? 20  DG  C "C2'"  4  
ATOM 8622  C "C1'"  . DG  B 2 3  ? -82.594  24.362  4.348   1.00 0.92 ? 20  DG  C "C1'"  4  
ATOM 8623  N N9     . DG  B 2 3  ? -81.729  25.188  3.485   1.00 0.91 ? 20  DG  C N9     4  
ATOM 8624  C C8     . DG  B 2 3  ? -80.470  25.646  3.726   1.00 1.01 ? 20  DG  C C8     4  
ATOM 8625  N N7     . DG  B 2 3  ? -79.950  26.362  2.774   1.00 1.00 ? 20  DG  C N7     4  
ATOM 8626  C C5     . DG  B 2 3  ? -80.953  26.383  1.807   1.00 0.88 ? 20  DG  C C5     4  
ATOM 8627  C C6     . DG  B 2 3  ? -80.979  27.008  0.531   1.00 0.83 ? 20  DG  C C6     4  
ATOM 8628  O O6     . DG  B 2 3  ? -80.106  27.686  -0.010  1.00 0.89 ? 20  DG  C O6     4  
ATOM 8629  N N1     . DG  B 2 3  ? -82.179  26.775  -0.121  1.00 0.75 ? 20  DG  C N1     4  
ATOM 8630  C C2     . DG  B 2 3  ? -83.227  26.038  0.387   1.00 0.73 ? 20  DG  C C2     4  
ATOM 8631  N N2     . DG  B 2 3  ? -84.300  25.929  -0.390  1.00 0.72 ? 20  DG  C N2     4  
ATOM 8632  N N3     . DG  B 2 3  ? -83.209  25.451  1.584   1.00 0.76 ? 20  DG  C N3     4  
ATOM 8633  C C4     . DG  B 2 3  ? -82.047  25.663  2.236   1.00 0.83 ? 20  DG  C C4     4  
ATOM 8634  H "H5'"  . DG  B 2 3  ? -81.997  25.729  8.157   1.00 1.34 ? 20  DG  C "H5'"  4  
ATOM 8635  H "H5''" . DG  B 2 3  ? -81.082  24.219  8.314   1.00 1.32 ? 20  DG  C "H5''" 4  
ATOM 8636  H "H4'"  . DG  B 2 3  ? -83.430  24.026  7.318   1.00 1.13 ? 20  DG  C "H4'"  4  
ATOM 8637  H "H3'"  . DG  B 2 3  ? -81.029  22.638  6.604   1.00 1.08 ? 20  DG  C "H3'"  4  
ATOM 8638  H "H2'"  . DG  B 2 3  ? -80.857  23.095  4.382   1.00 0.95 ? 20  DG  C "H2'"  4  
ATOM 8639  H "H2''" . DG  B 2 3  ? -82.398  22.221  4.178   1.00 0.85 ? 20  DG  C "H2''" 4  
ATOM 8640  H "H1'"  . DG  B 2 3  ? -83.531  24.157  3.824   1.00 0.86 ? 20  DG  C "H1'"  4  
ATOM 8641  H H8     . DG  B 2 3  ? -79.937  25.421  4.648   1.00 1.10 ? 20  DG  C H8     4  
ATOM 8642  H H1     . DG  B 2 3  ? -82.272  27.186  -1.038  1.00 0.73 ? 20  DG  C H1     4  
ATOM 8643  H H21    . DG  B 2 3  ? -84.314  26.374  -1.296  1.00 0.71 ? 20  DG  C H21    4  
ATOM 8644  H H22    . DG  B 2 3  ? -85.101  25.404  -0.071  1.00 0.74 ? 20  DG  C H22    4  
ATOM 8645  P P      . DA  B 2 4  ? -82.584  20.297  6.022   1.00 0.94 ? 21  DA  C P      4  
ATOM 8646  O OP1    . DA  B 2 4  ? -83.135  19.377  7.041   1.00 1.02 ? 21  DA  C OP1    4  
ATOM 8647  O OP2    . DA  B 2 4  ? -81.150  20.228  5.666   1.00 0.98 ? 21  DA  C OP2    4  
ATOM 8648  O "O5'"  . DA  B 2 4  ? -83.450  20.132  4.672   1.00 0.83 ? 21  DA  C "O5'"  4  
ATOM 8649  C "C5'"  . DA  B 2 4  ? -84.876  20.208  4.729   1.00 0.73 ? 21  DA  C "C5'"  4  
ATOM 8650  C "C4'"  . DA  B 2 4  ? -85.506  20.437  3.348   1.00 0.65 ? 21  DA  C "C4'"  4  
ATOM 8651  O "O4'"  . DA  B 2 4  ? -84.801  21.500  2.659   1.00 0.62 ? 21  DA  C "O4'"  4  
ATOM 8652  C "C3'"  . DA  B 2 4  ? -85.457  19.183  2.460   1.00 0.62 ? 21  DA  C "C3'"  4  
ATOM 8653  O "O3'"  . DA  B 2 4  ? -86.755  18.881  1.929   1.00 0.64 ? 21  DA  C "O3'"  4  
ATOM 8654  C "C2'"  . DA  B 2 4  ? -84.506  19.533  1.337   1.00 0.58 ? 21  DA  C "C2'"  4  
ATOM 8655  C "C1'"  . DA  B 2 4  ? -84.329  21.042  1.376   1.00 0.57 ? 21  DA  C "C1'"  4  
ATOM 8656  N N9     . DA  B 2 4  ? -82.914  21.408  1.150   1.00 0.55 ? 21  DA  C N9     4  
ATOM 8657  C C8     . DA  B 2 4  ? -81.805  21.050  1.860   1.00 0.58 ? 21  DA  C C8     4  
ATOM 8658  N N7     . DA  B 2 4  ? -80.683  21.524  1.406   1.00 0.58 ? 21  DA  C N7     4  
ATOM 8659  C C5     . DA  B 2 4  ? -81.081  22.264  0.293   1.00 0.54 ? 21  DA  C C5     4  
ATOM 8660  C C6     . DA  B 2 4  ? -80.375  23.025  -0.645  1.00 0.54 ? 21  DA  C C6     4  
ATOM 8661  N N6     . DA  B 2 4  ? -79.054  23.177  -0.618  1.00 0.59 ? 21  DA  C N6     4  
ATOM 8662  N N1     . DA  B 2 4  ? -81.081  23.623  -1.617  1.00 0.52 ? 21  DA  C N1     4  
ATOM 8663  C C2     . DA  B 2 4  ? -82.403  23.485  -1.670  1.00 0.50 ? 21  DA  C C2     4  
ATOM 8664  N N3     . DA  B 2 4  ? -83.170  22.790  -0.836  1.00 0.50 ? 21  DA  C N3     4  
ATOM 8665  C C4     . DA  B 2 4  ? -82.436  22.199  0.130   1.00 0.52 ? 21  DA  C C4     4  
ATOM 8666  H "H5'"  . DA  B 2 4  ? -85.154  21.033  5.382   1.00 0.76 ? 21  DA  C "H5'"  4  
ATOM 8667  H "H5''" . DA  B 2 4  ? -85.264  19.279  5.148   1.00 0.82 ? 21  DA  C "H5''" 4  
ATOM 8668  H "H4'"  . DA  B 2 4  ? -86.546  20.733  3.483   1.00 0.69 ? 21  DA  C "H4'"  4  
ATOM 8669  H "H3'"  . DA  B 2 4  ? -85.083  18.320  3.018   1.00 0.65 ? 21  DA  C "H3'"  4  
ATOM 8670  H "H2'"  . DA  B 2 4  ? -83.543  19.044  1.491   1.00 0.59 ? 21  DA  C "H2'"  4  
ATOM 8671  H "H2''" . DA  B 2 4  ? -84.928  19.230  0.382   1.00 0.60 ? 21  DA  C "H2''" 4  
ATOM 8672  H "H1'"  . DA  B 2 4  ? -84.941  21.499  0.595   1.00 0.58 ? 21  DA  C "H1'"  4  
ATOM 8673  H H8     . DA  B 2 4  ? -81.857  20.410  2.741   1.00 0.62 ? 21  DA  C H8     4  
ATOM 8674  H H61    . DA  B 2 4  ? -78.598  23.740  -1.324  1.00 0.60 ? 21  DA  C H61    4  
ATOM 8675  H H62    . DA  B 2 4  ? -78.507  22.730  0.105   1.00 0.62 ? 21  DA  C H62    4  
ATOM 8676  H H2     . DA  B 2 4  ? -82.911  23.999  -2.486  1.00 0.51 ? 21  DA  C H2     4  
ATOM 8677  P P      . DA  B 2 5  ? -86.975  17.627  0.934   1.00 0.68 ? 22  DA  C P      4  
ATOM 8678  O OP1    . DA  B 2 5  ? -88.426  17.354  0.848   1.00 0.83 ? 22  DA  C OP1    4  
ATOM 8679  O OP2    . DA  B 2 5  ? -86.045  16.546  1.337   1.00 0.67 ? 22  DA  C OP2    4  
ATOM 8680  O "O5'"  . DA  B 2 5  ? -86.490  18.211  -0.491  1.00 0.63 ? 22  DA  C "O5'"  4  
ATOM 8681  C "C5'"  . DA  B 2 5  ? -87.202  19.295  -1.099  1.00 0.62 ? 22  DA  C "C5'"  4  
ATOM 8682  C "C4'"  . DA  B 2 5  ? -86.986  19.358  -2.621  1.00 0.61 ? 22  DA  C "C4'"  4  
ATOM 8683  O "O4'"  . DA  B 2 5  ? -85.803  20.140  -2.910  1.00 0.58 ? 22  DA  C "O4'"  4  
ATOM 8684  C "C3'"  . DA  B 2 5  ? -86.803  17.963  -3.244  1.00 0.64 ? 22  DA  C "C3'"  4  
ATOM 8685  O "O3'"  . DA  B 2 5  ? -87.702  17.761  -4.348  1.00 0.72 ? 22  DA  C "O3'"  4  
ATOM 8686  C "C2'"  . DA  B 2 5  ? -85.375  17.927  -3.737  1.00 0.61 ? 22  DA  C "C2'"  4  
ATOM 8687  C "C1'"  . DA  B 2 5  ? -84.827  19.349  -3.619  1.00 0.57 ? 22  DA  C "C1'"  4  
ATOM 8688  N N9     . DA  B 2 5  ? -83.517  19.378  -2.926  1.00 0.53 ? 22  DA  C N9     4  
ATOM 8689  C C8     . DA  B 2 5  ? -83.117  18.736  -1.785  1.00 0.51 ? 22  DA  C C8     4  
ATOM 8690  N N7     . DA  B 2 5  ? -81.893  18.972  -1.420  1.00 0.50 ? 22  DA  C N7     4  
ATOM 8691  C C5     . DA  B 2 5  ? -81.432  19.846  -2.401  1.00 0.51 ? 22  DA  C C5     4  
ATOM 8692  C C6     . DA  B 2 5  ? -80.201  20.481  -2.603  1.00 0.53 ? 22  DA  C C6     4  
ATOM 8693  N N6     . DA  B 2 5  ? -79.161  20.334  -1.780  1.00 0.55 ? 22  DA  C N6     4  
ATOM 8694  N N1     . DA  B 2 5  ? -80.087  21.280  -3.678  1.00 0.57 ? 22  DA  C N1     4  
ATOM 8695  C C2     . DA  B 2 5  ? -81.120  21.445  -4.505  1.00 0.59 ? 22  DA  C C2     4  
ATOM 8696  N N3     . DA  B 2 5  ? -82.326  20.894  -4.405  1.00 0.57 ? 22  DA  C N3     4  
ATOM 8697  C C4     . DA  B 2 5  ? -82.412  20.098  -3.321  1.00 0.53 ? 22  DA  C C4     4  
ATOM 8698  H "H5'"  . DA  B 2 5  ? -86.863  20.231  -0.655  1.00 0.71 ? 22  DA  C "H5'"  4  
ATOM 8699  H "H5''" . DA  B 2 5  ? -88.266  19.172  -0.896  1.00 0.73 ? 22  DA  C "H5''" 4  
ATOM 8700  H "H4'"  . DA  B 2 5  ? -87.848  19.842  -3.082  1.00 0.65 ? 22  DA  C "H4'"  4  
ATOM 8701  H "H3'"  . DA  B 2 5  ? -86.965  17.182  -2.496  1.00 0.66 ? 22  DA  C "H3'"  4  
ATOM 8702  H "H2'"  . DA  B 2 5  ? -84.782  17.241  -3.133  1.00 0.59 ? 22  DA  C "H2'"  4  
ATOM 8703  H "H2''" . DA  B 2 5  ? -85.361  17.606  -4.777  1.00 0.66 ? 22  DA  C "H2''" 4  
ATOM 8704  H "H1'"  . DA  B 2 5  ? -84.701  19.769  -4.618  1.00 0.60 ? 22  DA  C "H1'"  4  
ATOM 8705  H H8     . DA  B 2 5  ? -83.771  18.069  -1.229  1.00 0.53 ? 22  DA  C H8     4  
ATOM 8706  H H61    . DA  B 2 5  ? -78.293  20.815  -1.971  1.00 0.59 ? 22  DA  C H61    4  
ATOM 8707  H H62    . DA  B 2 5  ? -79.241  19.748  -0.962  1.00 0.54 ? 22  DA  C H62    4  
ATOM 8708  H H2     . DA  B 2 5  ? -80.958  22.103  -5.357  1.00 0.64 ? 22  DA  C H2     4  
ATOM 8709  P P      . DC  B 2 6  ? -87.889  16.295  -5.006  1.00 0.73 ? 23  DC  C P      4  
ATOM 8710  O OP1    . DC  B 2 6  ? -89.255  16.206  -5.574  1.00 0.79 ? 23  DC  C OP1    4  
ATOM 8711  O OP2    . DC  B 2 6  ? -87.436  15.286  -4.024  1.00 0.77 ? 23  DC  C OP2    4  
ATOM 8712  O "O5'"  . DC  B 2 6  ? -86.836  16.304  -6.229  1.00 0.68 ? 23  DC  C "O5'"  4  
ATOM 8713  C "C5'"  . DC  B 2 6  ? -87.104  17.054  -7.417  1.00 0.69 ? 23  DC  C "C5'"  4  
ATOM 8714  C "C4'"  . DC  B 2 6  ? -85.911  17.041  -8.383  1.00 0.67 ? 23  DC  C "C4'"  4  
ATOM 8715  O "O4'"  . DC  B 2 6  ? -84.716  17.477  -7.685  1.00 0.69 ? 23  DC  C "O4'"  4  
ATOM 8716  C "C3'"  . DC  B 2 6  ? -85.634  15.637  -8.963  1.00 0.63 ? 23  DC  C "C3'"  4  
ATOM 8717  O "O3'"  . DC  B 2 6  ? -85.585  15.676  -10.404 1.00 0.62 ? 23  DC  C "O3'"  4  
ATOM 8718  C "C2'"  . DC  B 2 6  ? -84.280  15.249  -8.404  1.00 0.63 ? 23  DC  C "C2'"  4  
ATOM 8719  C "C1'"  . DC  B 2 6  ? -83.644  16.536  -7.898  1.00 0.66 ? 23  DC  C "C1'"  4  
ATOM 8720  N N1     . DC  B 2 6  ? -82.849  16.300  -6.653  1.00 0.67 ? 23  DC  C N1     4  
ATOM 8721  C C2     . DC  B 2 6  ? -81.482  16.575  -6.689  1.00 0.69 ? 23  DC  C C2     4  
ATOM 8722  O O2     . DC  B 2 6  ? -80.969  17.000  -7.723  1.00 0.70 ? 23  DC  C O2     4  
ATOM 8723  N N3     . DC  B 2 6  ? -80.742  16.361  -5.565  1.00 0.70 ? 23  DC  C N3     4  
ATOM 8724  C C4     . DC  B 2 6  ? -81.309  15.897  -4.445  1.00 0.70 ? 23  DC  C C4     4  
ATOM 8725  N N4     . DC  B 2 6  ? -80.549  15.686  -3.364  1.00 0.73 ? 23  DC  C N4     4  
ATOM 8726  C C5     . DC  B 2 6  ? -82.712  15.613  -4.396  1.00 0.68 ? 23  DC  C C5     4  
ATOM 8727  C C6     . DC  B 2 6  ? -83.441  15.825  -5.514  1.00 0.67 ? 23  DC  C C6     4  
ATOM 8728  H "H5'"  . DC  B 2 6  ? -87.321  18.086  -7.139  1.00 0.78 ? 23  DC  C "H5'"  4  
ATOM 8729  H "H5''" . DC  B 2 6  ? -87.974  16.631  -7.920  1.00 0.71 ? 23  DC  C "H5''" 4  
ATOM 8730  H "H4'"  . DC  B 2 6  ? -86.112  17.730  -9.203  1.00 0.68 ? 23  DC  C "H4'"  4  
ATOM 8731  H "H3'"  . DC  B 2 6  ? -86.397  14.922  -8.640  1.00 0.62 ? 23  DC  C "H3'"  4  
ATOM 8732  H "H2'"  . DC  B 2 6  ? -84.400  14.540  -7.585  1.00 0.64 ? 23  DC  C "H2'"  4  
ATOM 8733  H "H2''" . DC  B 2 6  ? -83.662  14.812  -9.181  1.00 0.63 ? 23  DC  C "H2''" 4  
ATOM 8734  H "H1'"  . DC  B 2 6  ? -82.992  16.938  -8.683  1.00 0.67 ? 23  DC  C "H1'"  4  
ATOM 8735  H H41    . DC  B 2 6  ? -79.558  15.887  -3.396  1.00 0.75 ? 23  DC  C H41    4  
ATOM 8736  H H42    . DC  B 2 6  ? -80.964  15.324  -2.516  1.00 0.74 ? 23  DC  C H42    4  
ATOM 8737  H H5     . DC  B 2 6  ? -83.176  15.247  -3.483  1.00 0.70 ? 23  DC  C H5     4  
ATOM 8738  H H6     . DC  B 2 6  ? -84.507  15.607  -5.511  1.00 0.66 ? 23  DC  C H6     4  
ATOM 8739  P P      . DT  B 2 7  ? -85.146  14.378  -11.275 1.00 0.60 ? 24  DT  C P      4  
ATOM 8740  O OP1    . DT  B 2 7  ? -85.927  14.371  -12.533 1.00 0.63 ? 24  DT  C OP1    4  
ATOM 8741  O OP2    . DT  B 2 7  ? -85.170  13.194  -10.387 1.00 0.59 ? 24  DT  C OP2    4  
ATOM 8742  O "O5'"  . DT  B 2 7  ? -83.606  14.712  -11.640 1.00 0.61 ? 24  DT  C "O5'"  4  
ATOM 8743  C "C5'"  . DT  B 2 7  ? -83.222  16.068  -11.885 1.00 0.64 ? 24  DT  C "C5'"  4  
ATOM 8744  C "C4'"  . DT  B 2 7  ? -81.748  16.221  -12.292 1.00 0.66 ? 24  DT  C "C4'"  4  
ATOM 8745  O "O4'"  . DT  B 2 7  ? -80.951  16.421  -11.101 1.00 0.67 ? 24  DT  C "O4'"  4  
ATOM 8746  C "C3'"  . DT  B 2 7  ? -81.202  14.995  -13.033 1.00 0.66 ? 24  DT  C "C3'"  4  
ATOM 8747  O "O3'"  . DT  B 2 7  ? -80.701  15.367  -14.321 1.00 0.74 ? 24  DT  C "O3'"  4  
ATOM 8748  C "C2'"  . DT  B 2 7  ? -80.056  14.480  -12.184 1.00 0.65 ? 24  DT  C "C2'"  4  
ATOM 8749  C "C1'"  . DT  B 2 7  ? -79.897  15.442  -11.010 1.00 0.64 ? 24  DT  C "C1'"  4  
ATOM 8750  N N1     . DT  B 2 7  ? -79.945  14.720  -9.700  1.00 0.60 ? 24  DT  C N1     4  
ATOM 8751  C C2     . DT  B 2 7  ? -78.886  14.905  -8.818  1.00 0.60 ? 24  DT  C C2     4  
ATOM 8752  O O2     . DT  B 2 7  ? -77.928  15.622  -9.095  1.00 0.64 ? 24  DT  C O2     4  
ATOM 8753  N N3     . DT  B 2 7  ? -78.968  14.237  -7.612  1.00 0.59 ? 24  DT  C N3     4  
ATOM 8754  C C4     . DT  B 2 7  ? -79.994  13.406  -7.206  1.00 0.58 ? 24  DT  C C4     4  
ATOM 8755  O O4     . DT  B 2 7  ? -79.964  12.863  -6.103  1.00 0.61 ? 24  DT  C O4     4  
ATOM 8756  C C5     . DT  B 2 7  ? -81.052  13.263  -8.180  1.00 0.58 ? 24  DT  C C5     4  
ATOM 8757  C C7     . DT  B 2 7  ? -82.236  12.352  -7.858  1.00 0.61 ? 24  DT  C C7     4  
ATOM 8758  C C6     . DT  B 2 7  ? -81.002  13.908  -9.370  1.00 0.58 ? 24  DT  C C6     4  
ATOM 8759  H "H5'"  . DT  B 2 7  ? -83.395  16.648  -10.979 1.00 0.67 ? 24  DT  C "H5'"  4  
ATOM 8760  H "H5''" . DT  B 2 7  ? -83.848  16.464  -12.680 1.00 0.67 ? 24  DT  C "H5''" 4  
ATOM 8761  H "H4'"  . DT  B 2 7  ? -81.641  17.097  -12.936 1.00 0.71 ? 24  DT  C "H4'"  4  
ATOM 8762  H "H3'"  . DT  B 2 7  ? -81.973  14.226  -13.141 1.00 0.65 ? 24  DT  C "H3'"  4  
ATOM 8763  H "H2'"  . DT  B 2 7  ? -80.268  13.475  -11.826 1.00 0.62 ? 24  DT  C "H2'"  4  
ATOM 8764  H "H2''" . DT  B 2 7  ? -79.142  14.470  -12.779 1.00 0.69 ? 24  DT  C "H2''" 4  
ATOM 8765  H "H1'"  . DT  B 2 7  ? -78.939  15.966  -11.107 1.00 0.68 ? 24  DT  C "H1'"  4  
ATOM 8766  H H3     . DT  B 2 7  ? -78.203  14.366  -6.964  1.00 0.60 ? 24  DT  C H3     4  
ATOM 8767  H H71    . DT  B 2 7  ? -82.441  12.389  -6.786  1.00 1.12 ? 24  DT  C H71    4  
ATOM 8768  H H72    . DT  B 2 7  ? -81.991  11.328  -8.147  1.00 1.24 ? 24  DT  C H72    4  
ATOM 8769  H H73    . DT  B 2 7  ? -83.116  12.681  -8.407  1.00 1.12 ? 24  DT  C H73    4  
ATOM 8770  H H6     . DT  B 2 7  ? -81.813  13.775  -10.083 1.00 0.60 ? 24  DT  C H6     4  
ATOM 8771  P P      . DT  B 2 8  ? -80.017  14.271  -15.285 1.00 0.79 ? 25  DT  C P      4  
ATOM 8772  O OP1    . DT  B 2 8  ? -79.861  14.861  -16.631 1.00 0.92 ? 25  DT  C OP1    4  
ATOM 8773  O OP2    . DT  B 2 8  ? -80.737  12.992  -15.118 1.00 0.79 ? 25  DT  C OP2    4  
ATOM 8774  O "O5'"  . DT  B 2 8  ? -78.556  14.111  -14.635 1.00 0.78 ? 25  DT  C "O5'"  4  
ATOM 8775  C "C5'"  . DT  B 2 8  ? -77.553  15.094  -14.886 1.00 0.86 ? 25  DT  C "C5'"  4  
ATOM 8776  C "C4'"  . DT  B 2 8  ? -76.231  14.740  -14.200 1.00 0.83 ? 25  DT  C "C4'"  4  
ATOM 8777  O "O4'"  . DT  B 2 8  ? -76.461  14.469  -12.795 1.00 0.77 ? 25  DT  C "O4'"  4  
ATOM 8778  C "C3'"  . DT  B 2 8  ? -75.582  13.492  -14.823 1.00 0.82 ? 25  DT  C "C3'"  4  
ATOM 8779  O "O3'"  . DT  B 2 8  ? -74.219  13.744  -15.186 1.00 0.87 ? 25  DT  C "O3'"  4  
ATOM 8780  C "C2'"  . DT  B 2 8  ? -75.635  12.442  -13.741 1.00 0.75 ? 25  DT  C "C2'"  4  
ATOM 8781  C "C1'"  . DT  B 2 8  ? -75.899  13.189  -12.438 1.00 0.72 ? 25  DT  C "C1'"  4  
ATOM 8782  N N1     . DT  B 2 8  ? -76.803  12.419  -11.527 1.00 0.66 ? 25  DT  C N1     4  
ATOM 8783  C C2     . DT  B 2 8  ? -76.328  12.112  -10.255 1.00 0.64 ? 25  DT  C C2     4  
ATOM 8784  O O2     . DT  B 2 8  ? -75.213  12.461  -9.874  1.00 0.67 ? 25  DT  C O2     4  
ATOM 8785  N N3     . DT  B 2 8  ? -77.179  11.393  -9.441  1.00 0.61 ? 25  DT  C N3     4  
ATOM 8786  C C4     . DT  B 2 8  ? -78.444  10.956  -9.768  1.00 0.59 ? 25  DT  C C4     4  
ATOM 8787  O O4     . DT  B 2 8  ? -79.118  10.328  -8.955  1.00 0.59 ? 25  DT  C O4     4  
ATOM 8788  C C5     . DT  B 2 8  ? -78.865  11.310  -11.102 1.00 0.61 ? 25  DT  C C5     4  
ATOM 8789  C C7     . DT  B 2 8  ? -80.244  10.847  -11.578 1.00 0.62 ? 25  DT  C C7     4  
ATOM 8790  C C6     . DT  B 2 8  ? -78.055  12.018  -11.928 1.00 0.65 ? 25  DT  C C6     4  
ATOM 8791  H "H5'"  . DT  B 2 8  ? -77.901  16.058  -14.518 1.00 0.92 ? 25  DT  C "H5'"  4  
ATOM 8792  H "H5''" . DT  B 2 8  ? -77.387  15.162  -15.961 1.00 0.98 ? 25  DT  C "H5''" 4  
ATOM 8793  H "H4'"  . DT  B 2 8  ? -75.546  15.584  -14.293 1.00 0.88 ? 25  DT  C "H4'"  4  
ATOM 8794  H "H3'"  . DT  B 2 8  ? -76.139  13.156  -15.704 1.00 0.85 ? 25  DT  C "H3'"  4  
ATOM 8795  H "H2'"  . DT  B 2 8  ? -76.431  11.727  -13.946 1.00 0.75 ? 25  DT  C "H2'"  4  
ATOM 8796  H "H2''" . DT  B 2 8  ? -74.685  11.926  -13.685 1.00 0.77 ? 25  DT  C "H2''" 4  
ATOM 8797  H "H1'"  . DT  B 2 8  ? -74.942  13.367  -11.939 1.00 0.73 ? 25  DT  C "H1'"  4  
ATOM 8798  H H3     . DT  B 2 8  ? -76.842  11.164  -8.518  1.00 0.62 ? 25  DT  C H3     4  
ATOM 8799  H H71    . DT  B 2 8  ? -80.373  11.068  -12.637 1.00 1.22 ? 25  DT  C H71    4  
ATOM 8800  H H72    . DT  B 2 8  ? -81.014  11.360  -11.002 1.00 1.15 ? 25  DT  C H72    4  
ATOM 8801  H H73    . DT  B 2 8  ? -80.330  9.772   -11.420 1.00 1.14 ? 25  DT  C H73    4  
ATOM 8802  H H6     . DT  B 2 8  ? -78.407  12.279  -12.926 1.00 0.68 ? 25  DT  C H6     4  
ATOM 8803  P P      . DC  B 2 9  ? -73.318  12.581  -15.859 1.00 0.90 ? 26  DC  C P      4  
ATOM 8804  O OP1    . DC  B 2 9  ? -72.563  13.174  -16.985 1.00 1.02 ? 26  DC  C OP1    4  
ATOM 8805  O OP2    . DC  B 2 9  ? -74.182  11.402  -16.091 1.00 0.93 ? 26  DC  C OP2    4  
ATOM 8806  O "O5'"  . DC  B 2 9  ? -72.268  12.213  -14.685 1.00 0.82 ? 26  DC  C "O5'"  4  
ATOM 8807  C "C5'"  . DC  B 2 9  ? -70.981  12.841  -14.637 1.00 1.02 ? 26  DC  C "C5'"  4  
ATOM 8808  C "C4'"  . DC  B 2 9  ? -70.006  12.094  -13.722 1.00 0.93 ? 26  DC  C "C4'"  4  
ATOM 8809  O "O4'"  . DC  B 2 9  ? -70.653  11.830  -12.456 1.00 0.84 ? 26  DC  C "O4'"  4  
ATOM 8810  C "C3'"  . DC  B 2 9  ? -69.550  10.749  -14.318 1.00 0.92 ? 26  DC  C "C3'"  4  
ATOM 8811  O "O3'"  . DC  B 2 9  ? -68.121  10.649  -14.341 1.00 0.99 ? 26  DC  C "O3'"  4  
ATOM 8812  C "C2'"  . DC  B 2 9  ? -70.114  9.692   -13.398 1.00 0.82 ? 26  DC  C "C2'"  4  
ATOM 8813  C "C1'"  . DC  B 2 9  ? -70.677  10.414  -12.179 1.00 0.76 ? 26  DC  C "C1'"  4  
ATOM 8814  N N1     . DC  B 2 9  ? -72.063  9.940   -11.863 1.00 0.70 ? 26  DC  C N1     4  
ATOM 8815  C C2     . DC  B 2 9  ? -72.292  9.386   -10.605 1.00 0.67 ? 26  DC  C C2     4  
ATOM 8816  O O2     . DC  B 2 9  ? -71.367  9.293   -9.801  1.00 0.70 ? 26  DC  C O2     4  
ATOM 8817  N N3     . DC  B 2 9  ? -73.547  8.953   -10.301 1.00 0.64 ? 26  DC  C N3     4  
ATOM 8818  C C4     . DC  B 2 9  ? -74.544  9.052   -11.187 1.00 0.64 ? 26  DC  C C4     4  
ATOM 8819  N N4     . DC  B 2 9  ? -75.766  8.629   -10.852 1.00 0.64 ? 26  DC  C N4     4  
ATOM 8820  C C5     . DC  B 2 9  ? -74.323  9.614   -12.482 1.00 0.69 ? 26  DC  C C5     4  
ATOM 8821  C C6     . DC  B 2 9  ? -73.075  10.045  -12.778 1.00 0.72 ? 26  DC  C C6     4  
ATOM 8822  H "H5'"  . DC  B 2 9  ? -71.101  13.858  -14.265 1.00 1.22 ? 26  DC  C "H5'"  4  
ATOM 8823  H "H5''" . DC  B 2 9  ? -70.566  12.877  -15.640 1.00 1.27 ? 26  DC  C "H5''" 4  
ATOM 8824  H "H4'"  . DC  B 2 9  ? -69.129  12.721  -13.553 1.00 0.98 ? 26  DC  C "H4'"  4  
ATOM 8825  H "H3'"  . DC  B 2 9  ? -69.940  10.617  -15.331 1.00 0.99 ? 26  DC  C "H3'"  4  
ATOM 8826  H "H2'"  . DC  B 2 9  ? -70.902  9.130   -13.901 1.00 0.83 ? 26  DC  C "H2'"  4  
ATOM 8827  H "H2''" . DC  B 2 9  ? -69.315  9.018   -13.097 1.00 0.84 ? 26  DC  C "H2''" 4  
ATOM 8828  H "H1'"  . DC  B 2 9  ? -70.021  10.230  -11.324 1.00 0.77 ? 26  DC  C "H1'"  4  
ATOM 8829  H H41    . DC  B 2 9  ? -75.930  8.228   -9.939  1.00 0.64 ? 26  DC  C H41    4  
ATOM 8830  H H42    . DC  B 2 9  ? -76.527  8.708   -11.512 1.00 0.67 ? 26  DC  C H42    4  
ATOM 8831  H H5     . DC  B 2 9  ? -75.134  9.689   -13.207 1.00 0.74 ? 26  DC  C H5     4  
ATOM 8832  H H6     . DC  B 2 9  ? -72.873  10.477  -13.758 1.00 0.79 ? 26  DC  C H6     4  
ATOM 8833  P P      . DC  B 2 10 ? -67.391  9.339   -14.950 1.00 1.07 ? 27  DC  C P      4  
ATOM 8834  O OP1    . DC  B 2 10 ? -65.938  9.616   -15.022 1.00 1.20 ? 27  DC  C OP1    4  
ATOM 8835  O OP2    . DC  B 2 10 ? -68.120  8.916   -16.167 1.00 1.12 ? 27  DC  C OP2    4  
ATOM 8836  O "O5'"  . DC  B 2 10 ? -67.625  8.222   -13.806 1.00 0.98 ? 27  DC  C "O5'"  4  
ATOM 8837  C "C5'"  . DC  B 2 10 ? -66.829  8.235   -12.616 1.00 0.97 ? 27  DC  C "C5'"  4  
ATOM 8838  C "C4'"  . DC  B 2 10 ? -66.481  6.818   -12.121 1.00 0.96 ? 27  DC  C "C4'"  4  
ATOM 8839  O "O4'"  . DC  B 2 10 ? -67.424  6.426   -11.097 1.00 0.87 ? 27  DC  C "O4'"  4  
ATOM 8840  C "C3'"  . DC  B 2 10 ? -66.523  5.760   -13.239 1.00 1.06 ? 27  DC  C "C3'"  4  
ATOM 8841  O "O3'"  . DC  B 2 10 ? -65.294  5.027   -13.302 1.00 1.19 ? 27  DC  C "O3'"  4  
ATOM 8842  C "C2'"  . DC  B 2 10 ? -67.649  4.815   -12.867 1.00 1.00 ? 27  DC  C "C2'"  4  
ATOM 8843  C "C1'"  . DC  B 2 10 ? -68.146  5.235   -11.482 1.00 0.88 ? 27  DC  C "C1'"  4  
ATOM 8844  N N1     . DC  B 2 10 ? -69.623  5.485   -11.468 1.00 0.79 ? 27  DC  C N1     4  
ATOM 8845  C C2     . DC  B 2 10 ? -70.377  4.870   -10.473 1.00 0.77 ? 27  DC  C C2     4  
ATOM 8846  O O2     . DC  B 2 10 ? -69.829  4.134   -9.652  1.00 0.85 ? 27  DC  C O2     4  
ATOM 8847  N N3     . DC  B 2 10 ? -71.719  5.101   -10.436 1.00 0.71 ? 27  DC  C N3     4  
ATOM 8848  C C4     . DC  B 2 10 ? -72.306  5.901   -11.334 1.00 0.69 ? 27  DC  C C4     4  
ATOM 8849  N N4     . DC  B 2 10 ? -73.622  6.120   -11.256 1.00 0.68 ? 27  DC  C N4     4  
ATOM 8850  C C5     . DC  B 2 10 ? -71.542  6.535   -12.364 1.00 0.74 ? 27  DC  C C5     4  
ATOM 8851  C C6     . DC  B 2 10 ? -70.214  6.303   -12.393 1.00 0.78 ? 27  DC  C C6     4  
ATOM 8852  H "H5'"  . DC  B 2 10 ? -67.383  8.752   -11.832 1.00 0.93 ? 27  DC  C "H5'"  4  
ATOM 8853  H "H5''" . DC  B 2 10 ? -65.908  8.786   -12.812 1.00 1.09 ? 27  DC  C "H5''" 4  
ATOM 8854  H "H4'"  . DC  B 2 10 ? -65.477  6.832   -11.689 1.00 1.01 ? 27  DC  C "H4'"  4  
ATOM 8855  H "H3'"  . DC  B 2 10 ? -66.720  6.226   -14.207 1.00 1.12 ? 27  DC  C "H3'"  4  
ATOM 8856  H "H2'"  . DC  B 2 10 ? -68.450  4.873   -13.601 1.00 0.99 ? 27  DC  C "H2'"  4  
ATOM 8857  H "H2''" . DC  B 2 10 ? -67.271  3.793   -12.828 1.00 1.08 ? 27  DC  C "H2''" 4  
ATOM 8858  H "H1'"  . DC  B 2 10 ? -67.902  4.443   -10.764 1.00 0.93 ? 27  DC  C "H1'"  4  
ATOM 8859  H H41    . DC  B 2 10 ? -74.166  5.675   -10.529 1.00 0.67 ? 27  DC  C H41    4  
ATOM 8860  H H42    . DC  B 2 10 ? -74.075  6.730   -11.922 1.00 0.72 ? 27  DC  C H42    4  
ATOM 8861  H H5     . DC  B 2 10 ? -72.017  7.180   -13.103 1.00 0.79 ? 27  DC  C H5     4  
ATOM 8862  H H6     . DC  B 2 10 ? -69.608  6.770   -13.166 1.00 0.85 ? 27  DC  C H6     4  
ATOM 8863  P P      . DG  B 2 11 ? -65.121  3.824   -14.366 1.00 1.36 ? 28  DG  C P      4  
ATOM 8864  O OP1    . DG  B 2 11 ? -63.686  3.477   -14.442 1.00 1.57 ? 28  DG  C OP1    4  
ATOM 8865  O OP2    . DG  B 2 11 ? -65.859  4.193   -15.596 1.00 1.38 ? 28  DG  C OP2    4  
ATOM 8866  O "O5'"  . DG  B 2 11 ? -65.902  2.598   -13.657 1.00 1.30 ? 28  DG  C "O5'"  4  
ATOM 8867  C "C5'"  . DG  B 2 11 ? -65.323  1.907   -12.545 1.00 1.31 ? 28  DG  C "C5'"  4  
ATOM 8868  C "C4'"  . DG  B 2 11 ? -66.311  0.928   -11.886 1.00 1.27 ? 28  DG  C "C4'"  4  
ATOM 8869  O "O4'"  . DG  B 2 11 ? -67.619  1.546   -11.770 1.00 1.22 ? 28  DG  C "O4'"  4  
ATOM 8870  C "C3'"  . DG  B 2 11 ? -66.476  -0.377  -12.682 1.00 1.26 ? 28  DG  C "C3'"  4  
ATOM 8871  O "O3'"  . DG  B 2 11 ? -66.253  -1.505  -11.829 1.00 1.31 ? 28  DG  C "O3'"  4  
ATOM 8872  C "C2'"  . DG  B 2 11 ? -67.911  -0.372  -13.170 1.00 1.20 ? 28  DG  C "C2'"  4  
ATOM 8873  C "C1'"  . DG  B 2 11 ? -68.630  0.711   -12.380 1.00 1.17 ? 28  DG  C "C1'"  4  
ATOM 8874  N N9     . DG  B 2 11 ? -69.516  1.497   -13.258 1.00 1.13 ? 28  DG  C N9     4  
ATOM 8875  C C8     . DG  B 2 11 ? -69.186  2.275   -14.328 1.00 1.15 ? 28  DG  C C8     4  
ATOM 8876  N N7     . DG  B 2 11 ? -70.189  2.841   -14.931 1.00 1.15 ? 28  DG  C N7     4  
ATOM 8877  C C5     . DG  B 2 11 ? -71.290  2.402   -14.202 1.00 1.10 ? 28  DG  C C5     4  
ATOM 8878  C C6     . DG  B 2 11 ? -72.670  2.686   -14.386 1.00 1.10 ? 28  DG  C C6     4  
ATOM 8879  O O6     . DG  B 2 11 ? -73.193  3.390   -15.246 1.00 1.13 ? 28  DG  C O6     4  
ATOM 8880  N N1     . DG  B 2 11 ? -73.454  2.046   -13.435 1.00 1.07 ? 28  DG  C N1     4  
ATOM 8881  C C2     . DG  B 2 11 ? -72.972  1.232   -12.429 1.00 1.06 ? 28  DG  C C2     4  
ATOM 8882  N N2     . DG  B 2 11 ? -73.883  0.702   -11.610 1.00 1.06 ? 28  DG  C N2     4  
ATOM 8883  N N3     . DG  B 2 11 ? -71.672  0.962   -12.253 1.00 1.08 ? 28  DG  C N3     4  
ATOM 8884  C C4     . DG  B 2 11 ? -70.891  1.579   -13.172 1.00 1.09 ? 28  DG  C C4     4  
ATOM 8885  H "H5'"  . DG  B 2 11 ? -65.009  2.642   -11.801 1.00 1.39 ? 28  DG  C "H5'"  4  
ATOM 8886  H "H5''" . DG  B 2 11 ? -64.446  1.356   -12.886 1.00 1.33 ? 28  DG  C "H5''" 4  
ATOM 8887  H "H4'"  . DG  B 2 11 ? -65.950  0.684   -10.887 1.00 1.32 ? 28  DG  C "H4'"  4  
ATOM 8888  H "H3'"  . DG  B 2 11 ? -65.786  -0.415  -13.531 1.00 1.29 ? 28  DG  C "H3'"  4  
ATOM 8889  H "H2'"  . DG  B 2 11 ? -67.947  -0.139  -14.235 1.00 1.20 ? 28  DG  C "H2'"  4  
ATOM 8890  H "H2''" . DG  B 2 11 ? -68.374  -1.342  -12.990 1.00 1.20 ? 28  DG  C "H2''" 4  
ATOM 8891  H "H1'"  . DG  B 2 11 ? -69.229  0.249   -11.590 1.00 1.16 ? 28  DG  C "H1'"  4  
ATOM 8892  H H8     . DG  B 2 11 ? -68.156  2.408   -14.656 1.00 1.19 ? 28  DG  C H8     4  
ATOM 8893  H H1     . DG  B 2 11 ? -74.454  2.201   -13.504 1.00 1.07 ? 28  DG  C H1     4  
ATOM 8894  H H21    . DG  B 2 11 ? -74.864  0.908   -11.745 1.00 1.06 ? 28  DG  C H21    4  
ATOM 8895  H H22    . DG  B 2 11 ? -73.594  0.097   -10.856 1.00 1.08 ? 28  DG  C H22    4  
ATOM 8896  P P      . DG  B 2 12 ? -66.413  -3.012  -12.379 1.00 1.33 ? 29  DG  C P      4  
ATOM 8897  O OP1    . DG  B 2 12 ? -65.467  -3.876  -11.638 1.00 1.52 ? 29  DG  C OP1    4  
ATOM 8898  O OP2    . DG  B 2 12 ? -66.380  -2.977  -13.857 1.00 1.36 ? 29  DG  C OP2    4  
ATOM 8899  O "O5'"  . DG  B 2 12 ? -67.912  -3.393  -11.927 1.00 1.18 ? 29  DG  C "O5'"  4  
ATOM 8900  C "C5'"  . DG  B 2 12 ? -68.214  -3.668  -10.559 1.00 1.24 ? 29  DG  C "C5'"  4  
ATOM 8901  C "C4'"  . DG  B 2 12 ? -69.560  -4.377  -10.409 1.00 1.15 ? 29  DG  C "C4'"  4  
ATOM 8902  O "O4'"  . DG  B 2 12 ? -70.623  -3.521  -10.899 1.00 1.12 ? 29  DG  C "O4'"  4  
ATOM 8903  C "C3'"  . DG  B 2 12 ? -69.620  -5.701  -11.193 1.00 1.05 ? 29  DG  C "C3'"  4  
ATOM 8904  O "O3'"  . DG  B 2 12 ? -70.059  -6.762  -10.321 1.00 1.07 ? 29  DG  C "O3'"  4  
ATOM 8905  C "C2'"  . DG  B 2 12 ? -70.628  -5.443  -12.296 1.00 0.97 ? 29  DG  C "C2'"  4  
ATOM 8906  C "C1'"  . DG  B 2 12 ? -71.434  -4.242  -11.842 1.00 1.00 ? 29  DG  C "C1'"  4  
ATOM 8907  N N9     . DG  B 2 12 ? -71.848  -3.395  -12.983 1.00 0.97 ? 29  DG  C N9     4  
ATOM 8908  C C8     . DG  B 2 12 ? -71.090  -2.734  -13.910 1.00 1.00 ? 29  DG  C C8     4  
ATOM 8909  N N7     . DG  B 2 12 ? -71.768  -2.062  -14.797 1.00 0.99 ? 29  DG  C N7     4  
ATOM 8910  C C5     . DG  B 2 12 ? -73.094  -2.296  -14.429 1.00 0.96 ? 29  DG  C C5     4  
ATOM 8911  C C6     . DG  B 2 12 ? -74.305  -1.832  -15.015 1.00 0.97 ? 29  DG  C C6     4  
ATOM 8912  O O6     . DG  B 2 12 ? -74.452  -1.101  -15.994 1.00 1.00 ? 29  DG  C O6     4  
ATOM 8913  N N1     . DG  B 2 12 ? -75.419  -2.310  -14.328 1.00 0.97 ? 29  DG  C N1     4  
ATOM 8914  C C2     . DG  B 2 12 ? -75.375  -3.130  -13.218 1.00 0.96 ? 29  DG  C C2     4  
ATOM 8915  N N2     . DG  B 2 12 ? -76.549  -3.496  -12.692 1.00 1.00 ? 29  DG  C N2     4  
ATOM 8916  N N3     . DG  B 2 12 ? -74.240  -3.562  -12.670 1.00 0.95 ? 29  DG  C N3     4  
ATOM 8917  C C4     . DG  B 2 12 ? -73.147  -3.111  -13.323 1.00 0.95 ? 29  DG  C C4     4  
ATOM 8918  H "H5'"  . DG  B 2 12 ? -68.249  -2.728  -10.006 1.00 1.28 ? 29  DG  C "H5'"  4  
ATOM 8919  H "H5''" . DG  B 2 12 ? -67.429  -4.296  -10.139 1.00 1.42 ? 29  DG  C "H5''" 4  
ATOM 8920  H "H4'"  . DG  B 2 12 ? -69.733  -4.587  -9.354  1.00 1.22 ? 29  DG  C "H4'"  4  
ATOM 8921  H "H3'"  . DG  B 2 12 ? -68.644  -5.951  -11.621 1.00 1.07 ? 29  DG  C "H3'"  4  
ATOM 8922  H "H2'"  . DG  B 2 12 ? -70.116  -5.215  -13.233 1.00 0.97 ? 29  DG  C "H2'"  4  
ATOM 8923  H "H2''" . DG  B 2 12 ? -71.274  -6.301  -12.432 1.00 0.94 ? 29  DG  C "H2''" 4  
ATOM 8924  H "H1'"  . DG  B 2 12 ? -72.329  -4.592  -11.325 1.00 1.00 ? 29  DG  C "H1'"  4  
ATOM 8925  H H8     . DG  B 2 12 ? -70.000  -2.769  -13.911 1.00 1.05 ? 29  DG  C H8     4  
ATOM 8926  H H1     . DG  B 2 12 ? -76.315  -2.026  -14.687 1.00 1.00 ? 29  DG  C H1     4  
ATOM 8927  H H21    . DG  B 2 12 ? -77.412  -3.171  -13.103 1.00 1.04 ? 29  DG  C H21    4  
ATOM 8928  H H22    . DG  B 2 12 ? -76.571  -4.104  -11.883 1.00 1.02 ? 29  DG  C H22    4  
ATOM 8929  P P      . DC  B 2 13 ? -70.465  -8.227  -10.876 1.00 1.01 ? 30  DC  C P      4  
ATOM 8930  O OP1    . DC  B 2 13 ? -70.020  -9.239  -9.893  1.00 1.13 ? 30  DC  C OP1    4  
ATOM 8931  O OP2    . DC  B 2 13 ? -70.028  -8.327  -12.285 1.00 1.02 ? 30  DC  C OP2    4  
ATOM 8932  O "O5'"  . DC  B 2 13 ? -72.077  -8.178  -10.849 1.00 0.88 ? 30  DC  C "O5'"  4  
ATOM 8933  C "C5'"  . DC  B 2 13 ? -72.760  -7.534  -9.770  1.00 0.93 ? 30  DC  C "C5'"  4  
ATOM 8934  C "C4'"  . DC  B 2 13 ? -74.272  -7.815  -9.797  1.00 0.88 ? 30  DC  C "C4'"  4  
ATOM 8935  O "O4'"  . DC  B 2 13 ? -74.945  -6.797  -10.578 1.00 0.83 ? 30  DC  C "O4'"  4  
ATOM 8936  C "C3'"  . DC  B 2 13 ? -74.592  -9.180  -10.418 1.00 0.82 ? 30  DC  C "C3'"  4  
ATOM 8937  O "O3'"  . DC  B 2 13 ? -75.388  -9.970  -9.533  1.00 0.91 ? 30  DC  C "O3'"  4  
ATOM 8938  C "C2'"  . DC  B 2 13 ? -75.379  -8.882  -11.678 1.00 0.73 ? 30  DC  C "C2'"  4  
ATOM 8939  C "C1'"  . DC  B 2 13 ? -75.692  -7.387  -11.666 1.00 0.73 ? 30  DC  C "C1'"  4  
ATOM 8940  N N1     . DC  B 2 13 ? -75.326  -6.754  -12.968 1.00 0.66 ? 30  DC  C N1     4  
ATOM 8941  C C2     . DC  B 2 13 ? -76.329  -6.136  -13.716 1.00 0.64 ? 30  DC  C C2     4  
ATOM 8942  O O2     . DC  B 2 13 ? -77.487  -6.125  -13.305 1.00 0.69 ? 30  DC  C O2     4  
ATOM 8943  N N3     . DC  B 2 13 ? -75.990  -5.553  -14.898 1.00 0.62 ? 30  DC  C N3     4  
ATOM 8944  C C4     . DC  B 2 13 ? -74.726  -5.571  -15.337 1.00 0.62 ? 30  DC  C C4     4  
ATOM 8945  N N4     . DC  B 2 13 ? -74.428  -4.998  -16.505 1.00 0.65 ? 30  DC  C N4     4  
ATOM 8946  C C5     . DC  B 2 13 ? -73.694  -6.201  -14.577 1.00 0.63 ? 30  DC  C C5     4  
ATOM 8947  C C6     . DC  B 2 13 ? -74.037  -6.777  -13.407 1.00 0.65 ? 30  DC  C C6     4  
ATOM 8948  H "H5'"  . DC  B 2 13 ? -72.596  -6.461  -9.839  1.00 0.96 ? 30  DC  C "H5'"  4  
ATOM 8949  H "H5''" . DC  B 2 13 ? -72.346  -7.895  -8.828  1.00 1.02 ? 30  DC  C "H5''" 4  
ATOM 8950  H "H4'"  . DC  B 2 13 ? -74.659  -7.791  -8.777  1.00 0.97 ? 30  DC  C "H4'"  4  
ATOM 8951  H "H3'"  . DC  B 2 13 ? -73.675  -9.724  -10.664 1.00 0.82 ? 30  DC  C "H3'"  4  
ATOM 8952  H "H2'"  . DC  B 2 13 ? -74.788  -9.133  -12.561 1.00 0.69 ? 30  DC  C "H2'"  4  
ATOM 8953  H "H2''" . DC  B 2 13 ? -76.302  -9.461  -11.677 1.00 0.75 ? 30  DC  C "H2''" 4  
ATOM 8954  H "H1'"  . DC  B 2 13 ? -76.760  -7.245  -11.472 1.00 0.77 ? 30  DC  C "H1'"  4  
ATOM 8955  H H41    . DC  B 2 13 ? -75.152  -4.553  -17.050 1.00 0.67 ? 30  DC  C H41    4  
ATOM 8956  H H42    . DC  B 2 13 ? -73.478  -5.011  -16.847 1.00 0.67 ? 30  DC  C H42    4  
ATOM 8957  H H5     . DC  B 2 13 ? -72.664  -6.214  -14.930 1.00 0.66 ? 30  DC  C H5     4  
ATOM 8958  H H6     . DC  B 2 13 ? -73.281  -7.283  -12.813 1.00 0.69 ? 30  DC  C H6     4  
ATOM 8959  P P      . DT  B 2 14 ? -75.749  -11.491 -9.916  1.00 0.94 ? 31  DT  C P      4  
ATOM 8960  O OP1    . DT  B 2 14 ? -76.139  -12.200 -8.677  1.00 1.09 ? 31  DT  C OP1    4  
ATOM 8961  O OP2    . DT  B 2 14 ? -74.656  -12.026 -10.759 1.00 0.91 ? 31  DT  C OP2    4  
ATOM 8962  O "O5'"  . DT  B 2 14 ? -77.063  -11.316 -10.834 1.00 0.88 ? 31  DT  C "O5'"  4  
ATOM 8963  C "C5'"  . DT  B 2 14 ? -78.339  -11.120 -10.220 1.00 0.99 ? 31  DT  C "C5'"  4  
ATOM 8964  C "C4'"  . DT  B 2 14 ? -79.445  -10.842 -11.244 1.00 0.96 ? 31  DT  C "C4'"  4  
ATOM 8965  O "O4'"  . DT  B 2 14 ? -78.996  -9.829  -12.176 1.00 0.86 ? 31  DT  C "O4'"  4  
ATOM 8966  C "C3'"  . DT  B 2 14 ? -79.826  -12.093 -12.054 1.00 0.98 ? 31  DT  C "C3'"  4  
ATOM 8967  O "O3'"  . DT  B 2 14 ? -81.228  -12.357 -11.960 1.00 1.07 ? 31  DT  C "O3'"  4  
ATOM 8968  C "C2'"  . DT  B 2 14 ? -79.491  -11.760 -13.486 1.00 0.91 ? 31  DT  C "C2'"  4  
ATOM 8969  C "C1'"  . DT  B 2 14 ? -79.203  -10.269 -13.531 1.00 0.82 ? 31  DT  C "C1'"  4  
ATOM 8970  N N1     . DT  B 2 14 ? -78.020  -9.982  -14.387 1.00 0.73 ? 31  DT  C N1     4  
ATOM 8971  C C2     . DT  B 2 14 ? -78.208  -9.164  -15.492 1.00 0.70 ? 31  DT  C C2     4  
ATOM 8972  O O2     . DT  B 2 14 ? -79.306  -8.685  -15.767 1.00 0.76 ? 31  DT  C O2     4  
ATOM 8973  N N3     . DT  B 2 14 ? -77.095  -8.920  -16.267 1.00 0.66 ? 31  DT  C N3     4  
ATOM 8974  C C4     . DT  B 2 14 ? -75.822  -9.412  -16.043 1.00 0.64 ? 31  DT  C C4     4  
ATOM 8975  O O4     . DT  B 2 14 ? -74.900  -9.128  -16.805 1.00 0.64 ? 31  DT  C O4     4  
ATOM 8976  C C5     . DT  B 2 14 ? -75.710  -10.255 -14.871 1.00 0.68 ? 31  DT  C C5     4  
ATOM 8977  C C7     . DT  B 2 14 ? -74.344  -10.855 -14.518 1.00 0.72 ? 31  DT  C C7     4  
ATOM 8978  C C6     . DT  B 2 14 ? -76.789  -10.511 -14.094 1.00 0.72 ? 31  DT  C C6     4  
ATOM 8979  H "H5'"  . DT  B 2 14 ? -78.274  -10.274 -9.536  1.00 1.08 ? 31  DT  C "H5'"  4  
ATOM 8980  H "H5''" . DT  B 2 14 ? -78.599  -12.013 -9.654  1.00 1.13 ? 31  DT  C "H5''" 4  
ATOM 8981  H "H4'"  . DT  B 2 14 ? -80.328  -10.476 -10.722 1.00 1.02 ? 31  DT  C "H4'"  4  
ATOM 8982  H "H3'"  . DT  B 2 14 ? -79.258  -12.968 -11.721 1.00 1.02 ? 31  DT  C "H3'"  4  
ATOM 8983  H "H2'"  . DT  B 2 14 ? -78.623  -12.329 -13.818 1.00 0.90 ? 31  DT  C "H2'"  4  
ATOM 8984  H "H2''" . DT  B 2 14 ? -80.341  -11.986 -14.119 1.00 0.97 ? 31  DT  C "H2''" 4  
ATOM 8985  H "H1'"  . DT  B 2 14 ? -80.083  -9.749  -13.926 1.00 0.85 ? 31  DT  C "H1'"  4  
ATOM 8986  H H3     . DT  B 2 14 ? -77.223  -8.325  -17.075 1.00 0.67 ? 31  DT  C H3     4  
ATOM 8987  H H71    . DT  B 2 14 ? -74.409  -11.430 -13.592 1.00 1.28 ? 31  DT  C H71    4  
ATOM 8988  H H72    . DT  B 2 14 ? -73.619  -10.048 -14.390 1.00 1.20 ? 31  DT  C H72    4  
ATOM 8989  H H73    . DT  B 2 14 ? -74.016  -11.510 -15.327 1.00 1.26 ? 31  DT  C H73    4  
ATOM 8990  H H6     . DT  B 2 14 ? -76.681  -11.156 -13.222 1.00 0.78 ? 31  DT  C H6     4  
ATOM 8991  P P      . DC  B 2 15 ? -81.874  -13.611 -12.744 1.00 1.17 ? 32  DC  C P      4  
ATOM 8992  O OP1    . DC  B 2 15 ? -82.962  -14.165 -11.910 1.00 1.31 ? 32  DC  C OP1    4  
ATOM 8993  O OP2    . DC  B 2 15 ? -80.770  -14.485 -13.202 1.00 1.18 ? 32  DC  C OP2    4  
ATOM 8994  O "O5'"  . DC  B 2 15 ? -82.536  -12.918 -14.041 1.00 1.11 ? 32  DC  C "O5'"  4  
ATOM 8995  C "C5'"  . DC  B 2 15 ? -83.609  -11.987 -13.888 1.00 1.12 ? 32  DC  C "C5'"  4  
ATOM 8996  C "C4'"  . DC  B 2 15 ? -84.488  -11.902 -15.140 1.00 1.09 ? 32  DC  C "C4'"  4  
ATOM 8997  O "O4'"  . DC  B 2 15 ? -83.822  -11.107 -16.148 1.00 0.97 ? 32  DC  C "O4'"  4  
ATOM 8998  C "C3'"  . DC  B 2 15 ? -84.782  -13.282 -15.739 1.00 1.18 ? 32  DC  C "C3'"  4  
ATOM 8999  O "O3'"  . DC  B 2 15 ? -86.191  -13.469 -15.889 1.00 1.29 ? 32  DC  C "O3'"  4  
ATOM 9000  C "C2'"  . DC  B 2 15 ? -84.112  -13.290 -17.098 1.00 1.14 ? 32  DC  C "C2'"  4  
ATOM 9001  C "C1'"  . DC  B 2 15 ? -83.475  -11.916 -17.294 1.00 1.00 ? 32  DC  C "C1'"  4  
ATOM 9002  N N1     . DC  B 2 15 ? -81.993  -12.031 -17.423 1.00 0.92 ? 32  DC  C N1     4  
ATOM 9003  C C2     . DC  B 2 15 ? -81.378  -11.461 -18.535 1.00 0.87 ? 32  DC  C C2     4  
ATOM 9004  O O2     . DC  B 2 15 ? -82.054  -10.886 -19.384 1.00 0.89 ? 32  DC  C O2     4  
ATOM 9005  N N3     . DC  B 2 15 ? -80.025  -11.558 -18.648 1.00 0.83 ? 32  DC  C N3     4  
ATOM 9006  C C4     . DC  B 2 15 ? -79.297  -12.185 -17.715 1.00 0.84 ? 32  DC  C C4     4  
ATOM 9007  N N4     . DC  B 2 15 ? -77.970  -12.244 -17.849 1.00 0.83 ? 32  DC  C N4     4  
ATOM 9008  C C5     . DC  B 2 15 ? -79.923  -12.776 -16.574 1.00 0.91 ? 32  DC  C C5     4  
ATOM 9009  C C6     . DC  B 2 15 ? -81.263  -12.675 -16.469 1.00 0.94 ? 32  DC  C C6     4  
ATOM 9010  H "H5'"  . DC  B 2 15 ? -83.194  -11.001 -13.680 1.00 1.19 ? 32  DC  C "H5'"  4  
ATOM 9011  H "H5''" . DC  B 2 15 ? -84.226  -12.296 -13.045 1.00 1.24 ? 32  DC  C "H5''" 4  
ATOM 9012  H "H4'"  . DC  B 2 15 ? -85.432  -11.424 -14.879 1.00 1.13 ? 32  DC  C "H4'"  4  
ATOM 9013  H "H3'"  . DC  B 2 15 ? -84.370  -14.076 -15.112 1.00 1.25 ? 32  DC  C "H3'"  4  
ATOM 9014  H "H2'"  . DC  B 2 15 ? -83.347  -14.068 -17.143 1.00 1.16 ? 32  DC  C "H2'"  4  
ATOM 9015  H "H2''" . DC  B 2 15 ? -84.863  -13.469 -17.871 1.00 1.22 ? 32  DC  C "H2''" 4  
ATOM 9016  H "H1'"  . DC  B 2 15 ? -83.893  -11.450 -18.191 1.00 1.01 ? 32  DC  C "H1'"  4  
ATOM 9017  H H41    . DC  B 2 15 ? -77.524  -11.830 -18.655 1.00 0.81 ? 32  DC  C H41    4  
ATOM 9018  H H42    . DC  B 2 15 ? -77.409  -12.697 -17.141 1.00 0.87 ? 32  DC  C H42    4  
ATOM 9019  H H5     . DC  B 2 15 ? -79.338  -13.294 -15.815 1.00 0.95 ? 32  DC  C H5     4  
ATOM 9020  H H6     . DC  B 2 15 ? -81.770  -13.111 -15.608 1.00 1.01 ? 32  DC  C H6     4  
ATOM 9021  P P      . DG  B 2 16 ? -86.776  -14.855 -16.459 1.00 1.44 ? 33  DG  C P      4  
ATOM 9022  O OP1    . DG  B 2 16 ? -88.212  -14.931 -16.104 1.00 1.57 ? 33  DG  C OP1    4  
ATOM 9023  O OP2    . DG  B 2 16 ? -85.858  -15.945 -16.067 1.00 1.48 ? 33  DG  C OP2    4  
ATOM 9024  O "O5'"  . DG  B 2 16 ? -86.663  -14.644 -18.047 1.00 1.39 ? 33  DG  C "O5'"  4  
ATOM 9025  C "C5'"  . DG  B 2 16 ? -87.596  -13.803 -18.724 1.00 1.37 ? 33  DG  C "C5'"  4  
ATOM 9026  C "C4'"  . DG  B 2 16 ? -87.317  -13.742 -20.224 1.00 1.33 ? 33  DG  C "C4'"  4  
ATOM 9027  O "O4'"  . DG  B 2 16 ? -85.933  -13.402 -20.454 1.00 1.27 ? 33  DG  C "O4'"  4  
ATOM 9028  C "C3'"  . DG  B 2 16 ? -87.599  -15.083 -20.913 1.00 1.41 ? 33  DG  C "C3'"  4  
ATOM 9029  O "O3'"  . DG  B 2 16 ? -88.464  -14.906 -22.035 1.00 1.45 ? 33  DG  C "O3'"  4  
ATOM 9030  C "C2'"  . DG  B 2 16 ? -86.257  -15.590 -21.381 1.00 1.40 ? 33  DG  C "C2'"  4  
ATOM 9031  C "C1'"  . DG  B 2 16 ? -85.274  -14.443 -21.205 1.00 1.29 ? 33  DG  C "C1'"  4  
ATOM 9032  N N9     . DG  B 2 16 ? -84.071  -14.903 -20.503 1.00 1.26 ? 33  DG  C N9     4  
ATOM 9033  C C8     . DG  B 2 16 ? -83.970  -15.508 -19.289 1.00 1.31 ? 33  DG  C C8     4  
ATOM 9034  N N7     . DG  B 2 16 ? -82.763  -15.800 -18.915 1.00 1.30 ? 33  DG  C N7     4  
ATOM 9035  C C5     . DG  B 2 16 ? -81.988  -15.346 -19.979 1.00 1.23 ? 33  DG  C C5     4  
ATOM 9036  C C6     . DG  B 2 16 ? -80.583  -15.383 -20.159 1.00 1.21 ? 33  DG  C C6     4  
ATOM 9037  O O6     . DG  B 2 16 ? -79.731  -15.838 -19.400 1.00 1.25 ? 33  DG  C O6     4  
ATOM 9038  N N1     . DG  B 2 16 ? -80.213  -14.818 -21.373 1.00 1.17 ? 33  DG  C N1     4  
ATOM 9039  C C2     . DG  B 2 16 ? -81.084  -14.287 -22.299 1.00 1.16 ? 33  DG  C C2     4  
ATOM 9040  N N2     . DG  B 2 16 ? -80.541  -13.797 -23.410 1.00 1.15 ? 33  DG  C N2     4  
ATOM 9041  N N3     . DG  B 2 16 ? -82.406  -14.253 -22.134 1.00 1.18 ? 33  DG  C N3     4  
ATOM 9042  C C4     . DG  B 2 16 ? -82.784  -14.798 -20.957 1.00 1.21 ? 33  DG  C C4     4  
ATOM 9043  H "H5'"  . DG  B 2 16 ? -87.536  -12.798 -18.309 1.00 1.36 ? 33  DG  C "H5'"  4  
ATOM 9044  H "H5''" . DG  B 2 16 ? -88.601  -14.192 -18.565 1.00 1.43 ? 33  DG  C "H5''" 4  
ATOM 9045  H "H4'"  . DG  B 2 16 ? -87.947  -12.974 -20.671 1.00 1.32 ? 33  DG  C "H4'"  4  
ATOM 9046  H "H3'"  . DG  B 2 16 ? -88.049  -15.797 -20.215 1.00 1.48 ? 33  DG  C "H3'"  4  
ATOM 9047  H "H2'"  . DG  B 2 16 ? -85.942  -16.445 -20.780 1.00 1.45 ? 33  DG  C "H2'"  4  
ATOM 9048  H "H2''" . DG  B 2 16 ? -86.317  -15.882 -22.428 1.00 1.44 ? 33  DG  C "H2''" 4  
ATOM 9049  H "H1'"  . DG  B 2 16 ? -84.992  -14.047 -22.183 1.00 1.27 ? 33  DG  C "H1'"  4  
ATOM 9050  H H8     . DG  B 2 16 ? -84.844  -15.731 -18.678 1.00 1.38 ? 33  DG  C H8     4  
ATOM 9051  H H1     . DG  B 2 16 ? -79.226  -14.802 -21.572 1.00 1.18 ? 33  DG  C H1     4  
ATOM 9052  H H21    . DG  B 2 16 ? -79.540  -13.820 -23.534 1.00 1.16 ? 33  DG  C H21    4  
ATOM 9053  H H22    . DG  B 2 16 ? -81.131  -13.399 -24.126 1.00 1.16 ? 33  DG  C H22    4  
ATOM 9054  P P      . DA  B 2 17 ? -88.961  -16.182 -22.880 1.00 1.56 ? 34  DA  C P      4  
ATOM 9055  O OP1    . DA  B 2 17 ? -90.168  -15.789 -23.640 1.00 1.62 ? 34  DA  C OP1    4  
ATOM 9056  O OP2    . DA  B 2 17 ? -89.009  -17.345 -21.968 1.00 1.64 ? 34  DA  C OP2    4  
ATOM 9057  O "O5'"  . DA  B 2 17 ? -87.753  -16.414 -23.924 1.00 1.55 ? 34  DA  C "O5'"  4  
ATOM 9058  C "C5'"  . DA  B 2 17 ? -87.369  -15.377 -24.831 1.00 1.50 ? 34  DA  C "C5'"  4  
ATOM 9059  C "C4'"  . DA  B 2 17 ? -86.556  -15.919 -26.018 1.00 1.56 ? 34  DA  C "C4'"  4  
ATOM 9060  O "O4'"  . DA  B 2 17 ? -85.148  -15.916 -25.684 1.00 1.51 ? 34  DA  C "O4'"  4  
ATOM 9061  C "C3'"  . DA  B 2 17 ? -86.953  -17.354 -26.398 1.00 1.70 ? 34  DA  C "C3'"  4  
ATOM 9062  O "O3'"  . DA  B 2 17 ? -87.232  -17.445 -27.799 1.00 1.79 ? 34  DA  C "O3'"  4  
ATOM 9063  C "C2'"  . DA  B 2 17 ? -85.755  -18.211 -26.051 1.00 1.72 ? 34  DA  C "C2'"  4  
ATOM 9064  C "C1'"  . DA  B 2 17 ? -84.603  -17.251 -25.753 1.00 1.60 ? 34  DA  C "C1'"  4  
ATOM 9065  N N9     . DA  B 2 17 ? -83.910  -17.604 -24.490 1.00 1.57 ? 34  DA  C N9     4  
ATOM 9066  C C8     . DA  B 2 17 ? -84.432  -17.933 -23.267 1.00 1.59 ? 34  DA  C C8     4  
ATOM 9067  N N7     . DA  B 2 17 ? -83.554  -18.205 -22.349 1.00 1.58 ? 34  DA  C N7     4  
ATOM 9068  C C5     . DA  B 2 17 ? -82.342  -18.043 -23.014 1.00 1.55 ? 34  DA  C C5     4  
ATOM 9069  C C6     . DA  B 2 17 ? -81.011  -18.182 -22.604 1.00 1.55 ? 34  DA  C C6     4  
ATOM 9070  N N6     . DA  B 2 17 ? -80.658  -18.529 -21.366 1.00 1.57 ? 34  DA  C N6     4  
ATOM 9071  N N1     . DA  B 2 17 ? -80.057  -17.949 -23.520 1.00 1.55 ? 34  DA  C N1     4  
ATOM 9072  C C2     . DA  B 2 17 ? -80.387  -17.594 -24.761 1.00 1.55 ? 34  DA  C C2     4  
ATOM 9073  N N3     . DA  B 2 17 ? -81.612  -17.433 -25.251 1.00 1.56 ? 34  DA  C N3     4  
ATOM 9074  C C4     . DA  B 2 17 ? -82.548  -17.677 -24.315 1.00 1.55 ? 34  DA  C C4     4  
ATOM 9075  H "H5'"  . DA  B 2 17 ? -86.765  -14.644 -24.300 1.00 1.41 ? 34  DA  C "H5'"  4  
ATOM 9076  H "H5''" . DA  B 2 17 ? -88.268  -14.888 -25.204 1.00 1.52 ? 34  DA  C "H5''" 4  
ATOM 9077  H "H4'"  . DA  B 2 17 ? -86.715  -15.271 -26.879 1.00 1.57 ? 34  DA  C "H4'"  4  
ATOM 9078  H "H3'"  . DA  B 2 17 ? -87.830  -17.681 -25.831 1.00 1.73 ? 34  DA  C "H3'"  4  
ATOM 9079  H "HO3'" . DA  B 2 17 ? -87.689  -16.641 -28.053 1.00 2.00 ? 34  DA  C "HO3'" 4  
ATOM 9080  H "H2'"  . DA  B 2 17 ? -85.970  -18.824 -25.177 1.00 1.75 ? 34  DA  C "H2'"  4  
ATOM 9081  H "H2''" . DA  B 2 17 ? -85.505  -18.855 -26.896 1.00 1.81 ? 34  DA  C "H2''" 4  
ATOM 9082  H "H1'"  . DA  B 2 17 ? -83.882  -17.290 -26.572 1.00 1.62 ? 34  DA  C "H1'"  4  
ATOM 9083  H H8     . DA  B 2 17 ? -85.503  -17.963 -23.075 1.00 1.62 ? 34  DA  C H8     4  
ATOM 9084  H H61    . DA  B 2 17 ? -79.681  -18.616 -21.123 1.00 1.58 ? 34  DA  C H61    4  
ATOM 9085  H H62    . DA  B 2 17 ? -81.369  -18.705 -20.669 1.00 1.59 ? 34  DA  C H62    4  
ATOM 9086  H H2     . DA  B 2 17 ? -79.565  -17.410 -25.450 1.00 1.57 ? 34  DA  C H2     4  
ATOM 9087  N N      . VAL C 3 1  ? -102.698 12.685  -32.081 1.00 2.88 ? 10  VAL A N      4  
ATOM 9088  C CA     . VAL C 3 1  ? -103.105 11.622  -31.119 1.00 2.54 ? 10  VAL A CA     4  
ATOM 9089  C C      . VAL C 3 1  ? -102.245 11.723  -29.858 1.00 2.47 ? 10  VAL A C      4  
ATOM 9090  O O      . VAL C 3 1  ? -102.119 10.780  -29.103 1.00 2.82 ? 10  VAL A O      4  
ATOM 9091  C CB     . VAL C 3 1  ? -102.917 10.240  -31.768 1.00 2.80 ? 10  VAL A CB     4  
ATOM 9092  C CG1    . VAL C 3 1  ? -101.448 10.049  -32.163 1.00 3.34 ? 10  VAL A CG1    4  
ATOM 9093  C CG2    . VAL C 3 1  ? -103.336 9.123   -30.784 1.00 2.97 ? 10  VAL A CG2    4  
ATOM 9094  H H      . VAL C 3 1  ? -102.944 13.619  -31.910 1.00 3.33 ? 10  VAL A H      4  
ATOM 9095  H HA     . VAL C 3 1  ? -104.145 11.756  -30.856 1.00 2.70 ? 10  VAL A HA     4  
ATOM 9096  H HB     . VAL C 3 1  ? -103.531 10.185  -32.658 1.00 3.12 ? 10  VAL A HB     4  
ATOM 9097  H HG11   . VAL C 3 1  ? -101.111 10.904  -32.728 1.00 3.62 ? 10  VAL A HG11   4  
ATOM 9098  H HG12   . VAL C 3 1  ? -100.849 9.947   -31.270 1.00 3.57 ? 10  VAL A HG12   4  
ATOM 9099  H HG13   . VAL C 3 1  ? -101.353 9.157   -32.765 1.00 3.84 ? 10  VAL A HG13   4  
ATOM 9100  H HG21   . VAL C 3 1  ? -104.046 9.508   -30.067 1.00 3.26 ? 10  VAL A HG21   4  
ATOM 9101  H HG22   . VAL C 3 1  ? -103.791 8.311   -31.335 1.00 3.06 ? 10  VAL A HG22   4  
ATOM 9102  H HG23   . VAL C 3 1  ? -102.468 8.749   -30.256 1.00 3.34 ? 10  VAL A HG23   4  
ATOM 9103  N N      . ILE C 3 2  ? -101.666 12.875  -29.619 1.00 2.30 ? 11  ILE A N      4  
ATOM 9104  C CA     . ILE C 3 2  ? -100.820 13.070  -28.408 1.00 2.34 ? 11  ILE A CA     4  
ATOM 9105  C C      . ILE C 3 2  ? -101.179 14.427  -27.744 1.00 2.16 ? 11  ILE A C      4  
ATOM 9106  O O      . ILE C 3 2  ? -100.312 15.198  -27.402 1.00 2.18 ? 11  ILE A O      4  
ATOM 9107  C CB     . ILE C 3 2  ? -99.337  13.000  -28.861 1.00 2.83 ? 11  ILE A CB     4  
ATOM 9108  C CG1    . ILE C 3 2  ? -98.446  12.450  -27.727 1.00 3.26 ? 11  ILE A CG1    4  
ATOM 9109  C CG2    . ILE C 3 2  ? -98.815  14.373  -29.342 1.00 2.95 ? 11  ILE A CG2    4  
ATOM 9110  C CD1    . ILE C 3 2  ? -98.530  13.338  -26.484 1.00 3.52 ? 11  ILE A CD1    4  
ATOM 9111  H H      . ILE C 3 2  ? -101.797 13.621  -30.234 1.00 2.35 ? 11  ILE A H      4  
ATOM 9112  H HA     . ILE C 3 2  ? -101.015 12.277  -27.697 1.00 2.58 ? 11  ILE A HA     4  
ATOM 9113  H HB     . ILE C 3 2  ? -99.285  12.312  -29.697 1.00 3.23 ? 11  ILE A HB     4  
ATOM 9114  H HG12   . ILE C 3 2  ? -98.774  11.453  -27.472 1.00 3.70 ? 11  ILE A HG12   4  
ATOM 9115  H HG13   . ILE C 3 2  ? -97.421  12.411  -28.069 1.00 3.50 ? 11  ILE A HG13   4  
ATOM 9116  H HG21   . ILE C 3 2  ? -99.630  14.942  -29.764 1.00 3.20 ? 11  ILE A HG21   4  
ATOM 9117  H HG22   . ILE C 3 2  ? -98.385  14.918  -28.516 1.00 3.25 ? 11  ILE A HG22   4  
ATOM 9118  H HG23   . ILE C 3 2  ? -98.058  14.225  -30.099 1.00 3.09 ? 11  ILE A HG23   4  
ATOM 9119  H HD11   . ILE C 3 2  ? -98.266  14.350  -26.746 1.00 3.94 ? 11  ILE A HD11   4  
ATOM 9120  H HD12   . ILE C 3 2  ? -99.534  13.315  -26.087 1.00 3.88 ? 11  ILE A HD12   4  
ATOM 9121  H HD13   . ILE C 3 2  ? -97.842  12.971  -25.736 1.00 3.51 ? 11  ILE A HD13   4  
ATOM 9122  N N      . PRO C 3 3  ? -102.460 14.678  -27.553 1.00 2.45 ? 12  PRO A N      4  
ATOM 9123  C CA     . PRO C 3 3  ? -102.908 15.927  -26.912 1.00 2.83 ? 12  PRO A CA     4  
ATOM 9124  C C      . PRO C 3 3  ? -102.255 16.053  -25.528 1.00 2.73 ? 12  PRO A C      4  
ATOM 9125  O O      . PRO C 3 3  ? -102.327 17.081  -24.885 1.00 3.20 ? 12  PRO A O      4  
ATOM 9126  C CB     . PRO C 3 3  ? -104.448 15.789  -26.805 1.00 3.56 ? 12  PRO A CB     4  
ATOM 9127  C CG     . PRO C 3 3  ? -104.825 14.378  -27.342 1.00 3.55 ? 12  PRO A CG     4  
ATOM 9128  C CD     . PRO C 3 3  ? -103.549 13.759  -27.946 1.00 2.86 ? 12  PRO A CD     4  
ATOM 9129  H HA     . PRO C 3 3  ? -102.651 16.778  -27.526 1.00 2.97 ? 12  PRO A HA     4  
ATOM 9130  H HB2    . PRO C 3 3  ? -104.767 15.892  -25.774 1.00 3.91 ? 12  PRO A HB2    4  
ATOM 9131  H HB3    . PRO C 3 3  ? -104.929 16.545  -27.411 1.00 3.95 ? 12  PRO A HB3    4  
ATOM 9132  H HG2    . PRO C 3 3  ? -105.192 13.760  -26.532 1.00 3.96 ? 12  PRO A HG2    4  
ATOM 9133  H HG3    . PRO C 3 3  ? -105.587 14.463  -28.109 1.00 3.84 ? 12  PRO A HG3    4  
ATOM 9134  H HD2    . PRO C 3 3  ? -103.375 12.767  -27.546 1.00 3.03 ? 12  PRO A HD2    4  
ATOM 9135  H HD3    . PRO C 3 3  ? -103.642 13.729  -29.017 1.00 2.81 ? 12  PRO A HD3    4  
ATOM 9136  N N      . ALA C 3 4  ? -101.622 15.008  -25.074 1.00 2.41 ? 13  ALA A N      4  
ATOM 9137  C CA     . ALA C 3 4  ? -100.969 15.048  -23.738 1.00 2.65 ? 13  ALA A CA     4  
ATOM 9138  C C      . ALA C 3 4  ? -99.935  16.178  -23.716 1.00 2.45 ? 13  ALA A C      4  
ATOM 9139  O O      . ALA C 3 4  ? -99.784  16.873  -22.730 1.00 2.41 ? 13  ALA A O      4  
ATOM 9140  C CB     . ALA C 3 4  ? -100.298 13.690  -23.473 1.00 2.93 ? 13  ALA A CB     4  
ATOM 9141  H H      . ALA C 3 4  ? -101.580 14.190  -25.613 1.00 2.29 ? 13  ALA A H      4  
ATOM 9142  H HA     . ALA C 3 4  ? -101.715 15.236  -22.983 1.00 3.12 ? 13  ALA A HA     4  
ATOM 9143  H HB1    . ALA C 3 4  ? -100.817 12.924  -24.033 1.00 3.08 ? 13  ALA A HB1    4  
ATOM 9144  H HB2    . ALA C 3 4  ? -99.264  13.720  -23.786 1.00 3.13 ? 13  ALA A HB2    4  
ATOM 9145  H HB3    . ALA C 3 4  ? -100.348 13.458  -22.417 1.00 3.43 ? 13  ALA A HB3    4  
ATOM 9146  N N      . ALA C 3 5  ? -99.238  16.381  -24.797 1.00 2.64 ? 14  ALA A N      4  
ATOM 9147  C CA     . ALA C 3 5  ? -98.239  17.484  -24.827 1.00 2.80 ? 14  ALA A CA     4  
ATOM 9148  C C      . ALA C 3 5  ? -98.975  18.809  -24.609 1.00 2.70 ? 14  ALA A C      4  
ATOM 9149  O O      . ALA C 3 5  ? -98.456  19.731  -24.014 1.00 2.87 ? 14  ALA A O      4  
ATOM 9150  C CB     . ALA C 3 5  ? -97.519  17.507  -26.182 1.00 3.29 ? 14  ALA A CB     4  
ATOM 9151  H H      . ALA C 3 5  ? -99.383  15.822  -25.589 1.00 2.86 ? 14  ALA A H      4  
ATOM 9152  H HA     . ALA C 3 5  ? -97.517  17.339  -24.036 1.00 2.86 ? 14  ALA A HA     4  
ATOM 9153  H HB1    . ALA C 3 5  ? -98.247  17.495  -26.980 1.00 3.56 ? 14  ALA A HB1    4  
ATOM 9154  H HB2    . ALA C 3 5  ? -96.919  18.403  -26.255 1.00 3.60 ? 14  ALA A HB2    4  
ATOM 9155  H HB3    . ALA C 3 5  ? -96.880  16.639  -26.265 1.00 3.55 ? 14  ALA A HB3    4  
ATOM 9156  N N      . ALA C 3 6  ? -100.187 18.909  -25.094 1.00 2.63 ? 15  ALA A N      4  
ATOM 9157  C CA     . ALA C 3 6  ? -100.965 20.173  -24.927 1.00 2.72 ? 15  ALA A CA     4  
ATOM 9158  C C      . ALA C 3 6  ? -101.724 20.174  -23.589 1.00 2.61 ? 15  ALA A C      4  
ATOM 9159  O O      . ALA C 3 6  ? -102.100 21.217  -23.093 1.00 2.73 ? 15  ALA A O      4  
ATOM 9160  C CB     . ALA C 3 6  ? -101.963 20.297  -26.082 1.00 2.93 ? 15  ALA A CB     4  
ATOM 9161  H H      . ALA C 3 6  ? -100.583 18.153  -25.576 1.00 2.65 ? 15  ALA A H      4  
ATOM 9162  H HA     . ALA C 3 6  ? -100.288 21.020  -24.944 1.00 2.88 ? 15  ALA A HA     4  
ATOM 9163  H HB1    . ALA C 3 6  ? -102.468 19.353  -26.223 1.00 2.95 ? 15  ALA A HB1    4  
ATOM 9164  H HB2    . ALA C 3 6  ? -102.688 21.063  -25.855 1.00 3.26 ? 15  ALA A HB2    4  
ATOM 9165  H HB3    . ALA C 3 6  ? -101.434 20.559  -26.988 1.00 3.28 ? 15  ALA A HB3    4  
ATOM 9166  N N      . LEU C 3 7  ? -101.943 19.034  -22.981 1.00 2.52 ? 16  LEU A N      4  
ATOM 9167  C CA     . LEU C 3 7  ? -102.661 19.035  -21.668 1.00 2.60 ? 16  LEU A CA     4  
ATOM 9168  C C      . LEU C 3 7  ? -101.661 19.440  -20.585 1.00 2.60 ? 16  LEU A C      4  
ATOM 9169  O O      . LEU C 3 7  ? -102.010 20.014  -19.572 1.00 2.88 ? 16  LEU A O      4  
ATOM 9170  C CB     . LEU C 3 7  ? -103.216 17.637  -21.370 1.00 2.69 ? 16  LEU A CB     4  
ATOM 9171  C CG     . LEU C 3 7  ? -104.378 17.305  -22.322 1.00 2.71 ? 16  LEU A CG     4  
ATOM 9172  C CD1    . LEU C 3 7  ? -104.791 15.845  -22.109 1.00 3.23 ? 16  LEU A CD1    4  
ATOM 9173  C CD2    . LEU C 3 7  ? -105.583 18.231  -22.049 1.00 2.88 ? 16  LEU A CD2    4  
ATOM 9174  H H      . LEU C 3 7  ? -101.627 18.192  -23.371 1.00 2.49 ? 16  LEU A H      4  
ATOM 9175  H HA     . LEU C 3 7  ? -103.465 19.753  -21.694 1.00 2.75 ? 16  LEU A HA     4  
ATOM 9176  H HB2    . LEU C 3 7  ? -102.430 16.909  -21.505 1.00 2.80 ? 16  LEU A HB2    4  
ATOM 9177  H HB3    . LEU C 3 7  ? -103.566 17.598  -20.350 1.00 3.11 ? 16  LEU A HB3    4  
ATOM 9178  H HG     . LEU C 3 7  ? -104.049 17.436  -23.342 1.00 3.07 ? 16  LEU A HG     4  
ATOM 9179  H HD11   . LEU C 3 7  ? -103.943 15.201  -22.284 1.00 3.53 ? 16  LEU A HD11   4  
ATOM 9180  H HD12   . LEU C 3 7  ? -105.138 15.714  -21.094 1.00 3.48 ? 16  LEU A HD12   4  
ATOM 9181  H HD13   . LEU C 3 7  ? -105.585 15.590  -22.796 1.00 3.69 ? 16  LEU A HD13   4  
ATOM 9182  H HD21   . LEU C 3 7  ? -105.634 18.468  -20.997 1.00 3.05 ? 16  LEU A HD21   4  
ATOM 9183  H HD22   . LEU C 3 7  ? -105.475 19.141  -22.620 1.00 3.17 ? 16  LEU A HD22   4  
ATOM 9184  H HD23   . LEU C 3 7  ? -106.498 17.736  -22.348 1.00 3.26 ? 16  LEU A HD23   4  
ATOM 9185  N N      . ALA C 3 8  ? -100.407 19.173  -20.822 1.00 2.45 ? 17  ALA A N      4  
ATOM 9186  C CA     . ALA C 3 8  ? -99.351  19.560  -19.854 1.00 2.61 ? 17  ALA A CA     4  
ATOM 9187  C C      . ALA C 3 8  ? -99.064  21.047  -20.046 1.00 2.87 ? 17  ALA A C      4  
ATOM 9188  O O      . ALA C 3 8  ? -99.731  21.713  -20.814 1.00 3.32 ? 17  ALA A O      4  
ATOM 9189  C CB     . ALA C 3 8  ? -98.089  18.746  -20.137 1.00 2.59 ? 17  ALA A CB     4  
ATOM 9190  H H      . ALA C 3 8  ? -100.157 18.736  -21.657 1.00 2.38 ? 17  ALA A H      4  
ATOM 9191  H HA     . ALA C 3 8  ? -99.688  19.379  -18.845 1.00 2.74 ? 17  ALA A HA     4  
ATOM 9192  H HB1    . ALA C 3 8  ? -98.356  17.707  -20.268 1.00 2.61 ? 17  ALA A HB1    4  
ATOM 9193  H HB2    . ALA C 3 8  ? -97.619  19.113  -21.039 1.00 2.93 ? 17  ALA A HB2    4  
ATOM 9194  H HB3    . ALA C 3 8  ? -97.405  18.842  -19.310 1.00 2.79 ? 17  ALA A HB3    4  
ATOM 9195  N N      . GLY C 3 9  ? -98.095  21.595  -19.371 1.00 2.87 ? 18  GLY A N      4  
ATOM 9196  C CA     . GLY C 3 9  ? -97.826  23.046  -19.559 1.00 3.24 ? 18  GLY A CA     4  
ATOM 9197  C C      . GLY C 3 9  ? -98.862  23.835  -18.763 1.00 2.97 ? 18  GLY A C      4  
ATOM 9198  O O      . GLY C 3 9  ? -98.993  25.034  -18.904 1.00 3.34 ? 18  GLY A O      4  
ATOM 9199  H H      . GLY C 3 9  ? -97.557  21.063  -18.746 1.00 2.82 ? 18  GLY A H      4  
ATOM 9200  H HA2    . GLY C 3 9  ? -96.833  23.285  -19.209 1.00 3.48 ? 18  GLY A HA2    4  
ATOM 9201  H HA3    . GLY C 3 9  ? -97.919  23.297  -20.609 1.00 3.70 ? 18  GLY A HA3    4  
ATOM 9202  N N      . TYR C 3 10 ? -99.606  23.162  -17.932 1.00 2.61 ? 19  TYR A N      4  
ATOM 9203  C CA     . TYR C 3 10 ? -100.646 23.861  -17.132 1.00 2.84 ? 19  TYR A CA     4  
ATOM 9204  C C      . TYR C 3 10 ? -99.967  24.756  -16.091 1.00 3.02 ? 19  TYR A C      4  
ATOM 9205  O O      . TYR C 3 10 ? -99.107  24.326  -15.349 1.00 3.28 ? 19  TYR A O      4  
ATOM 9206  C CB     . TYR C 3 10 ? -101.514 22.817  -16.427 1.00 2.96 ? 19  TYR A CB     4  
ATOM 9207  C CG     . TYR C 3 10 ? -100.671 22.057  -15.430 1.00 2.45 ? 19  TYR A CG     4  
ATOM 9208  C CD1    . TYR C 3 10 ? -99.852  21.002  -15.856 1.00 2.56 ? 19  TYR A CD1    4  
ATOM 9209  C CD2    . TYR C 3 10 ? -100.697 22.419  -14.078 1.00 2.68 ? 19  TYR A CD2    4  
ATOM 9210  C CE1    . TYR C 3 10 ? -99.064  20.309  -14.928 1.00 2.80 ? 19  TYR A CE1    4  
ATOM 9211  C CE2    . TYR C 3 10 ? -99.908  21.726  -13.152 1.00 2.90 ? 19  TYR A CE2    4  
ATOM 9212  C CZ     . TYR C 3 10 ? -99.092  20.671  -13.578 1.00 2.92 ? 19  TYR A CZ     4  
ATOM 9213  O OH     . TYR C 3 10 ? -98.315  19.986  -12.670 1.00 3.66 ? 19  TYR A OH     4  
ATOM 9214  H H      . TYR C 3 10 ? -99.490  22.191  -17.846 1.00 2.43 ? 19  TYR A H      4  
ATOM 9215  H HA     . TYR C 3 10 ? -101.261 24.465  -17.783 1.00 3.20 ? 19  TYR A HA     4  
ATOM 9216  H HB2    . TYR C 3 10 ? -102.328 23.311  -15.914 1.00 3.48 ? 19  TYR A HB2    4  
ATOM 9217  H HB3    . TYR C 3 10 ? -101.913 22.130  -17.158 1.00 3.39 ? 19  TYR A HB3    4  
ATOM 9218  H HD1    . TYR C 3 10 ? -99.830  20.719  -16.898 1.00 3.01 ? 19  TYR A HD1    4  
ATOM 9219  H HD2    . TYR C 3 10 ? -101.328 23.231  -13.749 1.00 3.20 ? 19  TYR A HD2    4  
ATOM 9220  H HE1    . TYR C 3 10 ? -98.426  19.500  -15.254 1.00 3.38 ? 19  TYR A HE1    4  
ATOM 9221  H HE2    . TYR C 3 10 ? -99.927  22.008  -12.110 1.00 3.51 ? 19  TYR A HE2    4  
ATOM 9222  H HH     . TYR C 3 10 ? -98.363  19.051  -12.886 1.00 4.08 ? 19  TYR A HH     4  
ATOM 9223  N N      . THR C 3 11 ? -100.343 26.004  -16.045 1.00 3.30 ? 20  THR A N      4  
ATOM 9224  C CA     . THR C 3 11 ? -99.726  26.953  -15.071 1.00 3.67 ? 20  THR A CA     4  
ATOM 9225  C C      . THR C 3 11 ? -100.645 27.134  -13.858 1.00 3.82 ? 20  THR A C      4  
ATOM 9226  O O      . THR C 3 11 ? -100.458 28.026  -13.057 1.00 4.07 ? 20  THR A O      4  
ATOM 9227  C CB     . THR C 3 11 ? -99.547  28.300  -15.764 1.00 4.26 ? 20  THR A CB     4  
ATOM 9228  O OG1    . THR C 3 11 ? -100.818 28.777  -16.181 1.00 4.68 ? 20  THR A OG1    4  
ATOM 9229  C CG2    . THR C 3 11 ? -98.638  28.128  -16.980 1.00 4.79 ? 20  THR A CG2    4  
ATOM 9230  H H      . THR C 3 11 ? -101.032 26.325  -16.665 1.00 3.51 ? 20  THR A H      4  
ATOM 9231  H HA     . THR C 3 11 ? -98.762  26.584  -14.748 1.00 3.87 ? 20  THR A HA     4  
ATOM 9232  H HB     . THR C 3 11 ? -99.101  29.004  -15.079 1.00 4.50 ? 20  THR A HB     4  
ATOM 9233  H HG1    . THR C 3 11 ? -100.754 29.725  -16.307 1.00 4.92 ? 20  THR A HG1    4  
ATOM 9234  H HG21   . THR C 3 11 ? -98.987  27.298  -17.578 1.00 5.01 ? 20  THR A HG21   4  
ATOM 9235  H HG22   . THR C 3 11 ? -98.654  29.031  -17.573 1.00 5.03 ? 20  THR A HG22   4  
ATOM 9236  H HG23   . THR C 3 11 ? -97.628  27.931  -16.650 1.00 5.16 ? 20  THR A HG23   4  
ATOM 9237  N N      . GLY C 3 12 ? -101.644 26.308  -13.727 1.00 4.13 ? 21  GLY A N      4  
ATOM 9238  C CA     . GLY C 3 12 ? -102.582 26.452  -12.575 1.00 4.78 ? 21  GLY A CA     4  
ATOM 9239  C C      . GLY C 3 12 ? -101.800 26.488  -11.262 1.00 4.66 ? 21  GLY A C      4  
ATOM 9240  O O      . GLY C 3 12 ? -102.089 27.271  -10.378 1.00 5.20 ? 21  GLY A O      4  
ATOM 9241  H H      . GLY C 3 12 ? -101.787 25.601  -14.390 1.00 4.20 ? 21  GLY A H      4  
ATOM 9242  H HA2    . GLY C 3 12 ? -103.145 27.367  -12.684 1.00 5.11 ? 21  GLY A HA2    4  
ATOM 9243  H HA3    . GLY C 3 12 ? -103.260 25.613  -12.559 1.00 5.28 ? 21  GLY A HA3    4  
ATOM 9244  N N      . SER C 3 13 ? -100.815 25.645  -11.129 1.00 4.13 ? 22  SER A N      4  
ATOM 9245  C CA     . SER C 3 13 ? -100.003 25.611  -9.876  1.00 4.18 ? 22  SER A CA     4  
ATOM 9246  C C      . SER C 3 13 ? -98.677  26.329  -10.119 1.00 3.70 ? 22  SER A C      4  
ATOM 9247  O O      . SER C 3 13 ? -97.769  26.267  -9.312  1.00 3.61 ? 22  SER A O      4  
ATOM 9248  C CB     . SER C 3 13 ? -99.721  24.158  -9.497  1.00 4.44 ? 22  SER A CB     4  
ATOM 9249  O OG     . SER C 3 13 ? -100.950 23.477  -9.270  1.00 4.83 ? 22  SER A OG     4  
ATOM 9250  H H      . SER C 3 13 ? -100.606 25.026  -11.859 1.00 3.82 ? 22  SER A H      4  
ATOM 9251  H HA     . SER C 3 13 ? -100.535 26.099  -9.071  1.00 4.60 ? 22  SER A HA     4  
ATOM 9252  H HB2    . SER C 3 13 ? -99.189  23.674  -10.298 1.00 4.64 ? 22  SER A HB2    4  
ATOM 9253  H HB3    . SER C 3 13 ? -99.115  24.134  -8.601  1.00 4.59 ? 22  SER A HB3    4  
ATOM 9254  H HG     . SER C 3 13 ? -101.629 23.900  -9.800  1.00 4.97 ? 22  SER A HG     4  
ATOM 9255  N N      . GLY C 3 14 ? -98.554  27.004  -11.225 1.00 3.71 ? 23  GLY A N      4  
ATOM 9256  C CA     . GLY C 3 14 ? -97.282  27.719  -11.522 1.00 3.61 ? 23  GLY A CA     4  
ATOM 9257  C C      . GLY C 3 14 ? -96.214  26.688  -11.953 1.00 3.02 ? 23  GLY A C      4  
ATOM 9258  O O      . GLY C 3 14 ? -96.460  25.949  -12.885 1.00 2.92 ? 23  GLY A O      4  
ATOM 9259  H H      . GLY C 3 14 ? -99.297  27.037  -11.864 1.00 4.01 ? 23  GLY A H      4  
ATOM 9260  H HA2    . GLY C 3 14 ? -97.456  28.417  -12.331 1.00 4.02 ? 23  GLY A HA2    4  
ATOM 9261  H HA3    . GLY C 3 14 ? -96.972  28.255  -10.651 1.00 3.82 ? 23  GLY A HA3    4  
ATOM 9262  N N      . PRO C 3 15 ? -95.060  26.635  -11.296 1.00 2.85 ? 24  PRO A N      4  
ATOM 9263  C CA     . PRO C 3 15 ? -94.023  25.662  -11.689 1.00 2.53 ? 24  PRO A CA     4  
ATOM 9264  C C      . PRO C 3 15 ? -94.621  24.252  -11.711 1.00 2.15 ? 24  PRO A C      4  
ATOM 9265  O O      . PRO C 3 15 ? -95.409  23.888  -10.861 1.00 2.13 ? 24  PRO A O      4  
ATOM 9266  C CB     . PRO C 3 15 ? -92.921  25.793  -10.614 1.00 2.78 ? 24  PRO A CB     4  
ATOM 9267  C CG     . PRO C 3 15 ? -93.264  27.047  -9.761  1.00 3.20 ? 24  PRO A CG     4  
ATOM 9268  C CD     . PRO C 3 15 ? -94.690  27.497  -10.150 1.00 3.25 ? 24  PRO A CD     4  
ATOM 9269  H HA     . PRO C 3 15 ? -93.626  25.912  -12.661 1.00 2.64 ? 24  PRO A HA     4  
ATOM 9270  H HB2    . PRO C 3 15 ? -92.902  24.909  -9.984  1.00 2.68 ? 24  PRO A HB2    4  
ATOM 9271  H HB3    . PRO C 3 15 ? -91.955  25.925  -11.084 1.00 2.97 ? 24  PRO A HB3    4  
ATOM 9272  H HG2    . PRO C 3 15 ? -93.225  26.798  -8.705  1.00 3.31 ? 24  PRO A HG2    4  
ATOM 9273  H HG3    . PRO C 3 15 ? -92.561  27.842  -9.972  1.00 3.56 ? 24  PRO A HG3    4  
ATOM 9274  H HD2    . PRO C 3 15 ? -95.370  27.339  -9.322  1.00 3.41 ? 24  PRO A HD2    4  
ATOM 9275  H HD3    . PRO C 3 15 ? -94.694  28.535  -10.450 1.00 3.58 ? 24  PRO A HD3    4  
ATOM 9276  N N      . ILE C 3 16 ? -94.257  23.467  -12.681 1.00 1.96 ? 25  ILE A N      4  
ATOM 9277  C CA     . ILE C 3 16 ? -94.803  22.093  -12.775 1.00 1.70 ? 25  ILE A CA     4  
ATOM 9278  C C      . ILE C 3 16 ? -94.127  21.202  -11.736 1.00 1.47 ? 25  ILE A C      4  
ATOM 9279  O O      . ILE C 3 16 ? -92.926  21.243  -11.556 1.00 1.48 ? 25  ILE A O      4  
ATOM 9280  C CB     . ILE C 3 16 ? -94.501  21.550  -14.171 1.00 1.67 ? 25  ILE A CB     4  
ATOM 9281  C CG1    . ILE C 3 16 ? -95.068  22.498  -15.236 1.00 2.29 ? 25  ILE A CG1    4  
ATOM 9282  C CG2    . ILE C 3 16 ? -95.119  20.168  -14.335 1.00 2.10 ? 25  ILE A CG2    4  
ATOM 9283  C CD1    . ILE C 3 16 ? -96.567  22.724  -15.011 1.00 2.80 ? 25  ILE A CD1    4  
ATOM 9284  H H      . ILE C 3 16 ? -93.628  23.782  -13.359 1.00 2.07 ? 25  ILE A H      4  
ATOM 9285  H HA     . ILE C 3 16 ? -95.868  22.106  -12.608 1.00 1.84 ? 25  ILE A HA     4  
ATOM 9286  H HB     . ILE C 3 16 ? -93.438  21.471  -14.294 1.00 1.81 ? 25  ILE A HB     4  
ATOM 9287  H HG12   . ILE C 3 16 ? -94.551  23.446  -15.183 1.00 2.68 ? 25  ILE A HG12   4  
ATOM 9288  H HG13   . ILE C 3 16 ? -94.916  22.064  -16.212 1.00 2.71 ? 25  ILE A HG13   4  
ATOM 9289  H HG21   . ILE C 3 16 ? -96.156  20.203  -14.036 1.00 2.53 ? 25  ILE A HG21   4  
ATOM 9290  H HG22   . ILE C 3 16 ? -95.052  19.869  -15.369 1.00 2.43 ? 25  ILE A HG22   4  
ATOM 9291  H HG23   . ILE C 3 16 ? -94.587  19.463  -13.717 1.00 2.57 ? 25  ILE A HG23   4  
ATOM 9292  H HD11   . ILE C 3 16 ? -97.021  21.819  -14.641 1.00 3.17 ? 25  ILE A HD11   4  
ATOM 9293  H HD12   . ILE C 3 16 ? -96.708  23.516  -14.290 1.00 3.15 ? 25  ILE A HD12   4  
ATOM 9294  H HD13   . ILE C 3 16 ? -97.031  23.003  -15.946 1.00 3.05 ? 25  ILE A HD13   4  
ATOM 9295  N N      . GLN C 3 17 ? -94.883  20.379  -11.060 1.00 1.36 ? 26  GLN A N      4  
ATOM 9296  C CA     . GLN C 3 17 ? -94.275  19.469  -10.050 1.00 1.23 ? 26  GLN A CA     4  
ATOM 9297  C C      . GLN C 3 17 ? -93.863  18.178  -10.776 1.00 1.07 ? 26  GLN A C      4  
ATOM 9298  O O      . GLN C 3 17 ? -94.456  17.805  -11.769 1.00 1.13 ? 26  GLN A O      4  
ATOM 9299  C CB     . GLN C 3 17 ? -95.306  19.175  -8.945  1.00 1.35 ? 26  GLN A CB     4  
ATOM 9300  C CG     . GLN C 3 17 ? -94.587  18.856  -7.632  1.00 1.13 ? 26  GLN A CG     4  
ATOM 9301  C CD     . GLN C 3 17 ? -93.741  17.605  -7.824  1.00 1.20 ? 26  GLN A CD     4  
ATOM 9302  O OE1    . GLN C 3 17 ? -94.160  16.681  -8.484  1.00 1.42 ? 26  GLN A OE1    4  
ATOM 9303  N NE2    . GLN C 3 17 ? -92.552  17.545  -7.294  1.00 1.66 ? 26  GLN A NE2    4  
ATOM 9304  H H      . GLN C 3 17 ? -95.850  20.349  -11.229 1.00 1.45 ? 26  GLN A H      4  
ATOM 9305  H HA     . GLN C 3 17 ? -93.397  19.937  -9.622  1.00 1.28 ? 26  GLN A HA     4  
ATOM 9306  H HB2    . GLN C 3 17 ? -95.937  20.041  -8.806  1.00 1.82 ? 26  GLN A HB2    4  
ATOM 9307  H HB3    . GLN C 3 17 ? -95.917  18.330  -9.230  1.00 1.77 ? 26  GLN A HB3    4  
ATOM 9308  H HG2    . GLN C 3 17 ? -93.952  19.684  -7.355  1.00 1.34 ? 26  GLN A HG2    4  
ATOM 9309  H HG3    . GLN C 3 17 ? -95.315  18.682  -6.853  1.00 1.52 ? 26  GLN A HG3    4  
ATOM 9310  H HE21   . GLN C 3 17 ? -92.207  18.302  -6.778  1.00 1.92 ? 26  GLN A HE21   4  
ATOM 9311  H HE22   . GLN C 3 17 ? -92.005  16.740  -7.410  1.00 1.99 ? 26  GLN A HE22   4  
ATOM 9312  N N      . LEU C 3 18 ? -92.837  17.511  -10.321 1.00 0.97 ? 27  LEU A N      4  
ATOM 9313  C CA     . LEU C 3 18 ? -92.385  16.272  -11.025 1.00 0.86 ? 27  LEU A CA     4  
ATOM 9314  C C      . LEU C 3 18 ? -93.489  15.216  -11.089 1.00 0.75 ? 27  LEU A C      4  
ATOM 9315  O O      . LEU C 3 18 ? -93.829  14.749  -12.157 1.00 0.73 ? 27  LEU A O      4  
ATOM 9316  C CB     . LEU C 3 18 ? -91.159  15.690  -10.304 1.00 0.86 ? 27  LEU A CB     4  
ATOM 9317  C CG     . LEU C 3 18 ? -90.762  14.327  -10.934 1.00 0.84 ? 27  LEU A CG     4  
ATOM 9318  C CD1    . LEU C 3 18 ? -89.252  14.087  -10.742 1.00 1.54 ? 27  LEU A CD1    4  
ATOM 9319  C CD2    . LEU C 3 18 ? -91.576  13.154  -10.310 1.00 1.54 ? 27  LEU A CD2    4  
ATOM 9320  H H      . LEU C 3 18 ? -92.352  17.835  -9.536  1.00 1.05 ? 27  LEU A H      4  
ATOM 9321  H HA     . LEU C 3 18 ? -92.100  16.533  -12.032 1.00 0.89 ? 27  LEU A HA     4  
ATOM 9322  H HB2    . LEU C 3 18 ? -90.337  16.387  -10.410 1.00 0.97 ? 27  LEU A HB2    4  
ATOM 9323  H HB3    . LEU C 3 18 ? -91.380  15.564  -9.257  1.00 0.86 ? 27  LEU A HB3    4  
ATOM 9324  H HG     . LEU C 3 18 ? -90.970  14.366  -11.992 1.00 1.37 ? 27  LEU A HG     4  
ATOM 9325  H HD11   . LEU C 3 18 ? -88.952  14.429  -9.768  1.00 1.92 ? 27  LEU A HD11   4  
ATOM 9326  H HD12   . LEU C 3 18 ? -89.036  13.032  -10.832 1.00 2.17 ? 27  LEU A HD12   4  
ATOM 9327  H HD13   . LEU C 3 18 ? -88.703  14.632  -11.497 1.00 2.10 ? 27  LEU A HD13   4  
ATOM 9328  H HD21   . LEU C 3 18 ? -92.013  13.450  -9.368  1.00 2.10 ? 27  LEU A HD21   4  
ATOM 9329  H HD22   . LEU C 3 18 ? -92.364  12.870  -10.991 1.00 1.99 ? 27  LEU A HD22   4  
ATOM 9330  H HD23   . LEU C 3 18 ? -90.930  12.300  -10.149 1.00 2.11 ? 27  LEU A HD23   4  
ATOM 9331  N N      . TRP C 3 19 ? -94.048  14.805  -9.984  1.00 0.75 ? 28  TRP A N      4  
ATOM 9332  C CA     . TRP C 3 19 ? -95.103  13.753  -10.078 1.00 0.70 ? 28  TRP A CA     4  
ATOM 9333  C C      . TRP C 3 19 ? -96.410  14.324  -10.647 1.00 0.73 ? 28  TRP A C      4  
ATOM 9334  O O      . TRP C 3 19 ? -97.105  13.651  -11.376 1.00 0.75 ? 28  TRP A O      4  
ATOM 9335  C CB     . TRP C 3 19 ? -95.366  13.112  -8.713  1.00 0.73 ? 28  TRP A CB     4  
ATOM 9336  C CG     . TRP C 3 19 ? -96.002  14.094  -7.793  1.00 0.83 ? 28  TRP A CG     4  
ATOM 9337  C CD1    . TRP C 3 19 ? -95.342  14.936  -6.970  1.00 0.92 ? 28  TRP A CD1    4  
ATOM 9338  C CD2    . TRP C 3 19 ? -97.417  14.333  -7.583  1.00 0.90 ? 28  TRP A CD2    4  
ATOM 9339  N NE1    . TRP C 3 19 ? -96.273  15.683  -6.264  1.00 1.02 ? 28  TRP A NE1    4  
ATOM 9340  C CE2    . TRP C 3 19 ? -97.568  15.345  -6.612  1.00 1.02 ? 28  TRP A CE2    4  
ATOM 9341  C CE3    . TRP C 3 19 ? -98.571  13.770  -8.144  1.00 0.93 ? 28  TRP A CE3    4  
ATOM 9342  C CZ2    . TRP C 3 19 ? -98.831  15.784  -6.208  1.00 1.14 ? 28  TRP A CZ2    4  
ATOM 9343  C CZ3    . TRP C 3 19 ? -99.842  14.203  -7.744  1.00 1.07 ? 28  TRP A CZ3    4  
ATOM 9344  C CH2    . TRP C 3 19 ? -99.973  15.211  -6.778  1.00 1.16 ? 28  TRP A CH2    4  
ATOM 9345  H H      . TRP C 3 19 ? -93.765  15.162  -9.112  1.00 0.82 ? 28  TRP A H      4  
ATOM 9346  H HA     . TRP C 3 19 ? -94.750  12.983  -10.752 1.00 0.67 ? 28  TRP A HA     4  
ATOM 9347  H HB2    . TRP C 3 19 ? -96.034  12.273  -8.844  1.00 0.72 ? 28  TRP A HB2    4  
ATOM 9348  H HB3    . TRP C 3 19 ? -94.436  12.765  -8.289  1.00 0.74 ? 28  TRP A HB3    4  
ATOM 9349  H HD1    . TRP C 3 19 ? -94.264  15.011  -6.879  1.00 0.95 ? 28  TRP A HD1    4  
ATOM 9350  H HE1    . TRP C 3 19 ? -96.061  16.366  -5.599  1.00 1.12 ? 28  TRP A HE1    4  
ATOM 9351  H HE3    . TRP C 3 19 ? -98.480  12.992  -8.886  1.00 0.88 ? 28  TRP A HE3    4  
ATOM 9352  H HZ2    . TRP C 3 19 ? -98.926  16.560  -5.464  1.00 1.23 ? 28  TRP A HZ2    4  
ATOM 9353  H HZ3    . TRP C 3 19 ? -100.723 13.760  -8.182  1.00 1.14 ? 28  TRP A HZ3    4  
ATOM 9354  H HH2    . TRP C 3 19 ? -100.954 15.539  -6.474  1.00 1.28 ? 28  TRP A HH2    4  
ATOM 9355  N N      . GLN C 3 20 ? -96.771  15.546  -10.343 1.00 0.83 ? 29  GLN A N      4  
ATOM 9356  C CA     . GLN C 3 20 ? -98.054  16.071  -10.908 1.00 0.90 ? 29  GLN A CA     4  
ATOM 9357  C C      . GLN C 3 20 ? -98.004  15.891  -12.421 1.00 0.84 ? 29  GLN A C      4  
ATOM 9358  O O      . GLN C 3 20 ? -98.939  15.418  -13.038 1.00 0.89 ? 29  GLN A O      4  
ATOM 9359  C CB     . GLN C 3 20 ? -98.219  17.546  -10.551 1.00 1.03 ? 29  GLN A CB     4  
ATOM 9360  C CG     . GLN C 3 20 ? -99.582  18.037  -11.036 1.00 1.42 ? 29  GLN A CG     4  
ATOM 9361  C CD     . GLN C 3 20 ? -99.787  19.481  -10.588 1.00 1.81 ? 29  GLN A CD     4  
ATOM 9362  O OE1    . GLN C 3 20 ? -100.741 20.120  -10.982 1.00 2.34 ? 29  GLN A OE1    4  
ATOM 9363  N NE2    . GLN C 3 20 ? -98.921  20.028  -9.780  1.00 2.29 ? 29  GLN A NE2    4  
ATOM 9364  H H      . GLN C 3 20 ? -96.218  16.103  -9.760  1.00 0.91 ? 29  GLN A H      4  
ATOM 9365  H HA     . GLN C 3 20 ? -98.884  15.504  -10.508 1.00 0.93 ? 29  GLN A HA     4  
ATOM 9366  H HB2    . GLN C 3 20 ? -98.152  17.664  -9.479  1.00 1.31 ? 29  GLN A HB2    4  
ATOM 9367  H HB3    . GLN C 3 20 ? -97.439  18.124  -11.026 1.00 1.14 ? 29  GLN A HB3    4  
ATOM 9368  H HG2    . GLN C 3 20 ? -99.622  17.984  -12.114 1.00 1.78 ? 29  GLN A HG2    4  
ATOM 9369  H HG3    . GLN C 3 20 ? -100.360 17.418  -10.613 1.00 2.06 ? 29  GLN A HG3    4  
ATOM 9370  H HE21   . GLN C 3 20 ? -98.149  19.510  -9.467  1.00 2.35 ? 29  GLN A HE21   4  
ATOM 9371  H HE22   . GLN C 3 20 ? -99.042  20.954  -9.485  1.00 2.89 ? 29  GLN A HE22   4  
ATOM 9372  N N      . PHE C 3 21 ? -96.891  16.214  -13.011 1.00 0.80 ? 30  PHE A N      4  
ATOM 9373  C CA     . PHE C 3 21 ? -96.730  16.008  -14.472 1.00 0.77 ? 30  PHE A CA     4  
ATOM 9374  C C      . PHE C 3 21 ? -96.876  14.504  -14.782 1.00 0.68 ? 30  PHE A C      4  
ATOM 9375  O O      . PHE C 3 21 ? -97.511  14.119  -15.742 1.00 0.69 ? 30  PHE A O      4  
ATOM 9376  C CB     . PHE C 3 21 ? -95.336  16.509  -14.892 1.00 0.80 ? 30  PHE A CB     4  
ATOM 9377  C CG     . PHE C 3 21 ? -94.995  16.007  -16.274 1.00 0.77 ? 30  PHE A CG     4  
ATOM 9378  C CD1    . PHE C 3 21 ? -95.565  16.606  -17.401 1.00 0.85 ? 30  PHE A CD1    4  
ATOM 9379  C CD2    . PHE C 3 21 ? -94.102  14.940  -16.421 1.00 0.75 ? 30  PHE A CD2    4  
ATOM 9380  C CE1    . PHE C 3 21 ? -95.239  16.142  -18.679 1.00 0.86 ? 30  PHE A CE1    4  
ATOM 9381  C CE2    . PHE C 3 21 ? -93.777  14.473  -17.694 1.00 0.78 ? 30  PHE A CE2    4  
ATOM 9382  C CZ     . PHE C 3 21 ? -94.344  15.073  -18.827 1.00 0.80 ? 30  PHE A CZ     4  
ATOM 9383  H H      . PHE C 3 21 ? -96.143  16.567  -12.485 1.00 0.83 ? 30  PHE A H      4  
ATOM 9384  H HA     . PHE C 3 21 ? -97.489  16.563  -15.003 1.00 0.83 ? 30  PHE A HA     4  
ATOM 9385  H HB2    . PHE C 3 21 ? -95.334  17.588  -14.901 1.00 0.90 ? 30  PHE A HB2    4  
ATOM 9386  H HB3    . PHE C 3 21 ? -94.595  16.157  -14.186 1.00 0.79 ? 30  PHE A HB3    4  
ATOM 9387  H HD1    . PHE C 3 21 ? -96.253  17.429  -17.283 1.00 0.94 ? 30  PHE A HD1    4  
ATOM 9388  H HD2    . PHE C 3 21 ? -93.667  14.478  -15.546 1.00 0.78 ? 30  PHE A HD2    4  
ATOM 9389  H HE1    . PHE C 3 21 ? -95.677  16.604  -19.550 1.00 0.95 ? 30  PHE A HE1    4  
ATOM 9390  H HE2    . PHE C 3 21 ? -93.085  13.650  -17.803 1.00 0.83 ? 30  PHE A HE2    4  
ATOM 9391  H HZ     . PHE C 3 21 ? -94.092  14.714  -19.813 1.00 0.85 ? 30  PHE A HZ     4  
ATOM 9392  N N      . LEU C 3 22 ? -96.284  13.655  -13.976 1.00 0.65 ? 31  LEU A N      4  
ATOM 9393  C CA     . LEU C 3 22 ? -96.375  12.179  -14.223 1.00 0.60 ? 31  LEU A CA     4  
ATOM 9394  C C      . LEU C 3 22 ? -97.851  11.740  -14.161 1.00 0.60 ? 31  LEU A C      4  
ATOM 9395  O O      . LEU C 3 22 ? -98.352  11.069  -15.040 1.00 0.61 ? 31  LEU A O      4  
ATOM 9396  C CB     . LEU C 3 22 ? -95.560  11.454  -13.125 1.00 0.62 ? 31  LEU A CB     4  
ATOM 9397  C CG     . LEU C 3 22 ? -95.128  10.029  -13.550 1.00 0.79 ? 31  LEU A CG     4  
ATOM 9398  C CD1    . LEU C 3 22 ? -96.288  9.274   -14.199 1.00 1.52 ? 31  LEU A CD1    4  
ATOM 9399  C CD2    . LEU C 3 22 ? -93.948  10.089  -14.530 1.00 1.42 ? 31  LEU A CD2    4  
ATOM 9400  H H      . LEU C 3 22 ? -95.770  13.987  -13.211 1.00 0.69 ? 31  LEU A H      4  
ATOM 9401  H HA     . LEU C 3 22 ? -95.968  11.953  -15.193 1.00 0.60 ? 31  LEU A HA     4  
ATOM 9402  H HB2    . LEU C 3 22 ? -94.681  12.037  -12.904 1.00 0.80 ? 31  LEU A HB2    4  
ATOM 9403  H HB3    . LEU C 3 22 ? -96.164  11.383  -12.230 1.00 0.79 ? 31  LEU A HB3    4  
ATOM 9404  H HG     . LEU C 3 22 ? -94.818  9.488   -12.667 1.00 1.44 ? 31  LEU A HG     4  
ATOM 9405  H HD11   . LEU C 3 22 ? -97.151  9.315   -13.552 1.00 2.08 ? 31  LEU A HD11   4  
ATOM 9406  H HD12   . LEU C 3 22 ? -96.523  9.721   -15.150 1.00 2.05 ? 31  LEU A HD12   4  
ATOM 9407  H HD13   . LEU C 3 22 ? -96.003  8.244   -14.350 1.00 1.96 ? 31  LEU A HD13   4  
ATOM 9408  H HD21   . LEU C 3 22 ? -93.220  10.804  -14.181 1.00 2.02 ? 31  LEU A HD21   4  
ATOM 9409  H HD22   . LEU C 3 22 ? -93.487  9.113   -14.591 1.00 1.85 ? 31  LEU A HD22   4  
ATOM 9410  H HD23   . LEU C 3 22 ? -94.301  10.377  -15.509 1.00 2.02 ? 31  LEU A HD23   4  
ATOM 9411  N N      . LEU C 3 23 ? -98.549  12.117  -13.121 1.00 0.67 ? 32  LEU A N      4  
ATOM 9412  C CA     . LEU C 3 23 ? -99.983  11.708  -12.999 1.00 0.74 ? 32  LEU A CA     4  
ATOM 9413  C C      . LEU C 3 23 ? -100.789 12.256  -14.181 1.00 0.76 ? 32  LEU A C      4  
ATOM 9414  O O      . LEU C 3 23 ? -101.595 11.558  -14.765 1.00 0.78 ? 32  LEU A O      4  
ATOM 9415  C CB     . LEU C 3 23 ? -100.568 12.249  -11.674 1.00 0.89 ? 32  LEU A CB     4  
ATOM 9416  C CG     . LEU C 3 23 ? -100.274 11.293  -10.498 1.00 1.17 ? 32  LEU A CG     4  
ATOM 9417  C CD1    . LEU C 3 23 ? -101.161 10.039  -10.583 1.00 1.42 ? 32  LEU A CD1    4  
ATOM 9418  C CD2    . LEU C 3 23 ? -98.795  10.881  -10.513 1.00 1.91 ? 32  LEU A CD2    4  
ATOM 9419  H H      . LEU C 3 23 ? -98.130  12.656  -12.420 1.00 0.71 ? 32  LEU A H      4  
ATOM 9420  H HA     . LEU C 3 23 ? -100.042 10.635  -13.008 1.00 0.75 ? 32  LEU A HA     4  
ATOM 9421  H HB2    . LEU C 3 23 ? -100.121 13.210  -11.461 1.00 0.98 ? 32  LEU A HB2    4  
ATOM 9422  H HB3    . LEU C 3 23 ? -101.637 12.374  -11.773 1.00 1.37 ? 32  LEU A HB3    4  
ATOM 9423  H HG     . LEU C 3 23 ? -100.488 11.806  -9.569  1.00 1.80 ? 32  LEU A HG     4  
ATOM 9424  H HD11   . LEU C 3 23 ? -102.154 10.316  -10.903 1.00 1.93 ? 32  LEU A HD11   4  
ATOM 9425  H HD12   . LEU C 3 23 ? -100.741 9.337   -11.285 1.00 1.86 ? 32  LEU A HD12   4  
ATOM 9426  H HD13   . LEU C 3 23 ? -101.217 9.576   -9.610  1.00 1.89 ? 32  LEU A HD13   4  
ATOM 9427  H HD21   . LEU C 3 23 ? -98.190  11.723  -10.795 1.00 2.28 ? 32  LEU A HD21   4  
ATOM 9428  H HD22   . LEU C 3 23 ? -98.506  10.549  -9.527  1.00 2.36 ? 32  LEU A HD22   4  
ATOM 9429  H HD23   . LEU C 3 23 ? -98.646  10.080  -11.222 1.00 2.46 ? 32  LEU A HD23   4  
ATOM 9430  N N      . GLU C 3 24 ? -100.584 13.488  -14.550 1.00 0.81 ? 33  GLU A N      4  
ATOM 9431  C CA     . GLU C 3 24 ? -101.349 14.041  -15.698 1.00 0.89 ? 33  GLU A CA     4  
ATOM 9432  C C      . GLU C 3 24 ? -101.021 13.212  -16.943 1.00 0.87 ? 33  GLU A C      4  
ATOM 9433  O O      . GLU C 3 24 ? -101.896 12.753  -17.650 1.00 0.94 ? 33  GLU A O      4  
ATOM 9434  C CB     . GLU C 3 24 ? -100.945 15.503  -15.913 1.00 0.99 ? 33  GLU A CB     4  
ATOM 9435  C CG     . GLU C 3 24 ? -101.810 16.119  -17.013 1.00 1.21 ? 33  GLU A CG     4  
ATOM 9436  C CD     . GLU C 3 24 ? -101.386 17.569  -17.258 1.00 1.80 ? 33  GLU A CD     4  
ATOM 9437  O OE1    . GLU C 3 24 ? -100.932 18.205  -16.319 1.00 2.40 ? 33  GLU A OE1    4  
ATOM 9438  O OE2    . GLU C 3 24 ? -101.528 18.022  -18.381 1.00 2.46 ? 33  GLU A OE2    4  
ATOM 9439  H H      . GLU C 3 24 ? -99.930  14.045  -14.077 1.00 0.82 ? 33  GLU A H      4  
ATOM 9440  H HA     . GLU C 3 24 ? -102.409 13.982  -15.493 1.00 0.95 ? 33  GLU A HA     4  
ATOM 9441  H HB2    . GLU C 3 24 ? -101.086 16.050  -14.992 1.00 1.19 ? 33  GLU A HB2    4  
ATOM 9442  H HB3    . GLU C 3 24 ? -99.907  15.549  -16.204 1.00 1.34 ? 33  GLU A HB3    4  
ATOM 9443  H HG2    . GLU C 3 24 ? -101.689 15.552  -17.924 1.00 1.68 ? 33  GLU A HG2    4  
ATOM 9444  H HG3    . GLU C 3 24 ? -102.845 16.098  -16.710 1.00 1.81 ? 33  GLU A HG3    4  
ATOM 9445  N N      . LEU C 3 25 ? -99.760  12.999  -17.201 1.00 0.84 ? 34  LEU A N      4  
ATOM 9446  C CA     . LEU C 3 25 ? -99.364  12.188  -18.385 1.00 0.90 ? 34  LEU A CA     4  
ATOM 9447  C C      . LEU C 3 25 ? -99.830  10.740  -18.205 1.00 0.87 ? 34  LEU A C      4  
ATOM 9448  O O      . LEU C 3 25 ? -100.262 10.094  -19.139 1.00 0.94 ? 34  LEU A O      4  
ATOM 9449  C CB     . LEU C 3 25 ? -97.838  12.209  -18.523 1.00 1.01 ? 34  LEU A CB     4  
ATOM 9450  C CG     . LEU C 3 25 ? -97.411  11.437  -19.785 1.00 1.09 ? 34  LEU A CG     4  
ATOM 9451  C CD1    . LEU C 3 25 ? -97.952  12.137  -21.046 1.00 1.47 ? 34  LEU A CD1    4  
ATOM 9452  C CD2    . LEU C 3 25 ? -95.880  11.373  -19.843 1.00 1.54 ? 34  LEU A CD2    4  
ATOM 9453  H H      . LEU C 3 25 ? -99.071  13.369  -16.610 1.00 0.83 ? 34  LEU A H      4  
ATOM 9454  H HA     . LEU C 3 25 ? -99.812  12.604  -19.272 1.00 0.99 ? 34  LEU A HA     4  
ATOM 9455  H HB2    . LEU C 3 25 ? -97.500  13.233  -18.590 1.00 1.31 ? 34  LEU A HB2    4  
ATOM 9456  H HB3    . LEU C 3 25 ? -97.397  11.743  -17.654 1.00 1.54 ? 34  LEU A HB3    4  
ATOM 9457  H HG     . LEU C 3 25 ? -97.805  10.433  -19.743 1.00 1.71 ? 34  LEU A HG     4  
ATOM 9458  H HD11   . LEU C 3 25 ? -97.978  13.207  -20.891 1.00 1.85 ? 34  LEU A HD11   4  
ATOM 9459  H HD12   . LEU C 3 25 ? -97.315  11.913  -21.891 1.00 1.86 ? 34  LEU A HD12   4  
ATOM 9460  H HD13   . LEU C 3 25 ? -98.950  11.781  -21.252 1.00 2.10 ? 34  LEU A HD13   4  
ATOM 9461  H HD21   . LEU C 3 25 ? -95.468  12.351  -19.644 1.00 2.05 ? 34  LEU A HD21   4  
ATOM 9462  H HD22   . LEU C 3 25 ? -95.522  10.671  -19.102 1.00 1.91 ? 34  LEU A HD22   4  
ATOM 9463  H HD23   . LEU C 3 25 ? -95.574  11.047  -20.825 1.00 2.01 ? 34  LEU A HD23   4  
ATOM 9464  N N      . LEU C 3 26 ? -99.721  10.219  -17.018 1.00 0.83 ? 35  LEU A N      4  
ATOM 9465  C CA     . LEU C 3 26 ? -100.126 8.807   -16.787 1.00 0.88 ? 35  LEU A CA     4  
ATOM 9466  C C      . LEU C 3 26 ? -101.587 8.625   -17.190 1.00 0.97 ? 35  LEU A C      4  
ATOM 9467  O O      . LEU C 3 26 ? -101.954 7.619   -17.766 1.00 1.12 ? 35  LEU A O      4  
ATOM 9468  C CB     . LEU C 3 26 ? -99.930  8.464   -15.298 1.00 0.86 ? 35  LEU A CB     4  
ATOM 9469  C CG     . LEU C 3 26 ? -100.121 6.943   -15.047 1.00 0.95 ? 35  LEU A CG     4  
ATOM 9470  C CD1    . LEU C 3 26 ? -99.215  6.486   -13.908 1.00 1.23 ? 35  LEU A CD1    4  
ATOM 9471  C CD2    . LEU C 3 26 ? -101.565 6.631   -14.641 1.00 1.45 ? 35  LEU A CD2    4  
ATOM 9472  H H      . LEU C 3 26 ? -99.352  10.750  -16.282 1.00 0.81 ? 35  LEU A H      4  
ATOM 9473  H HA     . LEU C 3 26 ? -99.507  8.160   -17.389 1.00 0.95 ? 35  LEU A HA     4  
ATOM 9474  H HB2    . LEU C 3 26 ? -98.926  8.755   -15.012 1.00 1.13 ? 35  LEU A HB2    4  
ATOM 9475  H HB3    . LEU C 3 26 ? -100.639 9.023   -14.705 1.00 0.99 ? 35  LEU A HB3    4  
ATOM 9476  H HG     . LEU C 3 26 ? -99.870  6.390   -15.940 1.00 1.60 ? 35  LEU A HG     4  
ATOM 9477  H HD11   . LEU C 3 26 ? -99.414  7.085   -13.030 1.00 1.79 ? 35  LEU A HD11   4  
ATOM 9478  H HD12   . LEU C 3 26 ? -99.414  5.447   -13.688 1.00 1.75 ? 35  LEU A HD12   4  
ATOM 9479  H HD13   . LEU C 3 26 ? -98.183  6.602   -14.199 1.00 1.64 ? 35  LEU A HD13   4  
ATOM 9480  H HD21   . LEU C 3 26 ? -101.832 7.222   -13.777 1.00 1.97 ? 35  LEU A HD21   4  
ATOM 9481  H HD22   . LEU C 3 26 ? -102.232 6.858   -15.454 1.00 1.94 ? 35  LEU A HD22   4  
ATOM 9482  H HD23   . LEU C 3 26 ? -101.643 5.581   -14.395 1.00 1.91 ? 35  LEU A HD23   4  
ATOM 9483  N N      . THR C 3 27 ? -102.423 9.587   -16.894 1.00 0.97 ? 36  THR A N      4  
ATOM 9484  C CA     . THR C 3 27 ? -103.872 9.477   -17.255 1.00 1.14 ? 36  THR A CA     4  
ATOM 9485  C C      . THR C 3 27 ? -104.224 10.527  -18.313 1.00 1.22 ? 36  THR A C      4  
ATOM 9486  O O      . THR C 3 27 ? -104.929 11.479  -18.040 1.00 1.57 ? 36  THR A O      4  
ATOM 9487  C CB     . THR C 3 27 ? -104.718 9.734   -16.006 1.00 1.24 ? 36  THR A CB     4  
ATOM 9488  O OG1    . THR C 3 27 ? -104.463 11.045  -15.529 1.00 1.68 ? 36  THR A OG1    4  
ATOM 9489  C CG2    . THR C 3 27 ? -104.359 8.725   -14.919 1.00 1.12 ? 36  THR A CG2    4  
ATOM 9490  H H      . THR C 3 27 ? -102.097 10.385  -16.430 1.00 0.94 ? 36  THR A H      4  
ATOM 9491  H HA     . THR C 3 27 ? -104.093 8.492   -17.640 1.00 1.28 ? 36  THR A HA     4  
ATOM 9492  H HB     . THR C 3 27 ? -105.762 9.634   -16.254 1.00 1.66 ? 36  THR A HB     4  
ATOM 9493  H HG1    . THR C 3 27 ? -104.185 11.581  -16.272 1.00 2.13 ? 36  THR A HG1    4  
ATOM 9494  H HG21   . THR C 3 27 ? -104.404 7.726   -15.323 1.00 1.67 ? 36  THR A HG21   4  
ATOM 9495  H HG22   . THR C 3 27 ? -103.360 8.924   -14.560 1.00 1.44 ? 36  THR A HG22   4  
ATOM 9496  H HG23   . THR C 3 27 ? -105.060 8.817   -14.103 1.00 1.54 ? 36  THR A HG23   4  
ATOM 9497  N N      . ASP C 3 28 ? -103.742 10.353  -19.522 1.00 1.13 ? 37  ASP A N      4  
ATOM 9498  C CA     . ASP C 3 28 ? -104.042 11.328  -20.624 1.00 1.32 ? 37  ASP A CA     4  
ATOM 9499  C C      . ASP C 3 28 ? -104.868 10.634  -21.720 1.00 1.23 ? 37  ASP A C      4  
ATOM 9500  O O      . ASP C 3 28 ? -105.821 9.938   -21.434 1.00 1.40 ? 37  ASP A O      4  
ATOM 9501  C CB     . ASP C 3 28 ? -102.723 11.864  -21.197 1.00 1.71 ? 37  ASP A CB     4  
ATOM 9502  C CG     . ASP C 3 28 ? -101.819 10.700  -21.607 1.00 2.39 ? 37  ASP A CG     4  
ATOM 9503  O OD1    . ASP C 3 28 ? -102.052 9.600   -21.139 1.00 3.08 ? 37  ASP A OD1    4  
ATOM 9504  O OD2    . ASP C 3 28 ? -100.900 10.932  -22.376 1.00 2.90 ? 37  ASP A OD2    4  
ATOM 9505  H H      . ASP C 3 28 ? -103.181 9.573   -19.707 1.00 1.13 ? 37  ASP A H      4  
ATOM 9506  H HA     . ASP C 3 28 ? -104.616 12.158  -20.234 1.00 1.55 ? 37  ASP A HA     4  
ATOM 9507  H HB2    . ASP C 3 28 ? -102.928 12.483  -22.056 1.00 2.12 ? 37  ASP A HB2    4  
ATOM 9508  H HB3    . ASP C 3 28 ? -102.222 12.453  -20.444 1.00 2.03 ? 37  ASP A HB3    4  
ATOM 9509  N N      . LYS C 3 29 ? -104.535 10.838  -22.968 1.00 1.35 ? 38  LYS A N      4  
ATOM 9510  C CA     . LYS C 3 29 ? -105.329 10.209  -24.069 1.00 1.54 ? 38  LYS A CA     4  
ATOM 9511  C C      . LYS C 3 29 ? -105.322 8.682   -23.949 1.00 1.38 ? 38  LYS A C      4  
ATOM 9512  O O      . LYS C 3 29 ? -105.360 8.131   -22.867 1.00 1.52 ? 38  LYS A O      4  
ATOM 9513  C CB     . LYS C 3 29 ? -104.785 10.667  -25.445 1.00 1.99 ? 38  LYS A CB     4  
ATOM 9514  C CG     . LYS C 3 29 ? -103.433 10.012  -25.832 1.00 2.26 ? 38  LYS A CG     4  
ATOM 9515  C CD     . LYS C 3 29 ? -102.486 9.910   -24.637 1.00 2.62 ? 38  LYS A CD     4  
ATOM 9516  C CE     . LYS C 3 29 ? -101.095 9.506   -25.129 1.00 2.90 ? 38  LYS A CE     4  
ATOM 9517  N NZ     . LYS C 3 29 ? -100.527 10.591  -25.978 1.00 3.33 ? 38  LYS A NZ     4  
ATOM 9518  H H      . LYS C 3 29 ? -103.783 11.420  -23.184 1.00 1.53 ? 38  LYS A H      4  
ATOM 9519  H HA     . LYS C 3 29 ? -106.353 10.546  -23.979 1.00 1.79 ? 38  LYS A HA     4  
ATOM 9520  H HB2    . LYS C 3 29 ? -105.514 10.424  -26.201 1.00 2.39 ? 38  LYS A HB2    4  
ATOM 9521  H HB3    . LYS C 3 29 ? -104.658 11.739  -25.421 1.00 2.33 ? 38  LYS A HB3    4  
ATOM 9522  H HG2    . LYS C 3 29 ? -103.601 9.028   -26.239 1.00 2.66 ? 38  LYS A HG2    4  
ATOM 9523  H HG3    . LYS C 3 29 ? -102.965 10.623  -26.593 1.00 2.59 ? 38  LYS A HG3    4  
ATOM 9524  H HD2    . LYS C 3 29 ? -102.425 10.863  -24.144 1.00 2.95 ? 38  LYS A HD2    4  
ATOM 9525  H HD3    . LYS C 3 29 ? -102.841 9.161   -23.948 1.00 2.89 ? 38  LYS A HD3    4  
ATOM 9526  H HE2    . LYS C 3 29 ? -100.450 9.338   -24.280 1.00 2.93 ? 38  LYS A HE2    4  
ATOM 9527  H HE3    . LYS C 3 29 ? -101.170 8.599   -25.709 1.00 3.19 ? 38  LYS A HE3    4  
ATOM 9528  H HZ1    . LYS C 3 29 ? -100.770 11.516  -25.568 1.00 3.54 ? 38  LYS A HZ1    4  
ATOM 9529  H HZ2    . LYS C 3 29 ? -99.494  10.491  -26.019 1.00 3.57 ? 38  LYS A HZ2    4  
ATOM 9530  H HZ3    . LYS C 3 29 ? -100.918 10.521  -26.939 1.00 3.68 ? 38  LYS A HZ3    4  
ATOM 9531  N N      . SER C 3 30 ? -105.277 7.996   -25.051 1.00 1.47 ? 39  SER A N      4  
ATOM 9532  C CA     . SER C 3 30 ? -105.276 6.511   -25.012 1.00 1.66 ? 39  SER A CA     4  
ATOM 9533  C C      . SER C 3 30 ? -104.013 6.004   -24.303 1.00 1.51 ? 39  SER A C      4  
ATOM 9534  O O      . SER C 3 30 ? -104.062 5.050   -23.556 1.00 2.21 ? 39  SER A O      4  
ATOM 9535  C CB     . SER C 3 30 ? -105.284 5.969   -26.443 1.00 2.14 ? 39  SER A CB     4  
ATOM 9536  O OG     . SER C 3 30 ? -105.449 4.559   -26.405 1.00 2.66 ? 39  SER A OG     4  
ATOM 9537  H H      . SER C 3 30 ? -105.256 8.461   -25.914 1.00 1.64 ? 39  SER A H      4  
ATOM 9538  H HA     . SER C 3 30 ? -106.153 6.159   -24.490 1.00 1.84 ? 39  SER A HA     4  
ATOM 9539  H HB2    . SER C 3 30 ? -106.102 6.406   -26.995 1.00 2.27 ? 39  SER A HB2    4  
ATOM 9540  H HB3    . SER C 3 30 ? -104.348 6.221   -26.929 1.00 2.50 ? 39  SER A HB3    4  
ATOM 9541  H HG     . SER C 3 30 ? -106.087 4.356   -25.716 1.00 2.78 ? 39  SER A HG     4  
ATOM 9542  N N      . CYS C 3 31 ? -102.883 6.622   -24.534 1.00 1.29 ? 40  CYS A N      4  
ATOM 9543  C CA     . CYS C 3 31 ? -101.618 6.156   -23.876 1.00 1.29 ? 40  CYS A CA     4  
ATOM 9544  C C      . CYS C 3 31 ? -101.195 4.808   -24.485 1.00 1.22 ? 40  CYS A C      4  
ATOM 9545  O O      . CYS C 3 31 ? -100.058 4.392   -24.381 1.00 1.43 ? 40  CYS A O      4  
ATOM 9546  C CB     . CYS C 3 31 ? -101.844 5.993   -22.357 1.00 1.49 ? 40  CYS A CB     4  
ATOM 9547  S SG     . CYS C 3 31 ? -103.065 7.201   -21.788 1.00 2.22 ? 40  CYS A SG     4  
ATOM 9548  H H      . CYS C 3 31 ? -102.860 7.386   -25.149 1.00 1.74 ? 40  CYS A H      4  
ATOM 9549  H HA     . CYS C 3 31 ? -100.837 6.884   -24.047 1.00 1.44 ? 40  CYS A HA     4  
ATOM 9550  H HB2    . CYS C 3 31 ? -102.201 4.996   -22.139 1.00 2.08 ? 40  CYS A HB2    4  
ATOM 9551  H HB3    . CYS C 3 31 ? -100.913 6.159   -21.836 1.00 1.69 ? 40  CYS A HB3    4  
ATOM 9552  H HG     . CYS C 3 31 ? -102.691 8.077   -21.900 1.00 2.54 ? 40  CYS A HG     4  
ATOM 9553  N N      . GLN C 3 32 ? -102.113 4.131   -25.120 1.00 1.22 ? 41  GLN A N      4  
ATOM 9554  C CA     . GLN C 3 32 ? -101.810 2.815   -25.749 1.00 1.29 ? 41  GLN A CA     4  
ATOM 9555  C C      . GLN C 3 32 ? -100.778 2.966   -26.870 1.00 1.34 ? 41  GLN A C      4  
ATOM 9556  O O      . GLN C 3 32 ? -99.994  2.076   -27.126 1.00 1.87 ? 41  GLN A O      4  
ATOM 9557  C CB     . GLN C 3 32 ? -103.105 2.256   -26.335 1.00 1.53 ? 41  GLN A CB     4  
ATOM 9558  C CG     . GLN C 3 32 ? -104.030 1.790   -25.203 1.00 1.82 ? 41  GLN A CG     4  
ATOM 9559  C CD     . GLN C 3 32 ? -103.546 0.440   -24.654 1.00 2.46 ? 41  GLN A CD     4  
ATOM 9560  O OE1    . GLN C 3 32 ? -102.584 -0.119  -25.143 1.00 3.09 ? 41  GLN A OE1    4  
ATOM 9561  N NE2    . GLN C 3 32 ? -104.178 -0.114  -23.648 1.00 3.04 ? 41  GLN A NE2    4  
ATOM 9562  H H      . GLN C 3 32 ? -103.017 4.494   -25.188 1.00 1.38 ? 41  GLN A H      4  
ATOM 9563  H HA     . GLN C 3 32 ? -101.435 2.131   -25.004 1.00 1.32 ? 41  GLN A HA     4  
ATOM 9564  H HB2    . GLN C 3 32 ? -103.596 3.039   -26.900 1.00 1.80 ? 41  GLN A HB2    4  
ATOM 9565  H HB3    . GLN C 3 32 ? -102.882 1.424   -26.986 1.00 1.71 ? 41  GLN A HB3    4  
ATOM 9566  H HG2    . GLN C 3 32 ? -104.024 2.524   -24.410 1.00 2.21 ? 41  GLN A HG2    4  
ATOM 9567  H HG3    . GLN C 3 32 ? -105.033 1.682   -25.585 1.00 2.11 ? 41  GLN A HG3    4  
ATOM 9568  H HE21   . GLN C 3 32 ? -104.954 0.334   -23.249 1.00 3.14 ? 41  GLN A HE21   4  
ATOM 9569  H HE22   . GLN C 3 32 ? -103.878 -0.979  -23.298 1.00 3.73 ? 41  GLN A HE22   4  
ATOM 9570  N N      . SER C 3 33 ? -100.791 4.068   -27.565 1.00 1.34 ? 42  SER A N      4  
ATOM 9571  C CA     . SER C 3 33 ? -99.831  4.241   -28.692 1.00 1.48 ? 42  SER A CA     4  
ATOM 9572  C C      . SER C 3 33 ? -98.443  4.629   -28.183 1.00 1.27 ? 42  SER A C      4  
ATOM 9573  O O      . SER C 3 33 ? -97.466  4.495   -28.892 1.00 1.35 ? 42  SER A O      4  
ATOM 9574  C CB     . SER C 3 33 ? -100.347 5.333   -29.627 1.00 1.80 ? 42  SER A CB     4  
ATOM 9575  O OG     . SER C 3 33 ? -101.519 4.868   -30.279 1.00 2.41 ? 42  SER A OG     4  
ATOM 9576  H H      . SER C 3 33 ? -101.447 4.768   -27.367 1.00 1.65 ? 42  SER A H      4  
ATOM 9577  H HA     . SER C 3 33 ? -99.759  3.315   -29.241 1.00 1.66 ? 42  SER A HA     4  
ATOM 9578  H HB2    . SER C 3 33 ? -100.585 6.216   -29.059 1.00 2.13 ? 42  SER A HB2    4  
ATOM 9579  H HB3    . SER C 3 33 ? -99.585  5.570   -30.358 1.00 2.05 ? 42  SER A HB3    4  
ATOM 9580  H HG     . SER C 3 33 ? -101.379 3.949   -30.517 1.00 2.79 ? 42  SER A HG     4  
ATOM 9581  N N      . PHE C 3 34 ? -98.338  5.128   -26.975 1.00 1.12 ? 43  PHE A N      4  
ATOM 9582  C CA     . PHE C 3 34 ? -96.999  5.545   -26.441 1.00 1.04 ? 43  PHE A CA     4  
ATOM 9583  C C      . PHE C 3 34 ? -96.668  4.774   -25.165 1.00 0.94 ? 43  PHE A C      4  
ATOM 9584  O O      . PHE C 3 34 ? -95.548  4.792   -24.693 1.00 0.91 ? 43  PHE A O      4  
ATOM 9585  C CB     . PHE C 3 34 ? -97.055  7.038   -26.139 1.00 1.12 ? 43  PHE A CB     4  
ATOM 9586  C CG     . PHE C 3 34 ? -97.443  7.774   -27.396 1.00 1.19 ? 43  PHE A CG     4  
ATOM 9587  C CD1    . PHE C 3 34 ? -98.795  7.926   -27.723 1.00 1.35 ? 43  PHE A CD1    4  
ATOM 9588  C CD2    . PHE C 3 34 ? -96.457  8.304   -28.232 1.00 1.41 ? 43  PHE A CD2    4  
ATOM 9589  C CE1    . PHE C 3 34 ? -99.162  8.610   -28.886 1.00 1.53 ? 43  PHE A CE1    4  
ATOM 9590  C CE2    . PHE C 3 34 ? -96.820  8.988   -29.397 1.00 1.56 ? 43  PHE A CE2    4  
ATOM 9591  C CZ     . PHE C 3 34 ? -98.174  9.142   -29.725 1.00 1.54 ? 43  PHE A CZ     4  
ATOM 9592  H H      . PHE C 3 34 ? -99.141  5.242   -26.422 1.00 1.16 ? 43  PHE A H      4  
ATOM 9593  H HA     . PHE C 3 34 ? -96.225  5.363   -27.174 1.00 1.15 ? 43  PHE A HA     4  
ATOM 9594  H HB2    . PHE C 3 34 ? -97.788  7.223   -25.368 1.00 1.21 ? 43  PHE A HB2    4  
ATOM 9595  H HB3    . PHE C 3 34 ? -96.084  7.376   -25.810 1.00 1.28 ? 43  PHE A HB3    4  
ATOM 9596  H HD1    . PHE C 3 34 ? -99.555  7.515   -27.075 1.00 1.52 ? 43  PHE A HD1    4  
ATOM 9597  H HD2    . PHE C 3 34 ? -95.413  8.182   -27.979 1.00 1.63 ? 43  PHE A HD2    4  
ATOM 9598  H HE1    . PHE C 3 34 ? -100.207 8.724   -29.137 1.00 1.81 ? 43  PHE A HE1    4  
ATOM 9599  H HE2    . PHE C 3 34 ? -96.057  9.400   -30.041 1.00 1.84 ? 43  PHE A HE2    4  
ATOM 9600  H HZ     . PHE C 3 34 ? -98.455  9.672   -30.624 1.00 1.73 ? 43  PHE A HZ     4  
ATOM 9601  N N      . ILE C 3 35 ? -97.627  4.106   -24.592 1.00 0.93 ? 44  ILE A N      4  
ATOM 9602  C CA     . ILE C 3 35 ? -97.353  3.349   -23.339 1.00 0.88 ? 44  ILE A CA     4  
ATOM 9603  C C      . ILE C 3 35 ? -98.479  2.337   -23.100 1.00 0.92 ? 44  ILE A C      4  
ATOM 9604  O O      . ILE C 3 35 ? -99.344  2.181   -23.939 1.00 1.02 ? 44  ILE A O      4  
ATOM 9605  C CB     . ILE C 3 35 ? -97.224  4.354   -22.189 1.00 0.83 ? 44  ILE A CB     4  
ATOM 9606  C CG1    . ILE C 3 35 ? -96.860  3.619   -20.885 1.00 1.11 ? 44  ILE A CG1    4  
ATOM 9607  C CG2    . ILE C 3 35 ? -98.534  5.128   -22.020 1.00 0.85 ? 44  ILE A CG2    4  
ATOM 9608  C CD1    . ILE C 3 35 ? -96.120  4.565   -19.932 1.00 1.14 ? 44  ILE A CD1    4  
ATOM 9609  H H      . ILE C 3 35 ? -98.527  4.107   -24.979 1.00 0.99 ? 44  ILE A H      4  
ATOM 9610  H HA     . ILE C 3 35 ? -96.421  2.815   -23.449 1.00 0.93 ? 44  ILE A HA     4  
ATOM 9611  H HB     . ILE C 3 35 ? -96.436  5.056   -22.435 1.00 1.08 ? 44  ILE A HB     4  
ATOM 9612  H HG12   . ILE C 3 35 ? -97.759  3.262   -20.404 1.00 1.23 ? 44  ILE A HG12   4  
ATOM 9613  H HG13   . ILE C 3 35 ? -96.222  2.780   -21.115 1.00 1.52 ? 44  ILE A HG13   4  
ATOM 9614  H HG21   . ILE C 3 35 ? -99.349  4.437   -21.881 1.00 1.50 ? 44  ILE A HG21   4  
ATOM 9615  H HG22   . ILE C 3 35 ? -98.459  5.776   -21.160 1.00 1.37 ? 44  ILE A HG22   4  
ATOM 9616  H HG23   . ILE C 3 35 ? -98.713  5.724   -22.903 1.00 1.24 ? 44  ILE A HG23   4  
ATOM 9617  H HD11   . ILE C 3 35 ? -96.513  5.567   -20.027 1.00 1.68 ? 44  ILE A HD11   4  
ATOM 9618  H HD12   . ILE C 3 35 ? -96.249  4.222   -18.913 1.00 1.39 ? 44  ILE A HD12   4  
ATOM 9619  H HD13   . ILE C 3 35 ? -95.072  4.568   -20.181 1.00 1.56 ? 44  ILE A HD13   4  
ATOM 9620  N N      . SER C 3 36 ? -98.477  1.617   -21.989 1.00 0.88 ? 45  SER A N      4  
ATOM 9621  C CA     . SER C 3 36 ? -99.554  0.599   -21.765 1.00 0.95 ? 45  SER A CA     4  
ATOM 9622  C C      . SER C 3 36 ? -100.340 0.916   -20.498 1.00 0.90 ? 45  SER A C      4  
ATOM 9623  O O      . SER C 3 36 ? -99.799  1.016   -19.412 1.00 0.88 ? 45  SER A O      4  
ATOM 9624  C CB     . SER C 3 36 ? -98.919  -0.784  -21.628 1.00 1.05 ? 45  SER A CB     4  
ATOM 9625  O OG     . SER C 3 36 ? -99.942  -1.767  -21.676 1.00 1.71 ? 45  SER A OG     4  
ATOM 9626  H H      . SER C 3 36 ? -97.767  1.731   -21.320 1.00 0.85 ? 45  SER A H      4  
ATOM 9627  H HA     . SER C 3 36 ? -100.239 0.583   -22.602 1.00 1.03 ? 45  SER A HA     4  
ATOM 9628  H HB2    . SER C 3 36 ? -98.229  -0.949  -22.439 1.00 1.42 ? 45  SER A HB2    4  
ATOM 9629  H HB3    . SER C 3 36 ? -98.390  -0.846  -20.685 1.00 1.48 ? 45  SER A HB3    4  
ATOM 9630  H HG     . SER C 3 36 ? -100.225 -1.851  -22.590 1.00 2.19 ? 45  SER A HG     4  
ATOM 9631  N N      . TRP C 3 37 ? -101.630 1.045   -20.647 1.00 0.95 ? 46  TRP A N      4  
ATOM 9632  C CA     . TRP C 3 37 ? -102.530 1.329   -19.491 1.00 0.94 ? 46  TRP A CA     4  
ATOM 9633  C C      . TRP C 3 37 ? -103.455 0.107   -19.342 1.00 1.08 ? 46  TRP A C      4  
ATOM 9634  O O      . TRP C 3 37 ? -104.348 -0.100  -20.140 1.00 1.46 ? 46  TRP A O      4  
ATOM 9635  C CB     . TRP C 3 37 ? -103.345 2.599   -19.833 1.00 0.98 ? 46  TRP A CB     4  
ATOM 9636  C CG     . TRP C 3 37 ? -103.437 3.542   -18.668 1.00 0.93 ? 46  TRP A CG     4  
ATOM 9637  C CD1    . TRP C 3 37 ? -103.245 4.877   -18.762 1.00 0.93 ? 46  TRP A CD1    4  
ATOM 9638  C CD2    . TRP C 3 37 ? -103.741 3.270   -17.264 1.00 0.95 ? 46  TRP A CD2    4  
ATOM 9639  N NE1    . TRP C 3 37 ? -103.425 5.448   -17.517 1.00 0.92 ? 46  TRP A NE1    4  
ATOM 9640  C CE2    . TRP C 3 37 ? -103.726 4.498   -16.556 1.00 0.93 ? 46  TRP A CE2    4  
ATOM 9641  C CE3    . TRP C 3 37 ? -104.028 2.094   -16.539 1.00 1.06 ? 46  TRP A CE3    4  
ATOM 9642  C CZ2    . TRP C 3 37 ? -103.985 4.556   -15.182 1.00 0.99 ? 46  TRP A CZ2    4  
ATOM 9643  C CZ3    . TRP C 3 37 ? -104.286 2.149   -15.158 1.00 1.14 ? 46  TRP A CZ3    4  
ATOM 9644  C CH2    . TRP C 3 37 ? -104.266 3.378   -14.482 1.00 1.10 ? 46  TRP A CH2    4  
ATOM 9645  H H      . TRP C 3 37 ? -102.020 0.938   -21.541 1.00 1.03 ? 46  TRP A H      4  
ATOM 9646  H HA     . TRP C 3 37 ? -101.951 1.473   -18.583 1.00 0.89 ? 46  TRP A HA     4  
ATOM 9647  H HB2    . TRP C 3 37 ? -102.855 3.110   -20.648 1.00 0.99 ? 46  TRP A HB2    4  
ATOM 9648  H HB3    . TRP C 3 37 ? -104.343 2.323   -20.145 1.00 1.09 ? 46  TRP A HB3    4  
ATOM 9649  H HD1    . TRP C 3 37 ? -103.001 5.412   -19.670 1.00 0.98 ? 46  TRP A HD1    4  
ATOM 9650  H HE1    . TRP C 3 37 ? -103.347 6.405   -17.319 1.00 0.95 ? 46  TRP A HE1    4  
ATOM 9651  H HE3    . TRP C 3 37 ? -104.044 1.145   -17.047 1.00 1.12 ? 46  TRP A HE3    4  
ATOM 9652  H HZ2    . TRP C 3 37 ? -103.967 5.504   -14.665 1.00 1.00 ? 46  TRP A HZ2    4  
ATOM 9653  H HZ3    . TRP C 3 37 ? -104.502 1.240   -14.614 1.00 1.27 ? 46  TRP A HZ3    4  
ATOM 9654  H HH2    . TRP C 3 37 ? -104.466 3.414   -13.419 1.00 1.19 ? 46  TRP A HH2    4  
ATOM 9655  N N      . THR C 3 38 ? -103.240 -0.712  -18.350 1.00 1.02 ? 47  THR A N      4  
ATOM 9656  C CA     . THR C 3 38 ? -104.095 -1.927  -18.188 1.00 1.19 ? 47  THR A CA     4  
ATOM 9657  C C      . THR C 3 38 ? -105.533 -1.520  -17.835 1.00 1.21 ? 47  THR A C      4  
ATOM 9658  O O      . THR C 3 38 ? -105.775 -0.448  -17.317 1.00 1.40 ? 47  THR A O      4  
ATOM 9659  C CB     . THR C 3 38 ? -103.526 -2.769  -17.052 1.00 1.42 ? 47  THR A CB     4  
ATOM 9660  O OG1    . THR C 3 38 ? -103.670 -2.042  -15.848 1.00 2.04 ? 47  THR A OG1    4  
ATOM 9661  C CG2    . THR C 3 38 ? -102.040 -3.051  -17.306 1.00 1.85 ? 47  THR A CG2    4  
ATOM 9662  H H      . THR C 3 38 ? -102.506 -0.542  -17.722 1.00 1.07 ? 47  THR A H      4  
ATOM 9663  H HA     . THR C 3 38 ? -104.091 -2.502  -19.101 1.00 1.47 ? 47  THR A HA     4  
ATOM 9664  H HB     . THR C 3 38 ? -104.064 -3.701  -16.983 1.00 1.84 ? 47  THR A HB     4  
ATOM 9665  H HG1    . THR C 3 38 ? -104.004 -1.168  -16.069 1.00 2.47 ? 47  THR A HG1    4  
ATOM 9666  H HG21   . THR C 3 38 ? -101.920 -3.510  -18.277 1.00 2.30 ? 47  THR A HG21   4  
ATOM 9667  H HG22   . THR C 3 38 ? -101.487 -2.125  -17.275 1.00 2.22 ? 47  THR A HG22   4  
ATOM 9668  H HG23   . THR C 3 38 ? -101.665 -3.718  -16.544 1.00 2.33 ? 47  THR A HG23   4  
ATOM 9669  N N      . GLY C 3 39 ? -106.489 -2.376  -18.108 1.00 1.49 ? 48  GLY A N      4  
ATOM 9670  C CA     . GLY C 3 39 ? -107.914 -2.050  -17.787 1.00 1.74 ? 48  GLY A CA     4  
ATOM 9671  C C      . GLY C 3 39 ? -108.278 -2.650  -16.428 1.00 1.64 ? 48  GLY A C      4  
ATOM 9672  O O      . GLY C 3 39 ? -109.166 -3.473  -16.320 1.00 1.95 ? 48  GLY A O      4  
ATOM 9673  H H      . GLY C 3 39 ? -106.270 -3.236  -18.522 1.00 1.75 ? 48  GLY A H      4  
ATOM 9674  H HA2    . GLY C 3 39 ? -108.047 -0.976  -17.758 1.00 1.91 ? 48  GLY A HA2    4  
ATOM 9675  H HA3    . GLY C 3 39 ? -108.558 -2.469  -18.544 1.00 2.13 ? 48  GLY A HA3    4  
ATOM 9676  N N      . ASP C 3 40 ? -107.594 -2.237  -15.391 1.00 1.50 ? 49  ASP A N      4  
ATOM 9677  C CA     . ASP C 3 40 ? -107.874 -2.759  -14.015 1.00 1.64 ? 49  ASP A CA     4  
ATOM 9678  C C      . ASP C 3 40 ? -108.210 -1.572  -13.113 1.00 1.38 ? 49  ASP A C      4  
ATOM 9679  O O      . ASP C 3 40 ? -108.673 -0.549  -13.579 1.00 1.37 ? 49  ASP A O      4  
ATOM 9680  C CB     . ASP C 3 40 ? -106.625 -3.480  -13.488 1.00 2.11 ? 49  ASP A CB     4  
ATOM 9681  C CG     . ASP C 3 40 ? -106.963 -4.256  -12.212 1.00 2.89 ? 49  ASP A CG     4  
ATOM 9682  O OD1    . ASP C 3 40 ? -107.915 -5.018  -12.236 1.00 3.56 ? 49  ASP A OD1    4  
ATOM 9683  O OD2    . ASP C 3 40 ? -106.265 -4.069  -11.227 1.00 3.35 ? 49  ASP A OD2    4  
ATOM 9684  H H      . ASP C 3 40 ? -106.888 -1.569  -15.516 1.00 1.54 ? 49  ASP A H      4  
ATOM 9685  H HA     . ASP C 3 40 ? -108.711 -3.446  -14.034 1.00 1.89 ? 49  ASP A HA     4  
ATOM 9686  H HB2    . ASP C 3 40 ? -106.266 -4.168  -14.240 1.00 2.24 ? 49  ASP A HB2    4  
ATOM 9687  H HB3    . ASP C 3 40 ? -105.856 -2.754  -13.274 1.00 2.45 ? 49  ASP A HB3    4  
ATOM 9688  N N      . GLY C 3 41 ? -107.978 -1.681  -11.834 1.00 1.32 ? 50  GLY A N      4  
ATOM 9689  C CA     . GLY C 3 41 ? -108.288 -0.538  -10.929 1.00 1.25 ? 50  GLY A CA     4  
ATOM 9690  C C      . GLY C 3 41 ? -107.177 0.507   -11.063 1.00 1.14 ? 50  GLY A C      4  
ATOM 9691  O O      . GLY C 3 41 ? -107.411 1.619   -11.491 1.00 1.18 ? 50  GLY A O      4  
ATOM 9692  H H      . GLY C 3 41 ? -107.601 -2.505  -11.469 1.00 1.46 ? 50  GLY A H      4  
ATOM 9693  H HA2    . GLY C 3 41 ? -109.235 -0.102  -11.213 1.00 1.28 ? 50  GLY A HA2    4  
ATOM 9694  H HA3    . GLY C 3 41 ? -108.338 -0.884  -9.909  1.00 1.37 ? 50  GLY A HA3    4  
ATOM 9695  N N      . TRP C 3 42 ? -105.962 0.151   -10.729 1.00 1.06 ? 51  TRP A N      4  
ATOM 9696  C CA     . TRP C 3 42 ? -104.828 1.116   -10.871 1.00 0.97 ? 51  TRP A CA     4  
ATOM 9697  C C      . TRP C 3 42 ? -103.549 0.315   -11.136 1.00 0.93 ? 51  TRP A C      4  
ATOM 9698  O O      . TRP C 3 42 ? -102.671 0.234   -10.303 1.00 0.98 ? 51  TRP A O      4  
ATOM 9699  C CB     . TRP C 3 42 ? -104.667 1.957   -9.588  1.00 0.99 ? 51  TRP A CB     4  
ATOM 9700  C CG     . TRP C 3 42 ? -103.859 3.192   -9.874  1.00 0.94 ? 51  TRP A CG     4  
ATOM 9701  C CD1    . TRP C 3 42 ? -102.520 3.226   -10.070 1.00 1.03 ? 51  TRP A CD1    4  
ATOM 9702  C CD2    . TRP C 3 42 ? -104.318 4.572   -9.983  1.00 0.88 ? 51  TRP A CD2    4  
ATOM 9703  N NE1    . TRP C 3 42 ? -102.133 4.533   -10.303 1.00 0.97 ? 51  TRP A NE1    4  
ATOM 9704  C CE2    . TRP C 3 42 ? -103.205 5.400   -10.257 1.00 0.87 ? 51  TRP A CE2    4  
ATOM 9705  C CE3    . TRP C 3 42 ? -105.582 5.177   -9.874  1.00 0.97 ? 51  TRP A CE3    4  
ATOM 9706  C CZ2    . TRP C 3 42 ? -103.343 6.782   -10.417 1.00 0.86 ? 51  TRP A CZ2    4  
ATOM 9707  C CZ3    . TRP C 3 42 ? -105.724 6.564   -10.035 1.00 1.05 ? 51  TRP A CZ3    4  
ATOM 9708  C CH2    . TRP C 3 42 ? -104.608 7.366   -10.306 1.00 0.97 ? 51  TRP A CH2    4  
ATOM 9709  H H      . TRP C 3 42 ? -105.790 -0.760  -10.408 1.00 1.09 ? 51  TRP A H      4  
ATOM 9710  H HA     . TRP C 3 42 ? -105.018 1.770   -11.713 1.00 0.96 ? 51  TRP A HA     4  
ATOM 9711  H HB2    . TRP C 3 42 ? -105.640 2.250   -9.225  1.00 1.05 ? 51  TRP A HB2    4  
ATOM 9712  H HB3    . TRP C 3 42 ? -104.166 1.372   -8.833  1.00 1.03 ? 51  TRP A HB3    4  
ATOM 9713  H HD1    . TRP C 3 42 ? -101.861 2.374   -10.055 1.00 1.18 ? 51  TRP A HD1    4  
ATOM 9714  H HE1    . TRP C 3 42 ? -101.216 4.826   -10.479 1.00 1.05 ? 51  TRP A HE1    4  
ATOM 9715  H HE3    . TRP C 3 42 ? -106.449 4.570   -9.666  1.00 1.05 ? 51  TRP A HE3    4  
ATOM 9716  H HZ2    . TRP C 3 42 ? -102.478 7.394   -10.625 1.00 0.87 ? 51  TRP A HZ2    4  
ATOM 9717  H HZ3    . TRP C 3 42 ? -106.701 7.016   -9.950  1.00 1.22 ? 51  TRP A HZ3    4  
ATOM 9718  H HH2    . TRP C 3 42 ? -104.725 8.432   -10.429 1.00 1.05 ? 51  TRP A HH2    4  
ATOM 9719  N N      . GLU C 3 43 ? -103.441 -0.281  -12.304 1.00 0.91 ? 52  GLU A N      4  
ATOM 9720  C CA     . GLU C 3 43 ? -102.223 -1.079  -12.661 1.00 0.89 ? 52  GLU A CA     4  
ATOM 9721  C C      . GLU C 3 43 ? -101.591 -0.426  -13.897 1.00 0.85 ? 52  GLU A C      4  
ATOM 9722  O O      . GLU C 3 43 ? -102.042 -0.603  -15.010 1.00 0.98 ? 52  GLU A O      4  
ATOM 9723  C CB     . GLU C 3 43 ? -102.635 -2.527  -12.963 1.00 0.97 ? 52  GLU A CB     4  
ATOM 9724  C CG     . GLU C 3 43 ? -103.036 -3.244  -11.669 1.00 1.48 ? 52  GLU A CG     4  
ATOM 9725  C CD     . GLU C 3 43 ? -103.626 -4.613  -12.018 1.00 1.81 ? 52  GLU A CD     4  
ATOM 9726  O OE1    . GLU C 3 43 ? -104.028 -4.789  -13.157 1.00 2.50 ? 52  GLU A OE1    4  
ATOM 9727  O OE2    . GLU C 3 43 ? -103.668 -5.463  -11.143 1.00 2.20 ? 52  GLU A OE2    4  
ATOM 9728  H H      . GLU C 3 43 ? -104.167 -0.196  -12.960 1.00 0.97 ? 52  GLU A H      4  
ATOM 9729  H HA     . GLU C 3 43 ? -101.512 -1.065  -11.845 1.00 0.88 ? 52  GLU A HA     4  
ATOM 9730  H HB2    . GLU C 3 43 ? -103.475 -2.526  -13.634 1.00 1.28 ? 52  GLU A HB2    4  
ATOM 9731  H HB3    . GLU C 3 43 ? -101.808 -3.050  -13.420 1.00 1.29 ? 52  GLU A HB3    4  
ATOM 9732  H HG2    . GLU C 3 43 ? -102.167 -3.373  -11.041 1.00 2.17 ? 52  GLU A HG2    4  
ATOM 9733  H HG3    . GLU C 3 43 ? -103.777 -2.658  -11.145 1.00 1.98 ? 52  GLU A HG3    4  
ATOM 9734  N N      . PHE C 3 44 ? -100.576 0.373   -13.694 1.00 0.74 ? 53  PHE A N      4  
ATOM 9735  C CA     . PHE C 3 44 ? -99.925  1.102   -14.826 1.00 0.72 ? 53  PHE A CA     4  
ATOM 9736  C C      . PHE C 3 44 ? -98.530  0.536   -15.102 1.00 0.72 ? 53  PHE A C      4  
ATOM 9737  O O      . PHE C 3 44 ? -97.749  0.347   -14.190 1.00 0.76 ? 53  PHE A O      4  
ATOM 9738  C CB     . PHE C 3 44 ? -99.801  2.563   -14.402 1.00 0.69 ? 53  PHE A CB     4  
ATOM 9739  C CG     . PHE C 3 44 ? -99.366  3.402   -15.569 1.00 0.71 ? 53  PHE A CG     4  
ATOM 9740  C CD1    . PHE C 3 44 ? -100.273 3.662   -16.595 1.00 0.77 ? 53  PHE A CD1    4  
ATOM 9741  C CD2    . PHE C 3 44 ? -98.070  3.929   -15.622 1.00 0.70 ? 53  PHE A CD2    4  
ATOM 9742  C CE1    . PHE C 3 44 ? -99.896  4.451   -17.680 1.00 0.82 ? 53  PHE A CE1    4  
ATOM 9743  C CE2    . PHE C 3 44 ? -97.685  4.718   -16.710 1.00 0.75 ? 53  PHE A CE2    4  
ATOM 9744  C CZ     . PHE C 3 44 ? -98.603  4.981   -17.740 1.00 0.80 ? 53  PHE A CZ     4  
ATOM 9745  H H      . PHE C 3 44 ? -100.257 0.528   -12.782 1.00 0.73 ? 53  PHE A H      4  
ATOM 9746  H HA     . PHE C 3 44 ? -100.530 1.038   -15.720 1.00 0.75 ? 53  PHE A HA     4  
ATOM 9747  H HB2    . PHE C 3 44 ? -100.762 2.913   -14.050 1.00 0.70 ? 53  PHE A HB2    4  
ATOM 9748  H HB3    . PHE C 3 44 ? -99.077  2.647   -13.605 1.00 0.68 ? 53  PHE A HB3    4  
ATOM 9749  H HD1    . PHE C 3 44 ? -101.268 3.252   -16.547 1.00 0.80 ? 53  PHE A HD1    4  
ATOM 9750  H HD2    . PHE C 3 44 ? -97.369  3.724   -14.825 1.00 0.70 ? 53  PHE A HD2    4  
ATOM 9751  H HE1    . PHE C 3 44 ? -100.605 4.650   -18.470 1.00 0.89 ? 53  PHE A HE1    4  
ATOM 9752  H HE2    . PHE C 3 44 ? -96.684  5.127   -16.754 1.00 0.77 ? 53  PHE A HE2    4  
ATOM 9753  H HZ     . PHE C 3 44 ? -98.313  5.593   -18.579 1.00 0.86 ? 53  PHE A HZ     4  
ATOM 9754  N N      . LYS C 3 45 ? -98.198  0.274   -16.354 1.00 0.75 ? 54  LYS A N      4  
ATOM 9755  C CA     . LYS C 3 45 ? -96.833  -0.265  -16.669 1.00 0.80 ? 54  LYS A CA     4  
ATOM 9756  C C      . LYS C 3 45 ? -96.231  0.494   -17.861 1.00 0.79 ? 54  LYS A C      4  
ATOM 9757  O O      . LYS C 3 45 ? -96.913  0.876   -18.809 1.00 0.82 ? 54  LYS A O      4  
ATOM 9758  C CB     . LYS C 3 45 ? -96.911  -1.771  -16.961 1.00 0.91 ? 54  LYS A CB     4  
ATOM 9759  C CG     . LYS C 3 45 ? -97.573  -2.038  -18.316 1.00 1.53 ? 54  LYS A CG     4  
ATOM 9760  C CD     . LYS C 3 45 ? -97.900  -3.540  -18.423 1.00 1.63 ? 54  LYS A CD     4  
ATOM 9761  C CE     . LYS C 3 45 ? -98.076  -3.953  -19.889 1.00 1.85 ? 54  LYS A CE     4  
ATOM 9762  N NZ     . LYS C 3 45 ? -96.790  -3.768  -20.622 1.00 2.34 ? 54  LYS A NZ     4  
ATOM 9763  H H      . LYS C 3 45 ? -98.837  0.445   -17.080 1.00 0.78 ? 54  LYS A H      4  
ATOM 9764  H HA     . LYS C 3 45 ? -96.185  -0.114  -15.815 1.00 0.81 ? 54  LYS A HA     4  
ATOM 9765  H HB2    . LYS C 3 45 ? -95.913  -2.185  -16.965 1.00 1.36 ? 54  LYS A HB2    4  
ATOM 9766  H HB3    . LYS C 3 45 ? -97.491  -2.251  -16.186 1.00 1.53 ? 54  LYS A HB3    4  
ATOM 9767  H HG2    . LYS C 3 45 ? -98.479  -1.458  -18.397 1.00 2.22 ? 54  LYS A HG2    4  
ATOM 9768  H HG3    . LYS C 3 45 ? -96.894  -1.761  -19.105 1.00 2.07 ? 54  LYS A HG3    4  
ATOM 9769  H HD2    . LYS C 3 45 ? -97.099  -4.120  -17.987 1.00 2.26 ? 54  LYS A HD2    4  
ATOM 9770  H HD3    . LYS C 3 45 ? -98.817  -3.742  -17.887 1.00 1.90 ? 54  LYS A HD3    4  
ATOM 9771  H HE2    . LYS C 3 45 ? -98.363  -4.995  -19.931 1.00 2.32 ? 54  LYS A HE2    4  
ATOM 9772  H HE3    . LYS C 3 45 ? -98.846  -3.351  -20.346 1.00 2.34 ? 54  LYS A HE3    4  
ATOM 9773  H HZ1    . LYS C 3 45 ? -96.427  -2.810  -20.453 1.00 2.82 ? 54  LYS A HZ1    4  
ATOM 9774  H HZ2    . LYS C 3 45 ? -96.095  -4.465  -20.286 1.00 2.78 ? 54  LYS A HZ2    4  
ATOM 9775  H HZ3    . LYS C 3 45 ? -96.949  -3.900  -21.640 1.00 2.58 ? 54  LYS A HZ3    4  
ATOM 9776  N N      . LEU C 3 46 ? -94.947  0.735   -17.795 1.00 0.80 ? 55  LEU A N      4  
ATOM 9777  C CA     . LEU C 3 46 ? -94.245  1.492   -18.868 1.00 0.82 ? 55  LEU A CA     4  
ATOM 9778  C C      . LEU C 3 46 ? -93.713  0.537   -19.940 1.00 0.90 ? 55  LEU A C      4  
ATOM 9779  O O      . LEU C 3 46 ? -92.682  -0.084  -19.772 1.00 0.98 ? 55  LEU A O      4  
ATOM 9780  C CB     . LEU C 3 46 ? -93.073  2.247   -18.235 1.00 0.85 ? 55  LEU A CB     4  
ATOM 9781  C CG     . LEU C 3 46 ? -93.585  3.494   -17.502 1.00 0.78 ? 55  LEU A CG     4  
ATOM 9782  C CD1    . LEU C 3 46 ? -94.655  3.097   -16.481 1.00 1.30 ? 55  LEU A CD1    4  
ATOM 9783  C CD2    . LEU C 3 46 ? -92.419  4.179   -16.786 1.00 1.25 ? 55  LEU A CD2    4  
ATOM 9784  H H      . LEU C 3 46 ? -94.441  0.432   -17.013 1.00 0.82 ? 55  LEU A H      4  
ATOM 9785  H HA     . LEU C 3 46 ? -94.923  2.199   -19.316 1.00 0.81 ? 55  LEU A HA     4  
ATOM 9786  H HB2    . LEU C 3 46 ? -92.571  1.600   -17.531 1.00 0.89 ? 55  LEU A HB2    4  
ATOM 9787  H HB3    . LEU C 3 46 ? -92.380  2.543   -19.000 1.00 0.94 ? 55  LEU A HB3    4  
ATOM 9788  H HG     . LEU C 3 46 ? -94.012  4.176   -18.215 1.00 1.16 ? 55  LEU A HG     4  
ATOM 9789  H HD11   . LEU C 3 46 ? -94.360  2.189   -15.978 1.00 1.77 ? 55  LEU A HD11   4  
ATOM 9790  H HD12   . LEU C 3 46 ? -94.774  3.887   -15.752 1.00 1.76 ? 55  LEU A HD12   4  
ATOM 9791  H HD13   . LEU C 3 46 ? -95.594  2.937   -16.991 1.00 1.90 ? 55  LEU A HD13   4  
ATOM 9792  H HD21   . LEU C 3 46 ? -91.554  4.185   -17.433 1.00 1.81 ? 55  LEU A HD21   4  
ATOM 9793  H HD22   . LEU C 3 46 ? -92.693  5.195   -16.545 1.00 1.70 ? 55  LEU A HD22   4  
ATOM 9794  H HD23   . LEU C 3 46 ? -92.189  3.643   -15.878 1.00 1.79 ? 55  LEU A HD23   4  
ATOM 9795  N N      . SER C 3 47 ? -94.404  0.415   -21.042 1.00 0.91 ? 56  SER A N      4  
ATOM 9796  C CA     . SER C 3 47 ? -93.935  -0.495  -22.122 1.00 1.02 ? 56  SER A CA     4  
ATOM 9797  C C      . SER C 3 47 ? -92.822  0.175   -22.945 1.00 1.01 ? 56  SER A C      4  
ATOM 9798  O O      . SER C 3 47 ? -91.706  -0.305  -22.993 1.00 1.08 ? 56  SER A O      4  
ATOM 9799  C CB     . SER C 3 47 ? -95.117  -0.821  -23.034 1.00 1.09 ? 56  SER A CB     4  
ATOM 9800  O OG     . SER C 3 47 ? -94.665  -1.570  -24.156 1.00 1.60 ? 56  SER A OG     4  
ATOM 9801  H H      . SER C 3 47 ? -95.231  0.925   -21.160 1.00 0.90 ? 56  SER A H      4  
ATOM 9802  H HA     . SER C 3 47 ? -93.558  -1.409  -21.685 1.00 1.09 ? 56  SER A HA     4  
ATOM 9803  H HB2    . SER C 3 47 ? -95.842  -1.402  -22.489 1.00 1.39 ? 56  SER A HB2    4  
ATOM 9804  H HB3    . SER C 3 47 ? -95.575  0.103   -23.364 1.00 1.65 ? 56  SER A HB3    4  
ATOM 9805  H HG     . SER C 3 47 ? -94.407  -2.441  -23.847 1.00 1.97 ? 56  SER A HG     4  
ATOM 9806  N N      . ASP C 3 48 ? -93.122  1.276   -23.607 1.00 0.98 ? 57  ASP A N      4  
ATOM 9807  C CA     . ASP C 3 48 ? -92.087  1.969   -24.452 1.00 1.02 ? 57  ASP A CA     4  
ATOM 9808  C C      . ASP C 3 48 ? -92.146  3.502   -24.271 1.00 0.91 ? 57  ASP A C      4  
ATOM 9809  O O      . ASP C 3 48 ? -92.658  4.185   -25.132 1.00 1.09 ? 57  ASP A O      4  
ATOM 9810  C CB     . ASP C 3 48 ? -92.365  1.652   -25.931 1.00 1.30 ? 57  ASP A CB     4  
ATOM 9811  C CG     . ASP C 3 48 ? -92.146  0.160   -26.187 1.00 1.93 ? 57  ASP A CG     4  
ATOM 9812  O OD1    . ASP C 3 48 ? -91.577  -0.490  -25.328 1.00 2.54 ? 57  ASP A OD1    4  
ATOM 9813  O OD2    . ASP C 3 48 ? -92.553  -0.308  -27.239 1.00 2.54 ? 57  ASP A OD2    4  
ATOM 9814  H H      . ASP C 3 48 ? -94.032  1.636   -23.560 1.00 0.98 ? 57  ASP A H      4  
ATOM 9815  H HA     . ASP C 3 48 ? -91.102  1.612   -24.199 1.00 1.02 ? 57  ASP A HA     4  
ATOM 9816  H HB2    . ASP C 3 48 ? -93.387  1.913   -26.170 1.00 1.58 ? 57  ASP A HB2    4  
ATOM 9817  H HB3    . ASP C 3 48 ? -91.694  2.224   -26.554 1.00 1.71 ? 57  ASP A HB3    4  
ATOM 9818  N N      . PRO C 3 49 ? -91.612  4.017   -23.185 1.00 0.73 ? 58  PRO A N      4  
ATOM 9819  C CA     . PRO C 3 49 ? -91.610  5.478   -22.958 1.00 0.78 ? 58  PRO A CA     4  
ATOM 9820  C C      . PRO C 3 49 ? -90.557  6.132   -23.874 1.00 0.88 ? 58  PRO A C      4  
ATOM 9821  O O      . PRO C 3 49 ? -89.636  6.785   -23.424 1.00 1.09 ? 58  PRO A O      4  
ATOM 9822  C CB     . PRO C 3 49 ? -91.233  5.626   -21.469 1.00 0.79 ? 58  PRO A CB     4  
ATOM 9823  C CG     . PRO C 3 49 ? -90.612  4.271   -21.030 1.00 0.82 ? 58  PRO A CG     4  
ATOM 9824  C CD     . PRO C 3 49 ? -90.994  3.222   -22.104 1.00 0.72 ? 58  PRO A CD     4  
ATOM 9825  H HA     . PRO C 3 49 ? -92.589  5.893   -23.142 1.00 0.89 ? 58  PRO A HA     4  
ATOM 9826  H HB2    . PRO C 3 49 ? -90.520  6.430   -21.329 1.00 0.85 ? 58  PRO A HB2    4  
ATOM 9827  H HB3    . PRO C 3 49 ? -92.120  5.822   -20.881 1.00 0.89 ? 58  PRO A HB3    4  
ATOM 9828  H HG2    . PRO C 3 49 ? -89.534  4.366   -20.967 1.00 0.96 ? 58  PRO A HG2    4  
ATOM 9829  H HG3    . PRO C 3 49 ? -91.004  3.978   -20.072 1.00 0.99 ? 58  PRO A HG3    4  
ATOM 9830  H HD2    . PRO C 3 49 ? -90.110  2.712   -22.461 1.00 0.83 ? 58  PRO A HD2    4  
ATOM 9831  H HD3    . PRO C 3 49 ? -91.709  2.513   -21.712 1.00 0.73 ? 58  PRO A HD3    4  
ATOM 9832  N N      . ASP C 3 50 ? -90.684  5.950   -25.162 1.00 1.08 ? 59  ASP A N      4  
ATOM 9833  C CA     . ASP C 3 50 ? -89.690  6.549   -26.099 1.00 1.21 ? 59  ASP A CA     4  
ATOM 9834  C C      . ASP C 3 50 ? -89.921  8.064   -26.200 1.00 0.99 ? 59  ASP A C      4  
ATOM 9835  O O      . ASP C 3 50 ? -88.989  8.845   -26.202 1.00 0.93 ? 59  ASP A O      4  
ATOM 9836  C CB     . ASP C 3 50 ? -89.836  5.894   -27.480 1.00 1.59 ? 59  ASP A CB     4  
ATOM 9837  C CG     . ASP C 3 50 ? -89.343  4.444   -27.410 1.00 2.29 ? 59  ASP A CG     4  
ATOM 9838  O OD1    . ASP C 3 50 ? -88.724  4.097   -26.417 1.00 2.89 ? 59  ASP A OD1    4  
ATOM 9839  O OD2    . ASP C 3 50 ? -89.601  3.704   -28.347 1.00 2.85 ? 59  ASP A OD2    4  
ATOM 9840  H H      . ASP C 3 50 ? -91.428  5.416   -25.512 1.00 1.31 ? 59  ASP A H      4  
ATOM 9841  H HA     . ASP C 3 50 ? -88.694  6.367   -25.723 1.00 1.33 ? 59  ASP A HA     4  
ATOM 9842  H HB2    . ASP C 3 50 ? -90.872  5.909   -27.781 1.00 1.90 ? 59  ASP A HB2    4  
ATOM 9843  H HB3    . ASP C 3 50 ? -89.244  6.436   -28.202 1.00 1.83 ? 59  ASP A HB3    4  
ATOM 9844  N N      . GLU C 3 51 ? -91.155  8.483   -26.268 1.00 1.03 ? 60  GLU A N      4  
ATOM 9845  C CA     . GLU C 3 51 ? -91.455  9.942   -26.350 1.00 1.01 ? 60  GLU A CA     4  
ATOM 9846  C C      . GLU C 3 51 ? -91.363  10.534  -24.949 1.00 0.85 ? 60  GLU A C      4  
ATOM 9847  O O      . GLU C 3 51 ? -90.964  11.667  -24.758 1.00 0.89 ? 60  GLU A O      4  
ATOM 9848  C CB     . GLU C 3 51 ? -92.873  10.122  -26.910 1.00 1.29 ? 60  GLU A CB     4  
ATOM 9849  C CG     . GLU C 3 51 ? -93.200  11.612  -27.118 1.00 1.82 ? 60  GLU A CG     4  
ATOM 9850  C CD     . GLU C 3 51 ? -93.713  12.240  -25.817 1.00 2.52 ? 60  GLU A CD     4  
ATOM 9851  O OE1    . GLU C 3 51 ? -93.792  11.535  -24.825 1.00 3.15 ? 60  GLU A OE1    4  
ATOM 9852  O OE2    . GLU C 3 51 ? -94.028  13.419  -25.841 1.00 3.05 ? 60  GLU A OE2    4  
ATOM 9853  H H      . GLU C 3 51 ? -91.891  7.838   -26.247 1.00 1.18 ? 60  GLU A H      4  
ATOM 9854  H HA     . GLU C 3 51 ? -90.741  10.428  -26.997 1.00 1.06 ? 60  GLU A HA     4  
ATOM 9855  H HB2    . GLU C 3 51 ? -92.941  9.610   -27.858 1.00 1.71 ? 60  GLU A HB2    4  
ATOM 9856  H HB3    . GLU C 3 51 ? -93.584  9.690   -26.223 1.00 1.56 ? 60  GLU A HB3    4  
ATOM 9857  H HG2    . GLU C 3 51 ? -92.313  12.136  -27.443 1.00 2.24 ? 60  GLU A HG2    4  
ATOM 9858  H HG3    . GLU C 3 51 ? -93.964  11.703  -27.878 1.00 2.29 ? 60  GLU A HG3    4  
ATOM 9859  N N      . VAL C 3 52 ? -91.738  9.772   -23.966 1.00 0.74 ? 61  VAL A N      4  
ATOM 9860  C CA     . VAL C 3 52 ? -91.686  10.278  -22.573 1.00 0.68 ? 61  VAL A CA     4  
ATOM 9861  C C      . VAL C 3 52 ? -90.231  10.478  -22.143 1.00 0.65 ? 61  VAL A C      4  
ATOM 9862  O O      . VAL C 3 52 ? -89.894  11.462  -21.521 1.00 0.72 ? 61  VAL A O      4  
ATOM 9863  C CB     . VAL C 3 52 ? -92.364  9.285   -21.635 1.00 0.69 ? 61  VAL A CB     4  
ATOM 9864  C CG1    . VAL C 3 52 ? -92.376  9.868   -20.224 1.00 0.76 ? 61  VAL A CG1    4  
ATOM 9865  C CG2    . VAL C 3 52 ? -93.800  9.023   -22.112 1.00 0.80 ? 61  VAL A CG2    4  
ATOM 9866  H H      . VAL C 3 52 ? -92.061  8.863   -24.147 1.00 0.78 ? 61  VAL A H      4  
ATOM 9867  H HA     . VAL C 3 52 ? -92.202  11.225  -22.522 1.00 0.74 ? 61  VAL A HA     4  
ATOM 9868  H HB     . VAL C 3 52 ? -91.808  8.361   -21.634 1.00 0.68 ? 61  VAL A HB     4  
ATOM 9869  H HG11   . VAL C 3 52 ? -92.794  10.864  -20.250 1.00 1.28 ? 61  VAL A HG11   4  
ATOM 9870  H HG12   . VAL C 3 52 ? -92.972  9.244   -19.577 1.00 1.34 ? 61  VAL A HG12   4  
ATOM 9871  H HG13   . VAL C 3 52 ? -91.365  9.913   -19.849 1.00 1.23 ? 61  VAL A HG13   4  
ATOM 9872  H HG21   . VAL C 3 52 ? -94.260  9.953   -22.412 1.00 1.29 ? 61  VAL A HG21   4  
ATOM 9873  H HG22   . VAL C 3 52 ? -93.778  8.346   -22.955 1.00 1.26 ? 61  VAL A HG22   4  
ATOM 9874  H HG23   . VAL C 3 52 ? -94.374  8.580   -21.310 1.00 1.35 ? 61  VAL A HG23   4  
ATOM 9875  N N      . ALA C 3 53 ? -89.364  9.554   -22.460 1.00 0.66 ? 62  ALA A N      4  
ATOM 9876  C CA     . ALA C 3 53 ? -87.941  9.712   -22.055 1.00 0.72 ? 62  ALA A CA     4  
ATOM 9877  C C      . ALA C 3 53 ? -87.340  10.916  -22.793 1.00 0.78 ? 62  ALA A C      4  
ATOM 9878  O O      . ALA C 3 53 ? -86.588  11.687  -22.229 1.00 0.84 ? 62  ALA A O      4  
ATOM 9879  C CB     . ALA C 3 53 ? -87.176  8.433   -22.396 1.00 0.80 ? 62  ALA A CB     4  
ATOM 9880  H H      . ALA C 3 53 ? -89.647  8.760   -22.961 1.00 0.71 ? 62  ALA A H      4  
ATOM 9881  H HA     . ALA C 3 53 ? -87.891  9.886   -20.990 1.00 0.73 ? 62  ALA A HA     4  
ATOM 9882  H HB1    . ALA C 3 53 ? -87.625  7.600   -21.874 1.00 1.26 ? 62  ALA A HB1    4  
ATOM 9883  H HB2    . ALA C 3 53 ? -87.221  8.257   -23.459 1.00 1.40 ? 62  ALA A HB2    4  
ATOM 9884  H HB3    . ALA C 3 53 ? -86.146  8.534   -22.089 1.00 1.24 ? 62  ALA A HB3    4  
ATOM 9885  N N      . ARG C 3 54 ? -87.684  11.093  -24.044 1.00 0.82 ? 63  ARG A N      4  
ATOM 9886  C CA     . ARG C 3 54 ? -87.157  12.262  -24.812 1.00 0.93 ? 63  ARG A CA     4  
ATOM 9887  C C      . ARG C 3 54 ? -87.626  13.548  -24.127 1.00 0.93 ? 63  ARG A C      4  
ATOM 9888  O O      . ARG C 3 54 ? -86.860  14.466  -23.905 1.00 1.02 ? 63  ARG A O      4  
ATOM 9889  C CB     . ARG C 3 54 ? -87.713  12.221  -26.249 1.00 1.04 ? 63  ARG A CB     4  
ATOM 9890  C CG     . ARG C 3 54 ? -87.069  13.324  -27.116 1.00 1.39 ? 63  ARG A CG     4  
ATOM 9891  C CD     . ARG C 3 54 ? -87.984  13.679  -28.300 1.00 1.86 ? 63  ARG A CD     4  
ATOM 9892  N NE     . ARG C 3 54 ? -88.671  12.449  -28.815 1.00 2.35 ? 63  ARG A NE     4  
ATOM 9893  C CZ     . ARG C 3 54 ? -88.003  11.402  -29.208 1.00 2.86 ? 63  ARG A CZ     4  
ATOM 9894  N NH1    . ARG C 3 54 ? -86.701  11.441  -29.314 1.00 3.05 ? 63  ARG A NH1    4  
ATOM 9895  N NH2    . ARG C 3 54 ? -88.648  10.321  -29.549 1.00 3.69 ? 63  ARG A NH2    4  
ATOM 9896  H H      . ARG C 3 54 ? -88.304  10.468  -24.474 1.00 0.82 ? 63  ARG A H      4  
ATOM 9897  H HA     . ARG C 3 54 ? -86.076  12.231  -24.835 1.00 0.99 ? 63  ARG A HA     4  
ATOM 9898  H HB2    . ARG C 3 54 ? -87.497  11.256  -26.681 1.00 1.35 ? 63  ARG A HB2    4  
ATOM 9899  H HB3    . ARG C 3 54 ? -88.783  12.367  -26.218 1.00 1.35 ? 63  ARG A HB3    4  
ATOM 9900  H HG2    . ARG C 3 54 ? -86.914  14.210  -26.517 1.00 1.83 ? 63  ARG A HG2    4  
ATOM 9901  H HG3    . ARG C 3 54 ? -86.118  12.978  -27.489 1.00 1.81 ? 63  ARG A HG3    4  
ATOM 9902  H HD2    . ARG C 3 54 ? -88.747  14.357  -27.968 1.00 2.39 ? 63  ARG A HD2    4  
ATOM 9903  H HD3    . ARG C 3 54 ? -87.394  14.165  -29.076 1.00 2.26 ? 63  ARG A HD3    4  
ATOM 9904  H HE     . ARG C 3 54 ? -89.651  12.419  -28.818 1.00 2.78 ? 63  ARG A HE     4  
ATOM 9905  H HH11   . ARG C 3 54 ? -86.207  12.280  -29.097 1.00 2.90 ? 63  ARG A HH11   4  
ATOM 9906  H HH12   . ARG C 3 54 ? -86.201  10.628  -29.613 1.00 3.72 ? 63  ARG A HH12   4  
ATOM 9907  H HH21   . ARG C 3 54 ? -89.648  10.304  -29.507 1.00 4.05 ? 63  ARG A HH21   4  
ATOM 9908  H HH22   . ARG C 3 54 ? -88.144  9.510   -29.847 1.00 4.21 ? 63  ARG A HH22   4  
ATOM 9909  N N      . ARG C 3 55 ? -88.889  13.621  -23.792 1.00 0.88 ? 64  ARG A N      4  
ATOM 9910  C CA     . ARG C 3 55 ? -89.419  14.850  -23.130 1.00 0.94 ? 64  ARG A CA     4  
ATOM 9911  C C      . ARG C 3 55 ? -88.815  15.014  -21.731 1.00 0.88 ? 64  ARG A C      4  
ATOM 9912  O O      . ARG C 3 55 ? -88.490  16.108  -21.312 1.00 0.99 ? 64  ARG A O      4  
ATOM 9913  C CB     . ARG C 3 55 ? -90.940  14.734  -22.999 1.00 0.96 ? 64  ARG A CB     4  
ATOM 9914  C CG     . ARG C 3 55 ? -91.605  14.891  -24.374 1.00 1.39 ? 64  ARG A CG     4  
ATOM 9915  C CD     . ARG C 3 55 ? -91.660  16.368  -24.796 1.00 1.63 ? 64  ARG A CD     4  
ATOM 9916  N NE     . ARG C 3 55 ? -92.702  16.537  -25.848 1.00 2.14 ? 64  ARG A NE     4  
ATOM 9917  C CZ     . ARG C 3 55 ? -93.158  17.728  -26.129 1.00 2.59 ? 64  ARG A CZ     4  
ATOM 9918  N NH1    . ARG C 3 55 ? -92.664  18.770  -25.524 1.00 2.81 ? 64  ARG A NH1    4  
ATOM 9919  N NH2    . ARG C 3 55 ? -94.100  17.876  -27.022 1.00 3.46 ? 64  ARG A NH2    4  
ATOM 9920  H H      . ARG C 3 55 ? -89.496  12.866  -23.987 1.00 0.85 ? 64  ARG A H      4  
ATOM 9921  H HA     . ARG C 3 55 ? -89.177  15.714  -23.726 1.00 1.03 ? 64  ARG A HA     4  
ATOM 9922  H HB2    . ARG C 3 55 ? -91.184  13.761  -22.596 1.00 1.10 ? 64  ARG A HB2    4  
ATOM 9923  H HB3    . ARG C 3 55 ? -91.305  15.497  -22.328 1.00 1.35 ? 64  ARG A HB3    4  
ATOM 9924  H HG2    . ARG C 3 55 ? -91.043  14.334  -25.108 1.00 2.06 ? 64  ARG A HG2    4  
ATOM 9925  H HG3    . ARG C 3 55 ? -92.610  14.502  -24.325 1.00 1.99 ? 64  ARG A HG3    4  
ATOM 9926  H HD2    . ARG C 3 55 ? -91.908  16.986  -23.944 1.00 2.13 ? 64  ARG A HD2    4  
ATOM 9927  H HD3    . ARG C 3 55 ? -90.702  16.669  -25.194 1.00 2.13 ? 64  ARG A HD3    4  
ATOM 9928  H HE     . ARG C 3 55 ? -93.055  15.754  -26.319 1.00 2.69 ? 64  ARG A HE     4  
ATOM 9929  H HH11   . ARG C 3 55 ? -91.935  18.656  -24.847 1.00 2.64 ? 64  ARG A HH11   4  
ATOM 9930  H HH12   . ARG C 3 55 ? -93.012  19.683  -25.734 1.00 3.55 ? 64  ARG A HH12   4  
ATOM 9931  H HH21   . ARG C 3 55 ? -94.474  17.077  -27.495 1.00 3.83 ? 64  ARG A HH21   4  
ATOM 9932  H HH22   . ARG C 3 55 ? -94.454  18.789  -27.229 1.00 4.01 ? 64  ARG A HH22   4  
ATOM 9933  N N      . TRP C 3 56 ? -88.693  13.945  -20.992 1.00 0.77 ? 65  TRP A N      4  
ATOM 9934  C CA     . TRP C 3 56 ? -88.145  14.056  -19.610 1.00 0.74 ? 65  TRP A CA     4  
ATOM 9935  C C      . TRP C 3 56 ? -86.707  14.580  -19.657 1.00 0.80 ? 65  TRP A C      4  
ATOM 9936  O O      . TRP C 3 56 ? -86.331  15.461  -18.910 1.00 0.89 ? 65  TRP A O      4  
ATOM 9937  C CB     . TRP C 3 56 ? -88.175  12.670  -18.947 1.00 0.67 ? 65  TRP A CB     4  
ATOM 9938  C CG     . TRP C 3 56 ? -88.158  12.809  -17.456 1.00 0.67 ? 65  TRP A CG     4  
ATOM 9939  C CD1    . TRP C 3 56 ? -87.058  13.021  -16.695 1.00 0.65 ? 65  TRP A CD1    4  
ATOM 9940  C CD2    . TRP C 3 56 ? -89.286  12.737  -16.538 1.00 0.77 ? 65  TRP A CD2    4  
ATOM 9941  N NE1    . TRP C 3 56 ? -87.444  13.083  -15.366 1.00 0.70 ? 65  TRP A NE1    4  
ATOM 9942  C CE2    . TRP C 3 56 ? -88.807  12.914  -15.221 1.00 0.79 ? 65  TRP A CE2    4  
ATOM 9943  C CE3    . TRP C 3 56 ? -90.667  12.538  -16.721 1.00 0.91 ? 65  TRP A CE3    4  
ATOM 9944  C CZ2    . TRP C 3 56 ? -89.666  12.893  -14.123 1.00 0.93 ? 65  TRP A CZ2    4  
ATOM 9945  C CZ3    . TRP C 3 56 ? -91.535  12.516  -15.618 1.00 1.08 ? 65  TRP A CZ3    4  
ATOM 9946  C CH2    . TRP C 3 56 ? -91.036  12.693  -14.321 1.00 1.08 ? 65  TRP A CH2    4  
ATOM 9947  H H      . TRP C 3 56 ? -88.982  13.075  -21.337 1.00 0.75 ? 65  TRP A H      4  
ATOM 9948  H HA     . TRP C 3 56 ? -88.754  14.742  -19.042 1.00 0.80 ? 65  TRP A HA     4  
ATOM 9949  H HB2    . TRP C 3 56 ? -89.078  12.155  -19.243 1.00 0.70 ? 65  TRP A HB2    4  
ATOM 9950  H HB3    . TRP C 3 56 ? -87.316  12.095  -19.265 1.00 0.66 ? 65  TRP A HB3    4  
ATOM 9951  H HD1    . TRP C 3 56 ? -86.047  13.123  -17.061 1.00 0.68 ? 65  TRP A HD1    4  
ATOM 9952  H HE1    . TRP C 3 56 ? -86.841  13.228  -14.607 1.00 0.73 ? 65  TRP A HE1    4  
ATOM 9953  H HE3    . TRP C 3 56 ? -91.064  12.400  -17.717 1.00 0.94 ? 65  TRP A HE3    4  
ATOM 9954  H HZ2    . TRP C 3 56 ? -89.278  13.029  -13.129 1.00 0.97 ? 65  TRP A HZ2    4  
ATOM 9955  H HZ3    . TRP C 3 56 ? -92.592  12.364  -15.771 1.00 1.23 ? 65  TRP A HZ3    4  
ATOM 9956  H HH2    . TRP C 3 56 ? -91.708  12.675  -13.475 1.00 1.23 ? 65  TRP A HH2    4  
ATOM 9957  N N      . GLY C 3 57 ? -85.899  14.038  -20.524 1.00 0.87 ? 66  GLY A N      4  
ATOM 9958  C CA     . GLY C 3 57 ? -84.483  14.493  -20.612 1.00 1.00 ? 66  GLY A CA     4  
ATOM 9959  C C      . GLY C 3 57 ? -84.406  15.930  -21.143 1.00 1.06 ? 66  GLY A C      4  
ATOM 9960  O O      . GLY C 3 57 ? -83.741  16.772  -20.575 1.00 1.09 ? 66  GLY A O      4  
ATOM 9961  H H      . GLY C 3 57 ? -86.222  13.325  -21.110 1.00 0.90 ? 66  GLY A H      4  
ATOM 9962  H HA2    . GLY C 3 57 ? -84.035  14.452  -19.630 1.00 1.01 ? 66  GLY A HA2    4  
ATOM 9963  H HA3    . GLY C 3 57 ? -83.941  13.840  -21.280 1.00 1.11 ? 66  GLY A HA3    4  
ATOM 9964  N N      . LYS C 3 58 ? -85.072  16.220  -22.230 1.00 1.15 ? 67  LYS A N      4  
ATOM 9965  C CA     . LYS C 3 58 ? -85.016  17.603  -22.792 1.00 1.31 ? 67  LYS A CA     4  
ATOM 9966  C C      . LYS C 3 58 ? -85.696  18.589  -21.835 1.00 1.29 ? 67  LYS A C      4  
ATOM 9967  O O      . LYS C 3 58 ? -85.652  19.788  -22.035 1.00 1.36 ? 67  LYS A O      4  
ATOM 9968  C CB     . LYS C 3 58 ? -85.724  17.644  -24.155 1.00 1.50 ? 67  LYS A CB     4  
ATOM 9969  C CG     . LYS C 3 58 ? -84.945  16.791  -25.171 1.00 1.98 ? 67  LYS A CG     4  
ATOM 9970  C CD     . LYS C 3 58 ? -85.647  16.804  -26.544 1.00 2.17 ? 67  LYS A CD     4  
ATOM 9971  C CE     . LYS C 3 58 ? -85.267  18.069  -27.324 1.00 2.32 ? 67  LYS A CE     4  
ATOM 9972  N NZ     . LYS C 3 58 ? -85.923  18.044  -28.662 1.00 2.71 ? 67  LYS A NZ     4  
ATOM 9973  H H      . LYS C 3 58 ? -85.598  15.527  -22.682 1.00 1.15 ? 67  LYS A H      4  
ATOM 9974  H HA     . LYS C 3 58 ? -83.982  17.891  -22.920 1.00 1.39 ? 67  LYS A HA     4  
ATOM 9975  H HB2    . LYS C 3 58 ? -86.725  17.255  -24.047 1.00 1.51 ? 67  LYS A HB2    4  
ATOM 9976  H HB3    . LYS C 3 58 ? -85.771  18.664  -24.500 1.00 1.70 ? 67  LYS A HB3    4  
ATOM 9977  H HG2    . LYS C 3 58 ? -83.944  17.183  -25.276 1.00 2.34 ? 67  LYS A HG2    4  
ATOM 9978  H HG3    . LYS C 3 58 ? -84.892  15.774  -24.812 1.00 2.33 ? 67  LYS A HG3    4  
ATOM 9979  H HD2    . LYS C 3 58 ? -85.340  15.934  -27.109 1.00 2.56 ? 67  LYS A HD2    4  
ATOM 9980  H HD3    . LYS C 3 58 ? -86.719  16.778  -26.404 1.00 2.44 ? 67  LYS A HD3    4  
ATOM 9981  H HE2    . LYS C 3 58 ? -85.595  18.940  -26.782 1.00 2.57 ? 67  LYS A HE2    4  
ATOM 9982  H HE3    . LYS C 3 58 ? -84.195  18.105  -27.451 1.00 2.74 ? 67  LYS A HE3    4  
ATOM 9983  H HZ1    . LYS C 3 58 ? -86.693  17.346  -28.658 1.00 3.04 ? 67  LYS A HZ1    4  
ATOM 9984  H HZ2    . LYS C 3 58 ? -86.310  18.985  -28.875 1.00 2.91 ? 67  LYS A HZ2    4  
ATOM 9985  H HZ3    . LYS C 3 58 ? -85.225  17.787  -29.389 1.00 3.18 ? 67  LYS A HZ3    4  
ATOM 9986  N N      . ARG C 3 59 ? -86.327  18.106  -20.803 1.00 1.28 ? 68  ARG A N      4  
ATOM 9987  C CA     . ARG C 3 59 ? -87.006  19.035  -19.857 1.00 1.36 ? 68  ARG A CA     4  
ATOM 9988  C C      . ARG C 3 59 ? -85.980  20.022  -19.291 1.00 1.32 ? 68  ARG A C      4  
ATOM 9989  O O      . ARG C 3 59 ? -86.263  21.189  -19.113 1.00 1.49 ? 68  ARG A O      4  
ATOM 9990  C CB     . ARG C 3 59 ? -87.650  18.223  -18.724 1.00 1.44 ? 68  ARG A CB     4  
ATOM 9991  C CG     . ARG C 3 59 ? -88.430  19.148  -17.769 1.00 1.80 ? 68  ARG A CG     4  
ATOM 9992  C CD     . ARG C 3 59 ? -89.664  19.740  -18.468 1.00 2.04 ? 68  ARG A CD     4  
ATOM 9993  N NE     . ARG C 3 59 ? -89.264  20.987  -19.175 1.00 2.47 ? 68  ARG A NE     4  
ATOM 9994  C CZ     . ARG C 3 59 ? -90.087  21.561  -20.003 1.00 3.08 ? 68  ARG A CZ     4  
ATOM 9995  N NH1    . ARG C 3 59 ? -91.296  21.088  -20.152 1.00 3.41 ? 68  ARG A NH1    4  
ATOM 9996  N NH2    . ARG C 3 59 ? -89.708  22.619  -20.665 1.00 3.88 ? 68  ARG A NH2    4  
ATOM 9997  H H      . ARG C 3 59 ? -86.357  17.139  -20.651 1.00 1.27 ? 68  ARG A H      4  
ATOM 9998  H HA     . ARG C 3 59 ? -87.770  19.579  -20.387 1.00 1.49 ? 68  ARG A HA     4  
ATOM 9999  H HB2    . ARG C 3 59 ? -88.325  17.494  -19.148 1.00 1.69 ? 68  ARG A HB2    4  
ATOM 10000 H HB3    . ARG C 3 59 ? -86.878  17.710  -18.169 1.00 1.59 ? 68  ARG A HB3    4  
ATOM 10001 H HG2    . ARG C 3 59 ? -88.748  18.580  -16.907 1.00 2.29 ? 68  ARG A HG2    4  
ATOM 10002 H HG3    . ARG C 3 59 ? -87.787  19.953  -17.444 1.00 2.33 ? 68  ARG A HG3    4  
ATOM 10003 H HD2    . ARG C 3 59 ? -90.062  19.039  -19.181 1.00 2.35 ? 68  ARG A HD2    4  
ATOM 10004 H HD3    . ARG C 3 59 ? -90.425  19.964  -17.729 1.00 2.55 ? 68  ARG A HD3    4  
ATOM 10005 H HE     . ARG C 3 59 ? -88.370  21.363  -19.037 1.00 2.79 ? 68  ARG A HE     4  
ATOM 10006 H HH11   . ARG C 3 59 ? -91.588  20.290  -19.623 1.00 3.26 ? 68  ARG A HH11   4  
ATOM 10007 H HH12   . ARG C 3 59 ? -91.926  21.517  -20.798 1.00 4.13 ? 68  ARG A HH12   4  
ATOM 10008 H HH21   . ARG C 3 59 ? -88.785  22.984  -20.534 1.00 4.13 ? 68  ARG A HH21   4  
ATOM 10009 H HH22   . ARG C 3 59 ? -90.338  23.069  -21.297 1.00 4.48 ? 68  ARG A HH22   4  
ATOM 10010 N N      . LYS C 3 60 ? -84.790  19.559  -19.010 1.00 1.21 ? 69  LYS A N      4  
ATOM 10011 C CA     . LYS C 3 60 ? -83.729  20.459  -18.453 1.00 1.26 ? 69  LYS A CA     4  
ATOM 10012 C C      . LYS C 3 60 ? -82.716  20.842  -19.534 1.00 1.29 ? 69  LYS A C      4  
ATOM 10013 O O      . LYS C 3 60 ? -81.560  21.064  -19.239 1.00 1.45 ? 69  LYS A O      4  
ATOM 10014 C CB     . LYS C 3 60 ? -82.986  19.737  -17.335 1.00 1.24 ? 69  LYS A CB     4  
ATOM 10015 C CG     . LYS C 3 60 ? -83.906  19.570  -16.130 1.00 1.34 ? 69  LYS A CG     4  
ATOM 10016 C CD     . LYS C 3 60 ? -83.083  19.108  -14.931 1.00 1.61 ? 69  LYS A CD     4  
ATOM 10017 C CE     . LYS C 3 60 ? -83.974  19.075  -13.687 1.00 1.89 ? 69  LYS A CE     4  
ATOM 10018 N NZ     . LYS C 3 60 ? -85.070  18.084  -13.882 1.00 2.56 ? 69  LYS A NZ     4  
ATOM 10019 H H      . LYS C 3 60 ? -84.592  18.614  -19.164 1.00 1.18 ? 69  LYS A H      4  
ATOM 10020 H HA     . LYS C 3 60 ? -84.179  21.358  -18.055 1.00 1.47 ? 69  LYS A HA     4  
ATOM 10021 H HB2    . LYS C 3 60 ? -82.669  18.766  -17.686 1.00 1.61 ? 69  LYS A HB2    4  
ATOM 10022 H HB3    . LYS C 3 60 ? -82.119  20.315  -17.049 1.00 1.55 ? 69  LYS A HB3    4  
ATOM 10023 H HG2    . LYS C 3 60 ? -84.381  20.513  -15.901 1.00 1.87 ? 69  LYS A HG2    4  
ATOM 10024 H HG3    . LYS C 3 60 ? -84.660  18.831  -16.353 1.00 1.90 ? 69  LYS A HG3    4  
ATOM 10025 H HD2    . LYS C 3 60 ? -82.689  18.121  -15.124 1.00 2.11 ? 69  LYS A HD2    4  
ATOM 10026 H HD3    . LYS C 3 60 ? -82.268  19.797  -14.768 1.00 2.12 ? 69  LYS A HD3    4  
ATOM 10027 H HE2    . LYS C 3 60 ? -83.381  18.792  -12.831 1.00 2.35 ? 69  LYS A HE2    4  
ATOM 10028 H HE3    . LYS C 3 60 ? -84.398  20.054  -13.524 1.00 2.07 ? 69  LYS A HE3    4  
ATOM 10029 H HZ1    . LYS C 3 60 ? -84.669  17.181  -14.198 1.00 2.93 ? 69  LYS A HZ1    4  
ATOM 10030 H HZ2    . LYS C 3 60 ? -85.570  17.944  -12.980 1.00 3.03 ? 69  LYS A HZ2    4  
ATOM 10031 H HZ3    . LYS C 3 60 ? -85.736  18.437  -14.599 1.00 2.92 ? 69  LYS A HZ3    4  
ATOM 10032 N N      . ASN C 3 61 ? -83.125  20.922  -20.769 1.00 1.49 ? 70  ASN A N      4  
ATOM 10033 C CA     . ASN C 3 61 ? -82.160  21.301  -21.846 1.00 1.75 ? 70  ASN A CA     4  
ATOM 10034 C C      . ASN C 3 61 ? -80.961  20.340  -21.840 1.00 1.60 ? 70  ASN A C      4  
ATOM 10035 O O      . ASN C 3 61 ? -79.826  20.752  -21.703 1.00 1.74 ? 70  ASN A O      4  
ATOM 10036 C CB     . ASN C 3 61 ? -81.681  22.740  -21.611 1.00 2.11 ? 70  ASN A CB     4  
ATOM 10037 C CG     . ASN C 3 61 ? -82.889  23.675  -21.669 1.00 2.80 ? 70  ASN A CG     4  
ATOM 10038 O OD1    . ASN C 3 61 ? -83.676  23.608  -22.591 1.00 3.49 ? 70  ASN A OD1    4  
ATOM 10039 N ND2    . ASN C 3 61 ? -83.075  24.545  -20.713 1.00 3.17 ? 70  ASN A ND2    4  
ATOM 10040 H H      . ASN C 3 61 ? -84.062  20.739  -20.991 1.00 1.66 ? 70  ASN A H      4  
ATOM 10041 H HA     . ASN C 3 61 ? -82.656  21.243  -22.803 1.00 1.96 ? 70  ASN A HA     4  
ATOM 10042 H HB2    . ASN C 3 61 ? -81.206  22.821  -20.645 1.00 2.33 ? 70  ASN A HB2    4  
ATOM 10043 H HB3    . ASN C 3 61 ? -80.979  23.019  -22.381 1.00 2.23 ? 70  ASN A HB3    4  
ATOM 10044 H HD21   . ASN C 3 61 ? -82.444  24.595  -19.965 1.00 3.12 ? 70  ASN A HD21   4  
ATOM 10045 H HD22   . ASN C 3 61 ? -83.849  25.146  -20.743 1.00 3.80 ? 70  ASN A HD22   4  
ATOM 10046 N N      . LYS C 3 62 ? -81.212  19.057  -21.982 1.00 1.48 ? 71  LYS A N      4  
ATOM 10047 C CA     . LYS C 3 62 ? -80.103  18.040  -21.981 1.00 1.47 ? 71  LYS A CA     4  
ATOM 10048 C C      . LYS C 3 62 ? -80.237  17.122  -23.214 1.00 1.58 ? 71  LYS A C      4  
ATOM 10049 O O      . LYS C 3 62 ? -81.333  16.949  -23.708 1.00 1.78 ? 71  LYS A O      4  
ATOM 10050 C CB     . LYS C 3 62 ? -80.236  17.192  -20.713 1.00 1.51 ? 71  LYS A CB     4  
ATOM 10051 C CG     . LYS C 3 62 ? -79.880  18.037  -19.494 1.00 1.55 ? 71  LYS A CG     4  
ATOM 10052 C CD     . LYS C 3 62 ? -79.827  17.140  -18.254 1.00 1.66 ? 71  LYS A CD     4  
ATOM 10053 C CE     . LYS C 3 62 ? -79.581  17.997  -17.011 1.00 1.66 ? 71  LYS A CE     4  
ATOM 10054 N NZ     . LYS C 3 62 ? -78.144  18.370  -16.963 1.00 2.35 ? 71  LYS A NZ     4  
ATOM 10055 H H      . LYS C 3 62 ? -82.139  18.758  -22.084 1.00 1.50 ? 71  LYS A H      4  
ATOM 10056 H HA     . LYS C 3 62 ? -79.149  18.540  -21.983 1.00 1.55 ? 71  LYS A HA     4  
ATOM 10057 H HB2    . LYS C 3 62 ? -81.257  16.851  -20.623 1.00 1.66 ? 71  LYS A HB2    4  
ATOM 10058 H HB3    . LYS C 3 62 ? -79.583  16.339  -20.764 1.00 1.69 ? 71  LYS A HB3    4  
ATOM 10059 H HG2    . LYS C 3 62 ? -78.914  18.500  -19.648 1.00 1.80 ? 71  LYS A HG2    4  
ATOM 10060 H HG3    . LYS C 3 62 ? -80.629  18.800  -19.354 1.00 1.99 ? 71  LYS A HG3    4  
ATOM 10061 H HD2    . LYS C 3 62 ? -80.763  16.610  -18.150 1.00 2.22 ? 71  LYS A HD2    4  
ATOM 10062 H HD3    . LYS C 3 62 ? -79.021  16.429  -18.361 1.00 1.96 ? 71  LYS A HD3    4  
ATOM 10063 H HE2    . LYS C 3 62 ? -80.184  18.892  -17.059 1.00 1.96 ? 71  LYS A HE2    4  
ATOM 10064 H HE3    . LYS C 3 62 ? -79.836  17.435  -16.125 1.00 1.85 ? 71  LYS A HE3    4  
ATOM 10065 H HZ1    . LYS C 3 62 ? -77.680  18.065  -17.842 1.00 2.60 ? 71  LYS A HZ1    4  
ATOM 10066 H HZ2    . LYS C 3 62 ? -78.056  19.400  -16.861 1.00 2.82 ? 71  LYS A HZ2    4  
ATOM 10067 H HZ3    . LYS C 3 62 ? -77.691  17.903  -16.152 1.00 2.86 ? 71  LYS A HZ3    4  
ATOM 10068 N N      . PRO C 3 63 ? -79.130  16.538  -23.678 1.00 1.85 ? 72  PRO A N      4  
ATOM 10069 C CA     . PRO C 3 63 ? -79.165  15.620  -24.842 1.00 2.09 ? 72  PRO A CA     4  
ATOM 10070 C C      . PRO C 3 63 ? -80.208  14.515  -24.626 1.00 1.70 ? 72  PRO A C      4  
ATOM 10071 O O      . PRO C 3 63 ? -81.125  14.648  -23.844 1.00 2.05 ? 72  PRO A O      4  
ATOM 10072 C CB     . PRO C 3 63 ? -77.736  15.035  -24.942 1.00 2.68 ? 72  PRO A CB     4  
ATOM 10073 C CG     . PRO C 3 63 ? -76.859  15.755  -23.877 1.00 2.96 ? 72  PRO A CG     4  
ATOM 10074 C CD     . PRO C 3 63 ? -77.772  16.739  -23.107 1.00 2.30 ? 72  PRO A CD     4  
ATOM 10075 H HA     . PRO C 3 63 ? -79.398  16.174  -25.739 1.00 2.46 ? 72  PRO A HA     4  
ATOM 10076 H HB2    . PRO C 3 63 ? -77.752  13.966  -24.746 1.00 2.64 ? 72  PRO A HB2    4  
ATOM 10077 H HB3    . PRO C 3 63 ? -77.329  15.213  -25.928 1.00 3.17 ? 72  PRO A HB3    4  
ATOM 10078 H HG2    . PRO C 3 63 ? -76.436  15.026  -23.194 1.00 3.22 ? 72  PRO A HG2    4  
ATOM 10079 H HG3    . PRO C 3 63 ? -76.061  16.300  -24.363 1.00 3.55 ? 72  PRO A HG3    4  
ATOM 10080 H HD2    . PRO C 3 63 ? -77.758  16.514  -22.053 1.00 2.26 ? 72  PRO A HD2    4  
ATOM 10081 H HD3    . PRO C 3 63 ? -77.447  17.755  -23.277 1.00 2.48 ? 72  PRO A HD3    4  
ATOM 10082 N N      . LYS C 3 64 ? -80.079  13.424  -25.326 1.00 1.44 ? 73  LYS A N      4  
ATOM 10083 C CA     . LYS C 3 64 ? -81.070  12.323  -25.179 1.00 1.53 ? 73  LYS A CA     4  
ATOM 10084 C C      . LYS C 3 64 ? -80.635  11.377  -24.046 1.00 1.33 ? 73  LYS A C      4  
ATOM 10085 O O      . LYS C 3 64 ? -79.545  10.839  -24.056 1.00 1.66 ? 73  LYS A O      4  
ATOM 10086 C CB     . LYS C 3 64 ? -81.122  11.553  -26.502 1.00 2.19 ? 73  LYS A CB     4  
ATOM 10087 C CG     . LYS C 3 64 ? -81.591  12.491  -27.629 1.00 2.95 ? 73  LYS A CG     4  
ATOM 10088 C CD     . LYS C 3 64 ? -81.541  11.764  -28.988 1.00 3.72 ? 73  LYS A CD     4  
ATOM 10089 C CE     . LYS C 3 64 ? -82.814  10.931  -29.199 1.00 4.37 ? 73  LYS A CE     4  
ATOM 10090 N NZ     . LYS C 3 64 ? -83.943  11.823  -29.595 1.00 5.24 ? 73  LYS A NZ     4  
ATOM 10091 H H      . LYS C 3 64 ? -79.337  13.333  -25.961 1.00 1.60 ? 73  LYS A H      4  
ATOM 10092 H HA     . LYS C 3 64 ? -82.046  12.732  -24.960 1.00 1.77 ? 73  LYS A HA     4  
ATOM 10093 H HB2    . LYS C 3 64 ? -80.136  11.176  -26.734 1.00 2.47 ? 73  LYS A HB2    4  
ATOM 10094 H HB3    . LYS C 3 64 ? -81.809  10.729  -26.407 1.00 2.56 ? 73  LYS A HB3    4  
ATOM 10095 H HG2    . LYS C 3 64 ? -82.603  12.816  -27.429 1.00 3.22 ? 73  LYS A HG2    4  
ATOM 10096 H HG3    . LYS C 3 64 ? -80.942  13.355  -27.665 1.00 3.26 ? 73  LYS A HG3    4  
ATOM 10097 H HD2    . LYS C 3 64 ? -81.459  12.495  -29.781 1.00 4.03 ? 73  LYS A HD2    4  
ATOM 10098 H HD3    . LYS C 3 64 ? -80.680  11.113  -29.017 1.00 3.96 ? 73  LYS A HD3    4  
ATOM 10099 H HE2    . LYS C 3 64 ? -82.642  10.205  -29.978 1.00 4.55 ? 73  LYS A HE2    4  
ATOM 10100 H HE3    . LYS C 3 64 ? -83.069  10.420  -28.286 1.00 4.50 ? 73  LYS A HE3    4  
ATOM 10101 H HZ1    . LYS C 3 64 ? -83.762  12.787  -29.249 1.00 5.57 ? 73  LYS A HZ1    4  
ATOM 10102 H HZ2    . LYS C 3 64 ? -84.028  11.835  -30.632 1.00 5.62 ? 73  LYS A HZ2    4  
ATOM 10103 H HZ3    . LYS C 3 64 ? -84.827  11.465  -29.182 1.00 5.48 ? 73  LYS A HZ3    4  
ATOM 10104 N N      . MET C 3 65 ? -81.492  11.177  -23.063 1.00 1.17 ? 74  MET A N      4  
ATOM 10105 C CA     . MET C 3 65 ? -81.153  10.274  -21.912 1.00 1.15 ? 74  MET A CA     4  
ATOM 10106 C C      . MET C 3 65 ? -82.026  9.021   -21.961 1.00 0.99 ? 74  MET A C      4  
ATOM 10107 O O      . MET C 3 65 ? -83.212  9.082   -22.218 1.00 1.00 ? 74  MET A O      4  
ATOM 10108 C CB     . MET C 3 65 ? -81.414  11.010  -20.599 1.00 1.47 ? 74  MET A CB     4  
ATOM 10109 C CG     . MET C 3 65 ? -80.462  12.200  -20.487 1.00 2.01 ? 74  MET A CG     4  
ATOM 10110 S SD     . MET C 3 65 ? -78.774  11.605  -20.219 1.00 2.41 ? 74  MET A SD     4  
ATOM 10111 C CE     . MET C 3 65 ? -78.043  13.204  -19.785 1.00 2.27 ? 74  MET A CE     4  
ATOM 10112 H H      . MET C 3 65 ? -82.361  11.628  -23.081 1.00 1.36 ? 74  MET A H      4  
ATOM 10113 H HA     . MET C 3 65 ? -80.112  9.985   -21.957 1.00 1.29 ? 74  MET A HA     4  
ATOM 10114 H HB2    . MET C 3 65 ? -82.437  11.361  -20.581 1.00 1.42 ? 74  MET A HB2    4  
ATOM 10115 H HB3    . MET C 3 65 ? -81.251  10.339  -19.768 1.00 1.94 ? 74  MET A HB3    4  
ATOM 10116 H HG2    . MET C 3 65 ? -80.498  12.775  -21.399 1.00 2.66 ? 74  MET A HG2    4  
ATOM 10117 H HG3    . MET C 3 65 ? -80.761  12.821  -19.657 1.00 2.34 ? 74  MET A HG3    4  
ATOM 10118 H HE1    . MET C 3 65 ? -78.697  13.729  -19.107 1.00 2.59 ? 74  MET A HE1    4  
ATOM 10119 H HE2    . MET C 3 65 ? -77.086  13.045  -19.307 1.00 2.52 ? 74  MET A HE2    4  
ATOM 10120 H HE3    . MET C 3 65 ? -77.910  13.795  -20.682 1.00 2.60 ? 74  MET A HE3    4  
ATOM 10121 N N      . ASN C 3 66 ? -81.439  7.886   -21.716 1.00 0.97 ? 75  ASN A N      4  
ATOM 10122 C CA     . ASN C 3 66 ? -82.216  6.622   -21.745 1.00 0.94 ? 75  ASN A CA     4  
ATOM 10123 C C      . ASN C 3 66 ? -83.167  6.563   -20.544 1.00 0.89 ? 75  ASN A C      4  
ATOM 10124 O O      . ASN C 3 66 ? -83.138  7.406   -19.669 1.00 0.90 ? 75  ASN A O      4  
ATOM 10125 C CB     . ASN C 3 66 ? -81.246  5.439   -21.722 1.00 1.07 ? 75  ASN A CB     4  
ATOM 10126 C CG     . ASN C 3 66 ? -80.471  5.434   -20.409 1.00 1.11 ? 75  ASN A CG     4  
ATOM 10127 O OD1    . ASN C 3 66 ? -80.776  6.188   -19.506 1.00 1.08 ? 75  ASN A OD1    4  
ATOM 10128 N ND2    . ASN C 3 66 ? -79.469  4.610   -20.266 1.00 1.48 ? 75  ASN A ND2    4  
ATOM 10129 H H      . ASN C 3 66 ? -80.483  7.867   -21.510 1.00 1.05 ? 75  ASN A H      4  
ATOM 10130 H HA     . ASN C 3 66 ? -82.796  6.587   -22.655 1.00 0.97 ? 75  ASN A HA     4  
ATOM 10131 H HB2    . ASN C 3 66 ? -81.797  4.517   -21.822 1.00 1.25 ? 75  ASN A HB2    4  
ATOM 10132 H HB3    . ASN C 3 66 ? -80.551  5.532   -22.544 1.00 1.21 ? 75  ASN A HB3    4  
ATOM 10133 H HD21   . ASN C 3 66 ? -79.225  4.006   -20.999 1.00 1.68 ? 75  ASN A HD21   4  
ATOM 10134 H HD22   . ASN C 3 66 ? -78.959  4.597   -19.431 1.00 1.66 ? 75  ASN A HD22   4  
ATOM 10135 N N      . TYR C 3 67 ? -84.017  5.577   -20.507 1.00 0.88 ? 76  TYR A N      4  
ATOM 10136 C CA     . TYR C 3 67 ? -84.984  5.446   -19.389 1.00 0.87 ? 76  TYR A CA     4  
ATOM 10137 C C      . TYR C 3 67 ? -84.246  5.067   -18.105 1.00 0.84 ? 76  TYR A C      4  
ATOM 10138 O O      . TYR C 3 67 ? -84.779  5.172   -17.018 1.00 0.83 ? 76  TYR A O      4  
ATOM 10139 C CB     . TYR C 3 67 ? -86.015  4.371   -19.733 1.00 0.95 ? 76  TYR A CB     4  
ATOM 10140 C CG     . TYR C 3 67 ? -87.091  4.372   -18.677 1.00 0.71 ? 76  TYR A CG     4  
ATOM 10141 C CD1    . TYR C 3 67 ? -88.164  5.267   -18.769 1.00 0.71 ? 76  TYR A CD1    4  
ATOM 10142 C CD2    . TYR C 3 67 ? -87.008  3.492   -17.589 1.00 0.79 ? 76  TYR A CD2    4  
ATOM 10143 C CE1    . TYR C 3 67 ? -89.145  5.287   -17.775 1.00 0.75 ? 76  TYR A CE1    4  
ATOM 10144 C CE2    . TYR C 3 67 ? -87.991  3.508   -16.601 1.00 0.85 ? 76  TYR A CE2    4  
ATOM 10145 C CZ     . TYR C 3 67 ? -89.059  4.408   -16.691 1.00 0.80 ? 76  TYR A CZ     4  
ATOM 10146 O OH     . TYR C 3 67 ? -90.017  4.442   -15.705 1.00 1.07 ? 76  TYR A OH     4  
ATOM 10147 H H      . TYR C 3 67 ? -84.023  4.916   -21.220 1.00 0.91 ? 76  TYR A H      4  
ATOM 10148 H HA     . TYR C 3 67 ? -85.489  6.389   -19.244 1.00 0.87 ? 76  TYR A HA     4  
ATOM 10149 H HB2    . TYR C 3 67 ? -86.449  4.586   -20.698 1.00 1.15 ? 76  TYR A HB2    4  
ATOM 10150 H HB3    . TYR C 3 67 ? -85.532  3.405   -19.759 1.00 1.13 ? 76  TYR A HB3    4  
ATOM 10151 H HD1    . TYR C 3 67 ? -88.232  5.946   -19.607 1.00 0.92 ? 76  TYR A HD1    4  
ATOM 10152 H HD2    . TYR C 3 67 ? -86.190  2.797   -17.516 1.00 1.01 ? 76  TYR A HD2    4  
ATOM 10153 H HE1    . TYR C 3 67 ? -89.976  5.971   -17.847 1.00 0.95 ? 76  TYR A HE1    4  
ATOM 10154 H HE2    . TYR C 3 67 ? -87.924  2.827   -15.766 1.00 1.10 ? 76  TYR A HE2    4  
ATOM 10155 H HH     . TYR C 3 67 ? -90.562  5.221   -15.851 1.00 1.51 ? 76  TYR A HH     4  
ATOM 10156 N N      . GLU C 3 68 ? -83.026  4.618   -18.220 1.00 0.85 ? 77  GLU A N      4  
ATOM 10157 C CA     . GLU C 3 68 ? -82.265  4.224   -17.002 1.00 0.86 ? 77  GLU A CA     4  
ATOM 10158 C C      . GLU C 3 68 ? -82.218  5.415   -16.050 1.00 0.84 ? 77  GLU A C      4  
ATOM 10159 O O      . GLU C 3 68 ? -82.223  5.261   -14.846 1.00 0.83 ? 77  GLU A O      4  
ATOM 10160 C CB     . GLU C 3 68 ? -80.837  3.827   -17.392 1.00 0.92 ? 77  GLU A CB     4  
ATOM 10161 C CG     . GLU C 3 68 ? -80.097  3.279   -16.167 1.00 1.49 ? 77  GLU A CG     4  
ATOM 10162 C CD     . GLU C 3 68 ? -78.737  2.733   -16.603 1.00 1.97 ? 77  GLU A CD     4  
ATOM 10163 O OE1    . GLU C 3 68 ? -78.630  2.300   -17.739 1.00 2.53 ? 77  GLU A OE1    4  
ATOM 10164 O OE2    . GLU C 3 68 ? -77.823  2.761   -15.796 1.00 2.43 ? 77  GLU A OE2    4  
ATOM 10165 H H      . GLU C 3 68 ? -82.615  4.535   -19.105 1.00 0.88 ? 77  GLU A H      4  
ATOM 10166 H HA     . GLU C 3 68 ? -82.757  3.394   -16.523 1.00 0.88 ? 77  GLU A HA     4  
ATOM 10167 H HB2    . GLU C 3 68 ? -80.869  3.071   -18.162 1.00 1.21 ? 77  GLU A HB2    4  
ATOM 10168 H HB3    . GLU C 3 68 ? -80.313  4.696   -17.762 1.00 1.32 ? 77  GLU A HB3    4  
ATOM 10169 H HG2    . GLU C 3 68 ? -79.951  4.071   -15.447 1.00 2.02 ? 77  GLU A HG2    4  
ATOM 10170 H HG3    . GLU C 3 68 ? -80.674  2.485   -15.716 1.00 1.92 ? 77  GLU A HG3    4  
ATOM 10171 N N      . LYS C 3 69 ? -82.181  6.601   -16.585 1.00 0.86 ? 78  LYS A N      4  
ATOM 10172 C CA     . LYS C 3 69 ? -82.144  7.809   -15.720 1.00 0.90 ? 78  LYS A CA     4  
ATOM 10173 C C      . LYS C 3 69 ? -83.335  7.793   -14.771 1.00 0.86 ? 78  LYS A C      4  
ATOM 10174 O O      . LYS C 3 69 ? -83.219  8.105   -13.604 1.00 0.90 ? 78  LYS A O      4  
ATOM 10175 C CB     . LYS C 3 69 ? -82.228  9.059   -16.601 1.00 0.96 ? 78  LYS A CB     4  
ATOM 10176 C CG     . LYS C 3 69 ? -82.216  10.336  -15.725 1.00 1.82 ? 78  LYS A CG     4  
ATOM 10177 C CD     . LYS C 3 69 ? -83.643  10.891  -15.564 1.00 2.38 ? 78  LYS A CD     4  
ATOM 10178 C CE     . LYS C 3 69 ? -83.695  11.835  -14.360 1.00 3.44 ? 78  LYS A CE     4  
ATOM 10179 N NZ     . LYS C 3 69 ? -85.072  12.376  -14.210 1.00 4.23 ? 78  LYS A NZ     4  
ATOM 10180 H H      . LYS C 3 69 ? -82.184  6.699   -17.560 1.00 0.89 ? 78  LYS A H      4  
ATOM 10181 H HA     . LYS C 3 69 ? -81.227  7.826   -15.153 1.00 0.95 ? 78  LYS A HA     4  
ATOM 10182 H HB2    . LYS C 3 69 ? -81.378  9.072   -17.271 1.00 1.32 ? 78  LYS A HB2    4  
ATOM 10183 H HB3    . LYS C 3 69 ? -83.137  9.023   -17.186 1.00 1.28 ? 78  LYS A HB3    4  
ATOM 10184 H HG2    . LYS C 3 69 ? -81.805  10.111  -14.748 1.00 2.37 ? 78  LYS A HG2    4  
ATOM 10185 H HG3    . LYS C 3 69 ? -81.601  11.085  -16.200 1.00 2.41 ? 78  LYS A HG3    4  
ATOM 10186 H HD2    . LYS C 3 69 ? -83.920  11.434  -16.457 1.00 2.64 ? 78  LYS A HD2    4  
ATOM 10187 H HD3    . LYS C 3 69 ? -84.336  10.080  -15.412 1.00 2.58 ? 78  LYS A HD3    4  
ATOM 10188 H HE2    . LYS C 3 69 ? -83.421  11.294  -13.467 1.00 3.82 ? 78  LYS A HE2    4  
ATOM 10189 H HE3    . LYS C 3 69 ? -83.006  12.648  -14.512 1.00 3.76 ? 78  LYS A HE3    4  
ATOM 10190 H HZ1    . LYS C 3 69 ? -85.762  11.651  -14.498 1.00 4.61 ? 78  LYS A HZ1    4  
ATOM 10191 H HZ2    . LYS C 3 69 ? -85.235  12.639  -13.218 1.00 4.55 ? 78  LYS A HZ2    4  
ATOM 10192 H HZ3    . LYS C 3 69 ? -85.180  13.216  -14.812 1.00 4.52 ? 78  LYS A HZ3    4  
ATOM 10193 N N      . LEU C 3 70 ? -84.483  7.442   -15.268 1.00 0.80 ? 79  LEU A N      4  
ATOM 10194 C CA     . LEU C 3 70 ? -85.689  7.417   -14.408 1.00 0.79 ? 79  LEU A CA     4  
ATOM 10195 C C      . LEU C 3 70 ? -85.566  6.301   -13.370 1.00 0.79 ? 79  LEU A C      4  
ATOM 10196 O O      . LEU C 3 70 ? -85.906  6.483   -12.220 1.00 0.86 ? 79  LEU A O      4  
ATOM 10197 C CB     . LEU C 3 70 ? -86.914  7.190   -15.307 1.00 0.77 ? 79  LEU A CB     4  
ATOM 10198 C CG     . LEU C 3 70 ? -87.413  8.547   -15.857 1.00 0.76 ? 79  LEU A CG     4  
ATOM 10199 C CD1    . LEU C 3 70 ? -88.140  8.351   -17.194 1.00 1.17 ? 79  LEU A CD1    4  
ATOM 10200 C CD2    . LEU C 3 70 ? -88.384  9.183   -14.845 1.00 1.13 ? 79  LEU A CD2    4  
ATOM 10201 H H      . LEU C 3 70 ? -84.554  7.206   -16.216 1.00 0.79 ? 79  LEU A H      4  
ATOM 10202 H HA     . LEU C 3 70 ? -85.781  8.366   -13.897 1.00 0.85 ? 79  LEU A HA     4  
ATOM 10203 H HB2    . LEU C 3 70 ? -86.623  6.544   -16.128 1.00 0.84 ? 79  LEU A HB2    4  
ATOM 10204 H HB3    . LEU C 3 70 ? -87.703  6.714   -14.742 1.00 0.81 ? 79  LEU A HB3    4  
ATOM 10205 H HG     . LEU C 3 70 ? -86.571  9.209   -16.009 1.00 1.08 ? 79  LEU A HG     4  
ATOM 10206 H HD11   . LEU C 3 70 ? -87.576  7.680   -17.826 1.00 1.72 ? 79  LEU A HD11   4  
ATOM 10207 H HD12   . LEU C 3 70 ? -89.119  7.940   -17.013 1.00 1.58 ? 79  LEU A HD12   4  
ATOM 10208 H HD13   . LEU C 3 70 ? -88.237  9.305   -17.688 1.00 1.65 ? 79  LEU A HD13   4  
ATOM 10209 H HD21   . LEU C 3 70 ? -87.970  9.109   -13.850 1.00 1.54 ? 79  LEU A HD21   4  
ATOM 10210 H HD22   . LEU C 3 70 ? -88.537  10.221  -15.093 1.00 1.55 ? 79  LEU A HD22   4  
ATOM 10211 H HD23   . LEU C 3 70 ? -89.331  8.661   -14.877 1.00 1.76 ? 79  LEU A HD23   4  
ATOM 10212 N N      . SER C 3 71 ? -85.079  5.154   -13.745 1.00 0.78 ? 80  SER A N      4  
ATOM 10213 C CA     . SER C 3 71 ? -84.949  4.067   -12.736 1.00 0.81 ? 80  SER A CA     4  
ATOM 10214 C C      . SER C 3 71 ? -84.008  4.524   -11.616 1.00 0.85 ? 80  SER A C      4  
ATOM 10215 O O      . SER C 3 71 ? -84.301  4.374   -10.452 1.00 1.01 ? 80  SER A O      4  
ATOM 10216 C CB     . SER C 3 71 ? -84.374  2.813   -13.394 1.00 0.88 ? 80  SER A CB     4  
ATOM 10217 O OG     . SER C 3 71 ? -83.092  3.108   -13.930 1.00 1.39 ? 80  SER A OG     4  
ATOM 10218 H H      . SER C 3 71 ? -84.797  5.009   -14.673 1.00 0.81 ? 80  SER A H      4  
ATOM 10219 H HA     . SER C 3 71 ? -85.923  3.845   -12.324 1.00 0.81 ? 80  SER A HA     4  
ATOM 10220 H HB2    . SER C 3 71 ? -84.273  2.034   -12.657 1.00 1.25 ? 80  SER A HB2    4  
ATOM 10221 H HB3    . SER C 3 71 ? -85.039  2.480   -14.183 1.00 1.13 ? 80  SER A HB3    4  
ATOM 10222 H HG     . SER C 3 71 ? -83.025  2.686   -14.789 1.00 1.86 ? 80  SER A HG     4  
ATOM 10223 N N      . ARG C 3 72 ? -82.882  5.087   -11.966 1.00 0.83 ? 81  ARG A N      4  
ATOM 10224 C CA     . ARG C 3 72 ? -81.917  5.558   -10.925 1.00 0.93 ? 81  ARG A CA     4  
ATOM 10225 C C      . ARG C 3 72 ? -82.401  6.885   -10.333 1.00 0.84 ? 81  ARG A C      4  
ATOM 10226 O O      . ARG C 3 72 ? -82.333  7.111   -9.141  1.00 0.87 ? 81  ARG A O      4  
ATOM 10227 C CB     . ARG C 3 72 ? -80.548  5.751   -11.584 1.00 1.06 ? 81  ARG A CB     4  
ATOM 10228 C CG     . ARG C 3 72 ? -79.497  6.190   -10.559 1.00 1.43 ? 81  ARG A CG     4  
ATOM 10229 C CD     . ARG C 3 72 ? -78.127  6.127   -11.233 1.00 2.09 ? 81  ARG A CD     4  
ATOM 10230 N NE     . ARG C 3 72 ? -78.140  7.032   -12.416 1.00 2.90 ? 81  ARG A NE     4  
ATOM 10231 C CZ     . ARG C 3 72 ? -77.033  7.301   -13.048 1.00 3.72 ? 81  ARG A CZ     4  
ATOM 10232 N NH1    . ARG C 3 72 ? -75.911  6.767   -12.649 1.00 3.91 ? 81  ARG A NH1    4  
ATOM 10233 N NH2    . ARG C 3 72 ? -77.047  8.100   -14.080 1.00 4.74 ? 81  ARG A NH2    4  
ATOM 10234 H H      . ARG C 3 72 ? -82.667  5.201   -12.915 1.00 0.83 ? 81  ARG A H      4  
ATOM 10235 H HA     . ARG C 3 72 ? -81.839  4.820   -10.141 1.00 1.02 ? 81  ARG A HA     4  
ATOM 10236 H HB2    . ARG C 3 72 ? -80.235  4.820   -12.031 1.00 1.28 ? 81  ARG A HB2    4  
ATOM 10237 H HB3    . ARG C 3 72 ? -80.627  6.505   -12.353 1.00 1.34 ? 81  ARG A HB3    4  
ATOM 10238 H HG2    . ARG C 3 72 ? -79.700  7.203   -10.237 1.00 1.77 ? 81  ARG A HG2    4  
ATOM 10239 H HG3    . ARG C 3 72 ? -79.511  5.526   -9.708  1.00 1.89 ? 81  ARG A HG3    4  
ATOM 10240 H HD2    . ARG C 3 72 ? -77.361  6.445   -10.547 1.00 2.52 ? 81  ARG A HD2    4  
ATOM 10241 H HD3    . ARG C 3 72 ? -77.928  5.110   -11.547 1.00 2.49 ? 81  ARG A HD3    4  
ATOM 10242 H HE     . ARG C 3 72 ? -78.984  7.430   -12.717 1.00 3.22 ? 81  ARG A HE     4  
ATOM 10243 H HH11   . ARG C 3 72 ? -75.903  6.151   -11.861 1.00 3.50 ? 81  ARG A HH11   4  
ATOM 10244 H HH12   . ARG C 3 72 ? -75.059  6.975   -13.129 1.00 4.74 ? 81  ARG A HH12   4  
ATOM 10245 H HH21   . ARG C 3 72 ? -77.909  8.507   -14.384 1.00 4.98 ? 81  ARG A HH21   4  
ATOM 10246 H HH22   . ARG C 3 72 ? -76.199  8.303   -14.566 1.00 5.47 ? 81  ARG A HH22   4  
ATOM 10247 N N      . GLY C 3 73 ? -82.876  7.772   -11.164 1.00 0.80 ? 82  GLY A N      4  
ATOM 10248 C CA     . GLY C 3 73 ? -83.347  9.093   -10.661 1.00 0.79 ? 82  GLY A CA     4  
ATOM 10249 C C      . GLY C 3 73 ? -84.671  8.967   -9.899  1.00 0.75 ? 82  GLY A C      4  
ATOM 10250 O O      . GLY C 3 73 ? -84.827  9.507   -8.821  1.00 0.80 ? 82  GLY A O      4  
ATOM 10251 H H      . GLY C 3 73 ? -82.911  7.575   -12.122 1.00 0.83 ? 82  GLY A H      4  
ATOM 10252 H HA2    . GLY C 3 73 ? -82.600  9.505   -10.001 1.00 0.85 ? 82  GLY A HA2    4  
ATOM 10253 H HA3    . GLY C 3 73 ? -83.488  9.761   -11.497 1.00 0.81 ? 82  GLY A HA3    4  
ATOM 10254 N N      . LEU C 3 74 ? -85.641  8.294   -10.452 1.00 0.73 ? 83  LEU A N      4  
ATOM 10255 C CA     . LEU C 3 74 ? -86.948  8.198   -9.745  1.00 0.76 ? 83  LEU A CA     4  
ATOM 10256 C C      . LEU C 3 74 ? -86.812  7.367   -8.467  1.00 0.78 ? 83  LEU A C      4  
ATOM 10257 O O      . LEU C 3 74 ? -87.507  7.595   -7.496  1.00 0.80 ? 83  LEU A O      4  
ATOM 10258 C CB     . LEU C 3 74 ? -88.006  7.594   -10.677 1.00 0.82 ? 83  LEU A CB     4  
ATOM 10259 C CG     . LEU C 3 74 ? -89.422  7.714   -10.040 1.00 0.85 ? 83  LEU A CG     4  
ATOM 10260 C CD1    . LEU C 3 74 ? -90.465  8.043   -11.117 1.00 1.57 ? 83  LEU A CD1    4  
ATOM 10261 C CD2    . LEU C 3 74 ? -89.808  6.389   -9.374  1.00 1.39 ? 83  LEU A CD2    4  
ATOM 10262 H H      . LEU C 3 74 ? -85.521  7.879   -11.332 1.00 0.75 ? 83  LEU A H      4  
ATOM 10263 H HA     . LEU C 3 74 ? -87.250  9.194   -9.477  1.00 0.78 ? 83  LEU A HA     4  
ATOM 10264 H HB2    . LEU C 3 74 ? -87.977  8.125   -11.618 1.00 0.94 ? 83  LEU A HB2    4  
ATOM 10265 H HB3    . LEU C 3 74 ? -87.774  6.553   -10.851 1.00 1.02 ? 83  LEU A HB3    4  
ATOM 10266 H HG     . LEU C 3 74 ? -89.432  8.500   -9.297  1.00 1.66 ? 83  LEU A HG     4  
ATOM 10267 H HD11   . LEU C 3 74 ? -90.154  8.919   -11.668 1.00 2.17 ? 83  LEU A HD11   4  
ATOM 10268 H HD12   . LEU C 3 74 ? -90.560  7.207   -11.795 1.00 2.12 ? 83  LEU A HD12   4  
ATOM 10269 H HD13   . LEU C 3 74 ? -91.419  8.235   -10.648 1.00 2.03 ? 83  LEU A HD13   4  
ATOM 10270 H HD21   . LEU C 3 74 ? -89.795  5.601   -10.114 1.00 2.04 ? 83  LEU A HD21   4  
ATOM 10271 H HD22   . LEU C 3 74 ? -89.102  6.159   -8.592  1.00 1.97 ? 83  LEU A HD22   4  
ATOM 10272 H HD23   . LEU C 3 74 ? -90.799  6.471   -8.954  1.00 1.79 ? 83  LEU A HD23   4  
ATOM 10273 N N      . ARG C 3 75 ? -85.927  6.412   -8.446  1.00 0.83 ? 84  ARG A N      4  
ATOM 10274 C CA     . ARG C 3 75 ? -85.766  5.591   -7.216  1.00 0.89 ? 84  ARG A CA     4  
ATOM 10275 C C      . ARG C 3 75 ? -85.541  6.512   -6.015  1.00 0.88 ? 84  ARG A C      4  
ATOM 10276 O O      . ARG C 3 75 ? -86.013  6.257   -4.928  1.00 0.97 ? 84  ARG A O      4  
ATOM 10277 C CB     . ARG C 3 75 ? -84.564  4.658   -7.375  1.00 1.03 ? 84  ARG A CB     4  
ATOM 10278 C CG     . ARG C 3 75 ? -84.366  3.817   -6.089  1.00 1.38 ? 84  ARG A CG     4  
ATOM 10279 C CD     . ARG C 3 75 ? -83.214  4.384   -5.253  1.00 1.27 ? 84  ARG A CD     4  
ATOM 10280 N NE     . ARG C 3 75 ? -81.945  4.271   -6.024  1.00 1.42 ? 84  ARG A NE     4  
ATOM 10281 C CZ     . ARG C 3 75 ? -80.878  4.903   -5.622  1.00 1.55 ? 84  ARG A CZ     4  
ATOM 10282 N NH1    . ARG C 3 75 ? -80.925  5.645   -4.548  1.00 1.74 ? 84  ARG A NH1    4  
ATOM 10283 N NH2    . ARG C 3 75 ? -79.765  4.799   -6.295  1.00 2.34 ? 84  ARG A NH2    4  
ATOM 10284 H H      . ARG C 3 75 ? -85.369  6.239   -9.232  1.00 0.86 ? 84  ARG A H      4  
ATOM 10285 H HA     . ARG C 3 75 ? -86.659  5.003   -7.057  1.00 0.91 ? 84  ARG A HA     4  
ATOM 10286 H HB2    . ARG C 3 75 ? -84.744  3.998   -8.212  1.00 1.12 ? 84  ARG A HB2    4  
ATOM 10287 H HB3    . ARG C 3 75 ? -83.679  5.247   -7.572  1.00 1.54 ? 84  ARG A HB3    4  
ATOM 10288 H HG2    . ARG C 3 75 ? -85.271  3.830   -5.495  1.00 2.07 ? 84  ARG A HG2    4  
ATOM 10289 H HG3    . ARG C 3 75 ? -84.136  2.797   -6.357  1.00 1.84 ? 84  ARG A HG3    4  
ATOM 10290 H HD2    . ARG C 3 75 ? -83.403  5.420   -5.026  1.00 1.63 ? 84  ARG A HD2    4  
ATOM 10291 H HD3    . ARG C 3 75 ? -83.133  3.825   -4.331  1.00 1.85 ? 84  ARG A HD3    4  
ATOM 10292 H HE     . ARG C 3 75 ? -81.912  3.718   -6.834  1.00 2.08 ? 84  ARG A HE     4  
ATOM 10293 H HH11   . ARG C 3 75 ? -81.780  5.730   -4.035  1.00 1.92 ? 84  ARG A HH11   4  
ATOM 10294 H HH12   . ARG C 3 75 ? -80.104  6.123   -4.235  1.00 2.25 ? 84  ARG A HH12   4  
ATOM 10295 H HH21   . ARG C 3 75 ? -79.730  4.235   -7.120  1.00 2.92 ? 84  ARG A HH21   4  
ATOM 10296 H HH22   . ARG C 3 75 ? -78.946  5.280   -5.985  1.00 2.64 ? 84  ARG A HH22   4  
ATOM 10297 N N      . TYR C 3 76 ? -84.825  7.581   -6.201  1.00 0.90 ? 85  TYR A N      4  
ATOM 10298 C CA     . TYR C 3 76 ? -84.586  8.520   -5.067  1.00 0.92 ? 85  TYR A CA     4  
ATOM 10299 C C      . TYR C 3 76 ? -85.870  9.311   -4.769  1.00 0.84 ? 85  TYR A C      4  
ATOM 10300 O O      . TYR C 3 76 ? -85.985  9.961   -3.750  1.00 0.88 ? 85  TYR A O      4  
ATOM 10301 C CB     . TYR C 3 76 ? -83.462  9.494   -5.436  1.00 1.04 ? 85  TYR A CB     4  
ATOM 10302 C CG     . TYR C 3 76 ? -83.299  10.518  -4.333  1.00 1.07 ? 85  TYR A CG     4  
ATOM 10303 C CD1    . TYR C 3 76 ? -84.120  11.651  -4.309  1.00 1.01 ? 85  TYR A CD1    4  
ATOM 10304 C CD2    . TYR C 3 76 ? -82.332  10.333  -3.338  1.00 1.31 ? 85  TYR A CD2    4  
ATOM 10305 C CE1    . TYR C 3 76 ? -83.977  12.598  -3.291  1.00 1.09 ? 85  TYR A CE1    4  
ATOM 10306 C CE2    . TYR C 3 76 ? -82.186  11.284  -2.319  1.00 1.39 ? 85  TYR A CE2    4  
ATOM 10307 C CZ     . TYR C 3 76 ? -83.011  12.417  -2.296  1.00 1.24 ? 85  TYR A CZ     4  
ATOM 10308 O OH     . TYR C 3 76 ? -82.865  13.358  -1.295  1.00 1.36 ? 85  TYR A OH     4  
ATOM 10309 H H      . TYR C 3 76 ? -84.448  7.773   -7.086  1.00 0.98 ? 85  TYR A H      4  
ATOM 10310 H HA     . TYR C 3 76 ? -84.299  7.957   -4.191  1.00 0.97 ? 85  TYR A HA     4  
ATOM 10311 H HB2    . TYR C 3 76 ? -82.538  8.946   -5.558  1.00 1.20 ? 85  TYR A HB2    4  
ATOM 10312 H HB3    . TYR C 3 76 ? -83.708  9.997   -6.359  1.00 1.03 ? 85  TYR A HB3    4  
ATOM 10313 H HD1    . TYR C 3 76 ? -84.867  11.793  -5.076  1.00 1.04 ? 85  TYR A HD1    4  
ATOM 10314 H HD2    . TYR C 3 76 ? -81.699  9.458   -3.355  1.00 1.51 ? 85  TYR A HD2    4  
ATOM 10315 H HE1    . TYR C 3 76 ? -84.617  13.466  -3.273  1.00 1.16 ? 85  TYR A HE1    4  
ATOM 10316 H HE2    . TYR C 3 76 ? -81.440  11.143  -1.551  1.00 1.64 ? 85  TYR A HE2    4  
ATOM 10317 H HH     . TYR C 3 76 ? -82.704  12.895  -0.470  1.00 1.43 ? 85  TYR A HH     4  
ATOM 10318 N N      . TYR C 3 77 ? -86.821  9.291   -5.670  1.00 0.79 ? 86  TYR A N      4  
ATOM 10319 C CA     . TYR C 3 77 ? -88.079  10.082  -5.459  1.00 0.79 ? 86  TYR A CA     4  
ATOM 10320 C C      . TYR C 3 77 ? -88.952  9.472   -4.354  1.00 0.84 ? 86  TYR A C      4  
ATOM 10321 O O      . TYR C 3 77 ? -90.063  9.910   -4.129  1.00 1.27 ? 86  TYR A O      4  
ATOM 10322 C CB     . TYR C 3 77 ? -88.875  10.128  -6.775  1.00 0.76 ? 86  TYR A CB     4  
ATOM 10323 C CG     . TYR C 3 77 ? -89.666  11.411  -6.842  1.00 0.77 ? 86  TYR A CG     4  
ATOM 10324 C CD1    . TYR C 3 77 ? -89.021  12.596  -7.209  1.00 0.82 ? 86  TYR A CD1    4  
ATOM 10325 C CD2    . TYR C 3 77 ? -91.028  11.424  -6.524  1.00 0.82 ? 86  TYR A CD2    4  
ATOM 10326 C CE1    . TYR C 3 77 ? -89.737  13.795  -7.263  1.00 0.87 ? 86  TYR A CE1    4  
ATOM 10327 C CE2    . TYR C 3 77 ? -91.742  12.626  -6.579  1.00 0.87 ? 86  TYR A CE2    4  
ATOM 10328 C CZ     . TYR C 3 77 ? -91.097  13.809  -6.949  1.00 0.89 ? 86  TYR A CZ     4  
ATOM 10329 O OH     . TYR C 3 77 ? -91.804  14.989  -7.009  1.00 0.98 ? 86  TYR A OH     4  
ATOM 10330 H H      . TYR C 3 77 ? -86.696  8.782   -6.499  1.00 0.79 ? 86  TYR A H      4  
ATOM 10331 H HA     . TYR C 3 77 ? -87.813  11.088  -5.172  1.00 0.85 ? 86  TYR A HA     4  
ATOM 10332 H HB2    . TYR C 3 77 ? -88.190  10.091  -7.604  1.00 0.78 ? 86  TYR A HB2    4  
ATOM 10333 H HB3    . TYR C 3 77 ? -89.551  9.284   -6.830  1.00 0.76 ? 86  TYR A HB3    4  
ATOM 10334 H HD1    . TYR C 3 77 ? -87.969  12.583  -7.456  1.00 0.85 ? 86  TYR A HD1    4  
ATOM 10335 H HD2    . TYR C 3 77 ? -91.527  10.508  -6.238  1.00 0.85 ? 86  TYR A HD2    4  
ATOM 10336 H HE1    . TYR C 3 77 ? -89.239  14.709  -7.538  1.00 0.95 ? 86  TYR A HE1    4  
ATOM 10337 H HE2    . TYR C 3 77 ? -92.787  12.644  -6.335  1.00 0.94 ? 86  TYR A HE2    4  
ATOM 10338 H HH     . TYR C 3 77 ? -91.630  15.477  -6.205  1.00 0.66 ? 86  TYR A HH     4  
ATOM 10339 N N      . TYR C 3 78 ? -88.476  8.481   -3.659  1.00 0.84 ? 87  TYR A N      4  
ATOM 10340 C CA     . TYR C 3 78 ? -89.307  7.876   -2.578  1.00 0.91 ? 87  TYR A CA     4  
ATOM 10341 C C      . TYR C 3 78 ? -89.288  8.784   -1.345  1.00 1.01 ? 87  TYR A C      4  
ATOM 10342 O O      . TYR C 3 78 ? -89.657  8.376   -0.262  1.00 1.20 ? 87  TYR A O      4  
ATOM 10343 C CB     . TYR C 3 78 ? -88.754  6.494   -2.206  1.00 1.01 ? 87  TYR A CB     4  
ATOM 10344 C CG     . TYR C 3 78 ? -89.201  5.460   -3.221  1.00 0.90 ? 87  TYR A CG     4  
ATOM 10345 C CD1    . TYR C 3 78 ? -88.866  5.607   -4.572  1.00 1.01 ? 87  TYR A CD1    4  
ATOM 10346 C CD2    . TYR C 3 78 ? -89.946  4.344   -2.805  1.00 1.48 ? 87  TYR A CD2    4  
ATOM 10347 C CE1    . TYR C 3 78 ? -89.274  4.649   -5.505  1.00 1.15 ? 87  TYR A CE1    4  
ATOM 10348 C CE2    . TYR C 3 78 ? -90.354  3.388   -3.739  1.00 1.65 ? 87  TYR A CE2    4  
ATOM 10349 C CZ     . TYR C 3 78 ? -90.018  3.540   -5.088  1.00 1.28 ? 87  TYR A CZ     4  
ATOM 10350 O OH     . TYR C 3 78 ? -90.420  2.598   -6.008  1.00 1.62 ? 87  TYR A OH     4  
ATOM 10351 H H      . TYR C 3 78 ? -87.577  8.135   -3.845  1.00 1.12 ? 87  TYR A H      4  
ATOM 10352 H HA     . TYR C 3 78 ? -90.326  7.774   -2.926  1.00 0.93 ? 87  TYR A HA     4  
ATOM 10353 H HB2    . TYR C 3 78 ? -87.675  6.534   -2.189  1.00 1.13 ? 87  TYR A HB2    4  
ATOM 10354 H HB3    . TYR C 3 78 ? -89.118  6.214   -1.227  1.00 1.32 ? 87  TYR A HB3    4  
ATOM 10355 H HD1    . TYR C 3 78 ? -88.298  6.463   -4.897  1.00 1.47 ? 87  TYR A HD1    4  
ATOM 10356 H HD2    . TYR C 3 78 ? -90.206  4.225   -1.763  1.00 2.02 ? 87  TYR A HD2    4  
ATOM 10357 H HE1    . TYR C 3 78 ? -89.015  4.767   -6.547  1.00 1.59 ? 87  TYR A HE1    4  
ATOM 10358 H HE2    . TYR C 3 78 ? -90.928  2.530   -3.419  1.00 2.28 ? 87  TYR A HE2    4  
ATOM 10359 H HH     . TYR C 3 78 ? -89.813  2.633   -6.750  1.00 2.01 ? 87  TYR A HH     4  
ATOM 10360 N N      . ASP C 3 79 ? -88.872  10.013  -1.491  1.00 1.01 ? 88  ASP A N      4  
ATOM 10361 C CA     . ASP C 3 79 ? -88.851  10.919  -0.308  1.00 1.13 ? 88  ASP A CA     4  
ATOM 10362 C C      . ASP C 3 79 ? -90.281  11.310  0.038   1.00 1.03 ? 88  ASP A C      4  
ATOM 10363 O O      . ASP C 3 79 ? -90.641  11.426  1.192   1.00 1.14 ? 88  ASP A O      4  
ATOM 10364 C CB     . ASP C 3 79 ? -88.047  12.181  -0.626  1.00 1.30 ? 88  ASP A CB     4  
ATOM 10365 C CG     . ASP C 3 79 ? -87.933  13.032  0.643   1.00 1.93 ? 88  ASP A CG     4  
ATOM 10366 O OD1    . ASP C 3 79 ? -88.383  12.574  1.681   1.00 2.30 ? 88  ASP A OD1    4  
ATOM 10367 O OD2    . ASP C 3 79 ? -87.401  14.125  0.557   1.00 2.74 ? 88  ASP A OD2    4  
ATOM 10368 H H      . ASP C 3 79 ? -88.581  10.337  -2.370  1.00 1.02 ? 88  ASP A H      4  
ATOM 10369 H HA     . ASP C 3 79 ? -88.411  10.408  0.532   1.00 1.31 ? 88  ASP A HA     4  
ATOM 10370 H HB2    . ASP C 3 79 ? -87.061  11.903  -0.967  1.00 1.70 ? 88  ASP A HB2    4  
ATOM 10371 H HB3    . ASP C 3 79 ? -88.550  12.749  -1.396  1.00 1.42 ? 88  ASP A HB3    4  
ATOM 10372 N N      . LYS C 3 80 ? -91.102  11.494  -0.957  1.00 0.99 ? 89  LYS A N      4  
ATOM 10373 C CA     . LYS C 3 80 ? -92.527  11.859  -0.714  1.00 1.08 ? 89  LYS A CA     4  
ATOM 10374 C C      . LYS C 3 80 ? -93.391  10.647  -1.081  1.00 1.10 ? 89  LYS A C      4  
ATOM 10375 O O      . LYS C 3 80 ? -93.159  9.993   -2.078  1.00 1.59 ? 89  LYS A O      4  
ATOM 10376 C CB     . LYS C 3 80 ? -92.878  13.067  -1.587  1.00 1.23 ? 89  LYS A CB     4  
ATOM 10377 C CG     . LYS C 3 80 ? -92.016  14.264  -1.150  1.00 1.31 ? 89  LYS A CG     4  
ATOM 10378 C CD     . LYS C 3 80 ? -92.421  15.531  -1.920  1.00 1.31 ? 89  LYS A CD     4  
ATOM 10379 C CE     . LYS C 3 80 ? -91.791  15.528  -3.322  1.00 1.90 ? 89  LYS A CE     4  
ATOM 10380 N NZ     . LYS C 3 80 ? -92.242  16.735  -4.075  1.00 2.52 ? 89  LYS A NZ     4  
ATOM 10381 H H      . LYS C 3 80 ? -90.781  11.381  -1.877  1.00 1.03 ? 89  LYS A H      4  
ATOM 10382 H HA     . LYS C 3 80 ? -92.682  12.108  0.328   1.00 1.16 ? 89  LYS A HA     4  
ATOM 10383 H HB2    . LYS C 3 80 ? -92.680  12.828  -2.619  1.00 1.35 ? 89  LYS A HB2    4  
ATOM 10384 H HB3    . LYS C 3 80 ? -93.922  13.315  -1.466  1.00 1.62 ? 89  LYS A HB3    4  
ATOM 10385 H HG2    . LYS C 3 80 ? -92.153  14.433  -0.091  1.00 1.90 ? 89  LYS A HG2    4  
ATOM 10386 H HG3    . LYS C 3 80 ? -90.975  14.047  -1.343  1.00 1.61 ? 89  LYS A HG3    4  
ATOM 10387 H HD2    . LYS C 3 80 ? -93.496  15.569  -2.008  1.00 1.79 ? 89  LYS A HD2    4  
ATOM 10388 H HD3    . LYS C 3 80 ? -92.077  16.400  -1.379  1.00 1.60 ? 89  LYS A HD3    4  
ATOM 10389 H HE2    . LYS C 3 80 ? -90.716  15.540  -3.235  1.00 2.47 ? 89  LYS A HE2    4  
ATOM 10390 H HE3    . LYS C 3 80 ? -92.096  14.644  -3.855  1.00 2.29 ? 89  LYS A HE3    4  
ATOM 10391 H HZ1    . LYS C 3 80 ? -92.632  17.434  -3.411  1.00 3.00 ? 89  LYS A HZ1    4  
ATOM 10392 H HZ2    . LYS C 3 80 ? -91.433  17.149  -4.581  1.00 2.97 ? 89  LYS A HZ2    4  
ATOM 10393 H HZ3    . LYS C 3 80 ? -92.976  16.463  -4.758  1.00 2.78 ? 89  LYS A HZ3    4  
ATOM 10394 N N      . ASN C 3 81 ? -94.369  10.317  -0.279  1.00 1.03 ? 90  ASN A N      4  
ATOM 10395 C CA     . ASN C 3 81 ? -95.208  9.121   -0.600  1.00 1.02 ? 90  ASN A CA     4  
ATOM 10396 C C      . ASN C 3 81 ? -96.199  9.487   -1.683  1.00 1.01 ? 90  ASN A C      4  
ATOM 10397 O O      . ASN C 3 81 ? -97.289  9.961   -1.427  1.00 1.12 ? 90  ASN A O      4  
ATOM 10398 C CB     . ASN C 3 81 ? -95.960  8.660   0.651   1.00 1.15 ? 90  ASN A CB     4  
ATOM 10399 C CG     . ASN C 3 81 ? -96.680  7.338   0.375   1.00 1.97 ? 90  ASN A CG     4  
ATOM 10400 O OD1    . ASN C 3 81 ? -96.090  6.395   -0.116  1.00 2.80 ? 90  ASN A OD1    4  
ATOM 10401 N ND2    . ASN C 3 81 ? -97.942  7.232   0.681   1.00 2.45 ? 90  ASN A ND2    4  
ATOM 10402 H H      . ASN C 3 81 ? -94.535  10.837  0.534   1.00 1.34 ? 90  ASN A H      4  
ATOM 10403 H HA     . ASN C 3 81 ? -94.579  8.324   -0.962  1.00 0.99 ? 90  ASN A HA     4  
ATOM 10404 H HB2    . ASN C 3 81 ? -95.260  8.525   1.462   1.00 1.58 ? 90  ASN A HB2    4  
ATOM 10405 H HB3    . ASN C 3 81 ? -96.689  9.407   0.925   1.00 1.40 ? 90  ASN A HB3    4  
ATOM 10406 H HD21   . ASN C 3 81 ? -98.413  7.992   1.082   1.00 2.39 ? 90  ASN A HD21   4  
ATOM 10407 H HD22   . ASN C 3 81 ? -98.421  6.393   0.514   1.00 3.23 ? 90  ASN A HD22   4  
ATOM 10408 N N      . ILE C 3 82 ? -95.805  9.273   -2.908  1.00 0.95 ? 91  ILE A N      4  
ATOM 10409 C CA     . ILE C 3 82 ? -96.674  9.605   -4.059  1.00 1.00 ? 91  ILE A CA     4  
ATOM 10410 C C      . ILE C 3 82 ? -96.630  8.456   -5.078  1.00 0.94 ? 91  ILE A C      4  
ATOM 10411 O O      . ILE C 3 82 ? -97.646  8.012   -5.575  1.00 1.01 ? 91  ILE A O      4  
ATOM 10412 C CB     . ILE C 3 82 ? -96.160  10.930  -4.652  1.00 1.10 ? 91  ILE A CB     4  
ATOM 10413 C CG1    . ILE C 3 82 ? -97.305  11.678  -5.332  1.00 1.28 ? 91  ILE A CG1    4  
ATOM 10414 C CG2    . ILE C 3 82 ? -95.016  10.708  -5.656  1.00 1.09 ? 91  ILE A CG2    4  
ATOM 10415 C CD1    . ILE C 3 82 ? -97.973  10.782  -6.369  1.00 0.84 ? 91  ILE A CD1    4  
ATOM 10416 H H      . ILE C 3 82 ? -94.914  8.899   -3.068  1.00 0.92 ? 91  ILE A H      4  
ATOM 10417 H HA     . ILE C 3 82 ? -97.690  9.736   -3.724  1.00 1.08 ? 91  ILE A HA     4  
ATOM 10418 H HB     . ILE C 3 82 ? -95.785  11.538  -3.842  1.00 1.17 ? 91  ILE A HB     4  
ATOM 10419 H HG12   . ILE C 3 82 ? -98.033  11.966  -4.587  1.00 1.93 ? 91  ILE A HG12   4  
ATOM 10420 H HG13   . ILE C 3 82 ? -96.918  12.558  -5.813  1.00 1.75 ? 91  ILE A HG13   4  
ATOM 10421 H HG21   . ILE C 3 82 ? -94.185  10.216  -5.166  1.00 1.56 ? 91  ILE A HG21   4  
ATOM 10422 H HG22   . ILE C 3 82 ? -95.354  10.108  -6.487  1.00 1.46 ? 91  ILE A HG22   4  
ATOM 10423 H HG23   . ILE C 3 82 ? -94.699  11.660  -6.027  1.00 1.46 ? 91  ILE A HG23   4  
ATOM 10424 H HD11   . ILE C 3 82 ? -97.220  10.241  -6.922  1.00 1.53 ? 91  ILE A HD11   4  
ATOM 10425 H HD12   . ILE C 3 82 ? -98.625  10.085  -5.867  1.00 1.12 ? 91  ILE A HD12   4  
ATOM 10426 H HD13   . ILE C 3 82 ? -98.551  11.392  -7.046  1.00 1.34 ? 91  ILE A HD13   4  
ATOM 10427 N N      . ILE C 3 83 ? -95.455  7.976   -5.396  1.00 0.89 ? 92  ILE A N      4  
ATOM 10428 C CA     . ILE C 3 83 ? -95.329  6.867   -6.388  1.00 0.84 ? 92  ILE A CA     4  
ATOM 10429 C C      . ILE C 3 83 ? -94.309  5.841   -5.898  1.00 0.81 ? 92  ILE A C      4  
ATOM 10430 O O      . ILE C 3 83 ? -93.241  6.184   -5.434  1.00 0.84 ? 92  ILE A O      4  
ATOM 10431 C CB     . ILE C 3 83 ? -94.857  7.447   -7.722  1.00 0.86 ? 92  ILE A CB     4  
ATOM 10432 C CG1    . ILE C 3 83 ? -94.898  6.352   -8.801  1.00 1.02 ? 92  ILE A CG1    4  
ATOM 10433 C CG2    . ILE C 3 83 ? -93.429  7.994   -7.580  1.00 0.85 ? 92  ILE A CG2    4  
ATOM 10434 C CD1    . ILE C 3 83 ? -94.218  6.853   -10.078 1.00 1.09 ? 92  ILE A CD1    4  
ATOM 10435 H H      . ILE C 3 83 ? -94.652  8.352   -4.987  1.00 0.95 ? 92  ILE A H      4  
ATOM 10436 H HA     . ILE C 3 83 ? -96.278  6.383   -6.528  1.00 0.83 ? 92  ILE A HA     4  
ATOM 10437 H HB     . ILE C 3 83 ? -95.517  8.254   -8.009  1.00 1.07 ? 92  ILE A HB     4  
ATOM 10438 H HG12   . ILE C 3 83 ? -94.383  5.471   -8.445  1.00 1.14 ? 92  ILE A HG12   4  
ATOM 10439 H HG13   . ILE C 3 83 ? -95.925  6.104   -9.018  1.00 1.34 ? 92  ILE A HG13   4  
ATOM 10440 H HG21   . ILE C 3 83 ? -93.310  8.456   -6.611  1.00 1.35 ? 92  ILE A HG21   4  
ATOM 10441 H HG22   . ILE C 3 83 ? -92.717  7.187   -7.683  1.00 1.32 ? 92  ILE A HG22   4  
ATOM 10442 H HG23   . ILE C 3 83 ? -93.250  8.731   -8.352  1.00 1.29 ? 92  ILE A HG23   4  
ATOM 10443 H HD11   . ILE C 3 83 ? -94.432  7.904   -10.220 1.00 1.45 ? 92  ILE A HD11   4  
ATOM 10444 H HD12   . ILE C 3 83 ? -93.152  6.711   -9.995  1.00 1.44 ? 92  ILE A HD12   4  
ATOM 10445 H HD13   . ILE C 3 83 ? -94.588  6.293   -10.925 1.00 1.67 ? 92  ILE A HD13   4  
ATOM 10446 N N      . HIS C 3 84 ? -94.630  4.578   -6.023  1.00 0.83 ? 93  HIS A N      4  
ATOM 10447 C CA     . HIS C 3 84 ? -93.688  3.498   -5.597  1.00 0.85 ? 93  HIS A CA     4  
ATOM 10448 C C      . HIS C 3 84 ? -93.628  2.432   -6.690  1.00 0.85 ? 93  HIS A C      4  
ATOM 10449 O O      . HIS C 3 84 ? -94.582  2.212   -7.408  1.00 0.91 ? 93  HIS A O      4  
ATOM 10450 C CB     . HIS C 3 84 ? -94.177  2.874   -4.291  1.00 0.88 ? 93  HIS A CB     4  
ATOM 10451 C CG     . HIS C 3 84 ? -93.899  3.821   -3.156  1.00 1.01 ? 93  HIS A CG     4  
ATOM 10452 N ND1    . HIS C 3 84 ? -92.961  3.540   -2.177  1.00 1.59 ? 93  HIS A ND1    4  
ATOM 10453 C CD2    . HIS C 3 84 ? -94.418  5.050   -2.837  1.00 1.02 ? 93  HIS A CD2    4  
ATOM 10454 C CE1    . HIS C 3 84 ? -92.946  4.578   -1.321  1.00 1.79 ? 93  HIS A CE1    4  
ATOM 10455 N NE2    . HIS C 3 84 ? -93.815  5.527   -1.677  1.00 1.41 ? 93  HIS A NE2    4  
ATOM 10456 H H      . HIS C 3 84 ? -95.496  4.338   -6.417  1.00 0.89 ? 93  HIS A H      4  
ATOM 10457 H HA     . HIS C 3 84 ? -92.698  3.910   -5.451  1.00 0.88 ? 93  HIS A HA     4  
ATOM 10458 H HB2    . HIS C 3 84 ? -95.239  2.688   -4.356  1.00 0.97 ? 93  HIS A HB2    4  
ATOM 10459 H HB3    . HIS C 3 84 ? -93.655  1.944   -4.119  1.00 0.99 ? 93  HIS A HB3    4  
ATOM 10460 H HD1    . HIS C 3 84 ? -92.402  2.737   -2.123  1.00 1.93 ? 93  HIS A HD1    4  
ATOM 10461 H HD2    . HIS C 3 84 ? -95.168  5.574   -3.407  1.00 1.12 ? 93  HIS A HD2    4  
ATOM 10462 H HE1    . HIS C 3 84 ? -92.311  4.633   -0.450  1.00 2.31 ? 93  HIS A HE1    4  
ATOM 10463 N N      . LYS C 3 85 ? -92.509  1.775   -6.834  1.00 0.92 ? 94  LYS A N      4  
ATOM 10464 C CA     . LYS C 3 85 ? -92.386  0.735   -7.897  1.00 0.96 ? 94  LYS A CA     4  
ATOM 10465 C C      . LYS C 3 85 ? -93.007  -0.586  -7.434  1.00 0.95 ? 94  LYS A C      4  
ATOM 10466 O O      . LYS C 3 85 ? -92.939  -0.954  -6.277  1.00 1.10 ? 94  LYS A O      4  
ATOM 10467 C CB     . LYS C 3 85 ? -90.910  0.514   -8.231  1.00 1.20 ? 94  LYS A CB     4  
ATOM 10468 C CG     . LYS C 3 85 ? -90.360  1.742   -8.966  1.00 1.61 ? 94  LYS A CG     4  
ATOM 10469 C CD     . LYS C 3 85 ? -88.860  1.562   -9.214  1.00 1.86 ? 94  LYS A CD     4  
ATOM 10470 C CE     . LYS C 3 85 ? -88.259  2.867   -9.754  1.00 2.16 ? 94  LYS A CE     4  
ATOM 10471 N NZ     . LYS C 3 85 ? -88.812  3.160   -11.108 1.00 2.83 ? 94  LYS A NZ     4  
ATOM 10472 H H      . LYS C 3 85 ? -91.746  1.973   -6.250  1.00 1.03 ? 94  LYS A H      4  
ATOM 10473 H HA     . LYS C 3 85 ? -92.900  1.072   -8.784  1.00 0.96 ? 94  LYS A HA     4  
ATOM 10474 H HB2    . LYS C 3 85 ? -90.353  0.362   -7.316  1.00 1.72 ? 94  LYS A HB2    4  
ATOM 10475 H HB3    . LYS C 3 85 ? -90.811  -0.355  -8.862  1.00 1.74 ? 94  LYS A HB3    4  
ATOM 10476 H HG2    . LYS C 3 85 ? -90.870  1.849   -9.913  1.00 2.19 ? 94  LYS A HG2    4  
ATOM 10477 H HG3    . LYS C 3 85 ? -90.523  2.626   -8.371  1.00 2.14 ? 94  LYS A HG3    4  
ATOM 10478 H HD2    . LYS C 3 85 ? -88.373  1.299   -8.286  1.00 2.20 ? 94  LYS A HD2    4  
ATOM 10479 H HD3    . LYS C 3 85 ? -88.709  0.773   -9.935  1.00 2.28 ? 94  LYS A HD3    4  
ATOM 10480 H HE2    . LYS C 3 85 ? -88.504  3.679   -9.085  1.00 2.48 ? 94  LYS A HE2    4  
ATOM 10481 H HE3    . LYS C 3 85 ? -87.184  2.767   -9.819  1.00 2.52 ? 94  LYS A HE3    4  
ATOM 10482 H HZ1    . LYS C 3 85 ? -89.850  3.101   -11.080 1.00 3.29 ? 94  LYS A HZ1    4  
ATOM 10483 H HZ2    . LYS C 3 85 ? -88.527  4.117   -11.398 1.00 3.25 ? 94  LYS A HZ2    4  
ATOM 10484 H HZ3    . LYS C 3 85 ? -88.444  2.471   -11.792 1.00 3.11 ? 94  LYS A HZ3    4  
ATOM 10485 N N      . THR C 3 86 ? -93.608  -1.302  -8.347  1.00 0.91 ? 95  THR A N      4  
ATOM 10486 C CA     . THR C 3 86 ? -94.240  -2.608  -8.003  1.00 1.04 ? 95  THR A CA     4  
ATOM 10487 C C      . THR C 3 86 ? -93.229  -3.738  -8.206  1.00 1.20 ? 95  THR A C      4  
ATOM 10488 O O      . THR C 3 86 ? -92.625  -3.861  -9.253  1.00 1.24 ? 95  THR A O      4  
ATOM 10489 C CB     . THR C 3 86 ? -95.443  -2.827  -8.917  1.00 1.05 ? 95  THR A CB     4  
ATOM 10490 O OG1    . THR C 3 86 ? -96.375  -1.772  -8.726  1.00 1.22 ? 95  THR A OG1    4  
ATOM 10491 C CG2    . THR C 3 86 ? -96.101  -4.164  -8.590  1.00 1.21 ? 95  THR A CG2    4  
ATOM 10492 H H      . THR C 3 86 ? -93.642  -0.979  -9.271  1.00 0.87 ? 95  THR A H      4  
ATOM 10493 H HA     . THR C 3 86 ? -94.569  -2.597  -6.973  1.00 1.18 ? 95  THR A HA     4  
ATOM 10494 H HB     . THR C 3 86 ? -95.114  -2.834  -9.945  1.00 1.06 ? 95  THR A HB     4  
ATOM 10495 H HG1    . THR C 3 86 ? -96.896  -1.690  -9.527  1.00 1.56 ? 95  THR A HG1    4  
ATOM 10496 H HG21   . THR C 3 86 ? -96.233  -4.248  -7.522  1.00 1.62 ? 95  THR A HG21   4  
ATOM 10497 H HG22   . THR C 3 86 ? -97.062  -4.221  -9.079  1.00 1.57 ? 95  THR A HG22   4  
ATOM 10498 H HG23   . THR C 3 86 ? -95.472  -4.969  -8.940  1.00 1.62 ? 95  THR A HG23   4  
ATOM 10499 N N      . ALA C 3 87 ? -93.042  -4.563  -7.214  1.00 1.58 ? 96  ALA A N      4  
ATOM 10500 C CA     . ALA C 3 87 ? -92.068  -5.688  -7.339  1.00 1.85 ? 96  ALA A CA     4  
ATOM 10501 C C      . ALA C 3 87 ? -92.657  -6.810  -8.201  1.00 1.77 ? 96  ALA A C      4  
ATOM 10502 O O      . ALA C 3 87 ? -92.307  -7.964  -8.052  1.00 2.10 ? 96  ALA A O      4  
ATOM 10503 C CB     . ALA C 3 87 ? -91.771  -6.246  -5.949  1.00 2.47 ? 96  ALA A CB     4  
ATOM 10504 H H      . ALA C 3 87 ? -93.541  -4.442  -6.379  1.00 1.82 ? 96  ALA A H      4  
ATOM 10505 H HA     . ALA C 3 87 ? -91.153  -5.327  -7.784  1.00 1.89 ? 96  ALA A HA     4  
ATOM 10506 H HB1    . ALA C 3 87 ? -92.703  -6.449  -5.440  1.00 2.84 ? 96  ALA A HB1    4  
ATOM 10507 H HB2    . ALA C 3 87 ? -91.206  -7.160  -6.043  1.00 2.87 ? 96  ALA A HB2    4  
ATOM 10508 H HB3    . ALA C 3 87 ? -91.202  -5.523  -5.384  1.00 2.72 ? 96  ALA A HB3    4  
ATOM 10509 N N      . GLY C 3 88 ? -93.553  -6.488  -9.093  1.00 1.65 ? 97  GLY A N      4  
ATOM 10510 C CA     . GLY C 3 88 ? -94.167  -7.548  -9.949  1.00 1.96 ? 97  GLY A CA     4  
ATOM 10511 C C      . GLY C 3 88 ? -93.227  -7.901  -11.104 1.00 1.94 ? 97  GLY A C      4  
ATOM 10512 O O      . GLY C 3 88 ? -92.674  -8.981  -11.150 1.00 2.32 ? 97  GLY A O      4  
ATOM 10513 H H      . GLY C 3 88 ? -93.827  -5.555  -9.195  1.00 1.59 ? 97  GLY A H      4  
ATOM 10514 H HA2    . GLY C 3 88 ? -94.348  -8.430  -9.351  1.00 2.24 ? 97  GLY A HA2    4  
ATOM 10515 H HA3    . GLY C 3 88 ? -95.102  -7.187  -10.350 1.00 2.17 ? 97  GLY A HA3    4  
ATOM 10516 N N      . LYS C 3 89 ? -93.044  -6.997  -12.037 1.00 1.64 ? 98  LYS A N      4  
ATOM 10517 C CA     . LYS C 3 89 ? -92.138  -7.266  -13.203 1.00 1.72 ? 98  LYS A CA     4  
ATOM 10518 C C      . LYS C 3 89 ? -90.931  -6.329  -13.100 1.00 1.44 ? 98  LYS A C      4  
ATOM 10519 O O      . LYS C 3 89 ? -90.348  -6.190  -12.044 1.00 1.85 ? 98  LYS A O      4  
ATOM 10520 C CB     . LYS C 3 89 ? -92.896  -7.010  -14.515 1.00 2.09 ? 98  LYS A CB     4  
ATOM 10521 C CG     . LYS C 3 89 ? -92.141  -7.633  -15.706 1.00 2.01 ? 98  LYS A CG     4  
ATOM 10522 C CD     . LYS C 3 89 ? -92.493  -9.117  -15.857 1.00 2.78 ? 98  LYS A CD     4  
ATOM 10523 C CE     . LYS C 3 89 ? -91.824  -9.659  -17.124 1.00 3.22 ? 98  LYS A CE     4  
ATOM 10524 N NZ     . LYS C 3 89 ? -92.484  -9.076  -18.327 1.00 3.60 ? 98  LYS A NZ     4  
ATOM 10525 H H      . LYS C 3 89 ? -93.506  -6.133  -11.972 1.00 1.50 ? 98  LYS A H      4  
ATOM 10526 H HA     . LYS C 3 89 ? -91.795  -8.290  -13.179 1.00 2.08 ? 98  LYS A HA     4  
ATOM 10527 H HB2    . LYS C 3 89 ? -93.886  -7.440  -14.448 1.00 2.74 ? 98  LYS A HB2    4  
ATOM 10528 H HB3    . LYS C 3 89 ? -92.982  -5.946  -14.670 1.00 2.38 ? 98  LYS A HB3    4  
ATOM 10529 H HG2    . LYS C 3 89 ? -92.415  -7.114  -16.613 1.00 2.19 ? 98  LYS A HG2    4  
ATOM 10530 H HG3    . LYS C 3 89 ? -91.077  -7.538  -15.552 1.00 2.14 ? 98  LYS A HG3    4  
ATOM 10531 H HD2    . LYS C 3 89 ? -92.134  -9.666  -14.998 1.00 3.13 ? 98  LYS A HD2    4  
ATOM 10532 H HD3    . LYS C 3 89 ? -93.562  -9.231  -15.937 1.00 3.29 ? 98  LYS A HD3    4  
ATOM 10533 H HE2    . LYS C 3 89 ? -90.779  -9.387  -17.123 1.00 3.55 ? 98  LYS A HE2    4  
ATOM 10534 H HE3    . LYS C 3 89 ? -91.916  -10.735 -17.149 1.00 3.59 ? 98  LYS A HE3    4  
ATOM 10535 H HZ1    . LYS C 3 89 ? -93.487  -8.893  -18.120 1.00 3.80 ? 98  LYS A HZ1    4  
ATOM 10536 H HZ2    . LYS C 3 89 ? -92.017  -8.182  -18.580 1.00 3.82 ? 98  LYS A HZ2    4  
ATOM 10537 H HZ3    . LYS C 3 89 ? -92.409  -9.745  -19.121 1.00 3.99 ? 98  LYS A HZ3    4  
ATOM 10538 N N      . ARG C 3 90 ? -90.548  -5.687  -14.181 1.00 1.21 ? 99  ARG A N      4  
ATOM 10539 C CA     . ARG C 3 90 ? -89.374  -4.754  -14.141 1.00 1.48 ? 99  ARG A CA     4  
ATOM 10540 C C      . ARG C 3 90 ? -89.820  -3.347  -14.564 1.00 1.11 ? 99  ARG A C      4  
ATOM 10541 O O      . ARG C 3 90 ? -89.296  -2.358  -14.088 1.00 1.22 ? 99  ARG A O      4  
ATOM 10542 C CB     . ARG C 3 90 ? -88.290  -5.261  -15.101 1.00 2.00 ? 99  ARG A CB     4  
ATOM 10543 C CG     . ARG C 3 90 ? -87.660  -6.542  -14.549 1.00 2.76 ? 99  ARG A CG     4  
ATOM 10544 C CD     . ARG C 3 90 ? -86.573  -7.017  -15.511 1.00 3.58 ? 99  ARG A CD     4  
ATOM 10545 N NE     . ARG C 3 90 ? -87.209  -7.414  -16.799 1.00 4.24 ? 99  ARG A NE     4  
ATOM 10546 C CZ     . ARG C 3 90 ? -86.476  -7.649  -17.852 1.00 4.91 ? 99  ARG A CZ     4  
ATOM 10547 N NH1    . ARG C 3 90 ? -85.177  -7.543  -17.782 1.00 5.13 ? 99  ARG A NH1    4  
ATOM 10548 N NH2    . ARG C 3 90 ? -87.042  -7.991  -18.976 1.00 5.66 ? 99  ARG A NH2    4  
ATOM 10549 H H      . ARG C 3 90 ? -91.035  -5.814  -15.021 1.00 1.29 ? 99  ARG A H      4  
ATOM 10550 H HA     . ARG C 3 90 ? -88.968  -4.708  -13.141 1.00 2.02 ? 99  ARG A HA     4  
ATOM 10551 H HB2    . ARG C 3 90 ? -88.728  -5.467  -16.065 1.00 2.35 ? 99  ARG A HB2    4  
ATOM 10552 H HB3    . ARG C 3 90 ? -87.524  -4.508  -15.207 1.00 2.27 ? 99  ARG A HB3    4  
ATOM 10553 H HG2    . ARG C 3 90 ? -87.225  -6.343  -13.579 1.00 3.10 ? 99  ARG A HG2    4  
ATOM 10554 H HG3    . ARG C 3 90 ? -88.417  -7.307  -14.455 1.00 3.02 ? 99  ARG A HG3    4  
ATOM 10555 H HD2    . ARG C 3 90 ? -85.873  -6.217  -15.691 1.00 3.70 ? 99  ARG A HD2    4  
ATOM 10556 H HD3    . ARG C 3 90 ? -86.050  -7.860  -15.081 1.00 4.02 ? 99  ARG A HD3    4  
ATOM 10557 H HE     . ARG C 3 90 ? -88.185  -7.494  -16.858 1.00 4.43 ? 99  ARG A HE     4  
ATOM 10558 H HH11   . ARG C 3 90 ? -84.743  -7.282  -16.919 1.00 4.79 ? 99  ARG A HH11   4  
ATOM 10559 H HH12   . ARG C 3 90 ? -84.616  -7.719  -18.590 1.00 5.82 ? 99  ARG A HH12   4  
ATOM 10560 H HH21   . ARG C 3 90 ? -88.037  -8.069  -19.031 1.00 5.80 ? 99  ARG A HH21   4  
ATOM 10561 H HH22   . ARG C 3 90 ? -86.480  -8.181  -19.781 1.00 6.26 ? 99  ARG A HH22   4  
ATOM 10562 N N      . TYR C 3 91 ? -90.779  -3.249  -15.459 1.00 0.92 ? 100 TYR A N      4  
ATOM 10563 C CA     . TYR C 3 91 ? -91.265  -1.904  -15.926 1.00 0.77 ? 100 TYR A CA     4  
ATOM 10564 C C      . TYR C 3 91 ? -92.654  -1.619  -15.336 1.00 0.76 ? 100 TYR A C      4  
ATOM 10565 O O      . TYR C 3 91 ? -93.434  -0.884  -15.913 1.00 0.77 ? 100 TYR A O      4  
ATOM 10566 C CB     . TYR C 3 91 ? -91.376  -1.899  -17.458 1.00 0.94 ? 100 TYR A CB     4  
ATOM 10567 C CG     . TYR C 3 91 ? -90.050  -2.276  -18.073 1.00 0.87 ? 100 TYR A CG     4  
ATOM 10568 C CD1    . TYR C 3 91 ? -89.051  -1.311  -18.255 1.00 0.87 ? 100 TYR A CD1    4  
ATOM 10569 C CD2    . TYR C 3 91 ? -89.818  -3.602  -18.455 1.00 1.18 ? 100 TYR A CD2    4  
ATOM 10570 C CE1    . TYR C 3 91 ? -87.821  -1.678  -18.818 1.00 0.87 ? 100 TYR A CE1    4  
ATOM 10571 C CE2    . TYR C 3 91 ? -88.590  -3.969  -19.014 1.00 1.27 ? 100 TYR A CE2    4  
ATOM 10572 C CZ     . TYR C 3 91 ? -87.590  -3.006  -19.195 1.00 1.00 ? 100 TYR A CZ     4  
ATOM 10573 O OH     . TYR C 3 91 ? -86.373  -3.369  -19.737 1.00 1.16 ? 100 TYR A OH     4  
ATOM 10574 H H      . TYR C 3 91 ? -91.179  -4.064  -15.828 1.00 1.08 ? 100 TYR A H      4  
ATOM 10575 H HA     . TYR C 3 91 ? -90.576  -1.129  -15.614 1.00 0.82 ? 100 TYR A HA     4  
ATOM 10576 H HB2    . TYR C 3 91 ? -92.129  -2.608  -17.765 1.00 1.17 ? 100 TYR A HB2    4  
ATOM 10577 H HB3    . TYR C 3 91 ? -91.658  -0.909  -17.794 1.00 1.13 ? 100 TYR A HB3    4  
ATOM 10578 H HD1    . TYR C 3 91 ? -89.229  -0.286  -17.967 1.00 1.11 ? 100 TYR A HD1    4  
ATOM 10579 H HD2    . TYR C 3 91 ? -90.590  -4.344  -18.316 1.00 1.48 ? 100 TYR A HD2    4  
ATOM 10580 H HE1    . TYR C 3 91 ? -87.052  -0.936  -18.958 1.00 1.04 ? 100 TYR A HE1    4  
ATOM 10581 H HE2    . TYR C 3 91 ? -88.415  -4.992  -19.309 1.00 1.66 ? 100 TYR A HE2    4  
ATOM 10582 H HH     . TYR C 3 91 ? -86.513  -3.599  -20.657 1.00 1.55 ? 100 TYR A HH     4  
ATOM 10583 N N      . VAL C 3 92 ? -92.986  -2.193  -14.204 1.00 0.77 ? 101 VAL A N      4  
ATOM 10584 C CA     . VAL C 3 92 ? -94.338  -1.943  -13.609 1.00 0.79 ? 101 VAL A CA     4  
ATOM 10585 C C      . VAL C 3 92 ? -94.274  -0.746  -12.651 1.00 0.73 ? 101 VAL A C      4  
ATOM 10586 O O      . VAL C 3 92 ? -93.498  -0.711  -11.718 1.00 0.76 ? 101 VAL A O      4  
ATOM 10587 C CB     . VAL C 3 92 ? -94.829  -3.196  -12.862 1.00 0.90 ? 101 VAL A CB     4  
ATOM 10588 C CG1    . VAL C 3 92 ? -95.293  -4.256  -13.874 1.00 1.07 ? 101 VAL A CG1    4  
ATOM 10589 C CG2    . VAL C 3 92 ? -93.693  -3.776  -12.013 1.00 1.14 ? 101 VAL A CG2    4  
ATOM 10590 H H      . VAL C 3 92 ? -92.353  -2.788  -13.750 1.00 0.80 ? 101 VAL A H      4  
ATOM 10591 H HA     . VAL C 3 92 ? -95.040  -1.713  -14.401 1.00 0.79 ? 101 VAL A HA     4  
ATOM 10592 H HB     . VAL C 3 92 ? -95.657  -2.929  -12.222 1.00 1.17 ? 101 VAL A HB     4  
ATOM 10593 H HG11   . VAL C 3 92 ? -94.608  -4.287  -14.707 1.00 1.49 ? 101 VAL A HG11   4  
ATOM 10594 H HG12   . VAL C 3 92 ? -95.324  -5.227  -13.396 1.00 1.48 ? 101 VAL A HG12   4  
ATOM 10595 H HG13   . VAL C 3 92 ? -96.282  -4.005  -14.230 1.00 1.63 ? 101 VAL A HG13   4  
ATOM 10596 H HG21   . VAL C 3 92 ? -93.196  -2.984  -11.479 1.00 1.63 ? 101 VAL A HG21   4  
ATOM 10597 H HG22   . VAL C 3 92 ? -94.099  -4.484  -11.306 1.00 1.56 ? 101 VAL A HG22   4  
ATOM 10598 H HG23   . VAL C 3 92 ? -92.983  -4.278  -12.656 1.00 1.56 ? 101 VAL A HG23   4  
ATOM 10599 N N      . TYR C 3 93 ? -95.102  0.239   -12.894 1.00 0.69 ? 102 TYR A N      4  
ATOM 10600 C CA     . TYR C 3 93 ? -95.141  1.462   -12.030 1.00 0.67 ? 102 TYR A CA     4  
ATOM 10601 C C      . TYR C 3 93 ? -96.527  1.570   -11.393 1.00 0.68 ? 102 TYR A C      4  
ATOM 10602 O O      . TYR C 3 93 ? -97.521  1.208   -11.987 1.00 0.73 ? 102 TYR A O      4  
ATOM 10603 C CB     . TYR C 3 93 ? -94.863  2.702   -12.895 1.00 0.69 ? 102 TYR A CB     4  
ATOM 10604 C CG     . TYR C 3 93 ? -93.376  2.819   -13.144 1.00 0.76 ? 102 TYR A CG     4  
ATOM 10605 C CD1    . TYR C 3 93 ? -92.707  1.836   -13.882 1.00 0.84 ? 102 TYR A CD1    4  
ATOM 10606 C CD2    . TYR C 3 93 ? -92.669  3.907   -12.623 1.00 1.09 ? 102 TYR A CD2    4  
ATOM 10607 C CE1    . TYR C 3 93 ? -91.325  1.943   -14.096 1.00 0.91 ? 102 TYR A CE1    4  
ATOM 10608 C CE2    . TYR C 3 93 ? -91.295  4.016   -12.838 1.00 1.23 ? 102 TYR A CE2    4  
ATOM 10609 C CZ     . TYR C 3 93 ? -90.621  3.033   -13.573 1.00 1.01 ? 102 TYR A CZ     4  
ATOM 10610 O OH     . TYR C 3 93 ? -89.263  3.138   -13.779 1.00 1.16 ? 102 TYR A OH     4  
ATOM 10611 H H      . TYR C 3 93 ? -95.712  0.172   -13.656 1.00 0.71 ? 102 TYR A H      4  
ATOM 10612 H HA     . TYR C 3 93 ? -94.396  1.392   -11.246 1.00 0.70 ? 102 TYR A HA     4  
ATOM 10613 H HB2    . TYR C 3 93 ? -95.375  2.604   -13.840 1.00 0.71 ? 102 TYR A HB2    4  
ATOM 10614 H HB3    . TYR C 3 93 ? -95.216  3.587   -12.385 1.00 0.71 ? 102 TYR A HB3    4  
ATOM 10615 H HD1    . TYR C 3 93 ? -93.254  0.997   -14.286 1.00 1.08 ? 102 TYR A HD1    4  
ATOM 10616 H HD2    . TYR C 3 93 ? -93.188  4.669   -12.059 1.00 1.37 ? 102 TYR A HD2    4  
ATOM 10617 H HE1    . TYR C 3 93 ? -90.803  1.188   -14.668 1.00 1.11 ? 102 TYR A HE1    4  
ATOM 10618 H HE2    . TYR C 3 93 ? -90.752  4.856   -12.435 1.00 1.60 ? 102 TYR A HE2    4  
ATOM 10619 H HH     . TYR C 3 93 ? -88.950  2.294   -14.111 1.00 1.41 ? 102 TYR A HH     4  
ATOM 10620 N N      . ARG C 3 94 ? -96.598  2.057   -10.182 1.00 0.68 ? 103 ARG A N      4  
ATOM 10621 C CA     . ARG C 3 94 ? -97.918  2.179   -9.492  1.00 0.73 ? 103 ARG A CA     4  
ATOM 10622 C C      . ARG C 3 94 ? -97.904  3.402   -8.588  1.00 0.74 ? 103 ARG A C      4  
ATOM 10623 O O      . ARG C 3 94 ? -96.858  3.891   -8.208  1.00 0.75 ? 103 ARG A O      4  
ATOM 10624 C CB     . ARG C 3 94 ? -98.169  0.932   -8.641  1.00 0.80 ? 103 ARG A CB     4  
ATOM 10625 C CG     . ARG C 3 94 ? -99.561  1.002   -8.006  1.00 1.30 ? 103 ARG A CG     4  
ATOM 10626 C CD     . ARG C 3 94 ? -99.869  -0.327  -7.327  1.00 1.34 ? 103 ARG A CD     4  
ATOM 10627 N NE     . ARG C 3 94 ? -101.209 -0.238  -6.692  1.00 1.78 ? 103 ARG A NE     4  
ATOM 10628 C CZ     . ARG C 3 94 ? -101.797 -1.309  -6.237  1.00 2.11 ? 103 ARG A CZ     4  
ATOM 10629 N NH1    . ARG C 3 94 ? -101.194 -2.468  -6.281  1.00 2.17 ? 103 ARG A NH1    4  
ATOM 10630 N NH2    . ARG C 3 94 ? -102.987 -1.217  -5.717  1.00 2.90 ? 103 ARG A NH2    4  
ATOM 10631 H H      . ARG C 3 94 ? -95.779  2.336   -9.719  1.00 0.66 ? 103 ARG A H      4  
ATOM 10632 H HA     . ARG C 3 94 ? -98.707  2.283   -10.222 1.00 0.76 ? 103 ARG A HA     4  
ATOM 10633 H HB2    . ARG C 3 94 ? -98.104  0.053   -9.264  1.00 1.08 ? 103 ARG A HB2    4  
ATOM 10634 H HB3    . ARG C 3 94 ? -97.424  0.874   -7.860  1.00 1.12 ? 103 ARG A HB3    4  
ATOM 10635 H HG2    . ARG C 3 94 ? -99.585  1.793   -7.268  1.00 1.92 ? 103 ARG A HG2    4  
ATOM 10636 H HG3    . ARG C 3 94 ? -100.300 1.195   -8.767  1.00 1.77 ? 103 ARG A HG3    4  
ATOM 10637 H HD2    . ARG C 3 94 ? -99.872  -1.116  -8.059  1.00 1.66 ? 103 ARG A HD2    4  
ATOM 10638 H HD3    . ARG C 3 94 ? -99.116  -0.532  -6.577  1.00 1.81 ? 103 ARG A HD3    4  
ATOM 10639 H HE     . ARG C 3 94 ? -101.662 0.629   -6.632  1.00 2.29 ? 103 ARG A HE     4  
ATOM 10640 H HH11   . ARG C 3 94 ? -100.275 -2.542  -6.669  1.00 2.12 ? 103 ARG A HH11   4  
ATOM 10641 H HH12   . ARG C 3 94 ? -101.649 -3.281  -5.916  1.00 2.68 ? 103 ARG A HH12   4  
ATOM 10642 H HH21   . ARG C 3 94 ? -103.441 -0.329  -5.666  1.00 3.34 ? 103 ARG A HH21   4  
ATOM 10643 H HH22   . ARG C 3 94 ? -103.447 -2.037  -5.380  1.00 3.25 ? 103 ARG A HH22   4  
ATOM 10644 N N      . PHE C 3 95 ? -99.064  3.896   -8.240  1.00 0.82 ? 104 PHE A N      4  
ATOM 10645 C CA     . PHE C 3 95 ? -99.149  5.097   -7.354  1.00 0.85 ? 104 PHE A CA     4  
ATOM 10646 C C      . PHE C 3 95 ? -100.114 4.824   -6.201  1.00 0.96 ? 104 PHE A C      4  
ATOM 10647 O O      . PHE C 3 95 ? -100.903 3.902   -6.237  1.00 1.16 ? 104 PHE A O      4  
ATOM 10648 C CB     . PHE C 3 95 ? -99.663  6.297   -8.148  1.00 0.89 ? 104 PHE A CB     4  
ATOM 10649 C CG     . PHE C 3 95 ? -98.682  6.678   -9.238  1.00 0.87 ? 104 PHE A CG     4  
ATOM 10650 C CD1    . PHE C 3 95 ? -98.506  5.851   -10.356 1.00 0.88 ? 104 PHE A CD1    4  
ATOM 10651 C CD2    . PHE C 3 95 ? -97.958  7.874   -9.136  1.00 0.97 ? 104 PHE A CD2    4  
ATOM 10652 C CE1    . PHE C 3 95 ? -97.609  6.224   -11.367 1.00 0.97 ? 104 PHE A CE1    4  
ATOM 10653 C CE2    . PHE C 3 95 ? -97.062  8.242   -10.146 1.00 1.07 ? 104 PHE A CE2    4  
ATOM 10654 C CZ     . PHE C 3 95 ? -96.890  7.421   -11.260 1.00 1.06 ? 104 PHE A CZ     4  
ATOM 10655 H H      . PHE C 3 95 ? -99.885  3.472   -8.568  1.00 0.88 ? 104 PHE A H      4  
ATOM 10656 H HA     . PHE C 3 95 ? -98.182  5.325   -6.950  1.00 0.82 ? 104 PHE A HA     4  
ATOM 10657 H HB2    . PHE C 3 95 ? -100.615 6.048   -8.592  1.00 0.95 ? 104 PHE A HB2    4  
ATOM 10658 H HB3    . PHE C 3 95 ? -99.790  7.130   -7.473  1.00 0.95 ? 104 PHE A HB3    4  
ATOM 10659 H HD1    . PHE C 3 95 ? -99.064  4.929   -10.440 1.00 0.90 ? 104 PHE A HD1    4  
ATOM 10660 H HD2    . PHE C 3 95 ? -98.087  8.511   -8.275  1.00 1.04 ? 104 PHE A HD2    4  
ATOM 10661 H HE1    . PHE C 3 95 ? -97.468  5.586   -12.226 1.00 1.05 ? 104 PHE A HE1    4  
ATOM 10662 H HE2    . PHE C 3 95 ? -96.508  9.165   -10.064 1.00 1.21 ? 104 PHE A HE2    4  
ATOM 10663 H HZ     . PHE C 3 95 ? -96.201  7.709   -12.041 1.00 1.18 ? 104 PHE A HZ     4  
ATOM 10664 N N      . VAL C 3 96 ? -100.039 5.624   -5.168  1.00 0.95 ? 105 VAL A N      4  
ATOM 10665 C CA     . VAL C 3 96 ? -100.929 5.435   -3.982  1.00 1.08 ? 105 VAL A CA     4  
ATOM 10666 C C      . VAL C 3 96 ? -101.984 6.542   -3.943  1.00 1.23 ? 105 VAL A C      4  
ATOM 10667 O O      . VAL C 3 96 ? -102.712 6.603   -2.967  1.00 1.69 ? 105 VAL A O      4  
ATOM 10668 C CB     . VAL C 3 96 ? -100.070 5.515   -2.725  1.00 1.25 ? 105 VAL A CB     4  
ATOM 10669 C CG1    . VAL C 3 96 ? -98.948  4.481   -2.817  1.00 1.20 ? 105 VAL A CG1    4  
ATOM 10670 C CG2    . VAL C 3 96 ? -99.452  6.910   -2.623  1.00 1.98 ? 105 VAL A CG2    4  
ATOM 10671 O OXT    . VAL C 3 96 ? -102.044 7.309   -4.888  1.00 1.75 ? 105 VAL A OXT    4  
ATOM 10672 H H      . VAL C 3 96 ? -99.384  6.353   -5.168  1.00 0.95 ? 105 VAL A H      4  
ATOM 10673 H HA     . VAL C 3 96 ? -101.415 4.470   -4.024  1.00 1.15 ? 105 VAL A HA     4  
ATOM 10674 H HB     . VAL C 3 96 ? -100.679 5.321   -1.854  1.00 1.77 ? 105 VAL A HB     4  
ATOM 10675 H HG11   . VAL C 3 96 ? -99.371  3.496   -2.942  1.00 1.68 ? 105 VAL A HG11   4  
ATOM 10676 H HG12   . VAL C 3 96 ? -98.319  4.712   -3.666  1.00 1.63 ? 105 VAL A HG12   4  
ATOM 10677 H HG13   . VAL C 3 96 ? -98.355  4.510   -1.914  1.00 1.63 ? 105 VAL A HG13   4  
ATOM 10678 H HG21   . VAL C 3 96 ? -99.013  7.176   -3.572  1.00 2.31 ? 105 VAL A HG21   4  
ATOM 10679 H HG22   . VAL C 3 96 ? -100.217 7.628   -2.365  1.00 2.56 ? 105 VAL A HG22   4  
ATOM 10680 H HG23   . VAL C 3 96 ? -98.687  6.908   -1.861  1.00 2.44 ? 105 VAL A HG23   4  
ATOM 10681 O "O5'"  . DT  A 1 1  ? -69.923  -20.065 -20.981 1.00 1.83 ? 1   DT  B "O5'"  5  
ATOM 10682 C "C5'"  . DT  A 1 1  ? -69.408  -20.564 -22.219 1.00 1.89 ? 1   DT  B "C5'"  5  
ATOM 10683 C "C4'"  . DT  A 1 1  ? -69.956  -19.782 -23.423 1.00 1.80 ? 1   DT  B "C4'"  5  
ATOM 10684 O "O4'"  . DT  A 1 1  ? -71.318  -20.196 -23.710 1.00 1.79 ? 1   DT  B "O4'"  5  
ATOM 10685 C "C3'"  . DT  A 1 1  ? -69.967  -18.270 -23.163 1.00 1.66 ? 1   DT  B "C3'"  5  
ATOM 10686 O "O3'"  . DT  A 1 1  ? -69.308  -17.554 -24.209 1.00 1.67 ? 1   DT  B "O3'"  5  
ATOM 10687 C "C2'"  . DT  A 1 1  ? -71.423  -17.881 -23.117 1.00 1.56 ? 1   DT  B "C2'"  5  
ATOM 10688 C "C1'"  . DT  A 1 1  ? -72.227  -19.078 -23.600 1.00 1.64 ? 1   DT  B "C1'"  5  
ATOM 10689 N N1     . DT  A 1 1  ? -73.322  -19.367 -22.636 1.00 1.61 ? 1   DT  B N1     5  
ATOM 10690 C C2     . DT  A 1 1  ? -74.631  -19.131 -23.032 1.00 1.58 ? 1   DT  B C2     5  
ATOM 10691 O O2     . DT  A 1 1  ? -74.913  -18.726 -24.158 1.00 1.58 ? 1   DT  B O2     5  
ATOM 10692 N N3     . DT  A 1 1  ? -75.604  -19.378 -22.083 1.00 1.57 ? 1   DT  B N3     5  
ATOM 10693 C C4     . DT  A 1 1  ? -75.389  -19.837 -20.795 1.00 1.61 ? 1   DT  B C4     5  
ATOM 10694 O O4     . DT  A 1 1  ? -76.335  -20.036 -20.035 1.00 1.63 ? 1   DT  B O4     5  
ATOM 10695 C C5     . DT  A 1 1  ? -73.996  -20.060 -20.471 1.00 1.64 ? 1   DT  B C5     5  
ATOM 10696 C C7     . DT  A 1 1  ? -73.619  -20.575 -19.080 1.00 1.70 ? 1   DT  B C7     5  
ATOM 10697 C C6     . DT  A 1 1  ? -73.029  -19.823 -21.380 1.00 1.64 ? 1   DT  B C6     5  
ATOM 10698 H "H5'"  . DT  A 1 1  ? -69.681  -21.613 -22.322 1.00 2.00 ? 1   DT  B "H5'"  5  
ATOM 10699 H "H5''" . DT  A 1 1  ? -68.322  -20.482 -22.208 1.00 1.93 ? 1   DT  B "H5''" 5  
ATOM 10700 H "H4'"  . DT  A 1 1  ? -69.330  -19.988 -24.292 1.00 1.87 ? 1   DT  B "H4'"  5  
ATOM 10701 H "H3'"  . DT  A 1 1  ? -69.485  -18.034 -22.210 1.00 1.66 ? 1   DT  B "H3'"  5  
ATOM 10702 H "H2'"  . DT  A 1 1  ? -71.710  -17.640 -22.094 1.00 1.50 ? 1   DT  B "H2'"  5  
ATOM 10703 H "H2''" . DT  A 1 1  ? -71.597  -17.019 -23.763 1.00 1.50 ? 1   DT  B "H2''" 5  
ATOM 10704 H "H1'"  . DT  A 1 1  ? -72.643  -18.860 -24.590 1.00 1.64 ? 1   DT  B "H1'"  5  
ATOM 10705 H H3     . DT  A 1 1  ? -76.560  -19.204 -22.352 1.00 1.57 ? 1   DT  B H3     5  
ATOM 10706 H H71    . DT  A 1 1  ? -72.696  -20.097 -18.753 1.00 1.80 ? 1   DT  B H71    5  
ATOM 10707 H H72    . DT  A 1 1  ? -73.472  -21.656 -19.118 1.00 2.13 ? 1   DT  B H72    5  
ATOM 10708 H H73    . DT  A 1 1  ? -74.417  -20.344 -18.375 1.00 2.05 ? 1   DT  B H73    5  
ATOM 10709 H H6     . DT  A 1 1  ? -71.988  -19.993 -21.104 1.00 1.68 ? 1   DT  B H6     5  
ATOM 10710 H "HO5'" . DT  A 1 1  ? -69.787  -20.748 -20.316 1.00 1.92 ? 1   DT  B "HO5'" 5  
ATOM 10711 P P      . DC  A 1 2  ? -69.031  -15.974 -24.046 1.00 1.58 ? 2   DC  B P      5  
ATOM 10712 O OP1    . DC  A 1 2  ? -68.020  -15.579 -25.049 1.00 1.68 ? 2   DC  B OP1    5  
ATOM 10713 O OP2    . DC  A 1 2  ? -68.800  -15.686 -22.612 1.00 1.55 ? 2   DC  B OP2    5  
ATOM 10714 O "O5'"  . DC  A 1 2  ? -70.443  -15.323 -24.465 1.00 1.47 ? 2   DC  B "O5'"  5  
ATOM 10715 C "C5'"  . DC  A 1 2  ? -70.831  -15.285 -25.841 1.00 1.50 ? 2   DC  B "C5'"  5  
ATOM 10716 C "C4'"  . DC  A 1 2  ? -71.929  -14.250 -26.102 1.00 1.41 ? 2   DC  B "C4'"  5  
ATOM 10717 O "O4'"  . DC  A 1 2  ? -73.190  -14.756 -25.609 1.00 1.38 ? 2   DC  B "O4'"  5  
ATOM 10718 C "C3'"  . DC  A 1 2  ? -71.645  -12.913 -25.409 1.00 1.31 ? 2   DC  B "C3'"  5  
ATOM 10719 O "O3'"  . DC  A 1 2  ? -71.673  -11.843 -26.352 1.00 1.32 ? 2   DC  B "O3'"  5  
ATOM 10720 C "C2'"  . DC  A 1 2  ? -72.763  -12.723 -24.411 1.00 1.21 ? 2   DC  B "C2'"  5  
ATOM 10721 C "C1'"  . DC  A 1 2  ? -73.779  -13.838 -24.673 1.00 1.25 ? 2   DC  B "C1'"  5  
ATOM 10722 N N1     . DC  A 1 2  ? -74.174  -14.554 -23.418 1.00 1.21 ? 2   DC  B N1     5  
ATOM 10723 C C2     . DC  A 1 2  ? -75.535  -14.664 -23.133 1.00 1.17 ? 2   DC  B C2     5  
ATOM 10724 O O2     . DC  A 1 2  ? -76.367  -14.174 -23.897 1.00 1.17 ? 2   DC  B O2     5  
ATOM 10725 N N3     . DC  A 1 2  ? -75.912  -15.326 -22.005 1.00 1.17 ? 2   DC  B N3     5  
ATOM 10726 C C4     . DC  A 1 2  ? -74.995  -15.861 -21.181 1.00 1.21 ? 2   DC  B C4     5  
ATOM 10727 N N4     . DC  A 1 2  ? -75.389  -16.510 -20.083 1.00 1.25 ? 2   DC  B N4     5  
ATOM 10728 C C5     . DC  A 1 2  ? -73.600  -15.750 -21.463 1.00 1.24 ? 2   DC  B C5     5  
ATOM 10729 C C6     . DC  A 1 2  ? -73.234  -15.095 -22.584 1.00 1.24 ? 2   DC  B C6     5  
ATOM 10730 H "H5'"  . DC  A 1 2  ? -71.193  -16.268 -26.139 1.00 1.62 ? 2   DC  B "H5'"  5  
ATOM 10731 H "H5''" . DC  A 1 2  ? -69.960  -15.032 -26.443 1.00 1.58 ? 2   DC  B "H5''" 5  
ATOM 10732 H "H4'"  . DC  A 1 2  ? -72.013  -14.083 -27.175 1.00 1.47 ? 2   DC  B "H4'"  5  
ATOM 10733 H "H3'"  . DC  A 1 2  ? -70.678  -12.928 -24.898 1.00 1.33 ? 2   DC  B "H3'"  5  
ATOM 10734 H "H2'"  . DC  A 1 2  ? -72.381  -12.778 -23.392 1.00 1.18 ? 2   DC  B "H2'"  5  
ATOM 10735 H "H2''" . DC  A 1 2  ? -73.227  -11.748 -24.572 1.00 1.17 ? 2   DC  B "H2''" 5  
ATOM 10736 H "H1'"  . DC  A 1 2  ? -74.666  -13.403 -25.145 1.00 1.24 ? 2   DC  B "H1'"  5  
ATOM 10737 H H41    . DC  A 1 2  ? -76.372  -16.595 -19.869 1.00 1.24 ? 2   DC  B H41    5  
ATOM 10738 H H42    . DC  A 1 2  ? -74.699  -16.918 -19.465 1.00 1.29 ? 2   DC  B H42    5  
ATOM 10739 H H5     . DC  A 1 2  ? -72.860  -16.167 -20.789 1.00 1.29 ? 2   DC  B H5     5  
ATOM 10740 H H6     . DC  A 1 2  ? -72.177  -14.996 -22.825 1.00 1.28 ? 2   DC  B H6     5  
ATOM 10741 P P      . DG  A 1 3  ? -71.341  -10.345 -25.874 1.00 1.27 ? 3   DG  B P      5  
ATOM 10742 O OP1    . DG  A 1 3  ? -70.599  -9.665  -26.959 1.00 1.42 ? 3   DG  B OP1    5  
ATOM 10743 O OP2    . DG  A 1 3  ? -70.764  -10.414 -24.514 1.00 1.23 ? 3   DG  B OP2    5  
ATOM 10744 O "O5'"  . DG  A 1 3  ? -72.802  -9.681  -25.775 1.00 1.15 ? 3   DG  B "O5'"  5  
ATOM 10745 C "C5'"  . DG  A 1 3  ? -73.524  -9.360  -26.965 1.00 1.23 ? 3   DG  B "C5'"  5  
ATOM 10746 C "C4'"  . DG  A 1 3  ? -74.926  -8.821  -26.661 1.00 1.13 ? 3   DG  B "C4'"  5  
ATOM 10747 O "O4'"  . DG  A 1 3  ? -75.568  -9.673  -25.687 1.00 1.06 ? 3   DG  B "O4'"  5  
ATOM 10748 C "C3'"  . DG  A 1 3  ? -74.900  -7.386  -26.102 1.00 1.07 ? 3   DG  B "C3'"  5  
ATOM 10749 O "O3'"  . DG  A 1 3  ? -75.784  -6.529  -26.843 1.00 1.13 ? 3   DG  B "O3'"  5  
ATOM 10750 C "C2'"  . DG  A 1 3  ? -75.377  -7.508  -24.672 1.00 0.93 ? 3   DG  B "C2'"  5  
ATOM 10751 C "C1'"  . DG  A 1 3  ? -75.894  -8.929  -24.496 1.00 0.93 ? 3   DG  B "C1'"  5  
ATOM 10752 N N9     . DG  A 1 3  ? -75.297  -9.560  -23.301 1.00 0.86 ? 3   DG  B N9     5  
ATOM 10753 C C8     . DG  A 1 3  ? -73.980  -9.764  -22.999 1.00 0.87 ? 3   DG  B C8     5  
ATOM 10754 N N7     . DG  A 1 3  ? -73.760  -10.358 -21.864 1.00 0.84 ? 3   DG  B N7     5  
ATOM 10755 C C5     . DG  A 1 3  ? -75.044  -10.572 -21.358 1.00 0.79 ? 3   DG  B C5     5  
ATOM 10756 C C6     . DG  A 1 3  ? -75.457  -11.186 -20.142 1.00 0.76 ? 3   DG  B C6     5  
ATOM 10757 O O6     . DG  A 1 3  ? -74.759  -11.664 -19.251 1.00 0.77 ? 3   DG  B O6     5  
ATOM 10758 N N1     . DG  A 1 3  ? -76.838  -11.197 -20.022 1.00 0.76 ? 3   DG  B N1     5  
ATOM 10759 C C2     . DG  A 1 3  ? -77.718  -10.684 -20.947 1.00 0.79 ? 3   DG  B C2     5  
ATOM 10760 N N2     . DG  A 1 3  ? -79.008  -10.779 -20.641 1.00 0.83 ? 3   DG  B N2     5  
ATOM 10761 N N3     . DG  A 1 3  ? -77.336  -10.107 -22.092 1.00 0.81 ? 3   DG  B N3     5  
ATOM 10762 C C4     . DG  A 1 3  ? -75.990  -10.085 -22.231 1.00 0.80 ? 3   DG  B C4     5  
ATOM 10763 H "H5'"  . DG  A 1 3  ? -73.618  -10.259 -27.576 1.00 1.32 ? 3   DG  B "H5'"  5  
ATOM 10764 H "H5''" . DG  A 1 3  ? -72.967  -8.613  -27.520 1.00 1.34 ? 3   DG  B "H5''" 5  
ATOM 10765 H "H4'"  . DG  A 1 3  ? -75.514  -8.833  -27.579 1.00 1.19 ? 3   DG  B "H4'"  5  
ATOM 10766 H "H3'"  . DG  A 1 3  ? -73.886  -6.974  -26.132 1.00 1.13 ? 3   DG  B "H3'"  5  
ATOM 10767 H "H2'"  . DG  A 1 3  ? -74.556  -7.319  -23.981 1.00 0.91 ? 3   DG  B "H2'"  5  
ATOM 10768 H "H2''" . DG  A 1 3  ? -76.179  -6.796  -24.494 1.00 0.92 ? 3   DG  B "H2''" 5  
ATOM 10769 H "H1'"  . DG  A 1 3  ? -76.979  -8.909  -24.384 1.00 0.92 ? 3   DG  B "H1'"  5  
ATOM 10770 H H8     . DG  A 1 3  ? -73.172  -9.451  -23.662 1.00 0.94 ? 3   DG  B H8     5  
ATOM 10771 H H1     . DG  A 1 3  ? -77.205  -11.629 -19.186 1.00 0.77 ? 3   DG  B H1     5  
ATOM 10772 H H21    . DG  A 1 3  ? -79.290  -11.210 -19.773 1.00 0.84 ? 3   DG  B H21    5  
ATOM 10773 H H22    . DG  A 1 3  ? -79.704  -10.415 -21.272 1.00 0.87 ? 3   DG  B H22    5  
ATOM 10774 P P      . DA  A 1 4  ? -76.009  -4.988  -26.409 1.00 1.15 ? 4   DA  B P      5  
ATOM 10775 O OP1    . DA  A 1 4  ? -76.463  -4.231  -27.596 1.00 1.30 ? 4   DA  B OP1    5  
ATOM 10776 O OP2    . DA  A 1 4  ? -74.816  -4.539  -25.658 1.00 1.15 ? 4   DA  B OP2    5  
ATOM 10777 O "O5'"  . DA  A 1 4  ? -77.246  -5.088  -25.382 1.00 1.04 ? 4   DA  B "O5'"  5  
ATOM 10778 C "C5'"  . DA  A 1 4  ? -78.451  -5.741  -25.777 1.00 1.09 ? 4   DA  B "C5'"  5  
ATOM 10779 C "C4'"  . DA  A 1 4  ? -79.579  -5.519  -24.772 1.00 1.02 ? 4   DA  B "C4'"  5  
ATOM 10780 O "O4'"  . DA  A 1 4  ? -79.407  -6.405  -23.641 1.00 0.95 ? 4   DA  B "O4'"  5  
ATOM 10781 C "C3'"  . DA  A 1 4  ? -79.607  -4.078  -24.250 1.00 1.01 ? 4   DA  B "C3'"  5  
ATOM 10782 O "O3'"  . DA  A 1 4  ? -80.921  -3.517  -24.406 1.00 1.07 ? 4   DA  B "O3'"  5  
ATOM 10783 C "C2'"  . DA  A 1 4  ? -79.258  -4.174  -22.780 1.00 0.92 ? 4   DA  B "C2'"  5  
ATOM 10784 C "C1'"  . DA  A 1 4  ? -79.273  -5.652  -22.419 1.00 0.87 ? 4   DA  B "C1'"  5  
ATOM 10785 N N9     . DA  A 1 4  ? -78.053  -6.048  -21.676 1.00 0.78 ? 4   DA  B N9     5  
ATOM 10786 C C8     . DA  A 1 4  ? -76.736  -5.811  -21.960 1.00 0.79 ? 4   DA  B C8     5  
ATOM 10787 N N7     . DA  A 1 4  ? -75.891  -6.307  -21.102 1.00 0.74 ? 4   DA  B N7     5  
ATOM 10788 C C5     . DA  A 1 4  ? -76.721  -6.925  -20.167 1.00 0.68 ? 4   DA  B C5     5  
ATOM 10789 C C6     . DA  A 1 4  ? -76.463  -7.642  -18.991 1.00 0.65 ? 4   DA  B C6     5  
ATOM 10790 N N6     . DA  A 1 4  ? -75.230  -7.891  -18.539 1.00 0.65 ? 4   DA  B N6     5  
ATOM 10791 N N1     . DA  A 1 4  ? -77.524  -8.109  -18.307 1.00 0.67 ? 4   DA  B N1     5  
ATOM 10792 C C2     . DA  A 1 4  ? -78.761  -7.886  -18.754 1.00 0.73 ? 4   DA  B C2     5  
ATOM 10793 N N3     . DA  A 1 4  ? -79.108  -7.226  -19.849 1.00 0.76 ? 4   DA  B N3     5  
ATOM 10794 C C4     . DA  A 1 4  ? -78.032  -6.769  -20.511 1.00 0.73 ? 4   DA  B C4     5  
ATOM 10795 H "H5'"  . DA  A 1 4  ? -78.261  -6.810  -25.872 1.00 1.15 ? 4   DA  B "H5'"  5  
ATOM 10796 H "H5''" . DA  A 1 4  ? -78.765  -5.347  -26.739 1.00 1.22 ? 4   DA  B "H5''" 5  
ATOM 10797 H "H4'"  . DA  A 1 4  ? -80.533  -5.739  -25.256 1.00 1.08 ? 4   DA  B "H4'"  5  
ATOM 10798 H "H3'"  . DA  A 1 4  ? -78.872  -3.456  -24.773 1.00 1.06 ? 4   DA  B "H3'"  5  
ATOM 10799 H "H2'"  . DA  A 1 4  ? -78.268  -3.752  -22.592 1.00 0.92 ? 4   DA  B "H2'"  5  
ATOM 10800 H "H2''" . DA  A 1 4  ? -80.003  -3.641  -22.195 1.00 0.95 ? 4   DA  B "H2''" 5  
ATOM 10801 H "H1'"  . DA  A 1 4  ? -80.141  -5.857  -21.798 1.00 0.88 ? 4   DA  B "H1'"  5  
ATOM 10802 H H8     . DA  A 1 4  ? -76.418  -5.237  -22.831 1.00 0.86 ? 4   DA  B H8     5  
ATOM 10803 H H61    . DA  A 1 4  ? -75.099  -8.410  -17.681 1.00 0.65 ? 4   DA  B H61    5  
ATOM 10804 H H62    . DA  A 1 4  ? -74.428  -7.559  -19.053 1.00 0.68 ? 4   DA  B H62    5  
ATOM 10805 H H2     . DA  A 1 4  ? -79.579  -8.291  -18.156 1.00 0.80 ? 4   DA  B H2     5  
ATOM 10806 P P      . DG  A 1 5  ? -81.267  -2.028  -23.883 1.00 1.10 ? 5   DG  B P      5  
ATOM 10807 O OP1    . DG  A 1 5  ? -82.377  -1.497  -24.703 1.00 1.25 ? 5   DG  B OP1    5  
ATOM 10808 O OP2    . DG  A 1 5  ? -80.002  -1.272  -23.775 1.00 1.13 ? 5   DG  B OP2    5  
ATOM 10809 O "O5'"  . DG  A 1 5  ? -81.833  -2.286  -22.393 1.00 1.01 ? 5   DG  B "O5'"  5  
ATOM 10810 C "C5'"  . DG  A 1 5  ? -83.217  -2.608  -22.200 1.00 1.03 ? 5   DG  B "C5'"  5  
ATOM 10811 C "C4'"  . DG  A 1 5  ? -83.490  -3.194  -20.796 1.00 0.95 ? 5   DG  B "C4'"  5  
ATOM 10812 O "O4'"  . DG  A 1 5  ? -82.341  -3.957  -20.344 1.00 0.89 ? 5   DG  B "O4'"  5  
ATOM 10813 C "C3'"  . DG  A 1 5  ? -83.790  -2.123  -19.728 1.00 0.96 ? 5   DG  B "C3'"  5  
ATOM 10814 O "O3'"  . DG  A 1 5  ? -84.989  -2.461  -19.014 1.00 1.02 ? 5   DG  B "O3'"  5  
ATOM 10815 C "C2'"  . DG  A 1 5  ? -82.597  -2.157  -18.804 1.00 0.90 ? 5   DG  B "C2'"  5  
ATOM 10816 C "C1'"  . DG  A 1 5  ? -81.897  -3.480  -19.055 1.00 0.84 ? 5   DG  B "C1'"  5  
ATOM 10817 N N9     . DG  A 1 5  ? -80.431  -3.313  -19.012 1.00 0.79 ? 5   DG  B N9     5  
ATOM 10818 C C8     . DG  A 1 5  ? -79.630  -2.554  -19.812 1.00 0.82 ? 5   DG  B C8     5  
ATOM 10819 N N7     . DG  A 1 5  ? -78.358  -2.596  -19.524 1.00 0.79 ? 5   DG  B N7     5  
ATOM 10820 C C5     . DG  A 1 5  ? -78.310  -3.463  -18.430 1.00 0.72 ? 5   DG  B C5     5  
ATOM 10821 C C6     . DG  A 1 5  ? -77.194  -3.907  -17.665 1.00 0.69 ? 5   DG  B C6     5  
ATOM 10822 O O6     . DG  A 1 5  ? -76.007  -3.615  -17.803 1.00 0.70 ? 5   DG  B O6     5  
ATOM 10823 N N1     . DG  A 1 5  ? -77.586  -4.773  -16.652 1.00 0.67 ? 5   DG  B N1     5  
ATOM 10824 C C2     . DG  A 1 5  ? -78.883  -5.164  -16.399 1.00 0.70 ? 5   DG  B C2     5  
ATOM 10825 N N2     . DG  A 1 5  ? -79.055  -5.992  -15.365 1.00 0.73 ? 5   DG  B N2     5  
ATOM 10826 N N3     . DG  A 1 5  ? -79.933  -4.752  -17.115 1.00 0.73 ? 5   DG  B N3     5  
ATOM 10827 C C4     . DG  A 1 5  ? -79.573  -3.906  -18.111 1.00 0.73 ? 5   DG  B C4     5  
ATOM 10828 H "H5'"  . DG  A 1 5  ? -83.502  -3.348  -22.949 1.00 1.09 ? 5   DG  B "H5'"  5  
ATOM 10829 H "H5''" . DG  A 1 5  ? -83.818  -1.712  -22.352 1.00 1.10 ? 5   DG  B "H5''" 5  
ATOM 10830 H "H4'"  . DG  A 1 5  ? -84.348  -3.862  -20.857 1.00 0.99 ? 5   DG  B "H4'"  5  
ATOM 10831 H "H3'"  . DG  A 1 5  ? -83.898  -1.130  -20.170 1.00 1.03 ? 5   DG  B "H3'"  5  
ATOM 10832 H "H2'"  . DG  A 1 5  ? -81.917  -1.334  -19.034 1.00 0.93 ? 5   DG  B "H2'"  5  
ATOM 10833 H "H2''" . DG  A 1 5  ? -82.921  -2.085  -17.772 1.00 0.93 ? 5   DG  B "H2''" 5  
ATOM 10834 H "H1'"  . DG  A 1 5  ? -82.195  -4.203  -18.293 1.00 0.82 ? 5   DG  B "H1'"  5  
ATOM 10835 H H8     . DG  A 1 5  ? -80.028  -1.950  -20.628 1.00 0.88 ? 5   DG  B H8     5  
ATOM 10836 H H1     . DG  A 1 5  ? -76.845  -5.136  -16.066 1.00 0.66 ? 5   DG  B H1     5  
ATOM 10837 H H21    . DG  A 1 5  ? -78.255  -6.300  -14.828 1.00 0.73 ? 5   DG  B H21    5  
ATOM 10838 H H22    . DG  A 1 5  ? -79.980  -6.304  -15.117 1.00 0.79 ? 5   DG  B H22    5  
ATOM 10839 P P      . DC  A 1 6  ? -85.545  -1.543  -17.804 1.00 1.10 ? 6   DC  B P      5  
ATOM 10840 O OP1    . DC  A 1 6  ? -86.910  -2.011  -17.458 1.00 1.23 ? 6   DC  B OP1    5  
ATOM 10841 O OP2    . DC  A 1 6  ? -85.322  -0.125  -18.152 1.00 1.16 ? 6   DC  B OP2    5  
ATOM 10842 O "O5'"  . DC  A 1 6  ? -84.564  -1.933  -16.587 1.00 1.03 ? 6   DC  B "O5'"  5  
ATOM 10843 C "C5'"  . DC  A 1 6  ? -84.562  -3.268  -16.084 1.00 1.10 ? 6   DC  B "C5'"  5  
ATOM 10844 C "C4'"  . DC  A 1 6  ? -84.042  -3.350  -14.641 1.00 1.07 ? 6   DC  B "C4'"  5  
ATOM 10845 O "O4'"  . DC  A 1 6  ? -82.635  -3.700  -14.654 1.00 1.09 ? 6   DC  B "O4'"  5  
ATOM 10846 C "C3'"  . DC  A 1 6  ? -84.193  -2.022  -13.886 1.00 1.06 ? 6   DC  B "C3'"  5  
ATOM 10847 O "O3'"  . DC  A 1 6  ? -85.012  -2.182  -12.736 1.00 1.11 ? 6   DC  B "O3'"  5  
ATOM 10848 C "C2'"  . DC  A 1 6  ? -82.802  -1.647  -13.426 1.00 1.06 ? 6   DC  B "C2'"  5  
ATOM 10849 C "C1'"  . DC  A 1 6  ? -81.872  -2.787  -13.837 1.00 1.04 ? 6   DC  B "C1'"  5  
ATOM 10850 N N1     . DC  A 1 6  ? -80.674  -2.279  -14.569 1.00 1.00 ? 6   DC  B N1     5  
ATOM 10851 C C2     . DC  A 1 6  ? -79.415  -2.654  -14.106 1.00 0.99 ? 6   DC  B C2     5  
ATOM 10852 O O2     . DC  A 1 6  ? -79.312  -3.381  -13.124 1.00 1.02 ? 6   DC  B O2     5  
ATOM 10853 N N3     . DC  A 1 6  ? -78.321  -2.197  -14.768 1.00 0.99 ? 6   DC  B N3     5  
ATOM 10854 C C4     . DC  A 1 6  ? -78.445  -1.407  -15.843 1.00 1.00 ? 6   DC  B C4     5  
ATOM 10855 N N4     . DC  A 1 6  ? -77.356  -0.972  -16.465 1.00 1.03 ? 6   DC  B N4     5  
ATOM 10856 C C5     . DC  A 1 6  ? -79.725  -1.022  -16.327 1.00 1.01 ? 6   DC  B C5     5  
ATOM 10857 C C6     . DC  A 1 6  ? -80.804  -1.473  -15.669 1.00 1.01 ? 6   DC  B C6     5  
ATOM 10858 H "H5'"  . DC  A 1 6  ? -83.930  -3.883  -16.723 1.00 1.21 ? 6   DC  B "H5'"  5  
ATOM 10859 H "H5''" . DC  A 1 6  ? -85.581  -3.654  -16.124 1.00 1.26 ? 6   DC  B "H5''" 5  
ATOM 10860 H "H4'"  . DC  A 1 6  ? -84.592  -4.127  -14.104 1.00 1.11 ? 6   DC  B "H4'"  5  
ATOM 10861 H "H3'"  . DC  A 1 6  ? -84.604  -1.246  -14.532 1.00 1.07 ? 6   DC  B "H3'"  5  
ATOM 10862 H "H2'"  . DC  A 1 6  ? -82.489  -0.710  -13.879 1.00 1.07 ? 6   DC  B "H2'"  5  
ATOM 10863 H "H2''" . DC  A 1 6  ? -82.799  -1.536  -12.340 1.00 1.11 ? 6   DC  B "H2''" 5  
ATOM 10864 H "H1'"  . DC  A 1 6  ? -81.552  -3.325  -12.938 1.00 1.06 ? 6   DC  B "H1'"  5  
ATOM 10865 H H41    . DC  A 1 6  ? -76.444  -1.238  -16.129 1.00 1.05 ? 6   DC  B H41    5  
ATOM 10866 H H42    . DC  A 1 6  ? -77.445  -0.374  -17.271 1.00 1.05 ? 6   DC  B H42    5  
ATOM 10867 H H5     . DC  A 1 6  ? -79.827  -0.385  -17.203 1.00 1.04 ? 6   DC  B H5     5  
ATOM 10868 H H6     . DC  A 1 6  ? -81.795  -1.182  -16.010 1.00 1.05 ? 6   DC  B H6     5  
ATOM 10869 P P      . DC  A 1 7  ? -85.473  -0.890  -11.903 1.00 1.17 ? 7   DC  B P      5  
ATOM 10870 O OP1    . DC  A 1 7  ? -86.702  -1.241  -11.159 1.00 1.38 ? 7   DC  B OP1    5  
ATOM 10871 O OP2    . DC  A 1 7  ? -85.467  0.271   -12.821 1.00 1.32 ? 7   DC  B OP2    5  
ATOM 10872 O "O5'"  . DC  A 1 7  ? -84.268  -0.709  -10.844 1.00 0.94 ? 7   DC  B "O5'"  5  
ATOM 10873 C "C5'"  . DC  A 1 7  ? -84.152  -1.600  -9.735  1.00 0.92 ? 7   DC  B "C5'"  5  
ATOM 10874 C "C4'"  . DC  A 1 7  ? -82.700  -1.784  -9.264  1.00 0.82 ? 7   DC  B "C4'"  5  
ATOM 10875 O "O4'"  . DC  A 1 7  ? -81.799  -1.839  -10.402 1.00 0.84 ? 7   DC  B "O4'"  5  
ATOM 10876 C "C3'"  . DC  A 1 7  ? -82.225  -0.651  -8.340  1.00 0.82 ? 7   DC  B "C3'"  5  
ATOM 10877 O "O3'"  . DC  A 1 7  ? -81.792  -1.186  -7.080  1.00 0.89 ? 7   DC  B "O3'"  5  
ATOM 10878 C "C2'"  . DC  A 1 7  ? -81.048  -0.022  -9.058  1.00 0.86 ? 7   DC  B "C2'"  5  
ATOM 10879 C "C1'"  . DC  A 1 7  ? -80.649  -1.005  -10.157 1.00 0.87 ? 7   DC  B "C1'"  5  
ATOM 10880 N N1     . DC  A 1 7  ? -80.203  -0.303  -11.402 1.00 0.93 ? 7   DC  B N1     5  
ATOM 10881 C C2     . DC  A 1 7  ? -78.904  -0.546  -11.862 1.00 1.05 ? 7   DC  B C2     5  
ATOM 10882 O O2     . DC  A 1 7  ? -78.169  -1.332  -11.261 1.00 1.14 ? 7   DC  B O2     5  
ATOM 10883 N N3     . DC  A 1 7  ? -78.483  0.098   -12.980 1.00 1.15 ? 7   DC  B N3     5  
ATOM 10884 C C4     . DC  A 1 7  ? -79.286  0.942   -13.629 1.00 1.15 ? 7   DC  B C4     5  
ATOM 10885 N N4     . DC  A 1 7  ? -78.834  1.569   -14.708 1.00 1.29 ? 7   DC  B N4     5  
ATOM 10886 C C5     . DC  A 1 7  ? -80.614  1.194   -13.172 1.00 1.08 ? 7   DC  B C5     5  
ATOM 10887 C C6     . DC  A 1 7  ? -81.030  0.556   -12.064 1.00 0.96 ? 7   DC  B C6     5  
ATOM 10888 H "H5'"  . DC  A 1 7  ? -84.547  -2.570  -10.030 1.00 1.09 ? 7   DC  B "H5'"  5  
ATOM 10889 H "H5''" . DC  A 1 7  ? -84.751  -1.216  -8.909  1.00 0.96 ? 7   DC  B "H5''" 5  
ATOM 10890 H "H4'"  . DC  A 1 7  ? -82.626  -2.717  -8.724  1.00 0.89 ? 7   DC  B "H4'"  5  
ATOM 10891 H "H3'"  . DC  A 1 7  ? -83.012  0.086   -8.184  1.00 0.86 ? 7   DC  B "H3'"  5  
ATOM 10892 H "H2'"  . DC  A 1 7  ? -81.338  0.935   -9.494  1.00 0.92 ? 7   DC  B "H2'"  5  
ATOM 10893 H "H2''" . DC  A 1 7  ? -80.224  0.125   -8.359  1.00 0.94 ? 7   DC  B "H2''" 5  
ATOM 10894 H "H1'"  . DC  A 1 7  ? -79.839  -1.641  -9.777  1.00 0.95 ? 7   DC  B "H1'"  5  
ATOM 10895 H H41    . DC  A 1 7  ? -77.895  1.397   -15.033 1.00 1.39 ? 7   DC  B H41    5  
ATOM 10896 H H42    . DC  A 1 7  ? -79.429  2.221   -15.200 1.00 1.35 ? 7   DC  B H42    5  
ATOM 10897 H H5     . DC  A 1 7  ? -81.269  1.875   -13.704 1.00 1.17 ? 7   DC  B H5     5  
ATOM 10898 H H6     . DC  A 1 7  ? -82.040  0.721   -11.696 1.00 0.96 ? 7   DC  B H6     5  
ATOM 10899 P P      . DG  A 1 8  ? -81.554  -0.224  -5.804  1.00 0.93 ? 8   DG  B P      5  
ATOM 10900 O OP1    . DG  A 1 8  ? -81.747  -1.030  -4.576  1.00 1.16 ? 8   DG  B OP1    5  
ATOM 10901 O OP2    . DG  A 1 8  ? -82.343  1.014   -5.996  1.00 1.05 ? 8   DG  B OP2    5  
ATOM 10902 O "O5'"  . DG  A 1 8  ? -79.989  0.152   -5.925  1.00 0.77 ? 8   DG  B "O5'"  5  
ATOM 10903 C "C5'"  . DG  A 1 8  ? -78.972  -0.827  -5.680  1.00 0.85 ? 8   DG  B "C5'"  5  
ATOM 10904 C "C4'"  . DG  A 1 8  ? -77.712  -0.198  -5.075  1.00 0.78 ? 8   DG  B "C4'"  5  
ATOM 10905 O "O4'"  . DG  A 1 8  ? -76.903  0.383   -6.129  1.00 0.76 ? 8   DG  B "O4'"  5  
ATOM 10906 C "C3'"  . DG  A 1 8  ? -78.044  0.913   -4.067  1.00 0.79 ? 8   DG  B "C3'"  5  
ATOM 10907 O "O3'"  . DG  A 1 8  ? -77.409  0.648   -2.811  1.00 0.86 ? 8   DG  B "O3'"  5  
ATOM 10908 C "C2'"  . DG  A 1 8  ? -77.480  2.185   -4.665  1.00 0.74 ? 8   DG  B "C2'"  5  
ATOM 10909 C "C1'"  . DG  A 1 8  ? -76.601  1.766   -5.835  1.00 0.71 ? 8   DG  B "C1'"  5  
ATOM 10910 N N9     . DG  A 1 8  ? -76.826  2.641   -7.014  1.00 0.69 ? 8   DG  B N9     5  
ATOM 10911 C C8     . DG  A 1 8  ? -77.999  2.989   -7.623  1.00 0.83 ? 8   DG  B C8     5  
ATOM 10912 N N7     . DG  A 1 8  ? -77.878  3.788   -8.641  1.00 0.83 ? 8   DG  B N7     5  
ATOM 10913 C C5     . DG  A 1 8  ? -76.506  3.997   -8.728  1.00 0.66 ? 8   DG  B C5     5  
ATOM 10914 C C6     . DG  A 1 8  ? -75.760  4.784   -9.651  1.00 0.64 ? 8   DG  B C6     5  
ATOM 10915 O O6     . DG  A 1 8  ? -76.174  5.462   -10.584 1.00 0.70 ? 8   DG  B O6     5  
ATOM 10916 N N1     . DG  A 1 8  ? -74.401  4.721   -9.387  1.00 0.66 ? 8   DG  B N1     5  
ATOM 10917 C C2     . DG  A 1 8  ? -73.826  3.993   -8.367  1.00 0.72 ? 8   DG  B C2     5  
ATOM 10918 N N2     . DG  A 1 8  ? -72.499  4.046   -8.286  1.00 0.93 ? 8   DG  B N2     5  
ATOM 10919 N N3     . DG  A 1 8  ? -74.519  3.253   -7.496  1.00 0.66 ? 8   DG  B N3     5  
ATOM 10920 C C4     . DG  A 1 8  ? -75.849  3.300   -7.735  1.00 0.62 ? 8   DG  B C4     5  
ATOM 10921 H "H5'"  . DG  A 1 8  ? -78.708  -1.309  -6.619  1.00 0.98 ? 8   DG  B "H5'"  5  
ATOM 10922 H "H5''" . DG  A 1 8  ? -79.357  -1.581  -4.992  1.00 1.03 ? 8   DG  B "H5''" 5  
ATOM 10923 H "H4'"  . DG  A 1 8  ? -77.133  -0.971  -4.567  1.00 0.83 ? 8   DG  B "H4'"  5  
ATOM 10924 H "H3'"  . DG  A 1 8  ? -79.123  1.008   -3.922  1.00 0.84 ? 8   DG  B "H3'"  5  
ATOM 10925 H "H2'"  . DG  A 1 8  ? -78.287  2.829   -5.017  1.00 0.75 ? 8   DG  B "H2'"  5  
ATOM 10926 H "H2''" . DG  A 1 8  ? -76.884  2.710   -3.920  1.00 0.78 ? 8   DG  B "H2''" 5  
ATOM 10927 H "H1'"  . DG  A 1 8  ? -75.551  1.835   -5.544  1.00 0.75 ? 8   DG  B "H1'"  5  
ATOM 10928 H H8     . DG  A 1 8  ? -78.966  2.624   -7.283  1.00 1.00 ? 8   DG  B H8     5  
ATOM 10929 H H1     . DG  A 1 8  ? -73.804  5.253   -10.004 1.00 0.73 ? 8   DG  B H1     5  
ATOM 10930 H H21    . DG  A 1 8  ? -71.978  4.605   -8.942  1.00 1.01 ? 8   DG  B H21    5  
ATOM 10931 H H22    . DG  A 1 8  ? -72.016  3.522   -7.571  1.00 1.04 ? 8   DG  B H22    5  
ATOM 10932 P P      . DG  A 1 9  ? -77.590  1.645   -1.556  1.00 0.95 ? 9   DG  B P      5  
ATOM 10933 O OP1    . DG  A 1 9  ? -77.074  0.958   -0.354  1.00 1.13 ? 9   DG  B OP1    5  
ATOM 10934 O OP2    . DG  A 1 9  ? -78.972  2.182   -1.569  1.00 0.98 ? 9   DG  B OP2    5  
ATOM 10935 O "O5'"  . DG  A 1 9  ? -76.579  2.838   -1.917  1.00 0.87 ? 9   DG  B "O5'"  5  
ATOM 10936 C "C5'"  . DG  A 1 9  ? -75.176  2.594   -1.928  1.00 0.94 ? 9   DG  B "C5'"  5  
ATOM 10937 C "C4'"  . DG  A 1 9  ? -74.381  3.880   -2.130  1.00 0.87 ? 9   DG  B "C4'"  5  
ATOM 10938 O "O4'"  . DG  A 1 9  ? -74.452  4.278   -3.518  1.00 0.82 ? 9   DG  B "O4'"  5  
ATOM 10939 C "C3'"  . DG  A 1 9  ? -74.923  5.042   -1.276  1.00 0.85 ? 9   DG  B "C3'"  5  
ATOM 10940 O "O3'"  . DG  A 1 9  ? -73.873  5.627   -0.503  1.00 0.88 ? 9   DG  B "O3'"  5  
ATOM 10941 C "C2'"  . DG  A 1 9  ? -75.447  6.055   -2.276  1.00 0.79 ? 9   DG  B "C2'"  5  
ATOM 10942 C "C1'"  . DG  A 1 9  ? -74.865  5.655   -3.623  1.00 0.76 ? 9   DG  B "C1'"  5  
ATOM 10943 N N9     . DG  A 1 9  ? -75.835  5.851   -4.723  1.00 0.72 ? 9   DG  B N9     5  
ATOM 10944 C C8     . DG  A 1 9  ? -77.137  5.441   -4.824  1.00 0.75 ? 9   DG  B C8     5  
ATOM 10945 N N7     . DG  A 1 9  ? -77.733  5.770   -5.930  1.00 0.73 ? 9   DG  B N7     5  
ATOM 10946 C C5     . DG  A 1 9  ? -76.750  6.459   -6.629  1.00 0.67 ? 9   DG  B C5     5  
ATOM 10947 C C6     . DG  A 1 9  ? -76.807  7.066   -7.912  1.00 0.66 ? 9   DG  B C6     5  
ATOM 10948 O O6     . DG  A 1 9  ? -77.758  7.113   -8.690  1.00 0.69 ? 9   DG  B O6     5  
ATOM 10949 N N1     . DG  A 1 9  ? -75.600  7.659   -8.251  1.00 0.65 ? 9   DG  B N1     5  
ATOM 10950 C C2     . DG  A 1 9  ? -74.474  7.670   -7.458  1.00 0.67 ? 9   DG  B C2     5  
ATOM 10951 N N2     . DG  A 1 9  ? -73.411  8.297   -7.954  1.00 0.72 ? 9   DG  B N2     5  
ATOM 10952 N N3     . DG  A 1 9  ? -74.416  7.098   -6.248  1.00 0.68 ? 9   DG  B N3     5  
ATOM 10953 C C4     . DG  A 1 9  ? -75.586  6.514   -5.901  1.00 0.67 ? 9   DG  B C4     5  
ATOM 10954 H "H5'"  . DG  A 1 9  ? -74.942  1.902   -2.737  1.00 1.00 ? 9   DG  B "H5'"  5  
ATOM 10955 H "H5''" . DG  A 1 9  ? -74.888  2.145   -0.981  1.00 1.08 ? 9   DG  B "H5''" 5  
ATOM 10956 H "H4'"  . DG  A 1 9  ? -73.342  3.697   -1.868  1.00 0.91 ? 9   DG  B "H4'"  5  
ATOM 10957 H "H3'"  . DG  A 1 9  ? -75.728  4.704   -0.616  1.00 0.90 ? 9   DG  B "H3'"  5  
ATOM 10958 H "H2'"  . DG  A 1 9  ? -76.537  6.024   -2.313  1.00 0.81 ? 9   DG  B "H2'"  5  
ATOM 10959 H "H2''" . DG  A 1 9  ? -75.116  7.060   -2.007  1.00 0.80 ? 9   DG  B "H2''" 5  
ATOM 10960 H "H1'"  . DG  A 1 9  ? -73.981  6.265   -3.823  1.00 0.76 ? 9   DG  B "H1'"  5  
ATOM 10961 H H8     . DG  A 1 9  ? -77.642  4.886   -4.034  1.00 0.80 ? 9   DG  B H8     5  
ATOM 10962 H H1     . DG  A 1 9  ? -75.565  8.111   -9.150  1.00 0.66 ? 9   DG  B H1     5  
ATOM 10963 H H21    . DG  A 1 9  ? -73.460  8.728   -8.865  1.00 0.73 ? 9   DG  B H21    5  
ATOM 10964 H H22    . DG  A 1 9  ? -72.554  8.340   -7.418  1.00 0.77 ? 9   DG  B H22    5  
ATOM 10965 P P      . DA  A 1 10 ? -74.155  6.904   0.438   1.00 0.92 ? 10  DA  B P      5  
ATOM 10966 O OP1    . DA  A 1 10 ? -73.450  6.698   1.722   1.00 1.03 ? 10  DA  B OP1    5  
ATOM 10967 O OP2    . DA  A 1 10 ? -75.611  7.164   0.427   1.00 0.96 ? 10  DA  B OP2    5  
ATOM 10968 O "O5'"  . DA  A 1 10 ? -73.420  8.101   -0.361  1.00 0.84 ? 10  DA  B "O5'"  5  
ATOM 10969 C "C5'"  . DA  A 1 10 ? -72.312  7.824   -1.224  1.00 0.84 ? 10  DA  B "C5'"  5  
ATOM 10970 C "C4'"  . DA  A 1 10 ? -71.809  9.082   -1.950  1.00 0.80 ? 10  DA  B "C4'"  5  
ATOM 10971 O "O4'"  . DA  A 1 10 ? -72.487  9.211   -3.225  1.00 0.75 ? 10  DA  B "O4'"  5  
ATOM 10972 C "C3'"  . DA  A 1 10 ? -72.068  10.361  -1.141  1.00 0.83 ? 10  DA  B "C3'"  5  
ATOM 10973 O "O3'"  . DA  A 1 10 ? -70.859  11.120  -0.993  1.00 0.87 ? 10  DA  B "O3'"  5  
ATOM 10974 C "C2'"  . DA  A 1 10 ? -73.086  11.142  -1.945  1.00 0.78 ? 10  DA  B "C2'"  5  
ATOM 10975 C "C1'"  . DA  A 1 10 ? -73.164  10.480  -3.318  1.00 0.74 ? 10  DA  B "C1'"  5  
ATOM 10976 N N9     . DA  A 1 10 ? -74.567  10.315  -3.757  1.00 0.70 ? 10  DA  B N9     5  
ATOM 10977 C C8     . DA  A 1 10 ? -75.634  9.787   -3.080  1.00 0.71 ? 10  DA  B C8     5  
ATOM 10978 N N7     . DA  A 1 10 ? -76.759  9.798   -3.732  1.00 0.69 ? 10  DA  B N7     5  
ATOM 10979 C C5     . DA  A 1 10 ? -76.412  10.381  -4.949  1.00 0.65 ? 10  DA  B C5     5  
ATOM 10980 C C6     . DA  A 1 10 ? -77.151  10.686  -6.096  1.00 0.64 ? 10  DA  B C6     5  
ATOM 10981 N N6     . DA  A 1 10 ? -78.452  10.442  -6.203  1.00 0.63 ? 10  DA  B N6     5  
ATOM 10982 N N1     . DA  A 1 10 ? -76.504  11.259  -7.123  1.00 0.65 ? 10  DA  B N1     5  
ATOM 10983 C C2     . DA  A 1 10 ? -75.203  11.518  -7.029  1.00 0.67 ? 10  DA  B C2     5  
ATOM 10984 N N3     . DA  A 1 10 ? -74.408  11.272  -5.990  1.00 0.68 ? 10  DA  B N3     5  
ATOM 10985 C C4     . DA  A 1 10 ? -75.086  10.698  -4.976  1.00 0.67 ? 10  DA  B C4     5  
ATOM 10986 H "H5'"  . DA  A 1 10 ? -72.620  7.092   -1.965  1.00 0.87 ? 10  DA  B "H5'"  5  
ATOM 10987 H "H5''" . DA  A 1 10 ? -71.502  7.406   -0.627  1.00 0.92 ? 10  DA  B "H5''" 5  
ATOM 10988 H "H4'"  . DA  A 1 10 ? -70.736  8.988   -2.129  1.00 0.83 ? 10  DA  B "H4'"  5  
ATOM 10989 H "H3'"  . DA  A 1 10 ? -72.470  10.121  -0.153  1.00 0.88 ? 10  DA  B "H3'"  5  
ATOM 10990 H "H2'"  . DA  A 1 10 ? -74.063  11.104  -1.456  1.00 0.81 ? 10  DA  B "H2'"  5  
ATOM 10991 H "H2''" . DA  A 1 10 ? -72.764  12.179  -2.045  1.00 0.80 ? 10  DA  B "H2''" 5  
ATOM 10992 H "H1'"  . DA  A 1 10 ? -72.641  11.100  -4.045  1.00 0.75 ? 10  DA  B "H1'"  5  
ATOM 10993 H H8     . DA  A 1 10 ? -75.546  9.385   -2.072  1.00 0.76 ? 10  DA  B H8     5  
ATOM 10994 H H61    . DA  A 1 10 ? -78.943  10.680  -7.053  1.00 0.63 ? 10  DA  B H61    5  
ATOM 10995 H H62    . DA  A 1 10 ? -78.949  10.022  -5.433  1.00 0.64 ? 10  DA  B H62    5  
ATOM 10996 H H2     . DA  A 1 10 ? -74.736  11.978  -7.899  1.00 0.70 ? 10  DA  B H2     5  
ATOM 10997 P P      . DA  A 1 11 ? -70.862  12.536  -0.221  1.00 0.93 ? 11  DA  B P      5  
ATOM 10998 O OP1    . DA  A 1 11 ? -69.633  12.623  0.603   1.00 1.04 ? 11  DA  B OP1    5  
ATOM 10999 O OP2    . DA  A 1 11 ? -72.187  12.705  0.417   1.00 0.96 ? 11  DA  B OP2    5  
ATOM 11000 O "O5'"  . DA  A 1 11 ? -70.740  13.596  -1.435  1.00 0.85 ? 11  DA  B "O5'"  5  
ATOM 11001 C "C5'"  . DA  A 1 11 ? -70.003  13.274  -2.620  1.00 0.84 ? 11  DA  B "C5'"  5  
ATOM 11002 C "C4'"  . DA  A 1 11 ? -70.257  14.276  -3.758  1.00 0.79 ? 11  DA  B "C4'"  5  
ATOM 11003 O "O4'"  . DA  A 1 11 ? -71.489  13.952  -4.447  1.00 0.74 ? 11  DA  B "O4'"  5  
ATOM 11004 C "C3'"  . DA  A 1 11 ? -70.371  15.720  -3.244  1.00 0.79 ? 11  DA  B "C3'"  5  
ATOM 11005 O "O3'"  . DA  A 1 11 ? -69.451  16.574  -3.933  1.00 0.81 ? 11  DA  B "O3'"  5  
ATOM 11006 C "C2'"  . DA  A 1 11 ? -71.788  16.147  -3.552  1.00 0.75 ? 11  DA  B "C2'"  5  
ATOM 11007 C "C1'"  . DA  A 1 11 ? -72.344  15.110  -4.519  1.00 0.71 ? 11  DA  B "C1'"  5  
ATOM 11008 N N9     . DA  A 1 11 ? -73.738  14.764  -4.190  1.00 0.68 ? 11  DA  B N9     5  
ATOM 11009 C C8     . DA  A 1 11 ? -74.277  14.396  -2.993  1.00 0.71 ? 11  DA  B C8     5  
ATOM 11010 N N7     . DA  A 1 11 ? -75.552  14.160  -3.015  1.00 0.69 ? 11  DA  B N7     5  
ATOM 11011 C C5     . DA  A 1 11 ? -75.893  14.395  -4.345  1.00 0.65 ? 11  DA  B C5     5  
ATOM 11012 C C6     . DA  A 1 11 ? -77.105  14.324  -5.042  1.00 0.63 ? 11  DA  B C6     5  
ATOM 11013 N N6     . DA  A 1 11 ? -78.260  13.975  -4.474  1.00 0.64 ? 11  DA  B N6     5  
ATOM 11014 N N1     . DA  A 1 11 ? -77.084  14.623  -6.353  1.00 0.62 ? 11  DA  B N1     5  
ATOM 11015 C C2     . DA  A 1 11 ? -75.944  14.970  -6.947  1.00 0.63 ? 11  DA  B C2     5  
ATOM 11016 N N3     . DA  A 1 11 ? -74.744  15.066  -6.382  1.00 0.64 ? 1