data_2STW
# 
_entry.id   2STW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2STW         
WWPDB D_1000178657 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1997-03-12 
_pdbx_database_PDB_obs_spr.pdb_id           2STW 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1STW 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2STT 
_pdbx_database_related.details        'ENSEMBLE OF 25 STRUCTURES' 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2STW 
_pdbx_database_status.recvd_initial_deposition_date   1996-08-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Werner, M.H.'     2 
'Gronenborn, A.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Correction of the NMR structure of the ETS1/DNA complex.' 
_citation.journal_abbrev            J.Biomol.NMR 
_citation.journal_volume            10 
_citation.page_first                317 
_citation.page_last                 328 
_citation.year                      1997 
_citation.journal_id_ASTM           JBNME9 
_citation.country                   NE 
_citation.journal_id_ISSN           0925-2738 
_citation.journal_id_CSD            0800 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9460239 
_citation.pdbx_database_id_DOI      10.1023/A:1018399711996 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Werner, M.H.'     1 
primary 'Clore, G.M.'      2 
primary 'Fisher, C.L.'     3 
primary 'Fisher, R.J.'     4 
primary 'Trinh, L.'        5 
primary 'Shiloach, J.'     6 
primary 'Gronenborn, A.M.' 7 
# 
_cell.entry_id           2STW 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2STW 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3')
;
5252.410  1 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3')
;
5163.348  1 ? ? ? ? 
3 polymer nat ETS1                                                                11255.954 1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DG)(DC)(DC)(DG)(DG)(DA)(DA)(DG)(DT)(DT)(DC)(DG)(DA)' TCGAGCCGGAAGTTCGA B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DA)(DC)(DT)(DT)(DC)(DC)(DG)(DG)(DC)(DT)(DC)(DG)(DA)' TCGAACTTCCGGCTCGA C ? 
3 'polypeptide(L)'        no no 
;VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFV
;
;VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFV
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DC  n 
1 3  DG  n 
1 4  DA  n 
1 5  DG  n 
1 6  DC  n 
1 7  DC  n 
1 8  DG  n 
1 9  DG  n 
1 10 DA  n 
1 11 DA  n 
1 12 DG  n 
1 13 DT  n 
1 14 DT  n 
1 15 DC  n 
1 16 DG  n 
1 17 DA  n 
2 1  DT  n 
2 2  DC  n 
2 3  DG  n 
2 4  DA  n 
2 5  DA  n 
2 6  DC  n 
2 7  DT  n 
2 8  DT  n 
2 9  DC  n 
2 10 DC  n 
2 11 DG  n 
2 12 DG  n 
2 13 DC  n 
2 14 DT  n 
2 15 DC  n 
2 16 DG  n 
2 17 DA  n 
3 1  VAL n 
3 2  ILE n 
3 3  PRO n 
3 4  ALA n 
3 5  ALA n 
3 6  ALA n 
3 7  LEU n 
3 8  ALA n 
3 9  GLY n 
3 10 TYR n 
3 11 THR n 
3 12 GLY n 
3 13 SER n 
3 14 GLY n 
3 15 PRO n 
3 16 ILE n 
3 17 GLN n 
3 18 LEU n 
3 19 TRP n 
3 20 GLN n 
3 21 PHE n 
3 22 LEU n 
3 23 LEU n 
3 24 GLU n 
3 25 LEU n 
3 26 LEU n 
3 27 THR n 
3 28 ASP n 
3 29 LYS n 
3 30 SER n 
3 31 CYS n 
3 32 GLN n 
3 33 SER n 
3 34 PHE n 
3 35 ILE n 
3 36 SER n 
3 37 TRP n 
3 38 THR n 
3 39 GLY n 
3 40 ASP n 
3 41 GLY n 
3 42 TRP n 
3 43 GLU n 
3 44 PHE n 
3 45 LYS n 
3 46 LEU n 
3 47 SER n 
3 48 ASP n 
3 49 PRO n 
3 50 ASP n 
3 51 GLU n 
3 52 VAL n 
3 53 ALA n 
3 54 ARG n 
3 55 ARG n 
3 56 TRP n 
3 57 GLY n 
3 58 LYS n 
3 59 ARG n 
3 60 LYS n 
3 61 ASN n 
3 62 LYS n 
3 63 PRO n 
3 64 LYS n 
3 65 MET n 
3 66 ASN n 
3 67 TYR n 
3 68 GLU n 
3 69 LYS n 
3 70 LEU n 
3 71 SER n 
3 72 ARG n 
3 73 GLY n 
3 74 LEU n 
3 75 ARG n 
3 76 TYR n 
3 77 TYR n 
3 78 TYR n 
3 79 ASP n 
3 80 LYS n 
3 81 ASN n 
3 82 ILE n 
3 83 ILE n 
3 84 HIS n 
3 85 LYS n 
3 86 THR n 
3 87 ALA n 
3 88 GLY n 
3 89 LYS n 
3 90 ARG n 
3 91 TYR n 
3 92 VAL n 
3 93 TYR n 
3 94 ARG n 
3 95 PHE n 
3 96 VAL n 
# 
_entity_src_nat.entity_id                  3 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP ETS1_HUMAN P14921 3 320 ? ? 
2 PDB 2STW       2STW   1 ?   ? ? 
3 PDB 2STW       2STW   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2STW A 1 ? 96 ? P14921 320 ? 415 ? 10 105 
2 2 2STW B 1 ? 17 ? 2STW   1   ? 17  ? 1  17  
3 3 2STW C 1 ? 17 ? 2STW   18  ? 34  ? 18 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         305.00 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.80 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AMX500 Bruker 500 
2 AMX600 Bruker 600 
# 
_pdbx_nmr_refine.entry_id           2STW 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE RESTRAINED REGULARIZED MEAN STRUCTURE IS PRESENTED IN
ENTRY 2STW AND 25 STRUCTURES ARE PRESENTED IN ENTRY 2STT.
IN 2STW THE LAST COLUMN REPRESENTS THE RMS OF THE 25
INDIVIDUAL SIMULATED ANNEALING STRUCTURES ABOUT THE MEAN
COORDINATE POSITIONS.  THE LAST COLUMN IN THE INDIVIDUAL SA
STRUCTURES HAS NO MEANING.  BEST FITTING TO GENERATE THE
AVERAGE STRUCTURE IS WITH RESPECT TO RESIDUES 24 - 105 OF
THE PROTEIN AND BASE PAIRS 1 - 17 OF THE DNA (RESIDUES 10 -
24 ARE DISORDERED IN SOLUTION).  RESIDUE 10 CORRESPONDS TO
RESIDUE 320 OF THE NATURAL SEQUENCE.  NOTE THE OCCUPANCY
FIELD HAS NO MEANING.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             2STW 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'REGULARIZED MEAN STRUCTURE' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' XPLOR ? ? 1 
refinement           XPLOR ? ? 2 
# 
_exptl.entry_id          2STW 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2STW 
_struct.title                     'SOLUTION NMR STRUCTURE OF THE HUMAN ETS1/DNA COMPLEX, RESTRAINED REGULARIZED MEAN STRUCTURE' 
_struct.pdbx_descriptor           'ETS1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2STW 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
'COMPLEX (DNA-BINDING PROTEIN-DNA), PROTO-ONCOGENE, DNA-BINDING, NUCLEAR PROTEIN, PHOSPHORYLATION, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 LEU C 18 ? THR C 27 ? LEU A 27 THR A 36 1 ? 10 
HELX_P HELX_P2 H2 SER C 30 ? GLN C 32 ? SER A 39 GLN A 41 5 ? 3  
HELX_P HELX_P3 H3 ASP C 50 ? LYS C 58 ? ASP A 59 LYS A 67 5 ? 9  
HELX_P HELX_P4 H4 TYR C 67 ? TYR C 76 ? TYR A 76 TYR A 85 5 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 1  N3 ? ? ? 1_555 B DA 17 N1 ? ? B DT 1  C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA 17 N6 ? ? B DT 1  C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 16 N1 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 16 O6 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 16 N2 ? ? B DC 2  C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 15 N3 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 15 O2 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 15 N4 ? ? B DG 3  C DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA 4  C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA 4  C DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC 13 N3 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC 13 O2 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC 13 N4 ? ? B DG 5  C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 12 N1 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 12 O6 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 12 N2 ? ? B DC 6  C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 10 N3 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 10 O2 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 10 N4 ? ? B DG 8  C DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 9  N3 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 9  O2 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 9  N4 ? ? B DG 9  C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 8  N3 ? ? B DA 10 C DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 8  O4 ? ? B DA 10 C DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 7  N3 ? ? B DA 11 C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 7  O4 ? ? B DA 11 C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 6  N3 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 6  O2 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 6  N4 ? ? B DG 12 C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 13 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 13 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 4  N1 ? ? B DT 14 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 4  N6 ? ? B DT 14 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DC 15 N3 ? ? ? 1_555 B DG 3  N1 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG 3  O6 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DC 15 O2 ? ? ? 1_555 B DG 3  N2 ? ? B DC 15 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DG 16 N1 ? ? ? 1_555 B DC 2  N3 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DG 16 N2 ? ? ? 1_555 B DC 2  O2 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DG 16 O6 ? ? ? 1_555 B DC 2  N4 ? ? B DG 16 C DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 1  N3 ? ? B DA 17 C DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 1  O4 ? ? B DA 17 C DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 36 ? THR C 38 ? SER A 45  THR A 47  
A 2 GLU C 43 ? LYS C 45 ? GLU A 52  LYS A 54  
B 1 ILE C 83 ? LYS C 85 ? ILE A 92  LYS A 94  
B 2 TYR C 93 ? PHE C 95 ? TYR A 102 PHE A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 36 ? O SER A 45 N LYS C 45 ? N LYS A 54  
B 1 2 O HIS C 84 ? O HIS A 93 N ARG C 94 ? N ARG A 103 
# 
_database_PDB_matrix.entry_id          2STW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2STW 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    O "O5'"  . DT  A 1 1  ? -70.475  -20.375 -21.653 1.00 1.46 ? 1   DT  B "O5'"  1 
ATOM 2    C "C5'"  . DT  A 1 1  ? -69.799  -20.650 -22.883 1.00 1.52 ? 1   DT  B "C5'"  1 
ATOM 3    C "C4'"  . DT  A 1 1  ? -70.252  -19.702 -23.995 1.00 1.48 ? 1   DT  B "C4'"  1 
ATOM 4    O "O4'"  . DT  A 1 1  ? -71.622  -19.998 -24.353 1.00 1.47 ? 1   DT  B "O4'"  1 
ATOM 5    C "C3'"  . DT  A 1 1  ? -70.182  -18.233 -23.557 1.00 1.39 ? 1   DT  B "C3'"  1 
ATOM 6    O "O3'"  . DT  A 1 1  ? -69.447  -17.445 -24.493 1.00 1.40 ? 1   DT  B "O3'"  1 
ATOM 7    C "C2'"  . DT  A 1 1  ? -71.611  -17.756 -23.506 1.00 1.32 ? 1   DT  B "C2'"  1 
ATOM 8    C "C1'"  . DT  A 1 1  ? -72.474  -18.862 -24.099 1.00 1.38 ? 1   DT  B "C1'"  1 
ATOM 9    N N1     . DT  A 1 1  ? -73.567  -19.215 -23.153 1.00 1.35 ? 1   DT  B N1     1 
ATOM 10   C C2     . DT  A 1 1  ? -74.882  -18.948 -23.538 1.00 1.32 ? 1   DT  B C2     1 
ATOM 11   O O2     . DT  A 1 1  ? -75.160  -18.458 -24.630 1.00 1.33 ? 1   DT  B O2     1 
ATOM 12   N N3     . DT  A 1 1  ? -75.858  -19.272 -22.606 1.00 1.31 ? 1   DT  B N3     1 
ATOM 13   C C4     . DT  A 1 1  ? -75.641  -19.830 -21.347 1.00 1.33 ? 1   DT  B C4     1 
ATOM 14   O O4     . DT  A 1 1  ? -76.588  -20.074 -20.603 1.00 1.34 ? 1   DT  B O4     1 
ATOM 15   C C5     . DT  A 1 1  ? -74.244  -20.076 -21.032 1.00 1.36 ? 1   DT  B C5     1 
ATOM 16   C C7     . DT  A 1 1  ? -73.864  -20.688 -19.685 1.00 1.41 ? 1   DT  B C7     1 
ATOM 17   C C6     . DT  A 1 1  ? -73.272  -19.768 -21.924 1.00 1.37 ? 1   DT  B C6     1 
ATOM 18   H "H5'"  . DT  A 1 1  ? -70.008  -21.676 -23.183 1.00 1.58 ? 1   DT  B "H5'"  1 
ATOM 19   H "H5''" . DT  A 1 1  ? -68.725  -20.534 -22.733 1.00 1.58 ? 1   DT  B "H5''" 1 
ATOM 20   H "H4'"  . DT  A 1 1  ? -69.617  -19.845 -24.869 1.00 1.54 ? 1   DT  B "H4'"  1 
ATOM 21   H "H3'"  . DT  A 1 1  ? -69.720  -18.142 -22.569 1.00 1.37 ? 1   DT  B "H3'"  1 
ATOM 22   H "H2'"  . DT  A 1 1  ? -71.908  -17.572 -22.474 1.00 1.28 ? 1   DT  B "H2'"  1 
ATOM 23   H "H2''" . DT  A 1 1  ? -71.714  -16.840 -24.090 1.00 1.29 ? 1   DT  B "H2''" 1 
ATOM 24   H "H1'"  . DT  A 1 1  ? -72.894  -18.523 -25.052 1.00 1.39 ? 1   DT  B "H1'"  1 
ATOM 25   H H3     . DT  A 1 1  ? -76.816  -19.086 -22.865 1.00 1.30 ? 1   DT  B H3     1 
ATOM 26   H H71    . DT  A 1 1  ? -73.322  -19.952 -19.091 1.00 1.73 ? 1   DT  B H71    1 
ATOM 27   H H72    . DT  A 1 1  ? -73.230  -21.559 -19.848 1.00 1.85 ? 1   DT  B H72    1 
ATOM 28   H H73    . DT  A 1 1  ? -74.766  -20.991 -19.151 1.00 1.66 ? 1   DT  B H73    1 
ATOM 29   H H6     . DT  A 1 1  ? -72.230  -19.959 -21.664 1.00 1.41 ? 1   DT  B H6     1 
ATOM 30   H "HO5'" . DT  A 1 1  ? -69.933  -20.729 -20.945 1.00 1.49 ? 1   DT  B "HO5'" 1 
ATOM 31   P P      . DC  A 1 2  ? -69.154  -15.891 -24.182 1.00 1.32 ? 2   DC  B P      1 
ATOM 32   O OP1    . DC  A 1 2  ? -68.075  -15.435 -25.086 1.00 1.39 ? 2   DC  B OP1    1 
ATOM 33   O OP2    . DC  A 1 2  ? -69.006  -15.732 -22.718 1.00 1.28 ? 2   DC  B OP2    1 
ATOM 34   O "O5'"  . DC  A 1 2  ? -70.524  -15.172 -24.631 1.00 1.24 ? 2   DC  B "O5'"  1 
ATOM 35   C "C5'"  . DC  A 1 2  ? -70.749  -14.858 -26.006 1.00 1.30 ? 2   DC  B "C5'"  1 
ATOM 36   C "C4'"  . DC  A 1 2  ? -71.873  -13.833 -26.195 1.00 1.21 ? 2   DC  B "C4'"  1 
ATOM 37   O "O4'"  . DC  A 1 2  ? -73.127  -14.405 -25.758 1.00 1.19 ? 2   DC  B "O4'"  1 
ATOM 38   C "C3'"  . DC  A 1 2  ? -71.632  -12.544 -25.396 1.00 1.13 ? 2   DC  B "C3'"  1 
ATOM 39   O "O3'"  . DC  A 1 2  ? -71.682  -11.402 -26.254 1.00 1.13 ? 2   DC  B "O3'"  1 
ATOM 40   C "C2'"  . DC  A 1 2  ? -72.769  -12.463 -24.400 1.00 1.06 ? 2   DC  B "C2'"  1 
ATOM 41   C "C1'"  . DC  A 1 2  ? -73.768  -13.552 -24.787 1.00 1.08 ? 2   DC  B "C1'"  1 
ATOM 42   N N1     . DC  A 1 2  ? -74.220  -14.339 -23.600 1.00 1.05 ? 2   DC  B N1     1 
ATOM 43   C C2     . DC  A 1 2  ? -75.597  -14.425 -23.362 1.00 1.02 ? 2   DC  B C2     1 
ATOM 44   O O2     . DC  A 1 2  ? -76.390  -13.859 -24.111 1.00 1.01 ? 2   DC  B O2     1 
ATOM 45   N N3     . DC  A 1 2  ? -76.017  -15.151 -22.283 1.00 1.01 ? 2   DC  B N3     1 
ATOM 46   C C4     . DC  A 1 2  ? -75.139  -15.767 -21.466 1.00 1.05 ? 2   DC  B C4     1 
ATOM 47   N N4     . DC  A 1 2  ? -75.598  -16.471 -20.432 1.00 1.06 ? 2   DC  B N4     1 
ATOM 48   C C5     . DC  A 1 2  ? -73.725  -15.684 -21.696 1.00 1.09 ? 2   DC  B C5     1 
ATOM 49   C C6     . DC  A 1 2  ? -73.312  -14.965 -22.769 1.00 1.09 ? 2   DC  B C6     1 
ATOM 50   H "H5'"  . DC  A 1 2  ? -71.011  -15.772 -26.539 1.00 1.40 ? 2   DC  B "H5'"  1 
ATOM 51   H "H5''" . DC  A 1 2  ? -69.829  -14.454 -26.429 1.00 1.37 ? 2   DC  B "H5''" 1 
ATOM 52   H "H4'"  . DC  A 1 2  ? -71.948  -13.584 -27.253 1.00 1.24 ? 2   DC  B "H4'"  1 
ATOM 53   H "H3'"  . DC  A 1 2  ? -70.671  -12.574 -24.876 1.00 1.15 ? 2   DC  B "H3'"  1 
ATOM 54   H "H2'"  . DC  A 1 2  ? -72.400  -12.619 -23.387 1.00 1.05 ? 2   DC  B "H2'"  1 
ATOM 55   H "H2''" . DC  A 1 2  ? -73.241  -11.483 -24.467 1.00 1.02 ? 2   DC  B "H2''" 1 
ATOM 56   H "H1'"  . DC  A 1 2  ? -74.632  -13.081 -25.269 1.00 1.07 ? 2   DC  B "H1'"  1 
ATOM 57   H H41    . DC  A 1 2  ? -76.593  -16.534 -20.265 1.00 1.05 ? 2   DC  B H41    1 
ATOM 58   H H42    . DC  A 1 2  ? -74.951  -16.941 -19.815 1.00 1.10 ? 2   DC  B H42    1 
ATOM 59   H H5     . DC  A 1 2  ? -73.015  -16.168 -21.027 1.00 1.13 ? 2   DC  B H5     1 
ATOM 60   H H6     . DC  A 1 2  ? -72.245  -14.880 -22.977 1.00 1.13 ? 2   DC  B H6     1 
ATOM 61   P P      . DG  A 1 3  ? -71.420  -9.927  -25.662 1.00 1.11 ? 3   DG  B P      1 
ATOM 62   O OP1    . DG  A 1 3  ? -70.654  -9.155  -26.665 1.00 1.19 ? 3   DG  B OP1    1 
ATOM 63   O OP2    . DG  A 1 3  ? -70.900  -10.067 -24.283 1.00 1.09 ? 3   DG  B OP2    1 
ATOM 64   O "O5'"  . DG  A 1 3  ? -72.906  -9.313  -25.579 1.00 1.04 ? 3   DG  B "O5'"  1 
ATOM 65   C "C5'"  . DG  A 1 3  ? -73.595  -8.930  -26.771 1.00 1.12 ? 3   DG  B "C5'"  1 
ATOM 66   C "C4'"  . DG  A 1 3  ? -75.034  -8.486  -26.484 1.00 1.02 ? 3   DG  B "C4'"  1 
ATOM 67   O "O4'"  . DG  A 1 3  ? -75.669  -9.436  -25.596 1.00 0.96 ? 3   DG  B "O4'"  1 
ATOM 68   C "C3'"  . DG  A 1 3  ? -75.096  -7.102  -25.822 1.00 0.97 ? 3   DG  B "C3'"  1 
ATOM 69   O "O3'"  . DG  A 1 3  ? -75.978  -6.238  -26.545 1.00 0.99 ? 3   DG  B "O3'"  1 
ATOM 70   C "C2'"  . DG  A 1 3  ? -75.638  -7.341  -24.429 1.00 0.86 ? 3   DG  B "C2'"  1 
ATOM 71   C "C1'"  . DG  A 1 3  ? -76.087  -8.794  -24.372 1.00 0.85 ? 3   DG  B "C1'"  1 
ATOM 72   N N9     . DG  A 1 3  ? -75.509  -9.471  -23.195 1.00 0.81 ? 3   DG  B N9     1 
ATOM 73   C C8     . DG  A 1 3  ? -74.195  -9.647  -22.861 1.00 0.84 ? 3   DG  B C8     1 
ATOM 74   N N7     . DG  A 1 3  ? -73.984  -10.296 -21.752 1.00 0.82 ? 3   DG  B N7     1 
ATOM 75   C C5     . DG  A 1 3  ? -75.271  -10.579 -21.303 1.00 0.77 ? 3   DG  B C5     1 
ATOM 76   C C6     . DG  A 1 3  ? -75.713  -11.276 -20.129 1.00 0.76 ? 3   DG  B C6     1 
ATOM 77   O O6     . DG  A 1 3  ? -75.025  -11.786 -19.247 1.00 0.79 ? 3   DG  B O6     1 
ATOM 78   N N1     . DG  A 1 3  ? -77.114  -11.343 -20.049 1.00 0.74 ? 3   DG  B N1     1 
ATOM 79   C C2     . DG  A 1 3  ? -77.993  -10.806 -20.982 1.00 0.74 ? 3   DG  B C2     1 
ATOM 80   N N2     . DG  A 1 3  ? -79.294  -10.966 -20.740 1.00 0.76 ? 3   DG  B N2     1 
ATOM 81   N N3     . DG  A 1 3  ? -77.578  -10.152 -22.086 1.00 0.75 ? 3   DG  B N3     1 
ATOM 82   C C4     . DG  A 1 3  ? -76.215  -10.077 -22.183 1.00 0.76 ? 3   DG  B C4     1 
ATOM 83   H "H5'"  . DG  A 1 3  ? -73.617  -9.779  -27.454 1.00 1.20 ? 3   DG  B "H5'"  1 
ATOM 84   H "H5''" . DG  A 1 3  ? -73.056  -8.110  -27.245 1.00 1.22 ? 3   DG  B "H5''" 1 
ATOM 85   H "H4'"  . DG  A 1 3  ? -75.587  -8.455  -27.422 1.00 1.06 ? 3   DG  B "H4'"  1 
ATOM 86   H "H3'"  . DG  A 1 3  ? -74.103  -6.646  -25.768 1.00 1.02 ? 3   DG  B "H3'"  1 
ATOM 87   H "H2'"  . DG  A 1 3  ? -74.860  -7.165  -23.683 1.00 0.85 ? 3   DG  B "H2'"  1 
ATOM 88   H "H2''" . DG  A 1 3  ? -76.484  -6.679  -24.242 1.00 0.84 ? 3   DG  B "H2''" 1 
ATOM 89   H "H1'"  . DG  A 1 3  ? -77.177  -8.838  -24.308 1.00 0.83 ? 3   DG  B "H1'"  1 
ATOM 90   H H8     . DG  A 1 3  ? -73.381  -9.271  -23.480 1.00 0.89 ? 3   DG  B H8     1 
ATOM 91   H H1     . DG  A 1 3  ? -77.491  -11.821 -19.243 1.00 0.75 ? 3   DG  B H1     1 
ATOM 92   H H21    . DG  A 1 3  ? -79.597  -11.456 -19.911 1.00 0.77 ? 3   DG  B H21    1 
ATOM 93   H H22    . DG  A 1 3  ? -79.976  -10.595 -21.385 1.00 0.79 ? 3   DG  B H22    1 
ATOM 94   P P      . DA  A 1 4  ? -76.231  -4.727  -26.047 1.00 1.00 ? 4   DA  B P      1 
ATOM 95   O OP1    . DA  A 1 4  ? -76.653  -3.919  -27.213 1.00 1.11 ? 4   DA  B OP1    1 
ATOM 96   O OP2    . DA  A 1 4  ? -75.066  -4.304  -25.238 1.00 1.01 ? 4   DA  B OP2    1 
ATOM 97   O "O5'"  . DA  A 1 4  ? -77.495  -4.893  -25.063 1.00 0.90 ? 4   DA  B "O5'"  1 
ATOM 98   C "C5'"  . DA  A 1 4  ? -78.706  -5.484  -25.541 1.00 0.89 ? 4   DA  B "C5'"  1 
ATOM 99   C "C4'"  . DA  A 1 4  ? -79.836  -5.378  -24.517 1.00 0.86 ? 4   DA  B "C4'"  1 
ATOM 100  O "O4'"  . DA  A 1 4  ? -79.632  -6.352  -23.470 1.00 0.84 ? 4   DA  B "O4'"  1 
ATOM 101  C "C3'"  . DA  A 1 4  ? -79.900  -3.987  -23.871 1.00 0.87 ? 4   DA  B "C3'"  1 
ATOM 102  O "O3'"  . DA  A 1 4  ? -81.214  -3.436  -23.984 1.00 0.96 ? 4   DA  B "O3'"  1 
ATOM 103  C "C2'"  . DA  A 1 4  ? -79.568  -4.201  -22.414 1.00 0.84 ? 4   DA  B "C2'"  1 
ATOM 104  C "C1'"  . DA  A 1 4  ? -79.555  -5.708  -22.184 1.00 0.80 ? 4   DA  B "C1'"  1 
ATOM 105  N N9     . DA  A 1 4  ? -78.342  -6.129  -21.450 1.00 0.74 ? 4   DA  B N9     1 
ATOM 106  C C8     . DA  A 1 4  ? -77.029  -5.819  -21.687 1.00 0.74 ? 4   DA  B C8     1 
ATOM 107  N N7     . DA  A 1 4  ? -76.176  -6.349  -20.860 1.00 0.72 ? 4   DA  B N7     1 
ATOM 108  C C5     . DA  A 1 4  ? -76.990  -7.075  -19.994 1.00 0.69 ? 4   DA  B C5     1 
ATOM 109  C C6     . DA  A 1 4  ? -76.724  -7.885  -18.866 1.00 0.68 ? 4   DA  B C6     1 
ATOM 110  N N6     . DA  A 1 4  ? -75.491  -8.100  -18.407 1.00 0.69 ? 4   DA  B N6     1 
ATOM 111  N N1     . DA  A 1 4  ? -77.779  -8.464  -18.228 1.00 0.70 ? 4   DA  B N1     1 
ATOM 112  C C2     . DA  A 1 4  ? -79.033  -8.262  -18.670 1.00 0.74 ? 4   DA  B C2     1 
ATOM 113  N N3     . DA  A 1 4  ? -79.390  -7.515  -19.725 1.00 0.75 ? 4   DA  B N3     1 
ATOM 114  C C4     . DA  A 1 4  ? -78.313  -6.947  -20.344 1.00 0.72 ? 4   DA  B C4     1 
ATOM 115  H "H5'"  . DA  A 1 4  ? -78.527  -6.535  -25.766 1.00 0.93 ? 4   DA  B "H5'"  1 
ATOM 116  H "H5''" . DA  A 1 4  ? -79.013  -4.974  -26.450 1.00 0.97 ? 4   DA  B "H5''" 1 
ATOM 117  H "H4'"  . DA  A 1 4  ? -80.784  -5.583  -25.013 1.00 0.92 ? 4   DA  B "H4'"  1 
ATOM 118  H "H3'"  . DA  A 1 4  ? -79.177  -3.306  -24.329 1.00 0.90 ? 4   DA  B "H3'"  1 
ATOM 119  H "H2'"  . DA  A 1 4  ? -78.590  -3.776  -22.179 1.00 0.83 ? 4   DA  B "H2'"  1 
ATOM 120  H "H2''" . DA  A 1 4  ? -80.332  -3.730  -21.794 1.00 0.89 ? 4   DA  B "H2''" 1 
ATOM 121  H "H1'"  . DA  A 1 4  ? -80.433  -5.990  -21.606 1.00 0.83 ? 4   DA  B "H1'"  1 
ATOM 122  H H8     . DA  A 1 4  ? -76.722  -5.168  -22.504 1.00 0.78 ? 4   DA  B H8     1 
ATOM 123  H H61    . DA  A 1 4  ? -75.348  -8.685  -17.597 1.00 0.70 ? 4   DA  B H61    1 
ATOM 124  H H62    . DA  A 1 4  ? -74.699  -7.677  -18.870 1.00 0.71 ? 4   DA  B H62    1 
ATOM 125  H H2     . DA  A 1 4  ? -79.835  -8.752  -18.117 1.00 0.79 ? 4   DA  B H2     1 
ATOM 126  P P      . DG  A 1 5  ? -81.506  -1.927  -23.501 1.00 1.02 ? 5   DG  B P      1 
ATOM 127  O OP1    . DG  A 1 5  ? -82.608  -1.383  -24.326 1.00 1.15 ? 5   DG  B OP1    1 
ATOM 128  O OP2    . DG  A 1 5  ? -80.216  -1.207  -23.425 1.00 1.05 ? 5   DG  B OP2    1 
ATOM 129  O "O5'"  . DG  A 1 5  ? -82.055  -2.135  -22.002 1.00 0.97 ? 5   DG  B "O5'"  1 
ATOM 130  C "C5'"  . DG  A 1 5  ? -83.424  -2.479  -21.774 1.00 0.98 ? 5   DG  B "C5'"  1 
ATOM 131  C "C4'"  . DG  A 1 5  ? -83.681  -2.841  -20.308 1.00 0.90 ? 5   DG  B "C4'"  1 
ATOM 132  O "O4'"  . DG  A 1 5  ? -82.634  -3.719  -19.831 1.00 0.87 ? 5   DG  B "O4'"  1 
ATOM 133  C "C3'"  . DG  A 1 5  ? -83.716  -1.602  -19.395 1.00 0.89 ? 5   DG  B "C3'"  1 
ATOM 134  O "O3'"  . DG  A 1 5  ? -84.903  -1.579  -18.594 1.00 0.96 ? 5   DG  B "O3'"  1 
ATOM 135  C "C2'"  . DG  A 1 5  ? -82.505  -1.739  -18.507 1.00 0.83 ? 5   DG  B "C2'"  1 
ATOM 136  C "C1'"  . DG  A 1 5  ? -82.028  -3.176  -18.643 1.00 0.80 ? 5   DG  B "C1'"  1 
ATOM 137  N N9     . DG  A 1 5  ? -80.554  -3.246  -18.704 1.00 0.75 ? 5   DG  B N9     1 
ATOM 138  C C8     . DG  A 1 5  ? -79.688  -2.582  -19.529 1.00 0.77 ? 5   DG  B C8     1 
ATOM 139  N N7     . DG  A 1 5  ? -78.428  -2.852  -19.345 1.00 0.75 ? 5   DG  B N7     1 
ATOM 140  C C5     . DG  A 1 5  ? -78.452  -3.778  -18.304 1.00 0.70 ? 5   DG  B C5     1 
ATOM 141  C C6     . DG  A 1 5  ? -77.377  -4.459  -17.641 1.00 0.70 ? 5   DG  B C6     1 
ATOM 142  O O6     . DG  A 1 5  ? -76.171  -4.365  -17.861 1.00 0.73 ? 5   DG  B O6     1 
ATOM 143  N N1     . DG  A 1 5  ? -77.839  -5.319  -16.631 1.00 0.71 ? 5   DG  B N1     1 
ATOM 144  C C2     . DG  A 1 5  ? -79.173  -5.508  -16.293 1.00 0.72 ? 5   DG  B C2     1 
ATOM 145  N N2     . DG  A 1 5  ? -79.424  -6.367  -15.305 1.00 0.79 ? 5   DG  B N2     1 
ATOM 146  N N3     . DG  A 1 5  ? -80.183  -4.869  -16.916 1.00 0.73 ? 5   DG  B N3     1 
ATOM 147  C C4     . DG  A 1 5  ? -79.754  -4.025  -17.904 1.00 0.71 ? 5   DG  B C4     1 
ATOM 148  H "H5'"  . DG  A 1 5  ? -83.681  -3.335  -22.399 1.00 1.04 ? 5   DG  B "H5'"  1 
ATOM 149  H "H5''" . DG  A 1 5  ? -84.055  -1.636  -22.052 1.00 1.06 ? 5   DG  B "H5''" 1 
ATOM 150  H "H4'"  . DG  A 1 5  ? -84.630  -3.361  -20.236 1.00 0.95 ? 5   DG  B "H4'"  1 
ATOM 151  H "H3'"  . DG  A 1 5  ? -83.661  -0.676  -19.975 1.00 0.96 ? 5   DG  B "H3'"  1 
ATOM 152  H "H2'"  . DG  A 1 5  ? -81.719  -1.053  -18.825 1.00 0.86 ? 5   DG  B "H2'"  1 
ATOM 153  H "H2''" . DG  A 1 5  ? -82.780  -1.535  -17.483 1.00 0.85 ? 5   DG  B "H2''" 1 
ATOM 154  H "H1'"  . DG  A 1 5  ? -82.374  -3.754  -17.781 1.00 0.81 ? 5   DG  B "H1'"  1 
ATOM 155  H H8     . DG  A 1 5  ? -80.029  -1.878  -20.287 1.00 0.84 ? 5   DG  B H8     1 
ATOM 156  H H1     . DG  A 1 5  ? -77.131  -5.830  -16.124 1.00 0.73 ? 5   DG  B H1     1 
ATOM 157  H H21    . DG  A 1 5  ? -78.662  -6.842  -14.843 1.00 0.82 ? 5   DG  B H21    1 
ATOM 158  H H22    . DG  A 1 5  ? -80.376  -6.543  -15.019 1.00 0.84 ? 5   DG  B H22    1 
ATOM 159  P P      . DC  A 1 6  ? -85.157  -0.372  -17.550 1.00 1.05 ? 6   DC  B P      1 
ATOM 160  O OP1    . DC  A 1 6  ? -86.613  -0.263  -17.313 1.00 1.23 ? 6   DC  B OP1    1 
ATOM 161  O OP2    . DC  A 1 6  ? -84.394  0.808   -18.015 1.00 1.10 ? 6   DC  B OP2    1 
ATOM 162  O "O5'"  . DC  A 1 6  ? -84.465  -0.922  -16.200 1.00 0.99 ? 6   DC  B "O5'"  1 
ATOM 163  C "C5'"  . DC  A 1 6  ? -84.766  -2.238  -15.731 1.00 1.10 ? 6   DC  B "C5'"  1 
ATOM 164  C "C4'"  . DC  A 1 6  ? -84.358  -2.452  -14.264 1.00 1.07 ? 6   DC  B "C4'"  1 
ATOM 165  O "O4'"  . DC  A 1 6  ? -83.026  -3.003  -14.194 1.00 1.03 ? 6   DC  B "O4'"  1 
ATOM 166  C "C3'"  . DC  A 1 6  ? -84.389  -1.165  -13.436 1.00 1.08 ? 6   DC  B "C3'"  1 
ATOM 167  O "O3'"  . DC  A 1 6  ? -85.244  -1.370  -12.307 1.00 1.19 ? 6   DC  B "O3'"  1 
ATOM 168  C "C2'"  . DC  A 1 6  ? -82.960  -0.932  -12.986 1.00 1.06 ? 6   DC  B "C2'"  1 
ATOM 169  C "C1'"  . DC  A 1 6  ? -82.162  -2.171  -13.394 1.00 0.97 ? 6   DC  B "C1'"  1 
ATOM 170  N N1     . DC  A 1 6  ? -80.941  -1.824  -14.177 1.00 0.90 ? 6   DC  B N1     1 
ATOM 171  C C2     . DC  A 1 6  ? -79.709  -2.318  -13.734 1.00 0.86 ? 6   DC  B C2     1 
ATOM 172  O O2     . DC  A 1 6  ? -79.643  -2.974  -12.697 1.00 0.87 ? 6   DC  B O2     1 
ATOM 173  N N3     . DC  A 1 6  ? -78.600  -2.043  -14.490 1.00 0.86 ? 6   DC  B N3     1 
ATOM 174  C C4     . DC  A 1 6  ? -78.690  -1.321  -15.628 1.00 0.89 ? 6   DC  B C4     1 
ATOM 175  N N4     . DC  A 1 6  ? -77.589  -1.078  -16.342 1.00 0.95 ? 6   DC  B N4     1 
ATOM 176  C C5     . DC  A 1 6  ? -79.946  -0.814  -16.083 1.00 0.93 ? 6   DC  B C5     1 
ATOM 177  C C6     . DC  A 1 6  ? -81.038  -1.083  -15.329 1.00 0.94 ? 6   DC  B C6     1 
ATOM 178  H "H5'"  . DC  A 1 6  ? -84.241  -2.963  -16.351 1.00 1.16 ? 6   DC  B "H5'"  1 
ATOM 179  H "H5''" . DC  A 1 6  ? -85.840  -2.404  -15.830 1.00 1.36 ? 6   DC  B "H5''" 1 
ATOM 180  H "H4'"  . DC  A 1 6  ? -85.045  -3.163  -13.808 1.00 1.14 ? 6   DC  B "H4'"  1 
ATOM 181  H "H3'"  . DC  A 1 6  ? -84.747  -0.321  -14.030 1.00 1.09 ? 6   DC  B "H3'"  1 
ATOM 182  H "H2'"  . DC  A 1 6  ? -82.549  -0.041  -13.463 1.00 1.08 ? 6   DC  B "H2'"  1 
ATOM 183  H "H2''" . DC  A 1 6  ? -82.936  -0.810  -11.902 1.00 1.18 ? 6   DC  B "H2''" 1 
ATOM 184  H "H1'"  . DC  A 1 6  ? -81.882  -2.729  -12.495 1.00 0.97 ? 6   DC  B "H1'"  1 
ATOM 185  H H41    . DC  A 1 6  ? -76.696  -1.427  -16.032 1.00 0.97 ? 6   DC  B H41    1 
ATOM 186  H H42    . DC  A 1 6  ? -77.651  -0.540  -17.195 1.00 1.00 ? 6   DC  B H42    1 
ATOM 187  H H5     . DC  A 1 6  ? -80.021  -0.257  -17.008 1.00 1.00 ? 6   DC  B H5     1 
ATOM 188  H H6     . DC  A 1 6  ? -82.003  -0.685  -15.624 1.00 1.02 ? 6   DC  B H6     1 
ATOM 189  P P      . DC  A 1 7  ? -85.501  -0.241  -11.188 1.00 1.32 ? 7   DC  B P      1 
ATOM 190  O OP1    . DC  A 1 7  ? -86.610  -0.712  -10.340 1.00 1.57 ? 7   DC  B OP1    1 
ATOM 191  O OP2    . DC  A 1 7  ? -85.592  1.075   -11.830 1.00 1.56 ? 7   DC  B OP2    1 
ATOM 192  O "O5'"  . DC  A 1 7  ? -84.159  -0.290  -10.311 1.00 0.99 ? 7   DC  B "O5'"  1 
ATOM 193  C "C5'"  . DC  A 1 7  ? -84.124  -1.127  -9.162  1.00 0.91 ? 7   DC  B "C5'"  1 
ATOM 194  C "C4'"  . DC  A 1 7  ? -82.688  -1.494  -8.755  1.00 0.76 ? 7   DC  B "C4'"  1 
ATOM 195  O "O4'"  . DC  A 1 7  ? -81.824  -1.463  -9.916  1.00 0.78 ? 7   DC  B "O4'"  1 
ATOM 196  C "C3'"  . DC  A 1 7  ? -82.081  -0.545  -7.699  1.00 0.83 ? 7   DC  B "C3'"  1 
ATOM 197  O "O3'"  . DC  A 1 7  ? -81.668  -1.278  -6.538  1.00 0.92 ? 7   DC  B "O3'"  1 
ATOM 198  C "C2'"  . DC  A 1 7  ? -80.863  0.049   -8.363  1.00 0.92 ? 7   DC  B "C2'"  1 
ATOM 199  C "C1'"  . DC  A 1 7  ? -80.587  -0.809  -9.581  1.00 0.90 ? 7   DC  B "C1'"  1 
ATOM 200  N N1     . DC  A 1 7  ? -80.066  0.004   -10.715 1.00 1.03 ? 7   DC  B N1     1 
ATOM 201  C C2     . DC  A 1 7  ? -78.736  -0.199  -11.100 1.00 1.22 ? 7   DC  B C2     1 
ATOM 202  O O2     . DC  A 1 7  ? -78.036  -1.010  -10.498 1.00 1.32 ? 7   DC  B O2     1 
ATOM 203  N N3     . DC  A 1 7  ? -78.254  0.527   -12.151 1.00 1.38 ? 7   DC  B N3     1 
ATOM 204  C C4     . DC  A 1 7  ? -79.029  1.415   -12.804 1.00 1.38 ? 7   DC  B C4     1 
ATOM 205  N N4     . DC  A 1 7  ? -78.513  2.093   -13.829 1.00 1.58 ? 7   DC  B N4     1 
ATOM 206  C C5     . DC  A 1 7  ? -80.396  1.636   -12.416 1.00 1.25 ? 7   DC  B C5     1 
ATOM 207  C C6     . DC  A 1 7  ? -80.870  0.913   -11.370 1.00 1.06 ? 7   DC  B C6     1 
ATOM 208  H "H5'"  . DC  A 1 7  ? -84.669  -2.046  -9.391  1.00 1.10 ? 7   DC  B "H5'"  1 
ATOM 209  H "H5''" . DC  A 1 7  ? -84.629  -0.624  -8.338  1.00 1.01 ? 7   DC  B "H5''" 1 
ATOM 210  H "H4'"  . DC  A 1 7  ? -82.687  -2.501  -8.357  1.00 0.84 ? 7   DC  B "H4'"  1 
ATOM 211  H "H3'"  . DC  A 1 7  ? -82.781  0.243   -7.414  1.00 0.92 ? 7   DC  B "H3'"  1 
ATOM 212  H "H2'"  . DC  A 1 7  ? -81.054  1.081   -8.667  1.00 1.02 ? 7   DC  B "H2'"  1 
ATOM 213  H "H2''" . DC  A 1 7  ? -80.019  0.008   -7.680  1.00 1.03 ? 7   DC  B "H2''" 1 
ATOM 214  H "H1'"  . DC  A 1 7  ? -79.858  -1.581  -9.312  1.00 1.01 ? 7   DC  B "H1'"  1 
ATOM 215  H H41    . DC  A 1 7  ? -77.553  1.939   -14.102 1.00 1.71 ? 7   DC  B H41    1 
ATOM 216  H H42    . DC  A 1 7  ? -79.080  2.760   -14.331 1.00 1.64 ? 7   DC  B H42    1 
ATOM 217  H H5     . DC  A 1 7  ? -81.026  2.355   -12.942 1.00 1.36 ? 7   DC  B H5     1 
ATOM 218  H H6     . DC  A 1 7  ? -81.897  1.061   -11.038 1.00 1.03 ? 7   DC  B H6     1 
ATOM 219  P P      . DG  A 1 8  ? -81.577  -0.566  -5.091  1.00 0.98 ? 8   DG  B P      1 
ATOM 220  O OP1    . DG  A 1 8  ? -81.744  -1.609  -4.056  1.00 1.18 ? 8   DG  B OP1    1 
ATOM 221  O OP2    . DG  A 1 8  ? -82.472  0.608   -5.095  1.00 1.06 ? 8   DG  B OP2    1 
ATOM 222  O "O5'"  . DG  A 1 8  ? -80.050  -0.043  -5.032  1.00 0.93 ? 8   DG  B "O5'"  1 
ATOM 223  C "C5'"  . DG  A 1 8  ? -79.002  -0.944  -4.659  1.00 1.10 ? 8   DG  B "C5'"  1 
ATOM 224  C "C4'"  . DG  A 1 8  ? -77.755  -0.221  -4.118  1.00 1.07 ? 8   DG  B "C4'"  1 
ATOM 225  O "O4'"  . DG  A 1 8  ? -76.867  0.106   -5.212  1.00 1.04 ? 8   DG  B "O4'"  1 
ATOM 226  C "C3'"  . DG  A 1 8  ? -78.092  1.082   -3.376  1.00 1.07 ? 8   DG  B "C3'"  1 
ATOM 227  O "O3'"  . DG  A 1 8  ? -77.485  1.087   -2.076  1.00 1.14 ? 8   DG  B "O3'"  1 
ATOM 228  C "C2'"  . DG  A 1 8  ? -77.512  2.192   -4.229  1.00 1.02 ? 8   DG  B "C2'"  1 
ATOM 229  C "C1'"  . DG  A 1 8  ? -76.624  1.527   -5.268  1.00 0.99 ? 8   DG  B "C1'"  1 
ATOM 230  N N9     . DG  A 1 8  ? -76.914  2.056   -6.608  1.00 0.98 ? 8   DG  B N9     1 
ATOM 231  C C8     . DG  A 1 8  ? -78.109  2.118   -7.261  1.00 1.17 ? 8   DG  B C8     1 
ATOM 232  N N7     . DG  A 1 8  ? -78.066  2.617   -8.457  1.00 1.17 ? 8   DG  B N7     1 
ATOM 233  C C5     . DG  A 1 8  ? -76.719  2.921   -8.619  1.00 0.94 ? 8   DG  B C5     1 
ATOM 234  C C6     . DG  A 1 8  ? -76.035  3.500   -9.728  1.00 0.89 ? 8   DG  B C6     1 
ATOM 235  O O6     . DG  A 1 8  ? -76.503  3.822   -10.805 1.00 1.00 ? 8   DG  B O6     1 
ATOM 236  N N1     . DG  A 1 8  ? -74.662  3.654   -9.490  1.00 0.79 ? 8   DG  B N1     1 
ATOM 237  C C2     . DG  A 1 8  ? -74.013  3.286   -8.319  1.00 0.76 ? 8   DG  B C2     1 
ATOM 238  N N2     . DG  A 1 8  ? -72.700  3.507   -8.269  1.00 0.87 ? 8   DG  B N2     1 
ATOM 239  N N3     . DG  A 1 8  ? -74.656  2.734   -7.268  1.00 0.76 ? 8   DG  B N3     1 
ATOM 240  C C4     . DG  A 1 8  ? -76.001  2.583   -7.487  1.00 0.85 ? 8   DG  B C4     1 
ATOM 241  H "H5'"  . DG  A 1 8  ? -78.717  -1.530  -5.534  1.00 1.22 ? 8   DG  B "H5'"  1 
ATOM 242  H "H5''" . DG  A 1 8  ? -79.382  -1.621  -3.892  1.00 1.28 ? 8   DG  B "H5''" 1 
ATOM 243  H "H4'"  . DG  A 1 8  ? -77.231  -0.887  -3.432  1.00 1.13 ? 8   DG  B "H4'"  1 
ATOM 244  H "H3'"  . DG  A 1 8  ? -79.174  1.206   -3.278  1.00 1.10 ? 8   DG  B "H3'"  1 
ATOM 245  H "H2'"  . DG  A 1 8  ? -78.311  2.748   -4.721  1.00 1.04 ? 8   DG  B "H2'"  1 
ATOM 246  H "H2''" . DG  A 1 8  ? -76.922  2.868   -3.618  1.00 1.04 ? 8   DG  B "H2''" 1 
ATOM 247  H "H1'"  . DG  A 1 8  ? -75.575  1.715   -5.029  1.00 1.00 ? 8   DG  B "H1'"  1 
ATOM 248  H H8     . DG  A 1 8  ? -79.036  1.799   -6.796  1.00 1.36 ? 8   DG  B H8     1 
ATOM 249  H H1     . DG  A 1 8  ? -74.127  4.076   -10.237 1.00 0.83 ? 8   DG  B H1     1 
ATOM 250  H H21    . DG  A 1 8  ? -72.227  3.921   -9.060  1.00 0.94 ? 8   DG  B H21    1 
ATOM 251  H H22    . DG  A 1 8  ? -72.177  3.260   -7.442  1.00 0.94 ? 8   DG  B H22    1 
ATOM 252  P P      . DG  A 1 9  ? -77.542  2.394   -1.129  1.00 1.22 ? 9   DG  B P      1 
ATOM 253  O OP1    . DG  A 1 9  ? -77.106  2.001   0.230   1.00 1.39 ? 9   DG  B OP1    1 
ATOM 254  O OP2    . DG  A 1 9  ? -78.855  3.049   -1.322  1.00 1.25 ? 9   DG  B OP2    1 
ATOM 255  O "O5'"  . DG  A 1 9  ? -76.403  3.344   -1.770  1.00 1.12 ? 9   DG  B "O5'"  1 
ATOM 256  C "C5'"  . DG  A 1 9  ? -75.033  2.926   -1.788  1.00 1.15 ? 9   DG  B "C5'"  1 
ATOM 257  C "C4'"  . DG  A 1 9  ? -74.074  4.092   -2.064  1.00 1.01 ? 9   DG  B "C4'"  1 
ATOM 258  O "O4'"  . DG  A 1 9  ? -74.054  4.390   -3.483  1.00 0.94 ? 9   DG  B "O4'"  1 
ATOM 259  C "C3'"  . DG  A 1 9  ? -74.479  5.374   -1.318  1.00 0.99 ? 9   DG  B "C3'"  1 
ATOM 260  O "O3'"  . DG  A 1 9  ? -73.380  5.877   -0.549  1.00 0.98 ? 9   DG  B "O3'"  1 
ATOM 261  C "C2'"  . DG  A 1 9  ? -74.845  6.367   -2.401  1.00 0.92 ? 9   DG  B "C2'"  1 
ATOM 262  C "C1'"  . DG  A 1 9  ? -74.325  5.789   -3.707  1.00 0.87 ? 9   DG  B "C1'"  1 
ATOM 263  N N9     . DG  A 1 9  ? -75.303  5.990   -4.796  1.00 0.86 ? 9   DG  B N9     1 
ATOM 264  C C8     . DG  A 1 9  ? -76.622  5.630   -4.855  1.00 0.93 ? 9   DG  B C8     1 
ATOM 265  N N7     . DG  A 1 9  ? -77.238  5.952   -5.954  1.00 0.93 ? 9   DG  B N7     1 
ATOM 266  C C5     . DG  A 1 9  ? -76.247  6.585   -6.699  1.00 0.86 ? 9   DG  B C5     1 
ATOM 267  C C6     . DG  A 1 9  ? -76.299  7.170   -8.006  1.00 0.85 ? 9   DG  B C6     1 
ATOM 268  O O6     . DG  A 1 9  ? -77.261  7.235   -8.769  1.00 0.89 ? 9   DG  B O6     1 
ATOM 269  N N1     . DG  A 1 9  ? -75.062  7.712   -8.393  1.00 0.83 ? 9   DG  B N1     1 
ATOM 270  C C2     . DG  A 1 9  ? -73.908  7.698   -7.621  1.00 0.81 ? 9   DG  B C2     1 
ATOM 271  N N2     . DG  A 1 9  ? -72.825  8.265   -8.153  1.00 0.84 ? 9   DG  B N2     1 
ATOM 272  N N3     . DG  A 1 9  ? -73.857  7.147   -6.391  1.00 0.80 ? 9   DG  B N3     1 
ATOM 273  C C4     . DG  A 1 9  ? -75.054  6.613   -5.995  1.00 0.83 ? 9   DG  B C4     1 
ATOM 274  H "H5'"  . DG  A 1 9  ? -74.903  2.171   -2.564  1.00 1.19 ? 9   DG  B "H5'"  1 
ATOM 275  H "H5''" . DG  A 1 9  ? -74.785  2.486   -0.822  1.00 1.31 ? 9   DG  B "H5''" 1 
ATOM 276  H "H4'"  . DG  A 1 9  ? -73.070  3.804   -1.751  1.00 1.01 ? 9   DG  B "H4'"  1 
ATOM 277  H "H3'"  . DG  A 1 9  ? -75.336  5.194   -0.663  1.00 1.08 ? 9   DG  B "H3'"  1 
ATOM 278  H "H2'"  . DG  A 1 9  ? -75.928  6.488   -2.455  1.00 0.97 ? 9   DG  B "H2'"  1 
ATOM 279  H "H2''" . DG  A 1 9  ? -74.375  7.329   -2.204  1.00 0.89 ? 9   DG  B "H2''" 1 
ATOM 280  H "H1'"  . DG  A 1 9  ? -73.390  6.287   -3.975  1.00 0.84 ? 9   DG  B "H1'"  1 
ATOM 281  H H8     . DG  A 1 9  ? -77.123  5.121   -4.035  1.00 1.00 ? 9   DG  B H8     1 
ATOM 282  H H1     . DG  A 1 9  ? -75.032  8.140   -9.304  1.00 0.85 ? 9   DG  B H1     1 
ATOM 283  H H21    . DG  A 1 9  ? -72.871  8.676   -9.074  1.00 0.88 ? 9   DG  B H21    1 
ATOM 284  H H22    . DG  A 1 9  ? -71.959  8.286   -7.634  1.00 0.85 ? 9   DG  B H22    1 
ATOM 285  P P      . DA  A 1 10 ? -73.522  7.243   0.296   1.00 1.01 ? 10  DA  B P      1 
ATOM 286  O OP1    . DA  A 1 10 ? -72.646  7.147   1.485   1.00 1.09 ? 10  DA  B OP1    1 
ATOM 287  O OP2    . DA  A 1 10 ? -74.964  7.537   0.462   1.00 1.12 ? 10  DA  B OP2    1 
ATOM 288  O "O5'"  . DA  A 1 10 ? -72.896  8.338   -0.708  1.00 0.91 ? 10  DA  B "O5'"  1 
ATOM 289  C "C5'"  . DA  A 1 10 ? -71.759  8.011   -1.512  1.00 0.87 ? 10  DA  B "C5'"  1 
ATOM 290  C "C4'"  . DA  A 1 10 ? -71.283  9.206   -2.350  1.00 0.84 ? 10  DA  B "C4'"  1 
ATOM 291  O "O4'"  . DA  A 1 10 ? -72.009  9.244   -3.603  1.00 0.80 ? 10  DA  B "O4'"  1 
ATOM 292  C "C3'"  . DA  A 1 10 ? -71.502  10.548  -1.634  1.00 0.87 ? 10  DA  B "C3'"  1 
ATOM 293  O "O3'"  . DA  A 1 10 ? -70.282  11.298  -1.589  1.00 0.88 ? 10  DA  B "O3'"  1 
ATOM 294  C "C2'"  . DA  A 1 10 ? -72.528  11.283  -2.468  1.00 0.85 ? 10  DA  B "C2'"  1 
ATOM 295  C "C1'"  . DA  A 1 10 ? -72.640  10.529  -3.784  1.00 0.79 ? 10  DA  B "C1'"  1 
ATOM 296  N N9     . DA  A 1 10 ? -74.051  10.384  -4.196  1.00 0.76 ? 10  DA  B N9     1 
ATOM 297  C C8     . DA  A 1 10 ? -75.118  9.894   -3.491  1.00 0.78 ? 10  DA  B C8     1 
ATOM 298  N N7     . DA  A 1 10 ? -76.252  9.895   -4.131  1.00 0.75 ? 10  DA  B N7     1 
ATOM 299  C C5     . DA  A 1 10 ? -75.912  10.435  -5.369  1.00 0.70 ? 10  DA  B C5     1 
ATOM 300  C C6     . DA  A 1 10 ? -76.655  10.721  -6.538  1.00 0.67 ? 10  DA  B C6     1 
ATOM 301  N N6     . DA  A 1 10 ? -77.963  10.484  -6.640  1.00 0.67 ? 10  DA  B N6     1 
ATOM 302  N N1     . DA  A 1 10 ? -75.995  11.263  -7.601  1.00 0.68 ? 10  DA  B N1     1 
ATOM 303  C C2     . DA  A 1 10 ? -74.676  11.513  -7.525  1.00 0.71 ? 10  DA  B C2     1 
ATOM 304  N N3     . DA  A 1 10 ? -73.886  11.279  -6.467  1.00 0.73 ? 10  DA  B N3     1 
ATOM 305  C C4     . DA  A 1 10 ? -74.573  10.737  -5.418  1.00 0.72 ? 10  DA  B C4     1 
ATOM 306  H "H5'"  . DA  A 1 10 ? -72.022  7.192   -2.181  1.00 0.88 ? 10  DA  B "H5'"  1 
ATOM 307  H "H5''" . DA  A 1 10 ? -70.948  7.688   -0.858  1.00 0.90 ? 10  DA  B "H5''" 1 
ATOM 308  H "H4'"  . DA  A 1 10 ? -70.219  9.089   -2.564  1.00 0.84 ? 10  DA  B "H4'"  1 
ATOM 309  H "H3'"  . DA  A 1 10 ? -71.877  10.395  -0.618  1.00 0.90 ? 10  DA  B "H3'"  1 
ATOM 310  H "H2'"  . DA  A 1 10 ? -73.494  11.292  -1.960  1.00 0.88 ? 10  DA  B "H2'"  1 
ATOM 311  H "H2''" . DA  A 1 10 ? -72.199  12.304  -2.650  1.00 0.87 ? 10  DA  B "H2''" 1 
ATOM 312  H "H1'"  . DA  A 1 10 ? -72.100  11.075  -4.560  1.00 0.79 ? 10  DA  B "H1'"  1 
ATOM 313  H H8     . DA  A 1 10 ? -75.026  9.537   -2.467  1.00 0.84 ? 10  DA  B H8     1 
ATOM 314  H H61    . DA  A 1 10 ? -78.451  10.705  -7.496  1.00 0.66 ? 10  DA  B H61    1 
ATOM 315  H H62    . DA  A 1 10 ? -78.465  10.084  -5.860  1.00 0.69 ? 10  DA  B H62    1 
ATOM 316  H H2     . DA  A 1 10 ? -74.205  11.948  -8.407  1.00 0.75 ? 10  DA  B H2     1 
ATOM 317  P P      . DA  A 1 11 ? -70.240  12.766  -0.924  1.00 0.94 ? 11  DA  B P      1 
ATOM 318  O OP1    . DA  A 1 11 ? -68.911  12.957  -0.301  1.00 1.07 ? 11  DA  B OP1    1 
ATOM 319  O OP2    . DA  A 1 11 ? -71.467  12.944  -0.115  1.00 1.00 ? 11  DA  B OP2    1 
ATOM 320  O "O5'"  . DA  A 1 11 ? -70.340  13.734  -2.209  1.00 0.81 ? 11  DA  B "O5'"  1 
ATOM 321  C "C5'"  . DA  A 1 11 ? -69.597  13.437  -3.395  1.00 0.80 ? 11  DA  B "C5'"  1 
ATOM 322  C "C4'"  . DA  A 1 11 ? -69.834  14.475  -4.499  1.00 0.73 ? 11  DA  B "C4'"  1 
ATOM 323  O "O4'"  . DA  A 1 11 ? -71.067  14.175  -5.194  1.00 0.68 ? 11  DA  B "O4'"  1 
ATOM 324  C "C3'"  . DA  A 1 11 ? -69.936  15.905  -3.945  1.00 0.74 ? 11  DA  B "C3'"  1 
ATOM 325  O "O3'"  . DA  A 1 11 ? -69.030  16.775  -4.632  1.00 0.76 ? 11  DA  B "O3'"  1 
ATOM 326  C "C2'"  . DA  A 1 11 ? -71.365  16.335  -4.203  1.00 0.69 ? 11  DA  B "C2'"  1 
ATOM 327  C "C1'"  . DA  A 1 11 ? -71.964  15.303  -5.148  1.00 0.64 ? 11  DA  B "C1'"  1 
ATOM 328  N N9     . DA  A 1 11 ? -73.313  14.895  -4.708  1.00 0.61 ? 11  DA  B N9     1 
ATOM 329  C C8     . DA  A 1 11 ? -73.741  14.484  -3.473  1.00 0.64 ? 11  DA  B C8     1 
ATOM 330  N N7     . DA  A 1 11 ? -75.004  14.182  -3.398  1.00 0.62 ? 11  DA  B N7     1 
ATOM 331  C C5     . DA  A 1 11 ? -75.456  14.412  -4.693  1.00 0.57 ? 11  DA  B C5     1 
ATOM 332  C C6     . DA  A 1 11 ? -76.718  14.289  -5.311  1.00 0.54 ? 11  DA  B C6     1 
ATOM 333  N N6     . DA  A 1 11 ? -77.807  13.882  -4.659  1.00 0.56 ? 11  DA  B N6     1 
ATOM 334  N N1     . DA  A 1 11 ? -76.820  14.607  -6.634  1.00 0.52 ? 11  DA  B N1     1 
ATOM 335  C C2     . DA  A 1 11 ? -75.739  15.024  -7.317  1.00 0.53 ? 11  DA  B C2     1 
ATOM 336  N N3     . DA  A 1 11 ? -74.502  15.173  -6.824  1.00 0.55 ? 11  DA  B N3     1 
ATOM 337  C C4     . DA  A 1 11 ? -74.433  14.848  -5.499  1.00 0.57 ? 11  DA  B C4     1 
ATOM 338  H "H5'"  . DA  A 1 11 ? -69.895  12.455  -3.763  1.00 0.84 ? 11  DA  B "H5'"  1 
ATOM 339  H "H5''" . DA  A 1 11 ? -68.535  13.416  -3.151  1.00 0.90 ? 11  DA  B "H5''" 1 
ATOM 340  H "H4'"  . DA  A 1 11 ? -69.009  14.430  -5.209  1.00 0.75 ? 11  DA  B "H4'"  1 
ATOM 341  H "H3'"  . DA  A 1 11 ? -69.723  15.926  -2.873  1.00 0.79 ? 11  DA  B "H3'"  1 
ATOM 342  H "H2'"  . DA  A 1 11 ? -71.928  16.360  -3.269  1.00 0.72 ? 11  DA  B "H2'"  1 
ATOM 343  H "H2''" . DA  A 1 11 ? -71.382  17.319  -4.666  1.00 0.69 ? 11  DA  B "H2''" 1 
ATOM 344  H "H1'"  . DA  A 1 11 ? -72.035  15.731  -6.151  1.00 0.63 ? 11  DA  B "H1'"  1 
ATOM 345  H H8     . DA  A 1 11 ? -73.077  14.428  -2.614  1.00 0.69 ? 11  DA  B H8     1 
ATOM 346  H H61    . DA  A 1 11 ? -78.690  13.810  -5.145  1.00 0.56 ? 11  DA  B H61    1 
ATOM 347  H H62    . DA  A 1 11 ? -77.750  13.645  -3.679  1.00 0.60 ? 11  DA  B H62    1 
ATOM 348  H H2     . DA  A 1 11 ? -75.883  15.264  -8.371  1.00 0.54 ? 11  DA  B H2     1 
ATOM 349  P P      . DG  A 1 12 ? -68.985  18.351  -4.295  1.00 0.77 ? 12  DG  B P      1 
ATOM 350  O OP1    . DG  A 1 12 ? -67.705  18.897  -4.799  1.00 0.86 ? 12  DG  B OP1    1 
ATOM 351  O OP2    . DG  A 1 12 ? -69.357  18.531  -2.874  1.00 0.79 ? 12  DG  B OP2    1 
ATOM 352  O "O5'"  . DG  A 1 12 ? -70.179  18.935  -5.207  1.00 0.71 ? 12  DG  B "O5'"  1 
ATOM 353  C "C5'"  . DG  A 1 12 ? -70.207  18.678  -6.615  1.00 0.73 ? 12  DG  B "C5'"  1 
ATOM 354  C "C4'"  . DG  A 1 12 ? -71.259  19.533  -7.334  1.00 0.69 ? 12  DG  B "C4'"  1 
ATOM 355  O "O4'"  . DG  A 1 12 ? -72.548  18.871  -7.281  1.00 0.65 ? 12  DG  B "O4'"  1 
ATOM 356  C "C3'"  . DG  A 1 12 ? -71.414  20.922  -6.695  1.00 0.69 ? 12  DG  B "C3'"  1 
ATOM 357  O "O3'"  . DG  A 1 12 ? -71.262  21.951  -7.677  1.00 0.72 ? 12  DG  B "O3'"  1 
ATOM 358  C "C2'"  . DG  A 1 12 ? -72.821  20.952  -6.140  1.00 0.65 ? 12  DG  B "C2'"  1 
ATOM 359  C "C1'"  . DG  A 1 12 ? -73.548  19.758  -6.739  1.00 0.62 ? 12  DG  B "C1'"  1 
ATOM 360  N N9     . DG  A 1 12 ? -74.389  19.081  -5.728  1.00 0.61 ? 12  DG  B N9     1 
ATOM 361  C C8     . DG  A 1 12 ? -74.063  18.652  -4.468  1.00 0.63 ? 12  DG  B C8     1 
ATOM 362  N N7     . DG  A 1 12 ? -75.032  18.096  -3.801  1.00 0.63 ? 12  DG  B N7     1 
ATOM 363  C C5     . DG  A 1 12 ? -76.103  18.157  -4.688  1.00 0.59 ? 12  DG  B C5     1 
ATOM 364  C C6     . DG  A 1 12 ? -77.456  17.706  -4.540  1.00 0.58 ? 12  DG  B C6     1 
ATOM 365  O O6     . DG  A 1 12 ? -77.969  17.156  -3.568  1.00 0.60 ? 12  DG  B O6     1 
ATOM 366  N N1     . DG  A 1 12 ? -78.228  17.960  -5.687  1.00 0.55 ? 12  DG  B N1     1 
ATOM 367  C C2     . DG  A 1 12 ? -77.760  18.574  -6.842  1.00 0.54 ? 12  DG  B C2     1 
ATOM 368  N N2     . DG  A 1 12 ? -78.637  18.729  -7.833  1.00 0.54 ? 12  DG  B N2     1 
ATOM 369  N N3     . DG  A 1 12 ? -76.487  18.997  -6.982  1.00 0.55 ? 12  DG  B N3     1 
ATOM 370  C C4     . DG  A 1 12 ? -75.718  18.758  -5.875  1.00 0.57 ? 12  DG  B C4     1 
ATOM 371  H "H5'"  . DG  A 1 12 ? -70.434  17.625  -6.780  1.00 0.75 ? 12  DG  B "H5'"  1 
ATOM 372  H "H5''" . DG  A 1 12 ? -69.224  18.898  -7.032  1.00 0.80 ? 12  DG  B "H5''" 1 
ATOM 373  H "H4'"  . DG  A 1 12 ? -70.967  19.655  -8.378  1.00 0.71 ? 12  DG  B "H4'"  1 
ATOM 374  H "H3'"  . DG  A 1 12 ? -70.686  21.070  -5.891  1.00 0.73 ? 12  DG  B "H3'"  1 
ATOM 375  H "H2'"  . DG  A 1 12 ? -72.801  20.872  -5.054  1.00 0.67 ? 12  DG  B "H2'"  1 
ATOM 376  H "H2''" . DG  A 1 12 ? -73.315  21.876  -6.432  1.00 0.66 ? 12  DG  B "H2''" 1 
ATOM 377  H "H1'"  . DG  A 1 12 ? -74.188  20.099  -7.557  1.00 0.60 ? 12  DG  B "H1'"  1 
ATOM 378  H H8     . DG  A 1 12 ? -73.066  18.775  -4.051  1.00 0.67 ? 12  DG  B H8     1 
ATOM 379  H H1     . DG  A 1 12 ? -79.195  17.671  -5.646  1.00 0.55 ? 12  DG  B H1     1 
ATOM 380  H H21    . DG  A 1 12 ? -79.587  18.408  -7.721  1.00 0.55 ? 12  DG  B H21    1 
ATOM 381  H H22    . DG  A 1 12 ? -78.351  19.169  -8.696  1.00 0.55 ? 12  DG  B H22    1 
ATOM 382  P P      . DT  A 1 13 ? -71.390  23.504  -7.261  1.00 0.74 ? 13  DT  B P      1 
ATOM 383  O OP1    . DT  A 1 13 ? -70.499  24.293  -8.140  1.00 0.83 ? 13  DT  B OP1    1 
ATOM 384  O OP2    . DT  A 1 13 ? -71.255  23.603  -5.791  1.00 0.79 ? 13  DT  B OP2    1 
ATOM 385  O "O5'"  . DT  A 1 13 ? -72.916  23.846  -7.651  1.00 0.65 ? 13  DT  B "O5'"  1 
ATOM 386  C "C5'"  . DT  A 1 13 ? -73.253  24.174  -9.000  1.00 0.73 ? 13  DT  B "C5'"  1 
ATOM 387  C "C4'"  . DT  A 1 13 ? -74.765  24.324  -9.202  1.00 0.67 ? 13  DT  B "C4'"  1 
ATOM 388  O "O4'"  . DT  A 1 13 ? -75.455  23.253  -8.514  1.00 0.65 ? 13  DT  B "O4'"  1 
ATOM 389  C "C3'"  . DT  A 1 13 ? -75.302  25.659  -8.660  1.00 0.63 ? 13  DT  B "C3'"  1 
ATOM 390  O "O3'"  . DT  A 1 13 ? -76.001  26.376  -9.679  1.00 0.66 ? 13  DT  B "O3'"  1 
ATOM 391  C "C2'"  . DT  A 1 13 ? -76.271  25.288  -7.559  1.00 0.59 ? 13  DT  B "C2'"  1 
ATOM 392  C "C1'"  . DT  A 1 13 ? -76.490  23.784  -7.663  1.00 0.60 ? 13  DT  B "C1'"  1 
ATOM 393  N N1     . DT  A 1 13 ? -76.467  23.140  -6.316  1.00 0.57 ? 13  DT  B N1     1 
ATOM 394  C C2     . DT  A 1 13 ? -77.602  22.435  -5.912  1.00 0.56 ? 13  DT  B C2     1 
ATOM 395  O O2     . DT  A 1 13 ? -78.599  22.334  -6.624  1.00 0.57 ? 13  DT  B O2     1 
ATOM 396  N N3     . DT  A 1 13 ? -77.535  21.853  -4.655  1.00 0.56 ? 13  DT  B N3     1 
ATOM 397  C C4     . DT  A 1 13 ? -76.455  21.911  -3.777  1.00 0.57 ? 13  DT  B C4     1 
ATOM 398  O O4     . DT  A 1 13 ? -76.511  21.354  -2.684  1.00 0.59 ? 13  DT  B O4     1 
ATOM 399  C C5     . DT  A 1 13 ? -75.318  22.665  -4.275  1.00 0.58 ? 13  DT  B C5     1 
ATOM 400  C C7     . DT  A 1 13 ? -74.072  22.811  -3.403  1.00 0.61 ? 13  DT  B C7     1 
ATOM 401  C C6     . DT  A 1 13 ? -75.356  23.243  -5.501  1.00 0.58 ? 13  DT  B C6     1 
ATOM 402  H "H5'"  . DT  A 1 13 ? -72.887  23.384  -9.656  1.00 0.88 ? 13  DT  B "H5'"  1 
ATOM 403  H "H5''" . DT  A 1 13 ? -72.765  25.109  -9.269  1.00 0.84 ? 13  DT  B "H5''" 1 
ATOM 404  H "H4'"  . DT  A 1 13 ? -74.987  24.260  -10.267 1.00 0.70 ? 13  DT  B "H4'"  1 
ATOM 405  H "H3'"  . DT  A 1 13 ? -74.495  26.280  -8.261  1.00 0.64 ? 13  DT  B "H3'"  1 
ATOM 406  H "H2'"  . DT  A 1 13 ? -75.855  25.544  -6.586  1.00 0.59 ? 13  DT  B "H2'"  1 
ATOM 407  H "H2''" . DT  A 1 13 ? -77.215  25.814  -7.704  1.00 0.60 ? 13  DT  B "H2''" 1 
ATOM 408  H "H1'"  . DT  A 1 13 ? -77.454  23.599  -8.147  1.00 0.61 ? 13  DT  B "H1'"  1 
ATOM 409  H H3     . DT  A 1 13 ? -78.347  21.339  -4.346  1.00 0.56 ? 13  DT  B H3     1 
ATOM 410  H H71    . DT  A 1 13 ? -74.182  23.684  -2.759  1.00 1.16 ? 13  DT  B H71    1 
ATOM 411  H H72    . DT  A 1 13 ? -73.192  22.936  -4.034  1.00 1.25 ? 13  DT  B H72    1 
ATOM 412  H H73    . DT  A 1 13 ? -73.953  21.919  -2.787  1.00 1.14 ? 13  DT  B H73    1 
ATOM 413  H H6     . DT  A 1 13 ? -74.489  23.804  -5.851  1.00 0.60 ? 13  DT  B H6     1 
ATOM 414  P P      . DT  A 1 14 ? -76.633  27.823  -9.365  1.00 0.68 ? 14  DT  B P      1 
ATOM 415  O OP1    . DT  A 1 14 ? -76.720  28.577  -10.635 1.00 0.82 ? 14  DT  B OP1    1 
ATOM 416  O OP2    . DT  A 1 14 ? -75.911  28.403  -8.210  1.00 0.68 ? 14  DT  B OP2    1 
ATOM 417  O "O5'"  . DT  A 1 14 ? -78.128  27.456  -8.892  1.00 0.61 ? 14  DT  B "O5'"  1 
ATOM 418  C "C5'"  . DT  A 1 14 ? -79.093  27.020  -9.851  1.00 0.74 ? 14  DT  B "C5'"  1 
ATOM 419  C "C4'"  . DT  A 1 14 ? -80.446  26.708  -9.207  1.00 0.71 ? 14  DT  B "C4'"  1 
ATOM 420  O "O4'"  . DT  A 1 14 ? -80.263  25.783  -8.108  1.00 0.64 ? 14  DT  B "O4'"  1 
ATOM 421  C "C3'"  . DT  A 1 14 ? -81.132  27.969  -8.655  1.00 0.71 ? 14  DT  B "C3'"  1 
ATOM 422  O "O3'"  . DT  A 1 14 ? -82.456  28.096  -9.183  1.00 0.81 ? 14  DT  B "O3'"  1 
ATOM 423  C "C2'"  . DT  A 1 14 ? -81.205  27.759  -7.161  1.00 0.63 ? 14  DT  B "C2'"  1 
ATOM 424  C "C1'"  . DT  A 1 14 ? -80.919  26.281  -6.926  1.00 0.59 ? 14  DT  B "C1'"  1 
ATOM 425  N N1     . DT  A 1 14 ? -80.087  26.063  -5.705  1.00 0.52 ? 14  DT  B N1     1 
ATOM 426  C C2     . DT  A 1 14 ? -80.618  25.254  -4.698  1.00 0.50 ? 14  DT  B C2     1 
ATOM 427  O O2     . DT  A 1 14 ? -81.727  24.733  -4.792  1.00 0.54 ? 14  DT  B O2     1 
ATOM 428  N N3     . DT  A 1 14 ? -79.815  25.073  -3.583  1.00 0.46 ? 14  DT  B N3     1 
ATOM 429  C C4     . DT  A 1 14 ? -78.550  25.618  -3.382  1.00 0.46 ? 14  DT  B C4     1 
ATOM 430  O O4     . DT  A 1 14 ? -77.931  25.384  -2.346  1.00 0.48 ? 14  DT  B O4     1 
ATOM 431  C C5     . DT  A 1 14 ? -78.071  26.448  -4.474  1.00 0.48 ? 14  DT  B C5     1 
ATOM 432  C C7     . DT  A 1 14 ? -76.699  27.116  -4.363  1.00 0.52 ? 14  DT  B C7     1 
ATOM 433  C C6     . DT  A 1 14 ? -78.837  26.641  -5.580  1.00 0.50 ? 14  DT  B C6     1 
ATOM 434  H "H5'"  . DT  A 1 14 ? -78.721  26.123  -10.346 1.00 0.83 ? 14  DT  B "H5'"  1 
ATOM 435  H "H5''" . DT  A 1 14 ? -79.231  27.804  -10.594 1.00 0.86 ? 14  DT  B "H5''" 1 
ATOM 436  H "H4'"  . DT  A 1 14 ? -81.095  26.248  -9.952  1.00 0.80 ? 14  DT  B "H4'"  1 
ATOM 437  H "H3'"  . DT  A 1 14 ? -80.553  28.868  -8.886  1.00 0.73 ? 14  DT  B "H3'"  1 
ATOM 438  H "H2'"  . DT  A 1 14 ? -80.465  28.377  -6.653  1.00 0.60 ? 14  DT  B "H2'"  1 
ATOM 439  H "H2''" . DT  A 1 14 ? -82.198  28.010  -6.802  1.00 0.68 ? 14  DT  B "H2''" 1 
ATOM 440  H "H1'"  . DT  A 1 14 ? -81.873  25.752  -6.824  1.00 0.62 ? 14  DT  B "H1'"  1 
ATOM 441  H H3     . DT  A 1 14 ? -80.184  24.491  -2.845  1.00 0.46 ? 14  DT  B H3     1 
ATOM 442  H H71    . DT  A 1 14 ? -76.769  27.976  -3.697  1.00 1.09 ? 14  DT  B H71    1 
ATOM 443  H H72    . DT  A 1 14 ? -76.363  27.447  -5.347  1.00 1.20 ? 14  DT  B H72    1 
ATOM 444  H H73    . DT  A 1 14 ? -75.981  26.403  -3.957  1.00 1.15 ? 14  DT  B H73    1 
ATOM 445  H H6     . DT  A 1 14 ? -78.455  27.267  -6.387  1.00 0.53 ? 14  DT  B H6     1 
ATOM 446  P P      . DC  A 1 15 ? -83.380  29.354  -8.780  1.00 0.89 ? 15  DC  B P      1 
ATOM 447  O OP1    . DC  A 1 15 ? -84.088  29.815  -9.995  1.00 1.01 ? 15  DC  B OP1    1 
ATOM 448  O OP2    . DC  A 1 15 ? -82.555  30.304  -8.001  1.00 0.89 ? 15  DC  B OP2    1 
ATOM 449  O "O5'"  . DC  A 1 15 ? -84.461  28.693  -7.785  1.00 0.88 ? 15  DC  B "O5'"  1 
ATOM 450  C "C5'"  . DC  A 1 15 ? -85.185  27.525  -8.180  1.00 0.95 ? 15  DC  B "C5'"  1 
ATOM 451  C "C4'"  . DC  A 1 15 ? -86.367  27.237  -7.246  1.00 0.98 ? 15  DC  B "C4'"  1 
ATOM 452  O "O4'"  . DC  A 1 15 ? -85.896  26.545  -6.068  1.00 0.90 ? 15  DC  B "O4'"  1 
ATOM 453  C "C3'"  . DC  A 1 15 ? -87.078  28.518  -6.792  1.00 1.07 ? 15  DC  B "C3'"  1 
ATOM 454  O "O3'"  . DC  A 1 15 ? -88.479  28.438  -7.061  1.00 1.22 ? 15  DC  B "O3'"  1 
ATOM 455  C "C2'"  . DC  A 1 15 ? -86.855  28.607  -5.299  1.00 1.04 ? 15  DC  B "C2'"  1 
ATOM 456  C "C1'"  . DC  A 1 15 ? -86.119  27.336  -4.882  1.00 0.92 ? 15  DC  B "C1'"  1 
ATOM 457  N N1     . DC  A 1 15 ? -84.821  27.657  -4.224  1.00 0.81 ? 15  DC  B N1     1 
ATOM 458  C C2     . DC  A 1 15 ? -84.569  27.112  -2.960  1.00 0.77 ? 15  DC  B C2     1 
ATOM 459  O O2     . DC  A 1 15 ? -85.411  26.404  -2.411  1.00 0.81 ? 15  DC  B O2     1 
ATOM 460  N N3     . DC  A 1 15 ? -83.368  27.395  -2.370  1.00 0.70 ? 15  DC  B N3     1 
ATOM 461  C C4     . DC  A 1 15 ? -82.451  28.174  -2.981  1.00 0.68 ? 15  DC  B C4     1 
ATOM 462  N N4     . DC  A 1 15 ? -81.294  28.420  -2.368  1.00 0.68 ? 15  DC  B N4     1 
ATOM 463  C C5     . DC  A 1 15 ? -82.702  28.738  -4.278  1.00 0.72 ? 15  DC  B C5     1 
ATOM 464  C C6     . DC  A 1 15 ? -83.894  28.454  -4.856  1.00 0.78 ? 15  DC  B C6     1 
ATOM 465  H "H5'"  . DC  A 1 15 ? -84.509  26.670  -8.171  1.00 0.98 ? 15  DC  B "H5'"  1 
ATOM 466  H "H5''" . DC  A 1 15 ? -85.561  27.668  -9.193  1.00 1.06 ? 15  DC  B "H5''" 1 
ATOM 467  H "H4'"  . DC  A 1 15 ? -87.082  26.600  -7.767  1.00 1.06 ? 15  DC  B "H4'"  1 
ATOM 468  H "H3'"  . DC  A 1 15 ? -86.660  29.396  -7.290  1.00 1.09 ? 15  DC  B "H3'"  1 
ATOM 469  H "H2'"  . DC  A 1 15 ? -86.260  29.489  -5.053  1.00 1.03 ? 15  DC  B "H2'"  1 
ATOM 470  H "H2''" . DC  A 1 15 ? -87.820  28.665  -4.792  1.00 1.13 ? 15  DC  B "H2''" 1 
ATOM 471  H "H1'"  . DC  A 1 15 ? -86.753  26.762  -4.198  1.00 0.96 ? 15  DC  B "H1'"  1 
ATOM 472  H H41    . DC  A 1 15 ? -81.112  28.027  -1.456  1.00 0.67 ? 15  DC  B H41    1 
ATOM 473  H H42    . DC  A 1 15 ? -80.599  29.001  -2.814  1.00 0.69 ? 15  DC  B H42    1 
ATOM 474  H H5     . DC  A 1 15 ? -81.965  29.368  -4.776  1.00 0.72 ? 15  DC  B H5     1 
ATOM 475  H H6     . DC  A 1 15 ? -84.127  28.868  -5.838  1.00 0.82 ? 15  DC  B H6     1 
ATOM 476  P P      . DG  A 1 16 ? -89.447  29.674  -6.707  1.00 1.37 ? 16  DG  B P      1 
ATOM 477  O OP1    . DG  A 1 16 ? -90.705  29.509  -7.467  1.00 1.51 ? 16  DG  B OP1    1 
ATOM 478  O OP2    . DG  A 1 16 ? -88.666  30.925  -6.835  1.00 1.39 ? 16  DG  B OP2    1 
ATOM 479  O "O5'"  . DG  A 1 16 ? -89.765  29.436  -5.147  1.00 1.36 ? 16  DG  B "O5'"  1 
ATOM 480  C "C5'"  . DG  A 1 16 ? -90.714  28.444  -4.748  1.00 1.38 ? 16  DG  B "C5'"  1 
ATOM 481  C "C4'"  . DG  A 1 16 ? -90.945  28.456  -3.234  1.00 1.38 ? 16  DG  B "C4'"  1 
ATOM 482  O "O4'"  . DG  A 1 16 ? -89.685  28.293  -2.542  1.00 1.26 ? 16  DG  B "O4'"  1 
ATOM 483  C "C3'"  . DG  A 1 16 ? -91.582  29.770  -2.758  1.00 1.52 ? 16  DG  B "C3'"  1 
ATOM 484  O "O3'"  . DG  A 1 16 ? -92.746  29.504  -1.967  1.00 1.62 ? 16  DG  B "O3'"  1 
ATOM 485  C "C2'"  . DG  A 1 16 ? -90.518  30.449  -1.922  1.00 1.48 ? 16  DG  B "C2'"  1 
ATOM 486  C "C1'"  . DG  A 1 16 ? -89.443  29.407  -1.659  1.00 1.31 ? 16  DG  B "C1'"  1 
ATOM 487  N N9     . DG  A 1 16 ? -88.098  29.975  -1.875  1.00 1.25 ? 16  DG  B N9     1 
ATOM 488  C C8     . DG  A 1 16 ? -87.587  30.596  -2.982  1.00 1.25 ? 16  DG  B C8     1 
ATOM 489  N N7     . DG  A 1 16 ? -86.349  30.985  -2.879  1.00 1.21 ? 16  DG  B N7     1 
ATOM 490  C C5     . DG  A 1 16 ? -86.001  30.591  -1.589  1.00 1.16 ? 16  DG  B C5     1 
ATOM 491  C C6     . DG  A 1 16 ? -84.766  30.735  -0.875  1.00 1.13 ? 16  DG  B C6     1 
ATOM 492  O O6     . DG  A 1 16 ? -83.721  31.253  -1.265  1.00 1.13 ? 16  DG  B O6     1 
ATOM 493  N N1     . DG  A 1 16 ? -84.837  30.195  0.421   1.00 1.12 ? 16  DG  B N1     1 
ATOM 494  C C2     . DG  A 1 16 ? -85.957  29.588  0.971   1.00 1.14 ? 16  DG  B C2     1 
ATOM 495  N N2     . DG  A 1 16 ? -85.840  29.142  2.222   1.00 1.16 ? 16  DG  B N2     1 
ATOM 496  N N3     . DG  A 1 16 ? -87.118  29.451  0.301   1.00 1.18 ? 16  DG  B N3     1 
ATOM 497  C C4     . DG  A 1 16 ? -87.069  29.971  -0.965  1.00 1.19 ? 16  DG  B C4     1 
ATOM 498  H "H5'"  . DG  A 1 16 ? -90.345  27.462  -5.043  1.00 1.36 ? 16  DG  B "H5'"  1 
ATOM 499  H "H5''" . DG  A 1 16 ? -91.660  28.635  -5.253  1.00 1.48 ? 16  DG  B "H5''" 1 
ATOM 500  H "H4'"  . DG  A 1 16 ? -91.603  27.628  -2.971  1.00 1.40 ? 16  DG  B "H4'"  1 
ATOM 501  H "H3'"  . DG  A 1 16 ? -91.855  30.403  -3.606  1.00 1.59 ? 16  DG  B "H3'"  1 
ATOM 502  H "H2'"  . DG  A 1 16 ? -90.088  31.292  -2.466  1.00 1.51 ? 16  DG  B "H2'"  1 
ATOM 503  H "H2''" . DG  A 1 16 ? -90.942  30.795  -0.983  1.00 1.58 ? 16  DG  B "H2''" 1 
ATOM 504  H "H1'"  . DG  A 1 16 ? -89.520  29.059  -0.626  1.00 1.31 ? 16  DG  B "H1'"  1 
ATOM 505  H H8     . DG  A 1 16 ? -88.177  30.763  -3.882  1.00 1.31 ? 16  DG  B H8     1 
ATOM 506  H H1     . DG  A 1 16 ? -84.001  30.264  0.977   1.00 1.11 ? 16  DG  B H1     1 
ATOM 507  H H21    . DG  A 1 16 ? -84.966  29.249  2.716   1.00 1.15 ? 16  DG  B H21    1 
ATOM 508  H H22    . DG  A 1 16 ? -86.625  28.700  2.676   1.00 1.20 ? 16  DG  B H22    1 
ATOM 509  P P      . DA  A 1 17 ? -93.562  30.705  -1.269  1.00 1.80 ? 17  DA  B P      1 
ATOM 510  O OP1    . DA  A 1 17 ? -94.949  30.248  -1.028  1.00 1.91 ? 17  DA  B OP1    1 
ATOM 511  O OP2    . DA  A 1 17 ? -93.314  31.944  -2.040  1.00 1.88 ? 17  DA  B OP2    1 
ATOM 512  O "O5'"  . DA  A 1 17 ? -92.819  30.840  0.155   1.00 1.77 ? 17  DA  B "O5'"  1 
ATOM 513  C "C5'"  . DA  A 1 17 ? -92.508  29.673  0.922   1.00 1.69 ? 17  DA  B "C5'"  1 
ATOM 514  C "C4'"  . DA  A 1 17 ? -91.991  30.032  2.321   1.00 1.73 ? 17  DA  B "C4'"  1 
ATOM 515  O "O4'"  . DA  A 1 17 ? -90.554  30.213  2.283   1.00 1.62 ? 17  DA  B "O4'"  1 
ATOM 516  C "C3'"  . DA  A 1 17 ? -92.619  31.328  2.855   1.00 1.92 ? 17  DA  B "C3'"  1 
ATOM 517  O "O3'"  . DA  A 1 17 ? -93.210  31.105  4.137   1.00 2.04 ? 17  DA  B "O3'"  1 
ATOM 518  C "C2'"  . DA  A 1 17 ? -91.475  32.311  2.983   1.00 1.92 ? 17  DA  B "C2'"  1 
ATOM 519  C "C1'"  . DA  A 1 17 ? -90.191  31.508  2.806   1.00 1.73 ? 17  DA  B "C1'"  1 
ATOM 520  N N9     . DA  A 1 17 ? -89.244  32.203  1.908   1.00 1.67 ? 17  DA  B N9     1 
ATOM 521  C C8     . DA  A 1 17 ? -89.454  32.743  0.667   1.00 1.69 ? 17  DA  B C8     1 
ATOM 522  N N7     . DA  A 1 17 ? -88.414  33.305  0.123   1.00 1.65 ? 17  DA  B N7     1 
ATOM 523  C C5     . DA  A 1 17 ? -87.423  33.126  1.084   1.00 1.60 ? 17  DA  B C5     1 
ATOM 524  C C6     . DA  A 1 17 ? -86.059  33.492  1.149   1.00 1.57 ? 17  DA  B C6     1 
ATOM 525  N N6     . DA  A 1 17 ? -85.439  34.143  0.164   1.00 1.57 ? 17  DA  B N6     1 
ATOM 526  N N1     . DA  A 1 17 ? -85.358  33.157  2.269   1.00 1.55 ? 17  DA  B N1     1 
ATOM 527  C C2     . DA  A 1 17 ? -85.958  32.494  3.272   1.00 1.57 ? 17  DA  B C2     1 
ATOM 528  N N3     . DA  A 1 17 ? -87.240  32.103  3.308   1.00 1.61 ? 17  DA  B N3     1 
ATOM 529  C C4     . DA  A 1 17 ? -87.919  32.455  2.176   1.00 1.62 ? 17  DA  B C4     1 
ATOM 530  H "H5'"  . DA  A 1 17 ? -91.746  29.094  0.400   1.00 1.57 ? 17  DA  B "H5'"  1 
ATOM 531  H "H5''" . DA  A 1 17 ? -93.409  29.065  1.019   1.00 1.72 ? 17  DA  B "H5''" 1 
ATOM 532  H "H4'"  . DA  A 1 17 ? -92.224  29.217  3.008   1.00 1.73 ? 17  DA  B "H4'"  1 
ATOM 533  H "H3'"  . DA  A 1 17 ? -93.374  31.713  2.165   1.00 1.99 ? 17  DA  B "H3'"  1 
ATOM 534  H "HO3'" . DA  A 1 17 ? -93.956  30.515  4.008   1.00 2.17 ? 17  DA  B "HO3'" 1 
ATOM 535  H "H2'"  . DA  A 1 17 ? -91.547  33.077  2.210   1.00 1.96 ? 17  DA  B "H2'"  1 
ATOM 536  H "H2''" . DA  A 1 17 ? -91.498  32.779  3.969   1.00 2.03 ? 17  DA  B "H2''" 1 
ATOM 537  H "H1'"  . DA  A 1 17 ? -89.716  31.369  3.780   1.00 1.74 ? 17  DA  B "H1'"  1 
ATOM 538  H H8     . DA  A 1 17 ? -90.425  32.715  0.176   1.00 1.74 ? 17  DA  B H8     1 
ATOM 539  H H61    . DA  A 1 17 ? -84.463  34.384  0.253   1.00 1.56 ? 17  DA  B H61    1 
ATOM 540  H H62    . DA  A 1 17 ? -85.945  34.394  -0.672  1.00 1.60 ? 17  DA  B H62    1 
ATOM 541  H H2     . DA  A 1 17 ? -85.344  32.249  4.139   1.00 1.57 ? 17  DA  B H2     1 
ATOM 542  O "O5'"  . DT  B 2 1  ? -77.149  35.523  2.915   1.00 1.76 ? 18  DT  C "O5'"  1 
ATOM 543  C "C5'"  . DT  B 2 1  ? -76.863  35.736  4.300   1.00 1.88 ? 18  DT  C "C5'"  1 
ATOM 544  C "C4'"  . DT  B 2 1  ? -77.725  34.842  5.193   1.00 1.81 ? 18  DT  C "C4'"  1 
ATOM 545  O "O4'"  . DT  B 2 1  ? -79.119  35.187  5.026   1.00 1.81 ? 18  DT  C "O4'"  1 
ATOM 546  C "C3'"  . DT  B 2 1  ? -77.557  33.357  4.846   1.00 1.63 ? 18  DT  C "C3'"  1 
ATOM 547  O "O3'"  . DT  B 2 1  ? -77.258  32.586  6.011   1.00 1.64 ? 18  DT  C "O3'"  1 
ATOM 548  C "C2'"  . DT  B 2 1  ? -78.885  32.927  4.273   1.00 1.52 ? 18  DT  C "C2'"  1 
ATOM 549  C "C1'"  . DT  B 2 1  ? -79.868  34.060  4.525   1.00 1.65 ? 18  DT  C "C1'"  1 
ATOM 550  N N1     . DT  B 2 1  ? -80.581  34.412  3.269   1.00 1.61 ? 18  DT  C N1     1 
ATOM 551  C C2     . DT  B 2 1  ? -81.903  33.992  3.128   1.00 1.57 ? 18  DT  C C2     1 
ATOM 552  O O2     . DT  B 2 1  ? -82.486  33.351  4.001   1.00 1.57 ? 18  DT  C O2     1 
ATOM 553  N N3     . DT  B 2 1  ? -82.522  34.343  1.937   1.00 1.56 ? 18  DT  C N3     1 
ATOM 554  C C4     . DT  B 2 1  ? -81.946  35.060  0.891   1.00 1.60 ? 18  DT  C C4     1 
ATOM 555  O O4     . DT  B 2 1  ? -82.595  35.312  -0.122  1.00 1.61 ? 18  DT  C O4     1 
ATOM 556  C C5     . DT  B 2 1  ? -80.568  35.457  1.123   1.00 1.64 ? 18  DT  C C5     1 
ATOM 557  C C7     . DT  B 2 1  ? -79.819  36.251  0.056   1.00 1.70 ? 18  DT  C C7     1 
ATOM 558  C C6     . DT  B 2 1  ? -79.940  35.129  2.278   1.00 1.64 ? 18  DT  C C6     1 
ATOM 559  H "H5'"  . DT  B 2 1  ? -77.058  36.779  4.548   1.00 1.99 ? 18  DT  C "H5'"  1 
ATOM 560  H "H5''" . DT  B 2 1  ? -75.812  35.515  4.485   1.00 1.95 ? 18  DT  C "H5''" 1 
ATOM 561  H "H4'"  . DT  B 2 1  ? -77.441  34.998  6.234   1.00 1.91 ? 18  DT  C "H4'"  1 
ATOM 562  H "H3'"  . DT  B 2 1  ? -76.763  33.215  4.106   1.00 1.59 ? 18  DT  C "H3'"  1 
ATOM 563  H "H2'"  . DT  B 2 1  ? -78.793  32.754  3.201   1.00 1.44 ? 18  DT  C "H2'"  1 
ATOM 564  H "H2''" . DT  B 2 1  ? -79.220  32.018  4.768   1.00 1.46 ? 18  DT  C "H2''" 1 
ATOM 565  H "H1'"  . DT  B 2 1  ? -80.588  33.754  5.292   1.00 1.67 ? 18  DT  C "H1'"  1 
ATOM 566  H H3     . DT  B 2 1  ? -83.482  34.055  1.820   1.00 1.55 ? 18  DT  C H3     1 
ATOM 567  H H71    . DT  B 2 1  ? -79.745  37.294  0.365   1.00 2.01 ? 18  DT  C H71    1 
ATOM 568  H H72    . DT  B 2 1  ? -80.358  36.191  -0.891  1.00 1.94 ? 18  DT  C H72    1 
ATOM 569  H H73    . DT  B 2 1  ? -78.818  35.838  -0.070  1.00 2.05 ? 18  DT  C H73    1 
ATOM 570  H H6     . DT  B 2 1  ? -78.905  35.437  2.428   1.00 1.69 ? 18  DT  C H6     1 
ATOM 571  H "HO5'" . DT  B 2 1  ? -76.318  35.586  2.439   1.00 1.81 ? 18  DT  C "HO5'" 1 
ATOM 572  P P      . DC  B 2 2  ? -76.979  31.003  5.886   1.00 1.48 ? 19  DC  C P      1 
ATOM 573  O OP1    . DC  B 2 2  ? -76.105  30.598  7.009   1.00 1.56 ? 19  DC  C OP1    1 
ATOM 574  O OP2    . DC  B 2 2  ? -76.572  30.713  4.493   1.00 1.38 ? 19  DC  C OP2    1 
ATOM 575  O "O5'"  . DC  B 2 2  ? -78.438  30.363  6.127   1.00 1.40 ? 19  DC  C "O5'"  1 
ATOM 576  C "C5'"  . DC  B 2 2  ? -79.018  30.365  7.433   1.00 1.48 ? 19  DC  C "C5'"  1 
ATOM 577  C "C4'"  . DC  B 2 2  ? -80.107  29.297  7.583   1.00 1.40 ? 19  DC  C "C4'"  1 
ATOM 578  O "O4'"  . DC  B 2 2  ? -81.260  29.666  6.795   1.00 1.39 ? 19  DC  C "O4'"  1 
ATOM 579  C "C3'"  . DC  B 2 2  ? -79.634  27.913  7.119   1.00 1.27 ? 19  DC  C "C3'"  1 
ATOM 580  O "O3'"  . DC  B 2 2  ? -79.843  26.939  8.143   1.00 1.31 ? 19  DC  C "O3'"  1 
ATOM 581  C "C2'"  . DC  B 2 2  ? -80.486  27.568  5.918   1.00 1.14 ? 19  DC  C "C2'"  1 
ATOM 582  C "C1'"  . DC  B 2 2  ? -81.537  28.670  5.788   1.00 1.22 ? 19  DC  C "C1'"  1 
ATOM 583  N N1     . DC  B 2 2  ? -81.516  29.285  4.429   1.00 1.15 ? 19  DC  C N1     1 
ATOM 584  C C2     . DC  B 2 2  ? -82.718  29.339  3.714   1.00 1.12 ? 19  DC  C C2     1 
ATOM 585  O O2     . DC  B 2 2  ? -83.748  28.876  4.199   1.00 1.15 ? 19  DC  C O2     1 
ATOM 586  N N3     . DC  B 2 2  ? -82.700  29.916  2.475   1.00 1.10 ? 19  DC  C N3     1 
ATOM 587  C C4     . DC  B 2 2  ? -81.563  30.420  1.952   1.00 1.10 ? 19  DC  C C4     1 
ATOM 588  N N4     . DC  B 2 2  ? -81.598  30.992  0.748   1.00 1.10 ? 19  DC  C N4     1 
ATOM 589  C C5     . DC  B 2 2  ? -80.326  30.367  2.675   1.00 1.13 ? 19  DC  C C5     1 
ATOM 590  C C6     . DC  B 2 2  ? -80.348  29.795  3.903   1.00 1.16 ? 19  DC  C C6     1 
ATOM 591  H "H5'"  . DC  B 2 2  ? -79.455  31.345  7.626   1.00 1.58 ? 19  DC  C "H5'"  1 
ATOM 592  H "H5''" . DC  B 2 2  ? -78.235  30.176  8.168   1.00 1.57 ? 19  DC  C "H5''" 1 
ATOM 593  H "H4'"  . DC  B 2 2  ? -80.400  29.236  8.630   1.00 1.49 ? 19  DC  C "H4'"  1 
ATOM 594  H "H3'"  . DC  B 2 2  ? -78.577  27.932  6.840   1.00 1.26 ? 19  DC  C "H3'"  1 
ATOM 595  H "H2'"  . DC  B 2 2  ? -79.874  27.518  5.019   1.00 1.07 ? 19  DC  C "H2'"  1 
ATOM 596  H "H2''" . DC  B 2 2  ? -80.970  26.604  6.084   1.00 1.11 ? 19  DC  C "H2''" 1 
ATOM 597  H "H1'"  . DC  B 2 2  ? -82.526  28.245  5.989   1.00 1.22 ? 19  DC  C "H1'"  1 
ATOM 598  H H41    . DC  B 2 2  ? -82.465  31.031  0.233   1.00 1.10 ? 19  DC  C H41    1 
ATOM 599  H H42    . DC  B 2 2  ? -80.758  31.384  0.351   1.00 1.13 ? 19  DC  C H42    1 
ATOM 600  H H5     . DC  B 2 2  ? -79.404  30.758  2.248   1.00 1.16 ? 19  DC  C H5     1 
ATOM 601  H H6     . DC  B 2 2  ? -79.428  29.735  4.483   1.00 1.21 ? 19  DC  C H6     1 
ATOM 602  P P      . DG  B 2 3  ? -79.312  25.432  7.949   1.00 1.22 ? 20  DG  C P      1 
ATOM 603  O OP1    . DG  B 2 3  ? -79.208  24.804  9.285   1.00 1.36 ? 20  DG  C OP1    1 
ATOM 604  O OP2    . DG  B 2 3  ? -78.133  25.467  7.055   1.00 1.18 ? 20  DG  C OP2    1 
ATOM 605  O "O5'"  . DG  B 2 3  ? -80.524  24.730  7.155   1.00 1.09 ? 20  DG  C "O5'"  1 
ATOM 606  C "C5'"  . DG  B 2 3  ? -81.628  24.174  7.872   1.00 1.11 ? 20  DG  C "C5'"  1 
ATOM 607  C "C4'"  . DG  B 2 3  ? -82.632  23.494  6.936   1.00 0.98 ? 20  DG  C "C4'"  1 
ATOM 608  O "O4'"  . DG  B 2 3  ? -82.954  24.378  5.837   1.00 0.93 ? 20  DG  C "O4'"  1 
ATOM 609  C "C3'"  . DG  B 2 3  ? -82.082  22.186  6.349   1.00 0.90 ? 20  DG  C "C3'"  1 
ATOM 610  O "O3'"  . DG  B 2 3  ? -83.000  21.110  6.568   1.00 0.90 ? 20  DG  C "O3'"  1 
ATOM 611  C "C2'"  . DG  B 2 3  ? -81.927  22.444  4.865   1.00 0.79 ? 20  DG  C "C2'"  1 
ATOM 612  C "C1'"  . DG  B 2 3  ? -82.632  23.759  4.574   1.00 0.80 ? 20  DG  C "C1'"  1 
ATOM 613  N N9     . DG  B 2 3  ? -81.777  24.637  3.752   1.00 0.77 ? 20  DG  C N9     1 
ATOM 614  C C8     . DG  B 2 3  ? -80.503  25.071  3.993   1.00 0.82 ? 20  DG  C C8     1 
ATOM 615  N N7     . DG  B 2 3  ? -79.998  25.848  3.079   1.00 0.80 ? 20  DG  C N7     1 
ATOM 616  C C5     . DG  B 2 3  ? -81.025  25.943  2.142   1.00 0.72 ? 20  DG  C C5     1 
ATOM 617  C C6     . DG  B 2 3  ? -81.088  26.658  0.900   1.00 0.69 ? 20  DG  C C6     1 
ATOM 618  O O6     . DG  B 2 3  ? -80.222  27.362  0.385   1.00 0.72 ? 20  DG  C O6     1 
ATOM 619  N N1     . DG  B 2 3  ? -82.322  26.483  0.251   1.00 0.67 ? 20  DG  C N1     1 
ATOM 620  C C2     . DG  B 2 3  ? -83.375  25.716  0.733   1.00 0.68 ? 20  DG  C C2     1 
ATOM 621  N N2     . DG  B 2 3  ? -84.473  25.666  -0.021  1.00 0.72 ? 20  DG  C N2     1 
ATOM 622  N N3     . DG  B 2 3  ? -83.317  25.044  1.900   1.00 0.70 ? 20  DG  C N3     1 
ATOM 623  C C4     . DG  B 2 3  ? -82.122  25.201  2.548   1.00 0.71 ? 20  DG  C C4     1 
ATOM 624  H "H5'"  . DG  B 2 3  ? -82.135  24.972  8.416   1.00 1.22 ? 20  DG  C "H5'"  1 
ATOM 625  H "H5''" . DG  B 2 3  ? -81.255  23.440  8.586   1.00 1.17 ? 20  DG  C "H5''" 1 
ATOM 626  H "H4'"  . DG  B 2 3  ? -83.543  23.276  7.493   1.00 1.03 ? 20  DG  C "H4'"  1 
ATOM 627  H "H3'"  . DG  B 2 3  ? -81.114  21.934  6.791   1.00 0.95 ? 20  DG  C "H3'"  1 
ATOM 628  H "H2'"  . DG  B 2 3  ? -80.870  22.524  4.603   1.00 0.78 ? 20  DG  C "H2'"  1 
ATOM 629  H "H2''" . DG  B 2 3  ? -82.386  21.639  4.295   1.00 0.75 ? 20  DG  C "H2''" 1 
ATOM 630  H "H1'"  . DG  B 2 3  ? -83.561  23.562  4.034   1.00 0.77 ? 20  DG  C "H1'"  1 
ATOM 631  H H8     . DG  B 2 3  ? -79.948  24.780  4.885   1.00 0.89 ? 20  DG  C H8     1 
ATOM 632  H H1     . DG  B 2 3  ? -82.431  26.960  -0.632  1.00 0.67 ? 20  DG  C H1     1 
ATOM 633  H H21    . DG  B 2 3  ? -84.509  26.172  -0.895  1.00 0.73 ? 20  DG  C H21    1 
ATOM 634  H H22    . DG  B 2 3  ? -85.269  25.124  0.282   1.00 0.76 ? 20  DG  C H22    1 
ATOM 635  P P      . DA  B 2 4  ? -82.683  19.634  6.005   1.00 0.88 ? 21  DA  C P      1 
ATOM 636  O OP1    . DA  B 2 4  ? -83.249  18.645  6.948   1.00 0.97 ? 21  DA  C OP1    1 
ATOM 637  O OP2    . DA  B 2 4  ? -81.249  19.575  5.643   1.00 0.88 ? 21  DA  C OP2    1 
ATOM 638  O "O5'"  . DA  B 2 4  ? -83.548  19.592  4.647   1.00 0.80 ? 21  DA  C "O5'"  1 
ATOM 639  C "C5'"  . DA  B 2 4  ? -84.963  19.791  4.692   1.00 0.85 ? 21  DA  C "C5'"  1 
ATOM 640  C "C4'"  . DA  B 2 4  ? -85.562  19.994  3.296   1.00 0.76 ? 21  DA  C "C4'"  1 
ATOM 641  O "O4'"  . DA  B 2 4  ? -84.886  21.086  2.625   1.00 0.71 ? 21  DA  C "O4'"  1 
ATOM 642  C "C3'"  . DA  B 2 4  ? -85.424  18.741  2.419   1.00 0.74 ? 21  DA  C "C3'"  1 
ATOM 643  O "O3'"  . DA  B 2 4  ? -86.695  18.352  1.887   1.00 0.74 ? 21  DA  C "O3'"  1 
ATOM 644  C "C2'"  . DA  B 2 4  ? -84.502  19.142  1.290   1.00 0.68 ? 21  DA  C "C2'"  1 
ATOM 645  C "C1'"  . DA  B 2 4  ? -84.382  20.655  1.344   1.00 0.65 ? 21  DA  C "C1'"  1 
ATOM 646  N N9     . DA  B 2 4  ? -82.981  21.074  1.142   1.00 0.60 ? 21  DA  C N9     1 
ATOM 647  C C8     . DA  B 2 4  ? -81.861  20.725  1.847   1.00 0.62 ? 21  DA  C C8     1 
ATOM 648  N N7     . DA  B 2 4  ? -80.752  21.260  1.423   1.00 0.58 ? 21  DA  C N7     1 
ATOM 649  C C5     . DA  B 2 4  ? -81.169  22.030  0.339   1.00 0.53 ? 21  DA  C C5     1 
ATOM 650  C C6     . DA  B 2 4  ? -80.489  22.868  -0.576  1.00 0.50 ? 21  DA  C C6     1 
ATOM 651  N N6     . DA  B 2 4  ? -79.172  23.070  -0.530  1.00 0.50 ? 21  DA  C N6     1 
ATOM 652  N N1     . DA  B 2 4  ? -81.220  23.489  -1.544  1.00 0.50 ? 21  DA  C N1     1 
ATOM 653  C C2     . DA  B 2 4  ? -82.549  23.301  -1.615  1.00 0.53 ? 21  DA  C C2     1 
ATOM 654  N N3     . DA  B 2 4  ? -83.285  22.532  -0.799  1.00 0.55 ? 21  DA  C N3     1 
ATOM 655  C C4     . DA  B 2 4  ? -82.527  21.923  0.160   1.00 0.55 ? 21  DA  C C4     1 
ATOM 656  H "H5'"  . DA  B 2 4  ? -85.178  20.670  5.300   1.00 0.93 ? 21  DA  C "H5'"  1 
ATOM 657  H "H5''" . DA  B 2 4  ? -85.428  18.919  5.152   1.00 0.93 ? 21  DA  C "H5''" 1 
ATOM 658  H "H4'"  . DA  B 2 4  ? -86.619  20.241  3.397   1.00 0.79 ? 21  DA  C "H4'"  1 
ATOM 659  H "H3'"  . DA  B 2 4  ? -84.992  17.909  2.984   1.00 0.79 ? 21  DA  C "H3'"  1 
ATOM 660  H "H2'"  . DA  B 2 4  ? -83.518  18.688  1.422   1.00 0.70 ? 21  DA  C "H2'"  1 
ATOM 661  H "H2''" . DA  B 2 4  ? -84.927  18.835  0.338   1.00 0.68 ? 21  DA  C "H2''" 1 
ATOM 662  H "H1'"  . DA  B 2 4  ? -85.000  21.096  0.558   1.00 0.64 ? 21  DA  C "H1'"  1 
ATOM 663  H H8     . DA  B 2 4  ? -81.894  20.041  2.694   1.00 0.67 ? 21  DA  C H8     1 
ATOM 664  H H61    . DA  B 2 4  ? -78.730  23.676  -1.205  1.00 0.48 ? 21  DA  C H61    1 
ATOM 665  H H62    . DA  B 2 4  ? -78.616  22.616  0.181   1.00 0.53 ? 21  DA  C H62    1 
ATOM 666  H H2     . DA  B 2 4  ? -83.080  23.824  -2.411  1.00 0.56 ? 21  DA  C H2     1 
ATOM 667  P P      . DA  B 2 5  ? -86.822  17.065  0.924   1.00 0.76 ? 22  DA  C P      1 
ATOM 668  O OP1    . DA  B 2 5  ? -88.226  16.599  0.955   1.00 0.85 ? 22  DA  C OP1    1 
ATOM 669  O OP2    . DA  B 2 5  ? -85.725  16.128  1.256   1.00 0.80 ? 22  DA  C OP2    1 
ATOM 670  O "O5'"  . DA  B 2 5  ? -86.528  17.689  -0.533  1.00 0.67 ? 22  DA  C "O5'"  1 
ATOM 671  C "C5'"  . DA  B 2 5  ? -87.325  18.768  -1.027  1.00 0.68 ? 22  DA  C "C5'"  1 
ATOM 672  C "C4'"  . DA  B 2 5  ? -87.086  19.026  -2.520  1.00 0.65 ? 22  DA  C "C4'"  1 
ATOM 673  O "O4'"  . DA  B 2 5  ? -85.923  19.870  -2.692  1.00 0.62 ? 22  DA  C "O4'"  1 
ATOM 674  C "C3'"  . DA  B 2 5  ? -86.851  17.729  -3.305  1.00 0.66 ? 22  DA  C "C3'"  1 
ATOM 675  O "O3'"  . DA  B 2 5  ? -87.742  17.653  -4.418  1.00 0.71 ? 22  DA  C "O3'"  1 
ATOM 676  C "C2'"  . DA  B 2 5  ? -85.426  17.808  -3.805  1.00 0.63 ? 22  DA  C "C2'"  1 
ATOM 677  C "C1'"  . DA  B 2 5  ? -84.952  19.232  -3.548  1.00 0.59 ? 22  DA  C "C1'"  1 
ATOM 678  N N9     . DA  B 2 5  ? -83.607  19.255  -2.932  1.00 0.56 ? 22  DA  C N9     1 
ATOM 679  C C8     . DA  B 2 5  ? -83.124  18.555  -1.859  1.00 0.58 ? 22  DA  C C8     1 
ATOM 680  N N7     . DA  B 2 5  ? -81.889  18.811  -1.538  1.00 0.57 ? 22  DA  C N7     1 
ATOM 681  C C5     . DA  B 2 5  ? -81.513  19.764  -2.482  1.00 0.55 ? 22  DA  C C5     1 
ATOM 682  C C6     . DA  B 2 5  ? -80.311  20.472  -2.719  1.00 0.54 ? 22  DA  C C6     1 
ATOM 683  N N6     . DA  B 2 5  ? -79.221  20.316  -1.969  1.00 0.56 ? 22  DA  C N6     1 
ATOM 684  N N1     . DA  B 2 5  ? -80.281  21.353  -3.757  1.00 0.54 ? 22  DA  C N1     1 
ATOM 685  C C2     . DA  B 2 5  ? -81.369  21.535  -4.525  1.00 0.55 ? 22  DA  C C2     1 
ATOM 686  N N3     . DA  B 2 5  ? -82.551  20.918  -4.384  1.00 0.55 ? 22  DA  C N3     1 
ATOM 687  C C4     . DA  B 2 5  ? -82.553  20.040  -3.337  1.00 0.55 ? 22  DA  C C4     1 
ATOM 688  H "H5'"  . DA  B 2 5  ? -87.084  19.672  -0.468  1.00 0.82 ? 22  DA  C "H5'"  1 
ATOM 689  H "H5''" . DA  B 2 5  ? -88.378  18.528  -0.873  1.00 0.75 ? 22  DA  C "H5''" 1 
ATOM 690  H "H4'"  . DA  B 2 5  ? -87.956  19.536  -2.935  1.00 0.67 ? 22  DA  C "H4'"  1 
ATOM 691  H "H3'"  . DA  B 2 5  ? -86.983  16.851  -2.666  1.00 0.69 ? 22  DA  C "H3'"  1 
ATOM 692  H "H2'"  . DA  B 2 5  ? -84.795  17.098  -3.269  1.00 0.63 ? 22  DA  C "H2'"  1 
ATOM 693  H "H2''" . DA  B 2 5  ? -85.403  17.591  -4.873  1.00 0.67 ? 22  DA  C "H2''" 1 
ATOM 694  H "H1'"  . DA  B 2 5  ? -84.913  19.775  -4.494  1.00 0.60 ? 22  DA  C "H1'"  1 
ATOM 695  H H8     . DA  B 2 5  ? -83.724  17.824  -1.321  1.00 0.61 ? 22  DA  C H8     1 
ATOM 696  H H61    . DA  B 2 5  ? -78.385  20.844  -2.177  1.00 0.57 ? 22  DA  C H61    1 
ATOM 697  H H62    . DA  B 2 5  ? -79.230  19.673  -1.191  1.00 0.58 ? 22  DA  C H62    1 
ATOM 698  H H2     . DA  B 2 5  ? -81.281  22.251  -5.342  1.00 0.57 ? 22  DA  C H2     1 
ATOM 699  P P      . DC  B 2 6  ? -87.943  16.268  -5.212  1.00 0.75 ? 23  DC  C P      1 
ATOM 700  O OP1    . DC  B 2 6  ? -89.309  16.261  -5.781  1.00 0.80 ? 23  DC  C OP1    1 
ATOM 701  O OP2    . DC  B 2 6  ? -87.502  15.160  -4.335  1.00 0.79 ? 23  DC  C OP2    1 
ATOM 702  O "O5'"  . DC  B 2 6  ? -86.890  16.399  -6.425  1.00 0.73 ? 23  DC  C "O5'"  1 
ATOM 703  C "C5'"  . DC  B 2 6  ? -87.253  17.086  -7.624  1.00 0.76 ? 23  DC  C "C5'"  1 
ATOM 704  C "C4'"  . DC  B 2 6  ? -86.088  17.166  -8.612  1.00 0.72 ? 23  DC  C "C4'"  1 
ATOM 705  O "O4'"  . DC  B 2 6  ? -84.907  17.650  -7.924  1.00 0.74 ? 23  DC  C "O4'"  1 
ATOM 706  C "C3'"  . DC  B 2 6  ? -85.753  15.796  -9.230  1.00 0.67 ? 23  DC  C "C3'"  1 
ATOM 707  O "O3'"  . DC  B 2 6  ? -85.766  15.873  -10.665 1.00 0.67 ? 23  DC  C "O3'"  1 
ATOM 708  C "C2'"  . DC  B 2 6  ? -84.358  15.471  -8.730  1.00 0.65 ? 23  DC  C "C2'"  1 
ATOM 709  C "C1'"  . DC  B 2 6  ? -83.793  16.768  -8.160  1.00 0.67 ? 23  DC  C "C1'"  1 
ATOM 710  N N1     . DC  B 2 6  ? -83.004  16.524  -6.921  1.00 0.66 ? 23  DC  C N1     1 
ATOM 711  C C2     . DC  B 2 6  ? -81.658  16.912  -6.926  1.00 0.64 ? 23  DC  C C2     1 
ATOM 712  O O2     . DC  B 2 6  ? -81.168  17.433  -7.926  1.00 0.65 ? 23  DC  C O2     1 
ATOM 713  N N3     . DC  B 2 6  ? -80.924  16.691  -5.797  1.00 0.64 ? 23  DC  C N3     1 
ATOM 714  C C4     . DC  B 2 6  ? -81.471  16.117  -4.708  1.00 0.66 ? 23  DC  C C4     1 
ATOM 715  N N4     . DC  B 2 6  ? -80.713  15.922  -3.632  1.00 0.67 ? 23  DC  C N4     1 
ATOM 716  C C5     . DC  B 2 6  ? -82.851  15.715  -4.691  1.00 0.68 ? 23  DC  C C5     1 
ATOM 717  C C6     . DC  B 2 6  ? -83.575  15.936  -5.815  1.00 0.68 ? 23  DC  C C6     1 
ATOM 718  H "H5'"  . DC  B 2 6  ? -87.571  18.097  -7.370  1.00 0.85 ? 23  DC  C "H5'"  1 
ATOM 719  H "H5''" . DC  B 2 6  ? -88.083  16.563  -8.097  1.00 0.79 ? 23  DC  C "H5''" 1 
ATOM 720  H "H4'"  . DC  B 2 6  ? -86.346  17.862  -9.410  1.00 0.73 ? 23  DC  C "H4'"  1 
ATOM 721  H "H3'"  . DC  B 2 6  ? -86.461  15.032  -8.898  1.00 0.68 ? 23  DC  C "H3'"  1 
ATOM 722  H "H2'"  . DC  B 2 6  ? -84.406  14.707  -7.955  1.00 0.67 ? 23  DC  C "H2'"  1 
ATOM 723  H "H2''" . DC  B 2 6  ? -83.735  15.120  -9.543  1.00 0.65 ? 23  DC  C "H2''" 1 
ATOM 724  H "H1'"  . DC  B 2 6  ? -83.150  17.236  -8.906  1.00 0.67 ? 23  DC  C "H1'"  1 
ATOM 725  H H41    . DC  B 2 6  ? -79.743  16.204  -3.641  1.00 0.67 ? 23  DC  C H41    1 
ATOM 726  H H42    . DC  B 2 6  ? -81.107  15.494  -2.807  1.00 0.70 ? 23  DC  C H42    1 
ATOM 727  H H5     . DC  B 2 6  ? -83.297  15.251  -3.812  1.00 0.71 ? 23  DC  C H5     1 
ATOM 728  H H6     . DC  B 2 6  ? -84.624  15.641  -5.843  1.00 0.71 ? 23  DC  C H6     1 
ATOM 729  P P      . DT  B 2 7  ? -85.294  14.622  -11.571 1.00 0.66 ? 24  DT  C P      1 
ATOM 730  O OP1    . DT  B 2 7  ? -86.079  14.620  -12.830 1.00 0.72 ? 24  DT  C OP1    1 
ATOM 731  O OP2    . DT  B 2 7  ? -85.268  13.415  -10.715 1.00 0.65 ? 24  DT  C OP2    1 
ATOM 732  O "O5'"  . DT  B 2 7  ? -83.773  15.024  -11.919 1.00 0.62 ? 24  DT  C "O5'"  1 
ATOM 733  C "C5'"  . DT  B 2 7  ? -83.401  16.403  -12.015 1.00 0.67 ? 24  DT  C "C5'"  1 
ATOM 734  C "C4'"  . DT  B 2 7  ? -81.944  16.579  -12.474 1.00 0.70 ? 24  DT  C "C4'"  1 
ATOM 735  O "O4'"  . DT  B 2 7  ? -81.091  16.749  -11.322 1.00 0.69 ? 24  DT  C "O4'"  1 
ATOM 736  C "C3'"  . DT  B 2 7  ? -81.438  15.367  -13.262 1.00 0.71 ? 24  DT  C "C3'"  1 
ATOM 737  O "O3'"  . DT  B 2 7  ? -80.983  15.735  -14.553 1.00 0.85 ? 24  DT  C "O3'"  1 
ATOM 738  C "C2'"  . DT  B 2 7  ? -80.258  14.827  -12.494 1.00 0.67 ? 24  DT  C "C2'"  1 
ATOM 739  C "C1'"  . DT  B 2 7  ? -80.047  15.755  -11.302 1.00 0.66 ? 24  DT  C "C1'"  1 
ATOM 740  N N1     . DT  B 2 7  ? -80.077  15.002  -10.020 1.00 0.60 ? 24  DT  C N1     1 
ATOM 741  C C2     . DT  B 2 7  ? -79.017  15.184  -9.137  1.00 0.60 ? 24  DT  C C2     1 
ATOM 742  O O2     . DT  B 2 7  ? -78.071  15.928  -9.391  1.00 0.63 ? 24  DT  C O2     1 
ATOM 743  N N3     . DT  B 2 7  ? -79.095  14.473  -7.954  1.00 0.57 ? 24  DT  C N3     1 
ATOM 744  C C4     . DT  B 2 7  ? -80.117  13.608  -7.575  1.00 0.56 ? 24  DT  C C4     1 
ATOM 745  O O4     . DT  B 2 7  ? -80.073  13.027  -6.493  1.00 0.58 ? 24  DT  C O4     1 
ATOM 746  C C5     . DT  B 2 7  ? -81.180  13.475  -8.553  1.00 0.56 ? 24  DT  C C5     1 
ATOM 747  C C7     . DT  B 2 7  ? -82.356  12.549  -8.264  1.00 0.58 ? 24  DT  C C7     1 
ATOM 748  C C6     . DT  B 2 7  ? -81.131  14.160  -9.718  1.00 0.58 ? 24  DT  C C6     1 
ATOM 749  H "H5'"  . DT  B 2 7  ? -83.521  16.870  -11.050 1.00 0.72 ? 24  DT  C "H5'"  1 
ATOM 750  H "H5''" . DT  B 2 7  ? -84.068  16.899  -12.717 1.00 0.74 ? 24  DT  C "H5''" 1 
ATOM 751  H "H4'"  . DT  B 2 7  ? -81.864  17.465  -13.094 1.00 0.77 ? 24  DT  C "H4'"  1 
ATOM 752  H "H3'"  . DT  B 2 7  ? -82.217  14.601  -13.352 1.00 0.70 ? 24  DT  C "H3'"  1 
ATOM 753  H "H2'"  . DT  B 2 7  ? -80.449  13.810  -12.167 1.00 0.63 ? 24  DT  C "H2'"  1 
ATOM 754  H "H2''" . DT  B 2 7  ? -79.375  14.835  -13.137 1.00 0.72 ? 24  DT  C "H2''" 1 
ATOM 755  H "H1'"  . DT  B 2 7  ? -79.083  16.265  -11.413 1.00 0.70 ? 24  DT  C "H1'"  1 
ATOM 756  H H3     . DT  B 2 7  ? -78.342  14.596  -7.304  1.00 0.58 ? 24  DT  C H3     1 
ATOM 757  H H71    . DT  B 2 7  ? -83.232  12.875  -8.827  1.00 1.24 ? 24  DT  C H71    1 
ATOM 758  H H72    . DT  B 2 7  ? -82.580  12.575  -7.200  1.00 1.11 ? 24  DT  C H72    1 
ATOM 759  H H73    . DT  B 2 7  ? -82.095  11.532  -8.555  1.00 1.11 ? 24  DT  C H73    1 
ATOM 760  H H6     . DT  B 2 7  ? -81.939  14.040  -10.437 1.00 0.59 ? 24  DT  C H6     1 
ATOM 761  P P      . DT  B 2 8  ? -80.548  14.554  -15.534 1.00 0.92 ? 25  DT  C P      1 
ATOM 762  O OP1    . DT  B 2 8  ? -80.609  15.041  -16.930 1.00 1.11 ? 25  DT  C OP1    1 
ATOM 763  O OP2    . DT  B 2 8  ? -81.309  13.362  -15.115 1.00 0.89 ? 25  DT  C OP2    1 
ATOM 764  O "O5'"  . DT  B 2 8  ? -79.012  14.309  -15.136 1.00 0.87 ? 25  DT  C "O5'"  1 
ATOM 765  C "C5'"  . DT  B 2 8  ? -77.990  15.170  -15.625 1.00 1.01 ? 25  DT  C "C5'"  1 
ATOM 766  C "C4'"  . DT  B 2 8  ? -76.634  14.816  -15.020 1.00 0.91 ? 25  DT  C "C4'"  1 
ATOM 767  O "O4'"  . DT  B 2 8  ? -76.778  14.635  -13.588 1.00 0.81 ? 25  DT  C "O4'"  1 
ATOM 768  C "C3'"  . DT  B 2 8  ? -76.065  13.514  -15.606 1.00 0.86 ? 25  DT  C "C3'"  1 
ATOM 769  O "O3'"  . DT  B 2 8  ? -74.748  13.714  -16.120 1.00 0.92 ? 25  DT  C "O3'"  1 
ATOM 770  C "C2'"  . DT  B 2 8  ? -75.998  12.550  -14.449 1.00 0.73 ? 25  DT  C "C2'"  1 
ATOM 771  C "C1'"  . DT  B 2 8  ? -76.212  13.373  -13.184 1.00 0.71 ? 25  DT  C "C1'"  1 
ATOM 772  N N1     . DT  B 2 8  ? -77.088  12.654  -12.208 1.00 0.64 ? 25  DT  C N1     1 
ATOM 773  C C2     . DT  B 2 8  ? -76.565  12.397  -10.938 1.00 0.62 ? 25  DT  C C2     1 
ATOM 774  O O2     . DT  B 2 8  ? -75.435  12.752  -10.611 1.00 0.67 ? 25  DT  C O2     1 
ATOM 775  N N3     . DT  B 2 8  ? -77.401  11.716  -10.067 1.00 0.59 ? 25  DT  C N3     1 
ATOM 776  C C4     . DT  B 2 8  ? -78.692  11.273  -10.340 1.00 0.57 ? 25  DT  C C4     1 
ATOM 777  O O4     . DT  B 2 8  ? -79.340  10.677  -9.482  1.00 0.57 ? 25  DT  C O4     1 
ATOM 778  C C5     . DT  B 2 8  ? -79.162  11.579  -11.679 1.00 0.59 ? 25  DT  C C5     1 
ATOM 779  C C7     . DT  B 2 8  ? -80.567  11.134  -12.099 1.00 0.63 ? 25  DT  C C7     1 
ATOM 780  C C6     . DT  B 2 8  ? -78.364  12.248  -12.555 1.00 0.63 ? 25  DT  C C6     1 
ATOM 781  H "H5'"  . DT  B 2 8  ? -78.237  16.200  -15.369 1.00 1.09 ? 25  DT  C "H5'"  1 
ATOM 782  H "H5''" . DT  B 2 8  ? -77.931  15.074  -16.709 1.00 1.18 ? 25  DT  C "H5''" 1 
ATOM 783  H "H4'"  . DT  B 2 8  ? -75.934  15.630  -15.209 1.00 0.97 ? 25  DT  C "H4'"  1 
ATOM 784  H "H3'"  . DT  B 2 8  ? -76.711  13.116  -16.395 1.00 0.92 ? 25  DT  C "H3'"  1 
ATOM 785  H "H2'"  . DT  B 2 8  ? -76.767  11.783  -14.546 1.00 0.71 ? 25  DT  C "H2'"  1 
ATOM 786  H "H2''" . DT  B 2 8  ? -75.022  12.086  -14.426 1.00 0.73 ? 25  DT  C "H2''" 1 
ATOM 787  H "H1'"  . DT  B 2 8  ? -75.237  13.573  -12.726 1.00 0.72 ? 25  DT  C "H1'"  1 
ATOM 788  H H3     . DT  B 2 8  ? -77.039  11.523  -9.144  1.00 0.60 ? 25  DT  C H3     1 
ATOM 789  H H71    . DT  B 2 8  ? -81.285  11.436  -11.336 1.00 1.15 ? 25  DT  C H71    1 
ATOM 790  H H72    . DT  B 2 8  ? -80.586  10.049  -12.202 1.00 1.15 ? 25  DT  C H72    1 
ATOM 791  H H73    . DT  B 2 8  ? -80.839  11.593  -13.051 1.00 1.21 ? 25  DT  C H73    1 
ATOM 792  H H6     . DT  B 2 8  ? -78.742  12.474  -13.553 1.00 0.68 ? 25  DT  C H6     1 
ATOM 793  P P      . DC  B 2 9  ? -73.994  12.520  -16.895 1.00 0.96 ? 26  DC  C P      1 
ATOM 794  O OP1    . DC  B 2 9  ? -73.214  13.112  -18.004 1.00 1.06 ? 26  DC  C OP1    1 
ATOM 795  O OP2    . DC  B 2 9  ? -74.982  11.453  -17.175 1.00 1.02 ? 26  DC  C OP2    1 
ATOM 796  O "O5'"  . DC  B 2 9  ? -72.960  11.972  -15.788 1.00 0.91 ? 26  DC  C "O5'"  1 
ATOM 797  C "C5'"  . DC  B 2 9  ? -71.660  12.554  -15.677 1.00 1.04 ? 26  DC  C "C5'"  1 
ATOM 798  C "C4'"  . DC  B 2 9  ? -70.744  11.765  -14.739 1.00 1.00 ? 26  DC  C "C4'"  1 
ATOM 799  O "O4'"  . DC  B 2 9  ? -71.386  11.615  -13.452 1.00 0.98 ? 26  DC  C "O4'"  1 
ATOM 800  C "C3'"  . DC  B 2 9  ? -70.424  10.363  -15.279 1.00 1.01 ? 26  DC  C "C3'"  1 
ATOM 801  O "O3'"  . DC  B 2 9  ? -69.012  10.154  -15.352 1.00 1.03 ? 26  DC  C "O3'"  1 
ATOM 802  C "C2'"  . DC  B 2 9  ? -71.006  9.398   -14.275 1.00 0.99 ? 26  DC  C "C2'"  1 
ATOM 803  C "C1'"  . DC  B 2 9  ? -71.442  10.227  -13.071 1.00 0.94 ? 26  DC  C "C1'"  1 
ATOM 804  N N1     . DC  B 2 9  ? -72.812  9.854   -12.618 1.00 0.90 ? 26  DC  C N1     1 
ATOM 805  C C2     . DC  B 2 9  ? -72.974  9.445   -11.290 1.00 0.87 ? 26  DC  C C2     1 
ATOM 806  O O2     . DC  B 2 9  ? -72.005  9.392   -10.536 1.00 0.88 ? 26  DC  C O2     1 
ATOM 807  N N3     . DC  B 2 9  ? -74.230  9.114   -10.871 1.00 0.86 ? 26  DC  C N3     1 
ATOM 808  C C4     . DC  B 2 9  ? -75.286  9.178   -11.705 1.00 0.88 ? 26  DC  C C4     1 
ATOM 809  N N4     . DC  B 2 9  ? -76.490  8.858   -11.242 1.00 0.89 ? 26  DC  C N4     1 
ATOM 810  C C5     . DC  B 2 9  ? -75.134  9.596   -13.071 1.00 0.92 ? 26  DC  C C5     1 
ATOM 811  C C6     . DC  B 2 9  ? -73.884  9.921   -13.481 1.00 0.94 ? 26  DC  C C6     1 
ATOM 812  H "H5'"  . DC  B 2 9  ? -71.761  13.572  -15.299 1.00 1.18 ? 26  DC  C "H5'"  1 
ATOM 813  H "H5''" . DC  B 2 9  ? -71.203  12.587  -16.664 1.00 1.18 ? 26  DC  C "H5''" 1 
ATOM 814  H "H4'"  . DC  B 2 9  ? -69.813  12.316  -14.607 1.00 1.01 ? 26  DC  C "H4'"  1 
ATOM 815  H "H3'"  . DC  B 2 9  ? -70.873  10.206  -16.264 1.00 1.04 ? 26  DC  C "H3'"  1 
ATOM 816  H "H2'"  . DC  B 2 9  ? -71.856  8.865   -14.704 1.00 1.01 ? 26  DC  C "H2'"  1 
ATOM 817  H "H2''" . DC  B 2 9  ? -70.240  8.685   -13.976 1.00 1.02 ? 26  DC  C "H2''" 1 
ATOM 818  H "H1'"  . DC  B 2 9  ? -70.727  10.072  -12.258 1.00 0.93 ? 26  DC  C "H1'"  1 
ATOM 819  H H41    . DC  B 2 9  ? -76.598  8.554   -10.285 1.00 0.88 ? 26  DC  C H41    1 
ATOM 820  H H42    . DC  B 2 9  ? -77.291  8.911   -11.847 1.00 0.93 ? 26  DC  C H42    1 
ATOM 821  H H5     . DC  B 2 9  ? -75.987  9.649   -13.748 1.00 0.97 ? 26  DC  C H5     1 
ATOM 822  H H6     . DC  B 2 9  ? -73.721  10.230  -14.513 1.00 0.99 ? 26  DC  C H6     1 
ATOM 823  P P      . DC  B 2 10 ? -68.425  8.778   -15.950 1.00 1.08 ? 27  DC  C P      1 
ATOM 824  O OP1    . DC  B 2 10 ? -67.004  8.997   -16.300 1.00 1.17 ? 27  DC  C OP1    1 
ATOM 825  O OP2    . DC  B 2 10 ? -69.369  8.278   -16.974 1.00 1.15 ? 27  DC  C OP2    1 
ATOM 826  O "O5'"  . DC  B 2 10 ? -68.484  7.782   -14.684 1.00 1.00 ? 27  DC  C "O5'"  1 
ATOM 827  C "C5'"  . DC  B 2 10 ? -67.662  8.025   -13.540 1.00 0.99 ? 27  DC  C "C5'"  1 
ATOM 828  C "C4'"  . DC  B 2 10 ? -67.413  6.751   -12.722 1.00 0.92 ? 27  DC  C "C4'"  1 
ATOM 829  O "O4'"  . DC  B 2 10 ? -68.505  6.554   -11.795 1.00 0.87 ? 27  DC  C "O4'"  1 
ATOM 830  C "C3'"  . DC  B 2 10 ? -67.301  5.496   -13.602 1.00 0.97 ? 27  DC  C "C3'"  1 
ATOM 831  O "O3'"  . DC  B 2 10 ? -66.074  4.809   -13.342 1.00 1.05 ? 27  DC  C "O3'"  1 
ATOM 832  C "C2'"  . DC  B 2 10 ? -68.469  4.612   -13.209 1.00 0.91 ? 27  DC  C "C2'"  1 
ATOM 833  C "C1'"  . DC  B 2 10 ? -69.125  5.267   -11.993 1.00 0.86 ? 27  DC  C "C1'"  1 
ATOM 834  N N1     . DC  B 2 10 ? -70.598  5.419   -12.175 1.00 0.85 ? 27  DC  C N1     1 
ATOM 835  C C2     . DC  B 2 10 ? -71.432  4.908   -11.175 1.00 0.86 ? 27  DC  C C2     1 
ATOM 836  O O2     . DC  B 2 10 ? -70.951  4.351   -10.191 1.00 0.87 ? 27  DC  C O2     1 
ATOM 837  N N3     . DC  B 2 10 ? -72.780  5.050   -11.333 1.00 0.88 ? 27  DC  C N3     1 
ATOM 838  C C4     . DC  B 2 10 ? -73.296  5.663   -12.415 1.00 0.91 ? 27  DC  C C4     1 
ATOM 839  N N4     . DC  B 2 10 ? -74.611  5.781   -12.521 1.00 0.98 ? 27  DC  C N4     1 
ATOM 840  C C5     . DC  B 2 10 ? -72.453  6.192   -13.448 1.00 0.92 ? 27  DC  C C5     1 
ATOM 841  C C6     . DC  B 2 10 ? -71.118  6.048   -13.288 1.00 0.88 ? 27  DC  C C6     1 
ATOM 842  H "H5'"  . DC  B 2 10 ? -68.150  8.764   -12.905 1.00 1.04 ? 27  DC  C "H5'"  1 
ATOM 843  H "H5''" . DC  B 2 10 ? -66.704  8.425   -13.875 1.00 1.05 ? 27  DC  C "H5''" 1 
ATOM 844  H "H4'"  . DC  B 2 10 ? -66.489  6.867   -12.155 1.00 0.94 ? 27  DC  C "H4'"  1 
ATOM 845  H "H3'"  . DC  B 2 10 ? -67.360  5.754   -14.664 1.00 1.04 ? 27  DC  C "H3'"  1 
ATOM 846  H "H2'"  . DC  B 2 10 ? -69.176  4.531   -14.032 1.00 0.93 ? 27  DC  C "H2'"  1 
ATOM 847  H "H2''" . DC  B 2 10 ? -68.108  3.617   -12.947 1.00 0.93 ? 27  DC  C "H2''" 1 
ATOM 848  H "H1'"  . DC  B 2 10 ? -68.923  4.653   -11.108 1.00 0.87 ? 27  DC  C "H1'"  1 
ATOM 849  H H41    . DC  B 2 10 ? -75.210  5.409   -11.799 1.00 1.00 ? 27  DC  C H41    1 
ATOM 850  H H42    . DC  B 2 10 ? -75.014  6.240   -13.326 1.00 1.03 ? 27  DC  C H42    1 
ATOM 851  H H5     . DC  B 2 10 ? -72.871  6.687   -14.324 1.00 0.97 ? 27  DC  C H5     1 
ATOM 852  H H6     . DC  B 2 10 ? -70.446  6.430   -14.053 1.00 0.90 ? 27  DC  C H6     1 
ATOM 853  P P      . DG  B 2 11 ? -65.728  3.437   -14.110 1.00 1.16 ? 28  DG  C P      1 
ATOM 854  O OP1    . DG  B 2 11 ? -64.289  3.150   -13.920 1.00 1.34 ? 28  DG  C OP1    1 
ATOM 855  O OP2    . DG  B 2 11 ? -66.293  3.514   -15.475 1.00 1.20 ? 28  DG  C OP2    1 
ATOM 856  O "O5'"  . DG  B 2 11 ? -66.575  2.349   -13.275 1.00 1.08 ? 28  DG  C "O5'"  1 
ATOM 857  C "C5'"  . DG  B 2 11 ? -66.191  2.004   -11.941 1.00 1.12 ? 28  DG  C "C5'"  1 
ATOM 858  C "C4'"  . DG  B 2 11 ? -67.217  1.087   -11.267 1.00 1.07 ? 28  DG  C "C4'"  1 
ATOM 859  O "O4'"  . DG  B 2 11 ? -68.544  1.651   -11.398 1.00 1.02 ? 28  DG  C "O4'"  1 
ATOM 860  C "C3'"  . DG  B 2 11 ? -67.235  -0.316  -11.888 1.00 1.05 ? 28  DG  C "C3'"  1 
ATOM 861  O "O3'"  . DG  B 2 11 ? -67.092  -1.318  -10.877 1.00 1.09 ? 28  DG  C "O3'"  1 
ATOM 862  C "C2'"  . DG  B 2 11 ? -68.587  -0.445  -12.553 1.00 0.99 ? 28  DG  C "C2'"  1 
ATOM 863  C "C1'"  . DG  B 2 11 ? -69.427  0.725   -12.064 1.00 0.98 ? 28  DG  C "C1'"  1 
ATOM 864  N N9     . DG  B 2 11 ? -70.126  1.373   -13.190 1.00 0.96 ? 28  DG  C N9     1 
ATOM 865  C C8     . DG  B 2 11 ? -69.607  1.916   -14.333 1.00 0.98 ? 28  DG  C C8     1 
ATOM 866  N N7     . DG  B 2 11 ? -70.480  2.428   -15.152 1.00 0.99 ? 28  DG  C N7     1 
ATOM 867  C C5     . DG  B 2 11 ? -71.692  2.208   -14.501 1.00 0.97 ? 28  DG  C C5     1 
ATOM 868  C C6     . DG  B 2 11 ? -73.032  2.542   -14.892 1.00 0.99 ? 28  DG  C C6     1 
ATOM 869  O O6     . DG  B 2 11 ? -73.402  3.111   -15.916 1.00 1.03 ? 28  DG  C O6     1 
ATOM 870  N N1     . DG  B 2 11 ? -73.980  2.136   -13.937 1.00 0.98 ? 28  DG  C N1     1 
ATOM 871  C C2     . DG  B 2 11 ? -73.682  1.487   -12.745 1.00 0.98 ? 28  DG  C C2     1 
ATOM 872  N N2     . DG  B 2 11 ? -74.713  1.179   -11.958 1.00 1.02 ? 28  DG  C N2     1 
ATOM 873  N N3     . DG  B 2 11 ? -72.424  1.173   -12.376 1.00 0.96 ? 28  DG  C N3     1 
ATOM 874  C C4     . DG  B 2 11 ? -71.485  1.560   -13.295 1.00 0.95 ? 28  DG  C C4     1 
ATOM 875  H "H5'"  . DG  B 2 11 ? -66.090  2.916   -11.354 1.00 1.17 ? 28  DG  C "H5'"  1 
ATOM 876  H "H5''" . DG  B 2 11 ? -65.228  1.494   -11.971 1.00 1.17 ? 28  DG  C "H5''" 1 
ATOM 877  H "H4'"  . DG  B 2 11 ? -66.973  1.002   -10.208 1.00 1.11 ? 28  DG  C "H4'"  1 
ATOM 878  H "H3'"  . DG  B 2 11 ? -66.438  -0.428  -12.629 1.00 1.08 ? 28  DG  C "H3'"  1 
ATOM 879  H "H2'"  . DG  B 2 11 ? -68.484  -0.397  -13.639 1.00 0.99 ? 28  DG  C "H2'"  1 
ATOM 880  H "H2''" . DG  B 2 11 ? -69.050  -1.388  -12.268 1.00 0.99 ? 28  DG  C "H2''" 1 
ATOM 881  H "H1'"  . DG  B 2 11 ? -70.166  0.366   -11.344 1.00 0.99 ? 28  DG  C "H1'"  1 
ATOM 882  H H8     . DG  B 2 11 ? -68.538  1.914   -14.545 1.00 1.01 ? 28  DG  C H8     1 
ATOM 883  H H1     . DG  B 2 11 ? -74.945  2.342   -14.153 1.00 1.01 ? 28  DG  C H1     1 
ATOM 884  H H21    . DG  B 2 11 ? -75.653  1.417   -12.240 1.00 1.04 ? 28  DG  C H21    1 
ATOM 885  H H22    . DG  B 2 11 ? -74.554  0.707   -11.079 1.00 1.04 ? 28  DG  C H22    1 
ATOM 886  P P      . DG  B 2 12 ? -67.065  -2.880  -11.269 1.00 1.12 ? 29  DG  C P      1 
ATOM 887  O OP1    . DG  B 2 12 ? -66.113  -3.568  -10.369 1.00 1.27 ? 29  DG  C OP1    1 
ATOM 888  O OP2    . DG  B 2 12 ? -66.901  -2.986  -12.736 1.00 1.12 ? 29  DG  C OP2    1 
ATOM 889  O "O5'"  . DG  B 2 12 ? -68.555  -3.364  -10.892 1.00 1.01 ? 29  DG  C "O5'"  1 
ATOM 890  C "C5'"  . DG  B 2 12 ? -69.054  -3.202  -9.562  1.00 1.04 ? 29  DG  C "C5'"  1 
ATOM 891  C "C4'"  . DG  B 2 12 ? -70.384  -3.936  -9.358  1.00 0.98 ? 29  DG  C "C4'"  1 
ATOM 892  O "O4'"  . DG  B 2 12 ? -71.447  -3.231  -10.046 1.00 0.91 ? 29  DG  C "O4'"  1 
ATOM 893  C "C3'"  . DG  B 2 12 ? -70.345  -5.375  -9.900  1.00 0.95 ? 29  DG  C "C3'"  1 
ATOM 894  O "O3'"  . DG  B 2 12 ? -70.794  -6.302  -8.899  1.00 0.99 ? 29  DG  C "O3'"  1 
ATOM 895  C "C2'"  . DG  B 2 12 ? -71.291  -5.368  -11.080 1.00 0.86 ? 29  DG  C "C2'"  1 
ATOM 896  C "C1'"  . DG  B 2 12 ? -72.154  -4.135  -10.916 1.00 0.84 ? 29  DG  C "C1'"  1 
ATOM 897  N N9     . DG  B 2 12 ? -72.443  -3.528  -12.226 1.00 0.79 ? 29  DG  C N9     1 
ATOM 898  C C8     . DG  B 2 12 ? -71.582  -3.022  -13.159 1.00 0.81 ? 29  DG  C C8     1 
ATOM 899  N N7     . DG  B 2 12 ? -72.143  -2.562  -14.241 1.00 0.78 ? 29  DG  C N7     1 
ATOM 900  C C5     . DG  B 2 12 ? -73.499  -2.782  -14.009 1.00 0.74 ? 29  DG  C C5     1 
ATOM 901  C C6     . DG  B 2 12 ? -74.641  -2.497  -14.826 1.00 0.73 ? 29  DG  C C6     1 
ATOM 902  O O6     . DG  B 2 12 ? -74.667  -1.976  -15.939 1.00 0.76 ? 29  DG  C O6     1 
ATOM 903  N N1     . DG  B 2 12 ? -75.842  -2.887  -14.208 1.00 0.73 ? 29  DG  C N1     1 
ATOM 904  C C2     . DG  B 2 12 ? -75.940  -3.478  -12.957 1.00 0.74 ? 29  DG  C C2     1 
ATOM 905  N N2     . DG  B 2 12 ? -77.166  -3.779  -12.532 1.00 0.78 ? 29  DG  C N2     1 
ATOM 906  N N3     . DG  B 2 12 ? -74.869  -3.746  -12.190 1.00 0.74 ? 29  DG  C N3     1 
ATOM 907  C C4     . DG  B 2 12 ? -73.689  -3.374  -12.774 1.00 0.74 ? 29  DG  C C4     1 
ATOM 908  H "H5'"  . DG  B 2 12 ? -69.201  -2.140  -9.365  1.00 1.13 ? 29  DG  C "H5'"  1 
ATOM 909  H "H5''" . DG  B 2 12 ? -68.321  -3.595  -8.858  1.00 1.17 ? 29  DG  C "H5''" 1 
ATOM 910  H "H4'"  . DG  B 2 12 ? -70.611  -3.965  -8.292  1.00 1.03 ? 29  DG  C "H4'"  1 
ATOM 911  H "H3'"  . DG  B 2 12 ? -69.337  -5.646  -10.225 1.00 0.99 ? 29  DG  C "H3'"  1 
ATOM 912  H "H2'"  . DG  B 2 12 ? -70.731  -5.303  -12.014 1.00 0.85 ? 29  DG  C "H2'"  1 
ATOM 913  H "H2''" . DG  B 2 12 ? -71.908  -6.260  -11.085 1.00 0.85 ? 29  DG  C "H2''" 1 
ATOM 914  H "H1'"  . DG  B 2 12 ? -73.096  -4.415  -10.437 1.00 0.83 ? 29  DG  C "H1'"  1 
ATOM 915  H H8     . DG  B 2 12 ? -70.506  -3.015  -13.011 1.00 0.87 ? 29  DG  C H8     1 
ATOM 916  H H1     . DG  B 2 12 ? -76.683  -2.724  -14.731 1.00 0.75 ? 29  DG  C H1     1 
ATOM 917  H H21    . DG  B 2 12 ? -77.966  -3.575  -13.114 1.00 0.80 ? 29  DG  C H21    1 
ATOM 918  H H22    . DG  B 2 12 ? -77.296  -4.211  -11.628 1.00 0.81 ? 29  DG  C H22    1 
ATOM 919  P P      . DC  B 2 13 ? -71.008  -7.865  -9.244  1.00 0.99 ? 30  DC  C P      1 
ATOM 920  O OP1    . DC  B 2 13 ? -70.761  -8.652  -8.015  1.00 1.09 ? 30  DC  C OP1    1 
ATOM 921  O OP2    . DC  B 2 13 ? -70.256  -8.172  -10.481 1.00 1.01 ? 30  DC  C OP2    1 
ATOM 922  O "O5'"  . DC  B 2 13 ? -72.586  -7.935  -9.583  1.00 0.89 ? 30  DC  C "O5'"  1 
ATOM 923  C "C5'"  . DC  B 2 13 ? -73.538  -7.285  -8.734  1.00 0.91 ? 30  DC  C "C5'"  1 
ATOM 924  C "C4'"  . DC  B 2 13 ? -74.953  -7.871  -8.891  1.00 0.89 ? 30  DC  C "C4'"  1 
ATOM 925  O "O4'"  . DC  B 2 13 ? -75.708  -7.065  -9.827  1.00 0.86 ? 30  DC  C "O4'"  1 
ATOM 926  C "C3'"  . DC  B 2 13 ? -74.935  -9.315  -9.412  1.00 0.87 ? 30  DC  C "C3'"  1 
ATOM 927  O "O3'"  . DC  B 2 13 ? -75.650  -10.184 -8.534  1.00 0.94 ? 30  DC  C "O3'"  1 
ATOM 928  C "C2'"  . DC  B 2 13 ? -75.636  -9.276  -10.754 1.00 0.81 ? 30  DC  C "C2'"  1 
ATOM 929  C "C1'"  . DC  B 2 13 ? -76.183  -7.863  -10.932 1.00 0.79 ? 30  DC  C "C1'"  1 
ATOM 930  N N1     . DC  B 2 13 ? -75.735  -7.282  -12.231 1.00 0.71 ? 30  DC  C N1     1 
ATOM 931  C C2     . DC  B 2 13 ? -76.713  -6.839  -13.128 1.00 0.70 ? 30  DC  C C2     1 
ATOM 932  O O2     . DC  B 2 13 ? -77.905  -6.934  -12.842 1.00 0.76 ? 30  DC  C O2     1 
ATOM 933  N N3     . DC  B 2 13 ? -76.296  -6.304  -14.316 1.00 0.65 ? 30  DC  C N3     1 
ATOM 934  C C4     . DC  B 2 13 ? -74.985  -6.204  -14.619 1.00 0.63 ? 30  DC  C C4     1 
ATOM 935  N N4     . DC  B 2 13 ? -74.625  -5.680  -15.790 1.00 0.63 ? 30  DC  C N4     1 
ATOM 936  C C5     . DC  B 2 13 ? -73.974  -6.656  -13.704 1.00 0.66 ? 30  DC  C C5     1 
ATOM 937  C C6     . DC  B 2 13 ? -74.394  -7.186  -12.531 1.00 0.69 ? 30  DC  C C6     1 
ATOM 938  H "H5'"  . DC  B 2 13 ? -73.566  -6.224  -8.982  1.00 0.93 ? 30  DC  C "H5'"  1 
ATOM 939  H "H5''" . DC  B 2 13 ? -73.216  -7.397  -7.697  1.00 0.98 ? 30  DC  C "H5''" 1 
ATOM 940  H "H4'"  . DC  B 2 13 ? -75.459  -7.852  -7.925  1.00 0.96 ? 30  DC  C "H4'"  1 
ATOM 941  H "H3'"  . DC  B 2 13 ? -73.908  -9.677  -9.531  1.00 0.87 ? 30  DC  C "H3'"  1 
ATOM 942  H "H2'"  . DC  B 2 13 ? -74.938  -9.510  -11.551 1.00 0.78 ? 30  DC  C "H2'"  1 
ATOM 943  H "H2''" . DC  B 2 13 ? -76.453  -10.000 -10.763 1.00 0.85 ? 30  DC  C "H2''" 1 
ATOM 944  H "H1'"  . DC  B 2 13 ? -77.277  -7.892  -10.893 1.00 0.83 ? 30  DC  C "H1'"  1 
ATOM 945  H H41    . DC  B 2 13 ? -75.331  -5.362  -16.438 1.00 0.65 ? 30  DC  C H41    1 
ATOM 946  H H42    . DC  B 2 13 ? -73.647  -5.602  -16.030 1.00 0.65 ? 30  DC  C H42    1 
ATOM 947  H H5     . DC  B 2 13 ? -72.914  -6.577  -13.945 1.00 0.68 ? 30  DC  C H5     1 
ATOM 948  H H6     . DC  B 2 13 ? -73.661  -7.553  -11.815 1.00 0.74 ? 30  DC  C H6     1 
ATOM 949  P P      . DT  B 2 14 ? -75.750  -11.757 -8.861  1.00 0.96 ? 31  DT  C P      1 
ATOM 950  O OP1    . DT  B 2 14 ? -76.198  -12.457 -7.637  1.00 1.07 ? 31  DT  C OP1    1 
ATOM 951  O OP2    . DT  B 2 14 ? -74.499  -12.172 -9.534  1.00 0.95 ? 31  DT  C OP2    1 
ATOM 952  O "O5'"  . DT  B 2 14 ? -76.944  -11.816 -9.941  1.00 0.93 ? 31  DT  C "O5'"  1 
ATOM 953  C "C5'"  . DT  B 2 14 ? -78.304  -11.772 -9.507  1.00 0.99 ? 31  DT  C "C5'"  1 
ATOM 954  C "C4'"  . DT  B 2 14 ? -79.283  -11.693 -10.681 1.00 0.96 ? 31  DT  C "C4'"  1 
ATOM 955  O "O4'"  . DT  B 2 14 ? -78.818  -10.708 -11.637 1.00 0.86 ? 31  DT  C "O4'"  1 
ATOM 956  C "C3'"  . DT  B 2 14 ? -79.423  -13.036 -11.419 1.00 0.99 ? 31  DT  C "C3'"  1 
ATOM 957  O "O3'"  . DT  B 2 14 ? -80.797  -13.428 -11.497 1.00 1.07 ? 31  DT  C "O3'"  1 
ATOM 958  C "C2'"  . DT  B 2 14 ? -78.896  -12.782 -12.813 1.00 0.93 ? 31  DT  C "C2'"  1 
ATOM 959  C "C1'"  . DT  B 2 14 ? -78.813  -11.268 -12.964 1.00 0.84 ? 31  DT  C "C1'"  1 
ATOM 960  N N1     . DT  B 2 14 ? -77.601  -10.848 -13.735 1.00 0.75 ? 31  DT  C N1     1 
ATOM 961  C C2     . DT  B 2 14 ? -77.806  -10.090 -14.890 1.00 0.71 ? 31  DT  C C2     1 
ATOM 962  O O2     . DT  B 2 14 ? -78.930  -9.766  -15.270 1.00 0.74 ? 31  DT  C O2     1 
ATOM 963  N N3     . DT  B 2 14 ? -76.664  -9.723  -15.584 1.00 0.66 ? 31  DT  C N3     1 
ATOM 964  C C4     . DT  B 2 14 ? -75.353  -10.039 -15.238 1.00 0.66 ? 31  DT  C C4     1 
ATOM 965  O O4     . DT  B 2 14 ? -74.417  -9.656  -15.935 1.00 0.66 ? 31  DT  C O4     1 
ATOM 966  C C5     . DT  B 2 14 ? -75.224  -10.828 -14.026 1.00 0.71 ? 31  DT  C C5     1 
ATOM 967  C C7     . DT  B 2 14 ? -73.832  -11.252 -13.555 1.00 0.76 ? 31  DT  C C7     1 
ATOM 968  C C6     . DT  B 2 14 ? -76.326  -11.202 -13.323 1.00 0.75 ? 31  DT  C C6     1 
ATOM 969  H "H5'"  . DT  B 2 14 ? -78.443  -10.895 -8.873  1.00 1.04 ? 31  DT  C "H5'"  1 
ATOM 970  H "H5''" . DT  B 2 14 ? -78.520  -12.667 -8.923  1.00 1.05 ? 31  DT  C "H5''" 1 
ATOM 971  H "H4'"  . DT  B 2 14 ? -80.261  -11.390 -10.308 1.00 1.00 ? 31  DT  C "H4'"  1 
ATOM 972  H "H3'"  . DT  B 2 14 ? -78.842  -13.822 -10.928 1.00 1.03 ? 31  DT  C "H3'"  1 
ATOM 973  H "H2'"  . DT  B 2 14 ? -77.914  -13.236 -12.936 1.00 0.92 ? 31  DT  C "H2'"  1 
ATOM 974  H "H2''" . DT  B 2 14 ? -79.582  -13.195 -13.546 1.00 0.99 ? 31  DT  C "H2''" 1 
ATOM 975  H "H1'"  . DT  B 2 14 ? -79.716  -10.919 -13.479 1.00 0.86 ? 31  DT  C "H1'"  1 
ATOM 976  H H3     . DT  B 2 14 ? -76.796  -9.174  -16.421 1.00 0.65 ? 31  DT  C H3     1 
ATOM 977  H H71    . DT  B 2 14 ? -73.906  -12.163 -12.959 1.00 1.30 ? 31  DT  C H71    1 
ATOM 978  H H72    . DT  B 2 14 ? -73.391  -10.458 -12.953 1.00 1.19 ? 31  DT  C H72    1 
ATOM 979  H H73    . DT  B 2 14 ? -73.199  -11.438 -14.422 1.00 1.28 ? 31  DT  C H73    1 
ATOM 980  H H6     . DT  B 2 14 ? -76.201  -11.789 -12.413 1.00 0.81 ? 31  DT  C H6     1 
ATOM 981  P P      . DC  B 2 15 ? -81.211  -14.822 -12.193 1.00 1.15 ? 32  DC  C P      1 
ATOM 982  O OP1    . DC  B 2 15 ? -82.249  -15.465 -11.357 1.00 1.30 ? 32  DC  C OP1    1 
ATOM 983  O OP2    . DC  B 2 15 ? -79.972  -15.559 -12.527 1.00 1.17 ? 32  DC  C OP2    1 
ATOM 984  O "O5'"  . DC  B 2 15 ? -81.898  -14.340 -13.568 1.00 1.07 ? 32  DC  C "O5'"  1 
ATOM 985  C "C5'"  . DC  B 2 15 ? -83.003  -13.435 -13.543 1.00 1.09 ? 32  DC  C "C5'"  1 
ATOM 986  C "C4'"  . DC  B 2 15 ? -83.685  -13.320 -14.911 1.00 1.01 ? 32  DC  C "C4'"  1 
ATOM 987  O "O4'"  . DC  B 2 15 ? -82.882  -12.500 -15.788 1.00 0.91 ? 32  DC  C "O4'"  1 
ATOM 988  C "C3'"  . DC  B 2 15 ? -83.877  -14.687 -15.582 1.00 1.08 ? 32  DC  C "C3'"  1 
ATOM 989  O "O3'"  . DC  B 2 15 ? -85.242  -14.870 -15.966 1.00 1.16 ? 32  DC  C "O3'"  1 
ATOM 990  C "C2'"  . DC  B 2 15 ? -83.001  -14.666 -16.816 1.00 1.02 ? 32  DC  C "C2'"  1 
ATOM 991  C "C1'"  . DC  B 2 15 ? -82.432  -13.254 -16.933 1.00 0.90 ? 32  DC  C "C1'"  1 
ATOM 992  N N1     . DC  B 2 15 ? -80.943  -13.273 -16.986 1.00 0.86 ? 32  DC  C N1     1 
ATOM 993  C C2     . DC  B 2 15 ? -80.313  -12.634 -18.060 1.00 0.80 ? 32  DC  C C2     1 
ATOM 994  O O2     . DC  B 2 15 ? -80.982  -12.090 -18.935 1.00 0.79 ? 32  DC  C O2     1 
ATOM 995  N N3     . DC  B 2 15 ? -78.946  -12.640 -18.094 1.00 0.78 ? 32  DC  C N3     1 
ATOM 996  C C4     . DC  B 2 15 ? -78.221  -13.241 -17.127 1.00 0.82 ? 32  DC  C C4     1 
ATOM 997  N N4     . DC  B 2 15 ? -76.891  -13.220 -17.203 1.00 0.83 ? 32  DC  C N4     1 
ATOM 998  C C5     . DC  B 2 15 ? -78.860  -13.901 -16.023 1.00 0.89 ? 32  DC  C C5     1 
ATOM 999  C C6     . DC  B 2 15 ? -80.215  -13.891 -15.995 1.00 0.90 ? 32  DC  C C6     1 
ATOM 1000 H "H5'"  . DC  B 2 15 ? -82.649  -12.450 -13.241 1.00 1.14 ? 32  DC  C "H5'"  1 
ATOM 1001 H "H5''" . DC  B 2 15 ? -83.732  -13.788 -12.814 1.00 1.21 ? 32  DC  C "H5''" 1 
ATOM 1002 H "H4'"  . DC  B 2 15 ? -84.659  -12.850 -14.782 1.00 1.04 ? 32  DC  C "H4'"  1 
ATOM 1003 H "H3'"  . DC  B 2 15 ? -83.573  -15.498 -14.916 1.00 1.16 ? 32  DC  C "H3'"  1 
ATOM 1004 H "H2'"  . DC  B 2 15 ? -82.193  -15.394 -16.722 1.00 1.03 ? 32  DC  C "H2'"  1 
ATOM 1005 H "H2''" . DC  B 2 15 ? -83.604  -14.902 -17.694 1.00 1.07 ? 32  DC  C "H2''" 1 
ATOM 1006 H "H1'"  . DC  B 2 15 ? -82.832  -12.781 -17.836 1.00 0.88 ? 32  DC  C "H1'"  1 
ATOM 1007 H H41    . DC  B 2 15 ? -76.438  -12.758 -17.978 1.00 0.81 ? 32  DC  C H41    1 
ATOM 1008 H H42    . DC  B 2 15 ? -76.337  -13.667 -16.487 1.00 0.89 ? 32  DC  C H42    1 
ATOM 1009 H H5     . DC  B 2 15 ? -78.279  -14.388 -15.239 1.00 0.95 ? 32  DC  C H5     1 
ATOM 1010 H H6     . DC  B 2 15 ? -80.738  -14.386 -15.176 1.00 0.97 ? 32  DC  C H6     1 
ATOM 1011 P P      . DG  B 2 16 ? -85.709  -16.231 -16.687 1.00 1.28 ? 33  DG  C P      1 
ATOM 1012 O OP1    . DG  B 2 16 ? -87.141  -16.447 -16.382 1.00 1.44 ? 33  DG  C OP1    1 
ATOM 1013 O OP2    . DG  B 2 16 ? -84.719  -17.286 -16.373 1.00 1.29 ? 33  DG  C OP2    1 
ATOM 1014 O "O5'"  . DG  B 2 16 ? -85.575  -15.864 -18.249 1.00 1.23 ? 33  DG  C "O5'"  1 
ATOM 1015 C "C5'"  . DG  B 2 16 ? -86.257  -14.728 -18.786 1.00 1.22 ? 33  DG  C "C5'"  1 
ATOM 1016 C "C4'"  . DG  B 2 16 ? -85.912  -14.507 -20.261 1.00 1.20 ? 33  DG  C "C4'"  1 
ATOM 1017 O "O4'"  . DG  B 2 16 ? -84.501  -14.218 -20.397 1.00 1.15 ? 33  DG  C "O4'"  1 
ATOM 1018 C "C3'"  . DG  B 2 16 ? -86.229  -15.740 -21.119 1.00 1.23 ? 33  DG  C "C3'"  1 
ATOM 1019 O "O3'"  . DG  B 2 16 ? -87.033  -15.375 -22.246 1.00 1.27 ? 33  DG  C "O3'"  1 
ATOM 1020 C "C2'"  . DG  B 2 16 ? -84.887  -16.266 -21.579 1.00 1.21 ? 33  DG  C "C2'"  1 
ATOM 1021 C "C1'"  . DG  B 2 16 ? -83.862  -15.192 -21.249 1.00 1.14 ? 33  DG  C "C1'"  1 
ATOM 1022 N N9     . DG  B 2 16 ? -82.679  -15.778 -20.589 1.00 1.10 ? 33  DG  C N9     1 
ATOM 1023 C C8     . DG  B 2 16 ? -82.612  -16.575 -19.478 1.00 1.13 ? 33  DG  C C8     1 
ATOM 1024 N N7     . DG  B 2 16 ? -81.413  -16.938 -19.126 1.00 1.12 ? 33  DG  C N7     1 
ATOM 1025 C C5     . DG  B 2 16 ? -80.605  -16.333 -20.086 1.00 1.07 ? 33  DG  C C5     1 
ATOM 1026 C C6     . DG  B 2 16 ? -79.180  -16.353 -20.247 1.00 1.06 ? 33  DG  C C6     1 
ATOM 1027 O O6     . DG  B 2 16 ? -78.347  -16.928 -19.549 1.00 1.08 ? 33  DG  C O6     1 
ATOM 1028 N N1     . DG  B 2 16 ? -78.762  -15.602 -21.358 1.00 1.03 ? 33  DG  C N1     1 
ATOM 1029 C C2     . DG  B 2 16 ? -79.609  -14.911 -22.218 1.00 1.03 ? 33  DG  C C2     1 
ATOM 1030 N N2     . DG  B 2 16 ? -79.033  -14.250 -23.222 1.00 1.03 ? 33  DG  C N2     1 
ATOM 1031 N N3     . DG  B 2 16 ? -80.948  -14.892 -22.067 1.00 1.05 ? 33  DG  C N3     1 
ATOM 1032 C C4     . DG  B 2 16 ? -81.374  -15.618 -20.988 1.00 1.06 ? 33  DG  C C4     1 
ATOM 1033 H "H5'"  . DG  B 2 16 ? -85.974  -13.842 -18.218 1.00 1.24 ? 33  DG  C "H5'"  1 
ATOM 1034 H "H5''" . DG  B 2 16 ? -87.332  -14.883 -18.692 1.00 1.27 ? 33  DG  C "H5''" 1 
ATOM 1035 H "H4'"  . DG  B 2 16 ? -86.485  -13.659 -20.635 1.00 1.21 ? 33  DG  C "H4'"  1 
ATOM 1036 H "H3'"  . DG  B 2 16 ? -86.751  -16.502 -20.532 1.00 1.26 ? 33  DG  C "H3'"  1 
ATOM 1037 H "H2'"  . DG  B 2 16 ? -84.640  -17.189 -21.050 1.00 1.22 ? 33  DG  C "H2'"  1 
ATOM 1038 H "H2''" . DG  B 2 16 ? -84.907  -16.452 -22.651 1.00 1.24 ? 33  DG  C "H2''" 1 
ATOM 1039 H "H1'"  . DG  B 2 16 ? -83.546  -14.697 -22.170 1.00 1.14 ? 33  DG  C "H1'"  1 
ATOM 1040 H H8     . DG  B 2 16 ? -83.500  -16.886 -18.929 1.00 1.18 ? 33  DG  C H8     1 
ATOM 1041 H H1     . DG  B 2 16 ? -77.769  -15.575 -21.529 1.00 1.03 ? 33  DG  C H1     1 
ATOM 1042 H H21    . DG  B 2 16 ? -78.029  -14.269 -23.329 1.00 1.03 ? 33  DG  C H21    1 
ATOM 1043 H H22    . DG  B 2 16 ? -79.601  -13.732 -23.877 1.00 1.05 ? 33  DG  C H22    1 
ATOM 1044 P P      . DA  B 2 17 ? -87.476  -16.480 -23.331 1.00 1.34 ? 34  DA  C P      1 
ATOM 1045 O OP1    . DA  B 2 17 ? -88.562  -15.909 -24.159 1.00 1.41 ? 34  DA  C OP1    1 
ATOM 1046 O OP2    . DA  B 2 17 ? -87.683  -17.766 -22.626 1.00 1.37 ? 34  DA  C OP2    1 
ATOM 1047 O "O5'"  . DA  B 2 17 ? -86.158  -16.614 -24.248 1.00 1.32 ? 34  DA  C "O5'"  1 
ATOM 1048 C "C5'"  . DA  B 2 17 ? -85.684  -15.495 -25.002 1.00 1.31 ? 34  DA  C "C5'"  1 
ATOM 1049 C "C4'"  . DA  B 2 17 ? -84.881  -15.937 -26.233 1.00 1.35 ? 34  DA  C "C4'"  1 
ATOM 1050 O "O4'"  . DA  B 2 17 ? -83.478  -16.024 -25.891 1.00 1.30 ? 34  DA  C "O4'"  1 
ATOM 1051 C "C3'"  . DA  B 2 17 ? -85.330  -17.310 -26.755 1.00 1.41 ? 34  DA  C "C3'"  1 
ATOM 1052 O "O3'"  . DA  B 2 17 ? -85.645  -17.242 -28.148 1.00 1.49 ? 34  DA  C "O3'"  1 
ATOM 1053 C "C2'"  . DA  B 2 17 ? -84.149  -18.235 -26.547 1.00 1.41 ? 34  DA  C "C2'"  1 
ATOM 1054 C "C1'"  . DA  B 2 17 ? -82.975  -17.358 -26.114 1.00 1.34 ? 34  DA  C "C1'"  1 
ATOM 1055 N N9     . DA  B 2 17 ? -82.322  -17.887 -24.894 1.00 1.29 ? 34  DA  C N9     1 
ATOM 1056 C C8     . DA  B 2 17 ? -82.884  -18.340 -23.728 1.00 1.28 ? 34  DA  C C8     1 
ATOM 1057 N N7     . DA  B 2 17 ? -82.038  -18.752 -22.829 1.00 1.25 ? 34  DA  C N7     1 
ATOM 1058 C C5     . DA  B 2 17 ? -80.806  -18.559 -23.447 1.00 1.24 ? 34  DA  C C5     1 
ATOM 1059 C C6     . DA  B 2 17 ? -79.472  -18.793 -23.039 1.00 1.24 ? 34  DA  C C6     1 
ATOM 1060 N N6     . DA  B 2 17 ? -79.159  -19.291 -21.843 1.00 1.24 ? 34  DA  C N6     1 
ATOM 1061 N N1     . DA  B 2 17 ? -78.471  -18.485 -23.912 1.00 1.25 ? 34  DA  C N1     1 
ATOM 1062 C C2     . DA  B 2 17 ? -78.759  -17.970 -25.120 1.00 1.28 ? 34  DA  C C2     1 
ATOM 1063 N N3     . DA  B 2 17 ? -79.985  -17.710 -25.599 1.00 1.28 ? 34  DA  C N3     1 
ATOM 1064 C C4     . DA  B 2 17 ? -80.967  -18.031 -24.706 1.00 1.26 ? 34  DA  C C4     1 
ATOM 1065 H "H5'"  . DA  B 2 17 ? -85.048  -14.879 -24.366 1.00 1.27 ? 34  DA  C "H5'"  1 
ATOM 1066 H "H5''" . DA  B 2 17 ? -86.541  -14.902 -25.326 1.00 1.35 ? 34  DA  C "H5''" 1 
ATOM 1067 H "H4'"  . DA  B 2 17 ? -85.004  -15.198 -27.026 1.00 1.37 ? 34  DA  C "H4'"  1 
ATOM 1068 H "H3'"  . DA  B 2 17 ? -86.200  -17.676 -26.201 1.00 1.42 ? 34  DA  C "H3'"  1 
ATOM 1069 H "HO3'" . DA  B 2 17 ? -85.429  -16.356 -28.447 1.00 1.72 ? 34  DA  C "HO3'" 1 
ATOM 1070 H "H2'"  . DA  B 2 17 ? -84.375  -18.972 -25.776 1.00 1.42 ? 34  DA  C "H2'"  1 
ATOM 1071 H "H2''" . DA  B 2 17 ? -83.914  -18.746 -27.483 1.00 1.48 ? 34  DA  C "H2''" 1 
ATOM 1072 H "H1'"  . DA  B 2 17 ? -82.236  -17.321 -26.917 1.00 1.36 ? 34  DA  C "H1'"  1 
ATOM 1073 H H8     . DA  B 2 17 ? -83.960  -18.358 -23.566 1.00 1.30 ? 34  DA  C H8     1 
ATOM 1074 H H61    . DA  B 2 17 ? -78.191  -19.441 -21.595 1.00 1.25 ? 34  DA  C H61    1 
ATOM 1075 H H62    . DA  B 2 17 ? -79.890  -19.518 -21.184 1.00 1.24 ? 34  DA  C H62    1 
ATOM 1076 H H2     . DA  B 2 17 ? -77.915  -17.742 -25.772 1.00 1.31 ? 34  DA  C H2     1 
ATOM 1077 N N      . VAL C 3 1  ? -101.930 15.241  -29.984 1.00 3.18 ? 10  VAL A N      1 
ATOM 1078 C CA     . VAL C 3 1  ? -101.710 14.073  -29.087 1.00 2.73 ? 10  VAL A CA     1 
ATOM 1079 C C      . VAL C 3 1  ? -100.633 14.446  -28.051 1.00 2.63 ? 10  VAL A C      1 
ATOM 1080 O O      . VAL C 3 1  ? -100.055 13.618  -27.379 1.00 2.81 ? 10  VAL A O      1 
ATOM 1081 C CB     . VAL C 3 1  ? -101.332 12.852  -29.950 1.00 2.87 ? 10  VAL A CB     1 
ATOM 1082 C CG1    . VAL C 3 1  ? -100.519 13.302  -31.160 1.00 2.95 ? 10  VAL A CG1    1 
ATOM 1083 C CG2    . VAL C 3 1  ? -100.524 11.826  -29.155 1.00 3.06 ? 10  VAL A CG2    1 
ATOM 1084 H H      . VAL C 3 1  ? -101.189 15.850  -30.184 1.00 3.43 ? 10  VAL A H      1 
ATOM 1085 H HA     . VAL C 3 1  ? -102.632 13.865  -28.561 1.00 2.87 ? 10  VAL A HA     1 
ATOM 1086 H HB     . VAL C 3 1  ? -102.242 12.383  -30.302 1.00 3.46 ? 10  VAL A HB     1 
ATOM 1087 H HG11   . VAL C 3 1  ? -99.679  13.894  -30.831 1.00 3.11 ? 10  VAL A HG11   1 
ATOM 1088 H HG12   . VAL C 3 1  ? -100.161 12.434  -31.694 1.00 3.00 ? 10  VAL A HG12   1 
ATOM 1089 H HG13   . VAL C 3 1  ? -101.145 13.892  -31.813 1.00 3.53 ? 10  VAL A HG13   1 
ATOM 1090 H HG21   . VAL C 3 1  ? -100.973 11.680  -28.183 1.00 3.27 ? 10  VAL A HG21   1 
ATOM 1091 H HG22   . VAL C 3 1  ? -100.526 10.898  -29.689 1.00 3.32 ? 10  VAL A HG22   1 
ATOM 1092 H HG23   . VAL C 3 1  ? -99.506  12.168  -29.043 1.00 3.36 ? 10  VAL A HG23   1 
ATOM 1093 N N      . ILE C 3 2  ? -100.433 15.725  -27.863 1.00 2.55 ? 11  ILE A N      1 
ATOM 1094 C CA     . ILE C 3 2  ? -99.478  16.216  -26.835 1.00 2.56 ? 11  ILE A CA     1 
ATOM 1095 C C      . ILE C 3 2  ? -100.203 17.314  -26.041 1.00 2.47 ? 11  ILE A C      1 
ATOM 1096 O O      . ILE C 3 2  ? -99.703  18.405  -25.882 1.00 2.54 ? 11  ILE A O      1 
ATOM 1097 C CB     . ILE C 3 2  ? -98.222  16.770  -27.537 1.00 2.88 ? 11  ILE A CB     1 
ATOM 1098 C CG1    . ILE C 3 2  ? -97.232  17.411  -26.534 1.00 3.28 ? 11  ILE A CG1    1 
ATOM 1099 C CG2    . ILE C 3 2  ? -98.632  17.813  -28.589 1.00 3.10 ? 11  ILE A CG2    1 
ATOM 1100 C CD1    . ILE C 3 2  ? -97.152  16.606  -25.230 1.00 3.16 ? 11  ILE A CD1    1 
ATOM 1101 H H      . ILE C 3 2  ? -100.958 16.374  -28.369 1.00 2.63 ? 11  ILE A H      1 
ATOM 1102 H HA     . ILE C 3 2  ? -99.206  15.407  -26.171 1.00 2.67 ? 11  ILE A HA     1 
ATOM 1103 H HB     . ILE C 3 2  ? -97.728  15.952  -28.043 1.00 3.13 ? 11  ILE A HB     1 
ATOM 1104 H HG12   . ILE C 3 2  ? -96.259  17.431  -26.987 1.00 3.80 ? 11  ILE A HG12   1 
ATOM 1105 H HG13   . ILE C 3 2  ? -97.529  18.423  -26.314 1.00 3.62 ? 11  ILE A HG13   1 
ATOM 1106 H HG21   . ILE C 3 2  ? -99.399  18.458  -28.191 1.00 3.34 ? 11  ILE A HG21   1 
ATOM 1107 H HG22   . ILE C 3 2  ? -97.772  18.407  -28.864 1.00 3.28 ? 11  ILE A HG22   1 
ATOM 1108 H HG23   . ILE C 3 2  ? -99.011  17.307  -29.464 1.00 3.35 ? 11  ILE A HG23   1 
ATOM 1109 H HD11   . ILE C 3 2  ? -96.991  15.563  -25.457 1.00 3.40 ? 11  ILE A HD11   1 
ATOM 1110 H HD12   . ILE C 3 2  ? -96.331  16.973  -24.631 1.00 3.44 ? 11  ILE A HD12   1 
ATOM 1111 H HD13   . ILE C 3 2  ? -98.072  16.719  -24.681 1.00 3.16 ? 11  ILE A HD13   1 
ATOM 1112 N N      . PRO C 3 3  ? -101.389 17.004  -25.571 1.00 2.58 ? 12  PRO A N      1 
ATOM 1113 C CA     . PRO C 3 3  ? -102.187 17.975  -24.817 1.00 2.86 ? 12  PRO A CA     1 
ATOM 1114 C C      . PRO C 3 3  ? -101.455 18.335  -23.530 1.00 2.86 ? 12  PRO A C      1 
ATOM 1115 O O      . PRO C 3 3  ? -101.899 19.156  -22.771 1.00 3.28 ? 12  PRO A O      1 
ATOM 1116 C CB     . PRO C 3 3  ? -103.503 17.231  -24.527 1.00 3.31 ? 12  PRO A CB     1 
ATOM 1117 C CG     . PRO C 3 3  ? -103.198 15.741  -24.734 1.00 3.22 ? 12  PRO A CG     1 
ATOM 1118 C CD     . PRO C 3 3  ? -102.036 15.684  -25.724 1.00 2.73 ? 12  PRO A CD     1 
ATOM 1119 H HA     . PRO C 3 3  ? -102.374 18.851  -25.411 1.00 2.98 ? 12  PRO A HA     1 
ATOM 1120 H HB2    . PRO C 3 3  ? -103.827 17.404  -23.522 1.00 3.60 ? 12  PRO A HB2    1 
ATOM 1121 H HB3    . PRO C 3 3  ? -104.270 17.542  -25.220 1.00 3.59 ? 12  PRO A HB3    1 
ATOM 1122 H HG2    . PRO C 3 3  ? -102.897 15.309  -23.790 1.00 3.47 ? 12  PRO A HG2    1 
ATOM 1123 H HG3    . PRO C 3 3  ? -104.061 15.229  -25.136 1.00 3.47 ? 12  PRO A HG3    1 
ATOM 1124 H HD2    . PRO C 3 3  ? -101.355 14.879  -25.477 1.00 2.77 ? 12  PRO A HD2    1 
ATOM 1125 H HD3    . PRO C 3 3  ? -102.425 15.576  -26.720 1.00 2.74 ? 12  PRO A HD3    1 
ATOM 1126 N N      . ALA C 3 4  ? -100.330 17.734  -23.285 1.00 2.66 ? 13  ALA A N      1 
ATOM 1127 C CA     . ALA C 3 4  ? -99.580  18.067  -22.049 1.00 2.94 ? 13  ALA A CA     1 
ATOM 1128 C C      . ALA C 3 4  ? -99.353  19.578  -22.014 1.00 2.87 ? 13  ALA A C      1 
ATOM 1129 O O      . ALA C 3 4  ? -99.898  20.282  -21.191 1.00 2.85 ? 13  ALA A O      1 
ATOM 1130 C CB     . ALA C 3 4  ? -98.235  17.338  -22.067 1.00 3.18 ? 13  ALA A CB     1 
ATOM 1131 H H      . ALA C 3 4  ? -99.975  17.073  -23.915 1.00 2.54 ? 13  ALA A H      1 
ATOM 1132 H HA     . ALA C 3 4  ? -100.149 17.764  -21.184 1.00 3.23 ? 13  ALA A HA     1 
ATOM 1133 H HB1    . ALA C 3 4  ? -98.383  16.326  -22.414 1.00 3.36 ? 13  ALA A HB1    1 
ATOM 1134 H HB2    . ALA C 3 4  ? -97.555  17.851  -22.731 1.00 3.43 ? 13  ALA A HB2    1 
ATOM 1135 H HB3    . ALA C 3 4  ? -97.821  17.320  -21.070 1.00 3.47 ? 13  ALA A HB3    1 
ATOM 1136 N N      . ALA C 3 5  ? -98.561  20.076  -22.917 1.00 3.01 ? 14  ALA A N      1 
ATOM 1137 C CA     . ALA C 3 5  ? -98.291  21.539  -22.958 1.00 3.10 ? 14  ALA A CA     1 
ATOM 1138 C C      . ALA C 3 5  ? -99.603  22.314  -23.151 1.00 2.95 ? 14  ALA A C      1 
ATOM 1139 O O      . ALA C 3 5  ? -99.713  23.460  -22.763 1.00 3.00 ? 14  ALA A O      1 
ATOM 1140 C CB     . ALA C 3 5  ? -97.338  21.840  -24.117 1.00 3.49 ? 14  ALA A CB     1 
ATOM 1141 H H      . ALA C 3 5  ? -98.144  19.484  -23.575 1.00 3.16 ? 14  ALA A H      1 
ATOM 1142 H HA     . ALA C 3 5  ? -97.830  21.843  -22.030 1.00 3.19 ? 14  ALA A HA     1 
ATOM 1143 H HB1    . ALA C 3 5  ? -96.565  21.086  -24.151 1.00 3.79 ? 14  ALA A HB1    1 
ATOM 1144 H HB2    . ALA C 3 5  ? -97.887  21.833  -25.048 1.00 3.57 ? 14  ALA A HB2    1 
ATOM 1145 H HB3    . ALA C 3 5  ? -96.888  22.810  -23.971 1.00 3.84 ? 14  ALA A HB3    1 
ATOM 1146 N N      . ALA C 3 6  ? -100.601 21.705  -23.744 1.00 2.95 ? 15  ALA A N      1 
ATOM 1147 C CA     . ALA C 3 6  ? -101.898 22.426  -23.951 1.00 3.11 ? 15  ALA A CA     1 
ATOM 1148 C C      . ALA C 3 6  ? -102.747 22.312  -22.680 1.00 3.03 ? 15  ALA A C      1 
ATOM 1149 O O      . ALA C 3 6  ? -103.449 23.228  -22.302 1.00 3.26 ? 15  ALA A O      1 
ATOM 1150 C CB     . ALA C 3 6  ? -102.652 21.808  -25.133 1.00 3.41 ? 15  ALA A CB     1 
ATOM 1151 H H      . ALA C 3 6  ? -100.498 20.780  -24.052 1.00 2.96 ? 15  ALA A H      1 
ATOM 1152 H HA     . ALA C 3 6  ? -101.700 23.469  -24.156 1.00 3.26 ? 15  ALA A HA     1 
ATOM 1153 H HB1    . ALA C 3 6  ? -101.948 21.541  -25.908 1.00 3.84 ? 15  ALA A HB1    1 
ATOM 1154 H HB2    . ALA C 3 6  ? -103.180 20.925  -24.806 1.00 3.46 ? 15  ALA A HB2    1 
ATOM 1155 H HB3    . ALA C 3 6  ? -103.359 22.525  -25.521 1.00 3.58 ? 15  ALA A HB3    1 
ATOM 1156 N N      . LEU C 3 7  ? -102.658 21.200  -22.007 1.00 2.90 ? 16  LEU A N      1 
ATOM 1157 C CA     . LEU C 3 7  ? -103.421 21.012  -20.742 1.00 3.07 ? 16  LEU A CA     1 
ATOM 1158 C C      . LEU C 3 7  ? -102.692 21.762  -19.692 1.00 3.01 ? 16  LEU A C      1 
ATOM 1159 O O      . LEU C 3 7  ? -103.241 22.553  -18.950 1.00 3.27 ? 16  LEU A O      1 
ATOM 1160 C CB     . LEU C 3 7  ? -103.375 19.560  -20.318 1.00 3.20 ? 16  LEU A CB     1 
ATOM 1161 C CG     . LEU C 3 7  ? -104.395 18.751  -21.101 1.00 3.32 ? 16  LEU A CG     1 
ATOM 1162 C CD1    . LEU C 3 7  ? -104.007 17.292  -20.945 1.00 3.71 ? 16  LEU A CD1    1 
ATOM 1163 C CD2    . LEU C 3 7  ? -105.824 18.979  -20.544 1.00 3.52 ? 16  LEU A CD2    1 
ATOM 1164 H H      . LEU C 3 7  ? -102.063 20.488  -22.326 1.00 2.82 ? 16  LEU A H      1 
ATOM 1165 H HA     . LEU C 3 7  ? -104.437 21.357  -20.838 1.00 3.33 ? 16  LEU A HA     1 
ATOM 1166 H HB2    . LEU C 3 7  ? -102.379 19.183  -20.507 1.00 3.31 ? 16  LEU A HB2    1 
ATOM 1167 H HB3    . LEU C 3 7  ? -103.580 19.471  -19.259 1.00 3.49 ? 16  LEU A HB3    1 
ATOM 1168 H HG     . LEU C 3 7  ? -104.356 19.038  -22.139 1.00 3.63 ? 16  LEU A HG     1 
ATOM 1169 H HD11   . LEU C 3 7  ? -103.970 17.080  -19.899 1.00 3.99 ? 16  LEU A HD11   1 
ATOM 1170 H HD12   . LEU C 3 7  ? -104.734 16.657  -21.425 1.00 3.81 ? 16  LEU A HD12   1 
ATOM 1171 H HD13   . LEU C 3 7  ? -103.031 17.131  -21.381 1.00 4.19 ? 16  LEU A HD13   1 
ATOM 1172 H HD21   . LEU C 3 7  ? -105.785 19.260  -19.501 1.00 3.88 ? 16  LEU A HD21   1 
ATOM 1173 H HD22   . LEU C 3 7  ? -106.306 19.765  -21.105 1.00 3.73 ? 16  LEU A HD22   1 
ATOM 1174 H HD23   . LEU C 3 7  ? -106.405 18.072  -20.639 1.00 3.64 ? 16  LEU A HD23   1 
ATOM 1175 N N      . ALA C 3 8  ? -101.425 21.522  -19.634 1.00 2.85 ? 17  ALA A N      1 
ATOM 1176 C CA     . ALA C 3 8  ? -100.640 22.221  -18.646 1.00 2.95 ? 17  ALA A CA     1 
ATOM 1177 C C      . ALA C 3 8  ? -100.801 23.679  -18.986 1.00 2.78 ? 17  ALA A C      1 
ATOM 1178 O O      . ALA C 3 8  ? -101.482 24.402  -18.284 1.00 2.88 ? 17  ALA A O      1 
ATOM 1179 C CB     . ALA C 3 8  ? -99.156  21.792  -18.716 1.00 3.19 ? 17  ALA A CB     1 
ATOM 1180 H H      . ALA C 3 8  ? -101.005 20.886  -20.251 1.00 2.81 ? 17  ALA A H      1 
ATOM 1181 H HA     . ALA C 3 8  ? -101.036 22.030  -17.661 1.00 3.20 ? 17  ALA A HA     1 
ATOM 1182 H HB1    . ALA C 3 8  ? -99.091  20.781  -19.086 1.00 3.41 ? 17  ALA A HB1    1 
ATOM 1183 H HB2    . ALA C 3 8  ? -98.606  22.449  -19.376 1.00 3.19 ? 17  ALA A HB2    1 
ATOM 1184 H HB3    . ALA C 3 8  ? -98.722  21.834  -17.727 1.00 3.68 ? 17  ALA A HB3    1 
ATOM 1185 N N      . GLY C 3 9  ? -100.168 24.148  -20.038 1.00 2.86 ? 18  GLY A N      1 
ATOM 1186 C CA     . GLY C 3 9  ? -100.278 25.603  -20.358 1.00 2.92 ? 18  GLY A CA     1 
ATOM 1187 C C      . GLY C 3 9  ? -99.900  26.317  -19.067 1.00 2.42 ? 18  GLY A C      1 
ATOM 1188 O O      . GLY C 3 9  ? -99.986  27.519  -18.917 1.00 2.61 ? 18  GLY A O      1 
ATOM 1189 H H      . GLY C 3 9  ? -99.608  23.557  -20.582 1.00 3.10 ? 18  GLY A H      1 
ATOM 1190 H HA2    . GLY C 3 9  ? -99.590  25.863  -21.154 1.00 3.25 ? 18  GLY A HA2    1 
ATOM 1191 H HA3    . GLY C 3 9  ? -101.289 25.855  -20.636 1.00 3.24 ? 18  GLY A HA3    1 
ATOM 1192 N N      . TYR C 3 10 ? -99.470  25.506  -18.140 1.00 2.11 ? 19  TYR A N      1 
ATOM 1193 C CA     . TYR C 3 10 ? -99.053  25.945  -16.830 1.00 2.08 ? 19  TYR A CA     1 
ATOM 1194 C C      . TYR C 3 10 ? -97.737  26.632  -17.127 1.00 2.40 ? 19  TYR A C      1 
ATOM 1195 O O      . TYR C 3 10 ? -96.815  26.054  -17.668 1.00 2.84 ? 19  TYR A O      1 
ATOM 1196 C CB     . TYR C 3 10 ? -98.997  24.670  -15.937 1.00 2.26 ? 19  TYR A CB     1 
ATOM 1197 C CG     . TYR C 3 10 ? -97.656  24.497  -15.309 1.00 2.18 ? 19  TYR A CG     1 
ATOM 1198 C CD1    . TYR C 3 10 ? -96.628  23.859  -16.023 1.00 2.69 ? 19  TYR A CD1    1 
ATOM 1199 C CD2    . TYR C 3 10 ? -97.429  24.994  -14.020 1.00 2.48 ? 19  TYR A CD2    1 
ATOM 1200 C CE1    . TYR C 3 10 ? -95.363  23.724  -15.441 1.00 3.16 ? 19  TYR A CE1    1 
ATOM 1201 C CE2    . TYR C 3 10 ? -96.165  24.867  -13.439 1.00 2.92 ? 19  TYR A CE2    1 
ATOM 1202 C CZ     . TYR C 3 10 ? -95.131  24.236  -14.147 1.00 3.14 ? 19  TYR A CZ     1 
ATOM 1203 O OH     . TYR C 3 10 ? -93.892  24.132  -13.575 1.00 3.89 ? 19  TYR A OH     1 
ATOM 1204 H H      . TYR C 3 10 ? -99.412  24.556  -18.341 1.00 2.18 ? 19  TYR A H      1 
ATOM 1205 H HA     . TYR C 3 10 ? -99.765  26.659  -16.437 1.00 2.26 ? 19  TYR A HA     1 
ATOM 1206 H HB2    . TYR C 3 10 ? -99.744  24.742  -15.159 1.00 2.65 ? 19  TYR A HB2    1 
ATOM 1207 H HB3    . TYR C 3 10 ? -99.215  23.799  -16.544 1.00 2.74 ? 19  TYR A HB3    1 
ATOM 1208 H HD1    . TYR C 3 10 ? -96.818  23.453  -17.008 1.00 3.15 ? 19  TYR A HD1    1 
ATOM 1209 H HD2    . TYR C 3 10 ? -98.228  25.475  -13.478 1.00 2.89 ? 19  TYR A HD2    1 
ATOM 1210 H HE1    . TYR C 3 10 ? -94.567  23.239  -15.988 1.00 3.88 ? 19  TYR A HE1    1 
ATOM 1211 H HE2    . TYR C 3 10 ? -95.988  25.244  -12.444 1.00 3.50 ? 19  TYR A HE2    1 
ATOM 1212 H HH     . TYR C 3 10 ? -94.001  24.198  -12.624 1.00 4.31 ? 19  TYR A HH     1 
ATOM 1213 N N      . THR C 3 11 ? -97.727  27.902  -16.922 1.00 2.61 ? 20  THR A N      1 
ATOM 1214 C CA     . THR C 3 11 ? -96.574  28.728  -17.341 1.00 3.16 ? 20  THR A CA     1 
ATOM 1215 C C      . THR C 3 11 ? -95.366  28.562  -16.438 1.00 3.46 ? 20  THR A C      1 
ATOM 1216 O O      . THR C 3 11 ? -95.353  27.780  -15.508 1.00 3.49 ? 20  THR A O      1 
ATOM 1217 C CB     . THR C 3 11 ? -97.048  30.199  -17.296 1.00 3.60 ? 20  THR A CB     1 
ATOM 1218 O OG1    . THR C 3 11 ? -98.469  30.217  -17.252 1.00 3.95 ? 20  THR A OG1    1 
ATOM 1219 C CG2    . THR C 3 11 ? -96.573  30.987  -18.525 1.00 4.19 ? 20  THR A CG2    1 
ATOM 1220 H H      . THR C 3 11 ? -98.539  28.340  -16.595 1.00 2.67 ? 20  THR A H      1 
ATOM 1221 H HA     . THR C 3 11 ? -96.302  28.461  -18.347 1.00 3.48 ? 20  THR A HA     1 
ATOM 1222 H HB     . THR C 3 11 ? -96.670  30.680  -16.403 1.00 3.82 ? 20  THR A HB     1 
ATOM 1223 H HG1    . THR C 3 11 ? -98.796  30.283  -18.150 1.00 4.14 ? 20  THR A HG1    1 
ATOM 1224 H HG21   . THR C 3 11 ? -96.678  30.386  -19.416 1.00 4.49 ? 20  THR A HG21   1 
ATOM 1225 H HG22   . THR C 3 11 ? -97.171  31.879  -18.626 1.00 4.69 ? 20  THR A HG22   1 
ATOM 1226 H HG23   . THR C 3 11 ? -95.538  31.263  -18.395 1.00 4.32 ? 20  THR A HG23   1 
ATOM 1227 N N      . GLY C 3 12 ? -94.351  29.328  -16.737 1.00 4.09 ? 21  GLY A N      1 
ATOM 1228 C CA     . GLY C 3 12 ? -93.113  29.295  -15.935 1.00 4.83 ? 21  GLY A CA     1 
ATOM 1229 C C      . GLY C 3 12 ? -93.447  29.850  -14.561 1.00 4.69 ? 21  GLY A C      1 
ATOM 1230 O O      . GLY C 3 12 ? -92.772  30.713  -14.037 1.00 5.28 ? 21  GLY A O      1 
ATOM 1231 H H      . GLY C 3 12 ? -94.419  29.943  -17.496 1.00 4.30 ? 21  GLY A H      1 
ATOM 1232 H HA2    . GLY C 3 12 ? -92.758  28.276  -15.849 1.00 5.02 ? 21  GLY A HA2    1 
ATOM 1233 H HA3    . GLY C 3 12 ? -92.358  29.910  -16.399 1.00 5.54 ? 21  GLY A HA3    1 
ATOM 1234 N N      . SER C 3 13 ? -94.487  29.338  -13.971 1.00 4.11 ? 22  SER A N      1 
ATOM 1235 C CA     . SER C 3 13 ? -94.891  29.796  -12.625 1.00 4.22 ? 22  SER A CA     1 
ATOM 1236 C C      . SER C 3 13 ? -94.088  28.945  -11.663 1.00 3.56 ? 22  SER A C      1 
ATOM 1237 O O      . SER C 3 13 ? -94.599  28.320  -10.757 1.00 3.47 ? 22  SER A O      1 
ATOM 1238 C CB     . SER C 3 13 ? -96.399  29.555  -12.445 1.00 4.67 ? 22  SER A CB     1 
ATOM 1239 O OG     . SER C 3 13 ? -96.931  30.539  -11.570 1.00 5.27 ? 22  SER A OG     1 
ATOM 1240 H H      . SER C 3 13 ? -95.003  28.636  -14.418 1.00 3.81 ? 22  SER A H      1 
ATOM 1241 H HA     . SER C 3 13 ? -94.655  30.843  -12.493 1.00 4.76 ? 22  SER A HA     1 
ATOM 1242 H HB2    . SER C 3 13 ? -96.890  29.632  -13.400 1.00 4.82 ? 22  SER A HB2    1 
ATOM 1243 H HB3    . SER C 3 13 ? -96.571  28.564  -12.039 1.00 4.81 ? 22  SER A HB3    1 
ATOM 1244 H HG     . SER C 3 13 ? -97.519  31.100  -12.082 1.00 5.32 ? 22  SER A HG     1 
ATOM 1245 N N      . GLY C 3 14 ? -92.812  28.895  -11.918 1.00 3.50 ? 23  GLY A N      1 
ATOM 1246 C CA     . GLY C 3 14 ? -91.898  28.066  -11.105 1.00 3.33 ? 23  GLY A CA     1 
ATOM 1247 C C      . GLY C 3 14 ? -91.840  26.680  -11.768 1.00 2.81 ? 23  GLY A C      1 
ATOM 1248 O O      . GLY C 3 14 ? -92.809  26.269  -12.377 1.00 2.61 ? 23  GLY A O      1 
ATOM 1249 H H      . GLY C 3 14 ? -92.457  29.391  -12.687 1.00 3.88 ? 23  GLY A H      1 
ATOM 1250 H HA2    . GLY C 3 14 ? -90.928  28.533  -11.092 1.00 3.76 ? 23  GLY A HA2    1 
ATOM 1251 H HA3    . GLY C 3 14 ? -92.276  27.972  -10.098 1.00 3.49 ? 23  GLY A HA3    1 
ATOM 1252 N N      . PRO C 3 15 ? -90.731  25.986  -11.648 1.00 2.68 ? 24  PRO A N      1 
ATOM 1253 C CA     . PRO C 3 15 ? -90.608  24.651  -12.256 1.00 2.27 ? 24  PRO A CA     1 
ATOM 1254 C C      . PRO C 3 15 ? -91.775  23.782  -11.778 1.00 1.89 ? 24  PRO A C      1 
ATOM 1255 O O      . PRO C 3 15 ? -92.281  23.961  -10.689 1.00 1.98 ? 24  PRO A O      1 
ATOM 1256 C CB     . PRO C 3 15 ? -89.247  24.112  -11.760 1.00 2.45 ? 24  PRO A CB     1 
ATOM 1257 C CG     . PRO C 3 15 ? -88.605  25.221  -10.873 1.00 2.90 ? 24  PRO A CG     1 
ATOM 1258 C CD     . PRO C 3 15 ? -89.540  26.448  -10.914 1.00 3.05 ? 24  PRO A CD     1 
ATOM 1259 H HA     . PRO C 3 15 ? -90.613  24.727  -13.334 1.00 2.29 ? 24  PRO A HA     1 
ATOM 1260 H HB2    . PRO C 3 15 ? -89.388  23.207  -11.181 1.00 2.29 ? 24  PRO A HB2    1 
ATOM 1261 H HB3    . PRO C 3 15 ? -88.603  23.905  -12.604 1.00 2.54 ? 24  PRO A HB3    1 
ATOM 1262 H HG2    . PRO C 3 15 ? -88.505  24.865  -9.855  1.00 2.91 ? 24  PRO A HG2    1 
ATOM 1263 H HG3    . PRO C 3 15 ? -87.631  25.491  -11.260 1.00 3.20 ? 24  PRO A HG3    1 
ATOM 1264 H HD2    . PRO C 3 15 ? -89.811  26.759  -9.912  1.00 3.15 ? 24  PRO A HD2    1 
ATOM 1265 H HD3    . PRO C 3 15 ? -89.070  27.262  -11.448 1.00 3.38 ? 24  PRO A HD3    1 
ATOM 1266 N N      . ILE C 3 16 ? -92.221  22.855  -12.579 1.00 1.64 ? 25  ILE A N      1 
ATOM 1267 C CA     . ILE C 3 16 ? -93.365  22.013  -12.144 1.00 1.48 ? 25  ILE A CA     1 
ATOM 1268 C C      . ILE C 3 16 ? -92.880  21.019  -11.113 1.00 1.26 ? 25  ILE A C      1 
ATOM 1269 O O      . ILE C 3 16 ? -91.702  20.745  -11.003 1.00 1.23 ? 25  ILE A O      1 
ATOM 1270 C CB     . ILE C 3 16 ? -93.964  21.246  -13.345 1.00 1.57 ? 25  ILE A CB     1 
ATOM 1271 C CG1    . ILE C 3 16 ? -95.385  20.718  -12.985 1.00 2.05 ? 25  ILE A CG1    1 
ATOM 1272 C CG2    . ILE C 3 16 ? -93.037  20.077  -13.743 1.00 2.04 ? 25  ILE A CG2    1 
ATOM 1273 C CD1    . ILE C 3 16 ? -96.246  20.599  -14.257 1.00 2.28 ? 25  ILE A CD1    1 
ATOM 1274 H H      . ILE C 3 16 ? -91.817  22.724  -13.460 1.00 1.71 ? 25  ILE A H      1 
ATOM 1275 H HA     . ILE C 3 16 ? -94.118  22.648  -11.704 1.00 1.68 ? 25  ILE A HA     1 
ATOM 1276 H HB     . ILE C 3 16 ? -94.033  21.912  -14.181 1.00 1.96 ? 25  ILE A HB     1 
ATOM 1277 H HG12   . ILE C 3 16 ? -95.310  19.750  -12.513 1.00 2.52 ? 25  ILE A HG12   1 
ATOM 1278 H HG13   . ILE C 3 16 ? -95.871  21.400  -12.302 1.00 2.50 ? 25  ILE A HG13   1 
ATOM 1279 H HG21   . ILE C 3 16 ? -92.008  20.397  -13.670 1.00 2.47 ? 25  ILE A HG21   1 
ATOM 1280 H HG22   . ILE C 3 16 ? -93.192  19.236  -13.083 1.00 2.38 ? 25  ILE A HG22   1 
ATOM 1281 H HG23   . ILE C 3 16 ? -93.245  19.782  -14.759 1.00 2.52 ? 25  ILE A HG23   1 
ATOM 1282 H HD11   . ILE C 3 16 ? -95.622  20.335  -15.098 1.00 2.57 ? 25  ILE A HD11   1 
ATOM 1283 H HD12   . ILE C 3 16 ? -96.999  19.836  -14.114 1.00 2.65 ? 25  ILE A HD12   1 
ATOM 1284 H HD13   . ILE C 3 16 ? -96.729  21.545  -14.454 1.00 2.48 ? 25  ILE A HD13   1 
ATOM 1285 N N      . GLN C 3 17 ? -93.778  20.442  -10.384 1.00 1.17 ? 26  GLN A N      1 
ATOM 1286 C CA     . GLN C 3 17 ? -93.357  19.430  -9.399  1.00 1.02 ? 26  GLN A CA     1 
ATOM 1287 C C      . GLN C 3 17 ? -93.201  18.126  -10.173 1.00 0.92 ? 26  GLN A C      1 
ATOM 1288 O O      . GLN C 3 17 ? -94.016  17.795  -11.013 1.00 0.91 ? 26  GLN A O      1 
ATOM 1289 C CB     . GLN C 3 17 ? -94.428  19.294  -8.311  1.00 1.07 ? 26  GLN A CB     1 
ATOM 1290 C CG     . GLN C 3 17 ? -93.799  18.742  -7.027  1.00 1.06 ? 26  GLN A CG     1 
ATOM 1291 C CD     . GLN C 3 17 ? -93.017  17.468  -7.346  1.00 0.90 ? 26  GLN A CD     1 
ATOM 1292 O OE1    . GLN C 3 17 ? -93.473  16.639  -8.102  1.00 0.97 ? 26  GLN A OE1    1 
ATOM 1293 N NE2    . GLN C 3 17 ? -91.847  17.278  -6.801  1.00 1.18 ? 26  GLN A NE2    1 
ATOM 1294 H H      . GLN C 3 17 ? -94.727  20.651  -10.508 1.00 1.27 ? 26  GLN A H      1 
ATOM 1295 H HA     . GLN C 3 17 ? -92.408  19.712  -8.959  1.00 1.04 ? 26  GLN A HA     1 
ATOM 1296 H HB2    . GLN C 3 17 ? -94.857  20.266  -8.113  1.00 1.21 ? 26  GLN A HB2    1 
ATOM 1297 H HB3    . GLN C 3 17 ? -95.201  18.625  -8.647  1.00 1.15 ? 26  GLN A HB3    1 
ATOM 1298 H HG2    . GLN C 3 17 ? -93.130  19.481  -6.609  1.00 1.29 ? 26  GLN A HG2    1 
ATOM 1299 H HG3    . GLN C 3 17 ? -94.577  18.516  -6.314  1.00 1.39 ? 26  GLN A HG3    1 
ATOM 1300 H HE21   . GLN C 3 17 ? -91.476  17.949  -6.192  1.00 1.33 ? 26  GLN A HE21   1 
ATOM 1301 H HE22   . GLN C 3 17 ? -91.339  16.465  -7.004  1.00 1.43 ? 26  GLN A HE22   1 
ATOM 1302 N N      . LEU C 3 18 ? -92.150  17.406  -9.930  1.00 0.89 ? 27  LEU A N      1 
ATOM 1303 C CA     . LEU C 3 18 ? -91.919  16.144  -10.682 1.00 0.83 ? 27  LEU A CA     1 
ATOM 1304 C C      . LEU C 3 18 ? -93.213  15.331  -10.821 1.00 0.75 ? 27  LEU A C      1 
ATOM 1305 O O      . LEU C 3 18 ? -93.803  15.268  -11.882 1.00 0.72 ? 27  LEU A O      1 
ATOM 1306 C CB     . LEU C 3 18 ? -90.867  15.293  -9.947  1.00 0.93 ? 27  LEU A CB     1 
ATOM 1307 C CG     . LEU C 3 18 ? -90.263  14.259  -10.909 1.00 0.77 ? 27  LEU A CG     1 
ATOM 1308 C CD1    . LEU C 3 18 ? -89.150  13.483  -10.206 1.00 1.34 ? 27  LEU A CD1    1 
ATOM 1309 C CD2    . LEU C 3 18 ? -91.340  13.277  -11.389 1.00 1.76 ? 27  LEU A CD2    1 
ATOM 1310 H H      . LEU C 3 18 ? -91.493  17.709  -9.271  1.00 0.95 ? 27  LEU A H      1 
ATOM 1311 H HA     . LEU C 3 18 ? -91.548  16.388  -11.667 1.00 0.82 ? 27  LEU A HA     1 
ATOM 1312 H HB2    . LEU C 3 18 ? -90.082  15.937  -9.577  1.00 1.13 ? 27  LEU A HB2    1 
ATOM 1313 H HB3    . LEU C 3 18 ? -91.327  14.781  -9.118  1.00 1.12 ? 27  LEU A HB3    1 
ATOM 1314 H HG     . LEU C 3 18 ? -89.850  14.775  -11.753 1.00 1.27 ? 27  LEU A HG     1 
ATOM 1315 H HD11   . LEU C 3 18 ? -88.453  14.175  -9.762  1.00 1.85 ? 27  LEU A HD11   1 
ATOM 1316 H HD12   . LEU C 3 18 ? -89.579  12.858  -9.439  1.00 1.92 ? 27  LEU A HD12   1 
ATOM 1317 H HD13   . LEU C 3 18 ? -88.635  12.864  -10.926 1.00 1.92 ? 27  LEU A HD13   1 
ATOM 1318 H HD21   . LEU C 3 18 ? -92.006  13.040  -10.574 1.00 2.35 ? 27  LEU A HD21   1 
ATOM 1319 H HD22   . LEU C 3 18 ? -91.897  13.731  -12.190 1.00 2.30 ? 27  LEU A HD22   1 
ATOM 1320 H HD23   . LEU C 3 18 ? -90.877  12.370  -11.748 1.00 2.21 ? 27  LEU A HD23   1 
ATOM 1321 N N      . TRP C 3 19 ? -93.616  14.650  -9.788  1.00 0.76 ? 28  TRP A N      1 
ATOM 1322 C CA     . TRP C 3 19 ? -94.813  13.773  -9.900  1.00 0.73 ? 28  TRP A CA     1 
ATOM 1323 C C      . TRP C 3 19 ? -96.059  14.534  -10.360 1.00 0.75 ? 28  TRP A C      1 
ATOM 1324 O O      . TRP C 3 19 ? -96.825  14.023  -11.151 1.00 0.73 ? 28  TRP A O      1 
ATOM 1325 C CB     . TRP C 3 19 ? -95.082  13.097  -8.564  1.00 0.80 ? 28  TRP A CB     1 
ATOM 1326 C CG     . TRP C 3 19 ? -95.455  14.115  -7.548  1.00 0.87 ? 28  TRP A CG     1 
ATOM 1327 C CD1    . TRP C 3 19 ? -94.581  14.788  -6.774  1.00 0.89 ? 28  TRP A CD1    1 
ATOM 1328 C CD2    . TRP C 3 19 ? -96.780  14.580  -7.180  1.00 0.95 ? 28  TRP A CD2    1 
ATOM 1329 N NE1    . TRP C 3 19 ? -95.286  15.651  -5.951  1.00 0.98 ? 28  TRP A NE1    1 
ATOM 1330 C CE2    . TRP C 3 19 ? -96.647  15.558  -6.160  1.00 1.02 ? 28  TRP A CE2    1 
ATOM 1331 C CE3    . TRP C 3 19 ? -98.075  14.250  -7.629  1.00 1.00 ? 28  TRP A CE3    1 
ATOM 1332 C CZ2    . TRP C 3 19 ? -97.766  16.192  -5.603  1.00 1.13 ? 28  TRP A CZ2    1 
ATOM 1333 C CZ3    . TRP C 3 19 ? -99.206  14.883  -7.071  1.00 1.11 ? 28  TRP A CZ3    1 
ATOM 1334 C CH2    . TRP C 3 19 ? -99.051  15.853  -6.060  1.00 1.18 ? 28  TRP A CH2    1 
ATOM 1335 H H      . TRP C 3 19 ? -93.099  14.667  -8.957  1.00 0.83 ? 28  TRP A H      1 
ATOM 1336 H HA     . TRP C 3 19 ? -94.599  13.008  -10.623 1.00 0.68 ? 28  TRP A HA     1 
ATOM 1337 H HB2    . TRP C 3 19 ? -95.890  12.390  -8.679  1.00 0.81 ? 28  TRP A HB2    1 
ATOM 1338 H HB3    . TRP C 3 19 ? -94.192  12.576  -8.241  1.00 0.81 ? 28  TRP A HB3    1 
ATOM 1339 H HD1    . TRP C 3 19 ? -93.502  14.680  -6.806  1.00 0.87 ? 28  TRP A HD1    1 
ATOM 1340 H HE1    . TRP C 3 19 ? -94.889  16.254  -5.294  1.00 1.02 ? 28  TRP A HE1    1 
ATOM 1341 H HE3    . TRP C 3 19 ? -98.199  13.505  -8.403  1.00 0.96 ? 28  TRP A HE3    1 
ATOM 1342 H HZ2    . TRP C 3 19 ? -97.643  16.935  -4.829  1.00 1.19 ? 28  TRP A HZ2    1 
ATOM 1343 H HZ3    . TRP C 3 19 ? -100.193 14.626  -7.418  1.00 1.17 ? 28  TRP A HZ3    1 
ATOM 1344 H HH2    . TRP C 3 19 ? -99.921  16.334  -5.637  1.00 1.27 ? 28  TRP A HH2    1 
ATOM 1345 N N      . GLN C 3 20 ? -96.300  15.730  -9.891  1.00 0.81 ? 29  GLN A N      1 
ATOM 1346 C CA     . GLN C 3 20 ? -97.532  16.436  -10.355 1.00 0.84 ? 29  GLN A CA     1 
ATOM 1347 C C      . GLN C 3 20 ? -97.551  16.427  -11.884 1.00 0.79 ? 29  GLN A C      1 
ATOM 1348 O O      . GLN C 3 20 ? -98.539  16.088  -12.493 1.00 0.79 ? 29  GLN A O      1 
ATOM 1349 C CB     . GLN C 3 20 ? -97.562  17.879  -9.845  1.00 0.91 ? 29  GLN A CB     1 
ATOM 1350 C CG     . GLN C 3 20 ? -98.945  18.476  -10.123 1.00 1.41 ? 29  GLN A CG     1 
ATOM 1351 C CD     . GLN C 3 20 ? -98.979  19.940  -9.683  1.00 1.66 ? 29  GLN A CD     1 
ATOM 1352 O OE1    . GLN C 3 20 ? -99.585  20.273  -8.684  1.00 2.13 ? 29  GLN A OE1    1 
ATOM 1353 N NE2    . GLN C 3 20 ? -98.354  20.837  -10.395 1.00 2.18 ? 29  GLN A NE2    1 
ATOM 1354 H H      . GLN C 3 20 ? -95.692  16.149  -9.246  1.00 0.84 ? 29  GLN A H      1 
ATOM 1355 H HA     . GLN C 3 20 ? -98.402  15.908  -9.988  1.00 0.85 ? 29  GLN A HA     1 
ATOM 1356 H HB2    . GLN C 3 20 ? -97.375  17.889  -8.782  1.00 1.18 ? 29  GLN A HB2    1 
ATOM 1357 H HB3    . GLN C 3 20 ? -96.810  18.461  -10.355 1.00 0.92 ? 29  GLN A HB3    1 
ATOM 1358 H HG2    . GLN C 3 20 ? -99.160  18.411  -11.180 1.00 1.85 ? 29  GLN A HG2    1 
ATOM 1359 H HG3    . GLN C 3 20 ? -99.690  17.922  -9.571  1.00 1.90 ? 29  GLN A HG3    1 
ATOM 1360 H HE21   . GLN C 3 20 ? -97.869  20.570  -11.203 1.00 2.47 ? 29  GLN A HE21   1 
ATOM 1361 H HE22   . GLN C 3 20 ? -98.373  21.779  -10.123 1.00 2.63 ? 29  GLN A HE22   1 
ATOM 1362 N N      . PHE C 3 21 ? -96.451  16.759  -12.506 1.00 0.77 ? 30  PHE A N      1 
ATOM 1363 C CA     . PHE C 3 21 ? -96.393  16.734  -13.997 1.00 0.74 ? 30  PHE A CA     1 
ATOM 1364 C C      . PHE C 3 21 ? -96.669  15.302  -14.484 1.00 0.68 ? 30  PHE A C      1 
ATOM 1365 O O      . PHE C 3 21 ? -97.569  15.058  -15.263 1.00 0.70 ? 30  PHE A O      1 
ATOM 1366 C CB     . PHE C 3 21 ? -94.989  17.173  -14.435 1.00 0.74 ? 30  PHE A CB     1 
ATOM 1367 C CG     . PHE C 3 21 ? -94.719  16.748  -15.863 1.00 0.71 ? 30  PHE A CG     1 
ATOM 1368 C CD1    . PHE C 3 21 ? -95.134  17.557  -16.939 1.00 0.80 ? 30  PHE A CD1    1 
ATOM 1369 C CD2    . PHE C 3 21 ? -94.053  15.532  -16.111 1.00 0.64 ? 30  PHE A CD2    1 
ATOM 1370 C CE1    . PHE C 3 21 ? -94.881  17.148  -18.263 1.00 0.80 ? 30  PHE A CE1    1 
ATOM 1371 C CE2    . PHE C 3 21 ? -93.800  15.124  -17.434 1.00 0.65 ? 30  PHE A CE2    1 
ATOM 1372 C CZ     . PHE C 3 21 ? -94.214  15.932  -18.511 1.00 0.72 ? 30  PHE A CZ     1 
ATOM 1373 H H      . PHE C 3 21 ? -95.653  17.001  -11.991 1.00 0.78 ? 30  PHE A H      1 
ATOM 1374 H HA     . PHE C 3 21 ? -97.130  17.418  -14.407 1.00 0.78 ? 30  PHE A HA     1 
ATOM 1375 H HB2    . PHE C 3 21 ? -94.920  18.244  -14.364 1.00 0.81 ? 30  PHE A HB2    1 
ATOM 1376 H HB3    . PHE C 3 21 ? -94.253  16.725  -13.783 1.00 0.74 ? 30  PHE A HB3    1 
ATOM 1377 H HD1    . PHE C 3 21 ? -95.645  18.490  -16.748 1.00 0.91 ? 30  PHE A HD1    1 
ATOM 1378 H HD2    . PHE C 3 21 ? -93.737  14.912  -15.284 1.00 0.63 ? 30  PHE A HD2    1 
ATOM 1379 H HE1    . PHE C 3 21 ? -95.199  17.767  -19.089 1.00 0.90 ? 30  PHE A HE1    1 
ATOM 1380 H HE2    . PHE C 3 21 ? -93.288  14.192  -17.623 1.00 0.65 ? 30  PHE A HE2    1 
ATOM 1381 H HZ     . PHE C 3 21 ? -94.020  15.617  -19.527 1.00 0.74 ? 30  PHE A HZ     1 
ATOM 1382 N N      . LEU C 3 22 ? -95.890  14.360  -14.023 1.00 0.65 ? 31  LEU A N      1 
ATOM 1383 C CA     . LEU C 3 22 ? -96.079  12.941  -14.443 1.00 0.63 ? 31  LEU A CA     1 
ATOM 1384 C C      . LEU C 3 22 ? -97.502  12.507  -14.112 1.00 0.66 ? 31  LEU A C      1 
ATOM 1385 O O      . LEU C 3 22 ? -98.165  11.869  -14.904 1.00 0.66 ? 31  LEU A O      1 
ATOM 1386 C CB     . LEU C 3 22 ? -95.069  12.071  -13.680 1.00 0.66 ? 31  LEU A CB     1 
ATOM 1387 C CG     . LEU C 3 22 ? -95.204  10.579  -14.028 1.00 0.77 ? 31  LEU A CG     1 
ATOM 1388 C CD1    . LEU C 3 22 ? -95.196  10.369  -15.550 1.00 1.45 ? 31  LEU A CD1    1 
ATOM 1389 C CD2    . LEU C 3 22 ? -94.025  9.821   -13.401 1.00 1.25 ? 31  LEU A CD2    1 
ATOM 1390 H H      . LEU C 3 22 ? -95.172  14.589  -13.397 1.00 0.67 ? 31  LEU A H      1 
ATOM 1391 H HA     . LEU C 3 22 ? -95.911  12.855  -15.504 1.00 0.61 ? 31  LEU A HA     1 
ATOM 1392 H HB2    . LEU C 3 22 ? -94.075  12.399  -13.921 1.00 0.85 ? 31  LEU A HB2    1 
ATOM 1393 H HB3    . LEU C 3 22 ? -95.234  12.196  -12.626 1.00 0.92 ? 31  LEU A HB3    1 
ATOM 1394 H HG     . LEU C 3 22 ? -96.125  10.197  -13.616 1.00 1.49 ? 31  LEU A HG     1 
ATOM 1395 H HD11   . LEU C 3 22 ? -94.517  11.067  -16.009 1.00 1.94 ? 31  LEU A HD11   1 
ATOM 1396 H HD12   . LEU C 3 22 ? -94.881  9.360   -15.778 1.00 1.95 ? 31  LEU A HD12   1 
ATOM 1397 H HD13   . LEU C 3 22 ? -96.190  10.528  -15.939 1.00 1.99 ? 31  LEU A HD13   1 
ATOM 1398 H HD21   . LEU C 3 22 ? -93.921  10.111  -12.365 1.00 1.77 ? 31  LEU A HD21   1 
ATOM 1399 H HD22   . LEU C 3 22 ? -94.207  8.758   -13.460 1.00 1.68 ? 31  LEU A HD22   1 
ATOM 1400 H HD23   . LEU C 3 22 ? -93.117  10.060  -13.935 1.00 1.87 ? 31  LEU A HD23   1 
ATOM 1401 N N      . LEU C 3 23 ? -97.981  12.850  -12.950 1.00 0.72 ? 32  LEU A N      1 
ATOM 1402 C CA     . LEU C 3 23 ? -99.364  12.454  -12.579 1.00 0.79 ? 32  LEU A CA     1 
ATOM 1403 C C      . LEU C 3 23 ? -100.367 13.177  -13.485 1.00 0.82 ? 32  LEU A C      1 
ATOM 1404 O O      . LEU C 3 23 ? -101.386 12.626  -13.851 1.00 0.85 ? 32  LEU A O      1 
ATOM 1405 C CB     . LEU C 3 23 ? -99.623  12.791  -11.104 1.00 0.86 ? 32  LEU A CB     1 
ATOM 1406 C CG     . LEU C 3 23 ? -101.059 12.392  -10.686 1.00 1.11 ? 32  LEU A CG     1 
ATOM 1407 C CD1    . LEU C 3 23 ? -101.347 10.930  -11.082 1.00 1.57 ? 32  LEU A CD1    1 
ATOM 1408 C CD2    . LEU C 3 23 ? -101.219 12.581  -9.152  1.00 1.60 ? 32  LEU A CD2    1 
ATOM 1409 H H      . LEU C 3 23 ? -97.433  13.368  -12.325 1.00 0.73 ? 32  LEU A H      1 
ATOM 1410 H HA     . LEU C 3 23 ? -99.455  11.393  -12.724 1.00 0.79 ? 32  LEU A HA     1 
ATOM 1411 H HB2    . LEU C 3 23 ? -98.909  12.255  -10.496 1.00 1.04 ? 32  LEU A HB2    1 
ATOM 1412 H HB3    . LEU C 3 23 ? -99.491  13.852  -10.955 1.00 1.11 ? 32  LEU A HB3    1 
ATOM 1413 H HG     . LEU C 3 23 ? -101.762 13.034  -11.198 1.00 1.71 ? 32  LEU A HG     1 
ATOM 1414 H HD11   . LEU C 3 23 ? -100.471 10.325  -10.894 1.00 1.84 ? 32  LEU A HD11   1 
ATOM 1415 H HD12   . LEU C 3 23 ? -102.178 10.547  -10.513 1.00 2.14 ? 32  LEU A HD12   1 
ATOM 1416 H HD13   . LEU C 3 23 ? -101.596 10.887  -12.132 1.00 2.08 ? 32  LEU A HD13   1 
ATOM 1417 H HD21   . LEU C 3 23 ? -100.269 12.427  -8.657  1.00 1.95 ? 32  LEU A HD21   1 
ATOM 1418 H HD22   . LEU C 3 23 ? -101.563 13.583  -8.953  1.00 2.21 ? 32  LEU A HD22   1 
ATOM 1419 H HD23   . LEU C 3 23 ? -101.940 11.882  -8.758  1.00 2.02 ? 32  LEU A HD23   1 
ATOM 1420 N N      . GLU C 3 24 ? -100.094 14.403  -13.861 1.00 0.85 ? 33  GLU A N      1 
ATOM 1421 C CA     . GLU C 3 24 ? -101.052 15.123  -14.752 1.00 0.92 ? 33  GLU A CA     1 
ATOM 1422 C C      . GLU C 3 24 ? -101.025 14.449  -16.131 1.00 0.87 ? 33  GLU A C      1 
ATOM 1423 O O      . GLU C 3 24 ? -102.047 14.253  -16.758 1.00 0.96 ? 33  GLU A O      1 
ATOM 1424 C CB     . GLU C 3 24 ? -100.662 16.623  -14.868 1.00 0.99 ? 33  GLU A CB     1 
ATOM 1425 C CG     . GLU C 3 24 ? -101.894 17.509  -14.633 1.00 1.42 ? 33  GLU A CG     1 
ATOM 1426 C CD     . GLU C 3 24 ? -101.503 18.985  -14.737 1.00 1.81 ? 33  GLU A CD     1 
ATOM 1427 O OE1    . GLU C 3 24 ? -100.344 19.290  -14.510 1.00 2.56 ? 33  GLU A OE1    1 
ATOM 1428 O OE2    . GLU C 3 24 ? -102.373 19.785  -15.039 1.00 2.17 ? 33  GLU A OE2    1 
ATOM 1429 H H      . GLU C 3 24 ? -99.266  14.839  -13.567 1.00 0.85 ? 33  GLU A H      1 
ATOM 1430 H HA     . GLU C 3 24 ? -102.046 15.029  -14.336 1.00 1.01 ? 33  GLU A HA     1 
ATOM 1431 H HB2    . GLU C 3 24 ? -99.917  16.858  -14.130 1.00 1.38 ? 33  GLU A HB2    1 
ATOM 1432 H HB3    . GLU C 3 24 ? -100.260 16.831  -15.850 1.00 1.43 ? 33  GLU A HB3    1 
ATOM 1433 H HG2    . GLU C 3 24 ? -102.645 17.282  -15.375 1.00 1.95 ? 33  GLU A HG2    1 
ATOM 1434 H HG3    . GLU C 3 24 ? -102.292 17.314  -13.648 1.00 2.11 ? 33  GLU A HG3    1 
ATOM 1435 N N      . LEU C 3 25 ? -99.860  14.083  -16.594 1.00 0.78 ? 34  LEU A N      1 
ATOM 1436 C CA     . LEU C 3 25 ? -99.758  13.407  -17.918 1.00 0.79 ? 34  LEU A CA     1 
ATOM 1437 C C      . LEU C 3 25 ? -100.328 11.993  -17.800 1.00 0.81 ? 34  LEU A C      1 
ATOM 1438 O O      . LEU C 3 25 ? -100.714 11.383  -18.777 1.00 0.88 ? 34  LEU A O      1 
ATOM 1439 C CB     . LEU C 3 25 ? -98.284  13.339  -18.345 1.00 0.78 ? 34  LEU A CB     1 
ATOM 1440 C CG     . LEU C 3 25 ? -98.138  12.557  -19.662 1.00 0.94 ? 34  LEU A CG     1 
ATOM 1441 C CD1    . LEU C 3 25 ? -98.938  13.250  -20.778 1.00 1.54 ? 34  LEU A CD1    1 
ATOM 1442 C CD2    . LEU C 3 25 ? -96.656  12.493  -20.050 1.00 1.25 ? 34  LEU A CD2    1 
ATOM 1443 H H      . LEU C 3 25 ? -99.052  14.243  -16.064 1.00 0.76 ? 34  LEU A H      1 
ATOM 1444 H HA     . LEU C 3 25 ? -100.321 13.965  -18.650 1.00 0.88 ? 34  LEU A HA     1 
ATOM 1445 H HB2    . LEU C 3 25 ? -97.908  14.343  -18.483 1.00 0.86 ? 34  LEU A HB2    1 
ATOM 1446 H HB3    . LEU C 3 25 ? -97.711  12.847  -17.573 1.00 0.75 ? 34  LEU A HB3    1 
ATOM 1447 H HG     . LEU C 3 25 ? -98.509  11.552  -19.531 1.00 1.51 ? 34  LEU A HG     1 
ATOM 1448 H HD11   . LEU C 3 25 ? -98.867  14.322  -20.666 1.00 1.96 ? 34  LEU A HD11   1 
ATOM 1449 H HD12   . LEU C 3 25 ? -98.542  12.962  -21.742 1.00 1.99 ? 34  LEU A HD12   1 
ATOM 1450 H HD13   . LEU C 3 25 ? -99.973  12.950  -20.716 1.00 2.14 ? 34  LEU A HD13   1 
ATOM 1451 H HD21   . LEU C 3 25 ? -96.061  12.284  -19.172 1.00 1.75 ? 34  LEU A HD21   1 
ATOM 1452 H HD22   . LEU C 3 25 ? -96.510  11.706  -20.776 1.00 1.81 ? 34  LEU A HD22   1 
ATOM 1453 H HD23   . LEU C 3 25 ? -96.351  13.437  -20.476 1.00 1.73 ? 34  LEU A HD23   1 
ATOM 1454 N N      . LEU C 3 26 ? -100.373 11.464  -16.615 1.00 0.81 ? 35  LEU A N      1 
ATOM 1455 C CA     . LEU C 3 26 ? -100.903 10.085  -16.438 1.00 0.92 ? 35  LEU A CA     1 
ATOM 1456 C C      . LEU C 3 26 ? -102.411 10.069  -16.736 1.00 1.07 ? 35  LEU A C      1 
ATOM 1457 O O      . LEU C 3 26 ? -102.851 9.550   -17.742 1.00 1.26 ? 35  LEU A O      1 
ATOM 1458 C CB     . LEU C 3 26 ? -100.637 9.648   -14.985 1.00 0.96 ? 35  LEU A CB     1 
ATOM 1459 C CG     . LEU C 3 26 ? -100.414 8.107   -14.889 1.00 0.99 ? 35  LEU A CG     1 
ATOM 1460 C CD1    . LEU C 3 26 ? -98.921  7.812   -14.699 1.00 1.50 ? 35  LEU A CD1    1 
ATOM 1461 C CD2    . LEU C 3 26 ? -101.189 7.513   -13.699 1.00 1.32 ? 35  LEU A CD2    1 
ATOM 1462 H H      . LEU C 3 26 ? -100.048 11.969  -15.840 1.00 0.80 ? 35  LEU A H      1 
ATOM 1463 H HA     . LEU C 3 26 ? -100.392 9.424   -17.122 1.00 0.96 ? 35  LEU A HA     1 
ATOM 1464 H HB2    . LEU C 3 26 ? -99.755  10.164  -14.637 1.00 1.20 ? 35  LEU A HB2    1 
ATOM 1465 H HB3    . LEU C 3 26 ? -101.471 9.943   -14.365 1.00 1.19 ? 35  LEU A HB3    1 
ATOM 1466 H HG     . LEU C 3 26 ? -100.751 7.627   -15.799 1.00 1.54 ? 35  LEU A HG     1 
ATOM 1467 H HD11   . LEU C 3 26 ? -98.352  8.336   -15.453 1.00 2.18 ? 35  LEU A HD11   1 
ATOM 1468 H HD12   . LEU C 3 26 ? -98.607  8.143   -13.720 1.00 1.91 ? 35  LEU A HD12   1 
ATOM 1469 H HD13   . LEU C 3 26 ? -98.750  6.755   -14.790 1.00 1.84 ? 35  LEU A HD13   1 
ATOM 1470 H HD21   . LEU C 3 26 ? -102.187 7.913   -13.682 1.00 1.79 ? 35  LEU A HD21   1 
ATOM 1471 H HD22   . LEU C 3 26 ? -101.236 6.438   -13.806 1.00 1.91 ? 35  LEU A HD22   1 
ATOM 1472 H HD23   . LEU C 3 26 ? -100.690 7.762   -12.777 1.00 1.76 ? 35  LEU A HD23   1 
ATOM 1473 N N      . THR C 3 27 ? -103.199 10.650  -15.872 1.00 1.09 ? 36  THR A N      1 
ATOM 1474 C CA     . THR C 3 27 ? -104.672 10.689  -16.103 1.00 1.32 ? 36  THR A CA     1 
ATOM 1475 C C      . THR C 3 27 ? -104.925 11.719  -17.191 1.00 1.35 ? 36  THR A C      1 
ATOM 1476 O O      . THR C 3 27 ? -105.605 12.703  -16.970 1.00 1.60 ? 36  THR A O      1 
ATOM 1477 C CB     . THR C 3 27 ? -105.387 11.151  -14.825 1.00 1.46 ? 36  THR A CB     1 
ATOM 1478 O OG1    . THR C 3 27 ? -105.105 12.527  -14.609 1.00 1.74 ? 36  THR A OG1    1 
ATOM 1479 C CG2    . THR C 3 27 ? -104.915 10.346  -13.607 1.00 1.39 ? 36  THR A CG2    1 
ATOM 1480 H H      . THR C 3 27 ? -102.819 11.074  -15.075 1.00 1.00 ? 36  THR A H      1 
ATOM 1481 H HA     . THR C 3 27 ? -105.033 9.718   -16.409 1.00 1.54 ? 36  THR A HA     1 
ATOM 1482 H HB     . THR C 3 27 ? -106.452 11.021  -14.946 1.00 1.84 ? 36  THR A HB     1 
ATOM 1483 H HG1    . THR C 3 27 ? -105.796 13.043  -15.031 1.00 1.93 ? 36  THR A HG1    1 
ATOM 1484 H HG21   . THR C 3 27 ? -103.868 10.102  -13.704 1.00 1.57 ? 36  THR A HG21   1 
ATOM 1485 H HG22   . THR C 3 27 ? -105.061 10.940  -12.718 1.00 1.69 ? 36  THR A HG22   1 
ATOM 1486 H HG23   . THR C 3 27 ? -105.491 9.436   -13.528 1.00 1.97 ? 36  THR A HG23   1 
ATOM 1487 N N      . ASP C 3 28 ? -104.321 11.541  -18.343 1.00 1.38 ? 37  ASP A N      1 
ATOM 1488 C CA     . ASP C 3 28 ? -104.449 12.561  -19.428 1.00 1.57 ? 37  ASP A CA     1 
ATOM 1489 C C      . ASP C 3 28 ? -105.133 12.022  -20.701 1.00 1.57 ? 37  ASP A C      1 
ATOM 1490 O O      . ASP C 3 28 ? -106.211 11.465  -20.656 1.00 1.89 ? 37  ASP A O      1 
ATOM 1491 C CB     . ASP C 3 28 ? -103.028 13.056  -19.735 1.00 1.93 ? 37  ASP A CB     1 
ATOM 1492 C CG     . ASP C 3 28 ? -103.073 14.518  -20.106 1.00 2.55 ? 37  ASP A CG     1 
ATOM 1493 O OD1    . ASP C 3 28 ? -103.531 15.263  -19.271 1.00 3.18 ? 37  ASP A OD1    1 
ATOM 1494 O OD2    . ASP C 3 28 ? -102.654 14.860  -21.199 1.00 3.04 ? 37  ASP A OD2    1 
ATOM 1495 H H      . ASP C 3 28 ? -103.732 10.768  -18.468 1.00 1.46 ? 37  ASP A H      1 
ATOM 1496 H HA     . ASP C 3 28 ? -105.036 13.396  -19.066 1.00 1.69 ? 37  ASP A HA     1 
ATOM 1497 H HB2    . ASP C 3 28 ? -102.433 12.952  -18.847 1.00 2.26 ? 37  ASP A HB2    1 
ATOM 1498 H HB3    . ASP C 3 28 ? -102.583 12.485  -20.532 1.00 2.21 ? 37  ASP A HB3    1 
ATOM 1499 N N      . LYS C 3 29 ? -104.538 12.271  -21.841 1.00 1.59 ? 38  LYS A N      1 
ATOM 1500 C CA     . LYS C 3 29 ? -105.149 11.879  -23.148 1.00 1.78 ? 38  LYS A CA     1 
ATOM 1501 C C      . LYS C 3 29 ? -105.342 10.357  -23.270 1.00 1.55 ? 38  LYS A C      1 
ATOM 1502 O O      . LYS C 3 29 ? -105.669 9.698   -22.304 1.00 1.79 ? 38  LYS A O      1 
ATOM 1503 C CB     . LYS C 3 29 ? -104.289 12.529  -24.271 1.00 2.28 ? 38  LYS A CB     1 
ATOM 1504 C CG     . LYS C 3 29 ? -103.212 11.631  -24.946 1.00 2.62 ? 38  LYS A CG     1 
ATOM 1505 C CD     . LYS C 3 29 ? -102.558 10.614  -23.969 1.00 2.98 ? 38  LYS A CD     1 
ATOM 1506 C CE     . LYS C 3 29 ? -101.009 10.641  -24.036 1.00 3.49 ? 38  LYS A CE     1 
ATOM 1507 N NZ     . LYS C 3 29 ? -100.531 11.047  -25.390 1.00 4.29 ? 38  LYS A NZ     1 
ATOM 1508 H H      . LYS C 3 29 ? -103.701 12.779  -21.844 1.00 1.74 ? 38  LYS A H      1 
ATOM 1509 H HA     . LYS C 3 29 ? -106.133 12.327  -23.184 1.00 2.06 ? 38  LYS A HA     1 
ATOM 1510 H HB2    . LYS C 3 29 ? -104.942 12.906  -25.042 1.00 2.69 ? 38  LYS A HB2    1 
ATOM 1511 H HB3    . LYS C 3 29 ? -103.789 13.363  -23.825 1.00 2.63 ? 38  LYS A HB3    1 
ATOM 1512 H HG2    . LYS C 3 29 ? -103.661 11.103  -25.775 1.00 3.01 ? 38  LYS A HG2    1 
ATOM 1513 H HG3    . LYS C 3 29 ? -102.452 12.285  -25.345 1.00 2.98 ? 38  LYS A HG3    1 
ATOM 1514 H HD2    . LYS C 3 29 ? -102.858 10.820  -22.958 1.00 3.27 ? 38  LYS A HD2    1 
ATOM 1515 H HD3    . LYS C 3 29 ? -102.888 9.638   -24.233 1.00 3.18 ? 38  LYS A HD3    1 
ATOM 1516 H HE2    . LYS C 3 29 ? -100.631 11.339  -23.305 1.00 3.59 ? 38  LYS A HE2    1 
ATOM 1517 H HE3    . LYS C 3 29 ? -100.625 9.654   -23.809 1.00 3.61 ? 38  LYS A HE3    1 
ATOM 1518 H HZ1    . LYS C 3 29 ? -101.026 10.494  -26.117 1.00 4.54 ? 38  LYS A HZ1    1 
ATOM 1519 H HZ2    . LYS C 3 29 ? -100.720 12.060  -25.532 1.00 4.66 ? 38  LYS A HZ2    1 
ATOM 1520 H HZ3    . LYS C 3 29 ? -99.509  10.874  -25.461 1.00 4.61 ? 38  LYS A HZ3    1 
ATOM 1521 N N      . SER C 3 30 ? -105.213 9.801   -24.442 1.00 1.50 ? 39  SER A N      1 
ATOM 1522 C CA     . SER C 3 30 ? -105.466 8.336   -24.602 1.00 1.70 ? 39  SER A CA     1 
ATOM 1523 C C      . SER C 3 30 ? -104.442 7.508   -23.819 1.00 1.48 ? 39  SER A C      1 
ATOM 1524 O O      . SER C 3 30 ? -104.795 6.873   -22.856 1.00 2.09 ? 39  SER A O      1 
ATOM 1525 C CB     . SER C 3 30 ? -105.408 7.978   -26.095 1.00 2.13 ? 39  SER A CB     1 
ATOM 1526 O OG     . SER C 3 30 ? -106.555 7.209   -26.428 1.00 2.93 ? 39  SER A OG     1 
ATOM 1527 H H      . SER C 3 30 ? -105.002 10.347  -25.221 1.00 1.64 ? 39  SER A H      1 
ATOM 1528 H HA     . SER C 3 30 ? -106.453 8.111   -24.228 1.00 2.01 ? 39  SER A HA     1 
ATOM 1529 H HB2    . SER C 3 30 ? -105.410 8.882   -26.681 1.00 2.22 ? 39  SER A HB2    1 
ATOM 1530 H HB3    . SER C 3 30 ? -104.508 7.415   -26.317 1.00 2.39 ? 39  SER A HB3    1 
ATOM 1531 H HG     . SER C 3 30 ? -107.302 7.808   -26.492 1.00 3.13 ? 39  SER A HG     1 
ATOM 1532 N N      . CYS C 3 31 ? -103.202 7.515   -24.243 1.00 1.30 ? 40  CYS A N      1 
ATOM 1533 C CA     . CYS C 3 31 ? -102.119 6.742   -23.558 1.00 1.35 ? 40  CYS A CA     1 
ATOM 1534 C C      . CYS C 3 31 ? -102.156 5.299   -24.053 1.00 1.22 ? 40  CYS A C      1 
ATOM 1535 O O      . CYS C 3 31 ? -101.464 4.434   -23.557 1.00 1.30 ? 40  CYS A O      1 
ATOM 1536 C CB     . CYS C 3 31 ? -102.270 6.795   -22.023 1.00 1.83 ? 40  CYS A CB     1 
ATOM 1537 S SG     . CYS C 3 31 ? -102.198 8.516   -21.472 1.00 2.89 ? 40  CYS A SG     1 
ATOM 1538 H H      . CYS C 3 31 ? -102.975 8.041   -25.038 1.00 1.72 ? 40  CYS A H      1 
ATOM 1539 H HA     . CYS C 3 31 ? -101.168 7.179   -23.833 1.00 1.42 ? 40  CYS A HA     1 
ATOM 1540 H HB2    . CYS C 3 31 ? -103.192 6.349   -21.715 1.00 2.07 ? 40  CYS A HB2    1 
ATOM 1541 H HB3    . CYS C 3 31 ? -101.469 6.256   -21.569 1.00 2.09 ? 40  CYS A HB3    1 
ATOM 1542 H HG     . CYS C 3 31 ? -101.274 8.783   -21.464 1.00 3.23 ? 40  CYS A HG     1 
ATOM 1543 N N      . GLN C 3 32 ? -102.954 5.044   -25.052 1.00 1.26 ? 41  GLN A N      1 
ATOM 1544 C CA     . GLN C 3 32 ? -103.046 3.669   -25.622 1.00 1.33 ? 41  GLN A CA     1 
ATOM 1545 C C      . GLN C 3 32 ? -102.055 3.539   -26.787 1.00 1.25 ? 41  GLN A C      1 
ATOM 1546 O O      . GLN C 3 32 ? -101.530 2.477   -27.057 1.00 1.54 ? 41  GLN A O      1 
ATOM 1547 C CB     . GLN C 3 32 ? -104.481 3.445   -26.152 1.00 1.52 ? 41  GLN A CB     1 
ATOM 1548 C CG     . GLN C 3 32 ? -105.350 2.736   -25.110 1.00 1.49 ? 41  GLN A CG     1 
ATOM 1549 C CD     . GLN C 3 32 ? -106.694 2.381   -25.750 1.00 1.89 ? 41  GLN A CD     1 
ATOM 1550 O OE1    . GLN C 3 32 ? -107.016 2.868   -26.816 1.00 2.48 ? 41  GLN A OE1    1 
ATOM 1551 N NE2    . GLN C 3 32 ? -107.495 1.549   -25.147 1.00 2.33 ? 41  GLN A NE2    1 
ATOM 1552 H H      . GLN C 3 32 ? -103.490 5.767   -25.441 1.00 1.40 ? 41  GLN A H      1 
ATOM 1553 H HA     . GLN C 3 32 ? -102.811 2.937   -24.863 1.00 1.43 ? 41  GLN A HA     1 
ATOM 1554 H HB2    . GLN C 3 32 ? -104.923 4.403   -26.382 1.00 1.74 ? 41  GLN A HB2    1 
ATOM 1555 H HB3    . GLN C 3 32 ? -104.454 2.845   -27.053 1.00 2.03 ? 41  GLN A HB3    1 
ATOM 1556 H HG2    . GLN C 3 32 ? -104.857 1.832   -24.780 1.00 1.87 ? 41  GLN A HG2    1 
ATOM 1557 H HG3    . GLN C 3 32 ? -105.515 3.389   -24.266 1.00 1.74 ? 41  GLN A HG3    1 
ATOM 1558 H HE21   . GLN C 3 32 ? -107.235 1.154   -24.288 1.00 2.58 ? 41  GLN A HE21   1 
ATOM 1559 H HE22   . GLN C 3 32 ? -108.356 1.316   -25.553 1.00 2.81 ? 41  GLN A HE22   1 
ATOM 1560 N N      . SER C 3 33 ? -101.839 4.606   -27.507 1.00 1.30 ? 42  SER A N      1 
ATOM 1561 C CA     . SER C 3 33 ? -100.933 4.549   -28.693 1.00 1.35 ? 42  SER A CA     1 
ATOM 1562 C C      . SER C 3 33 ? -99.453  4.688   -28.296 1.00 1.20 ? 42  SER A C      1 
ATOM 1563 O O      . SER C 3 33 ? -98.583  4.346   -29.072 1.00 1.30 ? 42  SER A O      1 
ATOM 1564 C CB     . SER C 3 33 ? -101.331 5.681   -29.660 1.00 1.52 ? 42  SER A CB     1 
ATOM 1565 O OG     . SER C 3 33 ? -101.987 6.704   -28.924 1.00 2.13 ? 42  SER A OG     1 
ATOM 1566 H H      . SER C 3 33 ? -102.304 5.441   -27.289 1.00 1.57 ? 42  SER A H      1 
ATOM 1567 H HA     . SER C 3 33 ? -101.069 3.600   -29.191 1.00 1.55 ? 42  SER A HA     1 
ATOM 1568 H HB2    . SER C 3 33 ? -100.457 6.094   -30.138 1.00 1.80 ? 42  SER A HB2    1 
ATOM 1569 H HB3    . SER C 3 33 ? -101.999 5.292   -30.420 1.00 1.92 ? 42  SER A HB3    1 
ATOM 1570 H HG     . SER C 3 33 ? -102.798 6.928   -29.387 1.00 2.60 ? 42  SER A HG     1 
ATOM 1571 N N      . PHE C 3 34 ? -99.147  5.198   -27.125 1.00 1.06 ? 43  PHE A N      1 
ATOM 1572 C CA     . PHE C 3 34 ? -97.703  5.364   -26.731 1.00 1.02 ? 43  PHE A CA     1 
ATOM 1573 C C      . PHE C 3 34 ? -97.428  4.663   -25.408 1.00 0.90 ? 43  PHE A C      1 
ATOM 1574 O O      . PHE C 3 34 ? -96.309  4.643   -24.935 1.00 0.88 ? 43  PHE A O      1 
ATOM 1575 C CB     . PHE C 3 34 ? -97.393  6.853   -26.578 1.00 1.13 ? 43  PHE A CB     1 
ATOM 1576 C CG     . PHE C 3 34 ? -97.907  7.577   -27.793 1.00 1.18 ? 43  PHE A CG     1 
ATOM 1577 C CD1    . PHE C 3 34 ? -99.282  7.841   -27.913 1.00 1.29 ? 43  PHE A CD1    1 
ATOM 1578 C CD2    . PHE C 3 34 ? -97.019  7.976   -28.811 1.00 1.30 ? 43  PHE A CD2    1 
ATOM 1579 C CE1    . PHE C 3 34 ? -99.774  8.503   -29.050 1.00 1.41 ? 43  PHE A CE1    1 
ATOM 1580 C CE2    . PHE C 3 34 ? -97.510  8.642   -29.949 1.00 1.40 ? 43  PHE A CE2    1 
ATOM 1581 C CZ     . PHE C 3 34 ? -98.888  8.905   -30.070 1.00 1.41 ? 43  PHE A CZ     1 
ATOM 1582 H H      . PHE C 3 34 ? -99.858  5.486   -26.514 1.00 1.07 ? 43  PHE A H      1 
ATOM 1583 H HA     . PHE C 3 34 ? -97.054  4.946   -27.488 1.00 1.12 ? 43  PHE A HA     1 
ATOM 1584 H HB2    . PHE C 3 34 ? -97.877  7.237   -25.691 1.00 1.20 ? 43  PHE A HB2    1 
ATOM 1585 H HB3    . PHE C 3 34 ? -96.325  6.993   -26.499 1.00 1.25 ? 43  PHE A HB3    1 
ATOM 1586 H HD1    . PHE C 3 34 ? -99.960  7.535   -27.130 1.00 1.39 ? 43  PHE A HD1    1 
ATOM 1587 H HD2    . PHE C 3 34 ? -95.962  7.774   -28.715 1.00 1.43 ? 43  PHE A HD2    1 
ATOM 1588 H HE1    . PHE C 3 34 ? -100.830 8.703   -29.139 1.00 1.60 ? 43  PHE A HE1    1 
ATOM 1589 H HE2    . PHE C 3 34 ? -96.831  8.950   -30.730 1.00 1.58 ? 43  PHE A HE2    1 
ATOM 1590 H HZ     . PHE C 3 34 ? -99.266  9.411   -30.946 1.00 1.54 ? 43  PHE A HZ     1 
ATOM 1591 N N      . ILE C 3 35 ? -98.424  4.097   -24.795 1.00 0.86 ? 44  ILE A N      1 
ATOM 1592 C CA     . ILE C 3 35 ? -98.180  3.420   -23.498 1.00 0.79 ? 44  ILE A CA     1 
ATOM 1593 C C      . ILE C 3 35 ? -99.390  2.544   -23.143 1.00 0.81 ? 44  ILE A C      1 
ATOM 1594 O O      . ILE C 3 35 ? -100.245 2.316   -23.977 1.00 0.87 ? 44  ILE A O      1 
ATOM 1595 C CB     . ILE C 3 35 ? -97.926  4.510   -22.445 1.00 0.70 ? 44  ILE A CB     1 
ATOM 1596 C CG1    . ILE C 3 35 ? -97.361  3.909   -21.148 1.00 0.81 ? 44  ILE A CG1    1 
ATOM 1597 C CG2    . ILE C 3 35 ? -99.216  5.256   -22.137 1.00 0.88 ? 44  ILE A CG2    1 
ATOM 1598 C CD1    . ILE C 3 35 ? -96.458  4.944   -20.450 1.00 0.85 ? 44  ILE A CD1    1 
ATOM 1599 H H      . ILE C 3 35 ? -99.325  4.125   -25.179 1.00 0.91 ? 44  ILE A H      1 
ATOM 1600 H HA     . ILE C 3 35 ? -97.304  2.798   -23.590 1.00 0.83 ? 44  ILE A HA     1 
ATOM 1601 H HB     . ILE C 3 35 ? -97.213  5.215   -22.852 1.00 0.90 ? 44  ILE A HB     1 
ATOM 1602 H HG12   . ILE C 3 35 ? -98.172  3.635   -20.483 1.00 0.94 ? 44  ILE A HG12   1 
ATOM 1603 H HG13   . ILE C 3 35 ? -96.785  3.031   -21.383 1.00 1.06 ? 44  ILE A HG13   1 
ATOM 1604 H HG21   . ILE C 3 35 ? -99.587  5.709   -23.039 1.00 1.35 ? 44  ILE A HG21   1 
ATOM 1605 H HG22   . ILE C 3 35 ? -99.948  4.568   -21.743 1.00 1.41 ? 44  ILE A HG22   1 
ATOM 1606 H HG23   . ILE C 3 35 ? -99.021  6.024   -21.405 1.00 1.44 ? 44  ILE A HG23   1 
ATOM 1607 H HD11   . ILE C 3 35 ? -96.829  5.943   -20.633 1.00 1.18 ? 44  ILE A HD11   1 
ATOM 1608 H HD12   . ILE C 3 35 ? -96.456  4.760   -19.395 1.00 1.42 ? 44  ILE A HD12   1 
ATOM 1609 H HD13   . ILE C 3 35 ? -95.452  4.861   -20.833 1.00 1.41 ? 44  ILE A HD13   1 
ATOM 1610 N N      . SER C 3 36 ? -99.474  2.036   -21.926 1.00 0.81 ? 45  SER A N      1 
ATOM 1611 C CA     . SER C 3 36 ? -100.640 1.162   -21.553 1.00 0.87 ? 45  SER A CA     1 
ATOM 1612 C C      . SER C 3 36 ? -101.294 1.648   -20.245 1.00 0.82 ? 45  SER A C      1 
ATOM 1613 O O      . SER C 3 36 ? -100.702 1.626   -19.183 1.00 0.79 ? 45  SER A O      1 
ATOM 1614 C CB     . SER C 3 36 ? -100.149 -0.285  -21.401 1.00 0.97 ? 45  SER A CB     1 
ATOM 1615 O OG     . SER C 3 36 ? -101.101 -1.160  -21.994 1.00 1.40 ? 45  SER A OG     1 
ATOM 1616 H H      . SER C 3 36 ? -98.769  2.216   -21.267 1.00 0.80 ? 45  SER A H      1 
ATOM 1617 H HA     . SER C 3 36 ? -101.387 1.194   -22.335 1.00 0.91 ? 45  SER A HA     1 
ATOM 1618 H HB2    . SER C 3 36 ? -99.204  -0.398  -21.905 1.00 1.40 ? 45  SER A HB2    1 
ATOM 1619 H HB3    . SER C 3 36 ? -100.024 -0.532  -20.354 1.00 1.58 ? 45  SER A HB3    1 
ATOM 1620 H HG     . SER C 3 36 ? -100.669 -2.002  -22.156 1.00 1.81 ? 45  SER A HG     1 
ATOM 1621 N N      . TRP C 3 37 ? -102.529 2.071   -20.340 1.00 0.89 ? 46  TRP A N      1 
ATOM 1622 C CA     . TRP C 3 37 ? -103.298 2.559   -19.151 1.00 0.91 ? 46  TRP A CA     1 
ATOM 1623 C C      . TRP C 3 37 ? -104.474 1.583   -18.923 1.00 1.04 ? 46  TRP A C      1 
ATOM 1624 O O      . TRP C 3 37 ? -105.479 1.657   -19.602 1.00 1.29 ? 46  TRP A O      1 
ATOM 1625 C CB     . TRP C 3 37 ? -103.841 3.962   -19.509 1.00 0.98 ? 46  TRP A CB     1 
ATOM 1626 C CG     . TRP C 3 37 ? -103.847 4.910   -18.342 1.00 0.93 ? 46  TRP A CG     1 
ATOM 1627 C CD1    . TRP C 3 37 ? -103.674 6.245   -18.473 1.00 0.96 ? 46  TRP A CD1    1 
ATOM 1628 C CD2    . TRP C 3 37 ? -104.044 4.664   -16.910 1.00 0.94 ? 46  TRP A CD2    1 
ATOM 1629 N NE1    . TRP C 3 37 ? -103.759 6.839   -17.231 1.00 0.96 ? 46  TRP A NE1    1 
ATOM 1630 C CE2    . TRP C 3 37 ? -103.985 5.914   -16.235 1.00 0.93 ? 46  TRP A CE2    1 
ATOM 1631 C CE3    . TRP C 3 37 ? -104.267 3.505   -16.129 1.00 1.04 ? 46  TRP A CE3    1 
ATOM 1632 C CZ2    . TRP C 3 37 ? -104.146 6.008   -14.847 1.00 0.98 ? 46  TRP A CZ2    1 
ATOM 1633 C CZ3    . TRP C 3 37 ? -104.426 3.597   -14.731 1.00 1.12 ? 46  TRP A CZ3    1 
ATOM 1634 C CH2    . TRP C 3 37 ? -104.368 4.847   -14.093 1.00 1.07 ? 46  TRP A CH2    1 
ATOM 1635 H H      . TRP C 3 37 ? -102.967 2.062   -21.215 1.00 0.97 ? 46  TRP A H      1 
ATOM 1636 H HA     . TRP C 3 37 ? -102.663 2.609   -18.270 1.00 0.86 ? 46  TRP A HA     1 
ATOM 1637 H HB2    . TRP C 3 37 ? -103.218 4.383   -20.282 1.00 1.03 ? 46  TRP A HB2    1 
ATOM 1638 H HB3    . TRP C 3 37 ? -104.849 3.877   -19.896 1.00 1.11 ? 46  TRP A HB3    1 
ATOM 1639 H HD1    . TRP C 3 37 ? -103.501 6.762   -19.405 1.00 1.04 ? 46  TRP A HD1    1 
ATOM 1640 H HE1    . TRP C 3 37 ? -103.671 7.800   -17.057 1.00 1.02 ? 46  TRP A HE1    1 
ATOM 1641 H HE3    . TRP C 3 37 ? -104.309 2.549   -16.596 1.00 1.11 ? 46  TRP A HE3    1 
ATOM 1642 H HZ2    . TRP C 3 37 ? -104.108 6.966   -14.364 1.00 1.01 ? 46  TRP A HZ2    1 
ATOM 1643 H HZ3    . TRP C 3 37 ? -104.598 2.703   -14.149 1.00 1.26 ? 46  TRP A HZ3    1 
ATOM 1644 H HH2    . TRP C 3 37 ? -104.490 4.913   -13.022 1.00 1.16 ? 46  TRP A HH2    1 
ATOM 1645 N N      . THR C 3 38 ? -104.378 0.672   -17.986 1.00 1.08 ? 47  THR A N      1 
ATOM 1646 C CA     . THR C 3 38 ? -105.528 -0.260  -17.780 1.00 1.23 ? 47  THR A CA     1 
ATOM 1647 C C      . THR C 3 38 ? -106.774 0.579   -17.495 1.00 1.27 ? 47  THR A C      1 
ATOM 1648 O O      . THR C 3 38 ? -106.684 1.718   -17.080 1.00 1.33 ? 47  THR A O      1 
ATOM 1649 C CB     . THR C 3 38 ? -105.294 -1.235  -16.593 1.00 1.40 ? 47  THR A CB     1 
ATOM 1650 O OG1    . THR C 3 38 ? -106.100 -0.845  -15.485 1.00 1.82 ? 47  THR A OG1    1 
ATOM 1651 C CG2    . THR C 3 38 ? -103.831 -1.230  -16.152 1.00 2.03 ? 47  THR A CG2    1 
ATOM 1652 H H      . THR C 3 38 ? -103.572 0.607   -17.433 1.00 1.15 ? 47  THR A H      1 
ATOM 1653 H HA     . THR C 3 38 ? -105.685 -0.826  -18.690 1.00 1.36 ? 47  THR A HA     1 
ATOM 1654 H HB     . THR C 3 38 ? -105.569 -2.238  -16.891 1.00 1.80 ? 47  THR A HB     1 
ATOM 1655 H HG1    . THR C 3 38 ? -105.687 -0.085  -15.067 1.00 2.19 ? 47  THR A HG1    1 
ATOM 1656 H HG21   . THR C 3 38 ? -103.184 -1.112  -17.006 1.00 2.57 ? 47  THR A HG21   1 
ATOM 1657 H HG22   . THR C 3 38 ? -103.679 -0.421  -15.466 1.00 2.46 ? 47  THR A HG22   1 
ATOM 1658 H HG23   . THR C 3 38 ? -103.601 -2.162  -15.655 1.00 2.37 ? 47  THR A HG23   1 
ATOM 1659 N N      . GLY C 3 39 ? -107.934 0.017   -17.703 1.00 1.49 ? 48  GLY A N      1 
ATOM 1660 C CA     . GLY C 3 39 ? -109.207 0.757   -17.435 1.00 1.65 ? 48  GLY A CA     1 
ATOM 1661 C C      . GLY C 3 39 ? -109.895 0.112   -16.235 1.00 1.68 ? 48  GLY A C      1 
ATOM 1662 O O      . GLY C 3 39 ? -111.065 -0.215  -16.285 1.00 2.12 ? 48  GLY A O      1 
ATOM 1663 H H      . GLY C 3 39 ? -107.971 -0.907  -18.027 1.00 1.68 ? 48  GLY A H      1 
ATOM 1664 H HA2    . GLY C 3 39 ? -109.003 1.799   -17.224 1.00 1.77 ? 48  GLY A HA2    1 
ATOM 1665 H HA3    . GLY C 3 39 ? -109.853 0.682   -18.295 1.00 1.98 ? 48  GLY A HA3    1 
ATOM 1666 N N      . ASP C 3 40 ? -109.168 -0.097  -15.158 1.00 1.66 ? 49  ASP A N      1 
ATOM 1667 C CA     . ASP C 3 40 ? -109.766 -0.750  -13.948 1.00 1.99 ? 49  ASP A CA     1 
ATOM 1668 C C      . ASP C 3 40 ? -109.468 0.099   -12.686 1.00 1.68 ? 49  ASP A C      1 
ATOM 1669 O O      . ASP C 3 40 ? -109.983 1.190   -12.544 1.00 1.69 ? 49  ASP A O      1 
ATOM 1670 C CB     . ASP C 3 40 ? -109.190 -2.193  -13.852 1.00 2.64 ? 49  ASP A CB     1 
ATOM 1671 C CG     . ASP C 3 40 ? -110.307 -3.215  -13.585 1.00 3.10 ? 49  ASP A CG     1 
ATOM 1672 O OD1    . ASP C 3 40 ? -111.392 -3.034  -14.112 1.00 3.61 ? 49  ASP A OD1    1 
ATOM 1673 O OD2    . ASP C 3 40 ? -110.050 -4.168  -12.869 1.00 3.46 ? 49  ASP A OD2    1 
ATOM 1674 H H      . ASP C 3 40 ? -108.222 0.162   -15.154 1.00 1.74 ? 49  ASP A H      1 
ATOM 1675 H HA     . ASP C 3 40 ? -110.840 -0.797  -14.064 1.00 2.32 ? 49  ASP A HA     1 
ATOM 1676 H HB2    . ASP C 3 40 ? -108.713 -2.438  -14.788 1.00 2.93 ? 49  ASP A HB2    1 
ATOM 1677 H HB3    . ASP C 3 40 ? -108.458 -2.261  -13.071 1.00 3.12 ? 49  ASP A HB3    1 
ATOM 1678 N N      . GLY C 3 41 ? -108.670 -0.383  -11.764 1.00 1.57 ? 50  GLY A N      1 
ATOM 1679 C CA     . GLY C 3 41 ? -108.388 0.402   -10.529 1.00 1.45 ? 50  GLY A CA     1 
ATOM 1680 C C      . GLY C 3 41 ? -107.294 1.434   -10.792 1.00 1.34 ? 50  GLY A C      1 
ATOM 1681 O O      . GLY C 3 41 ? -107.559 2.523   -11.259 1.00 1.38 ? 50  GLY A O      1 
ATOM 1682 H H      . GLY C 3 41 ? -108.270 -1.263  -11.873 1.00 1.69 ? 50  GLY A H      1 
ATOM 1683 H HA2    . GLY C 3 41 ? -109.289 0.907   -10.212 1.00 1.49 ? 50  GLY A HA2    1 
ATOM 1684 H HA3    . GLY C 3 41 ? -108.062 -0.269  -9.749  1.00 1.55 ? 50  GLY A HA3    1 
ATOM 1685 N N      . TRP C 3 42 ? -106.061 1.112   -10.487 1.00 1.27 ? 51  TRP A N      1 
ATOM 1686 C CA     . TRP C 3 42 ? -104.963 2.097   -10.716 1.00 1.18 ? 51  TRP A CA     1 
ATOM 1687 C C      . TRP C 3 42 ? -103.651 1.373   -11.019 1.00 1.13 ? 51  TRP A C      1 
ATOM 1688 O O      . TRP C 3 42 ? -102.771 1.292   -10.186 1.00 1.20 ? 51  TRP A O      1 
ATOM 1689 C CB     . TRP C 3 42 ? -104.779 2.961   -9.464  1.00 1.20 ? 51  TRP A CB     1 
ATOM 1690 C CG     . TRP C 3 42 ? -103.971 4.173   -9.808  1.00 1.10 ? 51  TRP A CG     1 
ATOM 1691 C CD1    . TRP C 3 42 ? -102.617 4.227   -9.854  1.00 1.08 ? 51  TRP A CD1    1 
ATOM 1692 C CD2    . TRP C 3 42 ? -104.445 5.505   -10.155 1.00 1.13 ? 51  TRP A CD2    1 
ATOM 1693 N NE1    . TRP C 3 42 ? -102.231 5.506   -10.213 1.00 1.01 ? 51  TRP A NE1    1 
ATOM 1694 C CE2    . TRP C 3 42 ? -103.317 6.332   -10.407 1.00 1.02 ? 51  TRP A CE2    1 
ATOM 1695 C CE3    . TRP C 3 42 ? -105.734 6.074   -10.277 1.00 1.39 ? 51  TRP A CE3    1 
ATOM 1696 C CZ2    . TRP C 3 42 ? -103.462 7.677   -10.766 1.00 1.10 ? 51  TRP A CZ2    1 
ATOM 1697 C CZ3    . TRP C 3 42 ? -105.883 7.430   -10.637 1.00 1.53 ? 51  TRP A CZ3    1 
ATOM 1698 C CH2    . TRP C 3 42 ? -104.749 8.228   -10.881 1.00 1.37 ? 51  TRP A CH2    1 
ATOM 1699 H H      . TRP C 3 42 ? -105.862 0.232   -10.104 1.00 1.32 ? 51  TRP A H      1 
ATOM 1700 H HA     . TRP C 3 42 ? -105.218 2.733   -11.555 1.00 1.18 ? 51  TRP A HA     1 
ATOM 1701 H HB2    . TRP C 3 42 ? -105.746 3.266   -9.092  1.00 1.29 ? 51  TRP A HB2    1 
ATOM 1702 H HB3    . TRP C 3 42 ? -104.265 2.390   -8.704  1.00 1.23 ? 51  TRP A HB3    1 
ATOM 1703 H HD1    . TRP C 3 42 ? -101.948 3.406   -9.647  1.00 1.21 ? 51  TRP A HD1    1 
ATOM 1704 H HE1    . TRP C 3 42 ? -101.306 5.808   -10.320 1.00 1.05 ? 51  TRP A HE1    1 
ATOM 1705 H HE3    . TRP C 3 42 ? -106.608 5.468   -10.092 1.00 1.53 ? 51  TRP A HE3    1 
ATOM 1706 H HZ2    . TRP C 3 42 ? -102.590 8.286   -10.953 1.00 1.04 ? 51  TRP A HZ2    1 
ATOM 1707 H HZ3    . TRP C 3 42 ? -106.872 7.857   -10.727 1.00 1.81 ? 51  TRP A HZ3    1 
ATOM 1708 H HH2    . TRP C 3 42 ? -104.868 9.263   -11.153 1.00 1.51 ? 51  TRP A HH2    1 
ATOM 1709 N N      . GLU C 3 43 ? -103.505 0.878   -12.217 1.00 1.11 ? 52  GLU A N      1 
ATOM 1710 C CA     . GLU C 3 43 ? -102.240 0.189   -12.620 1.00 1.07 ? 52  GLU A CA     1 
ATOM 1711 C C      . GLU C 3 43 ? -101.694 0.931   -13.839 1.00 1.00 ? 52  GLU A C      1 
ATOM 1712 O O      . GLU C 3 43 ? -102.423 1.265   -14.747 1.00 1.15 ? 52  GLU A O      1 
ATOM 1713 C CB     . GLU C 3 43 ? -102.536 -1.288  -12.963 1.00 1.12 ? 52  GLU A CB     1 
ATOM 1714 C CG     . GLU C 3 43 ? -102.272 -2.171  -11.735 1.00 1.61 ? 52  GLU A CG     1 
ATOM 1715 C CD     . GLU C 3 43 ? -102.941 -3.534  -11.922 1.00 2.10 ? 52  GLU A CD     1 
ATOM 1716 O OE1    . GLU C 3 43 ? -102.419 -4.328  -12.686 1.00 2.59 ? 52  GLU A OE1    1 
ATOM 1717 O OE2    . GLU C 3 43 ? -103.963 -3.760  -11.296 1.00 2.71 ? 52  GLU A OE2    1 
ATOM 1718 H H      . GLU C 3 43 ? -104.226 0.982   -12.873 1.00 1.19 ? 52  GLU A H      1 
ATOM 1719 H HA     . GLU C 3 43 ? -101.510 0.247   -11.822 1.00 1.07 ? 52  GLU A HA     1 
ATOM 1720 H HB2    . GLU C 3 43 ? -103.571 -1.384  -13.256 1.00 1.30 ? 52  GLU A HB2    1 
ATOM 1721 H HB3    . GLU C 3 43 ? -101.901 -1.613  -13.776 1.00 1.35 ? 52  GLU A HB3    1 
ATOM 1722 H HG2    . GLU C 3 43 ? -101.207 -2.308  -11.616 1.00 2.19 ? 52  GLU A HG2    1 
ATOM 1723 H HG3    . GLU C 3 43 ? -102.673 -1.692  -10.854 1.00 1.96 ? 52  GLU A HG3    1 
ATOM 1724 N N      . PHE C 3 44 ? -100.429 1.239   -13.850 1.00 0.84 ? 53  PHE A N      1 
ATOM 1725 C CA     . PHE C 3 44 ? -99.856  1.999   -15.002 1.00 0.78 ? 53  PHE A CA     1 
ATOM 1726 C C      . PHE C 3 44 ? -98.535  1.373   -15.443 1.00 0.78 ? 53  PHE A C      1 
ATOM 1727 O O      . PHE C 3 44 ? -97.578  1.357   -14.693 1.00 0.80 ? 53  PHE A O      1 
ATOM 1728 C CB     . PHE C 3 44 ? -99.601  3.427   -14.537 1.00 0.76 ? 53  PHE A CB     1 
ATOM 1729 C CG     . PHE C 3 44 ? -99.285  4.302   -15.720 1.00 0.72 ? 53  PHE A CG     1 
ATOM 1730 C CD1    . PHE C 3 44 ? -100.329 4.786   -16.528 1.00 0.78 ? 53  PHE A CD1    1 
ATOM 1731 C CD2    . PHE C 3 44 ? -97.951  4.646   -16.005 1.00 0.70 ? 53  PHE A CD2    1 
ATOM 1732 C CE1    . PHE C 3 44 ? -100.042 5.618   -17.623 1.00 0.79 ? 53  PHE A CE1    1 
ATOM 1733 C CE2    . PHE C 3 44 ? -97.659  5.477   -17.100 1.00 0.72 ? 53  PHE A CE2    1 
ATOM 1734 C CZ     . PHE C 3 44 ? -98.706  5.966   -17.912 1.00 0.75 ? 53  PHE A CZ     1 
ATOM 1735 H H      . PHE C 3 44 ? -99.860  1.003   -13.086 1.00 0.81 ? 53  PHE A H      1 
ATOM 1736 H HA     . PHE C 3 44 ? -100.543 2.010   -15.836 1.00 0.81 ? 53  PHE A HA     1 
ATOM 1737 H HB2    . PHE C 3 44 ? -100.482 3.804   -14.037 1.00 0.81 ? 53  PHE A HB2    1 
ATOM 1738 H HB3    . PHE C 3 44 ? -98.768  3.436   -13.850 1.00 0.76 ? 53  PHE A HB3    1 
ATOM 1739 H HD1    . PHE C 3 44 ? -101.352 4.520   -16.306 1.00 0.84 ? 53  PHE A HD1    1 
ATOM 1740 H HD2    . PHE C 3 44 ? -97.151  4.271   -15.383 1.00 0.72 ? 53  PHE A HD2    1 
ATOM 1741 H HE1    . PHE C 3 44 ? -100.848 5.990   -18.241 1.00 0.87 ? 53  PHE A HE1    1 
ATOM 1742 H HE2    . PHE C 3 44 ? -96.634  5.746   -17.313 1.00 0.74 ? 53  PHE A HE2    1 
ATOM 1743 H HZ     . PHE C 3 44 ? -98.483  6.605   -18.754 1.00 0.79 ? 53  PHE A HZ     1 
ATOM 1744 N N      . LYS C 3 45 ? -98.460  0.880   -16.666 1.00 0.80 ? 54  LYS A N      1 
ATOM 1745 C CA     . LYS C 3 45 ? -97.176  0.281   -17.162 1.00 0.86 ? 54  LYS A CA     1 
ATOM 1746 C C      . LYS C 3 45 ? -96.622  1.129   -18.298 1.00 0.77 ? 54  LYS A C      1 
ATOM 1747 O O      . LYS C 3 45 ? -97.344  1.677   -19.114 1.00 0.71 ? 54  LYS A O      1 
ATOM 1748 C CB     . LYS C 3 45 ? -97.353  -1.177  -17.669 1.00 1.04 ? 54  LYS A CB     1 
ATOM 1749 C CG     . LYS C 3 45 ? -98.801  -1.661  -17.527 1.00 1.58 ? 54  LYS A CG     1 
ATOM 1750 C CD     . LYS C 3 45 ? -99.004  -2.939  -18.396 1.00 1.59 ? 54  LYS A CD     1 
ATOM 1751 C CE     . LYS C 3 45 ? -99.718  -4.035  -17.602 1.00 1.92 ? 54  LYS A CE     1 
ATOM 1752 N NZ     . LYS C 3 45 ? -99.670  -5.301  -18.384 1.00 2.49 ? 54  LYS A NZ     1 
ATOM 1753 H H      . LYS C 3 45 ? -99.240  0.924   -17.259 1.00 0.81 ? 54  LYS A H      1 
ATOM 1754 H HA     . LYS C 3 45 ? -96.448  0.292   -16.368 1.00 0.92 ? 54  LYS A HA     1 
ATOM 1755 H HB2    . LYS C 3 45 ? -97.069  -1.241  -18.713 1.00 1.60 ? 54  LYS A HB2    1 
ATOM 1756 H HB3    . LYS C 3 45 ? -96.711  -1.835  -17.099 1.00 1.53 ? 54  LYS A HB3    1 
ATOM 1757 H HG2    . LYS C 3 45 ? -99.000  -1.875  -16.485 1.00 2.16 ? 54  LYS A HG2    1 
ATOM 1758 H HG3    . LYS C 3 45 ? -99.475  -0.887  -17.866 1.00 2.21 ? 54  LYS A HG3    1 
ATOM 1759 H HD2    . LYS C 3 45 ? -99.598  -2.694  -19.264 1.00 2.00 ? 54  LYS A HD2    1 
ATOM 1760 H HD3    . LYS C 3 45 ? -98.047  -3.324  -18.726 1.00 1.83 ? 54  LYS A HD3    1 
ATOM 1761 H HE2    . LYS C 3 45 ? -99.221  -4.178  -16.654 1.00 2.40 ? 54  LYS A HE2    1 
ATOM 1762 H HE3    . LYS C 3 45 ? -100.745 -3.750  -17.435 1.00 2.27 ? 54  LYS A HE3    1 
ATOM 1763 H HZ1    . LYS C 3 45 ? -99.545  -5.081  -19.393 1.00 2.86 ? 54  LYS A HZ1    1 
ATOM 1764 H HZ2    . LYS C 3 45 ? -98.870  -5.880  -18.058 1.00 2.82 ? 54  LYS A HZ2    1 
ATOM 1765 H HZ3    . LYS C 3 45 ? -100.557 -5.826  -18.250 1.00 2.95 ? 54  LYS A HZ3    1 
ATOM 1766 N N      . LEU C 3 46 ? -95.327  1.207   -18.355 1.00 0.82 ? 55  LEU A N      1 
ATOM 1767 C CA     . LEU C 3 46 ? -94.656  1.978   -19.422 1.00 0.78 ? 55  LEU A CA     1 
ATOM 1768 C C      . LEU C 3 46 ? -94.286  1.035   -20.571 1.00 0.85 ? 55  LEU A C      1 
ATOM 1769 O O      . LEU C 3 46 ? -93.244  0.411   -20.565 1.00 0.97 ? 55  LEU A O      1 
ATOM 1770 C CB     . LEU C 3 46 ? -93.411  2.625   -18.830 1.00 0.85 ? 55  LEU A CB     1 
ATOM 1771 C CG     . LEU C 3 46 ? -93.803  3.939   -18.138 1.00 0.78 ? 55  LEU A CG     1 
ATOM 1772 C CD1    . LEU C 3 46 ? -94.893  3.662   -17.090 1.00 1.31 ? 55  LEU A CD1    1 
ATOM 1773 C CD2    . LEU C 3 46 ? -92.572  4.556   -17.463 1.00 1.20 ? 55  LEU A CD2    1 
ATOM 1774 H H      . LEU C 3 46 ? -94.785  0.735   -17.689 1.00 0.92 ? 55  LEU A H      1 
ATOM 1775 H HA     . LEU C 3 46 ? -95.314  2.740   -19.786 1.00 0.71 ? 55  LEU A HA     1 
ATOM 1776 H HB2    . LEU C 3 46 ? -92.968  1.955   -18.107 1.00 0.97 ? 55  LEU A HB2    1 
ATOM 1777 H HB3    . LEU C 3 46 ? -92.706  2.826   -19.608 1.00 0.92 ? 55  LEU A HB3    1 
ATOM 1778 H HG     . LEU C 3 46 ? -94.188  4.626   -18.878 1.00 1.03 ? 55  LEU A HG     1 
ATOM 1779 H HD11   . LEU C 3 46 ? -94.671  2.749   -16.574 1.00 1.84 ? 55  LEU A HD11   1 
ATOM 1780 H HD12   . LEU C 3 46 ? -94.929  4.476   -16.381 1.00 1.81 ? 55  LEU A HD12   1 
ATOM 1781 H HD13   . LEU C 3 46 ? -95.848  3.565   -17.575 1.00 1.72 ? 55  LEU A HD13   1 
ATOM 1782 H HD21   . LEU C 3 46 ? -91.696  4.340   -18.053 1.00 1.72 ? 55  LEU A HD21   1 
ATOM 1783 H HD22   . LEU C 3 46 ? -92.698  5.627   -17.391 1.00 1.66 ? 55  LEU A HD22   1 
ATOM 1784 H HD23   . LEU C 3 46 ? -92.453  4.141   -16.473 1.00 1.77 ? 55  LEU A HD23   1 
ATOM 1785 N N      . SER C 3 47 ? -95.137  0.920   -21.554 1.00 0.84 ? 56  SER A N      1 
ATOM 1786 C CA     . SER C 3 47 ? -94.839  0.009   -22.696 1.00 0.94 ? 56  SER A CA     1 
ATOM 1787 C C      . SER C 3 47 ? -93.803  0.650   -23.630 1.00 0.89 ? 56  SER A C      1 
ATOM 1788 O O      . SER C 3 47 ? -92.766  0.076   -23.898 1.00 0.92 ? 56  SER A O      1 
ATOM 1789 C CB     . SER C 3 47 ? -96.135  -0.272  -23.471 1.00 1.05 ? 56  SER A CB     1 
ATOM 1790 O OG     . SER C 3 47 ? -95.843  -0.402  -24.857 1.00 1.71 ? 56  SER A OG     1 
ATOM 1791 H H      . SER C 3 47 ? -95.976  1.426   -21.538 1.00 0.81 ? 56  SER A H      1 
ATOM 1792 H HA     . SER C 3 47 ? -94.441  -0.920  -22.313 1.00 1.05 ? 56  SER A HA     1 
ATOM 1793 H HB2    . SER C 3 47 ? -96.581  -1.189  -23.119 1.00 1.57 ? 56  SER A HB2    1 
ATOM 1794 H HB3    . SER C 3 47 ? -96.829  0.541   -23.313 1.00 1.40 ? 56  SER A HB3    1 
ATOM 1795 H HG     . SER C 3 47 ? -96.608  -0.793  -25.286 1.00 2.09 ? 56  SER A HG     1 
ATOM 1796 N N      . ASP C 3 48 ? -94.079  1.825   -24.141 1.00 0.85 ? 57  ASP A N      1 
ATOM 1797 C CA     . ASP C 3 48 ? -93.111  2.493   -25.074 1.00 0.86 ? 57  ASP A CA     1 
ATOM 1798 C C      . ASP C 3 48 ? -93.030  4.004   -24.770 1.00 0.83 ? 57  ASP A C      1 
ATOM 1799 O O      . ASP C 3 48 ? -93.588  4.799   -25.501 1.00 0.90 ? 57  ASP A O      1 
ATOM 1800 C CB     . ASP C 3 48 ? -93.587  2.273   -26.531 1.00 0.99 ? 57  ASP A CB     1 
ATOM 1801 C CG     . ASP C 3 48 ? -92.916  1.033   -27.154 1.00 1.64 ? 57  ASP A CG     1 
ATOM 1802 O OD1    . ASP C 3 48 ? -92.093  0.418   -26.496 1.00 2.33 ? 57  ASP A OD1    1 
ATOM 1803 O OD2    . ASP C 3 48 ? -93.238  0.725   -28.290 1.00 2.27 ? 57  ASP A OD2    1 
ATOM 1804 H H      . ASP C 3 48 ? -94.925  2.266   -23.920 1.00 0.85 ? 57  ASP A H      1 
ATOM 1805 H HA     . ASP C 3 48 ? -92.132  2.065   -24.952 1.00 0.88 ? 57  ASP A HA     1 
ATOM 1806 H HB2    . ASP C 3 48 ? -94.657  2.125   -26.530 1.00 1.54 ? 57  ASP A HB2    1 
ATOM 1807 H HB3    . ASP C 3 48 ? -93.351  3.139   -27.134 1.00 1.18 ? 57  ASP A HB3    1 
ATOM 1808 N N      . PRO C 3 49 ? -92.326  4.372   -23.719 1.00 0.79 ? 58  PRO A N      1 
ATOM 1809 C CA     . PRO C 3 49 ? -92.169  5.795   -23.363 1.00 0.80 ? 58  PRO A CA     1 
ATOM 1810 C C      . PRO C 3 49 ? -91.194  6.453   -24.354 1.00 0.83 ? 58  PRO A C      1 
ATOM 1811 O O      . PRO C 3 49 ? -90.223  7.074   -23.974 1.00 0.84 ? 58  PRO A O      1 
ATOM 1812 C CB     . PRO C 3 49 ? -91.580  5.765   -21.937 1.00 0.83 ? 58  PRO A CB     1 
ATOM 1813 C CG     . PRO C 3 49 ? -91.003  4.343   -21.729 1.00 0.93 ? 58  PRO A CG     1 
ATOM 1814 C CD     . PRO C 3 49 ? -91.647  3.431   -22.797 1.00 0.84 ? 58  PRO A CD     1 
ATOM 1815 H HA     . PRO C 3 49 ? -93.124  6.300   -23.370 1.00 0.82 ? 58  PRO A HA     1 
ATOM 1816 H HB2    . PRO C 3 49 ? -90.801  6.508   -21.825 1.00 0.83 ? 58  PRO A HB2    1 
ATOM 1817 H HB3    . PRO C 3 49 ? -92.361  5.947   -21.212 1.00 0.90 ? 58  PRO A HB3    1 
ATOM 1818 H HG2    . PRO C 3 49 ? -89.927  4.363   -21.857 1.00 1.03 ? 58  PRO A HG2    1 
ATOM 1819 H HG3    . PRO C 3 49 ? -91.238  3.987   -20.747 1.00 1.09 ? 58  PRO A HG3    1 
ATOM 1820 H HD2    . PRO C 3 49 ? -90.882  2.868   -23.312 1.00 0.88 ? 58  PRO A HD2    1 
ATOM 1821 H HD3    . PRO C 3 49 ? -92.373  2.766   -22.348 1.00 0.85 ? 58  PRO A HD3    1 
ATOM 1822 N N      . ASP C 3 50 ? -91.441  6.319   -25.626 1.00 0.92 ? 59  ASP A N      1 
ATOM 1823 C CA     . ASP C 3 50 ? -90.520  6.933   -26.624 1.00 1.00 ? 59  ASP A CA     1 
ATOM 1824 C C      . ASP C 3 50 ? -90.683  8.457   -26.596 1.00 0.93 ? 59  ASP A C      1 
ATOM 1825 O O      . ASP C 3 50 ? -89.719  9.195   -26.661 1.00 0.94 ? 59  ASP A O      1 
ATOM 1826 C CB     . ASP C 3 50 ? -90.858  6.389   -28.030 1.00 1.17 ? 59  ASP A CB     1 
ATOM 1827 C CG     . ASP C 3 50 ? -90.014  5.146   -28.361 1.00 1.93 ? 59  ASP A CG     1 
ATOM 1828 O OD1    . ASP C 3 50 ? -89.161  4.789   -27.566 1.00 2.59 ? 59  ASP A OD1    1 
ATOM 1829 O OD2    . ASP C 3 50 ? -90.238  4.574   -29.415 1.00 2.53 ? 59  ASP A OD2    1 
ATOM 1830 H H      . ASP C 3 50 ? -92.227  5.814   -25.925 1.00 0.97 ? 59  ASP A H      1 
ATOM 1831 H HA     . ASP C 3 50 ? -89.503  6.690   -26.367 1.00 1.04 ? 59  ASP A HA     1 
ATOM 1832 H HB2    . ASP C 3 50 ? -91.902  6.119   -28.058 1.00 1.35 ? 59  ASP A HB2    1 
ATOM 1833 H HB3    . ASP C 3 50 ? -90.670  7.151   -28.775 1.00 1.54 ? 59  ASP A HB3    1 
ATOM 1834 N N      . GLU C 3 51 ? -91.890  8.934   -26.498 1.00 0.90 ? 60  GLU A N      1 
ATOM 1835 C CA     . GLU C 3 51 ? -92.106  10.406  -26.468 1.00 0.88 ? 60  GLU A CA     1 
ATOM 1836 C C      . GLU C 3 51 ? -91.931  10.906  -25.042 1.00 0.82 ? 60  GLU A C      1 
ATOM 1837 O O      . GLU C 3 51 ? -91.386  11.965  -24.801 1.00 0.83 ? 60  GLU A O      1 
ATOM 1838 C CB     . GLU C 3 51 ? -93.528  10.711  -26.948 1.00 0.95 ? 60  GLU A CB     1 
ATOM 1839 C CG     . GLU C 3 51 ? -93.675  10.366  -28.455 1.00 1.38 ? 60  GLU A CG     1 
ATOM 1840 C CD     . GLU C 3 51 ? -93.663  11.648  -29.297 1.00 1.79 ? 60  GLU A CD     1 
ATOM 1841 O OE1    . GLU C 3 51 ? -94.593  12.426  -29.165 1.00 2.41 ? 60  GLU A OE1    1 
ATOM 1842 O OE2    . GLU C 3 51 ? -92.726  11.827  -30.056 1.00 2.32 ? 60  GLU A OE2    1 
ATOM 1843 H H      . GLU C 3 51 ? -92.656  8.325   -26.439 1.00 0.92 ? 60  GLU A H      1 
ATOM 1844 H HA     . GLU C 3 51 ? -91.393  10.896  -27.111 1.00 0.91 ? 60  GLU A HA     1 
ATOM 1845 H HB2    . GLU C 3 51 ? -94.225  10.117  -26.371 1.00 1.20 ? 60  GLU A HB2    1 
ATOM 1846 H HB3    . GLU C 3 51 ? -93.739  11.758  -26.786 1.00 1.24 ? 60  GLU A HB3    1 
ATOM 1847 H HG2    . GLU C 3 51 ? -92.861  9.727   -28.772 1.00 1.86 ? 60  GLU A HG2    1 
ATOM 1848 H HG3    . GLU C 3 51 ? -94.610  9.848   -28.616 1.00 1.98 ? 60  GLU A HG3    1 
ATOM 1849 N N      . VAL C 3 52 ? -92.382  10.144  -24.095 1.00 0.76 ? 61  VAL A N      1 
ATOM 1850 C CA     . VAL C 3 52 ? -92.242  10.557  -22.679 1.00 0.72 ? 61  VAL A CA     1 
ATOM 1851 C C      . VAL C 3 52 ? -90.759  10.590  -22.318 1.00 0.73 ? 61  VAL A C      1 
ATOM 1852 O O      . VAL C 3 52 ? -90.261  11.552  -21.769 1.00 0.74 ? 61  VAL A O      1 
ATOM 1853 C CB     . VAL C 3 52 ? -92.949  9.529   -21.792 1.00 0.68 ? 61  VAL A CB     1 
ATOM 1854 C CG1    . VAL C 3 52 ? -92.887  9.962   -20.324 1.00 0.70 ? 61  VAL A CG1    1 
ATOM 1855 C CG2    . VAL C 3 52 ? -94.415  9.394   -22.225 1.00 0.71 ? 61  VAL A CG2    1 
ATOM 1856 H H      . VAL C 3 52 ? -92.812  9.291   -24.316 1.00 0.77 ? 61  VAL A H      1 
ATOM 1857 H HA     . VAL C 3 52 ? -92.681  11.532  -22.533 1.00 0.74 ? 61  VAL A HA     1 
ATOM 1858 H HB     . VAL C 3 52 ? -92.454  8.577   -21.900 1.00 0.68 ? 61  VAL A HB     1 
ATOM 1859 H HG11   . VAL C 3 52 ? -91.881  10.253  -20.070 1.00 1.23 ? 61  VAL A HG11   1 
ATOM 1860 H HG12   . VAL C 3 52 ? -93.553  10.795  -20.165 1.00 1.17 ? 61  VAL A HG12   1 
ATOM 1861 H HG13   . VAL C 3 52 ? -93.186  9.136   -19.697 1.00 1.27 ? 61  VAL A HG13   1 
ATOM 1862 H HG21   . VAL C 3 52 ? -94.468  9.282   -23.298 1.00 1.31 ? 61  VAL A HG21   1 
ATOM 1863 H HG22   . VAL C 3 52 ? -94.851  8.526   -21.753 1.00 1.21 ? 61  VAL A HG22   1 
ATOM 1864 H HG23   . VAL C 3 52 ? -94.964  10.276  -21.930 1.00 1.19 ? 61  VAL A HG23   1 
ATOM 1865 N N      . ALA C 3 53 ? -90.058  9.531   -22.606 1.00 0.75 ? 62  ALA A N      1 
ATOM 1866 C CA     . ALA C 3 53 ? -88.617  9.479   -22.257 1.00 0.81 ? 62  ALA A CA     1 
ATOM 1867 C C      . ALA C 3 53 ? -87.865  10.648  -22.888 1.00 0.85 ? 62  ALA A C      1 
ATOM 1868 O O      . ALA C 3 53 ? -87.025  11.248  -22.248 1.00 0.88 ? 62  ALA A O      1 
ATOM 1869 C CB     . ALA C 3 53 ? -88.013  8.159   -22.739 1.00 0.87 ? 62  ALA A CB     1 
ATOM 1870 H H      . ALA C 3 53 ? -90.486  8.761   -23.033 1.00 0.76 ? 62  ALA A H      1 
ATOM 1871 H HA     . ALA C 3 53 ? -88.515  9.538   -21.183 1.00 0.81 ? 62  ALA A HA     1 
ATOM 1872 H HB1    . ALA C 3 53 ? -88.581  7.335   -22.333 1.00 1.27 ? 62  ALA A HB1    1 
ATOM 1873 H HB2    . ALA C 3 53 ? -88.041  8.120   -23.818 1.00 1.50 ? 62  ALA A HB2    1 
ATOM 1874 H HB3    . ALA C 3 53 ? -86.989  8.088   -22.402 1.00 1.17 ? 62  ALA A HB3    1 
ATOM 1875 N N      . ARG C 3 54 ? -88.120  10.993  -24.134 1.00 0.90 ? 63  ARG A N      1 
ATOM 1876 C CA     . ARG C 3 54 ? -87.344  12.133  -24.719 1.00 0.98 ? 63  ARG A CA     1 
ATOM 1877 C C      . ARG C 3 54 ? -87.893  13.468  -24.201 1.00 0.93 ? 63  ARG A C      1 
ATOM 1878 O O      . ARG C 3 54 ? -87.153  14.416  -24.078 1.00 0.96 ? 63  ARG A O      1 
ATOM 1879 C CB     . ARG C 3 54 ? -87.276  12.071  -26.283 1.00 1.10 ? 63  ARG A CB     1 
ATOM 1880 C CG     . ARG C 3 54 ? -85.779  11.989  -26.666 1.00 1.62 ? 63  ARG A CG     1 
ATOM 1881 C CD     . ARG C 3 54 ? -85.485  11.898  -28.189 1.00 1.83 ? 63  ARG A CD     1 
ATOM 1882 N NE     . ARG C 3 54 ? -86.697  12.042  -29.046 1.00 2.34 ? 63  ARG A NE     1 
ATOM 1883 C CZ     . ARG C 3 54 ? -86.526  12.279  -30.329 1.00 2.89 ? 63  ARG A CZ     1 
ATOM 1884 N NH1    . ARG C 3 54 ? -85.311  12.425  -30.798 1.00 3.14 ? 63  ARG A NH1    1 
ATOM 1885 N NH2    . ARG C 3 54 ? -87.542  12.362  -31.141 1.00 3.70 ? 63  ARG A NH2    1 
ATOM 1886 H H      . ARG C 3 54 ? -88.790  10.509  -24.666 1.00 0.90 ? 63  ARG A H      1 
ATOM 1887 H HA     . ARG C 3 54 ? -86.335  12.059  -24.328 1.00 1.02 ? 63  ARG A HA     1 
ATOM 1888 H HB2    . ARG C 3 54 ? -87.801  11.195  -26.640 1.00 1.32 ? 63  ARG A HB2    1 
ATOM 1889 H HB3    . ARG C 3 54 ? -87.713  12.961  -26.715 1.00 1.53 ? 63  ARG A HB3    1 
ATOM 1890 H HG2    . ARG C 3 54 ? -85.284  12.862  -26.268 1.00 2.38 ? 63  ARG A HG2    1 
ATOM 1891 H HG3    . ARG C 3 54 ? -85.360  11.115  -26.180 1.00 2.07 ? 63  ARG A HG3    1 
ATOM 1892 H HD2    . ARG C 3 54 ? -84.790  12.679  -28.458 1.00 2.17 ? 63  ARG A HD2    1 
ATOM 1893 H HD3    . ARG C 3 54 ? -85.014  10.944  -28.402 1.00 2.30 ? 63  ARG A HD3    1 
ATOM 1894 H HE     . ARG C 3 54 ? -87.596  11.939  -28.670 1.00 2.73 ? 63  ARG A HE     1 
ATOM 1895 H HH11   . ARG C 3 54 ? -84.526  12.355  -30.182 1.00 2.97 ? 63  ARG A HH11   1 
ATOM 1896 H HH12   . ARG C 3 54 ? -85.167  12.604  -31.770 1.00 3.83 ? 63  ARG A HH12   1 
ATOM 1897 H HH21   . ARG C 3 54 ? -88.471  12.245  -30.797 1.00 3.99 ? 63  ARG A HH21   1 
ATOM 1898 H HH22   . ARG C 3 54 ? -87.387  12.539  -32.115 1.00 4.25 ? 63  ARG A HH22   1 
ATOM 1899 N N      . ARG C 3 55 ? -89.147  13.558  -23.834 1.00 0.89 ? 64  ARG A N      1 
ATOM 1900 C CA     . ARG C 3 55 ? -89.628  14.857  -23.269 1.00 0.89 ? 64  ARG A CA     1 
ATOM 1901 C C      . ARG C 3 55 ? -88.936  15.055  -21.922 1.00 0.82 ? 64  ARG A C      1 
ATOM 1902 O O      . ARG C 3 55 ? -88.531  16.144  -21.565 1.00 0.85 ? 64  ARG A O      1 
ATOM 1903 C CB     . ARG C 3 55 ? -91.162  14.842  -23.064 1.00 0.91 ? 64  ARG A CB     1 
ATOM 1904 C CG     . ARG C 3 55 ? -91.867  15.310  -24.342 1.00 1.34 ? 64  ARG A CG     1 
ATOM 1905 C CD     . ARG C 3 55 ? -93.356  15.525  -24.089 1.00 1.71 ? 64  ARG A CD     1 
ATOM 1906 N NE     . ARG C 3 55 ? -93.899  16.227  -25.302 1.00 2.29 ? 64  ARG A NE     1 
ATOM 1907 C CZ     . ARG C 3 55 ? -93.891  17.521  -25.408 1.00 3.04 ? 64  ARG A CZ     1 
ATOM 1908 N NH1    . ARG C 3 55 ? -93.773  18.268  -24.345 1.00 3.35 ? 64  ARG A NH1    1 
ATOM 1909 N NH2    . ARG C 3 55 ? -94.071  18.078  -26.573 1.00 3.93 ? 64  ARG A NH2    1 
ATOM 1910 H H      . ARG C 3 55 ? -89.742  12.781  -23.883 1.00 0.88 ? 64  ARG A H      1 
ATOM 1911 H HA     . ARG C 3 55 ? -89.347  15.662  -23.931 1.00 0.96 ? 64  ARG A HA     1 
ATOM 1912 H HB2    . ARG C 3 55 ? -91.480  13.838  -22.827 1.00 1.18 ? 64  ARG A HB2    1 
ATOM 1913 H HB3    . ARG C 3 55 ? -91.428  15.502  -22.249 1.00 1.30 ? 64  ARG A HB3    1 
ATOM 1914 H HG2    . ARG C 3 55 ? -91.431  16.239  -24.676 1.00 2.03 ? 64  ARG A HG2    1 
ATOM 1915 H HG3    . ARG C 3 55 ? -91.743  14.561  -25.110 1.00 1.89 ? 64  ARG A HG3    1 
ATOM 1916 H HD2    . ARG C 3 55 ? -93.859  14.590  -24.022 1.00 2.16 ? 64  ARG A HD2    1 
ATOM 1917 H HD3    . ARG C 3 55 ? -93.492  16.071  -23.146 1.00 2.23 ? 64  ARG A HD3    1 
ATOM 1918 H HE     . ARG C 3 55 ? -94.156  15.689  -26.078 1.00 2.61 ? 64  ARG A HE     1 
ATOM 1919 H HH11   . ARG C 3 55 ? -93.689  17.846  -23.442 1.00 3.12 ? 64  ARG A HH11   1 
ATOM 1920 H HH12   . ARG C 3 55 ? -93.780  19.265  -24.431 1.00 4.13 ? 64  ARG A HH12   1 
ATOM 1921 H HH21   . ARG C 3 55 ? -94.213  17.507  -27.383 1.00 4.16 ? 64  ARG A HH21   1 
ATOM 1922 H HH22   . ARG C 3 55 ? -94.070  19.074  -26.658 1.00 4.59 ? 64  ARG A HH22   1 
ATOM 1923 N N      . TRP C 3 56 ? -88.810  13.999  -21.171 1.00 0.74 ? 65  TRP A N      1 
ATOM 1924 C CA     . TRP C 3 56 ? -88.160  14.097  -19.838 1.00 0.70 ? 65  TRP A CA     1 
ATOM 1925 C C      . TRP C 3 56 ? -86.771  14.732  -19.974 1.00 0.73 ? 65  TRP A C      1 
ATOM 1926 O O      . TRP C 3 56 ? -86.392  15.593  -19.205 1.00 0.74 ? 65  TRP A O      1 
ATOM 1927 C CB     . TRP C 3 56 ? -88.022  12.679  -19.254 1.00 0.67 ? 65  TRP A CB     1 
ATOM 1928 C CG     . TRP C 3 56 ? -88.065  12.737  -17.764 1.00 0.64 ? 65  TRP A CG     1 
ATOM 1929 C CD1    . TRP C 3 56 ? -86.997  12.901  -16.947 1.00 0.66 ? 65  TRP A CD1    1 
ATOM 1930 C CD2    . TRP C 3 56 ? -89.227  12.633  -16.908 1.00 0.64 ? 65  TRP A CD2    1 
ATOM 1931 N NE1    . TRP C 3 56 ? -87.437  12.913  -15.634 1.00 0.67 ? 65  TRP A NE1    1 
ATOM 1932 C CE2    . TRP C 3 56 ? -88.805  12.745  -15.558 1.00 0.67 ? 65  TRP A CE2    1 
ATOM 1933 C CE3    . TRP C 3 56 ? -90.602  12.453  -17.172 1.00 0.68 ? 65  TRP A CE3    1 
ATOM 1934 C CZ2    . TRP C 3 56 ? -89.719  12.680  -14.503 1.00 0.74 ? 65  TRP A CZ2    1 
ATOM 1935 C CZ3    . TRP C 3 56 ? -91.524  12.384  -16.114 1.00 0.75 ? 65  TRP A CZ3    1 
ATOM 1936 C CH2    . TRP C 3 56 ? -91.084  12.497  -14.784 1.00 0.78 ? 65  TRP A CH2    1 
ATOM 1937 H H      . TRP C 3 56 ? -89.156  13.133  -21.484 1.00 0.74 ? 65  TRP A H      1 
ATOM 1938 H HA     . TRP C 3 56 ? -88.772  14.705  -19.189 1.00 0.70 ? 65  TRP A HA     1 
ATOM 1939 H HB2    . TRP C 3 56 ? -88.840  12.068  -19.608 1.00 0.69 ? 65  TRP A HB2    1 
ATOM 1940 H HB3    . TRP C 3 56 ? -87.087  12.238  -19.571 1.00 0.71 ? 65  TRP A HB3    1 
ATOM 1941 H HD1    . TRP C 3 56 ? -85.972  13.009  -17.267 1.00 0.71 ? 65  TRP A HD1    1 
ATOM 1942 H HE1    . TRP C 3 56 ? -86.865  13.024  -14.842 1.00 0.71 ? 65  TRP A HE1    1 
ATOM 1943 H HE3    . TRP C 3 56 ? -90.948  12.365  -18.192 1.00 0.69 ? 65  TRP A HE3    1 
ATOM 1944 H HZ2    . TRP C 3 56 ? -89.379  12.769  -13.483 1.00 0.79 ? 65  TRP A HZ2    1 
ATOM 1945 H HZ3    . TRP C 3 56 ? -92.571  12.248  -16.324 1.00 0.81 ? 65  TRP A HZ3    1 
ATOM 1946 H HH2    . TRP C 3 56 ? -91.791  12.434  -13.983 1.00 0.86 ? 65  TRP A HH2    1 
ATOM 1947 N N      . GLY C 3 57 ? -86.005  14.294  -20.932 1.00 0.78 ? 66  GLY A N      1 
ATOM 1948 C CA     . GLY C 3 57 ? -84.631  14.848  -21.106 1.00 0.85 ? 66  GLY A CA     1 
ATOM 1949 C C      . GLY C 3 57 ? -84.675  16.182  -21.856 1.00 0.93 ? 66  GLY A C      1 
ATOM 1950 O O      . GLY C 3 57 ? -83.763  16.979  -21.767 1.00 0.99 ? 66  GLY A O      1 
ATOM 1951 H H      . GLY C 3 57 ? -86.327  13.587  -21.528 1.00 0.80 ? 66  GLY A H      1 
ATOM 1952 H HA2    . GLY C 3 57 ? -84.183  15.001  -20.134 1.00 0.85 ? 66  GLY A HA2    1 
ATOM 1953 H HA3    . GLY C 3 57 ? -84.033  14.146  -21.667 1.00 0.91 ? 66  GLY A HA3    1 
ATOM 1954 N N      . LYS C 3 58 ? -85.712  16.431  -22.607 1.00 0.99 ? 67  LYS A N      1 
ATOM 1955 C CA     . LYS C 3 58 ? -85.783  17.713  -23.367 1.00 1.13 ? 67  LYS A CA     1 
ATOM 1956 C C      . LYS C 3 58 ? -85.960  18.885  -22.394 1.00 1.13 ? 67  LYS A C      1 
ATOM 1957 O O      . LYS C 3 58 ? -85.362  19.931  -22.549 1.00 1.24 ? 67  LYS A O      1 
ATOM 1958 C CB     . LYS C 3 58 ? -86.971  17.661  -24.352 1.00 1.22 ? 67  LYS A CB     1 
ATOM 1959 C CG     . LYS C 3 58 ? -86.610  18.374  -25.655 1.00 1.54 ? 67  LYS A CG     1 
ATOM 1960 C CD     . LYS C 3 58 ? -87.842  18.425  -26.563 1.00 1.73 ? 67  LYS A CD     1 
ATOM 1961 C CE     . LYS C 3 58 ? -87.487  19.078  -27.914 1.00 2.15 ? 67  LYS A CE     1 
ATOM 1962 N NZ     . LYS C 3 58 ? -88.561  20.040  -28.283 1.00 2.74 ? 67  LYS A NZ     1 
ATOM 1963 H H      . LYS C 3 58 ? -86.437  15.774  -22.680 1.00 0.97 ? 67  LYS A H      1 
ATOM 1964 H HA     . LYS C 3 58 ? -84.860  17.845  -23.914 1.00 1.21 ? 67  LYS A HA     1 
ATOM 1965 H HB2    . LYS C 3 58 ? -87.208  16.636  -24.569 1.00 1.55 ? 67  LYS A HB2    1 
ATOM 1966 H HB3    . LYS C 3 58 ? -87.838  18.138  -23.915 1.00 1.46 ? 67  LYS A HB3    1 
ATOM 1967 H HG2    . LYS C 3 58 ? -86.277  19.378  -25.438 1.00 2.03 ? 67  LYS A HG2    1 
ATOM 1968 H HG3    . LYS C 3 58 ? -85.820  17.832  -26.154 1.00 2.15 ? 67  LYS A HG3    1 
ATOM 1969 H HD2    . LYS C 3 58 ? -88.203  17.418  -26.728 1.00 2.26 ? 67  LYS A HD2    1 
ATOM 1970 H HD3    . LYS C 3 58 ? -88.614  19.003  -26.080 1.00 1.97 ? 67  LYS A HD3    1 
ATOM 1971 H HE2    . LYS C 3 58 ? -86.547  19.609  -27.841 1.00 2.50 ? 67  LYS A HE2    1 
ATOM 1972 H HE3    . LYS C 3 58 ? -87.410  18.318  -28.680 1.00 2.50 ? 67  LYS A HE3    1 
ATOM 1973 H HZ1    . LYS C 3 58 ? -89.066  20.340  -27.425 1.00 3.15 ? 67  LYS A HZ1    1 
ATOM 1974 H HZ2    . LYS C 3 58 ? -88.139  20.871  -28.742 1.00 3.04 ? 67  LYS A HZ2    1 
ATOM 1975 H HZ3    . LYS C 3 58 ? -89.228  19.581  -28.937 1.00 3.13 ? 67  LYS A HZ3    1 
ATOM 1976 N N      . ARG C 3 59 ? -86.788  18.719  -21.404 1.00 1.08 ? 68  ARG A N      1 
ATOM 1977 C CA     . ARG C 3 59 ? -87.023  19.822  -20.434 1.00 1.16 ? 68  ARG A CA     1 
ATOM 1978 C C      . ARG C 3 59 ? -85.693  20.325  -19.902 1.00 1.15 ? 68  ARG A C      1 
ATOM 1979 O O      . ARG C 3 59 ? -85.574  21.441  -19.439 1.00 1.29 ? 68  ARG A O      1 
ATOM 1980 C CB     . ARG C 3 59 ? -87.845  19.276  -19.263 1.00 1.18 ? 68  ARG A CB     1 
ATOM 1981 C CG     . ARG C 3 59 ? -89.176  18.666  -19.789 1.00 1.65 ? 68  ARG A CG     1 
ATOM 1982 C CD     . ARG C 3 59 ? -90.421  19.196  -19.034 1.00 1.99 ? 68  ARG A CD     1 
ATOM 1983 N NE     . ARG C 3 59 ? -90.232  20.585  -18.505 1.00 2.56 ? 68  ARG A NE     1 
ATOM 1984 C CZ     . ARG C 3 59 ? -91.239  21.411  -18.429 1.00 3.25 ? 68  ARG A CZ     1 
ATOM 1985 N NH1    . ARG C 3 59 ? -92.335  21.186  -19.100 1.00 3.56 ? 68  ARG A NH1    1 
ATOM 1986 N NH2    . ARG C 3 59 ? -91.120  22.509  -17.733 1.00 4.08 ? 68  ARG A NH2    1 
ATOM 1987 H H      . ARG C 3 59 ? -87.268  17.870  -21.305 1.00 1.03 ? 68  ARG A H      1 
ATOM 1988 H HA     . ARG C 3 59 ? -87.559  20.628  -20.912 1.00 1.30 ? 68  ARG A HA     1 
ATOM 1989 H HB2    . ARG C 3 59 ? -87.266  18.509  -18.761 1.00 1.48 ? 68  ARG A HB2    1 
ATOM 1990 H HB3    . ARG C 3 59 ? -88.035  20.069  -18.574 1.00 1.49 ? 68  ARG A HB3    1 
ATOM 1991 H HG2    . ARG C 3 59 ? -89.290  18.898  -20.842 1.00 2.23 ? 68  ARG A HG2    1 
ATOM 1992 H HG3    . ARG C 3 59 ? -89.136  17.589  -19.681 1.00 2.20 ? 68  ARG A HG3    1 
ATOM 1993 H HD2    . ARG C 3 59 ? -91.270  19.157  -19.720 1.00 2.37 ? 68  ARG A HD2    1 
ATOM 1994 H HD3    . ARG C 3 59 ? -90.616  18.569  -18.186 1.00 2.41 ? 68  ARG A HD3    1 
ATOM 1995 H HE     . ARG C 3 59 ? -89.377  20.840  -18.110 1.00 2.87 ? 68  ARG A HE     1 
ATOM 1996 H HH11   . ARG C 3 59 ? -92.411  20.379  -19.680 1.00 3.36 ? 68  ARG A HH11   1 
ATOM 1997 H HH12   . ARG C 3 59 ? -93.096  21.829  -19.040 1.00 4.29 ? 68  ARG A HH12   1 
ATOM 1998 H HH21   . ARG C 3 59 ? -90.262  22.711  -17.261 1.00 4.33 ? 68  ARG A HH21   1 
ATOM 1999 H HH22   . ARG C 3 59 ? -91.887  23.146  -17.671 1.00 4.69 ? 68  ARG A HH22   1 
ATOM 2000 N N      . LYS C 3 60 ? -84.697  19.495  -19.948 1.00 1.05 ? 69  LYS A N      1 
ATOM 2001 C CA     . LYS C 3 60 ? -83.359  19.883  -19.430 1.00 1.11 ? 69  LYS A CA     1 
ATOM 2002 C C      . LYS C 3 60 ? -82.442  20.227  -20.599 1.00 1.18 ? 69  LYS A C      1 
ATOM 2003 O O      . LYS C 3 60 ? -81.234  20.182  -20.493 1.00 1.24 ? 69  LYS A O      1 
ATOM 2004 C CB     . LYS C 3 60 ? -82.806  18.706  -18.640 1.00 1.10 ? 69  LYS A CB     1 
ATOM 2005 C CG     . LYS C 3 60 ? -83.878  18.248  -17.645 1.00 1.33 ? 69  LYS A CG     1 
ATOM 2006 C CD     . LYS C 3 60 ? -83.379  17.033  -16.823 1.00 1.50 ? 69  LYS A CD     1 
ATOM 2007 C CE     . LYS C 3 60 ? -83.416  17.363  -15.337 1.00 2.06 ? 69  LYS A CE     1 
ATOM 2008 N NZ     . LYS C 3 60 ? -84.742  17.952  -14.985 1.00 2.81 ? 69  LYS A NZ     1 
ATOM 2009 H H      . LYS C 3 60 ? -84.832  18.596  -20.314 1.00 1.00 ? 69  LYS A H      1 
ATOM 2010 H HA     . LYS C 3 60 ? -83.445  20.741  -18.776 1.00 1.22 ? 69  LYS A HA     1 
ATOM 2011 H HB2    . LYS C 3 60 ? -82.556  17.896  -19.311 1.00 1.19 ? 69  LYS A HB2    1 
ATOM 2012 H HB3    . LYS C 3 60 ? -81.929  19.017  -18.099 1.00 1.33 ? 69  LYS A HB3    1 
ATOM 2013 H HG2    . LYS C 3 60 ? -84.113  19.076  -16.989 1.00 1.89 ? 69  LYS A HG2    1 
ATOM 2014 H HG3    . LYS C 3 60 ? -84.771  17.968  -18.184 1.00 1.84 ? 69  LYS A HG3    1 
ATOM 2015 H HD2    . LYS C 3 60 ? -84.016  16.179  -17.010 1.00 2.02 ? 69  LYS A HD2    1 
ATOM 2016 H HD3    . LYS C 3 60 ? -82.364  16.783  -17.101 1.00 1.84 ? 69  LYS A HD3    1 
ATOM 2017 H HE2    . LYS C 3 60 ? -83.259  16.461  -14.776 1.00 2.25 ? 69  LYS A HE2    1 
ATOM 2018 H HE3    . LYS C 3 60 ? -82.637  18.075  -15.117 1.00 2.59 ? 69  LYS A HE3    1 
ATOM 2019 H HZ1    . LYS C 3 60 ? -85.493  17.455  -15.503 1.00 2.96 ? 69  LYS A HZ1    1 
ATOM 2020 H HZ2    . LYS C 3 60 ? -84.904  17.859  -13.962 1.00 3.30 ? 69  LYS A HZ2    1 
ATOM 2021 H HZ3    . LYS C 3 60 ? -84.753  18.959  -15.246 1.00 3.31 ? 69  LYS A HZ3    1 
ATOM 2022 N N      . ASN C 3 61 ? -83.018  20.578  -21.715 1.00 1.23 ? 70  ASN A N      1 
ATOM 2023 C CA     . ASN C 3 61 ? -82.199  20.938  -22.904 1.00 1.40 ? 70  ASN A CA     1 
ATOM 2024 C C      . ASN C 3 61 ? -81.235  19.804  -23.231 1.00 1.41 ? 70  ASN A C      1 
ATOM 2025 O O      . ASN C 3 61 ? -80.275  19.989  -23.951 1.00 1.56 ? 70  ASN A O      1 
ATOM 2026 C CB     . ASN C 3 61 ? -81.423  22.240  -22.626 1.00 1.56 ? 70  ASN A CB     1 
ATOM 2027 C CG     . ASN C 3 61 ? -82.274  23.459  -23.016 1.00 1.88 ? 70  ASN A CG     1 
ATOM 2028 O OD1    . ASN C 3 61 ? -83.263  23.333  -23.712 1.00 2.43 ? 70  ASN A OD1    1 
ATOM 2029 N ND2    . ASN C 3 61 ? -81.924  24.643  -22.600 1.00 2.35 ? 70  ASN A ND2    1 
ATOM 2030 H H      . ASN C 3 61 ? -83.996  20.608  -21.770 1.00 1.20 ? 70  ASN A H      1 
ATOM 2031 H HA     . ASN C 3 61 ? -82.853  21.078  -23.750 1.00 1.46 ? 70  ASN A HA     1 
ATOM 2032 H HB2    . ASN C 3 61 ? -81.189  22.295  -21.573 1.00 1.79 ? 70  ASN A HB2    1 
ATOM 2033 H HB3    . ASN C 3 61 ? -80.505  22.252  -23.197 1.00 1.80 ? 70  ASN A HB3    1 
ATOM 2034 H HD21   . ASN C 3 61 ? -81.126  24.750  -22.043 1.00 2.61 ? 70  ASN A HD21   1 
ATOM 2035 H HD22   . ASN C 3 61 ? -82.458  25.426  -22.849 1.00 2.81 ? 70  ASN A HD22   1 
ATOM 2036 N N      . LYS C 3 62 ? -81.498  18.622  -22.740 1.00 1.34 ? 71  LYS A N      1 
ATOM 2037 C CA     . LYS C 3 62 ? -80.613  17.468  -23.062 1.00 1.44 ? 71  LYS A CA     1 
ATOM 2038 C C      . LYS C 3 62 ? -81.287  16.698  -24.226 1.00 1.59 ? 71  LYS A C      1 
ATOM 2039 O O      . LYS C 3 62 ? -82.453  16.371  -24.122 1.00 1.89 ? 71  LYS A O      1 
ATOM 2040 C CB     . LYS C 3 62 ? -80.449  16.593  -21.816 1.00 1.31 ? 71  LYS A CB     1 
ATOM 2041 C CG     . LYS C 3 62 ? -79.468  17.307  -20.862 1.00 1.55 ? 71  LYS A CG     1 
ATOM 2042 C CD     . LYS C 3 62 ? -79.303  16.535  -19.535 1.00 1.59 ? 71  LYS A CD     1 
ATOM 2043 C CE     . LYS C 3 62 ? -79.031  17.503  -18.379 1.00 1.35 ? 71  LYS A CE     1 
ATOM 2044 N NZ     . LYS C 3 62 ? -77.684  18.111  -18.557 1.00 1.99 ? 71  LYS A NZ     1 
ATOM 2045 H H      . LYS C 3 62 ? -82.294  18.489  -22.183 1.00 1.29 ? 71  LYS A H      1 
ATOM 2046 H HA     . LYS C 3 62 ? -79.650  17.841  -23.354 1.00 1.64 ? 71  LYS A HA     1 
ATOM 2047 H HB2    . LYS C 3 62 ? -81.408  16.464  -21.332 1.00 1.31 ? 71  LYS A HB2    1 
ATOM 2048 H HB3    . LYS C 3 62 ? -80.050  15.637  -22.101 1.00 1.34 ? 71  LYS A HB3    1 
ATOM 2049 H HG2    . LYS C 3 62 ? -78.507  17.388  -21.350 1.00 1.95 ? 71  LYS A HG2    1 
ATOM 2050 H HG3    . LYS C 3 62 ? -79.843  18.299  -20.664 1.00 2.09 ? 71  LYS A HG3    1 
ATOM 2051 H HD2    . LYS C 3 62 ? -80.197  15.969  -19.325 1.00 2.30 ? 71  LYS A HD2    1 
ATOM 2052 H HD3    . LYS C 3 62 ? -78.461  15.866  -19.615 1.00 2.02 ? 71  LYS A HD3    1 
ATOM 2053 H HE2    . LYS C 3 62 ? -79.777  18.277  -18.368 1.00 1.62 ? 71  LYS A HE2    1 
ATOM 2054 H HE3    . LYS C 3 62 ? -79.061  16.964  -17.446 1.00 1.64 ? 71  LYS A HE3    1 
ATOM 2055 H HZ1    . LYS C 3 62 ? -77.056  17.428  -19.028 1.00 2.46 ? 71  LYS A HZ1    1 
ATOM 2056 H HZ2    . LYS C 3 62 ? -77.764  18.968  -19.140 1.00 2.51 ? 71  LYS A HZ2    1 
ATOM 2057 H HZ3    . LYS C 3 62 ? -77.291  18.361  -17.628 1.00 2.32 ? 71  LYS A HZ3    1 
ATOM 2058 N N      . PRO C 3 63 ? -80.584  16.485  -25.333 1.00 1.76 ? 72  PRO A N      1 
ATOM 2059 C CA     . PRO C 3 63 ? -81.188  15.835  -26.518 1.00 2.02 ? 72  PRO A CA     1 
ATOM 2060 C C      . PRO C 3 63 ? -81.767  14.451  -26.219 1.00 1.66 ? 72  PRO A C      1 
ATOM 2061 O O      . PRO C 3 63 ? -82.928  14.198  -26.476 1.00 2.15 ? 72  PRO A O      1 
ATOM 2062 C CB     . PRO C 3 63 ? -80.039  15.732  -27.553 1.00 2.52 ? 72  PRO A CB     1 
ATOM 2063 C CG     . PRO C 3 63 ? -78.755  16.288  -26.881 1.00 2.75 ? 72  PRO A CG     1 
ATOM 2064 C CD     . PRO C 3 63 ? -79.156  16.848  -25.503 1.00 2.14 ? 72  PRO A CD     1 
ATOM 2065 H HA     . PRO C 3 63 ? -81.966  16.465  -26.913 1.00 2.44 ? 72  PRO A HA     1 
ATOM 2066 H HB2    . PRO C 3 63 ? -79.885  14.699  -27.848 1.00 2.46 ? 72  PRO A HB2    1 
ATOM 2067 H HB3    . PRO C 3 63 ? -80.275  16.323  -28.427 1.00 3.05 ? 72  PRO A HB3    1 
ATOM 2068 H HG2    . PRO C 3 63 ? -78.028  15.492  -26.761 1.00 2.97 ? 72  PRO A HG2    1 
ATOM 2069 H HG3    . PRO C 3 63 ? -78.329  17.077  -27.487 1.00 3.32 ? 72  PRO A HG3    1 
ATOM 2070 H HD2    . PRO C 3 63 ? -78.555  16.394  -24.723 1.00 2.11 ? 72  PRO A HD2    1 
ATOM 2071 H HD3    . PRO C 3 63 ? -79.044  17.924  -25.493 1.00 2.32 ? 72  PRO A HD3    1 
ATOM 2072 N N      . LYS C 3 64 ? -80.963  13.537  -25.743 1.00 1.35 ? 73  LYS A N      1 
ATOM 2073 C CA     . LYS C 3 64 ? -81.471  12.149  -25.508 1.00 1.53 ? 73  LYS A CA     1 
ATOM 2074 C C      . LYS C 3 64 ? -81.134  11.639  -24.126 1.00 1.29 ? 73  LYS A C      1 
ATOM 2075 O O      . LYS C 3 64 ? -80.026  11.757  -23.640 1.00 1.52 ? 73  LYS A O      1 
ATOM 2076 C CB     . LYS C 3 64 ? -80.819  11.216  -26.514 1.00 2.21 ? 73  LYS A CB     1 
ATOM 2077 C CG     . LYS C 3 64 ? -81.284  11.574  -27.926 1.00 2.88 ? 73  LYS A CG     1 
ATOM 2078 C CD     . LYS C 3 64 ? -80.306  10.983  -28.943 1.00 3.58 ? 73  LYS A CD     1 
ATOM 2079 C CE     . LYS C 3 64 ? -80.199  9.460   -28.749 1.00 4.53 ? 73  LYS A CE     1 
ATOM 2080 N NZ     . LYS C 3 64 ? -79.993  8.816   -30.073 1.00 5.13 ? 73  LYS A NZ     1 
ATOM 2081 H H      . LYS C 3 64 ? -80.020  13.749  -25.586 1.00 1.52 ? 73  LYS A H      1 
ATOM 2082 H HA     . LYS C 3 64 ? -82.542  12.108  -25.641 1.00 1.88 ? 73  LYS A HA     1 
ATOM 2083 H HB2    . LYS C 3 64 ? -79.744  11.315  -26.445 1.00 2.65 ? 73  LYS A HB2    1 
ATOM 2084 H HB3    . LYS C 3 64 ? -81.101  10.198  -26.290 1.00 2.53 ? 73  LYS A HB3    1 
ATOM 2085 H HG2    . LYS C 3 64 ? -82.270  11.164  -28.092 1.00 3.15 ? 73  LYS A HG2    1 
ATOM 2086 H HG3    . LYS C 3 64 ? -81.314  12.647  -28.041 1.00 3.23 ? 73  LYS A HG3    1 
ATOM 2087 H HD2    . LYS C 3 64 ? -80.658  11.196  -29.941 1.00 3.79 ? 73  LYS A HD2    1 
ATOM 2088 H HD3    . LYS C 3 64 ? -79.333  11.433  -28.802 1.00 3.67 ? 73  LYS A HD3    1 
ATOM 2089 H HE2    . LYS C 3 64 ? -79.362  9.231   -28.105 1.00 4.88 ? 73  LYS A HE2    1 
ATOM 2090 H HE3    . LYS C 3 64 ? -81.108  9.074   -28.307 1.00 4.82 ? 73  LYS A HE3    1 
ATOM 2091 H HZ1    . LYS C 3 64 ? -80.671  9.212   -30.756 1.00 5.22 ? 73  LYS A HZ1    1 
ATOM 2092 H HZ2    . LYS C 3 64 ? -79.024  8.996   -30.400 1.00 5.45 ? 73  LYS A HZ2    1 
ATOM 2093 H HZ3    . LYS C 3 64 ? -80.144  7.792   -29.987 1.00 5.52 ? 73  LYS A HZ3    1 
ATOM 2094 N N      . MET C 3 65 ? -82.101  11.034  -23.513 1.00 1.16 ? 74  MET A N      1 
ATOM 2095 C CA     . MET C 3 65 ? -81.911  10.443  -22.177 1.00 1.15 ? 74  MET A CA     1 
ATOM 2096 C C      . MET C 3 65 ? -82.533  9.050   -22.156 1.00 1.02 ? 74  MET A C      1 
ATOM 2097 O O      . MET C 3 65 ? -83.728  8.886   -22.299 1.00 1.01 ? 74  MET A O      1 
ATOM 2098 C CB     . MET C 3 65 ? -82.564  11.368  -21.148 1.00 1.33 ? 74  MET A CB     1 
ATOM 2099 C CG     . MET C 3 65 ? -81.587  12.480  -20.680 1.00 1.77 ? 74  MET A CG     1 
ATOM 2100 S SD     . MET C 3 65 ? -79.857  11.900  -20.643 1.00 2.40 ? 74  MET A SD     1 
ATOM 2101 C CE     . MET C 3 65 ? -79.134  13.369  -19.939 1.00 2.36 ? 74  MET A CE     1 
ATOM 2102 H H      . MET C 3 65 ? -82.963  10.944  -23.955 1.00 1.33 ? 74  MET A H      1 
ATOM 2103 H HA     . MET C 3 65 ? -80.872  10.324  -21.979 1.00 1.37 ? 74  MET A HA     1 
ATOM 2104 H HB2    . MET C 3 65 ? -83.427  11.833  -21.604 1.00 1.51 ? 74  MET A HB2    1 
ATOM 2105 H HB3    . MET C 3 65 ? -82.892  10.794  -20.315 1.00 1.75 ? 74  MET A HB3    1 
ATOM 2106 H HG2    . MET C 3 65 ? -81.657  13.320  -21.354 1.00 2.28 ? 74  MET A HG2    1 
ATOM 2107 H HG3    . MET C 3 65 ? -81.875  12.804  -19.689 1.00 2.24 ? 74  MET A HG3    1 
ATOM 2108 H HE1    . MET C 3 65 ? -79.730  13.703  -19.105 1.00 2.54 ? 74  MET A HE1    1 
ATOM 2109 H HE2    . MET C 3 65 ? -78.130  13.153  -19.606 1.00 2.80 ? 74  MET A HE2    1 
ATOM 2110 H HE3    . MET C 3 65 ? -79.115  14.121  -20.700 1.00 2.55 ? 74  MET A HE3    1 
ATOM 2111 N N      . ASN C 3 66 ? -81.726  8.040   -21.985 1.00 1.02 ? 75  ASN A N      1 
ATOM 2112 C CA     . ASN C 3 66 ? -82.274  6.663   -21.970 1.00 1.00 ? 75  ASN A CA     1 
ATOM 2113 C C      . ASN C 3 66 ? -83.251  6.521   -20.803 1.00 0.90 ? 75  ASN A C      1 
ATOM 2114 O O      . ASN C 3 66 ? -83.337  7.371   -19.938 1.00 0.88 ? 75  ASN A O      1 
ATOM 2115 C CB     . ASN C 3 66 ? -81.137  5.645   -21.834 1.00 1.13 ? 75  ASN A CB     1 
ATOM 2116 C CG     . ASN C 3 66 ? -80.451  5.796   -20.476 1.00 1.17 ? 75  ASN A CG     1 
ATOM 2117 O OD1    . ASN C 3 66 ? -80.929  6.501   -19.612 1.00 1.27 ? 75  ASN A OD1    1 
ATOM 2118 N ND2    . ASN C 3 66 ? -79.337  5.154   -20.251 1.00 1.61 ? 75  ASN A ND2    1 
ATOM 2119 H H      . ASN C 3 66 ? -80.763  8.190   -21.878 1.00 1.09 ? 75  ASN A H      1 
ATOM 2120 H HA     . ASN C 3 66 ? -82.802  6.485   -22.896 1.00 1.05 ? 75  ASN A HA     1 
ATOM 2121 H HB2    . ASN C 3 66 ? -81.540  4.646   -21.923 1.00 1.36 ? 75  ASN A HB2    1 
ATOM 2122 H HB3    . ASN C 3 66 ? -80.415  5.810   -22.620 1.00 1.47 ? 75  ASN A HB3    1 
ATOM 2123 H HD21   . ASN C 3 66 ? -78.951  4.584   -20.949 1.00 1.76 ? 75  ASN A HD21   1 
ATOM 2124 H HD22   . ASN C 3 66 ? -78.888  5.239   -19.385 1.00 1.96 ? 75  ASN A HD22   1 
ATOM 2125 N N      . TYR C 3 67 ? -84.002  5.461   -20.793 1.00 0.86 ? 76  TYR A N      1 
ATOM 2126 C CA     . TYR C 3 67 ? -84.997  5.242   -19.725 1.00 0.79 ? 76  TYR A CA     1 
ATOM 2127 C C      . TYR C 3 67 ? -84.307  4.833   -18.424 1.00 0.74 ? 76  TYR A C      1 
ATOM 2128 O O      . TYR C 3 67 ? -84.885  4.907   -17.357 1.00 0.68 ? 76  TYR A O      1 
ATOM 2129 C CB     . TYR C 3 67 ? -85.949  4.143   -20.173 1.00 0.82 ? 76  TYR A CB     1 
ATOM 2130 C CG     . TYR C 3 67 ? -87.065  4.054   -19.182 1.00 0.77 ? 76  TYR A CG     1 
ATOM 2131 C CD1    . TYR C 3 67 ? -88.082  5.023   -19.197 1.00 0.80 ? 76  TYR A CD1    1 
ATOM 2132 C CD2    . TYR C 3 67 ? -87.082  3.021   -18.229 1.00 0.81 ? 76  TYR A CD2    1 
ATOM 2133 C CE1    . TYR C 3 67 ? -89.119  4.962   -18.261 1.00 0.86 ? 76  TYR A CE1    1 
ATOM 2134 C CE2    . TYR C 3 67 ? -88.121  2.954   -17.293 1.00 0.85 ? 76  TYR A CE2    1 
ATOM 2135 C CZ     . TYR C 3 67 ? -89.140  3.925   -17.308 1.00 0.87 ? 76  TYR A CZ     1 
ATOM 2136 O OH     . TYR C 3 67 ? -90.153  3.866   -16.390 1.00 1.00 ? 76  TYR A OH     1 
ATOM 2137 H H      . TYR C 3 67 ? -83.924  4.807   -21.502 1.00 0.90 ? 76  TYR A H      1 
ATOM 2138 H HA     . TYR C 3 67 ? -85.555  6.152   -19.563 1.00 0.78 ? 76  TYR A HA     1 
ATOM 2139 H HB2    . TYR C 3 67 ? -86.347  4.384   -21.148 1.00 0.90 ? 76  TYR A HB2    1 
ATOM 2140 H HB3    . TYR C 3 67 ? -85.424  3.201   -20.217 1.00 0.87 ? 76  TYR A HB3    1 
ATOM 2141 H HD1    . TYR C 3 67 ? -88.065  5.814   -19.932 1.00 0.87 ? 76  TYR A HD1    1 
ATOM 2142 H HD2    . TYR C 3 67 ? -86.299  2.279   -18.220 1.00 0.89 ? 76  TYR A HD2    1 
ATOM 2143 H HE1    . TYR C 3 67 ? -89.897  5.710   -18.271 1.00 0.97 ? 76  TYR A HE1    1 
ATOM 2144 H HE2    . TYR C 3 67 ? -88.135  2.158   -16.563 1.00 0.95 ? 76  TYR A HE2    1 
ATOM 2145 H HH     . TYR C 3 67 ? -90.721  4.627   -16.526 1.00 1.49 ? 76  TYR A HH     1 
ATOM 2146 N N      . GLU C 3 68 ? -83.080  4.399   -18.494 1.00 0.81 ? 77  GLU A N      1 
ATOM 2147 C CA     . GLU C 3 68 ? -82.378  3.989   -17.249 1.00 0.82 ? 77  GLU A CA     1 
ATOM 2148 C C      . GLU C 3 68 ? -82.440  5.137   -16.243 1.00 0.76 ? 77  GLU A C      1 
ATOM 2149 O O      . GLU C 3 68 ? -82.525  4.930   -15.051 1.00 0.75 ? 77  GLU A O      1 
ATOM 2150 C CB     . GLU C 3 68 ? -80.909  3.668   -17.563 1.00 0.94 ? 77  GLU A CB     1 
ATOM 2151 C CG     . GLU C 3 68 ? -80.789  2.249   -18.115 1.00 1.44 ? 77  GLU A CG     1 
ATOM 2152 C CD     . GLU C 3 68 ? -79.308  1.889   -18.253 1.00 1.88 ? 77  GLU A CD     1 
ATOM 2153 O OE1    . GLU C 3 68 ? -78.651  1.765   -17.231 1.00 2.24 ? 77  GLU A OE1    1 
ATOM 2154 O OE2    . GLU C 3 68 ? -78.855  1.745   -19.375 1.00 2.58 ? 77  GLU A OE2    1 
ATOM 2155 H H      . GLU C 3 68 ? -82.625  4.341   -19.359 1.00 0.87 ? 77  GLU A H      1 
ATOM 2156 H HA     . GLU C 3 68 ? -82.863  3.121   -16.837 1.00 0.81 ? 77  GLU A HA     1 
ATOM 2157 H HB2    . GLU C 3 68 ? -80.543  4.366   -18.299 1.00 1.32 ? 77  GLU A HB2    1 
ATOM 2158 H HB3    . GLU C 3 68 ? -80.315  3.751   -16.663 1.00 1.30 ? 77  GLU A HB3    1 
ATOM 2159 H HG2    . GLU C 3 68 ? -81.269  1.563   -17.436 1.00 2.00 ? 77  GLU A HG2    1 
ATOM 2160 H HG3    . GLU C 3 68 ? -81.265  2.192   -19.081 1.00 1.94 ? 77  GLU A HG3    1 
ATOM 2161 N N      . LYS C 3 69 ? -82.393  6.343   -16.726 1.00 0.76 ? 78  LYS A N      1 
ATOM 2162 C CA     . LYS C 3 69 ? -82.440  7.528   -15.825 1.00 0.75 ? 78  LYS A CA     1 
ATOM 2163 C C      . LYS C 3 69 ? -83.634  7.459   -14.898 1.00 0.69 ? 78  LYS A C      1 
ATOM 2164 O O      . LYS C 3 69 ? -83.530  7.563   -13.698 1.00 0.71 ? 78  LYS A O      1 
ATOM 2165 C CB     . LYS C 3 69 ? -82.661  8.760   -16.665 1.00 0.81 ? 78  LYS A CB     1 
ATOM 2166 C CG     . LYS C 3 69 ? -81.415  9.106   -17.449 1.00 1.87 ? 78  LYS A CG     1 
ATOM 2167 C CD     . LYS C 3 69 ? -81.628  10.493  -18.050 1.00 2.50 ? 78  LYS A CD     1 
ATOM 2168 C CE     . LYS C 3 69 ? -81.227  11.595  -17.064 1.00 3.51 ? 78  LYS A CE     1 
ATOM 2169 N NZ     . LYS C 3 69 ? -82.209  12.713  -17.188 1.00 4.50 ? 78  LYS A NZ     1 
ATOM 2170 H H      . LYS C 3 69 ? -82.323  6.474   -17.695 1.00 0.81 ? 78  LYS A H      1 
ATOM 2171 H HA     . LYS C 3 69 ? -81.522  7.625   -15.271 1.00 0.79 ? 78  LYS A HA     1 
ATOM 2172 H HB2    . LYS C 3 69 ? -83.469  8.570   -17.358 1.00 1.14 ? 78  LYS A HB2    1 
ATOM 2173 H HB3    . LYS C 3 69 ? -82.927  9.595   -16.029 1.00 1.25 ? 78  LYS A HB3    1 
ATOM 2174 H HG2    . LYS C 3 69 ? -80.555  9.108   -16.794 1.00 2.48 ? 78  LYS A HG2    1 
ATOM 2175 H HG3    . LYS C 3 69 ? -81.272  8.385   -18.241 1.00 2.45 ? 78  LYS A HG3    1 
ATOM 2176 H HD2    . LYS C 3 69 ? -81.054  10.574  -18.939 1.00 2.81 ? 78  LYS A HD2    1 
ATOM 2177 H HD3    . LYS C 3 69 ? -82.672  10.620  -18.285 1.00 2.67 ? 78  LYS A HD3    1 
ATOM 2178 H HE2    . LYS C 3 69 ? -81.244  11.211  -16.052 1.00 3.75 ? 78  LYS A HE2    1 
ATOM 2179 H HE3    . LYS C 3 69 ? -80.236  11.958  -17.296 1.00 3.75 ? 78  LYS A HE3    1 
ATOM 2180 H HZ1    . LYS C 3 69 ? -82.843  12.533  -17.990 1.00 4.84 ? 78  LYS A HZ1    1 
ATOM 2181 H HZ2    . LYS C 3 69 ? -82.768  12.780  -16.312 1.00 4.92 ? 78  LYS A HZ2    1 
ATOM 2182 H HZ3    . LYS C 3 69 ? -81.701  13.606  -17.343 1.00 4.85 ? 78  LYS A HZ3    1 
ATOM 2183 N N      . LEU C 3 70 ? -84.782  7.340   -15.465 1.00 0.64 ? 79  LEU A N      1 
ATOM 2184 C CA     . LEU C 3 70 ? -85.995  7.329   -14.638 1.00 0.60 ? 79  LEU A CA     1 
ATOM 2185 C C      . LEU C 3 70 ? -85.861  6.218   -13.602 1.00 0.60 ? 79  LEU A C      1 
ATOM 2186 O O      . LEU C 3 70 ? -86.039  6.444   -12.429 1.00 0.62 ? 79  LEU A O      1 
ATOM 2187 C CB     . LEU C 3 70 ? -87.188  7.125   -15.574 1.00 0.59 ? 79  LEU A CB     1 
ATOM 2188 C CG     . LEU C 3 70 ? -87.527  8.466   -16.259 1.00 0.61 ? 79  LEU A CG     1 
ATOM 2189 C CD1    . LEU C 3 70 ? -88.518  8.216   -17.401 1.00 1.26 ? 79  LEU A CD1    1 
ATOM 2190 C CD2    . LEU C 3 70 ? -88.134  9.466   -15.240 1.00 1.16 ? 79  LEU A CD2    1 
ATOM 2191 H H      . LEU C 3 70 ? -84.848  7.301   -16.442 1.00 0.64 ? 79  LEU A H      1 
ATOM 2192 H HA     . LEU C 3 70 ? -86.086  8.275   -14.126 1.00 0.64 ? 79  LEU A HA     1 
ATOM 2193 H HB2    . LEU C 3 70 ? -86.917  6.397   -16.338 1.00 0.64 ? 79  LEU A HB2    1 
ATOM 2194 H HB3    . LEU C 3 70 ? -88.039  6.771   -15.018 1.00 0.59 ? 79  LEU A HB3    1 
ATOM 2195 H HG     . LEU C 3 70 ? -86.619  8.884   -16.673 1.00 0.95 ? 79  LEU A HG     1 
ATOM 2196 H HD11   . LEU C 3 70 ? -89.412  7.754   -17.009 1.00 1.68 ? 79  LEU A HD11   1 
ATOM 2197 H HD12   . LEU C 3 70 ? -88.773  9.156   -17.868 1.00 1.85 ? 79  LEU A HD12   1 
ATOM 2198 H HD13   . LEU C 3 70 ? -88.066  7.562   -18.132 1.00 1.83 ? 79  LEU A HD13   1 
ATOM 2199 H HD21   . LEU C 3 70 ? -88.652  8.931   -14.458 1.00 1.65 ? 79  LEU A HD21   1 
ATOM 2200 H HD22   . LEU C 3 70 ? -87.345  10.062  -14.801 1.00 1.72 ? 79  LEU A HD22   1 
ATOM 2201 H HD23   . LEU C 3 70 ? -88.832  10.124  -15.740 1.00 1.71 ? 79  LEU A HD23   1 
ATOM 2202 N N      . SER C 3 71 ? -85.461  5.051   -13.992 1.00 0.63 ? 80  SER A N      1 
ATOM 2203 C CA     . SER C 3 71 ? -85.248  3.986   -12.975 1.00 0.68 ? 80  SER A CA     1 
ATOM 2204 C C      . SER C 3 71 ? -84.209  4.515   -11.974 1.00 0.72 ? 80  SER A C      1 
ATOM 2205 O O      . SER C 3 71 ? -84.041  4.002   -10.887 1.00 0.78 ? 80  SER A O      1 
ATOM 2206 C CB     . SER C 3 71 ? -84.709  2.733   -13.683 1.00 0.76 ? 80  SER A CB     1 
ATOM 2207 O OG     . SER C 3 71 ? -84.069  3.132   -14.881 1.00 1.37 ? 80  SER A OG     1 
ATOM 2208 H H      . SER C 3 71 ? -85.248  4.888   -14.934 1.00 0.65 ? 80  SER A H      1 
ATOM 2209 H HA     . SER C 3 71 ? -86.175  3.765   -12.467 1.00 0.66 ? 80  SER A HA     1 
ATOM 2210 H HB2    . SER C 3 71 ? -83.993  2.217   -13.054 1.00 1.19 ? 80  SER A HB2    1 
ATOM 2211 H HB3    . SER C 3 71 ? -85.530  2.066   -13.915 1.00 1.21 ? 80  SER A HB3    1 
ATOM 2212 H HG     . SER C 3 71 ? -84.731  3.535   -15.449 1.00 1.80 ? 80  SER A HG     1 
ATOM 2213 N N      . ARG C 3 72 ? -83.500  5.533   -12.375 1.00 0.76 ? 81  ARG A N      1 
ATOM 2214 C CA     . ARG C 3 72 ? -82.427  6.133   -11.525 1.00 0.85 ? 81  ARG A CA     1 
ATOM 2215 C C      . ARG C 3 72 ? -83.001  7.242   -10.623 1.00 0.78 ? 81  ARG A C      1 
ATOM 2216 O O      . ARG C 3 72 ? -83.134  7.082   -9.426  1.00 0.87 ? 81  ARG A O      1 
ATOM 2217 C CB     . ARG C 3 72 ? -81.386  6.733   -12.493 1.00 0.95 ? 81  ARG A CB     1 
ATOM 2218 C CG     . ARG C 3 72 ? -79.947  6.507   -12.038 1.00 1.62 ? 81  ARG A CG     1 
ATOM 2219 C CD     . ARG C 3 72 ? -79.001  7.060   -13.128 1.00 2.09 ? 81  ARG A CD     1 
ATOM 2220 N NE     . ARG C 3 72 ? -78.106  5.962   -13.585 1.00 3.09 ? 81  ARG A NE     1 
ATOM 2221 C CZ     . ARG C 3 72 ? -77.253  5.436   -12.780 1.00 3.91 ? 81  ARG A CZ     1 
ATOM 2222 N NH1    . ARG C 3 72 ? -77.048  5.988   -11.611 1.00 3.98 ? 81  ARG A NH1    1 
ATOM 2223 N NH2    . ARG C 3 72 ? -76.569  4.387   -13.153 1.00 4.99 ? 81  ARG A NH2    1 
ATOM 2224 H H      . ARG C 3 72 ? -83.660  5.901   -13.270 1.00 0.76 ? 81  ARG A H      1 
ATOM 2225 H HA     . ARG C 3 72 ? -81.968  5.366   -10.919 1.00 0.94 ? 81  ARG A HA     1 
ATOM 2226 H HB2    . ARG C 3 72 ? -81.508  6.264   -13.451 1.00 1.33 ? 81  ARG A HB2    1 
ATOM 2227 H HB3    . ARG C 3 72 ? -81.544  7.795   -12.606 1.00 1.14 ? 81  ARG A HB3    1 
ATOM 2228 H HG2    . ARG C 3 72 ? -79.779  7.019   -11.098 1.00 1.99 ? 81  ARG A HG2    1 
ATOM 2229 H HG3    . ARG C 3 72 ? -79.770  5.450   -11.911 1.00 2.32 ? 81  ARG A HG3    1 
ATOM 2230 H HD2    . ARG C 3 72 ? -79.551  7.382   -13.989 1.00 2.39 ? 81  ARG A HD2    1 
ATOM 2231 H HD3    . ARG C 3 72 ? -78.453  7.912   -12.734 1.00 2.27 ? 81  ARG A HD3    1 
ATOM 2232 H HE     . ARG C 3 72 ? -78.205  5.602   -14.490 1.00 3.46 ? 81  ARG A HE     1 
ATOM 2233 H HH11   . ARG C 3 72 ? -77.556  6.809   -11.351 1.00 3.46 ? 81  ARG A HH11   1 
ATOM 2234 H HH12   . ARG C 3 72 ? -76.374  5.599   -10.984 1.00 4.80 ? 81  ARG A HH12   1 
ATOM 2235 H HH21   . ARG C 3 72 ? -76.712  3.996   -14.062 1.00 5.27 ? 81  ARG A HH21   1 
ATOM 2236 H HH22   . ARG C 3 72 ? -75.901  3.977   -12.533 1.00 5.69 ? 81  ARG A HH22   1 
ATOM 2237 N N      . GLY C 3 73 ? -83.306  8.375   -11.199 1.00 0.68 ? 82  GLY A N      1 
ATOM 2238 C CA     . GLY C 3 73 ? -83.830  9.515   -10.401 1.00 0.69 ? 82  GLY A CA     1 
ATOM 2239 C C      . GLY C 3 73 ? -85.213  9.197   -9.850  1.00 0.68 ? 82  GLY A C      1 
ATOM 2240 O O      . GLY C 3 73 ? -85.553  9.591   -8.753  1.00 0.75 ? 82  GLY A O      1 
ATOM 2241 H H      . GLY C 3 73 ? -83.166  8.482   -12.163 1.00 0.65 ? 82  GLY A H      1 
ATOM 2242 H HA2    . GLY C 3 73 ? -83.157  9.715   -9.581  1.00 0.76 ? 82  GLY A HA2    1 
ATOM 2243 H HA3    . GLY C 3 73 ? -83.895  10.389  -11.031 1.00 0.69 ? 82  GLY A HA3    1 
ATOM 2244 N N      . LEU C 3 74 ? -86.029  8.510   -10.597 1.00 0.67 ? 83  LEU A N      1 
ATOM 2245 C CA     . LEU C 3 74 ? -87.390  8.214   -10.081 1.00 0.74 ? 83  LEU A CA     1 
ATOM 2246 C C      . LEU C 3 74 ? -87.247  7.302   -8.866  1.00 0.80 ? 83  LEU A C      1 
ATOM 2247 O O      . LEU C 3 74 ? -87.912  7.463   -7.866  1.00 0.87 ? 83  LEU A O      1 
ATOM 2248 C CB     . LEU C 3 74 ? -88.223  7.535   -11.187 1.00 0.78 ? 83  LEU A CB     1 
ATOM 2249 C CG     . LEU C 3 74 ? -89.777  7.589   -10.961 1.00 0.82 ? 83  LEU A CG     1 
ATOM 2250 C CD1    . LEU C 3 74 ? -90.304  6.308   -10.245 1.00 1.45 ? 83  LEU A CD1    1 
ATOM 2251 C CD2    . LEU C 3 74 ? -90.228  8.839   -10.167 1.00 1.43 ? 83  LEU A CD2    1 
ATOM 2252 H H      . LEU C 3 74 ? -85.755  8.207   -11.488 1.00 0.66 ? 83  LEU A H      1 
ATOM 2253 H HA     . LEU C 3 74 ? -87.824  9.141   -9.789  1.00 0.78 ? 83  LEU A HA     1 
ATOM 2254 H HB2    . LEU C 3 74 ? -87.991  8.018   -12.126 1.00 0.99 ? 83  LEU A HB2    1 
ATOM 2255 H HB3    . LEU C 3 74 ? -87.915  6.507   -11.255 1.00 0.88 ? 83  LEU A HB3    1 
ATOM 2256 H HG     . LEU C 3 74 ? -90.238  7.634   -11.941 1.00 1.63 ? 83  LEU A HG     1 
ATOM 2257 H HD11   . LEU C 3 74 ? -89.561  5.528   -10.260 1.00 2.00 ? 83  LEU A HD11   1 
ATOM 2258 H HD12   . LEU C 3 74 ? -90.557  6.527   -9.218  1.00 2.01 ? 83  LEU A HD12   1 
ATOM 2259 H HD13   . LEU C 3 74 ? -91.189  5.954   -10.753 1.00 1.98 ? 83  LEU A HD13   1 
ATOM 2260 H HD21   . LEU C 3 74 ? -89.805  9.729   -10.610 1.00 2.05 ? 83  LEU A HD21   1 
ATOM 2261 H HD22   . LEU C 3 74 ? -91.306  8.910   -10.202 1.00 1.92 ? 83  LEU A HD22   1 
ATOM 2262 H HD23   . LEU C 3 74 ? -89.912  8.753   -9.135  1.00 1.97 ? 83  LEU A HD23   1 
ATOM 2263 N N      . ARG C 3 75 ? -86.354  6.359   -8.935  1.00 0.81 ? 84  ARG A N      1 
ATOM 2264 C CA     . ARG C 3 75 ? -86.141  5.461   -7.772  1.00 0.91 ? 84  ARG A CA     1 
ATOM 2265 C C      . ARG C 3 75 ? -85.790  6.333   -6.560  1.00 0.89 ? 84  ARG A C      1 
ATOM 2266 O O      . ARG C 3 75 ? -86.532  6.409   -5.611  1.00 0.98 ? 84  ARG A O      1 
ATOM 2267 C CB     . ARG C 3 75 ? -84.988  4.501   -8.105  1.00 0.99 ? 84  ARG A CB     1 
ATOM 2268 C CG     . ARG C 3 75 ? -84.585  3.626   -6.886  1.00 1.43 ? 84  ARG A CG     1 
ATOM 2269 C CD     . ARG C 3 75 ? -83.061  3.458   -6.855  1.00 1.43 ? 84  ARG A CD     1 
ATOM 2270 N NE     . ARG C 3 75 ? -82.450  4.693   -6.287  1.00 1.44 ? 84  ARG A NE     1 
ATOM 2271 C CZ     . ARG C 3 75 ? -81.183  4.717   -5.979  1.00 1.65 ? 84  ARG A CZ     1 
ATOM 2272 N NH1    . ARG C 3 75 ? -80.431  3.680   -6.228  1.00 2.08 ? 84  ARG A NH1    1 
ATOM 2273 N NH2    . ARG C 3 75 ? -80.664  5.783   -5.435  1.00 2.28 ? 84  ARG A NH2    1 
ATOM 2274 H H      . ARG C 3 75 ? -85.811  6.253   -9.746  1.00 0.79 ? 84  ARG A H      1 
ATOM 2275 H HA     . ARG C 3 75 ? -87.043  4.900   -7.571  1.00 0.97 ? 84  ARG A HA     1 
ATOM 2276 H HB2    . ARG C 3 75 ? -85.302  3.856   -8.915  1.00 1.27 ? 84  ARG A HB2    1 
ATOM 2277 H HB3    . ARG C 3 75 ? -84.139  5.085   -8.433  1.00 1.50 ? 84  ARG A HB3    1 
ATOM 2278 H HG2    . ARG C 3 75 ? -84.907  4.084   -5.965  1.00 2.19 ? 84  ARG A HG2    1 
ATOM 2279 H HG3    . ARG C 3 75 ? -85.044  2.651   -6.972  1.00 1.98 ? 84  ARG A HG3    1 
ATOM 2280 H HD2    . ARG C 3 75 ? -82.801  2.621   -6.239  1.00 1.85 ? 84  ARG A HD2    1 
ATOM 2281 H HD3    . ARG C 3 75 ? -82.696  3.289   -7.860  1.00 2.06 ? 84  ARG A HD3    1 
ATOM 2282 H HE     . ARG C 3 75 ? -83.007  5.483   -6.124  1.00 2.00 ? 84  ARG A HE     1 
ATOM 2283 H HH11   . ARG C 3 75 ? -80.827  2.866   -6.655  1.00 2.31 ? 84  ARG A HH11   1 
ATOM 2284 H HH12   . ARG C 3 75 ? -79.459  3.699   -5.994  1.00 2.62 ? 84  ARG A HH12   1 
ATOM 2285 H HH21   . ARG C 3 75 ? -81.238  6.582   -5.254  1.00 2.76 ? 84  ARG A HH21   1 
ATOM 2286 H HH22   . ARG C 3 75 ? -79.693  5.802   -5.199  1.00 2.62 ? 84  ARG A HH22   1 
ATOM 2287 N N      . TYR C 3 76 ? -84.674  7.008   -6.593  1.00 0.82 ? 85  TYR A N      1 
ATOM 2288 C CA     . TYR C 3 76 ? -84.293  7.877   -5.437  1.00 0.84 ? 85  TYR A CA     1 
ATOM 2289 C C      . TYR C 3 76 ? -85.472  8.771   -5.031  1.00 0.83 ? 85  TYR A C      1 
ATOM 2290 O O      . TYR C 3 76 ? -85.424  9.459   -4.031  1.00 0.88 ? 85  TYR A O      1 
ATOM 2291 C CB     . TYR C 3 76 ? -83.105  8.760   -5.828  1.00 0.87 ? 85  TYR A CB     1 
ATOM 2292 C CG     . TYR C 3 76 ? -82.711  9.627   -4.654  1.00 0.90 ? 85  TYR A CG     1 
ATOM 2293 C CD1    . TYR C 3 76 ? -81.774  9.157   -3.713  1.00 1.01 ? 85  TYR A CD1    1 
ATOM 2294 C CD2    . TYR C 3 76 ? -83.281  10.906  -4.501  1.00 0.89 ? 85  TYR A CD2    1 
ATOM 2295 C CE1    . TYR C 3 76 ? -81.407  9.968   -2.621  1.00 1.07 ? 85  TYR A CE1    1 
ATOM 2296 C CE2    . TYR C 3 76 ? -82.913  11.716  -3.410  1.00 0.94 ? 85  TYR A CE2    1 
ATOM 2297 C CZ     . TYR C 3 76 ? -81.975  11.247  -2.470  1.00 1.02 ? 85  TYR A CZ     1 
ATOM 2298 O OH     . TYR C 3 76 ? -81.616  12.041  -1.400  1.00 1.10 ? 85  TYR A OH     1 
ATOM 2299 H H      . TYR C 3 76 ? -84.087  6.950   -7.377  1.00 0.78 ? 85  TYR A H      1 
ATOM 2300 H HA     . TYR C 3 76 ? -84.012  7.255   -4.601  1.00 0.87 ? 85  TYR A HA     1 
ATOM 2301 H HB2    . TYR C 3 76 ? -82.270  8.136   -6.111  1.00 0.93 ? 85  TYR A HB2    1 
ATOM 2302 H HB3    . TYR C 3 76 ? -83.382  9.389   -6.662  1.00 0.87 ? 85  TYR A HB3    1 
ATOM 2303 H HD1    . TYR C 3 76 ? -81.337  8.176   -3.829  1.00 1.08 ? 85  TYR A HD1    1 
ATOM 2304 H HD2    . TYR C 3 76 ? -84.003  11.264  -5.219  1.00 0.89 ? 85  TYR A HD2    1 
ATOM 2305 H HE1    . TYR C 3 76 ? -80.689  9.607   -1.899  1.00 1.19 ? 85  TYR A HE1    1 
ATOM 2306 H HE2    . TYR C 3 76 ? -83.348  12.698  -3.295  1.00 0.98 ? 85  TYR A HE2    1 
ATOM 2307 H HH     . TYR C 3 76 ? -82.412  12.255  -0.908  1.00 1.30 ? 85  TYR A HH     1 
ATOM 2308 N N      . TYR C 3 77 ? -86.516  8.791   -5.813  1.00 0.81 ? 86  TYR A N      1 
ATOM 2309 C CA     . TYR C 3 77 ? -87.681  9.664   -5.489  1.00 0.85 ? 86  TYR A CA     1 
ATOM 2310 C C      . TYR C 3 77 ? -88.540  9.065   -4.360  1.00 0.90 ? 86  TYR A C      1 
ATOM 2311 O O      . TYR C 3 77 ? -89.623  9.546   -4.089  1.00 1.10 ? 86  TYR A O      1 
ATOM 2312 C CB     . TYR C 3 77 ? -88.529  9.831   -6.758  1.00 0.84 ? 86  TYR A CB     1 
ATOM 2313 C CG     . TYR C 3 77 ? -89.236  11.163  -6.753  1.00 0.82 ? 86  TYR A CG     1 
ATOM 2314 C CD1    . TYR C 3 77 ? -88.500  12.338  -6.985  1.00 0.84 ? 86  TYR A CD1    1 
ATOM 2315 C CD2    . TYR C 3 77 ? -90.624  11.231  -6.530  1.00 0.85 ? 86  TYR A CD2    1 
ATOM 2316 C CE1    . TYR C 3 77 ? -89.148  13.583  -6.992  1.00 0.84 ? 86  TYR A CE1    1 
ATOM 2317 C CE2    . TYR C 3 77 ? -91.276  12.479  -6.537  1.00 0.85 ? 86  TYR A CE2    1 
ATOM 2318 C CZ     . TYR C 3 77 ? -90.535  13.656  -6.769  1.00 0.82 ? 86  TYR A CZ     1 
ATOM 2319 O OH     . TYR C 3 77 ? -91.168  14.880  -6.778  1.00 0.85 ? 86  TYR A OH     1 
ATOM 2320 H H      . TYR C 3 77 ? -86.527  8.248   -6.628  1.00 0.80 ? 86  TYR A H      1 
ATOM 2321 H HA     . TYR C 3 77 ? -87.312  10.630  -5.176  1.00 0.90 ? 86  TYR A HA     1 
ATOM 2322 H HB2    . TYR C 3 77 ? -87.882  9.785   -7.615  1.00 0.87 ? 86  TYR A HB2    1 
ATOM 2323 H HB3    . TYR C 3 77 ? -89.261  9.037   -6.819  1.00 0.86 ? 86  TYR A HB3    1 
ATOM 2324 H HD1    . TYR C 3 77 ? -87.435  12.282  -7.156  1.00 0.91 ? 86  TYR A HD1    1 
ATOM 2325 H HD2    . TYR C 3 77 ? -91.188  10.327  -6.352  1.00 0.93 ? 86  TYR A HD2    1 
ATOM 2326 H HE1    . TYR C 3 77 ? -88.581  14.482  -7.173  1.00 0.91 ? 86  TYR A HE1    1 
ATOM 2327 H HE2    . TYR C 3 77 ? -92.343  12.533  -6.368  1.00 0.93 ? 86  TYR A HE2    1 
ATOM 2328 H HH     . TYR C 3 77 ? -91.498  15.046  -5.894  1.00 0.82 ? 86  TYR A HH     1 
ATOM 2329 N N      . TYR C 3 78 ? -88.083  8.039   -3.688  1.00 0.87 ? 87  TYR A N      1 
ATOM 2330 C CA     . TYR C 3 78 ? -88.913  7.467   -2.581  1.00 0.94 ? 87  TYR A CA     1 
ATOM 2331 C C      . TYR C 3 78 ? -88.816  8.388   -1.359  1.00 1.06 ? 87  TYR A C      1 
ATOM 2332 O O      . TYR C 3 78 ? -88.912  7.944   -0.232  1.00 1.33 ? 87  TYR A O      1 
ATOM 2333 C CB     . TYR C 3 78 ? -88.405  6.077   -2.173  1.00 0.98 ? 87  TYR A CB     1 
ATOM 2334 C CG     . TYR C 3 78 ? -88.811  5.023   -3.171  1.00 0.96 ? 87  TYR A CG     1 
ATOM 2335 C CD1    . TYR C 3 78 ? -90.131  4.535   -3.180  1.00 1.27 ? 87  TYR A CD1    1 
ATOM 2336 C CD2    . TYR C 3 78 ? -87.867  4.514   -4.079  1.00 1.19 ? 87  TYR A CD2    1 
ATOM 2337 C CE1    . TYR C 3 78 ? -90.502  3.538   -4.096  1.00 1.38 ? 87  TYR A CE1    1 
ATOM 2338 C CE2    . TYR C 3 78 ? -88.240  3.520   -5.000  1.00 1.31 ? 87  TYR A CE2    1 
ATOM 2339 C CZ     . TYR C 3 78 ? -89.557  3.030   -5.005  1.00 1.23 ? 87  TYR A CZ     1 
ATOM 2340 O OH     . TYR C 3 78 ? -89.924  2.061   -5.908  1.00 1.47 ? 87  TYR A OH     1 
ATOM 2341 H H      . TYR C 3 78 ? -87.207  7.657   -3.901  1.00 0.93 ? 87  TYR A H      1 
ATOM 2342 H HA     . TYR C 3 78 ? -89.943  7.399   -2.900  1.00 0.94 ? 87  TYR A HA     1 
ATOM 2343 H HB2    . TYR C 3 78 ? -87.332  6.101   -2.103  1.00 1.02 ? 87  TYR A HB2    1 
ATOM 2344 H HB3    . TYR C 3 78 ? -88.821  5.817   -1.210  1.00 1.13 ? 87  TYR A HB3    1 
ATOM 2345 H HD1    . TYR C 3 78 ? -90.857  4.926   -2.482  1.00 1.66 ? 87  TYR A HD1    1 
ATOM 2346 H HD2    . TYR C 3 78 ? -86.855  4.876   -4.058  1.00 1.55 ? 87  TYR A HD2    1 
ATOM 2347 H HE1    . TYR C 3 78 ? -91.505  3.150   -4.090  1.00 1.80 ? 87  TYR A HE1    1 
ATOM 2348 H HE2    . TYR C 3 78 ? -87.515  3.131   -5.698  1.00 1.72 ? 87  TYR A HE2    1 
ATOM 2349 H HH     . TYR C 3 78 ? -89.145  1.819   -6.414  1.00 2.01 ? 87  TYR A HH     1 
ATOM 2350 N N      . ASP C 3 79 ? -88.620  9.660   -1.561  1.00 1.04 ? 88  ASP A N      1 
ATOM 2351 C CA     . ASP C 3 79 ? -88.513  10.581  -0.392  1.00 1.17 ? 88  ASP A CA     1 
ATOM 2352 C C      . ASP C 3 79 ? -89.901  10.887  0.139   1.00 1.03 ? 88  ASP A C      1 
ATOM 2353 O O      . ASP C 3 79 ? -90.090  11.067  1.326   1.00 1.14 ? 88  ASP A O      1 
ATOM 2354 C CB     . ASP C 3 79 ? -87.817  11.884  -0.818  1.00 1.37 ? 88  ASP A CB     1 
ATOM 2355 C CG     . ASP C 3 79 ? -86.299  11.689  -0.824  1.00 2.01 ? 88  ASP A CG     1 
ATOM 2356 O OD1    . ASP C 3 79 ? -85.848  10.712  -1.398  1.00 2.61 ? 88  ASP A OD1    1 
ATOM 2357 O OD2    . ASP C 3 79 ? -85.614  12.522  -0.254  1.00 2.54 ? 88  ASP A OD2    1 
ATOM 2358 H H      . ASP C 3 79 ? -88.539  10.009  -2.473  1.00 1.08 ? 88  ASP A H      1 
ATOM 2359 H HA     . ASP C 3 79 ? -87.953  10.106  0.390   1.00 1.38 ? 88  ASP A HA     1 
ATOM 2360 H HB2    . ASP C 3 79 ? -88.146  12.156  -1.810  1.00 1.60 ? 88  ASP A HB2    1 
ATOM 2361 H HB3    . ASP C 3 79 ? -88.071  12.677  -0.127  1.00 1.46 ? 88  ASP A HB3    1 
ATOM 2362 N N      . LYS C 3 80 ? -90.870  10.946  -0.725  1.00 1.00 ? 89  LYS A N      1 
ATOM 2363 C CA     . LYS C 3 80 ? -92.259  11.239  -0.280  1.00 1.13 ? 89  LYS A CA     1 
ATOM 2364 C C      . LYS C 3 80 ? -93.180  10.115  -0.713  1.00 1.13 ? 89  LYS A C      1 
ATOM 2365 O O      . LYS C 3 80 ? -92.942  9.429   -1.687  1.00 1.53 ? 89  LYS A O      1 
ATOM 2366 C CB     . LYS C 3 80 ? -92.744  12.524  -0.936  1.00 1.36 ? 89  LYS A CB     1 
ATOM 2367 C CG     . LYS C 3 80 ? -91.853  13.699  -0.520  1.00 1.54 ? 89  LYS A CG     1 
ATOM 2368 C CD     . LYS C 3 80 ? -92.043  14.864  -1.513  1.00 1.66 ? 89  LYS A CD     1 
ATOM 2369 C CE     . LYS C 3 80 ? -91.849  16.203  -0.802  1.00 2.21 ? 89  LYS A CE     1 
ATOM 2370 N NZ     . LYS C 3 80 ? -91.974  17.303  -1.797  1.00 2.85 ? 89  LYS A NZ     1 
ATOM 2371 H H      . LYS C 3 80 ? -90.685  10.795  -1.676  1.00 1.05 ? 89  LYS A H      1 
ATOM 2372 H HA     . LYS C 3 80 ? -92.306  11.345  0.795   1.00 1.21 ? 89  LYS A HA     1 
ATOM 2373 H HB2    . LYS C 3 80 ? -92.715  12.409  -2.009  1.00 1.54 ? 89  LYS A HB2    1 
ATOM 2374 H HB3    . LYS C 3 80 ? -93.759  12.720  -0.623  1.00 1.77 ? 89  LYS A HB3    1 
ATOM 2375 H HG2    . LYS C 3 80 ? -92.127  14.014  0.479   1.00 2.01 ? 89  LYS A HG2    1 
ATOM 2376 H HG3    . LYS C 3 80 ? -90.818  13.386  -0.525  1.00 1.78 ? 89  LYS A HG3    1 
ATOM 2377 H HD2    . LYS C 3 80 ? -91.319  14.777  -2.311  1.00 1.99 ? 89  LYS A HD2    1 
ATOM 2378 H HD3    . LYS C 3 80 ? -93.039  14.831  -1.934  1.00 1.97 ? 89  LYS A HD3    1 
ATOM 2379 H HE2    . LYS C 3 80 ? -92.606  16.318  -0.040  1.00 2.61 ? 89  LYS A HE2    1 
ATOM 2380 H HE3    . LYS C 3 80 ? -90.871  16.234  -0.348  1.00 2.63 ? 89  LYS A HE3    1 
ATOM 2381 H HZ1    . LYS C 3 80 ? -92.698  17.053  -2.501  1.00 3.23 ? 89  LYS A HZ1    1 
ATOM 2382 H HZ2    . LYS C 3 80 ? -92.253  18.179  -1.313  1.00 3.29 ? 89  LYS A HZ2    1 
ATOM 2383 H HZ3    . LYS C 3 80 ? -91.060  17.444  -2.273  1.00 3.13 ? 89  LYS A HZ3    1 
ATOM 2384 N N      . ASN C 3 81 ? -94.246  9.950   -0.005  1.00 1.01 ? 90  ASN A N      1 
ATOM 2385 C CA     . ASN C 3 81 ? -95.225  8.898   -0.375  1.00 1.02 ? 90  ASN A CA     1 
ATOM 2386 C C      . ASN C 3 81 ? -96.046  9.437   -1.531  1.00 0.97 ? 90  ASN A C      1 
ATOM 2387 O O      . ASN C 3 81 ? -97.069  10.062  -1.338  1.00 1.06 ? 90  ASN A O      1 
ATOM 2388 C CB     . ASN C 3 81 ? -96.154  8.612   0.808   1.00 1.19 ? 90  ASN A CB     1 
ATOM 2389 C CG     . ASN C 3 81 ? -95.326  8.423   2.077   1.00 1.95 ? 90  ASN A CG     1 
ATOM 2390 O OD1    . ASN C 3 81 ? -95.324  9.273   2.945   1.00 2.67 ? 90  ASN A OD1    1 
ATOM 2391 N ND2    . ASN C 3 81 ? -94.618  7.339   2.224   1.00 2.65 ? 90  ASN A ND2    1 
ATOM 2392 H H      . ASN C 3 81 ? -94.407  10.533  0.761   1.00 1.20 ? 90  ASN A H      1 
ATOM 2393 H HA     . ASN C 3 81 ? -94.714  8.000   -0.680  1.00 1.00 ? 90  ASN A HA     1 
ATOM 2394 H HB2    . ASN C 3 81 ? -96.834  9.443   0.942   1.00 1.39 ? 90  ASN A HB2    1 
ATOM 2395 H HB3    . ASN C 3 81 ? -96.718  7.714   0.611   1.00 1.65 ? 90  ASN A HB3    1 
ATOM 2396 H HD21   . ASN C 3 81 ? -94.619  6.654   1.524   1.00 2.78 ? 90  ASN A HD21   1 
ATOM 2397 H HD22   . ASN C 3 81 ? -94.084  7.211   3.035   1.00 3.41 ? 90  ASN A HD22   1 
ATOM 2398 N N      . ILE C 3 82 ? -95.590  9.217   -2.737  1.00 0.87 ? 91  ILE A N      1 
ATOM 2399 C CA     . ILE C 3 82 ? -96.329  9.732   -3.924  1.00 0.87 ? 91  ILE A CA     1 
ATOM 2400 C C      . ILE C 3 82 ? -96.336  8.667   -5.023  1.00 0.82 ? 91  ILE A C      1 
ATOM 2401 O O      . ILE C 3 82 ? -97.386  8.199   -5.416  1.00 0.88 ? 91  ILE A O      1 
ATOM 2402 C CB     . ILE C 3 82 ? -95.651  11.040  -4.386  1.00 0.92 ? 91  ILE A CB     1 
ATOM 2403 C CG1    . ILE C 3 82 ? -96.371  11.741  -5.604  1.00 1.17 ? 91  ILE A CG1    1 
ATOM 2404 C CG2    . ILE C 3 82 ? -94.171  10.762  -4.728  1.00 1.02 ? 91  ILE A CG2    1 
ATOM 2405 C CD1    . ILE C 3 82 ? -97.696  11.077  -6.041  1.00 0.95 ? 91  ILE A CD1    1 
ATOM 2406 H H      . ILE C 3 82 ? -94.752  8.722   -2.859  1.00 0.84 ? 91  ILE A H      1 
ATOM 2407 H HA     . ILE C 3 82 ? -97.338  9.939   -3.633  1.00 0.91 ? 91  ILE A HA     1 
ATOM 2408 H HB     . ILE C 3 82 ? -95.663  11.720  -3.541  1.00 0.97 ? 91  ILE A HB     1 
ATOM 2409 H HG12   . ILE C 3 82 ? -96.590  12.762  -5.332  1.00 1.73 ? 91  ILE A HG12   1 
ATOM 2410 H HG13   . ILE C 3 82 ? -95.708  11.759  -6.452  1.00 1.58 ? 91  ILE A HG13   1 
ATOM 2411 H HG21   . ILE C 3 82 ? -93.763  10.039  -4.038  1.00 1.37 ? 91  ILE A HG21   1 
ATOM 2412 H HG22   . ILE C 3 82 ? -94.090  10.382  -5.732  1.00 1.38 ? 91  ILE A HG22   1 
ATOM 2413 H HG23   . ILE C 3 82 ? -93.610  11.680  -4.648  1.00 1.58 ? 91  ILE A HG23   1 
ATOM 2414 H HD11   . ILE C 3 82 ? -98.303  10.835  -5.190  1.00 1.38 ? 91  ILE A HD11   1 
ATOM 2415 H HD12   . ILE C 3 82 ? -98.236  11.771  -6.667  1.00 1.39 ? 91  ILE A HD12   1 
ATOM 2416 H HD13   . ILE C 3 82 ? -97.491  10.189  -6.612  1.00 1.37 ? 91  ILE A HD13   1 
ATOM 2417 N N      . ILE C 3 83 ? -95.188  8.265   -5.518  1.00 0.86 ? 92  ILE A N      1 
ATOM 2418 C CA     . ILE C 3 83 ? -95.152  7.220   -6.591  1.00 0.81 ? 92  ILE A CA     1 
ATOM 2419 C C      . ILE C 3 83 ? -94.222  6.092   -6.183  1.00 0.80 ? 92  ILE A C      1 
ATOM 2420 O O      . ILE C 3 83 ? -93.047  6.290   -5.948  1.00 0.82 ? 92  ILE A O      1 
ATOM 2421 C CB     . ILE C 3 83 ? -94.652  7.817   -7.914  1.00 0.79 ? 92  ILE A CB     1 
ATOM 2422 C CG1    . ILE C 3 83 ? -94.776  6.755   -9.026  1.00 0.79 ? 92  ILE A CG1    1 
ATOM 2423 C CG2    . ILE C 3 83 ? -93.185  8.257   -7.778  1.00 0.79 ? 92  ILE A CG2    1 
ATOM 2424 C CD1    . ILE C 3 83 ? -94.081  7.240   -10.298 1.00 1.08 ? 92  ILE A CD1    1 
ATOM 2425 H H      . ILE C 3 83 ? -94.354  8.642   -5.184  1.00 1.01 ? 92  ILE A H      1 
ATOM 2426 H HA     . ILE C 3 83 ? -96.132  6.815   -6.742  1.00 0.83 ? 92  ILE A HA     1 
ATOM 2427 H HB     . ILE C 3 83 ? -95.260  8.674   -8.169  1.00 0.80 ? 92  ILE A HB     1 
ATOM 2428 H HG12   . ILE C 3 83 ? -94.317  5.832   -8.706  1.00 0.99 ? 92  ILE A HG12   1 
ATOM 2429 H HG13   . ILE C 3 83 ? -95.816  6.576   -9.237  1.00 1.25 ? 92  ILE A HG13   1 
ATOM 2430 H HG21   . ILE C 3 83 ? -93.013  8.655   -6.791  1.00 1.39 ? 92  ILE A HG21   1 
ATOM 2431 H HG22   . ILE C 3 83 ? -92.533  7.411   -7.938  1.00 1.14 ? 92  ILE A HG22   1 
ATOM 2432 H HG23   . ILE C 3 83 ? -92.971  9.019   -8.513  1.00 1.30 ? 92  ILE A HG23   1 
ATOM 2433 H HD11   . ILE C 3 83 ? -94.284  8.285   -10.450 1.00 1.62 ? 92  ILE A HD11   1 
ATOM 2434 H HD12   . ILE C 3 83 ? -93.024  7.099   -10.197 1.00 1.63 ? 92  ILE A HD12   1 
ATOM 2435 H HD13   . ILE C 3 83 ? -94.440  6.674   -11.144 1.00 1.52 ? 92  ILE A HD13   1 
ATOM 2436 N N      . HIS C 3 84 ? -94.748  4.898   -6.131  1.00 0.82 ? 93  HIS A N      1 
ATOM 2437 C CA     . HIS C 3 84 ? -93.922  3.709   -5.778  1.00 0.86 ? 93  HIS A CA     1 
ATOM 2438 C C      . HIS C 3 84 ? -93.899  2.773   -6.982  1.00 0.85 ? 93  HIS A C      1 
ATOM 2439 O O      . HIS C 3 84 ? -94.891  2.609   -7.663  1.00 0.88 ? 93  HIS A O      1 
ATOM 2440 C CB     . HIS C 3 84 ? -94.539  2.985   -4.579  1.00 0.96 ? 93  HIS A CB     1 
ATOM 2441 C CG     . HIS C 3 84 ? -94.298  3.776   -3.320  1.00 1.00 ? 93  HIS A CG     1 
ATOM 2442 N ND1    . HIS C 3 84 ? -93.804  3.188   -2.166  1.00 1.34 ? 93  HIS A ND1    1 
ATOM 2443 C CD2    . HIS C 3 84 ? -94.485  5.102   -3.013  1.00 1.00 ? 93  HIS A CD2    1 
ATOM 2444 C CE1    . HIS C 3 84 ? -93.712  4.149   -1.228  1.00 1.52 ? 93  HIS A CE1    1 
ATOM 2445 N NE2    . HIS C 3 84 ? -94.115  5.334   -1.692  1.00 1.30 ? 93  HIS A NE2    1 
ATOM 2446 H H      . HIS C 3 84 ? -95.698  4.779   -6.348  1.00 0.85 ? 93  HIS A H      1 
ATOM 2447 H HA     . HIS C 3 84 ? -92.918  4.014   -5.547  1.00 0.87 ? 93  HIS A HA     1 
ATOM 2448 H HB2    . HIS C 3 84 ? -95.601  2.875   -4.735  1.00 1.09 ? 93  HIS A HB2    1 
ATOM 2449 H HB3    . HIS C 3 84 ? -94.088  2.009   -4.480  1.00 1.08 ? 93  HIS A HB3    1 
ATOM 2450 H HD1    . HIS C 3 84 ? -93.562  2.245   -2.055  1.00 1.50 ? 93  HIS A HD1    1 
ATOM 2451 H HD2    . HIS C 3 84 ? -94.856  5.853   -3.691  1.00 0.98 ? 93  HIS A HD2    1 
ATOM 2452 H HE1    . HIS C 3 84 ? -93.359  3.981   -0.222  1.00 1.88 ? 93  HIS A HE1    1 
ATOM 2453 N N      . LYS C 3 85 ? -92.780  2.160   -7.269  1.00 0.88 ? 94  LYS A N      1 
ATOM 2454 C CA     . LYS C 3 85 ? -92.728  1.247   -8.448  1.00 0.89 ? 94  LYS A CA     1 
ATOM 2455 C C      . LYS C 3 85 ? -93.197  -0.147  -8.016  1.00 0.92 ? 94  LYS A C      1 
ATOM 2456 O O      . LYS C 3 85 ? -93.124  -0.508  -6.858  1.00 1.03 ? 94  LYS A O      1 
ATOM 2457 C CB     . LYS C 3 85 ? -91.304  1.235   -9.032  1.00 1.04 ? 94  LYS A CB     1 
ATOM 2458 C CG     . LYS C 3 85 ? -90.408  0.209   -8.325  1.00 1.61 ? 94  LYS A CG     1 
ATOM 2459 C CD     . LYS C 3 85 ? -88.941  0.438   -8.736  1.00 1.68 ? 94  LYS A CD     1 
ATOM 2460 C CE     . LYS C 3 85 ? -88.003  -0.151  -7.679  1.00 2.10 ? 94  LYS A CE     1 
ATOM 2461 N NZ     . LYS C 3 85 ? -88.453  -1.523  -7.324  1.00 2.90 ? 94  LYS A NZ     1 
ATOM 2462 H H      . LYS C 3 85 ? -91.981  2.303   -6.719  1.00 0.94 ? 94  LYS A H      1 
ATOM 2463 H HA     . LYS C 3 85 ? -93.411  1.615   -9.205  1.00 0.88 ? 94  LYS A HA     1 
ATOM 2464 H HB2    . LYS C 3 85 ? -91.351  0.998   -10.084 1.00 1.63 ? 94  LYS A HB2    1 
ATOM 2465 H HB3    . LYS C 3 85 ? -90.881  2.221   -8.911  1.00 1.45 ? 94  LYS A HB3    1 
ATOM 2466 H HG2    . LYS C 3 85 ? -90.514  0.309   -7.257  1.00 2.20 ? 94  LYS A HG2    1 
ATOM 2467 H HG3    . LYS C 3 85 ? -90.707  -0.785  -8.621  1.00 2.25 ? 94  LYS A HG3    1 
ATOM 2468 H HD2    . LYS C 3 85 ? -88.761  -0.043  -9.684  1.00 1.88 ? 94  LYS A HD2    1 
ATOM 2469 H HD3    . LYS C 3 85 ? -88.741  1.496   -8.831  1.00 2.21 ? 94  LYS A HD3    1 
ATOM 2470 H HE2    . LYS C 3 85 ? -86.998  -0.191  -8.070  1.00 2.46 ? 94  LYS A HE2    1 
ATOM 2471 H HE3    . LYS C 3 85 ? -88.018  0.473   -6.798  1.00 2.46 ? 94  LYS A HE3    1 
ATOM 2472 H HZ1    . LYS C 3 85 ? -89.308  -1.758  -7.869  1.00 3.20 ? 94  LYS A HZ1    1 
ATOM 2473 H HZ2    . LYS C 3 85 ? -87.700  -2.203  -7.546  1.00 3.38 ? 94  LYS A HZ2    1 
ATOM 2474 H HZ3    . LYS C 3 85 ? -88.666  -1.564  -6.308  1.00 3.33 ? 94  LYS A HZ3    1 
ATOM 2475 N N      . THR C 3 86 ? -93.732  -0.905  -8.932  1.00 0.90 ? 95  THR A N      1 
ATOM 2476 C CA     . THR C 3 86 ? -94.280  -2.251  -8.582  1.00 1.02 ? 95  THR A CA     1 
ATOM 2477 C C      . THR C 3 86 ? -93.203  -3.340  -8.662  1.00 1.13 ? 95  THR A C      1 
ATOM 2478 O O      . THR C 3 86 ? -92.383  -3.363  -9.558  1.00 1.13 ? 95  THR A O      1 
ATOM 2479 C CB     . THR C 3 86 ? -95.412  -2.571  -9.564  1.00 1.06 ? 95  THR A CB     1 
ATOM 2480 O OG1    . THR C 3 86 ? -96.364  -1.517  -9.531  1.00 1.11 ? 95  THR A OG1    1 
ATOM 2481 C CG2    . THR C 3 86 ? -96.107  -3.888  -9.185  1.00 1.22 ? 95  THR A CG2    1 
ATOM 2482 H H      . THR C 3 86 ? -93.818  -0.570  -9.849  1.00 0.87 ? 95  THR A H      1 
ATOM 2483 H HA     . THR C 3 86 ? -94.682  -2.224  -7.580  1.00 1.09 ? 95  THR A HA     1 
ATOM 2484 H HB     . THR C 3 86 ? -95.006  -2.653  -10.560 1.00 1.06 ? 95  THR A HB     1 
ATOM 2485 H HG1    . THR C 3 86 ? -96.206  -0.999  -8.738  1.00 1.48 ? 95  THR A HG1    1 
ATOM 2486 H HG21   . THR C 3 86 ? -96.029  -4.057  -8.120  1.00 1.62 ? 95  THR A HG21   1 
ATOM 2487 H HG22   . THR C 3 86 ? -97.150  -3.830  -9.461  1.00 1.48 ? 95  THR A HG22   1 
ATOM 2488 H HG23   . THR C 3 86 ? -95.646  -4.708  -9.714  1.00 1.68 ? 95  THR A HG23   1 
ATOM 2489 N N      . ALA C 3 87 ? -93.219  -4.251  -7.719  1.00 1.31 ? 96  ALA A N      1 
ATOM 2490 C CA     . ALA C 3 87 ? -92.222  -5.361  -7.710  1.00 1.51 ? 96  ALA A CA     1 
ATOM 2491 C C      . ALA C 3 87 ? -92.694  -6.478  -8.644  1.00 1.55 ? 96  ALA A C      1 
ATOM 2492 O O      . ALA C 3 87 ? -92.205  -7.589  -8.598  1.00 1.71 ? 96  ALA A O      1 
ATOM 2493 C CB     . ALA C 3 87 ? -92.086  -5.915  -6.287  1.00 1.76 ? 96  ALA A CB     1 
ATOM 2494 H H      . ALA C 3 87 ? -93.899  -4.206  -7.015  1.00 1.37 ? 96  ALA A H      1 
ATOM 2495 H HA     . ALA C 3 87 ? -91.265  -4.991  -8.045  1.00 1.54 ? 96  ALA A HA     1 
ATOM 2496 H HB1    . ALA C 3 87 ? -92.070  -5.097  -5.582  1.00 1.83 ? 96  ALA A HB1    1 
ATOM 2497 H HB2    . ALA C 3 87 ? -92.924  -6.561  -6.067  1.00 2.25 ? 96  ALA A HB2    1 
ATOM 2498 H HB3    . ALA C 3 87 ? -91.168  -6.478  -6.206  1.00 2.15 ? 96  ALA A HB3    1 
ATOM 2499 N N      . GLY C 3 88 ? -93.637  -6.190  -9.493  1.00 1.49 ? 97  GLY A N      1 
ATOM 2500 C CA     . GLY C 3 88 ? -94.135  -7.234  -10.432 1.00 1.63 ? 97  GLY A CA     1 
ATOM 2501 C C      . GLY C 3 88 ? -93.121  -7.384  -11.560 1.00 1.62 ? 97  GLY A C      1 
ATOM 2502 O O      . GLY C 3 88 ? -92.333  -8.308  -11.579 1.00 1.81 ? 97  GLY A O      1 
ATOM 2503 H H      . GLY C 3 88 ? -94.013  -5.288  -9.518  1.00 1.43 ? 97  GLY A H      1 
ATOM 2504 H HA2    . GLY C 3 88 ? -94.244  -8.173  -9.908  1.00 1.80 ? 97  GLY A HA2    1 
ATOM 2505 H HA3    . GLY C 3 88 ? -95.086  -6.931  -10.842 1.00 1.65 ? 97  GLY A HA3    1 
ATOM 2506 N N      . LYS C 3 89 ? -93.125  -6.464  -12.488 1.00 1.53 ? 98  LYS A N      1 
ATOM 2507 C CA     . LYS C 3 89 ? -92.154  -6.505  -13.620 1.00 1.59 ? 98  LYS A CA     1 
ATOM 2508 C C      . LYS C 3 89 ? -91.169  -5.338  -13.434 1.00 1.49 ? 98  LYS A C      1 
ATOM 2509 O O      . LYS C 3 89 ? -90.753  -5.059  -12.327 1.00 2.05 ? 98  LYS A O      1 
ATOM 2510 C CB     . LYS C 3 89 ? -92.940  -6.404  -14.955 1.00 1.77 ? 98  LYS A CB     1 
ATOM 2511 C CG     . LYS C 3 89 ? -92.528  -7.547  -15.890 1.00 2.16 ? 98  LYS A CG     1 
ATOM 2512 C CD     . LYS C 3 89 ? -93.239  -7.397  -17.231 1.00 2.56 ? 98  LYS A CD     1 
ATOM 2513 C CE     . LYS C 3 89 ? -92.699  -8.443  -18.205 1.00 2.74 ? 98  LYS A CE     1 
ATOM 2514 N NZ     . LYS C 3 89 ? -93.032  -9.807  -17.705 1.00 3.32 ? 98  LYS A NZ     1 
ATOM 2515 H H      . LYS C 3 89 ? -93.764  -5.728  -12.431 1.00 1.53 ? 98  LYS A H      1 
ATOM 2516 H HA     . LYS C 3 89 ? -91.595  -7.434  -13.589 1.00 1.76 ? 98  LYS A HA     1 
ATOM 2517 H HB2    . LYS C 3 89 ? -93.996  -6.484  -14.747 1.00 2.20 ? 98  LYS A HB2    1 
ATOM 2518 H HB3    . LYS C 3 89 ? -92.752  -5.462  -15.443 1.00 1.86 ? 98  LYS A HB3    1 
ATOM 2519 H HG2    . LYS C 3 89 ? -91.459  -7.520  -16.042 1.00 2.59 ? 98  LYS A HG2    1 
ATOM 2520 H HG3    . LYS C 3 89 ? -92.804  -8.490  -15.442 1.00 2.58 ? 98  LYS A HG3    1 
ATOM 2521 H HD2    . LYS C 3 89 ? -94.301  -7.542  -17.093 1.00 2.94 ? 98  LYS A HD2    1 
ATOM 2522 H HD3    . LYS C 3 89 ? -93.057  -6.409  -17.627 1.00 3.05 ? 98  LYS A HD3    1 
ATOM 2523 H HE2    . LYS C 3 89 ? -93.148  -8.296  -19.176 1.00 3.04 ? 98  LYS A HE2    1 
ATOM 2524 H HE3    . LYS C 3 89 ? -91.627  -8.340  -18.285 1.00 2.88 ? 98  LYS A HE3    1 
ATOM 2525 H HZ1    . LYS C 3 89 ? -93.721  -9.735  -16.930 1.00 3.75 ? 98  LYS A HZ1    1 
ATOM 2526 H HZ2    . LYS C 3 89 ? -93.438  -10.370 -18.480 1.00 3.75 ? 98  LYS A HZ2    1 
ATOM 2527 H HZ3    . LYS C 3 89 ? -92.168  -10.269 -17.355 1.00 3.47 ? 98  LYS A HZ3    1 
ATOM 2528 N N      . ARG C 3 90 ? -90.780  -4.665  -14.489 1.00 1.23 ? 99  ARG A N      1 
ATOM 2529 C CA     . ARG C 3 90 ? -89.812  -3.531  -14.355 1.00 1.32 ? 99  ARG A CA     1 
ATOM 2530 C C      . ARG C 3 90 ? -90.419  -2.270  -14.962 1.00 1.06 ? 99  ARG A C      1 
ATOM 2531 O O      . ARG C 3 90 ? -90.254  -1.180  -14.452 1.00 1.10 ? 99  ARG A O      1 
ATOM 2532 C CB     . ARG C 3 90 ? -88.524  -3.908  -15.094 1.00 1.69 ? 99  ARG A CB     1 
ATOM 2533 C CG     . ARG C 3 90 ? -88.246  -5.403  -14.864 1.00 2.21 ? 99  ARG A CG     1 
ATOM 2534 C CD     . ARG C 3 90 ? -86.775  -5.731  -15.124 1.00 2.61 ? 99  ARG A CD     1 
ATOM 2535 N NE     . ARG C 3 90 ? -86.460  -7.042  -14.497 1.00 3.31 ? 99  ARG A NE     1 
ATOM 2536 C CZ     . ARG C 3 90 ? -85.388  -7.691  -14.846 1.00 4.05 ? 99  ARG A CZ     1 
ATOM 2537 N NH1    . ARG C 3 90 ? -84.602  -7.206  -15.768 1.00 4.39 ? 99  ARG A NH1    1 
ATOM 2538 N NH2    . ARG C 3 90 ? -85.105  -8.829  -14.276 1.00 4.80 ? 99  ARG A NH2    1 
ATOM 2539 H H      . ARG C 3 90 ? -91.114  -4.911  -15.374 1.00 1.39 ? 99  ARG A H      1 
ATOM 2540 H HA     . ARG C 3 90 ? -89.585  -3.347  -13.315 1.00 1.57 ? 99  ARG A HA     1 
ATOM 2541 H HB2    . ARG C 3 90 ? -88.642  -3.720  -16.154 1.00 1.87 ? 99  ARG A HB2    1 
ATOM 2542 H HB3    . ARG C 3 90 ? -87.705  -3.321  -14.711 1.00 2.03 ? 99  ARG A HB3    1 
ATOM 2543 H HG2    . ARG C 3 90 ? -88.490  -5.666  -13.845 1.00 2.59 ? 99  ARG A HG2    1 
ATOM 2544 H HG3    . ARG C 3 90 ? -88.860  -5.983  -15.537 1.00 2.71 ? 99  ARG A HG3    1 
ATOM 2545 H HD2    . ARG C 3 90 ? -86.598  -5.783  -16.189 1.00 2.82 ? 99  ARG A HD2    1 
ATOM 2546 H HD3    . ARG C 3 90 ? -86.146  -4.976  -14.689 1.00 2.90 ? 99  ARG A HD3    1 
ATOM 2547 H HE     . ARG C 3 90 ? -87.056  -7.412  -13.812 1.00 3.50 ? 99  ARG A HE     1 
ATOM 2548 H HH11   . ARG C 3 90 ? -84.824  -6.335  -16.205 1.00 4.11 ? 99  ARG A HH11   1 
ATOM 2549 H HH12   . ARG C 3 90 ? -83.780  -7.706  -16.037 1.00 5.15 ? 99  ARG A HH12   1 
ATOM 2550 H HH21   . ARG C 3 90 ? -85.711  -9.199  -13.571 1.00 4.91 ? 99  ARG A HH21   1 
ATOM 2551 H HH22   . ARG C 3 90 ? -84.283  -9.331  -14.542 1.00 5.42 ? 99  ARG A HH22   1 
ATOM 2552 N N      . TYR C 3 91 ? -91.126  -2.407  -16.047 1.00 0.96 ? 100 TYR A N      1 
ATOM 2553 C CA     . TYR C 3 91 ? -91.746  -1.216  -16.685 1.00 0.85 ? 100 TYR A CA     1 
ATOM 2554 C C      . TYR C 3 91 ? -93.103  -0.955  -16.035 1.00 0.81 ? 100 TYR A C      1 
ATOM 2555 O O      . TYR C 3 91 ? -93.880  -0.144  -16.499 1.00 0.80 ? 100 TYR A O      1 
ATOM 2556 C CB     . TYR C 3 91 ? -91.917  -1.481  -18.177 1.00 0.99 ? 100 TYR A CB     1 
ATOM 2557 C CG     . TYR C 3 91 ? -90.597  -1.956  -18.726 1.00 1.08 ? 100 TYR A CG     1 
ATOM 2558 C CD1    . TYR C 3 91 ? -89.585  -1.026  -19.039 1.00 1.06 ? 100 TYR A CD1    1 
ATOM 2559 C CD2    . TYR C 3 91 ? -90.370  -3.332  -18.908 1.00 1.28 ? 100 TYR A CD2    1 
ATOM 2560 C CE1    . TYR C 3 91 ? -88.349  -1.476  -19.537 1.00 1.16 ? 100 TYR A CE1    1 
ATOM 2561 C CE2    . TYR C 3 91 ? -89.134  -3.781  -19.404 1.00 1.39 ? 100 TYR A CE2    1 
ATOM 2562 C CZ     . TYR C 3 91 ? -88.125  -2.854  -19.719 1.00 1.30 ? 100 TYR A CZ     1 
ATOM 2563 O OH     . TYR C 3 91 ? -86.918  -3.297  -20.206 1.00 1.43 ? 100 TYR A OH     1 
ATOM 2564 H H      . TYR C 3 91 ? -91.248  -3.296  -16.442 1.00 1.09 ? 100 TYR A H      1 
ATOM 2565 H HA     . TYR C 3 91 ? -91.108  -0.355  -16.547 1.00 0.86 ? 100 TYR A HA     1 
ATOM 2566 H HB2    . TYR C 3 91 ? -92.672  -2.240  -18.329 1.00 1.08 ? 100 TYR A HB2    1 
ATOM 2567 H HB3    . TYR C 3 91 ? -92.210  -0.570  -18.677 1.00 1.05 ? 100 TYR A HB3    1 
ATOM 2568 H HD1    . TYR C 3 91 ? -89.758  0.031   -18.898 1.00 1.06 ? 100 TYR A HD1    1 
ATOM 2569 H HD2    . TYR C 3 91 ? -91.145  -4.044  -18.667 1.00 1.40 ? 100 TYR A HD2    1 
ATOM 2570 H HE1    . TYR C 3 91 ? -87.573  -0.765  -19.779 1.00 1.21 ? 100 TYR A HE1    1 
ATOM 2571 H HE2    . TYR C 3 91 ? -88.959  -4.837  -19.542 1.00 1.60 ? 100 TYR A HE2    1 
ATOM 2572 H HH     . TYR C 3 91 ? -86.807  -2.943  -21.091 1.00 1.58 ? 100 TYR A HH     1 
ATOM 2573 N N      . VAL C 3 92 ? -93.391  -1.631  -14.950 1.00 0.83 ? 101 VAL A N      1 
ATOM 2574 C CA     . VAL C 3 92 ? -94.691  -1.415  -14.256 1.00 0.82 ? 101 VAL A CA     1 
ATOM 2575 C C      . VAL C 3 92 ? -94.520  -0.321  -13.205 1.00 0.76 ? 101 VAL A C      1 
ATOM 2576 O O      . VAL C 3 92 ? -93.792  -0.477  -12.244 1.00 0.79 ? 101 VAL A O      1 
ATOM 2577 C CB     . VAL C 3 92 ? -95.147  -2.712  -13.570 1.00 0.94 ? 101 VAL A CB     1 
ATOM 2578 C CG1    . VAL C 3 92 ? -95.853  -3.616  -14.586 1.00 1.33 ? 101 VAL A CG1    1 
ATOM 2579 C CG2    . VAL C 3 92 ? -93.930  -3.440  -12.987 1.00 1.14 ? 101 VAL A CG2    1 
ATOM 2580 H H      . VAL C 3 92 ? -92.746  -2.274  -14.587 1.00 0.87 ? 101 VAL A H      1 
ATOM 2581 H HA     . VAL C 3 92 ? -95.436  -1.109  -14.967 1.00 0.83 ? 101 VAL A HA     1 
ATOM 2582 H HB     . VAL C 3 92 ? -95.840  -2.474  -12.772 1.00 1.08 ? 101 VAL A HB     1 
ATOM 2583 H HG11   . VAL C 3 92 ? -95.177  -3.844  -15.397 1.00 1.78 ? 101 VAL A HG11   1 
ATOM 2584 H HG12   . VAL C 3 92 ? -96.158  -4.532  -14.102 1.00 1.72 ? 101 VAL A HG12   1 
ATOM 2585 H HG13   . VAL C 3 92 ? -96.723  -3.107  -14.975 1.00 1.76 ? 101 VAL A HG13   1 
ATOM 2586 H HG21   . VAL C 3 92 ? -93.241  -2.723  -12.566 1.00 1.52 ? 101 VAL A HG21   1 
ATOM 2587 H HG22   . VAL C 3 92 ? -94.257  -4.113  -12.213 1.00 1.49 ? 101 VAL A HG22   1 
ATOM 2588 H HG23   . VAL C 3 92 ? -93.433  -4.000  -13.765 1.00 1.74 ? 101 VAL A HG23   1 
ATOM 2589 N N      . TYR C 3 93 ? -95.203  0.777   -13.375 1.00 0.71 ? 102 TYR A N      1 
ATOM 2590 C CA     . TYR C 3 93 ? -95.117  1.894   -12.388 1.00 0.68 ? 102 TYR A CA     1 
ATOM 2591 C C      . TYR C 3 93 ? -96.460  2.012   -11.691 1.00 0.70 ? 102 TYR A C      1 
ATOM 2592 O O      . TYR C 3 93 ? -97.462  1.524   -12.172 1.00 0.73 ? 102 TYR A O      1 
ATOM 2593 C CB     . TYR C 3 93 ? -94.778  3.196   -13.115 1.00 0.70 ? 102 TYR A CB     1 
ATOM 2594 C CG     . TYR C 3 93 ? -93.302  3.198   -13.427 1.00 0.73 ? 102 TYR A CG     1 
ATOM 2595 C CD1    . TYR C 3 93 ? -92.797  2.357   -14.432 1.00 0.92 ? 102 TYR A CD1    1 
ATOM 2596 C CD2    . TYR C 3 93 ? -92.430  4.025   -12.697 1.00 0.91 ? 102 TYR A CD2    1 
ATOM 2597 C CE1    . TYR C 3 93 ? -91.418  2.341   -14.707 1.00 0.99 ? 102 TYR A CE1    1 
ATOM 2598 C CE2    . TYR C 3 93 ? -91.052  4.011   -12.976 1.00 0.98 ? 102 TYR A CE2    1 
ATOM 2599 C CZ     . TYR C 3 93 ? -90.546  3.168   -13.977 1.00 0.89 ? 102 TYR A CZ     1 
ATOM 2600 O OH     . TYR C 3 93 ? -89.193  3.151   -14.249 1.00 1.00 ? 102 TYR A OH     1 
ATOM 2601 H H      . TYR C 3 93 ? -95.791  0.864   -14.154 1.00 0.72 ? 102 TYR A H      1 
ATOM 2602 H HA     . TYR C 3 93 ? -94.356  1.684   -11.647 1.00 0.68 ? 102 TYR A HA     1 
ATOM 2603 H HB2    . TYR C 3 93 ? -95.345  3.255   -14.034 1.00 0.72 ? 102 TYR A HB2    1 
ATOM 2604 H HB3    . TYR C 3 93 ? -95.018  4.039   -12.485 1.00 0.74 ? 102 TYR A HB3    1 
ATOM 2605 H HD1    . TYR C 3 93 ? -93.466  1.721   -14.989 1.00 1.18 ? 102 TYR A HD1    1 
ATOM 2606 H HD2    . TYR C 3 93 ? -92.820  4.674   -11.928 1.00 1.16 ? 102 TYR A HD2    1 
ATOM 2607 H HE1    . TYR C 3 93 ? -91.029  1.701   -15.481 1.00 1.27 ? 102 TYR A HE1    1 
ATOM 2608 H HE2    . TYR C 3 93 ? -90.385  4.644   -12.421 1.00 1.26 ? 102 TYR A HE2    1 
ATOM 2609 H HH     . TYR C 3 93 ? -88.753  3.704   -13.599 1.00 1.31 ? 102 TYR A HH     1 
ATOM 2610 N N      . ARG C 3 94 ? -96.493  2.623   -10.545 1.00 0.72 ? 103 ARG A N      1 
ATOM 2611 C CA     . ARG C 3 94 ? -97.782  2.726   -9.815  1.00 0.76 ? 103 ARG A CA     1 
ATOM 2612 C C      . ARG C 3 94 ? -97.762  3.958   -8.916  1.00 0.76 ? 103 ARG A C      1 
ATOM 2613 O O      . ARG C 3 94 ? -96.719  4.509   -8.626  1.00 0.75 ? 103 ARG A O      1 
ATOM 2614 C CB     . ARG C 3 94 ? -97.950  1.453   -8.972  1.00 0.84 ? 103 ARG A CB     1 
ATOM 2615 C CG     . ARG C 3 94 ? -99.434  1.089   -8.825  1.00 1.44 ? 103 ARG A CG     1 
ATOM 2616 C CD     . ARG C 3 94 ? -99.572  -0.254  -8.081  1.00 1.50 ? 103 ARG A CD     1 
ATOM 2617 N NE     . ARG C 3 94 ? -100.529 -0.081  -6.957  1.00 1.93 ? 103 ARG A NE     1 
ATOM 2618 C CZ     . ARG C 3 94 ? -100.954 -1.121  -6.301  1.00 2.19 ? 103 ARG A CZ     1 
ATOM 2619 N NH1    . ARG C 3 94 ? -100.497 -2.307  -6.597  1.00 2.20 ? 103 ARG A NH1    1 
ATOM 2620 N NH2    . ARG C 3 94 ? -101.820 -0.975  -5.339  1.00 2.99 ? 103 ARG A NH2    1 
ATOM 2621 H H      . ARG C 3 94 ? -95.672  2.991   -10.155 1.00 0.72 ? 103 ARG A H      1 
ATOM 2622 H HA     . ARG C 3 94 ? -98.596  2.813   -10.521 1.00 0.77 ? 103 ARG A HA     1 
ATOM 2623 H HB2    . ARG C 3 94 ? -97.434  0.638   -9.458  1.00 1.02 ? 103 ARG A HB2    1 
ATOM 2624 H HB3    . ARG C 3 94 ? -97.524  1.604   -7.990  1.00 1.24 ? 103 ARG A HB3    1 
ATOM 2625 H HG2    . ARG C 3 94 ? -99.938  1.865   -8.266  1.00 2.02 ? 103 ARG A HG2    1 
ATOM 2626 H HG3    . ARG C 3 94 ? -99.881  1.008   -9.806  1.00 1.87 ? 103 ARG A HG3    1 
ATOM 2627 H HD2    . ARG C 3 94 ? -99.949  -1.011  -8.748  1.00 1.74 ? 103 ARG A HD2    1 
ATOM 2628 H HD3    . ARG C 3 94 ? -98.608  -0.575  -7.696  1.00 1.95 ? 103 ARG A HD3    1 
ATOM 2629 H HE     . ARG C 3 94 ? -100.850 0.814   -6.720  1.00 2.47 ? 103 ARG A HE     1 
ATOM 2630 H HH11   . ARG C 3 94 ? -99.822  -2.415  -7.327  1.00 2.18 ? 103 ARG A HH11   1 
ATOM 2631 H HH12   . ARG C 3 94 ? -100.819 -3.108  -6.092  1.00 2.66 ? 103 ARG A HH12   1 
ATOM 2632 H HH21   . ARG C 3 94 ? -102.159 -0.063  -5.106  1.00 3.50 ? 103 ARG A HH21   1 
ATOM 2633 H HH22   . ARG C 3 94 ? -102.146 -1.774  -4.834  1.00 3.30 ? 103 ARG A HH22   1 
ATOM 2634 N N      . PHE C 3 95 ? -98.915  4.393   -8.478  1.00 0.81 ? 104 PHE A N      1 
ATOM 2635 C CA     . PHE C 3 95 ? -98.981  5.599   -7.598  1.00 0.84 ? 104 PHE A CA     1 
ATOM 2636 C C      . PHE C 3 95 ? -99.926  5.341   -6.430  1.00 0.90 ? 104 PHE A C      1 
ATOM 2637 O O      . PHE C 3 95 ? -100.861 4.570   -6.526  1.00 0.99 ? 104 PHE A O      1 
ATOM 2638 C CB     . PHE C 3 95 ? -99.484  6.804   -8.398  1.00 0.87 ? 104 PHE A CB     1 
ATOM 2639 C CG     . PHE C 3 95 ? -98.548  7.086   -9.557  1.00 0.83 ? 104 PHE A CG     1 
ATOM 2640 C CD1    . PHE C 3 95 ? -98.473  6.189   -10.645 1.00 0.84 ? 104 PHE A CD1    1 
ATOM 2641 C CD2    . PHE C 3 95 ? -97.747  8.247   -9.550  1.00 0.86 ? 104 PHE A CD2    1 
ATOM 2642 C CE1    . PHE C 3 95 ? -97.597  6.452   -11.717 1.00 0.86 ? 104 PHE A CE1    1 
ATOM 2643 C CE2    . PHE C 3 95 ? -96.877  8.508   -10.625 1.00 0.88 ? 104 PHE A CE2    1 
ATOM 2644 C CZ     . PHE C 3 95 ? -96.802  7.611   -11.707 1.00 0.87 ? 104 PHE A CZ     1 
ATOM 2645 H H      . PHE C 3 95 ? -99.739  3.926   -8.737  1.00 0.85 ? 104 PHE A H      1 
ATOM 2646 H HA     . PHE C 3 95 ? -98.009  5.817   -7.206  1.00 0.81 ? 104 PHE A HA     1 
ATOM 2647 H HB2    . PHE C 3 95 ? -100.475 6.600   -8.772  1.00 0.91 ? 104 PHE A HB2    1 
ATOM 2648 H HB3    . PHE C 3 95 ? -99.515  7.667   -7.745  1.00 0.93 ? 104 PHE A HB3    1 
ATOM 2649 H HD1    . PHE C 3 95 ? -99.091  5.305   -10.662 1.00 0.88 ? 104 PHE A HD1    1 
ATOM 2650 H HD2    . PHE C 3 95 ? -97.801  8.936   -8.720  1.00 0.90 ? 104 PHE A HD2    1 
ATOM 2651 H HE1    . PHE C 3 95 ? -97.532  5.761   -12.547 1.00 0.90 ? 104 PHE A HE1    1 
ATOM 2652 H HE2    . PHE C 3 95 ? -96.268  9.400   -10.622 1.00 0.95 ? 104 PHE A HE2    1 
ATOM 2653 H HZ     . PHE C 3 95 ? -96.132  7.810   -12.529 1.00 0.92 ? 104 PHE A HZ     1 
ATOM 2654 N N      . VAL C 3 96 ? -99.672  5.988   -5.319  1.00 0.91 ? 105 VAL A N      1 
ATOM 2655 C CA     . VAL C 3 96 ? -100.523 5.813   -4.100  1.00 0.99 ? 105 VAL A CA     1 
ATOM 2656 C C      . VAL C 3 96 ? -101.264 7.131   -3.828  1.00 1.14 ? 105 VAL A C      1 
ATOM 2657 O O      . VAL C 3 96 ? -102.280 7.087   -3.155  1.00 1.72 ? 105 VAL A O      1 
ATOM 2658 C CB     . VAL C 3 96 ? -99.613  5.402   -2.894  1.00 1.08 ? 105 VAL A CB     1 
ATOM 2659 C CG1    . VAL C 3 96 ? -98.133  5.508   -3.278  1.00 1.31 ? 105 VAL A CG1    1 
ATOM 2660 C CG2    . VAL C 3 96 ? -99.858  6.285   -1.659  1.00 1.71 ? 105 VAL A CG2    1 
ATOM 2661 O OXT    . VAL C 3 96 ? -100.799 8.157   -4.297  1.00 1.38 ? 105 VAL A OXT    1 
ATOM 2662 H H      . VAL C 3 96 ? -98.905  6.597   -5.284  1.00 0.91 ? 105 VAL A H      1 
ATOM 2663 H HA     . VAL C 3 96 ? -101.257 5.035   -4.276  1.00 1.03 ? 105 VAL A HA     1 
ATOM 2664 H HB     . VAL C 3 96 ? -99.820  4.377   -2.636  1.00 1.62 ? 105 VAL A HB     1 
ATOM 2665 H HG11   . VAL C 3 96 ? -97.941  6.476   -3.715  1.00 1.59 ? 105 VAL A HG11   1 
ATOM 2666 H HG12   . VAL C 3 96 ? -97.522  5.385   -2.394  1.00 1.86 ? 105 VAL A HG12   1 
ATOM 2667 H HG13   . VAL C 3 96 ? -97.890  4.734   -3.991  1.00 1.90 ? 105 VAL A HG13   1 
ATOM 2668 H HG21   . VAL C 3 96 ? -100.906 6.262   -1.400  1.00 2.28 ? 105 VAL A HG21   1 
ATOM 2669 H HG22   . VAL C 3 96 ? -99.274  5.912   -0.830  1.00 2.21 ? 105 VAL A HG22   1 
ATOM 2670 H HG23   . VAL C 3 96 ? -99.561  7.300   -1.877  1.00 2.08 ? 105 VAL A HG23   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  1   1   DT  T   B . n 
A 1 2  DC  2  2   2   DC  C   B . n 
A 1 3  DG  3  3   3   DG  G   B . n 
A 1 4  DA  4  4   4   DA  A   B . n 
A 1 5  DG  5  5   5   DG  G   B . n 
A 1 6  DC  6  6   6   DC  C   B . n 
A 1 7  DC  7  7   7   DC  C   B . n 
A 1 8  DG  8  8   8   DG  G   B . n 
A 1 9  DG  9  9   9   DG  G   B . n 
A 1 10 DA  10 10  10  DA  A   B . n 
A 1 11 DA  11 11  11  DA  A   B . n 
A 1 12 DG  12 12  12  DG  G   B . n 
A 1 13 DT  13 13  13  DT  T   B . n 
A 1 14 DT  14 14  14  DT  T   B . n 
A 1 15 DC  15 15  15  DC  C   B . n 
A 1 16 DG  16 16  16  DG  G   B . n 
A 1 17 DA  17 17  17  DA  A   B . n 
B 2 1  DT  1  18  18  DT  T   C . n 
B 2 2  DC  2  19  19  DC  C   C . n 
B 2 3  DG  3  20  20  DG  G   C . n 
B 2 4  DA  4  21  21  DA  A   C . n 
B 2 5  DA  5  22  22  DA  A   C . n 
B 2 6  DC  6  23  23  DC  C   C . n 
B 2 7  DT  7  24  24  DT  T   C . n 
B 2 8  DT  8  25  25  DT  T   C . n 
B 2 9  DC  9  26  26  DC  C   C . n 
B 2 10 DC  10 27  27  DC  C   C . n 
B 2 11 DG  11 28  28  DG  G   C . n 
B 2 12 DG  12 29  29  DG  G   C . n 
B 2 13 DC  13 30  30  DC  C   C . n 
B 2 14 DT  14 31  31  DT  T   C . n 
B 2 15 DC  15 32  32  DC  C   C . n 
B 2 16 DG  16 33  33  DG  G   C . n 
B 2 17 DA  17 34  34  DA  A   C . n 
C 3 1  VAL 1  10  10  VAL VAL A . n 
C 3 2  ILE 2  11  11  ILE ILE A . n 
C 3 3  PRO 3  12  12  PRO PRO A . n 
C 3 4  ALA 4  13  13  ALA ALA A . n 
C 3 5  ALA 5  14  14  ALA ALA A . n 
C 3 6  ALA 6  15  15  ALA ALA A . n 
C 3 7  LEU 7  16  16  LEU LEU A . n 
C 3 8  ALA 8  17  17  ALA ALA A . n 
C 3 9  GLY 9  18  18  GLY GLY A . n 
C 3 10 TYR 10 19  19  TYR TYR A . n 
C 3 11 THR 11 20  20  THR THR A . n 
C 3 12 GLY 12 21  21  GLY GLY A . n 
C 3 13 SER 13 22  22  SER SER A . n 
C 3 14 GLY 14 23  23  GLY GLY A . n 
C 3 15 PRO 15 24  24  PRO PRO A . n 
C 3 16 ILE 16 25  25  ILE ILE A . n 
C 3 17 GLN 17 26  26  GLN GLN A . n 
C 3 18 LEU 18 27  27  LEU LEU A . n 
C 3 19 TRP 19 28  28  TRP TRP A . n 
C 3 20 GLN 20 29  29  GLN GLN A . n 
C 3 21 PHE 21 30  30  PHE PHE A . n 
C 3 22 LEU 22 31  31  LEU LEU A . n 
C 3 23 LEU 23 32  32  LEU LEU A . n 
C 3 24 GLU 24 33  33  GLU GLU A . n 
C 3 25 LEU 25 34  34  LEU LEU A . n 
C 3 26 LEU 26 35  35  LEU LEU A . n 
C 3 27 THR 27 36  36  THR THR A . n 
C 3 28 ASP 28 37  37  ASP ASP A . n 
C 3 29 LYS 29 38  38  LYS LYS A . n 
C 3 30 SER 30 39  39  SER SER A . n 
C 3 31 CYS 31 40  40  CYS CYS A . n 
C 3 32 GLN 32 41  41  GLN GLN A . n 
C 3 33 SER 33 42  42  SER SER A . n 
C 3 34 PHE 34 43  43  PHE PHE A . n 
C 3 35 ILE 35 44  44  ILE ILE A . n 
C 3 36 SER 36 45  45  SER SER A . n 
C 3 37 TRP 37 46  46  TRP TRP A . n 
C 3 38 THR 38 47  47  THR THR A . n 
C 3 39 GLY 39 48  48  GLY GLY A . n 
C 3 40 ASP 40 49  49  ASP ASP A . n 
C 3 41 GLY 41 50  50  GLY GLY A . n 
C 3 42 TRP 42 51  51  TRP TRP A . n 
C 3 43 GLU 43 52  52  GLU GLU A . n 
C 3 44 PHE 44 53  53  PHE PHE A . n 
C 3 45 LYS 45 54  54  LYS LYS A . n 
C 3 46 LEU 46 55  55  LEU LEU A . n 
C 3 47 SER 47 56  56  SER SER A . n 
C 3 48 ASP 48 57  57  ASP ASP A . n 
C 3 49 PRO 49 58  58  PRO PRO A . n 
C 3 50 ASP 50 59  59  ASP ASP A . n 
C 3 51 GLU 51 60  60  GLU GLU A . n 
C 3 52 VAL 52 61  61  VAL VAL A . n 
C 3 53 ALA 53 62  62  ALA ALA A . n 
C 3 54 ARG 54 63  63  ARG ARG A . n 
C 3 55 ARG 55 64  64  ARG ARG A . n 
C 3 56 TRP 56 65  65  TRP TRP A . n 
C 3 57 GLY 57 66  66  GLY GLY A . n 
C 3 58 LYS 58 67  67  LYS LYS A . n 
C 3 59 ARG 59 68  68  ARG ARG A . n 
C 3 60 LYS 60 69  69  LYS LYS A . n 
C 3 61 ASN 61 70  70  ASN ASN A . n 
C 3 62 LYS 62 71  71  LYS LYS A . n 
C 3 63 PRO 63 72  72  PRO PRO A . n 
C 3 64 LYS 64 73  73  LYS LYS A . n 
C 3 65 MET 65 74  74  MET MET A . n 
C 3 66 ASN 66 75  75  ASN ASN A . n 
C 3 67 TYR 67 76  76  TYR TYR A . n 
C 3 68 GLU 68 77  77  GLU GLU A . n 
C 3 69 LYS 69 78  78  LYS LYS A . n 
C 3 70 LEU 70 79  79  LEU LEU A . n 
C 3 71 SER 71 80  80  SER SER A . n 
C 3 72 ARG 72 81  81  ARG ARG A . n 
C 3 73 GLY 73 82  82  GLY GLY A . n 
C 3 74 LEU 74 83  83  LEU LEU A . n 
C 3 75 ARG 75 84  84  ARG ARG A . n 
C 3 76 TYR 76 85  85  TYR TYR A . n 
C 3 77 TYR 77 86  86  TYR TYR A . n 
C 3 78 TYR 78 87  87  TYR TYR A . n 
C 3 79 ASP 79 88  88  ASP ASP A . n 
C 3 80 LYS 80 89  89  LYS LYS A . n 
C 3 81 ASN 81 90  90  ASN ASN A . n 
C 3 82 ILE 82 91  91  ILE ILE A . n 
C 3 83 ILE 83 92  92  ILE ILE A . n 
C 3 84 HIS 84 93  93  HIS HIS A . n 
C 3 85 LYS 85 94  94  LYS LYS A . n 
C 3 86 THR 86 95  95  THR THR A . n 
C 3 87 ALA 87 96  96  ALA ALA A . n 
C 3 88 GLY 88 97  97  GLY GLY A . n 
C 3 89 LYS 89 98  98  LYS LYS A . n 
C 3 90 ARG 90 99  99  ARG ARG A . n 
C 3 91 TYR 91 100 100 TYR TYR A . n 
C 3 92 VAL 92 101 101 VAL VAL A . n 
C 3 93 TYR 93 102 102 TYR TYR A . n 
C 3 94 ARG 94 103 103 ARG ARG A . n 
C 3 95 PHE 95 104 104 PHE PHE A . n 
C 3 96 VAL 96 105 105 VAL VAL A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-03-12 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
X-PLOR phasing          3.1 ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A PRO 12 ? ? H A LEU 16 ? ? 1.41 
2 1 O A THR 20 ? ? H A SER 22 ? ? 1.43 
3 1 O A TRP 28 ? ? H A LEU 32 ? ? 1.48 
4 1 O A ALA 13 ? ? H A ALA 17 ? ? 1.57 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C5 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_1             25 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            C7 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_2             25 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.532 
_pdbx_validate_rmsd_bond.bond_target_value         1.496 
_pdbx_validate_rmsd_bond.bond_deviation            0.036 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DT 1  ? ? "C1'" B DT 1  ? ? N1 B DT 1  ? ? 111.04 108.30 2.74  0.30 N 
2  1 "O4'" B DC 2  ? ? "C1'" B DC 2  ? ? N1 B DC 2  ? ? 110.96 108.30 2.66  0.30 N 
3  1 "O4'" B DG 3  ? ? "C1'" B DG 3  ? ? N9 B DG 3  ? ? 111.02 108.30 2.72  0.30 N 
4  1 "O4'" B DA 4  ? ? "C1'" B DA 4  ? ? N9 B DA 4  ? ? 111.08 108.30 2.78  0.30 N 
5  1 N1    B DA 4  ? ? C2    B DA 4  ? ? N3 B DA 4  ? ? 126.19 129.30 -3.11 0.50 N 
6  1 "O4'" B DG 5  ? ? "C1'" B DG 5  ? ? N9 B DG 5  ? ? 111.60 108.30 3.30  0.30 N 
7  1 "O4'" B DC 7  ? ? "C1'" B DC 7  ? ? N1 B DC 7  ? ? 111.81 108.30 3.51  0.30 N 
8  1 "O4'" B DG 8  ? ? "C1'" B DG 8  ? ? N9 B DG 8  ? ? 110.90 108.30 2.60  0.30 N 
9  1 "O4'" B DG 9  ? ? "C1'" B DG 9  ? ? N9 B DG 9  ? ? 111.76 108.30 3.46  0.30 N 
10 1 "O4'" B DA 10 ? ? "C1'" B DA 10 ? ? N9 B DA 10 ? ? 111.43 108.30 3.13  0.30 N 
11 1 N1    B DA 10 ? ? C2    B DA 10 ? ? N3 B DA 10 ? ? 126.16 129.30 -3.14 0.50 N 
12 1 "O4'" B DA 11 ? ? "C1'" B DA 11 ? ? N9 B DA 11 ? ? 111.21 108.30 2.91  0.30 N 
13 1 N1    B DA 11 ? ? C2    B DA 11 ? ? N3 B DA 11 ? ? 126.13 129.30 -3.17 0.50 N 
14 1 "O4'" B DG 12 ? ? "C1'" B DG 12 ? ? N9 B DG 12 ? ? 111.69 108.30 3.39  0.30 N 
15 1 "O4'" B DT 13 ? ? "C1'" B DT 13 ? ? N1 B DT 13 ? ? 111.26 108.30 2.96  0.30 N 
16 1 "O4'" B DT 14 ? ? "C1'" B DT 14 ? ? N1 B DT 14 ? ? 111.51 108.30 3.21  0.30 N 
17 1 "O4'" B DC 15 ? ? "C1'" B DC 15 ? ? N1 B DC 15 ? ? 110.27 108.30 1.97  0.30 N 
18 1 "O4'" B DG 16 ? ? "C1'" B DG 16 ? ? N9 B DG 16 ? ? 111.14 108.30 2.84  0.30 N 
19 1 "O4'" B DA 17 ? ? "C1'" B DA 17 ? ? N9 B DA 17 ? ? 111.27 108.30 2.97  0.30 N 
20 1 N1    B DA 17 ? ? C2    B DA 17 ? ? N3 B DA 17 ? ? 126.22 129.30 -3.08 0.50 N 
21 1 "O4'" C DT 18 ? ? "C1'" C DT 18 ? ? N1 C DT 18 ? ? 110.94 108.30 2.64  0.30 N 
22 1 "O4'" C DC 19 ? ? "C1'" C DC 19 ? ? N1 C DC 19 ? ? 110.39 108.30 2.09  0.30 N 
23 1 "O4'" C DG 20 ? ? "C1'" C DG 20 ? ? N9 C DG 20 ? ? 111.20 108.30 2.90  0.30 N 
24 1 "O4'" C DA 21 ? ? "C1'" C DA 21 ? ? N9 C DA 21 ? ? 111.61 108.30 3.31  0.30 N 
25 1 N1    C DA 21 ? ? C2    C DA 21 ? ? N3 C DA 21 ? ? 126.20 129.30 -3.10 0.50 N 
26 1 "O4'" C DA 22 ? ? "C1'" C DA 22 ? ? N9 C DA 22 ? ? 110.97 108.30 2.67  0.30 N 
27 1 N1    C DA 22 ? ? C2    C DA 22 ? ? N3 C DA 22 ? ? 126.24 129.30 -3.06 0.50 N 
28 1 "O4'" C DC 23 ? ? "C1'" C DC 23 ? ? N1 C DC 23 ? ? 111.95 108.30 3.65  0.30 N 
29 1 "O4'" C DT 24 ? ? "C1'" C DT 24 ? ? N1 C DT 24 ? ? 110.27 108.30 1.97  0.30 N 
30 1 "O4'" C DT 25 ? ? "C1'" C DT 25 ? ? N1 C DT 25 ? ? 111.96 108.30 3.66  0.30 N 
31 1 "O4'" C DC 26 ? ? "C1'" C DC 26 ? ? N1 C DC 26 ? ? 110.93 108.30 2.63  0.30 N 
32 1 "O4'" C DC 27 ? ? "C1'" C DC 27 ? ? N1 C DC 27 ? ? 110.50 108.30 2.20  0.30 N 
33 1 "O4'" C DG 28 ? ? "C1'" C DG 28 ? ? N9 C DG 28 ? ? 111.13 108.30 2.83  0.30 N 
34 1 "O4'" C DG 29 ? ? "C1'" C DG 29 ? ? N9 C DG 29 ? ? 112.03 108.30 3.73  0.30 N 
35 1 "O4'" C DC 30 ? ? "C1'" C DC 30 ? ? N1 C DC 30 ? ? 110.64 108.30 2.34  0.30 N 
36 1 "O4'" C DT 31 ? ? "C1'" C DT 31 ? ? N1 C DT 31 ? ? 111.61 108.30 3.31  0.30 N 
37 1 "O4'" C DC 32 ? ? "C1'" C DC 32 ? ? N1 C DC 32 ? ? 110.28 108.30 1.98  0.30 N 
38 1 "O4'" C DG 33 ? ? "C1'" C DG 33 ? ? N9 C DG 33 ? ? 111.03 108.30 2.73  0.30 N 
39 1 "O4'" C DA 34 ? ? "C1'" C DA 34 ? ? N9 C DA 34 ? ? 110.88 108.30 2.58  0.30 N 
40 1 N1    C DA 34 ? ? C2    C DA 34 ? ? N3 C DA 34 ? ? 126.21 129.30 -3.09 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 17 ? ? -60.66  -73.97  
2  1 SER A 22 ? ? -86.77  49.85   
3  1 LEU A 27 ? ? -42.97  -77.70  
4  1 LEU A 35 ? ? -67.98  -70.96  
5  1 ASP A 37 ? ? -117.56 -131.55 
6  1 LYS A 38 ? ? -61.50  -146.29 
7  1 CYS A 40 ? ? 83.17   8.34    
8  1 ILE A 44 ? ? -166.05 -168.61 
9  1 ASP A 49 ? ? -129.23 -112.81 
10 1 ASN A 70 ? ? 54.78   18.86   
11 1 ARG A 81 ? ? -89.41  -73.93  
12 1 TYR A 85 ? ? -48.75  -8.97   
13 1 TYR A 87 ? ? -76.20  29.65   
14 1 ILE A 91 ? ? -138.45 -61.14  
15 1 LYS A 98 ? ? -110.75 -140.42 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 64 ? ? 0.088 'SIDE CHAIN' 
2 1 ARG A 68 ? ? 0.076 'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2STW 'double helix'         
2STW 'b-form double helix'  
2STW 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 17 1_555 0.582  -0.105 -0.044 -1.599 0.579   -4.335 1  B_DT1:DA34_C  B 1  ? C 34 ? 20 1 
1 A DC 2  1_555 B DG 16 1_555 -0.398 -0.043 -0.004 1.477  -1.230  -0.836 2  B_DC2:DG33_C  B 2  ? C 33 ? 19 1 
1 A DG 3  1_555 B DC 15 1_555 0.484  0.030  0.137  0.224  -1.882  2.913  3  B_DG3:DC32_C  B 3  ? C 32 ? 19 1 
1 A DA 4  1_555 B DT 14 1_555 -0.673 -0.032 -0.333 3.772  -8.031  -2.305 4  B_DA4:DT31_C  B 4  ? C 31 ? 20 1 
1 A DG 5  1_555 B DC 13 1_555 0.518  -0.049 -0.215 14.969 -8.130  -0.878 5  B_DG5:DC30_C  B 5  ? C 30 ? 19 1 
1 A DC 6  1_555 B DG 12 1_555 -0.605 -0.071 0.301  14.534 -1.916  4.287  6  B_DC6:DG29_C  B 6  ? C 29 ? 19 1 
1 A DG 8  1_555 B DC 10 1_555 0.073  0.004  -0.525 -3.556 12.550  1.890  7  B_DG8:DC27_C  B 8  ? C 27 ? 19 1 
1 A DG 9  1_555 B DC 9  1_555 0.509  -0.001 -0.453 -9.577 3.680   1.083  8  B_DG9:DC26_C  B 9  ? C 26 ? 19 1 
1 A DA 10 1_555 B DT 8  1_555 -0.280 -0.065 0.070  -3.416 -9.809  3.932  9  B_DA10:DT25_C B 10 ? C 25 ? 20 1 
1 A DA 11 1_555 B DT 7  1_555 -0.179 -0.272 -0.123 -5.481 -21.147 6.369  10 B_DA11:DT24_C B 11 ? C 24 ? 20 1 
1 A DG 12 1_555 B DC 6  1_555 -0.176 -0.059 0.465  -0.202 1.518   0.164  11 B_DG12:DC23_C B 12 ? C 23 ? 19 1 
1 A DT 13 1_555 B DA 5  1_555 0.371  -0.237 -0.818 -4.765 -12.949 2.307  12 B_DT13:DA22_C B 13 ? C 22 ? 20 1 
1 A DT 14 1_555 B DA 4  1_555 0.231  -0.013 0.038  -4.173 -18.380 2.650  13 B_DT14:DA21_C B 14 ? C 21 ? 20 1 
1 A DC 15 1_555 B DG 3  1_555 -0.482 0.030  0.007  -3.318 -1.382  3.888  14 B_DC15:DG20_C B 15 ? C 20 ? 19 1 
1 A DG 16 1_555 B DC 2  1_555 0.535  -0.006 -0.078 -6.680 -1.455  -1.655 15 B_DG16:DC19_C B 16 ? C 19 ? 19 1 
1 A DA 17 1_555 B DT 1  1_555 -0.699 -0.056 -0.025 3.705  0.422   -2.652 16 B_DA17:DT18_C B 17 ? C 18 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 17 1_555 A DC 2  1_555 B DG 16 1_555 0.076  -0.120 3.588 0.797  12.167 29.285 -2.674 0.022  3.280 22.857 
-1.496  31.671 1  BB_DT1DC2:DG33DA34_CC   B 1  ? C 34 ? B 2  ? C 33 ? 
1 A DC 2  1_555 B DG 16 1_555 A DG 3  1_555 B DC 15 1_555 -0.060 1.098  4.357 0.135  -5.402 37.468 2.601  0.116  4.165 -8.357 
-0.209  37.842 2  BB_DC2DG3:DC32DG33_CC   B 2  ? C 33 ? B 3  ? C 32 ? 
1 A DG 3  1_555 B DC 15 1_555 A DA 4  1_555 B DT 14 1_555 0.215  0.351  3.625 3.864  0.391  34.076 0.526  0.310  3.631 0.664  
-6.566  34.290 3  BB_DG3DA4:DT31DC32_CC   B 3  ? C 32 ? B 4  ? C 31 ? 
1 A DA 4  1_555 B DT 14 1_555 A DG 5  1_555 B DC 13 1_555 -0.181 0.815  3.341 -0.403 3.509  34.817 0.808  0.238  3.406 5.846  
0.671   34.990 4  BB_DA4DG5:DC30DT31_CC   B 4  ? C 31 ? B 5  ? C 30 ? 
1 A DG 5  1_555 B DC 13 1_555 A DC 6  1_555 B DG 12 1_555 0.474  -0.623 3.387 -3.265 3.509  34.095 -1.610 -1.320 3.250 5.947  
5.534   34.421 5  BB_DG5DC6:DG29DC30_CC   B 5  ? C 30 ? B 6  ? C 29 ? 
1 A DG 8  1_555 B DC 10 1_555 A DG 9  1_555 B DC 9  1_555 0.283  -0.287 4.135 0.502  9.899  31.042 -2.678 -0.395 3.868 17.932 
-0.910  32.549 6  BB_DG8DG9:DC26DC27_CC   B 8  ? C 27 ? B 9  ? C 26 ? 
1 A DG 9  1_555 B DC 9  1_555 A DA 10 1_555 B DT 8  1_555 0.681  -0.008 3.464 -0.197 4.304  32.448 -0.801 -1.244 3.431 7.660  
0.351   32.725 7  BB_DG9DA10:DT25DC26_CC  B 9  ? C 26 ? B 10 ? C 25 ? 
1 A DA 10 1_555 B DT 8  1_555 A DA 11 1_555 B DT 7  1_555 -0.233 0.539  3.658 2.095  4.000  34.439 0.214  0.751  3.675 6.719  
-3.520  34.724 8  BB_DA10DA11:DT24DT25_CC B 10 ? C 25 ? B 11 ? C 24 ? 
1 A DA 11 1_555 B DT 7  1_555 A DG 12 1_555 B DC 6  1_555 0.039  -0.138 3.343 -5.661 -1.658 34.241 0.029  -0.951 3.298 -2.791 
9.527   34.731 9  BB_DA11DG12:DC23DT24_CC B 11 ? C 24 ? B 12 ? C 23 ? 
1 A DG 12 1_555 B DC 6  1_555 A DT 13 1_555 B DA 5  1_555 0.010  0.710  4.008 8.176  8.743  35.910 -0.317 1.306  3.976 13.720 
-12.829 37.790 10 BB_DG12DT13:DA22DC23_CC B 12 ? C 23 ? B 13 ? C 22 ? 
1 A DT 13 1_555 B DA 5  1_555 A DT 14 1_555 B DA 4  1_555 0.072  0.071  3.475 -2.024 3.159  35.540 -0.369 -0.428 3.459 5.157  
3.305   35.731 11 BB_DT13DT14:DA21DA22_CC B 13 ? C 22 ? B 14 ? C 21 ? 
1 A DT 14 1_555 B DA 4  1_555 A DC 15 1_555 B DG 3  1_555 -0.533 0.522  3.777 -3.615 -6.084 36.881 1.726  0.285  3.682 -9.510 
5.651   37.531 12 BB_DT14DC15:DG20DA21_CC B 14 ? C 21 ? B 15 ? C 20 ? 
1 A DC 15 1_555 B DG 3  1_555 A DG 16 1_555 B DC 2  1_555 -0.243 1.061  3.997 -0.362 9.627  35.403 0.015  0.323  4.138 15.480 
0.583   36.650 13 BB_DC15DG16:DC19DG20_CC B 15 ? C 20 ? B 16 ? C 19 ? 
1 A DG 16 1_555 B DC 2  1_555 A DA 17 1_555 B DT 1  1_555 0.627  -0.078 3.419 -0.620 -2.906 31.369 0.422  -1.276 3.399 -5.359 
1.143   31.506 14 BB_DG16DA17:DT18DC19_CC B 16 ? C 19 ? B 17 ? C 18 ? 
#