data_2TMP
# 
_entry.id   2TMP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2TMP         
WWPDB D_1000178686 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2TMP 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-26 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muskett, F.W.'    1 
'Frenkiel, T.A.'   2 
'Feeney, J.'       3 
'Freedman, R.B.'   4 
'Carr, M.D.'       5 
'Williamson, R.A.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
;
J.Biol.Chem.   273 21736 21743 1998 JBCHA3 US 0021-9258 0071 ? 9705310 10.1074/jbc.273.34.21736 
1       
;Mapping the Binding Site for Matrix Metalloproteinase on the N-Terminal Domain of the Tissue Inhibitor of Metalloproteinases-2 by NMR Chemical Shift Perturbation
;
Biochemistry   36  13882 ?     1997 BICHAW US 0006-2960 0033 ? ?       ?                        
2       
;Chemically and Conformationally Authentic Active Domain of Human Tissue Inhibitor of Metalloproteinases-2 Refolded from Bacterial Inclusion Bodies
;
Eur.J.Biochem. 241 476   ?     1996 EJBCAI IX 0014-2956 0262 ? ?       ?                        
3       
'Solution Structure of the Active Domain of Tissue Inhibitor of Metalloproteinases-2. A New Member of the Ob Fold Protein Family' 
Biochemistry   33  11745 ?     1994 BICHAW US 0006-2960 0033 ? ?       ?                        
4       'Disulphide Bond Assignment in Human Tissue Inhibitor of Metalloproteinases (Timp)' Biochem.J.     268 267   ?     1990 
BIJOAK UK 0264-6021 0043 ? ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muskett, F.W.'    1  
primary 'Frenkiel, T.A.'   2  
primary 'Feeney, J.'       3  
primary 'Freedman, R.B.'   4  
primary 'Carr, M.D.'       5  
primary 'Williamson, R.A.' 6  
1       'Williamson, R.A.' 7  
1       'Carr, M.D.'       8  
1       'Frenkiel, T.A.'   9  
1       'Feeney, J.'       10 
1       'Freedman, R.B.'   11 
2       'Williamson, R.A.' 12 
2       'Natalia, D.'      13 
2       'Gee, C.K.'        14 
2       'Murphy, G.'       15 
2       'Carr, M.D.'       16 
2       'Freedman, R.B.'   17 
3       'Williamson, R.A.' 18 
3       'Martorell, G.'    19 
3       'Carr, M.D.'       20 
3       'Murphy, G.'       21 
3       'Docherty, A.J.'   22 
3       'Freedman, R.B.'   23 
3       'Feeney, J.'       24 
4       'Williamson, R.A.' 25 
4       'Marston, F.A.'    26 
4       'Angal, S.'        27 
4       'Koklitis, P.'     28 
4       'Panico, M.'       29 
4       'Morris, H.R.'     30 
4       'Carne, A.F.'      31 
4       'Smith, B.J.'      32 
4       'Harris, T.J.'     33 
4       'Freedman, R.B.'   34 
# 
_cell.entry_id           2TMP 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2TMP 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TISSUE INHIBITOR OF METALLOPROTEINASES-2' 
_entity.formula_weight             14109.167 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              A21T 
_entity.pdbx_fragment              'N-TERMINAL DOMAIN, RESIDUES 1-127' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'METALLOPROTEINASE INHIBITOR, TIMP-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGG
KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGG
KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   SER n 
1 3   CYS n 
1 4   SER n 
1 5   PRO n 
1 6   VAL n 
1 7   HIS n 
1 8   PRO n 
1 9   GLN n 
1 10  GLN n 
1 11  ALA n 
1 12  PHE n 
1 13  CYS n 
1 14  ASN n 
1 15  ALA n 
1 16  ASP n 
1 17  VAL n 
1 18  VAL n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  LYS n 
1 23  ALA n 
1 24  VAL n 
1 25  SER n 
1 26  GLU n 
1 27  LYS n 
1 28  GLU n 
1 29  VAL n 
1 30  ASP n 
1 31  SER n 
1 32  GLY n 
1 33  ASN n 
1 34  ASP n 
1 35  ILE n 
1 36  TYR n 
1 37  GLY n 
1 38  ASN n 
1 39  PRO n 
1 40  ILE n 
1 41  LYS n 
1 42  ARG n 
1 43  ILE n 
1 44  GLN n 
1 45  TYR n 
1 46  GLU n 
1 47  ILE n 
1 48  LYS n 
1 49  GLN n 
1 50  ILE n 
1 51  LYS n 
1 52  MET n 
1 53  PHE n 
1 54  LYS n 
1 55  GLY n 
1 56  PRO n 
1 57  GLU n 
1 58  LYS n 
1 59  ASP n 
1 60  ILE n 
1 61  GLU n 
1 62  PHE n 
1 63  ILE n 
1 64  TYR n 
1 65  THR n 
1 66  ALA n 
1 67  PRO n 
1 68  SER n 
1 69  SER n 
1 70  ALA n 
1 71  VAL n 
1 72  CYS n 
1 73  GLY n 
1 74  VAL n 
1 75  SER n 
1 76  LEU n 
1 77  ASP n 
1 78  VAL n 
1 79  GLY n 
1 80  GLY n 
1 81  LYS n 
1 82  LYS n 
1 83  GLU n 
1 84  TYR n 
1 85  LEU n 
1 86  ILE n 
1 87  ALA n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  GLU n 
1 92  GLY n 
1 93  ASP n 
1 94  GLY n 
1 95  LYS n 
1 96  MET n 
1 97  HIS n 
1 98  ILE n 
1 99  THR n 
1 100 LEU n 
1 101 CYS n 
1 102 ASP n 
1 103 PHE n 
1 104 ILE n 
1 105 VAL n 
1 106 PRO n 
1 107 TRP n 
1 108 ASP n 
1 109 THR n 
1 110 LEU n 
1 111 SER n 
1 112 THR n 
1 113 THR n 
1 114 GLN n 
1 115 LYS n 
1 116 LYS n 
1 117 SER n 
1 118 LEU n 
1 119 ASN n 
1 120 HIS n 
1 121 ARG n 
1 122 TYR n 
1 123 GLN n 
1 124 MET n 
1 125 GLY n 
1 126 CYS n 
1 127 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'INTRACELLULAR INCLUSION BODIES' 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET23D 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'PROTEIN REFOLDED FROM INCLUSION BODIES' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TIMP2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P16035 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFK
GPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCP
MIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2TMP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 127 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16035 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  153 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       127 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2TMP 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      21 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16035 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          47 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            21 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 2D-NOESY          1 
2  1 2D-TOCSY          1 
3  1 2D-COSY           1 
4  1 3D-NOESY-TOCSY    1 
5  1 2D-HSQC           1 
6  1 3D-15N-NOESY-HSQC 1 
7  1 3D-15N-HNHA       1 
8  1 3D-15N-HNHB       1 
9  1 '3D HCCH-TOCSY'   1 
10 1 '3D CBCA(CO)NH'   1 
11 1 3D-CBCAHN         1 
12 1 3D-13C-HMQC-NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '125 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ATMOSPHERE 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      AQUEOUS 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'UNITYPLUS & INOVA' 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           2TMP 
_pdbx_nmr_refine.method             'SIMULATED ANNEALING USING TORSION ANGLE DYNAMICS' 
_pdbx_nmr_refine.details            'SEE GUNTERT ET AL. (1997) J. MOL. BIOL. 273(1), 283-298' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2TMP 
_pdbx_nmr_details.text       'THE STRUCTURE CLOSEST TO THE MEAN OF THE 49 CONFORMERS' 
# 
_pdbx_nmr_ensemble.entry_id                             2TMP 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    49 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LEAST RESTRAINT VIOLATION' 
# 
_pdbx_nmr_representative.entry_id             2TMP 
_pdbx_nmr_representative.conformer_id         3 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           DYANA 1.4 GUNTERT,WUTHRICH 1 
'structure solution' DYANA ?   ?                2 
# 
_exptl.entry_id          2TMP 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2TMP 
_struct.title                     'N-TERMINAL DOMAIN OF TISSUE INHIBITOR OF METALLOPROTEINASE-2 (N-TIMP-2), NMR, 49 STRUCTURES' 
_struct.pdbx_descriptor           'TISSUE INHIBITOR OF METALLOPROTEINASES-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2TMP 
_struct_keywords.pdbx_keywords   'METALLOPROTEASE INHIBITOR' 
_struct_keywords.text            'TIMP, METALLOPROTEINASE INHIBITOR, OB PROTEIN FOLD, METALLOPROTEASE INHIBITOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 1  SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 1  A CYS 72  1_555 ? ? ? ? ? ? ? 1.959 ? 
disulf2 disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 3  A CYS 101 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 126 SG ? ? A CYS 13 A CYS 126 1_555 ? ? ? ? ? ? ? 1.941 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 44 ? GLU A 46 ? GLN A 44 GLU A 46 
A 2 PHE A 62 ? TYR A 64 ? PHE A 62 TYR A 64 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    45 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     45 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    63 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     63 
# 
_database_PDB_matrix.entry_id          2TMP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2TMP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . CYS A 1 1   ? -10.419 -9.917  1.543   1.00 0.00 ? 1   CYS A N    1  
ATOM 2     C CA   . CYS A 1 1   ? -9.914  -11.179 1.032   1.00 0.00 ? 1   CYS A CA   1  
ATOM 3     C C    . CYS A 1 1   ? -9.250  -11.934 2.186   1.00 0.00 ? 1   CYS A C    1  
ATOM 4     O O    . CYS A 1 1   ? -8.991  -13.132 2.082   1.00 0.00 ? 1   CYS A O    1  
ATOM 5     C CB   . CYS A 1 1   ? -8.953  -10.970 -0.141  1.00 0.00 ? 1   CYS A CB   1  
ATOM 6     S SG   . CYS A 1 1   ? -7.914  -9.469  -0.024  1.00 0.00 ? 1   CYS A SG   1  
ATOM 7     H H    . CYS A 1 1   ? -10.903 -9.353  0.873   1.00 0.00 ? 1   CYS A H    1  
ATOM 8     H HA   . CYS A 1 1   ? -10.774 -11.731 0.652   1.00 0.00 ? 1   CYS A HA   1  
ATOM 9     H HB2  . CYS A 1 1   ? -8.302  -11.841 -0.218  1.00 0.00 ? 1   CYS A HB2  1  
ATOM 10    H HB3  . CYS A 1 1   ? -9.532  -10.923 -1.063  1.00 0.00 ? 1   CYS A HB3  1  
ATOM 11    N N    . SER A 1 2   ? -8.992  -11.201 3.259   1.00 0.00 ? 2   SER A N    1  
ATOM 12    C CA   . SER A 1 2   ? -8.363  -11.786 4.431   1.00 0.00 ? 2   SER A CA   1  
ATOM 13    C C    . SER A 1 2   ? -7.078  -12.510 4.029   1.00 0.00 ? 2   SER A C    1  
ATOM 14    O O    . SER A 1 2   ? -6.650  -13.445 4.705   1.00 0.00 ? 2   SER A O    1  
ATOM 15    C CB   . SER A 1 2   ? -9.315  -12.750 5.144   1.00 0.00 ? 2   SER A CB   1  
ATOM 16    O OG   . SER A 1 2   ? -10.190 -13.408 4.231   1.00 0.00 ? 2   SER A OG   1  
ATOM 17    H H    . SER A 1 2   ? -9.205  -10.227 3.335   1.00 0.00 ? 2   SER A H    1  
ATOM 18    H HA   . SER A 1 2   ? -8.140  -10.945 5.089   1.00 0.00 ? 2   SER A HA   1  
ATOM 19    H HB2  . SER A 1 2   ? -8.736  -13.493 5.691   1.00 0.00 ? 2   SER A HB2  1  
ATOM 20    H HB3  . SER A 1 2   ? -9.905  -12.200 5.878   1.00 0.00 ? 2   SER A HB3  1  
ATOM 21    H HG   . SER A 1 2   ? -9.670  -14.037 3.654   1.00 0.00 ? 2   SER A HG   1  
ATOM 22    N N    . CYS A 1 3   ? -6.497  -12.051 2.930   1.00 0.00 ? 3   CYS A N    1  
ATOM 23    C CA   . CYS A 1 3   ? -5.269  -12.644 2.430   1.00 0.00 ? 3   CYS A CA   1  
ATOM 24    C C    . CYS A 1 3   ? -4.271  -12.733 3.587   1.00 0.00 ? 3   CYS A C    1  
ATOM 25    O O    . CYS A 1 3   ? -4.563  -12.291 4.697   1.00 0.00 ? 3   CYS A O    1  
ATOM 26    C CB   . CYS A 1 3   ? -4.701  -11.856 1.247   1.00 0.00 ? 3   CYS A CB   1  
ATOM 27    S SG   . CYS A 1 3   ? -4.093  -12.884 -0.139  1.00 0.00 ? 3   CYS A SG   1  
ATOM 28    H H    . CYS A 1 3   ? -6.851  -11.290 2.386   1.00 0.00 ? 3   CYS A H    1  
ATOM 29    H HA   . CYS A 1 3   ? -5.526  -13.638 2.064   1.00 0.00 ? 3   CYS A HA   1  
ATOM 30    H HB2  . CYS A 1 3   ? -5.473  -11.185 0.872   1.00 0.00 ? 3   CYS A HB2  1  
ATOM 31    H HB3  . CYS A 1 3   ? -3.882  -11.231 1.604   1.00 0.00 ? 3   CYS A HB3  1  
ATOM 32    N N    . SER A 1 4   ? -3.115  -13.306 3.288   1.00 0.00 ? 4   SER A N    1  
ATOM 33    C CA   . SER A 1 4   ? -2.074  -13.459 4.289   1.00 0.00 ? 4   SER A CA   1  
ATOM 34    C C    . SER A 1 4   ? -0.812  -12.713 3.850   1.00 0.00 ? 4   SER A C    1  
ATOM 35    O O    . SER A 1 4   ? -0.137  -13.128 2.910   1.00 0.00 ? 4   SER A O    1  
ATOM 36    C CB   . SER A 1 4   ? -1.758  -14.935 4.536   1.00 0.00 ? 4   SER A CB   1  
ATOM 37    O OG   . SER A 1 4   ? -1.047  -15.518 3.447   1.00 0.00 ? 4   SER A OG   1  
ATOM 38    H H    . SER A 1 4   ? -2.886  -13.662 2.382   1.00 0.00 ? 4   SER A H    1  
ATOM 39    H HA   . SER A 1 4   ? -2.482  -13.017 5.199   1.00 0.00 ? 4   SER A HA   1  
ATOM 40    H HB2  . SER A 1 4   ? -1.169  -15.032 5.447   1.00 0.00 ? 4   SER A HB2  1  
ATOM 41    H HB3  . SER A 1 4   ? -2.687  -15.482 4.697   1.00 0.00 ? 4   SER A HB3  1  
ATOM 42    H HG   . SER A 1 4   ? -1.068  -14.905 2.657   1.00 0.00 ? 4   SER A HG   1  
ATOM 43    N N    . PRO A 1 5   ? -0.525  -11.595 4.570   1.00 0.00 ? 5   PRO A N    1  
ATOM 44    C CA   . PRO A 1 5   ? 0.643   -10.787 4.264   1.00 0.00 ? 5   PRO A CA   1  
ATOM 45    C C    . PRO A 1 5   ? 1.924   -11.470 4.748   1.00 0.00 ? 5   PRO A C    1  
ATOM 46    O O    . PRO A 1 5   ? 1.999   -11.919 5.891   1.00 0.00 ? 5   PRO A O    1  
ATOM 47    C CB   . PRO A 1 5   ? 0.388   -9.452  4.945   1.00 0.00 ? 5   PRO A CB   1  
ATOM 48    C CG   . PRO A 1 5   ? -0.687  -9.715  5.988   1.00 0.00 ? 5   PRO A CG   1  
ATOM 49    C CD   . PRO A 1 5   ? -1.303  -11.073 5.691   1.00 0.00 ? 5   PRO A CD   1  
ATOM 50    H HA   . PRO A 1 5   ? 0.746   -10.685 3.275   1.00 0.00 ? 5   PRO A HA   1  
ATOM 51    H HB2  . PRO A 1 5   ? 1.298   -9.071  5.409   1.00 0.00 ? 5   PRO A HB2  1  
ATOM 52    H HB3  . PRO A 1 5   ? 0.060   -8.703  4.226   1.00 0.00 ? 5   PRO A HB3  1  
ATOM 53    H HG2  . PRO A 1 5   ? -0.258  -9.702  6.989   1.00 0.00 ? 5   PRO A HG2  1  
ATOM 54    H HG3  . PRO A 1 5   ? -1.448  -8.936  5.955   1.00 0.00 ? 5   PRO A HG3  1  
ATOM 55    H HD2  . PRO A 1 5   ? -1.242  -11.733 6.555   1.00 0.00 ? 5   PRO A HD2  1  
ATOM 56    H HD3  . PRO A 1 5   ? -2.357  -10.981 5.432   1.00 0.00 ? 5   PRO A HD3  1  
ATOM 57    N N    . VAL A 1 6   ? 2.900   -11.527 3.855   1.00 0.00 ? 6   VAL A N    1  
ATOM 58    C CA   . VAL A 1 6   ? 4.174   -12.148 4.176   1.00 0.00 ? 6   VAL A CA   1  
ATOM 59    C C    . VAL A 1 6   ? 5.265   -11.558 3.281   1.00 0.00 ? 6   VAL A C    1  
ATOM 60    O O    . VAL A 1 6   ? 5.350   -10.340 3.122   1.00 0.00 ? 6   VAL A O    1  
ATOM 61    C CB   . VAL A 1 6   ? 4.060   -13.669 4.055   1.00 0.00 ? 6   VAL A CB   1  
ATOM 62    C CG1  . VAL A 1 6   ? 3.936   -14.094 2.591   1.00 0.00 ? 6   VAL A CG1  1  
ATOM 63    C CG2  . VAL A 1 6   ? 5.246   -14.363 4.728   1.00 0.00 ? 6   VAL A CG2  1  
ATOM 64    H H    . VAL A 1 6   ? 2.831   -11.160 2.927   1.00 0.00 ? 6   VAL A H    1  
ATOM 65    H HA   . VAL A 1 6   ? 4.404   -11.909 5.215   1.00 0.00 ? 6   VAL A HA   1  
ATOM 66    H HB   . VAL A 1 6   ? 3.153   -13.980 4.572   1.00 0.00 ? 6   VAL A HB   1  
ATOM 67    H HG11 . VAL A 1 6   ? 4.008   -13.216 1.949   1.00 0.00 ? 6   VAL A HG11 1  
ATOM 68    H HG12 . VAL A 1 6   ? 4.738   -14.791 2.345   1.00 0.00 ? 6   VAL A HG12 1  
ATOM 69    H HG13 . VAL A 1 6   ? 2.973   -14.581 2.434   1.00 0.00 ? 6   VAL A HG13 1  
ATOM 70    H HG21 . VAL A 1 6   ? 6.059   -13.650 4.857   1.00 0.00 ? 6   VAL A HG21 1  
ATOM 71    H HG22 . VAL A 1 6   ? 4.939   -14.744 5.703   1.00 0.00 ? 6   VAL A HG22 1  
ATOM 72    H HG23 . VAL A 1 6   ? 5.584   -15.191 4.105   1.00 0.00 ? 6   VAL A HG23 1  
ATOM 73    N N    . HIS A 1 7   ? 6.073   -12.445 2.721   1.00 0.00 ? 7   HIS A N    1  
ATOM 74    C CA   . HIS A 1 7   ? 7.155   -12.027 1.847   1.00 0.00 ? 7   HIS A CA   1  
ATOM 75    C C    . HIS A 1 7   ? 7.778   -10.737 2.382   1.00 0.00 ? 7   HIS A C    1  
ATOM 76    O O    . HIS A 1 7   ? 7.402   -9.642  1.967   1.00 0.00 ? 7   HIS A O    1  
ATOM 77    C CB   . HIS A 1 7   ? 6.666   -11.895 0.402   1.00 0.00 ? 7   HIS A CB   1  
ATOM 78    C CG   . HIS A 1 7   ? 5.204   -11.538 0.279   1.00 0.00 ? 7   HIS A CG   1  
ATOM 79    N ND1  . HIS A 1 7   ? 4.269   -12.393 -0.278  1.00 0.00 ? 7   HIS A ND1  1  
ATOM 80    C CD2  . HIS A 1 7   ? 4.526   -10.414 0.648   1.00 0.00 ? 7   HIS A CD2  1  
ATOM 81    C CE1  . HIS A 1 7   ? 3.085   -11.798 -0.242  1.00 0.00 ? 7   HIS A CE1  1  
ATOM 82    N NE2  . HIS A 1 7   ? 3.247   -10.571 0.332   1.00 0.00 ? 7   HIS A NE2  1  
ATOM 83    H H    . HIS A 1 7   ? 5.996   -13.433 2.856   1.00 0.00 ? 7   HIS A H    1  
ATOM 84    H HA   . HIS A 1 7   ? 7.903   -12.820 1.873   1.00 0.00 ? 7   HIS A HA   1  
ATOM 85    H HB2  . HIS A 1 7   ? 7.259   -11.131 -0.102  1.00 0.00 ? 7   HIS A HB2  1  
ATOM 86    H HB3  . HIS A 1 7   ? 6.846   -12.834 -0.118  1.00 0.00 ? 7   HIS A HB3  1  
ATOM 87    H HD1  . HIS A 1 7   ? 4.455   -13.305 -0.644  1.00 0.00 ? 7   HIS A HD1  1  
ATOM 88    H HD2  . HIS A 1 7   ? 4.962   -9.534  1.122   1.00 0.00 ? 7   HIS A HD2  1  
ATOM 89    H HE1  . HIS A 1 7   ? 2.147   -12.216 -0.606  1.00 0.00 ? 7   HIS A HE1  1  
ATOM 90    N N    . PRO A 1 8   ? 8.744   -10.912 3.322   1.00 0.00 ? 8   PRO A N    1  
ATOM 91    C CA   . PRO A 1 8   ? 9.423   -9.775  3.920   1.00 0.00 ? 8   PRO A CA   1  
ATOM 92    C C    . PRO A 1 8   ? 10.433  -9.165  2.946   1.00 0.00 ? 8   PRO A C    1  
ATOM 93    O O    . PRO A 1 8   ? 11.141  -8.220  3.290   1.00 0.00 ? 8   PRO A O    1  
ATOM 94    C CB   . PRO A 1 8   ? 10.071  -10.321 5.182   1.00 0.00 ? 8   PRO A CB   1  
ATOM 95    C CG   . PRO A 1 8   ? 10.123  -11.830 5.003   1.00 0.00 ? 8   PRO A CG   1  
ATOM 96    C CD   . PRO A 1 8   ? 9.215   -12.194 3.840   1.00 0.00 ? 8   PRO A CD   1  
ATOM 97    H HA   . PRO A 1 8   ? 8.768   -9.048  4.125   1.00 0.00 ? 8   PRO A HA   1  
ATOM 98    H HB2  . PRO A 1 8   ? 11.070  -9.909  5.318   1.00 0.00 ? 8   PRO A HB2  1  
ATOM 99    H HB3  . PRO A 1 8   ? 9.492   -10.052 6.066   1.00 0.00 ? 8   PRO A HB3  1  
ATOM 100   H HG2  . PRO A 1 8   ? 11.144  -12.156 4.808   1.00 0.00 ? 8   PRO A HG2  1  
ATOM 101   H HG3  . PRO A 1 8   ? 9.796   -12.333 5.914   1.00 0.00 ? 8   PRO A HG3  1  
ATOM 102   H HD2  . PRO A 1 8   ? 9.755   -12.755 3.077   1.00 0.00 ? 8   PRO A HD2  1  
ATOM 103   H HD3  . PRO A 1 8   ? 8.384   -12.818 4.166   1.00 0.00 ? 8   PRO A HD3  1  
ATOM 104   N N    . GLN A 1 9   ? 10.468  -9.732  1.749   1.00 0.00 ? 9   GLN A N    1  
ATOM 105   C CA   . GLN A 1 9   ? 11.380  -9.256  0.722   1.00 0.00 ? 9   GLN A CA   1  
ATOM 106   C C    . GLN A 1 9   ? 10.686  -9.251  -0.642  1.00 0.00 ? 9   GLN A C    1  
ATOM 107   O O    . GLN A 1 9   ? 10.814  -8.292  -1.403  1.00 0.00 ? 9   GLN A O    1  
ATOM 108   C CB   . GLN A 1 9   ? 12.654  -10.101 0.686   1.00 0.00 ? 9   GLN A CB   1  
ATOM 109   C CG   . GLN A 1 9   ? 13.638  -9.565  -0.356  1.00 0.00 ? 9   GLN A CG   1  
ATOM 110   C CD   . GLN A 1 9   ? 14.896  -9.008  0.314   1.00 0.00 ? 9   GLN A CD   1  
ATOM 111   O OE1  . GLN A 1 9   ? 16.009  -9.440  0.061   1.00 0.00 ? 9   GLN A OE1  1  
ATOM 112   N NE2  . GLN A 1 9   ? 14.659  -8.027  1.181   1.00 0.00 ? 9   GLN A NE2  1  
ATOM 113   H H    . GLN A 1 9   ? 9.889   -10.500 1.476   1.00 0.00 ? 9   GLN A H    1  
ATOM 114   H HA   . GLN A 1 9   ? 11.635  -8.237  1.012   1.00 0.00 ? 9   GLN A HA   1  
ATOM 115   H HB2  . GLN A 1 9   ? 13.123  -10.100 1.670   1.00 0.00 ? 9   GLN A HB2  1  
ATOM 116   H HB3  . GLN A 1 9   ? 12.402  -11.136 0.455   1.00 0.00 ? 9   GLN A HB3  1  
ATOM 117   H HG2  . GLN A 1 9   ? 13.912  -10.363 -1.046  1.00 0.00 ? 9   GLN A HG2  1  
ATOM 118   H HG3  . GLN A 1 9   ? 13.160  -8.783  -0.945  1.00 0.00 ? 9   GLN A HG3  1  
ATOM 119   H HE21 . GLN A 1 9   ? 13.721  -7.719  1.342   1.00 0.00 ? 9   GLN A HE21 1  
ATOM 120   H HE22 . GLN A 1 9   ? 15.417  -7.598  1.670   1.00 0.00 ? 9   GLN A HE22 1  
ATOM 121   N N    . GLN A 1 10  ? 9.968   -10.331 -0.910  1.00 0.00 ? 10  GLN A N    1  
ATOM 122   C CA   . GLN A 1 10  ? 9.255   -10.463 -2.169  1.00 0.00 ? 10  GLN A CA   1  
ATOM 123   C C    . GLN A 1 10  ? 8.173   -9.387  -2.281  1.00 0.00 ? 10  GLN A C    1  
ATOM 124   O O    . GLN A 1 10  ? 7.520   -9.265  -3.316  1.00 0.00 ? 10  GLN A O    1  
ATOM 125   C CB   . GLN A 1 10  ? 8.654   -11.862 -2.314  1.00 0.00 ? 10  GLN A CB   1  
ATOM 126   C CG   . GLN A 1 10  ? 9.528   -12.910 -1.621  1.00 0.00 ? 10  GLN A CG   1  
ATOM 127   C CD   . GLN A 1 10  ? 9.344   -14.288 -2.260  1.00 0.00 ? 10  GLN A CD   1  
ATOM 128   O OE1  . GLN A 1 10  ? 8.418   -14.531 -3.016  1.00 0.00 ? 10  GLN A OE1  1  
ATOM 129   N NE2  . GLN A 1 10  ? 10.275  -15.173 -1.914  1.00 0.00 ? 10  GLN A NE2  1  
ATOM 130   H H    . GLN A 1 10  ? 9.870   -11.106 -0.286  1.00 0.00 ? 10  GLN A H    1  
ATOM 131   H HA   . GLN A 1 10  ? 10.006  -10.314 -2.944  1.00 0.00 ? 10  GLN A HA   1  
ATOM 132   H HB2  . GLN A 1 10  ? 7.653   -11.878 -1.886  1.00 0.00 ? 10  GLN A HB2  1  
ATOM 133   H HB3  . GLN A 1 10  ? 8.553   -12.110 -3.372  1.00 0.00 ? 10  GLN A HB3  1  
ATOM 134   H HG2  . GLN A 1 10  ? 10.575  -12.613 -1.683  1.00 0.00 ? 10  GLN A HG2  1  
ATOM 135   H HG3  . GLN A 1 10  ? 9.273   -12.958 -0.563  1.00 0.00 ? 10  GLN A HG3  1  
ATOM 136   H HE21 . GLN A 1 10  ? 11.009  -14.908 -1.289  1.00 0.00 ? 10  GLN A HE21 1  
ATOM 137   H HE22 . GLN A 1 10  ? 10.240  -16.103 -2.281  1.00 0.00 ? 10  GLN A HE22 1  
ATOM 138   N N    . ALA A 1 11  ? 8.018   -8.634  -1.202  1.00 0.00 ? 11  ALA A N    1  
ATOM 139   C CA   . ALA A 1 11  ? 7.026   -7.574  -1.165  1.00 0.00 ? 11  ALA A CA   1  
ATOM 140   C C    . ALA A 1 11  ? 7.604   -6.319  -1.823  1.00 0.00 ? 11  ALA A C    1  
ATOM 141   O O    . ALA A 1 11  ? 6.893   -5.593  -2.516  1.00 0.00 ? 11  ALA A O    1  
ATOM 142   C CB   . ALA A 1 11  ? 6.593   -7.327  0.281   1.00 0.00 ? 11  ALA A CB   1  
ATOM 143   H H    . ALA A 1 11  ? 8.553   -8.741  -0.364  1.00 0.00 ? 11  ALA A H    1  
ATOM 144   H HA   . ALA A 1 11  ? 6.161   -7.908  -1.739  1.00 0.00 ? 11  ALA A HA   1  
ATOM 145   H HB1  . ALA A 1 11  ? 7.309   -7.793  0.959   1.00 0.00 ? 11  ALA A HB1  1  
ATOM 146   H HB2  . ALA A 1 11  ? 6.559   -6.255  0.472   1.00 0.00 ? 11  ALA A HB2  1  
ATOM 147   H HB3  . ALA A 1 11  ? 5.606   -7.757  0.444   1.00 0.00 ? 11  ALA A HB3  1  
ATOM 148   N N    . PHE A 1 12  ? 8.889   -6.102  -1.583  1.00 0.00 ? 12  PHE A N    1  
ATOM 149   C CA   . PHE A 1 12  ? 9.571   -4.947  -2.142  1.00 0.00 ? 12  PHE A CA   1  
ATOM 150   C C    . PHE A 1 12  ? 10.109  -5.254  -3.541  1.00 0.00 ? 12  PHE A C    1  
ATOM 151   O O    . PHE A 1 12  ? 10.641  -4.371  -4.213  1.00 0.00 ? 12  PHE A O    1  
ATOM 152   C CB   . PHE A 1 12  ? 10.745  -4.629  -1.216  1.00 0.00 ? 12  PHE A CB   1  
ATOM 153   C CG   . PHE A 1 12  ? 10.328  -4.131  0.169   1.00 0.00 ? 12  PHE A CG   1  
ATOM 154   C CD1  . PHE A 1 12  ? 9.424   -4.835  0.901   1.00 0.00 ? 12  PHE A CD1  1  
ATOM 155   C CD2  . PHE A 1 12  ? 10.861  -2.984  0.669   1.00 0.00 ? 12  PHE A CD2  1  
ATOM 156   C CE1  . PHE A 1 12  ? 9.037   -4.373  2.187   1.00 0.00 ? 12  PHE A CE1  1  
ATOM 157   C CE2  . PHE A 1 12  ? 10.475  -2.521  1.955   1.00 0.00 ? 12  PHE A CE2  1  
ATOM 158   C CZ   . PHE A 1 12  ? 9.570   -3.226  2.686   1.00 0.00 ? 12  PHE A CZ   1  
ATOM 159   H H    . PHE A 1 12  ? 9.460   -6.697  -1.018  1.00 0.00 ? 12  PHE A H    1  
ATOM 160   H HA   . PHE A 1 12  ? 8.842   -4.140  -2.204  1.00 0.00 ? 12  PHE A HA   1  
ATOM 161   H HB2  . PHE A 1 12  ? 11.357  -5.524  -1.100  1.00 0.00 ? 12  PHE A HB2  1  
ATOM 162   H HB3  . PHE A 1 12  ? 11.373  -3.873  -1.689  1.00 0.00 ? 12  PHE A HB3  1  
ATOM 163   H HD1  . PHE A 1 12  ? 8.996   -5.755  0.501   1.00 0.00 ? 12  PHE A HD1  1  
ATOM 164   H HD2  . PHE A 1 12  ? 11.586  -2.420  0.082   1.00 0.00 ? 12  PHE A HD2  1  
ATOM 165   H HE1  . PHE A 1 12  ? 8.312   -4.938  2.774   1.00 0.00 ? 12  PHE A HE1  1  
ATOM 166   H HE2  . PHE A 1 12  ? 10.902  -1.602  2.355   1.00 0.00 ? 12  PHE A HE2  1  
ATOM 167   H HZ   . PHE A 1 12  ? 9.273   -2.871  3.673   1.00 0.00 ? 12  PHE A HZ   1  
ATOM 168   N N    . CYS A 1 13  ? 9.951   -6.508  -3.939  1.00 0.00 ? 13  CYS A N    1  
ATOM 169   C CA   . CYS A 1 13  ? 10.414  -6.942  -5.247  1.00 0.00 ? 13  CYS A CA   1  
ATOM 170   C C    . CYS A 1 13  ? 9.201   -7.066  -6.170  1.00 0.00 ? 13  CYS A C    1  
ATOM 171   O O    . CYS A 1 13  ? 9.349   -7.146  -7.389  1.00 0.00 ? 13  CYS A O    1  
ATOM 172   C CB   . CYS A 1 13  ? 11.203  -8.251  -5.162  1.00 0.00 ? 13  CYS A CB   1  
ATOM 173   S SG   . CYS A 1 13  ? 13.022  -8.052  -5.163  1.00 0.00 ? 13  CYS A SG   1  
ATOM 174   H H    . CYS A 1 13  ? 9.517   -7.219  -3.388  1.00 0.00 ? 13  CYS A H    1  
ATOM 175   H HA   . CYS A 1 13  ? 11.098  -6.174  -5.607  1.00 0.00 ? 13  CYS A HA   1  
ATOM 176   H HB2  . CYS A 1 13  ? 10.909  -8.777  -4.254  1.00 0.00 ? 13  CYS A HB2  1  
ATOM 177   H HB3  . CYS A 1 13  ? 10.920  -8.884  -6.003  1.00 0.00 ? 13  CYS A HB3  1  
ATOM 178   N N    . ASN A 1 14  ? 8.027   -7.077  -5.554  1.00 0.00 ? 14  ASN A N    1  
ATOM 179   C CA   . ASN A 1 14  ? 6.789   -7.190  -6.306  1.00 0.00 ? 14  ASN A CA   1  
ATOM 180   C C    . ASN A 1 14  ? 6.209   -5.793  -6.536  1.00 0.00 ? 14  ASN A C    1  
ATOM 181   O O    . ASN A 1 14  ? 5.723   -5.491  -7.625  1.00 0.00 ? 14  ASN A O    1  
ATOM 182   C CB   . ASN A 1 14  ? 5.752   -8.012  -5.538  1.00 0.00 ? 14  ASN A CB   1  
ATOM 183   C CG   . ASN A 1 14  ? 5.311   -9.233  -6.348  1.00 0.00 ? 14  ASN A CG   1  
ATOM 184   O OD1  . ASN A 1 14  ? 4.556   -9.139  -7.301  1.00 0.00 ? 14  ASN A OD1  1  
ATOM 185   N ND2  . ASN A 1 14  ? 5.825   -10.382 -5.917  1.00 0.00 ? 14  ASN A ND2  1  
ATOM 186   H H    . ASN A 1 14  ? 7.916   -7.011  -4.563  1.00 0.00 ? 14  ASN A H    1  
ATOM 187   H HA   . ASN A 1 14  ? 7.063   -7.687  -7.237  1.00 0.00 ? 14  ASN A HA   1  
ATOM 188   H HB2  . ASN A 1 14  ? 6.172   -8.335  -4.585  1.00 0.00 ? 14  ASN A HB2  1  
ATOM 189   H HB3  . ASN A 1 14  ? 4.886   -7.390  -5.310  1.00 0.00 ? 14  ASN A HB3  1  
ATOM 190   H HD21 . ASN A 1 14  ? 6.440   -10.390 -5.127  1.00 0.00 ? 14  ASN A HD21 1  
ATOM 191   H HD22 . ASN A 1 14  ? 5.597   -11.237 -6.381  1.00 0.00 ? 14  ASN A HD22 1  
ATOM 192   N N    . ALA A 1 15  ? 6.278   -4.978  -5.493  1.00 0.00 ? 15  ALA A N    1  
ATOM 193   C CA   . ALA A 1 15  ? 5.765   -3.621  -5.568  1.00 0.00 ? 15  ALA A CA   1  
ATOM 194   C C    . ALA A 1 15  ? 6.418   -2.899  -6.749  1.00 0.00 ? 15  ALA A C    1  
ATOM 195   O O    . ALA A 1 15  ? 7.306   -3.445  -7.402  1.00 0.00 ? 15  ALA A O    1  
ATOM 196   C CB   . ALA A 1 15  ? 6.014   -2.907  -4.239  1.00 0.00 ? 15  ALA A CB   1  
ATOM 197   H H    . ALA A 1 15  ? 6.674   -5.233  -4.611  1.00 0.00 ? 15  ALA A H    1  
ATOM 198   H HA   . ALA A 1 15  ? 4.690   -3.681  -5.739  1.00 0.00 ? 15  ALA A HA   1  
ATOM 199   H HB1  . ALA A 1 15  ? 7.078   -2.935  -4.004  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 200   H HB2  . ALA A 1 15  ? 5.686   -1.871  -4.316  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 201   H HB3  . ALA A 1 15  ? 5.455   -3.407  -3.447  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 202   N N    . ASP A 1 16  ? 5.952   -1.682  -6.987  1.00 0.00 ? 16  ASP A N    1  
ATOM 203   C CA   . ASP A 1 16  ? 6.479   -0.879  -8.077  1.00 0.00 ? 16  ASP A CA   1  
ATOM 204   C C    . ASP A 1 16  ? 6.296   0.604   -7.749  1.00 0.00 ? 16  ASP A C    1  
ATOM 205   O O    . ASP A 1 16  ? 6.401   1.457   -8.630  1.00 0.00 ? 16  ASP A O    1  
ATOM 206   C CB   . ASP A 1 16  ? 5.738   -1.169  -9.384  1.00 0.00 ? 16  ASP A CB   1  
ATOM 207   C CG   . ASP A 1 16  ? 6.369   -2.254  -10.259 1.00 0.00 ? 16  ASP A CG   1  
ATOM 208   O OD1  . ASP A 1 16  ? 6.262   -3.435  -9.863  1.00 0.00 ? 16  ASP A OD1  1  
ATOM 209   O OD2  . ASP A 1 16  ? 6.944   -1.878  -11.303 1.00 0.00 ? 16  ASP A OD2  1  
ATOM 210   H H    . ASP A 1 16  ? 5.230   -1.244  -6.452  1.00 0.00 ? 16  ASP A H    1  
ATOM 211   H HA   . ASP A 1 16  ? 7.530   -1.161  -8.160  1.00 0.00 ? 16  ASP A HA   1  
ATOM 212   H HB2  . ASP A 1 16  ? 4.716   -1.464  -9.146  1.00 0.00 ? 16  ASP A HB2  1  
ATOM 213   H HB3  . ASP A 1 16  ? 5.677   -0.247  -9.961  1.00 0.00 ? 16  ASP A HB3  1  
ATOM 214   N N    . VAL A 1 17  ? 6.025   0.866   -6.479  1.00 0.00 ? 17  VAL A N    1  
ATOM 215   C CA   . VAL A 1 17  ? 5.826   2.232   -6.023  1.00 0.00 ? 17  VAL A CA   1  
ATOM 216   C C    . VAL A 1 17  ? 5.868   2.265   -4.494  1.00 0.00 ? 17  VAL A C    1  
ATOM 217   O O    . VAL A 1 17  ? 4.831   2.181   -3.838  1.00 0.00 ? 17  VAL A O    1  
ATOM 218   C CB   . VAL A 1 17  ? 4.522   2.790   -6.597  1.00 0.00 ? 17  VAL A CB   1  
ATOM 219   C CG1  . VAL A 1 17  ? 3.345   1.863   -6.286  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 220   C CG2  . VAL A 1 17  ? 4.257   4.205   -6.079  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 221   H H    . VAL A 1 17  ? 5.942   0.167   -5.769  1.00 0.00 ? 17  VAL A H    1  
ATOM 222   H HA   . VAL A 1 17  ? 6.649   2.832   -6.410  1.00 0.00 ? 17  VAL A HA   1  
ATOM 223   H HB   . VAL A 1 17  ? 4.628   2.844   -7.680  1.00 0.00 ? 17  VAL A HB   1  
ATOM 224   H HG11 . VAL A 1 17  ? 3.409   1.528   -5.250  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 225   H HG12 . VAL A 1 17  ? 2.409   2.401   -6.436  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 226   H HG13 . VAL A 1 17  ? 3.377   0.999   -6.950  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 227   H HG21 . VAL A 1 17  ? 5.123   4.835   -6.283  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 228   H HG22 . VAL A 1 17  ? 3.382   4.618   -6.581  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 229   H HG23 . VAL A 1 17  ? 4.077   4.171   -5.005  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 230   N N    . VAL A 1 18  ? 7.080   2.389   -3.970  1.00 0.00 ? 18  VAL A N    1  
ATOM 231   C CA   . VAL A 1 18  ? 7.271   2.435   -2.531  1.00 0.00 ? 18  VAL A CA   1  
ATOM 232   C C    . VAL A 1 18  ? 7.381   3.894   -2.081  1.00 0.00 ? 18  VAL A C    1  
ATOM 233   O O    . VAL A 1 18  ? 8.304   4.602   -2.481  1.00 0.00 ? 18  VAL A O    1  
ATOM 234   C CB   . VAL A 1 18  ? 8.488   1.595   -2.137  1.00 0.00 ? 18  VAL A CB   1  
ATOM 235   C CG1  . VAL A 1 18  ? 8.334   1.035   -0.722  1.00 0.00 ? 18  VAL A CG1  1  
ATOM 236   C CG2  . VAL A 1 18  ? 8.729   0.473   -3.148  1.00 0.00 ? 18  VAL A CG2  1  
ATOM 237   H H    . VAL A 1 18  ? 7.918   2.457   -4.511  1.00 0.00 ? 18  VAL A H    1  
ATOM 238   H HA   . VAL A 1 18  ? 6.390   1.991   -2.067  1.00 0.00 ? 18  VAL A HA   1  
ATOM 239   H HB   . VAL A 1 18  ? 9.361   2.247   -2.146  1.00 0.00 ? 18  VAL A HB   1  
ATOM 240   H HG11 . VAL A 1 18  ? 7.291   1.110   -0.414  1.00 0.00 ? 18  VAL A HG11 1  
ATOM 241   H HG12 . VAL A 1 18  ? 8.642   -0.011  -0.710  1.00 0.00 ? 18  VAL A HG12 1  
ATOM 242   H HG13 . VAL A 1 18  ? 8.958   1.606   -0.035  1.00 0.00 ? 18  VAL A HG13 1  
ATOM 243   H HG21 . VAL A 1 18  ? 8.159   0.672   -4.056  1.00 0.00 ? 18  VAL A HG21 1  
ATOM 244   H HG22 . VAL A 1 18  ? 9.791   0.423   -3.390  1.00 0.00 ? 18  VAL A HG22 1  
ATOM 245   H HG23 . VAL A 1 18  ? 8.410   -0.477  -2.720  1.00 0.00 ? 18  VAL A HG23 1  
ATOM 246   N N    . ILE A 1 19  ? 6.427   4.299   -1.256  1.00 0.00 ? 19  ILE A N    1  
ATOM 247   C CA   . ILE A 1 19  ? 6.405   5.660   -0.749  1.00 0.00 ? 19  ILE A CA   1  
ATOM 248   C C    . ILE A 1 19  ? 5.960   5.647   0.715   1.00 0.00 ? 19  ILE A C    1  
ATOM 249   O O    . ILE A 1 19  ? 4.899   5.115   1.040   1.00 0.00 ? 19  ILE A O    1  
ATOM 250   C CB   . ILE A 1 19  ? 5.545   6.553   -1.645  1.00 0.00 ? 19  ILE A CB   1  
ATOM 251   C CG1  . ILE A 1 19  ? 4.057   6.260   -1.444  1.00 0.00 ? 19  ILE A CG1  1  
ATOM 252   C CG2  . ILE A 1 19  ? 5.962   6.421   -3.111  1.00 0.00 ? 19  ILE A CG2  1  
ATOM 253   C CD1  . ILE A 1 19  ? 3.270   6.502   -2.735  1.00 0.00 ? 19  ILE A CD1  1  
ATOM 254   H H    . ILE A 1 19  ? 5.680   3.717   -0.936  1.00 0.00 ? 19  ILE A H    1  
ATOM 255   H HA   . ILE A 1 19  ? 7.425   6.043   -0.797  1.00 0.00 ? 19  ILE A HA   1  
ATOM 256   H HB   . ILE A 1 19  ? 5.711   7.590   -1.355  1.00 0.00 ? 19  ILE A HB   1  
ATOM 257   H HG12 . ILE A 1 19  ? 3.925   5.227   -1.122  1.00 0.00 ? 19  ILE A HG12 1  
ATOM 258   H HG13 . ILE A 1 19  ? 3.662   6.894   -0.649  1.00 0.00 ? 19  ILE A HG13 1  
ATOM 259   H HG21 . ILE A 1 19  ? 7.039   6.274   -3.171  1.00 0.00 ? 19  ILE A HG21 1  
ATOM 260   H HG22 . ILE A 1 19  ? 5.453   5.567   -3.559  1.00 0.00 ? 19  ILE A HG22 1  
ATOM 261   H HG23 . ILE A 1 19  ? 5.688   7.329   -3.650  1.00 0.00 ? 19  ILE A HG23 1  
ATOM 262   H HD11 . ILE A 1 19  ? 3.575   7.452   -3.173  1.00 0.00 ? 19  ILE A HD11 1  
ATOM 263   H HD12 . ILE A 1 19  ? 3.473   5.695   -3.439  1.00 0.00 ? 19  ILE A HD12 1  
ATOM 264   H HD13 . ILE A 1 19  ? 2.204   6.530   -2.510  1.00 0.00 ? 19  ILE A HD13 1  
ATOM 265   N N    . ARG A 1 20  ? 6.791   6.239   1.559   1.00 0.00 ? 20  ARG A N    1  
ATOM 266   C CA   . ARG A 1 20  ? 6.497   6.302   2.980   1.00 0.00 ? 20  ARG A CA   1  
ATOM 267   C C    . ARG A 1 20  ? 5.466   7.397   3.260   1.00 0.00 ? 20  ARG A C    1  
ATOM 268   O O    . ARG A 1 20  ? 5.590   8.136   4.236   1.00 0.00 ? 20  ARG A O    1  
ATOM 269   C CB   . ARG A 1 20  ? 7.762   6.581   3.793   1.00 0.00 ? 20  ARG A CB   1  
ATOM 270   C CG   . ARG A 1 20  ? 7.581   6.159   5.253   1.00 0.00 ? 20  ARG A CG   1  
ATOM 271   C CD   . ARG A 1 20  ? 7.953   7.299   6.203   1.00 0.00 ? 20  ARG A CD   1  
ATOM 272   N NE   . ARG A 1 20  ? 9.321   7.782   5.903   1.00 0.00 ? 20  ARG A NE   1  
ATOM 273   C CZ   . ARG A 1 20  ? 10.009  8.624   6.686   1.00 0.00 ? 20  ARG A CZ   1  
ATOM 274   N NH1  . ARG A 1 20  ? 9.463   9.082   7.820   1.00 0.00 ? 20  ARG A NH1  1  
ATOM 275   N NH2  . ARG A 1 20  ? 11.243  9.008   6.333   1.00 0.00 ? 20  ARG A NH2  1  
ATOM 276   H H    . ARG A 1 20  ? 7.652   6.669   1.286   1.00 0.00 ? 20  ARG A H    1  
ATOM 277   H HA   . ARG A 1 20  ? 6.099   5.317   3.226   1.00 0.00 ? 20  ARG A HA   1  
ATOM 278   H HB2  . ARG A 1 20  ? 8.605   6.044   3.359   1.00 0.00 ? 20  ARG A HB2  1  
ATOM 279   H HB3  . ARG A 1 20  ? 8.003   7.643   3.745   1.00 0.00 ? 20  ARG A HB3  1  
ATOM 280   H HG2  . ARG A 1 20  ? 6.545   5.864   5.424   1.00 0.00 ? 20  ARG A HG2  1  
ATOM 281   H HG3  . ARG A 1 20  ? 8.201   5.288   5.463   1.00 0.00 ? 20  ARG A HG3  1  
ATOM 282   H HD2  . ARG A 1 20  ? 7.240   8.117   6.103   1.00 0.00 ? 20  ARG A HD2  1  
ATOM 283   H HD3  . ARG A 1 20  ? 7.900   6.955   7.236   1.00 0.00 ? 20  ARG A HD3  1  
ATOM 284   H HE   . ARG A 1 20  ? 9.757   7.459   5.063   1.00 0.00 ? 20  ARG A HE   1  
ATOM 285   H HH11 . ARG A 1 20  ? 8.541   8.795   8.083   1.00 0.00 ? 20  ARG A HH11 1  
ATOM 286   H HH12 . ARG A 1 20  ? 9.976   9.710   8.404   1.00 0.00 ? 20  ARG A HH12 1  
ATOM 287   H HH21 . ARG A 1 20  ? 11.651  8.667   5.486   1.00 0.00 ? 20  ARG A HH21 1  
ATOM 288   H HH22 . ARG A 1 20  ? 11.757  9.636   6.917   1.00 0.00 ? 20  ARG A HH22 1  
ATOM 289   N N    . THR A 1 21  ? 4.473   7.467   2.388   1.00 0.00 ? 21  THR A N    1  
ATOM 290   C CA   . THR A 1 21  ? 3.420   8.459   2.529   1.00 0.00 ? 21  THR A CA   1  
ATOM 291   C C    . THR A 1 21  ? 2.617   8.207   3.806   1.00 0.00 ? 21  THR A C    1  
ATOM 292   O O    . THR A 1 21  ? 2.801   7.187   4.469   1.00 0.00 ? 21  THR A O    1  
ATOM 293   C CB   . THR A 1 21  ? 2.569   8.430   1.259   1.00 0.00 ? 21  THR A CB   1  
ATOM 294   O OG1  . THR A 1 21  ? 1.402   9.173   1.605   1.00 0.00 ? 21  THR A OG1  1  
ATOM 295   C CG2  . THR A 1 21  ? 2.038   7.030   0.943   1.00 0.00 ? 21  THR A CG2  1  
ATOM 296   H H    . THR A 1 21  ? 4.379   6.862   1.597   1.00 0.00 ? 21  THR A H    1  
ATOM 297   H HA   . THR A 1 21  ? 3.885   9.440   2.632   1.00 0.00 ? 21  THR A HA   1  
ATOM 298   H HB   . THR A 1 21  ? 3.118   8.839   0.411   1.00 0.00 ? 21  THR A HB   1  
ATOM 299   H HG1  . THR A 1 21  ? 0.873   8.677   2.294   1.00 0.00 ? 21  THR A HG1  1  
ATOM 300   H HG21 . THR A 1 21  ? 2.831   6.298   1.093   1.00 0.00 ? 21  THR A HG21 1  
ATOM 301   H HG22 . THR A 1 21  ? 1.201   6.801   1.603   1.00 0.00 ? 21  THR A HG22 1  
ATOM 302   H HG23 . THR A 1 21  ? 1.702   6.994   -0.094  1.00 0.00 ? 21  THR A HG23 1  
ATOM 303   N N    . LYS A 1 22  ? 1.742   9.153   4.114   1.00 0.00 ? 22  LYS A N    1  
ATOM 304   C CA   . LYS A 1 22  ? 0.910   9.046   5.300   1.00 0.00 ? 22  LYS A CA   1  
ATOM 305   C C    . LYS A 1 22  ? -0.560  9.203   4.903   1.00 0.00 ? 22  LYS A C    1  
ATOM 306   O O    . LYS A 1 22  ? -0.952  10.234  4.358   1.00 0.00 ? 22  LYS A O    1  
ATOM 307   C CB   . LYS A 1 22  ? 1.368   10.042  6.368   1.00 0.00 ? 22  LYS A CB   1  
ATOM 308   C CG   . LYS A 1 22  ? 1.086   11.481  5.932   1.00 0.00 ? 22  LYS A CG   1  
ATOM 309   C CD   . LYS A 1 22  ? 1.351   12.462  7.076   1.00 0.00 ? 22  LYS A CD   1  
ATOM 310   C CE   . LYS A 1 22  ? 0.711   11.972  8.377   1.00 0.00 ? 22  LYS A CE   1  
ATOM 311   N NZ   . LYS A 1 22  ? 0.645   13.071  9.368   1.00 0.00 ? 22  LYS A NZ   1  
ATOM 312   H H    . LYS A 1 22  ? 1.598   9.980   3.570   1.00 0.00 ? 22  LYS A H    1  
ATOM 313   H HA   . LYS A 1 22  ? 1.051   8.046   5.709   1.00 0.00 ? 22  LYS A HA   1  
ATOM 314   H HB2  . LYS A 1 22  ? 0.855   9.835   7.307   1.00 0.00 ? 22  LYS A HB2  1  
ATOM 315   H HB3  . LYS A 1 22  ? 2.435   9.916   6.553   1.00 0.00 ? 22  LYS A HB3  1  
ATOM 316   H HG2  . LYS A 1 22  ? 1.712   11.736  5.078   1.00 0.00 ? 22  LYS A HG2  1  
ATOM 317   H HG3  . LYS A 1 22  ? 0.049   11.570  5.606   1.00 0.00 ? 22  LYS A HG3  1  
ATOM 318   H HD2  . LYS A 1 22  ? 2.425   12.579  7.218   1.00 0.00 ? 22  LYS A HD2  1  
ATOM 319   H HD3  . LYS A 1 22  ? 0.955   13.443  6.818   1.00 0.00 ? 22  LYS A HD3  1  
ATOM 320   H HE2  . LYS A 1 22  ? -0.293  11.596  8.177   1.00 0.00 ? 22  LYS A HE2  1  
ATOM 321   H HE3  . LYS A 1 22  ? 1.288   11.142  8.784   1.00 0.00 ? 22  LYS A HE3  1  
ATOM 322   H HZ1  . LYS A 1 22  ? 0.196   13.863  8.957   1.00 0.00 ? 22  LYS A HZ1  1  
ATOM 323   H HZ2  . LYS A 1 22  ? 0.125   12.768  10.166  1.00 0.00 ? 22  LYS A HZ2  1  
ATOM 324   H HZ3  . LYS A 1 22  ? 1.572   13.321  9.648   1.00 0.00 ? 22  LYS A HZ3  1  
ATOM 325   N N    . ALA A 1 23  ? -1.332  8.166   5.190   1.00 0.00 ? 23  ALA A N    1  
ATOM 326   C CA   . ALA A 1 23  ? -2.748  8.176   4.869   1.00 0.00 ? 23  ALA A CA   1  
ATOM 327   C C    . ALA A 1 23  ? -3.533  8.732   6.059   1.00 0.00 ? 23  ALA A C    1  
ATOM 328   O O    . ALA A 1 23  ? -3.663  8.068   7.086   1.00 0.00 ? 23  ALA A O    1  
ATOM 329   C CB   . ALA A 1 23  ? -3.196  6.764   4.485   1.00 0.00 ? 23  ALA A CB   1  
ATOM 330   H H    . ALA A 1 23  ? -1.005  7.331   5.632   1.00 0.00 ? 23  ALA A H    1  
ATOM 331   H HA   . ALA A 1 23  ? -2.890  8.834   4.011   1.00 0.00 ? 23  ALA A HA   1  
ATOM 332   H HB1  . ALA A 1 23  ? -2.980  6.079   5.305   1.00 0.00 ? 23  ALA A HB1  1  
ATOM 333   H HB2  . ALA A 1 23  ? -4.266  6.763   4.283   1.00 0.00 ? 23  ALA A HB2  1  
ATOM 334   H HB3  . ALA A 1 23  ? -2.658  6.443   3.593   1.00 0.00 ? 23  ALA A HB3  1  
ATOM 335   N N    . VAL A 1 24  ? -4.035  9.945   5.881   1.00 0.00 ? 24  VAL A N    1  
ATOM 336   C CA   . VAL A 1 24  ? -4.802  10.598  6.928   1.00 0.00 ? 24  VAL A CA   1  
ATOM 337   C C    . VAL A 1 24  ? -6.271  10.677  6.505   1.00 0.00 ? 24  VAL A C    1  
ATOM 338   O O    . VAL A 1 24  ? -7.168  10.539  7.334   1.00 0.00 ? 24  VAL A O    1  
ATOM 339   C CB   . VAL A 1 24  ? -4.198  11.968  7.244   1.00 0.00 ? 24  VAL A CB   1  
ATOM 340   C CG1  . VAL A 1 24  ? -3.042  11.841  8.239   1.00 0.00 ? 24  VAL A CG1  1  
ATOM 341   C CG2  . VAL A 1 24  ? -3.745  12.675  5.965   1.00 0.00 ? 24  VAL A CG2  1  
ATOM 342   H H    . VAL A 1 24  ? -3.924  10.479  5.043   1.00 0.00 ? 24  VAL A H    1  
ATOM 343   H HA   . VAL A 1 24  ? -4.729  9.981   7.824   1.00 0.00 ? 24  VAL A HA   1  
ATOM 344   H HB   . VAL A 1 24  ? -4.972  12.577  7.708   1.00 0.00 ? 24  VAL A HB   1  
ATOM 345   H HG11 . VAL A 1 24  ? -2.468  10.941  8.015   1.00 0.00 ? 24  VAL A HG11 1  
ATOM 346   H HG12 . VAL A 1 24  ? -2.394  12.714  8.158   1.00 0.00 ? 24  VAL A HG12 1  
ATOM 347   H HG13 . VAL A 1 24  ? -3.439  11.775  9.251   1.00 0.00 ? 24  VAL A HG13 1  
ATOM 348   H HG21 . VAL A 1 24  ? -4.544  12.635  5.225   1.00 0.00 ? 24  VAL A HG21 1  
ATOM 349   H HG22 . VAL A 1 24  ? -3.509  13.715  6.189   1.00 0.00 ? 24  VAL A HG22 1  
ATOM 350   H HG23 . VAL A 1 24  ? -2.858  12.179  5.570   1.00 0.00 ? 24  VAL A HG23 1  
ATOM 351   N N    . SER A 1 25  ? -6.470  10.898  5.213   1.00 0.00 ? 25  SER A N    1  
ATOM 352   C CA   . SER A 1 25  ? -7.813  10.996  4.670   1.00 0.00 ? 25  SER A CA   1  
ATOM 353   C C    . SER A 1 25  ? -8.066  9.851   3.687   1.00 0.00 ? 25  SER A C    1  
ATOM 354   O O    . SER A 1 25  ? -7.128  9.186   3.249   1.00 0.00 ? 25  SER A O    1  
ATOM 355   C CB   . SER A 1 25  ? -8.031  12.345  3.979   1.00 0.00 ? 25  SER A CB   1  
ATOM 356   O OG   . SER A 1 25  ? -8.981  12.255  2.921   1.00 0.00 ? 25  SER A OG   1  
ATOM 357   H H    . SER A 1 25  ? -5.734  11.009  4.545   1.00 0.00 ? 25  SER A H    1  
ATOM 358   H HA   . SER A 1 25  ? -8.479  10.918  5.529   1.00 0.00 ? 25  SER A HA   1  
ATOM 359   H HB2  . SER A 1 25  ? -8.372  13.076  4.712   1.00 0.00 ? 25  SER A HB2  1  
ATOM 360   H HB3  . SER A 1 25  ? -7.082  12.708  3.585   1.00 0.00 ? 25  SER A HB3  1  
ATOM 361   H HG   . SER A 1 25  ? -9.251  13.172  2.627   1.00 0.00 ? 25  SER A HG   1  
ATOM 362   N N    . GLU A 1 26  ? -9.337  9.655   3.369   1.00 0.00 ? 26  GLU A N    1  
ATOM 363   C CA   . GLU A 1 26  ? -9.725  8.602   2.447   1.00 0.00 ? 26  GLU A CA   1  
ATOM 364   C C    . GLU A 1 26  ? -10.983 9.006   1.677   1.00 0.00 ? 26  GLU A C    1  
ATOM 365   O O    . GLU A 1 26  ? -11.478 10.121  1.833   1.00 0.00 ? 26  GLU A O    1  
ATOM 366   C CB   . GLU A 1 26  ? -9.935  7.277   3.184   1.00 0.00 ? 26  GLU A CB   1  
ATOM 367   C CG   . GLU A 1 26  ? -8.597  6.650   3.580   1.00 0.00 ? 26  GLU A CG   1  
ATOM 368   C CD   . GLU A 1 26  ? -8.344  6.797   5.081   1.00 0.00 ? 26  GLU A CD   1  
ATOM 369   O OE1  . GLU A 1 26  ? -8.481  7.939   5.571   1.00 0.00 ? 26  GLU A OE1  1  
ATOM 370   O OE2  . GLU A 1 26  ? -8.020  5.764   5.706   1.00 0.00 ? 26  GLU A OE2  1  
ATOM 371   H H    . GLU A 1 26  ? -10.094 10.200  3.730   1.00 0.00 ? 26  GLU A H    1  
ATOM 372   H HA   . GLU A 1 26  ? -8.886  8.497   1.758   1.00 0.00 ? 26  GLU A HA   1  
ATOM 373   H HB2  . GLU A 1 26  ? -10.539 7.446   4.076   1.00 0.00 ? 26  GLU A HB2  1  
ATOM 374   H HB3  . GLU A 1 26  ? -10.491 6.588   2.549   1.00 0.00 ? 26  GLU A HB3  1  
ATOM 375   H HG2  . GLU A 1 26  ? -8.592  5.595   3.308   1.00 0.00 ? 26  GLU A HG2  1  
ATOM 376   H HG3  . GLU A 1 26  ? -7.790  7.126   3.022   1.00 0.00 ? 26  GLU A HG3  1  
ATOM 377   N N    . LYS A 1 27  ? -11.462 8.079   0.861   1.00 0.00 ? 27  LYS A N    1  
ATOM 378   C CA   . LYS A 1 27  ? -12.653 8.326   0.065   1.00 0.00 ? 27  LYS A CA   1  
ATOM 379   C C    . LYS A 1 27  ? -13.394 7.006   -0.158  1.00 0.00 ? 27  LYS A C    1  
ATOM 380   O O    . LYS A 1 27  ? -12.903 6.126   -0.863  1.00 0.00 ? 27  LYS A O    1  
ATOM 381   C CB   . LYS A 1 27  ? -12.290 9.055   -1.230  1.00 0.00 ? 27  LYS A CB   1  
ATOM 382   C CG   . LYS A 1 27  ? -13.548 9.442   -2.012  1.00 0.00 ? 27  LYS A CG   1  
ATOM 383   C CD   . LYS A 1 27  ? -13.344 10.759  -2.762  1.00 0.00 ? 27  LYS A CD   1  
ATOM 384   C CE   . LYS A 1 27  ? -12.014 10.759  -3.518  1.00 0.00 ? 27  LYS A CE   1  
ATOM 385   N NZ   . LYS A 1 27  ? -11.820 12.044  -4.226  1.00 0.00 ? 27  LYS A NZ   1  
ATOM 386   H H    . LYS A 1 27  ? -11.053 7.175   0.739   1.00 0.00 ? 27  LYS A H    1  
ATOM 387   H HA   . LYS A 1 27  ? -13.298 8.991   0.640   1.00 0.00 ? 27  LYS A HA   1  
ATOM 388   H HB2  . LYS A 1 27  ? -11.713 9.950   -0.999  1.00 0.00 ? 27  LYS A HB2  1  
ATOM 389   H HB3  . LYS A 1 27  ? -11.657 8.417   -1.845  1.00 0.00 ? 27  LYS A HB3  1  
ATOM 390   H HG2  . LYS A 1 27  ? -13.798 8.650   -2.719  1.00 0.00 ? 27  LYS A HG2  1  
ATOM 391   H HG3  . LYS A 1 27  ? -14.392 9.535   -1.327  1.00 0.00 ? 27  LYS A HG3  1  
ATOM 392   H HD2  . LYS A 1 27  ? -14.164 10.914  -3.463  1.00 0.00 ? 27  LYS A HD2  1  
ATOM 393   H HD3  . LYS A 1 27  ? -13.366 11.590  -2.057  1.00 0.00 ? 27  LYS A HD3  1  
ATOM 394   H HE2  . LYS A 1 27  ? -11.192 10.595  -2.821  1.00 0.00 ? 27  LYS A HE2  1  
ATOM 395   H HE3  . LYS A 1 27  ? -11.994 9.936   -4.233  1.00 0.00 ? 27  LYS A HE3  1  
ATOM 396   H HZ1  . LYS A 1 27  ? -12.675 12.312  -4.670  1.00 0.00 ? 27  LYS A HZ1  1  
ATOM 397   H HZ2  . LYS A 1 27  ? -11.548 12.749  -3.571  1.00 0.00 ? 27  LYS A HZ2  1  
ATOM 398   H HZ3  . LYS A 1 27  ? -11.105 11.939  -4.918  1.00 0.00 ? 27  LYS A HZ3  1  
ATOM 399   N N    . GLU A 1 28  ? -14.565 6.910   0.455   1.00 0.00 ? 28  GLU A N    1  
ATOM 400   C CA   . GLU A 1 28  ? -15.379 5.713   0.331   1.00 0.00 ? 28  GLU A CA   1  
ATOM 401   C C    . GLU A 1 28  ? -16.027 5.652   -1.053  1.00 0.00 ? 28  GLU A C    1  
ATOM 402   O O    . GLU A 1 28  ? -17.113 6.193   -1.257  1.00 0.00 ? 28  GLU A O    1  
ATOM 403   C CB   . GLU A 1 28  ? -16.435 5.652   1.436   1.00 0.00 ? 28  GLU A CB   1  
ATOM 404   C CG   . GLU A 1 28  ? -17.322 4.416   1.278   1.00 0.00 ? 28  GLU A CG   1  
ATOM 405   C CD   . GLU A 1 28  ? -18.787 4.750   1.568   1.00 0.00 ? 28  GLU A CD   1  
ATOM 406   O OE1  . GLU A 1 28  ? -19.281 5.718   0.952   1.00 0.00 ? 28  GLU A OE1  1  
ATOM 407   O OE2  . GLU A 1 28  ? -19.379 4.030   2.401   1.00 0.00 ? 28  GLU A OE2  1  
ATOM 408   H H    . GLU A 1 28  ? -14.957 7.631   1.026   1.00 0.00 ? 28  GLU A H    1  
ATOM 409   H HA   . GLU A 1 28  ? -14.686 4.879   0.452   1.00 0.00 ? 28  GLU A HA   1  
ATOM 410   H HB2  . GLU A 1 28  ? -15.948 5.631   2.410   1.00 0.00 ? 28  GLU A HB2  1  
ATOM 411   H HB3  . GLU A 1 28  ? -17.050 6.551   1.405   1.00 0.00 ? 28  GLU A HB3  1  
ATOM 412   H HG2  . GLU A 1 28  ? -17.230 4.023   0.265   1.00 0.00 ? 28  GLU A HG2  1  
ATOM 413   H HG3  . GLU A 1 28  ? -16.984 3.631   1.955   1.00 0.00 ? 28  GLU A HG3  1  
ATOM 414   N N    . VAL A 1 29  ? -15.335 4.990   -1.968  1.00 0.00 ? 29  VAL A N    1  
ATOM 415   C CA   . VAL A 1 29  ? -15.830 4.853   -3.327  1.00 0.00 ? 29  VAL A CA   1  
ATOM 416   C C    . VAL A 1 29  ? -16.291 3.411   -3.553  1.00 0.00 ? 29  VAL A C    1  
ATOM 417   O O    . VAL A 1 29  ? -15.482 2.486   -3.527  1.00 0.00 ? 29  VAL A O    1  
ATOM 418   C CB   . VAL A 1 29  ? -14.758 5.301   -4.323  1.00 0.00 ? 29  VAL A CB   1  
ATOM 419   C CG1  . VAL A 1 29  ? -14.389 6.770   -4.106  1.00 0.00 ? 29  VAL A CG1  1  
ATOM 420   C CG2  . VAL A 1 29  ? -13.521 4.405   -4.235  1.00 0.00 ? 29  VAL A CG2  1  
ATOM 421   H H    . VAL A 1 29  ? -14.452 4.554   -1.794  1.00 0.00 ? 29  VAL A H    1  
ATOM 422   H HA   . VAL A 1 29  ? -16.688 5.516   -3.433  1.00 0.00 ? 29  VAL A HA   1  
ATOM 423   H HB   . VAL A 1 29  ? -15.172 5.204   -5.326  1.00 0.00 ? 29  VAL A HB   1  
ATOM 424   H HG11 . VAL A 1 29  ? -15.222 7.287   -3.630  1.00 0.00 ? 29  VAL A HG11 1  
ATOM 425   H HG12 . VAL A 1 29  ? -13.509 6.833   -3.467  1.00 0.00 ? 29  VAL A HG12 1  
ATOM 426   H HG13 . VAL A 1 29  ? -14.175 7.235   -5.068  1.00 0.00 ? 29  VAL A HG13 1  
ATOM 427   H HG21 . VAL A 1 29  ? -13.606 3.750   -3.369  1.00 0.00 ? 29  VAL A HG21 1  
ATOM 428   H HG22 . VAL A 1 29  ? -13.444 3.804   -5.141  1.00 0.00 ? 29  VAL A HG22 1  
ATOM 429   H HG23 . VAL A 1 29  ? -12.630 5.026   -4.136  1.00 0.00 ? 29  VAL A HG23 1  
ATOM 430   N N    . ASP A 1 30  ? -17.591 3.267   -3.771  1.00 0.00 ? 30  ASP A N    1  
ATOM 431   C CA   . ASP A 1 30  ? -18.169 1.953   -4.002  1.00 0.00 ? 30  ASP A CA   1  
ATOM 432   C C    . ASP A 1 30  ? -17.469 1.296   -5.192  1.00 0.00 ? 30  ASP A C    1  
ATOM 433   O O    . ASP A 1 30  ? -16.846 1.977   -6.006  1.00 0.00 ? 30  ASP A O    1  
ATOM 434   C CB   . ASP A 1 30  ? -19.660 2.058   -4.327  1.00 0.00 ? 30  ASP A CB   1  
ATOM 435   C CG   . ASP A 1 30  ? -20.596 1.923   -3.125  1.00 0.00 ? 30  ASP A CG   1  
ATOM 436   O OD1  . ASP A 1 30  ? -20.653 0.802   -2.574  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 437   O OD2  . ASP A 1 30  ? -21.233 2.943   -2.784  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 438   H H    . ASP A 1 30  ? -18.242 4.025   -3.791  1.00 0.00 ? 30  ASP A H    1  
ATOM 439   H HA   . ASP A 1 30  ? -18.014 1.405   -3.072  1.00 0.00 ? 30  ASP A HA   1  
ATOM 440   H HB2  . ASP A 1 30  ? -19.845 3.020   -4.806  1.00 0.00 ? 30  ASP A HB2  1  
ATOM 441   H HB3  . ASP A 1 30  ? -19.912 1.286   -5.055  1.00 0.00 ? 30  ASP A HB3  1  
ATOM 442   N N    . SER A 1 31  ? -17.595 -0.022  -5.257  1.00 0.00 ? 31  SER A N    1  
ATOM 443   C CA   . SER A 1 31  ? -16.983 -0.780  -6.335  1.00 0.00 ? 31  SER A CA   1  
ATOM 444   C C    . SER A 1 31  ? -17.887 -1.948  -6.732  1.00 0.00 ? 31  SER A C    1  
ATOM 445   O O    . SER A 1 31  ? -17.442 -2.885  -7.394  1.00 0.00 ? 31  SER A O    1  
ATOM 446   C CB   . SER A 1 31  ? -15.599 -1.293  -5.932  1.00 0.00 ? 31  SER A CB   1  
ATOM 447   O OG   . SER A 1 31  ? -15.276 -2.522  -6.576  1.00 0.00 ? 31  SER A OG   1  
ATOM 448   H H    . SER A 1 31  ? -18.103 -0.569  -4.592  1.00 0.00 ? 31  SER A H    1  
ATOM 449   H HA   . SER A 1 31  ? -16.882 -0.076  -7.162  1.00 0.00 ? 31  SER A HA   1  
ATOM 450   H HB2  . SER A 1 31  ? -14.848 -0.544  -6.182  1.00 0.00 ? 31  SER A HB2  1  
ATOM 451   H HB3  . SER A 1 31  ? -15.564 -1.430  -4.850  1.00 0.00 ? 31  SER A HB3  1  
ATOM 452   H HG   . SER A 1 31  ? -15.551 -2.486  -7.536  1.00 0.00 ? 31  SER A HG   1  
ATOM 453   N N    . GLY A 1 32  ? -19.140 -1.856  -6.311  1.00 0.00 ? 32  GLY A N    1  
ATOM 454   C CA   . GLY A 1 32  ? -20.110 -2.894  -6.613  1.00 0.00 ? 32  GLY A CA   1  
ATOM 455   C C    . GLY A 1 32  ? -19.924 -4.104  -5.695  1.00 0.00 ? 32  GLY A C    1  
ATOM 456   O O    . GLY A 1 32  ? -19.013 -4.126  -4.869  1.00 0.00 ? 32  GLY A O    1  
ATOM 457   H H    . GLY A 1 32  ? -19.493 -1.091  -5.773  1.00 0.00 ? 32  GLY A H    1  
ATOM 458   H HA2  . GLY A 1 32  ? -21.119 -2.498  -6.500  1.00 0.00 ? 32  GLY A HA2  1  
ATOM 459   H HA3  . GLY A 1 32  ? -20.004 -3.203  -7.654  1.00 0.00 ? 32  GLY A HA3  1  
ATOM 460   N N    . ASN A 1 33  ? -20.802 -5.080  -5.871  1.00 0.00 ? 33  ASN A N    1  
ATOM 461   C CA   . ASN A 1 33  ? -20.746 -6.289  -5.069  1.00 0.00 ? 33  ASN A CA   1  
ATOM 462   C C    . ASN A 1 33  ? -19.758 -7.272  -5.701  1.00 0.00 ? 33  ASN A C    1  
ATOM 463   O O    . ASN A 1 33  ? -19.402 -7.133  -6.870  1.00 0.00 ? 33  ASN A O    1  
ATOM 464   C CB   . ASN A 1 33  ? -22.115 -6.972  -5.004  1.00 0.00 ? 33  ASN A CB   1  
ATOM 465   C CG   . ASN A 1 33  ? -23.238 -5.939  -4.902  1.00 0.00 ? 33  ASN A CG   1  
ATOM 466   O OD1  . ASN A 1 33  ? -23.726 -5.415  -5.890  1.00 0.00 ? 33  ASN A OD1  1  
ATOM 467   N ND2  . ASN A 1 33  ? -23.620 -5.675  -3.656  1.00 0.00 ? 33  ASN A ND2  1  
ATOM 468   H H    . ASN A 1 33  ? -21.540 -5.054  -6.546  1.00 0.00 ? 33  ASN A H    1  
ATOM 469   H HA   . ASN A 1 33  ? -20.432 -5.962  -4.077  1.00 0.00 ? 33  ASN A HA   1  
ATOM 470   H HB2  . ASN A 1 33  ? -22.260 -7.587  -5.891  1.00 0.00 ? 33  ASN A HB2  1  
ATOM 471   H HB3  . ASN A 1 33  ? -22.151 -7.640  -4.143  1.00 0.00 ? 33  ASN A HB3  1  
ATOM 472   H HD21 . ASN A 1 33  ? -23.178 -6.140  -2.888  1.00 0.00 ? 33  ASN A HD21 1  
ATOM 473   H HD22 . ASN A 1 33  ? -24.348 -5.012  -3.485  1.00 0.00 ? 33  ASN A HD22 1  
ATOM 474   N N    . ASP A 1 34  ? -19.343 -8.242  -4.900  1.00 0.00 ? 34  ASP A N    1  
ATOM 475   C CA   . ASP A 1 34  ? -18.402 -9.246  -5.368  1.00 0.00 ? 34  ASP A CA   1  
ATOM 476   C C    . ASP A 1 34  ? -19.176 -10.463 -5.880  1.00 0.00 ? 34  ASP A C    1  
ATOM 477   O O    . ASP A 1 34  ? -20.365 -10.367 -6.178  1.00 0.00 ? 34  ASP A O    1  
ATOM 478   C CB   . ASP A 1 34  ? -17.486 -9.712  -4.234  1.00 0.00 ? 34  ASP A CB   1  
ATOM 479   C CG   . ASP A 1 34  ? -16.086 -10.146 -4.672  1.00 0.00 ? 34  ASP A CG   1  
ATOM 480   O OD1  . ASP A 1 34  ? -15.497 -9.417  -5.499  1.00 0.00 ? 34  ASP A OD1  1  
ATOM 481   O OD2  . ASP A 1 34  ? -15.635 -11.199 -4.171  1.00 0.00 ? 34  ASP A OD2  1  
ATOM 482   H H    . ASP A 1 34  ? -19.637 -8.348  -3.950  1.00 0.00 ? 34  ASP A H    1  
ATOM 483   H HA   . ASP A 1 34  ? -17.826 -8.757  -6.153  1.00 0.00 ? 34  ASP A HA   1  
ATOM 484   H HB2  . ASP A 1 34  ? -17.389 -8.903  -3.509  1.00 0.00 ? 34  ASP A HB2  1  
ATOM 485   H HB3  . ASP A 1 34  ? -17.964 -10.546 -3.720  1.00 0.00 ? 34  ASP A HB3  1  
ATOM 486   N N    . ILE A 1 35  ? -18.468 -11.580 -5.968  1.00 0.00 ? 35  ILE A N    1  
ATOM 487   C CA   . ILE A 1 35  ? -19.073 -12.814 -6.440  1.00 0.00 ? 35  ILE A CA   1  
ATOM 488   C C    . ILE A 1 35  ? -19.829 -13.479 -5.289  1.00 0.00 ? 35  ILE A C    1  
ATOM 489   O O    . ILE A 1 35  ? -20.413 -14.548 -5.460  1.00 0.00 ? 35  ILE A O    1  
ATOM 490   C CB   . ILE A 1 35  ? -18.018 -13.716 -7.084  1.00 0.00 ? 35  ILE A CB   1  
ATOM 491   C CG1  . ILE A 1 35  ? -17.279 -12.981 -8.205  1.00 0.00 ? 35  ILE A CG1  1  
ATOM 492   C CG2  . ILE A 1 35  ? -18.640 -15.026 -7.572  1.00 0.00 ? 35  ILE A CG2  1  
ATOM 493   C CD1  . ILE A 1 35  ? -16.338 -11.917 -7.635  1.00 0.00 ? 35  ILE A CD1  1  
ATOM 494   H H    . ILE A 1 35  ? -17.501 -11.650 -5.724  1.00 0.00 ? 35  ILE A H    1  
ATOM 495   H HA   . ILE A 1 35  ? -19.789 -12.549 -7.218  1.00 0.00 ? 35  ILE A HA   1  
ATOM 496   H HB   . ILE A 1 35  ? -17.279 -13.973 -6.326  1.00 0.00 ? 35  ILE A HB   1  
ATOM 497   H HG12 . ILE A 1 35  ? -16.709 -13.695 -8.799  1.00 0.00 ? 35  ILE A HG12 1  
ATOM 498   H HG13 . ILE A 1 35  ? -18.000 -12.512 -8.875  1.00 0.00 ? 35  ILE A HG13 1  
ATOM 499   H HG21 . ILE A 1 35  ? -19.646 -14.833 -7.946  1.00 0.00 ? 35  ILE A HG21 1  
ATOM 500   H HG22 . ILE A 1 35  ? -18.028 -15.443 -8.371  1.00 0.00 ? 35  ILE A HG22 1  
ATOM 501   H HG23 . ILE A 1 35  ? -18.690 -15.734 -6.745  1.00 0.00 ? 35  ILE A HG23 1  
ATOM 502   H HD11 . ILE A 1 35  ? -15.941 -12.258 -6.679  1.00 0.00 ? 35  ILE A HD11 1  
ATOM 503   H HD12 . ILE A 1 35  ? -15.516 -11.749 -8.331  1.00 0.00 ? 35  ILE A HD12 1  
ATOM 504   H HD13 . ILE A 1 35  ? -16.887 -10.987 -7.490  1.00 0.00 ? 35  ILE A HD13 1  
ATOM 505   N N    . TYR A 1 36  ? -19.795 -12.818 -4.141  1.00 0.00 ? 36  TYR A N    1  
ATOM 506   C CA   . TYR A 1 36  ? -20.470 -13.332 -2.961  1.00 0.00 ? 36  TYR A CA   1  
ATOM 507   C C    . TYR A 1 36  ? -21.708 -12.495 -2.629  1.00 0.00 ? 36  TYR A C    1  
ATOM 508   O O    . TYR A 1 36  ? -22.418 -12.784 -1.667  1.00 0.00 ? 36  TYR A O    1  
ATOM 509   C CB   . TYR A 1 36  ? -19.465 -13.212 -1.814  1.00 0.00 ? 36  TYR A CB   1  
ATOM 510   C CG   . TYR A 1 36  ? -19.622 -14.284 -0.734  1.00 0.00 ? 36  TYR A CG   1  
ATOM 511   C CD1  . TYR A 1 36  ? -20.490 -14.081 0.319   1.00 0.00 ? 36  TYR A CD1  1  
ATOM 512   C CD2  . TYR A 1 36  ? -18.896 -15.454 -0.814  1.00 0.00 ? 36  TYR A CD2  1  
ATOM 513   C CE1  . TYR A 1 36  ? -20.638 -15.091 1.336   1.00 0.00 ? 36  TYR A CE1  1  
ATOM 514   C CE2  . TYR A 1 36  ? -19.043 -16.464 0.203   1.00 0.00 ? 36  TYR A CE2  1  
ATOM 515   C CZ   . TYR A 1 36  ? -19.907 -16.232 1.227   1.00 0.00 ? 36  TYR A CZ   1  
ATOM 516   O OH   . TYR A 1 36  ? -20.046 -17.186 2.187   1.00 0.00 ? 36  TYR A OH   1  
ATOM 517   H H    . TYR A 1 36  ? -19.318 -11.949 -4.009  1.00 0.00 ? 36  TYR A H    1  
ATOM 518   H HA   . TYR A 1 36  ? -20.778 -14.356 -3.169  1.00 0.00 ? 36  TYR A HA   1  
ATOM 519   H HB2  . TYR A 1 36  ? -18.456 -13.266 -2.222  1.00 0.00 ? 36  TYR A HB2  1  
ATOM 520   H HB3  . TYR A 1 36  ? -19.570 -12.229 -1.353  1.00 0.00 ? 36  TYR A HB3  1  
ATOM 521   H HD1  . TYR A 1 36  ? -21.064 -13.156 0.383   1.00 0.00 ? 36  TYR A HD1  1  
ATOM 522   H HD2  . TYR A 1 36  ? -18.210 -15.616 -1.646  1.00 0.00 ? 36  TYR A HD2  1  
ATOM 523   H HE1  . TYR A 1 36  ? -21.320 -14.943 2.173   1.00 0.00 ? 36  TYR A HE1  1  
ATOM 524   H HE2  . TYR A 1 36  ? -18.475 -17.393 0.152   1.00 0.00 ? 36  TYR A HE2  1  
ATOM 525   H HH   . TYR A 1 36  ? -20.423 -16.780 3.020   1.00 0.00 ? 36  TYR A HH   1  
ATOM 526   N N    . GLY A 1 37  ? -21.928 -11.475 -3.445  1.00 0.00 ? 37  GLY A N    1  
ATOM 527   C CA   . GLY A 1 37  ? -23.067 -10.593 -3.250  1.00 0.00 ? 37  GLY A CA   1  
ATOM 528   C C    . GLY A 1 37  ? -22.720 -9.452  -2.292  1.00 0.00 ? 37  GLY A C    1  
ATOM 529   O O    . GLY A 1 37  ? -23.503 -8.519  -2.124  1.00 0.00 ? 37  GLY A O    1  
ATOM 530   H H    . GLY A 1 37  ? -21.346 -11.246 -4.225  1.00 0.00 ? 37  GLY A H    1  
ATOM 531   H HA2  . GLY A 1 37  ? -23.383 -10.184 -4.210  1.00 0.00 ? 37  GLY A HA2  1  
ATOM 532   H HA3  . GLY A 1 37  ? -23.908 -11.163 -2.853  1.00 0.00 ? 37  GLY A HA3  1  
ATOM 533   N N    . ASN A 1 38  ? -21.545 -9.563  -1.691  1.00 0.00 ? 38  ASN A N    1  
ATOM 534   C CA   . ASN A 1 38  ? -21.084 -8.552  -0.755  1.00 0.00 ? 38  ASN A CA   1  
ATOM 535   C C    . ASN A 1 38  ? -20.560 -7.344  -1.532  1.00 0.00 ? 38  ASN A C    1  
ATOM 536   O O    . ASN A 1 38  ? -20.106 -7.481  -2.667  1.00 0.00 ? 38  ASN A O    1  
ATOM 537   C CB   . ASN A 1 38  ? -19.944 -9.085  0.115   1.00 0.00 ? 38  ASN A CB   1  
ATOM 538   C CG   . ASN A 1 38  ? -18.912 -9.834  -0.732  1.00 0.00 ? 38  ASN A CG   1  
ATOM 539   O OD1  . ASN A 1 38  ? -19.118 -10.116 -1.901  1.00 0.00 ? 38  ASN A OD1  1  
ATOM 540   N ND2  . ASN A 1 38  ? -17.794 -10.137 -0.078  1.00 0.00 ? 38  ASN A ND2  1  
ATOM 541   H H    . ASN A 1 38  ? -20.913 -10.326 -1.834  1.00 0.00 ? 38  ASN A H    1  
ATOM 542   H HA   . ASN A 1 38  ? -21.954 -8.310  -0.144  1.00 0.00 ? 38  ASN A HA   1  
ATOM 543   H HB2  . ASN A 1 38  ? -19.461 -8.258  0.635   1.00 0.00 ? 38  ASN A HB2  1  
ATOM 544   H HB3  . ASN A 1 38  ? -20.345 -9.751  0.879   1.00 0.00 ? 38  ASN A HB3  1  
ATOM 545   H HD21 . ASN A 1 38  ? -17.689 -9.876  0.881   1.00 0.00 ? 38  ASN A HD21 1  
ATOM 546   H HD22 . ASN A 1 38  ? -17.060 -10.627 -0.547  1.00 0.00 ? 38  ASN A HD22 1  
ATOM 547   N N    . PRO A 1 39  ? -20.643 -6.157  -0.875  1.00 0.00 ? 39  PRO A N    1  
ATOM 548   C CA   . PRO A 1 39  ? -20.183 -4.925  -1.492  1.00 0.00 ? 39  PRO A CA   1  
ATOM 549   C C    . PRO A 1 39  ? -18.655 -4.852  -1.500  1.00 0.00 ? 39  PRO A C    1  
ATOM 550   O O    . PRO A 1 39  ? -18.014 -5.069  -0.473  1.00 0.00 ? 39  PRO A O    1  
ATOM 551   C CB   . PRO A 1 39  ? -20.825 -3.812  -0.680  1.00 0.00 ? 39  PRO A CB   1  
ATOM 552   C CG   . PRO A 1 39  ? -21.242 -4.446  0.638   1.00 0.00 ? 39  PRO A CG   1  
ATOM 553   C CD   . PRO A 1 39  ? -21.175 -5.956  0.470   1.00 0.00 ? 39  PRO A CD   1  
ATOM 554   H HA   . PRO A 1 39  ? -20.463 -4.892  -2.452  1.00 0.00 ? 39  PRO A HA   1  
ATOM 555   H HB2  . PRO A 1 39  ? -20.125 -2.994  -0.514  1.00 0.00 ? 39  PRO A HB2  1  
ATOM 556   H HB3  . PRO A 1 39  ? -21.686 -3.394  -1.201  1.00 0.00 ? 39  PRO A HB3  1  
ATOM 557   H HG2  . PRO A 1 39  ? -20.583 -4.123  1.443   1.00 0.00 ? 39  PRO A HG2  1  
ATOM 558   H HG3  . PRO A 1 39  ? -22.251 -4.137  0.908   1.00 0.00 ? 39  PRO A HG3  1  
ATOM 559   H HD2  . PRO A 1 39  ? -20.531 -6.409  1.223   1.00 0.00 ? 39  PRO A HD2  1  
ATOM 560   H HD3  . PRO A 1 39  ? -22.160 -6.411  0.578   1.00 0.00 ? 39  PRO A HD3  1  
ATOM 561   N N    . ILE A 1 40  ? -18.114 -4.549  -2.671  1.00 0.00 ? 40  ILE A N    1  
ATOM 562   C CA   . ILE A 1 40  ? -16.673 -4.446  -2.827  1.00 0.00 ? 40  ILE A CA   1  
ATOM 563   C C    . ILE A 1 40  ? -16.161 -3.253  -2.017  1.00 0.00 ? 40  ILE A C    1  
ATOM 564   O O    . ILE A 1 40  ? -15.641 -3.424  -0.915  1.00 0.00 ? 40  ILE A O    1  
ATOM 565   C CB   . ILE A 1 40  ? -16.297 -4.390  -4.309  1.00 0.00 ? 40  ILE A CB   1  
ATOM 566   C CG1  . ILE A 1 40  ? -16.674 -5.691  -5.020  1.00 0.00 ? 40  ILE A CG1  1  
ATOM 567   C CG2  . ILE A 1 40  ? -14.816 -4.047  -4.485  1.00 0.00 ? 40  ILE A CG2  1  
ATOM 568   C CD1  . ILE A 1 40  ? -16.298 -5.634  -6.502  1.00 0.00 ? 40  ILE A CD1  1  
ATOM 569   H H    . ILE A 1 40  ? -18.643 -4.374  -3.503  1.00 0.00 ? 40  ILE A H    1  
ATOM 570   H HA   . ILE A 1 40  ? -16.235 -5.356  -2.417  1.00 0.00 ? 40  ILE A HA   1  
ATOM 571   H HB   . ILE A 1 40  ? -16.870 -3.589  -4.777  1.00 0.00 ? 40  ILE A HB   1  
ATOM 572   H HG12 . ILE A 1 40  ? -16.166 -6.530  -4.544  1.00 0.00 ? 40  ILE A HG12 1  
ATOM 573   H HG13 . ILE A 1 40  ? -17.745 -5.867  -4.919  1.00 0.00 ? 40  ILE A HG13 1  
ATOM 574   H HG21 . ILE A 1 40  ? -14.220 -4.650  -3.800  1.00 0.00 ? 40  ILE A HG21 1  
ATOM 575   H HG22 . ILE A 1 40  ? -14.514 -4.259  -5.512  1.00 0.00 ? 40  ILE A HG22 1  
ATOM 576   H HG23 . ILE A 1 40  ? -14.659 -2.991  -4.272  1.00 0.00 ? 40  ILE A HG23 1  
ATOM 577   H HD11 . ILE A 1 40  ? -16.083 -4.604  -6.783  1.00 0.00 ? 40  ILE A HD11 1  
ATOM 578   H HD12 . ILE A 1 40  ? -15.416 -6.250  -6.676  1.00 0.00 ? 40  ILE A HD12 1  
ATOM 579   H HD13 . ILE A 1 40  ? -17.127 -6.009  -7.101  1.00 0.00 ? 40  ILE A HD13 1  
ATOM 580   N N    . LYS A 1 41  ? -16.327 -2.071  -2.594  1.00 0.00 ? 41  LYS A N    1  
ATOM 581   C CA   . LYS A 1 41  ? -15.888 -0.851  -1.938  1.00 0.00 ? 41  LYS A CA   1  
ATOM 582   C C    . LYS A 1 41  ? -14.359 -0.815  -1.907  1.00 0.00 ? 41  LYS A C    1  
ATOM 583   O O    . LYS A 1 41  ? -13.722 -1.762  -1.448  1.00 0.00 ? 41  LYS A O    1  
ATOM 584   C CB   . LYS A 1 41  ? -16.534 -0.722  -0.558  1.00 0.00 ? 41  LYS A CB   1  
ATOM 585   C CG   . LYS A 1 41  ? -16.110 0.580   0.126   1.00 0.00 ? 41  LYS A CG   1  
ATOM 586   C CD   . LYS A 1 41  ? -16.530 1.796   -0.702  1.00 0.00 ? 41  LYS A CD   1  
ATOM 587   C CE   . LYS A 1 41  ? -18.047 1.989   -0.663  1.00 0.00 ? 41  LYS A CE   1  
ATOM 588   N NZ   . LYS A 1 41  ? -18.425 3.259   -1.322  1.00 0.00 ? 41  LYS A NZ   1  
ATOM 589   H H    . LYS A 1 41  ? -16.752 -1.942  -3.489  1.00 0.00 ? 41  LYS A H    1  
ATOM 590   H HA   . LYS A 1 41  ? -16.241 -0.013  -2.539  1.00 0.00 ? 41  LYS A HA   1  
ATOM 591   H HB2  . LYS A 1 41  ? -17.619 -0.749  -0.656  1.00 0.00 ? 41  LYS A HB2  1  
ATOM 592   H HB3  . LYS A 1 41  ? -16.250 -1.572  0.062   1.00 0.00 ? 41  LYS A HB3  1  
ATOM 593   H HG2  . LYS A 1 41  ? -16.560 0.637   1.118   1.00 0.00 ? 41  LYS A HG2  1  
ATOM 594   H HG3  . LYS A 1 41  ? -15.030 0.586   0.266   1.00 0.00 ? 41  LYS A HG3  1  
ATOM 595   H HD2  . LYS A 1 41  ? -16.037 2.689   -0.319  1.00 0.00 ? 41  LYS A HD2  1  
ATOM 596   H HD3  . LYS A 1 41  ? -16.202 1.669   -1.733  1.00 0.00 ? 41  LYS A HD3  1  
ATOM 597   H HE2  . LYS A 1 41  ? -18.538 1.153   -1.162  1.00 0.00 ? 41  LYS A HE2  1  
ATOM 598   H HE3  . LYS A 1 41  ? -18.393 1.991   0.370   1.00 0.00 ? 41  LYS A HE3  1  
ATOM 599   H HZ1  . LYS A 1 41  ? -17.599 3.746   -1.607  1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 600   H HZ2  . LYS A 1 41  ? -18.989 3.062   -2.125  1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 601   H HZ3  . LYS A 1 41  ? -18.942 3.826   -0.681  1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 602   N N    . ARG A 1 42  ? -13.814 0.285   -2.402  1.00 0.00 ? 42  ARG A N    1  
ATOM 603   C CA   . ARG A 1 42  ? -12.371 0.457   -2.437  1.00 0.00 ? 42  ARG A CA   1  
ATOM 604   C C    . ARG A 1 42  ? -11.986 1.827   -1.875  1.00 0.00 ? 42  ARG A C    1  
ATOM 605   O O    . ARG A 1 42  ? -11.504 2.689   -2.609  1.00 0.00 ? 42  ARG A O    1  
ATOM 606   C CB   . ARG A 1 42  ? -11.836 0.329   -3.864  1.00 0.00 ? 42  ARG A CB   1  
ATOM 607   C CG   . ARG A 1 42  ? -12.962 0.481   -4.889  1.00 0.00 ? 42  ARG A CG   1  
ATOM 608   C CD   . ARG A 1 42  ? -12.484 0.099   -6.291  1.00 0.00 ? 42  ARG A CD   1  
ATOM 609   N NE   . ARG A 1 42  ? -13.219 0.884   -7.307  1.00 0.00 ? 42  ARG A NE   1  
ATOM 610   C CZ   . ARG A 1 42  ? -13.250 0.581   -8.612  1.00 0.00 ? 42  ARG A CZ   1  
ATOM 611   N NH1  . ARG A 1 42  ? -12.589 -0.493  -9.067  1.00 0.00 ? 42  ARG A NH1  1  
ATOM 612   N NH2  . ARG A 1 42  ? -13.942 1.351   -9.462  1.00 0.00 ? 42  ARG A NH2  1  
ATOM 613   H H    . ARG A 1 42  ? -14.340 1.051   -2.774  1.00 0.00 ? 42  ARG A H    1  
ATOM 614   H HA   . ARG A 1 42  ? -11.980 -0.347  -1.813  1.00 0.00 ? 42  ARG A HA   1  
ATOM 615   H HB2  . ARG A 1 42  ? -11.075 1.089   -4.041  1.00 0.00 ? 42  ARG A HB2  1  
ATOM 616   H HB3  . ARG A 1 42  ? -11.353 -0.640  -3.991  1.00 0.00 ? 42  ARG A HB3  1  
ATOM 617   H HG2  . ARG A 1 42  ? -13.805 -0.149  -4.604  1.00 0.00 ? 42  ARG A HG2  1  
ATOM 618   H HG3  . ARG A 1 42  ? -13.320 1.510   -4.891  1.00 0.00 ? 42  ARG A HG3  1  
ATOM 619   H HD2  . ARG A 1 42  ? -11.413 0.282   -6.381  1.00 0.00 ? 42  ARG A HD2  1  
ATOM 620   H HD3  . ARG A 1 42  ? -12.640 -0.967  -6.459  1.00 0.00 ? 42  ARG A HD3  1  
ATOM 621   H HE   . ARG A 1 42  ? -13.722 1.693   -7.002  1.00 0.00 ? 42  ARG A HE   1  
ATOM 622   H HH11 . ARG A 1 42  ? -12.072 -1.067  -8.432  1.00 0.00 ? 42  ARG A HH11 1  
ATOM 623   H HH12 . ARG A 1 42  ? -12.613 -0.719  -10.040 1.00 0.00 ? 42  ARG A HH12 1  
ATOM 624   H HH21 . ARG A 1 42  ? -14.436 2.152   -9.123  1.00 0.00 ? 42  ARG A HH21 1  
ATOM 625   H HH22 . ARG A 1 42  ? -13.966 1.124   -10.436 1.00 0.00 ? 42  ARG A HH22 1  
ATOM 626   N N    . ILE A 1 43  ? -12.211 1.985   -0.579  1.00 0.00 ? 43  ILE A N    1  
ATOM 627   C CA   . ILE A 1 43  ? -11.893 3.235   0.089   1.00 0.00 ? 43  ILE A CA   1  
ATOM 628   C C    . ILE A 1 43  ? -10.576 3.783   -0.464  1.00 0.00 ? 43  ILE A C    1  
ATOM 629   O O    . ILE A 1 43  ? -9.645  3.023   -0.726  1.00 0.00 ? 43  ILE A O    1  
ATOM 630   C CB   . ILE A 1 43  ? -11.892 3.046   1.607   1.00 0.00 ? 43  ILE A CB   1  
ATOM 631   C CG1  . ILE A 1 43  ? -13.150 3.648   2.235   1.00 0.00 ? 43  ILE A CG1  1  
ATOM 632   C CG2  . ILE A 1 43  ? -10.614 3.612   2.229   1.00 0.00 ? 43  ILE A CG2  1  
ATOM 633   C CD1  . ILE A 1 43  ? -14.367 2.753   1.993   1.00 0.00 ? 43  ILE A CD1  1  
ATOM 634   H H    . ILE A 1 43  ? -12.602 1.278   0.010   1.00 0.00 ? 43  ILE A H    1  
ATOM 635   H HA   . ILE A 1 43  ? -12.688 3.943   -0.148  1.00 0.00 ? 43  ILE A HA   1  
ATOM 636   H HB   . ILE A 1 43  ? -11.907 1.977   1.818   1.00 0.00 ? 43  ILE A HB   1  
ATOM 637   H HG12 . ILE A 1 43  ? -12.998 3.780   3.307   1.00 0.00 ? 43  ILE A HG12 1  
ATOM 638   H HG13 . ILE A 1 43  ? -13.333 4.637   1.815   1.00 0.00 ? 43  ILE A HG13 1  
ATOM 639   H HG21 . ILE A 1 43  ? -10.500 4.656   1.937   1.00 0.00 ? 43  ILE A HG21 1  
ATOM 640   H HG22 . ILE A 1 43  ? -10.677 3.544   3.315   1.00 0.00 ? 43  ILE A HG22 1  
ATOM 641   H HG23 . ILE A 1 43  ? -9.755  3.040   1.878   1.00 0.00 ? 43  ILE A HG23 1  
ATOM 642   H HD11 . ILE A 1 43  ? -14.060 1.866   1.437   1.00 0.00 ? 43  ILE A HD11 1  
ATOM 643   H HD12 . ILE A 1 43  ? -14.793 2.452   2.949   1.00 0.00 ? 43  ILE A HD12 1  
ATOM 644   H HD13 . ILE A 1 43  ? -15.113 3.301   1.418   1.00 0.00 ? 43  ILE A HD13 1  
ATOM 645   N N    . GLN A 1 44  ? -10.540 5.097   -0.626  1.00 0.00 ? 44  GLN A N    1  
ATOM 646   C CA   . GLN A 1 44  ? -9.352  5.756   -1.141  1.00 0.00 ? 44  GLN A CA   1  
ATOM 647   C C    . GLN A 1 44  ? -8.336  5.976   -0.018  1.00 0.00 ? 44  GLN A C    1  
ATOM 648   O O    . GLN A 1 44  ? -8.583  5.606   1.128   1.00 0.00 ? 44  GLN A O    1  
ATOM 649   C CB   . GLN A 1 44  ? -9.710  7.078   -1.824  1.00 0.00 ? 44  GLN A CB   1  
ATOM 650   C CG   . GLN A 1 44  ? -10.494 6.834   -3.115  1.00 0.00 ? 44  GLN A CG   1  
ATOM 651   C CD   . GLN A 1 44  ? -9.922  5.643   -3.887  1.00 0.00 ? 44  GLN A CD   1  
ATOM 652   O OE1  . GLN A 1 44  ? -9.154  5.788   -4.823  1.00 0.00 ? 44  GLN A OE1  1  
ATOM 653   N NE2  . GLN A 1 44  ? -10.339 4.460   -3.444  1.00 0.00 ? 44  GLN A NE2  1  
ATOM 654   H H    . GLN A 1 44  ? -11.302 5.709   -0.410  1.00 0.00 ? 44  GLN A H    1  
ATOM 655   H HA   . GLN A 1 44  ? -8.941  5.071   -1.884  1.00 0.00 ? 44  GLN A HA   1  
ATOM 656   H HB2  . GLN A 1 44  ? -10.303 7.693   -1.145  1.00 0.00 ? 44  GLN A HB2  1  
ATOM 657   H HB3  . GLN A 1 44  ? -8.800  7.635   -2.047  1.00 0.00 ? 44  GLN A HB3  1  
ATOM 658   H HG2  . GLN A 1 44  ? -11.542 6.649   -2.879  1.00 0.00 ? 44  GLN A HG2  1  
ATOM 659   H HG3  . GLN A 1 44  ? -10.461 7.726   -3.739  1.00 0.00 ? 44  GLN A HG3  1  
ATOM 660   H HE21 . GLN A 1 44  ? -10.971 4.410   -2.671  1.00 0.00 ? 44  GLN A HE21 1  
ATOM 661   H HE22 . GLN A 1 44  ? -10.020 3.621   -3.885  1.00 0.00 ? 44  GLN A HE22 1  
ATOM 662   N N    . TYR A 1 45  ? -7.215  6.578   -0.388  1.00 0.00 ? 45  TYR A N    1  
ATOM 663   C CA   . TYR A 1 45  ? -6.161  6.851   0.574   1.00 0.00 ? 45  TYR A CA   1  
ATOM 664   C C    . TYR A 1 45  ? -5.582  8.252   0.368   1.00 0.00 ? 45  TYR A C    1  
ATOM 665   O O    . TYR A 1 45  ? -4.437  8.400   -0.057  1.00 0.00 ? 45  TYR A O    1  
ATOM 666   C CB   . TYR A 1 45  ? -5.067  5.816   0.307   1.00 0.00 ? 45  TYR A CB   1  
ATOM 667   C CG   . TYR A 1 45  ? -5.082  4.631   1.274   1.00 0.00 ? 45  TYR A CG   1  
ATOM 668   C CD1  . TYR A 1 45  ? -5.481  4.813   2.582   1.00 0.00 ? 45  TYR A CD1  1  
ATOM 669   C CD2  . TYR A 1 45  ? -4.697  3.379   0.838   1.00 0.00 ? 45  TYR A CD2  1  
ATOM 670   C CE1  . TYR A 1 45  ? -5.495  3.698   3.493   1.00 0.00 ? 45  TYR A CE1  1  
ATOM 671   C CE2  . TYR A 1 45  ? -4.711  2.264   1.749   1.00 0.00 ? 45  TYR A CE2  1  
ATOM 672   C CZ   . TYR A 1 45  ? -5.110  2.478   3.031   1.00 0.00 ? 45  TYR A CZ   1  
ATOM 673   O OH   . TYR A 1 45  ? -5.124  1.425   3.891   1.00 0.00 ? 45  TYR A OH   1  
ATOM 674   H H    . TYR A 1 45  ? -7.022  6.876   -1.323  1.00 0.00 ? 45  TYR A H    1  
ATOM 675   H HA   . TYR A 1 45  ? -6.593  6.788   1.573   1.00 0.00 ? 45  TYR A HA   1  
ATOM 676   H HB2  . TYR A 1 45  ? -5.175  5.443   -0.712  1.00 0.00 ? 45  TYR A HB2  1  
ATOM 677   H HB3  . TYR A 1 45  ? -4.095  6.307   0.365   1.00 0.00 ? 45  TYR A HB3  1  
ATOM 678   H HD1  . TYR A 1 45  ? -5.784  5.802   2.926   1.00 0.00 ? 45  TYR A HD1  1  
ATOM 679   H HD2  . TYR A 1 45  ? -4.383  3.236   -0.196  1.00 0.00 ? 45  TYR A HD2  1  
ATOM 680   H HE1  . TYR A 1 45  ? -5.808  3.828   4.529   1.00 0.00 ? 45  TYR A HE1  1  
ATOM 681   H HE2  . TYR A 1 45  ? -4.410  1.271   1.417   1.00 0.00 ? 45  TYR A HE2  1  
ATOM 682   H HH   . TYR A 1 45  ? -5.046  1.751   4.832   1.00 0.00 ? 45  TYR A HH   1  
ATOM 683   N N    . GLU A 1 46  ? -6.400  9.248   0.680   1.00 0.00 ? 46  GLU A N    1  
ATOM 684   C CA   . GLU A 1 46  ? -5.982  10.632  0.535   1.00 0.00 ? 46  GLU A CA   1  
ATOM 685   C C    . GLU A 1 46  ? -4.825  10.941  1.488   1.00 0.00 ? 46  GLU A C    1  
ATOM 686   O O    . GLU A 1 46  ? -4.982  11.715  2.430   1.00 0.00 ? 46  GLU A O    1  
ATOM 687   C CB   . GLU A 1 46  ? -7.156  11.586  0.771   1.00 0.00 ? 46  GLU A CB   1  
ATOM 688   C CG   . GLU A 1 46  ? -7.015  12.849  -0.080  1.00 0.00 ? 46  GLU A CG   1  
ATOM 689   C CD   . GLU A 1 46  ? -8.254  13.738  0.048   1.00 0.00 ? 46  GLU A CD   1  
ATOM 690   O OE1  . GLU A 1 46  ? -9.365  13.166  0.046   1.00 0.00 ? 46  GLU A OE1  1  
ATOM 691   O OE2  . GLU A 1 46  ? -8.061  14.969  0.146   1.00 0.00 ? 46  GLU A OE2  1  
ATOM 692   H H    . GLU A 1 46  ? -7.329  9.121   1.026   1.00 0.00 ? 46  GLU A H    1  
ATOM 693   H HA   . GLU A 1 46  ? -5.647  10.727  -0.498  1.00 0.00 ? 46  GLU A HA   1  
ATOM 694   H HB2  . GLU A 1 46  ? -8.091  11.082  0.530   1.00 0.00 ? 46  GLU A HB2  1  
ATOM 695   H HB3  . GLU A 1 46  ? -7.202  11.857  1.825   1.00 0.00 ? 46  GLU A HB3  1  
ATOM 696   H HG2  . GLU A 1 46  ? -6.130  13.405  0.230   1.00 0.00 ? 46  GLU A HG2  1  
ATOM 697   H HG3  . GLU A 1 46  ? -6.868  12.574  -1.125  1.00 0.00 ? 46  GLU A HG3  1  
ATOM 698   N N    . ILE A 1 47  ? -3.689  10.319  1.207   1.00 0.00 ? 47  ILE A N    1  
ATOM 699   C CA   . ILE A 1 47  ? -2.506  10.517  2.027   1.00 0.00 ? 47  ILE A CA   1  
ATOM 700   C C    . ILE A 1 47  ? -2.052  11.974  1.916   1.00 0.00 ? 47  ILE A C    1  
ATOM 701   O O    . ILE A 1 47  ? -2.728  12.793  1.294   1.00 0.00 ? 47  ILE A O    1  
ATOM 702   C CB   . ILE A 1 47  ? -1.420  9.506   1.655   1.00 0.00 ? 47  ILE A CB   1  
ATOM 703   C CG1  . ILE A 1 47  ? -0.982  9.682   0.199   1.00 0.00 ? 47  ILE A CG1  1  
ATOM 704   C CG2  . ILE A 1 47  ? -1.880  8.076   1.946   1.00 0.00 ? 47  ILE A CG2  1  
ATOM 705   C CD1  . ILE A 1 47  ? -0.367  8.392   -0.348  1.00 0.00 ? 47  ILE A CD1  1  
ATOM 706   H H    . ILE A 1 47  ? -3.570  9.691   0.438   1.00 0.00 ? 47  ILE A H    1  
ATOM 707   H HA   . ILE A 1 47  ? -2.788  10.321  3.062   1.00 0.00 ? 47  ILE A HA   1  
ATOM 708   H HB   . ILE A 1 47  ? -0.548  9.696   2.280   1.00 0.00 ? 47  ILE A HB   1  
ATOM 709   H HG12 . ILE A 1 47  ? -1.839  9.969   -0.410  1.00 0.00 ? 47  ILE A HG12 1  
ATOM 710   H HG13 . ILE A 1 47  ? -0.257  10.493  0.131   1.00 0.00 ? 47  ILE A HG13 1  
ATOM 711   H HG21 . ILE A 1 47  ? -2.911  8.091   2.299   1.00 0.00 ? 47  ILE A HG21 1  
ATOM 712   H HG22 . ILE A 1 47  ? -1.818  7.481   1.034   1.00 0.00 ? 47  ILE A HG22 1  
ATOM 713   H HG23 . ILE A 1 47  ? -1.240  7.637   2.711   1.00 0.00 ? 47  ILE A HG23 1  
ATOM 714   H HD11 . ILE A 1 47  ? -0.017  7.777   0.480   1.00 0.00 ? 47  ILE A HD11 1  
ATOM 715   H HD12 . ILE A 1 47  ? -1.119  7.845   -0.916  1.00 0.00 ? 47  ILE A HD12 1  
ATOM 716   H HD13 . ILE A 1 47  ? 0.472   8.638   -0.999  1.00 0.00 ? 47  ILE A HD13 1  
ATOM 717   N N    . LYS A 1 48  ? -0.912  12.254  2.530   1.00 0.00 ? 48  LYS A N    1  
ATOM 718   C CA   . LYS A 1 48  ? -0.361  13.598  2.508   1.00 0.00 ? 48  LYS A CA   1  
ATOM 719   C C    . LYS A 1 48  ? 1.027   13.565  1.863   1.00 0.00 ? 48  LYS A C    1  
ATOM 720   O O    . LYS A 1 48  ? 1.642   14.609  1.653   1.00 0.00 ? 48  LYS A O    1  
ATOM 721   C CB   . LYS A 1 48  ? -0.371  14.204  3.913   1.00 0.00 ? 48  LYS A CB   1  
ATOM 722   C CG   . LYS A 1 48  ? -0.534  15.725  3.852   1.00 0.00 ? 48  LYS A CG   1  
ATOM 723   C CD   . LYS A 1 48  ? -0.927  16.289  5.219   1.00 0.00 ? 48  LYS A CD   1  
ATOM 724   C CE   . LYS A 1 48  ? -0.256  15.505  6.349   1.00 0.00 ? 48  LYS A CE   1  
ATOM 725   N NZ   . LYS A 1 48  ? -0.308  16.273  7.614   1.00 0.00 ? 48  LYS A NZ   1  
ATOM 726   H H    . LYS A 1 48  ? -0.369  11.583  3.035   1.00 0.00 ? 48  LYS A H    1  
ATOM 727   H HA   . LYS A 1 48  ? -1.015  14.210  1.888   1.00 0.00 ? 48  LYS A HA   1  
ATOM 728   H HB2  . LYS A 1 48  ? -1.184  13.771  4.494   1.00 0.00 ? 48  LYS A HB2  1  
ATOM 729   H HB3  . LYS A 1 48  ? 0.556   13.955  4.428   1.00 0.00 ? 48  LYS A HB3  1  
ATOM 730   H HG2  . LYS A 1 48  ? 0.400   16.182  3.522   1.00 0.00 ? 48  LYS A HG2  1  
ATOM 731   H HG3  . LYS A 1 48  ? -1.294  15.984  3.116   1.00 0.00 ? 48  LYS A HG3  1  
ATOM 732   H HD2  . LYS A 1 48  ? -0.640  17.339  5.280   1.00 0.00 ? 48  LYS A HD2  1  
ATOM 733   H HD3  . LYS A 1 48  ? -2.010  16.248  5.336   1.00 0.00 ? 48  LYS A HD3  1  
ATOM 734   H HE2  . LYS A 1 48  ? -0.755  14.545  6.479   1.00 0.00 ? 48  LYS A HE2  1  
ATOM 735   H HE3  . LYS A 1 48  ? 0.780   15.294  6.088   1.00 0.00 ? 48  LYS A HE3  1  
ATOM 736   H HZ1  . LYS A 1 48  ? -1.255  16.522  7.814   1.00 0.00 ? 48  LYS A HZ1  1  
ATOM 737   H HZ2  . LYS A 1 48  ? 0.054   15.713  8.359   1.00 0.00 ? 48  LYS A HZ2  1  
ATOM 738   H HZ3  . LYS A 1 48  ? 0.243   17.103  7.523   1.00 0.00 ? 48  LYS A HZ3  1  
ATOM 739   N N    . GLN A 1 49  ? 1.478   12.356  1.568   1.00 0.00 ? 49  GLN A N    1  
ATOM 740   C CA   . GLN A 1 49  ? 2.781   12.172  0.952   1.00 0.00 ? 49  GLN A CA   1  
ATOM 741   C C    . GLN A 1 49  ? 3.872   12.807  1.817   1.00 0.00 ? 49  GLN A C    1  
ATOM 742   O O    . GLN A 1 49  ? 3.916   14.027  1.971   1.00 0.00 ? 49  GLN A O    1  
ATOM 743   C CB   . GLN A 1 49  ? 2.803   12.748  -0.466  1.00 0.00 ? 49  GLN A CB   1  
ATOM 744   C CG   . GLN A 1 49  ? 4.198   13.264  -0.828  1.00 0.00 ? 49  GLN A CG   1  
ATOM 745   C CD   . GLN A 1 49  ? 5.243   12.155  -0.695  1.00 0.00 ? 49  GLN A CD   1  
ATOM 746   O OE1  . GLN A 1 49  ? 6.278   12.315  -0.069  1.00 0.00 ? 49  GLN A OE1  1  
ATOM 747   N NE2  . GLN A 1 49  ? 4.916   11.026  -1.316  1.00 0.00 ? 49  GLN A NE2  1  
ATOM 748   H H    . GLN A 1 49  ? 0.971   11.512  1.742   1.00 0.00 ? 49  GLN A H    1  
ATOM 749   H HA   . GLN A 1 49  ? 2.929   11.094  0.901   1.00 0.00 ? 49  GLN A HA   1  
ATOM 750   H HB2  . GLN A 1 49  ? 2.499   11.981  -1.178  1.00 0.00 ? 49  GLN A HB2  1  
ATOM 751   H HB3  . GLN A 1 49  ? 2.079   13.559  -0.545  1.00 0.00 ? 49  GLN A HB3  1  
ATOM 752   H HG2  . GLN A 1 49  ? 4.195   13.645  -1.849  1.00 0.00 ? 49  GLN A HG2  1  
ATOM 753   H HG3  . GLN A 1 49  ? 4.461   14.097  -0.177  1.00 0.00 ? 49  GLN A HG3  1  
ATOM 754   H HE21 . GLN A 1 49  ? 4.050   10.960  -1.812  1.00 0.00 ? 49  GLN A HE21 1  
ATOM 755   H HE22 . GLN A 1 49  ? 5.537   10.242  -1.287  1.00 0.00 ? 49  GLN A HE22 1  
ATOM 756   N N    . ILE A 1 50  ? 4.725   11.951  2.359   1.00 0.00 ? 50  ILE A N    1  
ATOM 757   C CA   . ILE A 1 50  ? 5.812   12.412  3.205   1.00 0.00 ? 50  ILE A CA   1  
ATOM 758   C C    . ILE A 1 50  ? 7.143   11.922  2.631   1.00 0.00 ? 50  ILE A C    1  
ATOM 759   O O    . ILE A 1 50  ? 8.170   12.582  2.785   1.00 0.00 ? 50  ILE A O    1  
ATOM 760   C CB   . ILE A 1 50  ? 5.577   11.991  4.658   1.00 0.00 ? 50  ILE A CB   1  
ATOM 761   C CG1  . ILE A 1 50  ? 6.658   11.014  5.127   1.00 0.00 ? 50  ILE A CG1  1  
ATOM 762   C CG2  . ILE A 1 50  ? 4.170   11.420  4.841   1.00 0.00 ? 50  ILE A CG2  1  
ATOM 763   C CD1  . ILE A 1 50  ? 6.199   10.244  6.367   1.00 0.00 ? 50  ILE A CD1  1  
ATOM 764   H H    . ILE A 1 50  ? 4.682   10.960  2.228   1.00 0.00 ? 50  ILE A H    1  
ATOM 765   H HA   . ILE A 1 50  ? 5.806   13.502  3.181   1.00 0.00 ? 50  ILE A HA   1  
ATOM 766   H HB   . ILE A 1 50  ? 5.649   12.878  5.287   1.00 0.00 ? 50  ILE A HB   1  
ATOM 767   H HG12 . ILE A 1 50  ? 6.893   10.314  4.325   1.00 0.00 ? 50  ILE A HG12 1  
ATOM 768   H HG13 . ILE A 1 50  ? 7.573   11.561  5.352   1.00 0.00 ? 50  ILE A HG13 1  
ATOM 769   H HG21 . ILE A 1 50  ? 3.458   12.018  4.273   1.00 0.00 ? 50  ILE A HG21 1  
ATOM 770   H HG22 . ILE A 1 50  ? 4.146   10.390  4.485   1.00 0.00 ? 50  ILE A HG22 1  
ATOM 771   H HG23 . ILE A 1 50  ? 3.903   11.444  5.898   1.00 0.00 ? 50  ILE A HG23 1  
ATOM 772   H HD11 . ILE A 1 50  ? 5.542   10.876  6.964   1.00 0.00 ? 50  ILE A HD11 1  
ATOM 773   H HD12 . ILE A 1 50  ? 5.660   9.348   6.058   1.00 0.00 ? 50  ILE A HD12 1  
ATOM 774   H HD13 . ILE A 1 50  ? 7.068   9.959   6.959   1.00 0.00 ? 50  ILE A HD13 1  
ATOM 775   N N    . LYS A 1 51  ? 7.082   10.771  1.979   1.00 0.00 ? 51  LYS A N    1  
ATOM 776   C CA   . LYS A 1 51  ? 8.269   10.185  1.381   1.00 0.00 ? 51  LYS A CA   1  
ATOM 777   C C    . LYS A 1 51  ? 7.868   9.382   0.142   1.00 0.00 ? 51  LYS A C    1  
ATOM 778   O O    . LYS A 1 51  ? 6.704   9.016   -0.015  1.00 0.00 ? 51  LYS A O    1  
ATOM 779   C CB   . LYS A 1 51  ? 9.044   9.369   2.417   1.00 0.00 ? 51  LYS A CB   1  
ATOM 780   C CG   . LYS A 1 51  ? 10.498  9.839   2.510   1.00 0.00 ? 51  LYS A CG   1  
ATOM 781   C CD   . LYS A 1 51  ? 11.458  8.648   2.540   1.00 0.00 ? 51  LYS A CD   1  
ATOM 782   C CE   . LYS A 1 51  ? 12.815  9.023   1.938   1.00 0.00 ? 51  LYS A CE   1  
ATOM 783   N NZ   . LYS A 1 51  ? 13.849  8.047   2.344   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 784   H H    . LYS A 1 51  ? 6.242   10.241  1.859   1.00 0.00 ? 51  LYS A H    1  
ATOM 785   H HA   . LYS A 1 51  ? 8.915   11.005  1.067   1.00 0.00 ? 51  LYS A HA   1  
ATOM 786   H HB2  . LYS A 1 51  ? 8.566   9.462   3.392   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 787   H HB3  . LYS A 1 51  ? 9.016   8.313   2.149   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 788   H HG2  . LYS A 1 51  ? 10.731  10.478  1.659   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 789   H HG3  . LYS A 1 51  ? 10.632  10.442  3.408   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 790   H HD2  . LYS A 1 51  ? 11.594  8.311   3.568   1.00 0.00 ? 51  LYS A HD2  1  
ATOM 791   H HD3  . LYS A 1 51  ? 11.027  7.815   1.985   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 792   H HE2  . LYS A 1 51  ? 12.740  9.052   0.850   1.00 0.00 ? 51  LYS A HE2  1  
ATOM 793   H HE3  . LYS A 1 51  ? 13.100  10.022  2.265   1.00 0.00 ? 51  LYS A HE3  1  
ATOM 794   H HZ1  . LYS A 1 51  ? 13.471  7.427   3.031   1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 795   H HZ2  . LYS A 1 51  ? 14.143  7.521   1.546   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 796   H HZ3  . LYS A 1 51  ? 14.633  8.533   2.730   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 797   N N    . MET A 1 52  ? 8.854   9.133   -0.708  1.00 0.00 ? 52  MET A N    1  
ATOM 798   C CA   . MET A 1 52  ? 8.618   8.381   -1.928  1.00 0.00 ? 52  MET A CA   1  
ATOM 799   C C    . MET A 1 52  ? 9.832   7.523   -2.287  1.00 0.00 ? 52  MET A C    1  
ATOM 800   O O    . MET A 1 52  ? 10.537  7.811   -3.253  1.00 0.00 ? 52  MET A O    1  
ATOM 801   C CB   . MET A 1 52  ? 8.320   9.349   -3.075  1.00 0.00 ? 52  MET A CB   1  
ATOM 802   C CG   . MET A 1 52  ? 9.377   10.453  -3.149  1.00 0.00 ? 52  MET A CG   1  
ATOM 803   S SD   . MET A 1 52  ? 9.086   11.483  -4.578  1.00 0.00 ? 52  MET A SD   1  
ATOM 804   C CE   . MET A 1 52  ? 10.686  12.258  -4.735  1.00 0.00 ? 52  MET A CE   1  
ATOM 805   H H    . MET A 1 52  ? 9.797   9.435   -0.573  1.00 0.00 ? 52  MET A H    1  
ATOM 806   H HA   . MET A 1 52  ? 7.762   7.741   -1.716  1.00 0.00 ? 52  MET A HA   1  
ATOM 807   H HB2  . MET A 1 52  ? 8.292   8.804   -4.018  1.00 0.00 ? 52  MET A HB2  1  
ATOM 808   H HB3  . MET A 1 52  ? 7.335   9.794   -2.933  1.00 0.00 ? 52  MET A HB3  1  
ATOM 809   H HG2  . MET A 1 52  ? 9.349   11.058  -2.244  1.00 0.00 ? 52  MET A HG2  1  
ATOM 810   H HG3  . MET A 1 52  ? 10.373  10.010  -3.206  1.00 0.00 ? 52  MET A HG3  1  
ATOM 811   H HE1  . MET A 1 52  ? 11.169  12.293  -3.758  1.00 0.00 ? 52  MET A HE1  1  
ATOM 812   H HE2  . MET A 1 52  ? 11.304  11.682  -5.423  1.00 0.00 ? 52  MET A HE2  1  
ATOM 813   H HE3  . MET A 1 52  ? 10.563  13.271  -5.115  1.00 0.00 ? 52  MET A HE3  1  
ATOM 814   N N    . PHE A 1 53  ? 10.041  6.486   -1.489  1.00 0.00 ? 53  PHE A N    1  
ATOM 815   C CA   . PHE A 1 53  ? 11.158  5.584   -1.710  1.00 0.00 ? 53  PHE A CA   1  
ATOM 816   C C    . PHE A 1 53  ? 11.284  5.220   -3.190  1.00 0.00 ? 53  PHE A C    1  
ATOM 817   O O    . PHE A 1 53  ? 12.176  5.712   -3.881  1.00 0.00 ? 53  PHE A O    1  
ATOM 818   C CB   . PHE A 1 53  ? 10.873  4.313   -0.907  1.00 0.00 ? 53  PHE A CB   1  
ATOM 819   C CG   . PHE A 1 53  ? 11.050  4.478   0.604   1.00 0.00 ? 53  PHE A CG   1  
ATOM 820   C CD1  . PHE A 1 53  ? 12.253  4.862   1.108   1.00 0.00 ? 53  PHE A CD1  1  
ATOM 821   C CD2  . PHE A 1 53  ? 10.005  4.240   1.441   1.00 0.00 ? 53  PHE A CD2  1  
ATOM 822   C CE1  . PHE A 1 53  ? 12.418  5.016   2.511   1.00 0.00 ? 53  PHE A CE1  1  
ATOM 823   C CE2  . PHE A 1 53  ? 10.171  4.393   2.843   1.00 0.00 ? 53  PHE A CE2  1  
ATOM 824   C CZ   . PHE A 1 53  ? 11.373  4.778   3.349   1.00 0.00 ? 53  PHE A CZ   1  
ATOM 825   H H    . PHE A 1 53  ? 9.463   6.259   -0.704  1.00 0.00 ? 53  PHE A H    1  
ATOM 826   H HA   . PHE A 1 53  ? 12.061  6.101   -1.387  1.00 0.00 ? 53  PHE A HA   1  
ATOM 827   H HB2  . PHE A 1 53  ? 9.851   3.990   -1.109  1.00 0.00 ? 53  PHE A HB2  1  
ATOM 828   H HB3  . PHE A 1 53  ? 11.533  3.519   -1.256  1.00 0.00 ? 53  PHE A HB3  1  
ATOM 829   H HD1  . PHE A 1 53  ? 13.090  5.054   0.437   1.00 0.00 ? 53  PHE A HD1  1  
ATOM 830   H HD2  . PHE A 1 53  ? 9.041   3.932   1.036   1.00 0.00 ? 53  PHE A HD2  1  
ATOM 831   H HE1  . PHE A 1 53  ? 13.382  5.325   2.916   1.00 0.00 ? 53  PHE A HE1  1  
ATOM 832   H HE2  . PHE A 1 53  ? 9.333   4.202   3.514   1.00 0.00 ? 53  PHE A HE2  1  
ATOM 833   H HZ   . PHE A 1 53  ? 11.500  4.895   4.424   1.00 0.00 ? 53  PHE A HZ   1  
ATOM 834   N N    . LYS A 1 54  ? 10.379  4.361   -3.635  1.00 0.00 ? 54  LYS A N    1  
ATOM 835   C CA   . LYS A 1 54  ? 10.378  3.925   -5.021  1.00 0.00 ? 54  LYS A CA   1  
ATOM 836   C C    . LYS A 1 54  ? 9.005   4.203   -5.637  1.00 0.00 ? 54  LYS A C    1  
ATOM 837   O O    . LYS A 1 54  ? 8.016   4.349   -4.921  1.00 0.00 ? 54  LYS A O    1  
ATOM 838   C CB   . LYS A 1 54  ? 10.813  2.463   -5.124  1.00 0.00 ? 54  LYS A CB   1  
ATOM 839   C CG   . LYS A 1 54  ? 10.585  1.920   -6.537  1.00 0.00 ? 54  LYS A CG   1  
ATOM 840   C CD   . LYS A 1 54  ? 11.505  2.613   -7.544  1.00 0.00 ? 54  LYS A CD   1  
ATOM 841   C CE   . LYS A 1 54  ? 10.883  2.616   -8.942  1.00 0.00 ? 54  LYS A CE   1  
ATOM 842   N NZ   . LYS A 1 54  ? 11.286  3.830   -9.686  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 843   H H    . LYS A 1 54  ? 9.657   3.965   -3.067  1.00 0.00 ? 54  LYS A H    1  
ATOM 844   H HA   . LYS A 1 54  ? 11.121  4.521   -5.552  1.00 0.00 ? 54  LYS A HA   1  
ATOM 845   H HB2  . LYS A 1 54  ? 11.867  2.373   -4.862  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 846   H HB3  . LYS A 1 54  ? 10.254  1.862   -4.405  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 847   H HG2  . LYS A 1 54  ? 10.768  0.846   -6.551  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 848   H HG3  . LYS A 1 54  ? 9.545   2.071   -6.825  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 849   H HD2  . LYS A 1 54  ? 11.694  3.638   -7.224  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 850   H HD3  . LYS A 1 54  ? 12.468  2.105   -7.572  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 851   H HE2  . LYS A 1 54  ? 11.197  1.726   -9.488  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 852   H HE3  . LYS A 1 54  ? 9.796   2.574   -8.864  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 853   H HZ1  . LYS A 1 54  ? 12.237  4.051   -9.473  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 854   H HZ2  . LYS A 1 54  ? 11.194  3.665   -10.668 1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 855   H HZ3  . LYS A 1 54  ? 10.698  4.595   -9.420  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 856   N N    . GLY A 1 55  ? 8.988   4.268   -6.961  1.00 0.00 ? 55  GLY A N    1  
ATOM 857   C CA   . GLY A 1 55  ? 7.753   4.527   -7.682  1.00 0.00 ? 55  GLY A CA   1  
ATOM 858   C C    . GLY A 1 55  ? 7.932   5.670   -8.683  1.00 0.00 ? 55  GLY A C    1  
ATOM 859   O O    . GLY A 1 55  ? 8.988   5.801   -9.299  1.00 0.00 ? 55  GLY A O    1  
ATOM 860   H H    . GLY A 1 55  ? 9.797   4.149   -7.537  1.00 0.00 ? 55  GLY A H    1  
ATOM 861   H HA2  . GLY A 1 55  ? 7.439   3.624   -8.206  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 862   H HA3  . GLY A 1 55  ? 6.961   4.776   -6.976  1.00 0.00 ? 55  GLY A HA3  1  
ATOM 863   N N    . PRO A 1 56  ? 6.854   6.488   -8.819  1.00 0.00 ? 56  PRO A N    1  
ATOM 864   C CA   . PRO A 1 56  ? 6.881   7.616   -9.736  1.00 0.00 ? 56  PRO A CA   1  
ATOM 865   C C    . PRO A 1 56  ? 7.723   8.760   -9.170  1.00 0.00 ? 56  PRO A C    1  
ATOM 866   O O    . PRO A 1 56  ? 8.399   8.597   -8.156  1.00 0.00 ? 56  PRO A O    1  
ATOM 867   C CB   . PRO A 1 56  ? 5.423   7.994   -9.938  1.00 0.00 ? 56  PRO A CB   1  
ATOM 868   C CG   . PRO A 1 56  ? 4.667   7.371   -8.775  1.00 0.00 ? 56  PRO A CG   1  
ATOM 869   C CD   . PRO A 1 56  ? 5.585   6.363   -8.107  1.00 0.00 ? 56  PRO A CD   1  
ATOM 870   H HA   . PRO A 1 56  ? 7.319   7.353   -10.596 1.00 0.00 ? 56  PRO A HA   1  
ATOM 871   H HB2  . PRO A 1 56  ? 5.298   9.076   -9.950  1.00 0.00 ? 56  PRO A HB2  1  
ATOM 872   H HB3  . PRO A 1 56  ? 5.050   7.619   -10.891 1.00 0.00 ? 56  PRO A HB3  1  
ATOM 873   H HG2  . PRO A 1 56  ? 4.361   8.139   -8.063  1.00 0.00 ? 56  PRO A HG2  1  
ATOM 874   H HG3  . PRO A 1 56  ? 3.757   6.885   -9.127  1.00 0.00 ? 56  PRO A HG3  1  
ATOM 875   H HD2  . PRO A 1 56  ? 5.705   6.578   -7.045  1.00 0.00 ? 56  PRO A HD2  1  
ATOM 876   H HD3  . PRO A 1 56  ? 5.187   5.351   -8.184  1.00 0.00 ? 56  PRO A HD3  1  
ATOM 877   N N    . GLU A 1 57  ? 7.654   9.895   -9.852  1.00 0.00 ? 57  GLU A N    1  
ATOM 878   C CA   . GLU A 1 57  ? 8.403   11.068  -9.431  1.00 0.00 ? 57  GLU A CA   1  
ATOM 879   C C    . GLU A 1 57  ? 7.493   12.030  -8.663  1.00 0.00 ? 57  GLU A C    1  
ATOM 880   O O    . GLU A 1 57  ? 7.940   12.707  -7.739  1.00 0.00 ? 57  GLU A O    1  
ATOM 881   C CB   . GLU A 1 57  ? 9.052   11.764  -10.629 1.00 0.00 ? 57  GLU A CB   1  
ATOM 882   C CG   . GLU A 1 57  ? 9.336   10.767  -11.754 1.00 0.00 ? 57  GLU A CG   1  
ATOM 883   C CD   . GLU A 1 57  ? 10.199  11.403  -12.846 1.00 0.00 ? 57  GLU A CD   1  
ATOM 884   O OE1  . GLU A 1 57  ? 9.681   12.324  -13.515 1.00 0.00 ? 57  GLU A OE1  1  
ATOM 885   O OE2  . GLU A 1 57  ? 11.358  10.955  -12.987 1.00 0.00 ? 57  GLU A OE2  1  
ATOM 886   H H    . GLU A 1 57  ? 7.103   10.020  -10.676 1.00 0.00 ? 57  GLU A H    1  
ATOM 887   H HA   . GLU A 1 57  ? 9.184   10.691  -8.771  1.00 0.00 ? 57  GLU A HA   1  
ATOM 888   H HB2  . GLU A 1 57  ? 8.395   12.553  -10.994 1.00 0.00 ? 57  GLU A HB2  1  
ATOM 889   H HB3  . GLU A 1 57  ? 9.981   12.241  -10.317 1.00 0.00 ? 57  GLU A HB3  1  
ATOM 890   H HG2  . GLU A 1 57  ? 9.844   9.891   -11.349 1.00 0.00 ? 57  GLU A HG2  1  
ATOM 891   H HG3  . GLU A 1 57  ? 8.396   10.421  -12.185 1.00 0.00 ? 57  GLU A HG3  1  
ATOM 892   N N    . LYS A 1 58  ? 6.235   12.060  -9.076  1.00 0.00 ? 58  LYS A N    1  
ATOM 893   C CA   . LYS A 1 58  ? 5.259   12.928  -8.440  1.00 0.00 ? 58  LYS A CA   1  
ATOM 894   C C    . LYS A 1 58  ? 4.904   12.365  -7.063  1.00 0.00 ? 58  LYS A C    1  
ATOM 895   O O    . LYS A 1 58  ? 5.471   12.781  -6.053  1.00 0.00 ? 58  LYS A O    1  
ATOM 896   C CB   . LYS A 1 58  ? 4.048   13.132  -9.352  1.00 0.00 ? 58  LYS A CB   1  
ATOM 897   C CG   . LYS A 1 58  ? 2.970   13.964  -8.654  1.00 0.00 ? 58  LYS A CG   1  
ATOM 898   C CD   . LYS A 1 58  ? 2.927   15.387  -9.215  1.00 0.00 ? 58  LYS A CD   1  
ATOM 899   C CE   . LYS A 1 58  ? 4.066   16.235  -8.646  1.00 0.00 ? 58  LYS A CE   1  
ATOM 900   N NZ   . LYS A 1 58  ? 3.659   17.655  -8.554  1.00 0.00 ? 58  LYS A NZ   1  
ATOM 901   H H    . LYS A 1 58  ? 5.881   11.505  -9.830  1.00 0.00 ? 58  LYS A H    1  
ATOM 902   H HA   . LYS A 1 58  ? 5.728   13.902  -8.304  1.00 0.00 ? 58  LYS A HA   1  
ATOM 903   H HB2  . LYS A 1 58  ? 4.358   13.629  -10.270 1.00 0.00 ? 58  LYS A HB2  1  
ATOM 904   H HB3  . LYS A 1 58  ? 3.636   12.163  -9.638  1.00 0.00 ? 58  LYS A HB3  1  
ATOM 905   H HG2  . LYS A 1 58  ? 1.998   13.489  -8.784  1.00 0.00 ? 58  LYS A HG2  1  
ATOM 906   H HG3  . LYS A 1 58  ? 3.168   13.997  -7.583  1.00 0.00 ? 58  LYS A HG3  1  
ATOM 907   H HD2  . LYS A 1 58  ? 3.000   15.355  -10.303 1.00 0.00 ? 58  LYS A HD2  1  
ATOM 908   H HD3  . LYS A 1 58  ? 1.970   15.848  -8.973  1.00 0.00 ? 58  LYS A HD3  1  
ATOM 909   H HE2  . LYS A 1 58  ? 4.345   15.865  -7.660  1.00 0.00 ? 58  LYS A HE2  1  
ATOM 910   H HE3  . LYS A 1 58  ? 4.948   16.144  -9.282  1.00 0.00 ? 58  LYS A HE3  1  
ATOM 911   H HZ1  . LYS A 1 58  ? 2.800   17.788  -9.048  1.00 0.00 ? 58  LYS A HZ1  1  
ATOM 912   H HZ2  . LYS A 1 58  ? 3.533   17.903  -7.593  1.00 0.00 ? 58  LYS A HZ2  1  
ATOM 913   H HZ3  . LYS A 1 58  ? 4.369   18.232  -8.957  1.00 0.00 ? 58  LYS A HZ3  1  
ATOM 914   N N    . ASP A 1 59  ? 3.969   11.427  -7.065  1.00 0.00 ? 59  ASP A N    1  
ATOM 915   C CA   . ASP A 1 59  ? 3.531   10.802  -5.829  1.00 0.00 ? 59  ASP A CA   1  
ATOM 916   C C    . ASP A 1 59  ? 2.095   10.300  -5.995  1.00 0.00 ? 59  ASP A C    1  
ATOM 917   O O    . ASP A 1 59  ? 1.407   10.680  -6.941  1.00 0.00 ? 59  ASP A O    1  
ATOM 918   C CB   . ASP A 1 59  ? 3.551   11.801  -4.670  1.00 0.00 ? 59  ASP A CB   1  
ATOM 919   C CG   . ASP A 1 59  ? 2.636   11.448  -3.495  1.00 0.00 ? 59  ASP A CG   1  
ATOM 920   O OD1  . ASP A 1 59  ? 2.916   10.415  -2.849  1.00 0.00 ? 59  ASP A OD1  1  
ATOM 921   O OD2  . ASP A 1 59  ? 1.678   12.218  -3.270  1.00 0.00 ? 59  ASP A OD2  1  
ATOM 922   H H    . ASP A 1 59  ? 3.513   11.093  -7.891  1.00 0.00 ? 59  ASP A H    1  
ATOM 923   H HA   . ASP A 1 59  ? 4.238   9.992   -5.651  1.00 0.00 ? 59  ASP A HA   1  
ATOM 924   H HB2  . ASP A 1 59  ? 4.573   11.888  -4.301  1.00 0.00 ? 59  ASP A HB2  1  
ATOM 925   H HB3  . ASP A 1 59  ? 3.266   12.781  -5.050  1.00 0.00 ? 59  ASP A HB3  1  
ATOM 926   N N    . ILE A 1 60  ? 1.686   9.455   -5.061  1.00 0.00 ? 60  ILE A N    1  
ATOM 927   C CA   . ILE A 1 60  ? 0.345   8.897   -5.093  1.00 0.00 ? 60  ILE A CA   1  
ATOM 928   C C    . ILE A 1 60  ? -0.417  9.339   -3.841  1.00 0.00 ? 60  ILE A C    1  
ATOM 929   O O    . ILE A 1 60  ? -0.617  8.548   -2.920  1.00 0.00 ? 60  ILE A O    1  
ATOM 930   C CB   . ILE A 1 60  ? 0.399   7.379   -5.275  1.00 0.00 ? 60  ILE A CB   1  
ATOM 931   C CG1  . ILE A 1 60  ? 1.646   6.966   -6.060  1.00 0.00 ? 60  ILE A CG1  1  
ATOM 932   C CG2  . ILE A 1 60  ? -0.885  6.858   -5.924  1.00 0.00 ? 60  ILE A CG2  1  
ATOM 933   C CD1  . ILE A 1 60  ? 1.399   7.056   -7.568  1.00 0.00 ? 60  ILE A CD1  1  
ATOM 934   H H    . ILE A 1 60  ? 2.252   9.151   -4.295  1.00 0.00 ? 60  ILE A H    1  
ATOM 935   H HA   . ILE A 1 60  ? -0.160  9.309   -5.967  1.00 0.00 ? 60  ILE A HA   1  
ATOM 936   H HB   . ILE A 1 60  ? 0.472   6.919   -4.290  1.00 0.00 ? 60  ILE A HB   1  
ATOM 937   H HG12 . ILE A 1 60  ? 2.482   7.610   -5.786  1.00 0.00 ? 60  ILE A HG12 1  
ATOM 938   H HG13 . ILE A 1 60  ? 1.926   5.947   -5.795  1.00 0.00 ? 60  ILE A HG13 1  
ATOM 939   H HG21 . ILE A 1 60  ? -1.504  7.701   -6.232  1.00 0.00 ? 60  ILE A HG21 1  
ATOM 940   H HG22 . ILE A 1 60  ? -0.634  6.255   -6.796  1.00 0.00 ? 60  ILE A HG22 1  
ATOM 941   H HG23 . ILE A 1 60  ? -1.433  6.248   -5.205  1.00 0.00 ? 60  ILE A HG23 1  
ATOM 942   H HD11 . ILE A 1 60  ? 0.476   7.604   -7.752  1.00 0.00 ? 60  ILE A HD11 1  
ATOM 943   H HD12 . ILE A 1 60  ? 2.232   7.576   -8.041  1.00 0.00 ? 60  ILE A HD12 1  
ATOM 944   H HD13 . ILE A 1 60  ? 1.314   6.051   -7.982  1.00 0.00 ? 60  ILE A HD13 1  
ATOM 945   N N    . GLU A 1 61  ? -0.820  10.601  -3.847  1.00 0.00 ? 61  GLU A N    1  
ATOM 946   C CA   . GLU A 1 61  ? -1.555  11.157  -2.724  1.00 0.00 ? 61  GLU A CA   1  
ATOM 947   C C    . GLU A 1 61  ? -2.931  10.500  -2.612  1.00 0.00 ? 61  GLU A C    1  
ATOM 948   O O    . GLU A 1 61  ? -3.645  10.709  -1.632  1.00 0.00 ? 61  GLU A O    1  
ATOM 949   C CB   . GLU A 1 61  ? -1.681  12.677  -2.849  1.00 0.00 ? 61  GLU A CB   1  
ATOM 950   C CG   . GLU A 1 61  ? -0.764  13.388  -1.853  1.00 0.00 ? 61  GLU A CG   1  
ATOM 951   C CD   . GLU A 1 61  ? -0.050  14.570  -2.512  1.00 0.00 ? 61  GLU A CD   1  
ATOM 952   O OE1  . GLU A 1 61  ? 0.331   14.416  -3.692  1.00 0.00 ? 61  GLU A OE1  1  
ATOM 953   O OE2  . GLU A 1 61  ? 0.097   15.601  -1.821  1.00 0.00 ? 61  GLU A OE2  1  
ATOM 954   H H    . GLU A 1 61  ? -0.653  11.238  -4.600  1.00 0.00 ? 61  GLU A H    1  
ATOM 955   H HA   . GLU A 1 61  ? -0.959  10.920  -1.842  1.00 0.00 ? 61  GLU A HA   1  
ATOM 956   H HB2  . GLU A 1 61  ? -1.429  12.984  -3.865  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 957   H HB3  . GLU A 1 61  ? -2.715  12.975  -2.674  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 958   H HG2  . GLU A 1 61  ? -1.347  13.739  -1.002  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 959   H HG3  . GLU A 1 61  ? -0.027  12.684  -1.465  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 960   N N    . PHE A 1 62  ? -3.263  9.717   -3.628  1.00 0.00 ? 62  PHE A N    1  
ATOM 961   C CA   . PHE A 1 62  ? -4.542  9.027   -3.656  1.00 0.00 ? 62  PHE A CA   1  
ATOM 962   C C    . PHE A 1 62  ? -4.359  7.548   -3.998  1.00 0.00 ? 62  PHE A C    1  
ATOM 963   O O    . PHE A 1 62  ? -4.348  7.174   -5.170  1.00 0.00 ? 62  PHE A O    1  
ATOM 964   C CB   . PHE A 1 62  ? -5.383  9.691   -4.748  1.00 0.00 ? 62  PHE A CB   1  
ATOM 965   C CG   . PHE A 1 62  ? -6.362  10.744  -4.227  1.00 0.00 ? 62  PHE A CG   1  
ATOM 966   C CD1  . PHE A 1 62  ? -7.492  10.359  -3.575  1.00 0.00 ? 62  PHE A CD1  1  
ATOM 967   C CD2  . PHE A 1 62  ? -6.101  12.067  -4.415  1.00 0.00 ? 62  PHE A CD2  1  
ATOM 968   C CE1  . PHE A 1 62  ? -8.400  11.338  -3.091  1.00 0.00 ? 62  PHE A CE1  1  
ATOM 969   C CE2  . PHE A 1 62  ? -7.009  13.045  -3.930  1.00 0.00 ? 62  PHE A CE2  1  
ATOM 970   C CZ   . PHE A 1 62  ? -8.140  12.660  -3.279  1.00 0.00 ? 62  PHE A CZ   1  
ATOM 971   H H    . PHE A 1 62  ? -2.676  9.552   -4.421  1.00 0.00 ? 62  PHE A H    1  
ATOM 972   H HA   . PHE A 1 62  ? -4.980  9.118   -2.662  1.00 0.00 ? 62  PHE A HA   1  
ATOM 973   H HB2  . PHE A 1 62  ? -4.717  10.156  -5.475  1.00 0.00 ? 62  PHE A HB2  1  
ATOM 974   H HB3  . PHE A 1 62  ? -5.943  8.920   -5.279  1.00 0.00 ? 62  PHE A HB3  1  
ATOM 975   H HD1  . PHE A 1 62  ? -7.700  9.300   -3.424  1.00 0.00 ? 62  PHE A HD1  1  
ATOM 976   H HD2  . PHE A 1 62  ? -5.196  12.375  -4.937  1.00 0.00 ? 62  PHE A HD2  1  
ATOM 977   H HE1  . PHE A 1 62  ? -9.305  11.030  -2.569  1.00 0.00 ? 62  PHE A HE1  1  
ATOM 978   H HE2  . PHE A 1 62  ? -6.801  14.104  -4.081  1.00 0.00 ? 62  PHE A HE2  1  
ATOM 979   H HZ   . PHE A 1 62  ? -8.837  13.411  -2.907  1.00 0.00 ? 62  PHE A HZ   1  
ATOM 980   N N    . ILE A 1 63  ? -4.220  6.745   -2.952  1.00 0.00 ? 63  ILE A N    1  
ATOM 981   C CA   . ILE A 1 63  ? -4.037  5.314   -3.126  1.00 0.00 ? 63  ILE A CA   1  
ATOM 982   C C    . ILE A 1 63  ? -5.390  4.612   -2.989  1.00 0.00 ? 63  ILE A C    1  
ATOM 983   O O    . ILE A 1 63  ? -6.368  5.221   -2.557  1.00 0.00 ? 63  ILE A O    1  
ATOM 984   C CB   . ILE A 1 63  ? -2.971  4.789   -2.165  1.00 0.00 ? 63  ILE A CB   1  
ATOM 985   C CG1  . ILE A 1 63  ? -1.901  5.849   -1.899  1.00 0.00 ? 63  ILE A CG1  1  
ATOM 986   C CG2  . ILE A 1 63  ? -2.366  3.480   -2.677  1.00 0.00 ? 63  ILE A CG2  1  
ATOM 987   C CD1  . ILE A 1 63  ? -0.585  5.485   -2.590  1.00 0.00 ? 63  ILE A CD1  1  
ATOM 988   H H    . ILE A 1 63  ? -4.230  7.058   -2.002  1.00 0.00 ? 63  ILE A H    1  
ATOM 989   H HA   . ILE A 1 63  ? -3.667  5.153   -4.139  1.00 0.00 ? 63  ILE A HA   1  
ATOM 990   H HB   . ILE A 1 63  ? -3.450  4.569   -1.210  1.00 0.00 ? 63  ILE A HB   1  
ATOM 991   H HG12 . ILE A 1 63  ? -2.248  6.819   -2.258  1.00 0.00 ? 63  ILE A HG12 1  
ATOM 992   H HG13 . ILE A 1 63  ? -1.737  5.946   -0.826  1.00 0.00 ? 63  ILE A HG13 1  
ATOM 993   H HG21 . ILE A 1 63  ? -2.189  3.558   -3.750  1.00 0.00 ? 63  ILE A HG21 1  
ATOM 994   H HG22 . ILE A 1 63  ? -1.422  3.291   -2.167  1.00 0.00 ? 63  ILE A HG22 1  
ATOM 995   H HG23 . ILE A 1 63  ? -3.056  2.659   -2.481  1.00 0.00 ? 63  ILE A HG23 1  
ATOM 996   H HD11 . ILE A 1 63  ? -0.773  5.282   -3.645  1.00 0.00 ? 63  ILE A HD11 1  
ATOM 997   H HD12 . ILE A 1 63  ? 0.114   6.317   -2.501  1.00 0.00 ? 63  ILE A HD12 1  
ATOM 998   H HD13 . ILE A 1 63  ? -0.159  4.599   -2.120  1.00 0.00 ? 63  ILE A HD13 1  
ATOM 999   N N    . TYR A 1 64  ? -5.402  3.341   -3.363  1.00 0.00 ? 64  TYR A N    1  
ATOM 1000  C CA   . TYR A 1 64  ? -6.618  2.550   -3.286  1.00 0.00 ? 64  TYR A CA   1  
ATOM 1001  C C    . TYR A 1 64  ? -6.415  1.316   -2.404  1.00 0.00 ? 64  TYR A C    1  
ATOM 1002  O O    . TYR A 1 64  ? -5.329  0.740   -2.378  1.00 0.00 ? 64  TYR A O    1  
ATOM 1003  C CB   . TYR A 1 64  ? -6.917  2.096   -4.716  1.00 0.00 ? 64  TYR A CB   1  
ATOM 1004  C CG   . TYR A 1 64  ? -7.524  3.186   -5.602  1.00 0.00 ? 64  TYR A CG   1  
ATOM 1005  C CD1  . TYR A 1 64  ? -6.846  4.373   -5.797  1.00 0.00 ? 64  TYR A CD1  1  
ATOM 1006  C CD2  . TYR A 1 64  ? -8.749  2.984   -6.204  1.00 0.00 ? 64  TYR A CD2  1  
ATOM 1007  C CE1  . TYR A 1 64  ? -7.418  5.400   -6.630  1.00 0.00 ? 64  TYR A CE1  1  
ATOM 1008  C CE2  . TYR A 1 64  ? -9.320  4.011   -7.037  1.00 0.00 ? 64  TYR A CE2  1  
ATOM 1009  C CZ   . TYR A 1 64  ? -8.626  5.167   -7.209  1.00 0.00 ? 64  TYR A CZ   1  
ATOM 1010  O OH   . TYR A 1 64  ? -9.166  6.137   -7.996  1.00 0.00 ? 64  TYR A OH   1  
ATOM 1011  H H    . TYR A 1 64  ? -4.602  2.854   -3.713  1.00 0.00 ? 64  TYR A H    1  
ATOM 1012  H HA   . TYR A 1 64  ? -7.399  3.174   -2.851  1.00 0.00 ? 64  TYR A HA   1  
ATOM 1013  H HB2  . TYR A 1 64  ? -5.994  1.743   -5.175  1.00 0.00 ? 64  TYR A HB2  1  
ATOM 1014  H HB3  . TYR A 1 64  ? -7.600  1.248   -4.682  1.00 0.00 ? 64  TYR A HB3  1  
ATOM 1015  H HD1  . TYR A 1 64  ? -5.880  4.533   -5.321  1.00 0.00 ? 64  TYR A HD1  1  
ATOM 1016  H HD2  . TYR A 1 64  ? -9.284  2.047   -6.050  1.00 0.00 ? 64  TYR A HD2  1  
ATOM 1017  H HE1  . TYR A 1 64  ? -6.893  6.341   -6.792  1.00 0.00 ? 64  TYR A HE1  1  
ATOM 1018  H HE2  . TYR A 1 64  ? -10.287 3.864   -7.519  1.00 0.00 ? 64  TYR A HE2  1  
ATOM 1019  H HH   . TYR A 1 64  ? -8.996  7.038   -7.594  1.00 0.00 ? 64  TYR A HH   1  
ATOM 1020  N N    . THR A 1 65  ? -7.478  0.947   -1.704  1.00 0.00 ? 65  THR A N    1  
ATOM 1021  C CA   . THR A 1 65  ? -7.429  -0.208  -0.824  1.00 0.00 ? 65  THR A CA   1  
ATOM 1022  C C    . THR A 1 65  ? -8.846  -0.673  -0.478  1.00 0.00 ? 65  THR A C    1  
ATOM 1023  O O    . THR A 1 65  ? -9.815  -0.232  -1.092  1.00 0.00 ? 65  THR A O    1  
ATOM 1024  C CB   . THR A 1 65  ? -6.597  0.168   0.404   1.00 0.00 ? 65  THR A CB   1  
ATOM 1025  O OG1  . THR A 1 65  ? -6.624  -1.004  1.213   1.00 0.00 ? 65  THR A OG1  1  
ATOM 1026  C CG2  . THR A 1 65  ? -7.274  1.234   1.267   1.00 0.00 ? 65  THR A CG2  1  
ATOM 1027  H H    . THR A 1 65  ? -8.357  1.421   -1.732  1.00 0.00 ? 65  THR A H    1  
ATOM 1028  H HA   . THR A 1 65  ? -6.945  -1.026  -1.356  1.00 0.00 ? 65  THR A HA   1  
ATOM 1029  H HB   . THR A 1 65  ? -5.595  0.481   0.112   1.00 0.00 ? 65  THR A HB   1  
ATOM 1030  H HG1  . THR A 1 65  ? -6.224  -1.773  0.715   1.00 0.00 ? 65  THR A HG1  1  
ATOM 1031  H HG21 . THR A 1 65  ? -8.355  1.158   1.156   1.00 0.00 ? 65  THR A HG21 1  
ATOM 1032  H HG22 . THR A 1 65  ? -7.005  1.080   2.312   1.00 0.00 ? 65  THR A HG22 1  
ATOM 1033  H HG23 . THR A 1 65  ? -6.944  2.223   0.948   1.00 0.00 ? 65  THR A HG23 1  
ATOM 1034  N N    . ALA A 1 66  ? -8.919  -1.560  0.504   1.00 0.00 ? 66  ALA A N    1  
ATOM 1035  C CA   . ALA A 1 66  ? -10.199 -2.091  0.939   1.00 0.00 ? 66  ALA A CA   1  
ATOM 1036  C C    . ALA A 1 66  ? -10.657 -1.345  2.194   1.00 0.00 ? 66  ALA A C    1  
ATOM 1037  O O    . ALA A 1 66  ? -9.835  -0.809  2.935   1.00 0.00 ? 66  ALA A O    1  
ATOM 1038  C CB   . ALA A 1 66  ? -10.075 -3.599  1.170   1.00 0.00 ? 66  ALA A CB   1  
ATOM 1039  H H    . ALA A 1 66  ? -8.125  -1.915  0.998   1.00 0.00 ? 66  ALA A H    1  
ATOM 1040  H HA   . ALA A 1 66  ? -10.920 -1.916  0.140   1.00 0.00 ? 66  ALA A HA   1  
ATOM 1041  H HB1  . ALA A 1 66  ? -9.036  -3.901  1.046   1.00 0.00 ? 66  ALA A HB1  1  
ATOM 1042  H HB2  . ALA A 1 66  ? -10.406 -3.839  2.180   1.00 0.00 ? 66  ALA A HB2  1  
ATOM 1043  H HB3  . ALA A 1 66  ? -10.696 -4.129  0.448   1.00 0.00 ? 66  ALA A HB3  1  
ATOM 1044  N N    . PRO A 1 67  ? -12.001 -1.333  2.397   1.00 0.00 ? 67  PRO A N    1  
ATOM 1045  C CA   . PRO A 1 67  ? -12.576 -0.661  3.550   1.00 0.00 ? 67  PRO A CA   1  
ATOM 1046  C C    . PRO A 1 67  ? -12.356 -1.474  4.826   1.00 0.00 ? 67  PRO A C    1  
ATOM 1047  O O    . PRO A 1 67  ? -11.486 -2.344  4.870   1.00 0.00 ? 67  PRO A O    1  
ATOM 1048  C CB   . PRO A 1 67  ? -14.047 -0.483  3.207   1.00 0.00 ? 67  PRO A CB   1  
ATOM 1049  C CG   . PRO A 1 67  ? -14.336 -1.468  2.086   1.00 0.00 ? 67  PRO A CG   1  
ATOM 1050  C CD   . PRO A 1 67  ? -13.004 -1.957  1.540   1.00 0.00 ? 67  PRO A CD   1  
ATOM 1051  H HA   . PRO A 1 67  ? -12.123 0.217   3.703   1.00 0.00 ? 67  PRO A HA   1  
ATOM 1052  H HB2  . PRO A 1 67  ? -14.677 -0.681  4.074   1.00 0.00 ? 67  PRO A HB2  1  
ATOM 1053  H HB3  . PRO A 1 67  ? -14.253 0.540   2.891   1.00 0.00 ? 67  PRO A HB3  1  
ATOM 1054  H HG2  . PRO A 1 67  ? -14.927 -2.306  2.457   1.00 0.00 ? 67  PRO A HG2  1  
ATOM 1055  H HG3  . PRO A 1 67  ? -14.919 -0.990  1.299   1.00 0.00 ? 67  PRO A HG3  1  
ATOM 1056  H HD2  . PRO A 1 67  ? -12.936 -3.043  1.577   1.00 0.00 ? 67  PRO A HD2  1  
ATOM 1057  H HD3  . PRO A 1 67  ? -12.872 -1.664  0.498   1.00 0.00 ? 67  PRO A HD3  1  
ATOM 1058  N N    . SER A 1 68  ? -13.157 -1.164  5.834   1.00 0.00 ? 68  SER A N    1  
ATOM 1059  C CA   . SER A 1 68  ? -13.059 -1.855  7.108   1.00 0.00 ? 68  SER A CA   1  
ATOM 1060  C C    . SER A 1 68  ? -11.637 -1.739  7.660   1.00 0.00 ? 68  SER A C    1  
ATOM 1061  O O    . SER A 1 68  ? -10.825 -0.979  7.135   1.00 0.00 ? 68  SER A O    1  
ATOM 1062  C CB   . SER A 1 68  ? -13.458 -3.326  6.969   1.00 0.00 ? 68  SER A CB   1  
ATOM 1063  O OG   . SER A 1 68  ? -14.760 -3.579  7.490   1.00 0.00 ? 68  SER A OG   1  
ATOM 1064  H H    . SER A 1 68  ? -13.862 -0.456  5.791   1.00 0.00 ? 68  SER A H    1  
ATOM 1065  H HA   . SER A 1 68  ? -13.767 -1.350  7.767   1.00 0.00 ? 68  SER A HA   1  
ATOM 1066  H HB2  . SER A 1 68  ? -13.425 -3.612  5.918   1.00 0.00 ? 68  SER A HB2  1  
ATOM 1067  H HB3  . SER A 1 68  ? -12.731 -3.949  7.490   1.00 0.00 ? 68  SER A HB3  1  
ATOM 1068  H HG   . SER A 1 68  ? -15.444 -3.079  6.959   1.00 0.00 ? 68  SER A HG   1  
ATOM 1069  N N    . SER A 1 69  ? -11.379 -2.506  8.709   1.00 0.00 ? 69  SER A N    1  
ATOM 1070  C CA   . SER A 1 69  ? -10.069 -2.498  9.337   1.00 0.00 ? 69  SER A CA   1  
ATOM 1071  C C    . SER A 1 69  ? -8.992  -2.830  8.302   1.00 0.00 ? 69  SER A C    1  
ATOM 1072  O O    . SER A 1 69  ? -7.893  -2.277  8.345   1.00 0.00 ? 69  SER A O    1  
ATOM 1073  C CB   . SER A 1 69  ? -10.010 -3.491  10.500  1.00 0.00 ? 69  SER A CB   1  
ATOM 1074  O OG   . SER A 1 69  ? -8.683  -3.952  10.742  1.00 0.00 ? 69  SER A OG   1  
ATOM 1075  H H    . SER A 1 69  ? -12.045 -3.121  9.130   1.00 0.00 ? 69  SER A H    1  
ATOM 1076  H HA   . SER A 1 69  ? -9.936  -1.486  9.717   1.00 0.00 ? 69  SER A HA   1  
ATOM 1077  H HB2  . SER A 1 69  ? -10.398 -3.015  11.402  1.00 0.00 ? 69  SER A HB2  1  
ATOM 1078  H HB3  . SER A 1 69  ? -10.657 -4.341  10.285  1.00 0.00 ? 69  SER A HB3  1  
ATOM 1079  H HG   . SER A 1 69  ? -8.430  -4.637  10.057  1.00 0.00 ? 69  SER A HG   1  
ATOM 1080  N N    . ALA A 1 70  ? -9.344  -3.731  7.397   1.00 0.00 ? 70  ALA A N    1  
ATOM 1081  C CA   . ALA A 1 70  ? -8.420  -4.143  6.353   1.00 0.00 ? 70  ALA A CA   1  
ATOM 1082  C C    . ALA A 1 70  ? -8.745  -5.576  5.927   1.00 0.00 ? 70  ALA A C    1  
ATOM 1083  O O    . ALA A 1 70  ? -8.407  -6.527  6.630   1.00 0.00 ? 70  ALA A O    1  
ATOM 1084  C CB   . ALA A 1 70  ? -6.982  -3.995  6.855   1.00 0.00 ? 70  ALA A CB   1  
ATOM 1085  H H    . ALA A 1 70  ? -10.238 -4.176  7.369   1.00 0.00 ? 70  ALA A H    1  
ATOM 1086  H HA   . ALA A 1 70  ? -8.564  -3.478  5.501   1.00 0.00 ? 70  ALA A HA   1  
ATOM 1087  H HB1  . ALA A 1 70  ? -6.953  -4.172  7.930   1.00 0.00 ? 70  ALA A HB1  1  
ATOM 1088  H HB2  . ALA A 1 70  ? -6.345  -4.720  6.350   1.00 0.00 ? 70  ALA A HB2  1  
ATOM 1089  H HB3  . ALA A 1 70  ? -6.626  -2.987  6.643   1.00 0.00 ? 70  ALA A HB3  1  
ATOM 1090  N N    . VAL A 1 71  ? -9.395  -5.686  4.779   1.00 0.00 ? 71  VAL A N    1  
ATOM 1091  C CA   . VAL A 1 71  ? -9.769  -6.987  4.251   1.00 0.00 ? 71  VAL A CA   1  
ATOM 1092  C C    . VAL A 1 71  ? -8.851  -7.340  3.079   1.00 0.00 ? 71  VAL A C    1  
ATOM 1093  O O    . VAL A 1 71  ? -8.448  -8.492  2.926   1.00 0.00 ? 71  VAL A O    1  
ATOM 1094  C CB   . VAL A 1 71  ? -11.251 -6.992  3.872   1.00 0.00 ? 71  VAL A CB   1  
ATOM 1095  C CG1  . VAL A 1 71  ? -12.025 -5.942  4.671   1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1096  C CG2  . VAL A 1 71  ? -11.433 -6.779  2.368   1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1097  H H    . VAL A 1 71  ? -9.666  -4.907  4.212   1.00 0.00 ? 71  VAL A H    1  
ATOM 1098  H HA   . VAL A 1 71  ? -9.621  -7.718  5.045   1.00 0.00 ? 71  VAL A HA   1  
ATOM 1099  H HB   . VAL A 1 71  ? -11.658 -7.972  4.123   1.00 0.00 ? 71  VAL A HB   1  
ATOM 1100  H HG11 . VAL A 1 71  ? -11.564 -5.819  5.651   1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1101  H HG12 . VAL A 1 71  ? -12.005 -4.991  4.138   1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1102  H HG13 . VAL A 1 71  ? -13.058 -6.267  4.794   1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1103  H HG21 . VAL A 1 71  ? -10.986 -5.828  2.078   1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1104  H HG22 . VAL A 1 71  ? -10.947 -7.590  1.824   1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1105  H HG23 . VAL A 1 71  ? -12.497 -6.769  2.128   1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1106  N N    . CYS A 1 72  ? -8.547  -6.327  2.280   1.00 0.00 ? 72  CYS A N    1  
ATOM 1107  C CA   . CYS A 1 72  ? -7.684  -6.516  1.127   1.00 0.00 ? 72  CYS A CA   1  
ATOM 1108  C C    . CYS A 1 72  ? -6.628  -5.409  1.130   1.00 0.00 ? 72  CYS A C    1  
ATOM 1109  O O    . CYS A 1 72  ? -6.112  -5.036  0.077   1.00 0.00 ? 72  CYS A O    1  
ATOM 1110  C CB   . CYS A 1 72  ? -8.482  -6.540  -0.178  1.00 0.00 ? 72  CYS A CB   1  
ATOM 1111  S SG   . CYS A 1 72  ? -9.254  -8.151  -0.576  1.00 0.00 ? 72  CYS A SG   1  
ATOM 1112  H H    . CYS A 1 72  ? -8.879  -5.393  2.412   1.00 0.00 ? 72  CYS A H    1  
ATOM 1113  H HA   . CYS A 1 72  ? -7.219  -7.495  1.241   1.00 0.00 ? 72  CYS A HA   1  
ATOM 1114  H HB2  . CYS A 1 72  ? -9.264  -5.783  -0.125  1.00 0.00 ? 72  CYS A HB2  1  
ATOM 1115  H HB3  . CYS A 1 72  ? -7.820  -6.259  -0.997  1.00 0.00 ? 72  CYS A HB3  1  
ATOM 1116  N N    . GLY A 1 73  ? -6.340  -4.912  2.324   1.00 0.00 ? 73  GLY A N    1  
ATOM 1117  C CA   . GLY A 1 73  ? -5.356  -3.856  2.478   1.00 0.00 ? 73  GLY A CA   1  
ATOM 1118  C C    . GLY A 1 73  ? -4.880  -3.756  3.929   1.00 0.00 ? 73  GLY A C    1  
ATOM 1119  O O    . GLY A 1 73  ? -4.995  -4.715  4.690   1.00 0.00 ? 73  GLY A O    1  
ATOM 1120  H H    . GLY A 1 73  ? -6.766  -5.221  3.175   1.00 0.00 ? 73  GLY A H    1  
ATOM 1121  H HA2  . GLY A 1 73  ? -4.505  -4.048  1.825   1.00 0.00 ? 73  GLY A HA2  1  
ATOM 1122  H HA3  . GLY A 1 73  ? -5.787  -2.904  2.167   1.00 0.00 ? 73  GLY A HA3  1  
ATOM 1123  N N    . VAL A 1 74  ? -4.356  -2.587  4.267   1.00 0.00 ? 74  VAL A N    1  
ATOM 1124  C CA   . VAL A 1 74  ? -3.862  -2.350  5.613   1.00 0.00 ? 74  VAL A CA   1  
ATOM 1125  C C    . VAL A 1 74  ? -4.701  -1.253  6.273   1.00 0.00 ? 74  VAL A C    1  
ATOM 1126  O O    . VAL A 1 74  ? -4.474  -0.908  7.431   1.00 0.00 ? 74  VAL A O    1  
ATOM 1127  C CB   . VAL A 1 74  ? -2.369  -2.018  5.572   1.00 0.00 ? 74  VAL A CB   1  
ATOM 1128  C CG1  . VAL A 1 74  ? -1.852  -1.640  6.962   1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1129  C CG2  . VAL A 1 74  ? -1.565  -3.180  4.986   1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1130  H H    . VAL A 1 74  ? -4.267  -1.812  3.642   1.00 0.00 ? 74  VAL A H    1  
ATOM 1131  H HA   . VAL A 1 74  ? -3.987  -3.275  6.177   1.00 0.00 ? 74  VAL A HA   1  
ATOM 1132  H HB   . VAL A 1 74  ? -2.235  -1.156  4.919   1.00 0.00 ? 74  VAL A HB   1  
ATOM 1133  H HG11 . VAL A 1 74  ? -2.109  -2.427  7.671   1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1134  H HG12 . VAL A 1 74  ? -0.770  -1.520  6.927   1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1135  H HG13 . VAL A 1 74  ? -2.312  -0.703  7.276   1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1136  H HG21 . VAL A 1 74  ? -2.166  -3.698  4.238   1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1137  H HG22 . VAL A 1 74  ? -0.658  -2.795  4.519   1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1138  H HG23 . VAL A 1 74  ? -1.298  -3.875  5.781   1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1139  N N    . SER A 1 75  ? -5.651  -0.738  5.508   1.00 0.00 ? 75  SER A N    1  
ATOM 1140  C CA   . SER A 1 75  ? -6.524  0.312   6.005   1.00 0.00 ? 75  SER A CA   1  
ATOM 1141  C C    . SER A 1 75  ? -5.767  1.198   6.995   1.00 0.00 ? 75  SER A C    1  
ATOM 1142  O O    . SER A 1 75  ? -5.836  0.984   8.204   1.00 0.00 ? 75  SER A O    1  
ATOM 1143  C CB   . SER A 1 75  ? -7.772  -0.277  6.666   1.00 0.00 ? 75  SER A CB   1  
ATOM 1144  O OG   . SER A 1 75  ? -8.959  0.399   6.262   1.00 0.00 ? 75  SER A OG   1  
ATOM 1145  H H    . SER A 1 75  ? -5.829  -1.026  4.567   1.00 0.00 ? 75  SER A H    1  
ATOM 1146  H HA   . SER A 1 75  ? -6.817  0.885   5.124   1.00 0.00 ? 75  SER A HA   1  
ATOM 1147  H HB2  . SER A 1 75  ? -7.852  -1.334  6.414   1.00 0.00 ? 75  SER A HB2  1  
ATOM 1148  H HB3  . SER A 1 75  ? -7.671  -0.215  7.750   1.00 0.00 ? 75  SER A HB3  1  
ATOM 1149  H HG   . SER A 1 75  ? -9.307  0.960   7.013   1.00 0.00 ? 75  SER A HG   1  
ATOM 1150  N N    . LEU A 1 76  ? -5.059  2.174   6.445   1.00 0.00 ? 76  LEU A N    1  
ATOM 1151  C CA   . LEU A 1 76  ? -4.289  3.094   7.265   1.00 0.00 ? 76  LEU A CA   1  
ATOM 1152  C C    . LEU A 1 76  ? -5.024  4.433   7.350   1.00 0.00 ? 76  LEU A C    1  
ATOM 1153  O O    . LEU A 1 76  ? -5.479  4.960   6.336   1.00 0.00 ? 76  LEU A O    1  
ATOM 1154  C CB   . LEU A 1 76  ? -2.857  3.211   6.739   1.00 0.00 ? 76  LEU A CB   1  
ATOM 1155  C CG   . LEU A 1 76  ? -2.345  2.023   5.921   1.00 0.00 ? 76  LEU A CG   1  
ATOM 1156  C CD1  . LEU A 1 76  ? -2.431  2.312   4.421   1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1157  C CD2  . LEU A 1 76  ? -0.928  1.634   6.349   1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1158  H H    . LEU A 1 76  ? -5.008  2.341   5.460   1.00 0.00 ? 76  LEU A H    1  
ATOM 1159  H HA   . LEU A 1 76  ? -4.231  2.668   8.266   1.00 0.00 ? 76  LEU A HA   1  
ATOM 1160  H HB2  . LEU A 1 76  ? -2.789  4.107   6.122   1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1161  H HB3  . LEU A 1 76  ? -2.190  3.357   7.588   1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1162  H HG   . LEU A 1 76  ? -2.988  1.167   6.122   1.00 0.00 ? 76  LEU A HG   1  
ATOM 1163  H HD11 . LEU A 1 76  ? -2.974  3.244   4.261   1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1164  H HD12 . LEU A 1 76  ? -1.426  2.402   4.010   1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1165  H HD13 . LEU A 1 76  ? -2.956  1.496   3.924   1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1166  H HD21 . LEU A 1 76  ? -0.576  2.326   7.114   1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1167  H HD22 . LEU A 1 76  ? -0.936  0.621   6.751   1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1168  H HD23 . LEU A 1 76  ? -0.262  1.677   5.486   1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1169  N N    . ASP A 1 77  ? -5.116  4.946   8.568   1.00 0.00 ? 77  ASP A N    1  
ATOM 1170  C CA   . ASP A 1 77  ? -5.788  6.213   8.798   1.00 0.00 ? 77  ASP A CA   1  
ATOM 1171  C C    . ASP A 1 77  ? -4.806  7.198   9.436   1.00 0.00 ? 77  ASP A C    1  
ATOM 1172  O O    . ASP A 1 77  ? -5.171  8.330   9.750   1.00 0.00 ? 77  ASP A O    1  
ATOM 1173  C CB   . ASP A 1 77  ? -6.973  6.043   9.750   1.00 0.00 ? 77  ASP A CB   1  
ATOM 1174  C CG   . ASP A 1 77  ? -6.815  4.931   10.788  1.00 0.00 ? 77  ASP A CG   1  
ATOM 1175  O OD1  . ASP A 1 77  ? -7.148  3.777   10.439  1.00 0.00 ? 77  ASP A OD1  1  
ATOM 1176  O OD2  . ASP A 1 77  ? -6.363  5.257   11.907  1.00 0.00 ? 77  ASP A OD2  1  
ATOM 1177  H H    . ASP A 1 77  ? -4.742  4.510   9.387   1.00 0.00 ? 77  ASP A H    1  
ATOM 1178  H HA   . ASP A 1 77  ? -6.127  6.540   7.815   1.00 0.00 ? 77  ASP A HA   1  
ATOM 1179  H HB2  . ASP A 1 77  ? -7.138  6.986   10.273  1.00 0.00 ? 77  ASP A HB2  1  
ATOM 1180  H HB3  . ASP A 1 77  ? -7.868  5.845   9.161   1.00 0.00 ? 77  ASP A HB3  1  
ATOM 1181  N N    . VAL A 1 78  ? -3.578  6.731   9.609   1.00 0.00 ? 78  VAL A N    1  
ATOM 1182  C CA   . VAL A 1 78  ? -2.539  7.556   10.204  1.00 0.00 ? 78  VAL A CA   1  
ATOM 1183  C C    . VAL A 1 78  ? -2.828  7.733   11.696  1.00 0.00 ? 78  VAL A C    1  
ATOM 1184  O O    . VAL A 1 78  ? -1.984  7.425   12.536  1.00 0.00 ? 78  VAL A O    1  
ATOM 1185  C CB   . VAL A 1 78  ? -2.434  8.885   9.454   1.00 0.00 ? 78  VAL A CB   1  
ATOM 1186  C CG1  . VAL A 1 78  ? -2.165  10.040  10.420  1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1187  C CG2  . VAL A 1 78  ? -1.359  8.817   8.366   1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1188  H H    . VAL A 1 78  ? -3.288  5.809   9.350   1.00 0.00 ? 78  VAL A H    1  
ATOM 1189  H HA   . VAL A 1 78  ? -1.594  7.027   10.089  1.00 0.00 ? 78  VAL A HA   1  
ATOM 1190  H HB   . VAL A 1 78  ? -3.391  9.072   8.966   1.00 0.00 ? 78  VAL A HB   1  
ATOM 1191  H HG11 . VAL A 1 78  ? -1.532  9.691   11.236  1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1192  H HG12 . VAL A 1 78  ? -1.660  10.848  9.889   1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1193  H HG13 . VAL A 1 78  ? -3.109  10.405  10.823  1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1194  H HG21 . VAL A 1 78  ? -1.044  7.783   8.232   1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1195  H HG22 . VAL A 1 78  ? -1.765  9.199   7.430   1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1196  H HG23 . VAL A 1 78  ? -0.502  9.423   8.665   1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1197  N N    . GLY A 1 79  ? -4.024  8.228   11.981  1.00 0.00 ? 79  GLY A N    1  
ATOM 1198  C CA   . GLY A 1 79  ? -4.433  8.450   13.356  1.00 0.00 ? 79  GLY A CA   1  
ATOM 1199  C C    . GLY A 1 79  ? -4.345  7.158   14.170  1.00 0.00 ? 79  GLY A C    1  
ATOM 1200  O O    . GLY A 1 79  ? -4.463  7.181   15.394  1.00 0.00 ? 79  GLY A O    1  
ATOM 1201  H H    . GLY A 1 79  ? -4.705  8.476   11.291  1.00 0.00 ? 79  GLY A H    1  
ATOM 1202  H HA2  . GLY A 1 79  ? -3.801  9.213   13.810  1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1203  H HA3  . GLY A 1 79  ? -5.455  8.829   13.378  1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1204  N N    . GLY A 1 80  ? -4.139  6.060   13.456  1.00 0.00 ? 80  GLY A N    1  
ATOM 1205  C CA   . GLY A 1 80  ? -4.033  4.760   14.097  1.00 0.00 ? 80  GLY A CA   1  
ATOM 1206  C C    . GLY A 1 80  ? -2.668  4.125   13.826  1.00 0.00 ? 80  GLY A C    1  
ATOM 1207  O O    . GLY A 1 80  ? -2.255  3.208   14.534  1.00 0.00 ? 80  GLY A O    1  
ATOM 1208  H H    . GLY A 1 80  ? -4.045  6.050   12.461  1.00 0.00 ? 80  GLY A H    1  
ATOM 1209  H HA2  . GLY A 1 80  ? -4.182  4.867   15.172  1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1210  H HA3  . GLY A 1 80  ? -4.822  4.104   13.730  1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1211  N N    . LYS A 1 81  ? -2.006  4.637   12.799  1.00 0.00 ? 81  LYS A N    1  
ATOM 1212  C CA   . LYS A 1 81  ? -0.696  4.131   12.426  1.00 0.00 ? 81  LYS A CA   1  
ATOM 1213  C C    . LYS A 1 81  ? 0.300   5.292   12.380  1.00 0.00 ? 81  LYS A C    1  
ATOM 1214  O O    . LYS A 1 81  ? 0.882   5.656   13.400  1.00 0.00 ? 81  LYS A O    1  
ATOM 1215  C CB   . LYS A 1 81  ? -0.779  3.339   11.119  1.00 0.00 ? 81  LYS A CB   1  
ATOM 1216  C CG   . LYS A 1 81  ? -2.181  3.430   10.513  1.00 0.00 ? 81  LYS A CG   1  
ATOM 1217  C CD   . LYS A 1 81  ? -3.153  2.496   11.238  1.00 0.00 ? 81  LYS A CD   1  
ATOM 1218  C CE   . LYS A 1 81  ? -4.564  3.090   11.267  1.00 0.00 ? 81  LYS A CE   1  
ATOM 1219  N NZ   . LYS A 1 81  ? -5.382  2.430   12.308  1.00 0.00 ? 81  LYS A NZ   1  
ATOM 1220  H H    . LYS A 1 81  ? -2.349  5.384   12.229  1.00 0.00 ? 81  LYS A H    1  
ATOM 1221  H HA   . LYS A 1 81  ? -0.380  3.436   13.204  1.00 0.00 ? 81  LYS A HA   1  
ATOM 1222  H HB2  . LYS A 1 81  ? -0.046  3.723   10.410  1.00 0.00 ? 81  LYS A HB2  1  
ATOM 1223  H HB3  . LYS A 1 81  ? -0.526  2.296   11.305  1.00 0.00 ? 81  LYS A HB3  1  
ATOM 1224  H HG2  . LYS A 1 81  ? -2.542  4.456   10.574  1.00 0.00 ? 81  LYS A HG2  1  
ATOM 1225  H HG3  . LYS A 1 81  ? -2.141  3.169   9.455   1.00 0.00 ? 81  LYS A HG3  1  
ATOM 1226  H HD2  . LYS A 1 81  ? -3.173  1.527   10.739  1.00 0.00 ? 81  LYS A HD2  1  
ATOM 1227  H HD3  . LYS A 1 81  ? -2.806  2.324   12.257  1.00 0.00 ? 81  LYS A HD3  1  
ATOM 1228  H HE2  . LYS A 1 81  ? -4.510  4.160   11.462  1.00 0.00 ? 81  LYS A HE2  1  
ATOM 1229  H HE3  . LYS A 1 81  ? -5.037  2.966   10.293  1.00 0.00 ? 81  LYS A HE3  1  
ATOM 1230  H HZ1  . LYS A 1 81  ? -4.825  2.284   13.127  1.00 0.00 ? 81  LYS A HZ1  1  
ATOM 1231  H HZ2  . LYS A 1 81  ? -6.164  3.010   12.536  1.00 0.00 ? 81  LYS A HZ2  1  
ATOM 1232  H HZ3  . LYS A 1 81  ? -5.709  1.548   11.967  1.00 0.00 ? 81  LYS A HZ3  1  
ATOM 1233  N N    . LYS A 1 82  ? 0.465   5.841   11.185  1.00 0.00 ? 82  LYS A N    1  
ATOM 1234  C CA   . LYS A 1 82  ? 1.380   6.952   10.991  1.00 0.00 ? 82  LYS A CA   1  
ATOM 1235  C C    . LYS A 1 82  ? 1.666   7.118   9.497   1.00 0.00 ? 82  LYS A C    1  
ATOM 1236  O O    . LYS A 1 82  ? 1.011   7.910   8.821   1.00 0.00 ? 82  LYS A O    1  
ATOM 1237  C CB   . LYS A 1 82  ? 2.639   6.764   11.841  1.00 0.00 ? 82  LYS A CB   1  
ATOM 1238  C CG   . LYS A 1 82  ? 3.148   5.324   11.756  1.00 0.00 ? 82  LYS A CG   1  
ATOM 1239  C CD   . LYS A 1 82  ? 3.286   4.709   13.150  1.00 0.00 ? 82  LYS A CD   1  
ATOM 1240  C CE   . LYS A 1 82  ? 2.418   3.456   13.285  1.00 0.00 ? 82  LYS A CE   1  
ATOM 1241  N NZ   . LYS A 1 82  ? 3.209   2.334   13.839  1.00 0.00 ? 82  LYS A NZ   1  
ATOM 1242  H H    . LYS A 1 82  ? -0.013  5.538   10.359  1.00 0.00 ? 82  LYS A H    1  
ATOM 1243  H HA   . LYS A 1 82  ? 0.881   7.852   11.350  1.00 0.00 ? 82  LYS A HA   1  
ATOM 1244  H HB2  . LYS A 1 82  ? 3.416   7.449   11.503  1.00 0.00 ? 82  LYS A HB2  1  
ATOM 1245  H HB3  . LYS A 1 82  ? 2.422   7.017   12.879  1.00 0.00 ? 82  LYS A HB3  1  
ATOM 1246  H HG2  . LYS A 1 82  ? 2.460   4.727   11.158  1.00 0.00 ? 82  LYS A HG2  1  
ATOM 1247  H HG3  . LYS A 1 82  ? 4.111   5.305   11.249  1.00 0.00 ? 82  LYS A HG3  1  
ATOM 1248  H HD2  . LYS A 1 82  ? 4.330   4.454   13.338  1.00 0.00 ? 82  LYS A HD2  1  
ATOM 1249  H HD3  . LYS A 1 82  ? 2.996   5.439   13.905  1.00 0.00 ? 82  LYS A HD3  1  
ATOM 1250  H HE2  . LYS A 1 82  ? 1.566   3.664   13.932  1.00 0.00 ? 82  LYS A HE2  1  
ATOM 1251  H HE3  . LYS A 1 82  ? 2.016   3.178   12.311  1.00 0.00 ? 82  LYS A HE3  1  
ATOM 1252  H HZ1  . LYS A 1 82  ? 4.099   2.297   13.386  1.00 0.00 ? 82  LYS A HZ1  1  
ATOM 1253  H HZ2  . LYS A 1 82  ? 3.340   2.473   14.821  1.00 0.00 ? 82  LYS A HZ2  1  
ATOM 1254  H HZ3  . LYS A 1 82  ? 2.721   1.475   13.687  1.00 0.00 ? 82  LYS A HZ3  1  
ATOM 1255  N N    . GLU A 1 83  ? 2.645   6.359   9.027   1.00 0.00 ? 83  GLU A N    1  
ATOM 1256  C CA   . GLU A 1 83  ? 3.026   6.412   7.625   1.00 0.00 ? 83  GLU A CA   1  
ATOM 1257  C C    . GLU A 1 83  ? 3.468   5.029   7.143   1.00 0.00 ? 83  GLU A C    1  
ATOM 1258  O O    . GLU A 1 83  ? 3.880   4.192   7.944   1.00 0.00 ? 83  GLU A O    1  
ATOM 1259  C CB   . GLU A 1 83  ? 4.124   7.451   7.395   1.00 0.00 ? 83  GLU A CB   1  
ATOM 1260  C CG   . GLU A 1 83  ? 3.914   8.679   8.284   1.00 0.00 ? 83  GLU A CG   1  
ATOM 1261  C CD   . GLU A 1 83  ? 4.543   8.470   9.664   1.00 0.00 ? 83  GLU A CD   1  
ATOM 1262  O OE1  . GLU A 1 83  ? 5.139   7.390   9.858   1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1263  O OE2  . GLU A 1 83  ? 4.412   9.396   10.493  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1264  H H    . GLU A 1 83  ? 3.172   5.718   9.584   1.00 0.00 ? 83  GLU A H    1  
ATOM 1265  H HA   . GLU A 1 83  ? 2.125   6.719   7.093   1.00 0.00 ? 83  GLU A HA   1  
ATOM 1266  H HB2  . GLU A 1 83  ? 5.098   7.009   7.604   1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1267  H HB3  . GLU A 1 83  ? 4.130   7.753   6.348   1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1268  H HG2  . GLU A 1 83  ? 4.353   9.556   7.809   1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1269  H HG3  . GLU A 1 83  ? 2.847   8.875   8.393   1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1270  N N    . TYR A 1 84  ? 3.367   4.834   5.837   1.00 0.00 ? 84  TYR A N    1  
ATOM 1271  C CA   . TYR A 1 84  ? 3.752   3.566   5.238   1.00 0.00 ? 84  TYR A CA   1  
ATOM 1272  C C    . TYR A 1 84  ? 4.446   3.784   3.892   1.00 0.00 ? 84  TYR A C    1  
ATOM 1273  O O    . TYR A 1 84  ? 4.184   4.773   3.208   1.00 0.00 ? 84  TYR A O    1  
ATOM 1274  C CB   . TYR A 1 84  ? 2.451   2.795   5.009   1.00 0.00 ? 84  TYR A CB   1  
ATOM 1275  C CG   . TYR A 1 84  ? 1.411   3.561   4.188   1.00 0.00 ? 84  TYR A CG   1  
ATOM 1276  C CD1  . TYR A 1 84  ? 1.685   3.914   2.883   1.00 0.00 ? 84  TYR A CD1  1  
ATOM 1277  C CD2  . TYR A 1 84  ? 0.197   3.897   4.753   1.00 0.00 ? 84  TYR A CD2  1  
ATOM 1278  C CE1  . TYR A 1 84  ? 0.706   4.633   2.111   1.00 0.00 ? 84  TYR A CE1  1  
ATOM 1279  C CE2  . TYR A 1 84  ? -0.782  4.617   3.981   1.00 0.00 ? 84  TYR A CE2  1  
ATOM 1280  C CZ   . TYR A 1 84  ? -0.479  4.950   2.698   1.00 0.00 ? 84  TYR A CZ   1  
ATOM 1281  O OH   . TYR A 1 84  ? -1.404  5.630   1.968   1.00 0.00 ? 84  TYR A OH   1  
ATOM 1282  H H    . TYR A 1 84  ? 3.031   5.520   5.193   1.00 0.00 ? 84  TYR A H    1  
ATOM 1283  H HA   . TYR A 1 84  ? 4.444   3.070   5.918   1.00 0.00 ? 84  TYR A HA   1  
ATOM 1284  H HB2  . TYR A 1 84  ? 2.680   1.858   4.503   1.00 0.00 ? 84  TYR A HB2  1  
ATOM 1285  H HB3  . TYR A 1 84  ? 2.018   2.539   5.976   1.00 0.00 ? 84  TYR A HB3  1  
ATOM 1286  H HD1  . TYR A 1 84  ? 2.644   3.648   2.437   1.00 0.00 ? 84  TYR A HD1  1  
ATOM 1287  H HD2  . TYR A 1 84  ? -0.020  3.618   5.784   1.00 0.00 ? 84  TYR A HD2  1  
ATOM 1288  H HE1  . TYR A 1 84  ? 0.911   4.919   1.079   1.00 0.00 ? 84  TYR A HE1  1  
ATOM 1289  H HE2  . TYR A 1 84  ? -1.744  4.889   4.415   1.00 0.00 ? 84  TYR A HE2  1  
ATOM 1290  H HH   . TYR A 1 84  ? -1.777  5.039   1.254   1.00 0.00 ? 84  TYR A HH   1  
ATOM 1291  N N    . LEU A 1 85  ? 5.317   2.845   3.552   1.00 0.00 ? 85  LEU A N    1  
ATOM 1292  C CA   . LEU A 1 85  ? 6.050   2.923   2.300   1.00 0.00 ? 85  LEU A CA   1  
ATOM 1293  C C    . LEU A 1 85  ? 5.174   2.384   1.167   1.00 0.00 ? 85  LEU A C    1  
ATOM 1294  O O    . LEU A 1 85  ? 5.616   2.298   0.023   1.00 0.00 ? 85  LEU A O    1  
ATOM 1295  C CB   . LEU A 1 85  ? 7.399   2.213   2.424   1.00 0.00 ? 85  LEU A CB   1  
ATOM 1296  C CG   . LEU A 1 85  ? 7.349   0.751   2.873   1.00 0.00 ? 85  LEU A CG   1  
ATOM 1297  C CD1  . LEU A 1 85  ? 7.461   0.641   4.395   1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1298  C CD2  . LEU A 1 85  ? 6.095   0.056   2.338   1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1299  H H    . LEU A 1 85  ? 5.524   2.046   4.114   1.00 0.00 ? 85  LEU A H    1  
ATOM 1300  H HA   . LEU A 1 85  ? 6.256   3.975   2.107   1.00 0.00 ? 85  LEU A HA   1  
ATOM 1301  H HB2  . LEU A 1 85  ? 7.902   2.259   1.458   1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1302  H HB3  . LEU A 1 85  ? 8.016   2.768   3.131   1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1303  H HG   . LEU A 1 85  ? 8.209   0.234   2.449   1.00 0.00 ? 85  LEU A HG   1  
ATOM 1304  H HD11 . LEU A 1 85  ? 7.830   1.582   4.801   1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1305  H HD12 . LEU A 1 85  ? 6.480   0.423   4.817   1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1306  H HD13 . LEU A 1 85  ? 8.153   -0.162  4.651   1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1307  H HD21 . LEU A 1 85  ? 5.209   0.570   2.710   1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1308  H HD22 . LEU A 1 85  ? 6.101   0.084   1.249   1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1309  H HD23 . LEU A 1 85  ? 6.082   -0.980  2.676   1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1310  N N    . ILE A 1 86  ? 3.946   2.036   1.526   1.00 0.00 ? 86  ILE A N    1  
ATOM 1311  C CA   . ILE A 1 86  ? 3.004   1.509   0.554   1.00 0.00 ? 86  ILE A CA   1  
ATOM 1312  C C    . ILE A 1 86  ? 3.739   1.220   -0.757  1.00 0.00 ? 86  ILE A C    1  
ATOM 1313  O O    . ILE A 1 86  ? 4.081   2.140   -1.498  1.00 0.00 ? 86  ILE A O    1  
ATOM 1314  C CB   . ILE A 1 86  ? 1.812   2.455   0.394   1.00 0.00 ? 86  ILE A CB   1  
ATOM 1315  C CG1  . ILE A 1 86  ? 0.562   1.880   1.064   1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1316  C CG2  . ILE A 1 86  ? 1.570   2.790   -1.079  1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1317  C CD1  . ILE A 1 86  ? 0.879   1.367   2.470   1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1318  H H    . ILE A 1 86  ? 3.594   2.111   2.458   1.00 0.00 ? 86  ILE A H    1  
ATOM 1319  H HA   . ILE A 1 86  ? 2.619   0.569   0.948   1.00 0.00 ? 86  ILE A HA   1  
ATOM 1320  H HB   . ILE A 1 86  ? 2.048   3.390   0.902   1.00 0.00 ? 86  ILE A HB   1  
ATOM 1321  H HG12 . ILE A 1 86  ? -0.211  2.646   1.118   1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1322  H HG13 . ILE A 1 86  ? 0.163   1.065   0.458   1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1323  H HG21 . ILE A 1 86  ? 1.787   1.914   -1.691  1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1324  H HG22 . ILE A 1 86  ? 0.530   3.082   -1.219  1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1325  H HG23 . ILE A 1 86  ? 2.222   3.611   -1.376  1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1326  H HD11 . ILE A 1 86  ? 1.919   1.591   2.712   1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1327  H HD12 . ILE A 1 86  ? 0.225   1.857   3.192   1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1328  H HD13 . ILE A 1 86  ? 0.722   0.290   2.509   1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1329  N N    . ALA A 1 87  ? 3.958   -0.063  -1.004  1.00 0.00 ? 87  ALA A N    1  
ATOM 1330  C CA   . ALA A 1 87  ? 4.646   -0.486  -2.212  1.00 0.00 ? 87  ALA A CA   1  
ATOM 1331  C C    . ALA A 1 87  ? 3.862   -1.623  -2.870  1.00 0.00 ? 87  ALA A C    1  
ATOM 1332  O O    . ALA A 1 87  ? 3.776   -2.721  -2.321  1.00 0.00 ? 87  ALA A O    1  
ATOM 1333  C CB   . ALA A 1 87  ? 6.081   -0.890  -1.869  1.00 0.00 ? 87  ALA A CB   1  
ATOM 1334  H H    . ALA A 1 87  ? 3.677   -0.807  -0.397  1.00 0.00 ? 87  ALA A H    1  
ATOM 1335  H HA   . ALA A 1 87  ? 4.675   0.365   -2.893  1.00 0.00 ? 87  ALA A HA   1  
ATOM 1336  H HB1  . ALA A 1 87  ? 6.135   -1.181  -0.820  1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1337  H HB2  . ALA A 1 87  ? 6.382   -1.731  -2.494  1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1338  H HB3  . ALA A 1 87  ? 6.749   -0.047  -2.048  1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1339  N N    . GLY A 1 88  ? 3.308   -1.321  -4.035  1.00 0.00 ? 88  GLY A N    1  
ATOM 1340  C CA   . GLY A 1 88  ? 2.534   -2.304  -4.773  1.00 0.00 ? 88  GLY A CA   1  
ATOM 1341  C C    . GLY A 1 88  ? 2.716   -2.127  -6.281  1.00 0.00 ? 88  GLY A C    1  
ATOM 1342  O O    . GLY A 1 88  ? 3.332   -1.159  -6.726  1.00 0.00 ? 88  GLY A O    1  
ATOM 1343  H H    . GLY A 1 88  ? 3.383   -0.426  -4.474  1.00 0.00 ? 88  GLY A H    1  
ATOM 1344  H HA2  . GLY A 1 88  ? 2.843   -3.309  -4.482  1.00 0.00 ? 88  GLY A HA2  1  
ATOM 1345  H HA3  . GLY A 1 88  ? 1.479   -2.208  -4.516  1.00 0.00 ? 88  GLY A HA3  1  
ATOM 1346  N N    . LYS A 1 89  ? 2.169   -3.076  -7.028  1.00 0.00 ? 89  LYS A N    1  
ATOM 1347  C CA   . LYS A 1 89  ? 2.264   -3.035  -8.477  1.00 0.00 ? 89  LYS A CA   1  
ATOM 1348  C C    . LYS A 1 89  ? 2.002   -1.608  -8.962  1.00 0.00 ? 89  LYS A C    1  
ATOM 1349  O O    . LYS A 1 89  ? 2.517   -1.198  -10.000 1.00 0.00 ? 89  LYS A O    1  
ATOM 1350  C CB   . LYS A 1 89  ? 1.336   -4.079  -9.103  1.00 0.00 ? 89  LYS A CB   1  
ATOM 1351  C CG   . LYS A 1 89  ? -0.113  -3.857  -8.664  1.00 0.00 ? 89  LYS A CG   1  
ATOM 1352  C CD   . LYS A 1 89  ? -0.772  -5.178  -8.261  1.00 0.00 ? 89  LYS A CD   1  
ATOM 1353  C CE   . LYS A 1 89  ? -1.819  -4.957  -7.167  1.00 0.00 ? 89  LYS A CE   1  
ATOM 1354  N NZ   . LYS A 1 89  ? -3.151  -5.410  -7.625  1.00 0.00 ? 89  LYS A NZ   1  
ATOM 1355  H H    . LYS A 1 89  ? 1.671   -3.859  -6.658  1.00 0.00 ? 89  LYS A H    1  
ATOM 1356  H HA   . LYS A 1 89  ? 3.284   -3.310  -8.745  1.00 0.00 ? 89  LYS A HA   1  
ATOM 1357  H HB2  . LYS A 1 89  ? 1.403   -4.025  -10.190 1.00 0.00 ? 89  LYS A HB2  1  
ATOM 1358  H HB3  . LYS A 1 89  ? 1.659   -5.079  -8.813  1.00 0.00 ? 89  LYS A HB3  1  
ATOM 1359  H HG2  . LYS A 1 89  ? -0.140  -3.162  -7.825  1.00 0.00 ? 89  LYS A HG2  1  
ATOM 1360  H HG3  . LYS A 1 89  ? -0.677  -3.398  -9.475  1.00 0.00 ? 89  LYS A HG3  1  
ATOM 1361  H HD2  . LYS A 1 89  ? -1.242  -5.634  -9.132  1.00 0.00 ? 89  LYS A HD2  1  
ATOM 1362  H HD3  . LYS A 1 89  ? -0.012  -5.874  -7.907  1.00 0.00 ? 89  LYS A HD3  1  
ATOM 1363  H HE2  . LYS A 1 89  ? -1.532  -5.502  -6.266  1.00 0.00 ? 89  LYS A HE2  1  
ATOM 1364  H HE3  . LYS A 1 89  ? -1.858  -3.900  -6.901  1.00 0.00 ? 89  LYS A HE3  1  
ATOM 1365  H HZ1  . LYS A 1 89  ? -3.051  -5.945  -8.465  1.00 0.00 ? 89  LYS A HZ1  1  
ATOM 1366  H HZ2  . LYS A 1 89  ? -3.572  -5.977  -6.917  1.00 0.00 ? 89  LYS A HZ2  1  
ATOM 1367  H HZ3  . LYS A 1 89  ? -3.730  -4.614  -7.804  1.00 0.00 ? 89  LYS A HZ3  1  
ATOM 1368  N N    . ALA A 1 90  ? 1.201   -0.892  -8.186  1.00 0.00 ? 90  ALA A N    1  
ATOM 1369  C CA   . ALA A 1 90  ? 0.864   0.480   -8.523  1.00 0.00 ? 90  ALA A CA   1  
ATOM 1370  C C    . ALA A 1 90  ? -0.224  0.484   -9.599  1.00 0.00 ? 90  ALA A C    1  
ATOM 1371  O O    . ALA A 1 90  ? -0.626  -0.572  -10.085 1.00 0.00 ? 90  ALA A O    1  
ATOM 1372  C CB   . ALA A 1 90  ? 2.127   1.222   -8.970  1.00 0.00 ? 90  ALA A CB   1  
ATOM 1373  H H    . ALA A 1 90  ? 0.787   -1.234  -7.343  1.00 0.00 ? 90  ALA A H    1  
ATOM 1374  H HA   . ALA A 1 90  ? 0.477   0.958   -7.624  1.00 0.00 ? 90  ALA A HA   1  
ATOM 1375  H HB1  . ALA A 1 90  ? 2.996   0.581   -8.820  1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1376  H HB2  . ALA A 1 90  ? 2.043   1.479   -10.025 1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1377  H HB3  . ALA A 1 90  ? 2.241   2.131   -8.381  1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1378  N N    . GLU A 1 91  ? -0.670  1.684   -9.940  1.00 0.00 ? 91  GLU A N    1  
ATOM 1379  C CA   . GLU A 1 91  ? -1.704  1.840   -10.948 1.00 0.00 ? 91  GLU A CA   1  
ATOM 1380  C C    . GLU A 1 91  ? -1.359  2.996   -11.888 1.00 0.00 ? 91  GLU A C    1  
ATOM 1381  O O    . GLU A 1 91  ? -2.187  3.412   -12.698 1.00 0.00 ? 91  GLU A O    1  
ATOM 1382  C CB   . GLU A 1 91  ? -3.074  2.050   -10.300 1.00 0.00 ? 91  GLU A CB   1  
ATOM 1383  C CG   . GLU A 1 91  ? -4.194  1.536   -11.208 1.00 0.00 ? 91  GLU A CG   1  
ATOM 1384  C CD   . GLU A 1 91  ? -4.036  0.038   -11.479 1.00 0.00 ? 91  GLU A CD   1  
ATOM 1385  O OE1  . GLU A 1 91  ? -3.919  -0.710  -10.484 1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1386  O OE2  . GLU A 1 91  ? -4.034  -0.325  -12.675 1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1387  H H    . GLU A 1 91  ? -0.338  2.539   -9.540  1.00 0.00 ? 91  GLU A H    1  
ATOM 1388  H HA   . GLU A 1 91  ? -1.712  0.902   -11.503 1.00 0.00 ? 91  GLU A HA   1  
ATOM 1389  H HB2  . GLU A 1 91  ? -3.111  1.532   -9.342  1.00 0.00 ? 91  GLU A HB2  1  
ATOM 1390  H HB3  . GLU A 1 91  ? -3.226  3.110   -10.097 1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1391  H HG2  . GLU A 1 91  ? -5.161  1.723   -10.741 1.00 0.00 ? 91  GLU A HG2  1  
ATOM 1392  H HG3  . GLU A 1 91  ? -4.185  2.083   -12.150 1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1393  N N    . GLY A 1 92  ? -0.135  3.484   -11.750 1.00 0.00 ? 92  GLY A N    1  
ATOM 1394  C CA   . GLY A 1 92  ? 0.330   4.584   -12.579 1.00 0.00 ? 92  GLY A CA   1  
ATOM 1395  C C    . GLY A 1 92  ? 0.881   5.723   -11.717 1.00 0.00 ? 92  GLY A C    1  
ATOM 1396  O O    . GLY A 1 92  ? 1.825   5.528   -10.955 1.00 0.00 ? 92  GLY A O    1  
ATOM 1397  H H    . GLY A 1 92  ? 0.532   3.140   -11.091 1.00 0.00 ? 92  GLY A H    1  
ATOM 1398  H HA2  . GLY A 1 92  ? 1.104   4.230   -13.259 1.00 0.00 ? 92  GLY A HA2  1  
ATOM 1399  H HA3  . GLY A 1 92  ? -0.490  4.953   -13.194 1.00 0.00 ? 92  GLY A HA3  1  
ATOM 1400  N N    . ASP A 1 93  ? 0.266   6.886   -11.869 1.00 0.00 ? 93  ASP A N    1  
ATOM 1401  C CA   . ASP A 1 93  ? 0.684   8.056   -11.115 1.00 0.00 ? 93  ASP A CA   1  
ATOM 1402  C C    . ASP A 1 93  ? -0.550  8.743   -10.523 1.00 0.00 ? 93  ASP A C    1  
ATOM 1403  O O    . ASP A 1 93  ? -1.602  8.791   -11.158 1.00 0.00 ? 93  ASP A O    1  
ATOM 1404  C CB   . ASP A 1 93  ? 1.401   9.065   -12.014 1.00 0.00 ? 93  ASP A CB   1  
ATOM 1405  C CG   . ASP A 1 93  ? 2.909   9.175   -11.788 1.00 0.00 ? 93  ASP A CG   1  
ATOM 1406  O OD1  . ASP A 1 93  ? 3.287   9.536   -10.652 1.00 0.00 ? 93  ASP A OD1  1  
ATOM 1407  O OD2  . ASP A 1 93  ? 3.650   8.898   -12.755 1.00 0.00 ? 93  ASP A OD2  1  
ATOM 1408  H H    . ASP A 1 93  ? -0.501  7.037   -12.492 1.00 0.00 ? 93  ASP A H    1  
ATOM 1409  H HA   . ASP A 1 93  ? 1.357   7.677   -10.347 1.00 0.00 ? 93  ASP A HA   1  
ATOM 1410  H HB2  . ASP A 1 93  ? 1.223   8.791   -13.055 1.00 0.00 ? 93  ASP A HB2  1  
ATOM 1411  H HB3  . ASP A 1 93  ? 0.952   10.047  -11.863 1.00 0.00 ? 93  ASP A HB3  1  
ATOM 1412  N N    . GLY A 1 94  ? -0.377  9.257   -9.314  1.00 0.00 ? 94  GLY A N    1  
ATOM 1413  C CA   . GLY A 1 94  ? -1.463  9.939   -8.630  1.00 0.00 ? 94  GLY A CA   1  
ATOM 1414  C C    . GLY A 1 94  ? -2.458  8.935   -8.044  1.00 0.00 ? 94  GLY A C    1  
ATOM 1415  O O    . GLY A 1 94  ? -3.412  9.322   -7.371  1.00 0.00 ? 94  GLY A O    1  
ATOM 1416  H H    . GLY A 1 94  ? 0.481   9.214   -8.805  1.00 0.00 ? 94  GLY A H    1  
ATOM 1417  H HA2  . GLY A 1 94  ? -1.061  10.564  -7.834  1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1418  H HA3  . GLY A 1 94  ? -1.977  10.602  -9.327  1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1419  N N    . LYS A 1 95  ? -2.202  7.666   -8.323  1.00 0.00 ? 95  LYS A N    1  
ATOM 1420  C CA   . LYS A 1 95  ? -3.063  6.603   -7.831  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1421  C C    . LYS A 1 95  ? -2.425  5.249   -8.145  1.00 0.00 ? 95  LYS A C    1  
ATOM 1422  O O    . LYS A 1 95  ? -1.869  5.056   -9.225  1.00 0.00 ? 95  LYS A O    1  
ATOM 1423  C CB   . LYS A 1 95  ? -4.479  6.760   -8.389  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1424  C CG   . LYS A 1 95  ? -4.575  6.193   -9.807  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1425  C CD   . LYS A 1 95  ? -4.023  7.185   -10.832 1.00 0.00 ? 95  LYS A CD   1  
ATOM 1426  C CE   . LYS A 1 95  ? -3.140  6.476   -11.861 1.00 0.00 ? 95  LYS A CE   1  
ATOM 1427  N NZ   . LYS A 1 95  ? -3.334  7.065   -13.205 1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1428  H H    . LYS A 1 95  ? -1.424  7.359   -8.871  1.00 0.00 ? 95  LYS A H    1  
ATOM 1429  H HA   . LYS A 1 95  ? -3.130  6.711   -6.748  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1430  H HB2  . LYS A 1 95  ? -5.189  6.248   -7.739  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1431  H HB3  . LYS A 1 95  ? -4.757  7.815   -8.395  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1432  H HG2  . LYS A 1 95  ? -4.022  5.256   -9.866  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1433  H HG3  . LYS A 1 95  ? -5.616  5.964   -10.041 1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1434  H HD2  . LYS A 1 95  ? -4.848  7.686   -11.340 1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1435  H HD3  . LYS A 1 95  ? -3.446  7.957   -10.323 1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1436  H HE2  . LYS A 1 95  ? -2.094  6.557   -11.569 1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1437  H HE3  . LYS A 1 95  ? -3.382  5.413   -11.885 1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1438  H HZ1  . LYS A 1 95  ? -4.311  7.157   -13.391 1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1439  H HZ2  . LYS A 1 95  ? -2.902  7.966   -13.239 1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1440  H HZ3  . LYS A 1 95  ? -2.918  6.469   -13.892 1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1441  N N    . MET A 1 96  ? -2.526  4.345   -7.182  1.00 0.00 ? 96  MET A N    1  
ATOM 1442  C CA   . MET A 1 96  ? -1.966  3.014   -7.342  1.00 0.00 ? 96  MET A CA   1  
ATOM 1443  C C    . MET A 1 96  ? -2.847  1.962   -6.665  1.00 0.00 ? 96  MET A C    1  
ATOM 1444  O O    . MET A 1 96  ? -3.949  2.269   -6.212  1.00 0.00 ? 96  MET A O    1  
ATOM 1445  C CB   . MET A 1 96  ? -0.563  2.974   -6.733  1.00 0.00 ? 96  MET A CB   1  
ATOM 1446  C CG   . MET A 1 96  ? -0.459  3.918   -5.534  1.00 0.00 ? 96  MET A CG   1  
ATOM 1447  S SD   . MET A 1 96  ? 0.224   3.051   -4.131  1.00 0.00 ? 96  MET A SD   1  
ATOM 1448  C CE   . MET A 1 96  ? 1.812   3.856   -4.011  1.00 0.00 ? 96  MET A CE   1  
ATOM 1449  H H    . MET A 1 96  ? -2.980  4.510   -6.306  1.00 0.00 ? 96  MET A H    1  
ATOM 1450  H HA   . MET A 1 96  ? -1.937  2.836   -8.417  1.00 0.00 ? 96  MET A HA   1  
ATOM 1451  H HB2  . MET A 1 96  ? -0.328  1.956   -6.421  1.00 0.00 ? 96  MET A HB2  1  
ATOM 1452  H HB3  . MET A 1 96  ? 0.173   3.254   -7.486  1.00 0.00 ? 96  MET A HB3  1  
ATOM 1453  H HG2  . MET A 1 96  ? 0.171   4.771   -5.785  1.00 0.00 ? 96  MET A HG2  1  
ATOM 1454  H HG3  . MET A 1 96  ? -1.444  4.312   -5.284  1.00 0.00 ? 96  MET A HG3  1  
ATOM 1455  H HE1  . MET A 1 96  ? 2.142   4.159   -5.004  1.00 0.00 ? 96  MET A HE1  1  
ATOM 1456  H HE2  . MET A 1 96  ? 1.726   4.735   -3.373  1.00 0.00 ? 96  MET A HE2  1  
ATOM 1457  H HE3  . MET A 1 96  ? 2.538   3.165   -3.583  1.00 0.00 ? 96  MET A HE3  1  
ATOM 1458  N N    . HIS A 1 97  ? -2.329  0.744   -6.617  1.00 0.00 ? 97  HIS A N    1  
ATOM 1459  C CA   . HIS A 1 97  ? -3.055  -0.354  -6.002  1.00 0.00 ? 97  HIS A CA   1  
ATOM 1460  C C    . HIS A 1 97  ? -2.209  -0.966  -4.884  1.00 0.00 ? 97  HIS A C    1  
ATOM 1461  O O    . HIS A 1 97  ? -1.047  -1.311  -5.098  1.00 0.00 ? 97  HIS A O    1  
ATOM 1462  C CB   . HIS A 1 97  ? -3.480  -1.381  -7.055  1.00 0.00 ? 97  HIS A CB   1  
ATOM 1463  C CG   . HIS A 1 97  ? -4.949  -1.335  -7.399  1.00 0.00 ? 97  HIS A CG   1  
ATOM 1464  N ND1  . HIS A 1 97  ? -5.618  -2.400  -7.976  1.00 0.00 ? 97  HIS A ND1  1  
ATOM 1465  C CD2  . HIS A 1 97  ? -5.871  -0.342  -7.242  1.00 0.00 ? 97  HIS A CD2  1  
ATOM 1466  C CE1  . HIS A 1 97  ? -6.884  -2.053  -8.153  1.00 0.00 ? 97  HIS A CE1  1  
ATOM 1467  N NE2  . HIS A 1 97  ? -7.038  -0.776  -7.699  1.00 0.00 ? 97  HIS A NE2  1  
ATOM 1468  H H    . HIS A 1 97  ? -1.432  0.504   -6.988  1.00 0.00 ? 97  HIS A H    1  
ATOM 1469  H HA   . HIS A 1 97  ? -3.960  0.073   -5.570  1.00 0.00 ? 97  HIS A HA   1  
ATOM 1470  H HB2  . HIS A 1 97  ? -2.899  -1.217  -7.963  1.00 0.00 ? 97  HIS A HB2  1  
ATOM 1471  H HB3  . HIS A 1 97  ? -3.233  -2.379  -6.694  1.00 0.00 ? 97  HIS A HB3  1  
ATOM 1472  H HD1  . HIS A 1 97  ? -5.214  -3.282  -8.217  1.00 0.00 ? 97  HIS A HD1  1  
ATOM 1473  H HD2  . HIS A 1 97  ? -5.681  0.643   -6.813  1.00 0.00 ? 97  HIS A HD2  1  
ATOM 1474  H HE1  . HIS A 1 97  ? -7.665  -2.678  -8.587  1.00 0.00 ? 97  HIS A HE1  1  
ATOM 1475  N N    . ILE A 1 98  ? -2.825  -1.085  -3.717  1.00 0.00 ? 98  ILE A N    1  
ATOM 1476  C CA   . ILE A 1 98  ? -2.142  -1.650  -2.565  1.00 0.00 ? 98  ILE A CA   1  
ATOM 1477  C C    . ILE A 1 98  ? -3.123  -2.517  -1.773  1.00 0.00 ? 98  ILE A C    1  
ATOM 1478  O O    . ILE A 1 98  ? -4.253  -2.105  -1.516  1.00 0.00 ? 98  ILE A O    1  
ATOM 1479  C CB   . ILE A 1 98  ? -1.488  -0.544  -1.735  1.00 0.00 ? 98  ILE A CB   1  
ATOM 1480  C CG1  . ILE A 1 98  ? -2.541  0.263   -0.971  1.00 0.00 ? 98  ILE A CG1  1  
ATOM 1481  C CG2  . ILE A 1 98  ? -0.604  0.348   -2.608  1.00 0.00 ? 98  ILE A CG2  1  
ATOM 1482  C CD1  . ILE A 1 98  ? -1.938  1.549   -0.402  1.00 0.00 ? 98  ILE A CD1  1  
ATOM 1483  H H    . ILE A 1 98  ? -3.769  -0.802  -3.553  1.00 0.00 ? 98  ILE A H    1  
ATOM 1484  H HA   . ILE A 1 98  ? -1.342  -2.288  -2.940  1.00 0.00 ? 98  ILE A HA   1  
ATOM 1485  H HB   . ILE A 1 98  ? -0.841  -1.012  -0.993  1.00 0.00 ? 98  ILE A HB   1  
ATOM 1486  H HG12 . ILE A 1 98  ? -3.369  0.508   -1.636  1.00 0.00 ? 98  ILE A HG12 1  
ATOM 1487  H HG13 . ILE A 1 98  ? -2.950  -0.341  -0.161  1.00 0.00 ? 98  ILE A HG13 1  
ATOM 1488  H HG21 . ILE A 1 98  ? -0.219  -0.232  -3.447  1.00 0.00 ? 98  ILE A HG21 1  
ATOM 1489  H HG22 . ILE A 1 98  ? -1.192  1.185   -2.984  1.00 0.00 ? 98  ILE A HG22 1  
ATOM 1490  H HG23 . ILE A 1 98  ? 0.230   0.725   -2.015  1.00 0.00 ? 98  ILE A HG23 1  
ATOM 1491  H HD11 . ILE A 1 98  ? -1.003  1.771   -0.917  1.00 0.00 ? 98  ILE A HD11 1  
ATOM 1492  H HD12 . ILE A 1 98  ? -2.637  2.373   -0.547  1.00 0.00 ? 98  ILE A HD12 1  
ATOM 1493  H HD13 . ILE A 1 98  ? -1.745  1.420   0.663   1.00 0.00 ? 98  ILE A HD13 1  
ATOM 1494  N N    . THR A 1 99  ? -2.654  -3.701  -1.408  1.00 0.00 ? 99  THR A N    1  
ATOM 1495  C CA   . THR A 1 99  ? -3.476  -4.629  -0.650  1.00 0.00 ? 99  THR A CA   1  
ATOM 1496  C C    . THR A 1 99  ? -2.655  -5.279  0.466   1.00 0.00 ? 99  THR A C    1  
ATOM 1497  O O    . THR A 1 99  ? -1.427  -5.205  0.463   1.00 0.00 ? 99  THR A O    1  
ATOM 1498  C CB   . THR A 1 99  ? -4.075  -5.641  -1.630  1.00 0.00 ? 99  THR A CB   1  
ATOM 1499  O OG1  . THR A 1 99  ? -3.083  -5.769  -2.646  1.00 0.00 ? 99  THR A OG1  1  
ATOM 1500  C CG2  . THR A 1 99  ? -5.295  -5.087  -2.369  1.00 0.00 ? 99  THR A CG2  1  
ATOM 1501  H H    . THR A 1 99  ? -1.734  -4.028  -1.622  1.00 0.00 ? 99  THR A H    1  
ATOM 1502  H HA   . THR A 1 99  ? -4.278  -4.067  -0.172  1.00 0.00 ? 99  THR A HA   1  
ATOM 1503  H HB   . THR A 1 99  ? -4.315  -6.576  -1.126  1.00 0.00 ? 99  THR A HB   1  
ATOM 1504  H HG1  . THR A 1 99  ? -3.418  -6.360  -3.378  1.00 0.00 ? 99  THR A HG1  1  
ATOM 1505  H HG21 . THR A 1 99  ? -5.545  -4.104  -1.972  1.00 0.00 ? 99  THR A HG21 1  
ATOM 1506  H HG22 . THR A 1 99  ? -5.069  -5.003  -3.432  1.00 0.00 ? 99  THR A HG22 1  
ATOM 1507  H HG23 . THR A 1 99  ? -6.140  -5.761  -2.229  1.00 0.00 ? 99  THR A HG23 1  
ATOM 1508  N N    . LEU A 1 100 ? -3.366  -5.900  1.395   1.00 0.00 ? 100 LEU A N    1  
ATOM 1509  C CA   . LEU A 1 100 ? -2.719  -6.562  2.515   1.00 0.00 ? 100 LEU A CA   1  
ATOM 1510  C C    . LEU A 1 100 ? -1.790  -7.657  1.988   1.00 0.00 ? 100 LEU A C    1  
ATOM 1511  O O    . LEU A 1 100 ? -0.649  -7.775  2.432   1.00 0.00 ? 100 LEU A O    1  
ATOM 1512  C CB   . LEU A 1 100 ? -3.762  -7.068  3.514   1.00 0.00 ? 100 LEU A CB   1  
ATOM 1513  C CG   . LEU A 1 100 ? -4.221  -8.516  3.328   1.00 0.00 ? 100 LEU A CG   1  
ATOM 1514  C CD1  . LEU A 1 100 ? -4.526  -9.172  4.676   1.00 0.00 ? 100 LEU A CD1  1  
ATOM 1515  C CD2  . LEU A 1 100 ? -5.413  -8.594  2.370   1.00 0.00 ? 100 LEU A CD2  1  
ATOM 1516  H H    . LEU A 1 100 ? -4.364  -5.956  1.391   1.00 0.00 ? 100 LEU A H    1  
ATOM 1517  H HA   . LEU A 1 100 ? -2.116  -5.815  3.032   1.00 0.00 ? 100 LEU A HA   1  
ATOM 1518  H HB2  . LEU A 1 100 ? -3.354  -6.964  4.519   1.00 0.00 ? 100 LEU A HB2  1  
ATOM 1519  H HB3  . LEU A 1 100 ? -4.637  -6.419  3.456   1.00 0.00 ? 100 LEU A HB3  1  
ATOM 1520  H HG   . LEU A 1 100 ? -3.405  -9.077  2.873   1.00 0.00 ? 100 LEU A HG   1  
ATOM 1521  H HD11 . LEU A 1 100 ? -4.143  -8.544  5.480   1.00 0.00 ? 100 LEU A HD11 1  
ATOM 1522  H HD12 . LEU A 1 100 ? -5.604  -9.289  4.787   1.00 0.00 ? 100 LEU A HD12 1  
ATOM 1523  H HD13 . LEU A 1 100 ? -4.048  -10.150 4.719   1.00 0.00 ? 100 LEU A HD13 1  
ATOM 1524  H HD21 . LEU A 1 100 ? -5.191  -8.025  1.467   1.00 0.00 ? 100 LEU A HD21 1  
ATOM 1525  H HD22 . LEU A 1 100 ? -5.598  -9.635  2.106   1.00 0.00 ? 100 LEU A HD22 1  
ATOM 1526  H HD23 . LEU A 1 100 ? -6.296  -8.179  2.854   1.00 0.00 ? 100 LEU A HD23 1  
ATOM 1527  N N    . CYS A 1 101 ? -2.314  -8.431  1.048   1.00 0.00 ? 101 CYS A N    1  
ATOM 1528  C CA   . CYS A 1 101 ? -1.545  -9.512  0.456   1.00 0.00 ? 101 CYS A CA   1  
ATOM 1529  C C    . CYS A 1 101 ? -0.363  -8.903  -0.300  1.00 0.00 ? 101 CYS A C    1  
ATOM 1530  O O    . CYS A 1 101 ? 0.589   -9.605  -0.640  1.00 0.00 ? 101 CYS A O    1  
ATOM 1531  C CB   . CYS A 1 101 ? -2.411  -10.391 -0.450  1.00 0.00 ? 101 CYS A CB   1  
ATOM 1532  S SG   . CYS A 1 101 ? -2.150  -12.191 -0.250  1.00 0.00 ? 101 CYS A SG   1  
ATOM 1533  H H    . CYS A 1 101 ? -3.243  -8.328  0.693   1.00 0.00 ? 101 CYS A H    1  
ATOM 1534  H HA   . CYS A 1 101 ? -1.199  -10.138 1.279   1.00 0.00 ? 101 CYS A HA   1  
ATOM 1535  H HB2  . CYS A 1 101 ? -3.460  -10.167 -0.256  1.00 0.00 ? 101 CYS A HB2  1  
ATOM 1536  H HB3  . CYS A 1 101 ? -2.214  -10.123 -1.488  1.00 0.00 ? 101 CYS A HB3  1  
ATOM 1537  N N    . ASP A 1 102 ? -0.461  -7.605  -0.542  1.00 0.00 ? 102 ASP A N    1  
ATOM 1538  C CA   . ASP A 1 102 ? 0.588   -6.893  -1.252  1.00 0.00 ? 102 ASP A CA   1  
ATOM 1539  C C    . ASP A 1 102 ? 1.564   -6.290  -0.239  1.00 0.00 ? 102 ASP A C    1  
ATOM 1540  O O    . ASP A 1 102 ? 1.306   -6.308  0.964   1.00 0.00 ? 102 ASP A O    1  
ATOM 1541  C CB   . ASP A 1 102 ? 0.009   -5.751  -2.090  1.00 0.00 ? 102 ASP A CB   1  
ATOM 1542  C CG   . ASP A 1 102 ? 0.791   -5.425  -3.364  1.00 0.00 ? 102 ASP A CG   1  
ATOM 1543  O OD1  . ASP A 1 102 ? 1.899   -5.983  -3.510  1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1544  O OD2  . ASP A 1 102 ? 0.260   -4.625  -4.166  1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1545  H H    . ASP A 1 102 ? -1.239  -7.041  -0.262  1.00 0.00 ? 102 ASP A H    1  
ATOM 1546  H HA   . ASP A 1 102 ? 1.058   -7.640  -1.890  1.00 0.00 ? 102 ASP A HA   1  
ATOM 1547  H HB2  . ASP A 1 102 ? -1.015  -6.004  -2.363  1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1548  H HB3  . ASP A 1 102 ? -0.038  -4.854  -1.471  1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1549  N N    . PHE A 1 103 ? 2.663   -5.770  -0.763  1.00 0.00 ? 103 PHE A N    1  
ATOM 1550  C CA   . PHE A 1 103 ? 3.679   -5.163  0.080   1.00 0.00 ? 103 PHE A CA   1  
ATOM 1551  C C    . PHE A 1 103 ? 3.203   -3.816  0.627   1.00 0.00 ? 103 PHE A C    1  
ATOM 1552  O O    . PHE A 1 103 ? 2.973   -2.877  -0.134  1.00 0.00 ? 103 PHE A O    1  
ATOM 1553  C CB   . PHE A 1 103 ? 4.912   -4.935  -0.799  1.00 0.00 ? 103 PHE A CB   1  
ATOM 1554  C CG   . PHE A 1 103 ? 5.949   -3.994  -0.183  1.00 0.00 ? 103 PHE A CG   1  
ATOM 1555  C CD1  . PHE A 1 103 ? 5.959   -3.777  1.160   1.00 0.00 ? 103 PHE A CD1  1  
ATOM 1556  C CD2  . PHE A 1 103 ? 6.860   -3.373  -0.979  1.00 0.00 ? 103 PHE A CD2  1  
ATOM 1557  C CE1  . PHE A 1 103 ? 6.922   -2.903  1.731   1.00 0.00 ? 103 PHE A CE1  1  
ATOM 1558  C CE2  . PHE A 1 103 ? 7.823   -2.498  -0.408  1.00 0.00 ? 103 PHE A CE2  1  
ATOM 1559  C CZ   . PHE A 1 103 ? 7.833   -2.282  0.935   1.00 0.00 ? 103 PHE A CZ   1  
ATOM 1560  H H    . PHE A 1 103 ? 2.866   -5.759  -1.743  1.00 0.00 ? 103 PHE A H    1  
ATOM 1561  H HA   . PHE A 1 103 ? 3.863   -5.846  0.908   1.00 0.00 ? 103 PHE A HA   1  
ATOM 1562  H HB2  . PHE A 1 103 ? 5.384   -5.897  -1.000  1.00 0.00 ? 103 PHE A HB2  1  
ATOM 1563  H HB3  . PHE A 1 103 ? 4.592   -4.529  -1.758  1.00 0.00 ? 103 PHE A HB3  1  
ATOM 1564  H HD1  . PHE A 1 103 ? 5.228   -4.275  1.797   1.00 0.00 ? 103 PHE A HD1  1  
ATOM 1565  H HD2  . PHE A 1 103 ? 6.852   -3.546  -2.055  1.00 0.00 ? 103 PHE A HD2  1  
ATOM 1566  H HE1  . PHE A 1 103 ? 6.929   -2.730  2.807   1.00 0.00 ? 103 PHE A HE1  1  
ATOM 1567  H HE2  . PHE A 1 103 ? 8.554   -2.001  -1.045  1.00 0.00 ? 103 PHE A HE2  1  
ATOM 1568  H HZ   . PHE A 1 103 ? 8.572   -1.611  1.374   1.00 0.00 ? 103 PHE A HZ   1  
ATOM 1569  N N    . ILE A 1 104 ? 3.069   -3.763  1.945   1.00 0.00 ? 104 ILE A N    1  
ATOM 1570  C CA   . ILE A 1 104 ? 2.624   -2.548  2.603   1.00 0.00 ? 104 ILE A CA   1  
ATOM 1571  C C    . ILE A 1 104 ? 2.912   -2.651  4.103   1.00 0.00 ? 104 ILE A C    1  
ATOM 1572  O O    . ILE A 1 104 ? 2.599   -3.660  4.731   1.00 0.00 ? 104 ILE A O    1  
ATOM 1573  C CB   . ILE A 1 104 ? 1.155   -2.268  2.278   1.00 0.00 ? 104 ILE A CB   1  
ATOM 1574  C CG1  . ILE A 1 104 ? 0.324   -3.551  2.346   1.00 0.00 ? 104 ILE A CG1  1  
ATOM 1575  C CG2  . ILE A 1 104 ? 1.018   -1.566  0.924   1.00 0.00 ? 104 ILE A CG2  1  
ATOM 1576  C CD1  . ILE A 1 104 ? -1.158  -3.257  2.109   1.00 0.00 ? 104 ILE A CD1  1  
ATOM 1577  H H    . ILE A 1 104 ? 3.257   -4.531  2.557   1.00 0.00 ? 104 ILE A H    1  
ATOM 1578  H HA   . ILE A 1 104 ? 3.208   -1.722  2.196   1.00 0.00 ? 104 ILE A HA   1  
ATOM 1579  H HB   . ILE A 1 104 ? 0.761   -1.588  3.033   1.00 0.00 ? 104 ILE A HB   1  
ATOM 1580  H HG12 . ILE A 1 104 ? 0.682   -4.259  1.599   1.00 0.00 ? 104 ILE A HG12 1  
ATOM 1581  H HG13 . ILE A 1 104 ? 0.454   -4.021  3.321   1.00 0.00 ? 104 ILE A HG13 1  
ATOM 1582  H HG21 . ILE A 1 104 ? 1.974   -1.123  0.647   1.00 0.00 ? 104 ILE A HG21 1  
ATOM 1583  H HG22 . ILE A 1 104 ? 0.721   -2.293  0.167   1.00 0.00 ? 104 ILE A HG22 1  
ATOM 1584  H HG23 . ILE A 1 104 ? 0.262   -0.785  0.995   1.00 0.00 ? 104 ILE A HG23 1  
ATOM 1585  H HD11 . ILE A 1 104 ? -1.467  -2.420  2.735   1.00 0.00 ? 104 ILE A HD11 1  
ATOM 1586  H HD12 . ILE A 1 104 ? -1.315  -3.003  1.060   1.00 0.00 ? 104 ILE A HD12 1  
ATOM 1587  H HD13 . ILE A 1 104 ? -1.748  -4.138  2.361   1.00 0.00 ? 104 ILE A HD13 1  
ATOM 1588  N N    . VAL A 1 105 ? 3.506   -1.591  4.633   1.00 0.00 ? 105 VAL A N    1  
ATOM 1589  C CA   . VAL A 1 105 ? 3.840   -1.549  6.046   1.00 0.00 ? 105 VAL A CA   1  
ATOM 1590  C C    . VAL A 1 105 ? 3.884   -0.093  6.513   1.00 0.00 ? 105 VAL A C    1  
ATOM 1591  O O    . VAL A 1 105 ? 4.070   0.816   5.706   1.00 0.00 ? 105 VAL A O    1  
ATOM 1592  C CB   . VAL A 1 105 ? 5.151   -2.297  6.296   1.00 0.00 ? 105 VAL A CB   1  
ATOM 1593  C CG1  . VAL A 1 105 ? 4.894   -3.644  6.974   1.00 0.00 ? 105 VAL A CG1  1  
ATOM 1594  C CG2  . VAL A 1 105 ? 5.935   -2.479  4.996   1.00 0.00 ? 105 VAL A CG2  1  
ATOM 1595  H H    . VAL A 1 105 ? 3.757   -0.773  4.115   1.00 0.00 ? 105 VAL A H    1  
ATOM 1596  H HA   . VAL A 1 105 ? 3.048   -2.067  6.587   1.00 0.00 ? 105 VAL A HA   1  
ATOM 1597  H HB   . VAL A 1 105 ? 5.758   -1.692  6.971   1.00 0.00 ? 105 VAL A HB   1  
ATOM 1598  H HG11 . VAL A 1 105 ? 3.971   -3.590  7.551   1.00 0.00 ? 105 VAL A HG11 1  
ATOM 1599  H HG12 . VAL A 1 105 ? 4.804   -4.421  6.216   1.00 0.00 ? 105 VAL A HG12 1  
ATOM 1600  H HG13 . VAL A 1 105 ? 5.725   -3.880  7.640   1.00 0.00 ? 105 VAL A HG13 1  
ATOM 1601  H HG21 . VAL A 1 105 ? 5.302   -2.966  4.255   1.00 0.00 ? 105 VAL A HG21 1  
ATOM 1602  H HG22 . VAL A 1 105 ? 6.248   -1.504  4.620   1.00 0.00 ? 105 VAL A HG22 1  
ATOM 1603  H HG23 . VAL A 1 105 ? 6.815   -3.095  5.183   1.00 0.00 ? 105 VAL A HG23 1  
ATOM 1604  N N    . PRO A 1 106 ? 3.703   0.088   7.849   1.00 0.00 ? 106 PRO A N    1  
ATOM 1605  C CA   . PRO A 1 106 ? 3.720   1.418   8.433   1.00 0.00 ? 106 PRO A CA   1  
ATOM 1606  C C    . PRO A 1 106 ? 5.147   1.963   8.517   1.00 0.00 ? 106 PRO A C    1  
ATOM 1607  O O    . PRO A 1 106 ? 5.374   3.036   9.074   1.00 0.00 ? 106 PRO A O    1  
ATOM 1608  C CB   . PRO A 1 106 ? 3.063   1.259   9.795   1.00 0.00 ? 106 PRO A CB   1  
ATOM 1609  C CG   . PRO A 1 106 ? 3.126   -0.226  10.115  1.00 0.00 ? 106 PRO A CG   1  
ATOM 1610  C CD   . PRO A 1 106 ? 3.479   -0.965  8.835   1.00 0.00 ? 106 PRO A CD   1  
ATOM 1611  H HA   . PRO A 1 106 ? 3.216   2.059   7.852   1.00 0.00 ? 106 PRO A HA   1  
ATOM 1612  H HB2  . PRO A 1 106 ? 3.587   1.843   10.551  1.00 0.00 ? 106 PRO A HB2  1  
ATOM 1613  H HB3  . PRO A 1 106 ? 2.032   1.611   9.775   1.00 0.00 ? 106 PRO A HB3  1  
ATOM 1614  H HG2  . PRO A 1 106 ? 3.871   -0.420  10.886  1.00 0.00 ? 106 PRO A HG2  1  
ATOM 1615  H HG3  . PRO A 1 106 ? 2.168   -0.573  10.504  1.00 0.00 ? 106 PRO A HG3  1  
ATOM 1616  H HD2  . PRO A 1 106 ? 4.369   -1.580  8.966   1.00 0.00 ? 106 PRO A HD2  1  
ATOM 1617  H HD3  . PRO A 1 106 ? 2.673   -1.631  8.527   1.00 0.00 ? 106 PRO A HD3  1  
ATOM 1618  N N    . TRP A 1 107 ? 6.072   1.197   7.956   1.00 0.00 ? 107 TRP A N    1  
ATOM 1619  C CA   . TRP A 1 107 ? 7.471   1.589   7.960   1.00 0.00 ? 107 TRP A CA   1  
ATOM 1620  C C    . TRP A 1 107 ? 8.039   1.299   9.351   1.00 0.00 ? 107 TRP A C    1  
ATOM 1621  O O    . TRP A 1 107 ? 9.011   0.557   9.486   1.00 0.00 ? 107 TRP A O    1  
ATOM 1622  C CB   . TRP A 1 107 ? 7.632   3.053   7.543   1.00 0.00 ? 107 TRP A CB   1  
ATOM 1623  C CG   . TRP A 1 107 ? 9.045   3.417   7.083   1.00 0.00 ? 107 TRP A CG   1  
ATOM 1624  C CD1  . TRP A 1 107 ? 9.827   2.755   6.218   1.00 0.00 ? 107 TRP A CD1  1  
ATOM 1625  C CD2  . TRP A 1 107 ? 9.817   4.562   7.501   1.00 0.00 ? 107 TRP A CD2  1  
ATOM 1626  N NE1  . TRP A 1 107 ? 11.041  3.389   6.050   1.00 0.00 ? 107 TRP A NE1  1  
ATOM 1627  C CE2  . TRP A 1 107 ? 11.035  4.522   6.854   1.00 0.00 ? 107 TRP A CE2  1  
ATOM 1628  C CE3  . TRP A 1 107 ? 9.496   5.598   8.395   1.00 0.00 ? 107 TRP A CE3  1  
ATOM 1629  C CZ2  . TRP A 1 107 ? 12.030  5.491   7.033   1.00 0.00 ? 107 TRP A CZ2  1  
ATOM 1630  C CZ3  . TRP A 1 107 ? 10.501  6.558   8.563   1.00 0.00 ? 107 TRP A CZ3  1  
ATOM 1631  C CH2  . TRP A 1 107 ? 11.732  6.532   7.920   1.00 0.00 ? 107 TRP A CH2  1  
ATOM 1632  H H    . TRP A 1 107 ? 5.878   0.326   7.506   1.00 0.00 ? 107 TRP A H    1  
ATOM 1633  H HA   . TRP A 1 107 ? 7.988   0.988   7.213   1.00 0.00 ? 107 TRP A HA   1  
ATOM 1634  H HB2  . TRP A 1 107 ? 6.931   3.269   6.736   1.00 0.00 ? 107 TRP A HB2  1  
ATOM 1635  H HB3  . TRP A 1 107 ? 7.358   3.691   8.382   1.00 0.00 ? 107 TRP A HB3  1  
ATOM 1636  H HD1  . TRP A 1 107 ? 9.540   1.834   5.712   1.00 0.00 ? 107 TRP A HD1  1  
ATOM 1637  H HE1  . TRP A 1 107 ? 11.856  3.060   5.404   1.00 0.00 ? 107 TRP A HE1  1  
ATOM 1638  H HE3  . TRP A 1 107 ? 8.541   5.652   8.919   1.00 0.00 ? 107 TRP A HE3  1  
ATOM 1639  H HZ2  . TRP A 1 107 ? 12.985  5.437   6.510   1.00 0.00 ? 107 TRP A HZ2  1  
ATOM 1640  H HZ3  . TRP A 1 107 ? 10.304  7.384   9.248   1.00 0.00 ? 107 TRP A HZ3  1  
ATOM 1641  H HH2  . TRP A 1 107 ? 12.463  7.319   8.105   1.00 0.00 ? 107 TRP A HH2  1  
ATOM 1642  N N    . ASP A 1 108 ? 7.408   1.898   10.350  1.00 0.00 ? 108 ASP A N    1  
ATOM 1643  C CA   . ASP A 1 108 ? 7.838   1.712   11.726  1.00 0.00 ? 108 ASP A CA   1  
ATOM 1644  C C    . ASP A 1 108 ? 7.519   0.282   12.167  1.00 0.00 ? 108 ASP A C    1  
ATOM 1645  O O    . ASP A 1 108 ? 6.903   0.075   13.211  1.00 0.00 ? 108 ASP A O    1  
ATOM 1646  C CB   . ASP A 1 108 ? 7.107   2.672   12.665  1.00 0.00 ? 108 ASP A CB   1  
ATOM 1647  C CG   . ASP A 1 108 ? 7.450   2.512   14.148  1.00 0.00 ? 108 ASP A CG   1  
ATOM 1648  O OD1  . ASP A 1 108 ? 8.662   2.496   14.452  1.00 0.00 ? 108 ASP A OD1  1  
ATOM 1649  O OD2  . ASP A 1 108 ? 6.492   2.408   14.945  1.00 0.00 ? 108 ASP A OD2  1  
ATOM 1650  H H    . ASP A 1 108 ? 6.618   2.499   10.232  1.00 0.00 ? 108 ASP A H    1  
ATOM 1651  H HA   . ASP A 1 108 ? 8.908   1.917   11.721  1.00 0.00 ? 108 ASP A HA   1  
ATOM 1652  H HB2  . ASP A 1 108 ? 7.333   3.695   12.364  1.00 0.00 ? 108 ASP A HB2  1  
ATOM 1653  H HB3  . ASP A 1 108 ? 6.034   2.533   12.540  1.00 0.00 ? 108 ASP A HB3  1  
ATOM 1654  N N    . THR A 1 109 ? 7.952   -0.667  11.349  1.00 0.00 ? 109 THR A N    1  
ATOM 1655  C CA   . THR A 1 109 ? 7.719   -2.070  11.642  1.00 0.00 ? 109 THR A CA   1  
ATOM 1656  C C    . THR A 1 109 ? 8.718   -2.945  10.884  1.00 0.00 ? 109 THR A C    1  
ATOM 1657  O O    . THR A 1 109 ? 9.443   -3.734  11.488  1.00 0.00 ? 109 THR A O    1  
ATOM 1658  C CB   . THR A 1 109 ? 6.260   -2.387  11.312  1.00 0.00 ? 109 THR A CB   1  
ATOM 1659  O OG1  . THR A 1 109 ? 6.061   -1.806  10.026  1.00 0.00 ? 109 THR A OG1  1  
ATOM 1660  C CG2  . THR A 1 109 ? 5.278   -1.637  12.215  1.00 0.00 ? 109 THR A CG2  1  
ATOM 1661  H H    . THR A 1 109 ? 8.452   -0.488  10.502  1.00 0.00 ? 109 THR A H    1  
ATOM 1662  H HA   . THR A 1 109 ? 7.896   -2.233  12.706  1.00 0.00 ? 109 THR A HA   1  
ATOM 1663  H HB   . THR A 1 109 ? 6.077   -3.461  11.345  1.00 0.00 ? 109 THR A HB   1  
ATOM 1664  H HG1  . THR A 1 109 ? 6.197   -2.495  9.314   1.00 0.00 ? 109 THR A HG1  1  
ATOM 1665  H HG21 . THR A 1 109 ? 5.540   -1.812  13.259  1.00 0.00 ? 109 THR A HG21 1  
ATOM 1666  H HG22 . THR A 1 109 ? 5.330   -0.569  12.001  1.00 0.00 ? 109 THR A HG22 1  
ATOM 1667  H HG23 . THR A 1 109 ? 4.266   -1.997  12.029  1.00 0.00 ? 109 THR A HG23 1  
ATOM 1668  N N    . LEU A 1 110 ? 8.724   -2.778  9.570   1.00 0.00 ? 110 LEU A N    1  
ATOM 1669  C CA   . LEU A 1 110 ? 9.622   -3.543  8.721   1.00 0.00 ? 110 LEU A CA   1  
ATOM 1670  C C    . LEU A 1 110 ? 10.269  -4.657  9.546   1.00 0.00 ? 110 LEU A C    1  
ATOM 1671  O O    . LEU A 1 110 ? 9.612   -5.636  9.897   1.00 0.00 ? 110 LEU A O    1  
ATOM 1672  C CB   . LEU A 1 110 ? 10.631  -2.619  8.037   1.00 0.00 ? 110 LEU A CB   1  
ATOM 1673  C CG   . LEU A 1 110 ? 10.040  -1.466  7.222   1.00 0.00 ? 110 LEU A CG   1  
ATOM 1674  C CD1  . LEU A 1 110 ? 11.132  -0.490  6.782   1.00 0.00 ? 110 LEU A CD1  1  
ATOM 1675  C CD2  . LEU A 1 110 ? 9.229   -1.994  6.036   1.00 0.00 ? 110 LEU A CD2  1  
ATOM 1676  H H    . LEU A 1 110 ? 8.130   -2.135  9.085   1.00 0.00 ? 110 LEU A H    1  
ATOM 1677  H HA   . LEU A 1 110 ? 9.019   -4.000  7.936   1.00 0.00 ? 110 LEU A HA   1  
ATOM 1678  H HB2  . LEU A 1 110 ? 11.285  -2.199  8.801   1.00 0.00 ? 110 LEU A HB2  1  
ATOM 1679  H HB3  . LEU A 1 110 ? 11.257  -3.221  7.378   1.00 0.00 ? 110 LEU A HB3  1  
ATOM 1680  H HG   . LEU A 1 110 ? 9.352   -0.913  7.861   1.00 0.00 ? 110 LEU A HG   1  
ATOM 1681  H HD11 . LEU A 1 110 ? 11.854  -0.364  7.589   1.00 0.00 ? 110 LEU A HD11 1  
ATOM 1682  H HD12 . LEU A 1 110 ? 11.638  -0.883  5.900   1.00 0.00 ? 110 LEU A HD12 1  
ATOM 1683  H HD13 . LEU A 1 110 ? 10.683  0.474   6.543   1.00 0.00 ? 110 LEU A HD13 1  
ATOM 1684  H HD21 . LEU A 1 110 ? 9.184   -3.081  6.082   1.00 0.00 ? 110 LEU A HD21 1  
ATOM 1685  H HD22 . LEU A 1 110 ? 8.220   -1.585  6.076   1.00 0.00 ? 110 LEU A HD22 1  
ATOM 1686  H HD23 . LEU A 1 110 ? 9.708   -1.688  5.105   1.00 0.00 ? 110 LEU A HD23 1  
ATOM 1687  N N    . SER A 1 111 ? 11.550  -4.472  9.830   1.00 0.00 ? 111 SER A N    1  
ATOM 1688  C CA   . SER A 1 111 ? 12.294  -5.449  10.607  1.00 0.00 ? 111 SER A CA   1  
ATOM 1689  C C    . SER A 1 111 ? 13.748  -5.497  10.134  1.00 0.00 ? 111 SER A C    1  
ATOM 1690  O O    . SER A 1 111 ? 14.665  -5.597  10.947  1.00 0.00 ? 111 SER A O    1  
ATOM 1691  C CB   . SER A 1 111 ? 11.657  -6.836  10.502  1.00 0.00 ? 111 SER A CB   1  
ATOM 1692  O OG   . SER A 1 111 ? 10.643  -7.034  11.484  1.00 0.00 ? 111 SER A OG   1  
ATOM 1693  H H    . SER A 1 111 ? 12.077  -3.673  9.539   1.00 0.00 ? 111 SER A H    1  
ATOM 1694  H HA   . SER A 1 111 ? 12.237  -5.102  11.638  1.00 0.00 ? 111 SER A HA   1  
ATOM 1695  H HB2  . SER A 1 111 ? 11.228  -6.964  9.507   1.00 0.00 ? 111 SER A HB2  1  
ATOM 1696  H HB3  . SER A 1 111 ? 12.427  -7.599  10.617  1.00 0.00 ? 111 SER A HB3  1  
ATOM 1697  H HG   . SER A 1 111 ? 10.280  -7.963  11.418  1.00 0.00 ? 111 SER A HG   1  
ATOM 1698  N N    . THR A 1 112 ? 13.913  -5.423  8.821   1.00 0.00 ? 112 THR A N    1  
ATOM 1699  C CA   . THR A 1 112 ? 15.240  -5.455  8.231   1.00 0.00 ? 112 THR A CA   1  
ATOM 1700  C C    . THR A 1 112 ? 15.158  -5.859  6.757   1.00 0.00 ? 112 THR A C    1  
ATOM 1701  O O    . THR A 1 112 ? 15.481  -5.065  5.874   1.00 0.00 ? 112 THR A O    1  
ATOM 1702  C CB   . THR A 1 112 ? 16.108  -6.393  9.071   1.00 0.00 ? 112 THR A CB   1  
ATOM 1703  O OG1  . THR A 1 112 ? 16.867  -5.517  9.900   1.00 0.00 ? 112 THR A OG1  1  
ATOM 1704  C CG2  . THR A 1 112 ? 17.163  -7.121  8.235   1.00 0.00 ? 112 THR A CG2  1  
ATOM 1705  H H    . THR A 1 112 ? 13.161  -5.341  8.167   1.00 0.00 ? 112 THR A H    1  
ATOM 1706  H HA   . THR A 1 112 ? 15.656  -4.447  8.264   1.00 0.00 ? 112 THR A HA   1  
ATOM 1707  H HB   . THR A 1 112 ? 15.492  -7.103  9.624   1.00 0.00 ? 112 THR A HB   1  
ATOM 1708  H HG1  . THR A 1 112 ? 16.498  -5.522  10.830  1.00 0.00 ? 112 THR A HG1  1  
ATOM 1709  H HG21 . THR A 1 112 ? 17.598  -6.427  7.516   1.00 0.00 ? 112 THR A HG21 1  
ATOM 1710  H HG22 . THR A 1 112 ? 17.946  -7.503  8.891   1.00 0.00 ? 112 THR A HG22 1  
ATOM 1711  H HG23 . THR A 1 112 ? 16.697  -7.951  7.704   1.00 0.00 ? 112 THR A HG23 1  
ATOM 1712  N N    . THR A 1 113 ? 14.726  -7.092  6.538   1.00 0.00 ? 113 THR A N    1  
ATOM 1713  C CA   . THR A 1 113 ? 14.598  -7.610  5.186   1.00 0.00 ? 113 THR A CA   1  
ATOM 1714  C C    . THR A 1 113 ? 13.824  -6.625  4.309   1.00 0.00 ? 113 THR A C    1  
ATOM 1715  O O    . THR A 1 113 ? 14.012  -6.591  3.094   1.00 0.00 ? 113 THR A O    1  
ATOM 1716  C CB   . THR A 1 113 ? 13.946  -8.992  5.271   1.00 0.00 ? 113 THR A CB   1  
ATOM 1717  O OG1  . THR A 1 113 ? 14.913  -9.791  5.947   1.00 0.00 ? 113 THR A OG1  1  
ATOM 1718  C CG2  . THR A 1 113 ? 13.807  -9.657  3.900   1.00 0.00 ? 113 THR A CG2  1  
ATOM 1719  H H    . THR A 1 113 ? 14.466  -7.731  7.262   1.00 0.00 ? 113 THR A H    1  
ATOM 1720  H HA   . THR A 1 113 ? 15.596  -7.704  4.759   1.00 0.00 ? 113 THR A HA   1  
ATOM 1721  H HB   . THR A 1 113 ? 12.983  -8.937  5.778   1.00 0.00 ? 113 THR A HB   1  
ATOM 1722  H HG1  . THR A 1 113 ? 14.485  -10.628 6.290   1.00 0.00 ? 113 THR A HG1  1  
ATOM 1723  H HG21 . THR A 1 113 ? 13.780  -8.891  3.125   1.00 0.00 ? 113 THR A HG21 1  
ATOM 1724  H HG22 . THR A 1 113 ? 14.656  -10.319 3.728   1.00 0.00 ? 113 THR A HG22 1  
ATOM 1725  H HG23 . THR A 1 113 ? 12.883  -10.236 3.870   1.00 0.00 ? 113 THR A HG23 1  
ATOM 1726  N N    . GLN A 1 114 ? 12.968  -5.849  4.958   1.00 0.00 ? 114 GLN A N    1  
ATOM 1727  C CA   . GLN A 1 114 ? 12.165  -4.866  4.251   1.00 0.00 ? 114 GLN A CA   1  
ATOM 1728  C C    . GLN A 1 114 ? 12.967  -3.582  4.034   1.00 0.00 ? 114 GLN A C    1  
ATOM 1729  O O    . GLN A 1 114 ? 12.765  -2.879  3.044   1.00 0.00 ? 114 GLN A O    1  
ATOM 1730  C CB   . GLN A 1 114 ? 10.864  -4.579  5.003   1.00 0.00 ? 114 GLN A CB   1  
ATOM 1731  C CG   . GLN A 1 114 ? 9.778   -5.591  4.628   1.00 0.00 ? 114 GLN A CG   1  
ATOM 1732  C CD   . GLN A 1 114 ? 9.771   -6.772  5.600   1.00 0.00 ? 114 GLN A CD   1  
ATOM 1733  O OE1  . GLN A 1 114 ? 8.780   -7.069  6.249   1.00 0.00 ? 114 GLN A OE1  1  
ATOM 1734  N NE2  . GLN A 1 114 ? 10.926  -7.428  5.665   1.00 0.00 ? 114 GLN A NE2  1  
ATOM 1735  H H    . GLN A 1 114 ? 12.821  -5.884  5.946   1.00 0.00 ? 114 GLN A H    1  
ATOM 1736  H HA   . GLN A 1 114 ? 11.929  -5.322  3.290   1.00 0.00 ? 114 GLN A HA   1  
ATOM 1737  H HB2  . GLN A 1 114 ? 11.044  -4.617  6.077   1.00 0.00 ? 114 GLN A HB2  1  
ATOM 1738  H HB3  . GLN A 1 114 ? 10.520  -3.571  4.772   1.00 0.00 ? 114 GLN A HB3  1  
ATOM 1739  H HG2  . GLN A 1 114 ? 8.804   -5.105  4.634   1.00 0.00 ? 114 GLN A HG2  1  
ATOM 1740  H HG3  . GLN A 1 114 ? 9.948   -5.952  3.613   1.00 0.00 ? 114 GLN A HG3  1  
ATOM 1741  H HE21 . GLN A 1 114 ? 11.700  -7.132  5.106   1.00 0.00 ? 114 GLN A HE21 1  
ATOM 1742  H HE22 . GLN A 1 114 ? 11.020  -8.216  6.273   1.00 0.00 ? 114 GLN A HE22 1  
ATOM 1743  N N    . LYS A 1 115 ? 13.859  -3.314  4.975   1.00 0.00 ? 115 LYS A N    1  
ATOM 1744  C CA   . LYS A 1 115 ? 14.693  -2.125  4.900   1.00 0.00 ? 115 LYS A CA   1  
ATOM 1745  C C    . LYS A 1 115 ? 15.771  -2.331  3.833   1.00 0.00 ? 115 LYS A C    1  
ATOM 1746  O O    . LYS A 1 115 ? 16.061  -1.425  3.054   1.00 0.00 ? 115 LYS A O    1  
ATOM 1747  C CB   . LYS A 1 115 ? 15.252  -1.774  6.279   1.00 0.00 ? 115 LYS A CB   1  
ATOM 1748  C CG   . LYS A 1 115 ? 14.505  -0.583  6.886   1.00 0.00 ? 115 LYS A CG   1  
ATOM 1749  C CD   . LYS A 1 115 ? 14.448  -0.692  8.411   1.00 0.00 ? 115 LYS A CD   1  
ATOM 1750  C CE   . LYS A 1 115 ? 13.925  -2.063  8.844   1.00 0.00 ? 115 LYS A CE   1  
ATOM 1751  N NZ   . LYS A 1 115 ? 13.403  -2.005  10.228  1.00 0.00 ? 115 LYS A NZ   1  
ATOM 1752  H H    . LYS A 1 115 ? 14.017  -3.889  5.778   1.00 0.00 ? 115 LYS A H    1  
ATOM 1753  H HA   . LYS A 1 115 ? 14.055  -1.297  4.590   1.00 0.00 ? 115 LYS A HA   1  
ATOM 1754  H HB2  . LYS A 1 115 ? 15.167  -2.636  6.941   1.00 0.00 ? 115 LYS A HB2  1  
ATOM 1755  H HB3  . LYS A 1 115 ? 16.313  -1.538  6.197   1.00 0.00 ? 115 LYS A HB3  1  
ATOM 1756  H HG2  . LYS A 1 115 ? 15.002  0.344   6.602   1.00 0.00 ? 115 LYS A HG2  1  
ATOM 1757  H HG3  . LYS A 1 115 ? 13.494  -0.540  6.483   1.00 0.00 ? 115 LYS A HG3  1  
ATOM 1758  H HD2  . LYS A 1 115 ? 15.442  -0.530  8.829   1.00 0.00 ? 115 LYS A HD2  1  
ATOM 1759  H HD3  . LYS A 1 115 ? 13.803  0.090   8.811   1.00 0.00 ? 115 LYS A HD3  1  
ATOM 1760  H HE2  . LYS A 1 115 ? 13.138  -2.390  8.164   1.00 0.00 ? 115 LYS A HE2  1  
ATOM 1761  H HE3  . LYS A 1 115 ? 14.726  -2.801  8.783   1.00 0.00 ? 115 LYS A HE3  1  
ATOM 1762  H HZ1  . LYS A 1 115 ? 13.980  -1.401  10.777  1.00 0.00 ? 115 LYS A HZ1  1  
ATOM 1763  H HZ2  . LYS A 1 115 ? 12.467  -1.653  10.216  1.00 0.00 ? 115 LYS A HZ2  1  
ATOM 1764  H HZ3  . LYS A 1 115 ? 13.407  -2.923  10.625  1.00 0.00 ? 115 LYS A HZ3  1  
ATOM 1765  N N    . LYS A 1 116 ? 16.336  -3.530  3.833   1.00 0.00 ? 116 LYS A N    1  
ATOM 1766  C CA   . LYS A 1 116 ? 17.375  -3.867  2.876   1.00 0.00 ? 116 LYS A CA   1  
ATOM 1767  C C    . LYS A 1 116 ? 16.802  -3.795  1.460   1.00 0.00 ? 116 LYS A C    1  
ATOM 1768  O O    . LYS A 1 116 ? 17.545  -3.648  0.491   1.00 0.00 ? 116 LYS A O    1  
ATOM 1769  C CB   . LYS A 1 116 ? 18.002  -5.220  3.219   1.00 0.00 ? 116 LYS A CB   1  
ATOM 1770  C CG   . LYS A 1 116 ? 17.097  -6.371  2.773   1.00 0.00 ? 116 LYS A CG   1  
ATOM 1771  C CD   . LYS A 1 116 ? 17.658  -7.059  1.528   1.00 0.00 ? 116 LYS A CD   1  
ATOM 1772  C CE   . LYS A 1 116 ? 16.970  -6.543  0.261   1.00 0.00 ? 116 LYS A CE   1  
ATOM 1773  N NZ   . LYS A 1 116 ? 17.938  -5.826  -0.599  1.00 0.00 ? 116 LYS A NZ   1  
ATOM 1774  H H    . LYS A 1 116 ? 16.094  -4.262  4.470   1.00 0.00 ? 116 LYS A H    1  
ATOM 1775  H HA   . LYS A 1 116 ? 18.161  -3.116  2.969   1.00 0.00 ? 116 LYS A HA   1  
ATOM 1776  H HB2  . LYS A 1 116 ? 18.974  -5.309  2.734   1.00 0.00 ? 116 LYS A HB2  1  
ATOM 1777  H HB3  . LYS A 1 116 ? 18.175  -5.283  4.293   1.00 0.00 ? 116 LYS A HB3  1  
ATOM 1778  H HG2  . LYS A 1 116 ? 17.002  -7.097  3.581   1.00 0.00 ? 116 LYS A HG2  1  
ATOM 1779  H HG3  . LYS A 1 116 ? 16.097  -5.992  2.565   1.00 0.00 ? 116 LYS A HG3  1  
ATOM 1780  H HD2  . LYS A 1 116 ? 18.731  -6.881  1.460   1.00 0.00 ? 116 LYS A HD2  1  
ATOM 1781  H HD3  . LYS A 1 116 ? 17.518  -8.137  1.608   1.00 0.00 ? 116 LYS A HD3  1  
ATOM 1782  H HE2  . LYS A 1 116 ? 16.536  -7.378  -0.289  1.00 0.00 ? 116 LYS A HE2  1  
ATOM 1783  H HE3  . LYS A 1 116 ? 16.151  -5.878  0.530   1.00 0.00 ? 116 LYS A HE3  1  
ATOM 1784  H HZ1  . LYS A 1 116 ? 18.783  -6.356  -0.664  1.00 0.00 ? 116 LYS A HZ1  1  
ATOM 1785  H HZ2  . LYS A 1 116 ? 17.547  -5.705  -1.511  1.00 0.00 ? 116 LYS A HZ2  1  
ATOM 1786  H HZ3  . LYS A 1 116 ? 18.137  -4.930  -0.201  1.00 0.00 ? 116 LYS A HZ3  1  
ATOM 1787  N N    . SER A 1 117 ? 15.483  -3.905  1.384   1.00 0.00 ? 117 SER A N    1  
ATOM 1788  C CA   . SER A 1 117 ? 14.801  -3.855  0.102   1.00 0.00 ? 117 SER A CA   1  
ATOM 1789  C C    . SER A 1 117 ? 14.377  -2.418  -0.210  1.00 0.00 ? 117 SER A C    1  
ATOM 1790  O O    . SER A 1 117 ? 14.021  -2.105  -1.344  1.00 0.00 ? 117 SER A O    1  
ATOM 1791  C CB   . SER A 1 117 ? 13.584  -4.781  0.090   1.00 0.00 ? 117 SER A CB   1  
ATOM 1792  O OG   . SER A 1 117 ? 13.608  -5.680  -1.015  1.00 0.00 ? 117 SER A OG   1  
ATOM 1793  H H    . SER A 1 117 ? 14.886  -4.024  2.176   1.00 0.00 ? 117 SER A H    1  
ATOM 1794  H HA   . SER A 1 117 ? 15.531  -4.206  -0.627  1.00 0.00 ? 117 SER A HA   1  
ATOM 1795  H HB2  . SER A 1 117 ? 13.552  -5.350  1.019   1.00 0.00 ? 117 SER A HB2  1  
ATOM 1796  H HB3  . SER A 1 117 ? 12.673  -4.183  0.050   1.00 0.00 ? 117 SER A HB3  1  
ATOM 1797  H HG   . SER A 1 117 ? 13.856  -6.597  -0.704  1.00 0.00 ? 117 SER A HG   1  
ATOM 1798  N N    . LEU A 1 118 ? 14.432  -1.582  0.817   1.00 0.00 ? 118 LEU A N    1  
ATOM 1799  C CA   . LEU A 1 118 ? 14.059  -0.186  0.667   1.00 0.00 ? 118 LEU A CA   1  
ATOM 1800  C C    . LEU A 1 118 ? 15.178  0.561   -0.060  1.00 0.00 ? 118 LEU A C    1  
ATOM 1801  O O    . LEU A 1 118 ? 14.938  1.596   -0.679  1.00 0.00 ? 118 LEU A O    1  
ATOM 1802  C CB   . LEU A 1 118 ? 13.694  0.420   2.024   1.00 0.00 ? 118 LEU A CB   1  
ATOM 1803  C CG   . LEU A 1 118 ? 12.200  0.600   2.298   1.00 0.00 ? 118 LEU A CG   1  
ATOM 1804  C CD1  . LEU A 1 118 ? 11.829  0.071   3.685   1.00 0.00 ? 118 LEU A CD1  1  
ATOM 1805  C CD2  . LEU A 1 118 ? 11.781  2.060   2.111   1.00 0.00 ? 118 LEU A CD2  1  
ATOM 1806  H H    . LEU A 1 118 ? 14.723  -1.845  1.737   1.00 0.00 ? 118 LEU A H    1  
ATOM 1807  H HA   . LEU A 1 118 ? 13.162  -0.153  0.048   1.00 0.00 ? 118 LEU A HA   1  
ATOM 1808  H HB2  . LEU A 1 118 ? 14.114  -0.213  2.806   1.00 0.00 ? 118 LEU A HB2  1  
ATOM 1809  H HB3  . LEU A 1 118 ? 14.179  1.392   2.106   1.00 0.00 ? 118 LEU A HB3  1  
ATOM 1810  H HG   . LEU A 1 118 ? 11.645  0.011   1.570   1.00 0.00 ? 118 LEU A HG   1  
ATOM 1811  H HD11 . LEU A 1 118 ? 12.278  -0.912  3.830   1.00 0.00 ? 118 LEU A HD11 1  
ATOM 1812  H HD12 . LEU A 1 118 ? 12.200  0.756   4.447   1.00 0.00 ? 118 LEU A HD12 1  
ATOM 1813  H HD13 . LEU A 1 118 ? 10.745  -0.009  3.766   1.00 0.00 ? 118 LEU A HD13 1  
ATOM 1814  H HD21 . LEU A 1 118 ? 12.630  2.638   1.745   1.00 0.00 ? 118 LEU A HD21 1  
ATOM 1815  H HD22 . LEU A 1 118 ? 10.966  2.115   1.391   1.00 0.00 ? 118 LEU A HD22 1  
ATOM 1816  H HD23 . LEU A 1 118 ? 11.449  2.468   3.066   1.00 0.00 ? 118 LEU A HD23 1  
ATOM 1817  N N    . ASN A 1 119 ? 16.377  0.007   0.039   1.00 0.00 ? 119 ASN A N    1  
ATOM 1818  C CA   . ASN A 1 119 ? 17.535  0.608   -0.601  1.00 0.00 ? 119 ASN A CA   1  
ATOM 1819  C C    . ASN A 1 119 ? 17.458  0.369   -2.110  1.00 0.00 ? 119 ASN A C    1  
ATOM 1820  O O    . ASN A 1 119 ? 17.823  1.240   -2.899  1.00 0.00 ? 119 ASN A O    1  
ATOM 1821  C CB   . ASN A 1 119 ? 18.834  -0.017  -0.089  1.00 0.00 ? 119 ASN A CB   1  
ATOM 1822  C CG   . ASN A 1 119 ? 18.927  0.084   1.435   1.00 0.00 ? 119 ASN A CG   1  
ATOM 1823  O OD1  . ASN A 1 119 ? 18.929  1.158   2.013   1.00 0.00 ? 119 ASN A OD1  1  
ATOM 1824  N ND2  . ASN A 1 119 ? 19.004  -1.093  2.051   1.00 0.00 ? 119 ASN A ND2  1  
ATOM 1825  H H    . ASN A 1 119 ? 16.564  -0.836  0.545   1.00 0.00 ? 119 ASN A H    1  
ATOM 1826  H HA   . ASN A 1 119 ? 17.487  1.666   -0.343  1.00 0.00 ? 119 ASN A HA   1  
ATOM 1827  H HB2  . ASN A 1 119 ? 18.884  -1.063  -0.392  1.00 0.00 ? 119 ASN A HB2  1  
ATOM 1828  H HB3  . ASN A 1 119 ? 19.687  0.488   -0.542  1.00 0.00 ? 119 ASN A HB3  1  
ATOM 1829  H HD21 . ASN A 1 119 ? 18.998  -1.938  1.517   1.00 0.00 ? 119 ASN A HD21 1  
ATOM 1830  H HD22 . ASN A 1 119 ? 19.068  -1.131  3.049   1.00 0.00 ? 119 ASN A HD22 1  
ATOM 1831  N N    . HIS A 1 120 ? 16.983  -0.815  -2.467  1.00 0.00 ? 120 HIS A N    1  
ATOM 1832  C CA   . HIS A 1 120 ? 16.855  -1.179  -3.868  1.00 0.00 ? 120 HIS A CA   1  
ATOM 1833  C C    . HIS A 1 120 ? 15.802  -0.290  -4.534  1.00 0.00 ? 120 HIS A C    1  
ATOM 1834  O O    . HIS A 1 120 ? 14.790  0.046   -3.921  1.00 0.00 ? 120 HIS A O    1  
ATOM 1835  C CB   . HIS A 1 120 ? 16.550  -2.671  -4.015  1.00 0.00 ? 120 HIS A CB   1  
ATOM 1836  C CG   . HIS A 1 120 ? 15.142  -3.052  -3.624  1.00 0.00 ? 120 HIS A CG   1  
ATOM 1837  N ND1  . HIS A 1 120 ? 14.031  -2.326  -4.018  1.00 0.00 ? 120 HIS A ND1  1  
ATOM 1838  C CD2  . HIS A 1 120 ? 14.676  -4.090  -2.871  1.00 0.00 ? 120 HIS A CD2  1  
ATOM 1839  C CE1  . HIS A 1 120 ? 12.952  -2.910  -3.519  1.00 0.00 ? 120 HIS A CE1  1  
ATOM 1840  N NE2  . HIS A 1 120 ? 13.353  -4.002  -2.808  1.00 0.00 ? 120 HIS A NE2  1  
ATOM 1841  H H    . HIS A 1 120 ? 16.689  -1.518  -1.819  1.00 0.00 ? 120 HIS A H    1  
ATOM 1842  H HA   . HIS A 1 120 ? 17.823  -0.990  -4.330  1.00 0.00 ? 120 HIS A HA   1  
ATOM 1843  H HB2  . HIS A 1 120 ? 16.721  -2.966  -5.050  1.00 0.00 ? 120 HIS A HB2  1  
ATOM 1844  H HB3  . HIS A 1 120 ? 17.252  -3.238  -3.403  1.00 0.00 ? 120 HIS A HB3  1  
ATOM 1845  H HD1  . HIS A 1 120 ? 14.042  -1.502  -4.584  1.00 0.00 ? 120 HIS A HD1  1  
ATOM 1846  H HD2  . HIS A 1 120 ? 15.287  -4.861  -2.402  1.00 0.00 ? 120 HIS A HD2  1  
ATOM 1847  H HE1  . HIS A 1 120 ? 11.923  -2.575  -3.653  1.00 0.00 ? 120 HIS A HE1  1  
ATOM 1848  N N    . ARG A 1 121 ? 16.078  0.065   -5.780  1.00 0.00 ? 121 ARG A N    1  
ATOM 1849  C CA   . ARG A 1 121 ? 15.168  0.908   -6.537  1.00 0.00 ? 121 ARG A CA   1  
ATOM 1850  C C    . ARG A 1 121 ? 13.782  0.265   -6.607  1.00 0.00 ? 121 ARG A C    1  
ATOM 1851  O O    . ARG A 1 121 ? 12.838  0.747   -5.983  1.00 0.00 ? 121 ARG A O    1  
ATOM 1852  C CB   . ARG A 1 121 ? 15.687  1.141   -7.958  1.00 0.00 ? 121 ARG A CB   1  
ATOM 1853  C CG   . ARG A 1 121 ? 16.206  2.570   -8.124  1.00 0.00 ? 121 ARG A CG   1  
ATOM 1854  C CD   . ARG A 1 121 ? 15.068  3.586   -8.000  1.00 0.00 ? 121 ARG A CD   1  
ATOM 1855  N NE   . ARG A 1 121 ? 15.344  4.762   -8.855  1.00 0.00 ? 121 ARG A NE   1  
ATOM 1856  C CZ   . ARG A 1 121 ? 16.191  5.748   -8.527  1.00 0.00 ? 121 ARG A CZ   1  
ATOM 1857  N NH1  . ARG A 1 121 ? 16.849  5.705   -7.361  1.00 0.00 ? 121 ARG A NH1  1  
ATOM 1858  N NH2  . ARG A 1 121 ? 16.378  6.776   -9.366  1.00 0.00 ? 121 ARG A NH2  1  
ATOM 1859  H H    . ARG A 1 121 ? 16.904  -0.213  -6.271  1.00 0.00 ? 121 ARG A H    1  
ATOM 1860  H HA   . ARG A 1 121 ? 15.137  1.848   -5.987  1.00 0.00 ? 121 ARG A HA   1  
ATOM 1861  H HB2  . ARG A 1 121 ? 16.484  0.433   -8.179  1.00 0.00 ? 121 ARG A HB2  1  
ATOM 1862  H HB3  . ARG A 1 121 ? 14.887  0.956   -8.676  1.00 0.00 ? 121 ARG A HB3  1  
ATOM 1863  H HG2  . ARG A 1 121 ? 16.965  2.776   -7.368  1.00 0.00 ? 121 ARG A HG2  1  
ATOM 1864  H HG3  . ARG A 1 121 ? 16.689  2.676   -9.096  1.00 0.00 ? 121 ARG A HG3  1  
ATOM 1865  H HD2  . ARG A 1 121 ? 14.126  3.126   -8.293  1.00 0.00 ? 121 ARG A HD2  1  
ATOM 1866  H HD3  . ARG A 1 121 ? 14.960  3.899   -6.961  1.00 0.00 ? 121 ARG A HD3  1  
ATOM 1867  H HE   . ARG A 1 121 ? 14.869  4.824   -9.733  1.00 0.00 ? 121 ARG A HE   1  
ATOM 1868  H HH11 . ARG A 1 121 ? 16.709  4.938   -6.735  1.00 0.00 ? 121 ARG A HH11 1  
ATOM 1869  H HH12 . ARG A 1 121 ? 17.480  6.441   -7.116  1.00 0.00 ? 121 ARG A HH12 1  
ATOM 1870  H HH21 . ARG A 1 121 ? 15.887  6.808   -10.236 1.00 0.00 ? 121 ARG A HH21 1  
ATOM 1871  H HH22 . ARG A 1 121 ? 17.010  7.512   -9.121  1.00 0.00 ? 121 ARG A HH22 1  
ATOM 1872  N N    . TYR A 1 122 ? 13.704  -0.816  -7.370  1.00 0.00 ? 122 TYR A N    1  
ATOM 1873  C CA   . TYR A 1 122 ? 12.449  -1.530  -7.529  1.00 0.00 ? 122 TYR A CA   1  
ATOM 1874  C C    . TYR A 1 122 ? 12.694  -2.986  -7.934  1.00 0.00 ? 122 TYR A C    1  
ATOM 1875  O O    . TYR A 1 122 ? 12.729  -3.306  -9.121  1.00 0.00 ? 122 TYR A O    1  
ATOM 1876  C CB   . TYR A 1 122 ? 11.698  -0.820  -8.657  1.00 0.00 ? 122 TYR A CB   1  
ATOM 1877  C CG   . TYR A 1 122 ? 10.788  -1.738  -9.474  1.00 0.00 ? 122 TYR A CG   1  
ATOM 1878  C CD1  . TYR A 1 122 ? 9.955   -2.633  -8.833  1.00 0.00 ? 122 TYR A CD1  1  
ATOM 1879  C CD2  . TYR A 1 122 ? 10.800  -1.672  -10.853 1.00 0.00 ? 122 TYR A CD2  1  
ATOM 1880  C CE1  . TYR A 1 122 ? 9.098   -3.497  -9.603  1.00 0.00 ? 122 TYR A CE1  1  
ATOM 1881  C CE2  . TYR A 1 122 ? 9.942   -2.537  -11.622 1.00 0.00 ? 122 TYR A CE2  1  
ATOM 1882  C CZ   . TYR A 1 122 ? 9.135   -3.407  -10.959 1.00 0.00 ? 122 TYR A CZ   1  
ATOM 1883  O OH   . TYR A 1 122 ? 8.325   -4.223  -11.686 1.00 0.00 ? 122 TYR A OH   1  
ATOM 1884  H H    . TYR A 1 122 ? 14.477  -1.202  -7.874  1.00 0.00 ? 122 TYR A H    1  
ATOM 1885  H HA   . TYR A 1 122 ? 11.927  -1.511  -6.572  1.00 0.00 ? 122 TYR A HA   1  
ATOM 1886  H HB2  . TYR A 1 122 ? 11.098  -0.016  -8.231  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 1887  H HB3  . TYR A 1 122 ? 12.423  -0.355  -9.326  1.00 0.00 ? 122 TYR A HB3  1  
ATOM 1888  H HD1  . TYR A 1 122 ? 9.947   -2.685  -7.744  1.00 0.00 ? 122 TYR A HD1  1  
ATOM 1889  H HD2  . TYR A 1 122 ? 11.457  -0.966  -11.359 1.00 0.00 ? 122 TYR A HD2  1  
ATOM 1890  H HE1  . TYR A 1 122 ? 8.436   -4.208  -9.109  1.00 0.00 ? 122 TYR A HE1  1  
ATOM 1891  H HE2  . TYR A 1 122 ? 9.941   -2.494  -12.712 1.00 0.00 ? 122 TYR A HE2  1  
ATOM 1892  H HH   . TYR A 1 122 ? 7.366   -3.995  -11.515 1.00 0.00 ? 122 TYR A HH   1  
ATOM 1893  N N    . GLN A 1 123 ? 12.858  -3.828  -6.924  1.00 0.00 ? 123 GLN A N    1  
ATOM 1894  C CA   . GLN A 1 123 ? 13.099  -5.241  -7.160  1.00 0.00 ? 123 GLN A CA   1  
ATOM 1895  C C    . GLN A 1 123 ? 14.446  -5.441  -7.859  1.00 0.00 ? 123 GLN A C    1  
ATOM 1896  O O    . GLN A 1 123 ? 14.498  -5.926  -8.987  1.00 0.00 ? 123 GLN A O    1  
ATOM 1897  C CB   . GLN A 1 123 ? 11.962  -5.863  -7.973  1.00 0.00 ? 123 GLN A CB   1  
ATOM 1898  C CG   . GLN A 1 123 ? 12.236  -7.341  -8.257  1.00 0.00 ? 123 GLN A CG   1  
ATOM 1899  C CD   . GLN A 1 123 ? 12.139  -7.639  -9.755  1.00 0.00 ? 123 GLN A CD   1  
ATOM 1900  O OE1  . GLN A 1 123 ? 11.157  -7.338  -10.412 1.00 0.00 ? 123 GLN A OE1  1  
ATOM 1901  N NE2  . GLN A 1 123 ? 13.212  -8.244  -10.256 1.00 0.00 ? 123 GLN A NE2  1  
ATOM 1902  H H    . GLN A 1 123 ? 12.828  -3.559  -5.962  1.00 0.00 ? 123 GLN A H    1  
ATOM 1903  H HA   . GLN A 1 123 ? 13.123  -5.700  -6.172  1.00 0.00 ? 123 GLN A HA   1  
ATOM 1904  H HB2  . GLN A 1 123 ? 11.023  -5.761  -7.430  1.00 0.00 ? 123 GLN A HB2  1  
ATOM 1905  H HB3  . GLN A 1 123 ? 11.846  -5.324  -8.914  1.00 0.00 ? 123 GLN A HB3  1  
ATOM 1906  H HG2  . GLN A 1 123 ? 13.228  -7.607  -7.893  1.00 0.00 ? 123 GLN A HG2  1  
ATOM 1907  H HG3  . GLN A 1 123 ? 11.521  -7.958  -7.714  1.00 0.00 ? 123 GLN A HG3  1  
ATOM 1908  H HE21 . GLN A 1 123 ? 13.986  -8.463  -9.662  1.00 0.00 ? 123 GLN A HE21 1  
ATOM 1909  H HE22 . GLN A 1 123 ? 13.246  -8.481  -11.227 1.00 0.00 ? 123 GLN A HE22 1  
ATOM 1910  N N    . MET A 1 124 ? 15.501  -5.056  -7.157  1.00 0.00 ? 124 MET A N    1  
ATOM 1911  C CA   . MET A 1 124 ? 16.845  -5.187  -7.695  1.00 0.00 ? 124 MET A CA   1  
ATOM 1912  C C    . MET A 1 124 ? 17.272  -6.655  -7.755  1.00 0.00 ? 124 MET A C    1  
ATOM 1913  O O    . MET A 1 124 ? 18.314  -7.024  -7.217  1.00 0.00 ? 124 MET A O    1  
ATOM 1914  C CB   . MET A 1 124 ? 17.825  -4.406  -6.818  1.00 0.00 ? 124 MET A CB   1  
ATOM 1915  C CG   . MET A 1 124 ? 17.936  -2.951  -7.280  1.00 0.00 ? 124 MET A CG   1  
ATOM 1916  S SD   . MET A 1 124 ? 19.454  -2.712  -8.188  1.00 0.00 ? 124 MET A SD   1  
ATOM 1917  C CE   . MET A 1 124 ? 19.001  -3.445  -9.750  1.00 0.00 ? 124 MET A CE   1  
ATOM 1918  H H    . MET A 1 124 ? 15.451  -4.662  -6.239  1.00 0.00 ? 124 MET A H    1  
ATOM 1919  H HA   . MET A 1 124 ? 16.798  -4.774  -8.703  1.00 0.00 ? 124 MET A HA   1  
ATOM 1920  H HB2  . MET A 1 124 ? 17.494  -4.437  -5.780  1.00 0.00 ? 124 MET A HB2  1  
ATOM 1921  H HB3  . MET A 1 124 ? 18.807  -4.878  -6.854  1.00 0.00 ? 124 MET A HB3  1  
ATOM 1922  H HG2  . MET A 1 124 ? 17.082  -2.695  -7.909  1.00 0.00 ? 124 MET A HG2  1  
ATOM 1923  H HG3  . MET A 1 124 ? 17.907  -2.284  -6.419  1.00 0.00 ? 124 MET A HG3  1  
ATOM 1924  H HE1  . MET A 1 124 ? 17.917  -3.554  -9.800  1.00 0.00 ? 124 MET A HE1  1  
ATOM 1925  H HE2  . MET A 1 124 ? 19.340  -2.804  -10.564 1.00 0.00 ? 124 MET A HE2  1  
ATOM 1926  H HE3  . MET A 1 124 ? 19.468  -4.426  -9.840  1.00 0.00 ? 124 MET A HE3  1  
ATOM 1927  N N    . GLY A 1 125 ? 16.444  -7.453  -8.413  1.00 0.00 ? 125 GLY A N    1  
ATOM 1928  C CA   . GLY A 1 125 ? 16.722  -8.872  -8.550  1.00 0.00 ? 125 GLY A CA   1  
ATOM 1929  C C    . GLY A 1 125 ? 16.860  -9.538  -7.180  1.00 0.00 ? 125 GLY A C    1  
ATOM 1930  O O    . GLY A 1 125 ? 17.490  -10.587 -7.056  1.00 0.00 ? 125 GLY A O    1  
ATOM 1931  H H    . GLY A 1 125 ? 15.598  -7.144  -8.848  1.00 0.00 ? 125 GLY A H    1  
ATOM 1932  H HA2  . GLY A 1 125 ? 15.920  -9.351  -9.112  1.00 0.00 ? 125 GLY A HA2  1  
ATOM 1933  H HA3  . GLY A 1 125 ? 17.639  -9.013  -9.121  1.00 0.00 ? 125 GLY A HA3  1  
ATOM 1934  N N    . CYS A 1 126 ? 16.260  -8.901  -6.184  1.00 0.00 ? 126 CYS A N    1  
ATOM 1935  C CA   . CYS A 1 126 ? 16.308  -9.420  -4.828  1.00 0.00 ? 126 CYS A CA   1  
ATOM 1936  C C    . CYS A 1 126 ? 15.669  -10.809 -4.821  1.00 0.00 ? 126 CYS A C    1  
ATOM 1937  O O    . CYS A 1 126 ? 15.409  -11.382 -5.878  1.00 0.00 ? 126 CYS A O    1  
ATOM 1938  C CB   . CYS A 1 126 ? 15.628  -8.473  -3.837  1.00 0.00 ? 126 CYS A CB   1  
ATOM 1939  S SG   . CYS A 1 126 ? 13.845  -8.794  -3.570  1.00 0.00 ? 126 CYS A SG   1  
ATOM 1940  H H    . CYS A 1 126 ? 15.750  -8.049  -6.293  1.00 0.00 ? 126 CYS A H    1  
ATOM 1941  H HA   . CYS A 1 126 ? 17.361  -9.476  -4.552  1.00 0.00 ? 126 CYS A HA   1  
ATOM 1942  H HB2  . CYS A 1 126 ? 16.142  -8.541  -2.878  1.00 0.00 ? 126 CYS A HB2  1  
ATOM 1943  H HB3  . CYS A 1 126 ? 15.748  -7.449  -4.192  1.00 0.00 ? 126 CYS A HB3  1  
ATOM 1944  N N    . GLU A 1 127 ? 15.435  -11.312 -3.618  1.00 0.00 ? 127 GLU A N    1  
ATOM 1945  C CA   . GLU A 1 127 ? 14.831  -12.624 -3.459  1.00 0.00 ? 127 GLU A CA   1  
ATOM 1946  C C    . GLU A 1 127 ? 14.660  -12.954 -1.975  1.00 0.00 ? 127 GLU A C    1  
ATOM 1947  O O    . GLU A 1 127 ? 15.606  -13.390 -1.320  1.00 0.00 ? 127 GLU A O    1  
ATOM 1948  C CB   . GLU A 1 127 ? 15.659  -13.697 -4.168  1.00 0.00 ? 127 GLU A CB   1  
ATOM 1949  C CG   . GLU A 1 127 ? 14.939  -15.047 -4.147  1.00 0.00 ? 127 GLU A CG   1  
ATOM 1950  C CD   . GLU A 1 127 ? 14.516  -15.465 -5.558  1.00 0.00 ? 127 GLU A CD   1  
ATOM 1951  O OE1  . GLU A 1 127 ? 15.418  -15.552 -6.418  1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1952  O OE2  . GLU A 1 127 ? 13.299  -15.686 -5.743  1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1953  H H    . GLU A 1 127 ? 15.649  -10.839 -2.763  1.00 0.00 ? 127 GLU A H    1  
ATOM 1954  H HA   . GLU A 1 127 ? 13.854  -12.553 -3.937  1.00 0.00 ? 127 GLU A HA   1  
ATOM 1955  H HB2  . GLU A 1 127 ? 15.844  -13.396 -5.200  1.00 0.00 ? 127 GLU A HB2  1  
ATOM 1956  H HB3  . GLU A 1 127 ? 16.631  -13.792 -3.684  1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1957  H HG2  . GLU A 1 127 ? 15.595  -15.806 -3.722  1.00 0.00 ? 127 GLU A HG2  1  
ATOM 1958  H HG3  . GLU A 1 127 ? 14.061  -14.986 -3.504  1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1959  N N    . CYS A 1 1   ? -9.512  -12.540 -0.810  1.00 0.00 ? 1   CYS A N    2  
ATOM 1960  C CA   . CYS A 1 1   ? -8.757  -11.300 -0.798  1.00 0.00 ? 1   CYS A CA   2  
ATOM 1961  C C    . CYS A 1 1   ? -7.922  -11.258 0.483   1.00 0.00 ? 1   CYS A C    2  
ATOM 1962  O O    . CYS A 1 1   ? -6.739  -10.921 0.447   1.00 0.00 ? 1   CYS A O    2  
ATOM 1963  C CB   . CYS A 1 1   ? -9.671  -10.079 -0.924  1.00 0.00 ? 1   CYS A CB   2  
ATOM 1964  S SG   . CYS A 1 1   ? -9.624  -8.935  0.504   1.00 0.00 ? 1   CYS A SG   2  
ATOM 1965  H H    . CYS A 1 1   ? -9.033  -13.323 -1.206  1.00 0.00 ? 1   CYS A H    2  
ATOM 1966  H HA   . CYS A 1 1   ? -8.114  -11.316 -1.678  1.00 0.00 ? 1   CYS A HA   2  
ATOM 1967  H HB2  . CYS A 1 1   ? -9.394  -9.527  -1.823  1.00 0.00 ? 1   CYS A HB2  2  
ATOM 1968  H HB3  . CYS A 1 1   ? -10.695 -10.423 -1.062  1.00 0.00 ? 1   CYS A HB3  2  
ATOM 1969  N N    . SER A 1 2   ? -8.570  -11.605 1.585   1.00 0.00 ? 2   SER A N    2  
ATOM 1970  C CA   . SER A 1 2   ? -7.902  -11.612 2.875   1.00 0.00 ? 2   SER A CA   2  
ATOM 1971  C C    . SER A 1 2   ? -6.764  -12.635 2.871   1.00 0.00 ? 2   SER A C    2  
ATOM 1972  O O    . SER A 1 2   ? -6.898  -13.721 3.434   1.00 0.00 ? 2   SER A O    2  
ATOM 1973  C CB   . SER A 1 2   ? -8.887  -11.919 4.004   1.00 0.00 ? 2   SER A CB   2  
ATOM 1974  O OG   . SER A 1 2   ? -9.879  -12.862 3.606   1.00 0.00 ? 2   SER A OG   2  
ATOM 1975  H H    . SER A 1 2   ? -9.531  -11.878 1.606   1.00 0.00 ? 2   SER A H    2  
ATOM 1976  H HA   . SER A 1 2   ? -7.508  -10.603 3.002   1.00 0.00 ? 2   SER A HA   2  
ATOM 1977  H HB2  . SER A 1 2   ? -8.343  -12.309 4.865   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1978  H HB3  . SER A 1 2   ? -9.371  -10.996 4.324   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1979  H HG   . SER A 1 2   ? -9.486  -13.523 2.967   1.00 0.00 ? 2   SER A HG   2  
ATOM 1980  N N    . CYS A 1 3   ? -5.670  -12.254 2.228   1.00 0.00 ? 3   CYS A N    2  
ATOM 1981  C CA   . CYS A 1 3   ? -4.510  -13.124 2.142   1.00 0.00 ? 3   CYS A CA   2  
ATOM 1982  C C    . CYS A 1 3   ? -3.533  -12.734 3.253   1.00 0.00 ? 3   CYS A C    2  
ATOM 1983  O O    . CYS A 1 3   ? -3.651  -11.658 3.838   1.00 0.00 ? 3   CYS A O    2  
ATOM 1984  C CB   . CYS A 1 3   ? -3.858  -13.063 0.760   1.00 0.00 ? 3   CYS A CB   2  
ATOM 1985  S SG   . CYS A 1 3   ? -2.029  -12.991 0.778   1.00 0.00 ? 3   CYS A SG   2  
ATOM 1986  H H    . CYS A 1 3   ? -5.569  -11.369 1.773   1.00 0.00 ? 3   CYS A H    2  
ATOM 1987  H HA   . CYS A 1 3   ? -4.872  -14.143 2.286   1.00 0.00 ? 3   CYS A HA   2  
ATOM 1988  H HB2  . CYS A 1 3   ? -4.167  -13.938 0.188   1.00 0.00 ? 3   CYS A HB2  2  
ATOM 1989  H HB3  . CYS A 1 3   ? -4.236  -12.187 0.234   1.00 0.00 ? 3   CYS A HB3  2  
ATOM 1990  N N    . SER A 1 4   ? -2.590  -13.629 3.511   1.00 0.00 ? 4   SER A N    2  
ATOM 1991  C CA   . SER A 1 4   ? -1.593  -13.391 4.540   1.00 0.00 ? 4   SER A CA   2  
ATOM 1992  C C    . SER A 1 4   ? -0.451  -12.543 3.977   1.00 0.00 ? 4   SER A C    2  
ATOM 1993  O O    . SER A 1 4   ? 0.252   -12.971 3.064   1.00 0.00 ? 4   SER A O    2  
ATOM 1994  C CB   . SER A 1 4   ? -1.052  -14.710 5.096   1.00 0.00 ? 4   SER A CB   2  
ATOM 1995  O OG   . SER A 1 4   ? -0.232  -15.391 4.151   1.00 0.00 ? 4   SER A OG   2  
ATOM 1996  H H    . SER A 1 4   ? -2.502  -14.501 3.031   1.00 0.00 ? 4   SER A H    2  
ATOM 1997  H HA   . SER A 1 4   ? -2.117  -12.852 5.330   1.00 0.00 ? 4   SER A HA   2  
ATOM 1998  H HB2  . SER A 1 4   ? -0.474  -14.511 6.000   1.00 0.00 ? 4   SER A HB2  2  
ATOM 1999  H HB3  . SER A 1 4   ? -1.884  -15.351 5.385   1.00 0.00 ? 4   SER A HB3  2  
ATOM 2000  H HG   . SER A 1 4   ? -0.754  -16.122 3.711   1.00 0.00 ? 4   SER A HG   2  
ATOM 2001  N N    . PRO A 1 5   ? -0.300  -11.324 4.561   1.00 0.00 ? 5   PRO A N    2  
ATOM 2002  C CA   . PRO A 1 5   ? 0.744   -10.412 4.127   1.00 0.00 ? 5   PRO A CA   2  
ATOM 2003  C C    . PRO A 1 5   ? 2.114   -10.864 4.636   1.00 0.00 ? 5   PRO A C    2  
ATOM 2004  O O    . PRO A 1 5   ? 2.601   -10.363 5.649   1.00 0.00 ? 5   PRO A O    2  
ATOM 2005  C CB   . PRO A 1 5   ? 0.330   -9.053  4.668   1.00 0.00 ? 5   PRO A CB   2  
ATOM 2006  C CG   . PRO A 1 5   ? -0.679  -9.333  5.770   1.00 0.00 ? 5   PRO A CG   2  
ATOM 2007  C CD   . PRO A 1 5   ? -1.115  -10.784 5.645   1.00 0.00 ? 5   PRO A CD   2  
ATOM 2008  H HA   . PRO A 1 5   ? 0.811   -10.409 3.129   1.00 0.00 ? 5   PRO A HA   2  
ATOM 2009  H HB2  . PRO A 1 5   ? 1.190   -8.507  5.054   1.00 0.00 ? 5   PRO A HB2  2  
ATOM 2010  H HB3  . PRO A 1 5   ? -0.110  -8.438  3.883   1.00 0.00 ? 5   PRO A HB3  2  
ATOM 2011  H HG2  . PRO A 1 5   ? -0.234  -9.151  6.749   1.00 0.00 ? 5   PRO A HG2  2  
ATOM 2012  H HG3  . PRO A 1 5   ? -1.537  -8.667  5.681   1.00 0.00 ? 5   PRO A HG3  2  
ATOM 2013  H HD2  . PRO A 1 5   ? -0.949  -11.329 6.574   1.00 0.00 ? 5   PRO A HD2  2  
ATOM 2014  H HD3  . PRO A 1 5   ? -2.178  -10.859 5.416   1.00 0.00 ? 5   PRO A HD3  2  
ATOM 2015  N N    . VAL A 1 6   ? 2.698   -11.807 3.911   1.00 0.00 ? 6   VAL A N    2  
ATOM 2016  C CA   . VAL A 1 6   ? 4.002   -12.333 4.276   1.00 0.00 ? 6   VAL A CA   2  
ATOM 2017  C C    . VAL A 1 6   ? 5.069   -11.718 3.367   1.00 0.00 ? 6   VAL A C    2  
ATOM 2018  O O    . VAL A 1 6   ? 5.075   -10.510 3.142   1.00 0.00 ? 6   VAL A O    2  
ATOM 2019  C CB   . VAL A 1 6   ? 3.982   -13.862 4.225   1.00 0.00 ? 6   VAL A CB   2  
ATOM 2020  C CG1  . VAL A 1 6   ? 3.914   -14.362 2.781   1.00 0.00 ? 6   VAL A CG1  2  
ATOM 2021  C CG2  . VAL A 1 6   ? 5.193   -14.450 4.953   1.00 0.00 ? 6   VAL A CG2  2  
ATOM 2022  H H    . VAL A 1 6   ? 2.295   -12.210 3.088   1.00 0.00 ? 6   VAL A H    2  
ATOM 2023  H HA   . VAL A 1 6   ? 4.202   -12.032 5.304   1.00 0.00 ? 6   VAL A HA   2  
ATOM 2024  H HB   . VAL A 1 6   ? 3.085   -14.204 4.741   1.00 0.00 ? 6   VAL A HB   2  
ATOM 2025  H HG11 . VAL A 1 6   ? 3.965   -13.513 2.100   1.00 0.00 ? 6   VAL A HG11 2  
ATOM 2026  H HG12 . VAL A 1 6   ? 4.752   -15.033 2.589   1.00 0.00 ? 6   VAL A HG12 2  
ATOM 2027  H HG13 . VAL A 1 6   ? 2.977   -14.898 2.625   1.00 0.00 ? 6   VAL A HG13 2  
ATOM 2028  H HG21 . VAL A 1 6   ? 5.973   -13.693 5.031   1.00 0.00 ? 6   VAL A HG21 2  
ATOM 2029  H HG22 . VAL A 1 6   ? 4.896   -14.773 5.951   1.00 0.00 ? 6   VAL A HG22 2  
ATOM 2030  H HG23 . VAL A 1 6   ? 5.573   -15.306 4.393   1.00 0.00 ? 6   VAL A HG23 2  
ATOM 2031  N N    . HIS A 1 7   ? 5.943   -12.580 2.869   1.00 0.00 ? 7   HIS A N    2  
ATOM 2032  C CA   . HIS A 1 7   ? 7.012   -12.137 1.989   1.00 0.00 ? 7   HIS A CA   2  
ATOM 2033  C C    . HIS A 1 7   ? 7.585   -10.815 2.504   1.00 0.00 ? 7   HIS A C    2  
ATOM 2034  O O    . HIS A 1 7   ? 7.176   -9.742  2.060   1.00 0.00 ? 7   HIS A O    2  
ATOM 2035  C CB   . HIS A 1 7   ? 6.522   -12.047 0.542   1.00 0.00 ? 7   HIS A CB   2  
ATOM 2036  C CG   . HIS A 1 7   ? 5.073   -11.648 0.408   1.00 0.00 ? 7   HIS A CG   2  
ATOM 2037  N ND1  . HIS A 1 7   ? 4.097   -12.513 -0.056  1.00 0.00 ? 7   HIS A ND1  2  
ATOM 2038  C CD2  . HIS A 1 7   ? 4.444   -10.470 0.682   1.00 0.00 ? 7   HIS A CD2  2  
ATOM 2039  C CE1  . HIS A 1 7   ? 2.937   -11.873 -0.058  1.00 0.00 ? 7   HIS A CE1  2  
ATOM 2040  N NE2  . HIS A 1 7   ? 3.154   -10.606 0.399   1.00 0.00 ? 7   HIS A NE2  2  
ATOM 2041  H H    . HIS A 1 7   ? 5.931   -13.562 3.057   1.00 0.00 ? 7   HIS A H    2  
ATOM 2042  H HA   . HIS A 1 7   ? 7.788   -12.900 2.031   1.00 0.00 ? 7   HIS A HA   2  
ATOM 2043  H HB2  . HIS A 1 7   ? 7.139   -11.327 0.005   1.00 0.00 ? 7   HIS A HB2  2  
ATOM 2044  H HB3  . HIS A 1 7   ? 6.669   -13.014 0.060   1.00 0.00 ? 7   HIS A HB3  2  
ATOM 2045  H HD1  . HIS A 1 7   ? 4.242   -13.460 -0.340  1.00 0.00 ? 7   HIS A HD1  2  
ATOM 2046  H HD2  . HIS A 1 7   ? 4.920   -9.568  1.067   1.00 0.00 ? 7   HIS A HD2  2  
ATOM 2047  H HE1  . HIS A 1 7   ? 1.978   -12.286 -0.370  1.00 0.00 ? 7   HIS A HE1  2  
ATOM 2048  N N    . PRO A 1 8   ? 8.548   -10.938 3.456   1.00 0.00 ? 8   PRO A N    2  
ATOM 2049  C CA   . PRO A 1 8   ? 9.181   -9.765  4.036   1.00 0.00 ? 8   PRO A CA   2  
ATOM 2050  C C    . PRO A 1 8   ? 10.180  -9.141  3.059   1.00 0.00 ? 8   PRO A C    2  
ATOM 2051  O O    . PRO A 1 8   ? 10.827  -8.145  3.377   1.00 0.00 ? 8   PRO A O    2  
ATOM 2052  C CB   . PRO A 1 8   ? 9.834   -10.263 5.315   1.00 0.00 ? 8   PRO A CB   2  
ATOM 2053  C CG   . PRO A 1 8   ? 9.940   -11.772 5.169   1.00 0.00 ? 8   PRO A CG   2  
ATOM 2054  C CD   . PRO A 1 8   ? 9.057   -12.191 4.005   1.00 0.00 ? 8   PRO A CD   2  
ATOM 2055  H HA   . PRO A 1 8   ? 8.500   -9.057  4.219   1.00 0.00 ? 8   PRO A HA   2  
ATOM 2056  H HB2  . PRO A 1 8   ? 10.818  -9.813  5.452   1.00 0.00 ? 8   PRO A HB2  2  
ATOM 2057  H HB3  . PRO A 1 8   ? 9.239   -9.996  6.187   1.00 0.00 ? 8   PRO A HB3  2  
ATOM 2058  H HG2  . PRO A 1 8   ? 10.974  -12.067 4.989   1.00 0.00 ? 8   PRO A HG2  2  
ATOM 2059  H HG3  . PRO A 1 8   ? 9.623   -12.267 6.087   1.00 0.00 ? 8   PRO A HG3  2  
ATOM 2060  H HD2  . PRO A 1 8   ? 9.623   -12.749 3.259   1.00 0.00 ? 8   PRO A HD2  2  
ATOM 2061  H HD3  . PRO A 1 8   ? 8.244   -12.837 4.337   1.00 0.00 ? 8   PRO A HD3  2  
ATOM 2062  N N    . GLN A 1 9   ? 10.273  -9.755  1.887   1.00 0.00 ? 9   GLN A N    2  
ATOM 2063  C CA   . GLN A 1 9   ? 11.182  -9.272  0.861   1.00 0.00 ? 9   GLN A CA   2  
ATOM 2064  C C    . GLN A 1 9   ? 10.499  -9.300  -0.509  1.00 0.00 ? 9   GLN A C    2  
ATOM 2065  O O    . GLN A 1 9   ? 10.565  -8.329  -1.259  1.00 0.00 ? 9   GLN A O    2  
ATOM 2066  C CB   . GLN A 1 9   ? 12.475  -10.089 0.846   1.00 0.00 ? 9   GLN A CB   2  
ATOM 2067  C CG   . GLN A 1 9   ? 13.403  -9.625  -0.278  1.00 0.00 ? 9   GLN A CG   2  
ATOM 2068  C CD   . GLN A 1 9   ? 14.777  -9.235  0.270   1.00 0.00 ? 9   GLN A CD   2  
ATOM 2069  O OE1  . GLN A 1 9   ? 15.812  -9.672  -0.207  1.00 0.00 ? 9   GLN A OE1  2  
ATOM 2070  N NE2  . GLN A 1 9   ? 14.729  -8.391  1.296   1.00 0.00 ? 9   GLN A NE2  2  
ATOM 2071  H H    . GLN A 1 9   ? 9.744   -10.565 1.636   1.00 0.00 ? 9   GLN A H    2  
ATOM 2072  H HA   . GLN A 1 9   ? 11.412  -8.243  1.138   1.00 0.00 ? 9   GLN A HA   2  
ATOM 2073  H HB2  . GLN A 1 9   ? 12.983  -9.991  1.805   1.00 0.00 ? 9   GLN A HB2  2  
ATOM 2074  H HB3  . GLN A 1 9   ? 12.241  -11.145 0.716   1.00 0.00 ? 9   GLN A HB3  2  
ATOM 2075  H HG2  . GLN A 1 9   ? 13.515  -10.421 -1.015  1.00 0.00 ? 9   GLN A HG2  2  
ATOM 2076  H HG3  . GLN A 1 9   ? 12.959  -8.774  -0.794  1.00 0.00 ? 9   GLN A HG3  2  
ATOM 2077  H HE21 . GLN A 1 9   ? 13.847  -8.070  1.639   1.00 0.00 ? 9   GLN A HE21 2  
ATOM 2078  H HE22 . GLN A 1 9   ? 15.577  -8.076  1.725   1.00 0.00 ? 9   GLN A HE22 2  
ATOM 2079  N N    . GLN A 1 10  ? 9.858   -10.425 -0.792  1.00 0.00 ? 10  GLN A N    2  
ATOM 2080  C CA   . GLN A 1 10  ? 9.164   -10.593 -2.057  1.00 0.00 ? 10  GLN A CA   2  
ATOM 2081  C C    . GLN A 1 10  ? 8.115   -9.494  -2.236  1.00 0.00 ? 10  GLN A C    2  
ATOM 2082  O O    . GLN A 1 10  ? 7.546   -9.344  -3.317  1.00 0.00 ? 10  GLN A O    2  
ATOM 2083  C CB   . GLN A 1 10  ? 8.527   -11.980 -2.153  1.00 0.00 ? 10  GLN A CB   2  
ATOM 2084  C CG   . GLN A 1 10  ? 7.021   -11.876 -2.402  1.00 0.00 ? 10  GLN A CG   2  
ATOM 2085  C CD   . GLN A 1 10  ? 6.722   -11.701 -3.893  1.00 0.00 ? 10  GLN A CD   2  
ATOM 2086  O OE1  . GLN A 1 10  ? 7.610   -11.542 -4.715  1.00 0.00 ? 10  GLN A OE1  2  
ATOM 2087  N NE2  . GLN A 1 10  ? 5.428   -11.741 -4.193  1.00 0.00 ? 10  GLN A NE2  2  
ATOM 2088  H H    . GLN A 1 10  ? 9.810   -11.211 -0.175  1.00 0.00 ? 10  GLN A H    2  
ATOM 2089  H HA   . GLN A 1 10  ? 9.933   -10.499 -2.824  1.00 0.00 ? 10  GLN A HA   2  
ATOM 2090  H HB2  . GLN A 1 10  ? 8.994   -12.544 -2.960  1.00 0.00 ? 10  GLN A HB2  2  
ATOM 2091  H HB3  . GLN A 1 10  ? 8.709   -12.533 -1.231  1.00 0.00 ? 10  GLN A HB3  2  
ATOM 2092  H HG2  . GLN A 1 10  ? 6.524   -12.771 -2.030  1.00 0.00 ? 10  GLN A HG2  2  
ATOM 2093  H HG3  . GLN A 1 10  ? 6.615   -11.032 -1.845  1.00 0.00 ? 10  GLN A HG3  2  
ATOM 2094  H HE21 . GLN A 1 10  ? 4.750   -11.875 -3.469  1.00 0.00 ? 10  GLN A HE21 2  
ATOM 2095  H HE22 . GLN A 1 10  ? 5.131   -11.636 -5.142  1.00 0.00 ? 10  GLN A HE22 2  
ATOM 2096  N N    . ALA A 1 11  ? 7.891   -8.752  -1.161  1.00 0.00 ? 11  ALA A N    2  
ATOM 2097  C CA   . ALA A 1 11  ? 6.920   -7.672  -1.187  1.00 0.00 ? 11  ALA A CA   2  
ATOM 2098  C C    . ALA A 1 11  ? 7.562   -6.430  -1.809  1.00 0.00 ? 11  ALA A C    2  
ATOM 2099  O O    . ALA A 1 11  ? 6.894   -5.662  -2.500  1.00 0.00 ? 11  ALA A O    2  
ATOM 2100  C CB   . ALA A 1 11  ? 6.406   -7.413  0.232   1.00 0.00 ? 11  ALA A CB   2  
ATOM 2101  H H    . ALA A 1 11  ? 8.358   -8.880  -0.286  1.00 0.00 ? 11  ALA A H    2  
ATOM 2102  H HA   . ALA A 1 11  ? 6.085   -7.990  -1.810  1.00 0.00 ? 11  ALA A HA   2  
ATOM 2103  H HB1  . ALA A 1 11  ? 7.017   -7.966  0.946   1.00 0.00 ? 11  ALA A HB1  2  
ATOM 2104  H HB2  . ALA A 1 11  ? 6.466   -6.347  0.451   1.00 0.00 ? 11  ALA A HB2  2  
ATOM 2105  H HB3  . ALA A 1 11  ? 5.371   -7.743  0.308   1.00 0.00 ? 11  ALA A HB3  2  
ATOM 2106  N N    . PHE A 1 12  ? 8.851   -6.273  -1.543  1.00 0.00 ? 12  PHE A N    2  
ATOM 2107  C CA   . PHE A 1 12  ? 9.589   -5.137  -2.068  1.00 0.00 ? 12  PHE A CA   2  
ATOM 2108  C C    . PHE A 1 12  ? 10.209  -5.468  -3.428  1.00 0.00 ? 12  PHE A C    2  
ATOM 2109  O O    . PHE A 1 12  ? 10.946  -4.660  -3.992  1.00 0.00 ? 12  PHE A O    2  
ATOM 2110  C CB   . PHE A 1 12  ? 10.709  -4.832  -1.072  1.00 0.00 ? 12  PHE A CB   2  
ATOM 2111  C CG   . PHE A 1 12  ? 10.213  -4.400  0.309   1.00 0.00 ? 12  PHE A CG   2  
ATOM 2112  C CD1  . PHE A 1 12  ? 9.259   -5.130  0.947   1.00 0.00 ? 12  PHE A CD1  2  
ATOM 2113  C CD2  . PHE A 1 12  ? 10.724  -3.286  0.898   1.00 0.00 ? 12  PHE A CD2  2  
ATOM 2114  C CE1  . PHE A 1 12  ? 8.798   -4.728  2.230   1.00 0.00 ? 12  PHE A CE1  2  
ATOM 2115  C CE2  . PHE A 1 12  ? 10.263  -2.886  2.180   1.00 0.00 ? 12  PHE A CE2  2  
ATOM 2116  C CZ   . PHE A 1 12  ? 9.310   -3.615  2.819   1.00 0.00 ? 12  PHE A CZ   2  
ATOM 2117  H H    . PHE A 1 12  ? 9.386   -6.902  -0.981  1.00 0.00 ? 12  PHE A H    2  
ATOM 2118  H HA   . PHE A 1 12  ? 8.883   -4.316  -2.184  1.00 0.00 ? 12  PHE A HA   2  
ATOM 2119  H HB2  . PHE A 1 12  ? 11.335  -5.718  -0.961  1.00 0.00 ? 12  PHE A HB2  2  
ATOM 2120  H HB3  . PHE A 1 12  ? 11.343  -4.045  -1.482  1.00 0.00 ? 12  PHE A HB3  2  
ATOM 2121  H HD1  . PHE A 1 12  ? 8.848   -6.022  0.475   1.00 0.00 ? 12  PHE A HD1  2  
ATOM 2122  H HD2  . PHE A 1 12  ? 11.489  -2.701  0.387   1.00 0.00 ? 12  PHE A HD2  2  
ATOM 2123  H HE1  . PHE A 1 12  ? 8.033   -5.313  2.741   1.00 0.00 ? 12  PHE A HE1  2  
ATOM 2124  H HE2  . PHE A 1 12  ? 10.674  -1.992  2.652   1.00 0.00 ? 12  PHE A HE2  2  
ATOM 2125  H HZ   . PHE A 1 12  ? 8.955   -3.307  3.802   1.00 0.00 ? 12  PHE A HZ   2  
ATOM 2126  N N    . CYS A 1 13  ? 9.888   -6.658  -3.915  1.00 0.00 ? 13  CYS A N    2  
ATOM 2127  C CA   . CYS A 1 13  ? 10.403  -7.106  -5.197  1.00 0.00 ? 13  CYS A CA   2  
ATOM 2128  C C    . CYS A 1 13  ? 9.232   -7.212  -6.175  1.00 0.00 ? 13  CYS A C    2  
ATOM 2129  O O    . CYS A 1 13  ? 9.435   -7.352  -7.380  1.00 0.00 ? 13  CYS A O    2  
ATOM 2130  C CB   . CYS A 1 13  ? 11.164  -8.428  -5.071  1.00 0.00 ? 13  CYS A CB   2  
ATOM 2131  S SG   . CYS A 1 13  ? 12.976  -8.256  -4.879  1.00 0.00 ? 13  CYS A SG   2  
ATOM 2132  H H    . CYS A 1 13  ? 9.288   -7.309  -3.450  1.00 0.00 ? 13  CYS A H    2  
ATOM 2133  H HA   . CYS A 1 13  ? 11.117  -6.351  -5.529  1.00 0.00 ? 13  CYS A HA   2  
ATOM 2134  H HB2  . CYS A 1 13  ? 10.772  -8.975  -4.214  1.00 0.00 ? 13  CYS A HB2  2  
ATOM 2135  H HB3  . CYS A 1 13  ? 10.962  -9.032  -5.955  1.00 0.00 ? 13  CYS A HB3  2  
ATOM 2136  N N    . ASN A 1 14  ? 8.031   -7.143  -5.621  1.00 0.00 ? 14  ASN A N    2  
ATOM 2137  C CA   . ASN A 1 14  ? 6.827   -7.230  -6.429  1.00 0.00 ? 14  ASN A CA   2  
ATOM 2138  C C    . ASN A 1 14  ? 6.252   -5.826  -6.633  1.00 0.00 ? 14  ASN A C    2  
ATOM 2139  O O    . ASN A 1 14  ? 5.762   -5.505  -7.714  1.00 0.00 ? 14  ASN A O    2  
ATOM 2140  C CB   . ASN A 1 14  ? 5.760   -8.082  -5.738  1.00 0.00 ? 14  ASN A CB   2  
ATOM 2141  C CG   . ASN A 1 14  ? 5.269   -9.200  -6.660  1.00 0.00 ? 14  ASN A CG   2  
ATOM 2142  O OD1  . ASN A 1 14  ? 4.350   -9.034  -7.444  1.00 0.00 ? 14  ASN A OD1  2  
ATOM 2143  N ND2  . ASN A 1 14  ? 5.932   -10.344 -6.522  1.00 0.00 ? 14  ASN A ND2  2  
ATOM 2144  H H    . ASN A 1 14  ? 7.874   -7.029  -4.639  1.00 0.00 ? 14  ASN A H    2  
ATOM 2145  H HA   . ASN A 1 14  ? 7.143   -7.692  -7.364  1.00 0.00 ? 14  ASN A HA   2  
ATOM 2146  H HB2  . ASN A 1 14  ? 6.169   -8.512  -4.824  1.00 0.00 ? 14  ASN A HB2  2  
ATOM 2147  H HB3  . ASN A 1 14  ? 4.919   -7.451  -5.446  1.00 0.00 ? 14  ASN A HB3  2  
ATOM 2148  H HD21 . ASN A 1 14  ? 6.677   -10.414 -5.859  1.00 0.00 ? 14  ASN A HD21 2  
ATOM 2149  H HD22 . ASN A 1 14  ? 5.685   -11.136 -7.082  1.00 0.00 ? 14  ASN A HD22 2  
ATOM 2150  N N    . ALA A 1 15  ? 6.332   -5.030  -5.577  1.00 0.00 ? 15  ALA A N    2  
ATOM 2151  C CA   . ALA A 1 15  ? 5.826   -3.669  -5.627  1.00 0.00 ? 15  ALA A CA   2  
ATOM 2152  C C    . ALA A 1 15  ? 6.462   -2.935  -6.811  1.00 0.00 ? 15  ALA A C    2  
ATOM 2153  O O    . ALA A 1 15  ? 7.403   -3.438  -7.424  1.00 0.00 ? 15  ALA A O    2  
ATOM 2154  C CB   . ALA A 1 15  ? 6.103   -2.972  -4.294  1.00 0.00 ? 15  ALA A CB   2  
ATOM 2155  H H    . ALA A 1 15  ? 6.733   -5.300  -4.702  1.00 0.00 ? 15  ALA A H    2  
ATOM 2156  H HA   . ALA A 1 15  ? 4.748   -3.720  -5.779  1.00 0.00 ? 15  ALA A HA   2  
ATOM 2157  H HB1  . ALA A 1 15  ? 7.170   -3.016  -4.075  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 2158  H HB2  . ALA A 1 15  ? 5.789   -1.930  -4.356  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 2159  H HB3  . ALA A 1 15  ? 5.549   -3.472  -3.500  1.00 0.00 ? 15  ALA A HB3  2  
ATOM 2160  N N    . ASP A 1 16  ? 5.923   -1.760  -7.097  1.00 0.00 ? 16  ASP A N    2  
ATOM 2161  C CA   . ASP A 1 16  ? 6.425   -0.953  -8.196  1.00 0.00 ? 16  ASP A CA   2  
ATOM 2162  C C    . ASP A 1 16  ? 6.191   0.526   -7.885  1.00 0.00 ? 16  ASP A C    2  
ATOM 2163  O O    . ASP A 1 16  ? 6.256   1.369   -8.778  1.00 0.00 ? 16  ASP A O    2  
ATOM 2164  C CB   . ASP A 1 16  ? 5.696   -1.284  -9.499  1.00 0.00 ? 16  ASP A CB   2  
ATOM 2165  C CG   . ASP A 1 16  ? 6.360   -2.364  -10.356 1.00 0.00 ? 16  ASP A CG   2  
ATOM 2166  O OD1  . ASP A 1 16  ? 7.382   -2.910  -9.887  1.00 0.00 ? 16  ASP A OD1  2  
ATOM 2167  O OD2  . ASP A 1 16  ? 5.831   -2.619  -11.459 1.00 0.00 ? 16  ASP A OD2  2  
ATOM 2168  H H    . ASP A 1 16  ? 5.157   -1.359  -6.592  1.00 0.00 ? 16  ASP A H    2  
ATOM 2169  H HA   . ASP A 1 16  ? 7.484   -1.201  -8.273  1.00 0.00 ? 16  ASP A HA   2  
ATOM 2170  H HB2  . ASP A 1 16  ? 4.682   -1.604  -9.261  1.00 0.00 ? 16  ASP A HB2  2  
ATOM 2171  H HB3  . ASP A 1 16  ? 5.611   -0.373  -10.092 1.00 0.00 ? 16  ASP A HB3  2  
ATOM 2172  N N    . VAL A 1 17  ? 5.923   0.797   -6.616  1.00 0.00 ? 17  VAL A N    2  
ATOM 2173  C CA   . VAL A 1 17  ? 5.679   2.160   -6.177  1.00 0.00 ? 17  VAL A CA   2  
ATOM 2174  C C    . VAL A 1 17  ? 5.747   2.220   -4.650  1.00 0.00 ? 17  VAL A C    2  
ATOM 2175  O O    . VAL A 1 17  ? 4.718   2.182   -3.976  1.00 0.00 ? 17  VAL A O    2  
ATOM 2176  C CB   . VAL A 1 17  ? 4.345   2.659   -6.735  1.00 0.00 ? 17  VAL A CB   2  
ATOM 2177  C CG1  . VAL A 1 17  ? 3.173   1.876   -6.137  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 2178  C CG2  . VAL A 1 17  ? 4.178   4.161   -6.499  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 2179  H H    . VAL A 1 17  ? 5.872   0.105   -5.896  1.00 0.00 ? 17  VAL A H    2  
ATOM 2180  H HA   . VAL A 1 17  ? 6.471   2.785   -6.588  1.00 0.00 ? 17  VAL A HA   2  
ATOM 2181  H HB   . VAL A 1 17  ? 4.347   2.487   -7.811  1.00 0.00 ? 17  VAL A HB   2  
ATOM 2182  H HG11 . VAL A 1 17  ? 3.447   0.824   -6.047  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 2183  H HG12 . VAL A 1 17  ? 2.935   2.275   -5.151  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 2184  H HG13 . VAL A 1 17  ? 2.304   1.971   -6.788  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 2185  H HG21 . VAL A 1 17  ? 5.111   4.671   -6.733  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 2186  H HG22 . VAL A 1 17  ? 3.383   4.544   -7.138  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 2187  H HG23 . VAL A 1 17  ? 3.920   4.338   -5.454  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 2188  N N    . VAL A 1 18  ? 6.970   2.310   -4.147  1.00 0.00 ? 18  VAL A N    2  
ATOM 2189  C CA   . VAL A 1 18  ? 7.186   2.374   -2.711  1.00 0.00 ? 18  VAL A CA   2  
ATOM 2190  C C    . VAL A 1 18  ? 7.318   3.838   -2.285  1.00 0.00 ? 18  VAL A C    2  
ATOM 2191  O O    . VAL A 1 18  ? 8.211   4.545   -2.749  1.00 0.00 ? 18  VAL A O    2  
ATOM 2192  C CB   . VAL A 1 18  ? 8.401   1.528   -2.326  1.00 0.00 ? 18  VAL A CB   2  
ATOM 2193  C CG1  . VAL A 1 18  ? 8.156   0.783   -1.012  1.00 0.00 ? 18  VAL A CG1  2  
ATOM 2194  C CG2  . VAL A 1 18  ? 8.768   0.555   -3.448  1.00 0.00 ? 18  VAL A CG2  2  
ATOM 2195  H H    . VAL A 1 18  ? 7.802   2.340   -4.701  1.00 0.00 ? 18  VAL A H    2  
ATOM 2196  H HA   . VAL A 1 18  ? 6.309   1.945   -2.227  1.00 0.00 ? 18  VAL A HA   2  
ATOM 2197  H HB   . VAL A 1 18  ? 9.245   2.201   -2.178  1.00 0.00 ? 18  VAL A HB   2  
ATOM 2198  H HG11 . VAL A 1 18  ? 7.102   0.857   -0.744  1.00 0.00 ? 18  VAL A HG11 2  
ATOM 2199  H HG12 . VAL A 1 18  ? 8.428   -0.266  -1.133  1.00 0.00 ? 18  VAL A HG12 2  
ATOM 2200  H HG13 . VAL A 1 18  ? 8.765   1.228   -0.224  1.00 0.00 ? 18  VAL A HG13 2  
ATOM 2201  H HG21 . VAL A 1 18  ? 7.882   0.332   -4.042  1.00 0.00 ? 18  VAL A HG21 2  
ATOM 2202  H HG22 . VAL A 1 18  ? 9.529   1.005   -4.085  1.00 0.00 ? 18  VAL A HG22 2  
ATOM 2203  H HG23 . VAL A 1 18  ? 9.157   -0.369  -3.016  1.00 0.00 ? 18  VAL A HG23 2  
ATOM 2204  N N    . ILE A 1 19  ? 6.415   4.248   -1.406  1.00 0.00 ? 19  ILE A N    2  
ATOM 2205  C CA   . ILE A 1 19  ? 6.419   5.615   -0.912  1.00 0.00 ? 19  ILE A CA   2  
ATOM 2206  C C    . ILE A 1 19  ? 5.969   5.626   0.549   1.00 0.00 ? 19  ILE A C    2  
ATOM 2207  O O    . ILE A 1 19  ? 4.905   5.103   0.879   1.00 0.00 ? 19  ILE A O    2  
ATOM 2208  C CB   . ILE A 1 19  ? 5.579   6.515   -1.821  1.00 0.00 ? 19  ILE A CB   2  
ATOM 2209  C CG1  . ILE A 1 19  ? 4.088   6.216   -1.662  1.00 0.00 ? 19  ILE A CG1  2  
ATOM 2210  C CG2  . ILE A 1 19  ? 6.035   6.403   -3.277  1.00 0.00 ? 19  ILE A CG2  2  
ATOM 2211  C CD1  . ILE A 1 19  ? 3.314   6.597   -2.927  1.00 0.00 ? 19  ILE A CD1  2  
ATOM 2212  H H    . ILE A 1 19  ? 5.691   3.667   -1.035  1.00 0.00 ? 19  ILE A H    2  
ATOM 2213  H HA   . ILE A 1 19  ? 7.446   5.977   -0.960  1.00 0.00 ? 19  ILE A HA   2  
ATOM 2214  H HB   . ILE A 1 19  ? 5.734   7.550   -1.513  1.00 0.00 ? 19  ILE A HB   2  
ATOM 2215  H HG12 . ILE A 1 19  ? 3.946   5.156   -1.451  1.00 0.00 ? 19  ILE A HG12 2  
ATOM 2216  H HG13 . ILE A 1 19  ? 3.690   6.767   -0.810  1.00 0.00 ? 19  ILE A HG13 2  
ATOM 2217  H HG21 . ILE A 1 19  ? 7.122   6.338   -3.313  1.00 0.00 ? 19  ILE A HG21 2  
ATOM 2218  H HG22 . ILE A 1 19  ? 5.603   5.509   -3.726  1.00 0.00 ? 19  ILE A HG22 2  
ATOM 2219  H HG23 . ILE A 1 19  ? 5.706   7.283   -3.829  1.00 0.00 ? 19  ILE A HG23 2  
ATOM 2220  H HD11 . ILE A 1 19  ? 3.701   7.538   -3.319  1.00 0.00 ? 19  ILE A HD11 2  
ATOM 2221  H HD12 . ILE A 1 19  ? 3.435   5.814   -3.677  1.00 0.00 ? 19  ILE A HD12 2  
ATOM 2222  H HD13 . ILE A 1 19  ? 2.257   6.709   -2.687  1.00 0.00 ? 19  ILE A HD13 2  
ATOM 2223  N N    . ARG A 1 20  ? 6.801   6.226   1.388   1.00 0.00 ? 20  ARG A N    2  
ATOM 2224  C CA   . ARG A 1 20  ? 6.502   6.311   2.807   1.00 0.00 ? 20  ARG A CA   2  
ATOM 2225  C C    . ARG A 1 20  ? 5.470   7.411   3.067   1.00 0.00 ? 20  ARG A C    2  
ATOM 2226  O O    . ARG A 1 20  ? 5.598   8.172   4.024   1.00 0.00 ? 20  ARG A O    2  
ATOM 2227  C CB   . ARG A 1 20  ? 7.764   6.604   3.619   1.00 0.00 ? 20  ARG A CB   2  
ATOM 2228  C CG   . ARG A 1 20  ? 8.900   5.654   3.230   1.00 0.00 ? 20  ARG A CG   2  
ATOM 2229  C CD   . ARG A 1 20  ? 10.264  6.311   3.452   1.00 0.00 ? 20  ARG A CD   2  
ATOM 2230  N NE   . ARG A 1 20  ? 10.255  7.081   4.715   1.00 0.00 ? 20  ARG A NE   2  
ATOM 2231  C CZ   . ARG A 1 20  ? 11.356  7.404   5.406   1.00 0.00 ? 20  ARG A CZ   2  
ATOM 2232  N NH1  . ARG A 1 20  ? 12.562  7.026   4.960   1.00 0.00 ? 20  ARG A NH1  2  
ATOM 2233  N NH2  . ARG A 1 20  ? 11.253  8.106   6.543   1.00 0.00 ? 20  ARG A NH2  2  
ATOM 2234  H H    . ARG A 1 20  ? 7.664   6.648   1.111   1.00 0.00 ? 20  ARG A H    2  
ATOM 2235  H HA   . ARG A 1 20  ? 6.104   5.331   3.068   1.00 0.00 ? 20  ARG A HA   2  
ATOM 2236  H HB2  . ARG A 1 20  ? 8.076   7.635   3.456   1.00 0.00 ? 20  ARG A HB2  2  
ATOM 2237  H HB3  . ARG A 1 20  ? 7.549   6.501   4.683   1.00 0.00 ? 20  ARG A HB3  2  
ATOM 2238  H HG2  . ARG A 1 20  ? 8.832   4.739   3.818   1.00 0.00 ? 20  ARG A HG2  2  
ATOM 2239  H HG3  . ARG A 1 20  ? 8.796   5.368   2.183   1.00 0.00 ? 20  ARG A HG3  2  
ATOM 2240  H HD2  . ARG A 1 20  ? 11.042  5.547   3.487   1.00 0.00 ? 20  ARG A HD2  2  
ATOM 2241  H HD3  . ARG A 1 20  ? 10.500  6.969   2.616   1.00 0.00 ? 20  ARG A HD3  2  
ATOM 2242  H HE   . ARG A 1 20  ? 9.372   7.380   5.075   1.00 0.00 ? 20  ARG A HE   2  
ATOM 2243  H HH11 . ARG A 1 20  ? 12.639  6.501   4.112   1.00 0.00 ? 20  ARG A HH11 2  
ATOM 2244  H HH12 . ARG A 1 20  ? 13.385  7.267   5.475   1.00 0.00 ? 20  ARG A HH12 2  
ATOM 2245  H HH21 . ARG A 1 20  ? 10.353  8.390   6.875   1.00 0.00 ? 20  ARG A HH21 2  
ATOM 2246  H HH22 . ARG A 1 20  ? 12.076  8.348   7.058   1.00 0.00 ? 20  ARG A HH22 2  
ATOM 2247  N N    . THR A 1 21  ? 4.472   7.459   2.197   1.00 0.00 ? 21  THR A N    2  
ATOM 2248  C CA   . THR A 1 21  ? 3.419   8.454   2.321   1.00 0.00 ? 21  THR A CA   2  
ATOM 2249  C C    . THR A 1 21  ? 2.635   8.241   3.617   1.00 0.00 ? 21  THR A C    2  
ATOM 2250  O O    . THR A 1 21  ? 2.870   7.272   4.338   1.00 0.00 ? 21  THR A O    2  
ATOM 2251  C CB   . THR A 1 21  ? 2.549   8.379   1.065   1.00 0.00 ? 21  THR A CB   2  
ATOM 2252  O OG1  . THR A 1 21  ? 1.435   9.215   1.364   1.00 0.00 ? 21  THR A OG1  2  
ATOM 2253  C CG2  . THR A 1 21  ? 1.931   6.993   0.861   1.00 0.00 ? 21  THR A CG2  2  
ATOM 2254  H H    . THR A 1 21  ? 4.376   6.836   1.422   1.00 0.00 ? 21  THR A H    2  
ATOM 2255  H HA   . THR A 1 21  ? 3.882   9.438   2.385   1.00 0.00 ? 21  THR A HA   2  
ATOM 2256  H HB   . THR A 1 21  ? 3.111   8.688   0.183   1.00 0.00 ? 21  THR A HB   2  
ATOM 2257  H HG1  . THR A 1 21  ? 1.294   9.875   0.627   1.00 0.00 ? 21  THR A HG1  2  
ATOM 2258  H HG21 . THR A 1 21  ? 2.678   6.228   1.075   1.00 0.00 ? 21  THR A HG21 2  
ATOM 2259  H HG22 . THR A 1 21  ? 1.082   6.871   1.534   1.00 0.00 ? 21  THR A HG22 2  
ATOM 2260  H HG23 . THR A 1 21  ? 1.595   6.895   -0.171  1.00 0.00 ? 21  THR A HG23 2  
ATOM 2261  N N    . LYS A 1 22  ? 1.717   9.162   3.874   1.00 0.00 ? 22  LYS A N    2  
ATOM 2262  C CA   . LYS A 1 22  ? 0.896   9.088   5.070   1.00 0.00 ? 22  LYS A CA   2  
ATOM 2263  C C    . LYS A 1 22  ? -0.578  9.201   4.680   1.00 0.00 ? 22  LYS A C    2  
ATOM 2264  O O    . LYS A 1 22  ? -0.995  10.199  4.096   1.00 0.00 ? 22  LYS A O    2  
ATOM 2265  C CB   . LYS A 1 22  ? 1.344   10.135  6.092   1.00 0.00 ? 22  LYS A CB   2  
ATOM 2266  C CG   . LYS A 1 22  ? 1.082   11.551  5.576   1.00 0.00 ? 22  LYS A CG   2  
ATOM 2267  C CD   . LYS A 1 22  ? 1.281   12.585  6.687   1.00 0.00 ? 22  LYS A CD   2  
ATOM 2268  C CE   . LYS A 1 22  ? 0.636   12.118  7.993   1.00 0.00 ? 22  LYS A CE   2  
ATOM 2269  N NZ   . LYS A 1 22  ? 0.480   13.254  8.929   1.00 0.00 ? 22  LYS A NZ   2  
ATOM 2270  H H    . LYS A 1 22  ? 1.532   9.947   3.282   1.00 0.00 ? 22  LYS A H    2  
ATOM 2271  H HA   . LYS A 1 22  ? 1.062   8.109   5.520   1.00 0.00 ? 22  LYS A HA   2  
ATOM 2272  H HB2  . LYS A 1 22  ? 0.813   9.982   7.032   1.00 0.00 ? 22  LYS A HB2  2  
ATOM 2273  H HB3  . LYS A 1 22  ? 2.406   10.012  6.304   1.00 0.00 ? 22  LYS A HB3  2  
ATOM 2274  H HG2  . LYS A 1 22  ? 1.754   11.770  4.746   1.00 0.00 ? 22  LYS A HG2  2  
ATOM 2275  H HG3  . LYS A 1 22  ? 0.065   11.620  5.191   1.00 0.00 ? 22  LYS A HG3  2  
ATOM 2276  H HD2  . LYS A 1 22  ? 2.346   12.755  6.844   1.00 0.00 ? 22  LYS A HD2  2  
ATOM 2277  H HD3  . LYS A 1 22  ? 0.848   13.539  6.384   1.00 0.00 ? 22  LYS A HD3  2  
ATOM 2278  H HE2  . LYS A 1 22  ? -0.337  11.672  7.786   1.00 0.00 ? 22  LYS A HE2  2  
ATOM 2279  H HE3  . LYS A 1 22  ? 1.250   11.343  8.452   1.00 0.00 ? 22  LYS A HE3  2  
ATOM 2280  H HZ1  . LYS A 1 22  ? 1.286   13.843  8.876   1.00 0.00 ? 22  LYS A HZ1  2  
ATOM 2281  H HZ2  . LYS A 1 22  ? -0.335  13.780  8.682   1.00 0.00 ? 22  LYS A HZ2  2  
ATOM 2282  H HZ3  . LYS A 1 22  ? 0.381   12.906  9.861   1.00 0.00 ? 22  LYS A HZ3  2  
ATOM 2283  N N    . ALA A 1 23  ? -1.328  8.161   5.018   1.00 0.00 ? 23  ALA A N    2  
ATOM 2284  C CA   . ALA A 1 23  ? -2.747  8.131   4.710   1.00 0.00 ? 23  ALA A CA   2  
ATOM 2285  C C    . ALA A 1 23  ? -3.539  8.631   5.920   1.00 0.00 ? 23  ALA A C    2  
ATOM 2286  O O    . ALA A 1 23  ? -3.699  7.909   6.903   1.00 0.00 ? 23  ALA A O    2  
ATOM 2287  C CB   . ALA A 1 23  ? -3.149  6.714   4.296   1.00 0.00 ? 23  ALA A CB   2  
ATOM 2288  H H    . ALA A 1 23  ? -0.981  7.352   5.493   1.00 0.00 ? 23  ALA A H    2  
ATOM 2289  H HA   . ALA A 1 23  ? -2.919  8.804   3.870   1.00 0.00 ? 23  ALA A HA   2  
ATOM 2290  H HB1  . ALA A 1 23  ? -2.539  6.396   3.450   1.00 0.00 ? 23  ALA A HB1  2  
ATOM 2291  H HB2  . ALA A 1 23  ? -2.995  6.033   5.132   1.00 0.00 ? 23  ALA A HB2  2  
ATOM 2292  H HB3  . ALA A 1 23  ? -4.201  6.704   4.008   1.00 0.00 ? 23  ALA A HB3  2  
ATOM 2293  N N    . VAL A 1 24  ? -4.012  9.864   5.809   1.00 0.00 ? 24  VAL A N    2  
ATOM 2294  C CA   . VAL A 1 24  ? -4.782  10.468  6.883   1.00 0.00 ? 24  VAL A CA   2  
ATOM 2295  C C    . VAL A 1 24  ? -6.253  10.549  6.466   1.00 0.00 ? 24  VAL A C    2  
ATOM 2296  O O    . VAL A 1 24  ? -7.145  10.370  7.291   1.00 0.00 ? 24  VAL A O    2  
ATOM 2297  C CB   . VAL A 1 24  ? -4.189  11.831  7.248   1.00 0.00 ? 24  VAL A CB   2  
ATOM 2298  C CG1  . VAL A 1 24  ? -2.924  11.667  8.094   1.00 0.00 ? 24  VAL A CG1  2  
ATOM 2299  C CG2  . VAL A 1 24  ? -3.908  12.662  5.995   1.00 0.00 ? 24  VAL A CG2  2  
ATOM 2300  H H    . VAL A 1 24  ? -3.876  10.445  5.006   1.00 0.00 ? 24  VAL A H    2  
ATOM 2301  H HA   . VAL A 1 24  ? -4.699  9.819   7.754   1.00 0.00 ? 24  VAL A HA   2  
ATOM 2302  H HB   . VAL A 1 24  ? -4.926  12.367  7.848   1.00 0.00 ? 24  VAL A HB   2  
ATOM 2303  H HG11 . VAL A 1 24  ? -2.479  10.692  7.899   1.00 0.00 ? 24  VAL A HG11 2  
ATOM 2304  H HG12 . VAL A 1 24  ? -2.210  12.450  7.835   1.00 0.00 ? 24  VAL A HG12 2  
ATOM 2305  H HG13 . VAL A 1 24  ? -3.181  11.746  9.150   1.00 0.00 ? 24  VAL A HG13 2  
ATOM 2306  H HG21 . VAL A 1 24  ? -4.721  12.530  5.282   1.00 0.00 ? 24  VAL A HG21 2  
ATOM 2307  H HG22 . VAL A 1 24  ? -3.829  13.714  6.267   1.00 0.00 ? 24  VAL A HG22 2  
ATOM 2308  H HG23 . VAL A 1 24  ? -2.971  12.332  5.543   1.00 0.00 ? 24  VAL A HG23 2  
ATOM 2309  N N    . SER A 1 25  ? -6.457  10.820  5.185   1.00 0.00 ? 25  SER A N    2  
ATOM 2310  C CA   . SER A 1 25  ? -7.803  10.926  4.649   1.00 0.00 ? 25  SER A CA   2  
ATOM 2311  C C    . SER A 1 25  ? -8.078  9.768   3.688   1.00 0.00 ? 25  SER A C    2  
ATOM 2312  O O    . SER A 1 25  ? -7.149  9.108   3.225   1.00 0.00 ? 25  SER A O    2  
ATOM 2313  C CB   . SER A 1 25  ? -8.009  12.265  3.939   1.00 0.00 ? 25  SER A CB   2  
ATOM 2314  O OG   . SER A 1 25  ? -8.999  12.181  2.917   1.00 0.00 ? 25  SER A OG   2  
ATOM 2315  H H    . SER A 1 25  ? -5.725  10.964  4.519   1.00 0.00 ? 25  SER A H    2  
ATOM 2316  H HA   . SER A 1 25  ? -8.464  10.870  5.515   1.00 0.00 ? 25  SER A HA   2  
ATOM 2317  H HB2  . SER A 1 25  ? -8.304  13.021  4.667   1.00 0.00 ? 25  SER A HB2  2  
ATOM 2318  H HB3  . SER A 1 25  ? -7.066  12.594  3.502   1.00 0.00 ? 25  SER A HB3  2  
ATOM 2319  H HG   . SER A 1 25  ? -9.296  13.099  2.652   1.00 0.00 ? 25  SER A HG   2  
ATOM 2320  N N    . GLU A 1 26  ? -9.357  9.556   3.417   1.00 0.00 ? 26  GLU A N    2  
ATOM 2321  C CA   . GLU A 1 26  ? -9.765  8.489   2.519   1.00 0.00 ? 26  GLU A CA   2  
ATOM 2322  C C    . GLU A 1 26  ? -11.032 8.888   1.761   1.00 0.00 ? 26  GLU A C    2  
ATOM 2323  O O    . GLU A 1 26  ? -11.505 10.017  1.886   1.00 0.00 ? 26  GLU A O    2  
ATOM 2324  C CB   . GLU A 1 26  ? -9.973  7.179   3.283   1.00 0.00 ? 26  GLU A CB   2  
ATOM 2325  C CG   . GLU A 1 26  ? -8.633  6.520   3.616   1.00 0.00 ? 26  GLU A CG   2  
ATOM 2326  C CD   . GLU A 1 26  ? -8.314  6.649   5.107   1.00 0.00 ? 26  GLU A CD   2  
ATOM 2327  O OE1  . GLU A 1 26  ? -7.741  7.698   5.477   1.00 0.00 ? 26  GLU A OE1  2  
ATOM 2328  O OE2  . GLU A 1 26  ? -8.651  5.698   5.843   1.00 0.00 ? 26  GLU A OE2  2  
ATOM 2329  H H    . GLU A 1 26  ? -10.107 10.098  3.798   1.00 0.00 ? 26  GLU A H    2  
ATOM 2330  H HA   . GLU A 1 26  ? -8.939  8.367   1.819   1.00 0.00 ? 26  GLU A HA   2  
ATOM 2331  H HB2  . GLU A 1 26  ? -10.525 7.374   4.202   1.00 0.00 ? 26  GLU A HB2  2  
ATOM 2332  H HB3  . GLU A 1 26  ? -10.578 6.498   2.686   1.00 0.00 ? 26  GLU A HB3  2  
ATOM 2333  H HG2  . GLU A 1 26  ? -8.661  5.468   3.336   1.00 0.00 ? 26  GLU A HG2  2  
ATOM 2334  H HG3  . GLU A 1 26  ? -7.840  6.985   3.030   1.00 0.00 ? 26  GLU A HG3  2  
ATOM 2335  N N    . LYS A 1 27  ? -11.548 7.940   0.992   1.00 0.00 ? 27  LYS A N    2  
ATOM 2336  C CA   . LYS A 1 27  ? -12.751 8.179   0.214   1.00 0.00 ? 27  LYS A CA   2  
ATOM 2337  C C    . LYS A 1 27  ? -13.479 6.852   -0.013  1.00 0.00 ? 27  LYS A C    2  
ATOM 2338  O O    . LYS A 1 27  ? -12.959 5.962   -0.685  1.00 0.00 ? 27  LYS A O    2  
ATOM 2339  C CB   . LYS A 1 27  ? -12.414 8.925   -1.079  1.00 0.00 ? 27  LYS A CB   2  
ATOM 2340  C CG   . LYS A 1 27  ? -13.684 9.274   -1.858  1.00 0.00 ? 27  LYS A CG   2  
ATOM 2341  C CD   . LYS A 1 27  ? -13.514 10.588  -2.623  1.00 0.00 ? 27  LYS A CD   2  
ATOM 2342  C CE   . LYS A 1 27  ? -12.140 10.661  -3.290  1.00 0.00 ? 27  LYS A CE   2  
ATOM 2343  N NZ   . LYS A 1 27  ? -12.082 11.795  -4.238  1.00 0.00 ? 27  LYS A NZ   2  
ATOM 2344  H H    . LYS A 1 27  ? -11.157 7.025   0.896   1.00 0.00 ? 27  LYS A H    2  
ATOM 2345  H HA   . LYS A 1 27  ? -13.397 8.831   0.803   1.00 0.00 ? 27  LYS A HA   2  
ATOM 2346  H HB2  . LYS A 1 27  ? -11.864 9.837   -0.845  1.00 0.00 ? 27  LYS A HB2  2  
ATOM 2347  H HB3  . LYS A 1 27  ? -11.762 8.309   -1.698  1.00 0.00 ? 27  LYS A HB3  2  
ATOM 2348  H HG2  . LYS A 1 27  ? -13.920 8.470   -2.556  1.00 0.00 ? 27  LYS A HG2  2  
ATOM 2349  H HG3  . LYS A 1 27  ? -14.526 9.356   -1.170  1.00 0.00 ? 27  LYS A HG3  2  
ATOM 2350  H HD2  . LYS A 1 27  ? -14.294 10.676  -3.379  1.00 0.00 ? 27  LYS A HD2  2  
ATOM 2351  H HD3  . LYS A 1 27  ? -13.636 11.429  -1.940  1.00 0.00 ? 27  LYS A HD3  2  
ATOM 2352  H HE2  . LYS A 1 27  ? -11.365 10.774  -2.530  1.00 0.00 ? 27  LYS A HE2  2  
ATOM 2353  H HE3  . LYS A 1 27  ? -11.934 9.729   -3.816  1.00 0.00 ? 27  LYS A HE3  2  
ATOM 2354  H HZ1  . LYS A 1 27  ? -13.008 12.129  -4.414  1.00 0.00 ? 27  LYS A HZ1  2  
ATOM 2355  H HZ2  . LYS A 1 27  ? -11.532 12.532  -3.843  1.00 0.00 ? 27  LYS A HZ2  2  
ATOM 2356  H HZ3  . LYS A 1 27  ? -11.667 11.493  -5.096  1.00 0.00 ? 27  LYS A HZ3  2  
ATOM 2357  N N    . GLU A 1 28  ? -14.670 6.762   0.560   1.00 0.00 ? 28  GLU A N    2  
ATOM 2358  C CA   . GLU A 1 28  ? -15.473 5.558   0.429   1.00 0.00 ? 28  GLU A CA   2  
ATOM 2359  C C    . GLU A 1 28  ? -16.107 5.493   -0.962  1.00 0.00 ? 28  GLU A C    2  
ATOM 2360  O O    . GLU A 1 28  ? -17.204 6.008   -1.173  1.00 0.00 ? 28  GLU A O    2  
ATOM 2361  C CB   . GLU A 1 28  ? -16.542 5.491   1.523   1.00 0.00 ? 28  GLU A CB   2  
ATOM 2362  C CG   . GLU A 1 28  ? -17.520 4.343   1.262   1.00 0.00 ? 28  GLU A CG   2  
ATOM 2363  C CD   . GLU A 1 28  ? -18.912 4.677   1.802   1.00 0.00 ? 28  GLU A CD   2  
ATOM 2364  O OE1  . GLU A 1 28  ? -19.462 5.707   1.356   1.00 0.00 ? 28  GLU A OE1  2  
ATOM 2365  O OE2  . GLU A 1 28  ? -19.394 3.895   2.650   1.00 0.00 ? 28  GLU A OE2  2  
ATOM 2366  H H    . GLU A 1 28  ? -15.085 7.490   1.104   1.00 0.00 ? 28  GLU A H    2  
ATOM 2367  H HA   . GLU A 1 28  ? -14.777 4.729   0.558   1.00 0.00 ? 28  GLU A HA   2  
ATOM 2368  H HB2  . GLU A 1 28  ? -16.065 5.353   2.493   1.00 0.00 ? 28  GLU A HB2  2  
ATOM 2369  H HB3  . GLU A 1 28  ? -17.085 6.434   1.564   1.00 0.00 ? 28  GLU A HB3  2  
ATOM 2370  H HG2  . GLU A 1 28  ? -17.580 4.147   0.192   1.00 0.00 ? 28  GLU A HG2  2  
ATOM 2371  H HG3  . GLU A 1 28  ? -17.151 3.432   1.733   1.00 0.00 ? 28  GLU A HG3  2  
ATOM 2372  N N    . VAL A 1 29  ? -15.390 4.854   -1.875  1.00 0.00 ? 29  VAL A N    2  
ATOM 2373  C CA   . VAL A 1 29  ? -15.869 4.714   -3.239  1.00 0.00 ? 29  VAL A CA   2  
ATOM 2374  C C    . VAL A 1 29  ? -16.413 3.299   -3.442  1.00 0.00 ? 29  VAL A C    2  
ATOM 2375  O O    . VAL A 1 29  ? -15.645 2.343   -3.543  1.00 0.00 ? 29  VAL A O    2  
ATOM 2376  C CB   . VAL A 1 29  ? -14.755 5.073   -4.224  1.00 0.00 ? 29  VAL A CB   2  
ATOM 2377  C CG1  . VAL A 1 29  ? -14.402 6.559   -4.137  1.00 0.00 ? 29  VAL A CG1  2  
ATOM 2378  C CG2  . VAL A 1 29  ? -13.517 4.202   -3.994  1.00 0.00 ? 29  VAL A CG2  2  
ATOM 2379  H H    . VAL A 1 29  ? -14.499 4.437   -1.695  1.00 0.00 ? 29  VAL A H    2  
ATOM 2380  H HA   . VAL A 1 29  ? -16.683 5.426   -3.377  1.00 0.00 ? 29  VAL A HA   2  
ATOM 2381  H HB   . VAL A 1 29  ? -15.120 4.874   -5.232  1.00 0.00 ? 29  VAL A HB   2  
ATOM 2382  H HG11 . VAL A 1 29  ? -15.275 7.120   -3.799  1.00 0.00 ? 29  VAL A HG11 2  
ATOM 2383  H HG12 . VAL A 1 29  ? -13.585 6.698   -3.429  1.00 0.00 ? 29  VAL A HG12 2  
ATOM 2384  H HG13 . VAL A 1 29  ? -14.097 6.919   -5.121  1.00 0.00 ? 29  VAL A HG13 2  
ATOM 2385  H HG21 . VAL A 1 29  ? -13.750 3.428   -3.262  1.00 0.00 ? 29  VAL A HG21 2  
ATOM 2386  H HG22 . VAL A 1 29  ? -13.220 3.736   -4.933  1.00 0.00 ? 29  VAL A HG22 2  
ATOM 2387  H HG23 . VAL A 1 29  ? -12.702 4.822   -3.621  1.00 0.00 ? 29  VAL A HG23 2  
ATOM 2388  N N    . ASP A 1 30  ? -17.734 3.209   -3.496  1.00 0.00 ? 30  ASP A N    2  
ATOM 2389  C CA   . ASP A 1 30  ? -18.390 1.927   -3.685  1.00 0.00 ? 30  ASP A CA   2  
ATOM 2390  C C    . ASP A 1 30  ? -17.806 1.237   -4.918  1.00 0.00 ? 30  ASP A C    2  
ATOM 2391  O O    . ASP A 1 30  ? -17.351 1.901   -5.849  1.00 0.00 ? 30  ASP A O    2  
ATOM 2392  C CB   . ASP A 1 30  ? -19.893 2.103   -3.908  1.00 0.00 ? 30  ASP A CB   2  
ATOM 2393  C CG   . ASP A 1 30  ? -20.530 3.259   -3.133  1.00 0.00 ? 30  ASP A CG   2  
ATOM 2394  O OD1  . ASP A 1 30  ? -20.289 4.416   -3.539  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 2395  O OD2  . ASP A 1 30  ? -21.245 2.957   -2.153  1.00 0.00 ? 30  ASP A OD2  2  
ATOM 2396  H H    . ASP A 1 30  ? -18.351 3.991   -3.413  1.00 0.00 ? 30  ASP A H    2  
ATOM 2397  H HA   . ASP A 1 30  ? -18.200 1.369   -2.767  1.00 0.00 ? 30  ASP A HA   2  
ATOM 2398  H HB2  . ASP A 1 30  ? -20.070 2.259   -4.973  1.00 0.00 ? 30  ASP A HB2  2  
ATOM 2399  H HB3  . ASP A 1 30  ? -20.398 1.179   -3.632  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 2400  N N    . SER A 1 31  ? -17.838 -0.088  -4.888  1.00 0.00 ? 31  SER A N    2  
ATOM 2401  C CA   . SER A 1 31  ? -17.317 -0.875  -5.993  1.00 0.00 ? 31  SER A CA   2  
ATOM 2402  C C    . SER A 1 31  ? -18.266 -2.035  -6.301  1.00 0.00 ? 31  SER A C    2  
ATOM 2403  O O    . SER A 1 31  ? -17.858 -3.036  -6.890  1.00 0.00 ? 31  SER A O    2  
ATOM 2404  C CB   . SER A 1 31  ? -15.916 -1.403  -5.680  1.00 0.00 ? 31  SER A CB   2  
ATOM 2405  O OG   . SER A 1 31  ? -15.645 -2.628  -6.356  1.00 0.00 ? 31  SER A OG   2  
ATOM 2406  H H    . SER A 1 31  ? -18.210 -0.621  -4.128  1.00 0.00 ? 31  SER A H    2  
ATOM 2407  H HA   . SER A 1 31  ? -17.267 -0.188  -6.838  1.00 0.00 ? 31  SER A HA   2  
ATOM 2408  H HB2  . SER A 1 31  ? -15.176 -0.658  -5.970  1.00 0.00 ? 31  SER A HB2  2  
ATOM 2409  H HB3  . SER A 1 31  ? -15.816 -1.552  -4.606  1.00 0.00 ? 31  SER A HB3  2  
ATOM 2410  H HG   . SER A 1 31  ? -15.973 -2.580  -7.299  1.00 0.00 ? 31  SER A HG   2  
ATOM 2411  N N    . GLY A 1 32  ? -19.514 -1.864  -5.889  1.00 0.00 ? 32  GLY A N    2  
ATOM 2412  C CA   . GLY A 1 32  ? -20.523 -2.884  -6.114  1.00 0.00 ? 32  GLY A CA   2  
ATOM 2413  C C    . GLY A 1 32  ? -20.274 -4.106  -5.228  1.00 0.00 ? 32  GLY A C    2  
ATOM 2414  O O    . GLY A 1 32  ? -19.324 -4.128  -4.447  1.00 0.00 ? 32  GLY A O    2  
ATOM 2415  H H    . GLY A 1 32  ? -19.837 -1.047  -5.411  1.00 0.00 ? 32  GLY A H    2  
ATOM 2416  H HA2  . GLY A 1 32  ? -21.512 -2.475  -5.906  1.00 0.00 ? 32  GLY A HA2  2  
ATOM 2417  H HA3  . GLY A 1 32  ? -20.516 -3.183  -7.162  1.00 0.00 ? 32  GLY A HA3  2  
ATOM 2418  N N    . ASN A 1 33  ? -21.143 -5.094  -5.379  1.00 0.00 ? 33  ASN A N    2  
ATOM 2419  C CA   . ASN A 1 33  ? -21.030 -6.317  -4.602  1.00 0.00 ? 33  ASN A CA   2  
ATOM 2420  C C    . ASN A 1 33  ? -20.044 -7.263  -5.289  1.00 0.00 ? 33  ASN A C    2  
ATOM 2421  O O    . ASN A 1 33  ? -19.710 -7.075  -6.458  1.00 0.00 ? 33  ASN A O    2  
ATOM 2422  C CB   . ASN A 1 33  ? -22.378 -7.032  -4.499  1.00 0.00 ? 33  ASN A CB   2  
ATOM 2423  C CG   . ASN A 1 33  ? -23.515 -6.030  -4.285  1.00 0.00 ? 33  ASN A CG   2  
ATOM 2424  O OD1  . ASN A 1 33  ? -23.336 -4.957  -3.733  1.00 0.00 ? 33  ASN A OD1  2  
ATOM 2425  N ND2  . ASN A 1 33  ? -24.692 -6.440  -4.750  1.00 0.00 ? 33  ASN A ND2  2  
ATOM 2426  H H    . ASN A 1 33  ? -21.914 -5.068  -6.015  1.00 0.00 ? 33  ASN A H    2  
ATOM 2427  H HA   . ASN A 1 33  ? -20.686 -5.999  -3.617  1.00 0.00 ? 33  ASN A HA   2  
ATOM 2428  H HB2  . ASN A 1 33  ? -22.560 -7.606  -5.408  1.00 0.00 ? 33  ASN A HB2  2  
ATOM 2429  H HB3  . ASN A 1 33  ? -22.355 -7.743  -3.673  1.00 0.00 ? 33  ASN A HB3  2  
ATOM 2430  H HD21 . ASN A 1 33  ? -24.771 -7.334  -5.193  1.00 0.00 ? 33  ASN A HD21 2  
ATOM 2431  H HD22 . ASN A 1 33  ? -25.497 -5.855  -4.658  1.00 0.00 ? 33  ASN A HD22 2  
ATOM 2432  N N    . ASP A 1 34  ? -19.606 -8.260  -4.535  1.00 0.00 ? 34  ASP A N    2  
ATOM 2433  C CA   . ASP A 1 34  ? -18.664 -9.236  -5.058  1.00 0.00 ? 34  ASP A CA   2  
ATOM 2434  C C    . ASP A 1 34  ? -19.434 -10.456 -5.570  1.00 0.00 ? 34  ASP A C    2  
ATOM 2435  O O    . ASP A 1 34  ? -20.635 -10.378 -5.819  1.00 0.00 ? 34  ASP A O    2  
ATOM 2436  C CB   . ASP A 1 34  ? -17.699 -9.708  -3.970  1.00 0.00 ? 34  ASP A CB   2  
ATOM 2437  C CG   . ASP A 1 34  ? -16.307 -10.104 -4.467  1.00 0.00 ? 34  ASP A CG   2  
ATOM 2438  O OD1  . ASP A 1 34  ? -15.799 -9.391  -5.360  1.00 0.00 ? 34  ASP A OD1  2  
ATOM 2439  O OD2  . ASP A 1 34  ? -15.782 -11.110 -3.944  1.00 0.00 ? 34  ASP A OD2  2  
ATOM 2440  H H    . ASP A 1 34  ? -19.883 -8.406  -3.586  1.00 0.00 ? 34  ASP A H    2  
ATOM 2441  H HA   . ASP A 1 34  ? -18.127 -8.719  -5.853  1.00 0.00 ? 34  ASP A HA   2  
ATOM 2442  H HB2  . ASP A 1 34  ? -17.593 -8.914  -3.230  1.00 0.00 ? 34  ASP A HB2  2  
ATOM 2443  H HB3  . ASP A 1 34  ? -18.142 -10.563 -3.458  1.00 0.00 ? 34  ASP A HB3  2  
ATOM 2444  N N    . ILE A 1 35  ? -18.709 -11.557 -5.710  1.00 0.00 ? 35  ILE A N    2  
ATOM 2445  C CA   . ILE A 1 35  ? -19.307 -12.792 -6.187  1.00 0.00 ? 35  ILE A CA   2  
ATOM 2446  C C    . ILE A 1 35  ? -20.020 -13.490 -5.028  1.00 0.00 ? 35  ILE A C    2  
ATOM 2447  O O    . ILE A 1 35  ? -20.597 -14.561 -5.203  1.00 0.00 ? 35  ILE A O    2  
ATOM 2448  C CB   . ILE A 1 35  ? -18.258 -13.664 -6.878  1.00 0.00 ? 35  ILE A CB   2  
ATOM 2449  C CG1  . ILE A 1 35  ? -17.565 -12.899 -8.008  1.00 0.00 ? 35  ILE A CG1  2  
ATOM 2450  C CG2  . ILE A 1 35  ? -18.872 -14.978 -7.368  1.00 0.00 ? 35  ILE A CG2  2  
ATOM 2451  C CD1  . ILE A 1 35  ? -16.620 -11.833 -7.450  1.00 0.00 ? 35  ILE A CD1  2  
ATOM 2452  H H    . ILE A 1 35  ? -17.731 -11.613 -5.506  1.00 0.00 ? 35  ILE A H    2  
ATOM 2453  H HA   . ILE A 1 35  ? -20.051 -12.525 -6.939  1.00 0.00 ? 35  ILE A HA   2  
ATOM 2454  H HB   . ILE A 1 35  ? -17.492 -13.920 -6.147  1.00 0.00 ? 35  ILE A HB   2  
ATOM 2455  H HG12 . ILE A 1 35  ? -17.007 -13.594 -8.635  1.00 0.00 ? 35  ILE A HG12 2  
ATOM 2456  H HG13 . ILE A 1 35  ? -18.314 -12.427 -8.644  1.00 0.00 ? 35  ILE A HG13 2  
ATOM 2457  H HG21 . ILE A 1 35  ? -19.826 -14.773 -7.855  1.00 0.00 ? 35  ILE A HG21 2  
ATOM 2458  H HG22 . ILE A 1 35  ? -18.195 -15.452 -8.079  1.00 0.00 ? 35  ILE A HG22 2  
ATOM 2459  H HG23 . ILE A 1 35  ? -19.032 -15.642 -6.519  1.00 0.00 ? 35  ILE A HG23 2  
ATOM 2460  H HD11 . ILE A 1 35  ? -16.190 -12.185 -6.511  1.00 0.00 ? 35  ILE A HD11 2  
ATOM 2461  H HD12 . ILE A 1 35  ? -15.821 -11.646 -8.167  1.00 0.00 ? 35  ILE A HD12 2  
ATOM 2462  H HD13 . ILE A 1 35  ? -17.174 -10.912 -7.273  1.00 0.00 ? 35  ILE A HD13 2  
ATOM 2463  N N    . TYR A 1 36  ? -19.956 -12.853 -3.867  1.00 0.00 ? 36  TYR A N    2  
ATOM 2464  C CA   . TYR A 1 36  ? -20.588 -13.399 -2.678  1.00 0.00 ? 36  TYR A CA   2  
ATOM 2465  C C    . TYR A 1 36  ? -21.827 -12.588 -2.294  1.00 0.00 ? 36  TYR A C    2  
ATOM 2466  O O    . TYR A 1 36  ? -22.500 -12.902 -1.314  1.00 0.00 ? 36  TYR A O    2  
ATOM 2467  C CB   . TYR A 1 36  ? -19.551 -13.284 -1.559  1.00 0.00 ? 36  TYR A CB   2  
ATOM 2468  C CG   . TYR A 1 36  ? -19.661 -14.377 -0.494  1.00 0.00 ? 36  TYR A CG   2  
ATOM 2469  C CD1  . TYR A 1 36  ? -20.555 -14.238 0.548   1.00 0.00 ? 36  TYR A CD1  2  
ATOM 2470  C CD2  . TYR A 1 36  ? -18.865 -15.502 -0.575  1.00 0.00 ? 36  TYR A CD2  2  
ATOM 2471  C CE1  . TYR A 1 36  ? -20.658 -15.268 1.549   1.00 0.00 ? 36  TYR A CE1  2  
ATOM 2472  C CE2  . TYR A 1 36  ? -18.969 -16.531 0.426   1.00 0.00 ? 36  TYR A CE2  2  
ATOM 2473  C CZ   . TYR A 1 36  ? -19.860 -16.363 1.439   1.00 0.00 ? 36  TYR A CZ   2  
ATOM 2474  O OH   . TYR A 1 36  ? -19.957 -17.334 2.386   1.00 0.00 ? 36  TYR A OH   2  
ATOM 2475  H H    . TYR A 1 36  ? -19.484 -11.982 -3.732  1.00 0.00 ? 36  TYR A H    2  
ATOM 2476  H HA   . TYR A 1 36  ? -20.887 -14.424 -2.897  1.00 0.00 ? 36  TYR A HA   2  
ATOM 2477  H HB2  . TYR A 1 36  ? -18.553 -13.317 -1.997  1.00 0.00 ? 36  TYR A HB2  2  
ATOM 2478  H HB3  . TYR A 1 36  ? -19.657 -12.311 -1.079  1.00 0.00 ? 36  TYR A HB3  2  
ATOM 2479  H HD1  . TYR A 1 36  ? -21.183 -13.350 0.612   1.00 0.00 ? 36  TYR A HD1  2  
ATOM 2480  H HD2  . TYR A 1 36  ? -18.159 -15.611 -1.399  1.00 0.00 ? 36  TYR A HD2  2  
ATOM 2481  H HE1  . TYR A 1 36  ? -21.361 -15.170 2.378   1.00 0.00 ? 36  TYR A HE1  2  
ATOM 2482  H HE2  . TYR A 1 36  ? -18.347 -17.424 0.374   1.00 0.00 ? 36  TYR A HE2  2  
ATOM 2483  H HH   . TYR A 1 36  ? -19.235 -17.222 3.068   1.00 0.00 ? 36  TYR A HH   2  
ATOM 2484  N N    . GLY A 1 37  ? -22.092 -11.561 -3.088  1.00 0.00 ? 37  GLY A N    2  
ATOM 2485  C CA   . GLY A 1 37  ? -23.239 -10.703 -2.843  1.00 0.00 ? 37  GLY A CA   2  
ATOM 2486  C C    . GLY A 1 37  ? -22.884 -9.577  -1.869  1.00 0.00 ? 37  GLY A C    2  
ATOM 2487  O O    . GLY A 1 37  ? -23.681 -8.666  -1.650  1.00 0.00 ? 37  GLY A O    2  
ATOM 2488  H H    . GLY A 1 37  ? -21.540 -11.312 -3.884  1.00 0.00 ? 37  GLY A H    2  
ATOM 2489  H HA2  . GLY A 1 37  ? -23.586 -10.277 -3.785  1.00 0.00 ? 37  GLY A HA2  2  
ATOM 2490  H HA3  . GLY A 1 37  ? -24.060 -11.294 -2.438  1.00 0.00 ? 37  GLY A HA3  2  
ATOM 2491  N N    . ASN A 1 38  ? -21.687 -9.678  -1.310  1.00 0.00 ? 38  ASN A N    2  
ATOM 2492  C CA   . ASN A 1 38  ? -21.217 -8.680  -0.365  1.00 0.00 ? 38  ASN A CA   2  
ATOM 2493  C C    . ASN A 1 38  ? -20.724 -7.450  -1.130  1.00 0.00 ? 38  ASN A C    2  
ATOM 2494  O O    . ASN A 1 38  ? -20.314 -7.557  -2.285  1.00 0.00 ? 38  ASN A O    2  
ATOM 2495  C CB   . ASN A 1 38  ? -20.051 -9.216  0.468   1.00 0.00 ? 38  ASN A CB   2  
ATOM 2496  C CG   . ASN A 1 38  ? -19.018 -9.912  -0.419  1.00 0.00 ? 38  ASN A CG   2  
ATOM 2497  O OD1  . ASN A 1 38  ? -19.262 -10.226 -1.572  1.00 0.00 ? 38  ASN A OD1  2  
ATOM 2498  N ND2  . ASN A 1 38  ? -17.852 -10.136 0.182   1.00 0.00 ? 38  ASN A ND2  2  
ATOM 2499  H H    . ASN A 1 38  ? -21.045 -10.422 -1.493  1.00 0.00 ? 38  ASN A H    2  
ATOM 2500  H HA   . ASN A 1 38  ? -22.075 -8.460  0.270   1.00 0.00 ? 38  ASN A HA   2  
ATOM 2501  H HB2  . ASN A 1 38  ? -19.579 -8.397  1.010   1.00 0.00 ? 38  ASN A HB2  2  
ATOM 2502  H HB3  . ASN A 1 38  ? -20.425 -9.918  1.215   1.00 0.00 ? 38  ASN A HB3  2  
ATOM 2503  H HD21 . ASN A 1 38  ? -17.716 -9.853  1.131   1.00 0.00 ? 38  ASN A HD21 2  
ATOM 2504  H HD22 . ASN A 1 38  ? -17.111 -10.586 -0.316  1.00 0.00 ? 38  ASN A HD22 2  
ATOM 2505  N N    . PRO A 1 39  ? -20.781 -6.281  -0.438  1.00 0.00 ? 39  PRO A N    2  
ATOM 2506  C CA   . PRO A 1 39  ? -20.346 -5.033  -1.041  1.00 0.00 ? 39  PRO A CA   2  
ATOM 2507  C C    . PRO A 1 39  ? -18.818 -4.959  -1.105  1.00 0.00 ? 39  PRO A C    2  
ATOM 2508  O O    . PRO A 1 39  ? -18.140 -5.179  -0.104  1.00 0.00 ? 39  PRO A O    2  
ATOM 2509  C CB   . PRO A 1 39  ? -20.957 -3.943  -0.174  1.00 0.00 ? 39  PRO A CB   2  
ATOM 2510  C CG   . PRO A 1 39  ? -21.323 -4.613  1.141   1.00 0.00 ? 39  PRO A CG   2  
ATOM 2511  C CD   . PRO A 1 39  ? -21.261 -6.117  0.931   1.00 0.00 ? 39  PRO A CD   2  
ATOM 2512  H HA   . PRO A 1 39  ? -20.663 -4.975  -1.987  1.00 0.00 ? 39  PRO A HA   2  
ATOM 2513  H HB2  . PRO A 1 39  ? -20.250 -3.129  -0.014  1.00 0.00 ? 39  PRO A HB2  2  
ATOM 2514  H HB3  . PRO A 1 39  ? -21.837 -3.513  -0.651  1.00 0.00 ? 39  PRO A HB3  2  
ATOM 2515  H HG2  . PRO A 1 39  ? -20.633 -4.309  1.928   1.00 0.00 ? 39  PRO A HG2  2  
ATOM 2516  H HG3  . PRO A 1 39  ? -22.321 -4.311  1.458   1.00 0.00 ? 39  PRO A HG3  2  
ATOM 2517  H HD2  . PRO A 1 39  ? -20.587 -6.590  1.646   1.00 0.00 ? 39  PRO A HD2  2  
ATOM 2518  H HD3  . PRO A 1 39  ? -22.242 -6.575  1.065   1.00 0.00 ? 39  PRO A HD3  2  
ATOM 2519  N N    . ILE A 1 40  ? -18.323 -4.647  -2.294  1.00 0.00 ? 40  ILE A N    2  
ATOM 2520  C CA   . ILE A 1 40  ? -16.889 -4.541  -2.503  1.00 0.00 ? 40  ILE A CA   2  
ATOM 2521  C C    . ILE A 1 40  ? -16.347 -3.358  -1.699  1.00 0.00 ? 40  ILE A C    2  
ATOM 2522  O O    . ILE A 1 40  ? -15.818 -3.538  -0.603  1.00 0.00 ? 40  ILE A O    2  
ATOM 2523  C CB   . ILE A 1 40  ? -16.569 -4.468  -3.997  1.00 0.00 ? 40  ILE A CB   2  
ATOM 2524  C CG1  . ILE A 1 40  ? -16.988 -5.754  -4.711  1.00 0.00 ? 40  ILE A CG1  2  
ATOM 2525  C CG2  . ILE A 1 40  ? -15.093 -4.139  -4.226  1.00 0.00 ? 40  ILE A CG2  2  
ATOM 2526  C CD1  . ILE A 1 40  ? -16.602 -5.710  -6.192  1.00 0.00 ? 40  ILE A CD1  2  
ATOM 2527  H H    . ILE A 1 40  ? -18.882 -4.469  -3.104  1.00 0.00 ? 40  ILE A H    2  
ATOM 2528  H HA   . ILE A 1 40  ? -16.436 -5.455  -2.120  1.00 0.00 ? 40  ILE A HA   2  
ATOM 2529  H HB   . ILE A 1 40  ? -17.151 -3.655  -4.431  1.00 0.00 ? 40  ILE A HB   2  
ATOM 2530  H HG12 . ILE A 1 40  ? -16.512 -6.610  -4.234  1.00 0.00 ? 40  ILE A HG12 2  
ATOM 2531  H HG13 . ILE A 1 40  ? -18.065 -5.893  -4.617  1.00 0.00 ? 40  ILE A HG13 2  
ATOM 2532  H HG21 . ILE A 1 40  ? -14.475 -4.794  -3.612  1.00 0.00 ? 40  ILE A HG21 2  
ATOM 2533  H HG22 . ILE A 1 40  ? -14.846 -4.288  -5.277  1.00 0.00 ? 40  ILE A HG22 2  
ATOM 2534  H HG23 . ILE A 1 40  ? -14.905 -3.101  -3.952  1.00 0.00 ? 40  ILE A HG23 2  
ATOM 2535  H HD11 . ILE A 1 40  ? -16.442 -4.675  -6.494  1.00 0.00 ? 40  ILE A HD11 2  
ATOM 2536  H HD12 . ILE A 1 40  ? -15.686 -6.279  -6.345  1.00 0.00 ? 40  ILE A HD12 2  
ATOM 2537  H HD13 . ILE A 1 40  ? -17.405 -6.143  -6.789  1.00 0.00 ? 40  ILE A HD13 2  
ATOM 2538  N N    . LYS A 1 41  ? -16.498 -2.174  -2.274  1.00 0.00 ? 41  LYS A N    2  
ATOM 2539  C CA   . LYS A 1 41  ? -16.029 -0.961  -1.625  1.00 0.00 ? 41  LYS A CA   2  
ATOM 2540  C C    . LYS A 1 41  ? -14.500 -0.932  -1.649  1.00 0.00 ? 41  LYS A C    2  
ATOM 2541  O O    . LYS A 1 41  ? -13.851 -1.869  -1.188  1.00 0.00 ? 41  LYS A O    2  
ATOM 2542  C CB   . LYS A 1 41  ? -16.624 -0.842  -0.221  1.00 0.00 ? 41  LYS A CB   2  
ATOM 2543  C CG   . LYS A 1 41  ? -16.204 0.471   0.443   1.00 0.00 ? 41  LYS A CG   2  
ATOM 2544  C CD   . LYS A 1 41  ? -16.881 1.667   -0.229  1.00 0.00 ? 41  LYS A CD   2  
ATOM 2545  C CE   . LYS A 1 41  ? -18.373 1.713   0.110   1.00 0.00 ? 41  LYS A CE   2  
ATOM 2546  N NZ   . LYS A 1 41  ? -19.102 2.539   -0.879  1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2547  H H    . LYS A 1 41  ? -16.929 -2.036  -3.166  1.00 0.00 ? 41  LYS A H    2  
ATOM 2548  H HA   . LYS A 1 41  ? -16.400 -0.117  -2.205  1.00 0.00 ? 41  LYS A HA   2  
ATOM 2549  H HB2  . LYS A 1 41  ? -17.712 -0.893  -0.277  1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2550  H HB3  . LYS A 1 41  ? -16.297 -1.684  0.390   1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2551  H HG2  . LYS A 1 41  ? -16.465 0.447   1.501   1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2552  H HG3  . LYS A 1 41  ? -15.121 0.581   0.385   1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2553  H HD2  . LYS A 1 41  ? -16.402 2.591   0.097   1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2554  H HD3  . LYS A 1 41  ? -16.751 1.604   -1.309  1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2555  H HE2  . LYS A 1 41  ? -18.781 0.702   0.121   1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2556  H HE3  . LYS A 1 41  ? -18.512 2.125   1.109   1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2557  H HZ1  . LYS A 1 41  ? -18.458 2.892   -1.557  1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2558  H HZ2  . LYS A 1 41  ? -19.793 1.978   -1.336  1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2559  H HZ3  . LYS A 1 41  ? -19.548 3.302   -0.411  1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2560  N N    . ARG A 1 42  ? -13.968 0.153   -2.192  1.00 0.00 ? 42  ARG A N    2  
ATOM 2561  C CA   . ARG A 1 42  ? -12.528 0.316   -2.283  1.00 0.00 ? 42  ARG A CA   2  
ATOM 2562  C C    . ARG A 1 42  ? -12.116 1.692   -1.757  1.00 0.00 ? 42  ARG A C    2  
ATOM 2563  O O    . ARG A 1 42  ? -11.615 2.525   -2.512  1.00 0.00 ? 42  ARG A O    2  
ATOM 2564  C CB   . ARG A 1 42  ? -12.047 0.164   -3.727  1.00 0.00 ? 42  ARG A CB   2  
ATOM 2565  C CG   . ARG A 1 42  ? -13.199 0.362   -4.713  1.00 0.00 ? 42  ARG A CG   2  
ATOM 2566  C CD   . ARG A 1 42  ? -12.771 -0.001  -6.136  1.00 0.00 ? 42  ARG A CD   2  
ATOM 2567  N NE   . ARG A 1 42  ? -13.669 0.648   -7.116  1.00 0.00 ? 42  ARG A NE   2  
ATOM 2568  C CZ   . ARG A 1 42  ? -13.790 0.265   -8.395  1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2569  N NH1  . ARG A 1 42  ? -13.069 -0.766  -8.856  1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2570  N NH2  . ARG A 1 42  ? -14.631 0.913   -9.212  1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2571  H H    . ARG A 1 42  ? -14.504 0.911   -2.565  1.00 0.00 ? 42  ARG A H    2  
ATOM 2572  H HA   . ARG A 1 42  ? -12.118 -0.481  -1.661  1.00 0.00 ? 42  ARG A HA   2  
ATOM 2573  H HB2  . ARG A 1 42  ? -11.260 0.892   -3.929  1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2574  H HB3  . ARG A 1 42  ? -11.609 -0.825  -3.866  1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2575  H HG2  . ARG A 1 42  ? -14.047 -0.254  -4.416  1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2576  H HG3  . ARG A 1 42  ? -13.533 1.400   -4.684  1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2577  H HD2  . ARG A 1 42  ? -11.743 0.316   -6.308  1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2578  H HD3  . ARG A 1 42  ? -12.797 -1.083  -6.267  1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2579  H HE   . ARG A 1 42  ? -14.222 1.421   -6.805  1.00 0.00 ? 42  ARG A HE   2  
ATOM 2580  H HH11 . ARG A 1 42  ? -12.442 -1.250  -8.246  1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2581  H HH12 . ARG A 1 42  ? -13.158 -1.052  -9.810  1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2582  H HH21 . ARG A 1 42  ? -15.168 1.683   -8.869  1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2583  H HH22 . ARG A 1 42  ? -14.720 0.627   -10.167 1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2584  N N    . ILE A 1 43  ? -12.340 1.889   -0.465  1.00 0.00 ? 43  ILE A N    2  
ATOM 2585  C CA   . ILE A 1 43  ? -11.998 3.149   0.171   1.00 0.00 ? 43  ILE A CA   2  
ATOM 2586  C C    . ILE A 1 43  ? -10.692 3.679   -0.426  1.00 0.00 ? 43  ILE A C    2  
ATOM 2587  O O    . ILE A 1 43  ? -9.805  2.902   -0.774  1.00 0.00 ? 43  ILE A O    2  
ATOM 2588  C CB   . ILE A 1 43  ? -11.959 2.989   1.691   1.00 0.00 ? 43  ILE A CB   2  
ATOM 2589  C CG1  . ILE A 1 43  ? -13.150 3.690   2.348   1.00 0.00 ? 43  ILE A CG1  2  
ATOM 2590  C CG2  . ILE A 1 43  ? -10.624 3.476   2.259   1.00 0.00 ? 43  ILE A CG2  2  
ATOM 2591  C CD1  . ILE A 1 43  ? -14.407 2.819   2.275   1.00 0.00 ? 43  ILE A CD1  2  
ATOM 2592  H H    . ILE A 1 43  ? -12.748 1.206   0.142   1.00 0.00 ? 43  ILE A H    2  
ATOM 2593  H HA   . ILE A 1 43  ? -12.795 3.858   -0.058  1.00 0.00 ? 43  ILE A HA   2  
ATOM 2594  H HB   . ILE A 1 43  ? -12.041 1.928   1.925   1.00 0.00 ? 43  ILE A HB   2  
ATOM 2595  H HG12 . ILE A 1 43  ? -12.917 3.912   3.389   1.00 0.00 ? 43  ILE A HG12 2  
ATOM 2596  H HG13 . ILE A 1 43  ? -13.334 4.643   1.852   1.00 0.00 ? 43  ILE A HG13 2  
ATOM 2597  H HG21 . ILE A 1 43  ? -10.484 4.527   2.009   1.00 0.00 ? 43  ILE A HG21 2  
ATOM 2598  H HG22 . ILE A 1 43  ? -10.626 3.357   3.343   1.00 0.00 ? 43  ILE A HG22 2  
ATOM 2599  H HG23 . ILE A 1 43  ? -9.812  2.888   1.832   1.00 0.00 ? 43  ILE A HG23 2  
ATOM 2600  H HD11 . ILE A 1 43  ? -14.219 1.965   1.625   1.00 0.00 ? 43  ILE A HD11 2  
ATOM 2601  H HD12 . ILE A 1 43  ? -14.663 2.467   3.274   1.00 0.00 ? 43  ILE A HD12 2  
ATOM 2602  H HD13 . ILE A 1 43  ? -15.232 3.407   1.873   1.00 0.00 ? 43  ILE A HD13 2  
ATOM 2603  N N    . GLN A 1 44  ? -10.617 4.998   -0.526  1.00 0.00 ? 44  GLN A N    2  
ATOM 2604  C CA   . GLN A 1 44  ? -9.435  5.640   -1.075  1.00 0.00 ? 44  GLN A CA   2  
ATOM 2605  C C    . GLN A 1 44  ? -8.395  5.864   0.024   1.00 0.00 ? 44  GLN A C    2  
ATOM 2606  O O    . GLN A 1 44  ? -8.614  5.494   1.177   1.00 0.00 ? 44  GLN A O    2  
ATOM 2607  C CB   . GLN A 1 44  ? -9.797  6.957   -1.765  1.00 0.00 ? 44  GLN A CB   2  
ATOM 2608  C CG   . GLN A 1 44  ? -10.620 6.706   -3.029  1.00 0.00 ? 44  GLN A CG   2  
ATOM 2609  C CD   . GLN A 1 44  ? -10.068 5.515   -3.816  1.00 0.00 ? 44  GLN A CD   2  
ATOM 2610  O OE1  . GLN A 1 44  ? -9.301  5.660   -4.754  1.00 0.00 ? 44  GLN A OE1  2  
ATOM 2611  N NE2  . GLN A 1 44  ? -10.497 4.333   -3.382  1.00 0.00 ? 44  GLN A NE2  2  
ATOM 2612  H H    . GLN A 1 44  ? -11.344 5.623   -0.241  1.00 0.00 ? 44  GLN A H    2  
ATOM 2613  H HA   . GLN A 1 44  ? -9.044  4.944   -1.816  1.00 0.00 ? 44  GLN A HA   2  
ATOM 2614  H HB2  . GLN A 1 44  ? -10.361 7.589   -1.078  1.00 0.00 ? 44  GLN A HB2  2  
ATOM 2615  H HB3  . GLN A 1 44  ? -8.886  7.499   -2.021  1.00 0.00 ? 44  GLN A HB3  2  
ATOM 2616  H HG2  . GLN A 1 44  ? -11.658 6.516   -2.759  1.00 0.00 ? 44  GLN A HG2  2  
ATOM 2617  H HG3  . GLN A 1 44  ? -10.611 7.597   -3.656  1.00 0.00 ? 44  GLN A HG3  2  
ATOM 2618  H HE21 . GLN A 1 44  ? -11.126 4.284   -2.606  1.00 0.00 ? 44  GLN A HE21 2  
ATOM 2619  H HE22 . GLN A 1 44  ? -10.191 3.494   -3.833  1.00 0.00 ? 44  GLN A HE22 2  
ATOM 2620  N N    . TYR A 1 45  ? -7.284  6.471   -0.371  1.00 0.00 ? 45  TYR A N    2  
ATOM 2621  C CA   . TYR A 1 45  ? -6.209  6.750   0.567   1.00 0.00 ? 45  TYR A CA   2  
ATOM 2622  C C    . TYR A 1 45  ? -5.632  8.148   0.340   1.00 0.00 ? 45  TYR A C    2  
ATOM 2623  O O    . TYR A 1 45  ? -4.487  8.289   -0.084  1.00 0.00 ? 45  TYR A O    2  
ATOM 2624  C CB   . TYR A 1 45  ? -5.124  5.709   0.284   1.00 0.00 ? 45  TYR A CB   2  
ATOM 2625  C CG   . TYR A 1 45  ? -5.119  4.532   1.260   1.00 0.00 ? 45  TYR A CG   2  
ATOM 2626  C CD1  . TYR A 1 45  ? -5.494  4.724   2.575   1.00 0.00 ? 45  TYR A CD1  2  
ATOM 2627  C CD2  . TYR A 1 45  ? -4.742  3.277   0.827   1.00 0.00 ? 45  TYR A CD2  2  
ATOM 2628  C CE1  . TYR A 1 45  ? -5.490  3.615   3.494   1.00 0.00 ? 45  TYR A CE1  2  
ATOM 2629  C CE2  . TYR A 1 45  ? -4.738  2.169   1.745   1.00 0.00 ? 45  TYR A CE2  2  
ATOM 2630  C CZ   . TYR A 1 45  ? -5.113  2.392   3.034   1.00 0.00 ? 45  TYR A CZ   2  
ATOM 2631  O OH   . TYR A 1 45  ? -5.109  1.344   3.901   1.00 0.00 ? 45  TYR A OH   2  
ATOM 2632  H H    . TYR A 1 45  ? -7.114  6.769   -1.310  1.00 0.00 ? 45  TYR A H    2  
ATOM 2633  H HA   . TYR A 1 45  ? -6.620  6.693   1.576   1.00 0.00 ? 45  TYR A HA   2  
ATOM 2634  H HB2  . TYR A 1 45  ? -5.254  5.328   -0.728  1.00 0.00 ? 45  TYR A HB2  2  
ATOM 2635  H HB3  . TYR A 1 45  ? -4.149  6.198   0.317   1.00 0.00 ? 45  TYR A HB3  2  
ATOM 2636  H HD1  . TYR A 1 45  ? -5.792  5.714   2.917   1.00 0.00 ? 45  TYR A HD1  2  
ATOM 2637  H HD2  . TYR A 1 45  ? -4.447  3.126   -0.212  1.00 0.00 ? 45  TYR A HD2  2  
ATOM 2638  H HE1  . TYR A 1 45  ? -5.784  3.752   4.534   1.00 0.00 ? 45  TYR A HE1  2  
ATOM 2639  H HE2  . TYR A 1 45  ? -4.442  1.172   1.416   1.00 0.00 ? 45  TYR A HE2  2  
ATOM 2640  H HH   . TYR A 1 45  ? -4.846  0.507   3.425   1.00 0.00 ? 45  TYR A HH   2  
ATOM 2641  N N    . GLU A 1 46  ? -6.452  9.146   0.632   1.00 0.00 ? 46  GLU A N    2  
ATOM 2642  C CA   . GLU A 1 46  ? -6.037  10.529  0.465   1.00 0.00 ? 46  GLU A CA   2  
ATOM 2643  C C    . GLU A 1 46  ? -4.862  10.846  1.391   1.00 0.00 ? 46  GLU A C    2  
ATOM 2644  O O    . GLU A 1 46  ? -5.006  11.608  2.345   1.00 0.00 ? 46  GLU A O    2  
ATOM 2645  C CB   . GLU A 1 46  ? -7.205  11.485  0.714   1.00 0.00 ? 46  GLU A CB   2  
ATOM 2646  C CG   . GLU A 1 46  ? -7.079  12.742  -0.150  1.00 0.00 ? 46  GLU A CG   2  
ATOM 2647  C CD   . GLU A 1 46  ? -8.300  13.649  0.019   1.00 0.00 ? 46  GLU A CD   2  
ATOM 2648  O OE1  . GLU A 1 46  ? -9.394  13.209  -0.393  1.00 0.00 ? 46  GLU A OE1  2  
ATOM 2649  O OE2  . GLU A 1 46  ? -8.110  14.761  0.555   1.00 0.00 ? 46  GLU A OE2  2  
ATOM 2650  H H    . GLU A 1 46  ? -7.383  9.024   0.976   1.00 0.00 ? 46  GLU A H    2  
ATOM 2651  H HA   . GLU A 1 46  ? -5.722  10.613  -0.576  1.00 0.00 ? 46  GLU A HA   2  
ATOM 2652  H HB2  . GLU A 1 46  ? -8.147  10.982  0.494   1.00 0.00 ? 46  GLU A HB2  2  
ATOM 2653  H HB3  . GLU A 1 46  ? -7.232  11.766  1.767   1.00 0.00 ? 46  GLU A HB3  2  
ATOM 2654  H HG2  . GLU A 1 46  ? -6.175  13.287  0.123   1.00 0.00 ? 46  GLU A HG2  2  
ATOM 2655  H HG3  . GLU A 1 46  ? -6.975  12.458  -1.198  1.00 0.00 ? 46  GLU A HG3  2  
ATOM 2656  N N    . ILE A 1 47  ? -3.723  10.244  1.076   1.00 0.00 ? 47  ILE A N    2  
ATOM 2657  C CA   . ILE A 1 47  ? -2.523  10.453  1.868   1.00 0.00 ? 47  ILE A CA   2  
ATOM 2658  C C    . ILE A 1 47  ? -2.085  11.914  1.747   1.00 0.00 ? 47  ILE A C    2  
ATOM 2659  O O    . ILE A 1 47  ? -2.763  12.719  1.111   1.00 0.00 ? 47  ILE A O    2  
ATOM 2660  C CB   . ILE A 1 47  ? -1.439  9.450   1.472   1.00 0.00 ? 47  ILE A CB   2  
ATOM 2661  C CG1  . ILE A 1 47  ? -1.025  9.639   0.011   1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2662  C CG2  . ILE A 1 47  ? -1.886  8.015   1.760   1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2663  C CD1  . ILE A 1 47  ? -0.328  8.387   -0.528  1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2664  H H    . ILE A 1 47  ? -3.614  9.626   0.298   1.00 0.00 ? 47  ILE A H    2  
ATOM 2665  H HA   . ILE A 1 47  ? -2.780  10.255  2.910   1.00 0.00 ? 47  ILE A HA   2  
ATOM 2666  H HB   . ILE A 1 47  ? -0.556  9.641   2.083   1.00 0.00 ? 47  ILE A HB   2  
ATOM 2667  H HG12 . ILE A 1 47  ? -1.905  9.858   -0.594  1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2668  H HG13 . ILE A 1 47  ? -0.357  10.496  -0.074  1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2669  H HG21 . ILE A 1 47  ? -2.886  8.027   2.196   1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2670  H HG22 . ILE A 1 47  ? -1.901  7.446   0.832   1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2671  H HG23 . ILE A 1 47  ? -1.191  7.551   2.460   1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2672  H HD11 . ILE A 1 47  ? -0.121  7.705   0.296   1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2673  H HD12 . ILE A 1 47  ? -0.976  7.894   -1.252  1.00 0.00 ? 47  ILE A HD12 2  
ATOM 2674  H HD13 . ILE A 1 47  ? 0.606   8.671   -1.010  1.00 0.00 ? 47  ILE A HD13 2  
ATOM 2675  N N    . LYS A 1 48  ? -0.951  12.211  2.365   1.00 0.00 ? 48  LYS A N    2  
ATOM 2676  C CA   . LYS A 1 48  ? -0.413  13.561  2.334   1.00 0.00 ? 48  LYS A CA   2  
ATOM 2677  C C    . LYS A 1 48  ? 0.996   13.531  1.738   1.00 0.00 ? 48  LYS A C    2  
ATOM 2678  O O    . LYS A 1 48  ? 1.639   14.569  1.604   1.00 0.00 ? 48  LYS A O    2  
ATOM 2679  C CB   . LYS A 1 48  ? -0.479  14.197  3.724   1.00 0.00 ? 48  LYS A CB   2  
ATOM 2680  C CG   . LYS A 1 48  ? -0.671  15.712  3.625   1.00 0.00 ? 48  LYS A CG   2  
ATOM 2681  C CD   . LYS A 1 48  ? -1.098  16.299  4.972   1.00 0.00 ? 48  LYS A CD   2  
ATOM 2682  C CE   . LYS A 1 48  ? -0.428  15.558  6.130   1.00 0.00 ? 48  LYS A CE   2  
ATOM 2683  N NZ   . LYS A 1 48  ? -0.627  16.292  7.400   1.00 0.00 ? 48  LYS A NZ   2  
ATOM 2684  H H    . LYS A 1 48  ? -0.404  11.551  2.879   1.00 0.00 ? 48  LYS A H    2  
ATOM 2685  H HA   . LYS A 1 48  ? -1.053  14.152  1.678   1.00 0.00 ? 48  LYS A HA   2  
ATOM 2686  H HB2  . LYS A 1 48  ? -1.302  13.759  4.289   1.00 0.00 ? 48  LYS A HB2  2  
ATOM 2687  H HB3  . LYS A 1 48  ? 0.437   13.977  4.271   1.00 0.00 ? 48  LYS A HB3  2  
ATOM 2688  H HG2  . LYS A 1 48  ? 0.258   16.179  3.298   1.00 0.00 ? 48  LYS A HG2  2  
ATOM 2689  H HG3  . LYS A 1 48  ? -1.425  15.938  2.870   1.00 0.00 ? 48  LYS A HG3  2  
ATOM 2690  H HD2  . LYS A 1 48  ? -0.836  17.356  5.011   1.00 0.00 ? 48  LYS A HD2  2  
ATOM 2691  H HD3  . LYS A 1 48  ? -2.181  16.236  5.073   1.00 0.00 ? 48  LYS A HD3  2  
ATOM 2692  H HE2  . LYS A 1 48  ? -0.841  14.553  6.215   1.00 0.00 ? 48  LYS A HE2  2  
ATOM 2693  H HE3  . LYS A 1 48  ? 0.638   15.448  5.931   1.00 0.00 ? 48  LYS A HE3  2  
ATOM 2694  H HZ1  . LYS A 1 48  ? -1.512  16.759  7.379   1.00 0.00 ? 48  LYS A HZ1  2  
ATOM 2695  H HZ2  . LYS A 1 48  ? -0.609  15.647  8.164   1.00 0.00 ? 48  LYS A HZ2  2  
ATOM 2696  H HZ3  . LYS A 1 48  ? 0.102   16.966  7.514   1.00 0.00 ? 48  LYS A HZ3  2  
ATOM 2697  N N    . GLN A 1 49  ? 1.433   12.327  1.396   1.00 0.00 ? 49  GLN A N    2  
ATOM 2698  C CA   . GLN A 1 49  ? 2.754   12.148  0.817   1.00 0.00 ? 49  GLN A CA   2  
ATOM 2699  C C    . GLN A 1 49  ? 3.823   12.721  1.749   1.00 0.00 ? 49  GLN A C    2  
ATOM 2700  O O    . GLN A 1 49  ? 3.761   13.890  2.127   1.00 0.00 ? 49  GLN A O    2  
ATOM 2701  C CB   . GLN A 1 49  ? 2.837   12.785  -0.570  1.00 0.00 ? 49  GLN A CB   2  
ATOM 2702  C CG   . GLN A 1 49  ? 4.136   13.575  -0.735  1.00 0.00 ? 49  GLN A CG   2  
ATOM 2703  C CD   . GLN A 1 49  ? 5.351   12.644  -0.702  1.00 0.00 ? 49  GLN A CD   2  
ATOM 2704  O OE1  . GLN A 1 49  ? 6.302   12.848  0.032   1.00 0.00 ? 49  GLN A OE1  2  
ATOM 2705  N NE2  . GLN A 1 49  ? 5.264   11.613  -1.539  1.00 0.00 ? 49  GLN A NE2  2  
ATOM 2706  H H    . GLN A 1 49  ? 0.903   11.487  1.508   1.00 0.00 ? 49  GLN A H    2  
ATOM 2707  H HA   . GLN A 1 49  ? 2.885   11.070  0.724   1.00 0.00 ? 49  GLN A HA   2  
ATOM 2708  H HB2  . GLN A 1 49  ? 2.778   12.010  -1.335  1.00 0.00 ? 49  GLN A HB2  2  
ATOM 2709  H HB3  . GLN A 1 49  ? 1.983   13.447  -0.721  1.00 0.00 ? 49  GLN A HB3  2  
ATOM 2710  H HG2  . GLN A 1 49  ? 4.118   14.121  -1.678  1.00 0.00 ? 49  GLN A HG2  2  
ATOM 2711  H HG3  . GLN A 1 49  ? 4.221   14.314  0.061   1.00 0.00 ? 49  GLN A HG3  2  
ATOM 2712  H HE21 . GLN A 1 49  ? 4.454   11.503  -2.115  1.00 0.00 ? 49  GLN A HE21 2  
ATOM 2713  H HE22 . GLN A 1 49  ? 6.009   10.948  -1.591  1.00 0.00 ? 49  GLN A HE22 2  
ATOM 2714  N N    . ILE A 1 50  ? 4.781   11.873  2.093   1.00 0.00 ? 50  ILE A N    2  
ATOM 2715  C CA   . ILE A 1 50  ? 5.863   12.281  2.973   1.00 0.00 ? 50  ILE A CA   2  
ATOM 2716  C C    . ILE A 1 50  ? 7.198   11.828  2.376   1.00 0.00 ? 50  ILE A C    2  
ATOM 2717  O O    . ILE A 1 50  ? 8.214   12.499  2.542   1.00 0.00 ? 50  ILE A O    2  
ATOM 2718  C CB   . ILE A 1 50  ? 5.619   11.769  4.394   1.00 0.00 ? 50  ILE A CB   2  
ATOM 2719  C CG1  . ILE A 1 50  ? 6.675   10.738  4.795   1.00 0.00 ? 50  ILE A CG1  2  
ATOM 2720  C CG2  . ILE A 1 50  ? 4.198   11.222  4.544   1.00 0.00 ? 50  ILE A CG2  2  
ATOM 2721  C CD1  . ILE A 1 50  ? 6.208   9.911   5.993   1.00 0.00 ? 50  ILE A CD1  2  
ATOM 2722  H H    . ILE A 1 50  ? 4.825   10.924  1.782   1.00 0.00 ? 50  ILE A H    2  
ATOM 2723  H HA   . ILE A 1 50  ? 5.855   13.370  3.016   1.00 0.00 ? 50  ILE A HA   2  
ATOM 2724  H HB   . ILE A 1 50  ? 5.714   12.611  5.080   1.00 0.00 ? 50  ILE A HB   2  
ATOM 2725  H HG12 . ILE A 1 50  ? 6.883   10.079  3.951   1.00 0.00 ? 50  ILE A HG12 2  
ATOM 2726  H HG13 . ILE A 1 50  ? 7.609   11.245  5.039   1.00 0.00 ? 50  ILE A HG13 2  
ATOM 2727  H HG21 . ILE A 1 50  ? 3.512   11.824  3.948   1.00 0.00 ? 50  ILE A HG21 2  
ATOM 2728  H HG22 . ILE A 1 50  ? 4.168   10.189  4.198   1.00 0.00 ? 50  ILE A HG22 2  
ATOM 2729  H HG23 . ILE A 1 50  ? 3.902   11.264  5.592   1.00 0.00 ? 50  ILE A HG23 2  
ATOM 2730  H HD11 . ILE A 1 50  ? 5.238   9.466   5.771   1.00 0.00 ? 50  ILE A HD11 2  
ATOM 2731  H HD12 . ILE A 1 50  ? 6.932   9.122   6.195   1.00 0.00 ? 50  ILE A HD12 2  
ATOM 2732  H HD13 . ILE A 1 50  ? 6.120   10.556  6.868   1.00 0.00 ? 50  ILE A HD13 2  
ATOM 2733  N N    . LYS A 1 51  ? 7.150   10.692  1.696   1.00 0.00 ? 51  LYS A N    2  
ATOM 2734  C CA   . LYS A 1 51  ? 8.343   10.141  1.075   1.00 0.00 ? 51  LYS A CA   2  
ATOM 2735  C C    . LYS A 1 51  ? 7.945   9.353   -0.174  1.00 0.00 ? 51  LYS A C    2  
ATOM 2736  O O    . LYS A 1 51  ? 6.765   9.084   -0.392  1.00 0.00 ? 51  LYS A O    2  
ATOM 2737  C CB   . LYS A 1 51  ? 9.147   9.324   2.089   1.00 0.00 ? 51  LYS A CB   2  
ATOM 2738  C CG   . LYS A 1 51  ? 10.619  9.738   2.083   1.00 0.00 ? 51  LYS A CG   2  
ATOM 2739  C CD   . LYS A 1 51  ? 11.281  9.425   3.427   1.00 0.00 ? 51  LYS A CD   2  
ATOM 2740  C CE   . LYS A 1 51  ? 12.213  10.561  3.856   1.00 0.00 ? 51  LYS A CE   2  
ATOM 2741  N NZ   . LYS A 1 51  ? 13.033  10.147  5.017   1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2742  H H    . LYS A 1 51  ? 6.319   10.152  1.567   1.00 0.00 ? 51  LYS A H    2  
ATOM 2743  H HA   . LYS A 1 51  ? 8.969   10.981  0.769   1.00 0.00 ? 51  LYS A HA   2  
ATOM 2744  H HB2  . LYS A 1 51  ? 8.729   9.463   3.086   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2745  H HB3  . LYS A 1 51  ? 9.062   8.262   1.853   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2746  H HG2  . LYS A 1 51  ? 11.145  9.215   1.284   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 2747  H HG3  . LYS A 1 51  ? 10.700  10.805  1.874   1.00 0.00 ? 51  LYS A HG3  2  
ATOM 2748  H HD2  . LYS A 1 51  ? 10.515  9.273   4.187   1.00 0.00 ? 51  LYS A HD2  2  
ATOM 2749  H HD3  . LYS A 1 51  ? 11.845  8.496   3.351   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 2750  H HE2  . LYS A 1 51  ? 12.862  10.840  3.026   1.00 0.00 ? 51  LYS A HE2  2  
ATOM 2751  H HE3  . LYS A 1 51  ? 11.627  11.443  4.114   1.00 0.00 ? 51  LYS A HE3  2  
ATOM 2752  H HZ1  . LYS A 1 51  ? 13.560  9.331   4.778   1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 2753  H HZ2  . LYS A 1 51  ? 13.658  10.888  5.264   1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 2754  H HZ3  . LYS A 1 51  ? 12.435  9.942   5.792   1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 2755  N N    . MET A 1 52  ? 8.952   9.007   -0.962  1.00 0.00 ? 52  MET A N    2  
ATOM 2756  C CA   . MET A 1 52  ? 8.722   8.255   -2.185  1.00 0.00 ? 52  MET A CA   2  
ATOM 2757  C C    . MET A 1 52  ? 9.892   7.314   -2.477  1.00 0.00 ? 52  MET A C    2  
ATOM 2758  O O    . MET A 1 52  ? 10.649  7.536   -3.421  1.00 0.00 ? 52  MET A O    2  
ATOM 2759  C CB   . MET A 1 52  ? 8.540   9.225   -3.354  1.00 0.00 ? 52  MET A CB   2  
ATOM 2760  C CG   . MET A 1 52  ? 9.762   10.132  -3.509  1.00 0.00 ? 52  MET A CG   2  
ATOM 2761  S SD   . MET A 1 52  ? 9.407   11.752  -2.847  1.00 0.00 ? 52  MET A SD   2  
ATOM 2762  C CE   . MET A 1 52  ? 10.965  12.564  -3.163  1.00 0.00 ? 52  MET A CE   2  
ATOM 2763  H H    . MET A 1 52  ? 9.909   9.231   -0.778  1.00 0.00 ? 52  MET A H    2  
ATOM 2764  H HA   . MET A 1 52  ? 7.816   7.676   -2.005  1.00 0.00 ? 52  MET A HA   2  
ATOM 2765  H HB2  . MET A 1 52  ? 8.381   8.664   -4.275  1.00 0.00 ? 52  MET A HB2  2  
ATOM 2766  H HB3  . MET A 1 52  ? 7.650   9.832   -3.193  1.00 0.00 ? 52  MET A HB3  2  
ATOM 2767  H HG2  . MET A 1 52  ? 10.616  9.698   -2.989  1.00 0.00 ? 52  MET A HG2  2  
ATOM 2768  H HG3  . MET A 1 52  ? 10.036  10.212  -4.560  1.00 0.00 ? 52  MET A HG3  2  
ATOM 2769  H HE1  . MET A 1 52  ? 11.783  11.866  -2.979  1.00 0.00 ? 52  MET A HE1  2  
ATOM 2770  H HE2  . MET A 1 52  ? 10.997  12.896  -4.201  1.00 0.00 ? 52  MET A HE2  2  
ATOM 2771  H HE3  . MET A 1 52  ? 11.066  13.425  -2.503  1.00 0.00 ? 52  MET A HE3  2  
ATOM 2772  N N    . PHE A 1 53  ? 10.001  6.284   -1.652  1.00 0.00 ? 53  PHE A N    2  
ATOM 2773  C CA   . PHE A 1 53  ? 11.066  5.307   -1.811  1.00 0.00 ? 53  PHE A CA   2  
ATOM 2774  C C    . PHE A 1 53  ? 11.312  5.000   -3.290  1.00 0.00 ? 53  PHE A C    2  
ATOM 2775  O O    . PHE A 1 53  ? 12.283  5.480   -3.874  1.00 0.00 ? 53  PHE A O    2  
ATOM 2776  C CB   . PHE A 1 53  ? 10.610  4.029   -1.105  1.00 0.00 ? 53  PHE A CB   2  
ATOM 2777  C CG   . PHE A 1 53  ? 11.203  3.844   0.292   1.00 0.00 ? 53  PHE A CG   2  
ATOM 2778  C CD1  . PHE A 1 53  ? 12.546  3.951   0.481   1.00 0.00 ? 53  PHE A CD1  2  
ATOM 2779  C CD2  . PHE A 1 53  ? 10.388  3.572   1.347   1.00 0.00 ? 53  PHE A CD2  2  
ATOM 2780  C CE1  . PHE A 1 53  ? 13.097  3.780   1.779   1.00 0.00 ? 53  PHE A CE1  2  
ATOM 2781  C CE2  . PHE A 1 53  ? 10.939  3.401   2.644   1.00 0.00 ? 53  PHE A CE2  2  
ATOM 2782  C CZ   . PHE A 1 53  ? 12.281  3.508   2.833   1.00 0.00 ? 53  PHE A CZ   2  
ATOM 2783  H H    . PHE A 1 53  ? 9.381   6.110   -0.887  1.00 0.00 ? 53  PHE A H    2  
ATOM 2784  H HA   . PHE A 1 53  ? 11.968  5.739   -1.377  1.00 0.00 ? 53  PHE A HA   2  
ATOM 2785  H HB2  . PHE A 1 53  ? 9.523   4.036   -1.029  1.00 0.00 ? 53  PHE A HB2  2  
ATOM 2786  H HB3  . PHE A 1 53  ? 10.881  3.170   -1.720  1.00 0.00 ? 53  PHE A HB3  2  
ATOM 2787  H HD1  . PHE A 1 53  ? 13.199  4.169   -0.364  1.00 0.00 ? 53  PHE A HD1  2  
ATOM 2788  H HD2  . PHE A 1 53  ? 9.312   3.488   1.196   1.00 0.00 ? 53  PHE A HD2  2  
ATOM 2789  H HE1  . PHE A 1 53  ? 14.173  3.865   1.930   1.00 0.00 ? 53  PHE A HE1  2  
ATOM 2790  H HE2  . PHE A 1 53  ? 10.285  3.184   3.490   1.00 0.00 ? 53  PHE A HE2  2  
ATOM 2791  H HZ   . PHE A 1 53  ? 12.704  3.377   3.829   1.00 0.00 ? 53  PHE A HZ   2  
ATOM 2792  N N    . LYS A 1 54  ? 10.415  4.203   -3.852  1.00 0.00 ? 54  LYS A N    2  
ATOM 2793  C CA   . LYS A 1 54  ? 10.523  3.826   -5.251  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2794  C C    . LYS A 1 54  ? 9.181   4.069   -5.945  1.00 0.00 ? 54  LYS A C    2  
ATOM 2795  O O    . LYS A 1 54  ? 8.517   3.123   -6.368  1.00 0.00 ? 54  LYS A O    2  
ATOM 2796  C CB   . LYS A 1 54  ? 11.032  2.390   -5.381  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2797  C CG   . LYS A 1 54  ? 12.149  2.296   -6.423  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2798  C CD   . LYS A 1 54  ? 13.286  3.266   -6.096  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2799  C CE   . LYS A 1 54  ? 13.396  4.360   -7.160  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2800  N NZ   . LYS A 1 54  ? 13.832  3.785   -8.452  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2801  H H    . LYS A 1 54  ? 9.629   3.818   -3.370  1.00 0.00 ? 54  LYS A H    2  
ATOM 2802  H HA   . LYS A 1 54  ? 11.270  4.476   -5.708  1.00 0.00 ? 54  LYS A HA   2  
ATOM 2803  H HB2  . LYS A 1 54  ? 11.399  2.040   -4.417  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2804  H HB3  . LYS A 1 54  ? 10.209  1.733   -5.666  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2805  H HG2  . LYS A 1 54  ? 12.535  1.277   -6.457  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2806  H HG3  . LYS A 1 54  ? 11.749  2.519   -7.412  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2807  H HD2  . LYS A 1 54  ? 13.113  3.720   -5.120  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2808  H HD3  . LYS A 1 54  ? 14.227  2.721   -6.032  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2809  H HE2  . LYS A 1 54  ? 12.432  4.855   -7.282  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2810  H HE3  . LYS A 1 54  ? 14.106  5.121   -6.835  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2811  H HZ1  . LYS A 1 54  ? 13.304  2.958   -8.644  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2812  H HZ2  . LYS A 1 54  ? 13.684  4.452   -9.182  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2813  H HZ3  . LYS A 1 54  ? 14.805  3.555   -8.403  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2814  N N    . GLY A 1 55  ? 8.821   5.340   -6.040  1.00 0.00 ? 55  GLY A N    2  
ATOM 2815  C CA   . GLY A 1 55  ? 7.570   5.719   -6.675  1.00 0.00 ? 55  GLY A CA   2  
ATOM 2816  C C    . GLY A 1 55  ? 7.818   6.660   -7.856  1.00 0.00 ? 55  GLY A C    2  
ATOM 2817  O O    . GLY A 1 55  ? 8.904   6.667   -8.431  1.00 0.00 ? 55  GLY A O    2  
ATOM 2818  H H    . GLY A 1 55  ? 9.367   6.103   -5.693  1.00 0.00 ? 55  GLY A H    2  
ATOM 2819  H HA2  . GLY A 1 55  ? 7.048   4.827   -7.019  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2820  H HA3  . GLY A 1 55  ? 6.922   6.206   -5.947  1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2821  N N    . PRO A 1 56  ? 6.763   7.452   -8.190  1.00 0.00 ? 56  PRO A N    2  
ATOM 2822  C CA   . PRO A 1 56  ? 6.856   8.395   -9.291  1.00 0.00 ? 56  PRO A CA   2  
ATOM 2823  C C    . PRO A 1 56  ? 7.692   9.614   -8.901  1.00 0.00 ? 56  PRO A C    2  
ATOM 2824  O O    . PRO A 1 56  ? 8.268   9.654   -7.816  1.00 0.00 ? 56  PRO A O    2  
ATOM 2825  C CB   . PRO A 1 56  ? 5.415   8.746   -9.630  1.00 0.00 ? 56  PRO A CB   2  
ATOM 2826  C CG   . PRO A 1 56  ? 4.593   8.352   -8.414  1.00 0.00 ? 56  PRO A CG   2  
ATOM 2827  C CD   . PRO A 1 56  ? 5.461   7.470   -7.530  1.00 0.00 ? 56  PRO A CD   2  
ATOM 2828  H HA   . PRO A 1 56  ? 7.328   7.977   -10.068 1.00 0.00 ? 56  PRO A HA   2  
ATOM 2829  H HB2  . PRO A 1 56  ? 5.313   9.810   -9.844  1.00 0.00 ? 56  PRO A HB2  2  
ATOM 2830  H HB3  . PRO A 1 56  ? 5.081   8.208   -10.518 1.00 0.00 ? 56  PRO A HB3  2  
ATOM 2831  H HG2  . PRO A 1 56  ? 4.270   9.239   -7.868  1.00 0.00 ? 56  PRO A HG2  2  
ATOM 2832  H HG3  . PRO A 1 56  ? 3.693   7.819   -8.718  1.00 0.00 ? 56  PRO A HG3  2  
ATOM 2833  H HD2  . PRO A 1 56  ? 5.535   7.872   -6.520  1.00 0.00 ? 56  PRO A HD2  2  
ATOM 2834  H HD3  . PRO A 1 56  ? 5.046   6.467   -7.445  1.00 0.00 ? 56  PRO A HD3  2  
ATOM 2835  N N    . GLU A 1 57  ? 7.732   10.579  -9.808  1.00 0.00 ? 57  GLU A N    2  
ATOM 2836  C CA   . GLU A 1 57  ? 8.489   11.797  -9.572  1.00 0.00 ? 57  GLU A CA   2  
ATOM 2837  C C    . GLU A 1 57  ? 7.634   12.815  -8.814  1.00 0.00 ? 57  GLU A C    2  
ATOM 2838  O O    . GLU A 1 57  ? 8.143   13.557  -7.976  1.00 0.00 ? 57  GLU A O    2  
ATOM 2839  C CB   . GLU A 1 57  ? 9.005   12.386  -10.886 1.00 0.00 ? 57  GLU A CB   2  
ATOM 2840  C CG   . GLU A 1 57  ? 9.221   11.288  -11.931 1.00 0.00 ? 57  GLU A CG   2  
ATOM 2841  C CD   . GLU A 1 57  ? 10.024  11.815  -13.122 1.00 0.00 ? 57  GLU A CD   2  
ATOM 2842  O OE1  . GLU A 1 57  ? 9.651   12.897  -13.625 1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2843  O OE2  . GLU A 1 57  ? 10.993  11.124  -13.502 1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2844  H H    . GLU A 1 57  ? 7.259   10.539  -10.689 1.00 0.00 ? 57  GLU A H    2  
ATOM 2845  H HA   . GLU A 1 57  ? 9.337   11.497  -8.958  1.00 0.00 ? 57  GLU A HA   2  
ATOM 2846  H HB2  . GLU A 1 57  ? 8.293   13.119  -11.266 1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2847  H HB3  . GLU A 1 57  ? 9.942   12.913  -10.710 1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2848  H HG2  . GLU A 1 57  ? 9.745   10.447  -11.477 1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2849  H HG3  . GLU A 1 57  ? 8.257   10.914  -12.275 1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2850  N N    . LYS A 1 58  ? 6.348   12.817  -9.137  1.00 0.00 ? 58  LYS A N    2  
ATOM 2851  C CA   . LYS A 1 58  ? 5.417   13.732  -8.497  1.00 0.00 ? 58  LYS A CA   2  
ATOM 2852  C C    . LYS A 1 58  ? 4.973   13.144  -7.157  1.00 0.00 ? 58  LYS A C    2  
ATOM 2853  O O    . LYS A 1 58  ? 5.469   13.543  -6.104  1.00 0.00 ? 58  LYS A O    2  
ATOM 2854  C CB   . LYS A 1 58  ? 4.258   14.062  -9.439  1.00 0.00 ? 58  LYS A CB   2  
ATOM 2855  C CG   . LYS A 1 58  ? 3.751   15.486  -9.205  1.00 0.00 ? 58  LYS A CG   2  
ATOM 2856  C CD   . LYS A 1 58  ? 3.770   16.296  -10.503 1.00 0.00 ? 58  LYS A CD   2  
ATOM 2857  C CE   . LYS A 1 58  ? 5.204   16.621  -10.925 1.00 0.00 ? 58  LYS A CE   2  
ATOM 2858  N NZ   . LYS A 1 58  ? 5.243   17.880  -11.702 1.00 0.00 ? 58  LYS A NZ   2  
ATOM 2859  H H    . LYS A 1 58  ? 5.942   12.211  -9.820  1.00 0.00 ? 58  LYS A H    2  
ATOM 2860  H HA   . LYS A 1 58  ? 5.953   14.662  -8.306  1.00 0.00 ? 58  LYS A HA   2  
ATOM 2861  H HB2  . LYS A 1 58  ? 4.583   13.954  -10.474 1.00 0.00 ? 58  LYS A HB2  2  
ATOM 2862  H HB3  . LYS A 1 58  ? 3.446   13.353  -9.285  1.00 0.00 ? 58  LYS A HB3  2  
ATOM 2863  H HG2  . LYS A 1 58  ? 2.736   15.454  -8.808  1.00 0.00 ? 58  LYS A HG2  2  
ATOM 2864  H HG3  . LYS A 1 58  ? 4.370   15.978  -8.455  1.00 0.00 ? 58  LYS A HG3  2  
ATOM 2865  H HD2  . LYS A 1 58  ? 3.272   15.735  -11.293 1.00 0.00 ? 58  LYS A HD2  2  
ATOM 2866  H HD3  . LYS A 1 58  ? 3.209   17.221  -10.367 1.00 0.00 ? 58  LYS A HD3  2  
ATOM 2867  H HE2  . LYS A 1 58  ? 5.838   16.712  -10.042 1.00 0.00 ? 58  LYS A HE2  2  
ATOM 2868  H HE3  . LYS A 1 58  ? 5.607   15.805  -11.525 1.00 0.00 ? 58  LYS A HE3  2  
ATOM 2869  H HZ1  . LYS A 1 58  ? 4.674   17.786  -12.519 1.00 0.00 ? 58  LYS A HZ1  2  
ATOM 2870  H HZ2  . LYS A 1 58  ? 4.897   18.630  -11.140 1.00 0.00 ? 58  LYS A HZ2  2  
ATOM 2871  H HZ3  . LYS A 1 58  ? 6.186   18.075  -11.974 1.00 0.00 ? 58  LYS A HZ3  2  
ATOM 2872  N N    . ASP A 1 59  ? 4.041   12.205  -7.238  1.00 0.00 ? 59  ASP A N    2  
ATOM 2873  C CA   . ASP A 1 59  ? 3.523   11.559  -6.045  1.00 0.00 ? 59  ASP A CA   2  
ATOM 2874  C C    . ASP A 1 59  ? 2.114   11.033  -6.325  1.00 0.00 ? 59  ASP A C    2  
ATOM 2875  O O    . ASP A 1 59  ? 1.533   11.331  -7.368  1.00 0.00 ? 59  ASP A O    2  
ATOM 2876  C CB   . ASP A 1 59  ? 3.437   12.545  -4.878  1.00 0.00 ? 59  ASP A CB   2  
ATOM 2877  C CG   . ASP A 1 59  ? 2.577   12.080  -3.701  1.00 0.00 ? 59  ASP A CG   2  
ATOM 2878  O OD1  . ASP A 1 59  ? 2.779   10.922  -3.273  1.00 0.00 ? 59  ASP A OD1  2  
ATOM 2879  O OD2  . ASP A 1 59  ? 1.738   12.892  -3.254  1.00 0.00 ? 59  ASP A OD2  2  
ATOM 2880  H H    . ASP A 1 59  ? 3.643   11.887  -8.098  1.00 0.00 ? 59  ASP A H    2  
ATOM 2881  H HA   . ASP A 1 59  ? 4.230   10.760  -5.823  1.00 0.00 ? 59  ASP A HA   2  
ATOM 2882  H HB2  . ASP A 1 59  ? 4.445   12.745  -4.515  1.00 0.00 ? 59  ASP A HB2  2  
ATOM 2883  H HB3  . ASP A 1 59  ? 3.038   13.489  -5.249  1.00 0.00 ? 59  ASP A HB3  2  
ATOM 2884  N N    . ILE A 1 60  ? 1.605   10.262  -5.376  1.00 0.00 ? 60  ILE A N    2  
ATOM 2885  C CA   . ILE A 1 60  ? 0.275   9.692   -5.508  1.00 0.00 ? 60  ILE A CA   2  
ATOM 2886  C C    . ILE A 1 60  ? -0.730  10.575  -4.764  1.00 0.00 ? 60  ILE A C    2  
ATOM 2887  O O    . ILE A 1 60  ? -1.527  11.275  -5.387  1.00 0.00 ? 60  ILE A O    2  
ATOM 2888  C CB   . ILE A 1 60  ? 0.269   8.233   -5.048  1.00 0.00 ? 60  ILE A CB   2  
ATOM 2889  C CG1  . ILE A 1 60  ? 1.634   7.580   -5.277  1.00 0.00 ? 60  ILE A CG1  2  
ATOM 2890  C CG2  . ILE A 1 60  ? -0.861  7.450   -5.722  1.00 0.00 ? 60  ILE A CG2  2  
ATOM 2891  C CD1  . ILE A 1 60  ? 1.899   7.371   -6.770  1.00 0.00 ? 60  ILE A CD1  2  
ATOM 2892  H H    . ILE A 1 60  ? 2.084   10.024  -4.531  1.00 0.00 ? 60  ILE A H    2  
ATOM 2893  H HA   . ILE A 1 60  ? 0.021   9.697   -6.568  1.00 0.00 ? 60  ILE A HA   2  
ATOM 2894  H HB   . ILE A 1 60  ? 0.078   8.214   -3.976  1.00 0.00 ? 60  ILE A HB   2  
ATOM 2895  H HG12 . ILE A 1 60  ? 2.417   8.207   -4.850  1.00 0.00 ? 60  ILE A HG12 2  
ATOM 2896  H HG13 . ILE A 1 60  ? 1.675   6.622   -4.760  1.00 0.00 ? 60  ILE A HG13 2  
ATOM 2897  H HG21 . ILE A 1 60  ? -1.768  8.053   -5.726  1.00 0.00 ? 60  ILE A HG21 2  
ATOM 2898  H HG22 . ILE A 1 60  ? -0.577  7.214   -6.748  1.00 0.00 ? 60  ILE A HG22 2  
ATOM 2899  H HG23 . ILE A 1 60  ? -1.040  6.526   -5.173  1.00 0.00 ? 60  ILE A HG23 2  
ATOM 2900  H HD11 . ILE A 1 60  ? 1.512   8.222   -7.330  1.00 0.00 ? 60  ILE A HD11 2  
ATOM 2901  H HD12 . ILE A 1 60  ? 2.972   7.282   -6.939  1.00 0.00 ? 60  ILE A HD12 2  
ATOM 2902  H HD13 . ILE A 1 60  ? 1.401   6.461   -7.102  1.00 0.00 ? 60  ILE A HD13 2  
ATOM 2903  N N    . GLU A 1 61  ? -0.658  10.513  -3.442  1.00 0.00 ? 61  GLU A N    2  
ATOM 2904  C CA   . GLU A 1 61  ? -1.551  11.299  -2.607  1.00 0.00 ? 61  GLU A CA   2  
ATOM 2905  C C    . GLU A 1 61  ? -2.954  10.692  -2.615  1.00 0.00 ? 61  GLU A C    2  
ATOM 2906  O O    . GLU A 1 61  ? -3.828  11.130  -1.867  1.00 0.00 ? 61  GLU A O    2  
ATOM 2907  C CB   . GLU A 1 61  ? -1.581  12.760  -3.061  1.00 0.00 ? 61  GLU A CB   2  
ATOM 2908  C CG   . GLU A 1 61  ? -0.934  13.671  -2.016  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2909  C CD   . GLU A 1 61  ? -1.738  14.961  -1.839  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2910  O OE1  . GLU A 1 61  ? -2.273  15.440  -2.862  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2911  O OE2  . GLU A 1 61  ? -1.801  15.438  -0.686  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2912  H H    . GLU A 1 61  ? -0.006  9.942   -2.944  1.00 0.00 ? 61  GLU A H    2  
ATOM 2913  H HA   . GLU A 1 61  ? -1.130  11.244  -1.603  1.00 0.00 ? 61  GLU A HA   2  
ATOM 2914  H HB2  . GLU A 1 61  ? -1.058  12.861  -4.011  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2915  H HB3  . GLU A 1 61  ? -2.613  13.070  -3.230  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2916  H HG2  . GLU A 1 61  ? -0.865  13.148  -1.062  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2917  H HG3  . GLU A 1 61  ? 0.085   13.913  -2.320  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2918  N N    . PHE A 1 62  ? -3.129  9.694   -3.469  1.00 0.00 ? 62  PHE A N    2  
ATOM 2919  C CA   . PHE A 1 62  ? -4.413  9.024   -3.585  1.00 0.00 ? 62  PHE A CA   2  
ATOM 2920  C C    . PHE A 1 62  ? -4.230  7.548   -3.944  1.00 0.00 ? 62  PHE A C    2  
ATOM 2921  O O    . PHE A 1 62  ? -4.026  7.210   -5.110  1.00 0.00 ? 62  PHE A O    2  
ATOM 2922  C CB   . PHE A 1 62  ? -5.182  9.719   -4.709  1.00 0.00 ? 62  PHE A CB   2  
ATOM 2923  C CG   . PHE A 1 62  ? -6.302  10.640  -4.221  1.00 0.00 ? 62  PHE A CG   2  
ATOM 2924  C CD1  . PHE A 1 62  ? -7.501  10.116  -3.852  1.00 0.00 ? 62  PHE A CD1  2  
ATOM 2925  C CD2  . PHE A 1 62  ? -6.098  11.983  -4.156  1.00 0.00 ? 62  PHE A CD2  2  
ATOM 2926  C CE1  . PHE A 1 62  ? -8.541  10.970  -3.399  1.00 0.00 ? 62  PHE A CE1  2  
ATOM 2927  C CE2  . PHE A 1 62  ? -7.137  12.838  -3.703  1.00 0.00 ? 62  PHE A CE2  2  
ATOM 2928  C CZ   . PHE A 1 62  ? -8.336  12.314  -3.334  1.00 0.00 ? 62  PHE A CZ   2  
ATOM 2929  H H    . PHE A 1 62  ? -2.414  9.345   -4.075  1.00 0.00 ? 62  PHE A H    2  
ATOM 2930  H HA   . PHE A 1 62  ? -4.907  9.101   -2.615  1.00 0.00 ? 62  PHE A HA   2  
ATOM 2931  H HB2  . PHE A 1 62  ? -4.482  10.302  -5.309  1.00 0.00 ? 62  PHE A HB2  2  
ATOM 2932  H HB3  . PHE A 1 62  ? -5.610  8.961   -5.366  1.00 0.00 ? 62  PHE A HB3  2  
ATOM 2933  H HD1  . PHE A 1 62  ? -7.665  9.040   -3.905  1.00 0.00 ? 62  PHE A HD1  2  
ATOM 2934  H HD2  . PHE A 1 62  ? -5.136  12.403  -4.452  1.00 0.00 ? 62  PHE A HD2  2  
ATOM 2935  H HE1  . PHE A 1 62  ? -9.502  10.550  -3.104  1.00 0.00 ? 62  PHE A HE1  2  
ATOM 2936  H HE2  . PHE A 1 62  ? -6.974  13.914  -3.651  1.00 0.00 ? 62  PHE A HE2  2  
ATOM 2937  H HZ   . PHE A 1 62  ? -9.134  12.969  -2.986  1.00 0.00 ? 62  PHE A HZ   2  
ATOM 2938  N N    . ILE A 1 63  ? -4.309  6.708   -2.922  1.00 0.00 ? 63  ILE A N    2  
ATOM 2939  C CA   . ILE A 1 63  ? -4.155  5.277   -3.116  1.00 0.00 ? 63  ILE A CA   2  
ATOM 2940  C C    . ILE A 1 63  ? -5.511  4.592   -2.936  1.00 0.00 ? 63  ILE A C    2  
ATOM 2941  O O    . ILE A 1 63  ? -6.469  5.216   -2.481  1.00 0.00 ? 63  ILE A O    2  
ATOM 2942  C CB   . ILE A 1 63  ? -3.062  4.726   -2.198  1.00 0.00 ? 63  ILE A CB   2  
ATOM 2943  C CG1  . ILE A 1 63  ? -2.031  5.807   -1.865  1.00 0.00 ? 63  ILE A CG1  2  
ATOM 2944  C CG2  . ILE A 1 63  ? -2.411  3.481   -2.805  1.00 0.00 ? 63  ILE A CG2  2  
ATOM 2945  C CD1  . ILE A 1 63  ? -0.721  5.565   -2.617  1.00 0.00 ? 63  ILE A CD1  2  
ATOM 2946  H H    . ILE A 1 63  ? -4.475  6.992   -1.978  1.00 0.00 ? 63  ILE A H    2  
ATOM 2947  H HA   . ILE A 1 63  ? -3.823  5.120   -4.143  1.00 0.00 ? 63  ILE A HA   2  
ATOM 2948  H HB   . ILE A 1 63  ? -3.524  4.423   -1.259  1.00 0.00 ? 63  ILE A HB   2  
ATOM 2949  H HG12 . ILE A 1 63  ? -2.428  6.787   -2.126  1.00 0.00 ? 63  ILE A HG12 2  
ATOM 2950  H HG13 . ILE A 1 63  ? -1.841  5.815   -0.792  1.00 0.00 ? 63  ILE A HG13 2  
ATOM 2951  H HG21 . ILE A 1 63  ? -2.232  3.646   -3.867  1.00 0.00 ? 63  ILE A HG21 2  
ATOM 2952  H HG22 . ILE A 1 63  ? -1.464  3.284   -2.303  1.00 0.00 ? 63  ILE A HG22 2  
ATOM 2953  H HG23 . ILE A 1 63  ? -3.075  2.626   -2.678  1.00 0.00 ? 63  ILE A HG23 2  
ATOM 2954  H HD11 . ILE A 1 63  ? -0.937  5.339   -3.661  1.00 0.00 ? 63  ILE A HD11 2  
ATOM 2955  H HD12 . ILE A 1 63  ? -0.099  6.459   -2.561  1.00 0.00 ? 63  ILE A HD12 2  
ATOM 2956  H HD13 . ILE A 1 63  ? -0.191  4.725   -2.167  1.00 0.00 ? 63  ILE A HD13 2  
ATOM 2957  N N    . TYR A 1 64  ? -5.549  3.319   -3.300  1.00 0.00 ? 64  TYR A N    2  
ATOM 2958  C CA   . TYR A 1 64  ? -6.773  2.544   -3.184  1.00 0.00 ? 64  TYR A CA   2  
ATOM 2959  C C    . TYR A 1 64  ? -6.552  1.296   -2.327  1.00 0.00 ? 64  TYR A C    2  
ATOM 2960  O O    . TYR A 1 64  ? -5.459  0.734   -2.313  1.00 0.00 ? 64  TYR A O    2  
ATOM 2961  C CB   . TYR A 1 64  ? -7.136  2.113   -4.606  1.00 0.00 ? 64  TYR A CB   2  
ATOM 2962  C CG   . TYR A 1 64  ? -7.621  3.257   -5.498  1.00 0.00 ? 64  TYR A CG   2  
ATOM 2963  C CD1  . TYR A 1 64  ? -6.798  4.339   -5.742  1.00 0.00 ? 64  TYR A CD1  2  
ATOM 2964  C CD2  . TYR A 1 64  ? -8.879  3.208   -6.062  1.00 0.00 ? 64  TYR A CD2  2  
ATOM 2965  C CE1  . TYR A 1 64  ? -7.254  5.416   -6.581  1.00 0.00 ? 64  TYR A CE1  2  
ATOM 2966  C CE2  . TYR A 1 64  ? -9.336  4.285   -6.902  1.00 0.00 ? 64  TYR A CE2  2  
ATOM 2967  C CZ   . TYR A 1 64  ? -8.500  5.335   -7.120  1.00 0.00 ? 64  TYR A CZ   2  
ATOM 2968  O OH   . TYR A 1 64  ? -8.931  6.353   -7.914  1.00 0.00 ? 64  TYR A OH   2  
ATOM 2969  H H    . TYR A 1 64  ? -4.766  2.819   -3.669  1.00 0.00 ? 64  TYR A H    2  
ATOM 2970  H HA   . TYR A 1 64  ? -7.527  3.173   -2.710  1.00 0.00 ? 64  TYR A HA   2  
ATOM 2971  H HB2  . TYR A 1 64  ? -6.264  1.649   -5.068  1.00 0.00 ? 64  TYR A HB2  2  
ATOM 2972  H HB3  . TYR A 1 64  ? -7.913  1.351   -4.557  1.00 0.00 ? 64  TYR A HB3  2  
ATOM 2973  H HD1  . TYR A 1 64  ? -5.803  4.378   -5.297  1.00 0.00 ? 64  TYR A HD1  2  
ATOM 2974  H HD2  . TYR A 1 64  ? -9.529  2.353   -5.870  1.00 0.00 ? 64  TYR A HD2  2  
ATOM 2975  H HE1  . TYR A 1 64  ? -6.615  6.276   -6.780  1.00 0.00 ? 64  TYR A HE1  2  
ATOM 2976  H HE2  . TYR A 1 64  ? -10.327 4.259   -7.352  1.00 0.00 ? 64  TYR A HE2  2  
ATOM 2977  H HH   . TYR A 1 64  ? -8.278  6.509   -8.655  1.00 0.00 ? 64  TYR A HH   2  
ATOM 2978  N N    . THR A 1 65  ? -7.608  0.900   -1.632  1.00 0.00 ? 65  THR A N    2  
ATOM 2979  C CA   . THR A 1 65  ? -7.543  -0.271  -0.773  1.00 0.00 ? 65  THR A CA   2  
ATOM 2980  C C    . THR A 1 65  ? -8.951  -0.722  -0.379  1.00 0.00 ? 65  THR A C    2  
ATOM 2981  O O    . THR A 1 65  ? -9.937  -0.265  -0.955  1.00 0.00 ? 65  THR A O    2  
ATOM 2982  C CB   . THR A 1 65  ? -6.656  0.070   0.426   1.00 0.00 ? 65  THR A CB   2  
ATOM 2983  O OG1  . THR A 1 65  ? -6.685  -1.108  1.225   1.00 0.00 ? 65  THR A OG1  2  
ATOM 2984  C CG2  . THR A 1 65  ? -7.273  1.145   1.324   1.00 0.00 ? 65  THR A CG2  2  
ATOM 2985  H H    . THR A 1 65  ? -8.494  1.363   -1.648  1.00 0.00 ? 65  THR A H    2  
ATOM 2986  H HA   . THR A 1 65  ? -7.093  -1.087  -1.339  1.00 0.00 ? 65  THR A HA   2  
ATOM 2987  H HB   . THR A 1 65  ? -5.657  0.362   0.100   1.00 0.00 ? 65  THR A HB   2  
ATOM 2988  H HG1  . THR A 1 65  ? -6.287  -0.922  2.123   1.00 0.00 ? 65  THR A HG1  2  
ATOM 2989  H HG21 . THR A 1 65  ? -8.360  1.062   1.295   1.00 0.00 ? 65  THR A HG21 2  
ATOM 2990  H HG22 . THR A 1 65  ? -6.926  1.006   2.347   1.00 0.00 ? 65  THR A HG22 2  
ATOM 2991  H HG23 . THR A 1 65  ? -6.974  2.131   0.969   1.00 0.00 ? 65  THR A HG23 2  
ATOM 2992  N N    . ALA A 1 66  ? -9.000  -1.614  0.600   1.00 0.00 ? 66  ALA A N    2  
ATOM 2993  C CA   . ALA A 1 66  ? -10.270 -2.131  1.078   1.00 0.00 ? 66  ALA A CA   2  
ATOM 2994  C C    . ALA A 1 66  ? -10.684 -1.370  2.339   1.00 0.00 ? 66  ALA A C    2  
ATOM 2995  O O    . ALA A 1 66  ? -9.837  -0.837  3.053   1.00 0.00 ? 66  ALA A O    2  
ATOM 2996  C CB   . ALA A 1 66  ? -10.150 -3.637  1.319   1.00 0.00 ? 66  ALA A CB   2  
ATOM 2997  H H    . ALA A 1 66  ? -8.193  -1.980  1.063   1.00 0.00 ? 66  ALA A H    2  
ATOM 2998  H HA   . ALA A 1 66  ? -11.013 -1.959  0.299   1.00 0.00 ? 66  ALA A HA   2  
ATOM 2999  H HB1  . ALA A 1 66  ? -9.130  -3.959  1.103   1.00 0.00 ? 66  ALA A HB1  2  
ATOM 3000  H HB2  . ALA A 1 66  ? -10.389 -3.859  2.358   1.00 0.00 ? 66  ALA A HB2  2  
ATOM 3001  H HB3  . ALA A 1 66  ? -10.843 -4.166  0.665   1.00 0.00 ? 66  ALA A HB3  2  
ATOM 3002  N N    . PRO A 1 67  ? -12.022 -1.344  2.582   1.00 0.00 ? 67  PRO A N    2  
ATOM 3003  C CA   . PRO A 1 67  ? -12.558 -0.658  3.744   1.00 0.00 ? 67  PRO A CA   2  
ATOM 3004  C C    . PRO A 1 67  ? -12.309 -1.462  5.020   1.00 0.00 ? 67  PRO A C    2  
ATOM 3005  O O    . PRO A 1 67  ? -11.483 -2.375  5.031   1.00 0.00 ? 67  PRO A O    2  
ATOM 3006  C CB   . PRO A 1 67  ? -14.037 -0.468  3.441   1.00 0.00 ? 67  PRO A CB   2  
ATOM 3007  C CG   . PRO A 1 67  ? -14.366 -1.459  2.338   1.00 0.00 ? 67  PRO A CG   2  
ATOM 3008  C CD   . PRO A 1 67  ? -13.055 -1.965  1.758   1.00 0.00 ? 67  PRO A CD   2  
ATOM 3009  H HA   . PRO A 1 67  ? -12.092 0.218   3.876   1.00 0.00 ? 67  PRO A HA   2  
ATOM 3010  H HB2  . PRO A 1 67  ? -14.644 -0.653  4.327   1.00 0.00 ? 67  PRO A HB2  2  
ATOM 3011  H HB3  . PRO A 1 67  ? -14.241 0.553   3.123   1.00 0.00 ? 67  PRO A HB3  2  
ATOM 3012  H HG2  . PRO A 1 67  ? -14.955 -2.289  2.732   1.00 0.00 ? 67  PRO A HG2  2  
ATOM 3013  H HG3  . PRO A 1 67  ? -14.967 -0.983  1.563   1.00 0.00 ? 67  PRO A HG3  2  
ATOM 3014  H HD2  . PRO A 1 67  ? -12.996 -3.053  1.802   1.00 0.00 ? 67  PRO A HD2  2  
ATOM 3015  H HD3  . PRO A 1 67  ? -12.951 -1.682  0.710   1.00 0.00 ? 67  PRO A HD3  2  
ATOM 3016  N N    . SER A 1 68  ? -13.035 -1.095  6.065   1.00 0.00 ? 68  SER A N    2  
ATOM 3017  C CA   . SER A 1 68  ? -12.903 -1.772  7.344   1.00 0.00 ? 68  SER A CA   2  
ATOM 3018  C C    . SER A 1 68  ? -11.451 -1.703  7.825   1.00 0.00 ? 68  SER A C    2  
ATOM 3019  O O    . SER A 1 68  ? -10.641 -0.970  7.260   1.00 0.00 ? 68  SER A O    2  
ATOM 3020  C CB   . SER A 1 68  ? -13.359 -3.229  7.247   1.00 0.00 ? 68  SER A CB   2  
ATOM 3021  O OG   . SER A 1 68  ? -14.632 -3.432  7.855   1.00 0.00 ? 68  SER A OG   2  
ATOM 3022  H H    . SER A 1 68  ? -13.704 -0.353  6.048   1.00 0.00 ? 68  SER A H    2  
ATOM 3023  H HA   . SER A 1 68  ? -13.558 -1.232  8.027   1.00 0.00 ? 68  SER A HA   2  
ATOM 3024  H HB2  . SER A 1 68  ? -13.408 -3.525  6.199   1.00 0.00 ? 68  SER A HB2  2  
ATOM 3025  H HB3  . SER A 1 68  ? -12.622 -3.874  7.725   1.00 0.00 ? 68  SER A HB3  2  
ATOM 3026  H HG   . SER A 1 68  ? -14.530 -3.492  8.848   1.00 0.00 ? 68  SER A HG   2  
ATOM 3027  N N    . SER A 1 69  ? -11.168 -2.474  8.865   1.00 0.00 ? 69  SER A N    2  
ATOM 3028  C CA   . SER A 1 69  ? -9.829  -2.509  9.428   1.00 0.00 ? 69  SER A CA   2  
ATOM 3029  C C    . SER A 1 69  ? -8.809  -2.832  8.334   1.00 0.00 ? 69  SER A C    2  
ATOM 3030  O O    . SER A 1 69  ? -7.734  -2.237  8.288   1.00 0.00 ? 69  SER A O    2  
ATOM 3031  C CB   . SER A 1 69  ? -9.735  -3.532  10.561  1.00 0.00 ? 69  SER A CB   2  
ATOM 3032  O OG   . SER A 1 69  ? -10.236 -4.808  10.171  1.00 0.00 ? 69  SER A OG   2  
ATOM 3033  H H    . SER A 1 69  ? -11.833 -3.066  9.319   1.00 0.00 ? 69  SER A H    2  
ATOM 3034  H HA   . SER A 1 69  ? -9.658  -1.509  9.827   1.00 0.00 ? 69  SER A HA   2  
ATOM 3035  H HB2  . SER A 1 69  ? -8.695  -3.631  10.875  1.00 0.00 ? 69  SER A HB2  2  
ATOM 3036  H HB3  . SER A 1 69  ? -10.294 -3.170  11.424  1.00 0.00 ? 69  SER A HB3  2  
ATOM 3037  H HG   . SER A 1 69  ? -9.478  -5.442  10.022  1.00 0.00 ? 69  SER A HG   2  
ATOM 3038  N N    . ALA A 1 70  ? -9.183  -3.773  7.480   1.00 0.00 ? 70  ALA A N    2  
ATOM 3039  C CA   . ALA A 1 70  ? -8.315  -4.182  6.390   1.00 0.00 ? 70  ALA A CA   2  
ATOM 3040  C C    . ALA A 1 70  ? -8.670  -5.610  5.970   1.00 0.00 ? 70  ALA A C    2  
ATOM 3041  O O    . ALA A 1 70  ? -8.398  -6.562  6.701   1.00 0.00 ? 70  ALA A O    2  
ATOM 3042  C CB   . ALA A 1 70  ? -6.854  -4.049  6.823   1.00 0.00 ? 70  ALA A CB   2  
ATOM 3043  H H    . ALA A 1 70  ? -10.061 -4.252  7.525   1.00 0.00 ? 70  ALA A H    2  
ATOM 3044  H HA   . ALA A 1 70  ? -8.495  -3.510  5.551   1.00 0.00 ? 70  ALA A HA   2  
ATOM 3045  H HB1  . ALA A 1 70  ? -6.791  -4.100  7.911   1.00 0.00 ? 70  ALA A HB1  2  
ATOM 3046  H HB2  . ALA A 1 70  ? -6.269  -4.858  6.386   1.00 0.00 ? 70  ALA A HB2  2  
ATOM 3047  H HB3  . ALA A 1 70  ? -6.460  -3.091  6.482   1.00 0.00 ? 70  ALA A HB3  2  
ATOM 3048  N N    . VAL A 1 71  ? -9.270  -5.715  4.793   1.00 0.00 ? 71  VAL A N    2  
ATOM 3049  C CA   . VAL A 1 71  ? -9.665  -7.010  4.267   1.00 0.00 ? 71  VAL A CA   2  
ATOM 3050  C C    . VAL A 1 71  ? -8.832  -7.326  3.022   1.00 0.00 ? 71  VAL A C    2  
ATOM 3051  O O    . VAL A 1 71  ? -8.378  -8.455  2.844   1.00 0.00 ? 71  VAL A O    2  
ATOM 3052  C CB   . VAL A 1 71  ? -11.171 -7.029  3.999   1.00 0.00 ? 71  VAL A CB   2  
ATOM 3053  C CG1  . VAL A 1 71  ? -11.882 -5.929  4.788   1.00 0.00 ? 71  VAL A CG1  2  
ATOM 3054  C CG2  . VAL A 1 71  ? -11.463 -6.907  2.502   1.00 0.00 ? 71  VAL A CG2  2  
ATOM 3055  H H    . VAL A 1 71  ? -9.487  -4.936  4.205   1.00 0.00 ? 71  VAL A H    2  
ATOM 3056  H HA   . VAL A 1 71  ? -9.448  -7.755  5.031   1.00 0.00 ? 71  VAL A HA   2  
ATOM 3057  H HB   . VAL A 1 71  ? -11.559 -7.990  4.339   1.00 0.00 ? 71  VAL A HB   2  
ATOM 3058  H HG11 . VAL A 1 71  ? -11.358 -5.760  5.730   1.00 0.00 ? 71  VAL A HG11 2  
ATOM 3059  H HG12 . VAL A 1 71  ? -11.887 -5.009  4.205   1.00 0.00 ? 71  VAL A HG12 2  
ATOM 3060  H HG13 . VAL A 1 71  ? -12.908 -6.235  4.994   1.00 0.00 ? 71  VAL A HG13 2  
ATOM 3061  H HG21 . VAL A 1 71  ? -10.816 -6.146  2.067   1.00 0.00 ? 71  VAL A HG21 2  
ATOM 3062  H HG22 . VAL A 1 71  ? -11.277 -7.865  2.016   1.00 0.00 ? 71  VAL A HG22 2  
ATOM 3063  H HG23 . VAL A 1 71  ? -12.505 -6.623  2.357   1.00 0.00 ? 71  VAL A HG23 2  
ATOM 3064  N N    . CYS A 1 72  ? -8.656  -6.307  2.193   1.00 0.00 ? 72  CYS A N    2  
ATOM 3065  C CA   . CYS A 1 72  ? -7.886  -6.461  0.971   1.00 0.00 ? 72  CYS A CA   2  
ATOM 3066  C C    . CYS A 1 72  ? -6.736  -5.452  0.997   1.00 0.00 ? 72  CYS A C    2  
ATOM 3067  O O    . CYS A 1 72  ? -6.077  -5.231  -0.017  1.00 0.00 ? 72  CYS A O    2  
ATOM 3068  C CB   . CYS A 1 72  ? -8.761  -6.297  -0.274  1.00 0.00 ? 72  CYS A CB   2  
ATOM 3069  S SG   . CYS A 1 72  ? -10.331 -7.237  -0.238  1.00 0.00 ? 72  CYS A SG   2  
ATOM 3070  H H    . CYS A 1 72  ? -9.028  -5.391  2.346   1.00 0.00 ? 72  CYS A H    2  
ATOM 3071  H HA   . CYS A 1 72  ? -7.506  -7.483  0.967   1.00 0.00 ? 72  CYS A HA   2  
ATOM 3072  H HB2  . CYS A 1 72  ? -8.991  -5.238  -0.402  1.00 0.00 ? 72  CYS A HB2  2  
ATOM 3073  H HB3  . CYS A 1 72  ? -8.187  -6.606  -1.147  1.00 0.00 ? 72  CYS A HB3  2  
ATOM 3074  N N    . GLY A 1 73  ? -6.530  -4.869  2.169   1.00 0.00 ? 73  GLY A N    2  
ATOM 3075  C CA   . GLY A 1 73  ? -5.471  -3.889  2.340   1.00 0.00 ? 73  GLY A CA   2  
ATOM 3076  C C    . GLY A 1 73  ? -5.017  -3.823  3.800   1.00 0.00 ? 73  GLY A C    2  
ATOM 3077  O O    . GLY A 1 73  ? -5.186  -4.781  4.551   1.00 0.00 ? 73  GLY A O    2  
ATOM 3078  H H    . GLY A 1 73  ? -7.070  -5.054  2.988   1.00 0.00 ? 73  GLY A H    2  
ATOM 3079  H HA2  . GLY A 1 73  ? -4.625  -4.148  1.704   1.00 0.00 ? 73  GLY A HA2  2  
ATOM 3080  H HA3  . GLY A 1 73  ? -5.822  -2.908  2.020   1.00 0.00 ? 73  GLY A HA3  2  
ATOM 3081  N N    . VAL A 1 74  ? -4.449  -2.680  4.158   1.00 0.00 ? 74  VAL A N    2  
ATOM 3082  C CA   . VAL A 1 74  ? -3.970  -2.476  5.515   1.00 0.00 ? 74  VAL A CA   2  
ATOM 3083  C C    . VAL A 1 74  ? -4.795  -1.372  6.181   1.00 0.00 ? 74  VAL A C    2  
ATOM 3084  O O    . VAL A 1 74  ? -4.609  -1.081  7.362   1.00 0.00 ? 74  VAL A O    2  
ATOM 3085  C CB   . VAL A 1 74  ? -2.470  -2.175  5.500   1.00 0.00 ? 74  VAL A CB   2  
ATOM 3086  C CG1  . VAL A 1 74  ? -1.952  -1.903  6.914   1.00 0.00 ? 74  VAL A CG1  2  
ATOM 3087  C CG2  . VAL A 1 74  ? -1.689  -3.313  4.840   1.00 0.00 ? 74  VAL A CG2  2  
ATOM 3088  H H    . VAL A 1 74  ? -4.315  -1.905  3.542   1.00 0.00 ? 74  VAL A H    2  
ATOM 3089  H HA   . VAL A 1 74  ? -4.123  -3.406  6.061   1.00 0.00 ? 74  VAL A HA   2  
ATOM 3090  H HB   . VAL A 1 74  ? -2.315  -1.274  4.907   1.00 0.00 ? 74  VAL A HB   2  
ATOM 3091  H HG11 . VAL A 1 74  ? -2.208  -2.741  7.563   1.00 0.00 ? 74  VAL A HG11 2  
ATOM 3092  H HG12 . VAL A 1 74  ? -0.868  -1.783  6.886   1.00 0.00 ? 74  VAL A HG12 2  
ATOM 3093  H HG13 . VAL A 1 74  ? -2.410  -0.992  7.300   1.00 0.00 ? 74  VAL A HG13 2  
ATOM 3094  H HG21 . VAL A 1 74  ? -2.291  -3.752  4.044   1.00 0.00 ? 74  VAL A HG21 2  
ATOM 3095  H HG22 . VAL A 1 74  ? -0.762  -2.923  4.420   1.00 0.00 ? 74  VAL A HG22 2  
ATOM 3096  H HG23 . VAL A 1 74  ? -1.459  -4.076  5.583   1.00 0.00 ? 74  VAL A HG23 2  
ATOM 3097  N N    . SER A 1 75  ? -5.687  -0.787  5.395   1.00 0.00 ? 75  SER A N    2  
ATOM 3098  C CA   . SER A 1 75  ? -6.540  0.277   5.895   1.00 0.00 ? 75  SER A CA   2  
ATOM 3099  C C    . SER A 1 75  ? -5.767  1.142   6.892   1.00 0.00 ? 75  SER A C    2  
ATOM 3100  O O    . SER A 1 75  ? -5.844  0.924   8.100   1.00 0.00 ? 75  SER A O    2  
ATOM 3101  C CB   . SER A 1 75  ? -7.802  -0.289  6.549   1.00 0.00 ? 75  SER A CB   2  
ATOM 3102  O OG   . SER A 1 75  ? -8.982  0.362   6.085   1.00 0.00 ? 75  SER A OG   2  
ATOM 3103  H H    . SER A 1 75  ? -5.832  -1.030  4.436   1.00 0.00 ? 75  SER A H    2  
ATOM 3104  H HA   . SER A 1 75  ? -6.817  0.861   5.017   1.00 0.00 ? 75  SER A HA   2  
ATOM 3105  H HB2  . SER A 1 75  ? -7.870  -1.356  6.340   1.00 0.00 ? 75  SER A HB2  2  
ATOM 3106  H HB3  . SER A 1 75  ? -7.729  -0.179  7.632   1.00 0.00 ? 75  SER A HB3  2  
ATOM 3107  H HG   . SER A 1 75  ? -9.777  0.028   6.591   1.00 0.00 ? 75  SER A HG   2  
ATOM 3108  N N    . LEU A 1 76  ? -5.039  2.108   6.350   1.00 0.00 ? 76  LEU A N    2  
ATOM 3109  C CA   . LEU A 1 76  ? -4.253  3.007   7.177   1.00 0.00 ? 76  LEU A CA   2  
ATOM 3110  C C    . LEU A 1 76  ? -4.966  4.358   7.273   1.00 0.00 ? 76  LEU A C    2  
ATOM 3111  O O    . LEU A 1 76  ? -5.382  4.918   6.261   1.00 0.00 ? 76  LEU A O    2  
ATOM 3112  C CB   . LEU A 1 76  ? -2.820  3.104   6.650   1.00 0.00 ? 76  LEU A CB   2  
ATOM 3113  C CG   . LEU A 1 76  ? -2.327  1.915   5.823   1.00 0.00 ? 76  LEU A CG   2  
ATOM 3114  C CD1  . LEU A 1 76  ? -2.452  2.201   4.325   1.00 0.00 ? 76  LEU A CD1  2  
ATOM 3115  C CD2  . LEU A 1 76  ? -0.901  1.527   6.216   1.00 0.00 ? 76  LEU A CD2  2  
ATOM 3116  H H    . LEU A 1 76  ? -4.982  2.279   5.366   1.00 0.00 ? 76  LEU A H    2  
ATOM 3117  H HA   . LEU A 1 76  ? -4.201  2.572   8.174   1.00 0.00 ? 76  LEU A HA   2  
ATOM 3118  H HB2  . LEU A 1 76  ? -2.739  4.005   6.040   1.00 0.00 ? 76  LEU A HB2  2  
ATOM 3119  H HB3  . LEU A 1 76  ? -2.150  3.234   7.500   1.00 0.00 ? 76  LEU A HB3  2  
ATOM 3120  H HG   . LEU A 1 76  ? -2.966  1.059   6.041   1.00 0.00 ? 76  LEU A HG   2  
ATOM 3121  H HD11 . LEU A 1 76  ? -3.032  3.111   4.174   1.00 0.00 ? 76  LEU A HD11 2  
ATOM 3122  H HD12 . LEU A 1 76  ? -1.457  2.331   3.896   1.00 0.00 ? 76  LEU A HD12 2  
ATOM 3123  H HD13 . LEU A 1 76  ? -2.952  1.365   3.836   1.00 0.00 ? 76  LEU A HD13 2  
ATOM 3124  H HD21 . LEU A 1 76  ? -0.530  2.222   6.970   1.00 0.00 ? 76  LEU A HD21 2  
ATOM 3125  H HD22 . LEU A 1 76  ? -0.898  0.516   6.622   1.00 0.00 ? 76  LEU A HD22 2  
ATOM 3126  H HD23 . LEU A 1 76  ? -0.257  1.568   5.337   1.00 0.00 ? 76  LEU A HD23 2  
ATOM 3127  N N    . ASP A 1 77  ? -5.084  4.841   8.501   1.00 0.00 ? 77  ASP A N    2  
ATOM 3128  C CA   . ASP A 1 77  ? -5.739  6.116   8.745   1.00 0.00 ? 77  ASP A CA   2  
ATOM 3129  C C    . ASP A 1 77  ? -4.724  7.105   9.320   1.00 0.00 ? 77  ASP A C    2  
ATOM 3130  O O    . ASP A 1 77  ? -5.048  8.267   9.556   1.00 0.00 ? 77  ASP A O    2  
ATOM 3131  C CB   . ASP A 1 77  ? -6.878  5.966   9.755   1.00 0.00 ? 77  ASP A CB   2  
ATOM 3132  C CG   . ASP A 1 77  ? -6.679  4.862   10.795  1.00 0.00 ? 77  ASP A CG   2  
ATOM 3133  O OD1  . ASP A 1 77  ? -5.975  5.139   11.789  1.00 0.00 ? 77  ASP A OD1  2  
ATOM 3134  O OD2  . ASP A 1 77  ? -7.235  3.765   10.571  1.00 0.00 ? 77  ASP A OD2  2  
ATOM 3135  H H    . ASP A 1 77  ? -4.742  4.380   9.320   1.00 0.00 ? 77  ASP A H    2  
ATOM 3136  H HA   . ASP A 1 77  ? -6.122  6.430   7.774   1.00 0.00 ? 77  ASP A HA   2  
ATOM 3137  H HB2  . ASP A 1 77  ? -7.009  6.916   10.274  1.00 0.00 ? 77  ASP A HB2  2  
ATOM 3138  H HB3  . ASP A 1 77  ? -7.802  5.770   9.210   1.00 0.00 ? 77  ASP A HB3  2  
ATOM 3139  N N    . VAL A 1 78  ? -3.513  6.606   9.531   1.00 0.00 ? 78  VAL A N    2  
ATOM 3140  C CA   . VAL A 1 78  ? -2.449  7.432   10.075  1.00 0.00 ? 78  VAL A CA   2  
ATOM 3141  C C    . VAL A 1 78  ? -2.719  7.692   11.558  1.00 0.00 ? 78  VAL A C    2  
ATOM 3142  O O    . VAL A 1 78  ? -1.865  7.427   12.404  1.00 0.00 ? 78  VAL A O    2  
ATOM 3143  C CB   . VAL A 1 78  ? -2.313  8.718   9.257   1.00 0.00 ? 78  VAL A CB   2  
ATOM 3144  C CG1  . VAL A 1 78  ? -1.971  9.906   10.158  1.00 0.00 ? 78  VAL A CG1  2  
ATOM 3145  C CG2  . VAL A 1 78  ? -1.274  8.554   8.146   1.00 0.00 ? 78  VAL A CG2  2  
ATOM 3146  H H    . VAL A 1 78  ? -3.258  5.660   9.337   1.00 0.00 ? 78  VAL A H    2  
ATOM 3147  H HA   . VAL A 1 78  ? -1.518  6.872   9.980   1.00 0.00 ? 78  VAL A HA   2  
ATOM 3148  H HB   . VAL A 1 78  ? -3.276  8.920   8.788   1.00 0.00 ? 78  VAL A HB   2  
ATOM 3149  H HG11 . VAL A 1 78  ? -1.377  9.562   11.004  1.00 0.00 ? 78  VAL A HG11 2  
ATOM 3150  H HG12 . VAL A 1 78  ? -1.402  10.641  9.588   1.00 0.00 ? 78  VAL A HG12 2  
ATOM 3151  H HG13 . VAL A 1 78  ? -2.891  10.363  10.521  1.00 0.00 ? 78  VAL A HG13 2  
ATOM 3152  H HG21 . VAL A 1 78  ? -0.920  7.524   8.128   1.00 0.00 ? 78  VAL A HG21 2  
ATOM 3153  H HG22 . VAL A 1 78  ? -1.728  8.800   7.185   1.00 0.00 ? 78  VAL A HG22 2  
ATOM 3154  H HG23 . VAL A 1 78  ? -0.434  9.223   8.333   1.00 0.00 ? 78  VAL A HG23 2  
ATOM 3155  N N    . GLY A 1 79  ? -3.908  8.209   11.829  1.00 0.00 ? 79  GLY A N    2  
ATOM 3156  C CA   . GLY A 1 79  ? -4.300  8.509   13.195  1.00 0.00 ? 79  GLY A CA   2  
ATOM 3157  C C    . GLY A 1 79  ? -4.076  7.301   14.107  1.00 0.00 ? 79  GLY A C    2  
ATOM 3158  O O    . GLY A 1 79  ? -4.118  7.426   15.330  1.00 0.00 ? 79  GLY A O    2  
ATOM 3159  H H    . GLY A 1 79  ? -4.596  8.423   11.135  1.00 0.00 ? 79  GLY A H    2  
ATOM 3160  H HA2  . GLY A 1 79  ? -3.728  9.359   13.564  1.00 0.00 ? 79  GLY A HA2  2  
ATOM 3161  H HA3  . GLY A 1 79  ? -5.351  8.797   13.220  1.00 0.00 ? 79  GLY A HA3  2  
ATOM 3162  N N    . GLY A 1 80  ? -3.841  6.159   13.477  1.00 0.00 ? 80  GLY A N    2  
ATOM 3163  C CA   . GLY A 1 80  ? -3.608  4.930   14.217  1.00 0.00 ? 80  GLY A CA   2  
ATOM 3164  C C    . GLY A 1 80  ? -2.203  4.387   13.950  1.00 0.00 ? 80  GLY A C    2  
ATOM 3165  O O    . GLY A 1 80  ? -1.600  3.762   14.822  1.00 0.00 ? 80  GLY A O    2  
ATOM 3166  H H    . GLY A 1 80  ? -3.807  6.066   12.482  1.00 0.00 ? 80  GLY A H    2  
ATOM 3167  H HA2  . GLY A 1 80  ? -3.735  5.115   15.284  1.00 0.00 ? 80  GLY A HA2  2  
ATOM 3168  H HA3  . GLY A 1 80  ? -4.350  4.185   13.932  1.00 0.00 ? 80  GLY A HA3  2  
ATOM 3169  N N    . LYS A 1 81  ? -1.722  4.645   12.743  1.00 0.00 ? 81  LYS A N    2  
ATOM 3170  C CA   . LYS A 1 81  ? -0.400  4.189   12.350  1.00 0.00 ? 81  LYS A CA   2  
ATOM 3171  C C    . LYS A 1 81  ? 0.541   5.392   12.254  1.00 0.00 ? 81  LYS A C    2  
ATOM 3172  O O    . LYS A 1 81  ? 1.097   5.831   13.260  1.00 0.00 ? 81  LYS A O    2  
ATOM 3173  C CB   . LYS A 1 81  ? -0.477  3.365   11.064  1.00 0.00 ? 81  LYS A CB   2  
ATOM 3174  C CG   . LYS A 1 81  ? -1.888  3.401   10.473  1.00 0.00 ? 81  LYS A CG   2  
ATOM 3175  C CD   . LYS A 1 81  ? -2.860  2.579   11.323  1.00 0.00 ? 81  LYS A CD   2  
ATOM 3176  C CE   . LYS A 1 81  ? -4.244  3.228   11.355  1.00 0.00 ? 81  LYS A CE   2  
ATOM 3177  N NZ   . LYS A 1 81  ? -5.230  2.380   10.647  1.00 0.00 ? 81  LYS A NZ   2  
ATOM 3178  H H    . LYS A 1 81  ? -2.220  5.154   12.040  1.00 0.00 ? 81  LYS A H    2  
ATOM 3179  H HA   . LYS A 1 81  ? -0.036  3.527   13.136  1.00 0.00 ? 81  LYS A HA   2  
ATOM 3180  H HB2  . LYS A 1 81  ? 0.236   3.752   10.336  1.00 0.00 ? 81  LYS A HB2  2  
ATOM 3181  H HB3  . LYS A 1 81  ? -0.191  2.333   11.271  1.00 0.00 ? 81  LYS A HB3  2  
ATOM 3182  H HG2  . LYS A 1 81  ? -2.235  4.432   10.413  1.00 0.00 ? 81  LYS A HG2  2  
ATOM 3183  H HG3  . LYS A 1 81  ? -1.870  3.010   9.455   1.00 0.00 ? 81  LYS A HG3  2  
ATOM 3184  H HD2  . LYS A 1 81  ? -2.936  1.569   10.921  1.00 0.00 ? 81  LYS A HD2  2  
ATOM 3185  H HD3  . LYS A 1 81  ? -2.473  2.489   12.339  1.00 0.00 ? 81  LYS A HD3  2  
ATOM 3186  H HE2  . LYS A 1 81  ? -4.560  3.378   12.387  1.00 0.00 ? 81  LYS A HE2  2  
ATOM 3187  H HE3  . LYS A 1 81  ? -4.202  4.212   10.888  1.00 0.00 ? 81  LYS A HE3  2  
ATOM 3188  H HZ1  . LYS A 1 81  ? -4.930  1.427   10.675  1.00 0.00 ? 81  LYS A HZ1  2  
ATOM 3189  H HZ2  . LYS A 1 81  ? -6.121  2.462   11.093  1.00 0.00 ? 81  LYS A HZ2  2  
ATOM 3190  H HZ3  . LYS A 1 81  ? -5.304  2.679   9.695   1.00 0.00 ? 81  LYS A HZ3  2  
ATOM 3191  N N    . LYS A 1 82  ? 0.691   5.890   11.037  1.00 0.00 ? 82  LYS A N    2  
ATOM 3192  C CA   . LYS A 1 82  ? 1.555   7.033   10.795  1.00 0.00 ? 82  LYS A CA   2  
ATOM 3193  C C    . LYS A 1 82  ? 1.795   7.178   9.291   1.00 0.00 ? 82  LYS A C    2  
ATOM 3194  O O    . LYS A 1 82  ? 1.116   7.955   8.623   1.00 0.00 ? 82  LYS A O    2  
ATOM 3195  C CB   . LYS A 1 82  ? 2.841   6.914   11.616  1.00 0.00 ? 82  LYS A CB   2  
ATOM 3196  C CG   . LYS A 1 82  ? 3.409   5.495   11.543  1.00 0.00 ? 82  LYS A CG   2  
ATOM 3197  C CD   . LYS A 1 82  ? 3.619   4.915   12.943  1.00 0.00 ? 82  LYS A CD   2  
ATOM 3198  C CE   . LYS A 1 82  ? 2.787   3.646   13.142  1.00 0.00 ? 82  LYS A CE   2  
ATOM 3199  N NZ   . LYS A 1 82  ? 3.585   2.607   13.832  1.00 0.00 ? 82  LYS A NZ   2  
ATOM 3200  H H    . LYS A 1 82  ? 0.235   5.526   10.224  1.00 0.00 ? 82  LYS A H    2  
ATOM 3201  H HA   . LYS A 1 82  ? 1.029   7.920   11.148  1.00 0.00 ? 82  LYS A HA   2  
ATOM 3202  H HB2  . LYS A 1 82  ? 3.581   7.624   11.245  1.00 0.00 ? 82  LYS A HB2  2  
ATOM 3203  H HB3  . LYS A 1 82  ? 2.641   7.176   12.654  1.00 0.00 ? 82  LYS A HB3  2  
ATOM 3204  H HG2  . LYS A 1 82  ? 2.728   4.856   10.979  1.00 0.00 ? 82  LYS A HG2  2  
ATOM 3205  H HG3  . LYS A 1 82  ? 4.356   5.505   11.003  1.00 0.00 ? 82  LYS A HG3  2  
ATOM 3206  H HD2  . LYS A 1 82  ? 4.675   4.691   13.093  1.00 0.00 ? 82  LYS A HD2  2  
ATOM 3207  H HD3  . LYS A 1 82  ? 3.342   5.657   13.692  1.00 0.00 ? 82  LYS A HD3  2  
ATOM 3208  H HE2  . LYS A 1 82  ? 1.896   3.876   13.725  1.00 0.00 ? 82  LYS A HE2  2  
ATOM 3209  H HE3  . LYS A 1 82  ? 2.449   3.272   12.176  1.00 0.00 ? 82  LYS A HE3  2  
ATOM 3210  H HZ1  . LYS A 1 82  ? 4.552   2.857   13.802  1.00 0.00 ? 82  LYS A HZ1  2  
ATOM 3211  H HZ2  . LYS A 1 82  ? 3.287   2.537   14.783  1.00 0.00 ? 82  LYS A HZ2  2  
ATOM 3212  H HZ3  . LYS A 1 82  ? 3.452   1.728   13.375  1.00 0.00 ? 82  LYS A HZ3  2  
ATOM 3213  N N    . GLU A 1 83  ? 2.765   6.418   8.804   1.00 0.00 ? 83  GLU A N    2  
ATOM 3214  C CA   . GLU A 1 83  ? 3.103   6.452   7.391   1.00 0.00 ? 83  GLU A CA   2  
ATOM 3215  C C    . GLU A 1 83  ? 3.575   5.073   6.925   1.00 0.00 ? 83  GLU A C    2  
ATOM 3216  O O    . GLU A 1 83  ? 4.110   4.296   7.715   1.00 0.00 ? 83  GLU A O    2  
ATOM 3217  C CB   . GLU A 1 83  ? 4.162   7.518   7.107   1.00 0.00 ? 83  GLU A CB   2  
ATOM 3218  C CG   . GLU A 1 83  ? 4.015   8.705   8.060   1.00 0.00 ? 83  GLU A CG   2  
ATOM 3219  C CD   . GLU A 1 83  ? 4.710   8.427   9.395   1.00 0.00 ? 83  GLU A CD   2  
ATOM 3220  O OE1  . GLU A 1 83  ? 5.139   7.268   9.580   1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3221  O OE2  . GLU A 1 83  ? 4.796   9.380   10.199  1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3222  H H    . GLU A 1 83  ? 3.313   5.789   9.355   1.00 0.00 ? 83  GLU A H    2  
ATOM 3223  H HA   . GLU A 1 83  ? 2.179   6.720   6.878   1.00 0.00 ? 83  GLU A HA   2  
ATOM 3224  H HB2  . GLU A 1 83  ? 5.158   7.084   7.211   1.00 0.00 ? 83  GLU A HB2  2  
ATOM 3225  H HB3  . GLU A 1 83  ? 4.071   7.861   6.077   1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3226  H HG2  . GLU A 1 83  ? 4.442   9.599   7.604   1.00 0.00 ? 83  GLU A HG2  2  
ATOM 3227  H HG3  . GLU A 1 83  ? 2.958   8.909   8.231   1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3228  N N    . TYR A 1 84  ? 3.359   4.810   5.644   1.00 0.00 ? 84  TYR A N    2  
ATOM 3229  C CA   . TYR A 1 84  ? 3.755   3.539   5.063   1.00 0.00 ? 84  TYR A CA   2  
ATOM 3230  C C    . TYR A 1 84  ? 4.458   3.744   3.721   1.00 0.00 ? 84  TYR A C    2  
ATOM 3231  O O    . TYR A 1 84  ? 4.233   4.748   3.045   1.00 0.00 ? 84  TYR A O    2  
ATOM 3232  C CB   . TYR A 1 84  ? 2.459   2.759   4.832   1.00 0.00 ? 84  TYR A CB   2  
ATOM 3233  C CG   . TYR A 1 84  ? 1.413   3.518   4.012   1.00 0.00 ? 84  TYR A CG   2  
ATOM 3234  C CD1  . TYR A 1 84  ? 1.696   3.897   2.716   1.00 0.00 ? 84  TYR A CD1  2  
ATOM 3235  C CD2  . TYR A 1 84  ? 0.188   3.824   4.570   1.00 0.00 ? 84  TYR A CD2  2  
ATOM 3236  C CE1  . TYR A 1 84  ? 0.712   4.612   1.944   1.00 0.00 ? 84  TYR A CE1  2  
ATOM 3237  C CE2  . TYR A 1 84  ? -0.795  4.538   3.797   1.00 0.00 ? 84  TYR A CE2  2  
ATOM 3238  C CZ   . TYR A 1 84  ? -0.485  4.897   2.522   1.00 0.00 ? 84  TYR A CZ   2  
ATOM 3239  O OH   . TYR A 1 84  ? -1.414  5.571   1.794   1.00 0.00 ? 84  TYR A OH   2  
ATOM 3240  H H    . TYR A 1 84  ? 2.923   5.448   5.009   1.00 0.00 ? 84  TYR A H    2  
ATOM 3241  H HA   . TYR A 1 84  ? 4.443   3.053   5.755   1.00 0.00 ? 84  TYR A HA   2  
ATOM 3242  H HB2  . TYR A 1 84  ? 2.695   1.823   4.325   1.00 0.00 ? 84  TYR A HB2  2  
ATOM 3243  H HB3  . TYR A 1 84  ? 2.028   2.497   5.799   1.00 0.00 ? 84  TYR A HB3  2  
ATOM 3244  H HD1  . TYR A 1 84  ? 2.664   3.656   2.277   1.00 0.00 ? 84  TYR A HD1  2  
ATOM 3245  H HD2  . TYR A 1 84  ? -0.035  3.524   5.593   1.00 0.00 ? 84  TYR A HD2  2  
ATOM 3246  H HE1  . TYR A 1 84  ? 0.922   4.917   0.919   1.00 0.00 ? 84  TYR A HE1  2  
ATOM 3247  H HE2  . TYR A 1 84  ? -1.767  4.786   4.224   1.00 0.00 ? 84  TYR A HE2  2  
ATOM 3248  H HH   . TYR A 1 84  ? -2.170  4.962   1.555   1.00 0.00 ? 84  TYR A HH   2  
ATOM 3249  N N    . LEU A 1 85  ? 5.296   2.778   3.374   1.00 0.00 ? 85  LEU A N    2  
ATOM 3250  C CA   . LEU A 1 85  ? 6.034   2.841   2.124   1.00 0.00 ? 85  LEU A CA   2  
ATOM 3251  C C    . LEU A 1 85  ? 5.153   2.313   0.990   1.00 0.00 ? 85  LEU A C    2  
ATOM 3252  O O    . LEU A 1 85  ? 5.596   2.220   -0.154  1.00 0.00 ? 85  LEU A O    2  
ATOM 3253  C CB   . LEU A 1 85  ? 7.372   2.111   2.254   1.00 0.00 ? 85  LEU A CB   2  
ATOM 3254  C CG   . LEU A 1 85  ? 7.302   0.666   2.752   1.00 0.00 ? 85  LEU A CG   2  
ATOM 3255  C CD1  . LEU A 1 85  ? 7.410   0.606   4.277   1.00 0.00 ? 85  LEU A CD1  2  
ATOM 3256  C CD2  . LEU A 1 85  ? 6.039   -0.030  2.239   1.00 0.00 ? 85  LEU A CD2  2  
ATOM 3257  H H    . LEU A 1 85  ? 5.473   1.966   3.928   1.00 0.00 ? 85  LEU A H    2  
ATOM 3258  H HA   . LEU A 1 85  ? 6.256   3.890   1.928   1.00 0.00 ? 85  LEU A HA   2  
ATOM 3259  H HB2  . LEU A 1 85  ? 7.863   2.115   1.280   1.00 0.00 ? 85  LEU A HB2  2  
ATOM 3260  H HB3  . LEU A 1 85  ? 8.008   2.678   2.933   1.00 0.00 ? 85  LEU A HB3  2  
ATOM 3261  H HG   . LEU A 1 85  ? 8.156   0.123   2.347   1.00 0.00 ? 85  LEU A HG   2  
ATOM 3262  H HD11 . LEU A 1 85  ? 7.836   1.539   4.648   1.00 0.00 ? 85  LEU A HD11 2  
ATOM 3263  H HD12 . LEU A 1 85  ? 6.418   0.464   4.707   1.00 0.00 ? 85  LEU A HD12 2  
ATOM 3264  H HD13 . LEU A 1 85  ? 8.053   -0.227  4.563   1.00 0.00 ? 85  LEU A HD13 2  
ATOM 3265  H HD21 . LEU A 1 85  ? 6.020   0.008   1.150   1.00 0.00 ? 85  LEU A HD21 2  
ATOM 3266  H HD22 . LEU A 1 85  ? 6.040   -1.069  2.566   1.00 0.00 ? 85  LEU A HD22 2  
ATOM 3267  H HD23 . LEU A 1 85  ? 5.159   0.476   2.636   1.00 0.00 ? 85  LEU A HD23 2  
ATOM 3268  N N    . ILE A 1 86  ? 3.921   1.981   1.346   1.00 0.00 ? 86  ILE A N    2  
ATOM 3269  C CA   . ILE A 1 86  ? 2.974   1.464   0.371   1.00 0.00 ? 86  ILE A CA   2  
ATOM 3270  C C    . ILE A 1 86  ? 3.708   1.166   -0.937  1.00 0.00 ? 86  ILE A C    2  
ATOM 3271  O O    . ILE A 1 86  ? 4.012   2.078   -1.704  1.00 0.00 ? 86  ILE A O    2  
ATOM 3272  C CB   . ILE A 1 86  ? 1.793   2.424   0.211   1.00 0.00 ? 86  ILE A CB   2  
ATOM 3273  C CG1  . ILE A 1 86  ? 0.537   1.865   0.881   1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3274  C CG2  . ILE A 1 86  ? 1.556   2.759   -1.262  1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3275  C CD1  . ILE A 1 86  ? 0.848   1.355   2.290   1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3276  H H    . ILE A 1 86  ? 3.567   2.060   2.278   1.00 0.00 ? 86  ILE A H    2  
ATOM 3277  H HA   . ILE A 1 86  ? 2.577   0.529   0.766   1.00 0.00 ? 86  ILE A HA   2  
ATOM 3278  H HB   . ILE A 1 86  ? 2.041   3.357   0.717   1.00 0.00 ? 86  ILE A HB   2  
ATOM 3279  H HG12 . ILE A 1 86  ? -0.228  2.640   0.932   1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3280  H HG13 . ILE A 1 86  ? 0.129   1.053   0.279   1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3281  H HG21 . ILE A 1 86  ? 1.711   1.865   -1.868  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3282  H HG22 . ILE A 1 86  ? 0.534   3.114   -1.395  1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3283  H HG23 . ILE A 1 86  ? 2.253   3.535   -1.575  1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3284  H HD11 . ILE A 1 86  ? 1.878   1.603   2.547   1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3285  H HD12 . ILE A 1 86  ? 0.172   1.826   3.004   1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3286  H HD13 . ILE A 1 86  ? 0.716   0.273   2.323   1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3287  N N    . ALA A 1 87  ? 3.969   -0.114  -1.153  1.00 0.00 ? 87  ALA A N    2  
ATOM 3288  C CA   . ALA A 1 87  ? 4.661   -0.544  -2.357  1.00 0.00 ? 87  ALA A CA   2  
ATOM 3289  C C    . ALA A 1 87  ? 3.848   -1.645  -3.042  1.00 0.00 ? 87  ALA A C    2  
ATOM 3290  O O    . ALA A 1 87  ? 3.748   -2.758  -2.527  1.00 0.00 ? 87  ALA A O    2  
ATOM 3291  C CB   . ALA A 1 87  ? 6.076   -1.002  -1.997  1.00 0.00 ? 87  ALA A CB   2  
ATOM 3292  H H    . ALA A 1 87  ? 3.718   -0.850  -0.525  1.00 0.00 ? 87  ALA A H    2  
ATOM 3293  H HA   . ALA A 1 87  ? 4.729   0.315   -3.025  1.00 0.00 ? 87  ALA A HA   2  
ATOM 3294  H HB1  . ALA A 1 87  ? 6.225   -0.908  -0.922  1.00 0.00 ? 87  ALA A HB1  2  
ATOM 3295  H HB2  . ALA A 1 87  ? 6.207   -2.042  -2.292  1.00 0.00 ? 87  ALA A HB2  2  
ATOM 3296  H HB3  . ALA A 1 87  ? 6.802   -0.381  -2.521  1.00 0.00 ? 87  ALA A HB3  2  
ATOM 3297  N N    . GLY A 1 88  ? 3.290   -1.296  -4.191  1.00 0.00 ? 88  GLY A N    2  
ATOM 3298  C CA   . GLY A 1 88  ? 2.489   -2.241  -4.951  1.00 0.00 ? 88  GLY A CA   2  
ATOM 3299  C C    . GLY A 1 88  ? 2.697   -2.051  -6.455  1.00 0.00 ? 88  GLY A C    2  
ATOM 3300  O O    . GLY A 1 88  ? 3.425   -1.153  -6.875  1.00 0.00 ? 88  GLY A O    2  
ATOM 3301  H H    . GLY A 1 88  ? 3.376   -0.389  -4.603  1.00 0.00 ? 88  GLY A H    2  
ATOM 3302  H HA2  . GLY A 1 88  ? 2.757   -3.259  -4.669  1.00 0.00 ? 88  GLY A HA2  2  
ATOM 3303  H HA3  . GLY A 1 88  ? 1.435   -2.109  -4.706  1.00 0.00 ? 88  GLY A HA3  2  
ATOM 3304  N N    . LYS A 1 89  ? 2.043   -2.909  -7.224  1.00 0.00 ? 89  LYS A N    2  
ATOM 3305  C CA   . LYS A 1 89  ? 2.147   -2.847  -8.672  1.00 0.00 ? 89  LYS A CA   2  
ATOM 3306  C C    . LYS A 1 89  ? 1.955   -1.400  -9.130  1.00 0.00 ? 89  LYS A C    2  
ATOM 3307  O O    . LYS A 1 89  ? 2.530   -0.982  -10.134 1.00 0.00 ? 89  LYS A O    2  
ATOM 3308  C CB   . LYS A 1 89  ? 1.174   -3.833  -9.321  1.00 0.00 ? 89  LYS A CB   2  
ATOM 3309  C CG   . LYS A 1 89  ? 1.604   -4.163  -10.752 1.00 0.00 ? 89  LYS A CG   2  
ATOM 3310  C CD   . LYS A 1 89  ? 1.507   -5.667  -11.019 1.00 0.00 ? 89  LYS A CD   2  
ATOM 3311  C CE   . LYS A 1 89  ? 0.142   -6.213  -10.600 1.00 0.00 ? 89  LYS A CE   2  
ATOM 3312  N NZ   . LYS A 1 89  ? -0.575  -6.770  -11.770 1.00 0.00 ? 89  LYS A NZ   2  
ATOM 3313  H H    . LYS A 1 89  ? 1.453   -3.636  -6.873  1.00 0.00 ? 89  LYS A H    2  
ATOM 3314  H HA   . LYS A 1 89  ? 3.154   -3.163  -8.940  1.00 0.00 ? 89  LYS A HA   2  
ATOM 3315  H HB2  . LYS A 1 89  ? 1.129   -4.748  -8.731  1.00 0.00 ? 89  LYS A HB2  2  
ATOM 3316  H HB3  . LYS A 1 89  ? 0.171   -3.408  -9.328  1.00 0.00 ? 89  LYS A HB3  2  
ATOM 3317  H HG2  . LYS A 1 89  ? 0.973   -3.624  -11.459 1.00 0.00 ? 89  LYS A HG2  2  
ATOM 3318  H HG3  . LYS A 1 89  ? 2.626   -3.825  -10.916 1.00 0.00 ? 89  LYS A HG3  2  
ATOM 3319  H HD2  . LYS A 1 89  ? 1.672   -5.863  -12.080 1.00 0.00 ? 89  LYS A HD2  2  
ATOM 3320  H HD3  . LYS A 1 89  ? 2.294   -6.188  -10.474 1.00 0.00 ? 89  LYS A HD3  2  
ATOM 3321  H HE2  . LYS A 1 89  ? 0.268   -6.985  -9.842  1.00 0.00 ? 89  LYS A HE2  2  
ATOM 3322  H HE3  . LYS A 1 89  ? -0.452  -5.417  -10.149 1.00 0.00 ? 89  LYS A HE3  2  
ATOM 3323  H HZ1  . LYS A 1 89  ? 0.059   -7.314  -12.320 1.00 0.00 ? 89  LYS A HZ1  2  
ATOM 3324  H HZ2  . LYS A 1 89  ? -1.325  -7.352  -11.453 1.00 0.00 ? 89  LYS A HZ2  2  
ATOM 3325  H HZ3  . LYS A 1 89  ? -0.942  -6.023  -12.323 1.00 0.00 ? 89  LYS A HZ3  2  
ATOM 3326  N N    . ALA A 1 90  ? 1.143   -0.675  -8.374  1.00 0.00 ? 90  ALA A N    2  
ATOM 3327  C CA   . ALA A 1 90  ? 0.867   0.715   -8.690  1.00 0.00 ? 90  ALA A CA   2  
ATOM 3328  C C    . ALA A 1 90  ? -0.156  0.783   -9.824  1.00 0.00 ? 90  ALA A C    2  
ATOM 3329  O O    . ALA A 1 90  ? -0.529  -0.244  -10.391 1.00 0.00 ? 90  ALA A O    2  
ATOM 3330  C CB   . ALA A 1 90  ? 2.175   1.428   -9.041  1.00 0.00 ? 90  ALA A CB   2  
ATOM 3331  H H    . ALA A 1 90  ? 0.678   -1.024  -7.559  1.00 0.00 ? 90  ALA A H    2  
ATOM 3332  H HA   . ALA A 1 90  ? 0.443   1.180   -7.801  1.00 0.00 ? 90  ALA A HA   2  
ATOM 3333  H HB1  . ALA A 1 90  ? 2.998   0.967   -8.496  1.00 0.00 ? 90  ALA A HB1  2  
ATOM 3334  H HB2  . ALA A 1 90  ? 2.358   1.344   -10.112 1.00 0.00 ? 90  ALA A HB2  2  
ATOM 3335  H HB3  . ALA A 1 90  ? 2.101   2.480   -8.767  1.00 0.00 ? 90  ALA A HB3  2  
ATOM 3336  N N    . GLU A 1 91  ? -0.582  2.002   -10.123 1.00 0.00 ? 91  GLU A N    2  
ATOM 3337  C CA   . GLU A 1 91  ? -1.556  2.216   -11.181 1.00 0.00 ? 91  GLU A CA   2  
ATOM 3338  C C    . GLU A 1 91  ? -1.123  3.381   -12.072 1.00 0.00 ? 91  GLU A C    2  
ATOM 3339  O O    . GLU A 1 91  ? -1.872  3.809   -12.949 1.00 0.00 ? 91  GLU A O    2  
ATOM 3340  C CB   . GLU A 1 91  ? -2.951  2.459   -10.600 1.00 0.00 ? 91  GLU A CB   2  
ATOM 3341  C CG   . GLU A 1 91  ? -4.037  1.991   -11.571 1.00 0.00 ? 91  GLU A CG   2  
ATOM 3342  C CD   . GLU A 1 91  ? -3.828  0.527   -11.964 1.00 0.00 ? 91  GLU A CD   2  
ATOM 3343  O OE1  . GLU A 1 91  ? -4.050  -0.333  -11.084 1.00 0.00 ? 91  GLU A OE1  2  
ATOM 3344  O OE2  . GLU A 1 91  ? -3.452  0.301   -13.133 1.00 0.00 ? 91  GLU A OE2  2  
ATOM 3345  H H    . GLU A 1 91  ? -0.274  2.831   -9.658  1.00 0.00 ? 91  GLU A H    2  
ATOM 3346  H HA   . GLU A 1 91  ? -1.565  1.291   -11.758 1.00 0.00 ? 91  GLU A HA   2  
ATOM 3347  H HB2  . GLU A 1 91  ? -3.051  1.929   -9.653  1.00 0.00 ? 91  GLU A HB2  2  
ATOM 3348  H HB3  . GLU A 1 91  ? -3.080  3.520   -10.388 1.00 0.00 ? 91  GLU A HB3  2  
ATOM 3349  H HG2  . GLU A 1 91  ? -5.018  2.111   -11.109 1.00 0.00 ? 91  GLU A HG2  2  
ATOM 3350  H HG3  . GLU A 1 91  ? -4.026  2.616   -12.463 1.00 0.00 ? 91  GLU A HG3  2  
ATOM 3351  N N    . GLY A 1 92  ? 0.086   3.861   -11.819 1.00 0.00 ? 92  GLY A N    2  
ATOM 3352  C CA   . GLY A 1 92  ? 0.628   4.968   -12.588 1.00 0.00 ? 92  GLY A CA   2  
ATOM 3353  C C    . GLY A 1 92  ? 1.142   6.076   -11.666 1.00 0.00 ? 92  GLY A C    2  
ATOM 3354  O O    . GLY A 1 92  ? 2.031   5.846   -10.849 1.00 0.00 ? 92  GLY A O    2  
ATOM 3355  H H    . GLY A 1 92  ? 0.690   3.508   -11.104 1.00 0.00 ? 92  GLY A H    2  
ATOM 3356  H HA2  . GLY A 1 92  ? 1.439   4.612   -13.223 1.00 0.00 ? 92  GLY A HA2  2  
ATOM 3357  H HA3  . GLY A 1 92  ? -0.142  5.367   -13.249 1.00 0.00 ? 92  GLY A HA3  2  
ATOM 3358  N N    . ASP A 1 93  ? 0.561   7.255   -11.831 1.00 0.00 ? 93  ASP A N    2  
ATOM 3359  C CA   . ASP A 1 93  ? 0.949   8.400   -11.023 1.00 0.00 ? 93  ASP A CA   2  
ATOM 3360  C C    . ASP A 1 93  ? -0.306  9.073   -10.464 1.00 0.00 ? 93  ASP A C    2  
ATOM 3361  O O    . ASP A 1 93  ? -1.347  9.094   -11.117 1.00 0.00 ? 93  ASP A O    2  
ATOM 3362  C CB   . ASP A 1 93  ? 1.706   9.433   -11.861 1.00 0.00 ? 93  ASP A CB   2  
ATOM 3363  C CG   . ASP A 1 93  ? 2.838   8.865   -12.720 1.00 0.00 ? 93  ASP A CG   2  
ATOM 3364  O OD1  . ASP A 1 93  ? 2.544   7.937   -13.504 1.00 0.00 ? 93  ASP A OD1  2  
ATOM 3365  O OD2  . ASP A 1 93  ? 3.970   9.373   -12.573 1.00 0.00 ? 93  ASP A OD2  2  
ATOM 3366  H H    . ASP A 1 93  ? -0.162  7.435   -12.498 1.00 0.00 ? 93  ASP A H    2  
ATOM 3367  H HA   . ASP A 1 93  ? 1.590   7.994   -10.241 1.00 0.00 ? 93  ASP A HA   2  
ATOM 3368  H HB2  . ASP A 1 93  ? 0.995   9.941   -12.513 1.00 0.00 ? 93  ASP A HB2  2  
ATOM 3369  H HB3  . ASP A 1 93  ? 2.120   10.188  -11.193 1.00 0.00 ? 93  ASP A HB3  2  
ATOM 3370  N N    . GLY A 1 94  ? -0.165  9.606   -9.259  1.00 0.00 ? 94  GLY A N    2  
ATOM 3371  C CA   . GLY A 1 94  ? -1.274  10.278  -8.603  1.00 0.00 ? 94  GLY A CA   2  
ATOM 3372  C C    . GLY A 1 94  ? -2.314  9.268   -8.113  1.00 0.00 ? 94  GLY A C    2  
ATOM 3373  O O    . GLY A 1 94  ? -3.333  9.650   -7.540  1.00 0.00 ? 94  GLY A O    2  
ATOM 3374  H H    . GLY A 1 94  ? 0.686   9.584   -8.734  1.00 0.00 ? 94  GLY A H    2  
ATOM 3375  H HA2  . GLY A 1 94  ? -0.904  10.861  -7.761  1.00 0.00 ? 94  GLY A HA2  2  
ATOM 3376  H HA3  . GLY A 1 94  ? -1.740  10.978  -9.296  1.00 0.00 ? 94  GLY A HA3  2  
ATOM 3377  N N    . LYS A 1 95  ? -2.021  7.999   -8.355  1.00 0.00 ? 95  LYS A N    2  
ATOM 3378  C CA   . LYS A 1 95  ? -2.918  6.932   -7.946  1.00 0.00 ? 95  LYS A CA   2  
ATOM 3379  C C    . LYS A 1 95  ? -2.273  5.580   -8.263  1.00 0.00 ? 95  LYS A C    2  
ATOM 3380  O O    . LYS A 1 95  ? -1.597  5.434   -9.280  1.00 0.00 ? 95  LYS A O    2  
ATOM 3381  C CB   . LYS A 1 95  ? -4.297  7.118   -8.579  1.00 0.00 ? 95  LYS A CB   2  
ATOM 3382  C CG   . LYS A 1 95  ? -4.373  6.429   -9.943  1.00 0.00 ? 95  LYS A CG   2  
ATOM 3383  C CD   . LYS A 1 95  ? -3.483  7.137   -10.966 1.00 0.00 ? 95  LYS A CD   2  
ATOM 3384  C CE   . LYS A 1 95  ? -4.041  8.518   -11.316 1.00 0.00 ? 95  LYS A CE   2  
ATOM 3385  N NZ   . LYS A 1 95  ? -5.451  8.412   -11.754 1.00 0.00 ? 95  LYS A NZ   2  
ATOM 3386  H H    . LYS A 1 95  ? -1.189  7.697   -8.823  1.00 0.00 ? 95  LYS A H    2  
ATOM 3387  H HA   . LYS A 1 95  ? -3.046  7.009   -6.867  1.00 0.00 ? 95  LYS A HA   2  
ATOM 3388  H HB2  . LYS A 1 95  ? -5.063  6.711   -7.919  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 3389  H HB3  . LYS A 1 95  ? -4.508  8.182   -8.694  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 3390  H HG2  . LYS A 1 95  ? -4.063  5.388   -9.846  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 3391  H HG3  . LYS A 1 95  ? -5.404  6.423   -10.296 1.00 0.00 ? 95  LYS A HG3  2  
ATOM 3392  H HD2  . LYS A 1 95  ? -2.474  7.240   -10.566 1.00 0.00 ? 95  LYS A HD2  2  
ATOM 3393  H HD3  . LYS A 1 95  ? -3.408  6.532   -11.869 1.00 0.00 ? 95  LYS A HD3  2  
ATOM 3394  H HE2  . LYS A 1 95  ? -3.972  9.175   -10.448 1.00 0.00 ? 95  LYS A HE2  2  
ATOM 3395  H HE3  . LYS A 1 95  ? -3.441  8.970   -12.106 1.00 0.00 ? 95  LYS A HE3  2  
ATOM 3396  H HZ1  . LYS A 1 95  ? -5.668  7.455   -11.948 1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 3397  H HZ2  . LYS A 1 95  ? -6.052  8.749   -11.029 1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 3398  H HZ3  . LYS A 1 95  ? -5.586  8.959   -12.580 1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 3399  N N    . MET A 1 96  ? -2.506  4.627   -7.373  1.00 0.00 ? 96  MET A N    2  
ATOM 3400  C CA   . MET A 1 96  ? -1.957  3.293   -7.544  1.00 0.00 ? 96  MET A CA   2  
ATOM 3401  C C    . MET A 1 96  ? -2.882  2.237   -6.935  1.00 0.00 ? 96  MET A C    2  
ATOM 3402  O O    . MET A 1 96  ? -4.017  2.537   -6.570  1.00 0.00 ? 96  MET A O    2  
ATOM 3403  C CB   . MET A 1 96  ? -0.583  3.216   -6.876  1.00 0.00 ? 96  MET A CB   2  
ATOM 3404  C CG   . MET A 1 96  ? -0.508  4.151   -5.667  1.00 0.00 ? 96  MET A CG   2  
ATOM 3405  S SD   . MET A 1 96  ? 0.207   3.294   -4.274  1.00 0.00 ? 96  MET A SD   2  
ATOM 3406  C CE   . MET A 1 96  ? 1.723   4.216   -4.088  1.00 0.00 ? 96  MET A CE   2  
ATOM 3407  H H    . MET A 1 96  ? -3.057  4.755   -6.548  1.00 0.00 ? 96  MET A H    2  
ATOM 3408  H HA   . MET A 1 96  ? -1.883  3.143   -8.621  1.00 0.00 ? 96  MET A HA   2  
ATOM 3409  H HB2  . MET A 1 96  ? -0.385  2.192   -6.560  1.00 0.00 ? 96  MET A HB2  2  
ATOM 3410  H HB3  . MET A 1 96  ? 0.191   3.484   -7.595  1.00 0.00 ? 96  MET A HB3  2  
ATOM 3411  H HG2  . MET A 1 96  ? 0.092   5.028   -5.911  1.00 0.00 ? 96  MET A HG2  2  
ATOM 3412  H HG3  . MET A 1 96  ? -1.506  4.508   -5.412  1.00 0.00 ? 96  MET A HG3  2  
ATOM 3413  H HE1  . MET A 1 96  ? 2.011   4.641   -5.050  1.00 0.00 ? 96  MET A HE1  2  
ATOM 3414  H HE2  . MET A 1 96  ? 1.574   5.019   -3.366  1.00 0.00 ? 96  MET A HE2  2  
ATOM 3415  H HE3  . MET A 1 96  ? 2.512   3.552   -3.734  1.00 0.00 ? 96  MET A HE3  2  
ATOM 3416  N N    . HIS A 1 97  ? -2.360  1.022   -6.844  1.00 0.00 ? 97  HIS A N    2  
ATOM 3417  C CA   . HIS A 1 97  ? -3.125  -0.080  -6.284  1.00 0.00 ? 97  HIS A CA   2  
ATOM 3418  C C    . HIS A 1 97  ? -2.293  -0.790  -5.214  1.00 0.00 ? 97  HIS A C    2  
ATOM 3419  O O    . HIS A 1 97  ? -1.150  -1.172  -5.463  1.00 0.00 ? 97  HIS A O    2  
ATOM 3420  C CB   . HIS A 1 97  ? -3.602  -1.026  -7.389  1.00 0.00 ? 97  HIS A CB   2  
ATOM 3421  C CG   . HIS A 1 97  ? -5.102  -1.062  -7.560  1.00 0.00 ? 97  HIS A CG   2  
ATOM 3422  N ND1  . HIS A 1 97  ? -5.771  -2.159  -8.074  1.00 0.00 ? 97  HIS A ND1  2  
ATOM 3423  C CD2  . HIS A 1 97  ? -6.054  -0.127  -7.278  1.00 0.00 ? 97  HIS A CD2  2  
ATOM 3424  C CE1  . HIS A 1 97  ? -7.067  -1.884  -8.097  1.00 0.00 ? 97  HIS A CE1  2  
ATOM 3425  N NE2  . HIS A 1 97  ? -7.240  -0.625  -7.604  1.00 0.00 ? 97  HIS A NE2  2  
ATOM 3426  H H    . HIS A 1 97  ? -1.435  0.787   -7.142  1.00 0.00 ? 97  HIS A H    2  
ATOM 3427  H HA   . HIS A 1 97  ? -4.007  0.357   -5.816  1.00 0.00 ? 97  HIS A HA   2  
ATOM 3428  H HB2  . HIS A 1 97  ? -3.146  -0.724  -8.333  1.00 0.00 ? 97  HIS A HB2  2  
ATOM 3429  H HB3  . HIS A 1 97  ? -3.247  -2.032  -7.169  1.00 0.00 ? 97  HIS A HB3  2  
ATOM 3430  H HD1  . HIS A 1 97  ? -5.349  -3.013  -8.375  1.00 0.00 ? 97  HIS A HD1  2  
ATOM 3431  H HD2  . HIS A 1 97  ? -5.871  0.862   -6.857  1.00 0.00 ? 97  HIS A HD2  2  
ATOM 3432  H HE1  . HIS A 1 97  ? -7.856  -2.550  -8.448  1.00 0.00 ? 97  HIS A HE1  2  
ATOM 3433  N N    . ILE A 1 98  ? -2.899  -0.947  -4.047  1.00 0.00 ? 98  ILE A N    2  
ATOM 3434  C CA   . ILE A 1 98  ? -2.229  -1.604  -2.938  1.00 0.00 ? 98  ILE A CA   2  
ATOM 3435  C C    . ILE A 1 98  ? -3.228  -2.503  -2.205  1.00 0.00 ? 98  ILE A C    2  
ATOM 3436  O O    . ILE A 1 98  ? -4.396  -2.146  -2.056  1.00 0.00 ? 98  ILE A O    2  
ATOM 3437  C CB   . ILE A 1 98  ? -1.551  -0.574  -2.034  1.00 0.00 ? 98  ILE A CB   2  
ATOM 3438  C CG1  . ILE A 1 98  ? -2.580  0.161   -1.173  1.00 0.00 ? 98  ILE A CG1  2  
ATOM 3439  C CG2  . ILE A 1 98  ? -0.694  0.393   -2.852  1.00 0.00 ? 98  ILE A CG2  2  
ATOM 3440  C CD1  . ILE A 1 98  ? -1.995  1.456   -0.605  1.00 0.00 ? 98  ILE A CD1  2  
ATOM 3441  H H    . ILE A 1 98  ? -3.830  -0.634  -3.853  1.00 0.00 ? 98  ILE A H    2  
ATOM 3442  H HA   . ILE A 1 98  ? -1.443  -2.233  -3.358  1.00 0.00 ? 98  ILE A HA   2  
ATOM 3443  H HB   . ILE A 1 98  ? -0.881  -1.102  -1.356  1.00 0.00 ? 98  ILE A HB   2  
ATOM 3444  H HG12 . ILE A 1 98  ? -3.463  0.388   -1.768  1.00 0.00 ? 98  ILE A HG12 2  
ATOM 3445  H HG13 . ILE A 1 98  ? -2.903  -0.485  -0.355  1.00 0.00 ? 98  ILE A HG13 2  
ATOM 3446  H HG21 . ILE A 1 98  ? -0.372  -0.096  -3.772  1.00 0.00 ? 98  ILE A HG21 2  
ATOM 3447  H HG22 . ILE A 1 98  ? -1.279  1.279   -3.098  1.00 0.00 ? 98  ILE A HG22 2  
ATOM 3448  H HG23 . ILE A 1 98  ? 0.181   0.685   -2.271  1.00 0.00 ? 98  ILE A HG23 2  
ATOM 3449  H HD11 . ILE A 1 98  ? -1.067  1.694   -1.125  1.00 0.00 ? 98  ILE A HD11 2  
ATOM 3450  H HD12 . ILE A 1 98  ? -2.708  2.269   -0.745  1.00 0.00 ? 98  ILE A HD12 2  
ATOM 3451  H HD13 . ILE A 1 98  ? -1.794  1.329   0.458   1.00 0.00 ? 98  ILE A HD13 2  
ATOM 3452  N N    . THR A 1 99  ? -2.732  -3.651  -1.767  1.00 0.00 ? 99  THR A N    2  
ATOM 3453  C CA   . THR A 1 99  ? -3.567  -4.602  -1.053  1.00 0.00 ? 99  THR A CA   2  
ATOM 3454  C C    . THR A 1 99  ? -2.795  -5.217  0.115   1.00 0.00 ? 99  THR A C    2  
ATOM 3455  O O    . THR A 1 99  ? -1.573  -5.089  0.193   1.00 0.00 ? 99  THR A O    2  
ATOM 3456  C CB   . THR A 1 99  ? -4.071  -5.638  -2.061  1.00 0.00 ? 99  THR A CB   2  
ATOM 3457  O OG1  . THR A 1 99  ? -3.053  -5.677  -3.056  1.00 0.00 ? 99  THR A OG1  2  
ATOM 3458  C CG2  . THR A 1 99  ? -5.313  -5.163  -2.817  1.00 0.00 ? 99  THR A CG2  2  
ATOM 3459  H H    . THR A 1 99  ? -1.782  -3.933  -1.892  1.00 0.00 ? 99  THR A H    2  
ATOM 3460  H HA   . THR A 1 99  ? -4.414  -4.066  -0.628  1.00 0.00 ? 99  THR A HA   2  
ATOM 3461  H HB   . THR A 1 99  ? -4.253  -6.596  -1.576  1.00 0.00 ? 99  THR A HB   2  
ATOM 3462  H HG1  . THR A 1 99  ? -2.907  -4.763  -3.434  1.00 0.00 ? 99  THR A HG1  2  
ATOM 3463  H HG21 . THR A 1 99  ? -5.206  -4.107  -3.064  1.00 0.00 ? 99  THR A HG21 2  
ATOM 3464  H HG22 . THR A 1 99  ? -5.425  -5.741  -3.734  1.00 0.00 ? 99  THR A HG22 2  
ATOM 3465  H HG23 . THR A 1 99  ? -6.194  -5.302  -2.190  1.00 0.00 ? 99  THR A HG23 2  
ATOM 3466  N N    . LEU A 1 100 ? -3.538  -5.873  0.995   1.00 0.00 ? 100 LEU A N    2  
ATOM 3467  C CA   . LEU A 1 100 ? -2.937  -6.508  2.156   1.00 0.00 ? 100 LEU A CA   2  
ATOM 3468  C C    . LEU A 1 100 ? -1.941  -7.573  1.691   1.00 0.00 ? 100 LEU A C    2  
ATOM 3469  O O    . LEU A 1 100 ? -0.798  -7.598  2.144   1.00 0.00 ? 100 LEU A O    2  
ATOM 3470  C CB   . LEU A 1 100 ? -4.021  -7.048  3.091   1.00 0.00 ? 100 LEU A CB   2  
ATOM 3471  C CG   . LEU A 1 100 ? -4.503  -8.472  2.809   1.00 0.00 ? 100 LEU A CG   2  
ATOM 3472  C CD1  . LEU A 1 100 ? -5.134  -9.094  4.056   1.00 0.00 ? 100 LEU A CD1  2  
ATOM 3473  C CD2  . LEU A 1 100 ? -5.452  -8.502  1.610   1.00 0.00 ? 100 LEU A CD2  2  
ATOM 3474  H H    . LEU A 1 100 ? -4.530  -5.973  0.924   1.00 0.00 ? 100 LEU A H    2  
ATOM 3475  H HA   . LEU A 1 100 ? -2.392  -5.740  2.703   1.00 0.00 ? 100 LEU A HA   2  
ATOM 3476  H HB2  . LEU A 1 100 ? -3.644  -7.008  4.113   1.00 0.00 ? 100 LEU A HB2  2  
ATOM 3477  H HB3  . LEU A 1 100 ? -4.880  -6.378  3.044   1.00 0.00 ? 100 LEU A HB3  2  
ATOM 3478  H HG   . LEU A 1 100 ? -3.637  -9.081  2.549   1.00 0.00 ? 100 LEU A HG   2  
ATOM 3479  H HD11 . LEU A 1 100 ? -5.715  -8.339  4.584   1.00 0.00 ? 100 LEU A HD11 2  
ATOM 3480  H HD12 . LEU A 1 100 ? -5.788  -9.915  3.761   1.00 0.00 ? 100 LEU A HD12 2  
ATOM 3481  H HD13 . LEU A 1 100 ? -4.349  -9.473  4.711   1.00 0.00 ? 100 LEU A HD13 2  
ATOM 3482  H HD21 . LEU A 1 100 ? -5.552  -7.497  1.199   1.00 0.00 ? 100 LEU A HD21 2  
ATOM 3483  H HD22 . LEU A 1 100 ? -5.053  -9.169  0.846   1.00 0.00 ? 100 LEU A HD22 2  
ATOM 3484  H HD23 . LEU A 1 100 ? -6.431  -8.862  1.930   1.00 0.00 ? 100 LEU A HD23 2  
ATOM 3485  N N    . CYS A 1 101 ? -2.411  -8.426  0.794   1.00 0.00 ? 101 CYS A N    2  
ATOM 3486  C CA   . CYS A 1 101 ? -1.576  -9.490  0.263   1.00 0.00 ? 101 CYS A CA   2  
ATOM 3487  C C    . CYS A 1 101 ? -0.389  -8.852  -0.462  1.00 0.00 ? 101 CYS A C    2  
ATOM 3488  O O    . CYS A 1 101 ? 0.608   -9.519  -0.735  1.00 0.00 ? 101 CYS A O    2  
ATOM 3489  C CB   . CYS A 1 101 ? -2.366  -10.428 -0.653  1.00 0.00 ? 101 CYS A CB   2  
ATOM 3490  S SG   . CYS A 1 101 ? -1.612  -12.076 -0.899  1.00 0.00 ? 101 CYS A SG   2  
ATOM 3491  H H    . CYS A 1 101 ? -3.342  -8.399  0.430   1.00 0.00 ? 101 CYS A H    2  
ATOM 3492  H HA   . CYS A 1 101 ? -1.237  -10.078 1.116   1.00 0.00 ? 101 CYS A HA   2  
ATOM 3493  H HB2  . CYS A 1 101 ? -3.366  -10.559 -0.237  1.00 0.00 ? 101 CYS A HB2  2  
ATOM 3494  H HB3  . CYS A 1 101 ? -2.486  -9.949  -1.624  1.00 0.00 ? 101 CYS A HB3  2  
ATOM 3495  N N    . ASP A 1 102 ? -0.535  -7.568  -0.754  1.00 0.00 ? 102 ASP A N    2  
ATOM 3496  C CA   . ASP A 1 102 ? 0.513   -6.833  -1.442  1.00 0.00 ? 102 ASP A CA   2  
ATOM 3497  C C    . ASP A 1 102 ? 1.484   -6.254  -0.412  1.00 0.00 ? 102 ASP A C    2  
ATOM 3498  O O    . ASP A 1 102 ? 1.197   -6.249  0.785   1.00 0.00 ? 102 ASP A O    2  
ATOM 3499  C CB   . ASP A 1 102 ? -0.069  -5.670  -2.248  1.00 0.00 ? 102 ASP A CB   2  
ATOM 3500  C CG   . ASP A 1 102 ? 0.707   -5.310  -3.516  1.00 0.00 ? 102 ASP A CG   2  
ATOM 3501  O OD1  . ASP A 1 102 ? 1.711   -6.006  -3.784  1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3502  O OD2  . ASP A 1 102 ? 0.280   -4.348  -4.190  1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3503  H H    . ASP A 1 102 ? -1.349  -7.033  -0.529  1.00 0.00 ? 102 ASP A H    2  
ATOM 3504  H HA   . ASP A 1 102 ? 0.988   -7.560  -2.101  1.00 0.00 ? 102 ASP A HA   2  
ATOM 3505  H HB2  . ASP A 1 102 ? -1.094  -5.917  -2.526  1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3506  H HB3  . ASP A 1 102 ? -0.116  -4.790  -1.607  1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3507  N N    . PHE A 1 103 ? 2.616   -5.781  -0.913  1.00 0.00 ? 103 PHE A N    2  
ATOM 3508  C CA   . PHE A 1 103 ? 3.632   -5.202  -0.052  1.00 0.00 ? 103 PHE A CA   2  
ATOM 3509  C C    . PHE A 1 103 ? 3.184   -3.842  0.488   1.00 0.00 ? 103 PHE A C    2  
ATOM 3510  O O    . PHE A 1 103 ? 3.042   -2.885  -0.271  1.00 0.00 ? 103 PHE A O    2  
ATOM 3511  C CB   . PHE A 1 103 ? 4.886   -5.009  -0.906  1.00 0.00 ? 103 PHE A CB   2  
ATOM 3512  C CG   . PHE A 1 103 ? 5.944   -4.108  -0.265  1.00 0.00 ? 103 PHE A CG   2  
ATOM 3513  C CD1  . PHE A 1 103 ? 5.912   -3.867  1.073   1.00 0.00 ? 103 PHE A CD1  2  
ATOM 3514  C CD2  . PHE A 1 103 ? 6.916   -3.548  -1.034  1.00 0.00 ? 103 PHE A CD2  2  
ATOM 3515  C CE1  . PHE A 1 103 ? 6.893   -3.030  1.668   1.00 0.00 ? 103 PHE A CE1  2  
ATOM 3516  C CE2  . PHE A 1 103 ? 7.897   -2.711  -0.438  1.00 0.00 ? 103 PHE A CE2  2  
ATOM 3517  C CZ   . PHE A 1 103 ? 7.865   -2.470  0.900   1.00 0.00 ? 103 PHE A CZ   2  
ATOM 3518  H H    . PHE A 1 103 ? 2.842   -5.789  -1.887  1.00 0.00 ? 103 PHE A H    2  
ATOM 3519  H HA   . PHE A 1 103 ? 3.781   -5.889  0.781   1.00 0.00 ? 103 PHE A HA   2  
ATOM 3520  H HB2  . PHE A 1 103 ? 5.330   -5.985  -1.108  1.00 0.00 ? 103 PHE A HB2  2  
ATOM 3521  H HB3  . PHE A 1 103 ? 4.598   -4.585  -1.868  1.00 0.00 ? 103 PHE A HB3  2  
ATOM 3522  H HD1  . PHE A 1 103 ? 5.132   -4.316  1.689   1.00 0.00 ? 103 PHE A HD1  2  
ATOM 3523  H HD2  . PHE A 1 103 ? 6.942   -3.741  -2.106  1.00 0.00 ? 103 PHE A HD2  2  
ATOM 3524  H HE1  . PHE A 1 103 ? 6.867   -2.837  2.740   1.00 0.00 ? 103 PHE A HE1  2  
ATOM 3525  H HE2  . PHE A 1 103 ? 8.676   -2.262  -1.054  1.00 0.00 ? 103 PHE A HE2  2  
ATOM 3526  H HZ   . PHE A 1 103 ? 8.618   -1.828  1.357   1.00 0.00 ? 103 PHE A HZ   2  
ATOM 3527  N N    . ILE A 1 104 ? 2.971   -3.801  1.796   1.00 0.00 ? 104 ILE A N    2  
ATOM 3528  C CA   . ILE A 1 104 ? 2.542   -2.574  2.444   1.00 0.00 ? 104 ILE A CA   2  
ATOM 3529  C C    . ILE A 1 104 ? 2.809   -2.678  3.948   1.00 0.00 ? 104 ILE A C    2  
ATOM 3530  O O    . ILE A 1 104 ? 2.456   -3.674  4.577   1.00 0.00 ? 104 ILE A O    2  
ATOM 3531  C CB   . ILE A 1 104 ? 1.083   -2.267  2.099   1.00 0.00 ? 104 ILE A CB   2  
ATOM 3532  C CG1  . ILE A 1 104 ? 0.225   -3.532  2.170   1.00 0.00 ? 104 ILE A CG1  2  
ATOM 3533  C CG2  . ILE A 1 104 ? 0.975   -1.577  0.738   1.00 0.00 ? 104 ILE A CG2  2  
ATOM 3534  C CD1  . ILE A 1 104 ? -1.253  -3.204  1.957   1.00 0.00 ? 104 ILE A CD1  2  
ATOM 3535  H H    . ILE A 1 104 ? 3.088   -4.584  2.405   1.00 0.00 ? 104 ILE A H    2  
ATOM 3536  H HA   . ILE A 1 104 ? 3.146   -1.762  2.042   1.00 0.00 ? 104 ILE A HA   2  
ATOM 3537  H HB   . ILE A 1 104 ? 0.694   -1.573  2.844   1.00 0.00 ? 104 ILE A HB   2  
ATOM 3538  H HG12 . ILE A 1 104 ? 0.556   -4.244  1.414   1.00 0.00 ? 104 ILE A HG12 2  
ATOM 3539  H HG13 . ILE A 1 104 ? 0.359   -4.013  3.140   1.00 0.00 ? 104 ILE A HG13 2  
ATOM 3540  H HG21 . ILE A 1 104 ? 1.944   -1.159  0.465   1.00 0.00 ? 104 ILE A HG21 2  
ATOM 3541  H HG22 . ILE A 1 104 ? 0.669   -2.304  -0.014  1.00 0.00 ? 104 ILE A HG22 2  
ATOM 3542  H HG23 . ILE A 1 104 ? 0.237   -0.778  0.794   1.00 0.00 ? 104 ILE A HG23 2  
ATOM 3543  H HD11 . ILE A 1 104 ? -1.554  -2.414  2.645   1.00 0.00 ? 104 ILE A HD11 2  
ATOM 3544  H HD12 . ILE A 1 104 ? -1.408  -2.870  0.930   1.00 0.00 ? 104 ILE A HD12 2  
ATOM 3545  H HD13 . ILE A 1 104 ? -1.854  -4.095  2.142   1.00 0.00 ? 104 ILE A HD13 2  
ATOM 3546  N N    . VAL A 1 105 ? 3.431   -1.635  4.479   1.00 0.00 ? 105 VAL A N    2  
ATOM 3547  C CA   . VAL A 1 105 ? 3.749   -1.596  5.896   1.00 0.00 ? 105 VAL A CA   2  
ATOM 3548  C C    . VAL A 1 105 ? 3.791   -0.140  6.366   1.00 0.00 ? 105 VAL A C    2  
ATOM 3549  O O    . VAL A 1 105 ? 3.987   0.769   5.561   1.00 0.00 ? 105 VAL A O    2  
ATOM 3550  C CB   . VAL A 1 105 ? 5.056   -2.346  6.159   1.00 0.00 ? 105 VAL A CB   2  
ATOM 3551  C CG1  . VAL A 1 105 ? 4.785   -3.714  6.789   1.00 0.00 ? 105 VAL A CG1  2  
ATOM 3552  C CG2  . VAL A 1 105 ? 5.877   -2.486  4.876   1.00 0.00 ? 105 VAL A CG2  2  
ATOM 3553  H H    . VAL A 1 105 ? 3.714   -0.829  3.961   1.00 0.00 ? 105 VAL A H    2  
ATOM 3554  H HA   . VAL A 1 105 ? 2.950   -2.114  6.427   1.00 0.00 ? 105 VAL A HA   2  
ATOM 3555  H HB   . VAL A 1 105 ? 5.642   -1.761  6.869   1.00 0.00 ? 105 VAL A HB   2  
ATOM 3556  H HG11 . VAL A 1 105 ? 3.840   -3.686  7.329   1.00 0.00 ? 105 VAL A HG11 2  
ATOM 3557  H HG12 . VAL A 1 105 ? 4.734   -4.471  6.006   1.00 0.00 ? 105 VAL A HG12 2  
ATOM 3558  H HG13 . VAL A 1 105 ? 5.591   -3.963  7.480   1.00 0.00 ? 105 VAL A HG13 2  
ATOM 3559  H HG21 . VAL A 1 105 ? 5.278   -2.987  4.115   1.00 0.00 ? 105 VAL A HG21 2  
ATOM 3560  H HG22 . VAL A 1 105 ? 6.164   -1.497  4.519   1.00 0.00 ? 105 VAL A HG22 2  
ATOM 3561  H HG23 . VAL A 1 105 ? 6.772   -3.073  5.079   1.00 0.00 ? 105 VAL A HG23 2  
ATOM 3562  N N    . PRO A 1 106 ? 3.596   0.039   7.699   1.00 0.00 ? 106 PRO A N    2  
ATOM 3563  C CA   . PRO A 1 106 ? 3.609   1.368   8.286   1.00 0.00 ? 106 PRO A CA   2  
ATOM 3564  C C    . PRO A 1 106 ? 5.037   1.910   8.385   1.00 0.00 ? 106 PRO A C    2  
ATOM 3565  O O    . PRO A 1 106 ? 5.273   2.934   9.023   1.00 0.00 ? 106 PRO A O    2  
ATOM 3566  C CB   . PRO A 1 106 ? 2.940   1.208   9.641   1.00 0.00 ? 106 PRO A CB   2  
ATOM 3567  C CG   . PRO A 1 106 ? 2.995   -0.277  9.959   1.00 0.00 ? 106 PRO A CG   2  
ATOM 3568  C CD   . PRO A 1 106 ? 3.360   -1.015  8.682   1.00 0.00 ? 106 PRO A CD   2  
ATOM 3569  H HA   . PRO A 1 106 ? 3.115   2.011   7.701   1.00 0.00 ? 106 PRO A HA   2  
ATOM 3570  H HB2  . PRO A 1 106 ? 3.456   1.791   10.403  1.00 0.00 ? 106 PRO A HB2  2  
ATOM 3571  H HB3  . PRO A 1 106 ? 1.910   1.563   9.611   1.00 0.00 ? 106 PRO A HB3  2  
ATOM 3572  H HG2  . PRO A 1 106 ? 3.732   -0.473  10.738  1.00 0.00 ? 106 PRO A HG2  2  
ATOM 3573  H HG3  . PRO A 1 106 ? 2.032   -0.622  10.338  1.00 0.00 ? 106 PRO A HG3  2  
ATOM 3574  H HD2  . PRO A 1 106 ? 4.248   -1.633  8.821   1.00 0.00 ? 106 PRO A HD2  2  
ATOM 3575  H HD3  . PRO A 1 106 ? 2.556   -1.679  8.364   1.00 0.00 ? 106 PRO A HD3  2  
ATOM 3576  N N    . TRP A 1 107 ? 5.952   1.198   7.744   1.00 0.00 ? 107 TRP A N    2  
ATOM 3577  C CA   . TRP A 1 107 ? 7.350   1.594   7.753   1.00 0.00 ? 107 TRP A CA   2  
ATOM 3578  C C    . TRP A 1 107 ? 7.910   1.322   9.149   1.00 0.00 ? 107 TRP A C    2  
ATOM 3579  O O    . TRP A 1 107 ? 8.866   0.562   9.302   1.00 0.00 ? 107 TRP A O    2  
ATOM 3580  C CB   . TRP A 1 107 ? 7.509   3.052   7.317   1.00 0.00 ? 107 TRP A CB   2  
ATOM 3581  C CG   . TRP A 1 107 ? 8.956   3.463   7.039   1.00 0.00 ? 107 TRP A CG   2  
ATOM 3582  C CD1  . TRP A 1 107 ? 9.815   2.920   6.167   1.00 0.00 ? 107 TRP A CD1  2  
ATOM 3583  C CD2  . TRP A 1 107 ? 9.683   4.536   7.675   1.00 0.00 ? 107 TRP A CD2  2  
ATOM 3584  N NE1  . TRP A 1 107 ? 11.038  3.560   6.193   1.00 0.00 ? 107 TRP A NE1  2  
ATOM 3585  C CE2  . TRP A 1 107 ? 10.954  4.574   7.141   1.00 0.00 ? 107 TRP A CE2  2  
ATOM 3586  C CE3  . TRP A 1 107 ? 9.279   5.443   8.670   1.00 0.00 ? 107 TRP A CE3  2  
ATOM 3587  C CZ2  . TRP A 1 107 ? 11.925  5.502   7.537   1.00 0.00 ? 107 TRP A CZ2  2  
ATOM 3588  C CZ3  . TRP A 1 107 ? 10.261  6.364   9.056   1.00 0.00 ? 107 TRP A CZ3  2  
ATOM 3589  C CH2  . TRP A 1 107 ? 11.546  6.416   8.527   1.00 0.00 ? 107 TRP A CH2  2  
ATOM 3590  H H    . TRP A 1 107 ? 5.751   0.365   7.227   1.00 0.00 ? 107 TRP A H    2  
ATOM 3591  H HA   . TRP A 1 107 ? 7.873   0.983   7.016   1.00 0.00 ? 107 TRP A HA   2  
ATOM 3592  H HB2  . TRP A 1 107 ? 6.915   3.219   6.419   1.00 0.00 ? 107 TRP A HB2  2  
ATOM 3593  H HB3  . TRP A 1 107 ? 7.101   3.698   8.094   1.00 0.00 ? 107 TRP A HB3  2  
ATOM 3594  H HD1  . TRP A 1 107 ? 9.579   2.077   5.517   1.00 0.00 ? 107 TRP A HD1  2  
ATOM 3595  H HE1  . TRP A 1 107 ? 11.908  3.315   5.585   1.00 0.00 ? 107 TRP A HE1  2  
ATOM 3596  H HE3  . TRP A 1 107 ? 8.281   5.434   9.108   1.00 0.00 ? 107 TRP A HE3  2  
ATOM 3597  H HZ2  . TRP A 1 107 ? 12.923  5.511   7.099   1.00 0.00 ? 107 TRP A HZ2  2  
ATOM 3598  H HZ3  . TRP A 1 107 ? 10.000  7.092   9.825   1.00 0.00 ? 107 TRP A HZ3  2  
ATOM 3599  H HH2  . TRP A 1 107 ? 12.254  7.165   8.881   1.00 0.00 ? 107 TRP A HH2  2  
ATOM 3600  N N    . ASP A 1 108 ? 7.292   1.957   10.135  1.00 0.00 ? 108 ASP A N    2  
ATOM 3601  C CA   . ASP A 1 108 ? 7.717   1.793   11.514  1.00 0.00 ? 108 ASP A CA   2  
ATOM 3602  C C    . ASP A 1 108 ? 7.374   0.378   11.984  1.00 0.00 ? 108 ASP A C    2  
ATOM 3603  O O    . ASP A 1 108 ? 6.740   0.202   13.023  1.00 0.00 ? 108 ASP A O    2  
ATOM 3604  C CB   . ASP A 1 108 ? 6.998   2.784   12.433  1.00 0.00 ? 108 ASP A CB   2  
ATOM 3605  C CG   . ASP A 1 108 ? 7.513   2.820   13.873  1.00 0.00 ? 108 ASP A CG   2  
ATOM 3606  O OD1  . ASP A 1 108 ? 8.702   3.168   14.042  1.00 0.00 ? 108 ASP A OD1  2  
ATOM 3607  O OD2  . ASP A 1 108 ? 6.707   2.500   14.773  1.00 0.00 ? 108 ASP A OD2  2  
ATOM 3608  H H    . ASP A 1 108 ? 6.516   2.573   10.001  1.00 0.00 ? 108 ASP A H    2  
ATOM 3609  H HA   . ASP A 1 108 ? 8.790   1.983   11.508  1.00 0.00 ? 108 ASP A HA   2  
ATOM 3610  H HB2  . ASP A 1 108 ? 7.087   3.783   12.006  1.00 0.00 ? 108 ASP A HB2  2  
ATOM 3611  H HB3  . ASP A 1 108 ? 5.937   2.537   12.448  1.00 0.00 ? 108 ASP A HB3  2  
ATOM 3612  N N    . THR A 1 109 ? 7.809   -0.594  11.196  1.00 0.00 ? 109 THR A N    2  
ATOM 3613  C CA   . THR A 1 109 ? 7.557   -1.988  11.519  1.00 0.00 ? 109 THR A CA   2  
ATOM 3614  C C    . THR A 1 109 ? 8.550   -2.893  10.789  1.00 0.00 ? 109 THR A C    2  
ATOM 3615  O O    . THR A 1 109 ? 9.246   -3.692  11.415  1.00 0.00 ? 109 THR A O    2  
ATOM 3616  C CB   . THR A 1 109 ? 6.096   -2.294  11.183  1.00 0.00 ? 109 THR A CB   2  
ATOM 3617  O OG1  . THR A 1 109 ? 5.884   -1.644  9.933   1.00 0.00 ? 109 THR A OG1  2  
ATOM 3618  C CG2  . THR A 1 109 ? 5.118   -1.600  12.134  1.00 0.00 ? 109 THR A CG2  2  
ATOM 3619  H H    . THR A 1 109 ? 8.325   -0.442  10.354  1.00 0.00 ? 109 THR A H    2  
ATOM 3620  H HA   . THR A 1 109 ? 7.721   -2.129  12.587  1.00 0.00 ? 109 THR A HA   2  
ATOM 3621  H HB   . THR A 1 109 ? 5.919   -3.369  11.159  1.00 0.00 ? 109 THR A HB   2  
ATOM 3622  H HG1  . THR A 1 109 ? 6.160   -0.685  9.995   1.00 0.00 ? 109 THR A HG1  2  
ATOM 3623  H HG21 . THR A 1 109 ? 5.418   -1.790  13.165  1.00 0.00 ? 109 THR A HG21 2  
ATOM 3624  H HG22 . THR A 1 109 ? 5.128   -0.527  11.945  1.00 0.00 ? 109 THR A HG22 2  
ATOM 3625  H HG23 . THR A 1 109 ? 4.114   -1.989  11.969  1.00 0.00 ? 109 THR A HG23 2  
ATOM 3626  N N    . LEU A 1 110 ? 8.587   -2.739  9.473   1.00 0.00 ? 110 LEU A N    2  
ATOM 3627  C CA   . LEU A 1 110 ? 9.484   -3.531  8.651   1.00 0.00 ? 110 LEU A CA   2  
ATOM 3628  C C    . LEU A 1 110 ? 10.136  -4.614  9.512   1.00 0.00 ? 110 LEU A C    2  
ATOM 3629  O O    . LEU A 1 110 ? 9.483   -5.582  9.899   1.00 0.00 ? 110 LEU A O    2  
ATOM 3630  C CB   . LEU A 1 110 ? 10.488  -2.630  7.931   1.00 0.00 ? 110 LEU A CB   2  
ATOM 3631  C CG   . LEU A 1 110 ? 9.893   -1.525  7.057   1.00 0.00 ? 110 LEU A CG   2  
ATOM 3632  C CD1  . LEU A 1 110 ? 10.973  -0.539  6.608   1.00 0.00 ? 110 LEU A CD1  2  
ATOM 3633  C CD2  . LEU A 1 110 ? 9.129   -2.117  5.870   1.00 0.00 ? 110 LEU A CD2  2  
ATOM 3634  H H    . LEU A 1 110 ? 8.018   -2.087  8.971   1.00 0.00 ? 110 LEU A H    2  
ATOM 3635  H HA   . LEU A 1 110 ? 8.880   -4.018  7.883   1.00 0.00 ? 110 LEU A HA   2  
ATOM 3636  H HB2  . LEU A 1 110 ? 11.132  -2.167  8.679   1.00 0.00 ? 110 LEU A HB2  2  
ATOM 3637  H HB3  . LEU A 1 110 ? 11.126  -3.256  7.306   1.00 0.00 ? 110 LEU A HB3  2  
ATOM 3638  H HG   . LEU A 1 110 ? 9.174   -0.966  7.655   1.00 0.00 ? 110 LEU A HG   2  
ATOM 3639  H HD11 . LEU A 1 110 ? 11.849  -1.089  6.266   1.00 0.00 ? 110 LEU A HD11 2  
ATOM 3640  H HD12 . LEU A 1 110 ? 10.589  0.075   5.793   1.00 0.00 ? 110 LEU A HD12 2  
ATOM 3641  H HD13 . LEU A 1 110 ? 11.250  0.102   7.445   1.00 0.00 ? 110 LEU A HD13 2  
ATOM 3642  H HD21 . LEU A 1 110 ? 9.086   -3.201  5.970   1.00 0.00 ? 110 LEU A HD21 2  
ATOM 3643  H HD22 . LEU A 1 110 ? 8.117   -1.714  5.852   1.00 0.00 ? 110 LEU A HD22 2  
ATOM 3644  H HD23 . LEU A 1 110 ? 9.640   -1.857  4.942   1.00 0.00 ? 110 LEU A HD23 2  
ATOM 3645  N N    . SER A 1 111 ? 11.416  -4.415  9.789   1.00 0.00 ? 111 SER A N    2  
ATOM 3646  C CA   . SER A 1 111 ? 12.164  -5.362  10.597  1.00 0.00 ? 111 SER A CA   2  
ATOM 3647  C C    . SER A 1 111 ? 13.625  -5.396  10.147  1.00 0.00 ? 111 SER A C    2  
ATOM 3648  O O    . SER A 1 111 ? 14.533  -5.464  10.973  1.00 0.00 ? 111 SER A O    2  
ATOM 3649  C CB   . SER A 1 111 ? 11.550  -6.761  10.517  1.00 0.00 ? 111 SER A CB   2  
ATOM 3650  O OG   . SER A 1 111 ? 10.552  -6.965  11.512  1.00 0.00 ? 111 SER A OG   2  
ATOM 3651  H H    . SER A 1 111 ? 11.940  -3.624  9.470   1.00 0.00 ? 111 SER A H    2  
ATOM 3652  H HA   . SER A 1 111 ? 12.088  -4.991  11.620  1.00 0.00 ? 111 SER A HA   2  
ATOM 3653  H HB2  . SER A 1 111 ? 11.113  -6.908  9.529   1.00 0.00 ? 111 SER A HB2  2  
ATOM 3654  H HB3  . SER A 1 111 ? 12.335  -7.508  10.631  1.00 0.00 ? 111 SER A HB3  2  
ATOM 3655  H HG   . SER A 1 111 ? 9.846   -6.261  11.437  1.00 0.00 ? 111 SER A HG   2  
ATOM 3656  N N    . THR A 1 112 ? 13.808  -5.348  8.835   1.00 0.00 ? 112 THR A N    2  
ATOM 3657  C CA   . THR A 1 112 ? 15.143  -5.373  8.263   1.00 0.00 ? 112 THR A CA   2  
ATOM 3658  C C    . THR A 1 112 ? 15.090  -5.816  6.800   1.00 0.00 ? 112 THR A C    2  
ATOM 3659  O O    . THR A 1 112 ? 15.372  -5.029  5.898   1.00 0.00 ? 112 THR A O    2  
ATOM 3660  C CB   . THR A 1 112 ? 16.016  -6.275  9.139   1.00 0.00 ? 112 THR A CB   2  
ATOM 3661  O OG1  . THR A 1 112 ? 16.777  -5.363  9.927   1.00 0.00 ? 112 THR A OG1  2  
ATOM 3662  C CG2  . THR A 1 112 ? 17.068  -7.037  8.331   1.00 0.00 ? 112 THR A CG2  2  
ATOM 3663  H H    . THR A 1 112 ? 13.064  -5.293  8.169   1.00 0.00 ? 112 THR A H    2  
ATOM 3664  H HA   . THR A 1 112 ? 15.542  -4.358  8.276   1.00 0.00 ? 112 THR A HA   2  
ATOM 3665  H HB   . THR A 1 112 ? 15.403  -6.960  9.724   1.00 0.00 ? 112 THR A HB   2  
ATOM 3666  H HG1  . THR A 1 112 ? 16.188  -4.920  10.602  1.00 0.00 ? 112 THR A HG1  2  
ATOM 3667  H HG21 . THR A 1 112 ? 17.429  -6.406  7.519   1.00 0.00 ? 112 THR A HG21 2  
ATOM 3668  H HG22 . THR A 1 112 ? 17.901  -7.305  8.980   1.00 0.00 ? 112 THR A HG22 2  
ATOM 3669  H HG23 . THR A 1 112 ? 16.623  -7.942  7.917   1.00 0.00 ? 112 THR A HG23 2  
ATOM 3670  N N    . THR A 1 113 ? 14.725  -7.076  6.609   1.00 0.00 ? 113 THR A N    2  
ATOM 3671  C CA   . THR A 1 113 ? 14.630  -7.633  5.271   1.00 0.00 ? 113 THR A CA   2  
ATOM 3672  C C    . THR A 1 113 ? 13.853  -6.687  4.354   1.00 0.00 ? 113 THR A C    2  
ATOM 3673  O O    . THR A 1 113 ? 14.049  -6.695  3.139   1.00 0.00 ? 113 THR A O    2  
ATOM 3674  C CB   . THR A 1 113 ? 14.003  -9.025  5.381   1.00 0.00 ? 113 THR A CB   2  
ATOM 3675  O OG1  . THR A 1 113 ? 15.053  -9.840  5.894   1.00 0.00 ? 113 THR A OG1  2  
ATOM 3676  C CG2  . THR A 1 113 ? 13.689  -9.636  4.014   1.00 0.00 ? 113 THR A CG2  2  
ATOM 3677  H H    . THR A 1 113 ? 14.497  -7.710  7.349   1.00 0.00 ? 113 THR A H    2  
ATOM 3678  H HA   . THR A 1 113 ? 15.637  -7.719  4.863   1.00 0.00 ? 113 THR A HA   2  
ATOM 3679  H HB   . THR A 1 113 ? 13.113  -9.001  6.011   1.00 0.00 ? 113 THR A HB   2  
ATOM 3680  H HG1  . THR A 1 113 ? 15.824  -9.844  5.257   1.00 0.00 ? 113 THR A HG1  2  
ATOM 3681  H HG21 . THR A 1 113 ? 14.514  -9.436  3.330   1.00 0.00 ? 113 THR A HG21 2  
ATOM 3682  H HG22 . THR A 1 113 ? 13.558  -10.713 4.119   1.00 0.00 ? 113 THR A HG22 2  
ATOM 3683  H HG23 . THR A 1 113 ? 12.775  -9.194  3.620   1.00 0.00 ? 113 THR A HG23 2  
ATOM 3684  N N    . GLN A 1 114 ? 12.988  -5.895  4.969   1.00 0.00 ? 114 GLN A N    2  
ATOM 3685  C CA   . GLN A 1 114 ? 12.181  -4.945  4.222   1.00 0.00 ? 114 GLN A CA   2  
ATOM 3686  C C    . GLN A 1 114 ? 12.974  -3.663  3.963   1.00 0.00 ? 114 GLN A C    2  
ATOM 3687  O O    . GLN A 1 114 ? 12.793  -3.014  2.933   1.00 0.00 ? 114 GLN A O    2  
ATOM 3688  C CB   . GLN A 1 114 ? 10.873  -4.642  4.955   1.00 0.00 ? 114 GLN A CB   2  
ATOM 3689  C CG   . GLN A 1 114 ? 9.796   -5.671  4.606   1.00 0.00 ? 114 GLN A CG   2  
ATOM 3690  C CD   . GLN A 1 114 ? 9.706   -6.756  5.680   1.00 0.00 ? 114 GLN A CD   2  
ATOM 3691  O OE1  . GLN A 1 114 ? 8.682   -6.954  6.314   1.00 0.00 ? 114 GLN A OE1  2  
ATOM 3692  N NE2  . GLN A 1 114 ? 10.830  -7.446  5.849   1.00 0.00 ? 114 GLN A NE2  2  
ATOM 3693  H H    . GLN A 1 114 ? 12.835  -5.894  5.957   1.00 0.00 ? 114 GLN A H    2  
ATOM 3694  H HA   . GLN A 1 114 ? 11.954  -5.437  3.276   1.00 0.00 ? 114 GLN A HA   2  
ATOM 3695  H HB2  . GLN A 1 114 ? 11.046  -4.643  6.031   1.00 0.00 ? 114 GLN A HB2  2  
ATOM 3696  H HB3  . GLN A 1 114 ? 10.526  -3.643  4.690   1.00 0.00 ? 114 GLN A HB3  2  
ATOM 3697  H HG2  . GLN A 1 114 ? 8.832   -5.174  4.503   1.00 0.00 ? 114 GLN A HG2  2  
ATOM 3698  H HG3  . GLN A 1 114 ? 10.023  -6.126  3.642   1.00 0.00 ? 114 GLN A HG3  2  
ATOM 3699  H HE21 . GLN A 1 114 ? 11.635  -7.233  5.295   1.00 0.00 ? 114 GLN A HE21 2  
ATOM 3700  H HE22 . GLN A 1 114 ? 10.871  -8.177  6.530   1.00 0.00 ? 114 GLN A HE22 2  
ATOM 3701  N N    . LYS A 1 115 ? 13.836  -3.335  4.914   1.00 0.00 ? 115 LYS A N    2  
ATOM 3702  C CA   . LYS A 1 115 ? 14.657  -2.142  4.801   1.00 0.00 ? 115 LYS A CA   2  
ATOM 3703  C C    . LYS A 1 115 ? 15.743  -2.373  3.747   1.00 0.00 ? 115 LYS A C    2  
ATOM 3704  O O    . LYS A 1 115 ? 16.035  -1.485  2.948   1.00 0.00 ? 115 LYS A O    2  
ATOM 3705  C CB   . LYS A 1 115 ? 15.207  -1.739  6.172   1.00 0.00 ? 115 LYS A CB   2  
ATOM 3706  C CG   . LYS A 1 115 ? 14.541  -0.457  6.674   1.00 0.00 ? 115 LYS A CG   2  
ATOM 3707  C CD   . LYS A 1 115 ? 14.377  -0.484  8.195   1.00 0.00 ? 115 LYS A CD   2  
ATOM 3708  C CE   . LYS A 1 115 ? 13.841  -1.836  8.664   1.00 0.00 ? 115 LYS A CE   2  
ATOM 3709  N NZ   . LYS A 1 115 ? 13.236  -1.716  10.010  1.00 0.00 ? 115 LYS A NZ   2  
ATOM 3710  H H    . LYS A 1 115 ? 13.977  -3.868  5.749   1.00 0.00 ? 115 LYS A H    2  
ATOM 3711  H HA   . LYS A 1 115 ? 14.013  -1.332  4.462   1.00 0.00 ? 115 LYS A HA   2  
ATOM 3712  H HB2  . LYS A 1 115 ? 15.039  -2.544  6.886   1.00 0.00 ? 115 LYS A HB2  2  
ATOM 3713  H HB3  . LYS A 1 115 ? 16.285  -1.591  6.106   1.00 0.00 ? 115 LYS A HB3  2  
ATOM 3714  H HG2  . LYS A 1 115 ? 15.141  0.407   6.384   1.00 0.00 ? 115 LYS A HG2  2  
ATOM 3715  H HG3  . LYS A 1 115 ? 13.567  -0.340  6.201   1.00 0.00 ? 115 LYS A HG3  2  
ATOM 3716  H HD2  . LYS A 1 115 ? 15.336  -0.283  8.671   1.00 0.00 ? 115 LYS A HD2  2  
ATOM 3717  H HD3  . LYS A 1 115 ? 13.696  0.310   8.505   1.00 0.00 ? 115 LYS A HD3  2  
ATOM 3718  H HE2  . LYS A 1 115 ? 13.097  -2.206  7.956   1.00 0.00 ? 115 LYS A HE2  2  
ATOM 3719  H HE3  . LYS A 1 115 ? 14.649  -2.568  8.687   1.00 0.00 ? 115 LYS A HE3  2  
ATOM 3720  H HZ1  . LYS A 1 115 ? 13.797  -1.112  10.574  1.00 0.00 ? 115 LYS A HZ1  2  
ATOM 3721  H HZ2  . LYS A 1 115 ? 12.314  -1.336  9.929   1.00 0.00 ? 115 LYS A HZ2  2  
ATOM 3722  H HZ3  . LYS A 1 115 ? 13.187  -2.620  10.435  1.00 0.00 ? 115 LYS A HZ3  2  
ATOM 3723  N N    . LYS A 1 116 ? 16.309  -3.570  3.780   1.00 0.00 ? 116 LYS A N    2  
ATOM 3724  C CA   . LYS A 1 116 ? 17.355  -3.928  2.836   1.00 0.00 ? 116 LYS A CA   2  
ATOM 3725  C C    . LYS A 1 116 ? 16.780  -3.924  1.419   1.00 0.00 ? 116 LYS A C    2  
ATOM 3726  O O    . LYS A 1 116 ? 17.526  -3.860  0.443   1.00 0.00 ? 116 LYS A O    2  
ATOM 3727  C CB   . LYS A 1 116 ? 18.002  -5.257  3.234   1.00 0.00 ? 116 LYS A CB   2  
ATOM 3728  C CG   . LYS A 1 116 ? 17.112  -6.439  2.845   1.00 0.00 ? 116 LYS A CG   2  
ATOM 3729  C CD   . LYS A 1 116 ? 17.660  -7.155  1.609   1.00 0.00 ? 116 LYS A CD   2  
ATOM 3730  C CE   . LYS A 1 116 ? 16.904  -6.729  0.349   1.00 0.00 ? 116 LYS A CE   2  
ATOM 3731  N NZ   . LYS A 1 116 ? 17.819  -6.055  -0.599  1.00 0.00 ? 116 LYS A NZ   2  
ATOM 3732  H H    . LYS A 1 116 ? 16.065  -4.287  4.433   1.00 0.00 ? 116 LYS A H    2  
ATOM 3733  H HA   . LYS A 1 116 ? 18.127  -3.162  2.898   1.00 0.00 ? 116 LYS A HA   2  
ATOM 3734  H HB2  . LYS A 1 116 ? 18.973  -5.353  2.747   1.00 0.00 ? 116 LYS A HB2  2  
ATOM 3735  H HB3  . LYS A 1 116 ? 18.182  -5.270  4.309   1.00 0.00 ? 116 LYS A HB3  2  
ATOM 3736  H HG2  . LYS A 1 116 ? 17.047  -7.139  3.678   1.00 0.00 ? 116 LYS A HG2  2  
ATOM 3737  H HG3  . LYS A 1 116 ? 16.099  -6.086  2.647   1.00 0.00 ? 116 LYS A HG3  2  
ATOM 3738  H HD2  . LYS A 1 116 ? 18.720  -6.932  1.496   1.00 0.00 ? 116 LYS A HD2  2  
ATOM 3739  H HD3  . LYS A 1 116 ? 17.574  -8.234  1.742   1.00 0.00 ? 116 LYS A HD3  2  
ATOM 3740  H HE2  . LYS A 1 116 ? 16.457  -7.602  -0.127  1.00 0.00 ? 116 LYS A HE2  2  
ATOM 3741  H HE3  . LYS A 1 116 ? 16.089  -6.058  0.616   1.00 0.00 ? 116 LYS A HE3  2  
ATOM 3742  H HZ1  . LYS A 1 116 ? 18.704  -6.520  -0.598  1.00 0.00 ? 116 LYS A HZ1  2  
ATOM 3743  H HZ2  . LYS A 1 116 ? 17.427  -6.084  -1.520  1.00 0.00 ? 116 LYS A HZ2  2  
ATOM 3744  H HZ3  . LYS A 1 116 ? 17.944  -5.102  -0.322  1.00 0.00 ? 116 LYS A HZ3  2  
ATOM 3745  N N    . SER A 1 117 ? 15.459  -3.993  1.349   1.00 0.00 ? 117 SER A N    2  
ATOM 3746  C CA   . SER A 1 117 ? 14.776  -3.999  0.066   1.00 0.00 ? 117 SER A CA   2  
ATOM 3747  C C    . SER A 1 117 ? 14.385  -2.572  -0.323  1.00 0.00 ? 117 SER A C    2  
ATOM 3748  O O    . SER A 1 117 ? 14.004  -2.319  -1.466  1.00 0.00 ? 117 SER A O    2  
ATOM 3749  C CB   . SER A 1 117 ? 13.538  -4.896  0.105   1.00 0.00 ? 117 SER A CB   2  
ATOM 3750  O OG   . SER A 1 117 ? 13.496  -5.795  -0.999  1.00 0.00 ? 117 SER A OG   2  
ATOM 3751  H H    . SER A 1 117 ? 14.859  -4.045  2.148   1.00 0.00 ? 117 SER A H    2  
ATOM 3752  H HA   . SER A 1 117 ? 15.496  -4.405  -0.642  1.00 0.00 ? 117 SER A HA   2  
ATOM 3753  H HB2  . SER A 1 117 ? 13.531  -5.464  1.036   1.00 0.00 ? 117 SER A HB2  2  
ATOM 3754  H HB3  . SER A 1 117 ? 12.641  -4.278  0.103   1.00 0.00 ? 117 SER A HB3  2  
ATOM 3755  H HG   . SER A 1 117 ? 13.334  -6.728  -0.675  1.00 0.00 ? 117 SER A HG   2  
ATOM 3756  N N    . LEU A 1 118 ? 14.491  -1.676  0.648   1.00 0.00 ? 118 LEU A N    2  
ATOM 3757  C CA   . LEU A 1 118 ? 14.153  -0.281  0.420   1.00 0.00 ? 118 LEU A CA   2  
ATOM 3758  C C    . LEU A 1 118 ? 15.271  0.384   -0.385  1.00 0.00 ? 118 LEU A C    2  
ATOM 3759  O O    . LEU A 1 118 ? 15.027  1.344   -1.114  1.00 0.00 ? 118 LEU A O    2  
ATOM 3760  C CB   . LEU A 1 118 ? 13.849  0.419   1.746   1.00 0.00 ? 118 LEU A CB   2  
ATOM 3761  C CG   . LEU A 1 118 ? 12.505  0.076   2.392   1.00 0.00 ? 118 LEU A CG   2  
ATOM 3762  C CD1  . LEU A 1 118 ? 12.522  0.388   3.891   1.00 0.00 ? 118 LEU A CD1  2  
ATOM 3763  C CD2  . LEU A 1 118 ? 11.355  0.783   1.674   1.00 0.00 ? 118 LEU A CD2  2  
ATOM 3764  H H    . LEU A 1 118 ? 14.802  -1.891  1.574   1.00 0.00 ? 118 LEU A H    2  
ATOM 3765  H HA   . LEU A 1 118 ? 13.239  -0.259  -0.173  1.00 0.00 ? 118 LEU A HA   2  
ATOM 3766  H HB2  . LEU A 1 118 ? 14.643  0.177   2.453   1.00 0.00 ? 118 LEU A HB2  2  
ATOM 3767  H HB3  . LEU A 1 118 ? 13.886  1.496   1.582   1.00 0.00 ? 118 LEU A HB3  2  
ATOM 3768  H HG   . LEU A 1 118 ? 12.340  -0.996  2.289   1.00 0.00 ? 118 LEU A HG   2  
ATOM 3769  H HD11 . LEU A 1 118 ? 13.546  0.587   4.208   1.00 0.00 ? 118 LEU A HD11 2  
ATOM 3770  H HD12 . LEU A 1 118 ? 11.905  1.264   4.086   1.00 0.00 ? 118 LEU A HD12 2  
ATOM 3771  H HD13 . LEU A 1 118 ? 12.129  -0.465  4.444   1.00 0.00 ? 118 LEU A HD13 2  
ATOM 3772  H HD21 . LEU A 1 118 ? 11.736  1.660   1.152   1.00 0.00 ? 118 LEU A HD21 2  
ATOM 3773  H HD22 . LEU A 1 118 ? 10.903  0.100   0.954   1.00 0.00 ? 118 LEU A HD22 2  
ATOM 3774  H HD23 . LEU A 1 118 ? 10.605  1.090   2.402   1.00 0.00 ? 118 LEU A HD23 2  
ATOM 3775  N N    . ASN A 1 119 ? 16.472  -0.151  -0.225  1.00 0.00 ? 119 ASN A N    2  
ATOM 3776  C CA   . ASN A 1 119 ? 17.627  0.379   -0.929  1.00 0.00 ? 119 ASN A CA   2  
ATOM 3777  C C    . ASN A 1 119 ? 17.797  -0.363  -2.256  1.00 0.00 ? 119 ASN A C    2  
ATOM 3778  O O    . ASN A 1 119 ? 18.495  0.110   -3.151  1.00 0.00 ? 119 ASN A O    2  
ATOM 3779  C CB   . ASN A 1 119 ? 18.906  0.185   -0.111  1.00 0.00 ? 119 ASN A CB   2  
ATOM 3780  C CG   . ASN A 1 119 ? 19.006  -1.247  0.419   1.00 0.00 ? 119 ASN A CG   2  
ATOM 3781  O OD1  . ASN A 1 119 ? 18.376  -1.620  1.394   1.00 0.00 ? 119 ASN A OD1  2  
ATOM 3782  N ND2  . ASN A 1 119 ? 19.830  -2.025  -0.276  1.00 0.00 ? 119 ASN A ND2  2  
ATOM 3783  H H    . ASN A 1 119 ? 16.661  -0.932  0.370   1.00 0.00 ? 119 ASN A H    2  
ATOM 3784  H HA   . ASN A 1 119 ? 17.416  1.440   -1.068  1.00 0.00 ? 119 ASN A HA   2  
ATOM 3785  H HB2  . ASN A 1 119 ? 19.775  0.409   -0.731  1.00 0.00 ? 119 ASN A HB2  2  
ATOM 3786  H HB3  . ASN A 1 119 ? 18.920  0.887   0.722   1.00 0.00 ? 119 ASN A HB3  2  
ATOM 3787  H HD21 . ASN A 1 119 ? 20.318  -1.656  -1.069  1.00 0.00 ? 119 ASN A HD21 2  
ATOM 3788  H HD22 . ASN A 1 119 ? 19.964  -2.979  -0.008  1.00 0.00 ? 119 ASN A HD22 2  
ATOM 3789  N N    . HIS A 1 120 ? 17.146  -1.514  -2.340  1.00 0.00 ? 120 HIS A N    2  
ATOM 3790  C CA   . HIS A 1 120 ? 17.216  -2.327  -3.543  1.00 0.00 ? 120 HIS A CA   2  
ATOM 3791  C C    . HIS A 1 120 ? 16.142  -1.870  -4.534  1.00 0.00 ? 120 HIS A C    2  
ATOM 3792  O O    . HIS A 1 120 ? 15.485  -2.696  -5.166  1.00 0.00 ? 120 HIS A O    2  
ATOM 3793  C CB   . HIS A 1 120 ? 17.114  -3.814  -3.200  1.00 0.00 ? 120 HIS A CB   2  
ATOM 3794  C CG   . HIS A 1 120 ? 18.409  -4.571  -3.359  1.00 0.00 ? 120 HIS A CG   2  
ATOM 3795  N ND1  . HIS A 1 120 ? 19.647  -3.951  -3.349  1.00 0.00 ? 120 HIS A ND1  2  
ATOM 3796  C CD2  . HIS A 1 120 ? 18.648  -5.903  -3.529  1.00 0.00 ? 120 HIS A CD2  2  
ATOM 3797  C CE1  . HIS A 1 120 ? 20.580  -4.877  -3.509  1.00 0.00 ? 120 HIS A CE1  2  
ATOM 3798  N NE2  . HIS A 1 120 ? 19.960  -6.086  -3.621  1.00 0.00 ? 120 HIS A NE2  2  
ATOM 3799  H H    . HIS A 1 120 ? 16.580  -1.892  -1.607  1.00 0.00 ? 120 HIS A H    2  
ATOM 3800  H HA   . HIS A 1 120 ? 18.199  -2.153  -3.981  1.00 0.00 ? 120 HIS A HA   2  
ATOM 3801  H HB2  . HIS A 1 120 ? 16.768  -3.916  -2.172  1.00 0.00 ? 120 HIS A HB2  2  
ATOM 3802  H HB3  . HIS A 1 120 ? 16.356  -4.271  -3.838  1.00 0.00 ? 120 HIS A HB3  2  
ATOM 3803  H HD1  . HIS A 1 120 ? 19.808  -2.970  -3.241  1.00 0.00 ? 120 HIS A HD1  2  
ATOM 3804  H HD2  . HIS A 1 120 ? 17.891  -6.685  -3.581  1.00 0.00 ? 120 HIS A HD2  2  
ATOM 3805  H HE1  . HIS A 1 120 ? 21.656  -4.703  -3.545  1.00 0.00 ? 120 HIS A HE1  2  
ATOM 3806  N N    . ARG A 1 121 ? 15.997  -0.558  -4.636  1.00 0.00 ? 121 ARG A N    2  
ATOM 3807  C CA   . ARG A 1 121 ? 15.014  0.018   -5.538  1.00 0.00 ? 121 ARG A CA   2  
ATOM 3808  C C    . ARG A 1 121 ? 13.624  -0.546  -5.239  1.00 0.00 ? 121 ARG A C    2  
ATOM 3809  O O    . ARG A 1 121 ? 12.950  -0.089  -4.317  1.00 0.00 ? 121 ARG A O    2  
ATOM 3810  C CB   . ARG A 1 121 ? 15.371  -0.271  -6.998  1.00 0.00 ? 121 ARG A CB   2  
ATOM 3811  C CG   . ARG A 1 121 ? 16.306  0.805   -7.557  1.00 0.00 ? 121 ARG A CG   2  
ATOM 3812  C CD   . ARG A 1 121 ? 17.337  1.232   -6.511  1.00 0.00 ? 121 ARG A CD   2  
ATOM 3813  N NE   . ARG A 1 121 ? 18.504  1.855   -7.176  1.00 0.00 ? 121 ARG A NE   2  
ATOM 3814  C CZ   . ARG A 1 121 ? 18.473  3.050   -7.781  1.00 0.00 ? 121 ARG A CZ   2  
ATOM 3815  N NH1  . ARG A 1 121 ? 17.335  3.758   -7.810  1.00 0.00 ? 121 ARG A NH1  2  
ATOM 3816  N NH2  . ARG A 1 121 ? 19.580  3.537   -8.358  1.00 0.00 ? 121 ARG A NH2  2  
ATOM 3817  H H    . ARG A 1 121 ? 16.535  0.107   -4.118  1.00 0.00 ? 121 ARG A H    2  
ATOM 3818  H HA   . ARG A 1 121 ? 15.052  1.090   -5.346  1.00 0.00 ? 121 ARG A HA   2  
ATOM 3819  H HB2  . ARG A 1 121 ? 15.849  -1.247  -7.073  1.00 0.00 ? 121 ARG A HB2  2  
ATOM 3820  H HB3  . ARG A 1 121 ? 14.462  -0.313  -7.597  1.00 0.00 ? 121 ARG A HB3  2  
ATOM 3821  H HG2  . ARG A 1 121 ? 16.816  0.424   -8.442  1.00 0.00 ? 121 ARG A HG2  2  
ATOM 3822  H HG3  . ARG A 1 121 ? 15.722  1.669   -7.873  1.00 0.00 ? 121 ARG A HG3  2  
ATOM 3823  H HD2  . ARG A 1 121 ? 16.887  1.936   -5.811  1.00 0.00 ? 121 ARG A HD2  2  
ATOM 3824  H HD3  . ARG A 1 121 ? 17.658  0.367   -5.930  1.00 0.00 ? 121 ARG A HD3  2  
ATOM 3825  H HE   . ARG A 1 121 ? 19.368  1.354   -7.172  1.00 0.00 ? 121 ARG A HE   2  
ATOM 3826  H HH11 . ARG A 1 121 ? 16.508  3.394   -7.380  1.00 0.00 ? 121 ARG A HH11 2  
ATOM 3827  H HH12 . ARG A 1 121 ? 17.313  4.649   -8.263  1.00 0.00 ? 121 ARG A HH12 2  
ATOM 3828  H HH21 . ARG A 1 121 ? 20.429  3.010   -8.337  1.00 0.00 ? 121 ARG A HH21 2  
ATOM 3829  H HH22 . ARG A 1 121 ? 19.557  4.429   -8.811  1.00 0.00 ? 121 ARG A HH22 2  
ATOM 3830  N N    . TYR A 1 122 ? 13.236  -1.531  -6.035  1.00 0.00 ? 122 TYR A N    2  
ATOM 3831  C CA   . TYR A 1 122 ? 11.938  -2.163  -5.868  1.00 0.00 ? 122 TYR A CA   2  
ATOM 3832  C C    . TYR A 1 122 ? 11.988  -3.635  -6.284  1.00 0.00 ? 122 TYR A C    2  
ATOM 3833  O O    . TYR A 1 122 ? 10.960  -4.313  -6.302  1.00 0.00 ? 122 TYR A O    2  
ATOM 3834  C CB   . TYR A 1 122 ? 10.982  -1.414  -6.798  1.00 0.00 ? 122 TYR A CB   2  
ATOM 3835  C CG   . TYR A 1 122 ? 11.170  -1.744  -8.280  1.00 0.00 ? 122 TYR A CG   2  
ATOM 3836  C CD1  . TYR A 1 122 ? 12.073  -1.027  -9.037  1.00 0.00 ? 122 TYR A CD1  2  
ATOM 3837  C CD2  . TYR A 1 122 ? 10.435  -2.758  -8.860  1.00 0.00 ? 122 TYR A CD2  2  
ATOM 3838  C CE1  . TYR A 1 122 ? 12.251  -1.337  -10.432 1.00 0.00 ? 122 TYR A CE1  2  
ATOM 3839  C CE2  . TYR A 1 122 ? 10.612  -3.068  -10.255 1.00 0.00 ? 122 TYR A CE2  2  
ATOM 3840  C CZ   . TYR A 1 122 ? 11.511  -2.342  -10.973 1.00 0.00 ? 122 TYR A CZ   2  
ATOM 3841  O OH   . TYR A 1 122 ? 11.678  -2.635  -12.290 1.00 0.00 ? 122 TYR A OH   2  
ATOM 3842  H H    . TYR A 1 122 ? 13.791  -1.898  -6.783  1.00 0.00 ? 122 TYR A H    2  
ATOM 3843  H HA   . TYR A 1 122 ? 11.668  -2.100  -4.814  1.00 0.00 ? 122 TYR A HA   2  
ATOM 3844  H HB2  . TYR A 1 122 ? 9.956   -1.648  -6.512  1.00 0.00 ? 122 TYR A HB2  2  
ATOM 3845  H HB3  . TYR A 1 122 ? 11.117  -0.343  -6.655  1.00 0.00 ? 122 TYR A HB3  2  
ATOM 3846  H HD1  . TYR A 1 122 ? 12.655  -0.226  -8.579  1.00 0.00 ? 122 TYR A HD1  2  
ATOM 3847  H HD2  . TYR A 1 122 ? 9.721   -3.324  -8.262  1.00 0.00 ? 122 TYR A HD2  2  
ATOM 3848  H HE1  . TYR A 1 122 ? 12.961  -0.778  -11.042 1.00 0.00 ? 122 TYR A HE1  2  
ATOM 3849  H HE2  . TYR A 1 122 ? 10.039  -3.867  -10.726 1.00 0.00 ? 122 TYR A HE2  2  
ATOM 3850  H HH   . TYR A 1 122 ? 12.374  -2.037  -12.688 1.00 0.00 ? 122 TYR A HH   2  
ATOM 3851  N N    . GLN A 1 123 ? 13.191  -4.087  -6.606  1.00 0.00 ? 123 GLN A N    2  
ATOM 3852  C CA   . GLN A 1 123 ? 13.386  -5.466  -7.020  1.00 0.00 ? 123 GLN A CA   2  
ATOM 3853  C C    . GLN A 1 123 ? 14.812  -5.667  -7.538  1.00 0.00 ? 123 GLN A C    2  
ATOM 3854  O O    . GLN A 1 123 ? 15.015  -6.286  -8.582  1.00 0.00 ? 123 GLN A O    2  
ATOM 3855  C CB   . GLN A 1 123 ? 12.356  -5.873  -8.075  1.00 0.00 ? 123 GLN A CB   2  
ATOM 3856  C CG   . GLN A 1 123 ? 12.387  -7.383  -8.317  1.00 0.00 ? 123 GLN A CG   2  
ATOM 3857  C CD   . GLN A 1 123 ? 12.587  -7.697  -9.801  1.00 0.00 ? 123 GLN A CD   2  
ATOM 3858  O OE1  . GLN A 1 123 ? 13.694  -7.875  -10.282 1.00 0.00 ? 123 GLN A OE1  2  
ATOM 3859  N NE2  . GLN A 1 123 ? 11.456  -7.753  -10.499 1.00 0.00 ? 123 GLN A NE2  2  
ATOM 3860  H H    . GLN A 1 123 ? 14.020  -3.528  -6.588  1.00 0.00 ? 123 GLN A H    2  
ATOM 3861  H HA   . GLN A 1 123 ? 13.232  -6.062  -6.121  1.00 0.00 ? 123 GLN A HA   2  
ATOM 3862  H HB2  . GLN A 1 123 ? 11.360  -5.573  -7.751  1.00 0.00 ? 123 GLN A HB2  2  
ATOM 3863  H HB3  . GLN A 1 123 ? 12.560  -5.347  -9.008  1.00 0.00 ? 123 GLN A HB3  2  
ATOM 3864  H HG2  . GLN A 1 123 ? 13.193  -7.832  -7.735  1.00 0.00 ? 123 GLN A HG2  2  
ATOM 3865  H HG3  . GLN A 1 123 ? 11.456  -7.830  -7.969  1.00 0.00 ? 123 GLN A HG3  2  
ATOM 3866  H HE21 . GLN A 1 123 ? 10.579  -7.595  -10.043 1.00 0.00 ? 123 GLN A HE21 2  
ATOM 3867  H HE22 . GLN A 1 123 ? 11.482  -7.952  -11.479 1.00 0.00 ? 123 GLN A HE22 2  
ATOM 3868  N N    . MET A 1 124 ? 15.762  -5.132  -6.785  1.00 0.00 ? 124 MET A N    2  
ATOM 3869  C CA   . MET A 1 124 ? 17.163  -5.246  -7.155  1.00 0.00 ? 124 MET A CA   2  
ATOM 3870  C C    . MET A 1 124 ? 17.653  -6.687  -7.008  1.00 0.00 ? 124 MET A C    2  
ATOM 3871  O O    . MET A 1 124 ? 18.637  -6.944  -6.316  1.00 0.00 ? 124 MET A O    2  
ATOM 3872  C CB   . MET A 1 124 ? 18.002  -4.327  -6.265  1.00 0.00 ? 124 MET A CB   2  
ATOM 3873  C CG   . MET A 1 124 ? 18.735  -3.275  -7.100  1.00 0.00 ? 124 MET A CG   2  
ATOM 3874  S SD   . MET A 1 124 ? 20.459  -3.709  -7.253  1.00 0.00 ? 124 MET A SD   2  
ATOM 3875  C CE   . MET A 1 124 ? 20.931  -2.635  -8.599  1.00 0.00 ? 124 MET A CE   2  
ATOM 3876  H H    . MET A 1 124 ? 15.588  -4.631  -5.938  1.00 0.00 ? 124 MET A H    2  
ATOM 3877  H HA   . MET A 1 124 ? 17.214  -4.941  -8.200  1.00 0.00 ? 124 MET A HA   2  
ATOM 3878  H HB2  . MET A 1 124 ? 17.359  -3.834  -5.536  1.00 0.00 ? 124 MET A HB2  2  
ATOM 3879  H HB3  . MET A 1 124 ? 18.726  -4.920  -5.704  1.00 0.00 ? 124 MET A HB3  2  
ATOM 3880  H HG2  . MET A 1 124 ? 18.281  -3.201  -8.088  1.00 0.00 ? 124 MET A HG2  2  
ATOM 3881  H HG3  . MET A 1 124 ? 18.637  -2.295  -6.631  1.00 0.00 ? 124 MET A HG3  2  
ATOM 3882  H HE1  . MET A 1 124 ? 20.733  -1.599  -8.323  1.00 0.00 ? 124 MET A HE1  2  
ATOM 3883  H HE2  . MET A 1 124 ? 21.993  -2.759  -8.807  1.00 0.00 ? 124 MET A HE2  2  
ATOM 3884  H HE3  . MET A 1 124 ? 20.354  -2.890  -9.487  1.00 0.00 ? 124 MET A HE3  2  
ATOM 3885  N N    . GLY A 1 125 ? 16.946  -7.590  -7.671  1.00 0.00 ? 125 GLY A N    2  
ATOM 3886  C CA   . GLY A 1 125 ? 17.298  -8.999  -7.624  1.00 0.00 ? 125 GLY A CA   2  
ATOM 3887  C C    . GLY A 1 125 ? 17.220  -9.535  -6.193  1.00 0.00 ? 125 GLY A C    2  
ATOM 3888  O O    . GLY A 1 125 ? 17.800  -10.575 -5.884  1.00 0.00 ? 125 GLY A O    2  
ATOM 3889  H H    . GLY A 1 125 ? 16.148  -7.373  -8.233  1.00 0.00 ? 125 GLY A H    2  
ATOM 3890  H HA2  . GLY A 1 125 ? 16.626  -9.567  -8.266  1.00 0.00 ? 125 GLY A HA2  2  
ATOM 3891  H HA3  . GLY A 1 125 ? 18.306  -9.139  -8.014  1.00 0.00 ? 125 GLY A HA3  2  
ATOM 3892  N N    . CYS A 1 126 ? 16.498  -8.802  -5.359  1.00 0.00 ? 126 CYS A N    2  
ATOM 3893  C CA   . CYS A 1 126 ? 16.336  -9.191  -3.968  1.00 0.00 ? 126 CYS A CA   2  
ATOM 3894  C C    . CYS A 1 126 ? 15.730  -10.595 -3.929  1.00 0.00 ? 126 CYS A C    2  
ATOM 3895  O O    . CYS A 1 126 ? 15.520  -11.213 -4.971  1.00 0.00 ? 126 CYS A O    2  
ATOM 3896  C CB   . CYS A 1 126 ? 15.488  -8.180  -3.193  1.00 0.00 ? 126 CYS A CB   2  
ATOM 3897  S SG   . CYS A 1 126 ? 13.691  -8.524  -3.199  1.00 0.00 ? 126 CYS A SG   2  
ATOM 3898  H H    . CYS A 1 126 ? 16.030  -7.957  -5.619  1.00 0.00 ? 126 CYS A H    2  
ATOM 3899  H HA   . CYS A 1 126 ? 17.333  -9.186  -3.524  1.00 0.00 ? 126 CYS A HA   2  
ATOM 3900  H HB2  . CYS A 1 126 ? 15.835  -8.152  -2.160  1.00 0.00 ? 126 CYS A HB2  2  
ATOM 3901  H HB3  . CYS A 1 126 ? 15.656  -7.188  -3.613  1.00 0.00 ? 126 CYS A HB3  2  
ATOM 3902  N N    . GLU A 1 127 ? 15.466  -11.057 -2.716  1.00 0.00 ? 127 GLU A N    2  
ATOM 3903  C CA   . GLU A 1 127 ? 14.887  -12.376 -2.528  1.00 0.00 ? 127 GLU A CA   2  
ATOM 3904  C C    . GLU A 1 127 ? 14.620  -12.631 -1.042  1.00 0.00 ? 127 GLU A C    2  
ATOM 3905  O O    . GLU A 1 127 ? 13.467  -12.717 -0.622  1.00 0.00 ? 127 GLU A O    2  
ATOM 3906  C CB   . GLU A 1 127 ? 15.792  -13.460 -3.116  1.00 0.00 ? 127 GLU A CB   2  
ATOM 3907  C CG   . GLU A 1 127 ? 15.092  -14.821 -3.110  1.00 0.00 ? 127 GLU A CG   2  
ATOM 3908  C CD   . GLU A 1 127 ? 16.112  -15.962 -3.104  1.00 0.00 ? 127 GLU A CD   2  
ATOM 3909  O OE1  . GLU A 1 127 ? 16.946  -15.971 -2.172  1.00 0.00 ? 127 GLU A OE1  2  
ATOM 3910  O OE2  . GLU A 1 127 ? 16.034  -16.798 -4.029  1.00 0.00 ? 127 GLU A OE2  2  
ATOM 3911  H H    . GLU A 1 127 ? 15.639  -10.547 -1.873  1.00 0.00 ? 127 GLU A H    2  
ATOM 3912  H HA   . GLU A 1 127 ? 13.945  -12.361 -3.075  1.00 0.00 ? 127 GLU A HA   2  
ATOM 3913  H HB2  . GLU A 1 127 ? 16.068  -13.194 -4.136  1.00 0.00 ? 127 GLU A HB2  2  
ATOM 3914  H HB3  . GLU A 1 127 ? 16.716  -13.520 -2.541  1.00 0.00 ? 127 GLU A HB3  2  
ATOM 3915  H HG2  . GLU A 1 127 ? 14.448  -14.899 -2.234  1.00 0.00 ? 127 GLU A HG2  2  
ATOM 3916  H HG3  . GLU A 1 127 ? 14.449  -14.908 -3.987  1.00 0.00 ? 127 GLU A HG3  2  
ATOM 3917  N N    . CYS A 1 1   ? -7.945  -10.592 -0.827  1.00 0.00 ? 1   CYS A N    3  
ATOM 3918  C CA   . CYS A 1 1   ? -8.729  -10.215 0.336   1.00 0.00 ? 1   CYS A CA   3  
ATOM 3919  C C    . CYS A 1 1   ? -8.503  -11.262 1.428   1.00 0.00 ? 1   CYS A C    3  
ATOM 3920  O O    . CYS A 1 1   ? -8.514  -12.461 1.155   1.00 0.00 ? 1   CYS A O    3  
ATOM 3921  C CB   . CYS A 1 1   ? -10.212 -10.059 -0.007  1.00 0.00 ? 1   CYS A CB   3  
ATOM 3922  S SG   . CYS A 1 1   ? -10.593 -8.690  -1.161  1.00 0.00 ? 1   CYS A SG   3  
ATOM 3923  H H    . CYS A 1 1   ? -7.467  -9.838  -1.278  1.00 0.00 ? 1   CYS A H    3  
ATOM 3924  H HA   . CYS A 1 1   ? -8.365  -9.237  0.655   1.00 0.00 ? 1   CYS A HA   3  
ATOM 3925  H HB2  . CYS A 1 1   ? -10.570 -10.993 -0.443  1.00 0.00 ? 1   CYS A HB2  3  
ATOM 3926  H HB3  . CYS A 1 1   ? -10.770 -9.903  0.916   1.00 0.00 ? 1   CYS A HB3  3  
ATOM 3927  N N    . SER A 1 2   ? -8.304  -10.771 2.642   1.00 0.00 ? 2   SER A N    3  
ATOM 3928  C CA   . SER A 1 2   ? -8.075  -11.649 3.777   1.00 0.00 ? 2   SER A CA   3  
ATOM 3929  C C    . SER A 1 2   ? -6.833  -12.507 3.533   1.00 0.00 ? 2   SER A C    3  
ATOM 3930  O O    . SER A 1 2   ? -6.572  -13.454 4.273   1.00 0.00 ? 2   SER A O    3  
ATOM 3931  C CB   . SER A 1 2   ? -9.292  -12.538 4.039   1.00 0.00 ? 2   SER A CB   3  
ATOM 3932  O OG   . SER A 1 2   ? -10.220 -12.504 2.958   1.00 0.00 ? 2   SER A OG   3  
ATOM 3933  H H    . SER A 1 2   ? -8.296  -9.793  2.857   1.00 0.00 ? 2   SER A H    3  
ATOM 3934  H HA   . SER A 1 2   ? -7.921  -10.986 4.629   1.00 0.00 ? 2   SER A HA   3  
ATOM 3935  H HB2  . SER A 1 2   ? -8.963  -13.565 4.201   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3936  H HB3  . SER A 1 2   ? -9.788  -12.215 4.953   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3937  H HG   . SER A 1 2   ? -10.521 -11.565 2.795   1.00 0.00 ? 2   SER A HG   3  
ATOM 3938  N N    . CYS A 1 3   ? -6.099  -12.146 2.490   1.00 0.00 ? 3   CYS A N    3  
ATOM 3939  C CA   . CYS A 1 3   ? -4.890  -12.872 2.139   1.00 0.00 ? 3   CYS A CA   3  
ATOM 3940  C C    . CYS A 1 3   ? -3.931  -12.813 3.329   1.00 0.00 ? 3   CYS A C    3  
ATOM 3941  O O    . CYS A 1 3   ? -4.173  -12.086 4.291   1.00 0.00 ? 3   CYS A O    3  
ATOM 3942  C CB   . CYS A 1 3   ? -4.250  -12.321 0.863   1.00 0.00 ? 3   CYS A CB   3  
ATOM 3943  S SG   . CYS A 1 3   ? -3.067  -13.454 0.046   1.00 0.00 ? 3   CYS A SG   3  
ATOM 3944  H H    . CYS A 1 3   ? -6.318  -11.376 1.892   1.00 0.00 ? 3   CYS A H    3  
ATOM 3945  H HA   . CYS A 1 3   ? -5.189  -13.899 1.934   1.00 0.00 ? 3   CYS A HA   3  
ATOM 3946  H HB2  . CYS A 1 3   ? -5.040  -12.072 0.155   1.00 0.00 ? 3   CYS A HB2  3  
ATOM 3947  H HB3  . CYS A 1 3   ? -3.734  -11.392 1.103   1.00 0.00 ? 3   CYS A HB3  3  
ATOM 3948  N N    . SER A 1 4   ? -2.861  -13.587 3.225   1.00 0.00 ? 4   SER A N    3  
ATOM 3949  C CA   . SER A 1 4   ? -1.864  -13.632 4.281   1.00 0.00 ? 4   SER A CA   3  
ATOM 3950  C C    . SER A 1 4   ? -0.624  -12.837 3.866   1.00 0.00 ? 4   SER A C    3  
ATOM 3951  O O    . SER A 1 4   ? 0.092   -13.234 2.946   1.00 0.00 ? 4   SER A O    3  
ATOM 3952  C CB   . SER A 1 4   ? -1.481  -15.074 4.617   1.00 0.00 ? 4   SER A CB   3  
ATOM 3953  O OG   . SER A 1 4   ? -0.691  -15.670 3.592   1.00 0.00 ? 4   SER A OG   3  
ATOM 3954  H H    . SER A 1 4   ? -2.670  -14.175 2.439   1.00 0.00 ? 4   SER A H    3  
ATOM 3955  H HA   . SER A 1 4   ? -2.340  -13.171 5.147   1.00 0.00 ? 4   SER A HA   3  
ATOM 3956  H HB2  . SER A 1 4   ? -0.929  -15.094 5.557   1.00 0.00 ? 4   SER A HB2  3  
ATOM 3957  H HB3  . SER A 1 4   ? -2.386  -15.664 4.767   1.00 0.00 ? 4   SER A HB3  3  
ATOM 3958  H HG   . SER A 1 4   ? -1.146  -16.490 3.243   1.00 0.00 ? 4   SER A HG   3  
ATOM 3959  N N    . PRO A 1 5   ? -0.402  -11.701 4.578   1.00 0.00 ? 5   PRO A N    3  
ATOM 3960  C CA   . PRO A 1 5   ? 0.738   -10.848 4.293   1.00 0.00 ? 5   PRO A CA   3  
ATOM 3961  C C    . PRO A 1 5   ? 2.033   -11.470 4.816   1.00 0.00 ? 5   PRO A C    3  
ATOM 3962  O O    . PRO A 1 5   ? 2.130   -11.811 5.995   1.00 0.00 ? 5   PRO A O    3  
ATOM 3963  C CB   . PRO A 1 5   ? 0.410   -9.518  4.951   1.00 0.00 ? 5   PRO A CB   3  
ATOM 3964  C CG   . PRO A 1 5   ? -0.680  -9.814  5.969   1.00 0.00 ? 5   PRO A CG   3  
ATOM 3965  C CD   . PRO A 1 5   ? -1.230  -11.201 5.673   1.00 0.00 ? 5   PRO A CD   3  
ATOM 3966  H HA   . PRO A 1 5   ? 0.860   -10.752 3.305   1.00 0.00 ? 5   PRO A HA   3  
ATOM 3967  H HB2  . PRO A 1 5   ? 1.290   -9.093  5.433   1.00 0.00 ? 5   PRO A HB2  3  
ATOM 3968  H HB3  . PRO A 1 5   ? 0.068   -8.791  4.214   1.00 0.00 ? 5   PRO A HB3  3  
ATOM 3969  H HG2  . PRO A 1 5   ? -0.278  -9.771  6.981   1.00 0.00 ? 5   PRO A HG2  3  
ATOM 3970  H HG3  . PRO A 1 5   ? -1.472  -9.069  5.908   1.00 0.00 ? 5   PRO A HG3  3  
ATOM 3971  H HD2  . PRO A 1 5   ? -1.164  -11.847 6.547   1.00 0.00 ? 5   PRO A HD2  3  
ATOM 3972  H HD3  . PRO A 1 5   ? -2.281  -11.157 5.387   1.00 0.00 ? 5   PRO A HD3  3  
ATOM 3973  N N    . VAL A 1 6   ? 2.997   -11.599 3.916   1.00 0.00 ? 6   VAL A N    3  
ATOM 3974  C CA   . VAL A 1 6   ? 4.282   -12.175 4.273   1.00 0.00 ? 6   VAL A CA   3  
ATOM 3975  C C    . VAL A 1 6   ? 5.369   -11.582 3.374   1.00 0.00 ? 6   VAL A C    3  
ATOM 3976  O O    . VAL A 1 6   ? 5.440   -10.367 3.199   1.00 0.00 ? 6   VAL A O    3  
ATOM 3977  C CB   . VAL A 1 6   ? 4.211   -13.702 4.197   1.00 0.00 ? 6   VAL A CB   3  
ATOM 3978  C CG1  . VAL A 1 6   ? 4.062   -14.173 2.749   1.00 0.00 ? 6   VAL A CG1  3  
ATOM 3979  C CG2  . VAL A 1 6   ? 5.434   -14.341 4.859   1.00 0.00 ? 6   VAL A CG2  3  
ATOM 3980  H H    . VAL A 1 6   ? 2.910   -11.320 2.960   1.00 0.00 ? 6   VAL A H    3  
ATOM 3981  H HA   . VAL A 1 6   ? 4.492   -11.898 5.306   1.00 0.00 ? 6   VAL A HA   3  
ATOM 3982  H HB   . VAL A 1 6   ? 3.327   -14.023 4.747   1.00 0.00 ? 6   VAL A HB   3  
ATOM 3983  H HG11 . VAL A 1 6   ? 4.198   -13.326 2.076   1.00 0.00 ? 6   VAL A HG11 3  
ATOM 3984  H HG12 . VAL A 1 6   ? 4.814   -14.931 2.535   1.00 0.00 ? 6   VAL A HG12 3  
ATOM 3985  H HG13 . VAL A 1 6   ? 3.068   -14.596 2.606   1.00 0.00 ? 6   VAL A HG13 3  
ATOM 3986  H HG21 . VAL A 1 6   ? 6.222   -13.595 4.964   1.00 0.00 ? 6   VAL A HG21 3  
ATOM 3987  H HG22 . VAL A 1 6   ? 5.159   -14.719 5.843   1.00 0.00 ? 6   VAL A HG22 3  
ATOM 3988  H HG23 . VAL A 1 6   ? 5.793   -15.163 4.241   1.00 0.00 ? 6   VAL A HG23 3  
ATOM 3989  N N    . HIS A 1 7   ? 6.189   -12.468 2.827   1.00 0.00 ? 7   HIS A N    3  
ATOM 3990  C CA   . HIS A 1 7   ? 7.268   -12.048 1.950   1.00 0.00 ? 7   HIS A CA   3  
ATOM 3991  C C    . HIS A 1 7   ? 7.876   -10.744 2.473   1.00 0.00 ? 7   HIS A C    3  
ATOM 3992  O O    . HIS A 1 7   ? 7.503   -9.660  2.030   1.00 0.00 ? 7   HIS A O    3  
ATOM 3993  C CB   . HIS A 1 7   ? 6.782   -11.936 0.504   1.00 0.00 ? 7   HIS A CB   3  
ATOM 3994  C CG   . HIS A 1 7   ? 5.314   -11.608 0.374   1.00 0.00 ? 7   HIS A CG   3  
ATOM 3995  N ND1  . HIS A 1 7   ? 4.393   -12.488 -0.166  1.00 0.00 ? 7   HIS A ND1  3  
ATOM 3996  C CD2  . HIS A 1 7   ? 4.617   -10.487 0.718   1.00 0.00 ? 7   HIS A CD2  3  
ATOM 3997  C CE1  . HIS A 1 7   ? 3.200   -11.913 -0.143  1.00 0.00 ? 7   HIS A CE1  3  
ATOM 3998  N NE2  . HIS A 1 7   ? 3.341   -10.672 0.406   1.00 0.00 ? 7   HIS A NE2  3  
ATOM 3999  H H    . HIS A 1 7   ? 6.124   -13.455 2.975   1.00 0.00 ? 7   HIS A H    3  
ATOM 4000  H HA   . HIS A 1 7   ? 8.025   -12.831 1.987   1.00 0.00 ? 7   HIS A HA   3  
ATOM 4001  H HB2  . HIS A 1 7   ? 7.362   -11.168 -0.006  1.00 0.00 ? 7   HIS A HB2  3  
ATOM 4002  H HB3  . HIS A 1 7   ? 6.979   -12.877 -0.008  1.00 0.00 ? 7   HIS A HB3  3  
ATOM 4003  H HD1  . HIS A 1 7   ? 4.595   -13.404 -0.515  1.00 0.00 ? 7   HIS A HD1  3  
ATOM 4004  H HD2  . HIS A 1 7   ? 5.038   -9.591  1.175   1.00 0.00 ? 7   HIS A HD2  3  
ATOM 4005  H HE1  . HIS A 1 7   ? 2.269   -12.354 -0.499  1.00 0.00 ? 7   HIS A HE1  3  
ATOM 4006  N N    . PRO A 1 8   ? 8.826   -10.898 3.433   1.00 0.00 ? 8   PRO A N    3  
ATOM 4007  C CA   . PRO A 1 8   ? 9.490   -9.747  4.021   1.00 0.00 ? 8   PRO A CA   3  
ATOM 4008  C C    . PRO A 1 8   ? 10.514  -9.150  3.053   1.00 0.00 ? 8   PRO A C    3  
ATOM 4009  O O    . PRO A 1 8   ? 11.189  -8.176  3.381   1.00 0.00 ? 8   PRO A O    3  
ATOM 4010  C CB   . PRO A 1 8   ? 10.118  -10.266 5.304   1.00 0.00 ? 8   PRO A CB   3  
ATOM 4011  C CG   . PRO A 1 8   ? 10.181  -11.778 5.154   1.00 0.00 ? 8   PRO A CG   3  
ATOM 4012  C CD   . PRO A 1 8   ? 9.295   -12.168 3.982   1.00 0.00 ? 8   PRO A CD   3  
ATOM 4013  H HA   . PRO A 1 8   ? 8.828   -9.019  4.200   1.00 0.00 ? 8   PRO A HA   3  
ATOM 4014  H HB2  . PRO A 1 8   ? 11.113  -9.847  5.449   1.00 0.00 ? 8   PRO A HB2  3  
ATOM 4015  H HB3  . PRO A 1 8   ? 9.523   -9.984  6.172   1.00 0.00 ? 8   PRO A HB3  3  
ATOM 4016  H HG2  . PRO A 1 8   ? 11.207  -12.103 4.982   1.00 0.00 ? 8   PRO A HG2  3  
ATOM 4017  H HG3  . PRO A 1 8   ? 9.841   -12.267 6.068   1.00 0.00 ? 8   PRO A HG3  3  
ATOM 4018  H HD2  . PRO A 1 8   ? 9.850   -12.740 3.239   1.00 0.00 ? 8   PRO A HD2  3  
ATOM 4019  H HD3  . PRO A 1 8   ? 8.461   -12.790 4.305   1.00 0.00 ? 8   PRO A HD3  3  
ATOM 4020  N N    . GLN A 1 9   ? 10.596  -9.760  1.880   1.00 0.00 ? 9   GLN A N    3  
ATOM 4021  C CA   . GLN A 1 9   ? 11.527  -9.302  0.862   1.00 0.00 ? 9   GLN A CA   3  
ATOM 4022  C C    . GLN A 1 9   ? 10.856  -9.310  -0.513  1.00 0.00 ? 9   GLN A C    3  
ATOM 4023  O O    . GLN A 1 9   ? 11.012  -8.368  -1.289  1.00 0.00 ? 9   GLN A O    3  
ATOM 4024  C CB   . GLN A 1 9   ? 12.797  -10.153 0.857   1.00 0.00 ? 9   GLN A CB   3  
ATOM 4025  C CG   . GLN A 1 9   ? 13.805  -9.629  -0.168  1.00 0.00 ? 9   GLN A CG   3  
ATOM 4026  C CD   . GLN A 1 9   ? 15.058  -9.087  0.523   1.00 0.00 ? 9   GLN A CD   3  
ATOM 4027  O OE1  . GLN A 1 9   ? 16.169  -9.538  0.294   1.00 0.00 ? 9   GLN A OE1  3  
ATOM 4028  N NE2  . GLN A 1 9   ? 14.820  -8.097  1.379   1.00 0.00 ? 9   GLN A NE2  3  
ATOM 4029  H H    . GLN A 1 9   ? 10.044  -10.552 1.621   1.00 0.00 ? 9   GLN A H    3  
ATOM 4030  H HA   . GLN A 1 9   ? 11.782  -8.280  1.143   1.00 0.00 ? 9   GLN A HA   3  
ATOM 4031  H HB2  . GLN A 1 9   ? 13.248  -10.147 1.850   1.00 0.00 ? 9   GLN A HB2  3  
ATOM 4032  H HB3  . GLN A 1 9   ? 12.545  -11.188 0.627   1.00 0.00 ? 9   GLN A HB3  3  
ATOM 4033  H HG2  . GLN A 1 9   ? 14.081  -10.429 -0.855  1.00 0.00 ? 9   GLN A HG2  3  
ATOM 4034  H HG3  . GLN A 1 9   ? 13.346  -8.841  -0.765  1.00 0.00 ? 9   GLN A HG3  3  
ATOM 4035  H HE21 . GLN A 1 9   ? 13.884  -7.774  1.520   1.00 0.00 ? 9   GLN A HE21 3  
ATOM 4036  H HE22 . GLN A 1 9   ? 15.575  -7.677  1.880   1.00 0.00 ? 9   GLN A HE22 3  
ATOM 4037  N N    . GLN A 1 10  ? 10.123  -10.383 -0.772  1.00 0.00 ? 10  GLN A N    3  
ATOM 4038  C CA   . GLN A 1 10  ? 9.427   -10.525 -2.039  1.00 0.00 ? 10  GLN A CA   3  
ATOM 4039  C C    . GLN A 1 10  ? 8.343   -9.455  -2.174  1.00 0.00 ? 10  GLN A C    3  
ATOM 4040  O O    . GLN A 1 10  ? 7.699   -9.346  -3.216  1.00 0.00 ? 10  GLN A O    3  
ATOM 4041  C CB   . GLN A 1 10  ? 8.833   -11.928 -2.183  1.00 0.00 ? 10  GLN A CB   3  
ATOM 4042  C CG   . GLN A 1 10  ? 9.728   -12.973 -1.517  1.00 0.00 ? 10  GLN A CG   3  
ATOM 4043  C CD   . GLN A 1 10  ? 9.531   -14.351 -2.152  1.00 0.00 ? 10  GLN A CD   3  
ATOM 4044  O OE1  . GLN A 1 10  ? 10.398  -14.882 -2.827  1.00 0.00 ? 10  GLN A OE1  3  
ATOM 4045  N NE2  . GLN A 1 10  ? 8.345   -14.898 -1.901  1.00 0.00 ? 10  GLN A NE2  3  
ATOM 4046  H H    . GLN A 1 10  ? 10.001  -11.143 -0.135  1.00 0.00 ? 10  GLN A H    3  
ATOM 4047  H HA   . GLN A 1 10  ? 10.188  -10.379 -2.806  1.00 0.00 ? 10  GLN A HA   3  
ATOM 4048  H HB2  . GLN A 1 10  ? 7.841   -11.954 -1.735  1.00 0.00 ? 10  GLN A HB2  3  
ATOM 4049  H HB3  . GLN A 1 10  ? 8.712   -12.169 -3.240  1.00 0.00 ? 10  GLN A HB3  3  
ATOM 4050  H HG2  . GLN A 1 10  ? 10.773  -12.674 -1.605  1.00 0.00 ? 10  GLN A HG2  3  
ATOM 4051  H HG3  . GLN A 1 10  ? 9.502   -13.025 -0.451  1.00 0.00 ? 10  GLN A HG3  3  
ATOM 4052  H HE21 . GLN A 1 10  ? 7.678   -14.409 -1.340  1.00 0.00 ? 10  GLN A HE21 3  
ATOM 4053  H HE22 . GLN A 1 10  ? 8.121   -15.799 -2.274  1.00 0.00 ? 10  GLN A HE22 3  
ATOM 4054  N N    . ALA A 1 11  ? 8.174   -8.691  -1.104  1.00 0.00 ? 11  ALA A N    3  
ATOM 4055  C CA   . ALA A 1 11  ? 7.179   -7.633  -1.089  1.00 0.00 ? 11  ALA A CA   3  
ATOM 4056  C C    . ALA A 1 11  ? 7.763   -6.380  -1.747  1.00 0.00 ? 11  ALA A C    3  
ATOM 4057  O O    . ALA A 1 11  ? 7.057   -5.655  -2.446  1.00 0.00 ? 11  ALA A O    3  
ATOM 4058  C CB   . ALA A 1 11  ? 6.725   -7.378  0.350   1.00 0.00 ? 11  ALA A CB   3  
ATOM 4059  H H    . ALA A 1 11  ? 8.702   -8.786  -0.260  1.00 0.00 ? 11  ALA A H    3  
ATOM 4060  H HA   . ALA A 1 11  ? 6.324   -7.973  -1.672  1.00 0.00 ? 11  ALA A HA   3  
ATOM 4061  H HB1  . ALA A 1 11  ? 7.450   -7.809  1.041   1.00 0.00 ? 11  ALA A HB1  3  
ATOM 4062  H HB2  . ALA A 1 11  ? 6.651   -6.304  0.522   1.00 0.00 ? 11  ALA A HB2  3  
ATOM 4063  H HB3  . ALA A 1 11  ? 5.751   -7.840  0.511   1.00 0.00 ? 11  ALA A HB3  3  
ATOM 4064  N N    . PHE A 1 12  ? 9.047   -6.164  -1.499  1.00 0.00 ? 12  PHE A N    3  
ATOM 4065  C CA   . PHE A 1 12  ? 9.733   -5.013  -2.059  1.00 0.00 ? 12  PHE A CA   3  
ATOM 4066  C C    . PHE A 1 12  ? 10.301  -5.332  -3.443  1.00 0.00 ? 12  PHE A C    3  
ATOM 4067  O O    . PHE A 1 12  ? 10.951  -4.490  -4.060  1.00 0.00 ? 12  PHE A O    3  
ATOM 4068  C CB   . PHE A 1 12  ? 10.887  -4.677  -1.112  1.00 0.00 ? 12  PHE A CB   3  
ATOM 4069  C CG   . PHE A 1 12  ? 10.439  -4.156  0.254   1.00 0.00 ? 12  PHE A CG   3  
ATOM 4070  C CD1  . PHE A 1 12  ? 9.522   -4.851  0.980   1.00 0.00 ? 12  PHE A CD1  3  
ATOM 4071  C CD2  . PHE A 1 12  ? 10.958  -2.998  0.744   1.00 0.00 ? 12  PHE A CD2  3  
ATOM 4072  C CE1  . PHE A 1 12  ? 9.107   -4.367  2.249   1.00 0.00 ? 12  PHE A CE1  3  
ATOM 4073  C CE2  . PHE A 1 12  ? 10.543  -2.514  2.012   1.00 0.00 ? 12  PHE A CE2  3  
ATOM 4074  C CZ   . PHE A 1 12  ? 9.625   -3.208  2.738   1.00 0.00 ? 12  PHE A CZ   3  
ATOM 4075  H H    . PHE A 1 12  ? 9.614   -6.760  -0.930  1.00 0.00 ? 12  PHE A H    3  
ATOM 4076  H HA   . PHE A 1 12  ? 9.001   -4.210  -2.144  1.00 0.00 ? 12  PHE A HA   3  
ATOM 4077  H HB2  . PHE A 1 12  ? 11.497  -5.569  -0.968  1.00 0.00 ? 12  PHE A HB2  3  
ATOM 4078  H HB3  . PHE A 1 12  ? 11.525  -3.929  -1.584  1.00 0.00 ? 12  PHE A HB3  3  
ATOM 4079  H HD1  . PHE A 1 12  ? 9.107   -5.779  0.588   1.00 0.00 ? 12  PHE A HD1  3  
ATOM 4080  H HD2  . PHE A 1 12  ? 11.692  -2.441  0.163   1.00 0.00 ? 12  PHE A HD2  3  
ATOM 4081  H HE1  . PHE A 1 12  ? 8.372   -4.923  2.831   1.00 0.00 ? 12  PHE A HE1  3  
ATOM 4082  H HE2  . PHE A 1 12  ? 10.957  -1.585  2.405   1.00 0.00 ? 12  PHE A HE2  3  
ATOM 4083  H HZ   . PHE A 1 12  ? 9.306   -2.837  3.712   1.00 0.00 ? 12  PHE A HZ   3  
ATOM 4084  N N    . CYS A 1 13  ? 10.034  -6.550  -3.891  1.00 0.00 ? 13  CYS A N    3  
ATOM 4085  C CA   . CYS A 1 13  ? 10.510  -6.990  -5.190  1.00 0.00 ? 13  CYS A CA   3  
ATOM 4086  C C    . CYS A 1 13  ? 9.302   -7.152  -6.116  1.00 0.00 ? 13  CYS A C    3  
ATOM 4087  O O    . CYS A 1 13  ? 9.456   -7.250  -7.332  1.00 0.00 ? 13  CYS A O    3  
ATOM 4088  C CB   . CYS A 1 13  ? 11.326  -8.281  -5.087  1.00 0.00 ? 13  CYS A CB   3  
ATOM 4089  S SG   . CYS A 1 13  ? 13.113  -8.037  -4.778  1.00 0.00 ? 13  CYS A SG   3  
ATOM 4090  H H    . CYS A 1 13  ? 9.505   -7.229  -3.382  1.00 0.00 ? 13  CYS A H    3  
ATOM 4091  H HA   . CYS A 1 13  ? 11.179  -6.213  -5.559  1.00 0.00 ? 13  CYS A HA   3  
ATOM 4092  H HB2  . CYS A 1 13  ? 10.913  -8.892  -4.284  1.00 0.00 ? 13  CYS A HB2  3  
ATOM 4093  H HB3  . CYS A 1 13  ? 11.205  -8.846  -6.011  1.00 0.00 ? 13  CYS A HB3  3  
ATOM 4094  N N    . ASN A 1 14  ? 8.128   -7.174  -5.504  1.00 0.00 ? 14  ASN A N    3  
ATOM 4095  C CA   . ASN A 1 14  ? 6.894   -7.322  -6.257  1.00 0.00 ? 14  ASN A CA   3  
ATOM 4096  C C    . ASN A 1 14  ? 6.273   -5.943  -6.485  1.00 0.00 ? 14  ASN A C    3  
ATOM 4097  O O    . ASN A 1 14  ? 5.751   -5.665  -7.563  1.00 0.00 ? 14  ASN A O    3  
ATOM 4098  C CB   . ASN A 1 14  ? 5.881   -8.176  -5.492  1.00 0.00 ? 14  ASN A CB   3  
ATOM 4099  C CG   . ASN A 1 14  ? 5.489   -9.416  -6.299  1.00 0.00 ? 14  ASN A CG   3  
ATOM 4100  O OD1  . ASN A 1 14  ? 4.741   -9.352  -7.261  1.00 0.00 ? 14  ASN A OD1  3  
ATOM 4101  N ND2  . ASN A 1 14  ? 6.034   -10.544 -5.855  1.00 0.00 ? 14  ASN A ND2  3  
ATOM 4102  H H    . ASN A 1 14  ? 8.011   -7.094  -4.513  1.00 0.00 ? 14  ASN A H    3  
ATOM 4103  H HA   . ASN A 1 14  ? 7.184   -7.809  -7.188  1.00 0.00 ? 14  ASN A HA   3  
ATOM 4104  H HB2  . ASN A 1 14  ? 6.304   -8.480  -4.535  1.00 0.00 ? 14  ASN A HB2  3  
ATOM 4105  H HB3  . ASN A 1 14  ? 4.992   -7.584  -5.274  1.00 0.00 ? 14  ASN A HB3  3  
ATOM 4106  H HD21 . ASN A 1 14  ? 6.639   -10.529 -5.059  1.00 0.00 ? 14  ASN A HD21 3  
ATOM 4107  H HD22 . ASN A 1 14  ? 5.839   -11.410 -6.316  1.00 0.00 ? 14  ASN A HD22 3  
ATOM 4108  N N    . ALA A 1 15  ? 6.351   -5.115  -5.453  1.00 0.00 ? 15  ALA A N    3  
ATOM 4109  C CA   . ALA A 1 15  ? 5.802   -3.772  -5.528  1.00 0.00 ? 15  ALA A CA   3  
ATOM 4110  C C    . ALA A 1 15  ? 6.406   -3.046  -6.733  1.00 0.00 ? 15  ALA A C    3  
ATOM 4111  O O    . ALA A 1 15  ? 7.323   -3.557  -7.374  1.00 0.00 ? 15  ALA A O    3  
ATOM 4112  C CB   . ALA A 1 15  ? 6.069   -3.038  -4.213  1.00 0.00 ? 15  ALA A CB   3  
ATOM 4113  H H    . ALA A 1 15  ? 6.777   -5.350  -4.580  1.00 0.00 ? 15  ALA A H    3  
ATOM 4114  H HA   . ALA A 1 15  ? 4.725   -3.861  -5.669  1.00 0.00 ? 15  ALA A HA   3  
ATOM 4115  H HB1  . ALA A 1 15  ? 7.141   -3.025  -4.014  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 4116  H HB2  . ALA A 1 15  ? 5.701   -2.015  -4.286  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 4117  H HB3  . ALA A 1 15  ? 5.555   -3.552  -3.400  1.00 0.00 ? 15  ALA A HB3  3  
ATOM 4118  N N    . ASP A 1 16  ? 5.866   -1.868  -7.004  1.00 0.00 ? 16  ASP A N    3  
ATOM 4119  C CA   . ASP A 1 16  ? 6.338   -1.067  -8.120  1.00 0.00 ? 16  ASP A CA   3  
ATOM 4120  C C    . ASP A 1 16  ? 6.139   0.416   -7.800  1.00 0.00 ? 16  ASP A C    3  
ATOM 4121  O O    . ASP A 1 16  ? 6.221   1.264   -8.687  1.00 0.00 ? 16  ASP A O    3  
ATOM 4122  C CB   . ASP A 1 16  ? 5.556   -1.384  -9.397  1.00 0.00 ? 16  ASP A CB   3  
ATOM 4123  C CG   . ASP A 1 16  ? 6.176   -2.465  -10.283 1.00 0.00 ? 16  ASP A CG   3  
ATOM 4124  O OD1  . ASP A 1 16  ? 6.999   -3.237  -9.745  1.00 0.00 ? 16  ASP A OD1  3  
ATOM 4125  O OD2  . ASP A 1 16  ? 5.813   -2.496  -11.478 1.00 0.00 ? 16  ASP A OD2  3  
ATOM 4126  H H    . ASP A 1 16  ? 5.119   -1.459  -6.478  1.00 0.00 ? 16  ASP A H    3  
ATOM 4127  H HA   . ASP A 1 16  ? 7.389   -1.331  -8.237  1.00 0.00 ? 16  ASP A HA   3  
ATOM 4128  H HB2  . ASP A 1 16  ? 4.549   -1.696  -9.119  1.00 0.00 ? 16  ASP A HB2  3  
ATOM 4129  H HB3  . ASP A 1 16  ? 5.456   -0.469  -9.980  1.00 0.00 ? 16  ASP A HB3  3  
ATOM 4130  N N    . VAL A 1 17  ? 5.879   0.684   -6.528  1.00 0.00 ? 17  VAL A N    3  
ATOM 4131  C CA   . VAL A 1 17  ? 5.667   2.050   -6.079  1.00 0.00 ? 17  VAL A CA   3  
ATOM 4132  C C    . VAL A 1 17  ? 5.745   2.097   -4.552  1.00 0.00 ? 17  VAL A C    3  
ATOM 4133  O O    . VAL A 1 17  ? 4.734   1.939   -3.870  1.00 0.00 ? 17  VAL A O    3  
ATOM 4134  C CB   . VAL A 1 17  ? 4.340   2.580   -6.627  1.00 0.00 ? 17  VAL A CB   3  
ATOM 4135  C CG1  . VAL A 1 17  ? 3.154   1.844   -6.001  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 4136  C CG2  . VAL A 1 17  ? 4.224   4.090   -6.412  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 4137  H H    . VAL A 1 17  ? 5.813   -0.011  -5.813  1.00 0.00 ? 17  VAL A H    3  
ATOM 4138  H HA   . VAL A 1 17  ? 6.471   2.660   -6.491  1.00 0.00 ? 17  VAL A HA   3  
ATOM 4139  H HB   . VAL A 1 17  ? 4.322   2.392   -7.701  1.00 0.00 ? 17  VAL A HB   3  
ATOM 4140  H HG11 . VAL A 1 17  ? 3.454   0.830   -5.738  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 4141  H HG12 . VAL A 1 17  ? 2.833   2.372   -5.103  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 4142  H HG13 . VAL A 1 17  ? 2.332   1.807   -6.715  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 4143  H HG21 . VAL A 1 17  ? 5.217   4.540   -6.452  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 4144  H HG22 . VAL A 1 17  ? 3.599   4.521   -7.195  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 4145  H HG23 . VAL A 1 17  ? 3.775   4.286   -5.439  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 4146  N N    . VAL A 1 18  ? 6.955   2.317   -4.060  1.00 0.00 ? 18  VAL A N    3  
ATOM 4147  C CA   . VAL A 1 18  ? 7.178   2.388   -2.626  1.00 0.00 ? 18  VAL A CA   3  
ATOM 4148  C C    . VAL A 1 18  ? 7.273   3.855   -2.201  1.00 0.00 ? 18  VAL A C    3  
ATOM 4149  O O    . VAL A 1 18  ? 8.133   4.591   -2.682  1.00 0.00 ? 18  VAL A O    3  
ATOM 4150  C CB   . VAL A 1 18  ? 8.418   1.576   -2.248  1.00 0.00 ? 18  VAL A CB   3  
ATOM 4151  C CG1  . VAL A 1 18  ? 8.243   0.913   -0.880  1.00 0.00 ? 18  VAL A CG1  3  
ATOM 4152  C CG2  . VAL A 1 18  ? 8.741   0.537   -3.324  1.00 0.00 ? 18  VAL A CG2  3  
ATOM 4153  H H    . VAL A 1 18  ? 7.773   2.446   -4.621  1.00 0.00 ? 18  VAL A H    3  
ATOM 4154  H HA   . VAL A 1 18  ? 6.316   1.936   -2.135  1.00 0.00 ? 18  VAL A HA   3  
ATOM 4155  H HB   . VAL A 1 18  ? 9.262   2.263   -2.183  1.00 0.00 ? 18  VAL A HB   3  
ATOM 4156  H HG11 . VAL A 1 18  ? 7.209   1.020   -0.553  1.00 0.00 ? 18  VAL A HG11 3  
ATOM 4157  H HG12 . VAL A 1 18  ? 8.495   -0.145  -0.954  1.00 0.00 ? 18  VAL A HG12 3  
ATOM 4158  H HG13 . VAL A 1 18  ? 8.903   1.393   -0.157  1.00 0.00 ? 18  VAL A HG13 3  
ATOM 4159  H HG21 . VAL A 1 18  ? 8.777   1.021   -4.299  1.00 0.00 ? 18  VAL A HG21 3  
ATOM 4160  H HG22 . VAL A 1 18  ? 9.707   0.079   -3.109  1.00 0.00 ? 18  VAL A HG22 3  
ATOM 4161  H HG23 . VAL A 1 18  ? 7.969   -0.233  -3.329  1.00 0.00 ? 18  VAL A HG23 3  
ATOM 4162  N N    . ILE A 1 19  ? 6.376   4.237   -1.303  1.00 0.00 ? 19  ILE A N    3  
ATOM 4163  C CA   . ILE A 1 19  ? 6.347   5.602   -0.808  1.00 0.00 ? 19  ILE A CA   3  
ATOM 4164  C C    . ILE A 1 19  ? 5.917   5.600   0.660   1.00 0.00 ? 19  ILE A C    3  
ATOM 4165  O O    . ILE A 1 19  ? 4.866   5.058   1.001   1.00 0.00 ? 19  ILE A O    3  
ATOM 4166  C CB   . ILE A 1 19  ? 5.470   6.479   -1.704  1.00 0.00 ? 19  ILE A CB   3  
ATOM 4167  C CG1  . ILE A 1 19  ? 3.987   6.171   -1.491  1.00 0.00 ? 19  ILE A CG1  3  
ATOM 4168  C CG2  . ILE A 1 19  ? 5.879   6.344   -3.172  1.00 0.00 ? 19  ILE A CG2  3  
ATOM 4169  C CD1  . ILE A 1 19  ? 3.171   6.509   -2.740  1.00 0.00 ? 19  ILE A CD1  3  
ATOM 4170  H H    . ILE A 1 19  ? 5.680   3.633   -0.916  1.00 0.00 ? 19  ILE A H    3  
ATOM 4171  H HA   . ILE A 1 19  ? 7.363   5.994   -0.869  1.00 0.00 ? 19  ILE A HA   3  
ATOM 4172  H HB   . ILE A 1 19  ? 5.626   7.520   -1.422  1.00 0.00 ? 19  ILE A HB   3  
ATOM 4173  H HG12 . ILE A 1 19  ? 3.863   5.115   -1.245  1.00 0.00 ? 19  ILE A HG12 3  
ATOM 4174  H HG13 . ILE A 1 19  ? 3.612   6.741   -0.641  1.00 0.00 ? 19  ILE A HG13 3  
ATOM 4175  H HG21 . ILE A 1 19  ? 6.966   6.355   -3.250  1.00 0.00 ? 19  ILE A HG21 3  
ATOM 4176  H HG22 . ILE A 1 19  ? 5.496   5.404   -3.570  1.00 0.00 ? 19  ILE A HG22 3  
ATOM 4177  H HG23 . ILE A 1 19  ? 5.465   7.175   -3.743  1.00 0.00 ? 19  ILE A HG23 3  
ATOM 4178  H HD11 . ILE A 1 19  ? 3.519   7.456   -3.156  1.00 0.00 ? 19  ILE A HD11 3  
ATOM 4179  H HD12 . ILE A 1 19  ? 3.296   5.720   -3.480  1.00 0.00 ? 19  ILE A HD12 3  
ATOM 4180  H HD13 . ILE A 1 19  ? 2.118   6.595   -2.474  1.00 0.00 ? 19  ILE A HD13 3  
ATOM 4181  N N    . ARG A 1 20  ? 6.750   6.210   1.490   1.00 0.00 ? 20  ARG A N    3  
ATOM 4182  C CA   . ARG A 1 20  ? 6.469   6.284   2.913   1.00 0.00 ? 20  ARG A CA   3  
ATOM 4183  C C    . ARG A 1 20  ? 5.403   7.347   3.189   1.00 0.00 ? 20  ARG A C    3  
ATOM 4184  O O    . ARG A 1 20  ? 5.477   8.060   4.188   1.00 0.00 ? 20  ARG A O    3  
ATOM 4185  C CB   . ARG A 1 20  ? 7.733   6.620   3.708   1.00 0.00 ? 20  ARG A CB   3  
ATOM 4186  C CG   . ARG A 1 20  ? 8.905   5.738   3.273   1.00 0.00 ? 20  ARG A CG   3  
ATOM 4187  C CD   . ARG A 1 20  ? 10.240  6.448   3.503   1.00 0.00 ? 20  ARG A CD   3  
ATOM 4188  N NE   . ARG A 1 20  ? 10.194  7.216   4.767   1.00 0.00 ? 20  ARG A NE   3  
ATOM 4189  C CZ   . ARG A 1 20  ? 11.279  7.570   5.471   1.00 0.00 ? 20  ARG A CZ   3  
ATOM 4190  N NH1  . ARG A 1 20  ? 12.499  7.227   5.038   1.00 0.00 ? 20  ARG A NH1  3  
ATOM 4191  N NH2  . ARG A 1 20  ? 11.142  8.266   6.608   1.00 0.00 ? 20  ARG A NH2  3  
ATOM 4192  H H    . ARG A 1 20  ? 7.603   6.648   1.204   1.00 0.00 ? 20  ARG A H    3  
ATOM 4193  H HA   . ARG A 1 20  ? 6.110   5.289   3.178   1.00 0.00 ? 20  ARG A HA   3  
ATOM 4194  H HB2  . ARG A 1 20  ? 7.989   7.670   3.562   1.00 0.00 ? 20  ARG A HB2  3  
ATOM 4195  H HB3  . ARG A 1 20  ? 7.544   6.483   4.772   1.00 0.00 ? 20  ARG A HB3  3  
ATOM 4196  H HG2  . ARG A 1 20  ? 8.886   4.802   3.831   1.00 0.00 ? 20  ARG A HG2  3  
ATOM 4197  H HG3  . ARG A 1 20  ? 8.801   5.483   2.219   1.00 0.00 ? 20  ARG A HG3  3  
ATOM 4198  H HD2  . ARG A 1 20  ? 11.049  5.718   3.540   1.00 0.00 ? 20  ARG A HD2  3  
ATOM 4199  H HD3  . ARG A 1 20  ? 10.453  7.117   2.669   1.00 0.00 ? 20  ARG A HD3  3  
ATOM 4200  H HE   . ARG A 1 20  ? 9.299   7.488   5.119   1.00 0.00 ? 20  ARG A HE   3  
ATOM 4201  H HH11 . ARG A 1 20  ? 12.601  6.708   4.190   1.00 0.00 ? 20  ARG A HH11 3  
ATOM 4202  H HH12 . ARG A 1 20  ? 13.308  7.492   5.563   1.00 0.00 ? 20  ARG A HH12 3  
ATOM 4203  H HH21 . ARG A 1 20  ? 10.231  8.522   6.930   1.00 0.00 ? 20  ARG A HH21 3  
ATOM 4204  H HH22 . ARG A 1 20  ? 11.951  8.530   7.133   1.00 0.00 ? 20  ARG A HH22 3  
ATOM 4205  N N    . THR A 1 21  ? 4.437   7.419   2.286   1.00 0.00 ? 21  THR A N    3  
ATOM 4206  C CA   . THR A 1 21  ? 3.358   8.382   2.419   1.00 0.00 ? 21  THR A CA   3  
ATOM 4207  C C    . THR A 1 21  ? 2.579   8.135   3.713   1.00 0.00 ? 21  THR A C    3  
ATOM 4208  O O    . THR A 1 21  ? 2.723   7.085   4.337   1.00 0.00 ? 21  THR A O    3  
ATOM 4209  C CB   . THR A 1 21  ? 2.490   8.297   1.161   1.00 0.00 ? 21  THR A CB   3  
ATOM 4210  O OG1  . THR A 1 21  ? 1.346   9.087   1.475   1.00 0.00 ? 21  THR A OG1  3  
ATOM 4211  C CG2  . THR A 1 21  ? 1.924   6.894   0.935   1.00 0.00 ? 21  THR A CG2  3  
ATOM 4212  H H    . THR A 1 21  ? 4.385   6.834   1.475   1.00 0.00 ? 21  THR A H    3  
ATOM 4213  H HA   . THR A 1 21  ? 3.794   9.378   2.494   1.00 0.00 ? 21  THR A HA   3  
ATOM 4214  H HB   . THR A 1 21  ? 3.039   8.642   0.285   1.00 0.00 ? 21  THR A HB   3  
ATOM 4215  H HG1  . THR A 1 21  ? 1.631   9.993   1.785   1.00 0.00 ? 21  THR A HG1  3  
ATOM 4216  H HG21 . THR A 1 21  ? 2.711   6.156   1.084   1.00 0.00 ? 21  THR A HG21 3  
ATOM 4217  H HG22 . THR A 1 21  ? 1.114   6.710   1.641   1.00 0.00 ? 21  THR A HG22 3  
ATOM 4218  H HG23 . THR A 1 21  ? 1.542   6.817   -0.084  1.00 0.00 ? 21  THR A HG23 3  
ATOM 4219  N N    . LYS A 1 22  ? 1.771   9.119   4.076   1.00 0.00 ? 22  LYS A N    3  
ATOM 4220  C CA   . LYS A 1 22  ? 0.969   9.022   5.284   1.00 0.00 ? 22  LYS A CA   3  
ATOM 4221  C C    . LYS A 1 22  ? -0.512  9.144   4.919   1.00 0.00 ? 22  LYS A C    3  
ATOM 4222  O O    . LYS A 1 22  ? -0.936  10.154  4.360   1.00 0.00 ? 22  LYS A O    3  
ATOM 4223  C CB   . LYS A 1 22  ? 1.433   10.048  6.319   1.00 0.00 ? 22  LYS A CB   3  
ATOM 4224  C CG   . LYS A 1 22  ? 1.156   11.475  5.840   1.00 0.00 ? 22  LYS A CG   3  
ATOM 4225  C CD   . LYS A 1 22  ? 1.451   12.492  6.946   1.00 0.00 ? 22  LYS A CD   3  
ATOM 4226  C CE   . LYS A 1 22  ? 0.798   12.072  8.265   1.00 0.00 ? 22  LYS A CE   3  
ATOM 4227  N NZ   . LYS A 1 22  ? 0.822   13.190  9.233   1.00 0.00 ? 22  LYS A NZ   3  
ATOM 4228  H H    . LYS A 1 22  ? 1.659   9.970   3.563   1.00 0.00 ? 22  LYS A H    3  
ATOM 4229  H HA   . LYS A 1 22  ? 1.139   8.034   5.711   1.00 0.00 ? 22  LYS A HA   3  
ATOM 4230  H HB2  . LYS A 1 22  ? 0.922   9.873   7.266   1.00 0.00 ? 22  LYS A HB2  3  
ATOM 4231  H HB3  . LYS A 1 22  ? 2.500   9.925   6.506   1.00 0.00 ? 22  LYS A HB3  3  
ATOM 4232  H HG2  . LYS A 1 22  ? 1.770   11.695  4.967   1.00 0.00 ? 22  LYS A HG2  3  
ATOM 4233  H HG3  . LYS A 1 22  ? 0.115   11.562  5.530   1.00 0.00 ? 22  LYS A HG3  3  
ATOM 4234  H HD2  . LYS A 1 22  ? 2.528   12.584  7.082   1.00 0.00 ? 22  LYS A HD2  3  
ATOM 4235  H HD3  . LYS A 1 22  ? 1.082   13.473  6.649   1.00 0.00 ? 22  LYS A HD3  3  
ATOM 4236  H HE2  . LYS A 1 22  ? -0.230  11.759  8.086   1.00 0.00 ? 22  LYS A HE2  3  
ATOM 4237  H HE3  . LYS A 1 22  ? 1.325   11.212  8.680   1.00 0.00 ? 22  LYS A HE3  3  
ATOM 4238  H HZ1  . LYS A 1 22  ? 1.475   13.883  8.926   1.00 0.00 ? 22  LYS A HZ1  3  
ATOM 4239  H HZ2  . LYS A 1 22  ? -0.090  13.597  9.295   1.00 0.00 ? 22  LYS A HZ2  3  
ATOM 4240  H HZ3  . LYS A 1 22  ? 1.096   12.848  10.132  1.00 0.00 ? 22  LYS A HZ3  3  
ATOM 4241  N N    . ALA A 1 23  ? -1.258  8.100   5.251   1.00 0.00 ? 23  ALA A N    3  
ATOM 4242  C CA   . ALA A 1 23  ? -2.682  8.077   4.965   1.00 0.00 ? 23  ALA A CA   3  
ATOM 4243  C C    . ALA A 1 23  ? -3.451  8.592   6.184   1.00 0.00 ? 23  ALA A C    3  
ATOM 4244  O O    . ALA A 1 23  ? -3.609  7.875   7.171   1.00 0.00 ? 23  ALA A O    3  
ATOM 4245  C CB   . ALA A 1 23  ? -3.101  6.660   4.568   1.00 0.00 ? 23  ALA A CB   3  
ATOM 4246  H H    . ALA A 1 23  ? -0.905  7.283   5.705   1.00 0.00 ? 23  ALA A H    3  
ATOM 4247  H HA   . ALA A 1 23  ? -2.863  8.746   4.123   1.00 0.00 ? 23  ALA A HA   3  
ATOM 4248  H HB1  . ALA A 1 23  ? -2.526  6.341   3.699   1.00 0.00 ? 23  ALA A HB1  3  
ATOM 4249  H HB2  . ALA A 1 23  ? -2.911  5.979   5.398   1.00 0.00 ? 23  ALA A HB2  3  
ATOM 4250  H HB3  . ALA A 1 23  ? -4.163  6.650   4.324   1.00 0.00 ? 23  ALA A HB3  3  
ATOM 4251  N N    . VAL A 1 24  ? -3.908  9.830   6.075   1.00 0.00 ? 24  VAL A N    3  
ATOM 4252  C CA   . VAL A 1 24  ? -4.656  10.450  7.156   1.00 0.00 ? 24  VAL A CA   3  
ATOM 4253  C C    . VAL A 1 24  ? -6.131  10.543  6.761   1.00 0.00 ? 24  VAL A C    3  
ATOM 4254  O O    . VAL A 1 24  ? -7.014  10.422  7.610   1.00 0.00 ? 24  VAL A O    3  
ATOM 4255  C CB   . VAL A 1 24  ? -4.044  11.808  7.505   1.00 0.00 ? 24  VAL A CB   3  
ATOM 4256  C CG1  . VAL A 1 24  ? -2.768  11.637  8.332   1.00 0.00 ? 24  VAL A CG1  3  
ATOM 4257  C CG2  . VAL A 1 24  ? -3.774  12.629  6.242   1.00 0.00 ? 24  VAL A CG2  3  
ATOM 4258  H H    . VAL A 1 24  ? -3.775  10.407  5.268   1.00 0.00 ? 24  VAL A H    3  
ATOM 4259  H HA   . VAL A 1 24  ? -4.567  9.804   8.029   1.00 0.00 ? 24  VAL A HA   3  
ATOM 4260  H HB   . VAL A 1 24  ? -4.767  12.355  8.112   1.00 0.00 ? 24  VAL A HB   3  
ATOM 4261  H HG11 . VAL A 1 24  ? -2.260  10.722  8.030   1.00 0.00 ? 24  VAL A HG11 3  
ATOM 4262  H HG12 . VAL A 1 24  ? -2.111  12.491  8.165   1.00 0.00 ? 24  VAL A HG12 3  
ATOM 4263  H HG13 . VAL A 1 24  ? -3.026  11.579  9.390   1.00 0.00 ? 24  VAL A HG13 3  
ATOM 4264  H HG21 . VAL A 1 24  ? -4.580  12.470  5.527   1.00 0.00 ? 24  VAL A HG21 3  
ATOM 4265  H HG22 . VAL A 1 24  ? -3.720  13.686  6.501   1.00 0.00 ? 24  VAL A HG22 3  
ATOM 4266  H HG23 . VAL A 1 24  ? -2.828  12.315  5.800   1.00 0.00 ? 24  VAL A HG23 3  
ATOM 4267  N N    . SER A 1 25  ? -6.354  10.757  5.473   1.00 0.00 ? 25  SER A N    3  
ATOM 4268  C CA   . SER A 1 25  ? -7.707  10.868  4.955   1.00 0.00 ? 25  SER A CA   3  
ATOM 4269  C C    . SER A 1 25  ? -7.992  9.719   3.985   1.00 0.00 ? 25  SER A C    3  
ATOM 4270  O O    . SER A 1 25  ? -7.072  9.037   3.539   1.00 0.00 ? 25  SER A O    3  
ATOM 4271  C CB   . SER A 1 25  ? -7.923  12.214  4.261   1.00 0.00 ? 25  SER A CB   3  
ATOM 4272  O OG   . SER A 1 25  ? -8.919  12.138  3.245   1.00 0.00 ? 25  SER A OG   3  
ATOM 4273  H H    . SER A 1 25  ? -5.630  10.855  4.789   1.00 0.00 ? 25  SER A H    3  
ATOM 4274  H HA   . SER A 1 25  ? -8.356  10.801  5.828   1.00 0.00 ? 25  SER A HA   3  
ATOM 4275  H HB2  . SER A 1 25  ? -8.217  12.960  5.001   1.00 0.00 ? 25  SER A HB2  3  
ATOM 4276  H HB3  . SER A 1 25  ? -6.984  12.551  3.824   1.00 0.00 ? 25  SER A HB3  3  
ATOM 4277  H HG   . SER A 1 25  ? -9.023  13.026  2.799   1.00 0.00 ? 25  SER A HG   3  
ATOM 4278  N N    . GLU A 1 26  ? -9.271  9.542   3.688   1.00 0.00 ? 26  GLU A N    3  
ATOM 4279  C CA   . GLU A 1 26  ? -9.689  8.489   2.779   1.00 0.00 ? 26  GLU A CA   3  
ATOM 4280  C C    . GLU A 1 26  ? -10.952 8.908   2.025   1.00 0.00 ? 26  GLU A C    3  
ATOM 4281  O O    . GLU A 1 26  ? -11.405 10.045  2.148   1.00 0.00 ? 26  GLU A O    3  
ATOM 4282  C CB   . GLU A 1 26  ? -9.909  7.174   3.528   1.00 0.00 ? 26  GLU A CB   3  
ATOM 4283  C CG   . GLU A 1 26  ? -8.580  6.460   3.787   1.00 0.00 ? 26  GLU A CG   3  
ATOM 4284  C CD   . GLU A 1 26  ? -8.176  6.570   5.258   1.00 0.00 ? 26  GLU A CD   3  
ATOM 4285  O OE1  . GLU A 1 26  ? -8.670  5.735   6.047   1.00 0.00 ? 26  GLU A OE1  3  
ATOM 4286  O OE2  . GLU A 1 26  ? -7.383  7.486   5.562   1.00 0.00 ? 26  GLU A OE2  3  
ATOM 4287  H H    . GLU A 1 26  ? -10.014 10.103  4.054   1.00 0.00 ? 26  GLU A H    3  
ATOM 4288  H HA   . GLU A 1 26  ? -8.863  8.366   2.078   1.00 0.00 ? 26  GLU A HA   3  
ATOM 4289  H HB2  . GLU A 1 26  ? -10.411 7.370   4.476   1.00 0.00 ? 26  GLU A HB2  3  
ATOM 4290  H HB3  . GLU A 1 26  ? -10.567 6.525   2.949   1.00 0.00 ? 26  GLU A HB3  3  
ATOM 4291  H HG2  . GLU A 1 26  ? -8.666  5.411   3.507   1.00 0.00 ? 26  GLU A HG2  3  
ATOM 4292  H HG3  . GLU A 1 26  ? -7.803  6.895   3.159   1.00 0.00 ? 26  GLU A HG3  3  
ATOM 4293  N N    . LYS A 1 27  ? -11.487 7.967   1.260   1.00 0.00 ? 27  LYS A N    3  
ATOM 4294  C CA   . LYS A 1 27  ? -12.689 8.225   0.486   1.00 0.00 ? 27  LYS A CA   3  
ATOM 4295  C C    . LYS A 1 27  ? -13.411 6.902   0.219   1.00 0.00 ? 27  LYS A C    3  
ATOM 4296  O O    . LYS A 1 27  ? -12.872 6.020   -0.450  1.00 0.00 ? 27  LYS A O    3  
ATOM 4297  C CB   . LYS A 1 27  ? -12.351 9.008   -0.784  1.00 0.00 ? 27  LYS A CB   3  
ATOM 4298  C CG   . LYS A 1 27  ? -13.619 9.370   -1.559  1.00 0.00 ? 27  LYS A CG   3  
ATOM 4299  C CD   . LYS A 1 27  ? -13.456 10.706  -2.287  1.00 0.00 ? 27  LYS A CD   3  
ATOM 4300  C CE   . LYS A 1 27  ? -12.083 10.801  -2.955  1.00 0.00 ? 27  LYS A CE   3  
ATOM 4301  N NZ   . LYS A 1 27  ? -12.036 11.955  -3.881  1.00 0.00 ? 27  LYS A NZ   3  
ATOM 4302  H H    . LYS A 1 27  ? -11.113 7.044   1.165   1.00 0.00 ? 27  LYS A H    3  
ATOM 4303  H HA   . LYS A 1 27  ? -13.339 8.856   1.091   1.00 0.00 ? 27  LYS A HA   3  
ATOM 4304  H HB2  . LYS A 1 27  ? -11.810 9.917   -0.522  1.00 0.00 ? 27  LYS A HB2  3  
ATOM 4305  H HB3  . LYS A 1 27  ? -11.690 8.415   -1.417  1.00 0.00 ? 27  LYS A HB3  3  
ATOM 4306  H HG2  . LYS A 1 27  ? -13.846 8.584   -2.280  1.00 0.00 ? 27  LYS A HG2  3  
ATOM 4307  H HG3  . LYS A 1 27  ? -14.465 9.427   -0.873  1.00 0.00 ? 27  LYS A HG3  3  
ATOM 4308  H HD2  . LYS A 1 27  ? -14.239 10.813  -3.037  1.00 0.00 ? 27  LYS A HD2  3  
ATOM 4309  H HD3  . LYS A 1 27  ? -13.578 11.526  -1.579  1.00 0.00 ? 27  LYS A HD3  3  
ATOM 4310  H HE2  . LYS A 1 27  ? -11.308 10.904  -2.196  1.00 0.00 ? 27  LYS A HE2  3  
ATOM 4311  H HE3  . LYS A 1 27  ? -11.873 9.881   -3.501  1.00 0.00 ? 27  LYS A HE3  3  
ATOM 4312  H HZ1  . LYS A 1 27  ? -12.427 12.758  -3.431  1.00 0.00 ? 27  LYS A HZ1  3  
ATOM 4313  H HZ2  . LYS A 1 27  ? -11.086 12.143  -4.132  1.00 0.00 ? 27  LYS A HZ2  3  
ATOM 4314  H HZ3  . LYS A 1 27  ? -12.563 11.743  -4.704  1.00 0.00 ? 27  LYS A HZ3  3  
ATOM 4315  N N    . GLU A 1 28  ? -14.619 6.805   0.754   1.00 0.00 ? 28  GLU A N    3  
ATOM 4316  C CA   . GLU A 1 28  ? -15.420 5.606   0.582   1.00 0.00 ? 28  GLU A CA   3  
ATOM 4317  C C    . GLU A 1 28  ? -16.046 5.582   -0.815  1.00 0.00 ? 28  GLU A C    3  
ATOM 4318  O O    . GLU A 1 28  ? -17.131 6.123   -1.021  1.00 0.00 ? 28  GLU A O    3  
ATOM 4319  C CB   . GLU A 1 28  ? -16.495 5.503   1.666   1.00 0.00 ? 28  GLU A CB   3  
ATOM 4320  C CG   . GLU A 1 28  ? -17.462 4.354   1.373   1.00 0.00 ? 28  GLU A CG   3  
ATOM 4321  C CD   . GLU A 1 28  ? -18.825 4.607   2.019   1.00 0.00 ? 28  GLU A CD   3  
ATOM 4322  O OE1  . GLU A 1 28  ? -19.633 5.316   1.381   1.00 0.00 ? 28  GLU A OE1  3  
ATOM 4323  O OE2  . GLU A 1 28  ? -19.030 4.085   3.137   1.00 0.00 ? 28  GLU A OE2  3  
ATOM 4324  H H    . GLU A 1 28  ? -15.050 7.527   1.296   1.00 0.00 ? 28  GLU A H    3  
ATOM 4325  H HA   . GLU A 1 28  ? -14.724 4.773   0.689   1.00 0.00 ? 28  GLU A HA   3  
ATOM 4326  H HB2  . GLU A 1 28  ? -16.023 5.348   2.636   1.00 0.00 ? 28  GLU A HB2  3  
ATOM 4327  H HB3  . GLU A 1 28  ? -17.046 6.441   1.726   1.00 0.00 ? 28  GLU A HB3  3  
ATOM 4328  H HG2  . GLU A 1 28  ? -17.581 4.240   0.295   1.00 0.00 ? 28  GLU A HG2  3  
ATOM 4329  H HG3  . GLU A 1 28  ? -17.045 3.419   1.749   1.00 0.00 ? 28  GLU A HG3  3  
ATOM 4330  N N    . VAL A 1 29  ? -15.336 4.948   -1.737  1.00 0.00 ? 29  VAL A N    3  
ATOM 4331  C CA   . VAL A 1 29  ? -15.808 4.846   -3.106  1.00 0.00 ? 29  VAL A CA   3  
ATOM 4332  C C    . VAL A 1 29  ? -16.346 3.435   -3.352  1.00 0.00 ? 29  VAL A C    3  
ATOM 4333  O O    . VAL A 1 29  ? -15.609 2.458   -3.233  1.00 0.00 ? 29  VAL A O    3  
ATOM 4334  C CB   . VAL A 1 29  ? -14.691 5.238   -4.075  1.00 0.00 ? 29  VAL A CB   3  
ATOM 4335  C CG1  . VAL A 1 29  ? -14.348 6.724   -3.945  1.00 0.00 ? 29  VAL A CG1  3  
ATOM 4336  C CG2  . VAL A 1 29  ? -13.451 4.368   -3.864  1.00 0.00 ? 29  VAL A CG2  3  
ATOM 4337  H H    . VAL A 1 29  ? -14.455 4.510   -1.560  1.00 0.00 ? 29  VAL A H    3  
ATOM 4338  H HA   . VAL A 1 29  ? -16.625 5.559   -3.227  1.00 0.00 ? 29  VAL A HA   3  
ATOM 4339  H HB   . VAL A 1 29  ? -15.052 5.066   -5.090  1.00 0.00 ? 29  VAL A HB   3  
ATOM 4340  H HG11 . VAL A 1 29  ? -15.230 7.273   -3.614  1.00 0.00 ? 29  VAL A HG11 3  
ATOM 4341  H HG12 . VAL A 1 29  ? -13.548 6.848   -3.216  1.00 0.00 ? 29  VAL A HG12 3  
ATOM 4342  H HG13 . VAL A 1 29  ? -14.022 7.108   -4.911  1.00 0.00 ? 29  VAL A HG13 3  
ATOM 4343  H HG21 . VAL A 1 29  ? -13.728 3.317   -3.938  1.00 0.00 ? 29  VAL A HG21 3  
ATOM 4344  H HG22 . VAL A 1 29  ? -12.708 4.604   -4.625  1.00 0.00 ? 29  VAL A HG22 3  
ATOM 4345  H HG23 . VAL A 1 29  ? -13.034 4.565   -2.876  1.00 0.00 ? 29  VAL A HG23 3  
ATOM 4346  N N    . ASP A 1 30  ? -17.625 3.375   -3.691  1.00 0.00 ? 30  ASP A N    3  
ATOM 4347  C CA   . ASP A 1 30  ? -18.270 2.100   -3.956  1.00 0.00 ? 30  ASP A CA   3  
ATOM 4348  C C    . ASP A 1 30  ? -17.588 1.426   -5.148  1.00 0.00 ? 30  ASP A C    3  
ATOM 4349  O O    . ASP A 1 30  ? -16.940 2.091   -5.954  1.00 0.00 ? 30  ASP A O    3  
ATOM 4350  C CB   . ASP A 1 30  ? -19.748 2.291   -4.302  1.00 0.00 ? 30  ASP A CB   3  
ATOM 4351  C CG   . ASP A 1 30  ? -20.705 2.218   -3.112  1.00 0.00 ? 30  ASP A CG   3  
ATOM 4352  O OD1  . ASP A 1 30  ? -20.892 1.093   -2.601  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 4353  O OD2  . ASP A 1 30  ? -21.230 3.291   -2.739  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 4354  H H    . ASP A 1 30  ? -18.217 4.175   -3.786  1.00 0.00 ? 30  ASP A H    3  
ATOM 4355  H HA   . ASP A 1 30  ? -18.161 1.528   -3.034  1.00 0.00 ? 30  ASP A HA   3  
ATOM 4356  H HB2  . ASP A 1 30  ? -19.869 3.258   -4.789  1.00 0.00 ? 30  ASP A HB2  3  
ATOM 4357  H HB3  . ASP A 1 30  ? -20.037 1.531   -5.029  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 4358  N N    . SER A 1 31  ? -17.758 0.114   -5.222  1.00 0.00 ? 31  SER A N    3  
ATOM 4359  C CA   . SER A 1 31  ? -17.167 -0.657  -6.303  1.00 0.00 ? 31  SER A CA   3  
ATOM 4360  C C    . SER A 1 31  ? -18.095 -1.810  -6.690  1.00 0.00 ? 31  SER A C    3  
ATOM 4361  O O    . SER A 1 31  ? -17.661 -2.777  -7.315  1.00 0.00 ? 31  SER A O    3  
ATOM 4362  C CB   . SER A 1 31  ? -15.790 -1.194  -5.907  1.00 0.00 ? 31  SER A CB   3  
ATOM 4363  O OG   . SER A 1 31  ? -15.489 -2.425  -6.558  1.00 0.00 ? 31  SER A OG   3  
ATOM 4364  H H    . SER A 1 31  ? -18.286 -0.420  -4.562  1.00 0.00 ? 31  SER A H    3  
ATOM 4365  H HA   . SER A 1 31  ? -17.058 0.042   -7.130  1.00 0.00 ? 31  SER A HA   3  
ATOM 4366  H HB2  . SER A 1 31  ? -15.027 -0.457  -6.155  1.00 0.00 ? 31  SER A HB2  3  
ATOM 4367  H HB3  . SER A 1 31  ? -15.753 -1.338  -4.827  1.00 0.00 ? 31  SER A HB3  3  
ATOM 4368  H HG   . SER A 1 31  ? -15.846 -2.414  -7.492  1.00 0.00 ? 31  SER A HG   3  
ATOM 4369  N N    . GLY A 1 32  ? -19.354 -1.670  -6.304  1.00 0.00 ? 32  GLY A N    3  
ATOM 4370  C CA   . GLY A 1 32  ? -20.346 -2.687  -6.605  1.00 0.00 ? 32  GLY A CA   3  
ATOM 4371  C C    . GLY A 1 32  ? -20.164 -3.913  -5.707  1.00 0.00 ? 32  GLY A C    3  
ATOM 4372  O O    . GLY A 1 32  ? -19.240 -3.962  -4.897  1.00 0.00 ? 32  GLY A O    3  
ATOM 4373  H H    . GLY A 1 32  ? -19.698 -0.880  -5.797  1.00 0.00 ? 32  GLY A H    3  
ATOM 4374  H HA2  . GLY A 1 32  ? -21.347 -2.277  -6.467  1.00 0.00 ? 32  GLY A HA2  3  
ATOM 4375  H HA3  . GLY A 1 32  ? -20.265 -2.984  -7.650  1.00 0.00 ? 32  GLY A HA3  3  
ATOM 4376  N N    . ASN A 1 33  ? -21.059 -4.874  -5.882  1.00 0.00 ? 33  ASN A N    3  
ATOM 4377  C CA   . ASN A 1 33  ? -21.009 -6.095  -5.097  1.00 0.00 ? 33  ASN A CA   3  
ATOM 4378  C C    . ASN A 1 33  ? -20.040 -7.079  -5.756  1.00 0.00 ? 33  ASN A C    3  
ATOM 4379  O O    . ASN A 1 33  ? -19.687 -6.922  -6.923  1.00 0.00 ? 33  ASN A O    3  
ATOM 4380  C CB   . ASN A 1 33  ? -22.385 -6.762  -5.028  1.00 0.00 ? 33  ASN A CB   3  
ATOM 4381  C CG   . ASN A 1 33  ? -23.490 -5.722  -4.836  1.00 0.00 ? 33  ASN A CG   3  
ATOM 4382  O OD1  . ASN A 1 33  ? -24.115 -5.262  -5.776  1.00 0.00 ? 33  ASN A OD1  3  
ATOM 4383  N ND2  . ASN A 1 33  ? -23.694 -5.379  -3.568  1.00 0.00 ? 33  ASN A ND2  3  
ATOM 4384  H H    . ASN A 1 33  ? -21.809 -4.827  -6.543  1.00 0.00 ? 33  ASN A H    3  
ATOM 4385  H HA   . ASN A 1 33  ? -20.680 -5.786  -4.106  1.00 0.00 ? 33  ASN A HA   3  
ATOM 4386  H HB2  . ASN A 1 33  ? -22.566 -7.327  -5.943  1.00 0.00 ? 33  ASN A HB2  3  
ATOM 4387  H HB3  . ASN A 1 33  ? -22.405 -7.477  -4.204  1.00 0.00 ? 33  ASN A HB3  3  
ATOM 4388  H HD21 . ASN A 1 33  ? -23.145 -5.794  -2.842  1.00 0.00 ? 33  ASN A HD21 3  
ATOM 4389  H HD22 . ASN A 1 33  ? -24.397 -4.705  -3.339  1.00 0.00 ? 33  ASN A HD22 3  
ATOM 4390  N N    . ASP A 1 34  ? -19.635 -8.072  -4.977  1.00 0.00 ? 34  ASP A N    3  
ATOM 4391  C CA   . ASP A 1 34  ? -18.712 -9.081  -5.470  1.00 0.00 ? 34  ASP A CA   3  
ATOM 4392  C C    . ASP A 1 34  ? -19.506 -10.282 -5.988  1.00 0.00 ? 34  ASP A C    3  
ATOM 4393  O O    . ASP A 1 34  ? -20.698 -10.167 -6.270  1.00 0.00 ? 34  ASP A O    3  
ATOM 4394  C CB   . ASP A 1 34  ? -17.786 -9.571  -4.356  1.00 0.00 ? 34  ASP A CB   3  
ATOM 4395  C CG   . ASP A 1 34  ? -16.401 -10.028 -4.820  1.00 0.00 ? 34  ASP A CG   3  
ATOM 4396  O OD1  . ASP A 1 34  ? -15.880 -9.392  -5.761  1.00 0.00 ? 34  ASP A OD1  3  
ATOM 4397  O OD2  . ASP A 1 34  ? -15.895 -11.002 -4.223  1.00 0.00 ? 34  ASP A OD2  3  
ATOM 4398  H H    . ASP A 1 34  ? -19.925 -8.193  -4.028  1.00 0.00 ? 34  ASP A H    3  
ATOM 4399  H HA   . ASP A 1 34  ? -18.142 -8.587  -6.257  1.00 0.00 ? 34  ASP A HA   3  
ATOM 4400  H HB2  . ASP A 1 34  ? -17.662 -8.770  -3.627  1.00 0.00 ? 34  ASP A HB2  3  
ATOM 4401  H HB3  . ASP A 1 34  ? -18.271 -10.400 -3.839  1.00 0.00 ? 34  ASP A HB3  3  
ATOM 4402  N N    . ILE A 1 35  ? -18.814 -11.406 -6.097  1.00 0.00 ? 35  ILE A N    3  
ATOM 4403  C CA   . ILE A 1 35  ? -19.439 -12.627 -6.576  1.00 0.00 ? 35  ILE A CA   3  
ATOM 4404  C C    . ILE A 1 35  ? -20.207 -13.286 -5.428  1.00 0.00 ? 35  ILE A C    3  
ATOM 4405  O O    . ILE A 1 35  ? -20.808 -14.344 -5.605  1.00 0.00 ? 35  ILE A O    3  
ATOM 4406  C CB   . ILE A 1 35  ? -18.398 -13.543 -7.225  1.00 0.00 ? 35  ILE A CB   3  
ATOM 4407  C CG1  . ILE A 1 35  ? -17.655 -12.817 -8.349  1.00 0.00 ? 35  ILE A CG1  3  
ATOM 4408  C CG2  . ILE A 1 35  ? -19.040 -14.845 -7.710  1.00 0.00 ? 35  ILE A CG2  3  
ATOM 4409  C CD1  . ILE A 1 35  ? -16.701 -11.764 -7.783  1.00 0.00 ? 35  ILE A CD1  3  
ATOM 4410  H H    . ILE A 1 35  ? -17.845 -11.490 -5.865  1.00 0.00 ? 35  ILE A H    3  
ATOM 4411  H HA   . ILE A 1 35  ? -20.150 -12.347 -7.352  1.00 0.00 ? 35  ILE A HA   3  
ATOM 4412  H HB   . ILE A 1 35  ? -17.660 -13.810 -6.470  1.00 0.00 ? 35  ILE A HB   3  
ATOM 4413  H HG12 . ILE A 1 35  ? -17.094 -13.539 -8.942  1.00 0.00 ? 35  ILE A HG12 3  
ATOM 4414  H HG13 . ILE A 1 35  ? -18.372 -12.343 -9.017  1.00 0.00 ? 35  ILE A HG13 3  
ATOM 4415  H HG21 . ILE A 1 35  ? -20.106 -14.683 -7.879  1.00 0.00 ? 35  ILE A HG21 3  
ATOM 4416  H HG22 . ILE A 1 35  ? -18.569 -15.158 -8.641  1.00 0.00 ? 35  ILE A HG22 3  
ATOM 4417  H HG23 . ILE A 1 35  ? -18.905 -15.619 -6.954  1.00 0.00 ? 35  ILE A HG23 3  
ATOM 4418  H HD11 . ILE A 1 35  ? -16.298 -12.111 -6.832  1.00 0.00 ? 35  ILE A HD11 3  
ATOM 4419  H HD12 . ILE A 1 35  ? -15.884 -11.599 -8.485  1.00 0.00 ? 35  ILE A HD12 3  
ATOM 4420  H HD13 . ILE A 1 35  ? -17.242 -10.830 -7.629  1.00 0.00 ? 35  ILE A HD13 3  
ATOM 4421  N N    . TYR A 1 36  ? -20.163 -12.631 -4.277  1.00 0.00 ? 36  TYR A N    3  
ATOM 4422  C CA   . TYR A 1 36  ? -20.848 -13.140 -3.101  1.00 0.00 ? 36  TYR A CA   3  
ATOM 4423  C C    . TYR A 1 36  ? -22.072 -12.285 -2.767  1.00 0.00 ? 36  TYR A C    3  
ATOM 4424  O O    . TYR A 1 36  ? -22.781 -12.561 -1.800  1.00 0.00 ? 36  TYR A O    3  
ATOM 4425  C CB   . TYR A 1 36  ? -19.843 -13.040 -1.952  1.00 0.00 ? 36  TYR A CB   3  
ATOM 4426  C CG   . TYR A 1 36  ? -20.014 -14.119 -0.880  1.00 0.00 ? 36  TYR A CG   3  
ATOM 4427  C CD1  . TYR A 1 36  ? -19.966 -15.453 -1.231  1.00 0.00 ? 36  TYR A CD1  3  
ATOM 4428  C CD2  . TYR A 1 36  ? -20.214 -13.758 0.437   1.00 0.00 ? 36  TYR A CD2  3  
ATOM 4429  C CE1  . TYR A 1 36  ? -20.127 -16.468 -0.222  1.00 0.00 ? 36  TYR A CE1  3  
ATOM 4430  C CE2  . TYR A 1 36  ? -20.374 -14.774 1.445   1.00 0.00 ? 36  TYR A CE2  3  
ATOM 4431  C CZ   . TYR A 1 36  ? -20.324 -16.078 1.066   1.00 0.00 ? 36  TYR A CZ   3  
ATOM 4432  O OH   . TYR A 1 36  ? -20.475 -17.037 2.018   1.00 0.00 ? 36  TYR A OH   3  
ATOM 4433  H H    . TYR A 1 36  ? -19.672 -11.771 -4.141  1.00 0.00 ? 36  TYR A H    3  
ATOM 4434  H HA   . TYR A 1 36  ? -21.172 -14.158 -3.314  1.00 0.00 ? 36  TYR A HA   3  
ATOM 4435  H HB2  . TYR A 1 36  ? -18.834 -13.104 -2.359  1.00 0.00 ? 36  TYR A HB2  3  
ATOM 4436  H HB3  . TYR A 1 36  ? -19.937 -12.060 -1.484  1.00 0.00 ? 36  TYR A HB3  3  
ATOM 4437  H HD1  . TYR A 1 36  ? -19.808 -15.738 -2.270  1.00 0.00 ? 36  TYR A HD1  3  
ATOM 4438  H HD2  . TYR A 1 36  ? -20.251 -12.704 0.713   1.00 0.00 ? 36  TYR A HD2  3  
ATOM 4439  H HE1  . TYR A 1 36  ? -20.092 -17.526 -0.485  1.00 0.00 ? 36  TYR A HE1  3  
ATOM 4440  H HE2  . TYR A 1 36  ? -20.534 -14.501 2.488   1.00 0.00 ? 36  TYR A HE2  3  
ATOM 4441  H HH   . TYR A 1 36  ? -20.425 -17.945 1.601   1.00 0.00 ? 36  TYR A HH   3  
ATOM 4442  N N    . GLY A 1 37  ? -22.282 -11.265 -3.585  1.00 0.00 ? 37  GLY A N    3  
ATOM 4443  C CA   . GLY A 1 37  ? -23.409 -10.368 -3.388  1.00 0.00 ? 37  GLY A CA   3  
ATOM 4444  C C    . GLY A 1 37  ? -23.052 -9.244  -2.413  1.00 0.00 ? 37  GLY A C    3  
ATOM 4445  O O    . GLY A 1 37  ? -23.822 -8.301  -2.239  1.00 0.00 ? 37  GLY A O    3  
ATOM 4446  H H    . GLY A 1 37  ? -21.701 -11.047 -4.368  1.00 0.00 ? 37  GLY A H    3  
ATOM 4447  H HA2  . GLY A 1 37  ? -23.710 -9.942  -4.345  1.00 0.00 ? 37  GLY A HA2  3  
ATOM 4448  H HA3  . GLY A 1 37  ? -24.262 -10.928 -3.006  1.00 0.00 ? 37  GLY A HA3  3  
ATOM 4449  N N    . ASN A 1 38  ? -21.884 -9.383  -1.802  1.00 0.00 ? 38  ASN A N    3  
ATOM 4450  C CA   . ASN A 1 38  ? -21.415 -8.392  -0.849  1.00 0.00 ? 38  ASN A CA   3  
ATOM 4451  C C    . ASN A 1 38  ? -20.858 -7.185  -1.607  1.00 0.00 ? 38  ASN A C    3  
ATOM 4452  O O    . ASN A 1 38  ? -20.405 -7.316  -2.743  1.00 0.00 ? 38  ASN A O    3  
ATOM 4453  C CB   . ASN A 1 38  ? -20.296 -8.956  0.028   1.00 0.00 ? 38  ASN A CB   3  
ATOM 4454  C CG   . ASN A 1 38  ? -19.262 -9.703  -0.817  1.00 0.00 ? 38  ASN A CG   3  
ATOM 4455  O OD1  . ASN A 1 38  ? -19.466 -9.989  -1.985  1.00 0.00 ? 38  ASN A OD1  3  
ATOM 4456  N ND2  . ASN A 1 38  ? -18.142 -10.001 -0.163  1.00 0.00 ? 38  ASN A ND2  3  
ATOM 4457  H H    . ASN A 1 38  ? -21.264 -10.154 -1.950  1.00 0.00 ? 38  ASN A H    3  
ATOM 4458  H HA   . ASN A 1 38  ? -22.288 -8.140  -0.246  1.00 0.00 ? 38  ASN A HA   3  
ATOM 4459  H HB2  . ASN A 1 38  ? -19.812 -8.146  0.572   1.00 0.00 ? 38  ASN A HB2  3  
ATOM 4460  H HB3  . ASN A 1 38  ? -20.718 -9.632  0.773   1.00 0.00 ? 38  ASN A HB3  3  
ATOM 4461  H HD21 . ASN A 1 38  ? -18.039 -9.737  0.796   1.00 0.00 ? 38  ASN A HD21 3  
ATOM 4462  H HD22 . ASN A 1 38  ? -17.406 -10.489 -0.630  1.00 0.00 ? 38  ASN A HD22 3  
ATOM 4463  N N    . PRO A 1 39  ? -20.914 -6.006  -0.930  1.00 0.00 ? 39  PRO A N    3  
ATOM 4464  C CA   . PRO A 1 39  ? -20.421 -4.777  -1.528  1.00 0.00 ? 39  PRO A CA   3  
ATOM 4465  C C    . PRO A 1 39  ? -18.891 -4.744  -1.531  1.00 0.00 ? 39  PRO A C    3  
ATOM 4466  O O    . PRO A 1 39  ? -18.259 -4.983  -0.503  1.00 0.00 ? 39  PRO A O    3  
ATOM 4467  C CB   . PRO A 1 39  ? -21.037 -3.662  -0.699  1.00 0.00 ? 39  PRO A CB   3  
ATOM 4468  C CG   . PRO A 1 39  ? -21.473 -4.306  0.607   1.00 0.00 ? 39  PRO A CG   3  
ATOM 4469  C CD   . PRO A 1 39  ? -21.445 -5.814  0.416   1.00 0.00 ? 39  PRO A CD   3  
ATOM 4470  H HA   . PRO A 1 39  ? -20.697 -4.722  -2.488  1.00 0.00 ? 39  PRO A HA   3  
ATOM 4471  H HB2  . PRO A 1 39  ? -20.315 -2.865  -0.519  1.00 0.00 ? 39  PRO A HB2  3  
ATOM 4472  H HB3  . PRO A 1 39  ? -21.885 -3.214  -1.216  1.00 0.00 ? 39  PRO A HB3  3  
ATOM 4473  H HG2  . PRO A 1 39  ? -20.809 -4.011  1.419   1.00 0.00 ? 39  PRO A HG2  3  
ATOM 4474  H HG3  . PRO A 1 39  ? -22.476 -3.975  0.880   1.00 0.00 ? 39  PRO A HG3  3  
ATOM 4475  H HD2  . PRO A 1 39  ? -20.813 -6.295  1.163   1.00 0.00 ? 39  PRO A HD2  3  
ATOM 4476  H HD3  . PRO A 1 39  ? -22.441 -6.244  0.514   1.00 0.00 ? 39  PRO A HD3  3  
ATOM 4477  N N    . ILE A 1 40  ? -18.340 -4.447  -2.698  1.00 0.00 ? 40  ILE A N    3  
ATOM 4478  C CA   . ILE A 1 40  ? -16.895 -4.380  -2.849  1.00 0.00 ? 40  ILE A CA   3  
ATOM 4479  C C    . ILE A 1 40  ? -16.353 -3.222  -2.009  1.00 0.00 ? 40  ILE A C    3  
ATOM 4480  O O    . ILE A 1 40  ? -15.826 -3.436  -0.918  1.00 0.00 ? 40  ILE A O    3  
ATOM 4481  C CB   . ILE A 1 40  ? -16.515 -4.297  -4.328  1.00 0.00 ? 40  ILE A CB   3  
ATOM 4482  C CG1  . ILE A 1 40  ? -16.897 -5.582  -5.066  1.00 0.00 ? 40  ILE A CG1  3  
ATOM 4483  C CG2  . ILE A 1 40  ? -15.031 -3.961  -4.494  1.00 0.00 ? 40  ILE A CG2  3  
ATOM 4484  C CD1  . ILE A 1 40  ? -16.428 -5.539  -6.522  1.00 0.00 ? 40  ILE A CD1  3  
ATOM 4485  H H    . ILE A 1 40  ? -18.861 -4.254  -3.530  1.00 0.00 ? 40  ILE A H    3  
ATOM 4486  H HA   . ILE A 1 40  ? -16.483 -5.311  -2.461  1.00 0.00 ? 40  ILE A HA   3  
ATOM 4487  H HB   . ILE A 1 40  ? -17.082 -3.485  -4.783  1.00 0.00 ? 40  ILE A HB   3  
ATOM 4488  H HG12 . ILE A 1 40  ? -16.452 -6.441  -4.561  1.00 0.00 ? 40  ILE A HG12 3  
ATOM 4489  H HG13 . ILE A 1 40  ? -17.977 -5.718  -5.032  1.00 0.00 ? 40  ILE A HG13 3  
ATOM 4490  H HG21 . ILE A 1 40  ? -14.438 -4.602  -3.843  1.00 0.00 ? 40  ILE A HG21 3  
ATOM 4491  H HG22 . ILE A 1 40  ? -14.736 -4.122  -5.531  1.00 0.00 ? 40  ILE A HG22 3  
ATOM 4492  H HG23 . ILE A 1 40  ? -14.864 -2.917  -4.227  1.00 0.00 ? 40  ILE A HG23 3  
ATOM 4493  H HD11 . ILE A 1 40  ? -16.392 -4.504  -6.861  1.00 0.00 ? 40  ILE A HD11 3  
ATOM 4494  H HD12 . ILE A 1 40  ? -15.435 -5.980  -6.597  1.00 0.00 ? 40  ILE A HD12 3  
ATOM 4495  H HD13 . ILE A 1 40  ? -17.124 -6.102  -7.144  1.00 0.00 ? 40  ILE A HD13 3  
ATOM 4496  N N    . LYS A 1 41  ? -16.502 -2.020  -2.548  1.00 0.00 ? 41  LYS A N    3  
ATOM 4497  C CA   . LYS A 1 41  ? -16.033 -0.829  -1.861  1.00 0.00 ? 41  LYS A CA   3  
ATOM 4498  C C    . LYS A 1 41  ? -14.503 -0.824  -1.845  1.00 0.00 ? 41  LYS A C    3  
ATOM 4499  O O    . LYS A 1 41  ? -13.880 -1.781  -1.390  1.00 0.00 ? 41  LYS A O    3  
ATOM 4500  C CB   . LYS A 1 41  ? -16.663 -0.729  -0.470  1.00 0.00 ? 41  LYS A CB   3  
ATOM 4501  C CG   . LYS A 1 41  ? -16.210 0.544   0.247   1.00 0.00 ? 41  LYS A CG   3  
ATOM 4502  C CD   . LYS A 1 41  ? -16.931 1.773   -0.311  1.00 0.00 ? 41  LYS A CD   3  
ATOM 4503  C CE   . LYS A 1 41  ? -18.386 1.815   0.156   1.00 0.00 ? 41  LYS A CE   3  
ATOM 4504  N NZ   . LYS A 1 41  ? -19.161 2.786   -0.647  1.00 0.00 ? 41  LYS A NZ   3  
ATOM 4505  H H    . LYS A 1 41  ? -16.933 -1.855  -3.435  1.00 0.00 ? 41  LYS A H    3  
ATOM 4506  H HA   . LYS A 1 41  ? -16.376 0.033   -2.433  1.00 0.00 ? 41  LYS A HA   3  
ATOM 4507  H HB2  . LYS A 1 41  ? -17.750 -0.736  -0.557  1.00 0.00 ? 41  LYS A HB2  3  
ATOM 4508  H HB3  . LYS A 1 41  ? -16.387 -1.602  0.121   1.00 0.00 ? 41  LYS A HB3  3  
ATOM 4509  H HG2  . LYS A 1 41  ? -16.409 0.455   1.314   1.00 0.00 ? 41  LYS A HG2  3  
ATOM 4510  H HG3  . LYS A 1 41  ? -15.133 0.666   0.133   1.00 0.00 ? 41  LYS A HG3  3  
ATOM 4511  H HD2  . LYS A 1 41  ? -16.415 2.678   0.011   1.00 0.00 ? 41  LYS A HD2  3  
ATOM 4512  H HD3  . LYS A 1 41  ? -16.895 1.757   -1.401  1.00 0.00 ? 41  LYS A HD3  3  
ATOM 4513  H HE2  . LYS A 1 41  ? -18.832 0.823   0.068   1.00 0.00 ? 41  LYS A HE2  3  
ATOM 4514  H HE3  . LYS A 1 41  ? -18.428 2.090   1.210   1.00 0.00 ? 41  LYS A HE3  3  
ATOM 4515  H HZ1  . LYS A 1 41  ? -18.638 3.039   -1.461  1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 4516  H HZ2  . LYS A 1 41  ? -20.029 2.373   -0.924  1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 4517  H HZ3  . LYS A 1 41  ? -19.341 3.603   -0.100  1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 4518  N N    . ARG A 1 42  ? -13.942 0.266   -2.348  1.00 0.00 ? 42  ARG A N    3  
ATOM 4519  C CA   . ARG A 1 42  ? -12.497 0.409   -2.397  1.00 0.00 ? 42  ARG A CA   3  
ATOM 4520  C C    . ARG A 1 42  ? -12.078 1.765   -1.824  1.00 0.00 ? 42  ARG A C    3  
ATOM 4521  O O    . ARG A 1 42  ? -11.558 2.614   -2.546  1.00 0.00 ? 42  ARG A O    3  
ATOM 4522  C CB   . ARG A 1 42  ? -11.980 0.287   -3.831  1.00 0.00 ? 42  ARG A CB   3  
ATOM 4523  C CG   . ARG A 1 42  ? -13.108 0.506   -4.841  1.00 0.00 ? 42  ARG A CG   3  
ATOM 4524  C CD   . ARG A 1 42  ? -12.642 0.183   -6.262  1.00 0.00 ? 42  ARG A CD   3  
ATOM 4525  N NE   . ARG A 1 42  ? -13.492 0.892   -7.246  1.00 0.00 ? 42  ARG A NE   3  
ATOM 4526  C CZ   . ARG A 1 42  ? -13.583 0.554   -8.540  1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4527  N NH1  . ARG A 1 42  ? -12.879 -0.483  -9.013  1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4528  N NH2  . ARG A 1 42  ? -14.379 1.254   -9.360  1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4529  H H    . ARG A 1 42  ? -14.456 1.041   -2.715  1.00 0.00 ? 42  ARG A H    3  
ATOM 4530  H HA   . ARG A 1 42  ? -12.115 -0.409  -1.786  1.00 0.00 ? 42  ARG A HA   3  
ATOM 4531  H HB2  . ARG A 1 42  ? -11.189 1.019   -4.000  1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4532  H HB3  . ARG A 1 42  ? -11.539 -0.698  -3.980  1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4533  H HG2  . ARG A 1 42  ? -13.960 -0.123  -4.582  1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4534  H HG3  . ARG A 1 42  ? -13.450 1.540   -4.792  1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4535  H HD2  . ARG A 1 42  ? -11.601 0.479   -6.388  1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4536  H HD3  . ARG A 1 42  ? -12.691 -0.892  -6.434  1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4537  H HE   . ARG A 1 42  ? -14.030 1.671   -6.926  1.00 0.00 ? 42  ARG A HE   3  
ATOM 4538  H HH11 . ARG A 1 42  ? -12.285 -1.006  -8.401  1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4539  H HH12 . ARG A 1 42  ? -12.947 -0.735  -9.979  1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4540  H HH21 . ARG A 1 42  ? -14.905 2.028   -9.007  1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4541  H HH22 . ARG A 1 42  ? -14.447 1.002   -10.326 1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4542  N N    . ILE A 1 43  ? -12.320 1.926   -0.531  1.00 0.00 ? 43  ILE A N    3  
ATOM 4543  C CA   . ILE A 1 43  ? -11.974 3.164   0.146   1.00 0.00 ? 43  ILE A CA   3  
ATOM 4544  C C    . ILE A 1 43  ? -10.680 3.723   -0.450  1.00 0.00 ? 43  ILE A C    3  
ATOM 4545  O O    . ILE A 1 43  ? -9.833  2.966   -0.922  1.00 0.00 ? 43  ILE A O    3  
ATOM 4546  C CB   . ILE A 1 43  ? -11.911 2.947   1.659   1.00 0.00 ? 43  ILE A CB   3  
ATOM 4547  C CG1  . ILE A 1 43  ? -13.040 3.695   2.368   1.00 0.00 ? 43  ILE A CG1  3  
ATOM 4548  C CG2  . ILE A 1 43  ? -10.536 3.328   2.211   1.00 0.00 ? 43  ILE A CG2  3  
ATOM 4549  C CD1  . ILE A 1 43  ? -14.341 2.889   2.332   1.00 0.00 ? 43  ILE A CD1  3  
ATOM 4550  H H    . ILE A 1 43  ? -12.743 1.231   0.049   1.00 0.00 ? 43  ILE A H    3  
ATOM 4551  H HA   . ILE A 1 43  ? -12.778 3.876   -0.044  1.00 0.00 ? 43  ILE A HA   3  
ATOM 4552  H HB   . ILE A 1 43  ? -12.053 1.884   1.859   1.00 0.00 ? 43  ILE A HB   3  
ATOM 4553  H HG12 . ILE A 1 43  ? -12.759 3.891   3.404   1.00 0.00 ? 43  ILE A HG12 3  
ATOM 4554  H HG13 . ILE A 1 43  ? -13.196 4.664   1.892   1.00 0.00 ? 43  ILE A HG13 3  
ATOM 4555  H HG21 . ILE A 1 43  ? -9.758  2.905   1.575   1.00 0.00 ? 43  ILE A HG21 3  
ATOM 4556  H HG22 . ILE A 1 43  ? -10.439 4.415   2.227   1.00 0.00 ? 43  ILE A HG22 3  
ATOM 4557  H HG23 . ILE A 1 43  ? -10.429 2.940   3.223   1.00 0.00 ? 43  ILE A HG23 3  
ATOM 4558  H HD11 . ILE A 1 43  ? -14.272 2.125   1.558   1.00 0.00 ? 43  ILE A HD11 3  
ATOM 4559  H HD12 . ILE A 1 43  ? -14.499 2.413   3.299   1.00 0.00 ? 43  ILE A HD12 3  
ATOM 4560  H HD13 . ILE A 1 43  ? -15.175 3.555   2.113   1.00 0.00 ? 43  ILE A HD13 3  
ATOM 4561  N N    . GLN A 1 44  ? -10.568 5.042   -0.409  1.00 0.00 ? 44  GLN A N    3  
ATOM 4562  C CA   . GLN A 1 44  ? -9.392  5.710   -0.939  1.00 0.00 ? 44  GLN A CA   3  
ATOM 4563  C C    . GLN A 1 44  ? -8.355  5.916   0.166   1.00 0.00 ? 44  GLN A C    3  
ATOM 4564  O O    . GLN A 1 44  ? -8.589  5.551   1.317   1.00 0.00 ? 44  GLN A O    3  
ATOM 4565  C CB   . GLN A 1 44  ? -9.767  7.042   -1.594  1.00 0.00 ? 44  GLN A CB   3  
ATOM 4566  C CG   . GLN A 1 44  ? -10.567 6.815   -2.878  1.00 0.00 ? 44  GLN A CG   3  
ATOM 4567  C CD   . GLN A 1 44  ? -9.989  5.650   -3.686  1.00 0.00 ? 44  GLN A CD   3  
ATOM 4568  O OE1  . GLN A 1 44  ? -9.170  5.822   -4.574  1.00 0.00 ? 44  GLN A OE1  3  
ATOM 4569  N NE2  . GLN A 1 44  ? -10.458 4.459   -3.328  1.00 0.00 ? 44  GLN A NE2  3  
ATOM 4570  H H    . GLN A 1 44  ? -11.262 5.650   -0.023  1.00 0.00 ? 44  GLN A H    3  
ATOM 4571  H HA   . GLN A 1 44  ? -8.995  5.037   -1.699  1.00 0.00 ? 44  GLN A HA   3  
ATOM 4572  H HB2  . GLN A 1 44  ? -10.353 7.641   -0.898  1.00 0.00 ? 44  GLN A HB2  3  
ATOM 4573  H HB3  . GLN A 1 44  ? -8.863  7.607   -1.819  1.00 0.00 ? 44  GLN A HB3  3  
ATOM 4574  H HG2  . GLN A 1 44  ? -11.607 6.610   -2.631  1.00 0.00 ? 44  GLN A HG2  3  
ATOM 4575  H HG3  . GLN A 1 44  ? -10.555 7.722   -3.483  1.00 0.00 ? 44  GLN A HG3  3  
ATOM 4576  H HE21 . GLN A 1 44  ? -11.129 4.387   -2.589  1.00 0.00 ? 44  GLN A HE21 3  
ATOM 4577  H HE22 . GLN A 1 44  ? -10.141 3.634   -3.798  1.00 0.00 ? 44  GLN A HE22 3  
ATOM 4578  N N    . TYR A 1 45  ? -7.231  6.501   -0.222  1.00 0.00 ? 45  TYR A N    3  
ATOM 4579  C CA   . TYR A 1 45  ? -6.158  6.759   0.723   1.00 0.00 ? 45  TYR A CA   3  
ATOM 4580  C C    . TYR A 1 45  ? -5.584  8.164   0.529   1.00 0.00 ? 45  TYR A C    3  
ATOM 4581  O O    . TYR A 1 45  ? -4.448  8.319   0.081   1.00 0.00 ? 45  TYR A O    3  
ATOM 4582  C CB   . TYR A 1 45  ? -5.068  5.730   0.414   1.00 0.00 ? 45  TYR A CB   3  
ATOM 4583  C CG   . TYR A 1 45  ? -5.080  4.514   1.344   1.00 0.00 ? 45  TYR A CG   3  
ATOM 4584  C CD1  . TYR A 1 45  ? -5.459  4.658   2.663   1.00 0.00 ? 45  TYR A CD1  3  
ATOM 4585  C CD2  . TYR A 1 45  ? -4.711  3.273   0.863   1.00 0.00 ? 45  TYR A CD2  3  
ATOM 4586  C CE1  . TYR A 1 45  ? -5.471  3.514   3.537   1.00 0.00 ? 45  TYR A CE1  3  
ATOM 4587  C CE2  . TYR A 1 45  ? -4.723  2.129   1.737   1.00 0.00 ? 45  TYR A CE2  3  
ATOM 4588  C CZ   . TYR A 1 45  ? -5.102  2.306   3.031   1.00 0.00 ? 45  TYR A CZ   3  
ATOM 4589  O OH   . TYR A 1 45  ? -5.111  1.226   3.858   1.00 0.00 ? 45  TYR A OH   3  
ATOM 4590  H H    . TYR A 1 45  ? -7.049  6.795   -1.160  1.00 0.00 ? 45  TYR A H    3  
ATOM 4591  H HA   . TYR A 1 45  ? -6.567  6.677   1.729   1.00 0.00 ? 45  TYR A HA   3  
ATOM 4592  H HB2  . TYR A 1 45  ? -5.186  5.389   -0.614  1.00 0.00 ? 45  TYR A HB2  3  
ATOM 4593  H HB3  . TYR A 1 45  ? -4.094  6.214   0.480   1.00 0.00 ? 45  TYR A HB3  3  
ATOM 4594  H HD1  . TYR A 1 45  ? -5.750  5.637   3.043   1.00 0.00 ? 45  TYR A HD1  3  
ATOM 4595  H HD2  . TYR A 1 45  ? -4.412  3.160   -0.179  1.00 0.00 ? 45  TYR A HD2  3  
ATOM 4596  H HE1  . TYR A 1 45  ? -5.768  3.613   4.581   1.00 0.00 ? 45  TYR A HE1  3  
ATOM 4597  H HE2  . TYR A 1 45  ? -4.434  1.145   1.370   1.00 0.00 ? 45  TYR A HE2  3  
ATOM 4598  H HH   . TYR A 1 45  ? -5.271  0.392   3.329   1.00 0.00 ? 45  TYR A HH   3  
ATOM 4599  N N    . GLU A 1 46  ? -6.395  9.153   0.876   1.00 0.00 ? 46  GLU A N    3  
ATOM 4600  C CA   . GLU A 1 46  ? -5.982  10.540  0.747   1.00 0.00 ? 46  GLU A CA   3  
ATOM 4601  C C    . GLU A 1 46  ? -4.790  10.827  1.663   1.00 0.00 ? 46  GLU A C    3  
ATOM 4602  O O    . GLU A 1 46  ? -4.913  11.581  2.627   1.00 0.00 ? 46  GLU A O    3  
ATOM 4603  C CB   . GLU A 1 46  ? -7.145  11.487  1.045   1.00 0.00 ? 46  GLU A CB   3  
ATOM 4604  C CG   . GLU A 1 46  ? -7.040  12.764  0.209   1.00 0.00 ? 46  GLU A CG   3  
ATOM 4605  C CD   . GLU A 1 46  ? -8.317  13.600  0.321   1.00 0.00 ? 46  GLU A CD   3  
ATOM 4606  O OE1  . GLU A 1 46  ? -9.403  12.982  0.308   1.00 0.00 ? 46  GLU A OE1  3  
ATOM 4607  O OE2  . GLU A 1 46  ? -8.178  14.839  0.417   1.00 0.00 ? 46  GLU A OE2  3  
ATOM 4608  H H    . GLU A 1 46  ? -7.317  9.018   1.240   1.00 0.00 ? 46  GLU A H    3  
ATOM 4609  H HA   . GLU A 1 46  ? -5.683  10.657  -0.295  1.00 0.00 ? 46  GLU A HA   3  
ATOM 4610  H HB2  . GLU A 1 46  ? -8.090  10.987  0.835   1.00 0.00 ? 46  GLU A HB2  3  
ATOM 4611  H HB3  . GLU A 1 46  ? -7.148  11.742  2.106   1.00 0.00 ? 46  GLU A HB3  3  
ATOM 4612  H HG2  . GLU A 1 46  ? -6.186  13.353  0.542   1.00 0.00 ? 46  GLU A HG2  3  
ATOM 4613  H HG3  . GLU A 1 46  ? -6.861  12.506  -0.836  1.00 0.00 ? 46  GLU A HG3  3  
ATOM 4614  N N    . ILE A 1 47  ? -3.667  10.211  1.331   1.00 0.00 ? 47  ILE A N    3  
ATOM 4615  C CA   . ILE A 1 47  ? -2.455  10.391  2.112   1.00 0.00 ? 47  ILE A CA   3  
ATOM 4616  C C    . ILE A 1 47  ? -1.984  11.841  1.987   1.00 0.00 ? 47  ILE A C    3  
ATOM 4617  O O    . ILE A 1 47  ? -2.675  12.673  1.403   1.00 0.00 ? 47  ILE A O    3  
ATOM 4618  C CB   . ILE A 1 47  ? -1.397  9.363   1.703   1.00 0.00 ? 47  ILE A CB   3  
ATOM 4619  C CG1  . ILE A 1 47  ? -0.991  9.546   0.239   1.00 0.00 ? 47  ILE A CG1  3  
ATOM 4620  C CG2  . ILE A 1 47  ? -1.875  7.939   1.992   1.00 0.00 ? 47  ILE A CG2  3  
ATOM 4621  C CD1  . ILE A 1 47  ? -0.344  8.275   -0.313  1.00 0.00 ? 47  ILE A CD1  3  
ATOM 4622  H H    . ILE A 1 47  ? -3.576  9.598   0.544   1.00 0.00 ? 47  ILE A H    3  
ATOM 4623  H HA   . ILE A 1 47  ? -2.706  10.197  3.154   1.00 0.00 ? 47  ILE A HA   3  
ATOM 4624  H HB   . ILE A 1 47  ? -0.505  9.532   2.308   1.00 0.00 ? 47  ILE A HB   3  
ATOM 4625  H HG12 . ILE A 1 47  ? -1.868  9.801   -0.355  1.00 0.00 ? 47  ILE A HG12 3  
ATOM 4626  H HG13 . ILE A 1 47  ? -0.294  10.380  0.153   1.00 0.00 ? 47  ILE A HG13 3  
ATOM 4627  H HG21 . ILE A 1 47  ? -2.854  7.975   2.471   1.00 0.00 ? 47  ILE A HG21 3  
ATOM 4628  H HG22 . ILE A 1 47  ? -1.948  7.384   1.057   1.00 0.00 ? 47  ILE A HG22 3  
ATOM 4629  H HG23 . ILE A 1 47  ? -1.164  7.444   2.654   1.00 0.00 ? 47  ILE A HG23 3  
ATOM 4630  H HD11 . ILE A 1 47  ? -0.193  7.562   0.498   1.00 0.00 ? 47  ILE A HD11 3  
ATOM 4631  H HD12 . ILE A 1 47  ? -0.995  7.834   -1.068  1.00 0.00 ? 47  ILE A HD12 3  
ATOM 4632  H HD13 . ILE A 1 47  ? 0.618   8.523   -0.762  1.00 0.00 ? 47  ILE A HD13 3  
ATOM 4633  N N    . LYS A 1 48  ? -0.811  12.099  2.546   1.00 0.00 ? 48  LYS A N    3  
ATOM 4634  C CA   . LYS A 1 48  ? -0.240  13.435  2.506   1.00 0.00 ? 48  LYS A CA   3  
ATOM 4635  C C    . LYS A 1 48  ? 1.139   13.375  1.846   1.00 0.00 ? 48  LYS A C    3  
ATOM 4636  O O    . LYS A 1 48  ? 1.883   14.354  1.862   1.00 0.00 ? 48  LYS A O    3  
ATOM 4637  C CB   . LYS A 1 48  ? -0.226  14.055  3.905   1.00 0.00 ? 48  LYS A CB   3  
ATOM 4638  C CG   . LYS A 1 48  ? -0.385  15.574  3.832   1.00 0.00 ? 48  LYS A CG   3  
ATOM 4639  C CD   . LYS A 1 48  ? -0.507  16.181  5.232   1.00 0.00 ? 48  LYS A CD   3  
ATOM 4640  C CE   . LYS A 1 48  ? -1.297  15.257  6.162   1.00 0.00 ? 48  LYS A CE   3  
ATOM 4641  N NZ   . LYS A 1 48  ? -1.813  16.013  7.325   1.00 0.00 ? 48  LYS A NZ   3  
ATOM 4642  H H    . LYS A 1 48  ? -0.255  11.416  3.021   1.00 0.00 ? 48  LYS A H    3  
ATOM 4643  H HA   . LYS A 1 48  ? -0.893  14.050  1.887   1.00 0.00 ? 48  LYS A HA   3  
ATOM 4644  H HB2  . LYS A 1 48  ? -1.032  13.629  4.503   1.00 0.00 ? 48  LYS A HB2  3  
ATOM 4645  H HB3  . LYS A 1 48  ? 0.708   13.806  4.407   1.00 0.00 ? 48  LYS A HB3  3  
ATOM 4646  H HG2  . LYS A 1 48  ? 0.472   16.009  3.317   1.00 0.00 ? 48  LYS A HG2  3  
ATOM 4647  H HG3  . LYS A 1 48  ? -1.270  15.823  3.246   1.00 0.00 ? 48  LYS A HG3  3  
ATOM 4648  H HD2  . LYS A 1 48  ? 0.487   16.354  5.645   1.00 0.00 ? 48  LYS A HD2  3  
ATOM 4649  H HD3  . LYS A 1 48  ? -1.001  17.150  5.171   1.00 0.00 ? 48  LYS A HD3  3  
ATOM 4650  H HE2  . LYS A 1 48  ? -2.125  14.805  5.617   1.00 0.00 ? 48  LYS A HE2  3  
ATOM 4651  H HE3  . LYS A 1 48  ? -0.657  14.443  6.504   1.00 0.00 ? 48  LYS A HE3  3  
ATOM 4652  H HZ1  . LYS A 1 48  ? -1.090  16.598  7.692   1.00 0.00 ? 48  LYS A HZ1  3  
ATOM 4653  H HZ2  . LYS A 1 48  ? -2.586  16.579  7.038   1.00 0.00 ? 48  LYS A HZ2  3  
ATOM 4654  H HZ3  . LYS A 1 48  ? -2.114  15.372  8.032   1.00 0.00 ? 48  LYS A HZ3  3  
ATOM 4655  N N    . GLN A 1 49  ? 1.440   12.215  1.282   1.00 0.00 ? 49  GLN A N    3  
ATOM 4656  C CA   . GLN A 1 49  ? 2.717   12.014  0.618   1.00 0.00 ? 49  GLN A CA   3  
ATOM 4657  C C    . GLN A 1 49  ? 3.830   12.736  1.380   1.00 0.00 ? 49  GLN A C    3  
ATOM 4658  O O    . GLN A 1 49  ? 3.954   13.957  1.294   1.00 0.00 ? 49  GLN A O    3  
ATOM 4659  C CB   . GLN A 1 49  ? 2.657   12.479  -0.838  1.00 0.00 ? 49  GLN A CB   3  
ATOM 4660  C CG   . GLN A 1 49  ? 1.893   11.475  -1.703  1.00 0.00 ? 49  GLN A CG   3  
ATOM 4661  C CD   . GLN A 1 49  ? 2.783   10.289  -2.083  1.00 0.00 ? 49  GLN A CD   3  
ATOM 4662  O OE1  . GLN A 1 49  ? 2.414   9.134   -1.943  1.00 0.00 ? 49  GLN A OE1  3  
ATOM 4663  N NE2  . GLN A 1 49  ? 3.971   10.637  -2.567  1.00 0.00 ? 49  GLN A NE2  3  
ATOM 4664  H H    . GLN A 1 49  ? 0.830   11.422  1.274   1.00 0.00 ? 49  GLN A H    3  
ATOM 4665  H HA   . GLN A 1 49  ? 2.890   10.938  0.642   1.00 0.00 ? 49  GLN A HA   3  
ATOM 4666  H HB2  . GLN A 1 49  ? 2.172   13.453  -0.892  1.00 0.00 ? 49  GLN A HB2  3  
ATOM 4667  H HB3  . GLN A 1 49  ? 3.668   12.603  -1.226  1.00 0.00 ? 49  GLN A HB3  3  
ATOM 4668  H HG2  . GLN A 1 49  ? 1.016   11.119  -1.164  1.00 0.00 ? 49  GLN A HG2  3  
ATOM 4669  H HG3  . GLN A 1 49  ? 1.534   11.967  -2.607  1.00 0.00 ? 49  GLN A HG3  3  
ATOM 4670  H HE21 . GLN A 1 49  ? 4.211   11.603  -2.655  1.00 0.00 ? 49  GLN A HE21 3  
ATOM 4671  H HE22 . GLN A 1 49  ? 4.624   9.932   -2.842  1.00 0.00 ? 49  GLN A HE22 3  
ATOM 4672  N N    . ILE A 1 50  ? 4.612   11.952  2.106   1.00 0.00 ? 50  ILE A N    3  
ATOM 4673  C CA   . ILE A 1 50  ? 5.711   12.502  2.881   1.00 0.00 ? 50  ILE A CA   3  
ATOM 4674  C C    . ILE A 1 50  ? 7.038   12.026  2.286   1.00 0.00 ? 50  ILE A C    3  
ATOM 4675  O O    . ILE A 1 50  ? 8.036   12.745  2.329   1.00 0.00 ? 50  ILE A O    3  
ATOM 4676  C CB   . ILE A 1 50  ? 5.544   12.161  4.363   1.00 0.00 ? 50  ILE A CB   3  
ATOM 4677  C CG1  . ILE A 1 50  ? 6.600   11.150  4.815   1.00 0.00 ? 50  ILE A CG1  3  
ATOM 4678  C CG2  . ILE A 1 50  ? 4.123   11.677  4.658   1.00 0.00 ? 50  ILE A CG2  3  
ATOM 4679  C CD1  . ILE A 1 50  ? 6.169   10.446  6.104   1.00 0.00 ? 50  ILE A CD1  3  
ATOM 4680  H H    . ILE A 1 50  ? 4.506   10.959  2.169   1.00 0.00 ? 50  ILE A H    3  
ATOM 4681  H HA   . ILE A 1 50  ? 5.663   13.587  2.793   1.00 0.00 ? 50  ILE A HA   3  
ATOM 4682  H HB   . ILE A 1 50  ? 5.701   13.070  4.943   1.00 0.00 ? 50  ILE A HB   3  
ATOM 4683  H HG12 . ILE A 1 50  ? 6.761   10.412  4.030   1.00 0.00 ? 50  ILE A HG12 3  
ATOM 4684  H HG13 . ILE A 1 50  ? 7.551   11.658  4.975   1.00 0.00 ? 50  ILE A HG13 3  
ATOM 4685  H HG21 . ILE A 1 50  ? 3.419   12.208  4.019   1.00 0.00 ? 50  ILE A HG21 3  
ATOM 4686  H HG22 . ILE A 1 50  ? 4.056   10.607  4.462   1.00 0.00 ? 50  ILE A HG22 3  
ATOM 4687  H HG23 . ILE A 1 50  ? 3.883   11.869  5.703   1.00 0.00 ? 50  ILE A HG23 3  
ATOM 4688  H HD11 . ILE A 1 50  ? 5.991   11.188  6.882   1.00 0.00 ? 50  ILE A HD11 3  
ATOM 4689  H HD12 . ILE A 1 50  ? 5.252   9.884   5.922   1.00 0.00 ? 50  ILE A HD12 3  
ATOM 4690  H HD13 . ILE A 1 50  ? 6.955   9.763   6.426   1.00 0.00 ? 50  ILE A HD13 3  
ATOM 4691  N N    . LYS A 1 51  ? 7.007   10.817  1.746   1.00 0.00 ? 51  LYS A N    3  
ATOM 4692  C CA   . LYS A 1 51  ? 8.195   10.236  1.143   1.00 0.00 ? 51  LYS A CA   3  
ATOM 4693  C C    . LYS A 1 51  ? 7.787   9.385   -0.061  1.00 0.00 ? 51  LYS A C    3  
ATOM 4694  O O    . LYS A 1 51  ? 6.618   9.031   -0.208  1.00 0.00 ? 51  LYS A O    3  
ATOM 4695  C CB   . LYS A 1 51  ? 9.008   9.471   2.189   1.00 0.00 ? 51  LYS A CB   3  
ATOM 4696  C CG   . LYS A 1 51  ? 10.471  9.918   2.181   1.00 0.00 ? 51  LYS A CG   3  
ATOM 4697  C CD   . LYS A 1 51  ? 11.131  9.658   3.537   1.00 0.00 ? 51  LYS A CD   3  
ATOM 4698  C CE   . LYS A 1 51  ? 11.964  10.863  3.981   1.00 0.00 ? 51  LYS A CE   3  
ATOM 4699  N NZ   . LYS A 1 51  ? 12.750  10.532  5.190   1.00 0.00 ? 51  LYS A NZ   3  
ATOM 4700  H H    . LYS A 1 51  ? 6.192   10.238  1.715   1.00 0.00 ? 51  LYS A H    3  
ATOM 4701  H HA   . LYS A 1 51  ? 8.817   11.058  0.789   1.00 0.00 ? 51  LYS A HA   3  
ATOM 4702  H HB2  . LYS A 1 51  ? 8.580   9.633   3.178   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 4703  H HB3  . LYS A 1 51  ? 8.949   8.401   1.989   1.00 0.00 ? 51  LYS A HB3  3  
ATOM 4704  H HG2  . LYS A 1 51  ? 11.014  9.385   1.402   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 4705  H HG3  . LYS A 1 51  ? 10.530  10.980  1.942   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 4706  H HD2  . LYS A 1 51  ? 10.365  9.447   4.284   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 4707  H HD3  . LYS A 1 51  ? 11.767  8.776   3.473   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 4708  H HE2  . LYS A 1 51  ? 12.634  11.165  3.176   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 4709  H HE3  . LYS A 1 51  ? 11.309  11.710  4.186   1.00 0.00 ? 51  LYS A HE3  3  
ATOM 4710  H HZ1  . LYS A 1 51  ? 13.029  9.573   5.155   1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 4711  H HZ2  . LYS A 1 51  ? 13.563  11.115  5.229   1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 4712  H HZ3  . LYS A 1 51  ? 12.190  10.686  6.005   1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 4713  N N    . MET A 1 52  ? 8.773   9.081   -0.892  1.00 0.00 ? 52  MET A N    3  
ATOM 4714  C CA   . MET A 1 52  ? 8.531   8.277   -2.079  1.00 0.00 ? 52  MET A CA   3  
ATOM 4715  C C    . MET A 1 52  ? 9.717   7.354   -2.367  1.00 0.00 ? 52  MET A C    3  
ATOM 4716  O O    . MET A 1 52  ? 10.431  7.544   -3.350  1.00 0.00 ? 52  MET A O    3  
ATOM 4717  C CB   . MET A 1 52  ? 8.297   9.198   -3.279  1.00 0.00 ? 52  MET A CB   3  
ATOM 4718  C CG   . MET A 1 52  ? 9.553   10.010  -3.601  1.00 0.00 ? 52  MET A CG   3  
ATOM 4719  S SD   . MET A 1 52  ? 9.097   11.625  -4.209  1.00 0.00 ? 52  MET A SD   3  
ATOM 4720  C CE   . MET A 1 52  ? 9.444   12.610  -2.762  1.00 0.00 ? 52  MET A CE   3  
ATOM 4721  H H    . MET A 1 52  ? 9.721   9.372   -0.765  1.00 0.00 ? 52  MET A H    3  
ATOM 4722  H HA   . MET A 1 52  ? 7.644   7.684   -1.855  1.00 0.00 ? 52  MET A HA   3  
ATOM 4723  H HB2  . MET A 1 52  ? 8.011   8.603   -4.147  1.00 0.00 ? 52  MET A HB2  3  
ATOM 4724  H HB3  . MET A 1 52  ? 7.467   9.872   -3.068  1.00 0.00 ? 52  MET A HB3  3  
ATOM 4725  H HG2  . MET A 1 52  ? 10.170  10.110  -2.708  1.00 0.00 ? 52  MET A HG2  3  
ATOM 4726  H HG3  . MET A 1 52  ? 10.153  9.487   -4.346  1.00 0.00 ? 52  MET A HG3  3  
ATOM 4727  H HE1  . MET A 1 52  ? 10.410  12.322  -2.349  1.00 0.00 ? 52  MET A HE1  3  
ATOM 4728  H HE2  . MET A 1 52  ? 9.466   13.665  -3.037  1.00 0.00 ? 52  MET A HE2  3  
ATOM 4729  H HE3  . MET A 1 52  ? 8.666   12.445  -2.015  1.00 0.00 ? 52  MET A HE3  3  
ATOM 4730  N N    . PHE A 1 53  ? 9.888   6.374   -1.492  1.00 0.00 ? 53  PHE A N    3  
ATOM 4731  C CA   . PHE A 1 53  ? 10.975  5.420   -1.640  1.00 0.00 ? 53  PHE A CA   3  
ATOM 4732  C C    . PHE A 1 53  ? 11.225  5.100   -3.115  1.00 0.00 ? 53  PHE A C    3  
ATOM 4733  O O    . PHE A 1 53  ? 12.155  5.631   -3.719  1.00 0.00 ? 53  PHE A O    3  
ATOM 4734  C CB   . PHE A 1 53  ? 10.547  4.140   -0.919  1.00 0.00 ? 53  PHE A CB   3  
ATOM 4735  C CG   . PHE A 1 53  ? 11.144  3.988   0.482   1.00 0.00 ? 53  PHE A CG   3  
ATOM 4736  C CD1  . PHE A 1 53  ? 12.473  4.195   0.681   1.00 0.00 ? 53  PHE A CD1  3  
ATOM 4737  C CD2  . PHE A 1 53  ? 10.345  3.643   1.528   1.00 0.00 ? 53  PHE A CD2  3  
ATOM 4738  C CE1  . PHE A 1 53  ? 13.028  4.053   1.981   1.00 0.00 ? 53  PHE A CE1  3  
ATOM 4739  C CE2  . PHE A 1 53  ? 10.899  3.501   2.827   1.00 0.00 ? 53  PHE A CE2  3  
ATOM 4740  C CZ   . PHE A 1 53  ? 12.229  3.709   3.027   1.00 0.00 ? 53  PHE A CZ   3  
ATOM 4741  H H    . PHE A 1 53  ? 9.302   6.227   -0.696  1.00 0.00 ? 53  PHE A H    3  
ATOM 4742  H HA   . PHE A 1 53  ? 11.866  5.877   -1.212  1.00 0.00 ? 53  PHE A HA   3  
ATOM 4743  H HB2  . PHE A 1 53  ? 9.460   4.123   -0.843  1.00 0.00 ? 53  PHE A HB2  3  
ATOM 4744  H HB3  . PHE A 1 53  ? 10.839  3.280   -1.522  1.00 0.00 ? 53  PHE A HB3  3  
ATOM 4745  H HD1  . PHE A 1 53  ? 13.114  4.471   -0.157  1.00 0.00 ? 53  PHE A HD1  3  
ATOM 4746  H HD2  . PHE A 1 53  ? 9.280   3.477   1.367   1.00 0.00 ? 53  PHE A HD2  3  
ATOM 4747  H HE1  . PHE A 1 53  ? 14.093  4.219   2.141   1.00 0.00 ? 53  PHE A HE1  3  
ATOM 4748  H HE2  . PHE A 1 53  ? 10.259  3.226   3.665   1.00 0.00 ? 53  PHE A HE2  3  
ATOM 4749  H HZ   . PHE A 1 53  ? 12.653  3.600   4.024   1.00 0.00 ? 53  PHE A HZ   3  
ATOM 4750  N N    . LYS A 1 54  ? 10.379  4.233   -3.652  1.00 0.00 ? 54  LYS A N    3  
ATOM 4751  C CA   . LYS A 1 54  ? 10.499  3.836   -5.045  1.00 0.00 ? 54  LYS A CA   3  
ATOM 4752  C C    . LYS A 1 54  ? 9.149   4.025   -5.741  1.00 0.00 ? 54  LYS A C    3  
ATOM 4753  O O    . LYS A 1 54  ? 8.455   3.052   -6.032  1.00 0.00 ? 54  LYS A O    3  
ATOM 4754  C CB   . LYS A 1 54  ? 11.051  2.413   -5.151  1.00 0.00 ? 54  LYS A CB   3  
ATOM 4755  C CG   . LYS A 1 54  ? 11.058  1.935   -6.604  1.00 0.00 ? 54  LYS A CG   3  
ATOM 4756  C CD   . LYS A 1 54  ? 11.874  2.879   -7.489  1.00 0.00 ? 54  LYS A CD   3  
ATOM 4757  C CE   . LYS A 1 54  ? 10.976  3.605   -8.491  1.00 0.00 ? 54  LYS A CE   3  
ATOM 4758  N NZ   . LYS A 1 54  ? 11.791  4.378   -9.455  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 4759  H H    . LYS A 1 54  ? 9.625   3.806   -3.153  1.00 0.00 ? 54  LYS A H    3  
ATOM 4760  H HA   . LYS A 1 54  ? 11.225  4.500   -5.513  1.00 0.00 ? 54  LYS A HA   3  
ATOM 4761  H HB2  . LYS A 1 54  ? 12.064  2.382   -4.750  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 4762  H HB3  . LYS A 1 54  ? 10.447  1.738   -4.545  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 4763  H HG2  . LYS A 1 54  ? 11.475  0.929   -6.657  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 4764  H HG3  . LYS A 1 54  ? 10.035  1.875   -6.977  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 4765  H HD2  . LYS A 1 54  ? 12.395  3.607   -6.867  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 4766  H HD3  . LYS A 1 54  ? 12.638  2.313   -8.023  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 4767  H HE2  . LYS A 1 54  ? 10.358  2.883   -9.026  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 4768  H HE3  . LYS A 1 54  ? 10.297  4.274   -7.962  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 4769  H HZ1  . LYS A 1 54  ? 12.525  4.851   -8.965  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 4770  H HZ2  . LYS A 1 54  ? 12.187  3.756   -10.130 1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 4771  H HZ3  . LYS A 1 54  ? 11.213  5.049   -9.917  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 4772  N N    . GLY A 1 55  ? 8.818   5.283   -5.989  1.00 0.00 ? 55  GLY A N    3  
ATOM 4773  C CA   . GLY A 1 55  ? 7.565   5.613   -6.646  1.00 0.00 ? 55  GLY A CA   3  
ATOM 4774  C C    . GLY A 1 55  ? 7.808   6.447   -7.905  1.00 0.00 ? 55  GLY A C    3  
ATOM 4775  O O    . GLY A 1 55  ? 8.925   6.491   -8.418  1.00 0.00 ? 55  GLY A O    3  
ATOM 4776  H H    . GLY A 1 55  ? 9.389   6.070   -5.749  1.00 0.00 ? 55  GLY A H    3  
ATOM 4777  H HA2  . GLY A 1 55  ? 7.036   4.696   -6.909  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 4778  H HA3  . GLY A 1 55  ? 6.923   6.164   -5.958  1.00 0.00 ? 55  GLY A HA3  3  
ATOM 4779  N N    . PRO A 1 56  ? 6.716   7.106   -8.378  1.00 0.00 ? 56  PRO A N    3  
ATOM 4780  C CA   . PRO A 1 56  ? 6.799   7.937   -9.567  1.00 0.00 ? 56  PRO A CA   3  
ATOM 4781  C C    . PRO A 1 56  ? 7.507   9.258   -9.263  1.00 0.00 ? 56  PRO A C    3  
ATOM 4782  O O    . PRO A 1 56  ? 7.995   9.464   -8.153  1.00 0.00 ? 56  PRO A O    3  
ATOM 4783  C CB   . PRO A 1 56  ? 5.360   8.124   -10.018 1.00 0.00 ? 56  PRO A CB   3  
ATOM 4784  C CG   . PRO A 1 56  ? 4.498   7.784   -8.814  1.00 0.00 ? 56  PRO A CG   3  
ATOM 4785  C CD   . PRO A 1 56  ? 5.377   7.076   -7.795  1.00 0.00 ? 56  PRO A CD   3  
ATOM 4786  H HA   . PRO A 1 56  ? 7.352   7.484   -10.268 1.00 0.00 ? 56  PRO A HA   3  
ATOM 4787  H HB2  . PRO A 1 56  ? 5.185   9.148   -10.348 1.00 0.00 ? 56  PRO A HB2  3  
ATOM 4788  H HB3  . PRO A 1 56  ? 5.127   7.472   -10.860 1.00 0.00 ? 56  PRO A HB3  3  
ATOM 4789  H HG2  . PRO A 1 56  ? 4.070   8.690   -8.383  1.00 0.00 ? 56  PRO A HG2  3  
ATOM 4790  H HG3  . PRO A 1 56  ? 3.665   7.147   -9.107  1.00 0.00 ? 56  PRO A HG3  3  
ATOM 4791  H HD2  . PRO A 1 56  ? 5.354   7.584   -6.831  1.00 0.00 ? 56  PRO A HD2  3  
ATOM 4792  H HD3  . PRO A 1 56  ? 5.042   6.053   -7.626  1.00 0.00 ? 56  PRO A HD3  3  
ATOM 4793  N N    . GLU A 1 57  ? 7.543   10.119  -10.271 1.00 0.00 ? 57  GLU A N    3  
ATOM 4794  C CA   . GLU A 1 57  ? 8.182   11.415  -10.125 1.00 0.00 ? 57  GLU A CA   3  
ATOM 4795  C C    . GLU A 1 57  ? 7.158   12.469  -9.703  1.00 0.00 ? 57  GLU A C    3  
ATOM 4796  O O    . GLU A 1 57  ? 7.487   13.401  -8.970  1.00 0.00 ? 57  GLU A O    3  
ATOM 4797  C CB   . GLU A 1 57  ? 8.890   11.825  -11.419 1.00 0.00 ? 57  GLU A CB   3  
ATOM 4798  C CG   . GLU A 1 57  ? 9.341   10.596  -12.210 1.00 0.00 ? 57  GLU A CG   3  
ATOM 4799  C CD   . GLU A 1 57  ? 10.310  10.989  -13.327 1.00 0.00 ? 57  GLU A CD   3  
ATOM 4800  O OE1  . GLU A 1 57  ? 9.812   11.462  -14.371 1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4801  O OE2  . GLU A 1 57  ? 11.528  10.807  -13.111 1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4802  H H    . GLU A 1 57  ? 7.144   9.943   -11.171 1.00 0.00 ? 57  GLU A H    3  
ATOM 4803  H HA   . GLU A 1 57  ? 8.926   11.284  -9.338  1.00 0.00 ? 57  GLU A HA   3  
ATOM 4804  H HB2  . GLU A 1 57  ? 8.219   12.429  -12.029 1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4805  H HB3  . GLU A 1 57  ? 9.753   12.448  -11.184 1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4806  H HG2  . GLU A 1 57  ? 9.822   9.884   -11.540 1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4807  H HG3  . GLU A 1 57  ? 8.473   10.094  -12.637 1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4808  N N    . LYS A 1 58  ? 5.937   12.286  -10.183 1.00 0.00 ? 58  LYS A N    3  
ATOM 4809  C CA   . LYS A 1 58  ? 4.862   13.210  -9.864  1.00 0.00 ? 58  LYS A CA   3  
ATOM 4810  C C    . LYS A 1 58  ? 4.446   13.019  -8.404  1.00 0.00 ? 58  LYS A C    3  
ATOM 4811  O O    . LYS A 1 58  ? 4.827   13.805  -7.539  1.00 0.00 ? 58  LYS A O    3  
ATOM 4812  C CB   . LYS A 1 58  ? 3.708   13.054  -10.857 1.00 0.00 ? 58  LYS A CB   3  
ATOM 4813  C CG   . LYS A 1 58  ? 2.978   14.382  -11.064 1.00 0.00 ? 58  LYS A CG   3  
ATOM 4814  C CD   . LYS A 1 58  ? 3.096   14.853  -12.515 1.00 0.00 ? 58  LYS A CD   3  
ATOM 4815  C CE   . LYS A 1 58  ? 4.481   15.444  -12.788 1.00 0.00 ? 58  LYS A CE   3  
ATOM 4816  N NZ   . LYS A 1 58  ? 4.378   16.603  -13.702 1.00 0.00 ? 58  LYS A NZ   3  
ATOM 4817  H H    . LYS A 1 58  ? 5.677   11.526  -10.778 1.00 0.00 ? 58  LYS A H    3  
ATOM 4818  H HA   . LYS A 1 58  ? 5.253   14.221  -9.982  1.00 0.00 ? 58  LYS A HA   3  
ATOM 4819  H HB2  . LYS A 1 58  ? 4.091   12.692  -11.811 1.00 0.00 ? 58  LYS A HB2  3  
ATOM 4820  H HB3  . LYS A 1 58  ? 3.008   12.303  -10.491 1.00 0.00 ? 58  LYS A HB3  3  
ATOM 4821  H HG2  . LYS A 1 58  ? 1.926   14.268  -10.799 1.00 0.00 ? 58  LYS A HG2  3  
ATOM 4822  H HG3  . LYS A 1 58  ? 3.395   15.138  -10.397 1.00 0.00 ? 58  LYS A HG3  3  
ATOM 4823  H HD2  . LYS A 1 58  ? 2.915   14.016  -13.188 1.00 0.00 ? 58  LYS A HD2  3  
ATOM 4824  H HD3  . LYS A 1 58  ? 2.330   15.601  -12.721 1.00 0.00 ? 58  LYS A HD3  3  
ATOM 4825  H HE2  . LYS A 1 58  ? 4.942   15.753  -11.850 1.00 0.00 ? 58  LYS A HE2  3  
ATOM 4826  H HE3  . LYS A 1 58  ? 5.127   14.685  -13.226 1.00 0.00 ? 58  LYS A HE3  3  
ATOM 4827  H HZ1  . LYS A 1 58  ? 3.417   16.862  -13.806 1.00 0.00 ? 58  LYS A HZ1  3  
ATOM 4828  H HZ2  . LYS A 1 58  ? 4.891   17.374  -13.323 1.00 0.00 ? 58  LYS A HZ2  3  
ATOM 4829  H HZ3  . LYS A 1 58  ? 4.756   16.358  -14.595 1.00 0.00 ? 58  LYS A HZ3  3  
ATOM 4830  N N    . ASP A 1 59  ? 3.670   11.969  -8.176  1.00 0.00 ? 59  ASP A N    3  
ATOM 4831  C CA   . ASP A 1 59  ? 3.200   11.664  -6.835  1.00 0.00 ? 59  ASP A CA   3  
ATOM 4832  C C    . ASP A 1 59  ? 1.798   11.056  -6.918  1.00 0.00 ? 59  ASP A C    3  
ATOM 4833  O O    . ASP A 1 59  ? 1.139   11.143  -7.953  1.00 0.00 ? 59  ASP A O    3  
ATOM 4834  C CB   . ASP A 1 59  ? 3.116   12.929  -5.980  1.00 0.00 ? 59  ASP A CB   3  
ATOM 4835  C CG   . ASP A 1 59  ? 2.426   12.750  -4.626  1.00 0.00 ? 59  ASP A CG   3  
ATOM 4836  O OD1  . ASP A 1 59  ? 1.184   12.613  -4.636  1.00 0.00 ? 59  ASP A OD1  3  
ATOM 4837  O OD2  . ASP A 1 59  ? 3.157   12.755  -3.612  1.00 0.00 ? 59  ASP A OD2  3  
ATOM 4838  H H    . ASP A 1 59  ? 3.364   11.335  -8.885  1.00 0.00 ? 59  ASP A H    3  
ATOM 4839  H HA   . ASP A 1 59  ? 3.931   10.969  -6.425  1.00 0.00 ? 59  ASP A HA   3  
ATOM 4840  H HB2  . ASP A 1 59  ? 4.125   13.302  -5.809  1.00 0.00 ? 59  ASP A HB2  3  
ATOM 4841  H HB3  . ASP A 1 59  ? 2.583   13.697  -6.542  1.00 0.00 ? 59  ASP A HB3  3  
ATOM 4842  N N    . ILE A 1 60  ? 1.383   10.453  -5.814  1.00 0.00 ? 60  ILE A N    3  
ATOM 4843  C CA   . ILE A 1 60  ? 0.071   9.831   -5.748  1.00 0.00 ? 60  ILE A CA   3  
ATOM 4844  C C    . ILE A 1 60  ? -0.832  10.652  -4.827  1.00 0.00 ? 60  ILE A C    3  
ATOM 4845  O O    . ILE A 1 60  ? -1.659  11.432  -5.296  1.00 0.00 ? 60  ILE A O    3  
ATOM 4846  C CB   . ILE A 1 60  ? 0.195   8.362   -5.339  1.00 0.00 ? 60  ILE A CB   3  
ATOM 4847  C CG1  . ILE A 1 60  ? 1.519   7.768   -5.824  1.00 0.00 ? 60  ILE A CG1  3  
ATOM 4848  C CG2  . ILE A 1 60  ? -1.009  7.554   -5.826  1.00 0.00 ? 60  ILE A CG2  3  
ATOM 4849  C CD1  . ILE A 1 60  ? 1.412   7.305   -7.279  1.00 0.00 ? 60  ILE A CD1  3  
ATOM 4850  H H    . ILE A 1 60  ? 1.924   10.386  -4.975  1.00 0.00 ? 60  ILE A H    3  
ATOM 4851  H HA   . ILE A 1 60  ? -0.350  9.851   -6.753  1.00 0.00 ? 60  ILE A HA   3  
ATOM 4852  H HB   . ILE A 1 60  ? 0.199   8.310   -4.250  1.00 0.00 ? 60  ILE A HB   3  
ATOM 4853  H HG12 . ILE A 1 60  ? 2.311   8.511   -5.732  1.00 0.00 ? 60  ILE A HG12 3  
ATOM 4854  H HG13 . ILE A 1 60  ? 1.797   6.925   -5.190  1.00 0.00 ? 60  ILE A HG13 3  
ATOM 4855  H HG21 . ILE A 1 60  ? -1.928  8.066   -5.544  1.00 0.00 ? 60  ILE A HG21 3  
ATOM 4856  H HG22 . ILE A 1 60  ? -0.966  7.455   -6.910  1.00 0.00 ? 60  ILE A HG22 3  
ATOM 4857  H HG23 . ILE A 1 60  ? -0.990  6.564   -5.370  1.00 0.00 ? 60  ILE A HG23 3  
ATOM 4858  H HD11 . ILE A 1 60  ? 0.628   6.553   -7.363  1.00 0.00 ? 60  ILE A HD11 3  
ATOM 4859  H HD12 . ILE A 1 60  ? 1.169   8.156   -7.914  1.00 0.00 ? 60  ILE A HD12 3  
ATOM 4860  H HD13 . ILE A 1 60  ? 2.363   6.875   -7.594  1.00 0.00 ? 60  ILE A HD13 3  
ATOM 4861  N N    . GLU A 1 61  ? -0.645  10.448  -3.531  1.00 0.00 ? 61  GLU A N    3  
ATOM 4862  C CA   . GLU A 1 61  ? -1.434  11.160  -2.540  1.00 0.00 ? 61  GLU A CA   3  
ATOM 4863  C C    . GLU A 1 61  ? -2.834  10.552  -2.439  1.00 0.00 ? 61  GLU A C    3  
ATOM 4864  O O    . GLU A 1 61  ? -3.595  10.883  -1.531  1.00 0.00 ? 61  GLU A O    3  
ATOM 4865  C CB   . GLU A 1 61  ? -1.506  12.652  -2.865  1.00 0.00 ? 61  GLU A CB   3  
ATOM 4866  C CG   . GLU A 1 61  ? -0.819  13.484  -1.780  1.00 0.00 ? 61  GLU A CG   3  
ATOM 4867  C CD   . GLU A 1 61  ? -1.584  14.783  -1.518  1.00 0.00 ? 61  GLU A CD   3  
ATOM 4868  O OE1  . GLU A 1 61  ? -2.082  15.358  -2.509  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4869  O OE2  . GLU A 1 61  ? -1.656  15.170  -0.330  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4870  H H    . GLU A 1 61  ? 0.030   9.811   -3.158  1.00 0.00 ? 61  GLU A H    3  
ATOM 4871  H HA   . GLU A 1 61  ? -0.903  11.025  -1.596  1.00 0.00 ? 61  GLU A HA   3  
ATOM 4872  H HB2  . GLU A 1 61  ? -1.032  12.841  -3.828  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4873  H HB3  . GLU A 1 61  ? -2.548  12.958  -2.957  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4874  H HG2  . GLU A 1 61  ? -0.753  12.905  -0.860  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4875  H HG3  . GLU A 1 61  ? 0.202   13.715  -2.086  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4876  N N    . PHE A 1 62  ? -3.132  9.672   -3.383  1.00 0.00 ? 62  PHE A N    3  
ATOM 4877  C CA   . PHE A 1 62  ? -4.427  9.015   -3.413  1.00 0.00 ? 62  PHE A CA   3  
ATOM 4878  C C    . PHE A 1 62  ? -4.289  7.549   -3.828  1.00 0.00 ? 62  PHE A C    3  
ATOM 4879  O O    . PHE A 1 62  ? -4.275  7.234   -5.016  1.00 0.00 ? 62  PHE A O    3  
ATOM 4880  C CB   . PHE A 1 62  ? -5.277  9.748   -4.452  1.00 0.00 ? 62  PHE A CB   3  
ATOM 4881  C CG   . PHE A 1 62  ? -6.311  10.702  -3.849  1.00 0.00 ? 62  PHE A CG   3  
ATOM 4882  C CD1  . PHE A 1 62  ? -7.467  10.211  -3.327  1.00 0.00 ? 62  PHE A CD1  3  
ATOM 4883  C CD2  . PHE A 1 62  ? -6.074  12.042  -3.837  1.00 0.00 ? 62  PHE A CD2  3  
ATOM 4884  C CE1  . PHE A 1 62  ? -8.426  11.097  -2.768  1.00 0.00 ? 62  PHE A CE1  3  
ATOM 4885  C CE2  . PHE A 1 62  ? -7.033  12.927  -3.277  1.00 0.00 ? 62  PHE A CE2  3  
ATOM 4886  C CZ   . PHE A 1 62  ? -8.189  12.435  -2.755  1.00 0.00 ? 62  PHE A CZ   3  
ATOM 4887  H H    . PHE A 1 62  ? -2.507  9.408   -4.118  1.00 0.00 ? 62  PHE A H    3  
ATOM 4888  H HA   . PHE A 1 62  ? -4.840  9.068   -2.406  1.00 0.00 ? 62  PHE A HA   3  
ATOM 4889  H HB2  . PHE A 1 62  ? -4.620  10.312  -5.113  1.00 0.00 ? 62  PHE A HB2  3  
ATOM 4890  H HB3  . PHE A 1 62  ? -5.794  9.012   -5.069  1.00 0.00 ? 62  PHE A HB3  3  
ATOM 4891  H HD1  . PHE A 1 62  ? -7.657  9.138   -3.338  1.00 0.00 ? 62  PHE A HD1  3  
ATOM 4892  H HD2  . PHE A 1 62  ? -5.148  12.435  -4.255  1.00 0.00 ? 62  PHE A HD2  3  
ATOM 4893  H HE1  . PHE A 1 62  ? -9.352  10.703  -2.349  1.00 0.00 ? 62  PHE A HE1  3  
ATOM 4894  H HE2  . PHE A 1 62  ? -6.843  14.000  -3.267  1.00 0.00 ? 62  PHE A HE2  3  
ATOM 4895  H HZ   . PHE A 1 62  ? -8.925  13.115  -2.326  1.00 0.00 ? 62  PHE A HZ   3  
ATOM 4896  N N    . ILE A 1 63  ? -4.190  6.689   -2.823  1.00 0.00 ? 63  ILE A N    3  
ATOM 4897  C CA   . ILE A 1 63  ? -4.054  5.264   -3.068  1.00 0.00 ? 63  ILE A CA   3  
ATOM 4898  C C    . ILE A 1 63  ? -5.414  4.587   -2.887  1.00 0.00 ? 63  ILE A C    3  
ATOM 4899  O O    . ILE A 1 63  ? -6.350  5.196   -2.371  1.00 0.00 ? 63  ILE A O    3  
ATOM 4900  C CB   . ILE A 1 63  ? -2.950  4.673   -2.190  1.00 0.00 ? 63  ILE A CB   3  
ATOM 4901  C CG1  . ILE A 1 63  ? -1.912  5.735   -1.824  1.00 0.00 ? 63  ILE A CG1  3  
ATOM 4902  C CG2  . ILE A 1 63  ? -2.312  3.453   -2.857  1.00 0.00 ? 63  ILE A CG2  3  
ATOM 4903  C CD1  . ILE A 1 63  ? -0.555  5.418   -2.457  1.00 0.00 ? 63  ILE A CD1  3  
ATOM 4904  H H    . ILE A 1 63  ? -4.202  6.954   -1.859  1.00 0.00 ? 63  ILE A H    3  
ATOM 4905  H HA   . ILE A 1 63  ? -3.742  5.140   -4.105  1.00 0.00 ? 63  ILE A HA   3  
ATOM 4906  H HB   . ILE A 1 63  ? -3.402  4.330   -1.258  1.00 0.00 ? 63  ILE A HB   3  
ATOM 4907  H HG12 . ILE A 1 63  ? -2.254  6.714   -2.160  1.00 0.00 ? 63  ILE A HG12 3  
ATOM 4908  H HG13 . ILE A 1 63  ? -1.807  5.790   -0.740  1.00 0.00 ? 63  ILE A HG13 3  
ATOM 4909  H HG21 . ILE A 1 63  ? -2.068  3.692   -3.892  1.00 0.00 ? 63  ILE A HG21 3  
ATOM 4910  H HG22 . ILE A 1 63  ? -1.401  3.182   -2.323  1.00 0.00 ? 63  ILE A HG22 3  
ATOM 4911  H HG23 . ILE A 1 63  ? -3.011  2.617   -2.831  1.00 0.00 ? 63  ILE A HG23 3  
ATOM 4912  H HD11 . ILE A 1 63  ? -0.703  5.085   -3.484  1.00 0.00 ? 63  ILE A HD11 3  
ATOM 4913  H HD12 . ILE A 1 63  ? 0.067   6.312   -2.450  1.00 0.00 ? 63  ILE A HD12 3  
ATOM 4914  H HD13 . ILE A 1 63  ? -0.064  4.628   -1.886  1.00 0.00 ? 63  ILE A HD13 3  
ATOM 4915  N N    . TYR A 1 64  ? -5.479  3.337   -3.319  1.00 0.00 ? 64  TYR A N    3  
ATOM 4916  C CA   . TYR A 1 64  ? -6.709  2.570   -3.211  1.00 0.00 ? 64  TYR A CA   3  
ATOM 4917  C C    . TYR A 1 64  ? -6.497  1.308   -2.373  1.00 0.00 ? 64  TYR A C    3  
ATOM 4918  O O    . TYR A 1 64  ? -5.403  0.744   -2.359  1.00 0.00 ? 64  TYR A O    3  
ATOM 4919  C CB   . TYR A 1 64  ? -7.080  2.164   -4.638  1.00 0.00 ? 64  TYR A CB   3  
ATOM 4920  C CG   . TYR A 1 64  ? -7.668  3.302   -5.477  1.00 0.00 ? 64  TYR A CG   3  
ATOM 4921  C CD1  . TYR A 1 64  ? -6.953  4.470   -5.651  1.00 0.00 ? 64  TYR A CD1  3  
ATOM 4922  C CD2  . TYR A 1 64  ? -8.910  3.158   -6.059  1.00 0.00 ? 64  TYR A CD2  3  
ATOM 4923  C CE1  . TYR A 1 64  ? -7.507  5.540   -6.439  1.00 0.00 ? 64  TYR A CE1  3  
ATOM 4924  C CE2  . TYR A 1 64  ? -9.463  4.228   -6.847  1.00 0.00 ? 64  TYR A CE2  3  
ATOM 4925  C CZ   . TYR A 1 64  ? -8.734  5.366   -6.999  1.00 0.00 ? 64  TYR A CZ   3  
ATOM 4926  O OH   . TYR A 1 64  ? -9.256  6.378   -7.745  1.00 0.00 ? 64  TYR A OH   3  
ATOM 4927  H H    . TYR A 1 64  ? -4.712  2.849   -3.737  1.00 0.00 ? 64  TYR A H    3  
ATOM 4928  H HA   . TYR A 1 64  ? -7.455  3.199   -2.725  1.00 0.00 ? 64  TYR A HA   3  
ATOM 4929  H HB2  . TYR A 1 64  ? -6.190  1.779   -5.139  1.00 0.00 ? 64  TYR A HB2  3  
ATOM 4930  H HB3  . TYR A 1 64  ? -7.800  1.347   -4.598  1.00 0.00 ? 64  TYR A HB3  3  
ATOM 4931  H HD1  . TYR A 1 64  ? -5.971  4.582   -5.191  1.00 0.00 ? 64  TYR A HD1  3  
ATOM 4932  H HD2  . TYR A 1 64  ? -9.474  2.236   -5.921  1.00 0.00 ? 64  TYR A HD2  3  
ATOM 4933  H HE1  . TYR A 1 64  ? -6.953  6.468   -6.585  1.00 0.00 ? 64  TYR A HE1  3  
ATOM 4934  H HE2  . TYR A 1 64  ? -10.444 4.129   -7.313  1.00 0.00 ? 64  TYR A HE2  3  
ATOM 4935  H HH   . TYR A 1 64  ? -10.061 6.054   -8.243  1.00 0.00 ? 64  TYR A HH   3  
ATOM 4936  N N    . THR A 1 65  ? -7.559  0.901   -1.694  1.00 0.00 ? 65  THR A N    3  
ATOM 4937  C CA   . THR A 1 65  ? -7.503  -0.285  -0.856  1.00 0.00 ? 65  THR A CA   3  
ATOM 4938  C C    . THR A 1 65  ? -8.915  -0.764  -0.515  1.00 0.00 ? 65  THR A C    3  
ATOM 4939  O O    . THR A 1 65  ? -9.884  -0.356  -1.154  1.00 0.00 ? 65  THR A O    3  
ATOM 4940  C CB   . THR A 1 65  ? -6.660  0.048   0.377   1.00 0.00 ? 65  THR A CB   3  
ATOM 4941  O OG1  . THR A 1 65  ? -6.704  -1.142  1.159   1.00 0.00 ? 65  THR A OG1  3  
ATOM 4942  C CG2  . THR A 1 65  ? -7.316  1.105   1.267   1.00 0.00 ? 65  THR A CG2  3  
ATOM 4943  H H    . THR A 1 65  ? -8.444  1.365   -1.712  1.00 0.00 ? 65  THR A H    3  
ATOM 4944  H HA   . THR A 1 65  ? -7.021  -1.082  -1.422  1.00 0.00 ? 65  THR A HA   3  
ATOM 4945  H HB   . THR A 1 65  ? -5.653  0.352   0.090   1.00 0.00 ? 65  THR A HB   3  
ATOM 4946  H HG1  . THR A 1 65  ? -6.356  -0.959  2.079   1.00 0.00 ? 65  THR A HG1  3  
ATOM 4947  H HG21 . THR A 1 65  ? -8.399  1.059   1.149   1.00 0.00 ? 65  THR A HG21 3  
ATOM 4948  H HG22 . THR A 1 65  ? -7.057  0.914   2.309   1.00 0.00 ? 65  THR A HG22 3  
ATOM 4949  H HG23 . THR A 1 65  ? -6.961  2.095   0.979   1.00 0.00 ? 65  THR A HG23 3  
ATOM 4950  N N    . ALA A 1 66  ? -8.986  -1.624  0.490   1.00 0.00 ? 66  ALA A N    3  
ATOM 4951  C CA   . ALA A 1 66  ? -10.264 -2.164  0.923   1.00 0.00 ? 66  ALA A CA   3  
ATOM 4952  C C    . ALA A 1 66  ? -10.705 -1.453  2.205   1.00 0.00 ? 66  ALA A C    3  
ATOM 4953  O O    . ALA A 1 66  ? -9.870  -0.975  2.973   1.00 0.00 ? 66  ALA A O    3  
ATOM 4954  C CB   . ALA A 1 66  ? -10.143 -3.678  1.109   1.00 0.00 ? 66  ALA A CB   3  
ATOM 4955  H H    . ALA A 1 66  ? -8.193  -1.951  1.004   1.00 0.00 ? 66  ALA A H    3  
ATOM 4956  H HA   . ALA A 1 66  ? -10.993 -1.964  0.138   1.00 0.00 ? 66  ALA A HA   3  
ATOM 4957  H HB1  . ALA A 1 66  ? -9.093  -3.968  1.051   1.00 0.00 ? 66  ALA A HB1  3  
ATOM 4958  H HB2  . ALA A 1 66  ? -10.543 -3.958  2.083   1.00 0.00 ? 66  ALA A HB2  3  
ATOM 4959  H HB3  . ALA A 1 66  ? -10.704 -4.186  0.325   1.00 0.00 ? 66  ALA A HB3  3  
ATOM 4960  N N    . PRO A 1 67  ? -12.049 -1.404  2.401   1.00 0.00 ? 67  PRO A N    3  
ATOM 4961  C CA   . PRO A 1 67  ? -12.611 -0.760  3.576   1.00 0.00 ? 67  PRO A CA   3  
ATOM 4962  C C    . PRO A 1 67  ? -12.426 -1.631  4.821   1.00 0.00 ? 67  PRO A C    3  
ATOM 4963  O O    . PRO A 1 67  ? -11.573 -2.517  4.841   1.00 0.00 ? 67  PRO A O    3  
ATOM 4964  C CB   . PRO A 1 67  ? -14.072 -0.519  3.232   1.00 0.00 ? 67  PRO A CB   3  
ATOM 4965  C CG   . PRO A 1 67  ? -14.385 -1.449  2.072   1.00 0.00 ? 67  PRO A CG   3  
ATOM 4966  C CD   . PRO A 1 67  ? -13.067 -1.959  1.514   1.00 0.00 ? 67  PRO A CD   3  
ATOM 4967  H HA   . PRO A 1 67  ? -12.130 0.095   3.767   1.00 0.00 ? 67  PRO A HA   3  
ATOM 4968  H HB2  . PRO A 1 67  ? -14.714 -0.731  4.087   1.00 0.00 ? 67  PRO A HB2  3  
ATOM 4969  H HB3  . PRO A 1 67  ? -14.241 0.521   2.956   1.00 0.00 ? 67  PRO A HB3  3  
ATOM 4970  H HG2  . PRO A 1 67  ? -15.007 -2.280  2.405   1.00 0.00 ? 67  PRO A HG2  3  
ATOM 4971  H HG3  . PRO A 1 67  ? -14.947 -0.921  1.300   1.00 0.00 ? 67  PRO A HG3  3  
ATOM 4972  H HD2  . PRO A 1 67  ? -13.035 -3.049  1.508   1.00 0.00 ? 67  PRO A HD2  3  
ATOM 4973  H HD3  . PRO A 1 67  ? -12.918 -1.630  0.486   1.00 0.00 ? 67  PRO A HD3  3  
ATOM 4974  N N    . SER A 1 68  ? -13.238 -1.349  5.829   1.00 0.00 ? 68  SER A N    3  
ATOM 4975  C CA   . SER A 1 68  ? -13.175 -2.094  7.073   1.00 0.00 ? 68  SER A CA   3  
ATOM 4976  C C    . SER A 1 68  ? -11.800 -1.916  7.721   1.00 0.00 ? 68  SER A C    3  
ATOM 4977  O O    . SER A 1 68  ? -11.073 -0.979  7.394   1.00 0.00 ? 68  SER A O    3  
ATOM 4978  C CB   . SER A 1 68  ? -13.463 -3.579  6.841   1.00 0.00 ? 68  SER A CB   3  
ATOM 4979  O OG   . SER A 1 68  ? -14.642 -4.006  7.518   1.00 0.00 ? 68  SER A OG   3  
ATOM 4980  H H    . SER A 1 68  ? -13.929 -0.626  5.804   1.00 0.00 ? 68  SER A H    3  
ATOM 4981  H HA   . SER A 1 68  ? -13.953 -1.669  7.705   1.00 0.00 ? 68  SER A HA   3  
ATOM 4982  H HB2  . SER A 1 68  ? -13.572 -3.765  5.772   1.00 0.00 ? 68  SER A HB2  3  
ATOM 4983  H HB3  . SER A 1 68  ? -12.614 -4.171  7.182   1.00 0.00 ? 68  SER A HB3  3  
ATOM 4984  H HG   . SER A 1 68  ? -14.471 -4.870  7.990   1.00 0.00 ? 68  SER A HG   3  
ATOM 4985  N N    . SER A 1 69  ? -11.485 -2.830  8.627   1.00 0.00 ? 69  SER A N    3  
ATOM 4986  C CA   . SER A 1 69  ? -10.211 -2.785  9.323   1.00 0.00 ? 69  SER A CA   3  
ATOM 4987  C C    . SER A 1 69  ? -9.115  -3.401  8.449   1.00 0.00 ? 69  SER A C    3  
ATOM 4988  O O    . SER A 1 69  ? -8.151  -3.966  8.964   1.00 0.00 ? 69  SER A O    3  
ATOM 4989  C CB   . SER A 1 69  ? -10.290 -3.514  10.666  1.00 0.00 ? 69  SER A CB   3  
ATOM 4990  O OG   . SER A 1 69  ? -9.055  -3.466  11.374  1.00 0.00 ? 69  SER A OG   3  
ATOM 4991  H H    . SER A 1 69  ? -12.082 -3.589  8.887   1.00 0.00 ? 69  SER A H    3  
ATOM 4992  H HA   . SER A 1 69  ? -10.013 -1.727  9.496   1.00 0.00 ? 69  SER A HA   3  
ATOM 4993  H HB2  . SER A 1 69  ? -11.075 -3.066  11.275  1.00 0.00 ? 69  SER A HB2  3  
ATOM 4994  H HB3  . SER A 1 69  ? -10.572 -4.554  10.498  1.00 0.00 ? 69  SER A HB3  3  
ATOM 4995  H HG   . SER A 1 69  ? -8.329  -3.130  10.773  1.00 0.00 ? 69  SER A HG   3  
ATOM 4996  N N    . ALA A 1 70  ? -9.301  -3.270  7.144   1.00 0.00 ? 70  ALA A N    3  
ATOM 4997  C CA   . ALA A 1 70  ? -8.340  -3.806  6.195   1.00 0.00 ? 70  ALA A CA   3  
ATOM 4998  C C    . ALA A 1 70  ? -8.692  -5.263  5.887   1.00 0.00 ? 70  ALA A C    3  
ATOM 4999  O O    . ALA A 1 70  ? -8.328  -6.165  6.639   1.00 0.00 ? 70  ALA A O    3  
ATOM 5000  C CB   . ALA A 1 70  ? -6.925  -3.654  6.758   1.00 0.00 ? 70  ALA A CB   3  
ATOM 5001  H H    . ALA A 1 70  ? -10.088 -2.808  6.734   1.00 0.00 ? 70  ALA A H    3  
ATOM 5002  H HA   . ALA A 1 70  ? -8.417  -3.221  5.278   1.00 0.00 ? 70  ALA A HA   3  
ATOM 5003  H HB1  . ALA A 1 70  ? -6.920  -2.875  7.521   1.00 0.00 ? 70  ALA A HB1  3  
ATOM 5004  H HB2  . ALA A 1 70  ? -6.608  -4.598  7.201   1.00 0.00 ? 70  ALA A HB2  3  
ATOM 5005  H HB3  . ALA A 1 70  ? -6.242  -3.382  5.954   1.00 0.00 ? 70  ALA A HB3  3  
ATOM 5006  N N    . VAL A 1 71  ? -9.397  -5.447  4.781   1.00 0.00 ? 71  VAL A N    3  
ATOM 5007  C CA   . VAL A 1 71  ? -9.801  -6.779  4.364   1.00 0.00 ? 71  VAL A CA   3  
ATOM 5008  C C    . VAL A 1 71  ? -8.970  -7.205  3.153   1.00 0.00 ? 71  VAL A C    3  
ATOM 5009  O O    . VAL A 1 71  ? -8.619  -8.376  3.018   1.00 0.00 ? 71  VAL A O    3  
ATOM 5010  C CB   . VAL A 1 71  ? -11.308 -6.807  4.095   1.00 0.00 ? 71  VAL A CB   3  
ATOM 5011  C CG1  . VAL A 1 71  ? -12.022 -5.689  4.857   1.00 0.00 ? 71  VAL A CG1  3  
ATOM 5012  C CG2  . VAL A 1 71  ? -11.598 -6.720  2.596   1.00 0.00 ? 71  VAL A CG2  3  
ATOM 5013  H H    . VAL A 1 71  ? -9.689  -4.708  4.174   1.00 0.00 ? 71  VAL A H    3  
ATOM 5014  H HA   . VAL A 1 71  ? -9.594  -7.459  5.190   1.00 0.00 ? 71  VAL A HA   3  
ATOM 5015  H HB   . VAL A 1 71  ? -11.694 -7.760  4.456   1.00 0.00 ? 71  VAL A HB   3  
ATOM 5016  H HG11 . VAL A 1 71  ? -11.702 -5.698  5.900   1.00 0.00 ? 71  VAL A HG11 3  
ATOM 5017  H HG12 . VAL A 1 71  ? -11.775 -4.728  4.409   1.00 0.00 ? 71  VAL A HG12 3  
ATOM 5018  H HG13 . VAL A 1 71  ? -13.100 -5.847  4.808   1.00 0.00 ? 71  VAL A HG13 3  
ATOM 5019  H HG21 . VAL A 1 71  ? -10.950 -5.970  2.142   1.00 0.00 ? 71  VAL A HG21 3  
ATOM 5020  H HG22 . VAL A 1 71  ? -11.411 -7.689  2.132   1.00 0.00 ? 71  VAL A HG22 3  
ATOM 5021  H HG23 . VAL A 1 71  ? -12.641 -6.439  2.443   1.00 0.00 ? 71  VAL A HG23 3  
ATOM 5022  N N    . CYS A 1 72  ? -8.677  -6.231  2.304   1.00 0.00 ? 72  CYS A N    3  
ATOM 5023  C CA   . CYS A 1 72  ? -7.893  -6.491  1.109   1.00 0.00 ? 72  CYS A CA   3  
ATOM 5024  C C    . CYS A 1 72  ? -6.685  -5.552  1.113   1.00 0.00 ? 72  CYS A C    3  
ATOM 5025  O O    . CYS A 1 72  ? -5.955  -5.470  0.127   1.00 0.00 ? 72  CYS A O    3  
ATOM 5026  C CB   . CYS A 1 72  ? -8.730  -6.337  -0.162  1.00 0.00 ? 72  CYS A CB   3  
ATOM 5027  S SG   . CYS A 1 72  ? -10.391 -7.101  -0.085  1.00 0.00 ? 72  CYS A SG   3  
ATOM 5028  H H    . CYS A 1 72  ? -8.966  -5.281  2.422   1.00 0.00 ? 72  CYS A H    3  
ATOM 5029  H HA   . CYS A 1 72  ? -7.575  -7.532  1.163   1.00 0.00 ? 72  CYS A HA   3  
ATOM 5030  H HB2  . CYS A 1 72  ? -8.844  -5.274  -0.378  1.00 0.00 ? 72  CYS A HB2  3  
ATOM 5031  H HB3  . CYS A 1 72  ? -8.183  -6.775  -0.997  1.00 0.00 ? 72  CYS A HB3  3  
ATOM 5032  N N    . GLY A 1 73  ? -6.511  -4.870  2.236   1.00 0.00 ? 73  GLY A N    3  
ATOM 5033  C CA   . GLY A 1 73  ? -5.403  -3.940  2.382   1.00 0.00 ? 73  GLY A CA   3  
ATOM 5034  C C    . GLY A 1 73  ? -4.946  -3.857  3.839   1.00 0.00 ? 73  GLY A C    3  
ATOM 5035  O O    . GLY A 1 73  ? -5.124  -4.804  4.605   1.00 0.00 ? 73  GLY A O    3  
ATOM 5036  H H    . GLY A 1 73  ? -7.109  -4.943  3.033   1.00 0.00 ? 73  GLY A H    3  
ATOM 5037  H HA2  . GLY A 1 73  ? -4.571  -4.259  1.754   1.00 0.00 ? 73  GLY A HA2  3  
ATOM 5038  H HA3  . GLY A 1 73  ? -5.705  -2.952  2.035   1.00 0.00 ? 73  GLY A HA3  3  
ATOM 5039  N N    . VAL A 1 74  ? -4.366  -2.716  4.180   1.00 0.00 ? 74  VAL A N    3  
ATOM 5040  C CA   . VAL A 1 74  ? -3.882  -2.497  5.533   1.00 0.00 ? 74  VAL A CA   3  
ATOM 5041  C C    . VAL A 1 74  ? -4.714  -1.397  6.196   1.00 0.00 ? 74  VAL A C    3  
ATOM 5042  O O    . VAL A 1 74  ? -4.485  -1.054  7.355   1.00 0.00 ? 74  VAL A O    3  
ATOM 5043  C CB   . VAL A 1 74  ? -2.385  -2.181  5.508   1.00 0.00 ? 74  VAL A CB   3  
ATOM 5044  C CG1  . VAL A 1 74  ? -1.879  -1.817  6.906   1.00 0.00 ? 74  VAL A CG1  3  
ATOM 5045  C CG2  . VAL A 1 74  ? -1.589  -3.349  4.923   1.00 0.00 ? 74  VAL A CG2  3  
ATOM 5046  H H    . VAL A 1 74  ? -4.226  -1.950  3.552   1.00 0.00 ? 74  VAL A H    3  
ATOM 5047  H HA   . VAL A 1 74  ? -4.022  -3.425  6.087   1.00 0.00 ? 74  VAL A HA   3  
ATOM 5048  H HB   . VAL A 1 74  ? -2.236  -1.317  4.862   1.00 0.00 ? 74  VAL A HB   3  
ATOM 5049  H HG11 . VAL A 1 74  ? -2.159  -2.601  7.609   1.00 0.00 ? 74  VAL A HG11 3  
ATOM 5050  H HG12 . VAL A 1 74  ? -0.794  -1.719  6.884   1.00 0.00 ? 74  VAL A HG12 3  
ATOM 5051  H HG13 . VAL A 1 74  ? -2.323  -0.872  7.218   1.00 0.00 ? 74  VAL A HG13 3  
ATOM 5052  H HG21 . VAL A 1 74  ? -2.205  -3.884  4.201   1.00 0.00 ? 74  VAL A HG21 3  
ATOM 5053  H HG22 . VAL A 1 74  ? -0.696  -2.967  4.427   1.00 0.00 ? 74  VAL A HG22 3  
ATOM 5054  H HG23 . VAL A 1 74  ? -1.297  -4.028  5.725   1.00 0.00 ? 74  VAL A HG23 3  
ATOM 5055  N N    . SER A 1 75  ? -5.663  -0.875  5.432   1.00 0.00 ? 75  SER A N    3  
ATOM 5056  C CA   . SER A 1 75  ? -6.531  0.178   5.931   1.00 0.00 ? 75  SER A CA   3  
ATOM 5057  C C    . SER A 1 75  ? -5.779  1.033   6.955   1.00 0.00 ? 75  SER A C    3  
ATOM 5058  O O    . SER A 1 75  ? -5.907  0.819   8.159   1.00 0.00 ? 75  SER A O    3  
ATOM 5059  C CB   . SER A 1 75  ? -7.801  -0.403  6.554   1.00 0.00 ? 75  SER A CB   3  
ATOM 5060  O OG   . SER A 1 75  ? -8.980  0.142   5.969   1.00 0.00 ? 75  SER A OG   3  
ATOM 5061  H H    . SER A 1 75  ? -5.843  -1.160  4.490   1.00 0.00 ? 75  SER A H    3  
ATOM 5062  H HA   . SER A 1 75  ? -6.794  0.773   5.057   1.00 0.00 ? 75  SER A HA   3  
ATOM 5063  H HB2  . SER A 1 75  ? -7.803  -1.486  6.431   1.00 0.00 ? 75  SER A HB2  3  
ATOM 5064  H HB3  . SER A 1 75  ? -7.803  -0.204  7.626   1.00 0.00 ? 75  SER A HB3  3  
ATOM 5065  H HG   . SER A 1 75  ? -9.727  0.134   6.633   1.00 0.00 ? 75  SER A HG   3  
ATOM 5066  N N    . LEU A 1 76  ? -5.015  1.983   6.437   1.00 0.00 ? 76  LEU A N    3  
ATOM 5067  C CA   . LEU A 1 76  ? -4.244  2.870   7.292   1.00 0.00 ? 76  LEU A CA   3  
ATOM 5068  C C    . LEU A 1 76  ? -4.942  4.229   7.370   1.00 0.00 ? 76  LEU A C    3  
ATOM 5069  O O    . LEU A 1 76  ? -5.484  4.710   6.376   1.00 0.00 ? 76  LEU A O    3  
ATOM 5070  C CB   . LEU A 1 76  ? -2.794  2.951   6.811   1.00 0.00 ? 76  LEU A CB   3  
ATOM 5071  C CG   . LEU A 1 76  ? -2.315  1.797   5.926   1.00 0.00 ? 76  LEU A CG   3  
ATOM 5072  C CD1  . LEU A 1 76  ? -2.430  2.160   4.444   1.00 0.00 ? 76  LEU A CD1  3  
ATOM 5073  C CD2  . LEU A 1 76  ? -0.895  1.369   6.303   1.00 0.00 ? 76  LEU A CD2  3  
ATOM 5074  H H    . LEU A 1 76  ? -4.916  2.150   5.457   1.00 0.00 ? 76  LEU A H    3  
ATOM 5075  H HA   . LEU A 1 76  ? -4.228  2.432   8.289   1.00 0.00 ? 76  LEU A HA   3  
ATOM 5076  H HB2  . LEU A 1 76  ? -2.665  3.882   6.261   1.00 0.00 ? 76  LEU A HB2  3  
ATOM 5077  H HB3  . LEU A 1 76  ? -2.144  3.004   7.686   1.00 0.00 ? 76  LEU A HB3  3  
ATOM 5078  H HG   . LEU A 1 76  ? -2.966  0.941   6.099   1.00 0.00 ? 76  LEU A HG   3  
ATOM 5079  H HD11 . LEU A 1 76  ? -2.989  3.090   4.340   1.00 0.00 ? 76  LEU A HD11 3  
ATOM 5080  H HD12 . LEU A 1 76  ? -1.433  2.285   4.022   1.00 0.00 ? 76  LEU A HD12 3  
ATOM 5081  H HD13 . LEU A 1 76  ? -2.952  1.363   3.915   1.00 0.00 ? 76  LEU A HD13 3  
ATOM 5082  H HD21 . LEU A 1 76  ? -0.536  1.986   7.127   1.00 0.00 ? 76  LEU A HD21 3  
ATOM 5083  H HD22 . LEU A 1 76  ? -0.900  0.322   6.608   1.00 0.00 ? 76  LEU A HD22 3  
ATOM 5084  H HD23 . LEU A 1 76  ? -0.238  1.494   5.442   1.00 0.00 ? 76  LEU A HD23 3  
ATOM 5085  N N    . ASP A 1 77  ? -4.905  4.810   8.560   1.00 0.00 ? 77  ASP A N    3  
ATOM 5086  C CA   . ASP A 1 77  ? -5.528  6.105   8.780   1.00 0.00 ? 77  ASP A CA   3  
ATOM 5087  C C    . ASP A 1 77  ? -4.495  7.070   9.365   1.00 0.00 ? 77  ASP A C    3  
ATOM 5088  O O    . ASP A 1 77  ? -4.807  8.227   9.641   1.00 0.00 ? 77  ASP A O    3  
ATOM 5089  C CB   . ASP A 1 77  ? -6.688  5.996   9.772   1.00 0.00 ? 77  ASP A CB   3  
ATOM 5090  C CG   . ASP A 1 77  ? -6.544  4.889   10.818  1.00 0.00 ? 77  ASP A CG   3  
ATOM 5091  O OD1  . ASP A 1 77  ? -5.935  5.179   11.870  1.00 0.00 ? 77  ASP A OD1  3  
ATOM 5092  O OD2  . ASP A 1 77  ? -7.045  3.778   10.541  1.00 0.00 ? 77  ASP A OD2  3  
ATOM 5093  H H    . ASP A 1 77  ? -4.462  4.412   9.363   1.00 0.00 ? 77  ASP A H    3  
ATOM 5094  H HA   . ASP A 1 77  ? -5.886  6.421   7.801   1.00 0.00 ? 77  ASP A HA   3  
ATOM 5095  H HB2  . ASP A 1 77  ? -6.796  6.950   10.287  1.00 0.00 ? 77  ASP A HB2  3  
ATOM 5096  H HB3  . ASP A 1 77  ? -7.609  5.830   9.213   1.00 0.00 ? 77  ASP A HB3  3  
ATOM 5097  N N    . VAL A 1 78  ? -3.285  6.558   9.538   1.00 0.00 ? 78  VAL A N    3  
ATOM 5098  C CA   . VAL A 1 78  ? -2.204  7.359   10.086  1.00 0.00 ? 78  VAL A CA   3  
ATOM 5099  C C    . VAL A 1 78  ? -2.495  7.663   11.557  1.00 0.00 ? 78  VAL A C    3  
ATOM 5100  O O    . VAL A 1 78  ? -1.687  7.348   12.431  1.00 0.00 ? 78  VAL A O    3  
ATOM 5101  C CB   . VAL A 1 78  ? -2.010  8.621   9.242   1.00 0.00 ? 78  VAL A CB   3  
ATOM 5102  C CG1  . VAL A 1 78  ? -1.353  9.733   10.063  1.00 0.00 ? 78  VAL A CG1  3  
ATOM 5103  C CG2  . VAL A 1 78  ? -1.198  8.317   7.982   1.00 0.00 ? 78  VAL A CG2  3  
ATOM 5104  H H    . VAL A 1 78  ? -3.039  5.614   9.312   1.00 0.00 ? 78  VAL A H    3  
ATOM 5105  H HA   . VAL A 1 78  ? -1.291  6.767   10.023  1.00 0.00 ? 78  VAL A HA   3  
ATOM 5106  H HB   . VAL A 1 78  ? -2.994  8.971   8.931   1.00 0.00 ? 78  VAL A HB   3  
ATOM 5107  H HG11 . VAL A 1 78  ? -0.659  9.294   10.779  1.00 0.00 ? 78  VAL A HG11 3  
ATOM 5108  H HG12 . VAL A 1 78  ? -0.812  10.405  9.397   1.00 0.00 ? 78  VAL A HG12 3  
ATOM 5109  H HG13 . VAL A 1 78  ? -2.122  10.292  10.597  1.00 0.00 ? 78  VAL A HG13 3  
ATOM 5110  H HG21 . VAL A 1 78  ? -1.538  7.378   7.547   1.00 0.00 ? 78  VAL A HG21 3  
ATOM 5111  H HG22 . VAL A 1 78  ? -1.334  9.122   7.259   1.00 0.00 ? 78  VAL A HG22 3  
ATOM 5112  H HG23 . VAL A 1 78  ? -0.141  8.236   8.240   1.00 0.00 ? 78  VAL A HG23 3  
ATOM 5113  N N    . GLY A 1 79  ? -3.649  8.270   11.786  1.00 0.00 ? 79  GLY A N    3  
ATOM 5114  C CA   . GLY A 1 79  ? -4.056  8.620   13.136  1.00 0.00 ? 79  GLY A CA   3  
ATOM 5115  C C    . GLY A 1 79  ? -3.906  7.425   14.081  1.00 0.00 ? 79  GLY A C    3  
ATOM 5116  O O    . GLY A 1 79  ? -3.941  7.584   15.300  1.00 0.00 ? 79  GLY A O    3  
ATOM 5117  H H    . GLY A 1 79  ? -4.299  8.523   11.070  1.00 0.00 ? 79  GLY A H    3  
ATOM 5118  H HA2  . GLY A 1 79  ? -3.452  9.452   13.498  1.00 0.00 ? 79  GLY A HA2  3  
ATOM 5119  H HA3  . GLY A 1 79  ? -5.093  8.957   13.132  1.00 0.00 ? 79  GLY A HA3  3  
ATOM 5120  N N    . GLY A 1 80  ? -3.742  6.255   13.481  1.00 0.00 ? 80  GLY A N    3  
ATOM 5121  C CA   . GLY A 1 80  ? -3.587  5.034   14.253  1.00 0.00 ? 80  GLY A CA   3  
ATOM 5122  C C    . GLY A 1 80  ? -2.206  4.414   14.027  1.00 0.00 ? 80  GLY A C    3  
ATOM 5123  O O    . GLY A 1 80  ? -1.709  3.672   14.873  1.00 0.00 ? 80  GLY A O    3  
ATOM 5124  H H    . GLY A 1 80  ? -3.715  6.134   12.489  1.00 0.00 ? 80  GLY A H    3  
ATOM 5125  H HA2  . GLY A 1 80  ? -3.723  5.250   15.313  1.00 0.00 ? 80  GLY A HA2  3  
ATOM 5126  H HA3  . GLY A 1 80  ? -4.360  4.320   13.971  1.00 0.00 ? 80  GLY A HA3  3  
ATOM 5127  N N    . LYS A 1 81  ? -1.626  4.741   12.882  1.00 0.00 ? 81  LYS A N    3  
ATOM 5128  C CA   . LYS A 1 81  ? -0.313  4.226   12.533  1.00 0.00 ? 81  LYS A CA   3  
ATOM 5129  C C    . LYS A 1 81  ? 0.692   5.380   12.509  1.00 0.00 ? 81  LYS A C    3  
ATOM 5130  O O    . LYS A 1 81  ? 1.295   5.704   13.530  1.00 0.00 ? 81  LYS A O    3  
ATOM 5131  C CB   . LYS A 1 81  ? -0.377  3.437   11.224  1.00 0.00 ? 81  LYS A CB   3  
ATOM 5132  C CG   . LYS A 1 81  ? -1.794  3.448   10.647  1.00 0.00 ? 81  LYS A CG   3  
ATOM 5133  C CD   . LYS A 1 81  ? -2.741  2.606   11.503  1.00 0.00 ? 81  LYS A CD   3  
ATOM 5134  C CE   . LYS A 1 81  ? -4.168  3.156   11.444  1.00 0.00 ? 81  LYS A CE   3  
ATOM 5135  N NZ   . LYS A 1 81  ? -5.005  2.330   10.546  1.00 0.00 ? 81  LYS A NZ   3  
ATOM 5136  H H    . LYS A 1 81  ? -2.038  5.346   12.199  1.00 0.00 ? 81  LYS A H    3  
ATOM 5137  H HA   . LYS A 1 81  ? -0.018  3.528   13.316  1.00 0.00 ? 81  LYS A HA   3  
ATOM 5138  H HB2  . LYS A 1 81  ? 0.318   3.867   10.502  1.00 0.00 ? 81  LYS A HB2  3  
ATOM 5139  H HB3  . LYS A 1 81  ? -0.059  2.409   11.399  1.00 0.00 ? 81  LYS A HB3  3  
ATOM 5140  H HG2  . LYS A 1 81  ? -2.160  4.473   10.591  1.00 0.00 ? 81  LYS A HG2  3  
ATOM 5141  H HG3  . LYS A 1 81  ? -1.777  3.060   9.627   1.00 0.00 ? 81  LYS A HG3  3  
ATOM 5142  H HD2  . LYS A 1 81  ? -2.732  1.574   11.155  1.00 0.00 ? 81  LYS A HD2  3  
ATOM 5143  H HD3  . LYS A 1 81  ? -2.394  2.599   12.536  1.00 0.00 ? 81  LYS A HD3  3  
ATOM 5144  H HE2  . LYS A 1 81  ? -4.601  3.169   12.445  1.00 0.00 ? 81  LYS A HE2  3  
ATOM 5145  H HE3  . LYS A 1 81  ? -4.152  4.188   11.090  1.00 0.00 ? 81  LYS A HE3  3  
ATOM 5146  H HZ1  . LYS A 1 81  ? -4.448  1.603   10.145  1.00 0.00 ? 81  LYS A HZ1  3  
ATOM 5147  H HZ2  . LYS A 1 81  ? -5.756  1.925   11.068  1.00 0.00 ? 81  LYS A HZ2  3  
ATOM 5148  H HZ3  . LYS A 1 81  ? -5.378  2.903   9.817   1.00 0.00 ? 81  LYS A HZ3  3  
ATOM 5149  N N    . LYS A 1 82  ? 0.841   5.966   11.330  1.00 0.00 ? 82  LYS A N    3  
ATOM 5150  C CA   . LYS A 1 82  ? 1.763   7.077   11.158  1.00 0.00 ? 82  LYS A CA   3  
ATOM 5151  C C    . LYS A 1 82  ? 2.050   7.270   9.668   1.00 0.00 ? 82  LYS A C    3  
ATOM 5152  O O    . LYS A 1 82  ? 1.796   8.339   9.117   1.00 0.00 ? 82  LYS A O    3  
ATOM 5153  C CB   . LYS A 1 82  ? 3.020   6.865   12.005  1.00 0.00 ? 82  LYS A CB   3  
ATOM 5154  C CG   . LYS A 1 82  ? 3.564   5.445   11.833  1.00 0.00 ? 82  LYS A CG   3  
ATOM 5155  C CD   . LYS A 1 82  ? 3.900   4.819   13.188  1.00 0.00 ? 82  LYS A CD   3  
ATOM 5156  C CE   . LYS A 1 82  ? 3.076   3.552   13.426  1.00 0.00 ? 82  LYS A CE   3  
ATOM 5157  N NZ   . LYS A 1 82  ? 3.885   2.534   14.134  1.00 0.00 ? 82  LYS A NZ   3  
ATOM 5158  H H    . LYS A 1 82  ? 0.347   5.697   10.504  1.00 0.00 ? 82  LYS A H    3  
ATOM 5159  H HA   . LYS A 1 82  ? 1.269   7.973   11.534  1.00 0.00 ? 82  LYS A HA   3  
ATOM 5160  H HB2  . LYS A 1 82  ? 3.784   7.588   11.716  1.00 0.00 ? 82  LYS A HB2  3  
ATOM 5161  H HB3  . LYS A 1 82  ? 2.791   7.046   13.054  1.00 0.00 ? 82  LYS A HB3  3  
ATOM 5162  H HG2  . LYS A 1 82  ? 2.827   4.830   11.317  1.00 0.00 ? 82  LYS A HG2  3  
ATOM 5163  H HG3  . LYS A 1 82  ? 4.456   5.466   11.207  1.00 0.00 ? 82  LYS A HG3  3  
ATOM 5164  H HD2  . LYS A 1 82  ? 4.963   4.580   13.229  1.00 0.00 ? 82  LYS A HD2  3  
ATOM 5165  H HD3  . LYS A 1 82  ? 3.705   5.539   13.983  1.00 0.00 ? 82  LYS A HD3  3  
ATOM 5166  H HE2  . LYS A 1 82  ? 2.189   3.792   14.012  1.00 0.00 ? 82  LYS A HE2  3  
ATOM 5167  H HE3  . LYS A 1 82  ? 2.731   3.152   12.473  1.00 0.00 ? 82  LYS A HE3  3  
ATOM 5168  H HZ1  . LYS A 1 82  ? 4.822   2.868   14.240  1.00 0.00 ? 82  LYS A HZ1  3  
ATOM 5169  H HZ2  . LYS A 1 82  ? 3.489   2.361   15.036  1.00 0.00 ? 82  LYS A HZ2  3  
ATOM 5170  H HZ3  . LYS A 1 82  ? 3.891   1.686   13.604  1.00 0.00 ? 82  LYS A HZ3  3  
ATOM 5171  N N    . GLU A 1 83  ? 2.577   6.218   9.059   1.00 0.00 ? 83  GLU A N    3  
ATOM 5172  C CA   . GLU A 1 83  ? 2.901   6.258   7.642   1.00 0.00 ? 83  GLU A CA   3  
ATOM 5173  C C    . GLU A 1 83  ? 3.322   4.870   7.156   1.00 0.00 ? 83  GLU A C    3  
ATOM 5174  O O    . GLU A 1 83  ? 3.562   3.971   7.960   1.00 0.00 ? 83  GLU A O    3  
ATOM 5175  C CB   . GLU A 1 83  ? 3.993   7.292   7.359   1.00 0.00 ? 83  GLU A CB   3  
ATOM 5176  C CG   . GLU A 1 83  ? 4.703   7.707   8.650   1.00 0.00 ? 83  GLU A CG   3  
ATOM 5177  C CD   . GLU A 1 83  ? 4.251   9.096   9.103   1.00 0.00 ? 83  GLU A CD   3  
ATOM 5178  O OE1  . GLU A 1 83  ? 4.373   10.029  8.279   1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5179  O OE2  . GLU A 1 83  ? 3.795   9.195   10.262  1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5180  H H    . GLU A 1 83  ? 2.781   5.351   9.514   1.00 0.00 ? 83  GLU A H    3  
ATOM 5181  H HA   . GLU A 1 83  ? 1.982   6.563   7.143   1.00 0.00 ? 83  GLU A HA   3  
ATOM 5182  H HB2  . GLU A 1 83  ? 4.717   6.879   6.658   1.00 0.00 ? 83  GLU A HB2  3  
ATOM 5183  H HB3  . GLU A 1 83  ? 3.553   8.169   6.885   1.00 0.00 ? 83  GLU A HB3  3  
ATOM 5184  H HG2  . GLU A 1 83  ? 4.495   6.979   9.433   1.00 0.00 ? 83  GLU A HG2  3  
ATOM 5185  H HG3  . GLU A 1 83  ? 5.782   7.705   8.492   1.00 0.00 ? 83  GLU A HG3  3  
ATOM 5186  N N    . TYR A 1 84  ? 3.398   4.739   5.839   1.00 0.00 ? 84  TYR A N    3  
ATOM 5187  C CA   . TYR A 1 84  ? 3.786   3.475   5.234   1.00 0.00 ? 84  TYR A CA   3  
ATOM 5188  C C    . TYR A 1 84  ? 4.456   3.700   3.877   1.00 0.00 ? 84  TYR A C    3  
ATOM 5189  O O    . TYR A 1 84  ? 4.200   4.702   3.212   1.00 0.00 ? 84  TYR A O    3  
ATOM 5190  C CB   . TYR A 1 84  ? 2.488   2.692   5.026   1.00 0.00 ? 84  TYR A CB   3  
ATOM 5191  C CG   . TYR A 1 84  ? 1.430   3.445   4.216   1.00 0.00 ? 84  TYR A CG   3  
ATOM 5192  C CD1  . TYR A 1 84  ? 1.695   3.819   2.915   1.00 0.00 ? 84  TYR A CD1  3  
ATOM 5193  C CD2  . TYR A 1 84  ? 0.211   3.748   4.787   1.00 0.00 ? 84  TYR A CD2  3  
ATOM 5194  C CE1  . TYR A 1 84  ? 0.700   4.527   2.153   1.00 0.00 ? 84  TYR A CE1  3  
ATOM 5195  C CE2  . TYR A 1 84  ? -0.785  4.456   4.025   1.00 0.00 ? 84  TYR A CE2  3  
ATOM 5196  C CZ   . TYR A 1 84  ? -0.492  4.811   2.745   1.00 0.00 ? 84  TYR A CZ   3  
ATOM 5197  O OH   . TYR A 1 84  ? -1.431  5.479   2.025   1.00 0.00 ? 84  TYR A OH   3  
ATOM 5198  H H    . TYR A 1 84  ? 3.201   5.474   5.191   1.00 0.00 ? 84  TYR A H    3  
ATOM 5199  H HA   . TYR A 1 84  ? 4.492   2.984   5.903   1.00 0.00 ? 84  TYR A HA   3  
ATOM 5200  H HB2  . TYR A 1 84  ? 2.719   1.754   4.520   1.00 0.00 ? 84  TYR A HB2  3  
ATOM 5201  H HB3  . TYR A 1 84  ? 2.071   2.435   6.000   1.00 0.00 ? 84  TYR A HB3  3  
ATOM 5202  H HD1  . TYR A 1 84  ? 2.658   3.579   2.464   1.00 0.00 ? 84  TYR A HD1  3  
ATOM 5203  H HD2  . TYR A 1 84  ? 0.002   3.451   5.815   1.00 0.00 ? 84  TYR A HD2  3  
ATOM 5204  H HE1  . TYR A 1 84  ? 0.896   4.830   1.124   1.00 0.00 ? 84  TYR A HE1  3  
ATOM 5205  H HE2  . TYR A 1 84  ? -1.752  4.702   4.463   1.00 0.00 ? 84  TYR A HE2  3  
ATOM 5206  H HH   . TYR A 1 84  ? -1.772  4.900   1.285   1.00 0.00 ? 84  TYR A HH   3  
ATOM 5207  N N    . LEU A 1 85  ? 5.300   2.749   3.505   1.00 0.00 ? 85  LEU A N    3  
ATOM 5208  C CA   . LEU A 1 85  ? 6.009   2.830   2.239   1.00 0.00 ? 85  LEU A CA   3  
ATOM 5209  C C    . LEU A 1 85  ? 5.109   2.300   1.122   1.00 0.00 ? 85  LEU A C    3  
ATOM 5210  O O    . LEU A 1 85  ? 5.517   2.249   -0.037  1.00 0.00 ? 85  LEU A O    3  
ATOM 5211  C CB   . LEU A 1 85  ? 7.359   2.115   2.334   1.00 0.00 ? 85  LEU A CB   3  
ATOM 5212  C CG   . LEU A 1 85  ? 7.319   0.671   2.837   1.00 0.00 ? 85  LEU A CG   3  
ATOM 5213  C CD1  . LEU A 1 85  ? 7.472   0.615   4.358   1.00 0.00 ? 85  LEU A CD1  3  
ATOM 5214  C CD2  . LEU A 1 85  ? 6.051   -0.040  2.362   1.00 0.00 ? 85  LEU A CD2  3  
ATOM 5215  H H    . LEU A 1 85  ? 5.503   1.936   4.052   1.00 0.00 ? 85  LEU A H    3  
ATOM 5216  H HA   . LEU A 1 85  ? 6.215   3.883   2.047   1.00 0.00 ? 85  LEU A HA   3  
ATOM 5217  H HB2  . LEU A 1 85  ? 7.822   2.123   1.347   1.00 0.00 ? 85  LEU A HB2  3  
ATOM 5218  H HB3  . LEU A 1 85  ? 8.007   2.692   2.995   1.00 0.00 ? 85  LEU A HB3  3  
ATOM 5219  H HG   . LEU A 1 85  ? 8.167   0.137   2.408   1.00 0.00 ? 85  LEU A HG   3  
ATOM 5220  H HD11 . LEU A 1 85  ? 7.901   1.552   4.714   1.00 0.00 ? 85  LEU A HD11 3  
ATOM 5221  H HD12 . LEU A 1 85  ? 6.494   0.468   4.816   1.00 0.00 ? 85  LEU A HD12 3  
ATOM 5222  H HD13 . LEU A 1 85  ? 8.129   -0.212  4.627   1.00 0.00 ? 85  LEU A HD13 3  
ATOM 5223  H HD21 . LEU A 1 85  ? 6.020   -0.040  1.273   1.00 0.00 ? 85  LEU A HD21 3  
ATOM 5224  H HD22 . LEU A 1 85  ? 6.052   -1.067  2.725   1.00 0.00 ? 85  LEU A HD22 3  
ATOM 5225  H HD23 . LEU A 1 85  ? 5.175   0.481   2.749   1.00 0.00 ? 85  LEU A HD23 3  
ATOM 5226  N N    . ILE A 1 86  ? 3.901   1.918   1.509   1.00 0.00 ? 86  ILE A N    3  
ATOM 5227  C CA   . ILE A 1 86  ? 2.940   1.392   0.554   1.00 0.00 ? 86  ILE A CA   3  
ATOM 5228  C C    . ILE A 1 86  ? 3.652   1.094   -0.767  1.00 0.00 ? 86  ILE A C    3  
ATOM 5229  O O    . ILE A 1 86  ? 3.891   1.999   -1.566  1.00 0.00 ? 86  ILE A O    3  
ATOM 5230  C CB   . ILE A 1 86  ? 1.752   2.346   0.412   1.00 0.00 ? 86  ILE A CB   3  
ATOM 5231  C CG1  . ILE A 1 86  ? 0.518   1.795   1.129   1.00 0.00 ? 86  ILE A CG1  3  
ATOM 5232  C CG2  . ILE A 1 86  ? 1.469   2.652   -1.061  1.00 0.00 ? 86  ILE A CG2  3  
ATOM 5233  C CD1  . ILE A 1 86  ? 0.886   1.245   2.509   1.00 0.00 ? 86  ILE A CD1  3  
ATOM 5234  H H    . ILE A 1 86  ? 3.577   1.961   2.454   1.00 0.00 ? 86  ILE A H    3  
ATOM 5235  H HA   . ILE A 1 86  ? 2.556   0.456   0.958   1.00 0.00 ? 86  ILE A HA   3  
ATOM 5236  H HB   . ILE A 1 86  ? 2.010   3.288   0.893   1.00 0.00 ? 86  ILE A HB   3  
ATOM 5237  H HG12 . ILE A 1 86  ? -0.228  2.583   1.235   1.00 0.00 ? 86  ILE A HG12 3  
ATOM 5238  H HG13 . ILE A 1 86  ? 0.065   1.006   0.529   1.00 0.00 ? 86  ILE A HG13 3  
ATOM 5239  H HG21 . ILE A 1 86  ? 1.633   1.755   -1.657  1.00 0.00 ? 86  ILE A HG21 3  
ATOM 5240  H HG22 . ILE A 1 86  ? 0.434   2.977   -1.172  1.00 0.00 ? 86  ILE A HG22 3  
ATOM 5241  H HG23 . ILE A 1 86  ? 2.137   3.443   -1.403  1.00 0.00 ? 86  ILE A HG23 3  
ATOM 5242  H HD11 . ILE A 1 86  ? 1.913   1.523   2.749   1.00 0.00 ? 86  ILE A HD11 3  
ATOM 5243  H HD12 . ILE A 1 86  ? 0.213   1.663   3.257   1.00 0.00 ? 86  ILE A HD12 3  
ATOM 5244  H HD13 . ILE A 1 86  ? 0.796   0.159   2.504   1.00 0.00 ? 86  ILE A HD13 3  
ATOM 5245  N N    . ALA A 1 87  ? 3.970   -0.178  -0.957  1.00 0.00 ? 87  ALA A N    3  
ATOM 5246  C CA   . ALA A 1 87  ? 4.649   -0.607  -2.168  1.00 0.00 ? 87  ALA A CA   3  
ATOM 5247  C C    . ALA A 1 87  ? 3.842   -1.725  -2.832  1.00 0.00 ? 87  ALA A C    3  
ATOM 5248  O O    . ALA A 1 87  ? 3.828   -2.856  -2.348  1.00 0.00 ? 87  ALA A O    3  
ATOM 5249  C CB   . ALA A 1 87  ? 6.076   -1.042  -1.826  1.00 0.00 ? 87  ALA A CB   3  
ATOM 5250  H H    . ALA A 1 87  ? 3.772   -0.908  -0.303  1.00 0.00 ? 87  ALA A H    3  
ATOM 5251  H HA   . ALA A 1 87  ? 4.695   0.247   -2.843  1.00 0.00 ? 87  ALA A HA   3  
ATOM 5252  H HB1  . ALA A 1 87  ? 6.132   -1.308  -0.771  1.00 0.00 ? 87  ALA A HB1  3  
ATOM 5253  H HB2  . ALA A 1 87  ? 6.348   -1.904  -2.434  1.00 0.00 ? 87  ALA A HB2  3  
ATOM 5254  H HB3  . ALA A 1 87  ? 6.764   -0.222  -2.031  1.00 0.00 ? 87  ALA A HB3  3  
ATOM 5255  N N    . GLY A 1 88  ? 3.191   -1.368  -3.929  1.00 0.00 ? 88  GLY A N    3  
ATOM 5256  C CA   . GLY A 1 88  ? 2.384   -2.327  -4.664  1.00 0.00 ? 88  GLY A CA   3  
ATOM 5257  C C    . GLY A 1 88  ? 2.554   -2.144  -6.173  1.00 0.00 ? 88  GLY A C    3  
ATOM 5258  O O    . GLY A 1 88  ? 3.080   -1.127  -6.624  1.00 0.00 ? 88  GLY A O    3  
ATOM 5259  H H    . GLY A 1 88  ? 3.208   -0.446  -4.316  1.00 0.00 ? 88  GLY A H    3  
ATOM 5260  H HA2  . GLY A 1 88  ? 2.670   -3.341  -4.382  1.00 0.00 ? 88  GLY A HA2  3  
ATOM 5261  H HA3  . GLY A 1 88  ? 1.334   -2.206  -4.396  1.00 0.00 ? 88  GLY A HA3  3  
ATOM 5262  N N    . LYS A 1 89  ? 2.100   -3.146  -6.914  1.00 0.00 ? 89  LYS A N    3  
ATOM 5263  C CA   . LYS A 1 89  ? 2.196   -3.109  -8.363  1.00 0.00 ? 89  LYS A CA   3  
ATOM 5264  C C    . LYS A 1 89  ? 1.903   -1.689  -8.853  1.00 0.00 ? 89  LYS A C    3  
ATOM 5265  O O    . LYS A 1 89  ? 2.446   -1.253  -9.867  1.00 0.00 ? 89  LYS A O    3  
ATOM 5266  C CB   . LYS A 1 89  ? 1.293   -4.174  -8.988  1.00 0.00 ? 89  LYS A CB   3  
ATOM 5267  C CG   . LYS A 1 89  ? 1.578   -4.327  -10.483 1.00 0.00 ? 89  LYS A CG   3  
ATOM 5268  C CD   . LYS A 1 89  ? 1.557   -5.799  -10.897 1.00 0.00 ? 89  LYS A CD   3  
ATOM 5269  C CE   . LYS A 1 89  ? 2.621   -6.085  -11.959 1.00 0.00 ? 89  LYS A CE   3  
ATOM 5270  N NZ   . LYS A 1 89  ? 1.986   -6.440  -13.248 1.00 0.00 ? 89  LYS A NZ   3  
ATOM 5271  H H    . LYS A 1 89  ? 1.674   -3.969  -6.539  1.00 0.00 ? 89  LYS A H    3  
ATOM 5272  H HA   . LYS A 1 89  ? 3.222   -3.360  -8.629  1.00 0.00 ? 89  LYS A HA   3  
ATOM 5273  H HB2  . LYS A 1 89  ? 1.447   -5.128  -8.484  1.00 0.00 ? 89  LYS A HB2  3  
ATOM 5274  H HB3  . LYS A 1 89  ? 0.248   -3.902  -8.839  1.00 0.00 ? 89  LYS A HB3  3  
ATOM 5275  H HG2  . LYS A 1 89  ? 0.836   -3.772  -11.057 1.00 0.00 ? 89  LYS A HG2  3  
ATOM 5276  H HG3  . LYS A 1 89  ? 2.550   -3.893  -10.717 1.00 0.00 ? 89  LYS A HG3  3  
ATOM 5277  H HD2  . LYS A 1 89  ? 1.731   -6.428  -10.025 1.00 0.00 ? 89  LYS A HD2  3  
ATOM 5278  H HD3  . LYS A 1 89  ? 0.572   -6.057  -11.285 1.00 0.00 ? 89  LYS A HD3  3  
ATOM 5279  H HE2  . LYS A 1 89  ? 3.258   -5.210  -12.089 1.00 0.00 ? 89  LYS A HE2  3  
ATOM 5280  H HE3  . LYS A 1 89  ? 3.264   -6.901  -11.627 1.00 0.00 ? 89  LYS A HE3  3  
ATOM 5281  H HZ1  . LYS A 1 89  ? 1.060   -6.779  -13.080 1.00 0.00 ? 89  LYS A HZ1  3  
ATOM 5282  H HZ2  . LYS A 1 89  ? 1.943   -5.629  -13.833 1.00 0.00 ? 89  LYS A HZ2  3  
ATOM 5283  H HZ3  . LYS A 1 89  ? 2.523   -7.150  -13.700 1.00 0.00 ? 89  LYS A HZ3  3  
ATOM 5284  N N    . ALA A 1 90  ? 1.043   -1.007  -8.110  1.00 0.00 ? 90  ALA A N    3  
ATOM 5285  C CA   . ALA A 1 90  ? 0.671   0.355   -8.456  1.00 0.00 ? 90  ALA A CA   3  
ATOM 5286  C C    . ALA A 1 90  ? -0.450  0.323   -9.497  1.00 0.00 ? 90  ALA A C    3  
ATOM 5287  O O    . ALA A 1 90  ? -0.885  -0.749  -9.914  1.00 0.00 ? 90  ALA A O    3  
ATOM 5288  C CB   . ALA A 1 90  ? 1.906   1.112   -8.950  1.00 0.00 ? 90  ALA A CB   3  
ATOM 5289  H H    . ALA A 1 90  ? 0.605   -1.368  -7.287  1.00 0.00 ? 90  ALA A H    3  
ATOM 5290  H HA   . ALA A 1 90  ? 0.301   0.838   -7.552  1.00 0.00 ? 90  ALA A HA   3  
ATOM 5291  H HB1  . ALA A 1 90  ? 2.798   0.693   -8.487  1.00 0.00 ? 90  ALA A HB1  3  
ATOM 5292  H HB2  . ALA A 1 90  ? 1.979   1.018   -10.033 1.00 0.00 ? 90  ALA A HB2  3  
ATOM 5293  H HB3  . ALA A 1 90  ? 1.817   2.165   -8.681  1.00 0.00 ? 90  ALA A HB3  3  
ATOM 5294  N N    . GLU A 1 91  ? -0.884  1.512   -9.889  1.00 0.00 ? 91  GLU A N    3  
ATOM 5295  C CA   . GLU A 1 91  ? -1.945  1.634   -10.873 1.00 0.00 ? 91  GLU A CA   3  
ATOM 5296  C C    . GLU A 1 91  ? -1.566  2.666   -11.938 1.00 0.00 ? 91  GLU A C    3  
ATOM 5297  O O    . GLU A 1 91  ? -1.809  2.455   -13.125 1.00 0.00 ? 91  GLU A O    3  
ATOM 5298  C CB   . GLU A 1 91  ? -3.274  1.999   -10.206 1.00 0.00 ? 91  GLU A CB   3  
ATOM 5299  C CG   . GLU A 1 91  ? -4.457  1.473   -11.020 1.00 0.00 ? 91  GLU A CG   3  
ATOM 5300  C CD   . GLU A 1 91  ? -4.171  1.552   -12.520 1.00 0.00 ? 91  GLU A CD   3  
ATOM 5301  O OE1  . GLU A 1 91  ? -4.319  2.666   -13.068 1.00 0.00 ? 91  GLU A OE1  3  
ATOM 5302  O OE2  . GLU A 1 91  ? -3.810  0.498   -13.085 1.00 0.00 ? 91  GLU A OE2  3  
ATOM 5303  H H    . GLU A 1 91  ? -0.525  2.379   -9.544  1.00 0.00 ? 91  GLU A H    3  
ATOM 5304  H HA   . GLU A 1 91  ? -2.033  0.648   -11.329 1.00 0.00 ? 91  GLU A HA   3  
ATOM 5305  H HB2  . GLU A 1 91  ? -3.305  1.582   -9.200  1.00 0.00 ? 91  GLU A HB2  3  
ATOM 5306  H HB3  . GLU A 1 91  ? -3.349  3.082   -10.105 1.00 0.00 ? 91  GLU A HB3  3  
ATOM 5307  H HG2  . GLU A 1 91  ? -4.667  0.441   -10.739 1.00 0.00 ? 91  GLU A HG2  3  
ATOM 5308  H HG3  . GLU A 1 91  ? -5.350  2.054   -10.785 1.00 0.00 ? 91  GLU A HG3  3  
ATOM 5309  N N    . GLY A 1 92  ? -0.975  3.757   -11.474 1.00 0.00 ? 92  GLY A N    3  
ATOM 5310  C CA   . GLY A 1 92  ? -0.558  4.821   -12.373 1.00 0.00 ? 92  GLY A CA   3  
ATOM 5311  C C    . GLY A 1 92  ? -0.033  6.025   -11.588 1.00 0.00 ? 92  GLY A C    3  
ATOM 5312  O O    . GLY A 1 92  ? 0.647   5.863   -10.576 1.00 0.00 ? 92  GLY A O    3  
ATOM 5313  H H    . GLY A 1 92  ? -0.780  3.919   -10.507 1.00 0.00 ? 92  GLY A H    3  
ATOM 5314  H HA2  . GLY A 1 92  ? 0.218   4.452   -13.043 1.00 0.00 ? 92  GLY A HA2  3  
ATOM 5315  H HA3  . GLY A 1 92  ? -1.400  5.126   -12.994 1.00 0.00 ? 92  GLY A HA3  3  
ATOM 5316  N N    . ASP A 1 93  ? -0.367  7.207   -12.087 1.00 0.00 ? 93  ASP A N    3  
ATOM 5317  C CA   . ASP A 1 93  ? 0.062   8.438   -11.446 1.00 0.00 ? 93  ASP A CA   3  
ATOM 5318  C C    . ASP A 1 93  ? -1.134  9.091   -10.751 1.00 0.00 ? 93  ASP A C    3  
ATOM 5319  O O    . ASP A 1 93  ? -2.187  9.272   -11.361 1.00 0.00 ? 93  ASP A O    3  
ATOM 5320  C CB   . ASP A 1 93  ? 0.613   9.430   -12.473 1.00 0.00 ? 93  ASP A CB   3  
ATOM 5321  C CG   . ASP A 1 93  ? 1.958   9.042   -13.090 1.00 0.00 ? 93  ASP A CG   3  
ATOM 5322  O OD1  . ASP A 1 93  ? 2.503   8.004   -12.657 1.00 0.00 ? 93  ASP A OD1  3  
ATOM 5323  O OD2  . ASP A 1 93  ? 2.410   9.793   -13.981 1.00 0.00 ? 93  ASP A OD2  3  
ATOM 5324  H H    . ASP A 1 93  ? -0.920  7.329   -12.910 1.00 0.00 ? 93  ASP A H    3  
ATOM 5325  H HA   . ASP A 1 93  ? 0.841   8.138   -10.743 1.00 0.00 ? 93  ASP A HA   3  
ATOM 5326  H HB2  . ASP A 1 93  ? -0.119  9.544   -13.272 1.00 0.00 ? 93  ASP A HB2  3  
ATOM 5327  H HB3  . ASP A 1 93  ? 0.717   10.404  -11.994 1.00 0.00 ? 93  ASP A HB3  3  
ATOM 5328  N N    . GLY A 1 94  ? -0.932  9.426   -9.485  1.00 0.00 ? 94  GLY A N    3  
ATOM 5329  C CA   . GLY A 1 94  ? -1.981  10.055  -8.700  1.00 0.00 ? 94  GLY A CA   3  
ATOM 5330  C C    . GLY A 1 94  ? -2.913  9.005   -8.090  1.00 0.00 ? 94  GLY A C    3  
ATOM 5331  O O    . GLY A 1 94  ? -3.838  9.346   -7.354  1.00 0.00 ? 94  GLY A O    3  
ATOM 5332  H H    . GLY A 1 94  ? -0.073  9.275   -8.997  1.00 0.00 ? 94  GLY A H    3  
ATOM 5333  H HA2  . GLY A 1 94  ? -1.537  10.657  -7.909  1.00 0.00 ? 94  GLY A HA2  3  
ATOM 5334  H HA3  . GLY A 1 94  ? -2.556  10.732  -9.333  1.00 0.00 ? 94  GLY A HA3  3  
ATOM 5335  N N    . LYS A 1 95  ? -2.635  7.752   -8.418  1.00 0.00 ? 95  LYS A N    3  
ATOM 5336  C CA   . LYS A 1 95  ? -3.437  6.651   -7.911  1.00 0.00 ? 95  LYS A CA   3  
ATOM 5337  C C    . LYS A 1 95  ? -2.750  5.327   -8.249  1.00 0.00 ? 95  LYS A C    3  
ATOM 5338  O O    . LYS A 1 95  ? -2.219  5.162   -9.347  1.00 0.00 ? 95  LYS A O    3  
ATOM 5339  C CB   . LYS A 1 95  ? -4.872  6.750   -8.430  1.00 0.00 ? 95  LYS A CB   3  
ATOM 5340  C CG   . LYS A 1 95  ? -4.949  6.356   -9.907  1.00 0.00 ? 95  LYS A CG   3  
ATOM 5341  C CD   . LYS A 1 95  ? -4.559  7.528   -10.809 1.00 0.00 ? 95  LYS A CD   3  
ATOM 5342  C CE   . LYS A 1 95  ? -3.812  7.040   -12.051 1.00 0.00 ? 95  LYS A CE   3  
ATOM 5343  N NZ   . LYS A 1 95  ? -4.230  7.810   -13.244 1.00 0.00 ? 95  LYS A NZ   3  
ATOM 5344  H H    . LYS A 1 95  ? -1.881  7.484   -9.017  1.00 0.00 ? 95  LYS A H    3  
ATOM 5345  H HA   . LYS A 1 95  ? -3.480  6.751   -6.826  1.00 0.00 ? 95  LYS A HA   3  
ATOM 5346  H HB2  . LYS A 1 95  ? -5.522  6.101   -7.843  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 5347  H HB3  . LYS A 1 95  ? -5.240  7.768   -8.303  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 5348  H HG2  . LYS A 1 95  ? -4.287  5.511   -10.096 1.00 0.00 ? 95  LYS A HG2  3  
ATOM 5349  H HG3  . LYS A 1 95  ? -5.961  6.028   -10.148 1.00 0.00 ? 95  LYS A HG3  3  
ATOM 5350  H HD2  . LYS A 1 95  ? -5.454  8.074   -11.109 1.00 0.00 ? 95  LYS A HD2  3  
ATOM 5351  H HD3  . LYS A 1 95  ? -3.932  8.226   -10.253 1.00 0.00 ? 95  LYS A HD3  3  
ATOM 5352  H HE2  . LYS A 1 95  ? -2.738  7.145   -11.901 1.00 0.00 ? 95  LYS A HE2  3  
ATOM 5353  H HE3  . LYS A 1 95  ? -4.010  5.979   -12.209 1.00 0.00 ? 95  LYS A HE3  3  
ATOM 5354  H HZ1  . LYS A 1 95  ? -5.120  8.233   -13.073 1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 5355  H HZ2  . LYS A 1 95  ? -3.555  8.522   -13.436 1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 5356  H HZ3  . LYS A 1 95  ? -4.300  7.196   -14.030 1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 5357  N N    . MET A 1 96  ? -2.781  4.418   -7.287  1.00 0.00 ? 96  MET A N    3  
ATOM 5358  C CA   . MET A 1 96  ? -2.169  3.113   -7.470  1.00 0.00 ? 96  MET A CA   3  
ATOM 5359  C C    . MET A 1 96  ? -3.073  2.002   -6.933  1.00 0.00 ? 96  MET A C    3  
ATOM 5360  O O    . MET A 1 96  ? -4.283  2.186   -6.810  1.00 0.00 ? 96  MET A O    3  
ATOM 5361  C CB   . MET A 1 96  ? -0.824  3.074   -6.742  1.00 0.00 ? 96  MET A CB   3  
ATOM 5362  C CG   . MET A 1 96  ? -0.445  4.460   -6.214  1.00 0.00 ? 96  MET A CG   3  
ATOM 5363  S SD   . MET A 1 96  ? 1.325   4.578   -6.022  1.00 0.00 ? 96  MET A SD   3  
ATOM 5364  C CE   . MET A 1 96  ? 1.458   4.385   -4.252  1.00 0.00 ? 96  MET A CE   3  
ATOM 5365  H H    . MET A 1 96  ? -3.216  4.559   -6.398  1.00 0.00 ? 96  MET A H    3  
ATOM 5366  H HA   . MET A 1 96  ? -2.040  2.998   -8.547  1.00 0.00 ? 96  MET A HA   3  
ATOM 5367  H HB2  . MET A 1 96  ? -0.876  2.367   -5.912  1.00 0.00 ? 96  MET A HB2  3  
ATOM 5368  H HB3  . MET A 1 96  ? -0.049  2.715   -7.418  1.00 0.00 ? 96  MET A HB3  3  
ATOM 5369  H HG2  . MET A 1 96  ? -0.796  5.228   -6.904  1.00 0.00 ? 96  MET A HG2  3  
ATOM 5370  H HG3  . MET A 1 96  ? -0.937  4.641   -5.258  1.00 0.00 ? 96  MET A HG3  3  
ATOM 5371  H HE1  . MET A 1 96  ? 0.677   3.710   -3.900  1.00 0.00 ? 96  MET A HE1  3  
ATOM 5372  H HE2  . MET A 1 96  ? 2.435   3.970   -4.004  1.00 0.00 ? 96  MET A HE2  3  
ATOM 5373  H HE3  . MET A 1 96  ? 1.343   5.356   -3.771  1.00 0.00 ? 96  MET A HE3  3  
ATOM 5374  N N    . HIS A 1 97  ? -2.451  0.872   -6.627  1.00 0.00 ? 97  HIS A N    3  
ATOM 5375  C CA   . HIS A 1 97  ? -3.185  -0.268  -6.104  1.00 0.00 ? 97  HIS A CA   3  
ATOM 5376  C C    . HIS A 1 97  ? -2.338  -0.985  -5.051  1.00 0.00 ? 97  HIS A C    3  
ATOM 5377  O O    . HIS A 1 97  ? -1.199  -1.367  -5.320  1.00 0.00 ? 97  HIS A O    3  
ATOM 5378  C CB   . HIS A 1 97  ? -3.627  -1.194  -7.240  1.00 0.00 ? 97  HIS A CB   3  
ATOM 5379  C CG   . HIS A 1 97  ? -5.053  -0.979  -7.687  1.00 0.00 ? 97  HIS A CG   3  
ATOM 5380  N ND1  . HIS A 1 97  ? -5.510  -1.347  -8.941  1.00 0.00 ? 97  HIS A ND1  3  
ATOM 5381  C CD2  . HIS A 1 97  ? -6.118  -0.431  -7.035  1.00 0.00 ? 97  HIS A CD2  3  
ATOM 5382  C CE1  . HIS A 1 97  ? -6.792  -1.028  -9.028  1.00 0.00 ? 97  HIS A CE1  3  
ATOM 5383  N NE2  . HIS A 1 97  ? -7.168  -0.461  -7.847  1.00 0.00 ? 97  HIS A NE2  3  
ATOM 5384  H H    . HIS A 1 97  ? -1.466  0.731   -6.729  1.00 0.00 ? 97  HIS A H    3  
ATOM 5385  H HA   . HIS A 1 97  ? -4.081  0.128   -5.629  1.00 0.00 ? 97  HIS A HA   3  
ATOM 5386  H HB2  . HIS A 1 97  ? -2.964  -1.050  -8.092  1.00 0.00 ? 97  HIS A HB2  3  
ATOM 5387  H HB3  . HIS A 1 97  ? -3.510  -2.228  -6.917  1.00 0.00 ? 97  HIS A HB3  3  
ATOM 5388  H HD1  . HIS A 1 97  ? -4.963  -1.778  -9.659  1.00 0.00 ? 97  HIS A HD1  3  
ATOM 5389  H HD2  . HIS A 1 97  ? -6.110  -0.036  -6.019  1.00 0.00 ? 97  HIS A HD2  3  
ATOM 5390  H HE1  . HIS A 1 97  ? -7.435  -1.193  -9.894  1.00 0.00 ? 97  HIS A HE1  3  
ATOM 5391  N N    . ILE A 1 98  ? -2.926  -1.146  -3.875  1.00 0.00 ? 98  ILE A N    3  
ATOM 5392  C CA   . ILE A 1 98  ? -2.239  -1.809  -2.779  1.00 0.00 ? 98  ILE A CA   3  
ATOM 5393  C C    . ILE A 1 98  ? -3.224  -2.722  -2.046  1.00 0.00 ? 98  ILE A C    3  
ATOM 5394  O O    . ILE A 1 98  ? -4.406  -2.402  -1.930  1.00 0.00 ? 98  ILE A O    3  
ATOM 5395  C CB   . ILE A 1 98  ? -1.559  -0.782  -1.872  1.00 0.00 ? 98  ILE A CB   3  
ATOM 5396  C CG1  . ILE A 1 98  ? -2.593  0.008   -1.067  1.00 0.00 ? 98  ILE A CG1  3  
ATOM 5397  C CG2  . ILE A 1 98  ? -0.638  0.136   -2.677  1.00 0.00 ? 98  ILE A CG2  3  
ATOM 5398  C CD1  . ILE A 1 98  ? -2.009  1.333   -0.573  1.00 0.00 ? 98  ILE A CD1  3  
ATOM 5399  H H    . ILE A 1 98  ? -3.851  -0.831  -3.665  1.00 0.00 ? 98  ILE A H    3  
ATOM 5400  H HA   . ILE A 1 98  ? -1.453  -2.426  -3.213  1.00 0.00 ? 98  ILE A HA   3  
ATOM 5401  H HB   . ILE A 1 98  ? -0.935  -1.319  -1.157  1.00 0.00 ? 98  ILE A HB   3  
ATOM 5402  H HG12 . ILE A 1 98  ? -3.470  0.201   -1.684  1.00 0.00 ? 98  ILE A HG12 3  
ATOM 5403  H HG13 . ILE A 1 98  ? -2.927  -0.586  -0.215  1.00 0.00 ? 98  ILE A HG13 3  
ATOM 5404  H HG21 . ILE A 1 98  ? -0.331  -0.369  -3.593  1.00 0.00 ? 98  ILE A HG21 3  
ATOM 5405  H HG22 . ILE A 1 98  ? -1.168  1.054   -2.928  1.00 0.00 ? 98  ILE A HG22 3  
ATOM 5406  H HG23 . ILE A 1 98  ? 0.244   0.376   -2.084  1.00 0.00 ? 98  ILE A HG23 3  
ATOM 5407  H HD11 . ILE A 1 98  ? -1.016  1.475   -1.003  1.00 0.00 ? 98  ILE A HD11 3  
ATOM 5408  H HD12 . ILE A 1 98  ? -2.658  2.153   -0.880  1.00 0.00 ? 98  ILE A HD12 3  
ATOM 5409  H HD13 . ILE A 1 98  ? -1.934  1.315   0.514   1.00 0.00 ? 98  ILE A HD13 3  
ATOM 5410  N N    . THR A 1 99  ? -2.699  -3.841  -1.568  1.00 0.00 ? 99  THR A N    3  
ATOM 5411  C CA   . THR A 1 99  ? -3.517  -4.802  -0.848  1.00 0.00 ? 99  THR A CA   3  
ATOM 5412  C C    . THR A 1 99  ? -2.735  -5.396  0.325   1.00 0.00 ? 99  THR A C    3  
ATOM 5413  O O    . THR A 1 99  ? -1.511  -5.274  0.385   1.00 0.00 ? 99  THR A O    3  
ATOM 5414  C CB   . THR A 1 99  ? -4.002  -5.853  -1.848  1.00 0.00 ? 99  THR A CB   3  
ATOM 5415  O OG1  . THR A 1 99  ? -2.979  -5.887  -2.840  1.00 0.00 ? 99  THR A OG1  3  
ATOM 5416  C CG2  . THR A 1 99  ? -5.247  -5.402  -2.614  1.00 0.00 ? 99  THR A CG2  3  
ATOM 5417  H H    . THR A 1 99  ? -1.737  -4.094  -1.666  1.00 0.00 ? 99  THR A H    3  
ATOM 5418  H HA   . THR A 1 99  ? -4.375  -4.278  -0.427  1.00 0.00 ? 99  THR A HA   3  
ATOM 5419  H HB   . THR A 1 99  ? -4.174  -6.810  -1.355  1.00 0.00 ? 99  THR A HB   3  
ATOM 5420  H HG1  . THR A 1 99  ? -3.045  -6.733  -3.369  1.00 0.00 ? 99  THR A HG1  3  
ATOM 5421  H HG21 . THR A 1 99  ? -5.252  -4.314  -2.693  1.00 0.00 ? 99  THR A HG21 3  
ATOM 5422  H HG22 . THR A 1 99  ? -5.239  -5.839  -3.613  1.00 0.00 ? 99  THR A HG22 3  
ATOM 5423  H HG23 . THR A 1 99  ? -6.140  -5.730  -2.082  1.00 0.00 ? 99  THR A HG23 3  
ATOM 5424  N N    . LEU A 1 100 ? -3.471  -6.027  1.228   1.00 0.00 ? 100 LEU A N    3  
ATOM 5425  C CA   . LEU A 1 100 ? -2.861  -6.639  2.395   1.00 0.00 ? 100 LEU A CA   3  
ATOM 5426  C C    . LEU A 1 100 ? -1.857  -7.701  1.944   1.00 0.00 ? 100 LEU A C    3  
ATOM 5427  O O    . LEU A 1 100 ? -0.767  -7.810  2.503   1.00 0.00 ? 100 LEU A O    3  
ATOM 5428  C CB   . LEU A 1 100 ? -3.937  -7.174  3.344   1.00 0.00 ? 100 LEU A CB   3  
ATOM 5429  C CG   . LEU A 1 100 ? -4.461  -8.580  3.039   1.00 0.00 ? 100 LEU A CG   3  
ATOM 5430  C CD1  . LEU A 1 100 ? -4.670  -9.378  4.328   1.00 0.00 ? 100 LEU A CD1  3  
ATOM 5431  C CD2  . LEU A 1 100 ? -5.732  -8.519  2.191   1.00 0.00 ? 100 LEU A CD2  3  
ATOM 5432  H H    . LEU A 1 100 ? -4.465  -6.121  1.172   1.00 0.00 ? 100 LEU A H    3  
ATOM 5433  H HA   . LEU A 1 100 ? -2.321  -5.859  2.930   1.00 0.00 ? 100 LEU A HA   3  
ATOM 5434  H HB2  . LEU A 1 100 ? -3.535  -7.170  4.357   1.00 0.00 ? 100 LEU A HB2  3  
ATOM 5435  H HB3  . LEU A 1 100 ? -4.780  -6.483  3.332   1.00 0.00 ? 100 LEU A HB3  3  
ATOM 5436  H HG   . LEU A 1 100 ? -3.707  -9.105  2.454   1.00 0.00 ? 100 LEU A HG   3  
ATOM 5437  H HD11 . LEU A 1 100 ? -4.987  -8.705  5.124   1.00 0.00 ? 100 LEU A HD11 3  
ATOM 5438  H HD12 . LEU A 1 100 ? -5.435  -10.136 4.165   1.00 0.00 ? 100 LEU A HD12 3  
ATOM 5439  H HD13 . LEU A 1 100 ? -3.734  -9.861  4.612   1.00 0.00 ? 100 LEU A HD13 3  
ATOM 5440  H HD21 . LEU A 1 100 ? -6.472  -7.894  2.689   1.00 0.00 ? 100 LEU A HD21 3  
ATOM 5441  H HD22 . LEU A 1 100 ? -5.496  -8.095  1.214   1.00 0.00 ? 100 LEU A HD22 3  
ATOM 5442  H HD23 . LEU A 1 100 ? -6.132  -9.525  2.063   1.00 0.00 ? 100 LEU A HD23 3  
ATOM 5443  N N    . CYS A 1 101 ? -2.261  -8.459  0.934   1.00 0.00 ? 101 CYS A N    3  
ATOM 5444  C CA   . CYS A 1 101 ? -1.409  -9.509  0.399   1.00 0.00 ? 101 CYS A CA   3  
ATOM 5445  C C    . CYS A 1 101 ? -0.194  -8.853  -0.259  1.00 0.00 ? 101 CYS A C    3  
ATOM 5446  O O    . CYS A 1 101 ? 0.894   -9.427  -0.271  1.00 0.00 ? 101 CYS A O    3  
ATOM 5447  C CB   . CYS A 1 101 ? -2.169  -10.411 -0.575  1.00 0.00 ? 101 CYS A CB   3  
ATOM 5448  S SG   . CYS A 1 101 ? -1.689  -12.176 -0.519  1.00 0.00 ? 101 CYS A SG   3  
ATOM 5449  H H    . CYS A 1 101 ? -3.149  -8.365  0.485   1.00 0.00 ? 101 CYS A H    3  
ATOM 5450  H HA   . CYS A 1 101 ? -1.107  -10.126 1.245   1.00 0.00 ? 101 CYS A HA   3  
ATOM 5451  H HB2  . CYS A 1 101 ? -3.236  -10.333 -0.364  1.00 0.00 ? 101 CYS A HB2  3  
ATOM 5452  H HB3  . CYS A 1 101 ? -2.016  -10.040 -1.588  1.00 0.00 ? 101 CYS A HB3  3  
ATOM 5453  N N    . ASP A 1 102 ? -0.420  -7.661  -0.790  1.00 0.00 ? 102 ASP A N    3  
ATOM 5454  C CA   . ASP A 1 102 ? 0.643   -6.922  -1.449  1.00 0.00 ? 102 ASP A CA   3  
ATOM 5455  C C    . ASP A 1 102 ? 1.589   -6.346  -0.393  1.00 0.00 ? 102 ASP A C    3  
ATOM 5456  O O    . ASP A 1 102 ? 1.272   -6.350  0.796   1.00 0.00 ? 102 ASP A O    3  
ATOM 5457  C CB   . ASP A 1 102 ? 0.080   -5.757  -2.265  1.00 0.00 ? 102 ASP A CB   3  
ATOM 5458  C CG   . ASP A 1 102 ? 0.899   -5.376  -3.500  1.00 0.00 ? 102 ASP A CG   3  
ATOM 5459  O OD1  . ASP A 1 102 ? 1.947   -6.024  -3.707  1.00 0.00 ? 102 ASP A OD1  3  
ATOM 5460  O OD2  . ASP A 1 102 ? 0.459   -4.446  -4.208  1.00 0.00 ? 102 ASP A OD2  3  
ATOM 5461  H H    . ASP A 1 102 ? -1.308  -7.202  -0.776  1.00 0.00 ? 102 ASP A H    3  
ATOM 5462  H HA   . ASP A 1 102 ? 1.135   -7.646  -2.099  1.00 0.00 ? 102 ASP A HA   3  
ATOM 5463  H HB2  . ASP A 1 102 ? -0.932  -6.010  -2.582  1.00 0.00 ? 102 ASP A HB2  3  
ATOM 5464  H HB3  . ASP A 1 102 ? 0.002   -4.883  -1.617  1.00 0.00 ? 102 ASP A HB3  3  
ATOM 5465  N N    . PHE A 1 103 ? 2.730   -5.867  -0.864  1.00 0.00 ? 103 PHE A N    3  
ATOM 5466  C CA   . PHE A 1 103 ? 3.723   -5.289  0.025   1.00 0.00 ? 103 PHE A CA   3  
ATOM 5467  C C    . PHE A 1 103 ? 3.251   -3.941  0.572   1.00 0.00 ? 103 PHE A C    3  
ATOM 5468  O O    . PHE A 1 103 ? 3.046   -2.996  -0.188  1.00 0.00 ? 103 PHE A O    3  
ATOM 5469  C CB   . PHE A 1 103 ? 4.993   -5.075  -0.802  1.00 0.00 ? 103 PHE A CB   3  
ATOM 5470  C CG   . PHE A 1 103 ? 5.997   -4.116  -0.161  1.00 0.00 ? 103 PHE A CG   3  
ATOM 5471  C CD1  . PHE A 1 103 ? 5.965   -3.891  1.180   1.00 0.00 ? 103 PHE A CD1  3  
ATOM 5472  C CD2  . PHE A 1 103 ? 6.925   -3.486  -0.933  1.00 0.00 ? 103 PHE A CD2  3  
ATOM 5473  C CE1  . PHE A 1 103 ? 6.897   -3.001  1.775   1.00 0.00 ? 103 PHE A CE1  3  
ATOM 5474  C CE2  . PHE A 1 103 ? 7.857   -2.596  -0.339  1.00 0.00 ? 103 PHE A CE2  3  
ATOM 5475  C CZ   . PHE A 1 103 ? 7.824   -2.372  1.003   1.00 0.00 ? 103 PHE A CZ   3  
ATOM 5476  H H    . PHE A 1 103 ? 2.980   -5.869  -1.832  1.00 0.00 ? 103 PHE A H    3  
ATOM 5477  H HA   . PHE A 1 103 ? 3.862   -5.986  0.852   1.00 0.00 ? 103 PHE A HA   3  
ATOM 5478  H HB2  . PHE A 1 103 ? 5.477   -6.038  -0.963  1.00 0.00 ? 103 PHE A HB2  3  
ATOM 5479  H HB3  . PHE A 1 103 ? 4.714   -4.691  -1.783  1.00 0.00 ? 103 PHE A HB3  3  
ATOM 5480  H HD1  . PHE A 1 103 ? 5.222   -4.396  1.798   1.00 0.00 ? 103 PHE A HD1  3  
ATOM 5481  H HD2  . PHE A 1 103 ? 6.951   -3.665  -2.007  1.00 0.00 ? 103 PHE A HD2  3  
ATOM 5482  H HE1  . PHE A 1 103 ? 6.871   -2.822  2.849   1.00 0.00 ? 103 PHE A HE1  3  
ATOM 5483  H HE2  . PHE A 1 103 ? 8.600   -2.092  -0.957  1.00 0.00 ? 103 PHE A HE2  3  
ATOM 5484  H HZ   . PHE A 1 103 ? 8.540   -1.689  1.459   1.00 0.00 ? 103 PHE A HZ   3  
ATOM 5485  N N    . ILE A 1 104 ? 3.092   -3.895  1.887   1.00 0.00 ? 104 ILE A N    3  
ATOM 5486  C CA   . ILE A 1 104 ? 2.649   -2.678  2.545   1.00 0.00 ? 104 ILE A CA   3  
ATOM 5487  C C    . ILE A 1 104 ? 2.924   -2.785  4.046   1.00 0.00 ? 104 ILE A C    3  
ATOM 5488  O O    . ILE A 1 104 ? 2.637   -3.810  4.661   1.00 0.00 ? 104 ILE A O    3  
ATOM 5489  C CB   . ILE A 1 104 ? 1.185   -2.389  2.207   1.00 0.00 ? 104 ILE A CB   3  
ATOM 5490  C CG1  . ILE A 1 104 ? 0.350   -3.672  2.248   1.00 0.00 ? 104 ILE A CG1  3  
ATOM 5491  C CG2  . ILE A 1 104 ? 1.063   -1.669  0.864   1.00 0.00 ? 104 ILE A CG2  3  
ATOM 5492  C CD1  . ILE A 1 104 ? -1.135  -3.366  2.036   1.00 0.00 ? 104 ILE A CD1  3  
ATOM 5493  H H    . ILE A 1 104 ? 3.261   -4.668  2.498   1.00 0.00 ? 104 ILE A H    3  
ATOM 5494  H HA   . ILE A 1 104 ? 3.240   -1.855  2.143   1.00 0.00 ? 104 ILE A HA   3  
ATOM 5495  H HB   . ILE A 1 104 ? 0.784   -1.721  2.968   1.00 0.00 ? 104 ILE A HB   3  
ATOM 5496  H HG12 . ILE A 1 104 ? 0.697   -4.360  1.477   1.00 0.00 ? 104 ILE A HG12 3  
ATOM 5497  H HG13 . ILE A 1 104 ? 0.489   -4.171  3.206   1.00 0.00 ? 104 ILE A HG13 3  
ATOM 5498  H HG21 . ILE A 1 104 ? 2.032   -1.257  0.584   1.00 0.00 ? 104 ILE A HG21 3  
ATOM 5499  H HG22 . ILE A 1 104 ? 0.734   -2.375  0.101   1.00 0.00 ? 104 ILE A HG22 3  
ATOM 5500  H HG23 . ILE A 1 104 ? 0.336   -0.862  0.949   1.00 0.00 ? 104 ILE A HG23 3  
ATOM 5501  H HD11 . ILE A 1 104 ? -1.421  -2.512  2.649   1.00 0.00 ? 104 ILE A HD11 3  
ATOM 5502  H HD12 . ILE A 1 104 ? -1.312  -3.136  0.985   1.00 0.00 ? 104 ILE A HD12 3  
ATOM 5503  H HD13 . ILE A 1 104 ? -1.728  -4.234  2.323   1.00 0.00 ? 104 ILE A HD13 3  
ATOM 5504  N N    . VAL A 1 105 ? 3.477   -1.712  4.592   1.00 0.00 ? 105 VAL A N    3  
ATOM 5505  C CA   . VAL A 1 105 ? 3.794   -1.673  6.009   1.00 0.00 ? 105 VAL A CA   3  
ATOM 5506  C C    . VAL A 1 105 ? 3.778   -0.221  6.491   1.00 0.00 ? 105 VAL A C    3  
ATOM 5507  O O    . VAL A 1 105 ? 3.922   0.704   5.693   1.00 0.00 ? 105 VAL A O    3  
ATOM 5508  C CB   . VAL A 1 105 ? 5.130   -2.373  6.266   1.00 0.00 ? 105 VAL A CB   3  
ATOM 5509  C CG1  . VAL A 1 105 ? 4.914   -3.764  6.865   1.00 0.00 ? 105 VAL A CG1  3  
ATOM 5510  C CG2  . VAL A 1 105 ? 5.964   -2.449  4.985   1.00 0.00 ? 105 VAL A CG2  3  
ATOM 5511  H H    . VAL A 1 105 ? 3.707   -0.882  4.084   1.00 0.00 ? 105 VAL A H    3  
ATOM 5512  H HA   . VAL A 1 105 ? 3.017   -2.227  6.536   1.00 0.00 ? 105 VAL A HA   3  
ATOM 5513  H HB   . VAL A 1 105 ? 5.686   -1.778  6.992   1.00 0.00 ? 105 VAL A HB   3  
ATOM 5514  H HG11 . VAL A 1 105 ? 4.218   -3.696  7.700   1.00 0.00 ? 105 VAL A HG11 3  
ATOM 5515  H HG12 . VAL A 1 105 ? 4.505   -4.428  6.103   1.00 0.00 ? 105 VAL A HG12 3  
ATOM 5516  H HG13 . VAL A 1 105 ? 5.867   -4.160  7.217   1.00 0.00 ? 105 VAL A HG13 3  
ATOM 5517  H HG21 . VAL A 1 105 ? 5.394   -2.964  4.212   1.00 0.00 ? 105 VAL A HG21 3  
ATOM 5518  H HG22 . VAL A 1 105 ? 6.207   -1.442  4.649   1.00 0.00 ? 105 VAL A HG22 3  
ATOM 5519  H HG23 . VAL A 1 105 ? 6.884   -2.999  5.184   1.00 0.00 ? 105 VAL A HG23 3  
ATOM 5520  N N    . PRO A 1 106 ? 3.595   -0.062  7.829   1.00 0.00 ? 106 PRO A N    3  
ATOM 5521  C CA   . PRO A 1 106 ? 3.557   1.262   8.427   1.00 0.00 ? 106 PRO A CA   3  
ATOM 5522  C C    . PRO A 1 106 ? 4.961   1.866   8.513   1.00 0.00 ? 106 PRO A C    3  
ATOM 5523  O O    . PRO A 1 106 ? 5.160   2.894   9.157   1.00 0.00 ? 106 PRO A O    3  
ATOM 5524  C CB   . PRO A 1 106 ? 2.914   1.060   9.790   1.00 0.00 ? 106 PRO A CB   3  
ATOM 5525  C CG   . PRO A 1 106 ? 3.040   -0.423  10.095  1.00 0.00 ? 106 PRO A CG   3  
ATOM 5526  C CD   . PRO A 1 106 ? 3.420   -1.133  8.805   1.00 0.00 ? 106 PRO A CD   3  
ATOM 5527  H HA   . PRO A 1 106 ? 3.025   1.886   7.856   1.00 0.00 ? 106 PRO A HA   3  
ATOM 5528  H HB2  . PRO A 1 106 ? 3.414   1.659   10.551  1.00 0.00 ? 106 PRO A HB2  3  
ATOM 5529  H HB3  . PRO A 1 106 ? 1.869   1.369   9.778   1.00 0.00 ? 106 PRO A HB3  3  
ATOM 5530  H HG2  . PRO A 1 106 ? 3.797   -0.593  10.861  1.00 0.00 ? 106 PRO A HG2  3  
ATOM 5531  H HG3  . PRO A 1 106 ? 2.100   -0.815  10.483  1.00 0.00 ? 106 PRO A HG3  3  
ATOM 5532  H HD2  . PRO A 1 106 ? 4.336   -1.712  8.927   1.00 0.00 ? 106 PRO A HD2  3  
ATOM 5533  H HD3  . PRO A 1 106 ? 2.642   -1.831  8.493   1.00 0.00 ? 106 PRO A HD3  3  
ATOM 5534  N N    . TRP A 1 107 ? 5.897   1.200   7.852   1.00 0.00 ? 107 TRP A N    3  
ATOM 5535  C CA   . TRP A 1 107 ? 7.276   1.658   7.844   1.00 0.00 ? 107 TRP A CA   3  
ATOM 5536  C C    . TRP A 1 107 ? 7.870   1.392   9.228   1.00 0.00 ? 107 TRP A C    3  
ATOM 5537  O O    . TRP A 1 107 ? 8.837   0.643   9.359   1.00 0.00 ? 107 TRP A O    3  
ATOM 5538  C CB   . TRP A 1 107 ? 7.363   3.128   7.429   1.00 0.00 ? 107 TRP A CB   3  
ATOM 5539  C CG   . TRP A 1 107 ? 8.789   3.618   7.168   1.00 0.00 ? 107 TRP A CG   3  
ATOM 5540  C CD1  . TRP A 1 107 ? 9.683   3.128   6.297   1.00 0.00 ? 107 TRP A CD1  3  
ATOM 5541  C CD2  . TRP A 1 107 ? 9.453   4.720   7.821   1.00 0.00 ? 107 TRP A CD2  3  
ATOM 5542  N NE1  . TRP A 1 107 ? 10.870  3.831   6.342   1.00 0.00 ? 107 TRP A NE1  3  
ATOM 5543  C CE2  . TRP A 1 107 ? 10.725  4.830   7.297   1.00 0.00 ? 107 TRP A CE2  3  
ATOM 5544  C CE3  . TRP A 1 107 ? 8.994   5.595   8.821   1.00 0.00 ? 107 TRP A CE3  3  
ATOM 5545  C CZ2  . TRP A 1 107 ? 11.643  5.802   7.713   1.00 0.00 ? 107 TRP A CZ2  3  
ATOM 5546  C CZ3  . TRP A 1 107 ? 9.923   6.561   9.224   1.00 0.00 ? 107 TRP A CZ3  3  
ATOM 5547  C CH2  . TRP A 1 107 ? 11.208  6.685   8.708   1.00 0.00 ? 107 TRP A CH2  3  
ATOM 5548  H H    . TRP A 1 107 ? 5.726   0.365   7.330   1.00 0.00 ? 107 TRP A H    3  
ATOM 5549  H HA   . TRP A 1 107 ? 7.814   1.083   7.091   1.00 0.00 ? 107 TRP A HA   3  
ATOM 5550  H HB2  . TRP A 1 107 ? 6.768   3.277   6.528   1.00 0.00 ? 107 TRP A HB2  3  
ATOM 5551  H HB3  . TRP A 1 107 ? 6.917   3.743   8.211   1.00 0.00 ? 107 TRP A HB3  3  
ATOM 5552  H HD1  . TRP A 1 107 ? 9.496   2.281   5.637   1.00 0.00 ? 107 TRP A HD1  3  
ATOM 5553  H HE1  . TRP A 1 107 ? 11.756  3.639   5.739   1.00 0.00 ? 107 TRP A HE1  3  
ATOM 5554  H HE3  . TRP A 1 107 ? 7.994   5.529   9.250   1.00 0.00 ? 107 TRP A HE3  3  
ATOM 5555  H HZ2  . TRP A 1 107 ? 12.643  5.868   7.283   1.00 0.00 ? 107 TRP A HZ2  3  
ATOM 5556  H HZ3  . TRP A 1 107 ? 9.618   7.265   9.998   1.00 0.00 ? 107 TRP A HZ3  3  
ATOM 5557  H HH2  . TRP A 1 107 ? 11.873  7.466   9.076   1.00 0.00 ? 107 TRP A HH2  3  
ATOM 5558  N N    . ASP A 1 108 ? 7.266   2.019   10.227  1.00 0.00 ? 108 ASP A N    3  
ATOM 5559  C CA   . ASP A 1 108 ? 7.725   1.860   11.597  1.00 0.00 ? 108 ASP A CA   3  
ATOM 5560  C C    . ASP A 1 108 ? 7.420   0.437   12.069  1.00 0.00 ? 108 ASP A C    3  
ATOM 5561  O O    . ASP A 1 108 ? 6.793   0.245   13.110  1.00 0.00 ? 108 ASP A O    3  
ATOM 5562  C CB   . ASP A 1 108 ? 7.007   2.832   12.534  1.00 0.00 ? 108 ASP A CB   3  
ATOM 5563  C CG   . ASP A 1 108 ? 7.763   3.165   13.822  1.00 0.00 ? 108 ASP A CG   3  
ATOM 5564  O OD1  . ASP A 1 108 ? 9.011   3.134   13.772  1.00 0.00 ? 108 ASP A OD1  3  
ATOM 5565  O OD2  . ASP A 1 108 ? 7.075   3.443   14.828  1.00 0.00 ? 108 ASP A OD2  3  
ATOM 5566  H H    . ASP A 1 108 ? 6.481   2.627   10.112  1.00 0.00 ? 108 ASP A H    3  
ATOM 5567  H HA   . ASP A 1 108 ? 8.793   2.069   11.568  1.00 0.00 ? 108 ASP A HA   3  
ATOM 5568  H HB2  . ASP A 1 108 ? 6.814   3.760   11.994  1.00 0.00 ? 108 ASP A HB2  3  
ATOM 5569  H HB3  . ASP A 1 108 ? 6.037   2.411   12.799  1.00 0.00 ? 108 ASP A HB3  3  
ATOM 5570  N N    . THR A 1 109 ? 7.878   -0.525  11.281  1.00 0.00 ? 109 THR A N    3  
ATOM 5571  C CA   . THR A 1 109 ? 7.662   -1.925  11.606  1.00 0.00 ? 109 THR A CA   3  
ATOM 5572  C C    . THR A 1 109 ? 8.683   -2.804  10.879  1.00 0.00 ? 109 THR A C    3  
ATOM 5573  O O    . THR A 1 109 ? 9.407   -3.571  11.511  1.00 0.00 ? 109 THR A O    3  
ATOM 5574  C CB   . THR A 1 109 ? 6.212   -2.271  11.265  1.00 0.00 ? 109 THR A CB   3  
ATOM 5575  O OG1  . THR A 1 109 ? 5.960   -1.563  10.055  1.00 0.00 ? 109 THR A OG1  3  
ATOM 5576  C CG2  . THR A 1 109 ? 5.218   -1.669  12.262  1.00 0.00 ? 109 THR A CG2  3  
ATOM 5577  H H    . THR A 1 109 ? 8.387   -0.361  10.436  1.00 0.00 ? 109 THR A H    3  
ATOM 5578  H HA   . THR A 1 109 ? 7.827   -2.059  12.674  1.00 0.00 ? 109 THR A HA   3  
ATOM 5579  H HB   . THR A 1 109 ? 6.077   -3.349  11.184  1.00 0.00 ? 109 THR A HB   3  
ATOM 5580  H HG1  . THR A 1 109 ? 6.213   -2.128  9.269   1.00 0.00 ? 109 THR A HG1  3  
ATOM 5581  H HG21 . THR A 1 109 ? 5.541   -1.893  13.278  1.00 0.00 ? 109 THR A HG21 3  
ATOM 5582  H HG22 . THR A 1 109 ? 5.174   -0.589  12.124  1.00 0.00 ? 109 THR A HG22 3  
ATOM 5583  H HG23 . THR A 1 109 ? 4.229   -2.098  12.092  1.00 0.00 ? 109 THR A HG23 3  
ATOM 5584  N N    . LEU A 1 110 ? 8.706   -2.662  9.562   1.00 0.00 ? 110 LEU A N    3  
ATOM 5585  C CA   . LEU A 1 110 ? 9.626   -3.434  8.743   1.00 0.00 ? 110 LEU A CA   3  
ATOM 5586  C C    . LEU A 1 110 ? 10.264  -4.532  9.596   1.00 0.00 ? 110 LEU A C    3  
ATOM 5587  O O    . LEU A 1 110 ? 9.605   -5.509  9.952   1.00 0.00 ? 110 LEU A O    3  
ATOM 5588  C CB   . LEU A 1 110 ? 10.643  -2.513  8.066   1.00 0.00 ? 110 LEU A CB   3  
ATOM 5589  C CG   . LEU A 1 110 ? 10.060  -1.383  7.214   1.00 0.00 ? 110 LEU A CG   3  
ATOM 5590  C CD1  . LEU A 1 110 ? 11.156  -0.413  6.768   1.00 0.00 ? 110 LEU A CD1  3  
ATOM 5591  C CD2  . LEU A 1 110 ? 9.271   -1.941  6.028   1.00 0.00 ? 110 LEU A CD2  3  
ATOM 5592  H H    . LEU A 1 110 ? 8.114   -2.036  9.056   1.00 0.00 ? 110 LEU A H    3  
ATOM 5593  H HA   . LEU A 1 110 ? 9.042   -3.906  7.952   1.00 0.00 ? 110 LEU A HA   3  
ATOM 5594  H HB2  . LEU A 1 110 ? 11.273  -2.072  8.837   1.00 0.00 ? 110 LEU A HB2  3  
ATOM 5595  H HB3  . LEU A 1 110 ? 11.289  -3.121  7.433   1.00 0.00 ? 110 LEU A HB3  3  
ATOM 5596  H HG   . LEU A 1 110 ? 9.360   -0.817  7.829   1.00 0.00 ? 110 LEU A HG   3  
ATOM 5597  H HD11 . LEU A 1 110 ? 11.904  -0.323  7.555   1.00 0.00 ? 110 LEU A HD11 3  
ATOM 5598  H HD12 . LEU A 1 110 ? 11.627  -0.789  5.860   1.00 0.00 ? 110 LEU A HD12 3  
ATOM 5599  H HD13 . LEU A 1 110 ? 10.717  0.565   6.571   1.00 0.00 ? 110 LEU A HD13 3  
ATOM 5600  H HD21 . LEU A 1 110 ? 9.250   -3.029  6.084   1.00 0.00 ? 110 LEU A HD21 3  
ATOM 5601  H HD22 . LEU A 1 110 ? 8.252   -1.556  6.057   1.00 0.00 ? 110 LEU A HD22 3  
ATOM 5602  H HD23 . LEU A 1 110 ? 9.749   -1.634  5.097   1.00 0.00 ? 110 LEU A HD23 3  
ATOM 5603  N N    . SER A 1 111 ? 11.539  -4.336  9.900   1.00 0.00 ? 111 SER A N    3  
ATOM 5604  C CA   . SER A 1 111 ? 12.273  -5.297  10.705  1.00 0.00 ? 111 SER A CA   3  
ATOM 5605  C C    . SER A 1 111 ? 13.733  -5.352  10.252  1.00 0.00 ? 111 SER A C    3  
ATOM 5606  O O    . SER A 1 111 ? 14.640  -5.426  11.079  1.00 0.00 ? 111 SER A O    3  
ATOM 5607  C CB   . SER A 1 111 ? 11.637  -6.687  10.620  1.00 0.00 ? 111 SER A CB   3  
ATOM 5608  O OG   . SER A 1 111 ? 10.609  -6.864  11.590  1.00 0.00 ? 111 SER A OG   3  
ATOM 5609  H H    . SER A 1 111 ? 12.067  -3.539  9.607   1.00 0.00 ? 111 SER A H    3  
ATOM 5610  H HA   . SER A 1 111 ? 12.203  -4.929  11.729  1.00 0.00 ? 111 SER A HA   3  
ATOM 5611  H HB2  . SER A 1 111 ? 11.224  -6.835  9.622   1.00 0.00 ? 111 SER A HB2  3  
ATOM 5612  H HB3  . SER A 1 111 ? 12.406  -7.446  10.762  1.00 0.00 ? 111 SER A HB3  3  
ATOM 5613  H HG   . SER A 1 111 ? 10.684  -7.769  12.007  1.00 0.00 ? 111 SER A HG   3  
ATOM 5614  N N    . THR A 1 112 ? 13.914  -5.312  8.941   1.00 0.00 ? 112 THR A N    3  
ATOM 5615  C CA   . THR A 1 112 ? 15.249  -5.357  8.367   1.00 0.00 ? 112 THR A CA   3  
ATOM 5616  C C    . THR A 1 112 ? 15.187  -5.805  6.906   1.00 0.00 ? 112 THR A C    3  
ATOM 5617  O O    . THR A 1 112 ? 15.528  -5.042  6.003   1.00 0.00 ? 112 THR A O    3  
ATOM 5618  C CB   . THR A 1 112 ? 16.110  -6.267  9.246   1.00 0.00 ? 112 THR A CB   3  
ATOM 5619  O OG1  . THR A 1 112 ? 16.834  -5.363  10.076  1.00 0.00 ? 112 THR A OG1  3  
ATOM 5620  C CG2  . THR A 1 112 ? 17.196  -6.991  8.449   1.00 0.00 ? 112 THR A CG2  3  
ATOM 5621  H H    . THR A 1 112 ? 13.170  -5.251  8.275   1.00 0.00 ? 112 THR A H    3  
ATOM 5622  H HA   . THR A 1 112 ? 15.659  -4.347  8.375   1.00 0.00 ? 112 THR A HA   3  
ATOM 5623  H HB   . THR A 1 112 ? 15.492  -6.976  9.796   1.00 0.00 ? 112 THR A HB   3  
ATOM 5624  H HG1  . THR A 1 112 ? 16.202  -4.730  10.524  1.00 0.00 ? 112 THR A HG1  3  
ATOM 5625  H HG21 . THR A 1 112 ? 17.720  -6.277  7.815   1.00 0.00 ? 112 THR A HG21 3  
ATOM 5626  H HG22 . THR A 1 112 ? 17.904  -7.453  9.137   1.00 0.00 ? 112 THR A HG22 3  
ATOM 5627  H HG23 . THR A 1 112 ? 16.739  -7.761  7.828   1.00 0.00 ? 112 THR A HG23 3  
ATOM 5628  N N    . THR A 1 113 ? 14.748  -7.041  6.717   1.00 0.00 ? 113 THR A N    3  
ATOM 5629  C CA   . THR A 1 113 ? 14.638  -7.600  5.380   1.00 0.00 ? 113 THR A CA   3  
ATOM 5630  C C    . THR A 1 113 ? 13.886  -6.636  4.460   1.00 0.00 ? 113 THR A C    3  
ATOM 5631  O O    . THR A 1 113 ? 14.091  -6.642  3.248   1.00 0.00 ? 113 THR A O    3  
ATOM 5632  C CB   . THR A 1 113 ? 13.973  -8.973  5.496   1.00 0.00 ? 113 THR A CB   3  
ATOM 5633  O OG1  . THR A 1 113 ? 14.951  -9.778  6.148   1.00 0.00 ? 113 THR A OG1  3  
ATOM 5634  C CG2  . THR A 1 113 ? 13.782  -9.647  4.135   1.00 0.00 ? 113 THR A CG2  3  
ATOM 5635  H H    . THR A 1 113 ? 14.473  -7.655  7.456   1.00 0.00 ? 113 THR A H    3  
ATOM 5636  H HA   . THR A 1 113 ? 15.641  -7.714  4.972   1.00 0.00 ? 113 THR A HA   3  
ATOM 5637  H HB   . THR A 1 113 ? 13.027  -8.904  6.032   1.00 0.00 ? 113 THR A HB   3  
ATOM 5638  H HG1  . THR A 1 113 ? 14.589  -10.698 6.302   1.00 0.00 ? 113 THR A HG1  3  
ATOM 5639  H HG21 . THR A 1 113 ? 13.452  -8.907  3.406   1.00 0.00 ? 113 THR A HG21 3  
ATOM 5640  H HG22 . THR A 1 113 ? 14.727  -10.082 3.810   1.00 0.00 ? 113 THR A HG22 3  
ATOM 5641  H HG23 . THR A 1 113 ? 13.031  -10.432 4.221   1.00 0.00 ? 113 THR A HG23 3  
ATOM 5642  N N    . GLN A 1 114 ? 13.029  -5.831  5.072   1.00 0.00 ? 114 GLN A N    3  
ATOM 5643  C CA   . GLN A 1 114 ? 12.246  -4.864  4.323   1.00 0.00 ? 114 GLN A CA   3  
ATOM 5644  C C    . GLN A 1 114 ? 13.062  -3.593  4.081   1.00 0.00 ? 114 GLN A C    3  
ATOM 5645  O O    . GLN A 1 114 ? 12.917  -2.946  3.044   1.00 0.00 ? 114 GLN A O    3  
ATOM 5646  C CB   . GLN A 1 114 ? 10.934  -4.544  5.043   1.00 0.00 ? 114 GLN A CB   3  
ATOM 5647  C CG   . GLN A 1 114 ? 9.850   -5.566  4.690   1.00 0.00 ? 114 GLN A CG   3  
ATOM 5648  C CD   . GLN A 1 114 ? 9.833   -6.716  5.699   1.00 0.00 ? 114 GLN A CD   3  
ATOM 5649  O OE1  . GLN A 1 114 ? 8.839   -6.985  6.353   1.00 0.00 ? 114 GLN A OE1  3  
ATOM 5650  N NE2  . GLN A 1 114 ? 10.982  -7.377  5.787   1.00 0.00 ? 114 GLN A NE2  3  
ATOM 5651  H H    . GLN A 1 114 ? 12.867  -5.833  6.059   1.00 0.00 ? 114 GLN A H    3  
ATOM 5652  H HA   . GLN A 1 114 ? 12.021  -5.347  3.371   1.00 0.00 ? 114 GLN A HA   3  
ATOM 5653  H HB2  . GLN A 1 114 ? 11.099  -4.542  6.121   1.00 0.00 ? 114 GLN A HB2  3  
ATOM 5654  H HB3  . GLN A 1 114 ? 10.599  -3.544  4.770   1.00 0.00 ? 114 GLN A HB3  3  
ATOM 5655  H HG2  . GLN A 1 114 ? 8.877   -5.077  4.673   1.00 0.00 ? 114 GLN A HG2  3  
ATOM 5656  H HG3  . GLN A 1 114 ? 10.029  -5.958  3.689   1.00 0.00 ? 114 GLN A HG3  3  
ATOM 5657  H HE21 . GLN A 1 114 ? 11.761  -7.105  5.220   1.00 0.00 ? 114 GLN A HE21 3  
ATOM 5658  H HE22 . GLN A 1 114 ? 11.070  -8.147  6.419   1.00 0.00 ? 114 GLN A HE22 3  
ATOM 5659  N N    . LYS A 1 115 ? 13.903  -3.274  5.053   1.00 0.00 ? 115 LYS A N    3  
ATOM 5660  C CA   . LYS A 1 115 ? 14.742  -2.091  4.959   1.00 0.00 ? 115 LYS A CA   3  
ATOM 5661  C C    . LYS A 1 115 ? 15.850  -2.339  3.933   1.00 0.00 ? 115 LYS A C    3  
ATOM 5662  O O    . LYS A 1 115 ? 16.174  -1.458  3.139   1.00 0.00 ? 115 LYS A O    3  
ATOM 5663  C CB   . LYS A 1 115 ? 15.262  -1.691  6.340   1.00 0.00 ? 115 LYS A CB   3  
ATOM 5664  C CG   . LYS A 1 115 ? 14.499  -0.481  6.885   1.00 0.00 ? 115 LYS A CG   3  
ATOM 5665  C CD   . LYS A 1 115 ? 14.391  -0.541  8.409   1.00 0.00 ? 115 LYS A CD   3  
ATOM 5666  C CE   . LYS A 1 115 ? 13.920  -1.921  8.872   1.00 0.00 ? 115 LYS A CE   3  
ATOM 5667  N NZ   . LYS A 1 115 ? 13.395  -1.853  10.255  1.00 0.00 ? 115 LYS A NZ   3  
ATOM 5668  H H    . LYS A 1 115 ? 14.014  -3.805  5.893   1.00 0.00 ? 115 LYS A H    3  
ATOM 5669  H HA   . LYS A 1 115 ? 14.116  -1.274  4.600   1.00 0.00 ? 115 LYS A HA   3  
ATOM 5670  H HB2  . LYS A 1 115 ? 15.159  -2.530  7.029   1.00 0.00 ? 115 LYS A HB2  3  
ATOM 5671  H HB3  . LYS A 1 115 ? 16.325  -1.458  6.280   1.00 0.00 ? 115 LYS A HB3  3  
ATOM 5672  H HG2  . LYS A 1 115 ? 15.006  0.436   6.587   1.00 0.00 ? 115 LYS A HG2  3  
ATOM 5673  H HG3  . LYS A 1 115 ? 13.501  -0.450  6.446   1.00 0.00 ? 115 LYS A HG3  3  
ATOM 5674  H HD2  . LYS A 1 115 ? 15.360  -0.315  8.854   1.00 0.00 ? 115 LYS A HD2  3  
ATOM 5675  H HD3  . LYS A 1 115 ? 13.694  0.221   8.758   1.00 0.00 ? 115 LYS A HD3  3  
ATOM 5676  H HE2  . LYS A 1 115 ? 13.145  -2.292  8.201   1.00 0.00 ? 115 LYS A HE2  3  
ATOM 5677  H HE3  . LYS A 1 115 ? 14.747  -2.629  8.825   1.00 0.00 ? 115 LYS A HE3  3  
ATOM 5678  H HZ1  . LYS A 1 115 ? 13.961  -1.230  10.795  1.00 0.00 ? 115 LYS A HZ1  3  
ATOM 5679  H HZ2  . LYS A 1 115 ? 12.453  -1.518  10.238  1.00 0.00 ? 115 LYS A HZ2  3  
ATOM 5680  H HZ3  . LYS A 1 115 ? 13.418  -2.765  10.664  1.00 0.00 ? 115 LYS A HZ3  3  
ATOM 5681  N N    . LYS A 1 116 ? 16.401  -3.543  3.983   1.00 0.00 ? 116 LYS A N    3  
ATOM 5682  C CA   . LYS A 1 116 ? 17.466  -3.917  3.069   1.00 0.00 ? 116 LYS A CA   3  
ATOM 5683  C C    . LYS A 1 116 ? 16.938  -3.874  1.633   1.00 0.00 ? 116 LYS A C    3  
ATOM 5684  O O    . LYS A 1 116 ? 17.715  -3.786  0.685   1.00 0.00 ? 116 LYS A O    3  
ATOM 5685  C CB   . LYS A 1 116 ? 18.061  -5.270  3.464   1.00 0.00 ? 116 LYS A CB   3  
ATOM 5686  C CG   . LYS A 1 116 ? 17.166  -6.421  2.998   1.00 0.00 ? 116 LYS A CG   3  
ATOM 5687  C CD   . LYS A 1 116 ? 17.774  -7.134  1.789   1.00 0.00 ? 116 LYS A CD   3  
ATOM 5688  C CE   . LYS A 1 116 ? 17.144  -6.640  0.486   1.00 0.00 ? 116 LYS A CE   3  
ATOM 5689  N NZ   . LYS A 1 116 ? 18.154  -5.957  -0.352  1.00 0.00 ? 116 LYS A NZ   3  
ATOM 5690  H H    . LYS A 1 116 ? 16.131  -4.255  4.633   1.00 0.00 ? 116 LYS A H    3  
ATOM 5691  H HA   . LYS A 1 116 ? 18.258  -3.176  3.168   1.00 0.00 ? 116 LYS A HA   3  
ATOM 5692  H HB2  . LYS A 1 116 ? 19.054  -5.378  3.028   1.00 0.00 ? 116 LYS A HB2  3  
ATOM 5693  H HB3  . LYS A 1 116 ? 18.182  -5.315  4.547   1.00 0.00 ? 116 LYS A HB3  3  
ATOM 5694  H HG2  . LYS A 1 116 ? 17.027  -7.131  3.813   1.00 0.00 ? 116 LYS A HG2  3  
ATOM 5695  H HG3  . LYS A 1 116 ? 16.179  -6.037  2.740   1.00 0.00 ? 116 LYS A HG3  3  
ATOM 5696  H HD2  . LYS A 1 116 ? 18.851  -6.961  1.765   1.00 0.00 ? 116 LYS A HD2  3  
ATOM 5697  H HD3  . LYS A 1 116 ? 17.627  -8.210  1.884   1.00 0.00 ? 116 LYS A HD3  3  
ATOM 5698  H HE2  . LYS A 1 116 ? 16.717  -7.481  -0.061  1.00 0.00 ? 116 LYS A HE2  3  
ATOM 5699  H HE3  . LYS A 1 116 ? 16.325  -5.955  0.709   1.00 0.00 ? 116 LYS A HE3  3  
ATOM 5700  H HZ1  . LYS A 1 116 ? 18.633  -5.269  0.195   1.00 0.00 ? 116 LYS A HZ1  3  
ATOM 5701  H HZ2  . LYS A 1 116 ? 18.812  -6.628  -0.695  1.00 0.00 ? 116 LYS A HZ2  3  
ATOM 5702  H HZ3  . LYS A 1 116 ? 17.701  -5.511  -1.125  1.00 0.00 ? 116 LYS A HZ3  3  
ATOM 5703  N N    . SER A 1 117 ? 15.619  -3.939  1.520   1.00 0.00 ? 117 SER A N    3  
ATOM 5704  C CA   . SER A 1 117 ? 14.979  -3.908  0.215   1.00 0.00 ? 117 SER A CA   3  
ATOM 5705  C C    . SER A 1 117 ? 14.641  -2.465  -0.168  1.00 0.00 ? 117 SER A C    3  
ATOM 5706  O O    . SER A 1 117 ? 14.322  -2.185  -1.321  1.00 0.00 ? 117 SER A O    3  
ATOM 5707  C CB   . SER A 1 117 ? 13.715  -4.770  0.202   1.00 0.00 ? 117 SER A CB   3  
ATOM 5708  O OG   . SER A 1 117 ? 13.688  -5.661  -0.910  1.00 0.00 ? 117 SER A OG   3  
ATOM 5709  H H    . SER A 1 117 ? 14.993  -4.011  2.296   1.00 0.00 ? 117 SER A H    3  
ATOM 5710  H HA   . SER A 1 117 ? 15.710  -4.326  -0.476  1.00 0.00 ? 117 SER A HA   3  
ATOM 5711  H HB2  . SER A 1 117 ? 13.658  -5.344  1.128   1.00 0.00 ? 117 SER A HB2  3  
ATOM 5712  H HB3  . SER A 1 117 ? 12.837  -4.126  0.173   1.00 0.00 ? 117 SER A HB3  3  
ATOM 5713  H HG   . SER A 1 117 ? 13.662  -6.608  -0.590  1.00 0.00 ? 117 SER A HG   3  
ATOM 5714  N N    . LEU A 1 118 ? 14.722  -1.589  0.823   1.00 0.00 ? 118 LEU A N    3  
ATOM 5715  C CA   . LEU A 1 118 ? 14.429  -0.183  0.604   1.00 0.00 ? 118 LEU A CA   3  
ATOM 5716  C C    . LEU A 1 118 ? 15.548  0.443   -0.230  1.00 0.00 ? 118 LEU A C    3  
ATOM 5717  O O    . LEU A 1 118 ? 15.312  1.385   -0.986  1.00 0.00 ? 118 LEU A O    3  
ATOM 5718  C CB   . LEU A 1 118 ? 14.184  0.526   1.938   1.00 0.00 ? 118 LEU A CB   3  
ATOM 5719  C CG   . LEU A 1 118 ? 12.840  0.244   2.611   1.00 0.00 ? 118 LEU A CG   3  
ATOM 5720  C CD1  . LEU A 1 118 ? 12.726  0.989   3.942   1.00 0.00 ? 118 LEU A CD1  3  
ATOM 5721  C CD2  . LEU A 1 118 ? 11.676  0.568   1.671   1.00 0.00 ? 118 LEU A CD2  3  
ATOM 5722  H H    . LEU A 1 118 ? 14.982  -1.826  1.759   1.00 0.00 ? 118 LEU A H    3  
ATOM 5723  H HA   . LEU A 1 118 ? 13.502  -0.128  0.034   1.00 0.00 ? 118 LEU A HA   3  
ATOM 5724  H HB2  . LEU A 1 118 ? 14.979  0.246   2.627   1.00 0.00 ? 118 LEU A HB2  3  
ATOM 5725  H HB3  . LEU A 1 118 ? 14.267  1.601   1.775   1.00 0.00 ? 118 LEU A HB3  3  
ATOM 5726  H HG   . LEU A 1 118 ? 12.786  -0.823  2.833   1.00 0.00 ? 118 LEU A HG   3  
ATOM 5727  H HD11 . LEU A 1 118 ? 13.478  1.777   3.983   1.00 0.00 ? 118 LEU A HD11 3  
ATOM 5728  H HD12 . LEU A 1 118 ? 11.733  1.429   4.029   1.00 0.00 ? 118 LEU A HD12 3  
ATOM 5729  H HD13 . LEU A 1 118 ? 12.886  0.291   4.764   1.00 0.00 ? 118 LEU A HD13 3  
ATOM 5730  H HD21 . LEU A 1 118 ? 11.844  1.540   1.207   1.00 0.00 ? 118 LEU A HD21 3  
ATOM 5731  H HD22 . LEU A 1 118 ? 11.609  -0.198  0.898   1.00 0.00 ? 118 LEU A HD22 3  
ATOM 5732  H HD23 . LEU A 1 118 ? 10.747  0.592   2.240   1.00 0.00 ? 118 LEU A HD23 3  
ATOM 5733  N N    . ASN A 1 119 ? 16.743  -0.105  -0.064  1.00 0.00 ? 119 ASN A N    3  
ATOM 5734  C CA   . ASN A 1 119 ? 17.900  0.389   -0.791  1.00 0.00 ? 119 ASN A CA   3  
ATOM 5735  C C    . ASN A 1 119 ? 18.073  -0.423  -2.077  1.00 0.00 ? 119 ASN A C    3  
ATOM 5736  O O    . ASN A 1 119 ? 19.029  -0.215  -2.823  1.00 0.00 ? 119 ASN A O    3  
ATOM 5737  C CB   . ASN A 1 119 ? 19.178  0.238   0.037   1.00 0.00 ? 119 ASN A CB   3  
ATOM 5738  C CG   . ASN A 1 119 ? 19.523  -1.237  0.249   1.00 0.00 ? 119 ASN A CG   3  
ATOM 5739  O OD1  . ASN A 1 119 ? 19.880  -1.955  -0.670  1.00 0.00 ? 119 ASN A OD1  3  
ATOM 5740  N ND2  . ASN A 1 119 ? 19.399  -1.646  1.508   1.00 0.00 ? 119 ASN A ND2  3  
ATOM 5741  H H    . ASN A 1 119 ? 16.927  -0.870  0.553   1.00 0.00 ? 119 ASN A H    3  
ATOM 5742  H HA   . ASN A 1 119 ? 17.689  1.439   -0.987  1.00 0.00 ? 119 ASN A HA   3  
ATOM 5743  H HB2  . ASN A 1 119 ? 20.004  0.741   -0.467  1.00 0.00 ? 119 ASN A HB2  3  
ATOM 5744  H HB3  . ASN A 1 119 ? 19.049  0.728   1.003   1.00 0.00 ? 119 ASN A HB3  3  
ATOM 5745  H HD21 . ASN A 1 119 ? 19.101  -1.004  2.216   1.00 0.00 ? 119 ASN A HD21 3  
ATOM 5746  H HD22 . ASN A 1 119 ? 19.602  -2.596  1.747   1.00 0.00 ? 119 ASN A HD22 3  
ATOM 5747  N N    . HIS A 1 120 ? 17.132  -1.330  -2.298  1.00 0.00 ? 120 HIS A N    3  
ATOM 5748  C CA   . HIS A 1 120 ? 17.168  -2.174  -3.480  1.00 0.00 ? 120 HIS A CA   3  
ATOM 5749  C C    . HIS A 1 120 ? 16.551  -1.425  -4.664  1.00 0.00 ? 120 HIS A C    3  
ATOM 5750  O O    . HIS A 1 120 ? 16.345  -2.003  -5.729  1.00 0.00 ? 120 HIS A O    3  
ATOM 5751  C CB   . HIS A 1 120 ? 16.488  -3.517  -3.209  1.00 0.00 ? 120 HIS A CB   3  
ATOM 5752  C CG   . HIS A 1 120 ? 17.407  -4.708  -3.341  1.00 0.00 ? 120 HIS A CG   3  
ATOM 5753  N ND1  . HIS A 1 120 ? 18.588  -4.826  -2.627  1.00 0.00 ? 120 HIS A ND1  3  
ATOM 5754  C CD2  . HIS A 1 120 ? 17.308  -5.830  -4.109  1.00 0.00 ? 120 HIS A CD2  3  
ATOM 5755  C CE1  . HIS A 1 120 ? 19.165  -5.972  -2.960  1.00 0.00 ? 120 HIS A CE1  3  
ATOM 5756  N NE2  . HIS A 1 120 ? 18.370  -6.593  -3.878  1.00 0.00 ? 120 HIS A NE2  3  
ATOM 5757  H H    . HIS A 1 120 ? 16.358  -1.491  -1.686  1.00 0.00 ? 120 HIS A H    3  
ATOM 5758  H HA   . HIS A 1 120 ? 18.220  -2.369  -3.693  1.00 0.00 ? 120 HIS A HA   3  
ATOM 5759  H HB2  . HIS A 1 120 ? 16.069  -3.505  -2.204  1.00 0.00 ? 120 HIS A HB2  3  
ATOM 5760  H HB3  . HIS A 1 120 ? 15.655  -3.636  -3.901  1.00 0.00 ? 120 HIS A HB3  3  
ATOM 5761  H HD1  . HIS A 1 120 ? 18.945  -4.160  -1.973  1.00 0.00 ? 120 HIS A HD1  3  
ATOM 5762  H HD2  . HIS A 1 120 ? 16.494  -6.063  -4.796  1.00 0.00 ? 120 HIS A HD2  3  
ATOM 5763  H HE1  . HIS A 1 120 ? 20.108  -6.352  -2.568  1.00 0.00 ? 120 HIS A HE1  3  
ATOM 5764  N N    . ARG A 1 121 ? 16.275  -0.149  -4.436  1.00 0.00 ? 121 ARG A N    3  
ATOM 5765  C CA   . ARG A 1 121 ? 15.686  0.684   -5.470  1.00 0.00 ? 121 ARG A CA   3  
ATOM 5766  C C    . ARG A 1 121 ? 14.304  0.154   -5.856  1.00 0.00 ? 121 ARG A C    3  
ATOM 5767  O O    . ARG A 1 121 ? 13.286  0.742   -5.493  1.00 0.00 ? 121 ARG A O    3  
ATOM 5768  C CB   . ARG A 1 121 ? 16.574  0.728   -6.715  1.00 0.00 ? 121 ARG A CB   3  
ATOM 5769  C CG   . ARG A 1 121 ? 17.065  2.151   -6.989  1.00 0.00 ? 121 ARG A CG   3  
ATOM 5770  C CD   . ARG A 1 121 ? 15.913  3.049   -7.446  1.00 0.00 ? 121 ARG A CD   3  
ATOM 5771  N NE   . ARG A 1 121 ? 16.034  3.329   -8.894  1.00 0.00 ? 121 ARG A NE   3  
ATOM 5772  C CZ   . ARG A 1 121 ? 16.903  4.203   -9.421  1.00 0.00 ? 121 ARG A CZ   3  
ATOM 5773  N NH1  . ARG A 1 121 ? 17.733  4.887   -8.621  1.00 0.00 ? 121 ARG A NH1  3  
ATOM 5774  N NH2  . ARG A 1 121 ? 16.942  4.392   -10.746 1.00 0.00 ? 121 ARG A NH2  3  
ATOM 5775  H H    . ARG A 1 121 ? 16.446  0.314   -3.566  1.00 0.00 ? 121 ARG A H    3  
ATOM 5776  H HA   . ARG A 1 121 ? 15.615  1.676   -5.022  1.00 0.00 ? 121 ARG A HA   3  
ATOM 5777  H HB2  . ARG A 1 121 ? 17.429  0.065   -6.579  1.00 0.00 ? 121 ARG A HB2  3  
ATOM 5778  H HB3  . ARG A 1 121 ? 16.017  0.359   -7.576  1.00 0.00 ? 121 ARG A HB3  3  
ATOM 5779  H HG2  . ARG A 1 121 ? 17.517  2.564   -6.088  1.00 0.00 ? 121 ARG A HG2  3  
ATOM 5780  H HG3  . ARG A 1 121 ? 17.841  2.131   -7.755  1.00 0.00 ? 121 ARG A HG3  3  
ATOM 5781  H HD2  . ARG A 1 121 ? 14.959  2.565   -7.239  1.00 0.00 ? 121 ARG A HD2  3  
ATOM 5782  H HD3  . ARG A 1 121 ? 15.925  3.983   -6.884  1.00 0.00 ? 121 ARG A HD3  3  
ATOM 5783  H HE   . ARG A 1 121 ? 15.429  2.835   -9.519  1.00 0.00 ? 121 ARG A HE   3  
ATOM 5784  H HH11 . ARG A 1 121 ? 17.703  4.746   -7.632  1.00 0.00 ? 121 ARG A HH11 3  
ATOM 5785  H HH12 . ARG A 1 121 ? 18.381  5.539   -9.015  1.00 0.00 ? 121 ARG A HH12 3  
ATOM 5786  H HH21 . ARG A 1 121 ? 16.322  3.882   -11.344 1.00 0.00 ? 121 ARG A HH21 3  
ATOM 5787  H HH22 . ARG A 1 121 ? 17.590  5.045   -11.140 1.00 0.00 ? 121 ARG A HH22 3  
ATOM 5788  N N    . TYR A 1 122 ? 14.312  -0.950  -6.588  1.00 0.00 ? 122 TYR A N    3  
ATOM 5789  C CA   . TYR A 1 122 ? 13.071  -1.566  -7.028  1.00 0.00 ? 122 TYR A CA   3  
ATOM 5790  C C    . TYR A 1 122 ? 13.318  -2.983  -7.549  1.00 0.00 ? 122 TYR A C    3  
ATOM 5791  O O    . TYR A 1 122 ? 13.666  -3.168  -8.714  1.00 0.00 ? 122 TYR A O    3  
ATOM 5792  C CB   . TYR A 1 122 ? 12.552  -0.696  -8.174  1.00 0.00 ? 122 TYR A CB   3  
ATOM 5793  C CG   . TYR A 1 122 ? 13.115  -1.074  -9.546  1.00 0.00 ? 122 TYR A CG   3  
ATOM 5794  C CD1  . TYR A 1 122 ? 14.381  -0.662  -9.910  1.00 0.00 ? 122 TYR A CD1  3  
ATOM 5795  C CD2  . TYR A 1 122 ? 12.357  -1.827  -10.419 1.00 0.00 ? 122 TYR A CD2  3  
ATOM 5796  C CE1  . TYR A 1 122 ? 14.911  -1.017  -11.201 1.00 0.00 ? 122 TYR A CE1  3  
ATOM 5797  C CE2  . TYR A 1 122 ? 12.887  -2.182  -11.711 1.00 0.00 ? 122 TYR A CE2  3  
ATOM 5798  C CZ   . TYR A 1 122 ? 14.137  -1.760  -12.038 1.00 0.00 ? 122 TYR A CZ   3  
ATOM 5799  O OH   . TYR A 1 122 ? 14.638  -2.095  -13.257 1.00 0.00 ? 122 TYR A OH   3  
ATOM 5800  H H    . TYR A 1 122 ? 15.145  -1.421  -6.879  1.00 0.00 ? 122 TYR A H    3  
ATOM 5801  H HA   . TYR A 1 122 ? 12.398  -1.613  -6.172  1.00 0.00 ? 122 TYR A HA   3  
ATOM 5802  H HB2  . TYR A 1 122 ? 11.465  -0.768  -8.207  1.00 0.00 ? 122 TYR A HB2  3  
ATOM 5803  H HB3  . TYR A 1 122 ? 12.797  0.346   -7.967  1.00 0.00 ? 122 TYR A HB3  3  
ATOM 5804  H HD1  . TYR A 1 122 ? 14.980  -0.068  -9.220  1.00 0.00 ? 122 TYR A HD1  3  
ATOM 5805  H HD2  . TYR A 1 122 ? 11.356  -2.152  -10.132 1.00 0.00 ? 122 TYR A HD2  3  
ATOM 5806  H HE1  . TYR A 1 122 ? 15.909  -0.699  -11.500 1.00 0.00 ? 122 TYR A HE1  3  
ATOM 5807  H HE2  . TYR A 1 122 ? 12.298  -2.776  -12.410 1.00 0.00 ? 122 TYR A HE2  3  
ATOM 5808  H HH   . TYR A 1 122 ? 14.244  -2.963  -13.562 1.00 0.00 ? 122 TYR A HH   3  
ATOM 5809  N N    . GLN A 1 123 ? 13.128  -3.948  -6.661  1.00 0.00 ? 123 GLN A N    3  
ATOM 5810  C CA   . GLN A 1 123 ? 13.326  -5.343  -7.018  1.00 0.00 ? 123 GLN A CA   3  
ATOM 5811  C C    . GLN A 1 123 ? 14.715  -5.544  -7.626  1.00 0.00 ? 123 GLN A C    3  
ATOM 5812  O O    . GLN A 1 123 ? 14.840  -6.038  -8.746  1.00 0.00 ? 123 GLN A O    3  
ATOM 5813  C CB   . GLN A 1 123 ? 12.233  -5.824  -7.973  1.00 0.00 ? 123 GLN A CB   3  
ATOM 5814  C CG   . GLN A 1 123 ? 12.492  -7.263  -8.421  1.00 0.00 ? 123 GLN A CG   3  
ATOM 5815  C CD   . GLN A 1 123 ? 12.474  -7.373  -9.948  1.00 0.00 ? 123 GLN A CD   3  
ATOM 5816  O OE1  . GLN A 1 123 ? 13.150  -6.647  -10.656 1.00 0.00 ? 123 GLN A OE1  3  
ATOM 5817  N NE2  . GLN A 1 123 ? 11.664  -8.321  -10.412 1.00 0.00 ? 123 GLN A NE2  3  
ATOM 5818  H H    . GLN A 1 123 ? 12.845  -3.789  -5.715  1.00 0.00 ? 123 GLN A H    3  
ATOM 5819  H HA   . GLN A 1 123 ? 13.250  -5.895  -6.081  1.00 0.00 ? 123 GLN A HA   3  
ATOM 5820  H HB2  . GLN A 1 123 ? 11.262  -5.761  -7.482  1.00 0.00 ? 123 GLN A HB2  3  
ATOM 5821  H HB3  . GLN A 1 123 ? 12.192  -5.170  -8.843  1.00 0.00 ? 123 GLN A HB3  3  
ATOM 5822  H HG2  . GLN A 1 123 ? 13.457  -7.599  -8.041  1.00 0.00 ? 123 GLN A HG2  3  
ATOM 5823  H HG3  . GLN A 1 123 ? 11.734  -7.923  -7.997  1.00 0.00 ? 123 GLN A HG3  3  
ATOM 5824  H HE21 . GLN A 1 123 ? 11.137  -8.884  -9.776  1.00 0.00 ? 123 GLN A HE21 3  
ATOM 5825  H HE22 . GLN A 1 123 ? 11.583  -8.471  -11.397 1.00 0.00 ? 123 GLN A HE22 3  
ATOM 5826  N N    . MET A 1 124 ? 15.723  -5.149  -6.864  1.00 0.00 ? 124 MET A N    3  
ATOM 5827  C CA   . MET A 1 124 ? 17.098  -5.280  -7.315  1.00 0.00 ? 124 MET A CA   3  
ATOM 5828  C C    . MET A 1 124 ? 17.542  -6.744  -7.303  1.00 0.00 ? 124 MET A C    3  
ATOM 5829  O O    . MET A 1 124 ? 18.558  -7.083  -6.698  1.00 0.00 ? 124 MET A O    3  
ATOM 5830  C CB   . MET A 1 124 ? 18.015  -4.461  -6.403  1.00 0.00 ? 124 MET A CB   3  
ATOM 5831  C CG   . MET A 1 124 ? 18.724  -3.356  -7.188  1.00 0.00 ? 124 MET A CG   3  
ATOM 5832  S SD   . MET A 1 124 ? 20.207  -4.001  -7.946  1.00 0.00 ? 124 MET A SD   3  
ATOM 5833  C CE   . MET A 1 124 ? 21.387  -3.669  -6.647  1.00 0.00 ? 124 MET A CE   3  
ATOM 5834  H H    . MET A 1 124 ? 15.613  -4.747  -5.954  1.00 0.00 ? 124 MET A H    3  
ATOM 5835  H HA   . MET A 1 124 ? 17.109  -4.898  -8.335  1.00 0.00 ? 124 MET A HA   3  
ATOM 5836  H HB2  . MET A 1 124 ? 17.431  -4.020  -5.595  1.00 0.00 ? 124 MET A HB2  3  
ATOM 5837  H HB3  . MET A 1 124 ? 18.754  -5.115  -5.941  1.00 0.00 ? 124 MET A HB3  3  
ATOM 5838  H HG2  . MET A 1 124 ? 18.059  -2.958  -7.954  1.00 0.00 ? 124 MET A HG2  3  
ATOM 5839  H HG3  . MET A 1 124 ? 18.976  -2.529  -6.524  1.00 0.00 ? 124 MET A HG3  3  
ATOM 5840  H HE1  . MET A 1 124 ? 20.921  -3.046  -5.883  1.00 0.00 ? 124 MET A HE1  3  
ATOM 5841  H HE2  . MET A 1 124 ? 21.712  -4.609  -6.202  1.00 0.00 ? 124 MET A HE2  3  
ATOM 5842  H HE3  . MET A 1 124 ? 22.249  -3.147  -7.065  1.00 0.00 ? 124 MET A HE3  3  
ATOM 5843  N N    . GLY A 1 125 ? 16.759  -7.572  -7.978  1.00 0.00 ? 125 GLY A N    3  
ATOM 5844  C CA   . GLY A 1 125 ? 17.059  -8.991  -8.053  1.00 0.00 ? 125 GLY A CA   3  
ATOM 5845  C C    . GLY A 1 125 ? 17.150  -9.607  -6.656  1.00 0.00 ? 125 GLY A C    3  
ATOM 5846  O O    . GLY A 1 125 ? 17.838  -10.608 -6.457  1.00 0.00 ? 125 GLY A O    3  
ATOM 5847  H H    . GLY A 1 125 ? 15.934  -7.288  -8.467  1.00 0.00 ? 125 GLY A H    3  
ATOM 5848  H HA2  . GLY A 1 125 ? 16.286  -9.500  -8.630  1.00 0.00 ? 125 GLY A HA2  3  
ATOM 5849  H HA3  . GLY A 1 125 ? 18.000  -9.141  -8.583  1.00 0.00 ? 125 GLY A HA3  3  
ATOM 5850  N N    . CYS A 1 126 ? 16.444  -8.985  -5.723  1.00 0.00 ? 126 CYS A N    3  
ATOM 5851  C CA   . CYS A 1 126 ? 16.437  -9.459  -4.349  1.00 0.00 ? 126 CYS A CA   3  
ATOM 5852  C C    . CYS A 1 126 ? 15.955  -10.911 -4.345  1.00 0.00 ? 126 CYS A C    3  
ATOM 5853  O O    . CYS A 1 126 ? 15.843  -11.535 -5.400  1.00 0.00 ? 126 CYS A O    3  
ATOM 5854  C CB   . CYS A 1 126 ? 15.577  -8.570  -3.449  1.00 0.00 ? 126 CYS A CB   3  
ATOM 5855  S SG   . CYS A 1 126 ? 13.827  -9.086  -3.306  1.00 0.00 ? 126 CYS A SG   3  
ATOM 5856  H H    . CYS A 1 126 ? 15.888  -8.172  -5.893  1.00 0.00 ? 126 CYS A H    3  
ATOM 5857  H HA   . CYS A 1 126 ? 17.463  -9.390  -3.989  1.00 0.00 ? 126 CYS A HA   3  
ATOM 5858  H HB2  . CYS A 1 126 ? 16.018  -8.553  -2.452  1.00 0.00 ? 126 CYS A HB2  3  
ATOM 5859  H HB3  . CYS A 1 126 ? 15.611  -7.550  -3.830  1.00 0.00 ? 126 CYS A HB3  3  
ATOM 5860  N N    . GLU A 1 127 ? 15.684  -11.408 -3.147  1.00 0.00 ? 127 GLU A N    3  
ATOM 5861  C CA   . GLU A 1 127 ? 15.218  -12.776 -2.992  1.00 0.00 ? 127 GLU A CA   3  
ATOM 5862  C C    . GLU A 1 127 ? 14.957  -13.082 -1.517  1.00 0.00 ? 127 GLU A C    3  
ATOM 5863  O O    . GLU A 1 127 ? 13.878  -12.796 -1.000  1.00 0.00 ? 127 GLU A O    3  
ATOM 5864  C CB   . GLU A 1 127 ? 16.217  -13.767 -3.591  1.00 0.00 ? 127 GLU A CB   3  
ATOM 5865  C CG   . GLU A 1 127 ? 15.646  -15.187 -3.593  1.00 0.00 ? 127 GLU A CG   3  
ATOM 5866  C CD   . GLU A 1 127 ? 14.817  -15.442 -4.853  1.00 0.00 ? 127 GLU A CD   3  
ATOM 5867  O OE1  . GLU A 1 127 ? 13.831  -14.698 -5.044  1.00 0.00 ? 127 GLU A OE1  3  
ATOM 5868  O OE2  . GLU A 1 127 ? 15.188  -16.376 -5.597  1.00 0.00 ? 127 GLU A OE2  3  
ATOM 5869  H H    . GLU A 1 127 ? 15.779  -10.894 -2.295  1.00 0.00 ? 127 GLU A H    3  
ATOM 5870  H HA   . GLU A 1 127 ? 14.284  -12.828 -3.552  1.00 0.00 ? 127 GLU A HA   3  
ATOM 5871  H HB2  . GLU A 1 127 ? 16.465  -13.469 -4.609  1.00 0.00 ? 127 GLU A HB2  3  
ATOM 5872  H HB3  . GLU A 1 127 ? 17.144  -13.745 -3.018  1.00 0.00 ? 127 GLU A HB3  3  
ATOM 5873  H HG2  . GLU A 1 127 ? 16.460  -15.910 -3.536  1.00 0.00 ? 127 GLU A HG2  3  
ATOM 5874  H HG3  . GLU A 1 127 ? 15.026  -15.335 -2.709  1.00 0.00 ? 127 GLU A HG3  3  
ATOM 5875  N N    . CYS A 1 1   ? -11.766 -10.532 0.994   1.00 0.00 ? 1   CYS A N    4  
ATOM 5876  C CA   . CYS A 1 1   ? -10.586 -11.378 0.976   1.00 0.00 ? 1   CYS A CA   4  
ATOM 5877  C C    . CYS A 1 1   ? -10.005 -11.423 2.391   1.00 0.00 ? 1   CYS A C    4  
ATOM 5878  O O    . CYS A 1 1   ? -10.515 -10.765 3.296   1.00 0.00 ? 1   CYS A O    4  
ATOM 5879  C CB   . CYS A 1 1   ? -9.558  -10.892 -0.048  1.00 0.00 ? 1   CYS A CB   4  
ATOM 5880  S SG   . CYS A 1 1   ? -8.685  -9.350  0.413   1.00 0.00 ? 1   CYS A SG   4  
ATOM 5881  H H    . CYS A 1 1   ? -12.022 -10.144 0.109   1.00 0.00 ? 1   CYS A H    4  
ATOM 5882  H HA   . CYS A 1 1   ? -10.914 -12.368 0.661   1.00 0.00 ? 1   CYS A HA   4  
ATOM 5883  H HB2  . CYS A 1 1   ? -8.819  -11.679 -0.202  1.00 0.00 ? 1   CYS A HB2  4  
ATOM 5884  H HB3  . CYS A 1 1   ? -10.061 -10.737 -1.002  1.00 0.00 ? 1   CYS A HB3  4  
ATOM 5885  N N    . SER A 1 2   ? -8.946  -12.205 2.537   1.00 0.00 ? 2   SER A N    4  
ATOM 5886  C CA   . SER A 1 2   ? -8.290  -12.344 3.826   1.00 0.00 ? 2   SER A CA   4  
ATOM 5887  C C    . SER A 1 2   ? -6.854  -12.837 3.633   1.00 0.00 ? 2   SER A C    4  
ATOM 5888  O O    . SER A 1 2   ? -6.329  -13.573 4.465   1.00 0.00 ? 2   SER A O    4  
ATOM 5889  C CB   . SER A 1 2   ? -9.061  -13.303 4.736   1.00 0.00 ? 2   SER A CB   4  
ATOM 5890  O OG   . SER A 1 2   ? -9.861  -12.607 5.688   1.00 0.00 ? 2   SER A OG   4  
ATOM 5891  H H    . SER A 1 2   ? -8.537  -12.737 1.795   1.00 0.00 ? 2   SER A H    4  
ATOM 5892  H HA   . SER A 1 2   ? -8.297  -11.346 4.262   1.00 0.00 ? 2   SER A HA   4  
ATOM 5893  H HB2  . SER A 1 2   ? -9.699  -13.945 4.128   1.00 0.00 ? 2   SER A HB2  4  
ATOM 5894  H HB3  . SER A 1 2   ? -8.358  -13.953 5.257   1.00 0.00 ? 2   SER A HB3  4  
ATOM 5895  H HG   . SER A 1 2   ? -9.328  -11.873 6.111   1.00 0.00 ? 2   SER A HG   4  
ATOM 5896  N N    . CYS A 1 3   ? -6.259  -12.408 2.529   1.00 0.00 ? 3   CYS A N    4  
ATOM 5897  C CA   . CYS A 1 3   ? -4.895  -12.796 2.214   1.00 0.00 ? 3   CYS A CA   4  
ATOM 5898  C C    . CYS A 1 3   ? -4.031  -12.557 3.455   1.00 0.00 ? 3   CYS A C    4  
ATOM 5899  O O    . CYS A 1 3   ? -4.472  -11.920 4.410   1.00 0.00 ? 3   CYS A O    4  
ATOM 5900  C CB   . CYS A 1 3   ? -4.359  -12.045 0.994   1.00 0.00 ? 3   CYS A CB   4  
ATOM 5901  S SG   . CYS A 1 3   ? -3.558  -13.103 -0.267  1.00 0.00 ? 3   CYS A SG   4  
ATOM 5902  H H    . CYS A 1 3   ? -6.693  -11.809 1.856   1.00 0.00 ? 3   CYS A H    4  
ATOM 5903  H HA   . CYS A 1 3   ? -4.921  -13.856 1.959   1.00 0.00 ? 3   CYS A HA   4  
ATOM 5904  H HB2  . CYS A 1 3   ? -5.184  -11.508 0.525   1.00 0.00 ? 3   CYS A HB2  4  
ATOM 5905  H HB3  . CYS A 1 3   ? -3.641  -11.298 1.330   1.00 0.00 ? 3   CYS A HB3  4  
ATOM 5906  N N    . SER A 1 4   ? -2.815  -13.082 3.400   1.00 0.00 ? 4   SER A N    4  
ATOM 5907  C CA   . SER A 1 4   ? -1.886  -12.935 4.508   1.00 0.00 ? 4   SER A CA   4  
ATOM 5908  C C    . SER A 1 4   ? -0.620  -12.217 4.035   1.00 0.00 ? 4   SER A C    4  
ATOM 5909  O O    . SER A 1 4   ? 0.035   -12.661 3.092   1.00 0.00 ? 4   SER A O    4  
ATOM 5910  C CB   . SER A 1 4   ? -1.530  -14.295 5.113   1.00 0.00 ? 4   SER A CB   4  
ATOM 5911  O OG   . SER A 1 4   ? -0.774  -15.099 4.213   1.00 0.00 ? 4   SER A OG   4  
ATOM 5912  H H    . SER A 1 4   ? -2.464  -13.600 2.620   1.00 0.00 ? 4   SER A H    4  
ATOM 5913  H HA   . SER A 1 4   ? -2.413  -12.333 5.248   1.00 0.00 ? 4   SER A HA   4  
ATOM 5914  H HB2  . SER A 1 4   ? -0.963  -14.145 6.031   1.00 0.00 ? 4   SER A HB2  4  
ATOM 5915  H HB3  . SER A 1 4   ? -2.446  -14.819 5.388   1.00 0.00 ? 4   SER A HB3  4  
ATOM 5916  H HG   . SER A 1 4   ? 0.169   -14.769 4.169   1.00 0.00 ? 4   SER A HG   4  
ATOM 5917  N N    . PRO A 1 5   ? -0.305  -11.091 4.730   1.00 0.00 ? 5   PRO A N    4  
ATOM 5918  C CA   . PRO A 1 5   ? 0.872   -10.308 4.391   1.00 0.00 ? 5   PRO A CA   4  
ATOM 5919  C C    . PRO A 1 5   ? 2.149   -11.001 4.869   1.00 0.00 ? 5   PRO A C    4  
ATOM 5920  O O    . PRO A 1 5   ? 2.333   -11.215 6.066   1.00 0.00 ? 5   PRO A O    4  
ATOM 5921  C CB   . PRO A 1 5   ? 0.647   -8.957  5.050   1.00 0.00 ? 5   PRO A CB   4  
ATOM 5922  C CG   . PRO A 1 5   ? -0.416  -9.183  6.112   1.00 0.00 ? 5   PRO A CG   4  
ATOM 5923  C CD   . PRO A 1 5   ? -1.057  -10.535 5.851   1.00 0.00 ? 5   PRO A CD   4  
ATOM 5924  H HA   . PRO A 1 5   ? 0.960   -10.226 3.398   1.00 0.00 ? 5   PRO A HA   4  
ATOM 5925  H HB2  . PRO A 1 5   ? 1.569   -8.581  5.494   1.00 0.00 ? 5   PRO A HB2  4  
ATOM 5926  H HB3  . PRO A 1 5   ? 0.319   -8.217  4.321   1.00 0.00 ? 5   PRO A HB3  4  
ATOM 5927  H HG2  . PRO A 1 5   ? 0.027   -9.156  7.108   1.00 0.00 ? 5   PRO A HG2  4  
ATOM 5928  H HG3  . PRO A 1 5   ? -1.165  -8.392  6.077   1.00 0.00 ? 5   PRO A HG3  4  
ATOM 5929  H HD2  . PRO A 1 5   ? -0.994  -11.180 6.727   1.00 0.00 ? 5   PRO A HD2  4  
ATOM 5930  H HD3  . PRO A 1 5   ? -2.113  -10.433 5.606   1.00 0.00 ? 5   PRO A HD3  4  
ATOM 5931  N N    . VAL A 1 6   ? 2.999   -11.335 3.908   1.00 0.00 ? 6   VAL A N    4  
ATOM 5932  C CA   . VAL A 1 6   ? 4.252   -12.000 4.216   1.00 0.00 ? 6   VAL A CA   4  
ATOM 5933  C C    . VAL A 1 6   ? 5.362   -11.418 3.338   1.00 0.00 ? 6   VAL A C    4  
ATOM 5934  O O    . VAL A 1 6   ? 5.488   -10.200 3.216   1.00 0.00 ? 6   VAL A O    4  
ATOM 5935  C CB   . VAL A 1 6   ? 4.095   -13.514 4.056   1.00 0.00 ? 6   VAL A CB   4  
ATOM 5936  C CG1  . VAL A 1 6   ? 3.910   -13.893 2.586   1.00 0.00 ? 6   VAL A CG1  4  
ATOM 5937  C CG2  . VAL A 1 6   ? 5.285   -14.257 4.667   1.00 0.00 ? 6   VAL A CG2  4  
ATOM 5938  H H    . VAL A 1 6   ? 2.841   -11.158 2.937   1.00 0.00 ? 6   VAL A H    4  
ATOM 5939  H HA   . VAL A 1 6   ? 4.486   -11.794 5.260   1.00 0.00 ? 6   VAL A HA   4  
ATOM 5940  H HB   . VAL A 1 6   ? 3.199   -13.816 4.596   1.00 0.00 ? 6   VAL A HB   4  
ATOM 5941  H HG11 . VAL A 1 6   ? 3.963   -12.996 1.969   1.00 0.00 ? 6   VAL A HG11 4  
ATOM 5942  H HG12 . VAL A 1 6   ? 4.695   -14.587 2.286   1.00 0.00 ? 6   VAL A HG12 4  
ATOM 5943  H HG13 . VAL A 1 6   ? 2.936   -14.366 2.453   1.00 0.00 ? 6   VAL A HG13 4  
ATOM 5944  H HG21 . VAL A 1 6   ? 6.080   -13.545 4.891   1.00 0.00 ? 6   VAL A HG21 4  
ATOM 5945  H HG22 . VAL A 1 6   ? 4.971   -14.751 5.586   1.00 0.00 ? 6   VAL A HG22 4  
ATOM 5946  H HG23 . VAL A 1 6   ? 5.652   -15.000 3.960   1.00 0.00 ? 6   VAL A HG23 4  
ATOM 5947  N N    . HIS A 1 7   ? 6.139   -12.315 2.750   1.00 0.00 ? 7   HIS A N    4  
ATOM 5948  C CA   . HIS A 1 7   ? 7.234   -11.906 1.886   1.00 0.00 ? 7   HIS A CA   4  
ATOM 5949  C C    . HIS A 1 7   ? 7.870   -10.627 2.435   1.00 0.00 ? 7   HIS A C    4  
ATOM 5950  O O    . HIS A 1 7   ? 7.475   -9.524  2.061   1.00 0.00 ? 7   HIS A O    4  
ATOM 5951  C CB   . HIS A 1 7   ? 6.760   -11.759 0.439   1.00 0.00 ? 7   HIS A CB   4  
ATOM 5952  C CG   . HIS A 1 7   ? 5.293   -11.425 0.305   1.00 0.00 ? 7   HIS A CG   4  
ATOM 5953  N ND1  . HIS A 1 7   ? 4.386   -12.267 -0.313  1.00 0.00 ? 7   HIS A ND1  4  
ATOM 5954  C CD2  . HIS A 1 7   ? 4.586   -10.333 0.716   1.00 0.00 ? 7   HIS A CD2  4  
ATOM 5955  C CE1  . HIS A 1 7   ? 3.190   -11.697 -0.271  1.00 0.00 ? 7   HIS A CE1  4  
ATOM 5956  N NE2  . HIS A 1 7   ? 3.317   -10.498 0.367   1.00 0.00 ? 7   HIS A NE2  4  
ATOM 5957  H H    . HIS A 1 7   ? 6.030   -13.304 2.854   1.00 0.00 ? 7   HIS A H    4  
ATOM 5958  H HA   . HIS A 1 7   ? 7.971   -12.709 1.914   1.00 0.00 ? 7   HIS A HA   4  
ATOM 5959  H HB2  . HIS A 1 7   ? 7.345   -10.978 -0.046  1.00 0.00 ? 7   HIS A HB2  4  
ATOM 5960  H HB3  . HIS A 1 7   ? 6.961   -12.687 -0.094  1.00 0.00 ? 7   HIS A HB3  4  
ATOM 5961  H HD1  . HIS A 1 7   ? 4.597   -13.155 -0.722  1.00 0.00 ? 7   HIS A HD1  4  
ATOM 5962  H HD2  . HIS A 1 7   ? 4.996   -9.471  1.243   1.00 0.00 ? 7   HIS A HD2  4  
ATOM 5963  H HE1  . HIS A 1 7   ? 2.268   -12.114 -0.675  1.00 0.00 ? 7   HIS A HE1  4  
ATOM 5964  N N    . PRO A 1 8   ? 8.869   -10.824 3.337   1.00 0.00 ? 8   PRO A N    4  
ATOM 5965  C CA   . PRO A 1 8   ? 9.562   -9.699  3.942   1.00 0.00 ? 8   PRO A CA   4  
ATOM 5966  C C    . PRO A 1 8   ? 10.536  -9.058  2.950   1.00 0.00 ? 8   PRO A C    4  
ATOM 5967  O O    . PRO A 1 8   ? 11.145  -8.032  3.248   1.00 0.00 ? 8   PRO A O    4  
ATOM 5968  C CB   . PRO A 1 8   ? 10.254  -10.275 5.166   1.00 0.00 ? 8   PRO A CB   4  
ATOM 5969  C CG   . PRO A 1 8   ? 10.307  -11.778 4.946   1.00 0.00 ? 8   PRO A CG   4  
ATOM 5970  C CD   . PRO A 1 8   ? 9.362   -12.115 3.804   1.00 0.00 ? 8   PRO A CD   4  
ATOM 5971  H HA   . PRO A 1 8   ? 8.912   -8.980  4.187   1.00 0.00 ? 8   PRO A HA   4  
ATOM 5972  H HB2  . PRO A 1 8   ? 11.257  -9.862  5.279   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 5973  H HB3  . PRO A 1 8   ? 9.705   -10.032 6.076   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 5974  H HG2  . PRO A 1 8   ? 11.322  -12.094 4.707   1.00 0.00 ? 8   PRO A HG2  4  
ATOM 5975  H HG3  . PRO A 1 8   ? 10.013  -12.307 5.853   1.00 0.00 ? 8   PRO A HG3  4  
ATOM 5976  H HD2  . PRO A 1 8   ? 9.878   -12.654 3.009   1.00 0.00 ? 8   PRO A HD2  4  
ATOM 5977  H HD3  . PRO A 1 8   ? 8.544   -12.753 4.142   1.00 0.00 ? 8   PRO A HD3  4  
ATOM 5978  N N    . GLN A 1 9   ? 10.653  -9.692  1.793   1.00 0.00 ? 9   GLN A N    4  
ATOM 5979  C CA   . GLN A 1 9   ? 11.543  -9.197  0.756   1.00 0.00 ? 9   GLN A CA   4  
ATOM 5980  C C    . GLN A 1 9   ? 10.844  -9.229  -0.605  1.00 0.00 ? 9   GLN A C    4  
ATOM 5981  O O    . GLN A 1 9   ? 10.955  -8.287  -1.387  1.00 0.00 ? 9   GLN A O    4  
ATOM 5982  C CB   . GLN A 1 9   ? 12.845  -10.000 0.721   1.00 0.00 ? 9   GLN A CB   4  
ATOM 5983  C CG   . GLN A 1 9   ? 13.778  -9.484  -0.376  1.00 0.00 ? 9   GLN A CG   4  
ATOM 5984  C CD   . GLN A 1 9   ? 15.069  -8.922  0.223   1.00 0.00 ? 9   GLN A CD   4  
ATOM 5985  O OE1  . GLN A 1 9   ? 16.170  -9.315  -0.129  1.00 0.00 ? 9   GLN A OE1  4  
ATOM 5986  N NE2  . GLN A 1 9   ? 14.875  -7.984  1.145   1.00 0.00 ? 9   GLN A NE2  4  
ATOM 5987  H H    . GLN A 1 9   ? 10.154  -10.526 1.559   1.00 0.00 ? 9   GLN A H    4  
ATOM 5988  H HA   . GLN A 1 9   ? 11.767  -8.167  1.032   1.00 0.00 ? 9   GLN A HA   4  
ATOM 5989  H HB2  . GLN A 1 9   ? 13.343  -9.933  1.688   1.00 0.00 ? 9   GLN A HB2  4  
ATOM 5990  H HB3  . GLN A 1 9   ? 12.623  -11.054 0.549   1.00 0.00 ? 9   GLN A HB3  4  
ATOM 5991  H HG2  . GLN A 1 9   ? 14.016  -10.293 -1.067  1.00 0.00 ? 9   GLN A HG2  4  
ATOM 5992  H HG3  . GLN A 1 9   ? 13.274  -8.710  -0.953  1.00 0.00 ? 9   GLN A HG3  4  
ATOM 5993  H HE21 . GLN A 1 9   ? 13.945  -7.708  1.389   1.00 0.00 ? 9   GLN A HE21 4  
ATOM 5994  H HE22 . GLN A 1 9   ? 15.658  -7.555  1.596   1.00 0.00 ? 9   GLN A HE22 4  
ATOM 5995  N N    . GLN A 1 10  ? 10.137  -10.324 -0.845  1.00 0.00 ? 10  GLN A N    4  
ATOM 5996  C CA   . GLN A 1 10  ? 9.418   -10.492 -2.097  1.00 0.00 ? 10  GLN A CA   4  
ATOM 5997  C C    . GLN A 1 10  ? 8.329   -9.426  -2.230  1.00 0.00 ? 10  GLN A C    4  
ATOM 5998  O O    . GLN A 1 10  ? 7.675   -9.328  -3.267  1.00 0.00 ? 10  GLN A O    4  
ATOM 5999  C CB   . GLN A 1 10  ? 8.827   -11.898 -2.206  1.00 0.00 ? 10  GLN A CB   4  
ATOM 6000  C CG   . GLN A 1 10  ? 9.747   -12.933 -1.556  1.00 0.00 ? 10  GLN A CG   4  
ATOM 6001  C CD   . GLN A 1 10  ? 9.586   -14.302 -2.219  1.00 0.00 ? 10  GLN A CD   4  
ATOM 6002  O OE1  . GLN A 1 10  ? 9.396   -14.422 -3.418  1.00 0.00 ? 10  GLN A OE1  4  
ATOM 6003  N NE2  . GLN A 1 10  ? 9.674   -15.325 -1.373  1.00 0.00 ? 10  GLN A NE2  4  
ATOM 6004  H H    . GLN A 1 10  ? 10.051  -11.087 -0.204  1.00 0.00 ? 10  GLN A H    4  
ATOM 6005  H HA   . GLN A 1 10  ? 10.165  -10.357 -2.880  1.00 0.00 ? 10  GLN A HA   4  
ATOM 6006  H HB2  . GLN A 1 10  ? 7.849   -11.924 -1.724  1.00 0.00 ? 10  GLN A HB2  4  
ATOM 6007  H HB3  . GLN A 1 10  ? 8.672   -12.151 -3.254  1.00 0.00 ? 10  GLN A HB3  4  
ATOM 6008  H HG2  . GLN A 1 10  ? 10.784  -12.605 -1.640  1.00 0.00 ? 10  GLN A HG2  4  
ATOM 6009  H HG3  . GLN A 1 10  ? 9.522   -13.010 -0.493  1.00 0.00 ? 10  GLN A HG3  4  
ATOM 6010  H HE21 . GLN A 1 10  ? 9.832   -15.158 -0.400  1.00 0.00 ? 10  GLN A HE21 4  
ATOM 6011  H HE22 . GLN A 1 10  ? 9.581   -16.263 -1.710  1.00 0.00 ? 10  GLN A HE22 4  
ATOM 6012  N N    . ALA A 1 11  ? 8.167   -8.655  -1.165  1.00 0.00 ? 11  ALA A N    4  
ATOM 6013  C CA   . ALA A 1 11  ? 7.167   -7.600  -1.150  1.00 0.00 ? 11  ALA A CA   4  
ATOM 6014  C C    . ALA A 1 11  ? 7.738   -6.352  -1.826  1.00 0.00 ? 11  ALA A C    4  
ATOM 6015  O O    . ALA A 1 11  ? 7.026   -5.648  -2.540  1.00 0.00 ? 11  ALA A O    4  
ATOM 6016  C CB   . ALA A 1 11  ? 6.727   -7.333  0.291   1.00 0.00 ? 11  ALA A CB   4  
ATOM 6017  H H    . ALA A 1 11  ? 8.702   -8.741  -0.325  1.00 0.00 ? 11  ALA A H    4  
ATOM 6018  H HA   . ALA A 1 11  ? 6.306   -7.950  -1.720  1.00 0.00 ? 11  ALA A HA   4  
ATOM 6019  H HB1  . ALA A 1 11  ? 7.470   -7.739  0.978   1.00 0.00 ? 11  ALA A HB1  4  
ATOM 6020  H HB2  . ALA A 1 11  ? 6.635   -6.259  0.450   1.00 0.00 ? 11  ALA A HB2  4  
ATOM 6021  H HB3  . ALA A 1 11  ? 5.764   -7.811  0.472   1.00 0.00 ? 11  ALA A HB3  4  
ATOM 6022  N N    . PHE A 1 12  ? 9.018   -6.117  -1.577  1.00 0.00 ? 12  PHE A N    4  
ATOM 6023  C CA   . PHE A 1 12  ? 9.693   -4.967  -2.153  1.00 0.00 ? 12  PHE A CA   4  
ATOM 6024  C C    . PHE A 1 12  ? 10.237  -5.290  -3.546  1.00 0.00 ? 12  PHE A C    4  
ATOM 6025  O O    . PHE A 1 12  ? 10.798  -4.423  -4.214  1.00 0.00 ? 12  PHE A O    4  
ATOM 6026  C CB   . PHE A 1 12  ? 10.864  -4.626  -1.228  1.00 0.00 ? 12  PHE A CB   4  
ATOM 6027  C CG   . PHE A 1 12  ? 10.440  -4.114  0.149   1.00 0.00 ? 12  PHE A CG   4  
ATOM 6028  C CD1  . PHE A 1 12  ? 9.563   -4.831  0.901   1.00 0.00 ? 12  PHE A CD1  4  
ATOM 6029  C CD2  . PHE A 1 12  ? 10.940  -2.941  0.622   1.00 0.00 ? 12  PHE A CD2  4  
ATOM 6030  C CE1  . PHE A 1 12  ? 9.169   -4.355  2.180   1.00 0.00 ? 12  PHE A CE1  4  
ATOM 6031  C CE2  . PHE A 1 12  ? 10.546  -2.465  1.901   1.00 0.00 ? 12  PHE A CE2  4  
ATOM 6032  C CZ   . PHE A 1 12  ? 9.669   -3.182  2.653   1.00 0.00 ? 12  PHE A CZ   4  
ATOM 6033  H H    . PHE A 1 12  ? 9.590   -6.695  -0.995  1.00 0.00 ? 12  PHE A H    4  
ATOM 6034  H HA   . PHE A 1 12  ? 8.959   -4.165  -2.229  1.00 0.00 ? 12  PHE A HA   4  
ATOM 6035  H HB2  . PHE A 1 12  ? 11.483  -5.514  -1.099  1.00 0.00 ? 12  PHE A HB2  4  
ATOM 6036  H HB3  . PHE A 1 12  ? 11.486  -3.871  -1.709  1.00 0.00 ? 12  PHE A HB3  4  
ATOM 6037  H HD1  . PHE A 1 12  ? 9.161   -5.771  0.523   1.00 0.00 ? 12  PHE A HD1  4  
ATOM 6038  H HD2  . PHE A 1 12  ? 11.643  -2.365  0.020   1.00 0.00 ? 12  PHE A HD2  4  
ATOM 6039  H HE1  . PHE A 1 12  ? 8.466   -4.929  2.783   1.00 0.00 ? 12  PHE A HE1  4  
ATOM 6040  H HE2  . PHE A 1 12  ? 10.947  -1.525  2.280   1.00 0.00 ? 12  PHE A HE2  4  
ATOM 6041  H HZ   . PHE A 1 12  ? 9.367   -2.816  3.635   1.00 0.00 ? 12  PHE A HZ   4  
ATOM 6042  N N    . CYS A 1 13  ? 10.051  -6.540  -3.943  1.00 0.00 ? 13  CYS A N    4  
ATOM 6043  C CA   . CYS A 1 13  ? 10.516  -6.989  -5.245  1.00 0.00 ? 13  CYS A CA   4  
ATOM 6044  C C    . CYS A 1 13  ? 9.305   -7.110  -6.172  1.00 0.00 ? 13  CYS A C    4  
ATOM 6045  O O    . CYS A 1 13  ? 9.455   -7.162  -7.391  1.00 0.00 ? 13  CYS A O    4  
ATOM 6046  C CB   . CYS A 1 13  ? 11.292  -8.304  -5.146  1.00 0.00 ? 13  CYS A CB   4  
ATOM 6047  S SG   . CYS A 1 13  ? 13.112  -8.130  -5.236  1.00 0.00 ? 13  CYS A SG   4  
ATOM 6048  H H    . CYS A 1 13  ? 9.594   -7.239  -3.394  1.00 0.00 ? 13  CYS A H    4  
ATOM 6049  H HA   . CYS A 1 13  ? 11.208  -6.230  -5.609  1.00 0.00 ? 13  CYS A HA   4  
ATOM 6050  H HB2  . CYS A 1 13  ? 11.034  -8.793  -4.205  1.00 0.00 ? 13  CYS A HB2  4  
ATOM 6051  H HB3  . CYS A 1 13  ? 10.964  -8.964  -5.948  1.00 0.00 ? 13  CYS A HB3  4  
ATOM 6052  N N    . ASN A 1 14  ? 8.131   -7.151  -5.557  1.00 0.00 ? 14  ASN A N    4  
ATOM 6053  C CA   . ASN A 1 14  ? 6.895   -7.264  -6.312  1.00 0.00 ? 14  ASN A CA   4  
ATOM 6054  C C    . ASN A 1 14  ? 6.304   -5.870  -6.526  1.00 0.00 ? 14  ASN A C    4  
ATOM 6055  O O    . ASN A 1 14  ? 5.754   -5.581  -7.588  1.00 0.00 ? 14  ASN A O    4  
ATOM 6056  C CB   . ASN A 1 14  ? 5.864   -8.105  -5.557  1.00 0.00 ? 14  ASN A CB   4  
ATOM 6057  C CG   . ASN A 1 14  ? 5.473   -9.346  -6.362  1.00 0.00 ? 14  ASN A CG   4  
ATOM 6058  O OD1  . ASN A 1 14  ? 4.729   -9.283  -7.327  1.00 0.00 ? 14  ASN A OD1  4  
ATOM 6059  N ND2  . ASN A 1 14  ? 6.015   -10.475 -5.914  1.00 0.00 ? 14  ASN A ND2  4  
ATOM 6060  H H    . ASN A 1 14  ? 8.018   -7.108  -4.565  1.00 0.00 ? 14  ASN A H    4  
ATOM 6061  H HA   . ASN A 1 14  ? 7.175   -7.747  -7.249  1.00 0.00 ? 14  ASN A HA   4  
ATOM 6062  H HB2  . ASN A 1 14  ? 6.271   -8.406  -4.593  1.00 0.00 ? 14  ASN A HB2  4  
ATOM 6063  H HB3  . ASN A 1 14  ? 4.977   -7.505  -5.356  1.00 0.00 ? 14  ASN A HB3  4  
ATOM 6064  H HD21 . ASN A 1 14  ? 6.618   -10.458 -5.117  1.00 0.00 ? 14  ASN A HD21 4  
ATOM 6065  H HD22 . ASN A 1 14  ? 5.819   -11.342 -6.374  1.00 0.00 ? 14  ASN A HD22 4  
ATOM 6066  N N    . ALA A 1 15  ? 6.434   -5.043  -5.499  1.00 0.00 ? 15  ALA A N    4  
ATOM 6067  C CA   . ALA A 1 15  ? 5.920   -3.685  -5.561  1.00 0.00 ? 15  ALA A CA   4  
ATOM 6068  C C    . ALA A 1 15  ? 6.548   -2.959  -6.751  1.00 0.00 ? 15  ALA A C    4  
ATOM 6069  O O    . ALA A 1 15  ? 7.427   -3.501  -7.420  1.00 0.00 ? 15  ALA A O    4  
ATOM 6070  C CB   . ALA A 1 15  ? 6.192   -2.975  -4.234  1.00 0.00 ? 15  ALA A CB   4  
ATOM 6071  H H    . ALA A 1 15  ? 6.883   -5.286  -4.639  1.00 0.00 ? 15  ALA A H    4  
ATOM 6072  H HA   . ALA A 1 15  ? 4.842   -3.746  -5.712  1.00 0.00 ? 15  ALA A HA   4  
ATOM 6073  H HB1  . ALA A 1 15  ? 7.250   -3.058  -3.987  1.00 0.00 ? 15  ALA A HB1  4  
ATOM 6074  H HB2  . ALA A 1 15  ? 5.922   -1.923  -4.323  1.00 0.00 ? 15  ALA A HB2  4  
ATOM 6075  H HB3  . ALA A 1 15  ? 5.598   -3.437  -3.445  1.00 0.00 ? 15  ALA A HB3  4  
ATOM 6076  N N    . ASP A 1 16  ? 6.076   -1.743  -6.979  1.00 0.00 ? 16  ASP A N    4  
ATOM 6077  C CA   . ASP A 1 16  ? 6.581   -0.937  -8.077  1.00 0.00 ? 16  ASP A CA   4  
ATOM 6078  C C    . ASP A 1 16  ? 6.318   0.541   -7.783  1.00 0.00 ? 16  ASP A C    4  
ATOM 6079  O O    . ASP A 1 16  ? 6.370   1.377   -8.684  1.00 0.00 ? 16  ASP A O    4  
ATOM 6080  C CB   . ASP A 1 16  ? 5.878   -1.290  -9.390  1.00 0.00 ? 16  ASP A CB   4  
ATOM 6081  C CG   . ASP A 1 16  ? 6.582   -2.354  -10.234 1.00 0.00 ? 16  ASP A CG   4  
ATOM 6082  O OD1  . ASP A 1 16  ? 7.828   -2.405  -10.159 1.00 0.00 ? 16  ASP A OD1  4  
ATOM 6083  O OD2  . ASP A 1 16  ? 5.857   -3.093  -10.936 1.00 0.00 ? 16  ASP A OD2  4  
ATOM 6084  H H    . ASP A 1 16  ? 5.361   -1.309  -6.430  1.00 0.00 ? 16  ASP A H    4  
ATOM 6085  H HA   . ASP A 1 16  ? 7.645   -1.167  -8.136  1.00 0.00 ? 16  ASP A HA   4  
ATOM 6086  H HB2  . ASP A 1 16  ? 4.870   -1.636  -9.162  1.00 0.00 ? 16  ASP A HB2  4  
ATOM 6087  H HB3  . ASP A 1 16  ? 5.777   -0.383  -9.985  1.00 0.00 ? 16  ASP A HB3  4  
ATOM 6088  N N    . VAL A 1 17  ? 6.039   0.819   -6.518  1.00 0.00 ? 17  VAL A N    4  
ATOM 6089  C CA   . VAL A 1 17  ? 5.767   2.182   -6.092  1.00 0.00 ? 17  VAL A CA   4  
ATOM 6090  C C    . VAL A 1 17  ? 5.833   2.259   -4.567  1.00 0.00 ? 17  VAL A C    4  
ATOM 6091  O O    . VAL A 1 17  ? 4.801   2.237   -3.895  1.00 0.00 ? 17  VAL A O    4  
ATOM 6092  C CB   . VAL A 1 17  ? 4.423   2.647   -6.657  1.00 0.00 ? 17  VAL A CB   4  
ATOM 6093  C CG1  . VAL A 1 17  ? 3.300   1.686   -6.264  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 6094  C CG2  . VAL A 1 17  ? 4.105   4.076   -6.210  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 6095  H H    . VAL A 1 17  ? 5.997   0.134   -5.791  1.00 0.00 ? 17  VAL A H    4  
ATOM 6096  H HA   . VAL A 1 17  ? 6.548   2.818   -6.510  1.00 0.00 ? 17  VAL A HA   4  
ATOM 6097  H HB   . VAL A 1 17  ? 4.498   2.647   -7.745  1.00 0.00 ? 17  VAL A HB   4  
ATOM 6098  H HG11 . VAL A 1 17  ? 3.469   1.327   -5.248  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 6099  H HG12 . VAL A 1 17  ? 2.343   2.207   -6.310  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 6100  H HG13 . VAL A 1 17  ? 3.287   0.841   -6.951  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 6101  H HG21 . VAL A 1 17  ? 5.011   4.681   -6.257  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 6102  H HG22 . VAL A 1 17  ? 3.347   4.502   -6.867  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 6103  H HG23 . VAL A 1 17  ? 3.732   4.060   -5.186  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 6104  N N    . VAL A 1 18  ? 7.054   2.346   -4.062  1.00 0.00 ? 18  VAL A N    4  
ATOM 6105  C CA   . VAL A 1 18  ? 7.268   2.426   -2.627  1.00 0.00 ? 18  VAL A CA   4  
ATOM 6106  C C    . VAL A 1 18  ? 7.373   3.895   -2.213  1.00 0.00 ? 18  VAL A C    4  
ATOM 6107  O O    . VAL A 1 18  ? 8.267   4.609   -2.664  1.00 0.00 ? 18  VAL A O    4  
ATOM 6108  C CB   . VAL A 1 18  ? 8.498   1.605   -2.234  1.00 0.00 ? 18  VAL A CB   4  
ATOM 6109  C CG1  . VAL A 1 18  ? 8.298   0.936   -0.873  1.00 0.00 ? 18  VAL A CG1  4  
ATOM 6110  C CG2  . VAL A 1 18  ? 8.833   0.571   -3.311  1.00 0.00 ? 18  VAL A CG2  4  
ATOM 6111  H H    . VAL A 1 18  ? 7.888   2.364   -4.615  1.00 0.00 ? 18  VAL A H    4  
ATOM 6112  H HA   . VAL A 1 18  ? 6.398   1.986   -2.140  1.00 0.00 ? 18  VAL A HA   4  
ATOM 6113  H HB   . VAL A 1 18  ? 9.344   2.287   -2.151  1.00 0.00 ? 18  VAL A HB   4  
ATOM 6114  H HG11 . VAL A 1 18  ? 7.242   0.968   -0.604  1.00 0.00 ? 18  VAL A HG11 4  
ATOM 6115  H HG12 . VAL A 1 18  ? 8.627   -0.102  -0.928  1.00 0.00 ? 18  VAL A HG12 4  
ATOM 6116  H HG13 . VAL A 1 18  ? 8.882   1.463   -0.119  1.00 0.00 ? 18  VAL A HG13 4  
ATOM 6117  H HG21 . VAL A 1 18  ? 7.928   0.313   -3.861  1.00 0.00 ? 18  VAL A HG21 4  
ATOM 6118  H HG22 . VAL A 1 18  ? 9.570   0.987   -3.997  1.00 0.00 ? 18  VAL A HG22 4  
ATOM 6119  H HG23 . VAL A 1 18  ? 9.239   -0.325  -2.841  1.00 0.00 ? 18  VAL A HG23 4  
ATOM 6120  N N    . ILE A 1 19  ? 6.446   4.303   -1.358  1.00 0.00 ? 19  ILE A N    4  
ATOM 6121  C CA   . ILE A 1 19  ? 6.423   5.674   -0.878  1.00 0.00 ? 19  ILE A CA   4  
ATOM 6122  C C    . ILE A 1 19  ? 5.970   5.691   0.584   1.00 0.00 ? 19  ILE A C    4  
ATOM 6123  O O    . ILE A 1 19  ? 4.895   5.189   0.909   1.00 0.00 ? 19  ILE A O    4  
ATOM 6124  C CB   . ILE A 1 19  ? 5.569   6.550   -1.796  1.00 0.00 ? 19  ILE A CB   4  
ATOM 6125  C CG1  . ILE A 1 19  ? 4.081   6.243   -1.619  1.00 0.00 ? 19  ILE A CG1  4  
ATOM 6126  C CG2  . ILE A 1 19  ? 6.013   6.411   -3.253  1.00 0.00 ? 19  ILE A CG2  4  
ATOM 6127  C CD1  . ILE A 1 19  ? 3.306   6.520   -2.908  1.00 0.00 ? 19  ILE A CD1  4  
ATOM 6128  H H    . ILE A 1 19  ? 5.722   3.716   -0.996  1.00 0.00 ? 19  ILE A H    4  
ATOM 6129  H HA   . ILE A 1 19  ? 7.444   6.055   -0.926  1.00 0.00 ? 19  ILE A HA   4  
ATOM 6130  H HB   . ILE A 1 19  ? 5.719   7.592   -1.512  1.00 0.00 ? 19  ILE A HB   4  
ATOM 6131  H HG12 . ILE A 1 19  ? 3.953   5.200   -1.331  1.00 0.00 ? 19  ILE A HG12 4  
ATOM 6132  H HG13 . ILE A 1 19  ? 3.675   6.849   -0.809  1.00 0.00 ? 19  ILE A HG13 4  
ATOM 6133  H HG21 . ILE A 1 19  ? 7.101   6.372   -3.300  1.00 0.00 ? 19  ILE A HG21 4  
ATOM 6134  H HG22 . ILE A 1 19  ? 5.598   5.496   -3.675  1.00 0.00 ? 19  ILE A HG22 4  
ATOM 6135  H HG23 . ILE A 1 19  ? 5.657   7.269   -3.826  1.00 0.00 ? 19  ILE A HG23 4  
ATOM 6136  H HD11 . ILE A 1 19  ? 3.672   7.442   -3.360  1.00 0.00 ? 19  ILE A HD11 4  
ATOM 6137  H HD12 . ILE A 1 19  ? 3.450   5.693   -3.603  1.00 0.00 ? 19  ILE A HD12 4  
ATOM 6138  H HD13 . ILE A 1 19  ? 2.246   6.623   -2.680  1.00 0.00 ? 19  ILE A HD13 4  
ATOM 6139  N N    . ARG A 1 20  ? 6.812   6.273   1.425   1.00 0.00 ? 20  ARG A N    4  
ATOM 6140  C CA   . ARG A 1 20  ? 6.511   6.361   2.844   1.00 0.00 ? 20  ARG A CA   4  
ATOM 6141  C C    . ARG A 1 20  ? 5.459   7.445   3.097   1.00 0.00 ? 20  ARG A C    4  
ATOM 6142  O O    . ARG A 1 20  ? 5.561   8.199   4.064   1.00 0.00 ? 20  ARG A O    4  
ATOM 6143  C CB   . ARG A 1 20  ? 7.767   6.680   3.655   1.00 0.00 ? 20  ARG A CB   4  
ATOM 6144  C CG   . ARG A 1 20  ? 8.994   5.982   3.064   1.00 0.00 ? 20  ARG A CG   4  
ATOM 6145  C CD   . ARG A 1 20  ? 10.129  5.909   4.087   1.00 0.00 ? 20  ARG A CD   4  
ATOM 6146  N NE   . ARG A 1 20  ? 10.147  7.136   4.913   1.00 0.00 ? 20  ARG A NE   4  
ATOM 6147  C CZ   . ARG A 1 20  ? 11.246  7.633   5.497   1.00 0.00 ? 20  ARG A CZ   4  
ATOM 6148  N NH1  . ARG A 1 20  ? 12.423  7.010   5.348   1.00 0.00 ? 20  ARG A NH1  4  
ATOM 6149  N NH2  . ARG A 1 20  ? 11.168  8.753   6.227   1.00 0.00 ? 20  ARG A NH2  4  
ATOM 6150  H H    . ARG A 1 20  ? 7.683   6.679   1.153   1.00 0.00 ? 20  ARG A H    4  
ATOM 6151  H HA   . ARG A 1 20  ? 6.130   5.375   3.110   1.00 0.00 ? 20  ARG A HA   4  
ATOM 6152  H HB2  . ARG A 1 20  ? 7.931   7.758   3.671   1.00 0.00 ? 20  ARG A HB2  4  
ATOM 6153  H HB3  . ARG A 1 20  ? 7.627   6.364   4.689   1.00 0.00 ? 20  ARG A HB3  4  
ATOM 6154  H HG2  . ARG A 1 20  ? 8.723   4.976   2.742   1.00 0.00 ? 20  ARG A HG2  4  
ATOM 6155  H HG3  . ARG A 1 20  ? 9.331   6.520   2.178   1.00 0.00 ? 20  ARG A HG3  4  
ATOM 6156  H HD2  . ARG A 1 20  ? 10.000  5.033   4.724   1.00 0.00 ? 20  ARG A HD2  4  
ATOM 6157  H HD3  . ARG A 1 20  ? 11.084  5.791   3.574   1.00 0.00 ? 20  ARG A HD3  4  
ATOM 6158  H HE   . ARG A 1 20  ? 9.285   7.626   5.043   1.00 0.00 ? 20  ARG A HE   4  
ATOM 6159  H HH11 . ARG A 1 20  ? 12.481  6.174   4.803   1.00 0.00 ? 20  ARG A HH11 4  
ATOM 6160  H HH12 . ARG A 1 20  ? 13.243  7.381   5.784   1.00 0.00 ? 20  ARG A HH12 4  
ATOM 6161  H HH21 . ARG A 1 20  ? 10.290  9.218   6.337   1.00 0.00 ? 20  ARG A HH21 4  
ATOM 6162  H HH22 . ARG A 1 20  ? 11.988  9.124   6.663   1.00 0.00 ? 20  ARG A HH22 4  
ATOM 6163  N N    . THR A 1 21  ? 4.474   7.486   2.213   1.00 0.00 ? 21  THR A N    4  
ATOM 6164  C CA   . THR A 1 21  ? 3.406   8.464   2.329   1.00 0.00 ? 21  THR A CA   4  
ATOM 6165  C C    . THR A 1 21  ? 2.629   8.254   3.630   1.00 0.00 ? 21  THR A C    4  
ATOM 6166  O O    . THR A 1 21  ? 2.889   7.302   4.365   1.00 0.00 ? 21  THR A O    4  
ATOM 6167  C CB   . THR A 1 21  ? 2.533   8.360   1.076   1.00 0.00 ? 21  THR A CB   4  
ATOM 6168  O OG1  . THR A 1 21  ? 1.397   9.167   1.377   1.00 0.00 ? 21  THR A OG1  4  
ATOM 6169  C CG2  . THR A 1 21  ? 1.952   6.958   0.882   1.00 0.00 ? 21  THR A CG2  4  
ATOM 6170  H H    . THR A 1 21  ? 4.398   6.868   1.430   1.00 0.00 ? 21  THR A H    4  
ATOM 6171  H HA   . THR A 1 21  ? 3.852   9.457   2.379   1.00 0.00 ? 21  THR A HA   4  
ATOM 6172  H HB   . THR A 1 21  ? 3.082   8.681   0.191   1.00 0.00 ? 21  THR A HB   4  
ATOM 6173  H HG1  . THR A 1 21  ? 1.249   9.835   0.647   1.00 0.00 ? 21  THR A HG1  4  
ATOM 6174  H HG21 . THR A 1 21  ? 2.679   6.215   1.209   1.00 0.00 ? 21  THR A HG21 4  
ATOM 6175  H HG22 . THR A 1 21  ? 1.039   6.858   1.469   1.00 0.00 ? 21  THR A HG22 4  
ATOM 6176  H HG23 . THR A 1 21  ? 1.724   6.803   -0.173  1.00 0.00 ? 21  THR A HG23 4  
ATOM 6177  N N    . LYS A 1 22  ? 1.693   9.159   3.874   1.00 0.00 ? 22  LYS A N    4  
ATOM 6178  C CA   . LYS A 1 22  ? 0.877   9.085   5.075   1.00 0.00 ? 22  LYS A CA   4  
ATOM 6179  C C    . LYS A 1 22  ? -0.599  9.196   4.690   1.00 0.00 ? 22  LYS A C    4  
ATOM 6180  O O    . LYS A 1 22  ? -1.021  10.196  4.109   1.00 0.00 ? 22  LYS A O    4  
ATOM 6181  C CB   . LYS A 1 22  ? 1.327   10.133  6.094   1.00 0.00 ? 22  LYS A CB   4  
ATOM 6182  C CG   . LYS A 1 22  ? 0.992   11.546  5.611   1.00 0.00 ? 22  LYS A CG   4  
ATOM 6183  C CD   . LYS A 1 22  ? 1.215   12.573  6.724   1.00 0.00 ? 22  LYS A CD   4  
ATOM 6184  C CE   . LYS A 1 22  ? 0.612   12.090  8.044   1.00 0.00 ? 22  LYS A CE   4  
ATOM 6185  N NZ   . LYS A 1 22  ? 0.529   13.205  9.015   1.00 0.00 ? 22  LYS A NZ   4  
ATOM 6186  H H    . LYS A 1 22  ? 1.488   9.930   3.272   1.00 0.00 ? 22  LYS A H    4  
ATOM 6187  H HA   . LYS A 1 22  ? 1.044   8.106   5.524   1.00 0.00 ? 22  LYS A HA   4  
ATOM 6188  H HB2  . LYS A 1 22  ? 0.840   9.948   7.052   1.00 0.00 ? 22  LYS A HB2  4  
ATOM 6189  H HB3  . LYS A 1 22  ? 2.401   10.047  6.260   1.00 0.00 ? 22  LYS A HB3  4  
ATOM 6190  H HG2  . LYS A 1 22  ? 1.612   11.796  4.751   1.00 0.00 ? 22  LYS A HG2  4  
ATOM 6191  H HG3  . LYS A 1 22  ? -0.045  11.585  5.279   1.00 0.00 ? 22  LYS A HG3  4  
ATOM 6192  H HD2  . LYS A 1 22  ? 2.284   12.750  6.851   1.00 0.00 ? 22  LYS A HD2  4  
ATOM 6193  H HD3  . LYS A 1 22  ? 0.766   13.524  6.441   1.00 0.00 ? 22  LYS A HD3  4  
ATOM 6194  H HE2  . LYS A 1 22  ? -0.382  11.679  7.868   1.00 0.00 ? 22  LYS A HE2  4  
ATOM 6195  H HE3  . LYS A 1 22  ? 1.220   11.286  8.457   1.00 0.00 ? 22  LYS A HE3  4  
ATOM 6196  H HZ1  . LYS A 1 22  ? 1.202   13.906  8.775   1.00 0.00 ? 22  LYS A HZ1  4  
ATOM 6197  H HZ2  . LYS A 1 22  ? -0.388  13.602  8.990   1.00 0.00 ? 22  LYS A HZ2  4  
ATOM 6198  H HZ3  . LYS A 1 22  ? 0.718   12.862  9.935   1.00 0.00 ? 22  LYS A HZ3  4  
ATOM 6199  N N    . ALA A 1 23  ? -1.347  8.155   5.029   1.00 0.00 ? 23  ALA A N    4  
ATOM 6200  C CA   . ALA A 1 23  ? -2.768  8.123   4.726   1.00 0.00 ? 23  ALA A CA   4  
ATOM 6201  C C    . ALA A 1 23  ? -3.553  8.632   5.935   1.00 0.00 ? 23  ALA A C    4  
ATOM 6202  O O    . ALA A 1 23  ? -3.798  7.885   6.881   1.00 0.00 ? 23  ALA A O    4  
ATOM 6203  C CB   . ALA A 1 23  ? -3.171  6.702   4.324   1.00 0.00 ? 23  ALA A CB   4  
ATOM 6204  H H    . ALA A 1 23  ? -0.997  7.345   5.501   1.00 0.00 ? 23  ALA A H    4  
ATOM 6205  H HA   . ALA A 1 23  ? -2.942  8.789   3.882   1.00 0.00 ? 23  ALA A HA   4  
ATOM 6206  H HB1  . ALA A 1 23  ? -2.544  6.366   3.499   1.00 0.00 ? 23  ALA A HB1  4  
ATOM 6207  H HB2  . ALA A 1 23  ? -3.043  6.034   5.174   1.00 0.00 ? 23  ALA A HB2  4  
ATOM 6208  H HB3  . ALA A 1 23  ? -4.216  6.697   4.012   1.00 0.00 ? 23  ALA A HB3  4  
ATOM 6209  N N    . VAL A 1 24  ? -3.929  9.901   5.865   1.00 0.00 ? 24  VAL A N    4  
ATOM 6210  C CA   . VAL A 1 24  ? -4.682  10.520  6.943   1.00 0.00 ? 24  VAL A CA   4  
ATOM 6211  C C    . VAL A 1 24  ? -6.167  10.539  6.575   1.00 0.00 ? 24  VAL A C    4  
ATOM 6212  O O    . VAL A 1 24  ? -7.024  10.292  7.422   1.00 0.00 ? 24  VAL A O    4  
ATOM 6213  C CB   . VAL A 1 24  ? -4.122  11.912  7.241   1.00 0.00 ? 24  VAL A CB   4  
ATOM 6214  C CG1  . VAL A 1 24  ? -2.840  11.820  8.071   1.00 0.00 ? 24  VAL A CG1  4  
ATOM 6215  C CG2  . VAL A 1 24  ? -3.885  12.696  5.949   1.00 0.00 ? 24  VAL A CG2  4  
ATOM 6216  H H    . VAL A 1 24  ? -3.725  10.503  5.092   1.00 0.00 ? 24  VAL A H    4  
ATOM 6217  H HA   . VAL A 1 24  ? -4.550  9.904   7.832   1.00 0.00 ? 24  VAL A HA   4  
ATOM 6218  H HB   . VAL A 1 24  ? -4.863  12.452  7.829   1.00 0.00 ? 24  VAL A HB   4  
ATOM 6219  H HG11 . VAL A 1 24  ? -2.234  10.987  7.714   1.00 0.00 ? 24  VAL A HG11 4  
ATOM 6220  H HG12 . VAL A 1 24  ? -2.275  12.748  7.972   1.00 0.00 ? 24  VAL A HG12 4  
ATOM 6221  H HG13 . VAL A 1 24  ? -3.095  11.661  9.118   1.00 0.00 ? 24  VAL A HG13 4  
ATOM 6222  H HG21 . VAL A 1 24  ? -4.736  12.564  5.283   1.00 0.00 ? 24  VAL A HG21 4  
ATOM 6223  H HG22 . VAL A 1 24  ? -3.767  13.755  6.182   1.00 0.00 ? 24  VAL A HG22 4  
ATOM 6224  H HG23 . VAL A 1 24  ? -2.981  12.329  5.461   1.00 0.00 ? 24  VAL A HG23 4  
ATOM 6225  N N    . SER A 1 25  ? -6.426  10.835  5.309   1.00 0.00 ? 25  SER A N    4  
ATOM 6226  C CA   . SER A 1 25  ? -7.793  10.890  4.819   1.00 0.00 ? 25  SER A CA   4  
ATOM 6227  C C    . SER A 1 25  ? -8.043  9.744   3.836   1.00 0.00 ? 25  SER A C    4  
ATOM 6228  O O    . SER A 1 25  ? -7.102  9.089   3.390   1.00 0.00 ? 25  SER A O    4  
ATOM 6229  C CB   . SER A 1 25  ? -8.085  12.235  4.151   1.00 0.00 ? 25  SER A CB   4  
ATOM 6230  O OG   . SER A 1 25  ? -9.203  12.162  3.271   1.00 0.00 ? 25  SER A OG   4  
ATOM 6231  H H    . SER A 1 25  ? -5.724  11.035  4.627   1.00 0.00 ? 25  SER A H    4  
ATOM 6232  H HA   . SER A 1 25  ? -8.421  10.780  5.702   1.00 0.00 ? 25  SER A HA   4  
ATOM 6233  H HB2  . SER A 1 25  ? -8.275  12.987  4.917   1.00 0.00 ? 25  SER A HB2  4  
ATOM 6234  H HB3  . SER A 1 25  ? -7.207  12.562  3.595   1.00 0.00 ? 25  SER A HB3  4  
ATOM 6235  H HG   . SER A 1 25  ? -9.047  11.460  2.576   1.00 0.00 ? 25  SER A HG   4  
ATOM 6236  N N    . GLU A 1 26  ? -9.315  9.537   3.528   1.00 0.00 ? 26  GLU A N    4  
ATOM 6237  C CA   . GLU A 1 26  ? -9.700  8.482   2.607   1.00 0.00 ? 26  GLU A CA   4  
ATOM 6238  C C    . GLU A 1 26  ? -10.953 8.887   1.829   1.00 0.00 ? 26  GLU A C    4  
ATOM 6239  O O    . GLU A 1 26  ? -11.453 10.000  1.988   1.00 0.00 ? 26  GLU A O    4  
ATOM 6240  C CB   . GLU A 1 26  ? -9.916  7.160   3.346   1.00 0.00 ? 26  GLU A CB   4  
ATOM 6241  C CG   . GLU A 1 26  ? -8.581  6.489   3.672   1.00 0.00 ? 26  GLU A CG   4  
ATOM 6242  C CD   . GLU A 1 26  ? -8.257  6.607   5.162   1.00 0.00 ? 26  GLU A CD   4  
ATOM 6243  O OE1  . GLU A 1 26  ? -9.029  6.031   5.958   1.00 0.00 ? 26  GLU A OE1  4  
ATOM 6244  O OE2  . GLU A 1 26  ? -7.243  7.270   5.471   1.00 0.00 ? 26  GLU A OE2  4  
ATOM 6245  H H    . GLU A 1 26  ? -10.074 10.074  3.897   1.00 0.00 ? 26  GLU A H    4  
ATOM 6246  H HA   . GLU A 1 26  ? -8.858  8.374   1.922   1.00 0.00 ? 26  GLU A HA   4  
ATOM 6247  H HB2  . GLU A 1 26  ? -10.470 7.341   4.267   1.00 0.00 ? 26  GLU A HB2  4  
ATOM 6248  H HB3  . GLU A 1 26  ? -10.524 6.493   2.735   1.00 0.00 ? 26  GLU A HB3  4  
ATOM 6249  H HG2  . GLU A 1 26  ? -8.619  5.437   3.387   1.00 0.00 ? 26  GLU A HG2  4  
ATOM 6250  H HG3  . GLU A 1 26  ? -7.786  6.949   3.085   1.00 0.00 ? 26  GLU A HG3  4  
ATOM 6251  N N    . LYS A 1 27  ? -11.426 7.963   1.006   1.00 0.00 ? 27  LYS A N    4  
ATOM 6252  C CA   . LYS A 1 27  ? -12.611 8.209   0.204   1.00 0.00 ? 27  LYS A CA   4  
ATOM 6253  C C    . LYS A 1 27  ? -13.341 6.887   -0.041  1.00 0.00 ? 27  LYS A C    4  
ATOM 6254  O O    . LYS A 1 27  ? -12.820 6.002   -0.717  1.00 0.00 ? 27  LYS A O    4  
ATOM 6255  C CB   . LYS A 1 27  ? -12.244 8.955   -1.080  1.00 0.00 ? 27  LYS A CB   4  
ATOM 6256  C CG   . LYS A 1 27  ? -13.493 9.281   -1.902  1.00 0.00 ? 27  LYS A CG   4  
ATOM 6257  C CD   . LYS A 1 27  ? -13.297 10.563  -2.714  1.00 0.00 ? 27  LYS A CD   4  
ATOM 6258  C CE   . LYS A 1 27  ? -11.893 10.620  -3.318  1.00 0.00 ? 27  LYS A CE   4  
ATOM 6259  N NZ   . LYS A 1 27  ? -11.785 11.744  -4.274  1.00 0.00 ? 27  LYS A NZ   4  
ATOM 6260  H H    . LYS A 1 27  ? -11.013 7.060   0.884   1.00 0.00 ? 27  LYS A H    4  
ATOM 6261  H HA   . LYS A 1 27  ? -13.265 8.864   0.781   1.00 0.00 ? 27  LYS A HA   4  
ATOM 6262  H HB2  . LYS A 1 27  ? -11.717 9.877   -0.832  1.00 0.00 ? 27  LYS A HB2  4  
ATOM 6263  H HB3  . LYS A 1 27  ? -11.560 8.349   -1.674  1.00 0.00 ? 27  LYS A HB3  4  
ATOM 6264  H HG2  . LYS A 1 27  ? -13.716 8.452   -2.573  1.00 0.00 ? 27  LYS A HG2  4  
ATOM 6265  H HG3  . LYS A 1 27  ? -14.350 9.394   -1.238  1.00 0.00 ? 27  LYS A HG3  4  
ATOM 6266  H HD2  . LYS A 1 27  ? -14.040 10.612  -3.508  1.00 0.00 ? 27  LYS A HD2  4  
ATOM 6267  H HD3  . LYS A 1 27  ? -13.456 11.430  -2.074  1.00 0.00 ? 27  LYS A HD3  4  
ATOM 6268  H HE2  . LYS A 1 27  ? -11.153 10.737  -2.525  1.00 0.00 ? 27  LYS A HE2  4  
ATOM 6269  H HE3  . LYS A 1 27  ? -11.670 9.681   -3.825  1.00 0.00 ? 27  LYS A HE3  4  
ATOM 6270  H HZ1  . LYS A 1 27  ? -12.694 11.975  -4.621  1.00 0.00 ? 27  LYS A HZ1  4  
ATOM 6271  H HZ2  . LYS A 1 27  ? -11.393 12.538  -3.812  1.00 0.00 ? 27  LYS A HZ2  4  
ATOM 6272  H HZ3  . LYS A 1 27  ? -11.195 11.477  -5.037  1.00 0.00 ? 27  LYS A HZ3  4  
ATOM 6273  N N    . GLU A 1 28  ? -14.536 6.794   0.524   1.00 0.00 ? 28  GLU A N    4  
ATOM 6274  C CA   . GLU A 1 28  ? -15.343 5.595   0.376   1.00 0.00 ? 28  GLU A CA   4  
ATOM 6275  C C    . GLU A 1 28  ? -15.963 5.542   -1.022  1.00 0.00 ? 28  GLU A C    4  
ATOM 6276  O O    . GLU A 1 28  ? -17.037 6.098   -1.249  1.00 0.00 ? 28  GLU A O    4  
ATOM 6277  C CB   . GLU A 1 28  ? -16.422 5.523   1.458   1.00 0.00 ? 28  GLU A CB   4  
ATOM 6278  C CG   . GLU A 1 28  ? -17.416 4.396   1.168   1.00 0.00 ? 28  GLU A CG   4  
ATOM 6279  C CD   . GLU A 1 28  ? -18.796 4.720   1.742   1.00 0.00 ? 28  GLU A CD   4  
ATOM 6280  O OE1  . GLU A 1 28  ? -19.493 5.545   1.113   1.00 0.00 ? 28  GLU A OE1  4  
ATOM 6281  O OE2  . GLU A 1 28  ? -19.123 4.136   2.798   1.00 0.00 ? 28  GLU A OE2  4  
ATOM 6282  H H    . GLU A 1 28  ? -14.953 7.519   1.073   1.00 0.00 ? 28  GLU A H    4  
ATOM 6283  H HA   . GLU A 1 28  ? -14.651 4.763   0.505   1.00 0.00 ? 28  GLU A HA   4  
ATOM 6284  H HB2  . GLU A 1 28  ? -15.956 5.361   2.430   1.00 0.00 ? 28  GLU A HB2  4  
ATOM 6285  H HB3  . GLU A 1 28  ? -16.952 6.474   1.513   1.00 0.00 ? 28  GLU A HB3  4  
ATOM 6286  H HG2  . GLU A 1 28  ? -17.492 4.242   0.091   1.00 0.00 ? 28  GLU A HG2  4  
ATOM 6287  H HG3  . GLU A 1 28  ? -17.049 3.464   1.598   1.00 0.00 ? 28  GLU A HG3  4  
ATOM 6288  N N    . VAL A 1 29  ? -15.261 4.869   -1.921  1.00 0.00 ? 29  VAL A N    4  
ATOM 6289  C CA   . VAL A 1 29  ? -15.729 4.736   -3.290  1.00 0.00 ? 29  VAL A CA   4  
ATOM 6290  C C    . VAL A 1 29  ? -16.297 3.330   -3.496  1.00 0.00 ? 29  VAL A C    4  
ATOM 6291  O O    . VAL A 1 29  ? -15.613 2.339   -3.247  1.00 0.00 ? 29  VAL A O    4  
ATOM 6292  C CB   . VAL A 1 29  ? -14.600 5.075   -4.265  1.00 0.00 ? 29  VAL A CB   4  
ATOM 6293  C CG1  . VAL A 1 29  ? -14.229 6.556   -4.181  1.00 0.00 ? 29  VAL A CG1  4  
ATOM 6294  C CG2  . VAL A 1 29  ? -13.378 4.189   -4.017  1.00 0.00 ? 29  VAL A CG2  4  
ATOM 6295  H H    . VAL A 1 29  ? -14.389 4.420   -1.728  1.00 0.00 ? 29  VAL A H    4  
ATOM 6296  H HA   . VAL A 1 29  ? -16.530 5.462   -3.436  1.00 0.00 ? 29  VAL A HA   4  
ATOM 6297  H HB   . VAL A 1 29  ? -14.959 4.876   -5.275  1.00 0.00 ? 29  VAL A HB   4  
ATOM 6298  H HG11 . VAL A 1 29  ? -14.945 7.075   -3.543  1.00 0.00 ? 29  VAL A HG11 4  
ATOM 6299  H HG12 . VAL A 1 29  ? -13.228 6.658   -3.762  1.00 0.00 ? 29  VAL A HG12 4  
ATOM 6300  H HG13 . VAL A 1 29  ? -14.251 6.993   -5.179  1.00 0.00 ? 29  VAL A HG13 4  
ATOM 6301  H HG21 . VAL A 1 29  ? -13.653 3.367   -3.355  1.00 0.00 ? 29  VAL A HG21 4  
ATOM 6302  H HG22 . VAL A 1 29  ? -13.021 3.788   -4.965  1.00 0.00 ? 29  VAL A HG22 4  
ATOM 6303  H HG23 . VAL A 1 29  ? -12.589 4.780   -3.552  1.00 0.00 ? 29  VAL A HG23 4  
ATOM 6304  N N    . ASP A 1 30  ? -17.541 3.289   -3.949  1.00 0.00 ? 30  ASP A N    4  
ATOM 6305  C CA   . ASP A 1 30  ? -18.207 2.021   -4.192  1.00 0.00 ? 30  ASP A CA   4  
ATOM 6306  C C    . ASP A 1 30  ? -17.524 1.306   -5.359  1.00 0.00 ? 30  ASP A C    4  
ATOM 6307  O O    . ASP A 1 30  ? -16.851 1.938   -6.171  1.00 0.00 ? 30  ASP A O    4  
ATOM 6308  C CB   . ASP A 1 30  ? -19.676 2.233   -4.563  1.00 0.00 ? 30  ASP A CB   4  
ATOM 6309  C CG   . ASP A 1 30  ? -20.653 2.203   -3.386  1.00 0.00 ? 30  ASP A CG   4  
ATOM 6310  O OD1  . ASP A 1 30  ? -20.892 1.087   -2.875  1.00 0.00 ? 30  ASP A OD1  4  
ATOM 6311  O OD2  . ASP A 1 30  ? -21.138 3.296   -3.022  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 6312  H H    . ASP A 1 30  ? -18.091 4.101   -4.149  1.00 0.00 ? 30  ASP A H    4  
ATOM 6313  H HA   . ASP A 1 30  ? -18.122 1.469   -3.256  1.00 0.00 ? 30  ASP A HA   4  
ATOM 6314  H HB2  . ASP A 1 30  ? -19.772 3.193   -5.071  1.00 0.00 ? 30  ASP A HB2  4  
ATOM 6315  H HB3  . ASP A 1 30  ? -19.969 1.464   -5.278  1.00 0.00 ? 30  ASP A HB3  4  
ATOM 6316  N N    . SER A 1 31  ? -17.719 -0.004  -5.404  1.00 0.00 ? 31  SER A N    4  
ATOM 6317  C CA   . SER A 1 31  ? -17.129 -0.813  -6.457  1.00 0.00 ? 31  SER A CA   4  
ATOM 6318  C C    . SER A 1 31  ? -18.064 -1.970  -6.814  1.00 0.00 ? 31  SER A C    4  
ATOM 6319  O O    . SER A 1 31  ? -17.635 -2.961  -7.404  1.00 0.00 ? 31  SER A O    4  
ATOM 6320  C CB   . SER A 1 31  ? -15.758 -1.348  -6.038  1.00 0.00 ? 31  SER A CB   4  
ATOM 6321  O OG   . SER A 1 31  ? -15.391 -2.511  -6.775  1.00 0.00 ? 31  SER A OG   4  
ATOM 6322  H H    . SER A 1 31  ? -18.267 -0.511  -4.739  1.00 0.00 ? 31  SER A H    4  
ATOM 6323  H HA   . SER A 1 31  ? -17.011 -0.140  -7.306  1.00 0.00 ? 31  SER A HA   4  
ATOM 6324  H HB2  . SER A 1 31  ? -15.005 -0.573  -6.187  1.00 0.00 ? 31  SER A HB2  4  
ATOM 6325  H HB3  . SER A 1 31  ? -15.769 -1.581  -4.974  1.00 0.00 ? 31  SER A HB3  4  
ATOM 6326  H HG   . SER A 1 31  ? -15.708 -2.432  -7.720  1.00 0.00 ? 31  SER A HG   4  
ATOM 6327  N N    . GLY A 1 32  ? -19.325 -1.806  -6.442  1.00 0.00 ? 32  GLY A N    4  
ATOM 6328  C CA   . GLY A 1 32  ? -20.323 -2.825  -6.716  1.00 0.00 ? 32  GLY A CA   4  
ATOM 6329  C C    . GLY A 1 32  ? -20.171 -4.013  -5.764  1.00 0.00 ? 32  GLY A C    4  
ATOM 6330  O O    . GLY A 1 32  ? -19.273 -4.029  -4.925  1.00 0.00 ? 32  GLY A O    4  
ATOM 6331  H H    . GLY A 1 32  ? -19.665 -0.998  -5.963  1.00 0.00 ? 32  GLY A H    4  
ATOM 6332  H HA2  . GLY A 1 32  ? -21.321 -2.398  -6.613  1.00 0.00 ? 32  GLY A HA2  4  
ATOM 6333  H HA3  . GLY A 1 32  ? -20.228 -3.166  -7.746  1.00 0.00 ? 32  GLY A HA3  4  
ATOM 6334  N N    . ASN A 1 33  ? -21.063 -4.980  -5.927  1.00 0.00 ? 33  ASN A N    4  
ATOM 6335  C CA   . ASN A 1 33  ? -21.039 -6.169  -5.092  1.00 0.00 ? 33  ASN A CA   4  
ATOM 6336  C C    . ASN A 1 33  ? -20.039 -7.172  -5.671  1.00 0.00 ? 33  ASN A C    4  
ATOM 6337  O O    . ASN A 1 33  ? -19.647 -7.064  -6.832  1.00 0.00 ? 33  ASN A O    4  
ATOM 6338  C CB   . ASN A 1 33  ? -22.413 -6.840  -5.050  1.00 0.00 ? 33  ASN A CB   4  
ATOM 6339  C CG   . ASN A 1 33  ? -23.533 -5.800  -5.089  1.00 0.00 ? 33  ASN A CG   4  
ATOM 6340  O OD1  . ASN A 1 33  ? -23.587 -4.876  -4.293  1.00 0.00 ? 33  ASN A OD1  4  
ATOM 6341  N ND2  . ASN A 1 33  ? -24.423 -5.998  -6.058  1.00 0.00 ? 33  ASN A ND2  4  
ATOM 6342  H H    . ASN A 1 33  ? -21.791 -4.959  -6.612  1.00 0.00 ? 33  ASN A H    4  
ATOM 6343  H HA   . ASN A 1 33  ? -20.751 -5.817  -4.102  1.00 0.00 ? 33  ASN A HA   4  
ATOM 6344  H HB2  . ASN A 1 33  ? -22.515 -7.521  -5.894  1.00 0.00 ? 33  ASN A HB2  4  
ATOM 6345  H HB3  . ASN A 1 33  ? -22.501 -7.440  -4.144  1.00 0.00 ? 33  ASN A HB3  4  
ATOM 6346  H HD21 . ASN A 1 33  ? -24.321 -6.776  -6.677  1.00 0.00 ? 33  ASN A HD21 4  
ATOM 6347  H HD22 . ASN A 1 33  ? -25.194 -5.371  -6.166  1.00 0.00 ? 33  ASN A HD22 4  
ATOM 6348  N N    . ASP A 1 34  ? -19.655 -8.126  -4.835  1.00 0.00 ? 34  ASP A N    4  
ATOM 6349  C CA   . ASP A 1 34  ? -18.709 -9.147  -5.249  1.00 0.00 ? 34  ASP A CA   4  
ATOM 6350  C C    . ASP A 1 34  ? -19.475 -10.375 -5.744  1.00 0.00 ? 34  ASP A C    4  
ATOM 6351  O O    . ASP A 1 34  ? -20.660 -10.285 -6.062  1.00 0.00 ? 34  ASP A O    4  
ATOM 6352  C CB   . ASP A 1 34  ? -17.822 -9.583  -4.081  1.00 0.00 ? 34  ASP A CB   4  
ATOM 6353  C CG   . ASP A 1 34  ? -16.415 -10.040 -4.472  1.00 0.00 ? 34  ASP A CG   4  
ATOM 6354  O OD1  . ASP A 1 34  ? -15.845 -9.404  -5.385  1.00 0.00 ? 34  ASP A OD1  4  
ATOM 6355  O OD2  . ASP A 1 34  ? -15.942 -11.014 -3.849  1.00 0.00 ? 34  ASP A OD2  4  
ATOM 6356  H H    . ASP A 1 34  ? -19.978 -8.206  -3.892  1.00 0.00 ? 34  ASP A H    4  
ATOM 6357  H HA   . ASP A 1 34  ? -18.112 -8.683  -6.034  1.00 0.00 ? 34  ASP A HA   4  
ATOM 6358  H HB2  . ASP A 1 34  ? -17.736 -8.752  -3.380  1.00 0.00 ? 34  ASP A HB2  4  
ATOM 6359  H HB3  . ASP A 1 34  ? -18.318 -10.396 -3.551  1.00 0.00 ? 34  ASP A HB3  4  
ATOM 6360  N N    . ILE A 1 35  ? -18.768 -11.494 -5.793  1.00 0.00 ? 35  ILE A N    4  
ATOM 6361  C CA   . ILE A 1 35  ? -19.367 -12.739 -6.244  1.00 0.00 ? 35  ILE A CA   4  
ATOM 6362  C C    . ILE A 1 35  ? -20.164 -13.362 -5.096  1.00 0.00 ? 35  ILE A C    4  
ATOM 6363  O O    . ILE A 1 35  ? -20.747 -14.433 -5.251  1.00 0.00 ? 35  ILE A O    4  
ATOM 6364  C CB   . ILE A 1 35  ? -18.300 -13.668 -6.827  1.00 0.00 ? 35  ILE A CB   4  
ATOM 6365  C CG1  . ILE A 1 35  ? -17.527 -12.977 -7.952  1.00 0.00 ? 35  ILE A CG1  4  
ATOM 6366  C CG2  . ILE A 1 35  ? -18.914 -14.992 -7.283  1.00 0.00 ? 35  ILE A CG2  4  
ATOM 6367  C CD1  . ILE A 1 35  ? -16.623 -11.873 -7.399  1.00 0.00 ? 35  ILE A CD1  4  
ATOM 6368  H H    . ILE A 1 35  ? -17.805 -11.559 -5.532  1.00 0.00 ? 35  ILE A H    4  
ATOM 6369  H HA   . ILE A 1 35  ? -20.058 -12.496 -7.052  1.00 0.00 ? 35  ILE A HA   4  
ATOM 6370  H HB   . ILE A 1 35  ? -17.582 -13.900 -6.039  1.00 0.00 ? 35  ILE A HB   4  
ATOM 6371  H HG12 . ILE A 1 35  ? -16.924 -13.710 -8.488  1.00 0.00 ? 35  ILE A HG12 4  
ATOM 6372  H HG13 . ILE A 1 35  ? -18.226 -12.552 -8.671  1.00 0.00 ? 35  ILE A HG13 4  
ATOM 6373  H HG21 . ILE A 1 35  ? -19.872 -14.800 -7.768  1.00 0.00 ? 35  ILE A HG21 4  
ATOM 6374  H HG22 . ILE A 1 35  ? -18.241 -15.481 -7.987  1.00 0.00 ? 35  ILE A HG22 4  
ATOM 6375  H HG23 . ILE A 1 35  ? -19.069 -15.638 -6.418  1.00 0.00 ? 35  ILE A HG23 4  
ATOM 6376  H HD11 . ILE A 1 35  ? -16.243 -12.170 -6.422  1.00 0.00 ? 35  ILE A HD11 4  
ATOM 6377  H HD12 . ILE A 1 35  ? -15.787 -11.713 -8.080  1.00 0.00 ? 35  ILE A HD12 4  
ATOM 6378  H HD13 . ILE A 1 35  ? -17.194 -10.950 -7.302  1.00 0.00 ? 35  ILE A HD13 4  
ATOM 6379  N N    . TYR A 1 36  ? -20.162 -12.663 -3.970  1.00 0.00 ? 36  TYR A N    4  
ATOM 6380  C CA   . TYR A 1 36  ? -20.877 -13.135 -2.797  1.00 0.00 ? 36  TYR A CA   4  
ATOM 6381  C C    . TYR A 1 36  ? -22.117 -12.280 -2.531  1.00 0.00 ? 36  TYR A C    4  
ATOM 6382  O O    . TYR A 1 36  ? -22.850 -12.523 -1.572  1.00 0.00 ? 36  TYR A O    4  
ATOM 6383  C CB   . TYR A 1 36  ? -19.907 -12.985 -1.622  1.00 0.00 ? 36  TYR A CB   4  
ATOM 6384  C CG   . TYR A 1 36  ? -20.091 -14.033 -0.524  1.00 0.00 ? 36  TYR A CG   4  
ATOM 6385  C CD1  . TYR A 1 36  ? -19.546 -15.292 -0.675  1.00 0.00 ? 36  TYR A CD1  4  
ATOM 6386  C CD2  . TYR A 1 36  ? -20.802 -13.721 0.616   1.00 0.00 ? 36  TYR A CD2  4  
ATOM 6387  C CE1  . TYR A 1 36  ? -19.719 -16.280 0.358   1.00 0.00 ? 36  TYR A CE1  4  
ATOM 6388  C CE2  . TYR A 1 36  ? -20.975 -14.709 1.650   1.00 0.00 ? 36  TYR A CE2  4  
ATOM 6389  C CZ   . TYR A 1 36  ? -20.425 -15.940 1.470   1.00 0.00 ? 36  TYR A CZ   4  
ATOM 6390  O OH   . TYR A 1 36  ? -20.589 -16.873 2.446   1.00 0.00 ? 36  TYR A OH   4  
ATOM 6391  H H    . TYR A 1 36  ? -19.684 -11.794 -3.852  1.00 0.00 ? 36  TYR A H    4  
ATOM 6392  H HA   . TYR A 1 36  ? -21.187 -14.164 -2.981  1.00 0.00 ? 36  TYR A HA   4  
ATOM 6393  H HB2  . TYR A 1 36  ? -18.886 -13.043 -1.999  1.00 0.00 ? 36  TYR A HB2  4  
ATOM 6394  H HB3  . TYR A 1 36  ? -20.031 -11.992 -1.188  1.00 0.00 ? 36  TYR A HB3  4  
ATOM 6395  H HD1  . TYR A 1 36  ? -18.984 -15.539 -1.576  1.00 0.00 ? 36  TYR A HD1  4  
ATOM 6396  H HD2  . TYR A 1 36  ? -21.233 -12.727 0.735   1.00 0.00 ? 36  TYR A HD2  4  
ATOM 6397  H HE1  . TYR A 1 36  ? -19.294 -17.278 0.253   1.00 0.00 ? 36  TYR A HE1  4  
ATOM 6398  H HE2  . TYR A 1 36  ? -21.534 -14.475 2.556   1.00 0.00 ? 36  TYR A HE2  4  
ATOM 6399  H HH   . TYR A 1 36  ? -19.697 -17.185 2.773   1.00 0.00 ? 36  TYR A HH   4  
ATOM 6400  N N    . GLY A 1 37  ? -22.315 -11.296 -3.395  1.00 0.00 ? 37  GLY A N    4  
ATOM 6401  C CA   . GLY A 1 37  ? -23.455 -10.404 -3.266  1.00 0.00 ? 37  GLY A CA   4  
ATOM 6402  C C    . GLY A 1 37  ? -23.136 -9.240  -2.325  1.00 0.00 ? 37  GLY A C    4  
ATOM 6403  O O    . GLY A 1 37  ? -23.922 -8.301  -2.205  1.00 0.00 ? 37  GLY A O    4  
ATOM 6404  H H    . GLY A 1 37  ? -21.715 -11.105 -4.172  1.00 0.00 ? 37  GLY A H    4  
ATOM 6405  H HA2  . GLY A 1 37  ? -23.732 -10.017 -4.247  1.00 0.00 ? 37  GLY A HA2  4  
ATOM 6406  H HA3  . GLY A 1 37  ? -24.314 -10.958 -2.887  1.00 0.00 ? 37  GLY A HA3  4  
ATOM 6407  N N    . ASN A 1 38  ? -21.982 -9.341  -1.681  1.00 0.00 ? 38  ASN A N    4  
ATOM 6408  C CA   . ASN A 1 38  ? -21.550 -8.309  -0.755  1.00 0.00 ? 38  ASN A CA   4  
ATOM 6409  C C    . ASN A 1 38  ? -20.971 -7.132  -1.543  1.00 0.00 ? 38  ASN A C    4  
ATOM 6410  O O    . ASN A 1 38  ? -20.507 -7.303  -2.669  1.00 0.00 ? 38  ASN A O    4  
ATOM 6411  C CB   . ASN A 1 38  ? -20.459 -8.831  0.183   1.00 0.00 ? 38  ASN A CB   4  
ATOM 6412  C CG   . ASN A 1 38  ? -19.358 -9.548  -0.603  1.00 0.00 ? 38  ASN A CG   4  
ATOM 6413  O OD1  . ASN A 1 38  ? -19.526 -9.930  -1.749  1.00 0.00 ? 38  ASN A OD1  4  
ATOM 6414  N ND2  . ASN A 1 38  ? -18.226 -9.707  0.076   1.00 0.00 ? 38  ASN A ND2  4  
ATOM 6415  H H    . ASN A 1 38  ? -21.349 -10.108 -1.784  1.00 0.00 ? 38  ASN A H    4  
ATOM 6416  H HA   . ASN A 1 38  ? -22.442 -8.035  -0.194  1.00 0.00 ? 38  ASN A HA   4  
ATOM 6417  H HB2  . ASN A 1 38  ? -20.029 -8.002  0.744   1.00 0.00 ? 38  ASN A HB2  4  
ATOM 6418  H HB3  . ASN A 1 38  ? -20.897 -9.516  0.909   1.00 0.00 ? 38  ASN A HB3  4  
ATOM 6419  H HD21 . ASN A 1 38  ? -18.153 -9.369  1.015   1.00 0.00 ? 38  ASN A HD21 4  
ATOM 6420  H HD22 . ASN A 1 38  ? -17.447 -10.164 -0.352  1.00 0.00 ? 38  ASN A HD22 4  
ATOM 6421  N N    . PRO A 1 39  ? -21.020 -5.933  -0.904  1.00 0.00 ? 39  PRO A N    4  
ATOM 6422  C CA   . PRO A 1 39  ? -20.507 -4.727  -1.533  1.00 0.00 ? 39  PRO A CA   4  
ATOM 6423  C C    . PRO A 1 39  ? -18.977 -4.712  -1.520  1.00 0.00 ? 39  PRO A C    4  
ATOM 6424  O O    . PRO A 1 39  ? -18.359 -4.922  -0.478  1.00 0.00 ? 39  PRO A O    4  
ATOM 6425  C CB   . PRO A 1 39  ? -21.119 -3.580  -0.746  1.00 0.00 ? 39  PRO A CB   4  
ATOM 6426  C CG   . PRO A 1 39  ? -21.577 -4.179  0.574   1.00 0.00 ? 39  PRO A CG   4  
ATOM 6427  C CD   . PRO A 1 39  ? -21.563 -5.692  0.430   1.00 0.00 ? 39  PRO A CD   4  
ATOM 6428  H HA   . PRO A 1 39  ? -20.772 -4.700  -2.497  1.00 0.00 ? 39  PRO A HA   4  
ATOM 6429  H HB2  . PRO A 1 39  ? -20.391 -2.786  -0.583  1.00 0.00 ? 39  PRO A HB2  4  
ATOM 6430  H HB3  . PRO A 1 39  ? -21.957 -3.140  -1.286  1.00 0.00 ? 39  PRO A HB3  4  
ATOM 6431  H HG2  . PRO A 1 39  ? -20.918 -3.867  1.385   1.00 0.00 ? 39  PRO A HG2  4  
ATOM 6432  H HG3  . PRO A 1 39  ? -22.578 -3.829  0.825   1.00 0.00 ? 39  PRO A HG3  4  
ATOM 6433  H HD2  . PRO A 1 39  ? -20.946 -6.158  1.198   1.00 0.00 ? 39  PRO A HD2  4  
ATOM 6434  H HD3  . PRO A 1 39  ? -22.566 -6.109  0.530   1.00 0.00 ? 39  PRO A HD3  4  
ATOM 6435  N N    . ILE A 1 40  ? -18.410 -4.459  -2.691  1.00 0.00 ? 40  ILE A N    4  
ATOM 6436  C CA   . ILE A 1 40  ? -16.964 -4.412  -2.827  1.00 0.00 ? 40  ILE A CA   4  
ATOM 6437  C C    . ILE A 1 40  ? -16.415 -3.251  -1.996  1.00 0.00 ? 40  ILE A C    4  
ATOM 6438  O O    . ILE A 1 40  ? -15.917 -3.454  -0.890  1.00 0.00 ? 40  ILE A O    4  
ATOM 6439  C CB   . ILE A 1 40  ? -16.566 -4.354  -4.303  1.00 0.00 ? 40  ILE A CB   4  
ATOM 6440  C CG1  . ILE A 1 40  ? -16.961 -5.643  -5.028  1.00 0.00 ? 40  ILE A CG1  4  
ATOM 6441  C CG2  . ILE A 1 40  ? -15.076 -4.043  -4.459  1.00 0.00 ? 40  ILE A CG2  4  
ATOM 6442  C CD1  . ILE A 1 40  ? -16.521 -5.604  -6.493  1.00 0.00 ? 40  ILE A CD1  4  
ATOM 6443  H H    . ILE A 1 40  ? -18.920 -4.288  -3.534  1.00 0.00 ? 40  ILE A H    4  
ATOM 6444  H HA   . ILE A 1 40  ? -16.567 -5.344  -2.422  1.00 0.00 ? 40  ILE A HA   4  
ATOM 6445  H HB   . ILE A 1 40  ? -17.116 -3.540  -4.773  1.00 0.00 ? 40  ILE A HB   4  
ATOM 6446  H HG12 . ILE A 1 40  ? -16.504 -6.498  -4.530  1.00 0.00 ? 40  ILE A HG12 4  
ATOM 6447  H HG13 . ILE A 1 40  ? -18.040 -5.780  -4.972  1.00 0.00 ? 40  ILE A HG13 4  
ATOM 6448  H HG21 . ILE A 1 40  ? -14.494 -4.746  -3.863  1.00 0.00 ? 40  ILE A HG21 4  
ATOM 6449  H HG22 . ILE A 1 40  ? -14.794 -4.134  -5.507  1.00 0.00 ? 40  ILE A HG22 4  
ATOM 6450  H HG23 . ILE A 1 40  ? -14.880 -3.027  -4.115  1.00 0.00 ? 40  ILE A HG23 4  
ATOM 6451  H HD11 . ILE A 1 40  ? -16.281 -4.579  -6.773  1.00 0.00 ? 40  ILE A HD11 4  
ATOM 6452  H HD12 . ILE A 1 40  ? -15.641 -6.233  -6.625  1.00 0.00 ? 40  ILE A HD12 4  
ATOM 6453  H HD13 . ILE A 1 40  ? -17.329 -5.974  -7.125  1.00 0.00 ? 40  ILE A HD13 4  
ATOM 6454  N N    . LYS A 1 41  ? -16.522 -2.057  -2.562  1.00 0.00 ? 41  LYS A N    4  
ATOM 6455  C CA   . LYS A 1 41  ? -16.043 -0.863  -1.888  1.00 0.00 ? 41  LYS A CA   4  
ATOM 6456  C C    . LYS A 1 41  ? -14.513 -0.877  -1.863  1.00 0.00 ? 41  LYS A C    4  
ATOM 6457  O O    . LYS A 1 41  ? -13.905 -1.826  -1.370  1.00 0.00 ? 41  LYS A O    4  
ATOM 6458  C CB   . LYS A 1 41  ? -16.680 -0.737  -0.503  1.00 0.00 ? 41  LYS A CB   4  
ATOM 6459  C CG   . LYS A 1 41  ? -16.211 0.536   0.203   1.00 0.00 ? 41  LYS A CG   4  
ATOM 6460  C CD   . LYS A 1 41  ? -16.861 1.776   -0.415  1.00 0.00 ? 41  LYS A CD   4  
ATOM 6461  C CE   . LYS A 1 41  ? -18.337 1.874   -0.023  1.00 0.00 ? 41  LYS A CE   4  
ATOM 6462  N NZ   . LYS A 1 41  ? -19.031 2.875   -0.863  1.00 0.00 ? 41  LYS A NZ   4  
ATOM 6463  H H    . LYS A 1 41  ? -16.927 -1.900  -3.463  1.00 0.00 ? 41  LYS A H    4  
ATOM 6464  H HA   . LYS A 1 41  ? -16.371 -0.004  -2.472  1.00 0.00 ? 41  LYS A HA   4  
ATOM 6465  H HB2  . LYS A 1 41  ? -17.766 -0.727  -0.597  1.00 0.00 ? 41  LYS A HB2  4  
ATOM 6466  H HB3  . LYS A 1 41  ? -16.421 -1.608  0.100   1.00 0.00 ? 41  LYS A HB3  4  
ATOM 6467  H HG2  . LYS A 1 41  ? -16.458 0.481   1.263   1.00 0.00 ? 41  LYS A HG2  4  
ATOM 6468  H HG3  . LYS A 1 41  ? -15.126 0.616   0.133   1.00 0.00 ? 41  LYS A HG3  4  
ATOM 6469  H HD2  . LYS A 1 41  ? -16.333 2.671   -0.084  1.00 0.00 ? 41  LYS A HD2  4  
ATOM 6470  H HD3  . LYS A 1 41  ? -16.771 1.736   -1.500  1.00 0.00 ? 41  LYS A HD3  4  
ATOM 6471  H HE2  . LYS A 1 41  ? -18.815 0.901   -0.137  1.00 0.00 ? 41  LYS A HE2  4  
ATOM 6472  H HE3  . LYS A 1 41  ? -18.423 2.150   1.028   1.00 0.00 ? 41  LYS A HE3  4  
ATOM 6473  H HZ1  . LYS A 1 41  ? -18.419 3.179   -1.593  1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 6474  H HZ2  . LYS A 1 41  ? -19.849 2.464   -1.264  1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 6475  H HZ3  . LYS A 1 41  ? -19.294 3.658   -0.299  1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 6476  N N    . ARG A 1 42  ? -13.935 0.187   -2.400  1.00 0.00 ? 42  ARG A N    4  
ATOM 6477  C CA   . ARG A 1 42  ? -12.487 0.310   -2.445  1.00 0.00 ? 42  ARG A CA   4  
ATOM 6478  C C    . ARG A 1 42  ? -12.051 1.661   -1.876  1.00 0.00 ? 42  ARG A C    4  
ATOM 6479  O O    . ARG A 1 42  ? -11.499 2.492   -2.595  1.00 0.00 ? 42  ARG A O    4  
ATOM 6480  C CB   . ARG A 1 42  ? -11.968 0.176   -3.878  1.00 0.00 ? 42  ARG A CB   4  
ATOM 6481  C CG   . ARG A 1 42  ? -13.089 0.411   -4.892  1.00 0.00 ? 42  ARG A CG   4  
ATOM 6482  C CD   . ARG A 1 42  ? -12.642 0.023   -6.304  1.00 0.00 ? 42  ARG A CD   4  
ATOM 6483  N NE   . ARG A 1 42  ? -13.489 0.705   -7.307  1.00 0.00 ? 42  ARG A NE   4  
ATOM 6484  C CZ   . ARG A 1 42  ? -13.284 0.642   -8.630  1.00 0.00 ? 42  ARG A CZ   4  
ATOM 6485  N NH1  . ARG A 1 42  ? -12.260 -0.071  -9.116  1.00 0.00 ? 42  ARG A NH1  4  
ATOM 6486  N NH2  . ARG A 1 42  ? -14.103 1.293   -9.467  1.00 0.00 ? 42  ARG A NH2  4  
ATOM 6487  H H    . ARG A 1 42  ? -14.437 0.955   -2.799  1.00 0.00 ? 42  ARG A H    4  
ATOM 6488  H HA   . ARG A 1 42  ? -12.119 -0.512  -1.832  1.00 0.00 ? 42  ARG A HA   4  
ATOM 6489  H HB2  . ARG A 1 42  ? -11.165 0.893   -4.046  1.00 0.00 ? 42  ARG A HB2  4  
ATOM 6490  H HB3  . ARG A 1 42  ? -11.543 -0.818  -4.023  1.00 0.00 ? 42  ARG A HB3  4  
ATOM 6491  H HG2  . ARG A 1 42  ? -13.966 -0.174  -4.612  1.00 0.00 ? 42  ARG A HG2  4  
ATOM 6492  H HG3  . ARG A 1 42  ? -13.386 1.459   -4.876  1.00 0.00 ? 42  ARG A HG3  4  
ATOM 6493  H HD2  . ARG A 1 42  ? -11.597 0.297   -6.451  1.00 0.00 ? 42  ARG A HD2  4  
ATOM 6494  H HD3  . ARG A 1 42  ? -12.709 -1.057  -6.432  1.00 0.00 ? 42  ARG A HD3  4  
ATOM 6495  H HE   . ARG A 1 42  ? -14.262 1.246   -6.978  1.00 0.00 ? 42  ARG A HE   4  
ATOM 6496  H HH11 . ARG A 1 42  ? -11.648 -0.558  -8.492  1.00 0.00 ? 42  ARG A HH11 4  
ATOM 6497  H HH12 . ARG A 1 42  ? -12.107 -0.119  -10.104 1.00 0.00 ? 42  ARG A HH12 4  
ATOM 6498  H HH21 . ARG A 1 42  ? -14.868 1.826   -9.105  1.00 0.00 ? 42  ARG A HH21 4  
ATOM 6499  H HH22 . ARG A 1 42  ? -13.950 1.246   -10.454 1.00 0.00 ? 42  ARG A HH22 4  
ATOM 6500  N N    . ILE A 1 43  ? -12.315 1.839   -0.590  1.00 0.00 ? 43  ILE A N    4  
ATOM 6501  C CA   . ILE A 1 43  ? -11.957 3.075   0.083   1.00 0.00 ? 43  ILE A CA   4  
ATOM 6502  C C    . ILE A 1 43  ? -10.648 3.609   -0.502  1.00 0.00 ? 43  ILE A C    4  
ATOM 6503  O O    . ILE A 1 43  ? -9.790  2.835   -0.922  1.00 0.00 ? 43  ILE A O    4  
ATOM 6504  C CB   . ILE A 1 43  ? -11.912 2.866   1.598   1.00 0.00 ? 43  ILE A CB   4  
ATOM 6505  C CG1  . ILE A 1 43  ? -13.143 3.476   2.272   1.00 0.00 ? 43  ILE A CG1  4  
ATOM 6506  C CG2  . ILE A 1 43  ? -10.609 3.407   2.188   1.00 0.00 ? 43  ILE A CG2  4  
ATOM 6507  C CD1  . ILE A 1 43  ? -14.383 2.611   2.035   1.00 0.00 ? 43  ILE A CD1  4  
ATOM 6508  H H    . ILE A 1 43  ? -12.765 1.157   -0.013  1.00 0.00 ? 43  ILE A H    4  
ATOM 6509  H HA   . ILE A 1 43  ? -12.747 3.798   -0.118  1.00 0.00 ? 43  ILE A HA   4  
ATOM 6510  H HB   . ILE A 1 43  ? -11.935 1.794   1.796   1.00 0.00 ? 43  ILE A HB   4  
ATOM 6511  H HG12 . ILE A 1 43  ? -12.965 3.575   3.344   1.00 0.00 ? 43  ILE A HG12 4  
ATOM 6512  H HG13 . ILE A 1 43  ? -13.315 4.479   1.885   1.00 0.00 ? 43  ILE A HG13 4  
ATOM 6513  H HG21 . ILE A 1 43  ? -10.530 4.474   1.979   1.00 0.00 ? 43  ILE A HG21 4  
ATOM 6514  H HG22 . ILE A 1 43  ? -10.604 3.248   3.267   1.00 0.00 ? 43  ILE A HG22 4  
ATOM 6515  H HG23 . ILE A 1 43  ? -9.763  2.885   1.741   1.00 0.00 ? 43  ILE A HG23 4  
ATOM 6516  H HD11 . ILE A 1 43  ? -14.097 1.702   1.507   1.00 0.00 ? 43  ILE A HD11 4  
ATOM 6517  H HD12 . ILE A 1 43  ? -14.832 2.350   2.994   1.00 0.00 ? 43  ILE A HD12 4  
ATOM 6518  H HD13 . ILE A 1 43  ? -15.104 3.168   1.436   1.00 0.00 ? 43  ILE A HD13 4  
ATOM 6519  N N    . GLN A 1 44  ? -10.536 4.929   -0.511  1.00 0.00 ? 44  GLN A N    4  
ATOM 6520  C CA   . GLN A 1 44  ? -9.347  5.576   -1.037  1.00 0.00 ? 44  GLN A CA   4  
ATOM 6521  C C    . GLN A 1 44  ? -8.333  5.816   0.083   1.00 0.00 ? 44  GLN A C    4  
ATOM 6522  O O    . GLN A 1 44  ? -8.575  5.454   1.232   1.00 0.00 ? 44  GLN A O    4  
ATOM 6523  C CB   . GLN A 1 44  ? -9.703  6.886   -1.744  1.00 0.00 ? 44  GLN A CB   4  
ATOM 6524  C CG   . GLN A 1 44  ? -10.472 6.618   -3.040  1.00 0.00 ? 44  GLN A CG   4  
ATOM 6525  C CD   . GLN A 1 44  ? -9.857  5.448   -3.811  1.00 0.00 ? 44  GLN A CD   4  
ATOM 6526  O OE1  . GLN A 1 44  ? -9.037  5.620   -4.699  1.00 0.00 ? 44  GLN A OE1  4  
ATOM 6527  N NE2  . GLN A 1 44  ? -10.297 4.254   -3.425  1.00 0.00 ? 44  GLN A NE2  4  
ATOM 6528  H H    . GLN A 1 44  ? -11.238 5.553   -0.166  1.00 0.00 ? 44  GLN A H    4  
ATOM 6529  H HA   . GLN A 1 44  ? -8.936  4.877   -1.766  1.00 0.00 ? 44  GLN A HA   4  
ATOM 6530  H HB2  . GLN A 1 44  ? -10.303 7.509   -1.083  1.00 0.00 ? 44  GLN A HB2  4  
ATOM 6531  H HB3  . GLN A 1 44  ? -8.791  7.442   -1.966  1.00 0.00 ? 44  GLN A HB3  4  
ATOM 6532  H HG2  . GLN A 1 44  ? -11.514 6.398   -2.809  1.00 0.00 ? 44  GLN A HG2  4  
ATOM 6533  H HG3  . GLN A 1 44  ? -10.466 7.513   -3.662  1.00 0.00 ? 44  GLN A HG3  4  
ATOM 6534  H HE21 . GLN A 1 44  ? -10.970 4.184   -2.689  1.00 0.00 ? 44  GLN A HE21 4  
ATOM 6535  H HE22 . GLN A 1 44  ? -9.953  3.428   -3.870  1.00 0.00 ? 44  GLN A HE22 4  
ATOM 6536  N N    . TYR A 1 45  ? -7.216  6.424   -0.293  1.00 0.00 ? 45  TYR A N    4  
ATOM 6537  C CA   . TYR A 1 45  ? -6.165  6.715   0.665   1.00 0.00 ? 45  TYR A CA   4  
ATOM 6538  C C    . TYR A 1 45  ? -5.605  8.124   0.454   1.00 0.00 ? 45  TYR A C    4  
ATOM 6539  O O    . TYR A 1 45  ? -4.464  8.285   0.026   1.00 0.00 ? 45  TYR A O    4  
ATOM 6540  C CB   . TYR A 1 45  ? -5.056  5.695   0.399   1.00 0.00 ? 45  TYR A CB   4  
ATOM 6541  C CG   . TYR A 1 45  ? -5.077  4.493   1.345   1.00 0.00 ? 45  TYR A CG   4  
ATOM 6542  C CD1  . TYR A 1 45  ? -5.449  4.658   2.664   1.00 0.00 ? 45  TYR A CD1  4  
ATOM 6543  C CD2  . TYR A 1 45  ? -4.724  3.242   0.880   1.00 0.00 ? 45  TYR A CD2  4  
ATOM 6544  C CE1  . TYR A 1 45  ? -5.468  3.528   3.554   1.00 0.00 ? 45  TYR A CE1  4  
ATOM 6545  C CE2  . TYR A 1 45  ? -4.743  2.110   1.770   1.00 0.00 ? 45  TYR A CE2  4  
ATOM 6546  C CZ   . TYR A 1 45  ? -5.114  2.309   3.064   1.00 0.00 ? 45  TYR A CZ   4  
ATOM 6547  O OH   . TYR A 1 45  ? -5.133  1.241   3.905   1.00 0.00 ? 45  TYR A OH   4  
ATOM 6548  H H    . TYR A 1 45  ? -7.027  6.715   -1.231  1.00 0.00 ? 45  TYR A H    4  
ATOM 6549  H HA   . TYR A 1 45  ? -6.593  6.649   1.665   1.00 0.00 ? 45  TYR A HA   4  
ATOM 6550  H HB2  . TYR A 1 45  ? -5.145  5.338   -0.627  1.00 0.00 ? 45  TYR A HB2  4  
ATOM 6551  H HB3  . TYR A 1 45  ? -4.090  6.192   0.481   1.00 0.00 ? 45  TYR A HB3  4  
ATOM 6552  H HD1  . TYR A 1 45  ? -5.727  5.646   3.031   1.00 0.00 ? 45  TYR A HD1  4  
ATOM 6553  H HD2  . TYR A 1 45  ? -4.430  3.111   -0.162  1.00 0.00 ? 45  TYR A HD2  4  
ATOM 6554  H HE1  . TYR A 1 45  ? -5.759  3.645   4.598   1.00 0.00 ? 45  TYR A HE1  4  
ATOM 6555  H HE2  . TYR A 1 45  ? -4.466  1.118   1.416   1.00 0.00 ? 45  TYR A HE2  4  
ATOM 6556  H HH   . TYR A 1 45  ? -5.064  1.551   4.852   1.00 0.00 ? 45  TYR A HH   4  
ATOM 6557  N N    . GLU A 1 46  ? -6.437  9.108   0.765   1.00 0.00 ? 46  GLU A N    4  
ATOM 6558  C CA   . GLU A 1 46  ? -6.039  10.498  0.614   1.00 0.00 ? 46  GLU A CA   4  
ATOM 6559  C C    . GLU A 1 46  ? -4.847  10.811  1.520   1.00 0.00 ? 46  GLU A C    4  
ATOM 6560  O O    . GLU A 1 46  ? -4.989  11.518  2.517   1.00 0.00 ? 46  GLU A O    4  
ATOM 6561  C CB   . GLU A 1 46  ? -7.211  11.438  0.906   1.00 0.00 ? 46  GLU A CB   4  
ATOM 6562  C CG   . GLU A 1 46  ? -7.125  12.703  0.051   1.00 0.00 ? 46  GLU A CG   4  
ATOM 6563  C CD   . GLU A 1 46  ? -8.429  13.501  0.121   1.00 0.00 ? 46  GLU A CD   4  
ATOM 6564  O OE1  . GLU A 1 46  ? -9.494  12.849  0.116   1.00 0.00 ? 46  GLU A OE1  4  
ATOM 6565  O OE2  . GLU A 1 46  ? -8.330  14.746  0.176   1.00 0.00 ? 46  GLU A OE2  4  
ATOM 6566  H H    . GLU A 1 46  ? -7.363  8.969   1.113   1.00 0.00 ? 46  GLU A H    4  
ATOM 6567  H HA   . GLU A 1 46  ? -5.748  10.605  -0.431  1.00 0.00 ? 46  GLU A HA   4  
ATOM 6568  H HB2  . GLU A 1 46  ? -8.152  10.924  0.708   1.00 0.00 ? 46  GLU A HB2  4  
ATOM 6569  H HB3  . GLU A 1 46  ? -7.211  11.707  1.962   1.00 0.00 ? 46  GLU A HB3  4  
ATOM 6570  H HG2  . GLU A 1 46  ? -6.296  13.323  0.394   1.00 0.00 ? 46  GLU A HG2  4  
ATOM 6571  H HG3  . GLU A 1 46  ? -6.914  12.434  -0.984  1.00 0.00 ? 46  GLU A HG3  4  
ATOM 6572  N N    . ILE A 1 47  ? -3.698  10.268  1.142   1.00 0.00 ? 47  ILE A N    4  
ATOM 6573  C CA   . ILE A 1 47  ? -2.482  10.481  1.908   1.00 0.00 ? 47  ILE A CA   4  
ATOM 6574  C C    . ILE A 1 47  ? -2.073  11.951  1.810   1.00 0.00 ? 47  ILE A C    4  
ATOM 6575  O O    . ILE A 1 47  ? -2.837  12.780  1.316   1.00 0.00 ? 47  ILE A O    4  
ATOM 6576  C CB   . ILE A 1 47  ? -1.390  9.508   1.459   1.00 0.00 ? 47  ILE A CB   4  
ATOM 6577  C CG1  . ILE A 1 47  ? -1.033  9.725   -0.013  1.00 0.00 ? 47  ILE A CG1  4  
ATOM 6578  C CG2  . ILE A 1 47  ? -1.796  8.059   1.743   1.00 0.00 ? 47  ILE A CG2  4  
ATOM 6579  C CD1  . ILE A 1 47  ? -0.402  8.468   -0.616  1.00 0.00 ? 47  ILE A CD1  4  
ATOM 6580  H H    . ILE A 1 47  ? -3.592  9.695   0.330   1.00 0.00 ? 47  ILE A H    4  
ATOM 6581  H HA   . ILE A 1 47  ? -2.708  10.254  2.949   1.00 0.00 ? 47  ILE A HA   4  
ATOM 6582  H HB   . ILE A 1 47  ? -0.492  9.710   2.043   1.00 0.00 ? 47  ILE A HB   4  
ATOM 6583  H HG12 . ILE A 1 47  ? -1.929  9.992   -0.572  1.00 0.00 ? 47  ILE A HG12 4  
ATOM 6584  H HG13 . ILE A 1 47  ? -0.340  10.562  -0.102  1.00 0.00 ? 47  ILE A HG13 4  
ATOM 6585  H HG21 . ILE A 1 47  ? -2.882  7.989   1.789   1.00 0.00 ? 47  ILE A HG21 4  
ATOM 6586  H HG22 . ILE A 1 47  ? -1.423  7.416   0.946   1.00 0.00 ? 47  ILE A HG22 4  
ATOM 6587  H HG23 . ILE A 1 47  ? -1.371  7.743   2.694   1.00 0.00 ? 47  ILE A HG23 4  
ATOM 6588  H HD11 . ILE A 1 47  ? 0.185   7.955   0.146   1.00 0.00 ? 47  ILE A HD11 4  
ATOM 6589  H HD12 . ILE A 1 47  ? -1.189  7.805   -0.975  1.00 0.00 ? 47  ILE A HD12 4  
ATOM 6590  H HD13 . ILE A 1 47  ? 0.245   8.748   -1.446  1.00 0.00 ? 47  ILE A HD13 4  
ATOM 6591  N N    . LYS A 1 48  ? -0.869  12.231  2.287   1.00 0.00 ? 48  LYS A N    4  
ATOM 6592  C CA   . LYS A 1 48  ? -0.349  13.588  2.260   1.00 0.00 ? 48  LYS A CA   4  
ATOM 6593  C C    . LYS A 1 48  ? 1.058   13.578  1.660   1.00 0.00 ? 48  LYS A C    4  
ATOM 6594  O O    . LYS A 1 48  ? 1.714   14.617  1.589   1.00 0.00 ? 48  LYS A O    4  
ATOM 6595  C CB   . LYS A 1 48  ? -0.420  14.217  3.652   1.00 0.00 ? 48  LYS A CB   4  
ATOM 6596  C CG   . LYS A 1 48  ? -0.637  15.728  3.561   1.00 0.00 ? 48  LYS A CG   4  
ATOM 6597  C CD   . LYS A 1 48  ? -1.120  16.296  4.898   1.00 0.00 ? 48  LYS A CD   4  
ATOM 6598  C CE   . LYS A 1 48  ? -0.487  15.547  6.072   1.00 0.00 ? 48  LYS A CE   4  
ATOM 6599  N NZ   . LYS A 1 48  ? -0.682  16.298  7.332   1.00 0.00 ? 48  LYS A NZ   4  
ATOM 6600  H H    . LYS A 1 48  ? -0.255  11.551  2.687   1.00 0.00 ? 48  LYS A H    4  
ATOM 6601  H HA   . LYS A 1 48  ? -0.999  14.173  1.609   1.00 0.00 ? 48  LYS A HA   4  
ATOM 6602  H HB2  . LYS A 1 48  ? -1.233  13.764  4.220   1.00 0.00 ? 48  LYS A HB2  4  
ATOM 6603  H HB3  . LYS A 1 48  ? 0.501   14.010  4.197   1.00 0.00 ? 48  LYS A HB3  4  
ATOM 6604  H HG2  . LYS A 1 48  ? 0.293   16.216  3.270   1.00 0.00 ? 48  LYS A HG2  4  
ATOM 6605  H HG3  . LYS A 1 48  ? -1.369  15.948  2.784   1.00 0.00 ? 48  LYS A HG3  4  
ATOM 6606  H HD2  . LYS A 1 48  ? -0.869  17.355  4.960   1.00 0.00 ? 48  LYS A HD2  4  
ATOM 6607  H HD3  . LYS A 1 48  ? -2.206  16.221  4.958   1.00 0.00 ? 48  LYS A HD3  4  
ATOM 6608  H HE2  . LYS A 1 48  ? -0.929  14.555  6.160   1.00 0.00 ? 48  LYS A HE2  4  
ATOM 6609  H HE3  . LYS A 1 48  ? 0.579   15.404  5.887   1.00 0.00 ? 48  LYS A HE3  4  
ATOM 6610  H HZ1  . LYS A 1 48  ? -1.302  17.065  7.170   1.00 0.00 ? 48  LYS A HZ1  4  
ATOM 6611  H HZ2  . LYS A 1 48  ? -1.074  15.692  8.024   1.00 0.00 ? 48  LYS A HZ2  4  
ATOM 6612  H HZ3  . LYS A 1 48  ? 0.199   16.645  7.653   1.00 0.00 ? 48  LYS A HZ3  4  
ATOM 6613  N N    . GLN A 1 49  ? 1.482   12.394  1.245   1.00 0.00 ? 49  GLN A N    4  
ATOM 6614  C CA   . GLN A 1 49  ? 2.799   12.235  0.655   1.00 0.00 ? 49  GLN A CA   4  
ATOM 6615  C C    . GLN A 1 49  ? 3.868   12.833  1.572   1.00 0.00 ? 49  GLN A C    4  
ATOM 6616  O O    . GLN A 1 49  ? 3.913   14.047  1.767   1.00 0.00 ? 49  GLN A O    4  
ATOM 6617  C CB   . GLN A 1 49  ? 2.856   12.867  -0.738  1.00 0.00 ? 49  GLN A CB   4  
ATOM 6618  C CG   . GLN A 1 49  ? 4.248   13.430  -1.028  1.00 0.00 ? 49  GLN A CG   4  
ATOM 6619  C CD   . GLN A 1 49  ? 4.624   13.233  -2.498  1.00 0.00 ? 49  GLN A CD   4  
ATOM 6620  O OE1  . GLN A 1 49  ? 4.733   14.173  -3.269  1.00 0.00 ? 49  GLN A OE1  4  
ATOM 6621  N NE2  . GLN A 1 49  ? 4.814   11.963  -2.842  1.00 0.00 ? 49  GLN A NE2  4  
ATOM 6622  H H    . GLN A 1 49  ? 0.942   11.553  1.307   1.00 0.00 ? 49  GLN A H    4  
ATOM 6623  H HA   . GLN A 1 49  ? 2.949   11.159  0.564   1.00 0.00 ? 49  GLN A HA   4  
ATOM 6624  H HB2  . GLN A 1 49  ? 2.597   12.120  -1.490  1.00 0.00 ? 49  GLN A HB2  4  
ATOM 6625  H HB3  . GLN A 1 49  ? 2.114   13.662  -0.811  1.00 0.00 ? 49  GLN A HB3  4  
ATOM 6626  H HG2  . GLN A 1 49  ? 4.273   14.492  -0.782  1.00 0.00 ? 49  GLN A HG2  4  
ATOM 6627  H HG3  . GLN A 1 49  ? 4.984   12.938  -0.392  1.00 0.00 ? 49  GLN A HG3  4  
ATOM 6628  H HE21 . GLN A 1 49  ? 4.708   11.239  -2.161  1.00 0.00 ? 49  GLN A HE21 4  
ATOM 6629  H HE22 . GLN A 1 49  ? 5.064   11.731  -3.783  1.00 0.00 ? 49  GLN A HE22 4  
ATOM 6630  N N    . ILE A 1 50  ? 4.701   11.954  2.109   1.00 0.00 ? 50  ILE A N    4  
ATOM 6631  C CA   . ILE A 1 50  ? 5.765   12.380  3.001   1.00 0.00 ? 50  ILE A CA   4  
ATOM 6632  C C    . ILE A 1 50  ? 7.112   11.925  2.434   1.00 0.00 ? 50  ILE A C    4  
ATOM 6633  O O    . ILE A 1 50  ? 8.139   12.554  2.685   1.00 0.00 ? 50  ILE A O    4  
ATOM 6634  C CB   . ILE A 1 50  ? 5.500   11.890  4.425   1.00 0.00 ? 50  ILE A CB   4  
ATOM 6635  C CG1  . ILE A 1 50  ? 6.585   10.909  4.878   1.00 0.00 ? 50  ILE A CG1  4  
ATOM 6636  C CG2  . ILE A 1 50  ? 4.098   11.288  4.546   1.00 0.00 ? 50  ILE A CG2  4  
ATOM 6637  C CD1  . ILE A 1 50  ? 6.104   10.068  6.063   1.00 0.00 ? 50  ILE A CD1  4  
ATOM 6638  H H    . ILE A 1 50  ? 4.656   10.969  1.945   1.00 0.00 ? 50  ILE A H    4  
ATOM 6639  H HA   . ILE A 1 50  ? 5.752   13.470  3.028   1.00 0.00 ? 50  ILE A HA   4  
ATOM 6640  H HB   . ILE A 1 50  ? 5.541   12.747  5.096   1.00 0.00 ? 50  ILE A HB   4  
ATOM 6641  H HG12 . ILE A 1 50  ? 6.858   10.256  4.051   1.00 0.00 ? 50  ILE A HG12 4  
ATOM 6642  H HG13 . ILE A 1 50  ? 7.482   11.460  5.160   1.00 0.00 ? 50  ILE A HG13 4  
ATOM 6643  H HG21 . ILE A 1 50  ? 3.398   11.879  3.957   1.00 0.00 ? 50  ILE A HG21 4  
ATOM 6644  H HG22 . ILE A 1 50  ? 4.109   10.263  4.176   1.00 0.00 ? 50  ILE A HG22 4  
ATOM 6645  H HG23 . ILE A 1 50  ? 3.790   11.294  5.591   1.00 0.00 ? 50  ILE A HG23 4  
ATOM 6646  H HD11 . ILE A 1 50  ? 5.836   10.725  6.890   1.00 0.00 ? 50  ILE A HD11 4  
ATOM 6647  H HD12 . ILE A 1 50  ? 5.232   9.485   5.764   1.00 0.00 ? 50  ILE A HD12 4  
ATOM 6648  H HD13 . ILE A 1 50  ? 6.901   9.394   6.377   1.00 0.00 ? 50  ILE A HD13 4  
ATOM 6649  N N    . LYS A 1 51  ? 7.064   10.836  1.682   1.00 0.00 ? 51  LYS A N    4  
ATOM 6650  C CA   . LYS A 1 51  ? 8.267   10.290  1.078   1.00 0.00 ? 51  LYS A CA   4  
ATOM 6651  C C    . LYS A 1 51  ? 7.886   9.471   -0.158  1.00 0.00 ? 51  LYS A C    4  
ATOM 6652  O O    . LYS A 1 51  ? 6.714   9.154   -0.359  1.00 0.00 ? 51  LYS A O    4  
ATOM 6653  C CB   . LYS A 1 51  ? 9.076   9.504   2.111   1.00 0.00 ? 51  LYS A CB   4  
ATOM 6654  C CG   . LYS A 1 51  ? 10.490  10.072  2.247   1.00 0.00 ? 51  LYS A CG   4  
ATOM 6655  C CD   . LYS A 1 51  ? 11.526  8.949   2.329   1.00 0.00 ? 51  LYS A CD   4  
ATOM 6656  C CE   . LYS A 1 51  ? 12.870  9.398   1.751   1.00 0.00 ? 51  LYS A CE   4  
ATOM 6657  N NZ   . LYS A 1 51  ? 13.942  8.454   2.137   1.00 0.00 ? 51  LYS A NZ   4  
ATOM 6658  H H    . LYS A 1 51  ? 6.224   10.331  1.483   1.00 0.00 ? 51  LYS A H    4  
ATOM 6659  H HA   . LYS A 1 51  ? 8.882   11.131  0.757   1.00 0.00 ? 51  LYS A HA   4  
ATOM 6660  H HB2  . LYS A 1 51  ? 8.572   9.540   3.077   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 6661  H HB3  . LYS A 1 51  ? 9.127   8.456   1.818   1.00 0.00 ? 51  LYS A HB3  4  
ATOM 6662  H HG2  . LYS A 1 51  ? 10.712  10.713  1.394   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 6663  H HG3  . LYS A 1 51  ? 10.553  10.695  3.139   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 6664  H HD2  . LYS A 1 51  ? 11.656  8.644   3.367   1.00 0.00 ? 51  LYS A HD2  4  
ATOM 6665  H HD3  . LYS A 1 51  ? 11.165  8.076   1.785   1.00 0.00 ? 51  LYS A HD3  4  
ATOM 6666  H HE2  . LYS A 1 51  ? 12.803  9.458   0.664   1.00 0.00 ? 51  LYS A HE2  4  
ATOM 6667  H HE3  . LYS A 1 51  ? 13.111  10.398  2.111   1.00 0.00 ? 51  LYS A HE3  4  
ATOM 6668  H HZ1  . LYS A 1 51  ? 13.534  7.613   2.492   1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 6669  H HZ2  . LYS A 1 51  ? 14.502  8.241   1.337   1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 6670  H HZ3  . LYS A 1 51  ? 14.514  8.871   2.844   1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 6671  N N    . MET A 1 52  ? 8.898   9.151   -0.950  1.00 0.00 ? 52  MET A N    4  
ATOM 6672  C CA   . MET A 1 52  ? 8.682   8.374   -2.160  1.00 0.00 ? 52  MET A CA   4  
ATOM 6673  C C    . MET A 1 52  ? 9.873   7.454   -2.439  1.00 0.00 ? 52  MET A C    4  
ATOM 6674  O O    . MET A 1 52  ? 10.642  7.693   -3.369  1.00 0.00 ? 52  MET A O    4  
ATOM 6675  C CB   . MET A 1 52  ? 8.480   9.321   -3.345  1.00 0.00 ? 52  MET A CB   4  
ATOM 6676  C CG   . MET A 1 52  ? 9.638   10.314  -3.458  1.00 0.00 ? 52  MET A CG   4  
ATOM 6677  S SD   . MET A 1 52  ? 9.079   11.816  -4.244  1.00 0.00 ? 52  MET A SD   4  
ATOM 6678  C CE   . MET A 1 52  ? 9.434   11.425  -5.948  1.00 0.00 ? 52  MET A CE   4  
ATOM 6679  H H    . MET A 1 52  ? 9.847   9.412   -0.779  1.00 0.00 ? 52  MET A H    4  
ATOM 6680  H HA   . MET A 1 52  ? 7.790   7.778   -1.971  1.00 0.00 ? 52  MET A HA   4  
ATOM 6681  H HB2  . MET A 1 52  ? 8.401   8.743   -4.267  1.00 0.00 ? 52  MET A HB2  4  
ATOM 6682  H HB3  . MET A 1 52  ? 7.542   9.862   -3.226  1.00 0.00 ? 52  MET A HB3  4  
ATOM 6683  H HG2  . MET A 1 52  ? 10.034  10.538  -2.468  1.00 0.00 ? 52  MET A HG2  4  
ATOM 6684  H HG3  . MET A 1 52  ? 10.451  9.874   -4.034  1.00 0.00 ? 52  MET A HG3  4  
ATOM 6685  H HE1  . MET A 1 52  ? 9.165   10.388  -6.147  1.00 0.00 ? 52  MET A HE1  4  
ATOM 6686  H HE2  . MET A 1 52  ? 8.857   12.081  -6.600  1.00 0.00 ? 52  MET A HE2  4  
ATOM 6687  H HE3  . MET A 1 52  ? 10.498  11.567  -6.140  1.00 0.00 ? 52  MET A HE3  4  
ATOM 6688  N N    . PHE A 1 53  ? 9.987   6.422   -1.617  1.00 0.00 ? 53  PHE A N    4  
ATOM 6689  C CA   . PHE A 1 53  ? 11.071  5.465   -1.763  1.00 0.00 ? 53  PHE A CA   4  
ATOM 6690  C C    . PHE A 1 53  ? 11.310  5.129   -3.237  1.00 0.00 ? 53  PHE A C    4  
ATOM 6691  O O    . PHE A 1 53  ? 12.243  5.644   -3.851  1.00 0.00 ? 53  PHE A O    4  
ATOM 6692  C CB   . PHE A 1 53  ? 10.648  4.194   -1.024  1.00 0.00 ? 53  PHE A CB   4  
ATOM 6693  C CG   . PHE A 1 53  ? 11.247  4.060   0.377   1.00 0.00 ? 53  PHE A CG   4  
ATOM 6694  C CD1  . PHE A 1 53  ? 12.574  4.280   0.574   1.00 0.00 ? 53  PHE A CD1  4  
ATOM 6695  C CD2  . PHE A 1 53  ? 10.451  3.721   1.427   1.00 0.00 ? 53  PHE A CD2  4  
ATOM 6696  C CE1  . PHE A 1 53  ? 13.129  4.157   1.875   1.00 0.00 ? 53  PHE A CE1  4  
ATOM 6697  C CE2  . PHE A 1 53  ? 11.005  3.597   2.728   1.00 0.00 ? 53  PHE A CE2  4  
ATOM 6698  C CZ   . PHE A 1 53  ? 12.333  3.818   2.925   1.00 0.00 ? 53  PHE A CZ   4  
ATOM 6699  H H    . PHE A 1 53  ? 9.358   6.236   -0.862  1.00 0.00 ? 53  PHE A H    4  
ATOM 6700  H HA   . PHE A 1 53  ? 11.968  5.925   -1.347  1.00 0.00 ? 53  PHE A HA   4  
ATOM 6701  H HB2  . PHE A 1 53  ? 9.561   4.175   -0.947  1.00 0.00 ? 53  PHE A HB2  4  
ATOM 6702  H HB3  . PHE A 1 53  ? 10.941  3.327   -1.618  1.00 0.00 ? 53  PHE A HB3  4  
ATOM 6703  H HD1  . PHE A 1 53  ? 13.212  4.553   -0.267  1.00 0.00 ? 53  PHE A HD1  4  
ATOM 6704  H HD2  . PHE A 1 53  ? 9.387   3.545   1.270   1.00 0.00 ? 53  PHE A HD2  4  
ATOM 6705  H HE1  . PHE A 1 53  ? 14.193  4.334   2.033   1.00 0.00 ? 53  PHE A HE1  4  
ATOM 6706  H HE2  . PHE A 1 53  ? 10.368  3.325   3.569   1.00 0.00 ? 53  PHE A HE2  4  
ATOM 6707  H HZ   . PHE A 1 53  ? 12.760  3.723   3.923   1.00 0.00 ? 53  PHE A HZ   4  
ATOM 6708  N N    . LYS A 1 54  ? 10.452  4.267   -3.760  1.00 0.00 ? 54  LYS A N    4  
ATOM 6709  C CA   . LYS A 1 54  ? 10.558  3.856   -5.150  1.00 0.00 ? 54  LYS A CA   4  
ATOM 6710  C C    . LYS A 1 54  ? 9.203   4.041   -5.837  1.00 0.00 ? 54  LYS A C    4  
ATOM 6711  O O    . LYS A 1 54  ? 8.567   3.065   -6.235  1.00 0.00 ? 54  LYS A O    4  
ATOM 6712  C CB   . LYS A 1 54  ? 11.107  2.431   -5.247  1.00 0.00 ? 54  LYS A CB   4  
ATOM 6713  C CG   . LYS A 1 54  ? 12.247  2.351   -6.265  1.00 0.00 ? 54  LYS A CG   4  
ATOM 6714  C CD   . LYS A 1 54  ? 13.358  3.347   -5.924  1.00 0.00 ? 54  LYS A CD   4  
ATOM 6715  C CE   . LYS A 1 54  ? 13.536  4.374   -7.044  1.00 0.00 ? 54  LYS A CE   4  
ATOM 6716  N NZ   . LYS A 1 54  ? 13.817  3.696   -8.329  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 6717  H H    . LYS A 1 54  ? 9.696   3.852   -3.253  1.00 0.00 ? 54  LYS A H    4  
ATOM 6718  H HA   . LYS A 1 54  ? 11.282  4.514   -5.631  1.00 0.00 ? 54  LYS A HA   4  
ATOM 6719  H HB2  . LYS A 1 54  ? 11.465  2.108   -4.270  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 6720  H HB3  . LYS A 1 54  ? 10.308  1.748   -5.536  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 6721  H HG2  . LYS A 1 54  ? 12.654  1.340   -6.283  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 6722  H HG3  . LYS A 1 54  ? 11.862  2.558   -7.264  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 6723  H HD2  . LYS A 1 54  ? 13.119  3.859   -4.992  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 6724  H HD3  . LYS A 1 54  ? 14.294  2.813   -5.763  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 6725  H HE2  . LYS A 1 54  ? 12.635  4.981   -7.135  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 6726  H HE3  . LYS A 1 54  ? 14.354  5.052   -6.798  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 6727  H HZ1  . LYS A 1 54  ? 13.549  2.734   -8.263  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 6728  H HZ2  . LYS A 1 54  ? 13.296  4.138   -9.060  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 6729  H HZ3  . LYS A 1 54  ? 14.793  3.757   -8.533  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 6730  N N    . GLY A 1 55  ? 8.801   5.297   -5.955  1.00 0.00 ? 55  GLY A N    4  
ATOM 6731  C CA   . GLY A 1 55  ? 7.534   5.622   -6.587  1.00 0.00 ? 55  GLY A CA   4  
ATOM 6732  C C    . GLY A 1 55  ? 7.747   6.489   -7.829  1.00 0.00 ? 55  GLY A C    4  
ATOM 6733  O O    . GLY A 1 55  ? 8.825   6.477   -8.422  1.00 0.00 ? 55  GLY A O    4  
ATOM 6734  H H    . GLY A 1 55  ? 9.325   6.085   -5.629  1.00 0.00 ? 55  GLY A H    4  
ATOM 6735  H HA2  . GLY A 1 55  ? 7.016   4.704   -6.864  1.00 0.00 ? 55  GLY A HA2  4  
ATOM 6736  H HA3  . GLY A 1 55  ? 6.894   6.147   -5.878  1.00 0.00 ? 55  GLY A HA3  4  
ATOM 6737  N N    . PRO A 1 56  ? 6.674   7.239   -8.197  1.00 0.00 ? 56  PRO A N    4  
ATOM 6738  C CA   . PRO A 1 56  ? 6.733   8.110   -9.358  1.00 0.00 ? 56  PRO A CA   4  
ATOM 6739  C C    . PRO A 1 56  ? 7.554   9.367   -9.061  1.00 0.00 ? 56  PRO A C    4  
ATOM 6740  O O    . PRO A 1 56  ? 8.204   9.456   -8.021  1.00 0.00 ? 56  PRO A O    4  
ATOM 6741  C CB   . PRO A 1 56  ? 5.283   8.414   -9.697  1.00 0.00 ? 56  PRO A CB   4  
ATOM 6742  C CG   . PRO A 1 56  ? 4.485   8.086   -8.445  1.00 0.00 ? 56  PRO A CG   4  
ATOM 6743  C CD   . PRO A 1 56  ? 5.381   7.278   -7.520  1.00 0.00 ? 56  PRO A CD   4  
ATOM 6744  H HA   . PRO A 1 56  ? 7.201   7.651   -10.113 1.00 0.00 ? 56  PRO A HA   4  
ATOM 6745  H HB2  . PRO A 1 56  ? 5.158   9.460   -9.977  1.00 0.00 ? 56  PRO A HB2  4  
ATOM 6746  H HB3  . PRO A 1 56  ? 4.946   7.815   -10.543 1.00 0.00 ? 56  PRO A HB3  4  
ATOM 6747  H HG2  . PRO A 1 56  ? 4.154   9.001   -7.953  1.00 0.00 ? 56  PRO A HG2  4  
ATOM 6748  H HG3  . PRO A 1 56  ? 3.590   7.519   -8.700  1.00 0.00 ? 56  PRO A HG3  4  
ATOM 6749  H HD2  . PRO A 1 56  ? 5.463   7.746   -6.539  1.00 0.00 ? 56  PRO A HD2  4  
ATOM 6750  H HD3  . PRO A 1 56  ? 4.986   6.275   -7.363  1.00 0.00 ? 56  PRO A HD3  4  
ATOM 6751  N N    . GLU A 1 57  ? 7.495   10.307  -9.993  1.00 0.00 ? 57  GLU A N    4  
ATOM 6752  C CA   . GLU A 1 57  ? 8.225   11.555  -9.843  1.00 0.00 ? 57  GLU A CA   4  
ATOM 6753  C C    . GLU A 1 57  ? 7.337   12.613  -9.187  1.00 0.00 ? 57  GLU A C    4  
ATOM 6754  O O    . GLU A 1 57  ? 7.816   13.434  -8.405  1.00 0.00 ? 57  GLU A O    4  
ATOM 6755  C CB   . GLU A 1 57  ? 8.756   12.044  -11.191 1.00 0.00 ? 57  GLU A CB   4  
ATOM 6756  C CG   . GLU A 1 57  ? 9.007   10.871  -12.141 1.00 0.00 ? 57  GLU A CG   4  
ATOM 6757  C CD   . GLU A 1 57  ? 9.766   11.326  -13.389 1.00 0.00 ? 57  GLU A CD   4  
ATOM 6758  O OE1  . GLU A 1 57  ? 9.273   12.274  -14.038 1.00 0.00 ? 57  GLU A OE1  4  
ATOM 6759  O OE2  . GLU A 1 57  ? 10.822  10.718  -13.663 1.00 0.00 ? 57  GLU A OE2  4  
ATOM 6760  H H    . GLU A 1 57  ? 6.964   10.227  -10.836 1.00 0.00 ? 57  GLU A H    4  
ATOM 6761  H HA   . GLU A 1 57  ? 9.066   11.321  -9.191  1.00 0.00 ? 57  GLU A HA   4  
ATOM 6762  H HB2  . GLU A 1 57  ? 8.042   12.734  -11.640 1.00 0.00 ? 57  GLU A HB2  4  
ATOM 6763  H HB3  . GLU A 1 57  ? 9.683   12.599  -11.042 1.00 0.00 ? 57  GLU A HB3  4  
ATOM 6764  H HG2  . GLU A 1 57  ? 9.576   10.097  -11.627 1.00 0.00 ? 57  GLU A HG2  4  
ATOM 6765  H HG3  . GLU A 1 57  ? 8.055   10.426  -12.432 1.00 0.00 ? 57  GLU A HG3  4  
ATOM 6766  N N    . LYS A 1 58  ? 6.057   12.561  -9.528  1.00 0.00 ? 58  LYS A N    4  
ATOM 6767  C CA   . LYS A 1 58  ? 5.098   13.505  -8.983  1.00 0.00 ? 58  LYS A CA   4  
ATOM 6768  C C    . LYS A 1 58  ? 4.677   13.047  -7.584  1.00 0.00 ? 58  LYS A C    4  
ATOM 6769  O O    . LYS A 1 58  ? 5.175   13.559  -6.584  1.00 0.00 ? 58  LYS A O    4  
ATOM 6770  C CB   . LYS A 1 58  ? 3.925   13.696  -9.946  1.00 0.00 ? 58  LYS A CB   4  
ATOM 6771  C CG   . LYS A 1 58  ? 3.353   15.111  -9.842  1.00 0.00 ? 58  LYS A CG   4  
ATOM 6772  C CD   . LYS A 1 58  ? 3.730   15.946  -11.067 1.00 0.00 ? 58  LYS A CD   4  
ATOM 6773  C CE   . LYS A 1 58  ? 5.237   16.210  -11.109 1.00 0.00 ? 58  LYS A CE   4  
ATOM 6774  N NZ   . LYS A 1 58  ? 5.515   17.540  -11.696 1.00 0.00 ? 58  LYS A NZ   4  
ATOM 6775  H H    . LYS A 1 58  ? 5.675   11.891  -10.164 1.00 0.00 ? 58  LYS A H    4  
ATOM 6776  H HA   . LYS A 1 58  ? 5.602   14.468  -8.893  1.00 0.00 ? 58  LYS A HA   4  
ATOM 6777  H HB2  . LYS A 1 58  ? 4.255   13.507  -10.968 1.00 0.00 ? 58  LYS A HB2  4  
ATOM 6778  H HB3  . LYS A 1 58  ? 3.145   12.968  -9.725  1.00 0.00 ? 58  LYS A HB3  4  
ATOM 6779  H HG2  . LYS A 1 58  ? 2.269   15.063  -9.749  1.00 0.00 ? 58  LYS A HG2  4  
ATOM 6780  H HG3  . LYS A 1 58  ? 3.730   15.593  -8.939  1.00 0.00 ? 58  LYS A HG3  4  
ATOM 6781  H HD2  . LYS A 1 58  ? 3.423   15.427  -11.975 1.00 0.00 ? 58  LYS A HD2  4  
ATOM 6782  H HD3  . LYS A 1 58  ? 3.193   16.894  -11.045 1.00 0.00 ? 58  LYS A HD3  4  
ATOM 6783  H HE2  . LYS A 1 58  ? 5.649   16.156  -10.102 1.00 0.00 ? 58  LYS A HE2  4  
ATOM 6784  H HE3  . LYS A 1 58  ? 5.730   15.437  -11.698 1.00 0.00 ? 58  LYS A HE3  4  
ATOM 6785  H HZ1  . LYS A 1 58  ? 4.831   18.196  -11.374 1.00 0.00 ? 58  LYS A HZ1  4  
ATOM 6786  H HZ2  . LYS A 1 58  ? 6.425   17.845  -11.415 1.00 0.00 ? 58  LYS A HZ2  4  
ATOM 6787  H HZ3  . LYS A 1 58  ? 5.475   17.480  -12.693 1.00 0.00 ? 58  LYS A HZ3  4  
ATOM 6788  N N    . ASP A 1 59  ? 3.764   12.088  -7.561  1.00 0.00 ? 59  ASP A N    4  
ATOM 6789  C CA   . ASP A 1 59  ? 3.269   11.555  -6.304  1.00 0.00 ? 59  ASP A CA   4  
ATOM 6790  C C    . ASP A 1 59  ? 1.876   10.958  -6.519  1.00 0.00 ? 59  ASP A C    4  
ATOM 6791  O O    . ASP A 1 59  ? 1.281   11.132  -7.581  1.00 0.00 ? 59  ASP A O    4  
ATOM 6792  C CB   . ASP A 1 59  ? 3.154   12.655  -5.246  1.00 0.00 ? 59  ASP A CB   4  
ATOM 6793  C CG   . ASP A 1 59  ? 2.363   12.269  -3.995  1.00 0.00 ? 59  ASP A CG   4  
ATOM 6794  O OD1  . ASP A 1 59  ? 2.576   11.134  -3.517  1.00 0.00 ? 59  ASP A OD1  4  
ATOM 6795  O OD2  . ASP A 1 59  ? 1.563   13.118  -3.544  1.00 0.00 ? 59  ASP A OD2  4  
ATOM 6796  H H    . ASP A 1 59  ? 3.363   11.677  -8.381  1.00 0.00 ? 59  ASP A H    4  
ATOM 6797  H HA   . ASP A 1 59  ? 4.002   10.806  -6.002  1.00 0.00 ? 59  ASP A HA   4  
ATOM 6798  H HB2  . ASP A 1 59  ? 4.157   12.956  -4.946  1.00 0.00 ? 59  ASP A HB2  4  
ATOM 6799  H HB3  . ASP A 1 59  ? 2.683   13.527  -5.701  1.00 0.00 ? 59  ASP A HB3  4  
ATOM 6800  N N    . ILE A 1 60  ? 1.398   10.268  -5.493  1.00 0.00 ? 60  ILE A N    4  
ATOM 6801  C CA   . ILE A 1 60  ? 0.088   9.646   -5.557  1.00 0.00 ? 60  ILE A CA   4  
ATOM 6802  C C    . ILE A 1 60  ? -0.922  10.513  -4.802  1.00 0.00 ? 60  ILE A C    4  
ATOM 6803  O O    . ILE A 1 60  ? -1.794  11.131  -5.411  1.00 0.00 ? 60  ILE A O    4  
ATOM 6804  C CB   . ILE A 1 60  ? 0.155   8.202   -5.056  1.00 0.00 ? 60  ILE A CB   4  
ATOM 6805  C CG1  . ILE A 1 60  ? 1.524   7.584   -5.346  1.00 0.00 ? 60  ILE A CG1  4  
ATOM 6806  C CG2  . ILE A 1 60  ? -0.987  7.365   -5.636  1.00 0.00 ? 60  ILE A CG2  4  
ATOM 6807  C CD1  . ILE A 1 60  ? 1.624   7.135   -6.805  1.00 0.00 ? 60  ILE A CD1  4  
ATOM 6808  H H    . ILE A 1 60  ? 1.889   10.133  -4.634  1.00 0.00 ? 60  ILE A H    4  
ATOM 6809  H HA   . ILE A 1 60  ? -0.207  9.609   -6.606  1.00 0.00 ? 60  ILE A HA   4  
ATOM 6810  H HB   . ILE A 1 60  ? 0.029   8.211   -3.973  1.00 0.00 ? 60  ILE A HB   4  
ATOM 6811  H HG12 . ILE A 1 60  ? 2.308   8.311   -5.131  1.00 0.00 ? 60  ILE A HG12 4  
ATOM 6812  H HG13 . ILE A 1 60  ? 1.690   6.732   -4.687  1.00 0.00 ? 60  ILE A HG13 4  
ATOM 6813  H HG21 . ILE A 1 60  ? -1.920  7.923   -5.560  1.00 0.00 ? 60  ILE A HG21 4  
ATOM 6814  H HG22 . ILE A 1 60  ? -0.778  7.145   -6.683  1.00 0.00 ? 60  ILE A HG22 4  
ATOM 6815  H HG23 . ILE A 1 60  ? -1.074  6.433   -5.078  1.00 0.00 ? 60  ILE A HG23 4  
ATOM 6816  H HD11 . ILE A 1 60  ? 1.310   7.949   -7.459  1.00 0.00 ? 60  ILE A HD11 4  
ATOM 6817  H HD12 . ILE A 1 60  ? 2.656   6.864   -7.033  1.00 0.00 ? 60  ILE A HD12 4  
ATOM 6818  H HD13 . ILE A 1 60  ? 0.979   6.271   -6.964  1.00 0.00 ? 60  ILE A HD13 4  
ATOM 6819  N N    . GLU A 1 61  ? -0.770  10.531  -3.486  1.00 0.00 ? 61  GLU A N    4  
ATOM 6820  C CA   . GLU A 1 61  ? -1.657  11.312  -2.641  1.00 0.00 ? 61  GLU A CA   4  
ATOM 6821  C C    . GLU A 1 61  ? -3.042  10.665  -2.583  1.00 0.00 ? 61  GLU A C    4  
ATOM 6822  O O    . GLU A 1 61  ? -3.905  11.101  -1.823  1.00 0.00 ? 61  GLU A O    4  
ATOM 6823  C CB   . GLU A 1 61  ? -1.748  12.758  -3.130  1.00 0.00 ? 61  GLU A CB   4  
ATOM 6824  C CG   . GLU A 1 61  ? -0.948  13.695  -2.223  1.00 0.00 ? 61  GLU A CG   4  
ATOM 6825  C CD   . GLU A 1 61  ? -0.298  14.819  -3.031  1.00 0.00 ? 61  GLU A CD   4  
ATOM 6826  O OE1  . GLU A 1 61  ? -0.331  14.715  -4.277  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6827  O OE2  . GLU A 1 61  ? 0.218   15.757  -2.387  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6828  H H    . GLU A 1 61  ? -0.058  10.025  -2.998  1.00 0.00 ? 61  GLU A H    4  
ATOM 6829  H HA   . GLU A 1 61  ? -1.201  11.297  -1.651  1.00 0.00 ? 61  GLU A HA   4  
ATOM 6830  H HB2  . GLU A 1 61  ? -1.371  12.825  -4.150  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6831  H HB3  . GLU A 1 61  ? -2.790  13.073  -3.155  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6832  H HG2  . GLU A 1 61  ? -1.605  14.121  -1.464  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6833  H HG3  . GLU A 1 61  ? -0.179  13.130  -1.697  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6834  N N    . PHE A 1 62  ? -3.212  9.634   -3.398  1.00 0.00 ? 62  PHE A N    4  
ATOM 6835  C CA   . PHE A 1 62  ? -4.478  8.922   -3.451  1.00 0.00 ? 62  PHE A CA   4  
ATOM 6836  C C    . PHE A 1 62  ? -4.266  7.452   -3.820  1.00 0.00 ? 62  PHE A C    4  
ATOM 6837  O O    . PHE A 1 62  ? -4.084  7.123   -4.991  1.00 0.00 ? 62  PHE A O    4  
ATOM 6838  C CB   . PHE A 1 62  ? -5.323  9.591   -4.536  1.00 0.00 ? 62  PHE A CB   4  
ATOM 6839  C CG   . PHE A 1 62  ? -6.434  10.493  -3.992  1.00 0.00 ? 62  PHE A CG   4  
ATOM 6840  C CD1  . PHE A 1 62  ? -7.430  9.962   -3.234  1.00 0.00 ? 62  PHE A CD1  4  
ATOM 6841  C CD2  . PHE A 1 62  ? -6.424  11.824  -4.269  1.00 0.00 ? 62  PHE A CD2  4  
ATOM 6842  C CE1  . PHE A 1 62  ? -8.460  10.798  -2.729  1.00 0.00 ? 62  PHE A CE1  4  
ATOM 6843  C CE2  . PHE A 1 62  ? -7.455  12.661  -3.764  1.00 0.00 ? 62  PHE A CE2  4  
ATOM 6844  C CZ   . PHE A 1 62  ? -8.451  12.130  -3.005  1.00 0.00 ? 62  PHE A CZ   4  
ATOM 6845  H H    . PHE A 1 62  ? -2.506  9.285   -4.014  1.00 0.00 ? 62  PHE A H    4  
ATOM 6846  H HA   . PHE A 1 62  ? -4.925  8.984   -2.459  1.00 0.00 ? 62  PHE A HA   4  
ATOM 6847  H HB2  . PHE A 1 62  ? -4.670  10.183  -5.178  1.00 0.00 ? 62  PHE A HB2  4  
ATOM 6848  H HB3  . PHE A 1 62  ? -5.771  8.819   -5.162  1.00 0.00 ? 62  PHE A HB3  4  
ATOM 6849  H HD1  . PHE A 1 62  ? -7.437  8.894   -3.013  1.00 0.00 ? 62  PHE A HD1  4  
ATOM 6850  H HD2  . PHE A 1 62  ? -5.626  12.249  -4.877  1.00 0.00 ? 62  PHE A HD2  4  
ATOM 6851  H HE1  . PHE A 1 62  ? -9.259  10.373  -2.121  1.00 0.00 ? 62  PHE A HE1  4  
ATOM 6852  H HE2  . PHE A 1 62  ? -7.448  13.728  -3.985  1.00 0.00 ? 62  PHE A HE2  4  
ATOM 6853  H HZ   . PHE A 1 62  ? -9.243  12.773  -2.618  1.00 0.00 ? 62  PHE A HZ   4  
ATOM 6854  N N    . ILE A 1 63  ? -4.296  6.609   -2.799  1.00 0.00 ? 63  ILE A N    4  
ATOM 6855  C CA   . ILE A 1 63  ? -4.110  5.181   -3.002  1.00 0.00 ? 63  ILE A CA   4  
ATOM 6856  C C    . ILE A 1 63  ? -5.454  4.469   -2.847  1.00 0.00 ? 63  ILE A C    4  
ATOM 6857  O O    . ILE A 1 63  ? -6.416  5.051   -2.349  1.00 0.00 ? 63  ILE A O    4  
ATOM 6858  C CB   . ILE A 1 63  ? -3.019  4.647   -2.070  1.00 0.00 ? 63  ILE A CB   4  
ATOM 6859  C CG1  . ILE A 1 63  ? -1.985  5.730   -1.758  1.00 0.00 ? 63  ILE A CG1  4  
ATOM 6860  C CG2  . ILE A 1 63  ? -2.373  3.387   -2.650  1.00 0.00 ? 63  ILE A CG2  4  
ATOM 6861  C CD1  . ILE A 1 63  ? -0.698  5.506   -2.555  1.00 0.00 ? 63  ILE A CD1  4  
ATOM 6862  H H    . ILE A 1 63  ? -4.444  6.885   -1.849  1.00 0.00 ? 63  ILE A H    4  
ATOM 6863  H HA   . ILE A 1 63  ? -3.758  5.040   -4.023  1.00 0.00 ? 63  ILE A HA   4  
ATOM 6864  H HB   . ILE A 1 63  ? -3.485  4.364   -1.126  1.00 0.00 ? 63  ILE A HB   4  
ATOM 6865  H HG12 . ILE A 1 63  ? -2.397  6.711   -1.994  1.00 0.00 ? 63  ILE A HG12 4  
ATOM 6866  H HG13 . ILE A 1 63  ? -1.760  5.726   -0.691  1.00 0.00 ? 63  ILE A HG13 4  
ATOM 6867  H HG21 . ILE A 1 63  ? -2.246  3.506   -3.726  1.00 0.00 ? 63  ILE A HG21 4  
ATOM 6868  H HG22 . ILE A 1 63  ? -1.400  3.231   -2.185  1.00 0.00 ? 63  ILE A HG22 4  
ATOM 6869  H HG23 . ILE A 1 63  ? -3.012  2.526   -2.453  1.00 0.00 ? 63  ILE A HG23 4  
ATOM 6870  H HD11 . ILE A 1 63  ? -0.949  5.223   -3.578  1.00 0.00 ? 63  ILE A HD11 4  
ATOM 6871  H HD12 . ILE A 1 63  ? -0.113  6.425   -2.566  1.00 0.00 ? 63  ILE A HD12 4  
ATOM 6872  H HD13 . ILE A 1 63  ? -0.116  4.710   -2.092  1.00 0.00 ? 63  ILE A HD13 4  
ATOM 6873  N N    . TYR A 1 64  ? -5.478  3.218   -3.283  1.00 0.00 ? 64  TYR A N    4  
ATOM 6874  C CA   . TYR A 1 64  ? -6.689  2.419   -3.200  1.00 0.00 ? 64  TYR A CA   4  
ATOM 6875  C C    . TYR A 1 64  ? -6.478  1.195   -2.306  1.00 0.00 ? 64  TYR A C    4  
ATOM 6876  O O    . TYR A 1 64  ? -5.369  0.672   -2.215  1.00 0.00 ? 64  TYR A O    4  
ATOM 6877  C CB   . TYR A 1 64  ? -6.983  1.949   -4.626  1.00 0.00 ? 64  TYR A CB   4  
ATOM 6878  C CG   . TYR A 1 64  ? -7.649  3.010   -5.506  1.00 0.00 ? 64  TYR A CG   4  
ATOM 6879  C CD1  . TYR A 1 64  ? -6.945  4.134   -5.885  1.00 0.00 ? 64  TYR A CD1  4  
ATOM 6880  C CD2  . TYR A 1 64  ? -8.956  2.842   -5.918  1.00 0.00 ? 64  TYR A CD2  4  
ATOM 6881  C CE1  . TYR A 1 64  ? -7.572  5.131   -6.713  1.00 0.00 ? 64  TYR A CE1  4  
ATOM 6882  C CE2  . TYR A 1 64  ? -9.583  3.839   -6.746  1.00 0.00 ? 64  TYR A CE2  4  
ATOM 6883  C CZ   . TYR A 1 64  ? -8.860  4.935   -7.102  1.00 0.00 ? 64  TYR A CZ   4  
ATOM 6884  O OH   . TYR A 1 64  ? -9.452  5.877   -7.884  1.00 0.00 ? 64  TYR A OH   4  
ATOM 6885  H H    . TYR A 1 64  ? -4.691  2.751   -3.687  1.00 0.00 ? 64  TYR A H    4  
ATOM 6886  H HA   . TYR A 1 64  ? -7.474  3.042   -2.772  1.00 0.00 ? 64  TYR A HA   4  
ATOM 6887  H HB2  . TYR A 1 64  ? -6.050  1.637   -5.095  1.00 0.00 ? 64  TYR A HB2  4  
ATOM 6888  H HB3  . TYR A 1 64  ? -7.627  1.071   -4.583  1.00 0.00 ? 64  TYR A HB3  4  
ATOM 6889  H HD1  . TYR A 1 64  ? -5.913  4.266   -5.559  1.00 0.00 ? 64  TYR A HD1  4  
ATOM 6890  H HD2  . TYR A 1 64  ? -9.512  1.954   -5.618  1.00 0.00 ? 64  TYR A HD2  4  
ATOM 6891  H HE1  . TYR A 1 64  ? -7.027  6.024   -7.020  1.00 0.00 ? 64  TYR A HE1  4  
ATOM 6892  H HE2  . TYR A 1 64  ? -10.614 3.719   -7.079  1.00 0.00 ? 64  TYR A HE2  4  
ATOM 6893  H HH   . TYR A 1 64  ? -9.350  6.780   -7.467  1.00 0.00 ? 64  TYR A HH   4  
ATOM 6894  N N    . THR A 1 65  ? -7.561  0.775   -1.669  1.00 0.00 ? 65  THR A N    4  
ATOM 6895  C CA   . THR A 1 65  ? -7.509  -0.377  -0.785  1.00 0.00 ? 65  THR A CA   4  
ATOM 6896  C C    . THR A 1 65  ? -8.922  -0.868  -0.465  1.00 0.00 ? 65  THR A C    4  
ATOM 6897  O O    . THR A 1 65  ? -9.884  -0.476  -1.124  1.00 0.00 ? 65  THR A O    4  
ATOM 6898  C CB   . THR A 1 65  ? -6.706  0.014   0.456   1.00 0.00 ? 65  THR A CB   4  
ATOM 6899  O OG1  . THR A 1 65  ? -6.792  -1.129  1.302   1.00 0.00 ? 65  THR A OG1  4  
ATOM 6900  C CG2  . THR A 1 65  ? -7.381  1.126   1.263   1.00 0.00 ? 65  THR A CG2  4  
ATOM 6901  H H    . THR A 1 65  ? -8.460  1.206   -1.749  1.00 0.00 ? 65  THR A H    4  
ATOM 6902  H HA   . THR A 1 65  ? -7.000  -1.188  -1.307  1.00 0.00 ? 65  THR A HA   4  
ATOM 6903  H HB   . THR A 1 65  ? -5.686  0.292   0.189   1.00 0.00 ? 65  THR A HB   4  
ATOM 6904  H HG1  . THR A 1 65  ? -6.358  -0.938  2.182   1.00 0.00 ? 65  THR A HG1  4  
ATOM 6905  H HG21 . THR A 1 65  ? -8.458  1.087   1.105   1.00 0.00 ? 65  THR A HG21 4  
ATOM 6906  H HG22 . THR A 1 65  ? -7.164  0.988   2.323   1.00 0.00 ? 65  THR A HG22 4  
ATOM 6907  H HG23 . THR A 1 65  ? -7.000  2.094   0.938   1.00 0.00 ? 65  THR A HG23 4  
ATOM 6908  N N    . ALA A 1 66  ? -9.003  -1.719  0.548   1.00 0.00 ? 66  ALA A N    4  
ATOM 6909  C CA   . ALA A 1 66  ? -10.283 -2.267  0.964   1.00 0.00 ? 66  ALA A CA   4  
ATOM 6910  C C    . ALA A 1 66  ? -10.726 -1.589  2.262   1.00 0.00 ? 66  ALA A C    4  
ATOM 6911  O O    . ALA A 1 66  ? -9.893  -1.156  3.057   1.00 0.00 ? 66  ALA A O    4  
ATOM 6912  C CB   . ALA A 1 66  ? -10.165 -3.786  1.111   1.00 0.00 ? 66  ALA A CB   4  
ATOM 6913  H H    . ALA A 1 66  ? -8.216  -2.033  1.079   1.00 0.00 ? 66  ALA A H    4  
ATOM 6914  H HA   . ALA A 1 66  ? -11.009 -2.046  0.181   1.00 0.00 ? 66  ALA A HA   4  
ATOM 6915  H HB1  . ALA A 1 66  ? -9.123  -4.082  0.991   1.00 0.00 ? 66  ALA A HB1  4  
ATOM 6916  H HB2  . ALA A 1 66  ? -10.515 -4.083  2.098   1.00 0.00 ? 66  ALA A HB2  4  
ATOM 6917  H HB3  . ALA A 1 66  ? -10.772 -4.273  0.348   1.00 0.00 ? 66  ALA A HB3  4  
ATOM 6918  N N    . PRO A 1 67  ? -12.073 -1.513  2.440   1.00 0.00 ? 67  PRO A N    4  
ATOM 6919  C CA   . PRO A 1 67  ? -12.636 -0.895  3.627   1.00 0.00 ? 67  PRO A CA   4  
ATOM 6920  C C    . PRO A 1 67  ? -12.491 -1.810  4.845   1.00 0.00 ? 67  PRO A C    4  
ATOM 6921  O O    . PRO A 1 67  ? -11.637 -2.696  4.862   1.00 0.00 ? 67  PRO A O    4  
ATOM 6922  C CB   . PRO A 1 67  ? -14.085 -0.607  3.271   1.00 0.00 ? 67  PRO A CB   4  
ATOM 6923  C CG   . PRO A 1 67  ? -14.404 -1.490  2.075   1.00 0.00 ? 67  PRO A CG   4  
ATOM 6924  C CD   . PRO A 1 67  ? -13.089 -2.015  1.520   1.00 0.00 ? 67  PRO A CD   4  
ATOM 6925  H HA   . PRO A 1 67  ? -12.137 -0.058  3.854   1.00 0.00 ? 67  PRO A HA   4  
ATOM 6926  H HB2  . PRO A 1 67  ? -14.746 -0.831  4.109   1.00 0.00 ? 67  PRO A HB2  4  
ATOM 6927  H HB3  . PRO A 1 67  ? -14.226 0.446   3.027   1.00 0.00 ? 67  PRO A HB3  4  
ATOM 6928  H HG2  . PRO A 1 67  ? -15.050 -2.317  2.373   1.00 0.00 ? 67  PRO A HG2  4  
ATOM 6929  H HG3  . PRO A 1 67  ? -14.941 -0.924  1.314   1.00 0.00 ? 67  PRO A HG3  4  
ATOM 6930  H HD2  . PRO A 1 67  ? -13.083 -3.104  1.479   1.00 0.00 ? 67  PRO A HD2  4  
ATOM 6931  H HD3  . PRO A 1 67  ? -12.917 -1.655  0.506   1.00 0.00 ? 67  PRO A HD3  4  
ATOM 6932  N N    . SER A 1 68  ? -13.338 -1.567  5.834   1.00 0.00 ? 68  SER A N    4  
ATOM 6933  C CA   . SER A 1 68  ? -13.314 -2.357  7.052   1.00 0.00 ? 68  SER A CA   4  
ATOM 6934  C C    . SER A 1 68  ? -11.907 -2.351  7.652   1.00 0.00 ? 68  SER A C    4  
ATOM 6935  O O    . SER A 1 68  ? -11.043 -1.595  7.213   1.00 0.00 ? 68  SER A O    4  
ATOM 6936  C CB   . SER A 1 68  ? -13.771 -3.793  6.785   1.00 0.00 ? 68  SER A CB   4  
ATOM 6937  O OG   . SER A 1 68  ? -15.165 -3.964  7.027   1.00 0.00 ? 68  SER A OG   4  
ATOM 6938  H H    . SER A 1 68  ? -14.029 -0.844  5.812   1.00 0.00 ? 68  SER A H    4  
ATOM 6939  H HA   . SER A 1 68  ? -14.020 -1.872  7.726   1.00 0.00 ? 68  SER A HA   4  
ATOM 6940  H HB2  . SER A 1 68  ? -13.548 -4.059  5.752   1.00 0.00 ? 68  SER A HB2  4  
ATOM 6941  H HB3  . SER A 1 68  ? -13.207 -4.477  7.419   1.00 0.00 ? 68  SER A HB3  4  
ATOM 6942  H HG   . SER A 1 68  ? -15.609 -3.071  7.111   1.00 0.00 ? 68  SER A HG   4  
ATOM 6943  N N    . SER A 1 69  ? -11.720 -3.204  8.650   1.00 0.00 ? 69  SER A N    4  
ATOM 6944  C CA   . SER A 1 69  ? -10.432 -3.307  9.315   1.00 0.00 ? 69  SER A CA   4  
ATOM 6945  C C    . SER A 1 69  ? -9.410  -3.953  8.379   1.00 0.00 ? 69  SER A C    4  
ATOM 6946  O O    . SER A 1 69  ? -8.766  -4.937  8.742   1.00 0.00 ? 69  SER A O    4  
ATOM 6947  C CB   . SER A 1 69  ? -10.546 -4.109  10.613  1.00 0.00 ? 69  SER A CB   4  
ATOM 6948  O OG   . SER A 1 69  ? -10.470 -5.513  10.381  1.00 0.00 ? 69  SER A OG   4  
ATOM 6949  H H    . SER A 1 69  ? -12.427 -3.817  9.002   1.00 0.00 ? 69  SER A H    4  
ATOM 6950  H HA   . SER A 1 69  ? -10.145 -2.281  9.547   1.00 0.00 ? 69  SER A HA   4  
ATOM 6951  H HB2  . SER A 1 69  ? -9.750  -3.810  11.295  1.00 0.00 ? 69  SER A HB2  4  
ATOM 6952  H HB3  . SER A 1 69  ? -11.490 -3.873  11.104  1.00 0.00 ? 69  SER A HB3  4  
ATOM 6953  H HG   . SER A 1 69  ? -11.269 -5.819  9.866   1.00 0.00 ? 69  SER A HG   4  
ATOM 6954  N N    . ALA A 1 70  ? -9.291  -3.374  7.194   1.00 0.00 ? 70  ALA A N    4  
ATOM 6955  C CA   . ALA A 1 70  ? -8.357  -3.881  6.203   1.00 0.00 ? 70  ALA A CA   4  
ATOM 6956  C C    . ALA A 1 70  ? -8.699  -5.339  5.887   1.00 0.00 ? 70  ALA A C    4  
ATOM 6957  O O    . ALA A 1 70  ? -8.365  -6.240  6.655   1.00 0.00 ? 70  ALA A O    4  
ATOM 6958  C CB   . ALA A 1 70  ? -6.927  -3.716  6.718   1.00 0.00 ? 70  ALA A CB   4  
ATOM 6959  H H    . ALA A 1 70  ? -9.818  -2.575  6.906   1.00 0.00 ? 70  ALA A H    4  
ATOM 6960  H HA   . ALA A 1 70  ? -8.476  -3.285  5.298   1.00 0.00 ? 70  ALA A HA   4  
ATOM 6961  H HB1  . ALA A 1 70  ? -6.929  -3.736  7.808   1.00 0.00 ? 70  ALA A HB1  4  
ATOM 6962  H HB2  . ALA A 1 70  ? -6.308  -4.531  6.342   1.00 0.00 ? 70  ALA A HB2  4  
ATOM 6963  H HB3  . ALA A 1 70  ? -6.523  -2.765  6.372   1.00 0.00 ? 70  ALA A HB3  4  
ATOM 6964  N N    . VAL A 1 71  ? -9.359  -5.526  4.753   1.00 0.00 ? 71  VAL A N    4  
ATOM 6965  C CA   . VAL A 1 71  ? -9.748  -6.859  4.325   1.00 0.00 ? 71  VAL A CA   4  
ATOM 6966  C C    . VAL A 1 71  ? -8.869  -7.291  3.149   1.00 0.00 ? 71  VAL A C    4  
ATOM 6967  O O    . VAL A 1 71  ? -8.528  -8.466  3.022   1.00 0.00 ? 71  VAL A O    4  
ATOM 6968  C CB   . VAL A 1 71  ? -11.242 -6.888  3.996   1.00 0.00 ? 71  VAL A CB   4  
ATOM 6969  C CG1  . VAL A 1 71  ? -11.991 -5.786  4.750   1.00 0.00 ? 71  VAL A CG1  4  
ATOM 6970  C CG2  . VAL A 1 71  ? -11.474 -6.775  2.488   1.00 0.00 ? 71  VAL A CG2  4  
ATOM 6971  H H    . VAL A 1 71  ? -9.626  -4.788  4.133   1.00 0.00 ? 71  VAL A H    4  
ATOM 6972  H HA   . VAL A 1 71  ? -9.573  -7.537  5.161   1.00 0.00 ? 71  VAL A HA   4  
ATOM 6973  H HB   . VAL A 1 71  ? -11.639 -7.847  4.325   1.00 0.00 ? 71  VAL A HB   4  
ATOM 6974  H HG11 . VAL A 1 71  ? -11.843 -5.915  5.822   1.00 0.00 ? 71  VAL A HG11 4  
ATOM 6975  H HG12 . VAL A 1 71  ? -11.606 -4.813  4.445   1.00 0.00 ? 71  VAL A HG12 4  
ATOM 6976  H HG13 . VAL A 1 71  ? -13.054 -5.846  4.520   1.00 0.00 ? 71  VAL A HG13 4  
ATOM 6977  H HG21 . VAL A 1 71  ? -10.778 -6.049  2.067   1.00 0.00 ? 71  VAL A HG21 4  
ATOM 6978  H HG22 . VAL A 1 71  ? -11.311 -7.747  2.022   1.00 0.00 ? 71  VAL A HG22 4  
ATOM 6979  H HG23 . VAL A 1 71  ? -12.497 -6.449  2.302   1.00 0.00 ? 71  VAL A HG23 4  
ATOM 6980  N N    . CYS A 1 72  ? -8.526  -6.316  2.320   1.00 0.00 ? 72  CYS A N    4  
ATOM 6981  C CA   . CYS A 1 72  ? -7.694  -6.579  1.159   1.00 0.00 ? 72  CYS A CA   4  
ATOM 6982  C C    . CYS A 1 72  ? -6.562  -5.551  1.135   1.00 0.00 ? 72  CYS A C    4  
ATOM 6983  O O    . CYS A 1 72  ? -5.916  -5.356  0.107   1.00 0.00 ? 72  CYS A O    4  
ATOM 6984  C CB   . CYS A 1 72  ? -8.507  -6.562  -0.137  1.00 0.00 ? 72  CYS A CB   4  
ATOM 6985  S SG   . CYS A 1 72  ? -9.888  -7.762  -0.191  1.00 0.00 ? 72  CYS A SG   4  
ATOM 6986  H H    . CYS A 1 72  ? -8.808  -5.363  2.431   1.00 0.00 ? 72  CYS A H    4  
ATOM 6987  H HA   . CYS A 1 72  ? -7.297  -7.588  1.280   1.00 0.00 ? 72  CYS A HA   4  
ATOM 6988  H HB2  . CYS A 1 72  ? -8.909  -5.560  -0.284  1.00 0.00 ? 72  CYS A HB2  4  
ATOM 6989  H HB3  . CYS A 1 72  ? -7.837  -6.764  -0.973  1.00 0.00 ? 72  CYS A HB3  4  
ATOM 6990  N N    . GLY A 1 73  ? -6.356  -4.918  2.281   1.00 0.00 ? 73  GLY A N    4  
ATOM 6991  C CA   . GLY A 1 73  ? -5.313  -3.913  2.405   1.00 0.00 ? 73  GLY A CA   4  
ATOM 6992  C C    . GLY A 1 73  ? -4.818  -3.813  3.850   1.00 0.00 ? 73  GLY A C    4  
ATOM 6993  O O    . GLY A 1 73  ? -4.935  -4.767  4.618   1.00 0.00 ? 73  GLY A O    4  
ATOM 6994  H H    . GLY A 1 73  ? -6.886  -5.082  3.114   1.00 0.00 ? 73  GLY A H    4  
ATOM 6995  H HA2  . GLY A 1 73  ? -4.481  -4.165  1.748   1.00 0.00 ? 73  GLY A HA2  4  
ATOM 6996  H HA3  . GLY A 1 73  ? -5.696  -2.947  2.080   1.00 0.00 ? 73  GLY A HA3  4  
ATOM 6997  N N    . VAL A 1 74  ? -4.276  -2.649  4.176   1.00 0.00 ? 74  VAL A N    4  
ATOM 6998  C CA   . VAL A 1 74  ? -3.763  -2.411  5.514   1.00 0.00 ? 74  VAL A CA   4  
ATOM 6999  C C    . VAL A 1 74  ? -4.614  -1.340  6.199   1.00 0.00 ? 74  VAL A C    4  
ATOM 7000  O O    . VAL A 1 74  ? -4.358  -0.980  7.347   1.00 0.00 ? 74  VAL A O    4  
ATOM 7001  C CB   . VAL A 1 74  ? -2.280  -2.043  5.448   1.00 0.00 ? 74  VAL A CB   4  
ATOM 7002  C CG1  . VAL A 1 74  ? -1.716  -1.782  6.847   1.00 0.00 ? 74  VAL A CG1  4  
ATOM 7003  C CG2  . VAL A 1 74  ? -1.477  -3.129  4.728   1.00 0.00 ? 74  VAL A CG2  4  
ATOM 7004  H H    . VAL A 1 74  ? -4.185  -1.878  3.545   1.00 0.00 ? 74  VAL A H    4  
ATOM 7005  H HA   . VAL A 1 74  ? -3.855  -3.343  6.072   1.00 0.00 ? 74  VAL A HA   4  
ATOM 7006  H HB   . VAL A 1 74  ? -2.188  -1.122  4.872   1.00 0.00 ? 74  VAL A HB   4  
ATOM 7007  H HG11 . VAL A 1 74  ? -1.928  -2.636  7.489   1.00 0.00 ? 74  VAL A HG11 4  
ATOM 7008  H HG12 . VAL A 1 74  ? -0.638  -1.634  6.783   1.00 0.00 ? 74  VAL A HG12 4  
ATOM 7009  H HG13 . VAL A 1 74  ? -2.181  -0.889  7.263   1.00 0.00 ? 74  VAL A HG13 4  
ATOM 7010  H HG21 . VAL A 1 74  ? -2.115  -3.629  4.000   1.00 0.00 ? 74  VAL A HG21 4  
ATOM 7011  H HG22 . VAL A 1 74  ? -0.628  -2.675  4.216   1.00 0.00 ? 74  VAL A HG22 4  
ATOM 7012  H HG23 . VAL A 1 74  ? -1.116  -3.857  5.455   1.00 0.00 ? 74  VAL A HG23 4  
ATOM 7013  N N    . SER A 1 75  ? -5.609  -0.862  5.467   1.00 0.00 ? 75  SER A N    4  
ATOM 7014  C CA   . SER A 1 75  ? -6.500  0.160   5.989   1.00 0.00 ? 75  SER A CA   4  
ATOM 7015  C C    . SER A 1 75  ? -5.748  1.051   6.981   1.00 0.00 ? 75  SER A C    4  
ATOM 7016  O O    . SER A 1 75  ? -5.846  0.858   8.192   1.00 0.00 ? 75  SER A O    4  
ATOM 7017  C CB   . SER A 1 75  ? -7.723  -0.467  6.660   1.00 0.00 ? 75  SER A CB   4  
ATOM 7018  O OG   . SER A 1 75  ? -7.421  -0.972  7.958   1.00 0.00 ? 75  SER A OG   4  
ATOM 7019  H H    . SER A 1 75  ? -5.811  -1.161  4.534   1.00 0.00 ? 75  SER A H    4  
ATOM 7020  H HA   . SER A 1 75  ? -6.818  0.737   5.121   1.00 0.00 ? 75  SER A HA   4  
ATOM 7021  H HB2  . SER A 1 75  ? -8.516  0.279   6.737   1.00 0.00 ? 75  SER A HB2  4  
ATOM 7022  H HB3  . SER A 1 75  ? -8.105  -1.274  6.037   1.00 0.00 ? 75  SER A HB3  4  
ATOM 7023  H HG   . SER A 1 75  ? -8.254  -1.024  8.508   1.00 0.00 ? 75  SER A HG   4  
ATOM 7024  N N    . LEU A 1 76  ? -5.015  2.008   6.430   1.00 0.00 ? 76  LEU A N    4  
ATOM 7025  C CA   . LEU A 1 76  ? -4.249  2.929   7.250   1.00 0.00 ? 76  LEU A CA   4  
ATOM 7026  C C    . LEU A 1 76  ? -4.976  4.273   7.318   1.00 0.00 ? 76  LEU A C    4  
ATOM 7027  O O    . LEU A 1 76  ? -5.417  4.796   6.296   1.00 0.00 ? 76  LEU A O    4  
ATOM 7028  C CB   . LEU A 1 76  ? -2.811  3.034   6.738   1.00 0.00 ? 76  LEU A CB   4  
ATOM 7029  C CG   . LEU A 1 76  ? -2.319  1.868   5.877   1.00 0.00 ? 76  LEU A CG   4  
ATOM 7030  C CD1  . LEU A 1 76  ? -2.452  2.192   4.387   1.00 0.00 ? 76  LEU A CD1  4  
ATOM 7031  C CD2  . LEU A 1 76  ? -0.890  1.474   6.252   1.00 0.00 ? 76  LEU A CD2  4  
ATOM 7032  H H    . LEU A 1 76  ? -4.942  2.158   5.444   1.00 0.00 ? 76  LEU A H    4  
ATOM 7033  H HA   . LEU A 1 76  ? -4.202  2.511   8.256   1.00 0.00 ? 76  LEU A HA   4  
ATOM 7034  H HB2  . LEU A 1 76  ? -2.719  3.952   6.158   1.00 0.00 ? 76  LEU A HB2  4  
ATOM 7035  H HB3  . LEU A 1 76  ? -2.146  3.131   7.596   1.00 0.00 ? 76  LEU A HB3  4  
ATOM 7036  H HG   . LEU A 1 76  ? -2.954  1.005   6.076   1.00 0.00 ? 76  LEU A HG   4  
ATOM 7037  H HD11 . LEU A 1 76  ? -3.028  3.110   4.266   1.00 0.00 ? 76  LEU A HD11 4  
ATOM 7038  H HD12 . LEU A 1 76  ? -1.460  2.326   3.955   1.00 0.00 ? 76  LEU A HD12 4  
ATOM 7039  H HD13 . LEU A 1 76  ? -2.962  1.373   3.881   1.00 0.00 ? 76  LEU A HD13 4  
ATOM 7040  H HD21 . LEU A 1 76  ? -0.529  2.129   7.046   1.00 0.00 ? 76  LEU A HD21 4  
ATOM 7041  H HD22 . LEU A 1 76  ? -0.877  0.441   6.599   1.00 0.00 ? 76  LEU A HD22 4  
ATOM 7042  H HD23 . LEU A 1 76  ? -0.244  1.572   5.379   1.00 0.00 ? 76  LEU A HD23 4  
ATOM 7043  N N    . ASP A 1 77  ? -5.080  4.794   8.532   1.00 0.00 ? 77  ASP A N    4  
ATOM 7044  C CA   . ASP A 1 77  ? -5.748  6.066   8.745   1.00 0.00 ? 77  ASP A CA   4  
ATOM 7045  C C    . ASP A 1 77  ? -4.742  7.078   9.299   1.00 0.00 ? 77  ASP A C    4  
ATOM 7046  O O    . ASP A 1 77  ? -5.033  8.271   9.375   1.00 0.00 ? 77  ASP A O    4  
ATOM 7047  C CB   . ASP A 1 77  ? -6.885  5.928   9.760   1.00 0.00 ? 77  ASP A CB   4  
ATOM 7048  C CG   . ASP A 1 77  ? -6.678  4.845   10.820  1.00 0.00 ? 77  ASP A CG   4  
ATOM 7049  O OD1  . ASP A 1 77  ? -5.941  5.131   11.788  1.00 0.00 ? 77  ASP A OD1  4  
ATOM 7050  O OD2  . ASP A 1 77  ? -7.263  3.755   10.639  1.00 0.00 ? 77  ASP A OD2  4  
ATOM 7051  H H    . ASP A 1 77  ? -4.719  4.361   9.359   1.00 0.00 ? 77  ASP A H    4  
ATOM 7052  H HA   . ASP A 1 77  ? -6.135  6.354   7.769   1.00 0.00 ? 77  ASP A HA   4  
ATOM 7053  H HB2  . ASP A 1 77  ? -7.022  6.886   10.262  1.00 0.00 ? 77  ASP A HB2  4  
ATOM 7054  H HB3  . ASP A 1 77  ? -7.808  5.717   9.221   1.00 0.00 ? 77  ASP A HB3  4  
ATOM 7055  N N    . VAL A 1 78  ? -3.578  6.565   9.670   1.00 0.00 ? 78  VAL A N    4  
ATOM 7056  C CA   . VAL A 1 78  ? -2.527  7.409   10.213  1.00 0.00 ? 78  VAL A CA   4  
ATOM 7057  C C    . VAL A 1 78  ? -2.902  7.831   11.635  1.00 0.00 ? 78  VAL A C    4  
ATOM 7058  O O    . VAL A 1 78  ? -2.052  8.297   12.393  1.00 0.00 ? 78  VAL A O    4  
ATOM 7059  C CB   . VAL A 1 78  ? -2.277  8.597   9.282   1.00 0.00 ? 78  VAL A CB   4  
ATOM 7060  C CG1  . VAL A 1 78  ? -1.850  9.834   10.076  1.00 0.00 ? 78  VAL A CG1  4  
ATOM 7061  C CG2  . VAL A 1 78  ? -1.241  8.248   8.213   1.00 0.00 ? 78  VAL A CG2  4  
ATOM 7062  H H    . VAL A 1 78  ? -3.349  5.594   9.604   1.00 0.00 ? 78  VAL A H    4  
ATOM 7063  H HA   . VAL A 1 78  ? -1.615  6.813   10.253  1.00 0.00 ? 78  VAL A HA   4  
ATOM 7064  H HB   . VAL A 1 78  ? -3.214  8.830   8.778   1.00 0.00 ? 78  VAL A HB   4  
ATOM 7065  H HG11 . VAL A 1 78  ? -1.155  9.539   10.863  1.00 0.00 ? 78  VAL A HG11 4  
ATOM 7066  H HG12 . VAL A 1 78  ? -1.363  10.544  9.408   1.00 0.00 ? 78  VAL A HG12 4  
ATOM 7067  H HG13 . VAL A 1 78  ? -2.728  10.300  10.524  1.00 0.00 ? 78  VAL A HG13 4  
ATOM 7068  H HG21 . VAL A 1 78  ? -0.732  7.324   8.487   1.00 0.00 ? 78  VAL A HG21 4  
ATOM 7069  H HG22 . VAL A 1 78  ? -1.741  8.115   7.253   1.00 0.00 ? 78  VAL A HG22 4  
ATOM 7070  H HG23 . VAL A 1 78  ? -0.513  9.055   8.135   1.00 0.00 ? 78  VAL A HG23 4  
ATOM 7071  N N    . GLY A 1 79  ? -4.176  7.652   11.954  1.00 0.00 ? 79  GLY A N    4  
ATOM 7072  C CA   . GLY A 1 79  ? -4.673  8.008   13.273  1.00 0.00 ? 79  GLY A CA   4  
ATOM 7073  C C    . GLY A 1 79  ? -4.272  6.961   14.313  1.00 0.00 ? 79  GLY A C    4  
ATOM 7074  O O    . GLY A 1 79  ? -4.512  7.141   15.505  1.00 0.00 ? 79  GLY A O    4  
ATOM 7075  H H    . GLY A 1 79  ? -4.860  7.273   11.333  1.00 0.00 ? 79  GLY A H    4  
ATOM 7076  H HA2  . GLY A 1 79  ? -4.280  8.983   13.562  1.00 0.00 ? 79  GLY A HA2  4  
ATOM 7077  H HA3  . GLY A 1 79  ? -5.759  8.100   13.243  1.00 0.00 ? 79  GLY A HA3  4  
ATOM 7078  N N    . GLY A 1 80  ? -3.666  5.889   13.822  1.00 0.00 ? 80  GLY A N    4  
ATOM 7079  C CA   . GLY A 1 80  ? -3.228  4.812   14.695  1.00 0.00 ? 80  GLY A CA   4  
ATOM 7080  C C    . GLY A 1 80  ? -1.797  4.385   14.363  1.00 0.00 ? 80  GLY A C    4  
ATOM 7081  O O    . GLY A 1 80  ? -1.049  3.970   15.245  1.00 0.00 ? 80  GLY A O    4  
ATOM 7082  H H    . GLY A 1 80  ? -3.474  5.750   12.851  1.00 0.00 ? 80  GLY A H    4  
ATOM 7083  H HA2  . GLY A 1 80  ? -3.283  5.136   15.734  1.00 0.00 ? 80  GLY A HA2  4  
ATOM 7084  H HA3  . GLY A 1 80  ? -3.900  3.959   14.591  1.00 0.00 ? 80  GLY A HA3  4  
ATOM 7085  N N    . LYS A 1 81  ? -1.461  4.501   13.086  1.00 0.00 ? 81  LYS A N    4  
ATOM 7086  C CA   . LYS A 1 81  ? -0.132  4.133   12.627  1.00 0.00 ? 81  LYS A CA   4  
ATOM 7087  C C    . LYS A 1 81  ? 0.728   5.392   12.501  1.00 0.00 ? 81  LYS A C    4  
ATOM 7088  O O    . LYS A 1 81  ? 1.234   5.904   13.499  1.00 0.00 ? 81  LYS A O    4  
ATOM 7089  C CB   . LYS A 1 81  ? -0.219  3.317   11.335  1.00 0.00 ? 81  LYS A CB   4  
ATOM 7090  C CG   . LYS A 1 81  ? -1.594  3.472   10.680  1.00 0.00 ? 81  LYS A CG   4  
ATOM 7091  C CD   . LYS A 1 81  ? -2.660  2.691   11.451  1.00 0.00 ? 81  LYS A CD   4  
ATOM 7092  C CE   . LYS A 1 81  ? -3.930  3.524   11.628  1.00 0.00 ? 81  LYS A CE   4  
ATOM 7093  N NZ   . LYS A 1 81  ? -5.129  2.720   11.301  1.00 0.00 ? 81  LYS A NZ   4  
ATOM 7094  H H    . LYS A 1 81  ? -2.075  4.840   12.374  1.00 0.00 ? 81  LYS A H    4  
ATOM 7095  H HA   . LYS A 1 81  ? 0.309   3.487   13.386  1.00 0.00 ? 81  LYS A HA   4  
ATOM 7096  H HB2  . LYS A 1 81  ? 0.556   3.642   10.642  1.00 0.00 ? 81  LYS A HB2  4  
ATOM 7097  H HB3  . LYS A 1 81  ? -0.033  2.265   11.552  1.00 0.00 ? 81  LYS A HB3  4  
ATOM 7098  H HG2  . LYS A 1 81  ? -1.866  4.527   10.645  1.00 0.00 ? 81  LYS A HG2  4  
ATOM 7099  H HG3  . LYS A 1 81  ? -1.551  3.119   9.650   1.00 0.00 ? 81  LYS A HG3  4  
ATOM 7100  H HD2  . LYS A 1 81  ? -2.896  1.770   10.918  1.00 0.00 ? 81  LYS A HD2  4  
ATOM 7101  H HD3  . LYS A 1 81  ? -2.270  2.403   12.428  1.00 0.00 ? 81  LYS A HD3  4  
ATOM 7102  H HE2  . LYS A 1 81  ? -3.996  3.885   12.655  1.00 0.00 ? 81  LYS A HE2  4  
ATOM 7103  H HE3  . LYS A 1 81  ? -3.888  4.404   10.984  1.00 0.00 ? 81  LYS A HE3  4  
ATOM 7104  H HZ1  . LYS A 1 81  ? -4.907  1.747   11.374  1.00 0.00 ? 81  LYS A HZ1  4  
ATOM 7105  H HZ2  . LYS A 1 81  ? -5.865  2.943   11.940  1.00 0.00 ? 81  LYS A HZ2  4  
ATOM 7106  H HZ3  . LYS A 1 81  ? -5.423  2.925   10.367  1.00 0.00 ? 81  LYS A HZ3  4  
ATOM 7107  N N    . LYS A 1 82  ? 0.867   5.855   11.267  1.00 0.00 ? 82  LYS A N    4  
ATOM 7108  C CA   . LYS A 1 82  ? 1.656   7.045   10.999  1.00 0.00 ? 82  LYS A CA   4  
ATOM 7109  C C    . LYS A 1 82  ? 1.844   7.197   9.488   1.00 0.00 ? 82  LYS A C    4  
ATOM 7110  O O    . LYS A 1 82  ? 1.203   8.040   8.862   1.00 0.00 ? 82  LYS A O    4  
ATOM 7111  C CB   . LYS A 1 82  ? 2.971   7.002   11.780  1.00 0.00 ? 82  LYS A CB   4  
ATOM 7112  C CG   . LYS A 1 82  ? 3.625   5.622   11.679  1.00 0.00 ? 82  LYS A CG   4  
ATOM 7113  C CD   . LYS A 1 82  ? 4.010   5.095   13.063  1.00 0.00 ? 82  LYS A CD   4  
ATOM 7114  C CE   . LYS A 1 82  ? 3.268   3.795   13.379  1.00 0.00 ? 82  LYS A CE   4  
ATOM 7115  N NZ   . LYS A 1 82  ? 4.005   3.012   14.397  1.00 0.00 ? 82  LYS A NZ   4  
ATOM 7116  H H    . LYS A 1 82  ? 0.452   5.432   10.462  1.00 0.00 ? 82  LYS A H    4  
ATOM 7117  H HA   . LYS A 1 82  ? 1.091   7.902   11.365  1.00 0.00 ? 82  LYS A HA   4  
ATOM 7118  H HB2  . LYS A 1 82  ? 3.653   7.760   11.394  1.00 0.00 ? 82  LYS A HB2  4  
ATOM 7119  H HB3  . LYS A 1 82  ? 2.785   7.245   12.826  1.00 0.00 ? 82  LYS A HB3  4  
ATOM 7120  H HG2  . LYS A 1 82  ? 2.938   4.925   11.198  1.00 0.00 ? 82  LYS A HG2  4  
ATOM 7121  H HG3  . LYS A 1 82  ? 4.512   5.682   11.049  1.00 0.00 ? 82  LYS A HG3  4  
ATOM 7122  H HD2  . LYS A 1 82  ? 5.085   4.924   13.105  1.00 0.00 ? 82  LYS A HD2  4  
ATOM 7123  H HD3  . LYS A 1 82  ? 3.776   5.845   13.820  1.00 0.00 ? 82  LYS A HD3  4  
ATOM 7124  H HE2  . LYS A 1 82  ? 2.265   4.020   13.743  1.00 0.00 ? 82  LYS A HE2  4  
ATOM 7125  H HE3  . LYS A 1 82  ? 3.153   3.204   12.471  1.00 0.00 ? 82  LYS A HE3  4  
ATOM 7126  H HZ1  . LYS A 1 82  ? 4.970   2.954   14.137  1.00 0.00 ? 82  LYS A HZ1  4  
ATOM 7127  H HZ2  . LYS A 1 82  ? 3.926   3.462   15.286  1.00 0.00 ? 82  LYS A HZ2  4  
ATOM 7128  H HZ3  . LYS A 1 82  ? 3.619   2.091   14.452  1.00 0.00 ? 82  LYS A HZ3  4  
ATOM 7129  N N    . GLU A 1 83  ? 2.722   6.368   8.946   1.00 0.00 ? 83  GLU A N    4  
ATOM 7130  C CA   . GLU A 1 83  ? 3.001   6.399   7.521   1.00 0.00 ? 83  GLU A CA   4  
ATOM 7131  C C    . GLU A 1 83  ? 3.473   5.025   7.041   1.00 0.00 ? 83  GLU A C    4  
ATOM 7132  O O    . GLU A 1 83  ? 3.923   4.206   7.839   1.00 0.00 ? 83  GLU A O    4  
ATOM 7133  C CB   . GLU A 1 83  ? 4.033   7.479   7.188   1.00 0.00 ? 83  GLU A CB   4  
ATOM 7134  C CG   . GLU A 1 83  ? 3.706   8.790   7.906   1.00 0.00 ? 83  GLU A CG   4  
ATOM 7135  C CD   . GLU A 1 83  ? 4.169   8.746   9.364   1.00 0.00 ? 83  GLU A CD   4  
ATOM 7136  O OE1  . GLU A 1 83  ? 5.014   7.875   9.666   1.00 0.00 ? 83  GLU A OE1  4  
ATOM 7137  O OE2  . GLU A 1 83  ? 3.668   9.584   10.144  1.00 0.00 ? 83  GLU A OE2  4  
ATOM 7138  H H    . GLU A 1 83  ? 3.238   5.684   9.462   1.00 0.00 ? 83  GLU A H    4  
ATOM 7139  H HA   . GLU A 1 83  ? 2.054   6.652   7.045   1.00 0.00 ? 83  GLU A HA   4  
ATOM 7140  H HB2  . GLU A 1 83  ? 5.027   7.140   7.477   1.00 0.00 ? 83  GLU A HB2  4  
ATOM 7141  H HB3  . GLU A 1 83  ? 4.055   7.647   6.111   1.00 0.00 ? 83  GLU A HB3  4  
ATOM 7142  H HG2  . GLU A 1 83  ? 4.188   9.621   7.392   1.00 0.00 ? 83  GLU A HG2  4  
ATOM 7143  H HG3  . GLU A 1 83  ? 2.632   8.972   7.868   1.00 0.00 ? 83  GLU A HG3  4  
ATOM 7144  N N    . TYR A 1 84  ? 3.353   4.815   5.737   1.00 0.00 ? 84  TYR A N    4  
ATOM 7145  C CA   . TYR A 1 84  ? 3.760   3.554   5.142   1.00 0.00 ? 84  TYR A CA   4  
ATOM 7146  C C    . TYR A 1 84  ? 4.459   3.782   3.800   1.00 0.00 ? 84  TYR A C    4  
ATOM 7147  O O    . TYR A 1 84  ? 4.216   4.786   3.133   1.00 0.00 ? 84  TYR A O    4  
ATOM 7148  C CB   . TYR A 1 84  ? 2.472   2.763   4.906   1.00 0.00 ? 84  TYR A CB   4  
ATOM 7149  C CG   . TYR A 1 84  ? 1.419   3.518   4.094   1.00 0.00 ? 84  TYR A CG   4  
ATOM 7150  C CD1  . TYR A 1 84  ? 1.692   3.903   2.797   1.00 0.00 ? 84  TYR A CD1  4  
ATOM 7151  C CD2  . TYR A 1 84  ? 0.195   3.815   4.658   1.00 0.00 ? 84  TYR A CD2  4  
ATOM 7152  C CE1  . TYR A 1 84  ? 0.700   4.614   2.032   1.00 0.00 ? 84  TYR A CE1  4  
ATOM 7153  C CE2  . TYR A 1 84  ? -0.798  4.527   3.894   1.00 0.00 ? 84  TYR A CE2  4  
ATOM 7154  C CZ   . TYR A 1 84  ? -0.496  4.891   2.619   1.00 0.00 ? 84  TYR A CZ   4  
ATOM 7155  O OH   . TYR A 1 84  ? -1.433  5.562   1.896   1.00 0.00 ? 84  TYR A OH   4  
ATOM 7156  H H    . TYR A 1 84  ? 2.985   5.486   5.095   1.00 0.00 ? 84  TYR A H    4  
ATOM 7157  H HA   . TYR A 1 84  ? 4.456   3.068   5.827   1.00 0.00 ? 84  TYR A HA   4  
ATOM 7158  H HB2  . TYR A 1 84  ? 2.718   1.835   4.390   1.00 0.00 ? 84  TYR A HB2  4  
ATOM 7159  H HB3  . TYR A 1 84  ? 2.045   2.488   5.870   1.00 0.00 ? 84  TYR A HB3  4  
ATOM 7160  H HD1  . TYR A 1 84  ? 2.658   3.669   2.351   1.00 0.00 ? 84  TYR A HD1  4  
ATOM 7161  H HD2  . TYR A 1 84  ? -0.022  3.511   5.683   1.00 0.00 ? 84  TYR A HD2  4  
ATOM 7162  H HE1  . TYR A 1 84  ? 0.902   4.923   1.007   1.00 0.00 ? 84  TYR A HE1  4  
ATOM 7163  H HE2  . TYR A 1 84  ? -1.768  4.767   4.328   1.00 0.00 ? 84  TYR A HE2  4  
ATOM 7164  H HH   . TYR A 1 84  ? -1.835  4.955   1.211   1.00 0.00 ? 84  TYR A HH   4  
ATOM 7165  N N    . LEU A 1 85  ? 5.311   2.833   3.444   1.00 0.00 ? 85  LEU A N    4  
ATOM 7166  C CA   . LEU A 1 85  ? 6.047   2.917   2.193   1.00 0.00 ? 85  LEU A CA   4  
ATOM 7167  C C    . LEU A 1 85  ? 5.180   2.365   1.059   1.00 0.00 ? 85  LEU A C    4  
ATOM 7168  O O    . LEU A 1 85  ? 5.629   2.274   -0.082  1.00 0.00 ? 85  LEU A O    4  
ATOM 7169  C CB   . LEU A 1 85  ? 7.405   2.226   2.322   1.00 0.00 ? 85  LEU A CB   4  
ATOM 7170  C CG   . LEU A 1 85  ? 7.375   0.777   2.814   1.00 0.00 ? 85  LEU A CG   4  
ATOM 7171  C CD1  . LEU A 1 85  ? 7.495   0.713   4.338   1.00 0.00 ? 85  LEU A CD1  4  
ATOM 7172  C CD2  . LEU A 1 85  ? 6.129   0.051   2.305   1.00 0.00 ? 85  LEU A CD2  4  
ATOM 7173  H H    . LEU A 1 85  ? 5.503   2.019   3.993   1.00 0.00 ? 85  LEU A H    4  
ATOM 7174  H HA   . LEU A 1 85  ? 6.238   3.972   1.999   1.00 0.00 ? 85  LEU A HA   4  
ATOM 7175  H HB2  . LEU A 1 85  ? 7.895   2.248   1.349   1.00 0.00 ? 85  LEU A HB2  4  
ATOM 7176  H HB3  . LEU A 1 85  ? 8.023   2.808   3.004   1.00 0.00 ? 85  LEU A HB3  4  
ATOM 7177  H HG   . LEU A 1 85  ? 8.241   0.258   2.401   1.00 0.00 ? 85  LEU A HG   4  
ATOM 7178  H HD11 . LEU A 1 85  ? 7.839   1.676   4.716   1.00 0.00 ? 85  LEU A HD11 4  
ATOM 7179  H HD12 . LEU A 1 85  ? 6.521   0.479   4.769   1.00 0.00 ? 85  LEU A HD12 4  
ATOM 7180  H HD13 . LEU A 1 85  ? 8.210   -0.062  4.614   1.00 0.00 ? 85  LEU A HD13 4  
ATOM 7181  H HD21 . LEU A 1 85  ? 5.237   0.574   2.652   1.00 0.00 ? 85  LEU A HD21 4  
ATOM 7182  H HD22 . LEU A 1 85  ? 6.139   0.031   1.215   1.00 0.00 ? 85  LEU A HD22 4  
ATOM 7183  H HD23 . LEU A 1 85  ? 6.122   -0.970  2.688   1.00 0.00 ? 85  LEU A HD23 4  
ATOM 7184  N N    . ILE A 1 86  ? 3.953   2.012   1.413   1.00 0.00 ? 86  ILE A N    4  
ATOM 7185  C CA   . ILE A 1 86  ? 3.020   1.472   0.440   1.00 0.00 ? 86  ILE A CA   4  
ATOM 7186  C C    . ILE A 1 86  ? 3.762   1.183   -0.866  1.00 0.00 ? 86  ILE A C    4  
ATOM 7187  O O    . ILE A 1 86  ? 4.066   2.100   -1.628  1.00 0.00 ? 86  ILE A O    4  
ATOM 7188  C CB   . ILE A 1 86  ? 1.820   2.406   0.272   1.00 0.00 ? 86  ILE A CB   4  
ATOM 7189  C CG1  . ILE A 1 86  ? 0.569   1.815   0.923   1.00 0.00 ? 86  ILE A CG1  4  
ATOM 7190  C CG2  . ILE A 1 86  ? 1.592   2.746   -1.203  1.00 0.00 ? 86  ILE A CG2  4  
ATOM 7191  C CD1  . ILE A 1 86  ? 0.860   1.356   2.354   1.00 0.00 ? 86  ILE A CD1  4  
ATOM 7192  H H    . ILE A 1 86  ? 3.595   2.090   2.344   1.00 0.00 ? 86  ILE A H    4  
ATOM 7193  H HA   . ILE A 1 86  ? 2.641   0.531   0.838   1.00 0.00 ? 86  ILE A HA   4  
ATOM 7194  H HB   . ILE A 1 86  ? 2.040   3.341   0.786   1.00 0.00 ? 86  ILE A HB   4  
ATOM 7195  H HG12 . ILE A 1 86  ? -0.228  2.559   0.931   1.00 0.00 ? 86  ILE A HG12 4  
ATOM 7196  H HG13 . ILE A 1 86  ? 0.211   0.971   0.333   1.00 0.00 ? 86  ILE A HG13 4  
ATOM 7197  H HG21 . ILE A 1 86  ? 1.778   1.861   -1.812  1.00 0.00 ? 86  ILE A HG21 4  
ATOM 7198  H HG22 . ILE A 1 86  ? 0.563   3.075   -1.345  1.00 0.00 ? 86  ILE A HG22 4  
ATOM 7199  H HG23 . ILE A 1 86  ? 2.274   3.542   -1.501  1.00 0.00 ? 86  ILE A HG23 4  
ATOM 7200  H HD11 . ILE A 1 86  ? 1.892   1.594   2.607   1.00 0.00 ? 86  ILE A HD11 4  
ATOM 7201  H HD12 . ILE A 1 86  ? 0.189   1.870   3.043   1.00 0.00 ? 86  ILE A HD12 4  
ATOM 7202  H HD13 . ILE A 1 86  ? 0.705   0.280   2.428   1.00 0.00 ? 86  ILE A HD13 4  
ATOM 7203  N N    . ALA A 1 87  ? 4.033   -0.096  -1.086  1.00 0.00 ? 87  ALA A N    4  
ATOM 7204  C CA   . ALA A 1 87  ? 4.734   -0.517  -2.287  1.00 0.00 ? 87  ALA A CA   4  
ATOM 7205  C C    . ALA A 1 87  ? 3.955   -1.650  -2.957  1.00 0.00 ? 87  ALA A C    4  
ATOM 7206  O O    . ALA A 1 87  ? 3.861   -2.750  -2.413  1.00 0.00 ? 87  ALA A O    4  
ATOM 7207  C CB   . ALA A 1 87  ? 6.164   -0.925  -1.927  1.00 0.00 ? 87  ALA A CB   4  
ATOM 7208  H H    . ALA A 1 87  ? 3.782   -0.835  -0.461  1.00 0.00 ? 87  ALA A H    4  
ATOM 7209  H HA   . ALA A 1 87  ? 4.773   0.336   -2.965  1.00 0.00 ? 87  ALA A HA   4  
ATOM 7210  H HB1  . ALA A 1 87  ? 6.247   -1.040  -0.846  1.00 0.00 ? 87  ALA A HB1  4  
ATOM 7211  H HB2  . ALA A 1 87  ? 6.404   -1.872  -2.411  1.00 0.00 ? 87  ALA A HB2  4  
ATOM 7212  H HB3  . ALA A 1 87  ? 6.858   -0.156  -2.266  1.00 0.00 ? 87  ALA A HB3  4  
ATOM 7213  N N    . GLY A 1 88  ? 3.415   -1.344  -4.126  1.00 0.00 ? 88  GLY A N    4  
ATOM 7214  C CA   . GLY A 1 88  ? 2.646   -2.323  -4.876  1.00 0.00 ? 88  GLY A CA   4  
ATOM 7215  C C    . GLY A 1 88  ? 2.846   -2.141  -6.382  1.00 0.00 ? 88  GLY A C    4  
ATOM 7216  O O    . GLY A 1 88  ? 3.612   -1.280  -6.810  1.00 0.00 ? 88  GLY A O    4  
ATOM 7217  H H    . GLY A 1 88  ? 3.495   -0.447  -4.562  1.00 0.00 ? 88  GLY A H    4  
ATOM 7218  H HA2  . GLY A 1 88  ? 2.949   -3.328  -4.584  1.00 0.00 ? 88  GLY A HA2  4  
ATOM 7219  H HA3  . GLY A 1 88  ? 1.589   -2.225  -4.631  1.00 0.00 ? 88  GLY A HA3  4  
ATOM 7220  N N    . LYS A 1 89  ? 2.144   -2.966  -7.144  1.00 0.00 ? 89  LYS A N    4  
ATOM 7221  C CA   . LYS A 1 89  ? 2.234   -2.907  -8.593  1.00 0.00 ? 89  LYS A CA   4  
ATOM 7222  C C    . LYS A 1 89  ? 1.978   -1.472  -9.057  1.00 0.00 ? 89  LYS A C    4  
ATOM 7223  O O    . LYS A 1 89  ? 2.482   -1.054  -10.098 1.00 0.00 ? 89  LYS A O    4  
ATOM 7224  C CB   . LYS A 1 89  ? 1.298   -3.937  -9.231  1.00 0.00 ? 89  LYS A CB   4  
ATOM 7225  C CG   . LYS A 1 89  ? 1.305   -5.247  -8.441  1.00 0.00 ? 89  LYS A CG   4  
ATOM 7226  C CD   . LYS A 1 89  ? 0.954   -6.432  -9.342  1.00 0.00 ? 89  LYS A CD   4  
ATOM 7227  C CE   . LYS A 1 89  ? -0.063  -7.354  -8.665  1.00 0.00 ? 89  LYS A CE   4  
ATOM 7228  N NZ   . LYS A 1 89  ? -0.146  -8.647  -9.378  1.00 0.00 ? 89  LYS A NZ   4  
ATOM 7229  H H    . LYS A 1 89  ? 1.522   -3.664  -6.788  1.00 0.00 ? 89  LYS A H    4  
ATOM 7230  H HA   . LYS A 1 89  ? 3.252   -3.183  -8.868  1.00 0.00 ? 89  LYS A HA   4  
ATOM 7231  H HB2  . LYS A 1 89  ? 0.285   -3.537  -9.271  1.00 0.00 ? 89  LYS A HB2  4  
ATOM 7232  H HB3  . LYS A 1 89  ? 1.607   -4.126  -10.258 1.00 0.00 ? 89  LYS A HB3  4  
ATOM 7233  H HG2  . LYS A 1 89  ? 2.288   -5.403  -7.995  1.00 0.00 ? 89  LYS A HG2  4  
ATOM 7234  H HG3  . LYS A 1 89  ? 0.589   -5.185  -7.620  1.00 0.00 ? 89  LYS A HG3  4  
ATOM 7235  H HD2  . LYS A 1 89  ? 0.548   -6.068  -10.286 1.00 0.00 ? 89  LYS A HD2  4  
ATOM 7236  H HD3  . LYS A 1 89  ? 1.857   -6.994  -9.578  1.00 0.00 ? 89  LYS A HD3  4  
ATOM 7237  H HE2  . LYS A 1 89  ? 0.225   -7.522  -7.627  1.00 0.00 ? 89  LYS A HE2  4  
ATOM 7238  H HE3  . LYS A 1 89  ? -1.043  -6.876  -8.651  1.00 0.00 ? 89  LYS A HE3  4  
ATOM 7239  H HZ1  . LYS A 1 89  ? -0.381  -8.485  -10.337 1.00 0.00 ? 89  LYS A HZ1  4  
ATOM 7240  H HZ2  . LYS A 1 89  ? 0.736   -9.114  -9.326  1.00 0.00 ? 89  LYS A HZ2  4  
ATOM 7241  H HZ3  . LYS A 1 89  ? -0.850  -9.217  -8.955  1.00 0.00 ? 89  LYS A HZ3  4  
ATOM 7242  N N    . ALA A 1 90  ? 1.193   -0.759  -8.263  1.00 0.00 ? 90  ALA A N    4  
ATOM 7243  C CA   . ALA A 1 90  ? 0.864   0.621   -8.581  1.00 0.00 ? 90  ALA A CA   4  
ATOM 7244  C C    . ALA A 1 90  ? -0.202  0.647   -9.678  1.00 0.00 ? 90  ALA A C    4  
ATOM 7245  O O    . ALA A 1 90  ? -0.574  -0.397  -10.213 1.00 0.00 ? 90  ALA A O    4  
ATOM 7246  C CB   . ALA A 1 90  ? 2.135   1.370   -8.984  1.00 0.00 ? 90  ALA A CB   4  
ATOM 7247  H H    . ALA A 1 90  ? 0.786   -1.107  -7.419  1.00 0.00 ? 90  ALA A H    4  
ATOM 7248  H HA   . ALA A 1 90  ? 0.456   1.079   -7.680  1.00 0.00 ? 90  ALA A HA   4  
ATOM 7249  H HB1  . ALA A 1 90  ? 2.993   0.703   -8.897  1.00 0.00 ? 90  ALA A HB1  4  
ATOM 7250  H HB2  . ALA A 1 90  ? 2.043   1.711   -10.016 1.00 0.00 ? 90  ALA A HB2  4  
ATOM 7251  H HB3  . ALA A 1 90  ? 2.274   2.229   -8.328  1.00 0.00 ? 90  ALA A HB3  4  
ATOM 7252  N N    . GLU A 1 91  ? -0.664  1.850   -9.982  1.00 0.00 ? 91  GLU A N    4  
ATOM 7253  C CA   . GLU A 1 91  ? -1.679  2.026   -11.006 1.00 0.00 ? 91  GLU A CA   4  
ATOM 7254  C C    . GLU A 1 91  ? -1.303  3.182   -11.934 1.00 0.00 ? 91  GLU A C    4  
ATOM 7255  O O    . GLU A 1 91  ? -2.091  3.577   -12.792 1.00 0.00 ? 91  GLU A O    4  
ATOM 7256  C CB   . GLU A 1 91  ? -3.057  2.252   -10.380 1.00 0.00 ? 91  GLU A CB   4  
ATOM 7257  C CG   . GLU A 1 91  ? -4.169  1.759   -11.307 1.00 0.00 ? 91  GLU A CG   4  
ATOM 7258  C CD   . GLU A 1 91  ? -3.946  0.298   -11.705 1.00 0.00 ? 91  GLU A CD   4  
ATOM 7259  O OE1  . GLU A 1 91  ? -3.520  -0.473  -10.816 1.00 0.00 ? 91  GLU A OE1  4  
ATOM 7260  O OE2  . GLU A 1 91  ? -4.204  -0.015  -12.886 1.00 0.00 ? 91  GLU A OE2  4  
ATOM 7261  H H    . GLU A 1 91  ? -0.357  2.695   -9.542  1.00 0.00 ? 91  GLU A H    4  
ATOM 7262  H HA   . GLU A 1 91  ? -1.691  1.091   -11.566 1.00 0.00 ? 91  GLU A HA   4  
ATOM 7263  H HB2  . GLU A 1 91  ? -3.117  1.729   -9.425  1.00 0.00 ? 91  GLU A HB2  4  
ATOM 7264  H HB3  . GLU A 1 91  ? -3.197  3.312   -10.170 1.00 0.00 ? 91  GLU A HB3  4  
ATOM 7265  H HG2  . GLU A 1 91  ? -5.134  1.861   -10.812 1.00 0.00 ? 91  GLU A HG2  4  
ATOM 7266  H HG3  . GLU A 1 91  ? -4.204  2.381   -12.202 1.00 0.00 ? 91  GLU A HG3  4  
ATOM 7267  N N    . GLY A 1 92  ? -0.098  3.696   -11.729 1.00 0.00 ? 92  GLY A N    4  
ATOM 7268  C CA   . GLY A 1 92  ? 0.392   4.799   -12.537 1.00 0.00 ? 92  GLY A CA   4  
ATOM 7269  C C    . GLY A 1 92  ? 0.890   5.945   -11.654 1.00 0.00 ? 92  GLY A C    4  
ATOM 7270  O O    . GLY A 1 92  ? 1.811   5.767   -10.859 1.00 0.00 ? 92  GLY A O    4  
ATOM 7271  H H    . GLY A 1 92  ? 0.536   3.370   -11.029 1.00 0.00 ? 92  GLY A H    4  
ATOM 7272  H HA2  . GLY A 1 92  ? 1.201   4.453   -13.180 1.00 0.00 ? 92  GLY A HA2  4  
ATOM 7273  H HA3  . GLY A 1 92  ? -0.403  5.158   -13.191 1.00 0.00 ? 92  GLY A HA3  4  
ATOM 7274  N N    . ASP A 1 93  ? 0.258   7.097   -11.824 1.00 0.00 ? 93  ASP A N    4  
ATOM 7275  C CA   . ASP A 1 93  ? 0.626   8.273   -11.052 1.00 0.00 ? 93  ASP A CA   4  
ATOM 7276  C C    . ASP A 1 93  ? -0.638  8.913   -10.473 1.00 0.00 ? 93  ASP A C    4  
ATOM 7277  O O    . ASP A 1 93  ? -1.689  8.909   -11.111 1.00 0.00 ? 93  ASP A O    4  
ATOM 7278  C CB   . ASP A 1 93  ? 1.322   9.313   -11.931 1.00 0.00 ? 93  ASP A CB   4  
ATOM 7279  C CG   . ASP A 1 93  ? 2.659   8.868   -12.525 1.00 0.00 ? 93  ASP A CG   4  
ATOM 7280  O OD1  . ASP A 1 93  ? 2.978   7.669   -12.369 1.00 0.00 ? 93  ASP A OD1  4  
ATOM 7281  O OD2  . ASP A 1 93  ? 3.333   9.735   -13.120 1.00 0.00 ? 93  ASP A OD2  4  
ATOM 7282  H H    . ASP A 1 93  ? -0.491  7.235   -12.471 1.00 0.00 ? 93  ASP A H    4  
ATOM 7283  H HA   . ASP A 1 93  ? 1.301   7.908   -10.278 1.00 0.00 ? 93  ASP A HA   4  
ATOM 7284  H HB2  . ASP A 1 93  ? 0.652   9.585   -12.747 1.00 0.00 ? 93  ASP A HB2  4  
ATOM 7285  H HB3  . ASP A 1 93  ? 1.486   10.215  -11.341 1.00 0.00 ? 93  ASP A HB3  4  
ATOM 7286  N N    . GLY A 1 94  ? -0.494  9.447   -9.269  1.00 0.00 ? 94  GLY A N    4  
ATOM 7287  C CA   . GLY A 1 94  ? -1.610  10.089  -8.597  1.00 0.00 ? 94  GLY A CA   4  
ATOM 7288  C C    . GLY A 1 94  ? -2.562  9.051   -8.001  1.00 0.00 ? 94  GLY A C    4  
ATOM 7289  O O    . GLY A 1 94  ? -3.541  9.405   -7.345  1.00 0.00 ? 94  GLY A O    4  
ATOM 7290  H H    . GLY A 1 94  ? 0.365   9.446   -8.756  1.00 0.00 ? 94  GLY A H    4  
ATOM 7291  H HA2  . GLY A 1 94  ? -1.237  10.741  -7.807  1.00 0.00 ? 94  GLY A HA2  4  
ATOM 7292  H HA3  . GLY A 1 94  ? -2.150  10.721  -9.302  1.00 0.00 ? 94  GLY A HA3  4  
ATOM 7293  N N    . LYS A 1 95  ? -2.242  7.790   -8.250  1.00 0.00 ? 95  LYS A N    4  
ATOM 7294  C CA   . LYS A 1 95  ? -3.057  6.697   -7.747  1.00 0.00 ? 95  LYS A CA   4  
ATOM 7295  C C    . LYS A 1 95  ? -2.377  5.366   -8.075  1.00 0.00 ? 95  LYS A C    4  
ATOM 7296  O O    . LYS A 1 95  ? -1.711  5.241   -9.101  1.00 0.00 ? 95  LYS A O    4  
ATOM 7297  C CB   . LYS A 1 95  ? -4.486  6.805   -8.280  1.00 0.00 ? 95  LYS A CB   4  
ATOM 7298  C CG   . LYS A 1 95  ? -4.603  6.174   -9.669  1.00 0.00 ? 95  LYS A CG   4  
ATOM 7299  C CD   . LYS A 1 95  ? -3.863  7.010   -10.715 1.00 0.00 ? 95  LYS A CD   4  
ATOM 7300  C CE   . LYS A 1 95  ? -4.398  8.444   -10.750 1.00 0.00 ? 95  LYS A CE   4  
ATOM 7301  N NZ   . LYS A 1 95  ? -5.878  8.442   -10.802 1.00 0.00 ? 95  LYS A NZ   4  
ATOM 7302  H H    . LYS A 1 95  ? -1.444  7.510   -8.784  1.00 0.00 ? 95  LYS A H    4  
ATOM 7303  H HA   . LYS A 1 95  ? -3.109  6.800   -6.662  1.00 0.00 ? 95  LYS A HA   4  
ATOM 7304  H HB2  . LYS A 1 95  ? -5.174  6.310   -7.593  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 7305  H HB3  . LYS A 1 95  ? -4.783  7.853   -8.326  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 7306  H HG2  . LYS A 1 95  ? -4.192  5.165   -9.649  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 7307  H HG3  . LYS A 1 95  ? -5.654  6.085   -9.945  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 7308  H HD2  . LYS A 1 95  ? -2.796  7.022   -10.488 1.00 0.00 ? 95  LYS A HD2  4  
ATOM 7309  H HD3  . LYS A 1 95  ? -3.975  6.552   -11.697 1.00 0.00 ? 95  LYS A HD3  4  
ATOM 7310  H HE2  . LYS A 1 95  ? -4.060  8.986   -9.866  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 7311  H HE3  . LYS A 1 95  ? -3.998  8.966   -11.617 1.00 0.00 ? 95  LYS A HE3  4  
ATOM 7312  H HZ1  . LYS A 1 95  ? -6.187  7.787   -11.492 1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 7313  H HZ2  . LYS A 1 95  ? -6.243  8.183   -9.908  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 7314  H HZ3  . LYS A 1 95  ? -6.203  9.358   -11.042 1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 7315  N N    . MET A 1 96  ? -2.568  4.404   -7.183  1.00 0.00 ? 96  MET A N    4  
ATOM 7316  C CA   . MET A 1 96  ? -1.982  3.088   -7.365  1.00 0.00 ? 96  MET A CA   4  
ATOM 7317  C C    . MET A 1 96  ? -2.855  2.006   -6.725  1.00 0.00 ? 96  MET A C    4  
ATOM 7318  O O    . MET A 1 96  ? -3.986  2.273   -6.324  1.00 0.00 ? 96  MET A O    4  
ATOM 7319  C CB   . MET A 1 96  ? -0.588  3.058   -6.735  1.00 0.00 ? 96  MET A CB   4  
ATOM 7320  C CG   . MET A 1 96  ? -0.508  4.004   -5.535  1.00 0.00 ? 96  MET A CG   4  
ATOM 7321  S SD   . MET A 1 96  ? 0.212   3.159   -4.137  1.00 0.00 ? 96  MET A SD   4  
ATOM 7322  C CE   . MET A 1 96  ? 1.710   4.110   -3.939  1.00 0.00 ? 96  MET A CE   4  
ATOM 7323  H H    . MET A 1 96  ? -3.112  4.514   -6.350  1.00 0.00 ? 96  MET A H    4  
ATOM 7324  H HA   . MET A 1 96  ? -1.933  2.936   -8.443  1.00 0.00 ? 96  MET A HA   4  
ATOM 7325  H HB2  . MET A 1 96  ? -0.350  2.043   -6.418  1.00 0.00 ? 96  MET A HB2  4  
ATOM 7326  H HB3  . MET A 1 96  ? 0.157   3.343   -7.477  1.00 0.00 ? 96  MET A HB3  4  
ATOM 7327  H HG2  . MET A 1 96  ? 0.089   4.879   -5.790  1.00 0.00 ? 96  MET A HG2  4  
ATOM 7328  H HG3  . MET A 1 96  ? -1.505  4.364   -5.278  1.00 0.00 ? 96  MET A HG3  4  
ATOM 7329  H HE1  . MET A 1 96  ? 1.890   4.696   -4.840  1.00 0.00 ? 96  MET A HE1  4  
ATOM 7330  H HE2  . MET A 1 96  ? 1.604   4.780   -3.085  1.00 0.00 ? 96  MET A HE2  4  
ATOM 7331  H HE3  . MET A 1 96  ? 2.549   3.436   -3.770  1.00 0.00 ? 96  MET A HE3  4  
ATOM 7332  N N    . HIS A 1 97  ? -2.296  0.808   -6.651  1.00 0.00 ? 97  HIS A N    4  
ATOM 7333  C CA   . HIS A 1 97  ? -3.010  -0.316  -6.069  1.00 0.00 ? 97  HIS A CA   4  
ATOM 7334  C C    . HIS A 1 97  ? -2.164  -0.938  -4.954  1.00 0.00 ? 97  HIS A C    4  
ATOM 7335  O O    . HIS A 1 97  ? -0.979  -1.203  -5.144  1.00 0.00 ? 97  HIS A O    4  
ATOM 7336  C CB   . HIS A 1 97  ? -3.405  -1.328  -7.146  1.00 0.00 ? 97  HIS A CB   4  
ATOM 7337  C CG   . HIS A 1 97  ? -4.888  -1.376  -7.429  1.00 0.00 ? 97  HIS A CG   4  
ATOM 7338  N ND1  . HIS A 1 97  ? -5.428  -2.093  -8.482  1.00 0.00 ? 97  HIS A ND1  4  
ATOM 7339  C CD2  . HIS A 1 97  ? -5.937  -0.789  -6.784  1.00 0.00 ? 97  HIS A CD2  4  
ATOM 7340  C CE1  . HIS A 1 97  ? -6.743  -1.937  -8.462  1.00 0.00 ? 97  HIS A CE1  4  
ATOM 7341  N NE2  . HIS A 1 97  ? -7.056  -1.129  -7.410  1.00 0.00 ? 97  HIS A NE2  4  
ATOM 7342  H H    . HIS A 1 97  ? -1.375  0.598   -6.981  1.00 0.00 ? 97  HIS A H    4  
ATOM 7343  H HA   . HIS A 1 97  ? -3.925  0.085   -5.636  1.00 0.00 ? 97  HIS A HA   4  
ATOM 7344  H HB2  . HIS A 1 97  ? -2.878  -1.085  -8.069  1.00 0.00 ? 97  HIS A HB2  4  
ATOM 7345  H HB3  . HIS A 1 97  ? -3.071  -2.319  -6.840  1.00 0.00 ? 97  HIS A HB3  4  
ATOM 7346  H HD1  . HIS A 1 97  ? -4.912  -2.635  -9.145  1.00 0.00 ? 97  HIS A HD1  4  
ATOM 7347  H HD2  . HIS A 1 97  ? -5.867  -0.150  -5.904  1.00 0.00 ? 97  HIS A HD2  4  
ATOM 7348  H HE1  . HIS A 1 97  ? -7.450  -2.378  -9.166  1.00 0.00 ? 97  HIS A HE1  4  
ATOM 7349  N N    . ILE A 1 98  ? -2.809  -1.152  -3.816  1.00 0.00 ? 98  ILE A N    4  
ATOM 7350  C CA   . ILE A 1 98  ? -2.132  -1.737  -2.672  1.00 0.00 ? 98  ILE A CA   4  
ATOM 7351  C C    . ILE A 1 98  ? -3.106  -2.644  -1.918  1.00 0.00 ? 98  ILE A C    4  
ATOM 7352  O O    . ILE A 1 98  ? -4.267  -2.289  -1.722  1.00 0.00 ? 98  ILE A O    4  
ATOM 7353  C CB   . ILE A 1 98  ? -1.510  -0.643  -1.800  1.00 0.00 ? 98  ILE A CB   4  
ATOM 7354  C CG1  . ILE A 1 98  ? -2.593  0.214   -1.142  1.00 0.00 ? 98  ILE A CG1  4  
ATOM 7355  C CG2  . ILE A 1 98  ? -0.520  0.201   -2.604  1.00 0.00 ? 98  ILE A CG2  4  
ATOM 7356  C CD1  . ILE A 1 98  ? -1.976  1.406   -0.407  1.00 0.00 ? 98  ILE A CD1  4  
ATOM 7357  H H    . ILE A 1 98  ? -3.774  -0.933  -3.670  1.00 0.00 ? 98  ILE A H    4  
ATOM 7358  H HA   . ILE A 1 98  ? -1.315  -2.349  -3.053  1.00 0.00 ? 98  ILE A HA   4  
ATOM 7359  H HB   . ILE A 1 98  ? -0.948  -1.124  -0.999  1.00 0.00 ? 98  ILE A HB   4  
ATOM 7360  H HG12 . ILE A 1 98  ? -3.291  0.569   -1.899  1.00 0.00 ? 98  ILE A HG12 4  
ATOM 7361  H HG13 . ILE A 1 98  ? -3.166  -0.393  -0.440  1.00 0.00 ? 98  ILE A HG13 4  
ATOM 7362  H HG21 . ILE A 1 98  ? -0.024  -0.427  -3.344  1.00 0.00 ? 98  ILE A HG21 4  
ATOM 7363  H HG22 . ILE A 1 98  ? -1.055  1.005   -3.110  1.00 0.00 ? 98  ILE A HG22 4  
ATOM 7364  H HG23 . ILE A 1 98  ? 0.225   0.626   -1.931  1.00 0.00 ? 98  ILE A HG23 4  
ATOM 7365  H HD11 . ILE A 1 98  ? -1.079  1.734   -0.935  1.00 0.00 ? 98  ILE A HD11 4  
ATOM 7366  H HD12 . ILE A 1 98  ? -2.697  2.224   -0.374  1.00 0.00 ? 98  ILE A HD12 4  
ATOM 7367  H HD13 . ILE A 1 98  ? -1.714  1.112   0.609   1.00 0.00 ? 98  ILE A HD13 4  
ATOM 7368  N N    . THR A 1 99  ? -2.598  -3.800  -1.516  1.00 0.00 ? 99  THR A N    4  
ATOM 7369  C CA   . THR A 1 99  ? -3.408  -4.761  -0.788  1.00 0.00 ? 99  THR A CA   4  
ATOM 7370  C C    . THR A 1 99  ? -2.603  -5.379  0.358   1.00 0.00 ? 99  THR A C    4  
ATOM 7371  O O    . THR A 1 99  ? -1.374  -5.323  0.359   1.00 0.00 ? 99  THR A O    4  
ATOM 7372  C CB   . THR A 1 99  ? -3.930  -5.794  -1.788  1.00 0.00 ? 99  THR A CB   4  
ATOM 7373  O OG1  . THR A 1 99  ? -2.943  -5.811  -2.816  1.00 0.00 ? 99  THR A OG1  4  
ATOM 7374  C CG2  . THR A 1 99  ? -5.202  -5.328  -2.500  1.00 0.00 ? 99  THR A CG2  4  
ATOM 7375  H H    . THR A 1 99  ? -1.653  -4.083  -1.679  1.00 0.00 ? 99  THR A H    4  
ATOM 7376  H HA   . THR A 1 99  ? -4.249  -4.232  -0.338  1.00 0.00 ? 99  THR A HA   4  
ATOM 7377  H HB   . THR A 1 99  ? -4.085  -6.760  -1.307  1.00 0.00 ? 99  THR A HB   4  
ATOM 7378  H HG1  . THR A 1 99  ? -2.887  -6.723  -3.221  1.00 0.00 ? 99  THR A HG1  4  
ATOM 7379  H HG21 . THR A 1 99  ? -5.413  -4.294  -2.228  1.00 0.00 ? 99  THR A HG21 4  
ATOM 7380  H HG22 . THR A 1 99  ? -5.061  -5.398  -3.579  1.00 0.00 ? 99  THR A HG22 4  
ATOM 7381  H HG23 . THR A 1 99  ? -6.038  -5.960  -2.201  1.00 0.00 ? 99  THR A HG23 4  
ATOM 7382  N N    . LEU A 1 100 ? -3.328  -5.956  1.305   1.00 0.00 ? 100 LEU A N    4  
ATOM 7383  C CA   . LEU A 1 100 ? -2.697  -6.583  2.453   1.00 0.00 ? 100 LEU A CA   4  
ATOM 7384  C C    . LEU A 1 100 ? -1.704  -7.641  1.970   1.00 0.00 ? 100 LEU A C    4  
ATOM 7385  O O    . LEU A 1 100 ? -0.579  -7.712  2.460   1.00 0.00 ? 100 LEU A O    4  
ATOM 7386  C CB   . LEU A 1 100 ? -3.754  -7.126  3.416   1.00 0.00 ? 100 LEU A CB   4  
ATOM 7387  C CG   . LEU A 1 100 ? -4.201  -8.570  3.176   1.00 0.00 ? 100 LEU A CG   4  
ATOM 7388  C CD1  . LEU A 1 100 ? -4.669  -9.223  4.478   1.00 0.00 ? 100 LEU A CD1  4  
ATOM 7389  C CD2  . LEU A 1 100 ? -5.270  -8.639  2.084   1.00 0.00 ? 100 LEU A CD2  4  
ATOM 7390  H H    . LEU A 1 100 ? -4.327  -5.997  1.297   1.00 0.00 ? 100 LEU A H    4  
ATOM 7391  H HA   . LEU A 1 100 ? -2.144  -5.808  2.986   1.00 0.00 ? 100 LEU A HA   4  
ATOM 7392  H HB2  . LEU A 1 100 ? -3.367  -7.051  4.431   1.00 0.00 ? 100 LEU A HB2  4  
ATOM 7393  H HB3  . LEU A 1 100 ? -4.632  -6.482  3.362   1.00 0.00 ? 100 LEU A HB3  4  
ATOM 7394  H HG   . LEU A 1 100 ? -3.342  -9.139  2.821   1.00 0.00 ? 100 LEU A HG   4  
ATOM 7395  H HD11 . LEU A 1 100 ? -4.909  -8.449  5.206   1.00 0.00 ? 100 LEU A HD11 4  
ATOM 7396  H HD12 . LEU A 1 100 ? -5.556  -9.827  4.283   1.00 0.00 ? 100 LEU A HD12 4  
ATOM 7397  H HD13 . LEU A 1 100 ? -3.876  -9.858  4.872   1.00 0.00 ? 100 LEU A HD13 4  
ATOM 7398  H HD21 . LEU A 1 100 ? -5.224  -7.738  1.472   1.00 0.00 ? 100 LEU A HD21 4  
ATOM 7399  H HD22 . LEU A 1 100 ? -5.094  -9.513  1.456   1.00 0.00 ? 100 LEU A HD22 4  
ATOM 7400  H HD23 . LEU A 1 100 ? -6.255  -8.715  2.544   1.00 0.00 ? 100 LEU A HD23 4  
ATOM 7401  N N    . CYS A 1 101 ? -2.157  -8.437  1.011   1.00 0.00 ? 101 CYS A N    4  
ATOM 7402  C CA   . CYS A 1 101 ? -1.322  -9.489  0.455   1.00 0.00 ? 101 CYS A CA   4  
ATOM 7403  C C    . CYS A 1 101 ? -0.117  -8.836  -0.223  1.00 0.00 ? 101 CYS A C    4  
ATOM 7404  O O    . CYS A 1 101 ? 0.971   -9.408  -0.247  1.00 0.00 ? 101 CYS A O    4  
ATOM 7405  C CB   . CYS A 1 101 ? -2.106  -10.382 -0.508  1.00 0.00 ? 101 CYS A CB   4  
ATOM 7406  S SG   . CYS A 1 101 ? -1.693  -12.163 -0.412  1.00 0.00 ? 101 CYS A SG   4  
ATOM 7407  H H    . CYS A 1 101 ? -3.074  -8.372  0.618   1.00 0.00 ? 101 CYS A H    4  
ATOM 7408  H HA   . CYS A 1 101 ? -1.006  -10.113 1.292   1.00 0.00 ? 101 CYS A HA   4  
ATOM 7409  H HB2  . CYS A 1 101 ? -3.171  -10.260 -0.311  1.00 0.00 ? 101 CYS A HB2  4  
ATOM 7410  H HB3  . CYS A 1 101 ? -1.929  -10.037 -1.527  1.00 0.00 ? 101 CYS A HB3  4  
ATOM 7411  N N    . ASP A 1 102 ? -0.351  -7.647  -0.760  1.00 0.00 ? 102 ASP A N    4  
ATOM 7412  C CA   . ASP A 1 102 ? 0.702   -6.911  -1.438  1.00 0.00 ? 102 ASP A CA   4  
ATOM 7413  C C    . ASP A 1 102 ? 1.654   -6.317  -0.397  1.00 0.00 ? 102 ASP A C    4  
ATOM 7414  O O    . ASP A 1 102 ? 1.359   -6.329  0.797   1.00 0.00 ? 102 ASP A O    4  
ATOM 7415  C CB   . ASP A 1 102 ? 0.125   -5.759  -2.263  1.00 0.00 ? 102 ASP A CB   4  
ATOM 7416  C CG   . ASP A 1 102 ? 0.924   -5.400  -3.518  1.00 0.00 ? 102 ASP A CG   4  
ATOM 7417  O OD1  . ASP A 1 102 ? 1.976   -6.042  -3.724  1.00 0.00 ? 102 ASP A OD1  4  
ATOM 7418  O OD2  . ASP A 1 102 ? 0.464   -4.490  -4.242  1.00 0.00 ? 102 ASP A OD2  4  
ATOM 7419  H H    . ASP A 1 102 ? -1.239  -7.189  -0.736  1.00 0.00 ? 102 ASP A H    4  
ATOM 7420  H HA   . ASP A 1 102 ? 1.192   -7.640  -2.083  1.00 0.00 ? 102 ASP A HA   4  
ATOM 7421  H HB2  . ASP A 1 102 ? -0.891  -6.017  -2.559  1.00 0.00 ? 102 ASP A HB2  4  
ATOM 7422  H HB3  . ASP A 1 102 ? 0.058   -4.876  -1.628  1.00 0.00 ? 102 ASP A HB3  4  
ATOM 7423  N N    . PHE A 1 103 ? 2.776   -5.813  -0.888  1.00 0.00 ? 103 PHE A N    4  
ATOM 7424  C CA   . PHE A 1 103 ? 3.773   -5.217  -0.016  1.00 0.00 ? 103 PHE A CA   4  
ATOM 7425  C C    . PHE A 1 103 ? 3.291   -3.870  0.529   1.00 0.00 ? 103 PHE A C    4  
ATOM 7426  O O    . PHE A 1 103 ? 3.062   -2.933  -0.236  1.00 0.00 ? 103 PHE A O    4  
ATOM 7427  C CB   . PHE A 1 103 ? 5.029   -4.991  -0.860  1.00 0.00 ? 103 PHE A CB   4  
ATOM 7428  C CG   . PHE A 1 103 ? 6.044   -4.039  -0.224  1.00 0.00 ? 103 PHE A CG   4  
ATOM 7429  C CD1  . PHE A 1 103 ? 6.015   -3.811  1.116   1.00 0.00 ? 103 PHE A CD1  4  
ATOM 7430  C CD2  . PHE A 1 103 ? 6.976   -3.421  -0.999  1.00 0.00 ? 103 PHE A CD2  4  
ATOM 7431  C CE1  . PHE A 1 103 ? 6.958   -2.928  1.707   1.00 0.00 ? 103 PHE A CE1  4  
ATOM 7432  C CE2  . PHE A 1 103 ? 7.918   -2.538  -0.408  1.00 0.00 ? 103 PHE A CE2  4  
ATOM 7433  C CZ   . PHE A 1 103 ? 7.889   -2.311  0.932   1.00 0.00 ? 103 PHE A CZ   4  
ATOM 7434  H H    . PHE A 1 103 ? 3.008   -5.808  -1.861  1.00 0.00 ? 103 PHE A H    4  
ATOM 7435  H HA   . PHE A 1 103 ? 3.932   -5.906  0.813   1.00 0.00 ? 103 PHE A HA   4  
ATOM 7436  H HB2  . PHE A 1 103 ? 5.511   -5.951  -1.041  1.00 0.00 ? 103 PHE A HB2  4  
ATOM 7437  H HB3  . PHE A 1 103 ? 4.735   -4.594  -1.832  1.00 0.00 ? 103 PHE A HB3  4  
ATOM 7438  H HD1  . PHE A 1 103 ? 5.269   -4.306  1.737   1.00 0.00 ? 103 PHE A HD1  4  
ATOM 7439  H HD2  . PHE A 1 103 ? 6.999   -3.604  -2.073  1.00 0.00 ? 103 PHE A HD2  4  
ATOM 7440  H HE1  . PHE A 1 103 ? 6.935   -2.746  2.781   1.00 0.00 ? 103 PHE A HE1  4  
ATOM 7441  H HE2  . PHE A 1 103 ? 8.665   -2.043  -1.029  1.00 0.00 ? 103 PHE A HE2  4  
ATOM 7442  H HZ   . PHE A 1 103 ? 8.613   -1.633  1.386   1.00 0.00 ? 103 PHE A HZ   4  
ATOM 7443  N N    . ILE A 1 104 ? 3.149   -3.817  1.844   1.00 0.00 ? 104 ILE A N    4  
ATOM 7444  C CA   . ILE A 1 104 ? 2.697   -2.601  2.500   1.00 0.00 ? 104 ILE A CA   4  
ATOM 7445  C C    . ILE A 1 104 ? 2.976   -2.702  4.001   1.00 0.00 ? 104 ILE A C    4  
ATOM 7446  O O    . ILE A 1 104 ? 2.688   -3.724  4.621   1.00 0.00 ? 104 ILE A O    4  
ATOM 7447  C CB   . ILE A 1 104 ? 1.231   -2.324  2.163   1.00 0.00 ? 104 ILE A CB   4  
ATOM 7448  C CG1  . ILE A 1 104 ? 0.404   -3.610  2.216   1.00 0.00 ? 104 ILE A CG1  4  
ATOM 7449  C CG2  . ILE A 1 104 ? 1.102   -1.614  0.814   1.00 0.00 ? 104 ILE A CG2  4  
ATOM 7450  C CD1  . ILE A 1 104 ? -1.065  -3.331  1.890   1.00 0.00 ? 104 ILE A CD1  4  
ATOM 7451  H H    . ILE A 1 104 ? 3.337   -4.583  2.458   1.00 0.00 ? 104 ILE A H    4  
ATOM 7452  H HA   . ILE A 1 104 ? 3.283   -1.775  2.095   1.00 0.00 ? 104 ILE A HA   4  
ATOM 7453  H HB   . ILE A 1 104 ? 0.829   -1.652  2.920   1.00 0.00 ? 104 ILE A HB   4  
ATOM 7454  H HG12 . ILE A 1 104 ? 0.806   -4.334  1.506   1.00 0.00 ? 104 ILE A HG12 4  
ATOM 7455  H HG13 . ILE A 1 104 ? 0.483   -4.057  3.206   1.00 0.00 ? 104 ILE A HG13 4  
ATOM 7456  H HG21 . ILE A 1 104 ? 2.058   -1.162  0.549   1.00 0.00 ? 104 ILE A HG21 4  
ATOM 7457  H HG22 . ILE A 1 104 ? 0.818   -2.336  0.049   1.00 0.00 ? 104 ILE A HG22 4  
ATOM 7458  H HG23 . ILE A 1 104 ? 0.340   -0.838  0.883   1.00 0.00 ? 104 ILE A HG23 4  
ATOM 7459  H HD11 . ILE A 1 104 ? -1.389  -2.432  2.415   1.00 0.00 ? 104 ILE A HD11 4  
ATOM 7460  H HD12 . ILE A 1 104 ? -1.178  -3.187  0.816   1.00 0.00 ? 104 ILE A HD12 4  
ATOM 7461  H HD13 . ILE A 1 104 ? -1.674  -4.177  2.209   1.00 0.00 ? 104 ILE A HD13 4  
ATOM 7462  N N    . VAL A 1 105 ? 3.532   -1.628  4.542   1.00 0.00 ? 105 VAL A N    4  
ATOM 7463  C CA   . VAL A 1 105 ? 3.853   -1.583  5.958   1.00 0.00 ? 105 VAL A CA   4  
ATOM 7464  C C    . VAL A 1 105 ? 3.878   -0.126  6.424   1.00 0.00 ? 105 VAL A C    4  
ATOM 7465  O O    . VAL A 1 105 ? 4.055   0.785   5.617   1.00 0.00 ? 105 VAL A O    4  
ATOM 7466  C CB   . VAL A 1 105 ? 5.168   -2.319  6.220   1.00 0.00 ? 105 VAL A CB   4  
ATOM 7467  C CG1  . VAL A 1 105 ? 4.915   -3.685  6.861   1.00 0.00 ? 105 VAL A CG1  4  
ATOM 7468  C CG2  . VAL A 1 105 ? 5.984   -2.459  4.934   1.00 0.00 ? 105 VAL A CG2  4  
ATOM 7469  H H    . VAL A 1 105 ? 3.763   -0.801  4.029   1.00 0.00 ? 105 VAL A H    4  
ATOM 7470  H HA   . VAL A 1 105 ? 3.060   -2.109  6.490   1.00 0.00 ? 105 VAL A HA   4  
ATOM 7471  H HB   . VAL A 1 105 ? 5.751   -1.722  6.922   1.00 0.00 ? 105 VAL A HB   4  
ATOM 7472  H HG11 . VAL A 1 105 ? 4.360   -3.552  7.790   1.00 0.00 ? 105 VAL A HG11 4  
ATOM 7473  H HG12 . VAL A 1 105 ? 4.335   -4.304  6.177   1.00 0.00 ? 105 VAL A HG12 4  
ATOM 7474  H HG13 . VAL A 1 105 ? 5.868   -4.170  7.072   1.00 0.00 ? 105 VAL A HG13 4  
ATOM 7475  H HG21 . VAL A 1 105 ? 5.383   -2.962  4.176   1.00 0.00 ? 105 VAL A HG21 4  
ATOM 7476  H HG22 . VAL A 1 105 ? 6.269   -1.470  4.574   1.00 0.00 ? 105 VAL A HG22 4  
ATOM 7477  H HG23 . VAL A 1 105 ? 6.880   -3.046  5.134   1.00 0.00 ? 105 VAL A HG23 4  
ATOM 7478  N N    . PRO A 1 106 ? 3.693   0.052   7.760   1.00 0.00 ? 106 PRO A N    4  
ATOM 7479  C CA   . PRO A 1 106 ? 3.693   1.383   8.344   1.00 0.00 ? 106 PRO A CA   4  
ATOM 7480  C C    . PRO A 1 106 ? 5.115   1.944   8.431   1.00 0.00 ? 106 PRO A C    4  
ATOM 7481  O O    . PRO A 1 106 ? 5.337   2.990   9.038   1.00 0.00 ? 106 PRO A O    4  
ATOM 7482  C CB   . PRO A 1 106 ? 3.037   1.216   9.705   1.00 0.00 ? 106 PRO A CB   4  
ATOM 7483  C CG   . PRO A 1 106 ? 3.115   -0.268  10.025  1.00 0.00 ? 106 PRO A CG   4  
ATOM 7484  C CD   . PRO A 1 106 ? 3.480   -1.003  8.746   1.00 0.00 ? 106 PRO A CD   4  
ATOM 7485  H HA   . PRO A 1 106 ? 3.184   2.018   7.762   1.00 0.00 ? 106 PRO A HA   4  
ATOM 7486  H HB2  . PRO A 1 106 ? 3.552   1.807   10.462  1.00 0.00 ? 106 PRO A HB2  4  
ATOM 7487  H HB3  . PRO A 1 106 ? 2.002   1.556   9.683   1.00 0.00 ? 106 PRO A HB3  4  
ATOM 7488  H HG2  . PRO A 1 106 ? 3.861   -0.453  10.798  1.00 0.00 ? 106 PRO A HG2  4  
ATOM 7489  H HG3  . PRO A 1 106 ? 2.161   -0.625  10.412  1.00 0.00 ? 106 PRO A HG3  4  
ATOM 7490  H HD2  . PRO A 1 106 ? 4.377   -1.608  8.878   1.00 0.00 ? 106 PRO A HD2  4  
ATOM 7491  H HD3  . PRO A 1 106 ? 2.683   -1.678  8.436   1.00 0.00 ? 106 PRO A HD3  4  
ATOM 7492  N N    . TRP A 1 107 ? 6.039   1.223   7.814   1.00 0.00 ? 107 TRP A N    4  
ATOM 7493  C CA   . TRP A 1 107 ? 7.433   1.636   7.813   1.00 0.00 ? 107 TRP A CA   4  
ATOM 7494  C C    . TRP A 1 107 ? 8.003   1.374   9.208   1.00 0.00 ? 107 TRP A C    4  
ATOM 7495  O O    . TRP A 1 107 ? 8.978   0.638   9.356   1.00 0.00 ? 107 TRP A O    4  
ATOM 7496  C CB   . TRP A 1 107 ? 7.572   3.094   7.374   1.00 0.00 ? 107 TRP A CB   4  
ATOM 7497  C CG   . TRP A 1 107 ? 9.013   3.522   7.088   1.00 0.00 ? 107 TRP A CG   4  
ATOM 7498  C CD1  . TRP A 1 107 ? 9.877   2.982   6.217   1.00 0.00 ? 107 TRP A CD1  4  
ATOM 7499  C CD2  . TRP A 1 107 ? 9.727   4.610   7.714   1.00 0.00 ? 107 TRP A CD2  4  
ATOM 7500  N NE1  . TRP A 1 107 ? 11.091  3.639   6.236   1.00 0.00 ? 107 TRP A NE1  4  
ATOM 7501  C CE2  . TRP A 1 107 ? 10.997  4.660   7.175   1.00 0.00 ? 107 TRP A CE2  4  
ATOM 7502  C CE3  . TRP A 1 107 ? 9.314   5.520   8.702   1.00 0.00 ? 107 TRP A CE3  4  
ATOM 7503  C CZ2  . TRP A 1 107 ? 11.956  5.603   7.561   1.00 0.00 ? 107 TRP A CZ2  4  
ATOM 7504  C CZ3  . TRP A 1 107 ? 10.285  6.456   9.078   1.00 0.00 ? 107 TRP A CZ3  4  
ATOM 7505  C CH2  . TRP A 1 107 ? 11.567  6.521   8.545   1.00 0.00 ? 107 TRP A CH2  4  
ATOM 7506  H H    . TRP A 1 107 ? 5.850   0.373   7.322   1.00 0.00 ? 107 TRP A H    4  
ATOM 7507  H HA   . TRP A 1 107 ? 7.958   1.030   7.076   1.00 0.00 ? 107 TRP A HA   4  
ATOM 7508  H HB2  . TRP A 1 107 ? 6.973   3.252   6.478   1.00 0.00 ? 107 TRP A HB2  4  
ATOM 7509  H HB3  . TRP A 1 107 ? 7.160   3.738   8.151   1.00 0.00 ? 107 TRP A HB3  4  
ATOM 7510  H HD1  . TRP A 1 107 ? 9.650   2.132   5.575   1.00 0.00 ? 107 TRP A HD1  4  
ATOM 7511  H HE1  . TRP A 1 107 ? 11.963  3.401   5.627   1.00 0.00 ? 107 TRP A HE1  4  
ATOM 7512  H HE3  . TRP A 1 107 ? 8.317   5.500   9.143   1.00 0.00 ? 107 TRP A HE3  4  
ATOM 7513  H HZ2  . TRP A 1 107 ? 12.954  5.622   7.121   1.00 0.00 ? 107 TRP A HZ2  4  
ATOM 7514  H HZ3  . TRP A 1 107 ? 10.016  7.186   9.841   1.00 0.00 ? 107 TRP A HZ3  4  
ATOM 7515  H HH2  . TRP A 1 107 ? 12.267  7.281   8.891   1.00 0.00 ? 107 TRP A HH2  4  
ATOM 7516  N N    . ASP A 1 108 ? 7.371   1.989   10.197  1.00 0.00 ? 108 ASP A N    4  
ATOM 7517  C CA   . ASP A 1 108 ? 7.804   1.832   11.574  1.00 0.00 ? 108 ASP A CA   4  
ATOM 7518  C C    . ASP A 1 108 ? 7.498   0.408   12.042  1.00 0.00 ? 108 ASP A C    4  
ATOM 7519  O O    . ASP A 1 108 ? 6.881   0.214   13.088  1.00 0.00 ? 108 ASP A O    4  
ATOM 7520  C CB   . ASP A 1 108 ? 7.064   2.802   12.498  1.00 0.00 ? 108 ASP A CB   4  
ATOM 7521  C CG   . ASP A 1 108 ? 7.652   2.931   13.905  1.00 0.00 ? 108 ASP A CG   4  
ATOM 7522  O OD1  . ASP A 1 108 ? 7.843   1.871   14.539  1.00 0.00 ? 108 ASP A OD1  4  
ATOM 7523  O OD2  . ASP A 1 108 ? 7.897   4.086   14.314  1.00 0.00 ? 108 ASP A OD2  4  
ATOM 7524  H H    . ASP A 1 108 ? 6.579   2.586   10.068  1.00 0.00 ? 108 ASP A H    4  
ATOM 7525  H HA   . ASP A 1 108 ? 8.872   2.048   11.566  1.00 0.00 ? 108 ASP A HA   4  
ATOM 7526  H HB2  . ASP A 1 108 ? 7.056   3.788   12.034  1.00 0.00 ? 108 ASP A HB2  4  
ATOM 7527  H HB3  . ASP A 1 108 ? 6.026   2.481   12.582  1.00 0.00 ? 108 ASP A HB3  4  
ATOM 7528  N N    . THR A 1 109 ? 7.942   -0.551  11.244  1.00 0.00 ? 109 THR A N    4  
ATOM 7529  C CA   . THR A 1 109 ? 7.723   -1.951  11.562  1.00 0.00 ? 109 THR A CA   4  
ATOM 7530  C C    . THR A 1 109 ? 8.734   -2.830  10.824  1.00 0.00 ? 109 THR A C    4  
ATOM 7531  O O    . THR A 1 109 ? 9.463   -3.602  11.446  1.00 0.00 ? 109 THR A O    4  
ATOM 7532  C CB   . THR A 1 109 ? 6.268   -2.289  11.231  1.00 0.00 ? 109 THR A CB   4  
ATOM 7533  O OG1  . THR A 1 109 ? 6.041   -1.654  9.976   1.00 0.00 ? 109 THR A OG1  4  
ATOM 7534  C CG2  . THR A 1 109 ? 5.279   -1.608  12.179  1.00 0.00 ? 109 THR A CG2  4  
ATOM 7535  H H    . THR A 1 109 ? 8.443   -0.384  10.394  1.00 0.00 ? 109 THR A H    4  
ATOM 7536  H HA   . THR A 1 109 ? 7.896   -2.092  12.629  1.00 0.00 ? 109 THR A HA   4  
ATOM 7537  H HB   . THR A 1 109 ? 6.113   -3.368  11.216  1.00 0.00 ? 109 THR A HB   4  
ATOM 7538  H HG1  . THR A 1 109 ? 6.249   -0.679  10.045  1.00 0.00 ? 109 THR A HG1  4  
ATOM 7539  H HG21 . THR A 1 109 ? 5.564   -1.812  13.211  1.00 0.00 ? 109 THR A HG21 4  
ATOM 7540  H HG22 . THR A 1 109 ? 5.291   -0.532  12.004  1.00 0.00 ? 109 THR A HG22 4  
ATOM 7541  H HG23 . THR A 1 109 ? 4.276   -1.994  11.997  1.00 0.00 ? 109 THR A HG23 4  
ATOM 7542  N N    . LEU A 1 110 ? 8.745   -2.686  9.507   1.00 0.00 ? 110 LEU A N    4  
ATOM 7543  C CA   . LEU A 1 110 ? 9.655   -3.457  8.676   1.00 0.00 ? 110 LEU A CA   4  
ATOM 7544  C C    . LEU A 1 110 ? 10.336  -4.527  9.532   1.00 0.00 ? 110 LEU A C    4  
ATOM 7545  O O    . LEU A 1 110 ? 9.703   -5.502  9.934   1.00 0.00 ? 110 LEU A O    4  
ATOM 7546  C CB   . LEU A 1 110 ? 10.636  -2.532  7.953   1.00 0.00 ? 110 LEU A CB   4  
ATOM 7547  C CG   . LEU A 1 110 ? 10.010  -1.395  7.142   1.00 0.00 ? 110 LEU A CG   4  
ATOM 7548  C CD1  . LEU A 1 110 ? 11.076  -0.395  6.688   1.00 0.00 ? 110 LEU A CD1  4  
ATOM 7549  C CD2  . LEU A 1 110 ? 9.200   -1.942  5.966   1.00 0.00 ? 110 LEU A CD2  4  
ATOM 7550  H H    . LEU A 1 110 ? 8.149   -2.056  9.008   1.00 0.00 ? 110 LEU A H    4  
ATOM 7551  H HA   . LEU A 1 110 ? 9.058   -3.955  7.912   1.00 0.00 ? 110 LEU A HA   4  
ATOM 7552  H HB2  . LEU A 1 110 ? 11.308  -2.098  8.693   1.00 0.00 ? 110 LEU A HB2  4  
ATOM 7553  H HB3  . LEU A 1 110 ? 11.247  -3.137  7.283   1.00 0.00 ? 110 LEU A HB3  4  
ATOM 7554  H HG   . LEU A 1 110 ? 9.317   -0.856  7.787   1.00 0.00 ? 110 LEU A HG   4  
ATOM 7555  H HD11 . LEU A 1 110 ? 11.775  -0.213  7.505   1.00 0.00 ? 110 LEU A HD11 4  
ATOM 7556  H HD12 . LEU A 1 110 ? 11.615  -0.803  5.833   1.00 0.00 ? 110 LEU A HD12 4  
ATOM 7557  H HD13 . LEU A 1 110 ? 10.597  0.542   6.404   1.00 0.00 ? 110 LEU A HD13 4  
ATOM 7558  H HD21 . LEU A 1 110 ? 9.227   -3.031  5.980   1.00 0.00 ? 110 LEU A HD21 4  
ATOM 7559  H HD22 . LEU A 1 110 ? 8.166   -1.604  6.049   1.00 0.00 ? 110 LEU A HD22 4  
ATOM 7560  H HD23 . LEU A 1 110 ? 9.627   -1.579  5.031   1.00 0.00 ? 110 LEU A HD23 4  
ATOM 7561  N N    . SER A 1 111 ? 11.618  -4.308  9.786   1.00 0.00 ? 111 SER A N    4  
ATOM 7562  C CA   . SER A 1 111 ? 12.393  -5.241  10.587  1.00 0.00 ? 111 SER A CA   4  
ATOM 7563  C C    . SER A 1 111 ? 13.848  -5.253  10.117  1.00 0.00 ? 111 SER A C    4  
ATOM 7564  O O    . SER A 1 111 ? 14.767  -5.299  10.932  1.00 0.00 ? 111 SER A O    4  
ATOM 7565  C CB   . SER A 1 111 ? 11.801  -6.650  10.516  1.00 0.00 ? 111 SER A CB   4  
ATOM 7566  O OG   . SER A 1 111 ? 10.810  -6.865  11.518  1.00 0.00 ? 111 SER A OG   4  
ATOM 7567  H H    . SER A 1 111 ? 12.126  -3.512  9.457   1.00 0.00 ? 111 SER A H    4  
ATOM 7568  H HA   . SER A 1 111 ? 12.323  -4.871  11.610  1.00 0.00 ? 111 SER A HA   4  
ATOM 7569  H HB2  . SER A 1 111 ? 11.361  -6.810  9.533   1.00 0.00 ? 111 SER A HB2  4  
ATOM 7570  H HB3  . SER A 1 111 ? 12.598  -7.385  10.632  1.00 0.00 ? 111 SER A HB3  4  
ATOM 7571  H HG   . SER A 1 111 ? 11.242  -7.175  12.365  1.00 0.00 ? 111 SER A HG   4  
ATOM 7572  N N    . THR A 1 112 ? 14.012  -5.210  8.802   1.00 0.00 ? 112 THR A N    4  
ATOM 7573  C CA   . THR A 1 112 ? 15.340  -5.214  8.214   1.00 0.00 ? 112 THR A CA   4  
ATOM 7574  C C    . THR A 1 112 ? 15.272  -5.646  6.748   1.00 0.00 ? 112 THR A C    4  
ATOM 7575  O O    . THR A 1 112 ? 15.548  -4.853  5.850   1.00 0.00 ? 112 THR A O    4  
ATOM 7576  C CB   . THR A 1 112 ? 16.235  -6.112  9.071   1.00 0.00 ? 112 THR A CB   4  
ATOM 7577  O OG1  . THR A 1 112 ? 16.979  -5.198  9.872   1.00 0.00 ? 112 THR A OG1  4  
ATOM 7578  C CG2  . THR A 1 112 ? 17.299  -6.838  8.246   1.00 0.00 ? 112 THR A CG2  4  
ATOM 7579  H H    . THR A 1 112 ? 13.259  -5.172  8.146   1.00 0.00 ? 112 THR A H    4  
ATOM 7580  H HA   . THR A 1 112 ? 15.726  -4.195  8.228   1.00 0.00 ? 112 THR A HA   4  
ATOM 7581  H HB   . THR A 1 112 ? 15.637  -6.820  9.646   1.00 0.00 ? 112 THR A HB   4  
ATOM 7582  H HG1  . THR A 1 112 ? 17.121  -5.580  10.785  1.00 0.00 ? 112 THR A HG1  4  
ATOM 7583  H HG21 . THR A 1 112 ? 17.727  -6.149  7.519   1.00 0.00 ? 112 THR A HG21 4  
ATOM 7584  H HG22 . THR A 1 112 ? 18.085  -7.203  8.908   1.00 0.00 ? 112 THR A HG22 4  
ATOM 7585  H HG23 . THR A 1 112 ? 16.843  -7.680  7.724   1.00 0.00 ? 112 THR A HG23 4  
ATOM 7586  N N    . THR A 1 113 ? 14.903  -6.904  6.552   1.00 0.00 ? 113 THR A N    4  
ATOM 7587  C CA   . THR A 1 113 ? 14.795  -7.451  5.210   1.00 0.00 ? 113 THR A CA   4  
ATOM 7588  C C    . THR A 1 113 ? 13.985  -6.512  4.314   1.00 0.00 ? 113 THR A C    4  
ATOM 7589  O O    . THR A 1 113 ? 14.155  -6.509  3.096   1.00 0.00 ? 113 THR A O    4  
ATOM 7590  C CB   . THR A 1 113 ? 14.194  -8.854  5.318   1.00 0.00 ? 113 THR A CB   4  
ATOM 7591  O OG1  . THR A 1 113 ? 15.277  -9.660  5.775   1.00 0.00 ? 113 THR A OG1  4  
ATOM 7592  C CG2  . THR A 1 113 ? 13.839  -9.447  3.954   1.00 0.00 ? 113 THR A CG2  4  
ATOM 7593  H H    . THR A 1 113 ? 14.680  -7.542  7.288   1.00 0.00 ? 113 THR A H    4  
ATOM 7594  H HA   . THR A 1 113 ? 15.796  -7.515  4.783   1.00 0.00 ? 113 THR A HA   4  
ATOM 7595  H HB   . THR A 1 113 ? 13.329  -8.857  5.982   1.00 0.00 ? 113 THR A HB   4  
ATOM 7596  H HG1  . THR A 1 113 ? 15.508  -9.421  6.718   1.00 0.00 ? 113 THR A HG1  4  
ATOM 7597  H HG21 . THR A 1 113 ? 14.005  -8.698  3.178   1.00 0.00 ? 113 THR A HG21 4  
ATOM 7598  H HG22 . THR A 1 113 ? 14.468  -10.316 3.760   1.00 0.00 ? 113 THR A HG22 4  
ATOM 7599  H HG23 . THR A 1 113 ? 12.792  -9.748  3.949   1.00 0.00 ? 113 THR A HG23 4  
ATOM 7600  N N    . GLN A 1 114 ? 13.120  -5.736  4.952   1.00 0.00 ? 114 GLN A N    4  
ATOM 7601  C CA   . GLN A 1 114 ? 12.283  -4.794  4.229   1.00 0.00 ? 114 GLN A CA   4  
ATOM 7602  C C    . GLN A 1 114 ? 13.044  -3.490  3.982   1.00 0.00 ? 114 GLN A C    4  
ATOM 7603  O O    . GLN A 1 114 ? 12.842  -2.833  2.961   1.00 0.00 ? 114 GLN A O    4  
ATOM 7604  C CB   . GLN A 1 114 ? 10.976  -4.533  4.979   1.00 0.00 ? 114 GLN A CB   4  
ATOM 7605  C CG   . GLN A 1 114 ? 9.920   -5.582  4.622   1.00 0.00 ? 114 GLN A CG   4  
ATOM 7606  C CD   . GLN A 1 114 ? 9.956   -6.754  5.605   1.00 0.00 ? 114 GLN A CD   4  
ATOM 7607  O OE1  . GLN A 1 114 ? 8.979   -7.083  6.256   1.00 0.00 ? 114 GLN A OE1  4  
ATOM 7608  N NE2  . GLN A 1 114 ? 11.137  -7.363  5.676   1.00 0.00 ? 114 GLN A NE2  4  
ATOM 7609  H H    . GLN A 1 114 ? 12.987  -5.744  5.944   1.00 0.00 ? 114 GLN A H    4  
ATOM 7610  H HA   . GLN A 1 114 ? 12.059  -5.277  3.278   1.00 0.00 ? 114 GLN A HA   4  
ATOM 7611  H HB2  . GLN A 1 114 ? 11.160  -4.549  6.053   1.00 0.00 ? 114 GLN A HB2  4  
ATOM 7612  H HB3  . GLN A 1 114 ? 10.604  -3.539  4.733   1.00 0.00 ? 114 GLN A HB3  4  
ATOM 7613  H HG2  . GLN A 1 114 ? 8.931   -5.124  4.632   1.00 0.00 ? 114 GLN A HG2  4  
ATOM 7614  H HG3  . GLN A 1 114 ? 10.093  -5.946  3.609   1.00 0.00 ? 114 GLN A HG3  4  
ATOM 7615  H HE21 . GLN A 1 114 ? 11.900  -7.043  5.114   1.00 0.00 ? 114 GLN A HE21 4  
ATOM 7616  H HE22 . GLN A 1 114 ? 11.261  -8.142  6.292   1.00 0.00 ? 114 GLN A HE22 4  
ATOM 7617  N N    . LYS A 1 115 ? 13.903  -3.154  4.933   1.00 0.00 ? 115 LYS A N    4  
ATOM 7618  C CA   . LYS A 1 115 ? 14.694  -1.939  4.831   1.00 0.00 ? 115 LYS A CA   4  
ATOM 7619  C C    . LYS A 1 115 ? 15.788  -2.135  3.780   1.00 0.00 ? 115 LYS A C    4  
ATOM 7620  O O    . LYS A 1 115 ? 16.059  -1.235  2.986   1.00 0.00 ? 115 LYS A O    4  
ATOM 7621  C CB   . LYS A 1 115 ? 15.229  -1.532  6.206   1.00 0.00 ? 115 LYS A CB   4  
ATOM 7622  C CG   . LYS A 1 115 ? 14.452  -0.338  6.765   1.00 0.00 ? 115 LYS A CG   4  
ATOM 7623  C CD   . LYS A 1 115 ? 14.354  -0.413  8.289   1.00 0.00 ? 115 LYS A CD   4  
ATOM 7624  C CE   . LYS A 1 115 ? 13.938  -1.812  8.744   1.00 0.00 ? 115 LYS A CE   4  
ATOM 7625  N NZ   . LYS A 1 115 ? 13.407  -1.773  10.125  1.00 0.00 ? 115 LYS A NZ   4  
ATOM 7626  H H    . LYS A 1 115 ? 14.061  -3.693  5.760   1.00 0.00 ? 115 LYS A H    4  
ATOM 7627  H HA   . LYS A 1 115 ? 14.029  -1.143  4.495   1.00 0.00 ? 115 LYS A HA   4  
ATOM 7628  H HB2  . LYS A 1 115 ? 15.154  -2.373  6.894   1.00 0.00 ? 115 LYS A HB2  4  
ATOM 7629  H HB3  . LYS A 1 115 ? 16.286  -1.278  6.129   1.00 0.00 ? 115 LYS A HB3  4  
ATOM 7630  H HG2  . LYS A 1 115 ? 14.944  0.590   6.473   1.00 0.00 ? 115 LYS A HG2  4  
ATOM 7631  H HG3  . LYS A 1 115 ? 13.451  -0.316  6.332   1.00 0.00 ? 115 LYS A HG3  4  
ATOM 7632  H HD2  . LYS A 1 115 ? 15.315  -0.153  8.733   1.00 0.00 ? 115 LYS A HD2  4  
ATOM 7633  H HD3  . LYS A 1 115 ? 13.630  0.320   8.648   1.00 0.00 ? 115 LYS A HD3  4  
ATOM 7634  H HE2  . LYS A 1 115 ? 13.181  -2.211  8.068   1.00 0.00 ? 115 LYS A HE2  4  
ATOM 7635  H HE3  . LYS A 1 115 ? 14.794  -2.487  8.697   1.00 0.00 ? 115 LYS A HE3  4  
ATOM 7636  H HZ1  . LYS A 1 115 ? 13.959  -1.147  10.677  1.00 0.00 ? 115 LYS A HZ1  4  
ATOM 7637  H HZ2  . LYS A 1 115 ? 12.459  -1.456  10.109  1.00 0.00 ? 115 LYS A HZ2  4  
ATOM 7638  H HZ3  . LYS A 1 115 ? 13.444  -2.689  10.524  1.00 0.00 ? 115 LYS A HZ3  4  
ATOM 7639  N N    . LYS A 1 116 ? 16.387  -3.316  3.808   1.00 0.00 ? 116 LYS A N    4  
ATOM 7640  C CA   . LYS A 1 116 ? 17.445  -3.642  2.866   1.00 0.00 ? 116 LYS A CA   4  
ATOM 7641  C C    . LYS A 1 116 ? 16.887  -3.597  1.443   1.00 0.00 ? 116 LYS A C    4  
ATOM 7642  O O    . LYS A 1 116 ? 17.643  -3.487  0.478   1.00 0.00 ? 116 LYS A O    4  
ATOM 7643  C CB   . LYS A 1 116 ? 18.095  -4.979  3.231   1.00 0.00 ? 116 LYS A CB   4  
ATOM 7644  C CG   . LYS A 1 116 ? 17.228  -6.153  2.769   1.00 0.00 ? 116 LYS A CG   4  
ATOM 7645  C CD   . LYS A 1 116 ? 17.827  -6.821  1.530   1.00 0.00 ? 116 LYS A CD   4  
ATOM 7646  C CE   . LYS A 1 116 ? 17.119  -6.351  0.258   1.00 0.00 ? 116 LYS A CE   4  
ATOM 7647  N NZ   . LYS A 1 116 ? 18.072  -5.661  -0.641  1.00 0.00 ? 116 LYS A NZ   4  
ATOM 7648  H H    . LYS A 1 116 ? 16.161  -4.043  4.457   1.00 0.00 ? 116 LYS A H    4  
ATOM 7649  H HA   . LYS A 1 116 ? 18.213  -2.874  2.960   1.00 0.00 ? 116 LYS A HA   4  
ATOM 7650  H HB2  . LYS A 1 116 ? 19.079  -5.046  2.771   1.00 0.00 ? 116 LYS A HB2  4  
ATOM 7651  H HB3  . LYS A 1 116 ? 18.242  -5.033  4.309   1.00 0.00 ? 116 LYS A HB3  4  
ATOM 7652  H HG2  . LYS A 1 116 ? 17.141  -6.882  3.575   1.00 0.00 ? 116 LYS A HG2  4  
ATOM 7653  H HG3  . LYS A 1 116 ? 16.221  -5.800  2.547   1.00 0.00 ? 116 LYS A HG3  4  
ATOM 7654  H HD2  . LYS A 1 116 ? 18.890  -6.590  1.466   1.00 0.00 ? 116 LYS A HD2  4  
ATOM 7655  H HD3  . LYS A 1 116 ? 17.740  -7.904  1.619   1.00 0.00 ? 116 LYS A HD3  4  
ATOM 7656  H HE2  . LYS A 1 116 ? 16.678  -7.205  -0.257  1.00 0.00 ? 116 LYS A HE2  4  
ATOM 7657  H HE3  . LYS A 1 116 ? 16.301  -5.678  0.516   1.00 0.00 ? 116 LYS A HE3  4  
ATOM 7658  H HZ1  . LYS A 1 116 ? 18.917  -6.192  -0.701  1.00 0.00 ? 116 LYS A HZ1  4  
ATOM 7659  H HZ2  . LYS A 1 116 ? 17.668  -5.573  -1.550  1.00 0.00 ? 116 LYS A HZ2  4  
ATOM 7660  H HZ3  . LYS A 1 116 ? 18.274  -4.752  -0.276  1.00 0.00 ? 116 LYS A HZ3  4  
ATOM 7661  N N    . SER A 1 117 ? 15.567  -3.685  1.355   1.00 0.00 ? 117 SER A N    4  
ATOM 7662  C CA   . SER A 1 117 ? 14.899  -3.656  0.066   1.00 0.00 ? 117 SER A CA   4  
ATOM 7663  C C    . SER A 1 117 ? 14.484  -2.224  -0.276  1.00 0.00 ? 117 SER A C    4  
ATOM 7664  O O    . SER A 1 117 ? 13.985  -1.964  -1.370  1.00 0.00 ? 117 SER A O    4  
ATOM 7665  C CB   . SER A 1 117 ? 13.679  -4.580  0.057   1.00 0.00 ? 117 SER A CB   4  
ATOM 7666  O OG   . SER A 1 117 ? 13.700  -5.481  -1.048  1.00 0.00 ? 117 SER A OG   4  
ATOM 7667  H H    . SER A 1 117 ? 14.959  -3.775  2.145   1.00 0.00 ? 117 SER A H    4  
ATOM 7668  H HA   . SER A 1 117 ? 15.636  -4.022  -0.650  1.00 0.00 ? 117 SER A HA   4  
ATOM 7669  H HB2  . SER A 1 117 ? 13.648  -5.148  0.986   1.00 0.00 ? 117 SER A HB2  4  
ATOM 7670  H HB3  . SER A 1 117 ? 12.770  -3.980  0.019   1.00 0.00 ? 117 SER A HB3  4  
ATOM 7671  H HG   . SER A 1 117 ? 13.899  -6.407  -0.729  1.00 0.00 ? 117 SER A HG   4  
ATOM 7672  N N    . LEU A 1 118 ? 14.704  -1.333  0.679   1.00 0.00 ? 118 LEU A N    4  
ATOM 7673  C CA   . LEU A 1 118 ? 14.358  0.065   0.493   1.00 0.00 ? 118 LEU A CA   4  
ATOM 7674  C C    . LEU A 1 118 ? 15.465  0.757   -0.304  1.00 0.00 ? 118 LEU A C    4  
ATOM 7675  O O    . LEU A 1 118 ? 15.211  1.737   -1.004  1.00 0.00 ? 118 LEU A O    4  
ATOM 7676  C CB   . LEU A 1 118 ? 14.063  0.728   1.840   1.00 0.00 ? 118 LEU A CB   4  
ATOM 7677  C CG   . LEU A 1 118 ? 12.733  0.353   2.495   1.00 0.00 ? 118 LEU A CG   4  
ATOM 7678  C CD1  . LEU A 1 118 ? 12.574  1.044   3.851   1.00 0.00 ? 118 LEU A CD1  4  
ATOM 7679  C CD2  . LEU A 1 118 ? 11.557  0.648   1.560   1.00 0.00 ? 118 LEU A CD2  4  
ATOM 7680  H H    . LEU A 1 118 ? 15.110  -1.554  1.567   1.00 0.00 ? 118 LEU A H    4  
ATOM 7681  H HA   . LEU A 1 118 ? 13.439  0.100   -0.091  1.00 0.00 ? 118 LEU A HA   4  
ATOM 7682  H HB2  . LEU A 1 118 ? 14.869  0.477   2.530   1.00 0.00 ? 118 LEU A HB2  4  
ATOM 7683  H HB3  . LEU A 1 118 ? 14.085  1.810   1.704   1.00 0.00 ? 118 LEU A HB3  4  
ATOM 7684  H HG   . LEU A 1 118 ? 12.734  -0.721  2.681   1.00 0.00 ? 118 LEU A HG   4  
ATOM 7685  H HD11 . LEU A 1 118 ? 13.340  1.813   3.959   1.00 0.00 ? 118 LEU A HD11 4  
ATOM 7686  H HD12 . LEU A 1 118 ? 11.587  1.504   3.912   1.00 0.00 ? 118 LEU A HD12 4  
ATOM 7687  H HD13 . LEU A 1 118 ? 12.683  0.310   4.649   1.00 0.00 ? 118 LEU A HD13 4  
ATOM 7688  H HD21 . LEU A 1 118 ? 11.652  1.661   1.168   1.00 0.00 ? 118 LEU A HD21 4  
ATOM 7689  H HD22 . LEU A 1 118 ? 11.563  -0.063  0.735   1.00 0.00 ? 118 LEU A HD22 4  
ATOM 7690  H HD23 . LEU A 1 118 ? 10.623  0.558   2.112   1.00 0.00 ? 118 LEU A HD23 4  
ATOM 7691  N N    . ASN A 1 119 ? 16.670  0.223   -0.171  1.00 0.00 ? 119 ASN A N    4  
ATOM 7692  C CA   . ASN A 1 119 ? 17.817  0.777   -0.870  1.00 0.00 ? 119 ASN A CA   4  
ATOM 7693  C C    . ASN A 1 119 ? 18.087  -0.046  -2.131  1.00 0.00 ? 119 ASN A C    4  
ATOM 7694  O O    . ASN A 1 119 ? 18.889  0.349   -2.975  1.00 0.00 ? 119 ASN A O    4  
ATOM 7695  C CB   . ASN A 1 119 ? 19.070  0.729   0.004   1.00 0.00 ? 119 ASN A CB   4  
ATOM 7696  C CG   . ASN A 1 119 ? 19.583  -0.705  0.150   1.00 0.00 ? 119 ASN A CG   4  
ATOM 7697  O OD1  . ASN A 1 119 ? 20.205  -1.263  -0.740  1.00 0.00 ? 119 ASN A OD1  4  
ATOM 7698  N ND2  . ASN A 1 119 ? 19.289  -1.270  1.318   1.00 0.00 ? 119 ASN A ND2  4  
ATOM 7699  H H    . ASN A 1 119 ? 16.867  -0.574  0.401   1.00 0.00 ? 119 ASN A H    4  
ATOM 7700  H HA   . ASN A 1 119 ? 17.543  1.808   -1.096  1.00 0.00 ? 119 ASN A HA   4  
ATOM 7701  H HB2  . ASN A 1 119 ? 19.848  1.354   -0.434  1.00 0.00 ? 119 ASN A HB2  4  
ATOM 7702  H HB3  . ASN A 1 119 ? 18.849  1.141   0.988   1.00 0.00 ? 119 ASN A HB3  4  
ATOM 7703  H HD21 . ASN A 1 119 ? 18.776  -0.756  2.005   1.00 0.00 ? 119 ASN A HD21 4  
ATOM 7704  H HD22 . ASN A 1 119 ? 19.580  -2.207  1.508   1.00 0.00 ? 119 ASN A HD22 4  
ATOM 7705  N N    . HIS A 1 120 ? 17.401  -1.177  -2.219  1.00 0.00 ? 120 HIS A N    4  
ATOM 7706  C CA   . HIS A 1 120 ? 17.557  -2.059  -3.363  1.00 0.00 ? 120 HIS A CA   4  
ATOM 7707  C C    . HIS A 1 120 ? 16.530  -1.695  -4.436  1.00 0.00 ? 120 HIS A C    4  
ATOM 7708  O O    . HIS A 1 120 ? 16.061  -2.563  -5.171  1.00 0.00 ? 120 HIS A O    4  
ATOM 7709  C CB   . HIS A 1 120 ? 17.472  -3.525  -2.933  1.00 0.00 ? 120 HIS A CB   4  
ATOM 7710  C CG   . HIS A 1 120 ? 16.107  -4.142  -3.122  1.00 0.00 ? 120 HIS A CG   4  
ATOM 7711  N ND1  . HIS A 1 120 ? 15.902  -5.510  -3.170  1.00 0.00 ? 120 HIS A ND1  4  
ATOM 7712  C CD2  . HIS A 1 120 ? 14.881  -3.564  -3.275  1.00 0.00 ? 120 HIS A CD2  4  
ATOM 7713  C CE1  . HIS A 1 120 ? 14.609  -5.734  -3.345  1.00 0.00 ? 120 HIS A CE1  4  
ATOM 7714  N NE2  . HIS A 1 120 ? 13.977  -4.527  -3.410  1.00 0.00 ? 120 HIS A NE2  4  
ATOM 7715  H H    . HIS A 1 120 ? 16.750  -1.491  -1.528  1.00 0.00 ? 120 HIS A H    4  
ATOM 7716  H HA   . HIS A 1 120 ? 18.559  -1.886  -3.756  1.00 0.00 ? 120 HIS A HA   4  
ATOM 7717  H HB2  . HIS A 1 120 ? 18.202  -4.103  -3.500  1.00 0.00 ? 120 HIS A HB2  4  
ATOM 7718  H HB3  . HIS A 1 120 ? 17.752  -3.603  -1.882  1.00 0.00 ? 120 HIS A HB3  4  
ATOM 7719  H HD1  . HIS A 1 120 ? 16.611  -6.211  -3.087  1.00 0.00 ? 120 HIS A HD1  4  
ATOM 7720  H HD2  . HIS A 1 120 ? 14.678  -2.493  -3.285  1.00 0.00 ? 120 HIS A HD2  4  
ATOM 7721  H HE1  . HIS A 1 120 ? 14.132  -6.712  -3.422  1.00 0.00 ? 120 HIS A HE1  4  
ATOM 7722  N N    . ARG A 1 121 ? 16.210  -0.410  -4.493  1.00 0.00 ? 121 ARG A N    4  
ATOM 7723  C CA   . ARG A 1 121 ? 15.247  0.079   -5.464  1.00 0.00 ? 121 ARG A CA   4  
ATOM 7724  C C    . ARG A 1 121 ? 13.850  -0.459  -5.145  1.00 0.00 ? 121 ARG A C    4  
ATOM 7725  O O    . ARG A 1 121 ? 13.204  0.001   -4.204  1.00 0.00 ? 121 ARG A O    4  
ATOM 7726  C CB   . ARG A 1 121 ? 15.635  -0.339  -6.883  1.00 0.00 ? 121 ARG A CB   4  
ATOM 7727  C CG   . ARG A 1 121 ? 16.744  0.558   -7.435  1.00 0.00 ? 121 ARG A CG   4  
ATOM 7728  C CD   . ARG A 1 121 ? 16.241  1.988   -7.642  1.00 0.00 ? 121 ARG A CD   4  
ATOM 7729  N NE   . ARG A 1 121 ? 16.522  2.429   -9.027  1.00 0.00 ? 121 ARG A NE   4  
ATOM 7730  C CZ   . ARG A 1 121 ? 17.669  3.001   -9.414  1.00 0.00 ? 121 ARG A CZ   4  
ATOM 7731  N NH1  . ARG A 1 121 ? 18.650  3.207   -8.524  1.00 0.00 ? 121 ARG A NH1  4  
ATOM 7732  N NH2  . ARG A 1 121 ? 17.836  3.370   -10.692 1.00 0.00 ? 121 ARG A NH2  4  
ATOM 7733  H H    . ARG A 1 121 ? 16.596  0.289   -3.892  1.00 0.00 ? 121 ARG A H    4  
ATOM 7734  H HA   . ARG A 1 121 ? 15.280  1.164   -5.367  1.00 0.00 ? 121 ARG A HA   4  
ATOM 7735  H HB2  . ARG A 1 121 ? 15.968  -1.377  -6.882  1.00 0.00 ? 121 ARG A HB2  4  
ATOM 7736  H HB3  . ARG A 1 121 ? 14.761  -0.286  -7.534  1.00 0.00 ? 121 ARG A HB3  4  
ATOM 7737  H HG2  . ARG A 1 121 ? 17.590  0.561   -6.749  1.00 0.00 ? 121 ARG A HG2  4  
ATOM 7738  H HG3  . ARG A 1 121 ? 17.105  0.156   -8.383  1.00 0.00 ? 121 ARG A HG3  4  
ATOM 7739  H HD2  . ARG A 1 121 ? 15.170  2.037   -7.446  1.00 0.00 ? 121 ARG A HD2  4  
ATOM 7740  H HD3  . ARG A 1 121 ? 16.726  2.659   -6.932  1.00 0.00 ? 121 ARG A HD3  4  
ATOM 7741  H HE   . ARG A 1 121 ? 15.810  2.290   -9.716  1.00 0.00 ? 121 ARG A HE   4  
ATOM 7742  H HH11 . ARG A 1 121 ? 18.526  2.932   -7.571  1.00 0.00 ? 121 ARG A HH11 4  
ATOM 7743  H HH12 . ARG A 1 121 ? 19.506  3.634   -8.814  1.00 0.00 ? 121 ARG A HH12 4  
ATOM 7744  H HH21 . ARG A 1 121 ? 17.104  3.216   -11.355 1.00 0.00 ? 121 ARG A HH21 4  
ATOM 7745  H HH22 . ARG A 1 121 ? 18.693  3.797   -10.982 1.00 0.00 ? 121 ARG A HH22 4  
ATOM 7746  N N    . TYR A 1 122 ? 13.426  -1.426  -5.944  1.00 0.00 ? 122 TYR A N    4  
ATOM 7747  C CA   . TYR A 1 122 ? 12.119  -2.032  -5.759  1.00 0.00 ? 122 TYR A CA   4  
ATOM 7748  C C    . TYR A 1 122 ? 12.069  -3.430  -6.379  1.00 0.00 ? 122 TYR A C    4  
ATOM 7749  O O    . TYR A 1 122 ? 10.994  -4.007  -6.533  1.00 0.00 ? 122 TYR A O    4  
ATOM 7750  C CB   . TYR A 1 122 ? 11.127  -1.126  -6.492  1.00 0.00 ? 122 TYR A CB   4  
ATOM 7751  C CG   . TYR A 1 122 ? 11.228  -1.197  -8.017  1.00 0.00 ? 122 TYR A CG   4  
ATOM 7752  C CD1  . TYR A 1 122 ? 12.097  -0.363  -8.691  1.00 0.00 ? 122 TYR A CD1  4  
ATOM 7753  C CD2  . TYR A 1 122 ? 10.451  -2.096  -8.718  1.00 0.00 ? 122 TYR A CD2  4  
ATOM 7754  C CE1  . TYR A 1 122 ? 12.192  -0.430  -10.125 1.00 0.00 ? 122 TYR A CE1  4  
ATOM 7755  C CE2  . TYR A 1 122 ? 10.546  -2.163  -10.154 1.00 0.00 ? 122 TYR A CE2  4  
ATOM 7756  C CZ   . TYR A 1 122 ? 11.412  -1.327  -10.787 1.00 0.00 ? 122 TYR A CZ   4  
ATOM 7757  O OH   . TYR A 1 122 ? 11.502  -1.390  -12.142 1.00 0.00 ? 122 TYR A OH   4  
ATOM 7758  H H    . TYR A 1 122 ? 13.959  -1.795  -6.708  1.00 0.00 ? 122 TYR A H    4  
ATOM 7759  H HA   . TYR A 1 122 ? 11.934  -2.111  -4.687  1.00 0.00 ? 122 TYR A HA   4  
ATOM 7760  H HB2  . TYR A 1 122 ? 10.114  -1.397  -6.192  1.00 0.00 ? 122 TYR A HB2  4  
ATOM 7761  H HB3  . TYR A 1 122 ? 11.288  -0.096  -6.174  1.00 0.00 ? 122 TYR A HB3  4  
ATOM 7762  H HD1  . TYR A 1 122 ? 12.711  0.347   -8.135  1.00 0.00 ? 122 TYR A HD1  4  
ATOM 7763  H HD2  . TYR A 1 122 ? 9.765   -2.756  -8.186  1.00 0.00 ? 122 TYR A HD2  4  
ATOM 7764  H HE1  . TYR A 1 122 ? 12.874  0.224   -10.670 1.00 0.00 ? 122 TYR A HE1  4  
ATOM 7765  H HE2  . TYR A 1 122 ? 9.938   -2.868  -10.721 1.00 0.00 ? 122 TYR A HE2  4  
ATOM 7766  H HH   . TYR A 1 122 ? 11.809  -0.510  -12.505 1.00 0.00 ? 122 TYR A HH   4  
ATOM 7767  N N    . GLN A 1 123 ? 13.246  -3.934  -6.719  1.00 0.00 ? 123 GLN A N    4  
ATOM 7768  C CA   . GLN A 1 123 ? 13.350  -5.253  -7.319  1.00 0.00 ? 123 GLN A CA   4  
ATOM 7769  C C    . GLN A 1 123 ? 14.797  -5.536  -7.732  1.00 0.00 ? 123 GLN A C    4  
ATOM 7770  O O    . GLN A 1 123 ? 15.060  -5.892  -8.879  1.00 0.00 ? 123 GLN A O    4  
ATOM 7771  C CB   . GLN A 1 123 ? 12.403  -5.389  -8.513  1.00 0.00 ? 123 GLN A CB   4  
ATOM 7772  C CG   . GLN A 1 123 ? 12.186  -6.859  -8.876  1.00 0.00 ? 123 GLN A CG   4  
ATOM 7773  C CD   . GLN A 1 123 ? 12.642  -7.143  -10.309 1.00 0.00 ? 123 GLN A CD   4  
ATOM 7774  O OE1  . GLN A 1 123 ? 13.811  -7.051  -10.647 1.00 0.00 ? 123 GLN A OE1  4  
ATOM 7775  N NE2  . GLN A 1 123 ? 11.657  -7.492  -11.131 1.00 0.00 ? 123 GLN A NE2  4  
ATOM 7776  H H    . GLN A 1 123 ? 14.117  -3.458  -6.590  1.00 0.00 ? 123 GLN A H    4  
ATOM 7777  H HA   . GLN A 1 123 ? 13.045  -5.950  -6.540  1.00 0.00 ? 123 GLN A HA   4  
ATOM 7778  H HB2  . GLN A 1 123 ? 11.446  -4.924  -8.277  1.00 0.00 ? 123 GLN A HB2  4  
ATOM 7779  H HB3  . GLN A 1 123 ? 12.814  -4.855  -9.370  1.00 0.00 ? 123 GLN A HB3  4  
ATOM 7780  H HG2  . GLN A 1 123 ? 12.738  -7.494  -8.183  1.00 0.00 ? 123 GLN A HG2  4  
ATOM 7781  H HG3  . GLN A 1 123 ? 11.131  -7.112  -8.770  1.00 0.00 ? 123 GLN A HG3  4  
ATOM 7782  H HE21 . GLN A 1 123 ? 10.718  -7.548  -10.791 1.00 0.00 ? 123 GLN A HE21 4  
ATOM 7783  H HE22 . GLN A 1 123 ? 11.854  -7.697  -12.089 1.00 0.00 ? 123 GLN A HE22 4  
ATOM 7784  N N    . MET A 1 124 ? 15.695  -5.366  -6.773  1.00 0.00 ? 124 MET A N    4  
ATOM 7785  C CA   . MET A 1 124 ? 17.108  -5.599  -7.022  1.00 0.00 ? 124 MET A CA   4  
ATOM 7786  C C    . MET A 1 124 ? 17.404  -7.096  -7.141  1.00 0.00 ? 124 MET A C    4  
ATOM 7787  O O    . MET A 1 124 ? 18.275  -7.617  -6.444  1.00 0.00 ? 124 MET A O    4  
ATOM 7788  C CB   . MET A 1 124 ? 17.933  -5.004  -5.879  1.00 0.00 ? 124 MET A CB   4  
ATOM 7789  C CG   . MET A 1 124 ? 18.788  -3.835  -6.372  1.00 0.00 ? 124 MET A CG   4  
ATOM 7790  S SD   . MET A 1 124 ? 20.502  -4.328  -6.464  1.00 0.00 ? 124 MET A SD   4  
ATOM 7791  C CE   . MET A 1 124 ? 20.559  -4.940  -8.140  1.00 0.00 ? 124 MET A CE   4  
ATOM 7792  H H    . MET A 1 124 ? 15.472  -5.077  -5.842  1.00 0.00 ? 124 MET A H    4  
ATOM 7793  H HA   . MET A 1 124 ? 17.324  -5.103  -7.969  1.00 0.00 ? 124 MET A HA   4  
ATOM 7794  H HB2  . MET A 1 124 ? 17.268  -4.664  -5.086  1.00 0.00 ? 124 MET A HB2  4  
ATOM 7795  H HB3  . MET A 1 124 ? 18.575  -5.774  -5.450  1.00 0.00 ? 124 MET A HB3  4  
ATOM 7796  H HG2  . MET A 1 124 ? 18.443  -3.508  -7.353  1.00 0.00 ? 124 MET A HG2  4  
ATOM 7797  H HG3  . MET A 1 124 ? 18.681  -2.985  -5.697  1.00 0.00 ? 124 MET A HG3  4  
ATOM 7798  H HE1  . MET A 1 124 ? 19.560  -4.901  -8.575  1.00 0.00 ? 124 MET A HE1  4  
ATOM 7799  H HE2  . MET A 1 124 ? 21.236  -4.322  -8.729  1.00 0.00 ? 124 MET A HE2  4  
ATOM 7800  H HE3  . MET A 1 124 ? 20.915  -5.970  -8.138  1.00 0.00 ? 124 MET A HE3  4  
ATOM 7801  N N    . GLY A 1 125 ? 16.665  -7.745  -8.029  1.00 0.00 ? 125 GLY A N    4  
ATOM 7802  C CA   . GLY A 1 125 ? 16.838  -9.171  -8.247  1.00 0.00 ? 125 GLY A CA   4  
ATOM 7803  C C    . GLY A 1 125 ? 16.829  -9.934  -6.921  1.00 0.00 ? 125 GLY A C    4  
ATOM 7804  O O    . GLY A 1 125 ? 17.346  -11.047 -6.838  1.00 0.00 ? 125 GLY A O    4  
ATOM 7805  H H    . GLY A 1 125 ? 15.960  -7.313  -8.591  1.00 0.00 ? 125 GLY A H    4  
ATOM 7806  H HA2  . GLY A 1 125 ? 16.041  -9.542  -8.891  1.00 0.00 ? 125 GLY A HA2  4  
ATOM 7807  H HA3  . GLY A 1 125 ? 17.778  -9.351  -8.768  1.00 0.00 ? 125 GLY A HA3  4  
ATOM 7808  N N    . CYS A 1 126 ? 16.236  -9.305  -5.917  1.00 0.00 ? 126 CYS A N    4  
ATOM 7809  C CA   . CYS A 1 126 ? 16.153  -9.910  -4.599  1.00 0.00 ? 126 CYS A CA   4  
ATOM 7810  C C    . CYS A 1 126 ? 15.460  -11.267 -4.737  1.00 0.00 ? 126 CYS A C    4  
ATOM 7811  O O    . CYS A 1 126 ? 15.263  -11.759 -5.847  1.00 0.00 ? 126 CYS A O    4  
ATOM 7812  C CB   . CYS A 1 126 ? 15.433  -8.999  -3.603  1.00 0.00 ? 126 CYS A CB   4  
ATOM 7813  S SG   . CYS A 1 126 ? 13.623  -9.251  -3.501  1.00 0.00 ? 126 CYS A SG   4  
ATOM 7814  H H    . CYS A 1 126 ? 15.819  -8.399  -5.993  1.00 0.00 ? 126 CYS A H    4  
ATOM 7815  H HA   . CYS A 1 126 ? 17.177  -10.033 -4.246  1.00 0.00 ? 126 CYS A HA   4  
ATOM 7816  H HB2  . CYS A 1 126 ? 15.863  -9.156  -2.613  1.00 0.00 ? 126 CYS A HB2  4  
ATOM 7817  H HB3  . CYS A 1 126 ? 15.627  -7.962  -3.874  1.00 0.00 ? 126 CYS A HB3  4  
ATOM 7818  N N    . GLU A 1 127 ? 15.106  -11.834 -3.592  1.00 0.00 ? 127 GLU A N    4  
ATOM 7819  C CA   . GLU A 1 127 ? 14.438  -13.124 -3.572  1.00 0.00 ? 127 GLU A CA   4  
ATOM 7820  C C    . GLU A 1 127 ? 14.111  -13.529 -2.133  1.00 0.00 ? 127 GLU A C    4  
ATOM 7821  O O    . GLU A 1 127 ? 13.042  -14.077 -1.866  1.00 0.00 ? 127 GLU A O    4  
ATOM 7822  C CB   . GLU A 1 127 ? 15.288  -14.193 -4.261  1.00 0.00 ? 127 GLU A CB   4  
ATOM 7823  C CG   . GLU A 1 127 ? 14.510  -15.502 -4.407  1.00 0.00 ? 127 GLU A CG   4  
ATOM 7824  C CD   . GLU A 1 127 ? 15.354  -16.567 -5.112  1.00 0.00 ? 127 GLU A CD   4  
ATOM 7825  O OE1  . GLU A 1 127 ? 16.583  -16.562 -4.878  1.00 0.00 ? 127 GLU A OE1  4  
ATOM 7826  O OE2  . GLU A 1 127 ? 14.753  -17.359 -5.868  1.00 0.00 ? 127 GLU A OE2  4  
ATOM 7827  H H    . GLU A 1 127 ? 15.269  -11.427 -2.693  1.00 0.00 ? 127 GLU A H    4  
ATOM 7828  H HA   . GLU A 1 127 ? 13.516  -12.982 -4.135  1.00 0.00 ? 127 GLU A HA   4  
ATOM 7829  H HB2  . GLU A 1 127 ? 15.596  -13.838 -5.245  1.00 0.00 ? 127 GLU A HB2  4  
ATOM 7830  H HB3  . GLU A 1 127 ? 16.196  -14.368 -3.686  1.00 0.00 ? 127 GLU A HB3  4  
ATOM 7831  H HG2  . GLU A 1 127 ? 14.211  -15.863 -3.423  1.00 0.00 ? 127 GLU A HG2  4  
ATOM 7832  H HG3  . GLU A 1 127 ? 13.595  -15.325 -4.973  1.00 0.00 ? 127 GLU A HG3  4  
ATOM 7833  N N    . CYS A 1 1   ? -11.311 -11.305 -0.490  1.00 0.00 ? 1   CYS A N    5  
ATOM 7834  C CA   . CYS A 1 1   ? -9.905  -11.048 -0.230  1.00 0.00 ? 1   CYS A CA   5  
ATOM 7835  C C    . CYS A 1 1   ? -9.659  -11.200 1.273   1.00 0.00 ? 1   CYS A C    5  
ATOM 7836  O O    . CYS A 1 1   ? -10.514 -10.846 2.084   1.00 0.00 ? 1   CYS A O    5  
ATOM 7837  C CB   . CYS A 1 1   ? -9.478  -9.670  -0.742  1.00 0.00 ? 1   CYS A CB   5  
ATOM 7838  S SG   . CYS A 1 1   ? -10.837 -8.456  -0.901  1.00 0.00 ? 1   CYS A SG   5  
ATOM 7839  H H    . CYS A 1 1   ? -11.689 -10.826 -1.282  1.00 0.00 ? 1   CYS A H    5  
ATOM 7840  H HA   . CYS A 1 1   ? -9.341  -11.793 -0.791  1.00 0.00 ? 1   CYS A HA   5  
ATOM 7841  H HB2  . CYS A 1 1   ? -8.725  -9.265  -0.066  1.00 0.00 ? 1   CYS A HB2  5  
ATOM 7842  H HB3  . CYS A 1 1   ? -9.002  -9.792  -1.714  1.00 0.00 ? 1   CYS A HB3  5  
ATOM 7843  N N    . SER A 1 2   ? -8.487  -11.725 1.599   1.00 0.00 ? 2   SER A N    5  
ATOM 7844  C CA   . SER A 1 2   ? -8.119  -11.929 2.990   1.00 0.00 ? 2   SER A CA   5  
ATOM 7845  C C    . SER A 1 2   ? -6.868  -12.805 3.076   1.00 0.00 ? 2   SER A C    5  
ATOM 7846  O O    . SER A 1 2   ? -6.901  -13.884 3.666   1.00 0.00 ? 2   SER A O    5  
ATOM 7847  C CB   . SER A 1 2   ? -9.267  -12.563 3.777   1.00 0.00 ? 2   SER A CB   5  
ATOM 7848  O OG   . SER A 1 2   ? -10.264 -13.112 2.918   1.00 0.00 ? 2   SER A OG   5  
ATOM 7849  H H    . SER A 1 2   ? -7.799  -12.011 0.932   1.00 0.00 ? 2   SER A H    5  
ATOM 7850  H HA   . SER A 1 2   ? -7.916  -10.932 3.382   1.00 0.00 ? 2   SER A HA   5  
ATOM 7851  H HB2  . SER A 1 2   ? -8.873  -13.347 4.423   1.00 0.00 ? 2   SER A HB2  5  
ATOM 7852  H HB3  . SER A 1 2   ? -9.720  -11.812 4.425   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7853  H HG   . SER A 1 2   ? -9.834  -13.530 2.119   1.00 0.00 ? 2   SER A HG   5  
ATOM 7854  N N    . CYS A 1 3   ? -5.793  -12.309 2.480   1.00 0.00 ? 3   CYS A N    5  
ATOM 7855  C CA   . CYS A 1 3   ? -4.534  -13.034 2.482   1.00 0.00 ? 3   CYS A CA   5  
ATOM 7856  C C    . CYS A 1 3   ? -3.648  -12.454 3.587   1.00 0.00 ? 3   CYS A C    5  
ATOM 7857  O O    . CYS A 1 3   ? -3.891  -11.346 4.063   1.00 0.00 ? 3   CYS A O    5  
ATOM 7858  C CB   . CYS A 1 3   ? -3.849  -12.982 1.116   1.00 0.00 ? 3   CYS A CB   5  
ATOM 7859  S SG   . CYS A 1 3   ? -2.022  -12.907 1.175   1.00 0.00 ? 3   CYS A SG   5  
ATOM 7860  H H    . CYS A 1 3   ? -5.775  -11.431 2.002   1.00 0.00 ? 3   CYS A H    5  
ATOM 7861  H HA   . CYS A 1 3   ? -4.774  -14.077 2.687   1.00 0.00 ? 3   CYS A HA   5  
ATOM 7862  H HB2  . CYS A 1 3   ? -4.144  -13.863 0.544   1.00 0.00 ? 3   CYS A HB2  5  
ATOM 7863  H HB3  . CYS A 1 3   ? -4.217  -12.112 0.573   1.00 0.00 ? 3   CYS A HB3  5  
ATOM 7864  N N    . SER A 1 4   ? -2.641  -13.228 3.961   1.00 0.00 ? 4   SER A N    5  
ATOM 7865  C CA   . SER A 1 4   ? -1.717  -12.804 5.000   1.00 0.00 ? 4   SER A CA   5  
ATOM 7866  C C    . SER A 1 4   ? -0.559  -12.017 4.382   1.00 0.00 ? 4   SER A C    5  
ATOM 7867  O O    . SER A 1 4   ? 0.051   -12.464 3.412   1.00 0.00 ? 4   SER A O    5  
ATOM 7868  C CB   . SER A 1 4   ? -1.185  -14.004 5.786   1.00 0.00 ? 4   SER A CB   5  
ATOM 7869  O OG   . SER A 1 4   ? -0.499  -14.929 4.947   1.00 0.00 ? 4   SER A OG   5  
ATOM 7870  H H    . SER A 1 4   ? -2.451  -14.127 3.568   1.00 0.00 ? 4   SER A H    5  
ATOM 7871  H HA   . SER A 1 4   ? -2.302  -12.167 5.664   1.00 0.00 ? 4   SER A HA   5  
ATOM 7872  H HB2  . SER A 1 4   ? -0.509  -13.655 6.567   1.00 0.00 ? 4   SER A HB2  5  
ATOM 7873  H HB3  . SER A 1 4   ? -2.013  -14.508 6.282   1.00 0.00 ? 4   SER A HB3  5  
ATOM 7874  H HG   . SER A 1 4   ? -0.161  -14.465 4.129   1.00 0.00 ? 4   SER A HG   5  
ATOM 7875  N N    . PRO A 1 5   ? -0.286  -10.830 4.986   1.00 0.00 ? 5   PRO A N    5  
ATOM 7876  C CA   . PRO A 1 5   ? 0.789   -9.977  4.507   1.00 0.00 ? 5   PRO A CA   5  
ATOM 7877  C C    . PRO A 1 5   ? 2.155   -10.536 4.907   1.00 0.00 ? 5   PRO A C    5  
ATOM 7878  O O    . PRO A 1 5   ? 2.709   -10.152 5.937   1.00 0.00 ? 5   PRO A O    5  
ATOM 7879  C CB   . PRO A 1 5   ? 0.505   -8.611  5.109   1.00 0.00 ? 5   PRO A CB   5  
ATOM 7880  C CG   . PRO A 1 5   ? -0.444  -8.857  6.271   1.00 0.00 ? 5   PRO A CG   5  
ATOM 7881  C CD   . PRO A 1 5   ? -0.988  -10.270 6.138   1.00 0.00 ? 5   PRO A CD   5  
ATOM 7882  H HA   . PRO A 1 5   ? 0.788   -9.948  3.507   1.00 0.00 ? 5   PRO A HA   5  
ATOM 7883  H HB2  . PRO A 1 5   ? 1.425   -8.136  5.451   1.00 0.00 ? 5   PRO A HB2  5  
ATOM 7884  H HB3  . PRO A 1 5   ? 0.058   -7.944  4.372   1.00 0.00 ? 5   PRO A HB3  5  
ATOM 7885  H HG2  . PRO A 1 5   ? 0.075   -8.735  7.220   1.00 0.00 ? 5   PRO A HG2  5  
ATOM 7886  H HG3  . PRO A 1 5   ? -1.258  -8.132  6.257   1.00 0.00 ? 5   PRO A HG3  5  
ATOM 7887  H HD2  . PRO A 1 5   ? -0.798  -10.853 7.038   1.00 0.00 ? 5   PRO A HD2  5  
ATOM 7888  H HD3  . PRO A 1 5   ? -2.066  -10.266 5.980   1.00 0.00 ? 5   PRO A HD3  5  
ATOM 7889  N N    . VAL A 1 6   ? 2.659   -11.435 4.075   1.00 0.00 ? 6   VAL A N    5  
ATOM 7890  C CA   . VAL A 1 6   ? 3.949   -12.051 4.330   1.00 0.00 ? 6   VAL A CA   5  
ATOM 7891  C C    . VAL A 1 6   ? 4.997   -11.436 3.399   1.00 0.00 ? 6   VAL A C    5  
ATOM 7892  O O    . VAL A 1 6   ? 5.069   -10.215 3.261   1.00 0.00 ? 6   VAL A O    5  
ATOM 7893  C CB   . VAL A 1 6   ? 3.842   -13.571 4.187   1.00 0.00 ? 6   VAL A CB   5  
ATOM 7894  C CG1  . VAL A 1 6   ? 3.637   -13.970 2.725   1.00 0.00 ? 6   VAL A CG1  5  
ATOM 7895  C CG2  . VAL A 1 6   ? 5.070   -14.265 4.779   1.00 0.00 ? 6   VAL A CG2  5  
ATOM 7896  H H    . VAL A 1 6   ? 2.202   -11.742 3.240   1.00 0.00 ? 6   VAL A H    5  
ATOM 7897  H HA   . VAL A 1 6   ? 4.222   -11.827 5.361   1.00 0.00 ? 6   VAL A HA   5  
ATOM 7898  H HB   . VAL A 1 6   ? 2.969   -13.899 4.750   1.00 0.00 ? 6   VAL A HB   5  
ATOM 7899  H HG11 . VAL A 1 6   ? 3.681   -13.082 2.096   1.00 0.00 ? 6   VAL A HG11 5  
ATOM 7900  H HG12 . VAL A 1 6   ? 4.419   -14.667 2.425   1.00 0.00 ? 6   VAL A HG12 5  
ATOM 7901  H HG13 . VAL A 1 6   ? 2.663   -14.447 2.612   1.00 0.00 ? 6   VAL A HG13 5  
ATOM 7902  H HG21 . VAL A 1 6   ? 5.884   -13.547 4.872   1.00 0.00 ? 6   VAL A HG21 5  
ATOM 7903  H HG22 . VAL A 1 6   ? 4.823   -14.665 5.762   1.00 0.00 ? 6   VAL A HG22 5  
ATOM 7904  H HG23 . VAL A 1 6   ? 5.378   -15.079 4.122   1.00 0.00 ? 6   VAL A HG23 5  
ATOM 7905  N N    . HIS A 1 7   ? 5.783   -12.309 2.786   1.00 0.00 ? 7   HIS A N    5  
ATOM 7906  C CA   . HIS A 1 7   ? 6.823   -11.867 1.873   1.00 0.00 ? 7   HIS A CA   5  
ATOM 7907  C C    . HIS A 1 7   ? 7.493   -10.608 2.429   1.00 0.00 ? 7   HIS A C    5  
ATOM 7908  O O    . HIS A 1 7   ? 7.100   -9.492  2.094   1.00 0.00 ? 7   HIS A O    5  
ATOM 7909  C CB   . HIS A 1 7   ? 6.259   -11.665 0.464   1.00 0.00 ? 7   HIS A CB   5  
ATOM 7910  C CG   . HIS A 1 7   ? 4.793   -11.308 0.435   1.00 0.00 ? 7   HIS A CG   5  
ATOM 7911  N ND1  . HIS A 1 7   ? 3.825   -12.154 -0.077  1.00 0.00 ? 7   HIS A ND1  5  
ATOM 7912  C CD2  . HIS A 1 7   ? 4.139   -10.189 0.861   1.00 0.00 ? 7   HIS A CD2  5  
ATOM 7913  C CE1  . HIS A 1 7   ? 2.646   -11.560 0.038   1.00 0.00 ? 7   HIS A CE1  5  
ATOM 7914  N NE2  . HIS A 1 7   ? 2.843   -10.343 0.620   1.00 0.00 ? 7   HIS A NE2  5  
ATOM 7915  H H    . HIS A 1 7   ? 5.717   -13.299 2.904   1.00 0.00 ? 7   HIS A H    5  
ATOM 7916  H HA   . HIS A 1 7   ? 7.559   -12.669 1.825   1.00 0.00 ? 7   HIS A HA   5  
ATOM 7917  H HB2  . HIS A 1 7   ? 6.825   -10.877 -0.033  1.00 0.00 ? 7   HIS A HB2  5  
ATOM 7918  H HB3  . HIS A 1 7   ? 6.411   -12.579 -0.110  1.00 0.00 ? 7   HIS A HB3  5  
ATOM 7919  H HD1  . HIS A 1 7   ? 3.987   -13.060 -0.470  1.00 0.00 ? 7   HIS A HD1  5  
ATOM 7920  H HD2  . HIS A 1 7   ? 4.603   -9.316  1.321   1.00 0.00 ? 7   HIS A HD2  5  
ATOM 7921  H HE1  . HIS A 1 7   ? 1.687   -11.973 -0.276  1.00 0.00 ? 7   HIS A HE1  5  
ATOM 7922  N N    . PRO A 1 8   ? 8.520   -10.838 3.290   1.00 0.00 ? 8   PRO A N    5  
ATOM 7923  C CA   . PRO A 1 8   ? 9.248   -9.736  3.896   1.00 0.00 ? 8   PRO A CA   5  
ATOM 7924  C C    . PRO A 1 8   ? 10.195  -9.084  2.885   1.00 0.00 ? 8   PRO A C    5  
ATOM 7925  O O    . PRO A 1 8   ? 10.605  -7.938  3.064   1.00 0.00 ? 8   PRO A O    5  
ATOM 7926  C CB   . PRO A 1 8   ? 9.975   -10.349 5.082   1.00 0.00 ? 8   PRO A CB   5  
ATOM 7927  C CG   . PRO A 1 8   ? 10.001  -11.847 4.826   1.00 0.00 ? 8   PRO A CG   5  
ATOM 7928  C CD   . PRO A 1 8   ? 9.013   -12.146 3.709   1.00 0.00 ? 8   PRO A CD   5  
ATOM 7929  H HA   . PRO A 1 8   ? 8.615   -9.016  4.180   1.00 0.00 ? 8   PRO A HA   5  
ATOM 7930  H HB2  . PRO A 1 8   ? 10.985  -9.950  5.169   1.00 0.00 ? 8   PRO A HB2  5  
ATOM 7931  H HB3  . PRO A 1 8   ? 9.461   -10.121 6.014   1.00 0.00 ? 8   PRO A HB3  5  
ATOM 7932  H HG2  . PRO A 1 8   ? 11.003  -12.168 4.543   1.00 0.00 ? 8   PRO A HG2  5  
ATOM 7933  H HG3  . PRO A 1 8   ? 9.733   -12.393 5.729   1.00 0.00 ? 8   PRO A HG3  5  
ATOM 7934  H HD2  . PRO A 1 8   ? 9.494   -12.671 2.885   1.00 0.00 ? 8   PRO A HD2  5  
ATOM 7935  H HD3  . PRO A 1 8   ? 8.200   -12.781 4.061   1.00 0.00 ? 8   PRO A HD3  5  
ATOM 7936  N N    . GLN A 1 9   ? 10.516  -9.843  1.849   1.00 0.00 ? 9   GLN A N    5  
ATOM 7937  C CA   . GLN A 1 9   ? 11.406  -9.353  0.810   1.00 0.00 ? 9   GLN A CA   5  
ATOM 7938  C C    . GLN A 1 9   ? 10.698  -9.365  -0.546  1.00 0.00 ? 9   GLN A C    5  
ATOM 7939  O O    . GLN A 1 9   ? 10.827  -8.421  -1.325  1.00 0.00 ? 9   GLN A O    5  
ATOM 7940  C CB   . GLN A 1 9   ? 12.696  -10.176 0.762   1.00 0.00 ? 9   GLN A CB   5  
ATOM 7941  C CG   . GLN A 1 9   ? 13.667  -9.613  -0.279  1.00 0.00 ? 9   GLN A CG   5  
ATOM 7942  C CD   . GLN A 1 9   ? 14.933  -9.073  0.388   1.00 0.00 ? 9   GLN A CD   5  
ATOM 7943  O OE1  . GLN A 1 9   ? 16.039  -9.522  0.135   1.00 0.00 ? 9   GLN A OE1  5  
ATOM 7944  N NE2  . GLN A 1 9   ? 14.711  -8.087  1.252   1.00 0.00 ? 9   GLN A NE2  5  
ATOM 7945  H H    . GLN A 1 9   ? 10.178  -10.774 1.711   1.00 0.00 ? 9   GLN A H    5  
ATOM 7946  H HA   . GLN A 1 9   ? 11.647  -8.328  1.094   1.00 0.00 ? 9   GLN A HA   5  
ATOM 7947  H HB2  . GLN A 1 9   ? 13.170  -10.175 1.744   1.00 0.00 ? 9   GLN A HB2  5  
ATOM 7948  H HB3  . GLN A 1 9   ? 12.462  -11.213 0.522   1.00 0.00 ? 9   GLN A HB3  5  
ATOM 7949  H HG2  . GLN A 1 9   ? 13.931  -10.394 -0.993  1.00 0.00 ? 9   GLN A HG2  5  
ATOM 7950  H HG3  . GLN A 1 9   ? 13.180  -8.818  -0.843  1.00 0.00 ? 9   GLN A HG3  5  
ATOM 7951  H HE21 . GLN A 1 9   ? 13.778  -7.765  1.414   1.00 0.00 ? 9   GLN A HE21 5  
ATOM 7952  H HE22 . GLN A 1 9   ? 15.477  -7.667  1.739   1.00 0.00 ? 9   GLN A HE22 5  
ATOM 7953  N N    . GLN A 1 10  ? 9.967   -10.442 -0.787  1.00 0.00 ? 10  GLN A N    5  
ATOM 7954  C CA   . GLN A 1 10  ? 9.238   -10.588 -2.035  1.00 0.00 ? 10  GLN A CA   5  
ATOM 7955  C C    . GLN A 1 10  ? 8.177   -9.493  -2.162  1.00 0.00 ? 10  GLN A C    5  
ATOM 7956  O O    . GLN A 1 10  ? 7.514   -9.382  -3.192  1.00 0.00 ? 10  GLN A O    5  
ATOM 7957  C CB   . GLN A 1 10  ? 8.607   -11.978 -2.142  1.00 0.00 ? 10  GLN A CB   5  
ATOM 7958  C CG   . GLN A 1 10  ? 9.488   -13.033 -1.471  1.00 0.00 ? 10  GLN A CG   5  
ATOM 7959  C CD   . GLN A 1 10  ? 9.324   -14.395 -2.148  1.00 0.00 ? 10  GLN A CD   5  
ATOM 7960  O OE1  . GLN A 1 10  ? 8.346   -14.668 -2.825  1.00 0.00 ? 10  GLN A OE1  5  
ATOM 7961  N NE2  . GLN A 1 10  ? 10.333  -15.234 -1.927  1.00 0.00 ? 10  GLN A NE2  5  
ATOM 7962  H H    . GLN A 1 10  ? 9.868   -11.205 -0.148  1.00 0.00 ? 10  GLN A H    5  
ATOM 7963  H HA   . GLN A 1 10  ? 9.983   -10.473 -2.822  1.00 0.00 ? 10  GLN A HA   5  
ATOM 7964  H HB2  . GLN A 1 10  ? 7.621   -11.971 -1.677  1.00 0.00 ? 10  GLN A HB2  5  
ATOM 7965  H HB3  . GLN A 1 10  ? 8.461   -12.235 -3.192  1.00 0.00 ? 10  GLN A HB3  5  
ATOM 7966  H HG2  . GLN A 1 10  ? 10.531  -12.724 -1.516  1.00 0.00 ? 10  GLN A HG2  5  
ATOM 7967  H HG3  . GLN A 1 10  ? 9.225   -13.113 -0.416  1.00 0.00 ? 10  GLN A HG3  5  
ATOM 7968  H HE21 . GLN A 1 10  ? 11.105  -14.947 -1.360  1.00 0.00 ? 10  GLN A HE21 5  
ATOM 7969  H HE22 . GLN A 1 10  ? 10.318  -16.150 -2.328  1.00 0.00 ? 10  GLN A HE22 5  
ATOM 7970  N N    . ALA A 1 11  ? 8.048   -8.713  -1.098  1.00 0.00 ? 11  ALA A N    5  
ATOM 7971  C CA   . ALA A 1 11  ? 7.079   -7.630  -1.078  1.00 0.00 ? 11  ALA A CA   5  
ATOM 7972  C C    . ALA A 1 11  ? 7.683   -6.397  -1.752  1.00 0.00 ? 11  ALA A C    5  
ATOM 7973  O O    . ALA A 1 11  ? 6.993   -5.678  -2.473  1.00 0.00 ? 11  ALA A O    5  
ATOM 7974  C CB   . ALA A 1 11  ? 6.651   -7.356  0.366   1.00 0.00 ? 11  ALA A CB   5  
ATOM 7975  H H    . ALA A 1 11  ? 8.591   -8.810  -0.264  1.00 0.00 ? 11  ALA A H    5  
ATOM 7976  H HA   . ALA A 1 11  ? 6.207   -7.954  -1.647  1.00 0.00 ? 11  ALA A HA   5  
ATOM 7977  H HB1  . ALA A 1 11  ? 7.408   -7.740  1.048   1.00 0.00 ? 11  ALA A HB1  5  
ATOM 7978  H HB2  . ALA A 1 11  ? 6.540   -6.282  0.514   1.00 0.00 ? 11  ALA A HB2  5  
ATOM 7979  H HB3  . ALA A 1 11  ? 5.700   -7.850  0.563   1.00 0.00 ? 11  ALA A HB3  5  
ATOM 7980  N N    . PHE A 1 12  ? 8.966   -6.189  -1.492  1.00 0.00 ? 12  PHE A N    5  
ATOM 7981  C CA   . PHE A 1 12  ? 9.671   -5.055  -2.063  1.00 0.00 ? 12  PHE A CA   5  
ATOM 7982  C C    . PHE A 1 12  ? 10.237  -5.401  -3.443  1.00 0.00 ? 12  PHE A C    5  
ATOM 7983  O O    . PHE A 1 12  ? 10.919  -4.584  -4.059  1.00 0.00 ? 12  PHE A O    5  
ATOM 7984  C CB   . PHE A 1 12  ? 10.828  -4.725  -1.119  1.00 0.00 ? 12  PHE A CB   5  
ATOM 7985  C CG   . PHE A 1 12  ? 10.384  -4.204  0.249   1.00 0.00 ? 12  PHE A CG   5  
ATOM 7986  C CD1  . PHE A 1 12  ? 9.450   -4.884  0.966   1.00 0.00 ? 12  PHE A CD1  5  
ATOM 7987  C CD2  . PHE A 1 12  ? 10.924  -3.059  0.749   1.00 0.00 ? 12  PHE A CD2  5  
ATOM 7988  C CE1  . PHE A 1 12  ? 9.038   -4.401  2.236   1.00 0.00 ? 12  PHE A CE1  5  
ATOM 7989  C CE2  . PHE A 1 12  ? 10.512  -2.576  2.019   1.00 0.00 ? 12  PHE A CE2  5  
ATOM 7990  C CZ   . PHE A 1 12  ? 9.578   -3.257  2.736   1.00 0.00 ? 12  PHE A CZ   5  
ATOM 7991  H H    . PHE A 1 12  ? 9.520   -6.779  -0.904  1.00 0.00 ? 12  PHE A H    5  
ATOM 7992  H HA   . PHE A 1 12  ? 8.952   -4.242  -2.162  1.00 0.00 ? 12  PHE A HA   5  
ATOM 7993  H HB2  . PHE A 1 12  ? 11.434  -5.619  -0.976  1.00 0.00 ? 12  PHE A HB2  5  
ATOM 7994  H HB3  . PHE A 1 12  ? 11.467  -3.978  -1.591  1.00 0.00 ? 12  PHE A HB3  5  
ATOM 7995  H HD1  . PHE A 1 12  ? 9.017   -5.800  0.565   1.00 0.00 ? 12  PHE A HD1  5  
ATOM 7996  H HD2  . PHE A 1 12  ? 11.673  -2.514  0.175   1.00 0.00 ? 12  PHE A HD2  5  
ATOM 7997  H HE1  . PHE A 1 12  ? 8.289   -4.946  2.810   1.00 0.00 ? 12  PHE A HE1  5  
ATOM 7998  H HE2  . PHE A 1 12  ? 10.945  -1.660  2.420   1.00 0.00 ? 12  PHE A HE2  5  
ATOM 7999  H HZ   . PHE A 1 12  ? 9.262   -2.886  3.710   1.00 0.00 ? 12  PHE A HZ   5  
ATOM 8000  N N    . CYS A 1 13  ? 9.931   -6.611  -3.886  1.00 0.00 ? 13  CYS A N    5  
ATOM 8001  C CA   . CYS A 1 13  ? 10.402  -7.074  -5.181  1.00 0.00 ? 13  CYS A CA   5  
ATOM 8002  C C    . CYS A 1 13  ? 9.193   -7.213  -6.109  1.00 0.00 ? 13  CYS A C    5  
ATOM 8003  O O    . CYS A 1 13  ? 9.348   -7.311  -7.325  1.00 0.00 ? 13  CYS A O    5  
ATOM 8004  C CB   . CYS A 1 13  ? 11.184  -8.383  -5.063  1.00 0.00 ? 13  CYS A CB   5  
ATOM 8005  S SG   . CYS A 1 13  ? 13.000  -8.184  -4.946  1.00 0.00 ? 13  CYS A SG   5  
ATOM 8006  H H    . CYS A 1 13  ? 9.376   -7.268  -3.378  1.00 0.00 ? 13  CYS A H    5  
ATOM 8007  H HA   . CYS A 1 13  ? 11.090  -6.316  -5.554  1.00 0.00 ? 13  CYS A HA   5  
ATOM 8008  H HB2  . CYS A 1 13  ? 10.834  -8.922  -4.183  1.00 0.00 ? 13  CYS A HB2  5  
ATOM 8009  H HB3  . CYS A 1 13  ? 10.956  -9.006  -5.929  1.00 0.00 ? 13  CYS A HB3  5  
ATOM 8010  N N    . ASN A 1 14  ? 8.017   -7.216  -5.500  1.00 0.00 ? 14  ASN A N    5  
ATOM 8011  C CA   . ASN A 1 14  ? 6.782   -7.341  -6.257  1.00 0.00 ? 14  ASN A CA   5  
ATOM 8012  C C    . ASN A 1 14  ? 6.185   -5.951  -6.483  1.00 0.00 ? 14  ASN A C    5  
ATOM 8013  O O    . ASN A 1 14  ? 5.667   -5.662  -7.561  1.00 0.00 ? 14  ASN A O    5  
ATOM 8014  C CB   . ASN A 1 14  ? 5.754   -8.180  -5.496  1.00 0.00 ? 14  ASN A CB   5  
ATOM 8015  C CG   . ASN A 1 14  ? 5.339   -9.409  -6.309  1.00 0.00 ? 14  ASN A CG   5  
ATOM 8016  O OD1  . ASN A 1 14  ? 4.599   -9.326  -7.274  1.00 0.00 ? 14  ASN A OD1  5  
ATOM 8017  N ND2  . ASN A 1 14  ? 5.859   -10.550 -5.865  1.00 0.00 ? 14  ASN A ND2  5  
ATOM 8018  H H    . ASN A 1 14  ? 7.899   -7.135  -4.510  1.00 0.00 ? 14  ASN A H    5  
ATOM 8019  H HA   . ASN A 1 14  ? 7.066   -7.830  -7.188  1.00 0.00 ? 14  ASN A HA   5  
ATOM 8020  H HB2  . ASN A 1 14  ? 6.170   -8.495  -4.540  1.00 0.00 ? 14  ASN A HB2  5  
ATOM 8021  H HB3  . ASN A 1 14  ? 4.875   -7.573  -5.276  1.00 0.00 ? 14  ASN A HB3  5  
ATOM 8022  H HD21 . ASN A 1 14  ? 6.460   -10.549 -5.066  1.00 0.00 ? 14  ASN A HD21 5  
ATOM 8023  H HD22 . ASN A 1 14  ? 5.647   -11.410 -6.330  1.00 0.00 ? 14  ASN A HD22 5  
ATOM 8024  N N    . ALA A 1 15  ? 6.276   -5.127  -5.449  1.00 0.00 ? 15  ALA A N    5  
ATOM 8025  C CA   . ALA A 1 15  ? 5.751   -3.774  -5.522  1.00 0.00 ? 15  ALA A CA   5  
ATOM 8026  C C    . ALA A 1 15  ? 6.360   -3.060  -6.730  1.00 0.00 ? 15  ALA A C    5  
ATOM 8027  O O    . ALA A 1 15  ? 7.250   -3.595  -7.389  1.00 0.00 ? 15  ALA A O    5  
ATOM 8028  C CB   . ALA A 1 15  ? 6.038   -3.044  -4.208  1.00 0.00 ? 15  ALA A CB   5  
ATOM 8029  H H    . ALA A 1 15  ? 6.700   -5.370  -4.576  1.00 0.00 ? 15  ALA A H    5  
ATOM 8030  H HA   . ALA A 1 15  ? 4.673   -3.843  -5.657  1.00 0.00 ? 15  ALA A HA   5  
ATOM 8031  H HB1  . ALA A 1 15  ? 7.106   -3.089  -3.992  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 8032  H HB2  . ALA A 1 15  ? 5.729   -2.002  -4.297  1.00 0.00 ? 15  ALA A HB2  5  
ATOM 8033  H HB3  . ALA A 1 15  ? 5.484   -3.520  -3.400  1.00 0.00 ? 15  ALA A HB3  5  
ATOM 8034  N N    . ASP A 1 16  ? 5.855   -1.862  -6.986  1.00 0.00 ? 16  ASP A N    5  
ATOM 8035  C CA   . ASP A 1 16  ? 6.337   -1.069  -8.104  1.00 0.00 ? 16  ASP A CA   5  
ATOM 8036  C C    . ASP A 1 16  ? 6.165   0.417   -7.781  1.00 0.00 ? 16  ASP A C    5  
ATOM 8037  O O    . ASP A 1 16  ? 6.256   1.263   -8.669  1.00 0.00 ? 16  ASP A O    5  
ATOM 8038  C CB   . ASP A 1 16  ? 5.545   -1.372  -9.377  1.00 0.00 ? 16  ASP A CB   5  
ATOM 8039  C CG   . ASP A 1 16  ? 6.132   -2.475  -10.259 1.00 0.00 ? 16  ASP A CG   5  
ATOM 8040  O OD1  . ASP A 1 16  ? 7.337   -2.759  -10.082 1.00 0.00 ? 16  ASP A OD1  5  
ATOM 8041  O OD2  . ASP A 1 16  ? 5.364   -3.008  -11.087 1.00 0.00 ? 16  ASP A OD2  5  
ATOM 8042  H H    . ASP A 1 16  ? 5.131   -1.434  -6.446  1.00 0.00 ? 16  ASP A H    5  
ATOM 8043  H HA   . ASP A 1 16  ? 7.383   -1.351  -8.225  1.00 0.00 ? 16  ASP A HA   5  
ATOM 8044  H HB2  . ASP A 1 16  ? 4.530   -1.654  -9.096  1.00 0.00 ? 16  ASP A HB2  5  
ATOM 8045  H HB3  . ASP A 1 16  ? 5.469   -0.457  -9.966  1.00 0.00 ? 16  ASP A HB3  5  
ATOM 8046  N N    . VAL A 1 17  ? 5.918   0.688   -6.509  1.00 0.00 ? 17  VAL A N    5  
ATOM 8047  C CA   . VAL A 1 17  ? 5.732   2.058   -6.057  1.00 0.00 ? 17  VAL A CA   5  
ATOM 8048  C C    . VAL A 1 17  ? 5.819   2.104   -4.531  1.00 0.00 ? 17  VAL A C    5  
ATOM 8049  O O    . VAL A 1 17  ? 4.807   1.970   -3.844  1.00 0.00 ? 17  VAL A O    5  
ATOM 8050  C CB   . VAL A 1 17  ? 4.412   2.612   -6.599  1.00 0.00 ? 17  VAL A CB   5  
ATOM 8051  C CG1  . VAL A 1 17  ? 3.218   1.887   -5.977  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 8052  C CG2  . VAL A 1 17  ? 4.318   4.121   -6.370  1.00 0.00 ? 17  VAL A CG2  5  
ATOM 8053  H H    . VAL A 1 17  ? 5.845   -0.006  -5.792  1.00 0.00 ? 17  VAL A H    5  
ATOM 8054  H HA   . VAL A 1 17  ? 6.544   2.654   -6.474  1.00 0.00 ? 17  VAL A HA   5  
ATOM 8055  H HB   . VAL A 1 17  ? 4.390   2.434   -7.674  1.00 0.00 ? 17  VAL A HB   5  
ATOM 8056  H HG11 . VAL A 1 17  ? 3.464   0.834   -5.838  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 8057  H HG12 . VAL A 1 17  ? 2.982   2.335   -5.012  1.00 0.00 ? 17  VAL A HG12 5  
ATOM 8058  H HG13 . VAL A 1 17  ? 2.355   1.973   -6.639  1.00 0.00 ? 17  VAL A HG13 5  
ATOM 8059  H HG21 . VAL A 1 17  ? 5.309   4.566   -6.458  1.00 0.00 ? 17  VAL A HG21 5  
ATOM 8060  H HG22 . VAL A 1 17  ? 3.654   4.561   -7.115  1.00 0.00 ? 17  VAL A HG22 5  
ATOM 8061  H HG23 . VAL A 1 17  ? 3.921   4.313   -5.372  1.00 0.00 ? 17  VAL A HG23 5  
ATOM 8062  N N    . VAL A 1 18  ? 7.036   2.293   -4.045  1.00 0.00 ? 18  VAL A N    5  
ATOM 8063  C CA   . VAL A 1 18  ? 7.268   2.359   -2.612  1.00 0.00 ? 18  VAL A CA   5  
ATOM 8064  C C    . VAL A 1 18  ? 7.402   3.823   -2.188  1.00 0.00 ? 18  VAL A C    5  
ATOM 8065  O O    . VAL A 1 18  ? 8.331   4.512   -2.605  1.00 0.00 ? 18  VAL A O    5  
ATOM 8066  C CB   . VAL A 1 18  ? 8.490   1.516   -2.240  1.00 0.00 ? 18  VAL A CB   5  
ATOM 8067  C CG1  . VAL A 1 18  ? 8.332   0.906   -0.846  1.00 0.00 ? 18  VAL A CG1  5  
ATOM 8068  C CG2  . VAL A 1 18  ? 8.745   0.429   -3.288  1.00 0.00 ? 18  VAL A CG2  5  
ATOM 8069  H H    . VAL A 1 18  ? 7.854   2.401   -4.611  1.00 0.00 ? 18  VAL A H    5  
ATOM 8070  H HA   . VAL A 1 18  ? 6.399   1.928   -2.118  1.00 0.00 ? 18  VAL A HA   5  
ATOM 8071  H HB   . VAL A 1 18  ? 9.359   2.173   -2.222  1.00 0.00 ? 18  VAL A HB   5  
ATOM 8072  H HG11 . VAL A 1 18  ? 7.303   1.029   -0.510  1.00 0.00 ? 18  VAL A HG11 5  
ATOM 8073  H HG12 . VAL A 1 18  ? 8.577   -0.155  -0.883  1.00 0.00 ? 18  VAL A HG12 5  
ATOM 8074  H HG13 . VAL A 1 18  ? 9.003   1.410   -0.151  1.00 0.00 ? 18  VAL A HG13 5  
ATOM 8075  H HG21 . VAL A 1 18  ? 8.745   0.876   -4.282  1.00 0.00 ? 18  VAL A HG21 5  
ATOM 8076  H HG22 . VAL A 1 18  ? 9.712   -0.037  -3.100  1.00 0.00 ? 18  VAL A HG22 5  
ATOM 8077  H HG23 . VAL A 1 18  ? 7.960   -0.325  -3.228  1.00 0.00 ? 18  VAL A HG23 5  
ATOM 8078  N N    . ILE A 1 19  ? 6.460   4.254   -1.362  1.00 0.00 ? 19  ILE A N    5  
ATOM 8079  C CA   . ILE A 1 19  ? 6.460   5.623   -0.876  1.00 0.00 ? 19  ILE A CA   5  
ATOM 8080  C C    . ILE A 1 19  ? 6.022   5.641   0.589   1.00 0.00 ? 19  ILE A C    5  
ATOM 8081  O O    . ILE A 1 19  ? 4.961   5.118   0.929   1.00 0.00 ? 19  ILE A O    5  
ATOM 8082  C CB   . ILE A 1 19  ? 5.609   6.514   -1.783  1.00 0.00 ? 19  ILE A CB   5  
ATOM 8083  C CG1  . ILE A 1 19  ? 4.117   6.239   -1.578  1.00 0.00 ? 19  ILE A CG1  5  
ATOM 8084  C CG2  . ILE A 1 19  ? 6.023   6.361   -3.249  1.00 0.00 ? 19  ILE A CG2  5  
ATOM 8085  C CD1  . ILE A 1 19  ? 3.321   6.565   -2.844  1.00 0.00 ? 19  ILE A CD1  5  
ATOM 8086  H H    . ILE A 1 19  ? 5.708   3.687   -1.027  1.00 0.00 ? 19  ILE A H    5  
ATOM 8087  H HA   . ILE A 1 19  ? 7.484   5.991   -0.934  1.00 0.00 ? 19  ILE A HA   5  
ATOM 8088  H HB   . ILE A 1 19  ? 5.785   7.554   -1.506  1.00 0.00 ? 19  ILE A HB   5  
ATOM 8089  H HG12 . ILE A 1 19  ? 3.971   5.193   -1.310  1.00 0.00 ? 19  ILE A HG12 5  
ATOM 8090  H HG13 . ILE A 1 19  ? 3.745   6.837   -0.746  1.00 0.00 ? 19  ILE A HG13 5  
ATOM 8091  H HG21 . ILE A 1 19  ? 7.103   6.219   -3.307  1.00 0.00 ? 19  ILE A HG21 5  
ATOM 8092  H HG22 . ILE A 1 19  ? 5.519   5.496   -3.680  1.00 0.00 ? 19  ILE A HG22 5  
ATOM 8093  H HG23 . ILE A 1 19  ? 5.743   7.258   -3.801  1.00 0.00 ? 19  ILE A HG23 5  
ATOM 8094  H HD11 . ILE A 1 19  ? 3.753   7.439   -3.331  1.00 0.00 ? 19  ILE A HD11 5  
ATOM 8095  H HD12 . ILE A 1 19  ? 3.356   5.714   -3.524  1.00 0.00 ? 19  ILE A HD12 5  
ATOM 8096  H HD13 . ILE A 1 19  ? 2.284   6.774   -2.576  1.00 0.00 ? 19  ILE A HD13 5  
ATOM 8097  N N    . ARG A 1 20  ? 6.859   6.247   1.418   1.00 0.00 ? 20  ARG A N    5  
ATOM 8098  C CA   . ARG A 1 20  ? 6.571   6.339   2.839   1.00 0.00 ? 20  ARG A CA   5  
ATOM 8099  C C    . ARG A 1 20  ? 5.537   7.436   3.101   1.00 0.00 ? 20  ARG A C    5  
ATOM 8100  O O    . ARG A 1 20  ? 5.676   8.213   4.044   1.00 0.00 ? 20  ARG A O    5  
ATOM 8101  C CB   . ARG A 1 20  ? 7.839   6.641   3.640   1.00 0.00 ? 20  ARG A CB   5  
ATOM 8102  C CG   . ARG A 1 20  ? 7.838   5.891   4.973   1.00 0.00 ? 20  ARG A CG   5  
ATOM 8103  C CD   . ARG A 1 20  ? 7.705   6.860   6.148   1.00 0.00 ? 20  ARG A CD   5  
ATOM 8104  N NE   . ARG A 1 20  ? 8.768   7.888   6.078   1.00 0.00 ? 20  ARG A NE   5  
ATOM 8105  C CZ   . ARG A 1 20  ? 9.175   8.619   7.125   1.00 0.00 ? 20  ARG A CZ   5  
ATOM 8106  N NH1  . ARG A 1 20  ? 8.611   8.440   8.327   1.00 0.00 ? 20  ARG A NH1  5  
ATOM 8107  N NH2  . ARG A 1 20  ? 10.146  9.529   6.969   1.00 0.00 ? 20  ARG A NH2  5  
ATOM 8108  H H    . ARG A 1 20  ? 7.719   6.670   1.133   1.00 0.00 ? 20  ARG A H    5  
ATOM 8109  H HA   . ARG A 1 20  ? 6.178   5.358   3.108   1.00 0.00 ? 20  ARG A HA   5  
ATOM 8110  H HB2  . ARG A 1 20  ? 8.717   6.357   3.058   1.00 0.00 ? 20  ARG A HB2  5  
ATOM 8111  H HB3  . ARG A 1 20  ? 7.912   7.714   3.822   1.00 0.00 ? 20  ARG A HB3  5  
ATOM 8112  H HG2  . ARG A 1 20  ? 7.014   5.176   4.991   1.00 0.00 ? 20  ARG A HG2  5  
ATOM 8113  H HG3  . ARG A 1 20  ? 8.759   5.317   5.072   1.00 0.00 ? 20  ARG A HG3  5  
ATOM 8114  H HD2  . ARG A 1 20  ? 6.725   7.336   6.128   1.00 0.00 ? 20  ARG A HD2  5  
ATOM 8115  H HD3  . ARG A 1 20  ? 7.776   6.315   7.089   1.00 0.00 ? 20  ARG A HD3  5  
ATOM 8116  H HE   . ARG A 1 20  ? 9.210   8.047   5.196   1.00 0.00 ? 20  ARG A HE   5  
ATOM 8117  H HH11 . ARG A 1 20  ? 7.886   7.761   8.444   1.00 0.00 ? 20  ARG A HH11 5  
ATOM 8118  H HH12 . ARG A 1 20  ? 8.915   8.987   9.108   1.00 0.00 ? 20  ARG A HH12 5  
ATOM 8119  H HH21 . ARG A 1 20  ? 10.567  9.663   6.072   1.00 0.00 ? 20  ARG A HH21 5  
ATOM 8120  H HH22 . ARG A 1 20  ? 10.450  10.076  7.749   1.00 0.00 ? 20  ARG A HH22 5  
ATOM 8121  N N    . THR A 1 21  ? 4.523   7.465   2.249   1.00 0.00 ? 21  THR A N    5  
ATOM 8122  C CA   . THR A 1 21  ? 3.466   8.454   2.377   1.00 0.00 ? 21  THR A CA   5  
ATOM 8123  C C    . THR A 1 21  ? 2.691   8.241   3.678   1.00 0.00 ? 21  THR A C    5  
ATOM 8124  O O    . THR A 1 21  ? 2.942   7.280   4.404   1.00 0.00 ? 21  THR A O    5  
ATOM 8125  C CB   . THR A 1 21  ? 2.589   8.373   1.125   1.00 0.00 ? 21  THR A CB   5  
ATOM 8126  O OG1  . THR A 1 21  ? 1.477   9.212   1.427   1.00 0.00 ? 21  THR A OG1  5  
ATOM 8127  C CG2  . THR A 1 21  ? 1.969   6.987   0.934   1.00 0.00 ? 21  THR A CG2  5  
ATOM 8128  H H    . THR A 1 21  ? 4.417   6.830   1.483   1.00 0.00 ? 21  THR A H    5  
ATOM 8129  H HA   . THR A 1 21  ? 3.925   9.441   2.436   1.00 0.00 ? 21  THR A HA   5  
ATOM 8130  H HB   . THR A 1 21  ? 3.146   8.677   0.239   1.00 0.00 ? 21  THR A HB   5  
ATOM 8131  H HG1  . THR A 1 21  ? 1.303   9.835   0.664   1.00 0.00 ? 21  THR A HG1  5  
ATOM 8132  H HG21 . THR A 1 21  ? 2.713   6.222   1.158   1.00 0.00 ? 21  THR A HG21 5  
ATOM 8133  H HG22 . THR A 1 21  ? 1.118   6.873   1.605   1.00 0.00 ? 21  THR A HG22 5  
ATOM 8134  H HG23 . THR A 1 21  ? 1.635   6.878   -0.098  1.00 0.00 ? 21  THR A HG23 5  
ATOM 8135  N N    . LYS A 1 22  ? 1.763   9.152   3.933   1.00 0.00 ? 22  LYS A N    5  
ATOM 8136  C CA   . LYS A 1 22  ? 0.948   9.075   5.133   1.00 0.00 ? 22  LYS A CA   5  
ATOM 8137  C C    . LYS A 1 22  ? -0.529  9.188   4.751   1.00 0.00 ? 22  LYS A C    5  
ATOM 8138  O O    . LYS A 1 22  ? -0.947  10.185  4.165   1.00 0.00 ? 22  LYS A O    5  
ATOM 8139  C CB   . LYS A 1 22  ? 1.401   10.120  6.155   1.00 0.00 ? 22  LYS A CB   5  
ATOM 8140  C CG   . LYS A 1 22  ? 1.133   11.538  5.644   1.00 0.00 ? 22  LYS A CG   5  
ATOM 8141  C CD   . LYS A 1 22  ? 1.341   12.569  6.756   1.00 0.00 ? 22  LYS A CD   5  
ATOM 8142  C CE   . LYS A 1 22  ? 0.651   12.128  8.048   1.00 0.00 ? 22  LYS A CE   5  
ATOM 8143  N NZ   . LYS A 1 22  ? 0.512   13.273  8.977   1.00 0.00 ? 22  LYS A NZ   5  
ATOM 8144  H H    . LYS A 1 22  ? 1.565   9.929   3.337   1.00 0.00 ? 22  LYS A H    5  
ATOM 8145  H HA   . LYS A 1 22  ? 1.116   8.095   5.580   1.00 0.00 ? 22  LYS A HA   5  
ATOM 8146  H HB2  . LYS A 1 22  ? 0.876   9.965   7.097   1.00 0.00 ? 22  LYS A HB2  5  
ATOM 8147  H HB3  . LYS A 1 22  ? 2.464   9.998   6.359   1.00 0.00 ? 22  LYS A HB3  5  
ATOM 8148  H HG2  . LYS A 1 22  ? 1.798   11.759  4.809   1.00 0.00 ? 22  LYS A HG2  5  
ATOM 8149  H HG3  . LYS A 1 22  ? 0.113   11.606  5.266   1.00 0.00 ? 22  LYS A HG3  5  
ATOM 8150  H HD2  . LYS A 1 22  ? 2.408   12.706  6.936   1.00 0.00 ? 22  LYS A HD2  5  
ATOM 8151  H HD3  . LYS A 1 22  ? 0.945   13.534  6.440   1.00 0.00 ? 22  LYS A HD3  5  
ATOM 8152  H HE2  . LYS A 1 22  ? -0.331  11.715  7.821   1.00 0.00 ? 22  LYS A HE2  5  
ATOM 8153  H HE3  . LYS A 1 22  ? 1.229   11.335  8.523   1.00 0.00 ? 22  LYS A HE3  5  
ATOM 8154  H HZ1  . LYS A 1 22  ? 0.764   14.117  8.506   1.00 0.00 ? 22  LYS A HZ1  5  
ATOM 8155  H HZ2  . LYS A 1 22  ? -0.435  13.334  9.290   1.00 0.00 ? 22  LYS A HZ2  5  
ATOM 8156  H HZ3  . LYS A 1 22  ? 1.115   13.138  9.764   1.00 0.00 ? 22  LYS A HZ3  5  
ATOM 8157  N N    . ALA A 1 23  ? -1.278  8.152   5.099   1.00 0.00 ? 23  ALA A N    5  
ATOM 8158  C CA   . ALA A 1 23  ? -2.700  8.122   4.799   1.00 0.00 ? 23  ALA A CA   5  
ATOM 8159  C C    . ALA A 1 23  ? -3.480  8.666   5.997   1.00 0.00 ? 23  ALA A C    5  
ATOM 8160  O O    . ALA A 1 23  ? -3.575  8.007   7.032   1.00 0.00 ? 23  ALA A O    5  
ATOM 8161  C CB   . ALA A 1 23  ? -3.115  6.696   4.432   1.00 0.00 ? 23  ALA A CB   5  
ATOM 8162  H H    . ALA A 1 23  ? -0.930  7.345   5.576   1.00 0.00 ? 23  ALA A H    5  
ATOM 8163  H HA   . ALA A 1 23  ? -2.871  8.770   3.939   1.00 0.00 ? 23  ALA A HA   5  
ATOM 8164  H HB1  . ALA A 1 23  ? -2.901  6.029   5.268   1.00 0.00 ? 23  ALA A HB1  5  
ATOM 8165  H HB2  . ALA A 1 23  ? -4.182  6.673   4.211   1.00 0.00 ? 23  ALA A HB2  5  
ATOM 8166  H HB3  . ALA A 1 23  ? -2.555  6.369   3.554   1.00 0.00 ? 23  ALA A HB3  5  
ATOM 8167  N N    . VAL A 1 24  ? -4.019  9.863   5.817   1.00 0.00 ? 24  VAL A N    5  
ATOM 8168  C CA   . VAL A 1 24  ? -4.788  10.503  6.871   1.00 0.00 ? 24  VAL A CA   5  
ATOM 8169  C C    . VAL A 1 24  ? -6.258  10.578  6.449   1.00 0.00 ? 24  VAL A C    5  
ATOM 8170  O O    . VAL A 1 24  ? -7.153  10.441  7.281   1.00 0.00 ? 24  VAL A O    5  
ATOM 8171  C CB   . VAL A 1 24  ? -4.189  11.872  7.198   1.00 0.00 ? 24  VAL A CB   5  
ATOM 8172  C CG1  . VAL A 1 24  ? -2.971  11.732  8.114   1.00 0.00 ? 24  VAL A CG1  5  
ATOM 8173  C CG2  . VAL A 1 24  ? -3.830  12.634  5.922   1.00 0.00 ? 24  VAL A CG2  5  
ATOM 8174  H H    . VAL A 1 24  ? -3.937  10.393  4.973   1.00 0.00 ? 24  VAL A H    5  
ATOM 8175  H HA   . VAL A 1 24  ? -4.710  9.878   7.761   1.00 0.00 ? 24  VAL A HA   5  
ATOM 8176  H HB   . VAL A 1 24  ? -4.944  12.450  7.733   1.00 0.00 ? 24  VAL A HB   5  
ATOM 8177  H HG11 . VAL A 1 24  ? -2.446  10.806  7.881   1.00 0.00 ? 24  VAL A HG11 5  
ATOM 8178  H HG12 . VAL A 1 24  ? -2.301  12.578  7.960   1.00 0.00 ? 24  VAL A HG12 5  
ATOM 8179  H HG13 . VAL A 1 24  ? -3.297  11.712  9.154   1.00 0.00 ? 24  VAL A HG13 5  
ATOM 8180  H HG21 . VAL A 1 24  ? -4.597  12.458  5.166   1.00 0.00 ? 24  VAL A HG21 5  
ATOM 8181  H HG22 . VAL A 1 24  ? -3.773  13.701  6.139   1.00 0.00 ? 24  VAL A HG22 5  
ATOM 8182  H HG23 . VAL A 1 24  ? -2.867  12.287  5.550   1.00 0.00 ? 24  VAL A HG23 5  
ATOM 8183  N N    . SER A 1 25  ? -6.459  10.798  5.158   1.00 0.00 ? 25  SER A N    5  
ATOM 8184  C CA   . SER A 1 25  ? -7.804  10.894  4.616   1.00 0.00 ? 25  SER A CA   5  
ATOM 8185  C C    . SER A 1 25  ? -8.058  9.743   3.641   1.00 0.00 ? 25  SER A C    5  
ATOM 8186  O O    . SER A 1 25  ? -7.121  9.076   3.204   1.00 0.00 ? 25  SER A O    5  
ATOM 8187  C CB   . SER A 1 25  ? -8.021  12.238  3.920   1.00 0.00 ? 25  SER A CB   5  
ATOM 8188  O OG   . SER A 1 25  ? -9.005  12.153  2.891   1.00 0.00 ? 25  SER A OG   5  
ATOM 8189  H H    . SER A 1 25  ? -5.725  10.909  4.489   1.00 0.00 ? 25  SER A H    5  
ATOM 8190  H HA   . SER A 1 25  ? -8.468  10.819  5.478   1.00 0.00 ? 25  SER A HA   5  
ATOM 8191  H HB2  . SER A 1 25  ? -8.330  12.981  4.655   1.00 0.00 ? 25  SER A HB2  5  
ATOM 8192  H HB3  . SER A 1 25  ? -7.080  12.583  3.494   1.00 0.00 ? 25  SER A HB3  5  
ATOM 8193  H HG   . SER A 1 25  ? -9.120  13.045  2.454   1.00 0.00 ? 25  SER A HG   5  
ATOM 8194  N N    . GLU A 1 26  ? -9.330  9.545   3.328   1.00 0.00 ? 26  GLU A N    5  
ATOM 8195  C CA   . GLU A 1 26  ? -9.719  8.487   2.413   1.00 0.00 ? 26  GLU A CA   5  
ATOM 8196  C C    . GLU A 1 26  ? -10.985 8.882   1.650   1.00 0.00 ? 26  GLU A C    5  
ATOM 8197  O O    . GLU A 1 26  ? -11.527 9.967   1.861   1.00 0.00 ? 26  GLU A O    5  
ATOM 8198  C CB   . GLU A 1 26  ? -9.918  7.164   3.156   1.00 0.00 ? 26  GLU A CB   5  
ATOM 8199  C CG   . GLU A 1 26  ? -8.574  6.545   3.543   1.00 0.00 ? 26  GLU A CG   5  
ATOM 8200  C CD   . GLU A 1 26  ? -8.317  6.687   5.045   1.00 0.00 ? 26  GLU A CD   5  
ATOM 8201  O OE1  . GLU A 1 26  ? -8.523  7.810   5.551   1.00 0.00 ? 26  GLU A OE1  5  
ATOM 8202  O OE2  . GLU A 1 26  ? -7.920  5.668   5.651   1.00 0.00 ? 26  GLU A OE2  5  
ATOM 8203  H H    . GLU A 1 26  ? -10.086 10.091  3.688   1.00 0.00 ? 26  GLU A H    5  
ATOM 8204  H HA   . GLU A 1 26  ? -8.886  8.383   1.717   1.00 0.00 ? 26  GLU A HA   5  
ATOM 8205  H HB2  . GLU A 1 26  ? -10.516 7.332   4.051   1.00 0.00 ? 26  GLU A HB2  5  
ATOM 8206  H HB3  . GLU A 1 26  ? -10.475 6.469   2.527   1.00 0.00 ? 26  GLU A HB3  5  
ATOM 8207  H HG2  . GLU A 1 26  ? -8.562  5.490   3.266   1.00 0.00 ? 26  GLU A HG2  5  
ATOM 8208  H HG3  . GLU A 1 26  ? -7.773  7.029   2.986   1.00 0.00 ? 26  GLU A HG3  5  
ATOM 8209  N N    . LYS A 1 27  ? -11.420 7.983   0.779   1.00 0.00 ? 27  LYS A N    5  
ATOM 8210  C CA   . LYS A 1 27  ? -12.612 8.226   -0.015  1.00 0.00 ? 27  LYS A CA   5  
ATOM 8211  C C    . LYS A 1 27  ? -13.364 6.908   -0.213  1.00 0.00 ? 27  LYS A C    5  
ATOM 8212  O O    . LYS A 1 27  ? -12.883 6.013   -0.908  1.00 0.00 ? 27  LYS A O    5  
ATOM 8213  C CB   . LYS A 1 27  ? -12.249 8.930   -1.324  1.00 0.00 ? 27  LYS A CB   5  
ATOM 8214  C CG   . LYS A 1 27  ? -13.506 9.305   -2.111  1.00 0.00 ? 27  LYS A CG   5  
ATOM 8215  C CD   . LYS A 1 27  ? -13.296 10.606  -2.891  1.00 0.00 ? 27  LYS A CD   5  
ATOM 8216  C CE   . LYS A 1 27  ? -11.975 10.576  -3.661  1.00 0.00 ? 27  LYS A CE   5  
ATOM 8217  N NZ   . LYS A 1 27  ? -11.781 11.841  -4.405  1.00 0.00 ? 27  LYS A NZ   5  
ATOM 8218  H H    . LYS A 1 27  ? -10.972 7.104   0.614   1.00 0.00 ? 27  LYS A H    5  
ATOM 8219  H HA   . LYS A 1 27  ? -13.249 8.905   0.551   1.00 0.00 ? 27  LYS A HA   5  
ATOM 8220  H HB2  . LYS A 1 27  ? -11.667 9.827   -1.111  1.00 0.00 ? 27  LYS A HB2  5  
ATOM 8221  H HB3  . LYS A 1 27  ? -11.618 8.279   -1.929  1.00 0.00 ? 27  LYS A HB3  5  
ATOM 8222  H HG2  . LYS A 1 27  ? -13.761 8.501   -2.801  1.00 0.00 ? 27  LYS A HG2  5  
ATOM 8223  H HG3  . LYS A 1 27  ? -14.347 9.418   -1.427  1.00 0.00 ? 27  LYS A HG3  5  
ATOM 8224  H HD2  . LYS A 1 27  ? -14.123 10.754  -3.585  1.00 0.00 ? 27  LYS A HD2  5  
ATOM 8225  H HD3  . LYS A 1 27  ? -13.301 11.451  -2.203  1.00 0.00 ? 27  LYS A HD3  5  
ATOM 8226  H HE2  . LYS A 1 27  ? -11.147 10.424  -2.970  1.00 0.00 ? 27  LYS A HE2  5  
ATOM 8227  H HE3  . LYS A 1 27  ? -11.970 9.735   -4.355  1.00 0.00 ? 27  LYS A HE3  5  
ATOM 8228  H HZ1  . LYS A 1 27  ? -12.394 12.541  -4.040  1.00 0.00 ? 27  LYS A HZ1  5  
ATOM 8229  H HZ2  . LYS A 1 27  ? -10.833 12.143  -4.307  1.00 0.00 ? 27  LYS A HZ2  5  
ATOM 8230  H HZ3  . LYS A 1 27  ? -11.984 11.692  -5.373  1.00 0.00 ? 27  LYS A HZ3  5  
ATOM 8231  N N    . GLU A 1 28  ? -14.532 6.831   0.409   1.00 0.00 ? 28  GLU A N    5  
ATOM 8232  C CA   . GLU A 1 28  ? -15.354 5.638   0.309   1.00 0.00 ? 28  GLU A CA   5  
ATOM 8233  C C    . GLU A 1 28  ? -16.010 5.559   -1.072  1.00 0.00 ? 28  GLU A C    5  
ATOM 8234  O O    . GLU A 1 28  ? -17.091 6.106   -1.282  1.00 0.00 ? 28  GLU A O    5  
ATOM 8235  C CB   . GLU A 1 28  ? -16.408 5.604   1.418   1.00 0.00 ? 28  GLU A CB   5  
ATOM 8236  C CG   . GLU A 1 28  ? -17.221 4.309   1.362   1.00 0.00 ? 28  GLU A CG   5  
ATOM 8237  C CD   . GLU A 1 28  ? -18.694 4.573   1.680   1.00 0.00 ? 28  GLU A CD   5  
ATOM 8238  O OE1  . GLU A 1 28  ? -19.243 5.521   1.078   1.00 0.00 ? 28  GLU A OE1  5  
ATOM 8239  O OE2  . GLU A 1 28  ? -19.238 3.822   2.518   1.00 0.00 ? 28  GLU A OE2  5  
ATOM 8240  H H    . GLU A 1 28  ? -14.915 7.564   0.970   1.00 0.00 ? 28  GLU A H    5  
ATOM 8241  H HA   . GLU A 1 28  ? -14.669 4.801   0.442   1.00 0.00 ? 28  GLU A HA   5  
ATOM 8242  H HB2  . GLU A 1 28  ? -15.921 5.690   2.389   1.00 0.00 ? 28  GLU A HB2  5  
ATOM 8243  H HB3  . GLU A 1 28  ? -17.073 6.461   1.318   1.00 0.00 ? 28  GLU A HB3  5  
ATOM 8244  H HG2  . GLU A 1 28  ? -17.133 3.863   0.372   1.00 0.00 ? 28  GLU A HG2  5  
ATOM 8245  H HG3  . GLU A 1 28  ? -16.815 3.590   2.074   1.00 0.00 ? 28  GLU A HG3  5  
ATOM 8246  N N    . VAL A 1 29  ? -15.327 4.872   -1.976  1.00 0.00 ? 29  VAL A N    5  
ATOM 8247  C CA   . VAL A 1 29  ? -15.829 4.714   -3.331  1.00 0.00 ? 29  VAL A CA   5  
ATOM 8248  C C    . VAL A 1 29  ? -16.280 3.267   -3.537  1.00 0.00 ? 29  VAL A C    5  
ATOM 8249  O O    . VAL A 1 29  ? -15.458 2.352   -3.550  1.00 0.00 ? 29  VAL A O    5  
ATOM 8250  C CB   . VAL A 1 29  ? -14.767 5.159   -4.339  1.00 0.00 ? 29  VAL A CB   5  
ATOM 8251  C CG1  . VAL A 1 29  ? -14.376 6.621   -4.113  1.00 0.00 ? 29  VAL A CG1  5  
ATOM 8252  C CG2  . VAL A 1 29  ? -13.540 4.247   -4.279  1.00 0.00 ? 29  VAL A CG2  5  
ATOM 8253  H H    . VAL A 1 29  ? -14.449 4.429   -1.798  1.00 0.00 ? 29  VAL A H    5  
ATOM 8254  H HA   . VAL A 1 29  ? -16.693 5.370   -3.441  1.00 0.00 ? 29  VAL A HA   5  
ATOM 8255  H HB   . VAL A 1 29  ? -15.197 5.077   -5.336  1.00 0.00 ? 29  VAL A HB   5  
ATOM 8256  H HG11 . VAL A 1 29  ? -15.116 7.100   -3.472  1.00 0.00 ? 29  VAL A HG11 5  
ATOM 8257  H HG12 . VAL A 1 29  ? -13.397 6.666   -3.636  1.00 0.00 ? 29  VAL A HG12 5  
ATOM 8258  H HG13 . VAL A 1 29  ? -14.337 7.138   -5.072  1.00 0.00 ? 29  VAL A HG13 5  
ATOM 8259  H HG21 . VAL A 1 29  ? -13.225 4.130   -3.242  1.00 0.00 ? 29  VAL A HG21 5  
ATOM 8260  H HG22 . VAL A 1 29  ? -13.791 3.272   -4.695  1.00 0.00 ? 29  VAL A HG22 5  
ATOM 8261  H HG23 . VAL A 1 29  ? -12.729 4.692   -4.857  1.00 0.00 ? 29  VAL A HG23 5  
ATOM 8262  N N    . ASP A 1 30  ? -17.585 3.104   -3.694  1.00 0.00 ? 30  ASP A N    5  
ATOM 8263  C CA   . ASP A 1 30  ? -18.155 1.783   -3.899  1.00 0.00 ? 30  ASP A CA   5  
ATOM 8264  C C    . ASP A 1 30  ? -17.500 1.133   -5.119  1.00 0.00 ? 30  ASP A C    5  
ATOM 8265  O O    . ASP A 1 30  ? -16.910 1.821   -5.952  1.00 0.00 ? 30  ASP A O    5  
ATOM 8266  C CB   . ASP A 1 30  ? -19.661 1.868   -4.161  1.00 0.00 ? 30  ASP A CB   5  
ATOM 8267  C CG   . ASP A 1 30  ? -20.542 1.724   -2.919  1.00 0.00 ? 30  ASP A CG   5  
ATOM 8268  O OD1  . ASP A 1 30  ? -20.715 0.568   -2.477  1.00 0.00 ? 30  ASP A OD1  5  
ATOM 8269  O OD2  . ASP A 1 30  ? -21.025 2.773   -2.442  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 8270  H H    . ASP A 1 30  ? -18.248 3.853   -3.683  1.00 0.00 ? 30  ASP A H    5  
ATOM 8271  H HA   . ASP A 1 30  ? -17.955 1.238   -2.977  1.00 0.00 ? 30  ASP A HA   5  
ATOM 8272  H HB2  . ASP A 1 30  ? -19.879 2.825   -4.635  1.00 0.00 ? 30  ASP A HB2  5  
ATOM 8273  H HB3  . ASP A 1 30  ? -19.934 1.091   -4.875  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 8274  N N    . SER A 1 31  ? -17.623 -0.185  -5.185  1.00 0.00 ? 31  SER A N    5  
ATOM 8275  C CA   . SER A 1 31  ? -17.049 -0.935  -6.289  1.00 0.00 ? 31  SER A CA   5  
ATOM 8276  C C    . SER A 1 31  ? -17.967 -2.101  -6.662  1.00 0.00 ? 31  SER A C    5  
ATOM 8277  O O    . SER A 1 31  ? -17.544 -3.035  -7.343  1.00 0.00 ? 31  SER A O    5  
ATOM 8278  C CB   . SER A 1 31  ? -15.652 -1.451  -5.936  1.00 0.00 ? 31  SER A CB   5  
ATOM 8279  O OG   . SER A 1 31  ? -15.336 -2.655  -6.632  1.00 0.00 ? 31  SER A OG   5  
ATOM 8280  H H    . SER A 1 31  ? -18.103 -0.736  -4.504  1.00 0.00 ? 31  SER A H    5  
ATOM 8281  H HA   . SER A 1 31  ? -16.975 -0.226  -7.113  1.00 0.00 ? 31  SER A HA   5  
ATOM 8282  H HB2  . SER A 1 31  ? -14.912 -0.689  -6.178  1.00 0.00 ? 31  SER A HB2  5  
ATOM 8283  H HB3  . SER A 1 31  ? -15.590 -1.627  -4.862  1.00 0.00 ? 31  SER A HB3  5  
ATOM 8284  H HG   . SER A 1 31  ? -15.403 -2.506  -7.619  1.00 0.00 ? 31  SER A HG   5  
ATOM 8285  N N    . GLY A 1 32  ? -19.205 -2.008  -6.203  1.00 0.00 ? 32  GLY A N    5  
ATOM 8286  C CA   . GLY A 1 32  ? -20.187 -3.043  -6.479  1.00 0.00 ? 32  GLY A CA   5  
ATOM 8287  C C    . GLY A 1 32  ? -19.973 -4.257  -5.574  1.00 0.00 ? 32  GLY A C    5  
ATOM 8288  O O    . GLY A 1 32  ? -19.026 -4.293  -4.789  1.00 0.00 ? 32  GLY A O    5  
ATOM 8289  H H    . GLY A 1 32  ? -19.541 -1.245  -5.650  1.00 0.00 ? 32  GLY A H    5  
ATOM 8290  H HA2  . GLY A 1 32  ? -21.191 -2.646  -6.331  1.00 0.00 ? 32  GLY A HA2  5  
ATOM 8291  H HA3  . GLY A 1 32  ? -20.114 -3.346  -7.524  1.00 0.00 ? 32  GLY A HA3  5  
ATOM 8292  N N    . ASN A 1 33  ? -20.870 -5.223  -5.712  1.00 0.00 ? 33  ASN A N    5  
ATOM 8293  C CA   . ASN A 1 33  ? -20.792 -6.437  -4.915  1.00 0.00 ? 33  ASN A CA   5  
ATOM 8294  C C    . ASN A 1 33  ? -19.831 -7.420  -5.586  1.00 0.00 ? 33  ASN A C    5  
ATOM 8295  O O    . ASN A 1 33  ? -19.518 -7.281  -6.767  1.00 0.00 ? 33  ASN A O    5  
ATOM 8296  C CB   . ASN A 1 33  ? -22.160 -7.112  -4.806  1.00 0.00 ? 33  ASN A CB   5  
ATOM 8297  C CG   . ASN A 1 33  ? -23.275 -6.073  -4.673  1.00 0.00 ? 33  ASN A CG   5  
ATOM 8298  O OD1  . ASN A 1 33  ? -23.882 -5.647  -5.642  1.00 0.00 ? 33  ASN A OD1  5  
ATOM 8299  N ND2  . ASN A 1 33  ? -23.511 -5.691  -3.421  1.00 0.00 ? 33  ASN A ND2  5  
ATOM 8300  H H    . ASN A 1 33  ? -21.637 -5.186  -6.352  1.00 0.00 ? 33  ASN A H    5  
ATOM 8301  H HA   . ASN A 1 33  ? -20.441 -6.114  -3.935  1.00 0.00 ? 33  ASN A HA   5  
ATOM 8302  H HB2  . ASN A 1 33  ? -22.336 -7.729  -5.686  1.00 0.00 ? 33  ASN A HB2  5  
ATOM 8303  H HB3  . ASN A 1 33  ? -22.173 -7.777  -3.943  1.00 0.00 ? 33  ASN A HB3  5  
ATOM 8304  H HD21 . ASN A 1 33  ? -22.978 -6.079  -2.670  1.00 0.00 ? 33  ASN A HD21 5  
ATOM 8305  H HD22 . ASN A 1 33  ? -24.223 -5.014  -3.231  1.00 0.00 ? 33  ASN A HD22 5  
ATOM 8306  N N    . ASP A 1 34  ? -19.390 -8.393  -4.803  1.00 0.00 ? 34  ASP A N    5  
ATOM 8307  C CA   . ASP A 1 34  ? -18.472 -9.400  -5.306  1.00 0.00 ? 34  ASP A CA   5  
ATOM 8308  C C    . ASP A 1 34  ? -19.266 -10.616 -5.785  1.00 0.00 ? 34  ASP A C    5  
ATOM 8309  O O    . ASP A 1 34  ? -20.469 -10.520 -6.026  1.00 0.00 ? 34  ASP A O    5  
ATOM 8310  C CB   . ASP A 1 34  ? -17.510 -9.865  -4.210  1.00 0.00 ? 34  ASP A CB   5  
ATOM 8311  C CG   . ASP A 1 34  ? -16.129 -10.303 -4.703  1.00 0.00 ? 34  ASP A CG   5  
ATOM 8312  O OD1  . ASP A 1 34  ? -15.636 -9.657  -5.653  1.00 0.00 ? 34  ASP A OD1  5  
ATOM 8313  O OD2  . ASP A 1 34  ? -15.600 -11.274 -4.121  1.00 0.00 ? 34  ASP A OD2  5  
ATOM 8314  H H    . ASP A 1 34  ? -19.649 -8.500  -3.843  1.00 0.00 ? 34  ASP A H    5  
ATOM 8315  H HA   . ASP A 1 34  ? -17.927 -8.913  -6.114  1.00 0.00 ? 34  ASP A HA   5  
ATOM 8316  H HB2  . ASP A 1 34  ? -17.382 -9.056  -3.491  1.00 0.00 ? 34  ASP A HB2  5  
ATOM 8317  H HB3  . ASP A 1 34  ? -17.968 -10.698 -3.675  1.00 0.00 ? 34  ASP A HB3  5  
ATOM 8318  N N    . ILE A 1 35  ? -18.563 -11.733 -5.908  1.00 0.00 ? 35  ILE A N    5  
ATOM 8319  C CA   . ILE A 1 35  ? -19.189 -12.966 -6.353  1.00 0.00 ? 35  ILE A CA   5  
ATOM 8320  C C    . ILE A 1 35  ? -19.913 -13.620 -5.175  1.00 0.00 ? 35  ILE A C    5  
ATOM 8321  O O    . ILE A 1 35  ? -20.509 -14.686 -5.322  1.00 0.00 ? 35  ILE A O    5  
ATOM 8322  C CB   . ILE A 1 35  ? -18.159 -13.877 -7.025  1.00 0.00 ? 35  ILE A CB   5  
ATOM 8323  C CG1  . ILE A 1 35  ? -17.451 -13.153 -8.172  1.00 0.00 ? 35  ILE A CG1  5  
ATOM 8324  C CG2  . ILE A 1 35  ? -18.802 -15.187 -7.484  1.00 0.00 ? 35  ILE A CG2  5  
ATOM 8325  C CD1  . ILE A 1 35  ? -16.477 -12.101 -7.637  1.00 0.00 ? 35  ILE A CD1  5  
ATOM 8326  H H    . ILE A 1 35  ? -17.585 -11.803 -5.709  1.00 0.00 ? 35  ILE A H    5  
ATOM 8327  H HA   . ILE A 1 35  ? -19.928 -12.703 -7.109  1.00 0.00 ? 35  ILE A HA   5  
ATOM 8328  H HB   . ILE A 1 35  ? -17.397 -14.133 -6.288  1.00 0.00 ? 35  ILE A HB   5  
ATOM 8329  H HG12 . ILE A 1 35  ? -16.914 -13.875 -8.786  1.00 0.00 ? 35  ILE A HG12 5  
ATOM 8330  H HG13 . ILE A 1 35  ? -18.190 -12.674 -8.815  1.00 0.00 ? 35  ILE A HG13 5  
ATOM 8331  H HG21 . ILE A 1 35  ? -19.879 -15.048 -7.583  1.00 0.00 ? 35  ILE A HG21 5  
ATOM 8332  H HG22 . ILE A 1 35  ? -18.384 -15.478 -8.448  1.00 0.00 ? 35  ILE A HG22 5  
ATOM 8333  H HG23 . ILE A 1 35  ? -18.603 -15.967 -6.750  1.00 0.00 ? 35  ILE A HG23 5  
ATOM 8334  H HD11 . ILE A 1 35  ? -16.059 -12.442 -6.690  1.00 0.00 ? 35  ILE A HD11 5  
ATOM 8335  H HD12 . ILE A 1 35  ? -15.671 -11.953 -8.358  1.00 0.00 ? 35  ILE A HD12 5  
ATOM 8336  H HD13 . ILE A 1 35  ? -17.004 -11.160 -7.486  1.00 0.00 ? 35  ILE A HD13 5  
ATOM 8337  N N    . TYR A 1 36  ? -19.836 -12.955 -4.031  1.00 0.00 ? 36  TYR A N    5  
ATOM 8338  C CA   . TYR A 1 36  ? -20.476 -13.460 -2.828  1.00 0.00 ? 36  TYR A CA   5  
ATOM 8339  C C    . TYR A 1 36  ? -21.705 -12.622 -2.470  1.00 0.00 ? 36  TYR A C    5  
ATOM 8340  O O    . TYR A 1 36  ? -22.393 -12.910 -1.491  1.00 0.00 ? 36  TYR A O    5  
ATOM 8341  C CB   . TYR A 1 36  ? -19.439 -13.326 -1.711  1.00 0.00 ? 36  TYR A CB   5  
ATOM 8342  C CG   . TYR A 1 36  ? -19.569 -14.384 -0.613  1.00 0.00 ? 36  TYR A CG   5  
ATOM 8343  C CD1  . TYR A 1 36  ? -19.250 -15.699 -0.880  1.00 0.00 ? 36  TYR A CD1  5  
ATOM 8344  C CD2  . TYR A 1 36  ? -20.004 -14.021 0.646   1.00 0.00 ? 36  TYR A CD2  5  
ATOM 8345  C CE1  . TYR A 1 36  ? -19.372 -16.694 0.154   1.00 0.00 ? 36  TYR A CE1  5  
ATOM 8346  C CE2  . TYR A 1 36  ? -20.126 -15.015 1.679   1.00 0.00 ? 36  TYR A CE2  5  
ATOM 8347  C CZ   . TYR A 1 36  ? -19.803 -16.303 1.383   1.00 0.00 ? 36  TYR A CZ   5  
ATOM 8348  O OH   . TYR A 1 36  ? -19.919 -17.243 2.359   1.00 0.00 ? 36  TYR A OH   5  
ATOM 8349  H H    . TYR A 1 36  ? -19.348 -12.090 -3.919  1.00 0.00 ? 36  TYR A H    5  
ATOM 8350  H HA   . TYR A 1 36  ? -20.788 -14.487 -3.017  1.00 0.00 ? 36  TYR A HA   5  
ATOM 8351  H HB2  . TYR A 1 36  ? -18.442 -13.389 -2.146  1.00 0.00 ? 36  TYR A HB2  5  
ATOM 8352  H HB3  . TYR A 1 36  ? -19.529 -12.337 -1.262  1.00 0.00 ? 36  TYR A HB3  5  
ATOM 8353  H HD1  . TYR A 1 36  ? -18.906 -15.985 -1.874  1.00 0.00 ? 36  TYR A HD1  5  
ATOM 8354  H HD2  . TYR A 1 36  ? -20.256 -12.981 0.857   1.00 0.00 ? 36  TYR A HD2  5  
ATOM 8355  H HE1  . TYR A 1 36  ? -19.124 -17.737 -0.044  1.00 0.00 ? 36  TYR A HE1  5  
ATOM 8356  H HE2  . TYR A 1 36  ? -20.469 -14.743 2.678   1.00 0.00 ? 36  TYR A HE2  5  
ATOM 8357  H HH   . TYR A 1 36  ? -19.011 -17.526 2.669   1.00 0.00 ? 36  TYR A HH   5  
ATOM 8358  N N    . GLY A 1 37  ? -21.944 -11.602 -3.280  1.00 0.00 ? 37  GLY A N    5  
ATOM 8359  C CA   . GLY A 1 37  ? -23.078 -10.720 -3.062  1.00 0.00 ? 37  GLY A CA   5  
ATOM 8360  C C    . GLY A 1 37  ? -22.709 -9.577  -2.114  1.00 0.00 ? 37  GLY A C    5  
ATOM 8361  O O    . GLY A 1 37  ? -23.487 -8.644  -1.930  1.00 0.00 ? 37  GLY A O    5  
ATOM 8362  H H    . GLY A 1 37  ? -21.379 -11.375 -4.075  1.00 0.00 ? 37  GLY A H    5  
ATOM 8363  H HA2  . GLY A 1 37  ? -23.416 -10.313 -4.014  1.00 0.00 ? 37  GLY A HA2  5  
ATOM 8364  H HA3  . GLY A 1 37  ? -23.909 -11.289 -2.645  1.00 0.00 ? 37  GLY A HA3  5  
ATOM 8365  N N    . ASN A 1 38  ? -21.520 -9.689  -1.539  1.00 0.00 ? 38  ASN A N    5  
ATOM 8366  C CA   . ASN A 1 38  ? -21.038 -8.677  -0.614  1.00 0.00 ? 38  ASN A CA   5  
ATOM 8367  C C    . ASN A 1 38  ? -20.534 -7.468  -1.406  1.00 0.00 ? 38  ASN A C    5  
ATOM 8368  O O    . ASN A 1 38  ? -20.089 -7.609  -2.544  1.00 0.00 ? 38  ASN A O    5  
ATOM 8369  C CB   . ASN A 1 38  ? -19.877 -9.207  0.229   1.00 0.00 ? 38  ASN A CB   5  
ATOM 8370  C CG   . ASN A 1 38  ? -18.864 -9.954  -0.643  1.00 0.00 ? 38  ASN A CG   5  
ATOM 8371  O OD1  . ASN A 1 38  ? -19.096 -10.237 -1.807  1.00 0.00 ? 38  ASN A OD1  5  
ATOM 8372  N ND2  . ASN A 1 38  ? -17.730 -10.254 -0.016  1.00 0.00 ? 38  ASN A ND2  5  
ATOM 8373  H H    . ASN A 1 38  ? -20.893 -10.452 -1.693  1.00 0.00 ? 38  ASN A H    5  
ATOM 8374  H HA   . ASN A 1 38  ? -21.893 -8.435  0.017   1.00 0.00 ? 38  ASN A HA   5  
ATOM 8375  H HB2  . ASN A 1 38  ? -19.384 -8.380  0.738   1.00 0.00 ? 38  ASN A HB2  5  
ATOM 8376  H HB3  . ASN A 1 38  ? -20.259 -9.876  1.001   1.00 0.00 ? 38  ASN A HB3  5  
ATOM 8377  H HD21 . ASN A 1 38  ? -17.602 -9.991  0.941   1.00 0.00 ? 38  ASN A HD21 5  
ATOM 8378  H HD22 . ASN A 1 38  ? -17.005 -10.741 -0.502  1.00 0.00 ? 38  ASN A HD22 5  
ATOM 8379  N N    . PRO A 1 39  ? -20.622 -6.277  -0.756  1.00 0.00 ? 39  PRO A N    5  
ATOM 8380  C CA   . PRO A 1 39  ? -20.181 -5.045  -1.386  1.00 0.00 ? 39  PRO A CA   5  
ATOM 8381  C C    . PRO A 1 39  ? -18.653 -4.959  -1.410  1.00 0.00 ? 39  PRO A C    5  
ATOM 8382  O O    . PRO A 1 39  ? -18.001 -5.138  -0.383  1.00 0.00 ? 39  PRO A O    5  
ATOM 8383  C CB   . PRO A 1 39  ? -20.826 -3.934  -0.575  1.00 0.00 ? 39  PRO A CB   5  
ATOM 8384  C CG   . PRO A 1 39  ? -21.224 -4.563  0.750   1.00 0.00 ? 39  PRO A CG   5  
ATOM 8385  C CD   . PRO A 1 39  ? -21.143 -6.073  0.593   1.00 0.00 ? 39  PRO A CD   5  
ATOM 8386  H HA   . PRO A 1 39  ? -20.470 -5.022  -2.343  1.00 0.00 ? 39  PRO A HA   5  
ATOM 8387  H HB2  . PRO A 1 39  ? -20.132 -3.108  -0.424  1.00 0.00 ? 39  PRO A HB2  5  
ATOM 8388  H HB3  . PRO A 1 39  ? -21.696 -3.529  -1.092  1.00 0.00 ? 39  PRO A HB3  5  
ATOM 8389  H HG2  . PRO A 1 39  ? -20.560 -4.226  1.546   1.00 0.00 ? 39  PRO A HG2  5  
ATOM 8390  H HG3  . PRO A 1 39  ? -22.233 -4.261  1.028   1.00 0.00 ? 39  PRO A HG3  5  
ATOM 8391  H HD2  . PRO A 1 39  ? -20.487 -6.515  1.342   1.00 0.00 ? 39  PRO A HD2  5  
ATOM 8392  H HD3  . PRO A 1 39  ? -22.123 -6.536  0.714   1.00 0.00 ? 39  PRO A HD3  5  
ATOM 8393  N N    . ILE A 1 40  ? -18.126 -4.684  -2.595  1.00 0.00 ? 40  ILE A N    5  
ATOM 8394  C CA   . ILE A 1 40  ? -16.687 -4.572  -2.765  1.00 0.00 ? 40  ILE A CA   5  
ATOM 8395  C C    . ILE A 1 40  ? -16.177 -3.365  -1.976  1.00 0.00 ? 40  ILE A C    5  
ATOM 8396  O O    . ILE A 1 40  ? -15.655 -3.515  -0.872  1.00 0.00 ? 40  ILE A O    5  
ATOM 8397  C CB   . ILE A 1 40  ? -16.326 -4.532  -4.251  1.00 0.00 ? 40  ILE A CB   5  
ATOM 8398  C CG1  . ILE A 1 40  ? -16.699 -5.846  -4.942  1.00 0.00 ? 40  ILE A CG1  5  
ATOM 8399  C CG2  . ILE A 1 40  ? -14.850 -4.181  -4.447  1.00 0.00 ? 40  ILE A CG2  5  
ATOM 8400  C CD1  . ILE A 1 40  ? -16.381 -5.788  -6.438  1.00 0.00 ? 40  ILE A CD1  5  
ATOM 8401  H H    . ILE A 1 40  ? -18.662 -4.541  -3.426  1.00 0.00 ? 40  ILE A H    5  
ATOM 8402  H HA   . ILE A 1 40  ? -16.238 -5.473  -2.348  1.00 0.00 ? 40  ILE A HA   5  
ATOM 8403  H HB   . ILE A 1 40  ? -16.909 -3.743  -4.724  1.00 0.00 ? 40  ILE A HB   5  
ATOM 8404  H HG12 . ILE A 1 40  ? -16.154 -6.670  -4.482  1.00 0.00 ? 40  ILE A HG12 5  
ATOM 8405  H HG13 . ILE A 1 40  ? -17.761 -6.046  -4.799  1.00 0.00 ? 40  ILE A HG13 5  
ATOM 8406  H HG21 . ILE A 1 40  ? -14.235 -4.838  -3.832  1.00 0.00 ? 40  ILE A HG21 5  
ATOM 8407  H HG22 . ILE A 1 40  ? -14.582 -4.310  -5.496  1.00 0.00 ? 40  ILE A HG22 5  
ATOM 8408  H HG23 . ILE A 1 40  ? -14.680 -3.145  -4.153  1.00 0.00 ? 40  ILE A HG23 5  
ATOM 8409  H HD11 . ILE A 1 40  ? -16.276 -4.748  -6.746  1.00 0.00 ? 40  ILE A HD11 5  
ATOM 8410  H HD12 . ILE A 1 40  ? -15.450 -6.321  -6.632  1.00 0.00 ? 40  ILE A HD12 5  
ATOM 8411  H HD13 . ILE A 1 40  ? -17.191 -6.255  -6.999  1.00 0.00 ? 40  ILE A HD13 5  
ATOM 8412  N N    . LYS A 1 41  ? -16.346 -2.194  -2.572  1.00 0.00 ? 41  LYS A N    5  
ATOM 8413  C CA   . LYS A 1 41  ? -15.910 -0.961  -1.938  1.00 0.00 ? 41  LYS A CA   5  
ATOM 8414  C C    . LYS A 1 41  ? -14.381 -0.929  -1.895  1.00 0.00 ? 41  LYS A C    5  
ATOM 8415  O O    . LYS A 1 41  ? -13.750 -1.864  -1.404  1.00 0.00 ? 41  LYS A O    5  
ATOM 8416  C CB   . LYS A 1 41  ? -16.567 -0.802  -0.565  1.00 0.00 ? 41  LYS A CB   5  
ATOM 8417  C CG   . LYS A 1 41  ? -16.157 0.519   0.089   1.00 0.00 ? 41  LYS A CG   5  
ATOM 8418  C CD   . LYS A 1 41  ? -16.583 1.711   -0.770  1.00 0.00 ? 41  LYS A CD   5  
ATOM 8419  C CE   . LYS A 1 41  ? -18.086 1.971   -0.641  1.00 0.00 ? 41  LYS A CE   5  
ATOM 8420  N NZ   . LYS A 1 41  ? -18.445 3.259   -1.276  1.00 0.00 ? 41  LYS A NZ   5  
ATOM 8421  H H    . LYS A 1 41  ? -16.772 -2.080  -3.469  1.00 0.00 ? 41  LYS A H    5  
ATOM 8422  H HA   . LYS A 1 41  ? -16.255 -0.135  -2.558  1.00 0.00 ? 41  LYS A HA   5  
ATOM 8423  H HB2  . LYS A 1 41  ? -17.651 -0.840  -0.671  1.00 0.00 ? 41  LYS A HB2  5  
ATOM 8424  H HB3  . LYS A 1 41  ? -16.280 -1.635  0.078   1.00 0.00 ? 41  LYS A HB3  5  
ATOM 8425  H HG2  . LYS A 1 41  ? -16.613 0.596   1.076   1.00 0.00 ? 41  LYS A HG2  5  
ATOM 8426  H HG3  . LYS A 1 41  ? -15.077 0.538   0.234   1.00 0.00 ? 41  LYS A HG3  5  
ATOM 8427  H HD2  . LYS A 1 41  ? -16.029 2.599   -0.466  1.00 0.00 ? 41  LYS A HD2  5  
ATOM 8428  H HD3  . LYS A 1 41  ? -16.332 1.520   -1.814  1.00 0.00 ? 41  LYS A HD3  5  
ATOM 8429  H HE2  . LYS A 1 41  ? -18.643 1.159   -1.109  1.00 0.00 ? 41  LYS A HE2  5  
ATOM 8430  H HE3  . LYS A 1 41  ? -18.369 1.987   0.412   1.00 0.00 ? 41  LYS A HE3  5  
ATOM 8431  H HZ1  . LYS A 1 41  ? -17.612 3.768   -1.493  1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 8432  H HZ2  . LYS A 1 41  ? -18.957 3.083   -2.118  1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 8433  H HZ3  . LYS A 1 41  ? -19.010 3.794   -0.648  1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 8434  N N    . ARG A 1 42  ? -13.828 0.157   -2.416  1.00 0.00 ? 42  ARG A N    5  
ATOM 8435  C CA   . ARG A 1 42  ? -12.385 0.323   -2.444  1.00 0.00 ? 42  ARG A CA   5  
ATOM 8436  C C    . ARG A 1 42  ? -11.998 1.698   -1.895  1.00 0.00 ? 42  ARG A C    5  
ATOM 8437  O O    . ARG A 1 42  ? -11.533 2.559   -2.641  1.00 0.00 ? 42  ARG A O    5  
ATOM 8438  C CB   . ARG A 1 42  ? -11.840 0.177   -3.866  1.00 0.00 ? 42  ARG A CB   5  
ATOM 8439  C CG   . ARG A 1 42  ? -12.961 0.314   -4.898  1.00 0.00 ? 42  ARG A CG   5  
ATOM 8440  C CD   . ARG A 1 42  ? -12.462 -0.044  -6.300  1.00 0.00 ? 42  ARG A CD   5  
ATOM 8441  N NE   . ARG A 1 42  ? -13.335 0.577   -7.322  1.00 0.00 ? 42  ARG A NE   5  
ATOM 8442  C CZ   . ARG A 1 42  ? -13.097 0.533   -8.640  1.00 0.00 ? 42  ARG A CZ   5  
ATOM 8443  N NH1  . ARG A 1 42  ? -12.012 -0.101  -9.104  1.00 0.00 ? 42  ARG A NH1  5  
ATOM 8444  N NH2  . ARG A 1 42  ? -13.944 1.125   -9.494  1.00 0.00 ? 42  ARG A NH2  5  
ATOM 8445  H H    . ARG A 1 42  ? -14.349 0.913   -2.814  1.00 0.00 ? 42  ARG A H    5  
ATOM 8446  H HA   . ARG A 1 42  ? -12.000 -0.475  -1.808  1.00 0.00 ? 42  ARG A HA   5  
ATOM 8447  H HB2  . ARG A 1 42  ? -11.079 0.936   -4.047  1.00 0.00 ? 42  ARG A HB2  5  
ATOM 8448  H HB3  . ARG A 1 42  ? -11.356 -0.793  -3.976  1.00 0.00 ? 42  ARG A HB3  5  
ATOM 8449  H HG2  . ARG A 1 42  ? -13.792 -0.338  -4.628  1.00 0.00 ? 42  ARG A HG2  5  
ATOM 8450  H HG3  . ARG A 1 42  ? -13.342 1.335   -4.894  1.00 0.00 ? 42  ARG A HG3  5  
ATOM 8451  H HD2  . ARG A 1 42  ? -11.435 0.301   -6.429  1.00 0.00 ? 42  ARG A HD2  5  
ATOM 8452  H HD3  . ARG A 1 42  ? -12.453 -1.127  -6.427  1.00 0.00 ? 42  ARG A HD3  5  
ATOM 8453  H HE   . ARG A 1 42  ? -14.153 1.058   -7.010  1.00 0.00 ? 42  ARG A HE   5  
ATOM 8454  H HH11 . ARG A 1 42  ? -11.379 -0.542  -8.466  1.00 0.00 ? 42  ARG A HH11 5  
ATOM 8455  H HH12 . ARG A 1 42  ? -11.833 -0.133  -10.087 1.00 0.00 ? 42  ARG A HH12 5  
ATOM 8456  H HH21 . ARG A 1 42  ? -14.753 1.598   -9.147  1.00 0.00 ? 42  ARG A HH21 5  
ATOM 8457  H HH22 . ARG A 1 42  ? -13.765 1.092   -10.477 1.00 0.00 ? 42  ARG A HH22 5  
ATOM 8458  N N    . ILE A 1 43  ? -12.206 1.862   -0.597  1.00 0.00 ? 43  ILE A N    5  
ATOM 8459  C CA   . ILE A 1 43  ? -11.885 3.118   0.060   1.00 0.00 ? 43  ILE A CA   5  
ATOM 8460  C C    . ILE A 1 43  ? -10.561 3.652   -0.490  1.00 0.00 ? 43  ILE A C    5  
ATOM 8461  O O    . ILE A 1 43  ? -9.633  2.884   -0.740  1.00 0.00 ? 43  ILE A O    5  
ATOM 8462  C CB   . ILE A 1 43  ? -11.895 2.945   1.579   1.00 0.00 ? 43  ILE A CB   5  
ATOM 8463  C CG1  . ILE A 1 43  ? -13.162 3.546   2.191   1.00 0.00 ? 43  ILE A CG1  5  
ATOM 8464  C CG2  . ILE A 1 43  ? -10.625 3.526   2.206   1.00 0.00 ? 43  ILE A CG2  5  
ATOM 8465  C CD1  . ILE A 1 43  ? -14.372 2.642   1.944   1.00 0.00 ? 43  ILE A CD1  5  
ATOM 8466  H H    . ILE A 1 43  ? -12.584 1.156   0.002   1.00 0.00 ? 43  ILE A H    5  
ATOM 8467  H HA   . ILE A 1 43  ? -12.673 3.828   -0.189  1.00 0.00 ? 43  ILE A HA   5  
ATOM 8468  H HB   . ILE A 1 43  ? -11.905 1.878   1.802   1.00 0.00 ? 43  ILE A HB   5  
ATOM 8469  H HG12 . ILE A 1 43  ? -13.021 3.686   3.263   1.00 0.00 ? 43  ILE A HG12 5  
ATOM 8470  H HG13 . ILE A 1 43  ? -13.346 4.531   1.762   1.00 0.00 ? 43  ILE A HG13 5  
ATOM 8471  H HG21 . ILE A 1 43  ? -10.454 4.529   1.816   1.00 0.00 ? 43  ILE A HG21 5  
ATOM 8472  H HG22 . ILE A 1 43  ? -10.743 3.572   3.289   1.00 0.00 ? 43  ILE A HG22 5  
ATOM 8473  H HG23 . ILE A 1 43  ? -9.775  2.891   1.959   1.00 0.00 ? 43  ILE A HG23 5  
ATOM 8474  H HD11 . ILE A 1 43  ? -14.041 1.711   1.485   1.00 0.00 ? 43  ILE A HD11 5  
ATOM 8475  H HD12 . ILE A 1 43  ? -14.863 2.425   2.893   1.00 0.00 ? 43  ILE A HD12 5  
ATOM 8476  H HD13 . ILE A 1 43  ? -15.072 3.147   1.279   1.00 0.00 ? 43  ILE A HD13 5  
ATOM 8477  N N    . GLN A 1 44  ? -10.515 4.965   -0.663  1.00 0.00 ? 44  GLN A N    5  
ATOM 8478  C CA   . GLN A 1 44  ? -9.320  5.610   -1.178  1.00 0.00 ? 44  GLN A CA   5  
ATOM 8479  C C    . GLN A 1 44  ? -8.318  5.854   -0.048  1.00 0.00 ? 44  GLN A C    5  
ATOM 8480  O O    . GLN A 1 44  ? -8.585  5.519   1.106   1.00 0.00 ? 44  GLN A O    5  
ATOM 8481  C CB   . GLN A 1 44  ? -9.668  6.917   -1.894  1.00 0.00 ? 44  GLN A CB   5  
ATOM 8482  C CG   . GLN A 1 44  ? -10.470 6.648   -3.168  1.00 0.00 ? 44  GLN A CG   5  
ATOM 8483  C CD   . GLN A 1 44  ? -9.888  5.464   -3.943  1.00 0.00 ? 44  GLN A CD   5  
ATOM 8484  O OE1  . GLN A 1 44  ? -9.142  5.619   -4.895  1.00 0.00 ? 44  GLN A OE1  5  
ATOM 8485  N NE2  . GLN A 1 44  ? -10.269 4.276   -3.482  1.00 0.00 ? 44  GLN A NE2  5  
ATOM 8486  H H    . GLN A 1 44  ? -11.274 5.583   -0.458  1.00 0.00 ? 44  GLN A H    5  
ATOM 8487  H HA   . GLN A 1 44  ? -8.900  4.909   -1.899  1.00 0.00 ? 44  GLN A HA   5  
ATOM 8488  H HB2  . GLN A 1 44  ? -10.243 7.559   -1.226  1.00 0.00 ? 44  GLN A HB2  5  
ATOM 8489  H HB3  . GLN A 1 44  ? -8.752  7.455   -2.142  1.00 0.00 ? 44  GLN A HB3  5  
ATOM 8490  H HG2  . GLN A 1 44  ? -11.510 6.443   -2.911  1.00 0.00 ? 44  GLN A HG2  5  
ATOM 8491  H HG3  . GLN A 1 44  ? -10.467 7.537   -3.799  1.00 0.00 ? 44  GLN A HG3  5  
ATOM 8492  H HE21 . GLN A 1 44  ? -10.884 4.219   -2.695  1.00 0.00 ? 44  GLN A HE21 5  
ATOM 8493  H HE22 . GLN A 1 44  ? -9.941  3.440   -3.922  1.00 0.00 ? 44  GLN A HE22 5  
ATOM 8494  N N    . TYR A 1 45  ? -7.186  6.437   -0.417  1.00 0.00 ? 45  TYR A N    5  
ATOM 8495  C CA   . TYR A 1 45  ? -6.144  6.729   0.552   1.00 0.00 ? 45  TYR A CA   5  
ATOM 8496  C C    . TYR A 1 45  ? -5.570  8.130   0.334   1.00 0.00 ? 45  TYR A C    5  
ATOM 8497  O O    . TYR A 1 45  ? -4.425  8.277   -0.092  1.00 0.00 ? 45  TYR A O    5  
ATOM 8498  C CB   . TYR A 1 45  ? -5.042  5.696   0.311   1.00 0.00 ? 45  TYR A CB   5  
ATOM 8499  C CG   . TYR A 1 45  ? -5.071  4.515   1.284   1.00 0.00 ? 45  TYR A CG   5  
ATOM 8500  C CD1  . TYR A 1 45  ? -5.485  4.707   2.587   1.00 0.00 ? 45  TYR A CD1  5  
ATOM 8501  C CD2  . TYR A 1 45  ? -4.682  3.261   0.860   1.00 0.00 ? 45  TYR A CD2  5  
ATOM 8502  C CE1  . TYR A 1 45  ? -5.511  3.597   3.504   1.00 0.00 ? 45  TYR A CE1  5  
ATOM 8503  C CE2  . TYR A 1 45  ? -4.708  2.151   1.777   1.00 0.00 ? 45  TYR A CE2  5  
ATOM 8504  C CZ   . TYR A 1 45  ? -5.122  2.374   3.054   1.00 0.00 ? 45  TYR A CZ   5  
ATOM 8505  O OH   . TYR A 1 45  ? -5.146  1.325   3.920   1.00 0.00 ? 45  TYR A OH   5  
ATOM 8506  H H    . TYR A 1 45  ? -6.978  6.706   -1.357  1.00 0.00 ? 45  TYR A H    5  
ATOM 8507  H HA   . TYR A 1 45  ? -6.586  6.676   1.547   1.00 0.00 ? 45  TYR A HA   5  
ATOM 8508  H HB2  . TYR A 1 45  ? -5.131  5.315   -0.707  1.00 0.00 ? 45  TYR A HB2  5  
ATOM 8509  H HB3  . TYR A 1 45  ? -4.073  6.189   0.383   1.00 0.00 ? 45  TYR A HB3  5  
ATOM 8510  H HD1  . TYR A 1 45  ? -5.792  5.697   2.921   1.00 0.00 ? 45  TYR A HD1  5  
ATOM 8511  H HD2  . TYR A 1 45  ? -4.354  3.111   -0.168  1.00 0.00 ? 45  TYR A HD2  5  
ATOM 8512  H HE1  . TYR A 1 45  ? -5.836  3.732   4.535   1.00 0.00 ? 45  TYR A HE1  5  
ATOM 8513  H HE2  . TYR A 1 45  ? -4.404  1.155   1.455   1.00 0.00 ? 45  TYR A HE2  5  
ATOM 8514  H HH   . TYR A 1 45  ? -4.724  0.523   3.498   1.00 0.00 ? 45  TYR A HH   5  
ATOM 8515  N N    . GLU A 1 46  ? -6.392  9.125   0.634   1.00 0.00 ? 46  GLU A N    5  
ATOM 8516  C CA   . GLU A 1 46  ? -5.981  10.509  0.476   1.00 0.00 ? 46  GLU A CA   5  
ATOM 8517  C C    . GLU A 1 46  ? -4.814  10.827  1.414   1.00 0.00 ? 46  GLU A C    5  
ATOM 8518  O O    . GLU A 1 46  ? -4.970  11.586  2.370   1.00 0.00 ? 46  GLU A O    5  
ATOM 8519  C CB   . GLU A 1 46  ? -7.153  11.461  0.718   1.00 0.00 ? 46  GLU A CB   5  
ATOM 8520  C CG   . GLU A 1 46  ? -7.019  12.725  -0.133  1.00 0.00 ? 46  GLU A CG   5  
ATOM 8521  C CD   . GLU A 1 46  ? -8.328  13.516  -0.150  1.00 0.00 ? 46  GLU A CD   5  
ATOM 8522  O OE1  . GLU A 1 46  ? -9.388  12.861  -0.070  1.00 0.00 ? 46  GLU A OE1  5  
ATOM 8523  O OE2  . GLU A 1 46  ? -8.238  14.760  -0.242  1.00 0.00 ? 46  GLU A OE2  5  
ATOM 8524  H H    . GLU A 1 46  ? -7.322  8.997   0.981   1.00 0.00 ? 46  GLU A H    5  
ATOM 8525  H HA   . GLU A 1 46  ? -5.656  10.598  -0.561  1.00 0.00 ? 46  GLU A HA   5  
ATOM 8526  H HB2  . GLU A 1 46  ? -8.091  10.958  0.482   1.00 0.00 ? 46  GLU A HB2  5  
ATOM 8527  H HB3  . GLU A 1 46  ? -7.194  11.732  1.773   1.00 0.00 ? 46  GLU A HB3  5  
ATOM 8528  H HG2  . GLU A 1 46  ? -6.217  13.349  0.260   1.00 0.00 ? 46  GLU A HG2  5  
ATOM 8529  H HG3  . GLU A 1 46  ? -6.741  12.454  -1.151  1.00 0.00 ? 46  GLU A HG3  5  
ATOM 8530  N N    . ILE A 1 47  ? -3.671  10.230  1.108   1.00 0.00 ? 47  ILE A N    5  
ATOM 8531  C CA   . ILE A 1 47  ? -2.479  10.439  1.912   1.00 0.00 ? 47  ILE A CA   5  
ATOM 8532  C C    . ILE A 1 47  ? -2.044  11.902  1.800   1.00 0.00 ? 47  ILE A C    5  
ATOM 8533  O O    . ILE A 1 47  ? -2.742  12.716  1.198   1.00 0.00 ? 47  ILE A O    5  
ATOM 8534  C CB   . ILE A 1 47  ? -1.387  9.441   1.522   1.00 0.00 ? 47  ILE A CB   5  
ATOM 8535  C CG1  . ILE A 1 47  ? -0.972  9.626   0.061   1.00 0.00 ? 47  ILE A CG1  5  
ATOM 8536  C CG2  . ILE A 1 47  ? -1.827  8.005   1.815   1.00 0.00 ? 47  ILE A CG2  5  
ATOM 8537  C CD1  . ILE A 1 47  ? -0.255  8.383   -0.468  1.00 0.00 ? 47  ILE A CD1  5  
ATOM 8538  H H    . ILE A 1 47  ? -3.553  9.614   0.330   1.00 0.00 ? 47  ILE A H    5  
ATOM 8539  H HA   . ILE A 1 47  ? -2.745  10.237  2.950   1.00 0.00 ? 47  ILE A HA   5  
ATOM 8540  H HB   . ILE A 1 47  ? -0.508  9.640   2.135   1.00 0.00 ? 47  ILE A HB   5  
ATOM 8541  H HG12 . ILE A 1 47  ? -1.853  9.829   -0.548  1.00 0.00 ? 47  ILE A HG12 5  
ATOM 8542  H HG13 . ILE A 1 47  ? -0.318  10.494  -0.027  1.00 0.00 ? 47  ILE A HG13 5  
ATOM 8543  H HG21 . ILE A 1 47  ? -2.825  8.013   2.253   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 8544  H HG22 . ILE A 1 47  ? -1.843  7.434   0.887   1.00 0.00 ? 47  ILE A HG22 5  
ATOM 8545  H HG23 . ILE A 1 47  ? -1.127  7.546   2.512   1.00 0.00 ? 47  ILE A HG23 5  
ATOM 8546  H HD11 . ILE A 1 47  ? -0.069  7.693   0.356   1.00 0.00 ? 47  ILE A HD11 5  
ATOM 8547  H HD12 . ILE A 1 47  ? -0.878  7.894   -1.217  1.00 0.00 ? 47  ILE A HD12 5  
ATOM 8548  H HD13 . ILE A 1 47  ? 0.695   8.674   -0.917  1.00 0.00 ? 47  ILE A HD13 5  
ATOM 8549  N N    . LYS A 1 48  ? -0.893  12.190  2.389   1.00 0.00 ? 48  LYS A N    5  
ATOM 8550  C CA   . LYS A 1 48  ? -0.357  13.540  2.363   1.00 0.00 ? 48  LYS A CA   5  
ATOM 8551  C C    . LYS A 1 48  ? 1.063   13.509  1.794   1.00 0.00 ? 48  LYS A C    5  
ATOM 8552  O O    . LYS A 1 48  ? 1.724   14.543  1.706   1.00 0.00 ? 48  LYS A O    5  
ATOM 8553  C CB   . LYS A 1 48  ? -0.450  14.182  3.748   1.00 0.00 ? 48  LYS A CB   5  
ATOM 8554  C CG   . LYS A 1 48  ? -0.639  15.696  3.640   1.00 0.00 ? 48  LYS A CG   5  
ATOM 8555  C CD   . LYS A 1 48  ? -1.050  16.295  4.987   1.00 0.00 ? 48  LYS A CD   5  
ATOM 8556  C CE   . LYS A 1 48  ? -0.425  15.517  6.147   1.00 0.00 ? 48  LYS A CE   5  
ATOM 8557  N NZ   . LYS A 1 48  ? -0.712  16.186  7.435   1.00 0.00 ? 48  LYS A NZ   5  
ATOM 8558  H H    . LYS A 1 48  ? -0.331  11.522  2.877   1.00 0.00 ? 48  LYS A H    5  
ATOM 8559  H HA   . LYS A 1 48  ? -0.984  14.128  1.692   1.00 0.00 ? 48  LYS A HA   5  
ATOM 8560  H HB2  . LYS A 1 48  ? -1.284  13.746  4.299   1.00 0.00 ? 48  LYS A HB2  5  
ATOM 8561  H HB3  . LYS A 1 48  ? 0.454   13.963  4.315   1.00 0.00 ? 48  LYS A HB3  5  
ATOM 8562  H HG2  . LYS A 1 48  ? 0.288   16.158  3.301   1.00 0.00 ? 48  LYS A HG2  5  
ATOM 8563  H HG3  . LYS A 1 48  ? -1.399  15.919  2.892   1.00 0.00 ? 48  LYS A HG3  5  
ATOM 8564  H HD2  . LYS A 1 48  ? -0.739  17.339  5.035   1.00 0.00 ? 48  LYS A HD2  5  
ATOM 8565  H HD3  . LYS A 1 48  ? -2.136  16.281  5.079   1.00 0.00 ? 48  LYS A HD3  5  
ATOM 8566  H HE2  . LYS A 1 48  ? -0.817  14.500  6.163   1.00 0.00 ? 48  LYS A HE2  5  
ATOM 8567  H HE3  . LYS A 1 48  ? 0.652   15.440  6.002   1.00 0.00 ? 48  LYS A HE3  5  
ATOM 8568  H HZ1  . LYS A 1 48  ? -0.491  17.159  7.362   1.00 0.00 ? 48  LYS A HZ1  5  
ATOM 8569  H HZ2  . LYS A 1 48  ? -1.682  16.081  7.656   1.00 0.00 ? 48  LYS A HZ2  5  
ATOM 8570  H HZ3  . LYS A 1 48  ? -0.159  15.771  8.157   1.00 0.00 ? 48  LYS A HZ3  5  
ATOM 8571  N N    . GLN A 1 49  ? 1.492   12.312  1.423   1.00 0.00 ? 49  GLN A N    5  
ATOM 8572  C CA   . GLN A 1 49  ? 2.822   12.132  0.865   1.00 0.00 ? 49  GLN A CA   5  
ATOM 8573  C C    . GLN A 1 49  ? 3.878   12.694  1.820   1.00 0.00 ? 49  GLN A C    5  
ATOM 8574  O O    . GLN A 1 49  ? 3.805   13.855  2.218   1.00 0.00 ? 49  GLN A O    5  
ATOM 8575  C CB   . GLN A 1 49  ? 2.930   12.782  -0.516  1.00 0.00 ? 49  GLN A CB   5  
ATOM 8576  C CG   . GLN A 1 49  ? 4.347   13.300  -0.768  1.00 0.00 ? 49  GLN A CG   5  
ATOM 8577  C CD   . GLN A 1 49  ? 4.721   13.175  -2.247  1.00 0.00 ? 49  GLN A CD   5  
ATOM 8578  O OE1  . GLN A 1 49  ? 4.825   14.150  -2.972  1.00 0.00 ? 49  GLN A OE1  5  
ATOM 8579  N NE2  . GLN A 1 49  ? 4.915   11.922  -2.652  1.00 0.00 ? 49  GLN A NE2  5  
ATOM 8580  H H    . GLN A 1 49  ? 0.949   11.475  1.498   1.00 0.00 ? 49  GLN A H    5  
ATOM 8581  H HA   . GLN A 1 49  ? 2.951   11.054  0.764   1.00 0.00 ? 49  GLN A HA   5  
ATOM 8582  H HB2  . GLN A 1 49  ? 2.660   12.059  -1.284  1.00 0.00 ? 49  GLN A HB2  5  
ATOM 8583  H HB3  . GLN A 1 49  ? 2.220   13.606  -0.590  1.00 0.00 ? 49  GLN A HB3  5  
ATOM 8584  H HG2  . GLN A 1 49  ? 4.419   14.343  -0.459  1.00 0.00 ? 49  GLN A HG2  5  
ATOM 8585  H HG3  . GLN A 1 49  ? 5.057   12.738  -0.162  1.00 0.00 ? 49  GLN A HG3  5  
ATOM 8586  H HE21 . GLN A 1 49  ? 4.812   11.167  -2.005  1.00 0.00 ? 49  GLN A HE21 5  
ATOM 8587  H HE22 . GLN A 1 49  ? 5.162   11.737  -3.603  1.00 0.00 ? 49  GLN A HE22 5  
ATOM 8588  N N    . ILE A 1 50  ? 4.835   11.843  2.159   1.00 0.00 ? 50  ILE A N    5  
ATOM 8589  C CA   . ILE A 1 50  ? 5.904   12.239  3.059   1.00 0.00 ? 50  ILE A CA   5  
ATOM 8590  C C    . ILE A 1 50  ? 7.245   11.768  2.491   1.00 0.00 ? 50  ILE A C    5  
ATOM 8591  O O    . ILE A 1 50  ? 8.261   12.443  2.647   1.00 0.00 ? 50  ILE A O    5  
ATOM 8592  C CB   . ILE A 1 50  ? 5.626   11.736  4.477   1.00 0.00 ? 50  ILE A CB   5  
ATOM 8593  C CG1  . ILE A 1 50  ? 6.694   10.735  4.923   1.00 0.00 ? 50  ILE A CG1  5  
ATOM 8594  C CG2  . ILE A 1 50  ? 4.215   11.155  4.585   1.00 0.00 ? 50  ILE A CG2  5  
ATOM 8595  C CD1  . ILE A 1 50  ? 6.232   9.952   6.153   1.00 0.00 ? 50  ILE A CD1  5  
ATOM 8596  H H    . ILE A 1 50  ? 4.887   10.900  1.830   1.00 0.00 ? 50  ILE A H    5  
ATOM 8597  H HA   . ILE A 1 50  ? 5.910   13.329  3.099   1.00 0.00 ? 50  ILE A HA   5  
ATOM 8598  H HB   . ILE A 1 50  ? 5.677   12.586  5.157   1.00 0.00 ? 50  ILE A HB   5  
ATOM 8599  H HG12 . ILE A 1 50  ? 6.913   10.044  4.108   1.00 0.00 ? 50  ILE A HG12 5  
ATOM 8600  H HG13 . ILE A 1 50  ? 7.620   11.263  5.149   1.00 0.00 ? 50  ILE A HG13 5  
ATOM 8601  H HG21 . ILE A 1 50  ? 3.532   11.743  3.971   1.00 0.00 ? 50  ILE A HG21 5  
ATOM 8602  H HG22 . ILE A 1 50  ? 4.220   10.123  4.237   1.00 0.00 ? 50  ILE A HG22 5  
ATOM 8603  H HG23 . ILE A 1 50  ? 3.888   11.187  5.624   1.00 0.00 ? 50  ILE A HG23 5  
ATOM 8604  H HD11 . ILE A 1 50  ? 6.018   10.646  6.966   1.00 0.00 ? 50  ILE A HD11 5  
ATOM 8605  H HD12 . ILE A 1 50  ? 5.330   9.390   5.909   1.00 0.00 ? 50  ILE A HD12 5  
ATOM 8606  H HD13 . ILE A 1 50  ? 7.018   9.263   6.461   1.00 0.00 ? 50  ILE A HD13 5  
ATOM 8607  N N    . LYS A 1 51  ? 7.203   10.612  1.844   1.00 0.00 ? 51  LYS A N    5  
ATOM 8608  C CA   . LYS A 1 51  ? 8.401   10.043  1.252   1.00 0.00 ? 51  LYS A CA   5  
ATOM 8609  C C    . LYS A 1 51  ? 8.024   9.286   -0.023  1.00 0.00 ? 51  LYS A C    5  
ATOM 8610  O O    . LYS A 1 51  ? 6.859   8.953   -0.230  1.00 0.00 ? 51  LYS A O    5  
ATOM 8611  C CB   . LYS A 1 51  ? 9.151   9.188   2.276   1.00 0.00 ? 51  LYS A CB   5  
ATOM 8612  C CG   . LYS A 1 51  ? 10.661  9.409   2.174   1.00 0.00 ? 51  LYS A CG   5  
ATOM 8613  C CD   . LYS A 1 51  ? 11.360  9.036   3.483   1.00 0.00 ? 51  LYS A CD   5  
ATOM 8614  C CE   . LYS A 1 51  ? 12.420  10.075  3.855   1.00 0.00 ? 51  LYS A CE   5  
ATOM 8615  N NZ   . LYS A 1 51  ? 13.231  9.601   4.997   1.00 0.00 ? 51  LYS A NZ   5  
ATOM 8616  H H    . LYS A 1 51  ? 6.372   10.069  1.722   1.00 0.00 ? 51  LYS A H    5  
ATOM 8617  H HA   . LYS A 1 51  ? 9.057   10.870  0.980   1.00 0.00 ? 51  LYS A HA   5  
ATOM 8618  H HB2  . LYS A 1 51  ? 8.811   9.437   3.282   1.00 0.00 ? 51  LYS A HB2  5  
ATOM 8619  H HB3  . LYS A 1 51  ? 8.921   8.135   2.114   1.00 0.00 ? 51  LYS A HB3  5  
ATOM 8620  H HG2  . LYS A 1 51  ? 11.066  8.810   1.358   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 8621  H HG3  . LYS A 1 51  ? 10.865  10.452  1.933   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 8622  H HD2  . LYS A 1 51  ? 10.624  8.959   4.283   1.00 0.00 ? 51  LYS A HD2  5  
ATOM 8623  H HD3  . LYS A 1 51  ? 11.826  8.055   3.384   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 8624  H HE2  . LYS A 1 51  ? 13.064  10.269  2.998   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 8625  H HE3  . LYS A 1 51  ? 11.938  11.019  4.110   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 8626  H HZ1  . LYS A 1 51  ? 12.637  9.434   5.783   1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 8627  H HZ2  . LYS A 1 51  ? 13.698  8.753   4.745   1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 8628  H HZ3  . LYS A 1 51  ? 13.910  10.297  5.235   1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 8629  N N    . MET A 1 52  ? 9.034   9.034   -0.845  1.00 0.00 ? 52  MET A N    5  
ATOM 8630  C CA   . MET A 1 52  ? 8.824   8.323   -2.093  1.00 0.00 ? 52  MET A CA   5  
ATOM 8631  C C    . MET A 1 52  ? 10.012  7.414   -2.414  1.00 0.00 ? 52  MET A C    5  
ATOM 8632  O O    . MET A 1 52  ? 10.716  7.631   -3.399  1.00 0.00 ? 52  MET A O    5  
ATOM 8633  C CB   . MET A 1 52  ? 8.629   9.329   -3.228  1.00 0.00 ? 52  MET A CB   5  
ATOM 8634  C CG   . MET A 1 52  ? 9.788   10.326  -3.282  1.00 0.00 ? 52  MET A CG   5  
ATOM 8635  S SD   . MET A 1 52  ? 9.173   11.960  -3.653  1.00 0.00 ? 52  MET A SD   5  
ATOM 8636  C CE   . MET A 1 52  ? 8.741   11.746  -5.371  1.00 0.00 ? 52  MET A CE   5  
ATOM 8637  H H    . MET A 1 52  ? 9.979   9.308   -0.668  1.00 0.00 ? 52  MET A H    5  
ATOM 8638  H HA   . MET A 1 52  ? 7.927   7.720   -1.939  1.00 0.00 ? 52  MET A HA   5  
ATOM 8639  H HB2  . MET A 1 52  ? 8.554   8.801   -4.179  1.00 0.00 ? 52  MET A HB2  5  
ATOM 8640  H HB3  . MET A 1 52  ? 7.690   9.865   -3.088  1.00 0.00 ? 52  MET A HB3  5  
ATOM 8641  H HG2  . MET A 1 52  ? 10.316  10.335  -2.328  1.00 0.00 ? 52  MET A HG2  5  
ATOM 8642  H HG3  . MET A 1 52  ? 10.509  10.019  -4.041  1.00 0.00 ? 52  MET A HG3  5  
ATOM 8643  H HE1  . MET A 1 52  ? 8.451   10.710  -5.547  1.00 0.00 ? 52  MET A HE1  5  
ATOM 8644  H HE2  . MET A 1 52  ? 7.909   12.404  -5.622  1.00 0.00 ? 52  MET A HE2  5  
ATOM 8645  H HE3  . MET A 1 52  ? 9.601   11.993  -5.994  1.00 0.00 ? 52  MET A HE3  5  
ATOM 8646  N N    . PHE A 1 53  ? 10.200  6.416   -1.563  1.00 0.00 ? 53  PHE A N    5  
ATOM 8647  C CA   . PHE A 1 53  ? 11.291  5.474   -1.743  1.00 0.00 ? 53  PHE A CA   5  
ATOM 8648  C C    . PHE A 1 53  ? 11.441  5.083   -3.215  1.00 0.00 ? 53  PHE A C    5  
ATOM 8649  O O    . PHE A 1 53  ? 12.302  5.611   -3.916  1.00 0.00 ? 53  PHE A O    5  
ATOM 8650  C CB   . PHE A 1 53  ? 10.943  4.225   -0.930  1.00 0.00 ? 53  PHE A CB   5  
ATOM 8651  C CG   . PHE A 1 53  ? 11.065  4.416   0.584   1.00 0.00 ? 53  PHE A CG   5  
ATOM 8652  C CD1  . PHE A 1 53  ? 12.263  4.748   1.134   1.00 0.00 ? 53  PHE A CD1  5  
ATOM 8653  C CD2  . PHE A 1 53  ? 9.974   4.253   1.379   1.00 0.00 ? 53  PHE A CD2  5  
ATOM 8654  C CE1  . PHE A 1 53  ? 12.376  4.923   2.538   1.00 0.00 ? 53  PHE A CE1  5  
ATOM 8655  C CE2  . PHE A 1 53  ? 10.086  4.430   2.784   1.00 0.00 ? 53  PHE A CE2  5  
ATOM 8656  C CZ   . PHE A 1 53  ? 11.284  4.761   3.333   1.00 0.00 ? 53  PHE A CZ   5  
ATOM 8657  H H    . PHE A 1 53  ? 9.623   6.247   -0.763  1.00 0.00 ? 53  PHE A H    5  
ATOM 8658  H HA   . PHE A 1 53  ? 12.203  5.967   -1.405  1.00 0.00 ? 53  PHE A HA   5  
ATOM 8659  H HB2  . PHE A 1 53  ? 9.924   3.922   -1.167  1.00 0.00 ? 53  PHE A HB2  5  
ATOM 8660  H HB3  . PHE A 1 53  ? 11.598  3.411   -1.236  1.00 0.00 ? 53  PHE A HB3  5  
ATOM 8661  H HD1  . PHE A 1 53  ? 13.138  4.878   0.497   1.00 0.00 ? 53  PHE A HD1  5  
ATOM 8662  H HD2  . PHE A 1 53  ? 9.012   3.987   0.939   1.00 0.00 ? 53  PHE A HD2  5  
ATOM 8663  H HE1  . PHE A 1 53  ? 13.336  5.190   2.980   1.00 0.00 ? 53  PHE A HE1  5  
ATOM 8664  H HE2  . PHE A 1 53  ? 9.211   4.298   3.421   1.00 0.00 ? 53  PHE A HE2  5  
ATOM 8665  H HZ   . PHE A 1 53  ? 11.371  4.896   4.412   1.00 0.00 ? 53  PHE A HZ   5  
ATOM 8666  N N    . LYS A 1 54  ? 10.589  4.162   -3.639  1.00 0.00 ? 54  LYS A N    5  
ATOM 8667  C CA   . LYS A 1 54  ? 10.615  3.694   -5.015  1.00 0.00 ? 54  LYS A CA   5  
ATOM 8668  C C    . LYS A 1 54  ? 9.254   3.956   -5.664  1.00 0.00 ? 54  LYS A C    5  
ATOM 8669  O O    . LYS A 1 54  ? 8.508   3.021   -5.947  1.00 0.00 ? 54  LYS A O    5  
ATOM 8670  C CB   . LYS A 1 54  ? 11.054  2.230   -5.074  1.00 0.00 ? 54  LYS A CB   5  
ATOM 8671  C CG   . LYS A 1 54  ? 10.826  1.647   -6.470  1.00 0.00 ? 54  LYS A CG   5  
ATOM 8672  C CD   . LYS A 1 54  ? 11.302  2.616   -7.554  1.00 0.00 ? 54  LYS A CD   5  
ATOM 8673  C CE   . LYS A 1 54  ? 10.931  2.104   -8.948  1.00 0.00 ? 54  LYS A CE   5  
ATOM 8674  N NZ   . LYS A 1 54  ? 12.136  2.006   -9.802  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 8675  H H    . LYS A 1 54  ? 9.891   3.738   -3.062  1.00 0.00 ? 54  LYS A H    5  
ATOM 8676  H HA   . LYS A 1 54  ? 11.368  4.279   -5.544  1.00 0.00 ? 54  LYS A HA   5  
ATOM 8677  H HB2  . LYS A 1 54  ? 12.108  2.151   -4.812  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 8678  H HB3  . LYS A 1 54  ? 10.498  1.650   -4.338  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 8679  H HG2  . LYS A 1 54  ? 11.360  0.701   -6.564  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 8680  H HG3  . LYS A 1 54  ? 9.767   1.431   -6.610  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 8681  H HD2  . LYS A 1 54  ? 10.854  3.597   -7.393  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 8682  H HD3  . LYS A 1 54  ? 12.382  2.743   -7.485  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 8683  H HE2  . LYS A 1 54  ? 10.453  1.128   -8.869  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 8684  H HE3  . LYS A 1 54  ? 10.207  2.776   -9.408  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 8685  H HZ1  . LYS A 1 54  ? 12.953  1.987   -9.224  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 8686  H HZ2  . LYS A 1 54  ? 12.093  1.166   -10.344 1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 8687  H HZ3  . LYS A 1 54  ? 12.178  2.796   -10.412 1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 8688  N N    . GLY A 1 55  ? 8.973   5.232   -5.881  1.00 0.00 ? 55  GLY A N    5  
ATOM 8689  C CA   . GLY A 1 55  ? 7.716   5.629   -6.492  1.00 0.00 ? 55  GLY A CA   5  
ATOM 8690  C C    . GLY A 1 55  ? 7.953   6.569   -7.674  1.00 0.00 ? 55  GLY A C    5  
ATOM 8691  O O    . GLY A 1 55  ? 9.052   6.617   -8.225  1.00 0.00 ? 55  GLY A O    5  
ATOM 8692  H H    . GLY A 1 55  ? 9.587   5.988   -5.648  1.00 0.00 ? 55  GLY A H    5  
ATOM 8693  H HA2  . GLY A 1 55  ? 7.177   4.743   -6.829  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 8694  H HA3  . GLY A 1 55  ? 7.086   6.121   -5.751  1.00 0.00 ? 55  GLY A HA3  5  
ATOM 8695  N N    . PRO A 1 56  ? 6.876   7.316   -8.040  1.00 0.00 ? 56  PRO A N    5  
ATOM 8696  C CA   . PRO A 1 56  ? 6.956   8.254   -9.147  1.00 0.00 ? 56  PRO A CA   5  
ATOM 8697  C C    . PRO A 1 56  ? 7.735   9.509   -8.747  1.00 0.00 ? 56  PRO A C    5  
ATOM 8698  O O    . PRO A 1 56  ? 8.286   9.578   -7.650  1.00 0.00 ? 56  PRO A O    5  
ATOM 8699  C CB   . PRO A 1 56  ? 5.513   8.544   -9.523  1.00 0.00 ? 56  PRO A CB   5  
ATOM 8700  C CG   . PRO A 1 56  ? 4.679   8.127   -8.322  1.00 0.00 ? 56  PRO A CG   5  
ATOM 8701  C CD   . PRO A 1 56  ? 5.560   7.288   -7.411  1.00 0.00 ? 56  PRO A CD   5  
ATOM 8702  H HA   . PRO A 1 56  ? 7.463   7.849   -9.908  1.00 0.00 ? 56  PRO A HA   5  
ATOM 8703  H HB2  . PRO A 1 56  ? 5.373   9.602   -9.747  1.00 0.00 ? 56  PRO A HB2  5  
ATOM 8704  H HB3  . PRO A 1 56  ? 5.221   7.988   -10.413 1.00 0.00 ? 56  PRO A HB3  5  
ATOM 8705  H HG2  . PRO A 1 56  ? 4.307   9.004   -7.791  1.00 0.00 ? 56  PRO A HG2  5  
ATOM 8706  H HG3  . PRO A 1 56  ? 3.807   7.556   -8.643  1.00 0.00 ? 56  PRO A HG3  5  
ATOM 8707  H HD2  . PRO A 1 56  ? 5.593   7.700   -6.403  1.00 0.00 ? 56  PRO A HD2  5  
ATOM 8708  H HD3  . PRO A 1 56  ? 5.183   6.268   -7.326  1.00 0.00 ? 56  PRO A HD3  5  
ATOM 8709  N N    . GLU A 1 57  ? 7.755   10.470  -9.660  1.00 0.00 ? 57  GLU A N    5  
ATOM 8710  C CA   . GLU A 1 57  ? 8.455   11.719  -9.416  1.00 0.00 ? 57  GLU A CA   5  
ATOM 8711  C C    . GLU A 1 57  ? 7.499   12.758  -8.827  1.00 0.00 ? 57  GLU A C    5  
ATOM 8712  O O    . GLU A 1 57  ? 7.904   13.590  -8.017  1.00 0.00 ? 57  GLU A O    5  
ATOM 8713  C CB   . GLU A 1 57  ? 9.111   12.239  -10.697 1.00 0.00 ? 57  GLU A CB   5  
ATOM 8714  C CG   . GLU A 1 57  ? 9.456   11.087  -11.642 1.00 0.00 ? 57  GLU A CG   5  
ATOM 8715  C CD   . GLU A 1 57  ? 10.343  11.569  -12.793 1.00 0.00 ? 57  GLU A CD   5  
ATOM 8716  O OE1  . GLU A 1 57  ? 10.112  12.710  -13.248 1.00 0.00 ? 57  GLU A OE1  5  
ATOM 8717  O OE2  . GLU A 1 57  ? 11.230  10.785  -13.192 1.00 0.00 ? 57  GLU A OE2  5  
ATOM 8718  H H    . GLU A 1 57  ? 7.303   10.405  -10.550 1.00 0.00 ? 57  GLU A H    5  
ATOM 8719  H HA   . GLU A 1 57  ? 9.232   11.478  -8.690  1.00 0.00 ? 57  GLU A HA   5  
ATOM 8720  H HB2  . GLU A 1 57  ? 8.437   12.935  -11.198 1.00 0.00 ? 57  GLU A HB2  5  
ATOM 8721  H HB3  . GLU A 1 57  ? 10.015  12.794  -10.448 1.00 0.00 ? 57  GLU A HB3  5  
ATOM 8722  H HG2  . GLU A 1 57  ? 9.968   10.299  -11.090 1.00 0.00 ? 57  GLU A HG2  5  
ATOM 8723  H HG3  . GLU A 1 57  ? 8.540   10.652  -12.043 1.00 0.00 ? 57  GLU A HG3  5  
ATOM 8724  N N    . LYS A 1 58  ? 6.250   12.677  -9.259  1.00 0.00 ? 58  LYS A N    5  
ATOM 8725  C CA   . LYS A 1 58  ? 5.232   13.600  -8.785  1.00 0.00 ? 58  LYS A CA   5  
ATOM 8726  C C    . LYS A 1 58  ? 4.765   13.168  -7.394  1.00 0.00 ? 58  LYS A C    5  
ATOM 8727  O O    . LYS A 1 58  ? 5.200   13.728  -6.388  1.00 0.00 ? 58  LYS A O    5  
ATOM 8728  C CB   . LYS A 1 58  ? 4.099   13.718  -9.806  1.00 0.00 ? 58  LYS A CB   5  
ATOM 8729  C CG   . LYS A 1 58  ? 3.498   15.125  -9.800  1.00 0.00 ? 58  LYS A CG   5  
ATOM 8730  C CD   . LYS A 1 58  ? 3.785   15.849  -11.116 1.00 0.00 ? 58  LYS A CD   5  
ATOM 8731  C CE   . LYS A 1 58  ? 5.261   16.241  -11.216 1.00 0.00 ? 58  LYS A CE   5  
ATOM 8732  N NZ   . LYS A 1 58  ? 5.397   17.624  -11.724 1.00 0.00 ? 58  LYS A NZ   5  
ATOM 8733  H H    . LYS A 1 58  ? 5.928   11.997  -9.919  1.00 0.00 ? 58  LYS A H    5  
ATOM 8734  H HA   . LYS A 1 58  ? 5.697   14.583  -8.705  1.00 0.00 ? 58  LYS A HA   5  
ATOM 8735  H HB2  . LYS A 1 58  ? 4.474   13.483  -10.802 1.00 0.00 ? 58  LYS A HB2  5  
ATOM 8736  H HB3  . LYS A 1 58  ? 3.323   12.987  -9.579  1.00 0.00 ? 58  LYS A HB3  5  
ATOM 8737  H HG2  . LYS A 1 58  ? 2.422   15.065  -9.641  1.00 0.00 ? 58  LYS A HG2  5  
ATOM 8738  H HG3  . LYS A 1 58  ? 3.911   15.696  -8.969  1.00 0.00 ? 58  LYS A HG3  5  
ATOM 8739  H HD2  . LYS A 1 58  ? 3.518   15.206  -11.955 1.00 0.00 ? 58  LYS A HD2  5  
ATOM 8740  H HD3  . LYS A 1 58  ? 3.163   16.742  -11.188 1.00 0.00 ? 58  LYS A HD3  5  
ATOM 8741  H HE2  . LYS A 1 58  ? 5.733   16.158  -10.237 1.00 0.00 ? 58  LYS A HE2  5  
ATOM 8742  H HE3  . LYS A 1 58  ? 5.782   15.551  -11.881 1.00 0.00 ? 58  LYS A HE3  5  
ATOM 8743  H HZ1  . LYS A 1 58  ? 4.693   17.797  -12.413 1.00 0.00 ? 58  LYS A HZ1  5  
ATOM 8744  H HZ2  . LYS A 1 58  ? 5.288   18.269  -10.967 1.00 0.00 ? 58  LYS A HZ2  5  
ATOM 8745  H HZ3  . LYS A 1 58  ? 6.301   17.742  -12.134 1.00 0.00 ? 58  LYS A HZ3  5  
ATOM 8746  N N    . ASP A 1 59  ? 3.887   12.177  -7.381  1.00 0.00 ? 59  ASP A N    5  
ATOM 8747  C CA   . ASP A 1 59  ? 3.357   11.663  -6.130  1.00 0.00 ? 59  ASP A CA   5  
ATOM 8748  C C    . ASP A 1 59  ? 1.958   11.092  -6.370  1.00 0.00 ? 59  ASP A C    5  
ATOM 8749  O O    . ASP A 1 59  ? 1.379   11.286  -7.438  1.00 0.00 ? 59  ASP A O    5  
ATOM 8750  C CB   . ASP A 1 59  ? 3.241   12.774  -5.084  1.00 0.00 ? 59  ASP A CB   5  
ATOM 8751  C CG   . ASP A 1 59  ? 2.349   12.443  -3.885  1.00 0.00 ? 59  ASP A CG   5  
ATOM 8752  O OD1  . ASP A 1 59  ? 2.531   11.337  -3.331  1.00 0.00 ? 59  ASP A OD1  5  
ATOM 8753  O OD2  . ASP A 1 59  ? 1.506   13.302  -3.550  1.00 0.00 ? 59  ASP A OD2  5  
ATOM 8754  H H    . ASP A 1 59  ? 3.539   11.727  -8.204  1.00 0.00 ? 59  ASP A H    5  
ATOM 8755  H HA   . ASP A 1 59  ? 4.069   10.903  -5.808  1.00 0.00 ? 59  ASP A HA   5  
ATOM 8756  H HB2  . ASP A 1 59  ? 4.240   13.014  -4.719  1.00 0.00 ? 59  ASP A HB2  5  
ATOM 8757  H HB3  . ASP A 1 59  ? 2.853   13.670  -5.568  1.00 0.00 ? 59  ASP A HB3  5  
ATOM 8758  N N    . ILE A 1 60  ? 1.455   10.399  -5.359  1.00 0.00 ? 60  ILE A N    5  
ATOM 8759  C CA   . ILE A 1 60  ? 0.135   9.798   -5.446  1.00 0.00 ? 60  ILE A CA   5  
ATOM 8760  C C    . ILE A 1 60  ? -0.864  10.655  -4.666  1.00 0.00 ? 60  ILE A C    5  
ATOM 8761  O O    . ILE A 1 60  ? -1.701  11.335  -5.259  1.00 0.00 ? 60  ILE A O    5  
ATOM 8762  C CB   . ILE A 1 60  ? 0.180   8.338   -4.992  1.00 0.00 ? 60  ILE A CB   5  
ATOM 8763  C CG1  . ILE A 1 60  ? 1.541   7.709   -5.298  1.00 0.00 ? 60  ILE A CG1  5  
ATOM 8764  C CG2  . ILE A 1 60  ? -0.972  7.538   -5.603  1.00 0.00 ? 60  ILE A CG2  5  
ATOM 8765  C CD1  . ILE A 1 60  ? 1.674   7.389   -6.788  1.00 0.00 ? 60  ILE A CD1  5  
ATOM 8766  H H    . ILE A 1 60  ? 1.932   10.246  -4.493  1.00 0.00 ? 60  ILE A H    5  
ATOM 8767  H HA   . ILE A 1 60  ? -0.156  9.800   -6.497  1.00 0.00 ? 60  ILE A HA   5  
ATOM 8768  H HB   . ILE A 1 60  ? 0.050   8.313   -3.910  1.00 0.00 ? 60  ILE A HB   5  
ATOM 8769  H HG12 . ILE A 1 60  ? 2.335   8.391   -4.996  1.00 0.00 ? 60  ILE A HG12 5  
ATOM 8770  H HG13 . ILE A 1 60  ? 1.663   6.798   -4.713  1.00 0.00 ? 60  ILE A HG13 5  
ATOM 8771  H HG21 . ILE A 1 60  ? -1.912  8.062   -5.429  1.00 0.00 ? 60  ILE A HG21 5  
ATOM 8772  H HG22 . ILE A 1 60  ? -0.810  7.430   -6.676  1.00 0.00 ? 60  ILE A HG22 5  
ATOM 8773  H HG23 . ILE A 1 60  ? -1.015  6.551   -5.142  1.00 0.00 ? 60  ILE A HG23 5  
ATOM 8774  H HD11 . ILE A 1 60  ? 1.539   8.302   -7.369  1.00 0.00 ? 60  ILE A HD11 5  
ATOM 8775  H HD12 . ILE A 1 60  ? 2.663   6.978   -6.984  1.00 0.00 ? 60  ILE A HD12 5  
ATOM 8776  H HD13 . ILE A 1 60  ? 0.914   6.662   -7.072  1.00 0.00 ? 60  ILE A HD13 5  
ATOM 8777  N N    . GLU A 1 61  ? -0.742  10.596  -3.348  1.00 0.00 ? 61  GLU A N    5  
ATOM 8778  C CA   . GLU A 1 61  ? -1.624  11.358  -2.480  1.00 0.00 ? 61  GLU A CA   5  
ATOM 8779  C C    . GLU A 1 61  ? -3.013  10.717  -2.440  1.00 0.00 ? 61  GLU A C    5  
ATOM 8780  O O    . GLU A 1 61  ? -3.863  11.119  -1.647  1.00 0.00 ? 61  GLU A O    5  
ATOM 8781  C CB   . GLU A 1 61  ? -1.707  12.818  -2.929  1.00 0.00 ? 61  GLU A CB   5  
ATOM 8782  C CG   . GLU A 1 61  ? -1.086  13.748  -1.884  1.00 0.00 ? 61  GLU A CG   5  
ATOM 8783  C CD   . GLU A 1 61  ? -1.876  15.055  -1.775  1.00 0.00 ? 61  GLU A CD   5  
ATOM 8784  O OE1  . GLU A 1 61  ? -2.969  15.008  -1.171  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 8785  O OE2  . GLU A 1 61  ? -1.369  16.070  -2.299  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 8786  H H    . GLU A 1 61  ? -0.059  10.041  -2.873  1.00 0.00 ? 61  GLU A H    5  
ATOM 8787  H HA   . GLU A 1 61  ? -1.167  11.313  -1.491  1.00 0.00 ? 61  GLU A HA   5  
ATOM 8788  H HB2  . GLU A 1 61  ? -1.191  12.940  -3.881  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 8789  H HB3  . GLU A 1 61  ? -2.748  13.093  -3.093  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 8790  H HG2  . GLU A 1 61  ? -1.065  13.250  -0.914  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 8791  H HG3  . GLU A 1 61  ? -0.052  13.966  -2.154  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 8792  N N    . PHE A 1 62  ? -3.200  9.731   -3.304  1.00 0.00 ? 62  PHE A N    5  
ATOM 8793  C CA   . PHE A 1 62  ? -4.472  9.032   -3.378  1.00 0.00 ? 62  PHE A CA   5  
ATOM 8794  C C    . PHE A 1 62  ? -4.273  7.577   -3.808  1.00 0.00 ? 62  PHE A C    5  
ATOM 8795  O O    . PHE A 1 62  ? -4.152  7.289   -4.998  1.00 0.00 ? 62  PHE A O    5  
ATOM 8796  C CB   . PHE A 1 62  ? -5.318  9.750   -4.430  1.00 0.00 ? 62  PHE A CB   5  
ATOM 8797  C CG   . PHE A 1 62  ? -6.416  10.641  -3.842  1.00 0.00 ? 62  PHE A CG   5  
ATOM 8798  C CD1  . PHE A 1 62  ? -7.479  10.080  -3.207  1.00 0.00 ? 62  PHE A CD1  5  
ATOM 8799  C CD2  . PHE A 1 62  ? -6.328  11.993  -3.956  1.00 0.00 ? 62  PHE A CD2  5  
ATOM 8800  C CE1  . PHE A 1 62  ? -8.498  10.906  -2.662  1.00 0.00 ? 62  PHE A CE1  5  
ATOM 8801  C CE2  . PHE A 1 62  ? -7.347  12.819  -3.412  1.00 0.00 ? 62  PHE A CE2  5  
ATOM 8802  C CZ   . PHE A 1 62  ? -8.410  12.259  -2.776  1.00 0.00 ? 62  PHE A CZ   5  
ATOM 8803  H H    . PHE A 1 62  ? -2.504  9.410   -3.947  1.00 0.00 ? 62  PHE A H    5  
ATOM 8804  H HA   . PHE A 1 62  ? -4.912  9.057   -2.381  1.00 0.00 ? 62  PHE A HA   5  
ATOM 8805  H HB2  . PHE A 1 62  ? -4.664  10.360  -5.052  1.00 0.00 ? 62  PHE A HB2  5  
ATOM 8806  H HB3  . PHE A 1 62  ? -5.777  9.007   -5.082  1.00 0.00 ? 62  PHE A HB3  5  
ATOM 8807  H HD1  . PHE A 1 62  ? -7.549  8.995   -3.115  1.00 0.00 ? 62  PHE A HD1  5  
ATOM 8808  H HD2  . PHE A 1 62  ? -5.475  12.443  -4.466  1.00 0.00 ? 62  PHE A HD2  5  
ATOM 8809  H HE1  . PHE A 1 62  ? -9.350  10.456  -2.152  1.00 0.00 ? 62  PHE A HE1  5  
ATOM 8810  H HE2  . PHE A 1 62  ? -7.276  13.903  -3.503  1.00 0.00 ? 62  PHE A HE2  5  
ATOM 8811  H HZ   . PHE A 1 62  ? -9.191  12.893  -2.358  1.00 0.00 ? 62  PHE A HZ   5  
ATOM 8812  N N    . ILE A 1 63  ? -4.244  6.698   -2.817  1.00 0.00 ? 63  ILE A N    5  
ATOM 8813  C CA   . ILE A 1 63  ? -4.062  5.280   -3.078  1.00 0.00 ? 63  ILE A CA   5  
ATOM 8814  C C    . ILE A 1 63  ? -5.406  4.563   -2.938  1.00 0.00 ? 63  ILE A C    5  
ATOM 8815  O O    . ILE A 1 63  ? -6.381  5.151   -2.473  1.00 0.00 ? 63  ILE A O    5  
ATOM 8816  C CB   . ILE A 1 63  ? -2.963  4.708   -2.180  1.00 0.00 ? 63  ILE A CB   5  
ATOM 8817  C CG1  . ILE A 1 63  ? -1.937  5.782   -1.815  1.00 0.00 ? 63  ILE A CG1  5  
ATOM 8818  C CG2  . ILE A 1 63  ? -2.307  3.485   -2.827  1.00 0.00 ? 63  ILE A CG2  5  
ATOM 8819  C CD1  . ILE A 1 63  ? -0.589  5.503   -2.483  1.00 0.00 ? 63  ILE A CD1  5  
ATOM 8820  H H    . ILE A 1 63  ? -4.342  6.941   -1.851  1.00 0.00 ? 63  ILE A H    5  
ATOM 8821  H HA   . ILE A 1 63  ? -3.721  5.180   -4.109  1.00 0.00 ? 63  ILE A HA   5  
ATOM 8822  H HB   . ILE A 1 63  ? -3.422  4.371   -1.251  1.00 0.00 ? 63  ILE A HB   5  
ATOM 8823  H HG12 . ILE A 1 63  ? -2.304  6.761   -2.124  1.00 0.00 ? 63  ILE A HG12 5  
ATOM 8824  H HG13 . ILE A 1 63  ? -1.810  5.817   -0.733  1.00 0.00 ? 63  ILE A HG13 5  
ATOM 8825  H HG21 . ILE A 1 63  ? -2.107  3.696   -3.879  1.00 0.00 ? 63  ILE A HG21 5  
ATOM 8826  H HG22 . ILE A 1 63  ? -1.371  3.262   -2.317  1.00 0.00 ? 63  ILE A HG22 5  
ATOM 8827  H HG23 . ILE A 1 63  ? -2.978  2.630   -2.749  1.00 0.00 ? 63  ILE A HG23 5  
ATOM 8828  H HD11 . ILE A 1 63  ? -0.753  5.182   -3.512  1.00 0.00 ? 63  ILE A HD11 5  
ATOM 8829  H HD12 . ILE A 1 63  ? 0.015   6.411   -2.478  1.00 0.00 ? 63  ILE A HD12 5  
ATOM 8830  H HD13 . ILE A 1 63  ? -0.068  4.717   -1.936  1.00 0.00 ? 63  ILE A HD13 5  
ATOM 8831  N N    . TYR A 1 64  ? -5.414  3.304   -3.350  1.00 0.00 ? 64  TYR A N    5  
ATOM 8832  C CA   . TYR A 1 64  ? -6.622  2.501   -3.276  1.00 0.00 ? 64  TYR A CA   5  
ATOM 8833  C C    . TYR A 1 64  ? -6.403  1.258   -2.411  1.00 0.00 ? 64  TYR A C    5  
ATOM 8834  O O    . TYR A 1 64  ? -5.308  0.699   -2.387  1.00 0.00 ? 64  TYR A O    5  
ATOM 8835  C CB   . TYR A 1 64  ? -6.925  2.062   -4.711  1.00 0.00 ? 64  TYR A CB   5  
ATOM 8836  C CG   . TYR A 1 64  ? -7.452  0.631   -4.825  1.00 0.00 ? 64  TYR A CG   5  
ATOM 8837  C CD1  . TYR A 1 64  ? -6.613  -0.436  -4.574  1.00 0.00 ? 64  TYR A CD1  5  
ATOM 8838  C CD2  . TYR A 1 64  ? -8.767  0.406   -5.180  1.00 0.00 ? 64  TYR A CD2  5  
ATOM 8839  C CE1  . TYR A 1 64  ? -7.109  -1.783  -4.682  1.00 0.00 ? 64  TYR A CE1  5  
ATOM 8840  C CE2  . TYR A 1 64  ? -9.263  -0.942  -5.289  1.00 0.00 ? 64  TYR A CE2  5  
ATOM 8841  C CZ   . TYR A 1 64  ? -8.410  -1.969  -5.034  1.00 0.00 ? 64  TYR A CZ   5  
ATOM 8842  O OH   . TYR A 1 64  ? -8.879  -3.242  -5.135  1.00 0.00 ? 64  TYR A OH   5  
ATOM 8843  H H    . TYR A 1 64  ? -4.616  2.834   -3.727  1.00 0.00 ? 64  TYR A H    5  
ATOM 8844  H HA   . TYR A 1 64  ? -7.406  3.113   -2.830  1.00 0.00 ? 64  TYR A HA   5  
ATOM 8845  H HB2  . TYR A 1 64  ? -7.658  2.744   -5.142  1.00 0.00 ? 64  TYR A HB2  5  
ATOM 8846  H HB3  . TYR A 1 64  ? -6.016  2.153   -5.307  1.00 0.00 ? 64  TYR A HB3  5  
ATOM 8847  H HD1  . TYR A 1 64  ? -5.575  -0.258  -4.293  1.00 0.00 ? 64  TYR A HD1  5  
ATOM 8848  H HD2  . TYR A 1 64  ? -9.429  1.248   -5.379  1.00 0.00 ? 64  TYR A HD2  5  
ATOM 8849  H HE1  . TYR A 1 64  ? -6.458  -2.635  -4.485  1.00 0.00 ? 64  TYR A HE1  5  
ATOM 8850  H HE2  . TYR A 1 64  ? -10.299 -1.133  -5.568  1.00 0.00 ? 64  TYR A HE2  5  
ATOM 8851  H HH   . TYR A 1 64  ? -9.371  -3.358  -5.998  1.00 0.00 ? 64  TYR A HH   5  
ATOM 8852  N N    . THR A 1 65  ? -7.463  0.862   -1.721  1.00 0.00 ? 65  THR A N    5  
ATOM 8853  C CA   . THR A 1 65  ? -7.400  -0.304  -0.856  1.00 0.00 ? 65  THR A CA   5  
ATOM 8854  C C    . THR A 1 65  ? -8.809  -0.811  -0.543  1.00 0.00 ? 65  THR A C    5  
ATOM 8855  O O    . THR A 1 65  ? -9.758  -0.501  -1.260  1.00 0.00 ? 65  THR A O    5  
ATOM 8856  C CB   . THR A 1 65  ? -6.598  0.075   0.390   1.00 0.00 ? 65  THR A CB   5  
ATOM 8857  O OG1  . THR A 1 65  ? -6.585  -1.118  1.170   1.00 0.00 ? 65  THR A OG1  5  
ATOM 8858  C CG2  . THR A 1 65  ? -7.331  1.088   1.272   1.00 0.00 ? 65  THR A CG2  5  
ATOM 8859  H H    . THR A 1 65  ? -8.351  1.323   -1.746  1.00 0.00 ? 65  THR A H    5  
ATOM 8860  H HA   . THR A 1 65  ? -6.885  -1.101  -1.392  1.00 0.00 ? 65  THR A HA   5  
ATOM 8861  H HB   . THR A 1 65  ? -5.607  0.439   0.120   1.00 0.00 ? 65  THR A HB   5  
ATOM 8862  H HG1  . THR A 1 65  ? -6.291  -1.890  0.607   1.00 0.00 ? 65  THR A HG1  5  
ATOM 8863  H HG21 . THR A 1 65  ? -8.407  0.981   1.131   1.00 0.00 ? 65  THR A HG21 5  
ATOM 8864  H HG22 . THR A 1 65  ? -7.082  0.907   2.318   1.00 0.00 ? 65  THR A HG22 5  
ATOM 8865  H HG23 . THR A 1 65  ? -7.027  2.097   0.996   1.00 0.00 ? 65  THR A HG23 5  
ATOM 8866  N N    . ALA A 1 66  ? -8.900  -1.583  0.530   1.00 0.00 ? 66  ALA A N    5  
ATOM 8867  C CA   . ALA A 1 66  ? -10.176 -2.138  0.947   1.00 0.00 ? 66  ALA A CA   5  
ATOM 8868  C C    . ALA A 1 66  ? -10.634 -1.440  2.230   1.00 0.00 ? 66  ALA A C    5  
ATOM 8869  O O    . ALA A 1 66  ? -9.813  -0.948  3.001   1.00 0.00 ? 66  ALA A O    5  
ATOM 8870  C CB   . ALA A 1 66  ? -10.043 -3.651  1.123   1.00 0.00 ? 66  ALA A CB   5  
ATOM 8871  H H    . ALA A 1 66  ? -8.122  -1.832  1.108   1.00 0.00 ? 66  ALA A H    5  
ATOM 8872  H HA   . ALA A 1 66  ? -10.900 -1.938  0.157   1.00 0.00 ? 66  ALA A HA   5  
ATOM 8873  H HB1  . ALA A 1 66  ? -8.988  -3.920  1.173   1.00 0.00 ? 66  ALA A HB1  5  
ATOM 8874  H HB2  . ALA A 1 66  ? -10.540 -3.956  2.044   1.00 0.00 ? 66  ALA A HB2  5  
ATOM 8875  H HB3  . ALA A 1 66  ? -10.508 -4.158  0.276   1.00 0.00 ? 66  ALA A HB3  5  
ATOM 8876  N N    . PRO A 1 67  ? -11.980 -1.419  2.423   1.00 0.00 ? 67  PRO A N    5  
ATOM 8877  C CA   . PRO A 1 67  ? -12.558 -0.790  3.598   1.00 0.00 ? 67  PRO A CA   5  
ATOM 8878  C C    . PRO A 1 67  ? -12.359 -1.661  4.840   1.00 0.00 ? 67  PRO A C    5  
ATOM 8879  O O    . PRO A 1 67  ? -11.467 -2.507  4.873   1.00 0.00 ? 67  PRO A O    5  
ATOM 8880  C CB   . PRO A 1 67  ? -14.023 -0.577  3.251   1.00 0.00 ? 67  PRO A CB   5  
ATOM 8881  C CG   . PRO A 1 67  ? -14.315 -1.509  2.086   1.00 0.00 ? 67  PRO A CG   5  
ATOM 8882  C CD   . PRO A 1 67  ? -12.985 -1.991  1.530   1.00 0.00 ? 67  PRO A CD   5  
ATOM 8883  H HA   . PRO A 1 67  ? -12.094 0.074   3.793   1.00 0.00 ? 67  PRO A HA   5  
ATOM 8884  H HB2  . PRO A 1 67  ? -14.663 -0.804  4.103   1.00 0.00 ? 67  PRO A HB2  5  
ATOM 8885  H HB3  . PRO A 1 67  ? -14.212 0.461   2.978   1.00 0.00 ? 67  PRO A HB3  5  
ATOM 8886  H HG2  . PRO A 1 67  ? -14.920 -2.353  2.416   1.00 0.00 ? 67  PRO A HG2  5  
ATOM 8887  H HG3  . PRO A 1 67  ? -14.884 -0.990  1.316   1.00 0.00 ? 67  PRO A HG3  5  
ATOM 8888  H HD2  . PRO A 1 67  ? -12.931 -3.080  1.521   1.00 0.00 ? 67  PRO A HD2  5  
ATOM 8889  H HD3  . PRO A 1 67  ? -12.839 -1.656  0.504   1.00 0.00 ? 67  PRO A HD3  5  
ATOM 8890  N N    . SER A 1 68  ? -13.205 -1.424  5.832   1.00 0.00 ? 68  SER A N    5  
ATOM 8891  C CA   . SER A 1 68  ? -13.133 -2.176  7.073   1.00 0.00 ? 68  SER A CA   5  
ATOM 8892  C C    . SER A 1 68  ? -11.762 -1.980  7.725   1.00 0.00 ? 68  SER A C    5  
ATOM 8893  O O    . SER A 1 68  ? -11.044 -1.038  7.396   1.00 0.00 ? 68  SER A O    5  
ATOM 8894  C CB   . SER A 1 68  ? -13.397 -3.664  6.831   1.00 0.00 ? 68  SER A CB   5  
ATOM 8895  O OG   . SER A 1 68  ? -14.567 -4.115  7.510   1.00 0.00 ? 68  SER A OG   5  
ATOM 8896  H H    . SER A 1 68  ? -13.928 -0.733  5.798   1.00 0.00 ? 68  SER A H    5  
ATOM 8897  H HA   . SER A 1 68  ? -13.919 -1.765  7.706   1.00 0.00 ? 68  SER A HA   5  
ATOM 8898  H HB2  . SER A 1 68  ? -13.506 -3.843  5.762   1.00 0.00 ? 68  SER A HB2  5  
ATOM 8899  H HB3  . SER A 1 68  ? -12.538 -4.244  7.166   1.00 0.00 ? 68  SER A HB3  5  
ATOM 8900  H HG   . SER A 1 68  ? -15.279 -3.414  7.465   1.00 0.00 ? 68  SER A HG   5  
ATOM 8901  N N    . SER A 1 69  ? -11.442 -2.885  8.638   1.00 0.00 ? 69  SER A N    5  
ATOM 8902  C CA   . SER A 1 69  ? -10.171 -2.823  9.340   1.00 0.00 ? 69  SER A CA   5  
ATOM 8903  C C    . SER A 1 69  ? -9.065  -3.424  8.471   1.00 0.00 ? 69  SER A C    5  
ATOM 8904  O O    . SER A 1 69  ? -8.099  -3.984  8.989   1.00 0.00 ? 69  SER A O    5  
ATOM 8905  C CB   . SER A 1 69  ? -10.247 -3.551  10.683  1.00 0.00 ? 69  SER A CB   5  
ATOM 8906  O OG   . SER A 1 69  ? -8.965  -3.688  11.289  1.00 0.00 ? 69  SER A OG   5  
ATOM 8907  H H    . SER A 1 69  ? -12.032 -3.649  8.900   1.00 0.00 ? 69  SER A H    5  
ATOM 8908  H HA   . SER A 1 69  ? -9.988  -1.763  9.513   1.00 0.00 ? 69  SER A HA   5  
ATOM 8909  H HB2  . SER A 1 69  ? -10.910 -3.006  11.354  1.00 0.00 ? 69  SER A HB2  5  
ATOM 8910  H HB3  . SER A 1 69  ? -10.685 -4.539  10.535  1.00 0.00 ? 69  SER A HB3  5  
ATOM 8911  H HG   . SER A 1 69  ? -8.401  -2.887  11.083  1.00 0.00 ? 69  SER A HG   5  
ATOM 8912  N N    . ALA A 1 70  ? -9.242  -3.288  7.165   1.00 0.00 ? 70  ALA A N    5  
ATOM 8913  C CA   . ALA A 1 70  ? -8.270  -3.813  6.220   1.00 0.00 ? 70  ALA A CA   5  
ATOM 8914  C C    . ALA A 1 70  ? -8.619  -5.264  5.887   1.00 0.00 ? 70  ALA A C    5  
ATOM 8915  O O    . ALA A 1 70  ? -8.232  -6.181  6.610   1.00 0.00 ? 70  ALA A O    5  
ATOM 8916  C CB   . ALA A 1 70  ? -6.862  -3.670  6.803   1.00 0.00 ? 70  ALA A CB   5  
ATOM 8917  H H    . ALA A 1 70  ? -10.029 -2.832  6.752   1.00 0.00 ? 70  ALA A H    5  
ATOM 8918  H HA   . ALA A 1 70  ? -8.336  -3.214  5.310   1.00 0.00 ? 70  ALA A HA   5  
ATOM 8919  H HB1  . ALA A 1 70  ? -6.858  -2.881  7.555   1.00 0.00 ? 70  ALA A HB1  5  
ATOM 8920  H HB2  . ALA A 1 70  ? -6.562  -4.612  7.262   1.00 0.00 ? 70  ALA A HB2  5  
ATOM 8921  H HB3  . ALA A 1 70  ? -6.163  -3.417  6.006   1.00 0.00 ? 70  ALA A HB3  5  
ATOM 8922  N N    . VAL A 1 71  ? -9.347  -5.428  4.792   1.00 0.00 ? 71  VAL A N    5  
ATOM 8923  C CA   . VAL A 1 71  ? -9.752  -6.753  4.354   1.00 0.00 ? 71  VAL A CA   5  
ATOM 8924  C C    . VAL A 1 71  ? -8.942  -7.147  3.117   1.00 0.00 ? 71  VAL A C    5  
ATOM 8925  O O    . VAL A 1 71  ? -8.712  -8.330  2.873   1.00 0.00 ? 71  VAL A O    5  
ATOM 8926  C CB   . VAL A 1 71  ? -11.263 -6.785  4.114   1.00 0.00 ? 71  VAL A CB   5  
ATOM 8927  C CG1  . VAL A 1 71  ? -11.976 -5.736  4.971   1.00 0.00 ? 71  VAL A CG1  5  
ATOM 8928  C CG2  . VAL A 1 71  ? -11.587 -6.593  2.631   1.00 0.00 ? 71  VAL A CG2  5  
ATOM 8929  H H    . VAL A 1 71  ? -9.657  -4.677  4.209   1.00 0.00 ? 71  VAL A H    5  
ATOM 8930  H HA   . VAL A 1 71  ? -9.524  -7.450  5.160   1.00 0.00 ? 71  VAL A HA   5  
ATOM 8931  H HB   . VAL A 1 71  ? -11.629 -7.766  4.413   1.00 0.00 ? 71  VAL A HB   5  
ATOM 8932  H HG11 . VAL A 1 71  ? -11.575 -4.748  4.744   1.00 0.00 ? 71  VAL A HG11 5  
ATOM 8933  H HG12 . VAL A 1 71  ? -13.045 -5.754  4.752   1.00 0.00 ? 71  VAL A HG12 5  
ATOM 8934  H HG13 . VAL A 1 71  ? -11.817 -5.961  6.025   1.00 0.00 ? 71  VAL A HG13 5  
ATOM 8935  H HG21 . VAL A 1 71  ? -10.875 -5.897  2.190   1.00 0.00 ? 71  VAL A HG21 5  
ATOM 8936  H HG22 . VAL A 1 71  ? -11.521 -7.553  2.118   1.00 0.00 ? 71  VAL A HG22 5  
ATOM 8937  H HG23 . VAL A 1 71  ? -12.596 -6.195  2.527   1.00 0.00 ? 71  VAL A HG23 5  
ATOM 8938  N N    . CYS A 1 72  ? -8.532  -6.133  2.370   1.00 0.00 ? 72  CYS A N    5  
ATOM 8939  C CA   . CYS A 1 72  ? -7.753  -6.359  1.164   1.00 0.00 ? 72  CYS A CA   5  
ATOM 8940  C C    . CYS A 1 72  ? -6.575  -5.383  1.164   1.00 0.00 ? 72  CYS A C    5  
ATOM 8941  O O    . CYS A 1 72  ? -5.894  -5.226  0.151   1.00 0.00 ? 72  CYS A O    5  
ATOM 8942  C CB   . CYS A 1 72  ? -8.608  -6.221  -0.097  1.00 0.00 ? 72  CYS A CB   5  
ATOM 8943  S SG   . CYS A 1 72  ? -10.276 -6.965  0.021   1.00 0.00 ? 72  CYS A SG   5  
ATOM 8944  H H    . CYS A 1 72  ? -8.724  -5.174  2.575   1.00 0.00 ? 72  CYS A H    5  
ATOM 8945  H HA   . CYS A 1 72  ? -7.401  -7.390  1.207   1.00 0.00 ? 72  CYS A HA   5  
ATOM 8946  H HB2  . CYS A 1 72  ? -8.714  -5.162  -0.332  1.00 0.00 ? 72  CYS A HB2  5  
ATOM 8947  H HB3  . CYS A 1 72  ? -8.078  -6.681  -0.931  1.00 0.00 ? 72  CYS A HB3  5  
ATOM 8948  N N    . GLY A 1 73  ? -6.368  -4.754  2.312   1.00 0.00 ? 73  GLY A N    5  
ATOM 8949  C CA   . GLY A 1 73  ? -5.285  -3.798  2.457   1.00 0.00 ? 73  GLY A CA   5  
ATOM 8950  C C    . GLY A 1 73  ? -4.813  -3.720  3.911   1.00 0.00 ? 73  GLY A C    5  
ATOM 8951  O O    . GLY A 1 73  ? -4.945  -4.684  4.662   1.00 0.00 ? 73  GLY A O    5  
ATOM 8952  H H    . GLY A 1 73  ? -6.926  -4.888  3.131   1.00 0.00 ? 73  GLY A H    5  
ATOM 8953  H HA2  . GLY A 1 73  ? -4.452  -4.087  1.816   1.00 0.00 ? 73  GLY A HA2  5  
ATOM 8954  H HA3  . GLY A 1 73  ? -5.615  -2.814  2.125   1.00 0.00 ? 73  GLY A HA3  5  
ATOM 8955  N N    . VAL A 1 74  ? -4.272  -2.562  4.263   1.00 0.00 ? 74  VAL A N    5  
ATOM 8956  C CA   . VAL A 1 74  ? -3.780  -2.346  5.612   1.00 0.00 ? 74  VAL A CA   5  
ATOM 8957  C C    . VAL A 1 74  ? -4.622  -1.263  6.290   1.00 0.00 ? 74  VAL A C    5  
ATOM 8958  O O    . VAL A 1 74  ? -4.377  -0.912  7.443   1.00 0.00 ? 74  VAL A O    5  
ATOM 8959  C CB   . VAL A 1 74  ? -2.288  -2.009  5.578   1.00 0.00 ? 74  VAL A CB   5  
ATOM 8960  C CG1  . VAL A 1 74  ? -1.777  -1.640  6.972   1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8961  C CG2  . VAL A 1 74  ? -1.479  -3.164  4.985   1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8962  H H    . VAL A 1 74  ? -4.168  -1.783  3.645   1.00 0.00 ? 74  VAL A H    5  
ATOM 8963  H HA   . VAL A 1 74  ? -3.903  -3.280  6.161   1.00 0.00 ? 74  VAL A HA   5  
ATOM 8964  H HB   . VAL A 1 74  ? -2.156  -1.141  4.933   1.00 0.00 ? 74  VAL A HB   5  
ATOM 8965  H HG11 . VAL A 1 74  ? -2.032  -2.434  7.674   1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8966  H HG12 . VAL A 1 74  ? -0.695  -1.516  6.941   1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8967  H HG13 . VAL A 1 74  ? -2.241  -0.708  7.295   1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8968  H HG21 . VAL A 1 74  ? -2.095  -3.712  4.273   1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8969  H HG22 . VAL A 1 74  ? -0.601  -2.768  4.476   1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8970  H HG23 . VAL A 1 74  ? -1.164  -3.835  5.785   1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8971  N N    . SER A 1 75  ? -5.597  -0.763  5.545   1.00 0.00 ? 75  SER A N    5  
ATOM 8972  C CA   . SER A 1 75  ? -6.477  0.272   6.059   1.00 0.00 ? 75  SER A CA   5  
ATOM 8973  C C    . SER A 1 75  ? -5.707  1.185   7.015   1.00 0.00 ? 75  SER A C    5  
ATOM 8974  O O    . SER A 1 75  ? -5.755  0.999   8.229   1.00 0.00 ? 75  SER A O    5  
ATOM 8975  C CB   . SER A 1 75  ? -7.690  -0.335  6.766   1.00 0.00 ? 75  SER A CB   5  
ATOM 8976  O OG   . SER A 1 75  ? -7.362  -0.817  8.067   1.00 0.00 ? 75  SER A OG   5  
ATOM 8977  H H    . SER A 1 75  ? -5.789  -1.054  4.607   1.00 0.00 ? 75  SER A H    5  
ATOM 8978  H HA   . SER A 1 75  ? -6.809  0.829   5.182   1.00 0.00 ? 75  SER A HA   5  
ATOM 8979  H HB2  . SER A 1 75  ? -8.478  0.414   6.844   1.00 0.00 ? 75  SER A HB2  5  
ATOM 8980  H HB3  . SER A 1 75  ? -8.086  -1.154  6.165   1.00 0.00 ? 75  SER A HB3  5  
ATOM 8981  H HG   . SER A 1 75  ? -8.185  -1.153  8.524   1.00 0.00 ? 75  SER A HG   5  
ATOM 8982  N N    . LEU A 1 76  ? -5.016  2.153   6.430   1.00 0.00 ? 76  LEU A N    5  
ATOM 8983  C CA   . LEU A 1 76  ? -4.237  3.095   7.214   1.00 0.00 ? 76  LEU A CA   5  
ATOM 8984  C C    . LEU A 1 76  ? -4.973  4.435   7.272   1.00 0.00 ? 76  LEU A C    5  
ATOM 8985  O O    . LEU A 1 76  ? -5.479  4.913   6.258   1.00 0.00 ? 76  LEU A O    5  
ATOM 8986  C CB   . LEU A 1 76  ? -2.811  3.199   6.668   1.00 0.00 ? 76  LEU A CB   5  
ATOM 8987  C CG   . LEU A 1 76  ? -2.321  2.008   5.844   1.00 0.00 ? 76  LEU A CG   5  
ATOM 8988  C CD1  . LEU A 1 76  ? -2.409  2.302   4.345   1.00 0.00 ? 76  LEU A CD1  5  
ATOM 8989  C CD2  . LEU A 1 76  ? -0.909  1.594   6.265   1.00 0.00 ? 76  LEU A CD2  5  
ATOM 8990  H H    . LEU A 1 76  ? -4.982  2.297   5.441   1.00 0.00 ? 76  LEU A H    5  
ATOM 8991  H HA   . LEU A 1 76  ? -4.165  2.697   8.227   1.00 0.00 ? 76  LEU A HA   5  
ATOM 8992  H HB2  . LEU A 1 76  ? -2.746  4.095   6.049   1.00 0.00 ? 76  LEU A HB2  5  
ATOM 8993  H HB3  . LEU A 1 76  ? -2.130  3.341   7.507   1.00 0.00 ? 76  LEU A HB3  5  
ATOM 8994  H HG   . LEU A 1 76  ? -2.977  1.160   6.044   1.00 0.00 ? 76  LEU A HG   5  
ATOM 8995  H HD11 . LEU A 1 76  ? -2.915  3.255   4.192   1.00 0.00 ? 76  LEU A HD11 5  
ATOM 8996  H HD12 . LEU A 1 76  ? -1.404  2.352   3.925   1.00 0.00 ? 76  LEU A HD12 5  
ATOM 8997  H HD13 . LEU A 1 76  ? -2.970  1.509   3.851   1.00 0.00 ? 76  LEU A HD13 5  
ATOM 8998  H HD21 . LEU A 1 76  ? -0.561  2.250   7.065   1.00 0.00 ? 76  LEU A HD21 5  
ATOM 8999  H HD22 . LEU A 1 76  ? -0.922  0.564   6.619   1.00 0.00 ? 76  LEU A HD22 5  
ATOM 9000  H HD23 . LEU A 1 76  ? -0.237  1.677   5.410   1.00 0.00 ? 76  LEU A HD23 5  
ATOM 9001  N N    . ASP A 1 77  ? -5.008  5.004   8.469   1.00 0.00 ? 77  ASP A N    5  
ATOM 9002  C CA   . ASP A 1 77  ? -5.674  6.280   8.671   1.00 0.00 ? 77  ASP A CA   5  
ATOM 9003  C C    . ASP A 1 77  ? -4.691  7.269   9.301   1.00 0.00 ? 77  ASP A C    5  
ATOM 9004  O O    . ASP A 1 77  ? -5.045  8.416   9.568   1.00 0.00 ? 77  ASP A O    5  
ATOM 9005  C CB   . ASP A 1 77  ? -6.868  6.133   9.616   1.00 0.00 ? 77  ASP A CB   5  
ATOM 9006  C CG   . ASP A 1 77  ? -6.715  5.055   10.691  1.00 0.00 ? 77  ASP A CG   5  
ATOM 9007  O OD1  . ASP A 1 77  ? -6.100  5.373   11.732  1.00 0.00 ? 77  ASP A OD1  5  
ATOM 9008  O OD2  . ASP A 1 77  ? -7.215  3.935   10.446  1.00 0.00 ? 77  ASP A OD2  5  
ATOM 9009  H H    . ASP A 1 77  ? -4.593  4.608   9.288   1.00 0.00 ? 77  ASP A H    5  
ATOM 9010  H HA   . ASP A 1 77  ? -6.003  6.592   7.680   1.00 0.00 ? 77  ASP A HA   5  
ATOM 9011  H HB2  . ASP A 1 77  ? -7.043  7.091   10.107  1.00 0.00 ? 77  ASP A HB2  5  
ATOM 9012  H HB3  . ASP A 1 77  ? -7.755  5.912   9.025   1.00 0.00 ? 77  ASP A HB3  5  
ATOM 9013  N N    . VAL A 1 78  ? -3.475  6.788   9.519   1.00 0.00 ? 78  VAL A N    5  
ATOM 9014  C CA   . VAL A 1 78  ? -2.438  7.616   10.113  1.00 0.00 ? 78  VAL A CA   5  
ATOM 9015  C C    . VAL A 1 78  ? -2.754  7.836   11.593  1.00 0.00 ? 78  VAL A C    5  
ATOM 9016  O O    . VAL A 1 78  ? -1.925  7.553   12.457  1.00 0.00 ? 78  VAL A O    5  
ATOM 9017  C CB   . VAL A 1 78  ? -2.301  8.922   9.329   1.00 0.00 ? 78  VAL A CB   5  
ATOM 9018  C CG1  . VAL A 1 78  ? -1.971  10.089  10.262  1.00 0.00 ? 78  VAL A CG1  5  
ATOM 9019  C CG2  . VAL A 1 78  ? -1.250  8.791   8.224   1.00 0.00 ? 78  VAL A CG2  5  
ATOM 9020  H H    . VAL A 1 78  ? -3.196  5.853   9.299   1.00 0.00 ? 78  VAL A H    5  
ATOM 9021  H HA   . VAL A 1 78  ? -1.498  7.072   10.031  1.00 0.00 ? 78  VAL A HA   5  
ATOM 9022  H HB   . VAL A 1 78  ? -3.260  9.133   8.856   1.00 0.00 ? 78  VAL A HB   5  
ATOM 9023  H HG11 . VAL A 1 78  ? -1.352  9.731   11.086  1.00 0.00 ? 78  VAL A HG11 5  
ATOM 9024  H HG12 . VAL A 1 78  ? -1.431  10.856  9.708   1.00 0.00 ? 78  VAL A HG12 5  
ATOM 9025  H HG13 . VAL A 1 78  ? -2.896  10.510  10.659  1.00 0.00 ? 78  VAL A HG13 5  
ATOM 9026  H HG21 . VAL A 1 78  ? -0.927  7.752   8.152   1.00 0.00 ? 78  VAL A HG21 5  
ATOM 9027  H HG22 . VAL A 1 78  ? -1.683  9.103   7.273   1.00 0.00 ? 78  VAL A HG22 5  
ATOM 9028  H HG23 . VAL A 1 78  ? -0.395  9.423   8.459   1.00 0.00 ? 78  VAL A HG23 5  
ATOM 9029  N N    . GLY A 1 79  ? -3.954  8.342   11.841  1.00 0.00 ? 79  GLY A N    5  
ATOM 9030  C CA   . GLY A 1 79  ? -4.388  8.604   13.203  1.00 0.00 ? 79  GLY A CA   5  
ATOM 9031  C C    . GLY A 1 79  ? -4.263  7.350   14.069  1.00 0.00 ? 79  GLY A C    5  
ATOM 9032  O O    . GLY A 1 79  ? -4.398  7.418   15.290  1.00 0.00 ? 79  GLY A O    5  
ATOM 9033  H H    . GLY A 1 79  ? -4.621  8.570   11.133  1.00 0.00 ? 79  GLY A H    5  
ATOM 9034  H HA2  . GLY A 1 79  ? -3.789  9.407   13.631  1.00 0.00 ? 79  GLY A HA2  5  
ATOM 9035  H HA3  . GLY A 1 79  ? -5.423  8.946   13.198  1.00 0.00 ? 79  GLY A HA3  5  
ATOM 9036  N N    . GLY A 1 80  ? -4.008  6.232   13.404  1.00 0.00 ? 80  GLY A N    5  
ATOM 9037  C CA   . GLY A 1 80  ? -3.863  4.965   14.099  1.00 0.00 ? 80  GLY A CA   5  
ATOM 9038  C C    . GLY A 1 80  ? -2.475  4.366   13.864  1.00 0.00 ? 80  GLY A C    5  
ATOM 9039  O O    . GLY A 1 80  ? -1.980  3.596   14.686  1.00 0.00 ? 80  GLY A O    5  
ATOM 9040  H H    . GLY A 1 80  ? -3.900  6.185   12.411  1.00 0.00 ? 80  GLY A H    5  
ATOM 9041  H HA2  . GLY A 1 80  ? -4.025  5.110   15.167  1.00 0.00 ? 80  GLY A HA2  5  
ATOM 9042  H HA3  . GLY A 1 80  ? -4.627  4.267   13.753  1.00 0.00 ? 80  GLY A HA3  5  
ATOM 9043  N N    . LYS A 1 81  ? -1.886  4.742   12.739  1.00 0.00 ? 81  LYS A N    5  
ATOM 9044  C CA   . LYS A 1 81  ? -0.564  4.252   12.385  1.00 0.00 ? 81  LYS A CA   5  
ATOM 9045  C C    . LYS A 1 81  ? 0.410   5.429   12.315  1.00 0.00 ? 81  LYS A C    5  
ATOM 9046  O O    . LYS A 1 81  ? 0.976   5.832   13.329  1.00 0.00 ? 81  LYS A O    5  
ATOM 9047  C CB   . LYS A 1 81  ? -0.625  3.426   11.098  1.00 0.00 ? 81  LYS A CB   5  
ATOM 9048  C CG   . LYS A 1 81  ? -2.029  3.463   10.489  1.00 0.00 ? 81  LYS A CG   5  
ATOM 9049  C CD   . LYS A 1 81  ? -3.007  2.628   11.317  1.00 0.00 ? 81  LYS A CD   5  
ATOM 9050  C CE   . LYS A 1 81  ? -4.421  3.209   11.243  1.00 0.00 ? 81  LYS A CE   5  
ATOM 9051  N NZ   . LYS A 1 81  ? -5.236  2.465   10.257  1.00 0.00 ? 81  LYS A NZ   5  
ATOM 9052  H H    . LYS A 1 81  ? -2.296  5.369   12.075  1.00 0.00 ? 81  LYS A H    5  
ATOM 9053  H HA   . LYS A 1 81  ? -0.241  3.582   13.183  1.00 0.00 ? 81  LYS A HA   5  
ATOM 9054  H HB2  . LYS A 1 81  ? 0.097   3.812   10.380  1.00 0.00 ? 81  LYS A HB2  5  
ATOM 9055  H HB3  . LYS A 1 81  ? -0.344  2.394   11.310  1.00 0.00 ? 81  LYS A HB3  5  
ATOM 9056  H HG2  . LYS A 1 81  ? -2.378  4.495   10.436  1.00 0.00 ? 81  LYS A HG2  5  
ATOM 9057  H HG3  . LYS A 1 81  ? -1.995  3.084   9.468   1.00 0.00 ? 81  LYS A HG3  5  
ATOM 9058  H HD2  . LYS A 1 81  ? -3.014  1.601   10.953  1.00 0.00 ? 81  LYS A HD2  5  
ATOM 9059  H HD3  . LYS A 1 81  ? -2.677  2.597   12.355  1.00 0.00 ? 81  LYS A HD3  5  
ATOM 9060  H HE2  . LYS A 1 81  ? -4.893  3.160   12.224  1.00 0.00 ? 81  LYS A HE2  5  
ATOM 9061  H HE3  . LYS A 1 81  ? -4.374  4.262   10.965  1.00 0.00 ? 81  LYS A HE3  5  
ATOM 9062  H HZ1  . LYS A 1 81  ? -4.675  1.759   9.826   1.00 0.00 ? 81  LYS A HZ1  5  
ATOM 9063  H HZ2  . LYS A 1 81  ? -6.012  2.037   10.721  1.00 0.00 ? 81  LYS A HZ2  5  
ATOM 9064  H HZ3  . LYS A 1 81  ? -5.573  3.097   9.558   1.00 0.00 ? 81  LYS A HZ3  5  
ATOM 9065  N N    . LYS A 1 82  ? 0.575   5.948   11.107  1.00 0.00 ? 82  LYS A N    5  
ATOM 9066  C CA   . LYS A 1 82  ? 1.470   7.072   10.891  1.00 0.00 ? 82  LYS A CA   5  
ATOM 9067  C C    . LYS A 1 82  ? 1.752   7.213   9.394   1.00 0.00 ? 82  LYS A C    5  
ATOM 9068  O O    . LYS A 1 82  ? 1.113   8.011   8.711   1.00 0.00 ? 82  LYS A O    5  
ATOM 9069  C CB   . LYS A 1 82  ? 2.732   6.923   11.743  1.00 0.00 ? 82  LYS A CB   5  
ATOM 9070  C CG   . LYS A 1 82  ? 3.268   5.491   11.682  1.00 0.00 ? 82  LYS A CG   5  
ATOM 9071  C CD   . LYS A 1 82  ? 3.414   4.900   13.086  1.00 0.00 ? 82  LYS A CD   5  
ATOM 9072  C CE   . LYS A 1 82  ? 2.564   3.637   13.241  1.00 0.00 ? 82  LYS A CE   5  
ATOM 9073  N NZ   . LYS A 1 82  ? 3.331   2.578   13.932  1.00 0.00 ? 82  LYS A NZ   5  
ATOM 9074  H H    . LYS A 1 82  ? 0.109   5.614   10.286  1.00 0.00 ? 82  LYS A H    5  
ATOM 9075  H HA   . LYS A 1 82  ? 0.956   7.970   11.232  1.00 0.00 ? 82  LYS A HA   5  
ATOM 9076  H HB2  . LYS A 1 82  ? 3.497   7.616   11.393  1.00 0.00 ? 82  LYS A HB2  5  
ATOM 9077  H HB3  . LYS A 1 82  ? 2.510   7.188   12.777  1.00 0.00 ? 82  LYS A HB3  5  
ATOM 9078  H HG2  . LYS A 1 82  ? 2.595   4.871   11.091  1.00 0.00 ? 82  LYS A HG2  5  
ATOM 9079  H HG3  . LYS A 1 82  ? 4.235   5.482   11.178  1.00 0.00 ? 82  LYS A HG3  5  
ATOM 9080  H HD2  . LYS A 1 82  ? 4.461   4.664   13.278  1.00 0.00 ? 82  LYS A HD2  5  
ATOM 9081  H HD3  . LYS A 1 82  ? 3.112   5.639   13.828  1.00 0.00 ? 82  LYS A HD3  5  
ATOM 9082  H HE2  . LYS A 1 82  ? 1.660   3.867   13.804  1.00 0.00 ? 82  LYS A HE2  5  
ATOM 9083  H HE3  . LYS A 1 82  ? 2.247   3.283   12.259  1.00 0.00 ? 82  LYS A HE3  5  
ATOM 9084  H HZ1  . LYS A 1 82  ? 4.299   2.826   13.953  1.00 0.00 ? 82  LYS A HZ1  5  
ATOM 9085  H HZ2  . LYS A 1 82  ? 2.993   2.479   14.869  1.00 0.00 ? 82  LYS A HZ2  5  
ATOM 9086  H HZ3  . LYS A 1 82  ? 3.218   1.712   13.445  1.00 0.00 ? 82  LYS A HZ3  5  
ATOM 9087  N N    . GLU A 1 83  ? 2.711   6.426   8.928   1.00 0.00 ? 83  GLU A N    5  
ATOM 9088  C CA   . GLU A 1 83  ? 3.086   6.453   7.524   1.00 0.00 ? 83  GLU A CA   5  
ATOM 9089  C C    . GLU A 1 83  ? 3.518   5.060   7.063   1.00 0.00 ? 83  GLU A C    5  
ATOM 9090  O O    . GLU A 1 83  ? 3.857   4.207   7.883   1.00 0.00 ? 83  GLU A O    5  
ATOM 9091  C CB   . GLU A 1 83  ? 4.189   7.481   7.271   1.00 0.00 ? 83  GLU A CB   5  
ATOM 9092  C CG   . GLU A 1 83  ? 4.016   8.705   8.174   1.00 0.00 ? 83  GLU A CG   5  
ATOM 9093  C CD   . GLU A 1 83  ? 4.654   8.470   9.544   1.00 0.00 ? 83  GLU A CD   5  
ATOM 9094  O OE1  . GLU A 1 83  ? 5.001   7.301   9.817   1.00 0.00 ? 83  GLU A OE1  5  
ATOM 9095  O OE2  . GLU A 1 83  ? 4.780   9.465   10.289  1.00 0.00 ? 83  GLU A OE2  5  
ATOM 9096  H H    . GLU A 1 83  ? 3.226   5.779   9.490   1.00 0.00 ? 83  GLU A H    5  
ATOM 9097  H HA   . GLU A 1 83  ? 2.185   6.756   6.990   1.00 0.00 ? 83  GLU A HA   5  
ATOM 9098  H HB2  . GLU A 1 83  ? 5.164   7.026   7.452   1.00 0.00 ? 83  GLU A HB2  5  
ATOM 9099  H HB3  . GLU A 1 83  ? 4.171   7.790   6.226   1.00 0.00 ? 83  GLU A HB3  5  
ATOM 9100  H HG2  . GLU A 1 83  ? 4.470   9.576   7.702   1.00 0.00 ? 83  GLU A HG2  5  
ATOM 9101  H HG3  . GLU A 1 83  ? 2.955   8.924   8.294   1.00 0.00 ? 83  GLU A HG3  5  
ATOM 9102  N N    . TYR A 1 84  ? 3.493   4.871   5.752   1.00 0.00 ? 84  TYR A N    5  
ATOM 9103  C CA   . TYR A 1 84  ? 3.878   3.595   5.172   1.00 0.00 ? 84  TYR A CA   5  
ATOM 9104  C C    . TYR A 1 84  ? 4.550   3.792   3.811   1.00 0.00 ? 84  TYR A C    5  
ATOM 9105  O O    . TYR A 1 84  ? 4.292   4.780   3.125   1.00 0.00 ? 84  TYR A O    5  
ATOM 9106  C CB   . TYR A 1 84  ? 2.580   2.811   4.978   1.00 0.00 ? 84  TYR A CB   5  
ATOM 9107  C CG   . TYR A 1 84  ? 1.516   3.557   4.169   1.00 0.00 ? 84  TYR A CG   5  
ATOM 9108  C CD1  . TYR A 1 84  ? 1.776   3.925   2.864   1.00 0.00 ? 84  TYR A CD1  5  
ATOM 9109  C CD2  . TYR A 1 84  ? 0.300   3.863   4.744   1.00 0.00 ? 84  TYR A CD2  5  
ATOM 9110  C CE1  . TYR A 1 84  ? 0.775   4.627   2.102   1.00 0.00 ? 84  TYR A CE1  5  
ATOM 9111  C CE2  . TYR A 1 84  ? -0.700  4.565   3.982   1.00 0.00 ? 84  TYR A CE2  5  
ATOM 9112  C CZ   . TYR A 1 84  ? -0.413  4.912   2.699   1.00 0.00 ? 84  TYR A CZ   5  
ATOM 9113  O OH   . TYR A 1 84  ? -1.358  5.575   1.979   1.00 0.00 ? 84  TYR A OH   5  
ATOM 9114  H H    . TYR A 1 84  ? 3.216   5.568   5.092   1.00 0.00 ? 84  TYR A H    5  
ATOM 9115  H HA   . TYR A 1 84  ? 4.584   3.116   5.852   1.00 0.00 ? 84  TYR A HA   5  
ATOM 9116  H HB2  . TYR A 1 84  ? 2.806   1.869   4.479   1.00 0.00 ? 84  TYR A HB2  5  
ATOM 9117  H HB3  . TYR A 1 84  ? 2.167   2.561   5.955   1.00 0.00 ? 84  TYR A HB3  5  
ATOM 9118  H HD1  . TYR A 1 84  ? 2.736   3.682   2.410   1.00 0.00 ? 84  TYR A HD1  5  
ATOM 9119  H HD2  . TYR A 1 84  ? 0.096   3.572   5.775   1.00 0.00 ? 84  TYR A HD2  5  
ATOM 9120  H HE1  . TYR A 1 84  ? 0.966   4.922   1.070   1.00 0.00 ? 84  TYR A HE1  5  
ATOM 9121  H HE2  . TYR A 1 84  ? -1.665  4.813   4.424   1.00 0.00 ? 84  TYR A HE2  5  
ATOM 9122  H HH   . TYR A 1 84  ? -1.119  5.564   1.008   1.00 0.00 ? 84  TYR A HH   5  
ATOM 9123  N N    . LEU A 1 85  ? 5.398   2.836   3.462   1.00 0.00 ? 85  LEU A N    5  
ATOM 9124  C CA   . LEU A 1 85  ? 6.108   2.891   2.196   1.00 0.00 ? 85  LEU A CA   5  
ATOM 9125  C C    . LEU A 1 85  ? 5.204   2.353   1.085   1.00 0.00 ? 85  LEU A C    5  
ATOM 9126  O O    . LEU A 1 85  ? 5.621   2.259   -0.069  1.00 0.00 ? 85  LEU A O    5  
ATOM 9127  C CB   . LEU A 1 85  ? 7.451   2.166   2.302   1.00 0.00 ? 85  LEU A CB   5  
ATOM 9128  C CG   . LEU A 1 85  ? 7.395   0.723   2.808   1.00 0.00 ? 85  LEU A CG   5  
ATOM 9129  C CD1  . LEU A 1 85  ? 7.505   0.672   4.333   1.00 0.00 ? 85  LEU A CD1  5  
ATOM 9130  C CD2  . LEU A 1 85  ? 6.140   0.012   2.300   1.00 0.00 ? 85  LEU A CD2  5  
ATOM 9131  H H    . LEU A 1 85  ? 5.601   2.035   4.026   1.00 0.00 ? 85  LEU A H    5  
ATOM 9132  H HA   . LEU A 1 85  ? 6.324   3.940   1.988   1.00 0.00 ? 85  LEU A HA   5  
ATOM 9133  H HB2  . LEU A 1 85  ? 7.921   2.168   1.319   1.00 0.00 ? 85  LEU A HB2  5  
ATOM 9134  H HB3  . LEU A 1 85  ? 8.099   2.738   2.966   1.00 0.00 ? 85  LEU A HB3  5  
ATOM 9135  H HG   . LEU A 1 85  ? 8.255   0.187   2.405   1.00 0.00 ? 85  LEU A HG   5  
ATOM 9136  H HD11 . LEU A 1 85  ? 7.860   1.634   4.704   1.00 0.00 ? 85  LEU A HD11 5  
ATOM 9137  H HD12 . LEU A 1 85  ? 6.526   0.458   4.761   1.00 0.00 ? 85  LEU A HD12 5  
ATOM 9138  H HD13 . LEU A 1 85  ? 8.206   -0.110  4.621   1.00 0.00 ? 85  LEU A HD13 5  
ATOM 9139  H HD21 . LEU A 1 85  ? 5.254   0.545   2.646   1.00 0.00 ? 85  LEU A HD21 5  
ATOM 9140  H HD22 . LEU A 1 85  ? 6.150   -0.007  1.209   1.00 0.00 ? 85  LEU A HD22 5  
ATOM 9141  H HD23 . LEU A 1 85  ? 6.121   -1.009  2.680   1.00 0.00 ? 85  LEU A HD23 5  
ATOM 9142  N N    . ILE A 1 86  ? 3.984   2.013   1.472   1.00 0.00 ? 86  ILE A N    5  
ATOM 9143  C CA   . ILE A 1 86  ? 3.018   1.486   0.523   1.00 0.00 ? 86  ILE A CA   5  
ATOM 9144  C C    . ILE A 1 86  ? 3.726   1.164   -0.794  1.00 0.00 ? 86  ILE A C    5  
ATOM 9145  O O    . ILE A 1 86  ? 3.988   2.059   -1.597  1.00 0.00 ? 86  ILE A O    5  
ATOM 9146  C CB   . ILE A 1 86  ? 1.839   2.449   0.367   1.00 0.00 ? 86  ILE A CB   5  
ATOM 9147  C CG1  . ILE A 1 86  ? 0.596   1.915   1.083   1.00 0.00 ? 86  ILE A CG1  5  
ATOM 9148  C CG2  . ILE A 1 86  ? 1.567   2.749   -1.108  1.00 0.00 ? 86  ILE A CG2  5  
ATOM 9149  C CD1  . ILE A 1 86  ? 0.952   1.375   2.470   1.00 0.00 ? 86  ILE A CD1  5  
ATOM 9150  H H    . ILE A 1 86  ? 3.653   2.092   2.412   1.00 0.00 ? 86  ILE A H    5  
ATOM 9151  H HA   . ILE A 1 86  ? 2.623   0.559   0.939   1.00 0.00 ? 86  ILE A HA   5  
ATOM 9152  H HB   . ILE A 1 86  ? 2.104   3.393   0.845   1.00 0.00 ? 86  ILE A HB   5  
ATOM 9153  H HG12 . ILE A 1 86  ? -0.143  2.710   1.177   1.00 0.00 ? 86  ILE A HG12 5  
ATOM 9154  H HG13 . ILE A 1 86  ? 0.141   1.124   0.487   1.00 0.00 ? 86  ILE A HG13 5  
ATOM 9155  H HG21 . ILE A 1 86  ? 1.767   1.858   -1.702  1.00 0.00 ? 86  ILE A HG21 5  
ATOM 9156  H HG22 . ILE A 1 86  ? 0.524   3.043   -1.232  1.00 0.00 ? 86  ILE A HG22 5  
ATOM 9157  H HG23 . ILE A 1 86  ? 2.215   3.560   -1.440  1.00 0.00 ? 86  ILE A HG23 5  
ATOM 9158  H HD11 . ILE A 1 86  ? 1.989   1.617   2.699   1.00 0.00 ? 86  ILE A HD11 5  
ATOM 9159  H HD12 . ILE A 1 86  ? 0.299   1.831   3.215   1.00 0.00 ? 86  ILE A HD12 5  
ATOM 9160  H HD13 . ILE A 1 86  ? 0.818   0.293   2.483   1.00 0.00 ? 86  ILE A HD13 5  
ATOM 9161  N N    . ALA A 1 87  ? 4.016   -0.116  -0.976  1.00 0.00 ? 87  ALA A N    5  
ATOM 9162  C CA   . ALA A 1 87  ? 4.689   -0.567  -2.182  1.00 0.00 ? 87  ALA A CA   5  
ATOM 9163  C C    . ALA A 1 87  ? 3.866   -1.679  -2.835  1.00 0.00 ? 87  ALA A C    5  
ATOM 9164  O O    . ALA A 1 87  ? 3.806   -2.795  -2.321  1.00 0.00 ? 87  ALA A O    5  
ATOM 9165  C CB   . ALA A 1 87  ? 6.110   -1.020  -1.836  1.00 0.00 ? 87  ALA A CB   5  
ATOM 9166  H H    . ALA A 1 87  ? 3.800   -0.838  -0.318  1.00 0.00 ? 87  ALA A H    5  
ATOM 9167  H HA   . ALA A 1 87  ? 4.748   0.279   -2.866  1.00 0.00 ? 87  ALA A HA   5  
ATOM 9168  H HB1  . ALA A 1 87  ? 6.144   -1.343  -0.795  1.00 0.00 ? 87  ALA A HB1  5  
ATOM 9169  H HB2  . ALA A 1 87  ? 6.395   -1.848  -2.483  1.00 0.00 ? 87  ALA A HB2  5  
ATOM 9170  H HB3  . ALA A 1 87  ? 6.801   -0.190  -1.981  1.00 0.00 ? 87  ALA A HB3  5  
ATOM 9171  N N    . GLY A 1 88  ? 3.252   -1.335  -3.958  1.00 0.00 ? 88  GLY A N    5  
ATOM 9172  C CA   . GLY A 1 88  ? 2.435   -2.290  -4.686  1.00 0.00 ? 88  GLY A CA   5  
ATOM 9173  C C    . GLY A 1 88  ? 2.615   -2.127  -6.197  1.00 0.00 ? 88  GLY A C    5  
ATOM 9174  O O    . GLY A 1 88  ? 3.260   -1.182  -6.649  1.00 0.00 ? 88  GLY A O    5  
ATOM 9175  H H    . GLY A 1 88  ? 3.306   -0.426  -4.368  1.00 0.00 ? 88  GLY A H    5  
ATOM 9176  H HA2  . GLY A 1 88  ? 2.705   -3.305  -4.392  1.00 0.00 ? 88  GLY A HA2  5  
ATOM 9177  H HA3  . GLY A 1 88  ? 1.385   -2.152  -4.424  1.00 0.00 ? 88  GLY A HA3  5  
ATOM 9178  N N    . LYS A 1 89  ? 2.032   -3.060  -6.934  1.00 0.00 ? 89  LYS A N    5  
ATOM 9179  C CA   . LYS A 1 89  ? 2.120   -3.031  -8.384  1.00 0.00 ? 89  LYS A CA   5  
ATOM 9180  C C    . LYS A 1 89  ? 1.859   -1.607  -8.878  1.00 0.00 ? 89  LYS A C    5  
ATOM 9181  O O    . LYS A 1 89  ? 2.366   -1.207  -9.925  1.00 0.00 ? 89  LYS A O    5  
ATOM 9182  C CB   . LYS A 1 89  ? 1.186   -4.076  -8.999  1.00 0.00 ? 89  LYS A CB   5  
ATOM 9183  C CG   . LYS A 1 89  ? -0.275  -3.771  -8.662  1.00 0.00 ? 89  LYS A CG   5  
ATOM 9184  C CD   . LYS A 1 89  ? -0.985  -5.014  -8.124  1.00 0.00 ? 89  LYS A CD   5  
ATOM 9185  C CE   . LYS A 1 89  ? -2.086  -4.631  -7.132  1.00 0.00 ? 89  LYS A CE   5  
ATOM 9186  N NZ   . LYS A 1 89  ? -3.418  -4.750  -7.766  1.00 0.00 ? 89  LYS A NZ   5  
ATOM 9187  H H    . LYS A 1 89  ? 1.510   -3.825  -6.558  1.00 0.00 ? 89  LYS A H    5  
ATOM 9188  H HA   . LYS A 1 89  ? 3.138   -3.310  -8.656  1.00 0.00 ? 89  LYS A HA   5  
ATOM 9189  H HB2  . LYS A 1 89  ? 1.317   -4.095  -10.081 1.00 0.00 ? 89  LYS A HB2  5  
ATOM 9190  H HB3  . LYS A 1 89  ? 1.449   -5.066  -8.629  1.00 0.00 ? 89  LYS A HB3  5  
ATOM 9191  H HG2  . LYS A 1 89  ? -0.322  -2.972  -7.922  1.00 0.00 ? 89  LYS A HG2  5  
ATOM 9192  H HG3  . LYS A 1 89  ? -0.790  -3.411  -9.553  1.00 0.00 ? 89  LYS A HG3  5  
ATOM 9193  H HD2  . LYS A 1 89  ? -1.416  -5.578  -8.951  1.00 0.00 ? 89  LYS A HD2  5  
ATOM 9194  H HD3  . LYS A 1 89  ? -0.262  -5.667  -7.635  1.00 0.00 ? 89  LYS A HD3  5  
ATOM 9195  H HE2  . LYS A 1 89  ? -2.035  -5.276  -6.256  1.00 0.00 ? 89  LYS A HE2  5  
ATOM 9196  H HE3  . LYS A 1 89  ? -1.932  -3.609  -6.785  1.00 0.00 ? 89  LYS A HE3  5  
ATOM 9197  H HZ1  . LYS A 1 89  ? -3.310  -5.045  -8.716  1.00 0.00 ? 89  LYS A HZ1  5  
ATOM 9198  H HZ2  . LYS A 1 89  ? -3.965  -5.423  -7.268  1.00 0.00 ? 89  LYS A HZ2  5  
ATOM 9199  H HZ3  . LYS A 1 89  ? -3.879  -3.862  -7.743  1.00 0.00 ? 89  LYS A HZ3  5  
ATOM 9200  N N    . ALA A 1 90  ? 1.069   -0.880  -8.102  1.00 0.00 ? 90  ALA A N    5  
ATOM 9201  C CA   . ALA A 1 90  ? 0.735   0.491   -8.446  1.00 0.00 ? 90  ALA A CA   5  
ATOM 9202  C C    . ALA A 1 90  ? -0.363  0.491   -9.511  1.00 0.00 ? 90  ALA A C    5  
ATOM 9203  O O    . ALA A 1 90  ? -0.799  -0.569  -9.960  1.00 0.00 ? 90  ALA A O    5  
ATOM 9204  C CB   . ALA A 1 90  ? 1.996   1.222   -8.910  1.00 0.00 ? 90  ALA A CB   5  
ATOM 9205  H H    . ALA A 1 90  ? 0.661   -1.214  -7.251  1.00 0.00 ? 90  ALA A H    5  
ATOM 9206  H HA   . ALA A 1 90  ? 0.358   0.977   -7.547  1.00 0.00 ? 90  ALA A HA   5  
ATOM 9207  H HB1  . ALA A 1 90  ? 2.863   0.820   -8.386  1.00 0.00 ? 90  ALA A HB1  5  
ATOM 9208  H HB2  . ALA A 1 90  ? 2.123   1.083   -9.983  1.00 0.00 ? 90  ALA A HB2  5  
ATOM 9209  H HB3  . ALA A 1 90  ? 1.900   2.286   -8.691  1.00 0.00 ? 90  ALA A HB3  5  
ATOM 9210  N N    . GLU A 1 91  ? -0.782  1.692   -9.883  1.00 0.00 ? 91  GLU A N    5  
ATOM 9211  C CA   . GLU A 1 91  ? -1.823  1.844   -10.887 1.00 0.00 ? 91  GLU A CA   5  
ATOM 9212  C C    . GLU A 1 91  ? -1.407  2.885   -11.928 1.00 0.00 ? 91  GLU A C    5  
ATOM 9213  O O    . GLU A 1 91  ? -1.692  2.729   -13.114 1.00 0.00 ? 91  GLU A O    5  
ATOM 9214  C CB   . GLU A 1 91  ? -3.157  2.217   -10.240 1.00 0.00 ? 91  GLU A CB   5  
ATOM 9215  C CG   . GLU A 1 91  ? -4.333  1.764   -11.108 1.00 0.00 ? 91  GLU A CG   5  
ATOM 9216  C CD   . GLU A 1 91  ? -4.239  0.269   -11.424 1.00 0.00 ? 91  GLU A CD   5  
ATOM 9217  O OE1  . GLU A 1 91  ? -3.606  -0.054  -12.452 1.00 0.00 ? 91  GLU A OE1  5  
ATOM 9218  O OE2  . GLU A 1 91  ? -4.800  -0.515  -10.629 1.00 0.00 ? 91  GLU A OE2  5  
ATOM 9219  H H    . GLU A 1 91  ? -0.424  2.549   -9.513  1.00 0.00 ? 91  GLU A H    5  
ATOM 9220  H HA   . GLU A 1 91  ? -1.915  0.866   -11.358 1.00 0.00 ? 91  GLU A HA   5  
ATOM 9221  H HB2  . GLU A 1 91  ? -3.231  1.756   -9.254  1.00 0.00 ? 91  GLU A HB2  5  
ATOM 9222  H HB3  . GLU A 1 91  ? -3.205  3.296   -10.092 1.00 0.00 ? 91  GLU A HB3  5  
ATOM 9223  H HG2  . GLU A 1 91  ? -5.271  1.971   -10.594 1.00 0.00 ? 91  GLU A HG2  5  
ATOM 9224  H HG3  . GLU A 1 91  ? -4.345  2.335   -12.037 1.00 0.00 ? 91  GLU A HG3  5  
ATOM 9225  N N    . GLY A 1 92  ? -0.741  3.924   -11.446 1.00 0.00 ? 92  GLY A N    5  
ATOM 9226  C CA   . GLY A 1 92  ? -0.285  4.991   -12.320 1.00 0.00 ? 92  GLY A CA   5  
ATOM 9227  C C    . GLY A 1 92  ? 0.255   6.171   -11.509 1.00 0.00 ? 92  GLY A C    5  
ATOM 9228  O O    . GLY A 1 92  ? 1.000   5.981   -10.549 1.00 0.00 ? 92  GLY A O    5  
ATOM 9229  H H    . GLY A 1 92  ? -0.514  4.043   -10.480 1.00 0.00 ? 92  GLY A H    5  
ATOM 9230  H HA2  . GLY A 1 92  ? 0.495   4.614   -12.983 1.00 0.00 ? 92  GLY A HA2  5  
ATOM 9231  H HA3  . GLY A 1 92  ? -1.106  5.325   -12.952 1.00 0.00 ? 92  GLY A HA3  5  
ATOM 9232  N N    . ASP A 1 93  ? -0.142  7.364   -11.926 1.00 0.00 ? 93  ASP A N    5  
ATOM 9233  C CA   . ASP A 1 93  ? 0.292   8.575   -11.250 1.00 0.00 ? 93  ASP A CA   5  
ATOM 9234  C C    . ASP A 1 93  ? -0.905  9.216   -10.542 1.00 0.00 ? 93  ASP A C    5  
ATOM 9235  O O    . ASP A 1 93  ? -1.982  9.337   -11.122 1.00 0.00 ? 93  ASP A O    5  
ATOM 9236  C CB   . ASP A 1 93  ? 0.851   9.593   -12.247 1.00 0.00 ? 93  ASP A CB   5  
ATOM 9237  C CG   . ASP A 1 93  ? 2.344   9.450   -12.546 1.00 0.00 ? 93  ASP A CG   5  
ATOM 9238  O OD1  . ASP A 1 93  ? 2.742   8.331   -12.935 1.00 0.00 ? 93  ASP A OD1  5  
ATOM 9239  O OD2  . ASP A 1 93  ? 3.055   10.465  -12.379 1.00 0.00 ? 93  ASP A OD2  5  
ATOM 9240  H H    . ASP A 1 93  ? -0.749  7.511   -12.708 1.00 0.00 ? 93  ASP A H    5  
ATOM 9241  H HA   . ASP A 1 93  ? 1.065   8.253   -10.553 1.00 0.00 ? 93  ASP A HA   5  
ATOM 9242  H HB2  . ASP A 1 93  ? 0.298   9.503   -13.183 1.00 0.00 ? 93  ASP A HB2  5  
ATOM 9243  H HB3  . ASP A 1 93  ? 0.665   10.595  -11.863 1.00 0.00 ? 93  ASP A HB3  5  
ATOM 9244  N N    . GLY A 1 94  ? -0.673  9.610   -9.298  1.00 0.00 ? 94  GLY A N    5  
ATOM 9245  C CA   . GLY A 1 94  ? -1.718  10.235  -8.505  1.00 0.00 ? 94  GLY A CA   5  
ATOM 9246  C C    . GLY A 1 94  ? -2.635  9.182   -7.879  1.00 0.00 ? 94  GLY A C    5  
ATOM 9247  O O    . GLY A 1 94  ? -3.514  9.512   -7.084  1.00 0.00 ? 94  GLY A O    5  
ATOM 9248  H H    . GLY A 1 94  ? 0.206   9.508   -8.834  1.00 0.00 ? 94  GLY A H    5  
ATOM 9249  H HA2  . GLY A 1 94  ? -1.269  10.844  -7.721  1.00 0.00 ? 94  GLY A HA2  5  
ATOM 9250  H HA3  . GLY A 1 94  ? -2.305  10.905  -9.133  1.00 0.00 ? 94  GLY A HA3  5  
ATOM 9251  N N    . LYS A 1 95  ? -2.398  7.935   -8.260  1.00 0.00 ? 95  LYS A N    5  
ATOM 9252  C CA   . LYS A 1 95  ? -3.191  6.832   -7.745  1.00 0.00 ? 95  LYS A CA   5  
ATOM 9253  C C    . LYS A 1 95  ? -2.527  5.509   -8.131  1.00 0.00 ? 95  LYS A C    5  
ATOM 9254  O O    . LYS A 1 95  ? -1.957  5.388   -9.214  1.00 0.00 ? 95  LYS A O    5  
ATOM 9255  C CB   . LYS A 1 95  ? -4.642  6.951   -8.213  1.00 0.00 ? 95  LYS A CB   5  
ATOM 9256  C CG   . LYS A 1 95  ? -4.801  6.436   -9.645  1.00 0.00 ? 95  LYS A CG   5  
ATOM 9257  C CD   . LYS A 1 95  ? -4.274  7.456   -10.657 1.00 0.00 ? 95  LYS A CD   5  
ATOM 9258  C CE   . LYS A 1 95  ? -3.444  6.771   -11.744 1.00 0.00 ? 95  LYS A CE   5  
ATOM 9259  N NZ   . LYS A 1 95  ? -3.965  7.114   -13.087 1.00 0.00 ? 95  LYS A NZ   5  
ATOM 9260  H H    . LYS A 1 95  ? -1.681  7.675   -8.907  1.00 0.00 ? 95  LYS A H    5  
ATOM 9261  H HA   . LYS A 1 95  ? -3.196  6.912   -6.658  1.00 0.00 ? 95  LYS A HA   5  
ATOM 9262  H HB2  . LYS A 1 95  ? -5.292  6.385   -7.546  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 9263  H HB3  . LYS A 1 95  ? -4.961  7.992   -8.160  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 9264  H HG2  . LYS A 1 95  ? -4.262  5.495   -9.759  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 9265  H HG3  . LYS A 1 95  ? -5.851  6.228   -9.847  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 9266  H HD2  . LYS A 1 95  ? -5.109  7.987   -11.112 1.00 0.00 ? 95  LYS A HD2  5  
ATOM 9267  H HD3  . LYS A 1 95  ? -3.664  8.201   -10.144 1.00 0.00 ? 95  LYS A HD3  5  
ATOM 9268  H HE2  . LYS A 1 95  ? -2.402  7.080   -11.663 1.00 0.00 ? 95  LYS A HE2  5  
ATOM 9269  H HE3  . LYS A 1 95  ? -3.469  5.691   -11.604 1.00 0.00 ? 95  LYS A HE3  5  
ATOM 9270  H HZ1  . LYS A 1 95  ? -4.959  7.008   -13.095 1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 9271  H HZ2  . LYS A 1 95  ? -3.729  8.062   -13.304 1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 9272  H HZ3  . LYS A 1 95  ? -3.559  6.505   -13.768 1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 9273  N N    . MET A 1 96  ? -2.623  4.549   -7.223  1.00 0.00 ? 96  MET A N    5  
ATOM 9274  C CA   . MET A 1 96  ? -2.039  3.239   -7.454  1.00 0.00 ? 96  MET A CA   5  
ATOM 9275  C C    . MET A 1 96  ? -2.947  2.130   -6.917  1.00 0.00 ? 96  MET A C    5  
ATOM 9276  O O    . MET A 1 96  ? -4.145  2.339   -6.733  1.00 0.00 ? 96  MET A O    5  
ATOM 9277  C CB   . MET A 1 96  ? -0.674  3.158   -6.767  1.00 0.00 ? 96  MET A CB   5  
ATOM 9278  C CG   . MET A 1 96  ? -0.310  4.494   -6.114  1.00 0.00 ? 96  MET A CG   5  
ATOM 9279  S SD   . MET A 1 96  ? 1.442   4.552   -5.777  1.00 0.00 ? 96  MET A SD   5  
ATOM 9280  C CE   . MET A 1 96  ? 1.428   4.265   -4.016  1.00 0.00 ? 96  MET A CE   5  
ATOM 9281  H H    . MET A 1 96  ? -3.088  4.654   -6.344  1.00 0.00 ? 96  MET A H    5  
ATOM 9282  H HA   . MET A 1 96  ? -1.944  3.147   -8.536  1.00 0.00 ? 96  MET A HA   5  
ATOM 9283  H HB2  . MET A 1 96  ? -0.689  2.373   -6.011  1.00 0.00 ? 96  MET A HB2  5  
ATOM 9284  H HB3  . MET A 1 96  ? 0.089   2.886   -7.496  1.00 0.00 ? 96  MET A HB3  5  
ATOM 9285  H HG2  . MET A 1 96  ? -0.590  5.317   -6.772  1.00 0.00 ? 96  MET A HG2  5  
ATOM 9286  H HG3  . MET A 1 96  ? -0.872  4.621   -5.189  1.00 0.00 ? 96  MET A HG3  5  
ATOM 9287  H HE1  . MET A 1 96  ? 0.522   3.723   -3.742  1.00 0.00 ? 96  MET A HE1  5  
ATOM 9288  H HE2  . MET A 1 96  ? 2.301   3.676   -3.736  1.00 0.00 ? 96  MET A HE2  5  
ATOM 9289  H HE3  . MET A 1 96  ? 1.451   5.221   -3.492  1.00 0.00 ? 96  MET A HE3  5  
ATOM 9290  N N    . HIS A 1 97  ? -2.341  0.976   -6.679  1.00 0.00 ? 97  HIS A N    5  
ATOM 9291  C CA   . HIS A 1 97  ? -3.080  -0.166  -6.166  1.00 0.00 ? 97  HIS A CA   5  
ATOM 9292  C C    . HIS A 1 97  ? -2.244  -0.881  -5.103  1.00 0.00 ? 97  HIS A C    5  
ATOM 9293  O O    . HIS A 1 97  ? -1.108  -1.274  -5.362  1.00 0.00 ? 97  HIS A O    5  
ATOM 9294  C CB   . HIS A 1 97  ? -3.509  -1.091  -7.305  1.00 0.00 ? 97  HIS A CB   5  
ATOM 9295  C CG   . HIS A 1 97  ? -4.963  -0.959  -7.690  1.00 0.00 ? 97  HIS A CG   5  
ATOM 9296  N ND1  . HIS A 1 97  ? -5.567  -1.773  -8.632  1.00 0.00 ? 97  HIS A ND1  5  
ATOM 9297  C CD2  . HIS A 1 97  ? -5.927  -0.101  -7.248  1.00 0.00 ? 97  HIS A CD2  5  
ATOM 9298  C CE1  . HIS A 1 97  ? -6.836  -1.412  -8.746  1.00 0.00 ? 97  HIS A CE1  5  
ATOM 9299  N NE2  . HIS A 1 97  ? -7.058  -0.375  -7.887  1.00 0.00 ? 97  HIS A NE2  5  
ATOM 9300  H H    . HIS A 1 97  ? -1.365  0.815   -6.831  1.00 0.00 ? 97  HIS A H    5  
ATOM 9301  H HA   . HIS A 1 97  ? -3.983  0.230   -5.700  1.00 0.00 ? 97  HIS A HA   5  
ATOM 9302  H HB2  . HIS A 1 97  ? -2.892  -0.884  -8.181  1.00 0.00 ? 97  HIS A HB2  5  
ATOM 9303  H HB3  . HIS A 1 97  ? -3.312  -2.123  -7.015  1.00 0.00 ? 97  HIS A HB3  5  
ATOM 9304  H HD1  . HIS A 1 97  ? -5.121  -2.509  -9.141  1.00 0.00 ? 97  HIS A HD1  5  
ATOM 9305  H HD2  . HIS A 1 97  ? -5.792  0.677   -6.497  1.00 0.00 ? 97  HIS A HD2  5  
ATOM 9306  H HE1  . HIS A 1 97  ? -7.574  -1.863  -9.408  1.00 0.00 ? 97  HIS A HE1  5  
ATOM 9307  N N    . ILE A 1 98  ? -2.841  -1.029  -3.929  1.00 0.00 ? 98  ILE A N    5  
ATOM 9308  C CA   . ILE A 1 98  ? -2.166  -1.691  -2.825  1.00 0.00 ? 98  ILE A CA   5  
ATOM 9309  C C    . ILE A 1 98  ? -3.159  -2.602  -2.098  1.00 0.00 ? 98  ILE A C    5  
ATOM 9310  O O    . ILE A 1 98  ? -4.359  -2.334  -2.089  1.00 0.00 ? 98  ILE A O    5  
ATOM 9311  C CB   . ILE A 1 98  ? -1.494  -0.663  -1.914  1.00 0.00 ? 98  ILE A CB   5  
ATOM 9312  C CG1  . ILE A 1 98  ? -2.529  0.073   -1.060  1.00 0.00 ? 98  ILE A CG1  5  
ATOM 9313  C CG2  . ILE A 1 98  ? -0.627  0.304   -2.724  1.00 0.00 ? 98  ILE A CG2  5  
ATOM 9314  C CD1  . ILE A 1 98  ? -1.966  1.395   -0.536  1.00 0.00 ? 98  ILE A CD1  5  
ATOM 9315  H H    . ILE A 1 98  ? -3.766  -0.707  -3.727  1.00 0.00 ? 98  ILE A H    5  
ATOM 9316  H HA   . ILE A 1 98  ? -1.375  -2.311  -3.250  1.00 0.00 ? 98  ILE A HA   5  
ATOM 9317  H HB   . ILE A 1 98  ? -0.831  -1.194  -1.230  1.00 0.00 ? 98  ILE A HB   5  
ATOM 9318  H HG12 . ILE A 1 98  ? -3.424  0.263   -1.653  1.00 0.00 ? 98  ILE A HG12 5  
ATOM 9319  H HG13 . ILE A 1 98  ? -2.829  -0.557  -0.223  1.00 0.00 ? 98  ILE A HG13 5  
ATOM 9320  H HG21 . ILE A 1 98  ? -0.318  -0.176  -3.652  1.00 0.00 ? 98  ILE A HG21 5  
ATOM 9321  H HG22 . ILE A 1 98  ? -1.201  1.202   -2.951  1.00 0.00 ? 98  ILE A HG22 5  
ATOM 9322  H HG23 . ILE A 1 98  ? 0.255   0.574   -2.142  1.00 0.00 ? 98  ILE A HG23 5  
ATOM 9323  H HD11 . ILE A 1 98  ? -1.008  1.597   -1.013  1.00 0.00 ? 98  ILE A HD11 5  
ATOM 9324  H HD12 . ILE A 1 98  ? -2.663  2.202   -0.763  1.00 0.00 ? 98  ILE A HD12 5  
ATOM 9325  H HD13 . ILE A 1 98  ? -1.828  1.329   0.544   1.00 0.00 ? 98  ILE A HD13 5  
ATOM 9326  N N    . THR A 1 99  ? -2.620  -3.659  -1.508  1.00 0.00 ? 99  THR A N    5  
ATOM 9327  C CA   . THR A 1 99  ? -3.443  -4.610  -0.781  1.00 0.00 ? 99  THR A CA   5  
ATOM 9328  C C    . THR A 1 99  ? -2.654  -5.222  0.378   1.00 0.00 ? 99  THR A C    5  
ATOM 9329  O O    . THR A 1 99  ? -1.429  -5.120  0.421   1.00 0.00 ? 99  THR A O    5  
ATOM 9330  C CB   . THR A 1 99  ? -3.960  -5.649  -1.780  1.00 0.00 ? 99  THR A CB   5  
ATOM 9331  O OG1  . THR A 1 99  ? -3.056  -5.553  -2.878  1.00 0.00 ? 99  THR A OG1  5  
ATOM 9332  C CG2  . THR A 1 99  ? -5.315  -5.263  -2.376  1.00 0.00 ? 99  THR A CG2  5  
ATOM 9333  H H    . THR A 1 99  ? -1.642  -3.869  -1.521  1.00 0.00 ? 99  THR A H    5  
ATOM 9334  H HA   . THR A 1 99  ? -4.285  -4.073  -0.346  1.00 0.00 ? 99  THR A HA   5  
ATOM 9335  H HB   . THR A 1 99  ? -4.001  -6.638  -1.325  1.00 0.00 ? 99  THR A HB   5  
ATOM 9336  H HG1  . THR A 1 99  ? -3.122  -6.373  -3.446  1.00 0.00 ? 99  THR A HG1  5  
ATOM 9337  H HG21 . THR A 1 99  ? -5.536  -4.223  -2.136  1.00 0.00 ? 99  THR A HG21 5  
ATOM 9338  H HG22 . THR A 1 99  ? -5.283  -5.388  -3.459  1.00 0.00 ? 99  THR A HG22 5  
ATOM 9339  H HG23 . THR A 1 99  ? -6.091  -5.905  -1.959  1.00 0.00 ? 99  THR A HG23 5  
ATOM 9340  N N    . LEU A 1 100 ? -3.388  -5.843  1.289   1.00 0.00 ? 100 LEU A N    5  
ATOM 9341  C CA   . LEU A 1 100 ? -2.772  -6.472  2.445   1.00 0.00 ? 100 LEU A CA   5  
ATOM 9342  C C    . LEU A 1 100 ? -1.791  -7.546  1.974   1.00 0.00 ? 100 LEU A C    5  
ATOM 9343  O O    . LEU A 1 100 ? -0.638  -7.570  2.402   1.00 0.00 ? 100 LEU A O    5  
ATOM 9344  C CB   . LEU A 1 100 ? -3.843  -6.994  3.405   1.00 0.00 ? 100 LEU A CB   5  
ATOM 9345  C CG   . LEU A 1 100 ? -4.289  -8.442  3.187   1.00 0.00 ? 100 LEU A CG   5  
ATOM 9346  C CD1  . LEU A 1 100 ? -4.920  -9.017  4.456   1.00 0.00 ? 100 LEU A CD1  5  
ATOM 9347  C CD2  . LEU A 1 100 ? -5.225  -8.551  1.982   1.00 0.00 ? 100 LEU A CD2  5  
ATOM 9348  H H    . LEU A 1 100 ? -4.384  -5.922  1.246   1.00 0.00 ? 100 LEU A H    5  
ATOM 9349  H HA   . LEU A 1 100 ? -2.212  -5.701  2.976   1.00 0.00 ? 100 LEU A HA   5  
ATOM 9350  H HB2  . LEU A 1 100 ? -3.466  -6.900  4.423   1.00 0.00 ? 100 LEU A HB2  5  
ATOM 9351  H HB3  . LEU A 1 100 ? -4.718  -6.349  3.328   1.00 0.00 ? 100 LEU A HB3  5  
ATOM 9352  H HG   . LEU A 1 100 ? -3.407  -9.042  2.965   1.00 0.00 ? 100 LEU A HG   5  
ATOM 9353  H HD11 . LEU A 1 100 ? -5.483  -8.236  4.969   1.00 0.00 ? 100 LEU A HD11 5  
ATOM 9354  H HD12 . LEU A 1 100 ? -5.592  -9.833  4.190   1.00 0.00 ? 100 LEU A HD12 5  
ATOM 9355  H HD13 . LEU A 1 100 ? -4.136  -9.391  5.115   1.00 0.00 ? 100 LEU A HD13 5  
ATOM 9356  H HD21 . LEU A 1 100 ? -5.276  -7.588  1.473   1.00 0.00 ? 100 LEU A HD21 5  
ATOM 9357  H HD22 . LEU A 1 100 ? -4.844  -9.305  1.294   1.00 0.00 ? 100 LEU A HD22 5  
ATOM 9358  H HD23 . LEU A 1 100 ? -6.221  -8.836  2.320   1.00 0.00 ? 100 LEU A HD23 5  
ATOM 9359  N N    . CYS A 1 101 ? -2.284  -8.410  1.098   1.00 0.00 ? 101 CYS A N    5  
ATOM 9360  C CA   . CYS A 1 101 ? -1.465  -9.485  0.564   1.00 0.00 ? 101 CYS A CA   5  
ATOM 9361  C C    . CYS A 1 101 ? -0.282  -8.862  -0.181  1.00 0.00 ? 101 CYS A C    5  
ATOM 9362  O O    . CYS A 1 101 ? 0.726   -9.526  -0.417  1.00 0.00 ? 101 CYS A O    5  
ATOM 9363  C CB   . CYS A 1 101 ? -2.276  -10.422 -0.333  1.00 0.00 ? 101 CYS A CB   5  
ATOM 9364  S SG   . CYS A 1 101 ? -1.548  -12.084 -0.563  1.00 0.00 ? 101 CYS A SG   5  
ATOM 9365  H H    . CYS A 1 101 ? -3.223  -8.383  0.755   1.00 0.00 ? 101 CYS A H    5  
ATOM 9366  H HA   . CYS A 1 101 ? -1.121  -10.069 1.417   1.00 0.00 ? 101 CYS A HA   5  
ATOM 9367  H HB2  . CYS A 1 101 ? -3.274  -10.532 0.090   1.00 0.00 ? 101 CYS A HB2  5  
ATOM 9368  H HB3  . CYS A 1 101 ? -2.393  -9.954  -1.311  1.00 0.00 ? 101 CYS A HB3  5  
ATOM 9369  N N    . ASP A 1 102 ? -0.445  -7.595  -0.531  1.00 0.00 ? 102 ASP A N    5  
ATOM 9370  C CA   . ASP A 1 102 ? 0.596   -6.876  -1.245  1.00 0.00 ? 102 ASP A CA   5  
ATOM 9371  C C    . ASP A 1 102 ? 1.575   -6.272  -0.237  1.00 0.00 ? 102 ASP A C    5  
ATOM 9372  O O    . ASP A 1 102 ? 1.298   -6.240  0.961   1.00 0.00 ? 102 ASP A O    5  
ATOM 9373  C CB   . ASP A 1 102 ? 0.008   -5.734  -2.076  1.00 0.00 ? 102 ASP A CB   5  
ATOM 9374  C CG   . ASP A 1 102 ? 0.766   -5.414  -3.365  1.00 0.00 ? 102 ASP A CG   5  
ATOM 9375  O OD1  . ASP A 1 102 ? 1.874   -5.970  -3.524  1.00 0.00 ? 102 ASP A OD1  5  
ATOM 9376  O OD2  . ASP A 1 102 ? 0.222   -4.619  -4.161  1.00 0.00 ? 102 ASP A OD2  5  
ATOM 9377  H H    . ASP A 1 102 ? -1.269  -7.062  -0.336  1.00 0.00 ? 102 ASP A H    5  
ATOM 9378  H HA   . ASP A 1 102 ? 1.067   -7.619  -1.890  1.00 0.00 ? 102 ASP A HA   5  
ATOM 9379  H HB2  . ASP A 1 102 ? -1.022  -5.984  -2.330  1.00 0.00 ? 102 ASP A HB2  5  
ATOM 9380  H HB3  . ASP A 1 102 ? -0.026  -4.837  -1.458  1.00 0.00 ? 102 ASP A HB3  5  
ATOM 9381  N N    . PHE A 1 103 ? 2.701   -5.808  -0.759  1.00 0.00 ? 103 PHE A N    5  
ATOM 9382  C CA   . PHE A 1 103 ? 3.723   -5.207  0.080   1.00 0.00 ? 103 PHE A CA   5  
ATOM 9383  C C    . PHE A 1 103 ? 3.266   -3.846  0.611   1.00 0.00 ? 103 PHE A C    5  
ATOM 9384  O O    . PHE A 1 103 ? 3.057   -2.913  -0.161  1.00 0.00 ? 103 PHE A O    5  
ATOM 9385  C CB   . PHE A 1 103 ? 4.962   -5.008  -0.795  1.00 0.00 ? 103 PHE A CB   5  
ATOM 9386  C CG   . PHE A 1 103 ? 6.006   -4.066  -0.192  1.00 0.00 ? 103 PHE A CG   5  
ATOM 9387  C CD1  . PHE A 1 103 ? 6.007   -3.819  1.145   1.00 0.00 ? 103 PHE A CD1  5  
ATOM 9388  C CD2  . PHE A 1 103 ? 6.934   -3.477  -0.994  1.00 0.00 ? 103 PHE A CD2  5  
ATOM 9389  C CE1  . PHE A 1 103 ? 6.976   -2.944  1.705   1.00 0.00 ? 103 PHE A CE1  5  
ATOM 9390  C CE2  . PHE A 1 103 ? 7.904   -2.603  -0.434  1.00 0.00 ? 103 PHE A CE2  5  
ATOM 9391  C CZ   . PHE A 1 103 ? 7.904   -2.355  0.904   1.00 0.00 ? 103 PHE A CZ   5  
ATOM 9392  H H    . PHE A 1 103 ? 2.919   -5.838  -1.735  1.00 0.00 ? 103 PHE A H    5  
ATOM 9393  H HA   . PHE A 1 103 ? 3.893   -5.883  0.918   1.00 0.00 ? 103 PHE A HA   5  
ATOM 9394  H HB2  . PHE A 1 103 ? 5.425   -5.978  -0.978  1.00 0.00 ? 103 PHE A HB2  5  
ATOM 9395  H HB3  . PHE A 1 103 ? 4.651   -4.617  -1.764  1.00 0.00 ? 103 PHE A HB3  5  
ATOM 9396  H HD1  . PHE A 1 103 ? 5.263   -4.290  1.787   1.00 0.00 ? 103 PHE A HD1  5  
ATOM 9397  H HD2  . PHE A 1 103 ? 6.934   -3.676  -2.065  1.00 0.00 ? 103 PHE A HD2  5  
ATOM 9398  H HE1  . PHE A 1 103 ? 6.976   -2.746  2.776   1.00 0.00 ? 103 PHE A HE1  5  
ATOM 9399  H HE2  . PHE A 1 103 ? 8.647   -2.132  -1.076  1.00 0.00 ? 103 PHE A HE2  5  
ATOM 9400  H HZ   . PHE A 1 103 ? 8.648   -1.685  1.333   1.00 0.00 ? 103 PHE A HZ   5  
ATOM 9401  N N    . ILE A 1 104 ? 3.124   -3.778  1.927   1.00 0.00 ? 104 ILE A N    5  
ATOM 9402  C CA   . ILE A 1 104 ? 2.695   -2.548  2.571   1.00 0.00 ? 104 ILE A CA   5  
ATOM 9403  C C    . ILE A 1 104 ? 2.973   -2.639  4.072   1.00 0.00 ? 104 ILE A C    5  
ATOM 9404  O O    . ILE A 1 104 ? 2.652   -3.642  4.707   1.00 0.00 ? 104 ILE A O    5  
ATOM 9405  C CB   . ILE A 1 104 ? 1.233   -2.248  2.234   1.00 0.00 ? 104 ILE A CB   5  
ATOM 9406  C CG1  . ILE A 1 104 ? 0.383   -3.518  2.303   1.00 0.00 ? 104 ILE A CG1  5  
ATOM 9407  C CG2  . ILE A 1 104 ? 1.116   -1.553  0.876   1.00 0.00 ? 104 ILE A CG2  5  
ATOM 9408  C CD1  . ILE A 1 104 ? -1.098  -3.198  2.090   1.00 0.00 ? 104 ILE A CD1  5  
ATOM 9409  H H    . ILE A 1 104 ? 3.296   -4.543  2.548   1.00 0.00 ? 104 ILE A H    5  
ATOM 9410  H HA   . ILE A 1 104 ? 3.294   -1.737  2.158   1.00 0.00 ? 104 ILE A HA   5  
ATOM 9411  H HB   . ILE A 1 104 ? 0.845   -1.559  2.983   1.00 0.00 ? 104 ILE A HB   5  
ATOM 9412  H HG12 . ILE A 1 104 ? 0.719   -4.226  1.544   1.00 0.00 ? 104 ILE A HG12 5  
ATOM 9413  H HG13 . ILE A 1 104 ? 0.519   -3.999  3.271   1.00 0.00 ? 104 ILE A HG13 5  
ATOM 9414  H HG21 . ILE A 1 104 ? 2.089   -1.159  0.583   1.00 0.00 ? 104 ILE A HG21 5  
ATOM 9415  H HG22 . ILE A 1 104 ? 0.776   -2.269  0.129   1.00 0.00 ? 104 ILE A HG22 5  
ATOM 9416  H HG23 . ILE A 1 104 ? 0.400   -0.734  0.948   1.00 0.00 ? 104 ILE A HG23 5  
ATOM 9417  H HD11 . ILE A 1 104 ? -1.380  -2.350  2.713   1.00 0.00 ? 104 ILE A HD11 5  
ATOM 9418  H HD12 . ILE A 1 104 ? -1.270  -2.952  1.042   1.00 0.00 ? 104 ILE A HD12 5  
ATOM 9419  H HD13 . ILE A 1 104 ? -1.700  -4.065  2.363   1.00 0.00 ? 104 ILE A HD13 5  
ATOM 9420  N N    . VAL A 1 105 ? 3.568   -1.578  4.598   1.00 0.00 ? 105 VAL A N    5  
ATOM 9421  C CA   . VAL A 1 105 ? 3.893   -1.526  6.013   1.00 0.00 ? 105 VAL A CA   5  
ATOM 9422  C C    . VAL A 1 105 ? 3.939   -0.066  6.468   1.00 0.00 ? 105 VAL A C    5  
ATOM 9423  O O    . VAL A 1 105 ? 4.149   0.834   5.656   1.00 0.00 ? 105 VAL A O    5  
ATOM 9424  C CB   . VAL A 1 105 ? 5.200   -2.276  6.277   1.00 0.00 ? 105 VAL A CB   5  
ATOM 9425  C CG1  . VAL A 1 105 ? 4.933   -3.616  6.966   1.00 0.00 ? 105 VAL A CG1  5  
ATOM 9426  C CG2  . VAL A 1 105 ? 5.991   -2.474  4.983   1.00 0.00 ? 105 VAL A CG2  5  
ATOM 9427  H H    . VAL A 1 105 ? 3.826   -0.766  4.075   1.00 0.00 ? 105 VAL A H    5  
ATOM 9428  H HA   . VAL A 1 105 ? 3.095   -2.037  6.552   1.00 0.00 ? 105 VAL A HA   5  
ATOM 9429  H HB   . VAL A 1 105 ? 5.805   -1.669  6.950   1.00 0.00 ? 105 VAL A HB   5  
ATOM 9430  H HG11 . VAL A 1 105 ? 4.017   -3.547  7.553   1.00 0.00 ? 105 VAL A HG11 5  
ATOM 9431  H HG12 . VAL A 1 105 ? 4.825   -4.397  6.214   1.00 0.00 ? 105 VAL A HG12 5  
ATOM 9432  H HG13 . VAL A 1 105 ? 5.768   -3.859  7.624   1.00 0.00 ? 105 VAL A HG13 5  
ATOM 9433  H HG21 . VAL A 1 105 ? 5.368   -2.986  4.251   1.00 0.00 ? 105 VAL A HG21 5  
ATOM 9434  H HG22 . VAL A 1 105 ? 6.290   -1.503  4.589   1.00 0.00 ? 105 VAL A HG22 5  
ATOM 9435  H HG23 . VAL A 1 105 ? 6.878   -3.072  5.187   1.00 0.00 ? 105 VAL A HG23 5  
ATOM 9436  N N    . PRO A 1 106 ? 3.735   0.128   7.799   1.00 0.00 ? 106 PRO A N    5  
ATOM 9437  C CA   . PRO A 1 106 ? 3.750   1.463   8.370   1.00 0.00 ? 106 PRO A CA   5  
ATOM 9438  C C    . PRO A 1 106 ? 5.181   1.997   8.478   1.00 0.00 ? 106 PRO A C    5  
ATOM 9439  O O    . PRO A 1 106 ? 5.406   3.074   9.028   1.00 0.00 ? 106 PRO A O    5  
ATOM 9440  C CB   . PRO A 1 106 ? 3.067   1.320   9.721   1.00 0.00 ? 106 PRO A CB   5  
ATOM 9441  C CG   . PRO A 1 106 ? 3.111   -0.161  10.056  1.00 0.00 ? 106 PRO A CG   5  
ATOM 9442  C CD   . PRO A 1 106 ? 3.483   -0.914  8.789   1.00 0.00 ? 106 PRO A CD   5  
ATOM 9443  H HA   . PRO A 1 106 ? 3.264   2.103   7.775   1.00 0.00 ? 106 PRO A HA   5  
ATOM 9444  H HB2  . PRO A 1 106 ? 3.580   1.908   10.482  1.00 0.00 ? 106 PRO A HB2  5  
ATOM 9445  H HB3  . PRO A 1 106 ? 2.040   1.682   9.679   1.00 0.00 ? 106 PRO A HB3  5  
ATOM 9446  H HG2  . PRO A 1 106 ? 3.840   -0.354  10.843  1.00 0.00 ? 106 PRO A HG2  5  
ATOM 9447  H HG3  . PRO A 1 106 ? 2.143   -0.497  10.428  1.00 0.00 ? 106 PRO A HG3  5  
ATOM 9448  H HD2  . PRO A 1 106 ? 4.365   -1.535  8.942   1.00 0.00 ? 106 PRO A HD2  5  
ATOM 9449  H HD3  . PRO A 1 106 ? 2.679   -1.577  8.471   1.00 0.00 ? 106 PRO A HD3  5  
ATOM 9450  N N    . TRP A 1 107 ? 6.110   1.218   7.943   1.00 0.00 ? 107 TRP A N    5  
ATOM 9451  C CA   . TRP A 1 107 ? 7.512   1.600   7.971   1.00 0.00 ? 107 TRP A CA   5  
ATOM 9452  C C    . TRP A 1 107 ? 8.053   1.309   9.373   1.00 0.00 ? 107 TRP A C    5  
ATOM 9453  O O    . TRP A 1 107 ? 9.018   0.563   9.526   1.00 0.00 ? 107 TRP A O    5  
ATOM 9454  C CB   . TRP A 1 107 ? 7.692   3.060   7.551   1.00 0.00 ? 107 TRP A CB   5  
ATOM 9455  C CG   . TRP A 1 107 ? 9.100   3.395   7.054   1.00 0.00 ? 107 TRP A CG   5  
ATOM 9456  C CD1  . TRP A 1 107 ? 9.849   2.713   6.177   1.00 0.00 ? 107 TRP A CD1  5  
ATOM 9457  C CD2  . TRP A 1 107 ? 9.900   4.532   7.442   1.00 0.00 ? 107 TRP A CD2  5  
ATOM 9458  N NE1  . TRP A 1 107 ? 11.069  3.323   5.972   1.00 0.00 ? 107 TRP A NE1  5  
ATOM 9459  C CE2  . TRP A 1 107 ? 11.101  4.465   6.766   1.00 0.00 ? 107 TRP A CE2  5  
ATOM 9460  C CE3  . TRP A 1 107 ? 9.619   5.581   8.334   1.00 0.00 ? 107 TRP A CE3  5  
ATOM 9461  C CZ2  . TRP A 1 107 ? 12.117  5.418   6.911   1.00 0.00 ? 107 TRP A CZ2  5  
ATOM 9462  C CZ3  . TRP A 1 107 ? 10.644  6.526   8.467   1.00 0.00 ? 107 TRP A CZ3  5  
ATOM 9463  C CH2  . TRP A 1 107 ? 11.859  6.473   7.795   1.00 0.00 ? 107 TRP A CH2  5  
ATOM 9464  H H    . TRP A 1 107 ? 5.919   0.344   7.497   1.00 0.00 ? 107 TRP A H    5  
ATOM 9465  H HA   . TRP A 1 107 ? 8.037   0.991   7.235   1.00 0.00 ? 107 TRP A HA   5  
ATOM 9466  H HB2  . TRP A 1 107 ? 6.975   3.292   6.765   1.00 0.00 ? 107 TRP A HB2  5  
ATOM 9467  H HB3  . TRP A 1 107 ? 7.455   3.702   8.399   1.00 0.00 ? 107 TRP A HB3  5  
ATOM 9468  H HD1  . TRP A 1 107 ? 9.535   1.791   5.688   1.00 0.00 ? 107 TRP A HD1  5  
ATOM 9469  H HE1  . TRP A 1 107 ? 11.863  2.976   5.311   1.00 0.00 ? 107 TRP A HE1  5  
ATOM 9470  H HE3  . TRP A 1 107 ? 8.678   5.657   8.878   1.00 0.00 ? 107 TRP A HE3  5  
ATOM 9471  H HZ2  . TRP A 1 107 ? 13.058  5.342   6.366   1.00 0.00 ? 107 TRP A HZ2  5  
ATOM 9472  H HZ3  . TRP A 1 107 ? 10.477  7.361   9.147   1.00 0.00 ? 107 TRP A HZ3  5  
ATOM 9473  H HH2  . TRP A 1 107 ? 12.608  7.249   7.954   1.00 0.00 ? 107 TRP A HH2  5  
ATOM 9474  N N    . ASP A 1 108 ? 7.407   1.914   10.358  1.00 0.00 ? 108 ASP A N    5  
ATOM 9475  C CA   . ASP A 1 108 ? 7.810   1.729   11.742  1.00 0.00 ? 108 ASP A CA   5  
ATOM 9476  C C    . ASP A 1 108 ? 7.478   0.302   12.180  1.00 0.00 ? 108 ASP A C    5  
ATOM 9477  O O    . ASP A 1 108 ? 6.849   0.098   13.218  1.00 0.00 ? 108 ASP A O    5  
ATOM 9478  C CB   . ASP A 1 108 ? 7.064   2.694   12.667  1.00 0.00 ? 108 ASP A CB   5  
ATOM 9479  C CG   . ASP A 1 108 ? 7.563   2.719   14.113  1.00 0.00 ? 108 ASP A CG   5  
ATOM 9480  O OD1  . ASP A 1 108 ? 8.801   2.695   14.286  1.00 0.00 ? 108 ASP A OD1  5  
ATOM 9481  O OD2  . ASP A 1 108 ? 6.696   2.762   15.012  1.00 0.00 ? 108 ASP A OD2  5  
ATOM 9482  H H    . ASP A 1 108 ? 6.622   2.519   10.224  1.00 0.00 ? 108 ASP A H    5  
ATOM 9483  H HA   . ASP A 1 108 ? 8.881   1.932   11.757  1.00 0.00 ? 108 ASP A HA   5  
ATOM 9484  H HB2  . ASP A 1 108 ? 7.139   3.700   12.254  1.00 0.00 ? 108 ASP A HB2  5  
ATOM 9485  H HB3  . ASP A 1 108 ? 6.007   2.428   12.668  1.00 0.00 ? 108 ASP A HB3  5  
ATOM 9486  N N    . THR A 1 109 ? 7.913   -0.649  11.367  1.00 0.00 ? 109 THR A N    5  
ATOM 9487  C CA   . THR A 1 109 ? 7.668   -2.052  11.658  1.00 0.00 ? 109 THR A CA   5  
ATOM 9488  C C    . THR A 1 109 ? 8.667   -2.934  10.906  1.00 0.00 ? 109 THR A C    5  
ATOM 9489  O O    . THR A 1 109 ? 9.397   -3.712  11.518  1.00 0.00 ? 109 THR A O    5  
ATOM 9490  C CB   . THR A 1 109 ? 6.209   -2.359  11.315  1.00 0.00 ? 109 THR A CB   5  
ATOM 9491  O OG1  . THR A 1 109 ? 6.028   -1.787  10.022  1.00 0.00 ? 109 THR A OG1  5  
ATOM 9492  C CG2  . THR A 1 109 ? 5.226   -1.593  12.202  1.00 0.00 ? 109 THR A CG2  5  
ATOM 9493  H H    . THR A 1 109 ? 8.423   -0.474  10.524  1.00 0.00 ? 109 THR A H    5  
ATOM 9494  H HA   . THR A 1 109 ? 7.835   -2.216  12.721  1.00 0.00 ? 109 THR A HA   5  
ATOM 9495  H HB   . THR A 1 109 ? 6.016   -3.431  11.356  1.00 0.00 ? 109 THR A HB   5  
ATOM 9496  H HG1  . THR A 1 109 ? 6.111   -2.494  9.321   1.00 0.00 ? 109 THR A HG1  5  
ATOM 9497  H HG21 . THR A 1 109 ? 5.483   -1.752  13.250  1.00 0.00 ? 109 THR A HG21 5  
ATOM 9498  H HG22 . THR A 1 109 ? 5.281   -0.530  11.972  1.00 0.00 ? 109 THR A HG22 5  
ATOM 9499  H HG23 . THR A 1 109 ? 4.214   -1.953  12.018  1.00 0.00 ? 109 THR A HG23 5  
ATOM 9500  N N    . LEU A 1 110 ? 8.668   -2.782  9.589   1.00 0.00 ? 110 LEU A N    5  
ATOM 9501  C CA   . LEU A 1 110 ? 9.565   -3.555  8.747   1.00 0.00 ? 110 LEU A CA   5  
ATOM 9502  C C    . LEU A 1 110 ? 10.195  -4.677  9.575   1.00 0.00 ? 110 LEU A C    5  
ATOM 9503  O O    . LEU A 1 110 ? 9.527   -5.651  9.917   1.00 0.00 ? 110 LEU A O    5  
ATOM 9504  C CB   . LEU A 1 110 ? 10.589  -2.639  8.073   1.00 0.00 ? 110 LEU A CB   5  
ATOM 9505  C CG   . LEU A 1 110 ? 10.016  -1.488  7.245   1.00 0.00 ? 110 LEU A CG   5  
ATOM 9506  C CD1  . LEU A 1 110 ? 11.114  -0.499  6.848   1.00 0.00 ? 110 LEU A CD1  5  
ATOM 9507  C CD2  . LEU A 1 110 ? 9.252   -2.014  6.028   1.00 0.00 ? 110 LEU A CD2  5  
ATOM 9508  H H    . LEU A 1 110 ? 8.072   -2.147  9.100   1.00 0.00 ? 110 LEU A H    5  
ATOM 9509  H HA   . LEU A 1 110 ? 8.965   -4.004  7.956   1.00 0.00 ? 110 LEU A HA   5  
ATOM 9510  H HB2  . LEU A 1 110 ? 11.235  -2.220  8.845   1.00 0.00 ? 110 LEU A HB2  5  
ATOM 9511  H HB3  . LEU A 1 110 ? 11.220  -3.248  7.425   1.00 0.00 ? 110 LEU A HB3  5  
ATOM 9512  H HG   . LEU A 1 110 ? 9.302   -0.945  7.863   1.00 0.00 ? 110 LEU A HG   5  
ATOM 9513  H HD11 . LEU A 1 110 ? 11.848  -0.429  7.651   1.00 0.00 ? 110 LEU A HD11 5  
ATOM 9514  H HD12 . LEU A 1 110 ? 11.602  -0.845  5.937   1.00 0.00 ? 110 LEU A HD12 5  
ATOM 9515  H HD13 . LEU A 1 110 ? 10.673  0.482   6.674   1.00 0.00 ? 110 LEU A HD13 5  
ATOM 9516  H HD21 . LEU A 1 110 ? 9.147   -3.097  6.106   1.00 0.00 ? 110 LEU A HD21 5  
ATOM 9517  H HD22 . LEU A 1 110 ? 8.264   -1.555  5.993   1.00 0.00 ? 110 LEU A HD22 5  
ATOM 9518  H HD23 . LEU A 1 110 ? 9.800   -1.767  5.119   1.00 0.00 ? 110 LEU A HD23 5  
ATOM 9519  N N    . SER A 1 111 ? 11.473  -4.502  9.875   1.00 0.00 ? 111 SER A N    5  
ATOM 9520  C CA   . SER A 1 111 ? 12.201  -5.487  10.657  1.00 0.00 ? 111 SER A CA   5  
ATOM 9521  C C    . SER A 1 111 ? 13.662  -5.538  10.206  1.00 0.00 ? 111 SER A C    5  
ATOM 9522  O O    . SER A 1 111 ? 14.568  -5.625  11.034  1.00 0.00 ? 111 SER A O    5  
ATOM 9523  C CB   . SER A 1 111 ? 11.560  -6.870  10.533  1.00 0.00 ? 111 SER A CB   5  
ATOM 9524  O OG   . SER A 1 111 ? 10.532  -7.071  11.501  1.00 0.00 ? 111 SER A OG   5  
ATOM 9525  H H    . SER A 1 111 ? 12.010  -3.706  9.594   1.00 0.00 ? 111 SER A H    5  
ATOM 9526  H HA   . SER A 1 111 ? 12.131  -5.146  11.690  1.00 0.00 ? 111 SER A HA   5  
ATOM 9527  H HB2  . SER A 1 111 ? 11.144  -6.990  9.533   1.00 0.00 ? 111 SER A HB2  5  
ATOM 9528  H HB3  . SER A 1 111 ? 12.325  -7.637  10.654  1.00 0.00 ? 111 SER A HB3  5  
ATOM 9529  H HG   . SER A 1 111 ? 9.689   -7.362  11.048  1.00 0.00 ? 111 SER A HG   5  
ATOM 9530  N N    . THR A 1 112 ? 13.847  -5.481  8.896   1.00 0.00 ? 112 THR A N    5  
ATOM 9531  C CA   . THR A 1 112 ? 15.183  -5.519  8.325   1.00 0.00 ? 112 THR A CA   5  
ATOM 9532  C C    . THR A 1 112 ? 15.121  -5.918  6.850   1.00 0.00 ? 112 THR A C    5  
ATOM 9533  O O    . THR A 1 112 ? 15.462  -5.124  5.973   1.00 0.00 ? 112 THR A O    5  
ATOM 9534  C CB   . THR A 1 112 ? 16.032  -6.466  9.176   1.00 0.00 ? 112 THR A CB   5  
ATOM 9535  O OG1  . THR A 1 112 ? 16.784  -5.596  10.017  1.00 0.00 ? 112 THR A OG1  5  
ATOM 9536  C CG2  . THR A 1 112 ? 17.094  -7.198  8.352   1.00 0.00 ? 112 THR A CG2  5  
ATOM 9537  H H    . THR A 1 112 ? 13.104  -5.410  8.229   1.00 0.00 ? 112 THR A H    5  
ATOM 9538  H HA   . THR A 1 112 ? 15.603  -4.515  8.368   1.00 0.00 ? 112 THR A HA   5  
ATOM 9539  H HB   . THR A 1 112 ? 15.404  -7.173  9.717   1.00 0.00 ? 112 THR A HB   5  
ATOM 9540  H HG1  . THR A 1 112 ? 17.379  -5.013  9.463   1.00 0.00 ? 112 THR A HG1  5  
ATOM 9541  H HG21 . THR A 1 112 ? 17.586  -6.492  7.682   1.00 0.00 ? 112 THR A HG21 5  
ATOM 9542  H HG22 . THR A 1 112 ? 17.834  -7.637  9.022   1.00 0.00 ? 112 THR A HG22 5  
ATOM 9543  H HG23 . THR A 1 112 ? 16.621  -7.985  7.766   1.00 0.00 ? 112 THR A HG23 5  
ATOM 9544  N N    . THR A 1 113 ? 14.683  -7.147  6.619   1.00 0.00 ? 113 THR A N    5  
ATOM 9545  C CA   . THR A 1 113 ? 14.572  -7.660  5.264   1.00 0.00 ? 113 THR A CA   5  
ATOM 9546  C C    . THR A 1 113 ? 13.820  -6.667  4.377   1.00 0.00 ? 113 THR A C    5  
ATOM 9547  O O    . THR A 1 113 ? 14.017  -6.639  3.164   1.00 0.00 ? 113 THR A O    5  
ATOM 9548  C CB   . THR A 1 113 ? 13.908  -9.037  5.333   1.00 0.00 ? 113 THR A CB   5  
ATOM 9549  O OG1  . THR A 1 113 ? 14.872  -9.854  5.993   1.00 0.00 ? 113 THR A OG1  5  
ATOM 9550  C CG2  . THR A 1 113 ? 13.755  -9.683  3.955   1.00 0.00 ? 113 THR A CG2  5  
ATOM 9551  H H    . THR A 1 113 ? 14.408  -7.786  7.337   1.00 0.00 ? 113 THR A H    5  
ATOM 9552  H HA   . THR A 1 113 ? 15.576  -7.760  4.852   1.00 0.00 ? 113 THR A HA   5  
ATOM 9553  H HB   . THR A 1 113 ? 12.948  -8.981  5.846   1.00 0.00 ? 113 THR A HB   5  
ATOM 9554  H HG1  . THR A 1 113 ? 14.824  -9.709  6.982   1.00 0.00 ? 113 THR A HG1  5  
ATOM 9555  H HG21 . THR A 1 113 ? 14.484  -9.252  3.269   1.00 0.00 ? 113 THR A HG21 5  
ATOM 9556  H HG22 . THR A 1 113 ? 13.920  -10.756 4.036   1.00 0.00 ? 113 THR A HG22 5  
ATOM 9557  H HG23 . THR A 1 113 ? 12.748  -9.498  3.578   1.00 0.00 ? 113 THR A HG23 5  
ATOM 9558  N N    . GLN A 1 114 ? 12.973  -5.874  5.018   1.00 0.00 ? 114 GLN A N    5  
ATOM 9559  C CA   . GLN A 1 114 ? 12.189  -4.881  4.302   1.00 0.00 ? 114 GLN A CA   5  
ATOM 9560  C C    . GLN A 1 114 ? 13.012  -3.609  4.089   1.00 0.00 ? 114 GLN A C    5  
ATOM 9561  O O    . GLN A 1 114 ? 12.855  -2.926  3.077   1.00 0.00 ? 114 GLN A O    5  
ATOM 9562  C CB   . GLN A 1 114 ? 10.886  -4.574  5.042   1.00 0.00 ? 114 GLN A CB   5  
ATOM 9563  C CG   . GLN A 1 114 ? 9.793   -5.576  4.667   1.00 0.00 ? 114 GLN A CG   5  
ATOM 9564  C CD   . GLN A 1 114 ? 9.755   -6.742  5.658   1.00 0.00 ? 114 GLN A CD   5  
ATOM 9565  O OE1  . GLN A 1 114 ? 8.758   -7.004  6.310   1.00 0.00 ? 114 GLN A OE1  5  
ATOM 9566  N NE2  . GLN A 1 114 ? 10.894  -7.425  5.731   1.00 0.00 ? 114 GLN A NE2  5  
ATOM 9567  H H    . GLN A 1 114 ? 12.817  -5.903  6.005   1.00 0.00 ? 114 GLN A H    5  
ATOM 9568  H HA   . GLN A 1 114 ? 11.955  -5.337  3.340   1.00 0.00 ? 114 GLN A HA   5  
ATOM 9569  H HB2  . GLN A 1 114 ? 11.059  -4.604  6.118   1.00 0.00 ? 114 GLN A HB2  5  
ATOM 9570  H HB3  . GLN A 1 114 ? 10.556  -3.563  4.801   1.00 0.00 ? 114 GLN A HB3  5  
ATOM 9571  H HG2  . GLN A 1 114 ? 8.825   -5.075  4.653   1.00 0.00 ? 114 GLN A HG2  5  
ATOM 9572  H HG3  . GLN A 1 114 ? 9.971   -5.955  3.660   1.00 0.00 ? 114 GLN A HG3  5  
ATOM 9573  H HE21 . GLN A 1 114 ? 11.675  -7.158  5.168   1.00 0.00 ? 114 GLN A HE21 5  
ATOM 9574  H HE22 . GLN A 1 114 ? 10.968  -8.207  6.351   1.00 0.00 ? 114 GLN A HE22 5  
ATOM 9575  N N    . LYS A 1 115 ? 13.872  -3.329  5.057   1.00 0.00 ? 115 LYS A N    5  
ATOM 9576  C CA   . LYS A 1 115 ? 14.720  -2.152  4.987   1.00 0.00 ? 115 LYS A CA   5  
ATOM 9577  C C    . LYS A 1 115 ? 15.818  -2.379  3.947   1.00 0.00 ? 115 LYS A C    5  
ATOM 9578  O O    . LYS A 1 115 ? 16.146  -1.477  3.178   1.00 0.00 ? 115 LYS A O    5  
ATOM 9579  C CB   . LYS A 1 115 ? 15.254  -1.792  6.376   1.00 0.00 ? 115 LYS A CB   5  
ATOM 9580  C CG   . LYS A 1 115 ? 14.487  -0.610  6.970   1.00 0.00 ? 115 LYS A CG   5  
ATOM 9581  C CD   . LYS A 1 115 ? 14.401  -0.720  8.493   1.00 0.00 ? 115 LYS A CD   5  
ATOM 9582  C CE   . LYS A 1 115 ? 13.869  -2.092  8.914   1.00 0.00 ? 115 LYS A CE   5  
ATOM 9583  N NZ   . LYS A 1 115 ? 13.317  -2.035  10.286  1.00 0.00 ? 115 LYS A NZ   5  
ATOM 9584  H H    . LYS A 1 115 ? 13.993  -3.890  5.876   1.00 0.00 ? 115 LYS A H    5  
ATOM 9585  H HA   . LYS A 1 115 ? 14.097  -1.320  4.657   1.00 0.00 ? 115 LYS A HA   5  
ATOM 9586  H HB2  . LYS A 1 115 ? 15.167  -2.655  7.037   1.00 0.00 ? 115 LYS A HB2  5  
ATOM 9587  H HB3  . LYS A 1 115 ? 16.313  -1.547  6.310   1.00 0.00 ? 115 LYS A HB3  5  
ATOM 9588  H HG2  . LYS A 1 115 ? 14.982  0.323   6.696   1.00 0.00 ? 115 LYS A HG2  5  
ATOM 9589  H HG3  . LYS A 1 115 ? 13.483  -0.573  6.547   1.00 0.00 ? 115 LYS A HG3  5  
ATOM 9590  H HD2  . LYS A 1 115 ? 15.387  -0.560  8.930   1.00 0.00 ? 115 LYS A HD2  5  
ATOM 9591  H HD3  . LYS A 1 115 ? 13.749  0.062   8.882   1.00 0.00 ? 115 LYS A HD3  5  
ATOM 9592  H HE2  . LYS A 1 115 ? 13.095  -2.417  8.218   1.00 0.00 ? 115 LYS A HE2  5  
ATOM 9593  H HE3  . LYS A 1 115 ? 14.669  -2.829  8.868   1.00 0.00 ? 115 LYS A HE3  5  
ATOM 9594  H HZ1  . LYS A 1 115 ? 13.874  -1.418  10.844  1.00 0.00 ? 115 LYS A HZ1  5  
ATOM 9595  H HZ2  . LYS A 1 115 ? 12.376  -1.697  10.253  1.00 0.00 ? 115 LYS A HZ2  5  
ATOM 9596  H HZ3  . LYS A 1 115 ? 13.329  -2.950  10.689  1.00 0.00 ? 115 LYS A HZ3  5  
ATOM 9597  N N    . LYS A 1 116 ? 16.355  -3.590  3.956   1.00 0.00 ? 116 LYS A N    5  
ATOM 9598  C CA   . LYS A 1 116 ? 17.409  -3.948  3.022   1.00 0.00 ? 116 LYS A CA   5  
ATOM 9599  C C    . LYS A 1 116 ? 16.861  -3.889  1.594   1.00 0.00 ? 116 LYS A C    5  
ATOM 9600  O O    . LYS A 1 116 ? 17.626  -3.785  0.636   1.00 0.00 ? 116 LYS A O    5  
ATOM 9601  C CB   . LYS A 1 116 ? 18.016  -5.302  3.392   1.00 0.00 ? 116 LYS A CB   5  
ATOM 9602  C CG   . LYS A 1 116 ? 17.126  -6.452  2.913   1.00 0.00 ? 116 LYS A CG   5  
ATOM 9603  C CD   . LYS A 1 116 ? 17.728  -7.135  1.683   1.00 0.00 ? 116 LYS A CD   5  
ATOM 9604  C CE   . LYS A 1 116 ? 17.063  -6.636  0.399   1.00 0.00 ? 116 LYS A CE   5  
ATOM 9605  N NZ   . LYS A 1 116 ? 18.049  -5.941  -0.459  1.00 0.00 ? 116 LYS A NZ   5  
ATOM 9606  H H    . LYS A 1 116 ? 16.082  -4.318  4.584   1.00 0.00 ? 116 LYS A H    5  
ATOM 9607  H HA   . LYS A 1 116 ? 18.198  -3.203  3.120   1.00 0.00 ? 116 LYS A HA   5  
ATOM 9608  H HB2  . LYS A 1 116 ? 19.007  -5.396  2.948   1.00 0.00 ? 116 LYS A HB2  5  
ATOM 9609  H HB3  . LYS A 1 116 ? 18.145  -5.364  4.473   1.00 0.00 ? 116 LYS A HB3  5  
ATOM 9610  H HG2  . LYS A 1 116 ? 17.004  -7.180  3.714   1.00 0.00 ? 116 LYS A HG2  5  
ATOM 9611  H HG3  . LYS A 1 116 ? 16.133  -6.072  2.672   1.00 0.00 ? 116 LYS A HG3  5  
ATOM 9612  H HD2  . LYS A 1 116 ? 18.799  -6.939  1.642   1.00 0.00 ? 116 LYS A HD2  5  
ATOM 9613  H HD3  . LYS A 1 116 ? 17.604  -8.215  1.766   1.00 0.00 ? 116 LYS A HD3  5  
ATOM 9614  H HE2  . LYS A 1 116 ? 16.630  -7.478  -0.144  1.00 0.00 ? 116 LYS A HE2  5  
ATOM 9615  H HE3  . LYS A 1 116 ? 16.245  -5.961  0.644   1.00 0.00 ? 116 LYS A HE3  5  
ATOM 9616  H HZ1  . LYS A 1 116 ? 18.904  -6.459  -0.471  1.00 0.00 ? 116 LYS A HZ1  5  
ATOM 9617  H HZ2  . LYS A 1 116 ? 17.689  -5.868  -1.388  1.00 0.00 ? 116 LYS A HZ2  5  
ATOM 9618  H HZ3  . LYS A 1 116 ? 18.220  -5.026  -0.095  1.00 0.00 ? 116 LYS A HZ3  5  
ATOM 9619  N N    . SER A 1 117 ? 15.542  -3.958  1.498   1.00 0.00 ? 117 SER A N    5  
ATOM 9620  C CA   . SER A 1 117 ? 14.884  -3.914  0.203   1.00 0.00 ? 117 SER A CA   5  
ATOM 9621  C C    . SER A 1 117 ? 14.457  -2.480  -0.118  1.00 0.00 ? 117 SER A C    5  
ATOM 9622  O O    . SER A 1 117 ? 14.095  -2.176  -1.255  1.00 0.00 ? 117 SER A O    5  
ATOM 9623  C CB   . SER A 1 117 ? 13.673  -4.849  0.168   1.00 0.00 ? 117 SER A CB   5  
ATOM 9624  O OG   . SER A 1 117 ? 13.710  -5.731  -0.950  1.00 0.00 ? 117 SER A OG   5  
ATOM 9625  H H    . SER A 1 117 ? 14.927  -4.043  2.282   1.00 0.00 ? 117 SER A H    5  
ATOM 9626  H HA   . SER A 1 117 ? 15.629  -4.261  -0.512  1.00 0.00 ? 117 SER A HA   5  
ATOM 9627  H HB2  . SER A 1 117 ? 13.638  -5.432  1.090   1.00 0.00 ? 117 SER A HB2  5  
ATOM 9628  H HB3  . SER A 1 117 ? 12.758  -4.257  0.133   1.00 0.00 ? 117 SER A HB3  5  
ATOM 9629  H HG   . SER A 1 117 ? 14.599  -6.188  -0.995  1.00 0.00 ? 117 SER A HG   5  
ATOM 9630  N N    . LEU A 1 118 ? 14.511  -1.638  0.903   1.00 0.00 ? 118 LEU A N    5  
ATOM 9631  C CA   . LEU A 1 118 ? 14.135  -0.244  0.743   1.00 0.00 ? 118 LEU A CA   5  
ATOM 9632  C C    . LEU A 1 118 ? 15.245  0.499   -0.002  1.00 0.00 ? 118 LEU A C    5  
ATOM 9633  O O    . LEU A 1 118 ? 14.985  1.481   -0.694  1.00 0.00 ? 118 LEU A O    5  
ATOM 9634  C CB   . LEU A 1 118 ? 13.783  0.375   2.099   1.00 0.00 ? 118 LEU A CB   5  
ATOM 9635  C CG   . LEU A 1 118 ? 12.292  0.570   2.379   1.00 0.00 ? 118 LEU A CG   5  
ATOM 9636  C CD1  . LEU A 1 118 ? 11.921  0.044   3.767   1.00 0.00 ? 118 LEU A CD1  5  
ATOM 9637  C CD2  . LEU A 1 118 ? 11.887  2.035   2.195   1.00 0.00 ? 118 LEU A CD2  5  
ATOM 9638  H H    . LEU A 1 118 ? 14.806  -1.893  1.824   1.00 0.00 ? 118 LEU A H    5  
ATOM 9639  H HA   . LEU A 1 118 ? 13.232  -0.217  0.133   1.00 0.00 ? 118 LEU A HA   5  
ATOM 9640  H HB2  . LEU A 1 118 ? 14.200  -0.257  2.882   1.00 0.00 ? 118 LEU A HB2  5  
ATOM 9641  H HB3  . LEU A 1 118 ? 14.277  1.343   2.172   1.00 0.00 ? 118 LEU A HB3  5  
ATOM 9642  H HG   . LEU A 1 118 ? 11.727  -0.013  1.651   1.00 0.00 ? 118 LEU A HG   5  
ATOM 9643  H HD11 . LEU A 1 118 ? 12.253  -0.990  3.863   1.00 0.00 ? 118 LEU A HD11 5  
ATOM 9644  H HD12 . LEU A 1 118 ? 12.408  0.654   4.528   1.00 0.00 ? 118 LEU A HD12 5  
ATOM 9645  H HD13 . LEU A 1 118 ? 10.840  0.093   3.897   1.00 0.00 ? 118 LEU A HD13 5  
ATOM 9646  H HD21 . LEU A 1 118 ? 12.419  2.454   1.340   1.00 0.00 ? 118 LEU A HD21 5  
ATOM 9647  H HD22 . LEU A 1 118 ? 10.813  2.096   2.020   1.00 0.00 ? 118 LEU A HD22 5  
ATOM 9648  H HD23 . LEU A 1 118 ? 12.142  2.598   3.093   1.00 0.00 ? 118 LEU A HD23 5  
ATOM 9649  N N    . ASN A 1 119 ? 16.462  0.001   0.166   1.00 0.00 ? 119 ASN A N    5  
ATOM 9650  C CA   . ASN A 1 119 ? 17.614  0.604   -0.481  1.00 0.00 ? 119 ASN A CA   5  
ATOM 9651  C C    . ASN A 1 119 ? 17.613  0.232   -1.965  1.00 0.00 ? 119 ASN A C    5  
ATOM 9652  O O    . ASN A 1 119 ? 18.015  1.031   -2.809  1.00 0.00 ? 119 ASN A O    5  
ATOM 9653  C CB   . ASN A 1 119 ? 18.920  0.096   0.133   1.00 0.00 ? 119 ASN A CB   5  
ATOM 9654  C CG   . ASN A 1 119 ? 18.866  -1.416  0.362   1.00 0.00 ? 119 ASN A CG   5  
ATOM 9655  O OD1  . ASN A 1 119 ? 18.773  -1.898  1.479   1.00 0.00 ? 119 ASN A OD1  5  
ATOM 9656  N ND2  . ASN A 1 119 ? 18.930  -2.136  -0.755  1.00 0.00 ? 119 ASN A ND2  5  
ATOM 9657  H H    . ASN A 1 119 ? 16.666  -0.799  0.731   1.00 0.00 ? 119 ASN A H    5  
ATOM 9658  H HA   . ASN A 1 119 ? 17.504  1.676   -0.320  1.00 0.00 ? 119 ASN A HA   5  
ATOM 9659  H HB2  . ASN A 1 119 ? 19.754  0.338   -0.527  1.00 0.00 ? 119 ASN A HB2  5  
ATOM 9660  H HB3  . ASN A 1 119 ? 19.104  0.604   1.079   1.00 0.00 ? 119 ASN A HB3  5  
ATOM 9661  H HD21 . ASN A 1 119 ? 19.005  -1.678  -1.641  1.00 0.00 ? 119 ASN A HD21 5  
ATOM 9662  H HD22 . ASN A 1 119 ? 18.901  -3.134  -0.709  1.00 0.00 ? 119 ASN A HD22 5  
ATOM 9663  N N    . HIS A 1 120 ? 17.155  -0.981  -2.238  1.00 0.00 ? 120 HIS A N    5  
ATOM 9664  C CA   . HIS A 1 120 ? 17.096  -1.469  -3.606  1.00 0.00 ? 120 HIS A CA   5  
ATOM 9665  C C    . HIS A 1 120 ? 16.084  -0.642  -4.402  1.00 0.00 ? 120 HIS A C    5  
ATOM 9666  O O    . HIS A 1 120 ? 14.961  -0.426  -3.950  1.00 0.00 ? 120 HIS A O    5  
ATOM 9667  C CB   . HIS A 1 120 ? 16.791  -2.968  -3.635  1.00 0.00 ? 120 HIS A CB   5  
ATOM 9668  C CG   . HIS A 1 120 ? 15.319  -3.293  -3.734  1.00 0.00 ? 120 HIS A CG   5  
ATOM 9669  N ND1  . HIS A 1 120 ? 14.704  -4.239  -2.932  1.00 0.00 ? 120 HIS A ND1  5  
ATOM 9670  C CD2  . HIS A 1 120 ? 14.349  -2.789  -4.549  1.00 0.00 ? 120 HIS A CD2  5  
ATOM 9671  C CE1  . HIS A 1 120 ? 13.421  -4.293  -3.258  1.00 0.00 ? 120 HIS A CE1  5  
ATOM 9672  N NE2  . HIS A 1 120 ? 13.203  -3.394  -4.260  1.00 0.00 ? 120 HIS A NE2  5  
ATOM 9673  H H    . HIS A 1 120 ? 16.830  -1.624  -1.545  1.00 0.00 ? 120 HIS A H    5  
ATOM 9674  H HA   . HIS A 1 120 ? 18.088  -1.323  -4.033  1.00 0.00 ? 120 HIS A HA   5  
ATOM 9675  H HB2  . HIS A 1 120 ? 17.310  -3.417  -4.481  1.00 0.00 ? 120 HIS A HB2  5  
ATOM 9676  H HB3  . HIS A 1 120 ? 17.194  -3.428  -2.733  1.00 0.00 ? 120 HIS A HB3  5  
ATOM 9677  H HD1  . HIS A 1 120 ? 15.152  -4.787  -2.226  1.00 0.00 ? 120 HIS A HD1  5  
ATOM 9678  H HD2  . HIS A 1 120 ? 14.489  -2.019  -5.308  1.00 0.00 ? 120 HIS A HD2  5  
ATOM 9679  H HE1  . HIS A 1 120 ? 12.673  -4.942  -2.805  1.00 0.00 ? 120 HIS A HE1  5  
ATOM 9680  N N    . ARG A 1 121 ? 16.520  -0.202  -5.573  1.00 0.00 ? 121 ARG A N    5  
ATOM 9681  C CA   . ARG A 1 121 ? 15.666  0.597   -6.436  1.00 0.00 ? 121 ARG A CA   5  
ATOM 9682  C C    . ARG A 1 121 ? 14.241  0.041   -6.435  1.00 0.00 ? 121 ARG A C    5  
ATOM 9683  O O    . ARG A 1 121 ? 13.366  0.567   -5.750  1.00 0.00 ? 121 ARG A O    5  
ATOM 9684  C CB   . ARG A 1 121 ? 16.198  0.615   -7.872  1.00 0.00 ? 121 ARG A CB   5  
ATOM 9685  C CG   . ARG A 1 121 ? 16.496  2.045   -8.327  1.00 0.00 ? 121 ARG A CG   5  
ATOM 9686  C CD   . ARG A 1 121 ? 15.371  2.996   -7.917  1.00 0.00 ? 121 ARG A CD   5  
ATOM 9687  N NE   . ARG A 1 121 ? 14.936  3.798   -9.083  1.00 0.00 ? 121 ARG A NE   5  
ATOM 9688  C CZ   . ARG A 1 121 ? 15.644  4.807   -9.608  1.00 0.00 ? 121 ARG A CZ   5  
ATOM 9689  N NH1  . ARG A 1 121 ? 16.825  5.145   -9.074  1.00 0.00 ? 121 ARG A NH1  5  
ATOM 9690  N NH2  . ARG A 1 121 ? 15.171  5.479   -10.667 1.00 0.00 ? 121 ARG A NH2  5  
ATOM 9691  H H    . ARG A 1 121 ? 17.435  -0.382  -5.933  1.00 0.00 ? 121 ARG A H    5  
ATOM 9692  H HA   . ARG A 1 121 ? 15.696  1.599   -6.009  1.00 0.00 ? 121 ARG A HA   5  
ATOM 9693  H HB2  . ARG A 1 121 ? 17.104  0.012   -7.936  1.00 0.00 ? 121 ARG A HB2  5  
ATOM 9694  H HB3  . ARG A 1 121 ? 15.466  0.162   -8.540  1.00 0.00 ? 121 ARG A HB3  5  
ATOM 9695  H HG2  . ARG A 1 121 ? 17.438  2.380   -7.892  1.00 0.00 ? 121 ARG A HG2  5  
ATOM 9696  H HG3  . ARG A 1 121 ? 16.620  2.067   -9.410  1.00 0.00 ? 121 ARG A HG3  5  
ATOM 9697  H HD2  . ARG A 1 121 ? 14.529  2.430   -7.521  1.00 0.00 ? 121 ARG A HD2  5  
ATOM 9698  H HD3  . ARG A 1 121 ? 15.714  3.656   -7.121  1.00 0.00 ? 121 ARG A HD3  5  
ATOM 9699  H HE   . ARG A 1 121 ? 14.059  3.572   -9.506  1.00 0.00 ? 121 ARG A HE   5  
ATOM 9700  H HH11 . ARG A 1 121 ? 17.179  4.645   -8.283  1.00 0.00 ? 121 ARG A HH11 5  
ATOM 9701  H HH12 . ARG A 1 121 ? 17.354  5.899   -9.465  1.00 0.00 ? 121 ARG A HH12 5  
ATOM 9702  H HH21 . ARG A 1 121 ? 14.290  5.226   -11.066 1.00 0.00 ? 121 ARG A HH21 5  
ATOM 9703  H HH22 . ARG A 1 121 ? 15.700  6.231   -11.059 1.00 0.00 ? 121 ARG A HH22 5  
ATOM 9704  N N    . TYR A 1 122 ? 14.052  -1.018  -7.210  1.00 0.00 ? 122 TYR A N    5  
ATOM 9705  C CA   . TYR A 1 122 ? 12.747  -1.650  -7.307  1.00 0.00 ? 122 TYR A CA   5  
ATOM 9706  C C    . TYR A 1 122 ? 12.876  -3.103  -7.768  1.00 0.00 ? 122 TYR A C    5  
ATOM 9707  O O    . TYR A 1 122 ? 12.948  -3.373  -8.967  1.00 0.00 ? 122 TYR A O    5  
ATOM 9708  C CB   . TYR A 1 122 ? 11.972  -0.859  -8.362  1.00 0.00 ? 122 TYR A CB   5  
ATOM 9709  C CG   . TYR A 1 122 ? 12.265  -1.288  -9.801  1.00 0.00 ? 122 TYR A CG   5  
ATOM 9710  C CD1  . TYR A 1 122 ? 13.405  -0.838  -10.436 1.00 0.00 ? 122 TYR A CD1  5  
ATOM 9711  C CD2  . TYR A 1 122 ? 11.389  -2.123  -10.465 1.00 0.00 ? 122 TYR A CD2  5  
ATOM 9712  C CE1  . TYR A 1 122 ? 13.681  -1.241  -11.791 1.00 0.00 ? 122 TYR A CE1  5  
ATOM 9713  C CE2  . TYR A 1 122 ? 11.666  -2.526  -11.819 1.00 0.00 ? 122 TYR A CE2  5  
ATOM 9714  C CZ   . TYR A 1 122 ? 12.797  -2.065  -12.415 1.00 0.00 ? 122 TYR A CZ   5  
ATOM 9715  O OH   . TYR A 1 122 ? 13.058  -2.446  -13.694 1.00 0.00 ? 122 TYR A OH   5  
ATOM 9716  H H    . TYR A 1 122 ? 14.768  -1.439  -7.764  1.00 0.00 ? 122 TYR A H    5  
ATOM 9717  H HA   . TYR A 1 122 ? 12.290  -1.630  -6.318  1.00 0.00 ? 122 TYR A HA   5  
ATOM 9718  H HB2  . TYR A 1 122 ? 10.904  -0.968  -8.171  1.00 0.00 ? 122 TYR A HB2  5  
ATOM 9719  H HB3  . TYR A 1 122 ? 12.207  0.199   -8.253  1.00 0.00 ? 122 TYR A HB3  5  
ATOM 9720  H HD1  . TYR A 1 122 ? 14.096  -0.177  -9.912  1.00 0.00 ? 122 TYR A HD1  5  
ATOM 9721  H HD2  . TYR A 1 122 ? 10.489  -2.478  -9.963  1.00 0.00 ? 122 TYR A HD2  5  
ATOM 9722  H HE1  . TYR A 1 122 ? 14.578  -0.893  -12.304 1.00 0.00 ? 122 TYR A HE1  5  
ATOM 9723  H HE2  . TYR A 1 122 ? 10.982  -3.186  -12.354 1.00 0.00 ? 122 TYR A HE2  5  
ATOM 9724  H HH   . TYR A 1 122 ? 12.981  -1.660  -14.308 1.00 0.00 ? 122 TYR A HH   5  
ATOM 9725  N N    . GLN A 1 123 ? 12.901  -4.000  -6.794  1.00 0.00 ? 123 GLN A N    5  
ATOM 9726  C CA   . GLN A 1 123 ? 13.020  -5.419  -7.086  1.00 0.00 ? 123 GLN A CA   5  
ATOM 9727  C C    . GLN A 1 123 ? 14.365  -5.713  -7.752  1.00 0.00 ? 123 GLN A C    5  
ATOM 9728  O O    . GLN A 1 123 ? 14.412  -6.124  -8.910  1.00 0.00 ? 123 GLN A O    5  
ATOM 9729  C CB   . GLN A 1 123 ? 11.859  -5.898  -7.960  1.00 0.00 ? 123 GLN A CB   5  
ATOM 9730  C CG   . GLN A 1 123 ? 12.066  -7.349  -8.401  1.00 0.00 ? 123 GLN A CG   5  
ATOM 9731  C CD   . GLN A 1 123 ? 11.934  -7.484  -9.919  1.00 0.00 ? 123 GLN A CD   5  
ATOM 9732  O OE1  . GLN A 1 123 ? 12.847  -7.198  -10.676 1.00 0.00 ? 123 GLN A OE1  5  
ATOM 9733  N NE2  . GLN A 1 123 ? 10.749  -7.937  -10.320 1.00 0.00 ? 123 GLN A NE2  5  
ATOM 9734  H H    . GLN A 1 123 ? 12.842  -3.773  -5.822  1.00 0.00 ? 123 GLN A H    5  
ATOM 9735  H HA   . GLN A 1 123 ? 12.968  -5.919  -6.118  1.00 0.00 ? 123 GLN A HA   5  
ATOM 9736  H HB2  . GLN A 1 123 ? 10.923  -5.812  -7.407  1.00 0.00 ? 123 GLN A HB2  5  
ATOM 9737  H HB3  . GLN A 1 123 ? 11.771  -5.257  -8.837  1.00 0.00 ? 123 GLN A HB3  5  
ATOM 9738  H HG2  . GLN A 1 123 ? 13.052  -7.690  -8.086  1.00 0.00 ? 123 GLN A HG2  5  
ATOM 9739  H HG3  . GLN A 1 123 ? 11.335  -7.990  -7.909  1.00 0.00 ? 123 GLN A HG3  5  
ATOM 9740  H HE21 . GLN A 1 123 ? 10.043  -8.153  -9.647  1.00 0.00 ? 123 GLN A HE21 5  
ATOM 9741  H HE22 . GLN A 1 123 ? 10.565  -8.059  -11.295 1.00 0.00 ? 123 GLN A HE22 5  
ATOM 9742  N N    . MET A 1 124 ? 15.427  -5.491  -6.991  1.00 0.00 ? 124 MET A N    5  
ATOM 9743  C CA   . MET A 1 124 ? 16.770  -5.727  -7.493  1.00 0.00 ? 124 MET A CA   5  
ATOM 9744  C C    . MET A 1 124 ? 17.052  -7.225  -7.619  1.00 0.00 ? 124 MET A C    5  
ATOM 9745  O O    . MET A 1 124 ? 18.035  -7.724  -7.072  1.00 0.00 ? 124 MET A O    5  
ATOM 9746  C CB   . MET A 1 124 ? 17.789  -5.094  -6.543  1.00 0.00 ? 124 MET A CB   5  
ATOM 9747  C CG   . MET A 1 124 ? 18.216  -3.712  -7.041  1.00 0.00 ? 124 MET A CG   5  
ATOM 9748  S SD   . MET A 1 124 ? 19.906  -3.766  -7.616  1.00 0.00 ? 124 MET A SD   5  
ATOM 9749  C CE   . MET A 1 124 ? 20.750  -3.195  -6.152  1.00 0.00 ? 124 MET A CE   5  
ATOM 9750  H H    . MET A 1 124 ? 15.380  -5.156  -6.050  1.00 0.00 ? 124 MET A H    5  
ATOM 9751  H HA   . MET A 1 124 ? 16.801  -5.260  -8.477  1.00 0.00 ? 124 MET A HA   5  
ATOM 9752  H HB2  . MET A 1 124 ? 17.357  -5.008  -5.546  1.00 0.00 ? 124 MET A HB2  5  
ATOM 9753  H HB3  . MET A 1 124 ? 18.662  -5.740  -6.458  1.00 0.00 ? 124 MET A HB3  5  
ATOM 9754  H HG2  . MET A 1 124 ? 17.560  -3.386  -7.847  1.00 0.00 ? 124 MET A HG2  5  
ATOM 9755  H HG3  . MET A 1 124 ? 18.121  -2.981  -6.237  1.00 0.00 ? 124 MET A HG3  5  
ATOM 9756  H HE1  . MET A 1 124 ? 20.137  -3.398  -5.275  1.00 0.00 ? 124 MET A HE1  5  
ATOM 9757  H HE2  . MET A 1 124 ? 21.704  -3.715  -6.057  1.00 0.00 ? 124 MET A HE2  5  
ATOM 9758  H HE3  . MET A 1 124 ? 20.928  -2.122  -6.231  1.00 0.00 ? 124 MET A HE3  5  
ATOM 9759  N N    . GLY A 1 125 ? 16.173  -7.902  -8.343  1.00 0.00 ? 125 GLY A N    5  
ATOM 9760  C CA   . GLY A 1 125 ? 16.315  -9.334  -8.548  1.00 0.00 ? 125 GLY A CA   5  
ATOM 9761  C C    . GLY A 1 125 ? 16.463  -10.066 -7.213  1.00 0.00 ? 125 GLY A C    5  
ATOM 9762  O O    . GLY A 1 125 ? 17.005  -11.169 -7.164  1.00 0.00 ? 125 GLY A O    5  
ATOM 9763  H H    . GLY A 1 125 ? 15.376  -7.489  -8.784  1.00 0.00 ? 125 GLY A H    5  
ATOM 9764  H HA2  . GLY A 1 125 ? 15.446  -9.716  -9.084  1.00 0.00 ? 125 GLY A HA2  5  
ATOM 9765  H HA3  . GLY A 1 125 ? 17.186  -9.530  -9.173  1.00 0.00 ? 125 GLY A HA3  5  
ATOM 9766  N N    . CYS A 1 126 ? 15.970  -9.424  -6.164  1.00 0.00 ? 126 CYS A N    5  
ATOM 9767  C CA   . CYS A 1 126 ? 16.040  -10.002 -4.833  1.00 0.00 ? 126 CYS A CA   5  
ATOM 9768  C C    . CYS A 1 126 ? 15.250  -11.312 -4.835  1.00 0.00 ? 126 CYS A C    5  
ATOM 9769  O O    . CYS A 1 126 ? 14.871  -11.810 -5.894  1.00 0.00 ? 126 CYS A O    5  
ATOM 9770  C CB   . CYS A 1 126 ? 15.529  -9.029  -3.768  1.00 0.00 ? 126 CYS A CB   5  
ATOM 9771  S SG   . CYS A 1 126 ? 13.745  -9.174  -3.389  1.00 0.00 ? 126 CYS A SG   5  
ATOM 9772  H H    . CYS A 1 126 ? 15.530  -8.527  -6.214  1.00 0.00 ? 126 CYS A H    5  
ATOM 9773  H HA   . CYS A 1 126 ? 17.094  -10.186 -4.627  1.00 0.00 ? 126 CYS A HA   5  
ATOM 9774  H HB2  . CYS A 1 126 ? 16.095  -9.189  -2.850  1.00 0.00 ? 126 CYS A HB2  5  
ATOM 9775  H HB3  . CYS A 1 126 ? 15.736  -8.011  -4.097  1.00 0.00 ? 126 CYS A HB3  5  
ATOM 9776  N N    . GLU A 1 127 ? 15.026  -11.833 -3.638  1.00 0.00 ? 127 GLU A N    5  
ATOM 9777  C CA   . GLU A 1 127 ? 14.288  -13.076 -3.488  1.00 0.00 ? 127 GLU A CA   5  
ATOM 9778  C C    . GLU A 1 127 ? 14.125  -13.422 -2.007  1.00 0.00 ? 127 GLU A C    5  
ATOM 9779  O O    . GLU A 1 127 ? 14.732  -14.374 -1.518  1.00 0.00 ? 127 GLU A O    5  
ATOM 9780  C CB   . GLU A 1 127 ? 14.974  -14.214 -4.246  1.00 0.00 ? 127 GLU A CB   5  
ATOM 9781  C CG   . GLU A 1 127 ? 14.090  -15.463 -4.275  1.00 0.00 ? 127 GLU A CG   5  
ATOM 9782  C CD   . GLU A 1 127 ? 12.990  -15.333 -5.329  1.00 0.00 ? 127 GLU A CD   5  
ATOM 9783  O OE1  . GLU A 1 127 ? 12.603  -14.176 -5.605  1.00 0.00 ? 127 GLU A OE1  5  
ATOM 9784  O OE2  . GLU A 1 127 ? 12.560  -16.391 -5.836  1.00 0.00 ? 127 GLU A OE2  5  
ATOM 9785  H H    . GLU A 1 127 ? 15.338  -11.421 -2.782  1.00 0.00 ? 127 GLU A H    5  
ATOM 9786  H HA   . GLU A 1 127 ? 13.311  -12.888 -3.935  1.00 0.00 ? 127 GLU A HA   5  
ATOM 9787  H HB2  . GLU A 1 127 ? 15.195  -13.898 -5.265  1.00 0.00 ? 127 GLU A HB2  5  
ATOM 9788  H HB3  . GLU A 1 127 ? 15.926  -14.450 -3.771  1.00 0.00 ? 127 GLU A HB3  5  
ATOM 9789  H HG2  . GLU A 1 127 ? 14.701  -16.340 -4.489  1.00 0.00 ? 127 GLU A HG2  5  
ATOM 9790  H HG3  . GLU A 1 127 ? 13.643  -15.619 -3.294  1.00 0.00 ? 127 GLU A HG3  5  
ATOM 9791  N N    . CYS A 1 1   ? -12.038 -11.859 0.699   1.00 0.00 ? 1   CYS A N    6  
ATOM 9792  C CA   . CYS A 1 1   ? -10.746 -11.254 0.975   1.00 0.00 ? 1   CYS A CA   6  
ATOM 9793  C C    . CYS A 1 1   ? -10.256 -11.765 2.332   1.00 0.00 ? 1   CYS A C    6  
ATOM 9794  O O    . CYS A 1 1   ? -11.055 -11.986 3.241   1.00 0.00 ? 1   CYS A O    6  
ATOM 9795  C CB   . CYS A 1 1   ? -10.817 -9.726  0.933   1.00 0.00 ? 1   CYS A CB   6  
ATOM 9796  S SG   . CYS A 1 1   ? -10.184 -8.971  -0.610  1.00 0.00 ? 1   CYS A SG   6  
ATOM 9797  H H    . CYS A 1 1   ? -12.669 -11.879 1.474   1.00 0.00 ? 1   CYS A H    6  
ATOM 9798  H HA   . CYS A 1 1   ? -10.074 -11.570 0.177   1.00 0.00 ? 1   CYS A HA   6  
ATOM 9799  H HB2  . CYS A 1 1   ? -11.854 -9.420  1.072   1.00 0.00 ? 1   CYS A HB2  6  
ATOM 9800  H HB3  . CYS A 1 1   ? -10.250 -9.327  1.775   1.00 0.00 ? 1   CYS A HB3  6  
ATOM 9801  N N    . SER A 1 2   ? -8.946  -11.938 2.426   1.00 0.00 ? 2   SER A N    6  
ATOM 9802  C CA   . SER A 1 2   ? -8.340  -12.419 3.654   1.00 0.00 ? 2   SER A CA   6  
ATOM 9803  C C    . SER A 1 2   ? -6.984  -13.059 3.355   1.00 0.00 ? 2   SER A C    6  
ATOM 9804  O O    . SER A 1 2   ? -6.656  -14.112 3.899   1.00 0.00 ? 2   SER A O    6  
ATOM 9805  C CB   . SER A 1 2   ? -9.254  -13.420 4.363   1.00 0.00 ? 2   SER A CB   6  
ATOM 9806  O OG   . SER A 1 2   ? -10.060 -14.153 3.444   1.00 0.00 ? 2   SER A OG   6  
ATOM 9807  H H    . SER A 1 2   ? -8.303  -11.756 1.680   1.00 0.00 ? 2   SER A H    6  
ATOM 9808  H HA   . SER A 1 2   ? -8.216  -11.535 4.281   1.00 0.00 ? 2   SER A HA   6  
ATOM 9809  H HB2  . SER A 1 2   ? -8.648  -14.114 4.947   1.00 0.00 ? 2   SER A HB2  6  
ATOM 9810  H HB3  . SER A 1 2   ? -9.897  -12.890 5.067   1.00 0.00 ? 2   SER A HB3  6  
ATOM 9811  H HG   . SER A 1 2   ? -10.797 -14.619 3.931   1.00 0.00 ? 2   SER A HG   6  
ATOM 9812  N N    . CYS A 1 3   ? -6.230  -12.395 2.489   1.00 0.00 ? 3   CYS A N    6  
ATOM 9813  C CA   . CYS A 1 3   ? -4.917  -12.886 2.111   1.00 0.00 ? 3   CYS A CA   6  
ATOM 9814  C C    . CYS A 1 3   ? -4.018  -12.861 3.349   1.00 0.00 ? 3   CYS A C    6  
ATOM 9815  O O    . CYS A 1 3   ? -4.435  -12.406 4.413   1.00 0.00 ? 3   CYS A O    6  
ATOM 9816  C CB   . CYS A 1 3   ? -4.320  -12.076 0.958   1.00 0.00 ? 3   CYS A CB   6  
ATOM 9817  S SG   . CYS A 1 3   ? -3.633  -13.078 -0.410  1.00 0.00 ? 3   CYS A SG   6  
ATOM 9818  H H    . CYS A 1 3   ? -6.504  -11.539 2.051   1.00 0.00 ? 3   CYS A H    6  
ATOM 9819  H HA   . CYS A 1 3   ? -5.054  -13.906 1.753   1.00 0.00 ? 3   CYS A HA   6  
ATOM 9820  H HB2  . CYS A 1 3   ? -5.093  -11.419 0.556   1.00 0.00 ? 3   CYS A HB2  6  
ATOM 9821  H HB3  . CYS A 1 3   ? -3.532  -11.435 1.353   1.00 0.00 ? 3   CYS A HB3  6  
ATOM 9822  N N    . SER A 1 4   ? -2.803  -13.356 3.170   1.00 0.00 ? 4   SER A N    6  
ATOM 9823  C CA   . SER A 1 4   ? -1.843  -13.397 4.260   1.00 0.00 ? 4   SER A CA   6  
ATOM 9824  C C    . SER A 1 4   ? -0.565  -12.657 3.860   1.00 0.00 ? 4   SER A C    6  
ATOM 9825  O O    . SER A 1 4   ? 0.159   -13.098 2.969   1.00 0.00 ? 4   SER A O    6  
ATOM 9826  C CB   . SER A 1 4   ? -1.518  -14.839 4.655   1.00 0.00 ? 4   SER A CB   6  
ATOM 9827  O OG   . SER A 1 4   ? -0.690  -15.483 3.691   1.00 0.00 ? 4   SER A OG   6  
ATOM 9828  H H    . SER A 1 4   ? -2.472  -13.726 2.301   1.00 0.00 ? 4   SER A H    6  
ATOM 9829  H HA   . SER A 1 4   ? -2.332  -12.894 5.094   1.00 0.00 ? 4   SER A HA   6  
ATOM 9830  H HB2  . SER A 1 4   ? -1.019  -14.846 5.624   1.00 0.00 ? 4   SER A HB2  6  
ATOM 9831  H HB3  . SER A 1 4   ? -2.445  -15.401 4.770   1.00 0.00 ? 4   SER A HB3  6  
ATOM 9832  H HG   . SER A 1 4   ? -1.250  -16.038 3.075   1.00 0.00 ? 4   SER A HG   6  
ATOM 9833  N N    . PRO A 1 5   ? -0.321  -11.514 4.555   1.00 0.00 ? 5   PRO A N    6  
ATOM 9834  C CA   . PRO A 1 5   ? 0.856   -10.707 4.282   1.00 0.00 ? 5   PRO A CA   6  
ATOM 9835  C C    . PRO A 1 5   ? 2.115   -11.365 4.852   1.00 0.00 ? 5   PRO A C    6  
ATOM 9836  O O    . PRO A 1 5   ? 2.138   -11.765 6.015   1.00 0.00 ? 5   PRO A O    6  
ATOM 9837  C CB   . PRO A 1 5   ? 0.559   -9.354  4.904   1.00 0.00 ? 5   PRO A CB   6  
ATOM 9838  C CG   . PRO A 1 5   ? -0.565  -9.589  5.899   1.00 0.00 ? 5   PRO A CG   6  
ATOM 9839  C CD   . PRO A 1 5   ? -1.157  -10.961 5.617   1.00 0.00 ? 5   PRO A CD   6  
ATOM 9840  H HA   . PRO A 1 5   ? 1.007   -10.637 3.295   1.00 0.00 ? 5   PRO A HA   6  
ATOM 9841  H HB2  . PRO A 1 5   ? 1.441   -8.950  5.400   1.00 0.00 ? 5   PRO A HB2  6  
ATOM 9842  H HB3  . PRO A 1 5   ? 0.263   -8.630  4.144   1.00 0.00 ? 5   PRO A HB3  6  
ATOM 9843  H HG2  . PRO A 1 5   ? -0.188  -9.538  6.921   1.00 0.00 ? 5   PRO A HG2  6  
ATOM 9844  H HG3  . PRO A 1 5   ? -1.329  -8.817  5.802   1.00 0.00 ? 5   PRO A HG3  6  
ATOM 9845  H HD2  . PRO A 1 5   ? -1.137  -11.592 6.506   1.00 0.00 ? 5   PRO A HD2  6  
ATOM 9846  H HD3  . PRO A 1 5   ? -2.198  -10.886 5.303   1.00 0.00 ? 5   PRO A HD3  6  
ATOM 9847  N N    . VAL A 1 6   ? 3.131   -11.455 4.006   1.00 0.00 ? 6   VAL A N    6  
ATOM 9848  C CA   . VAL A 1 6   ? 4.390   -12.056 4.411   1.00 0.00 ? 6   VAL A CA   6  
ATOM 9849  C C    . VAL A 1 6   ? 5.521   -11.493 3.548   1.00 0.00 ? 6   VAL A C    6  
ATOM 9850  O O    . VAL A 1 6   ? 5.603   -10.284 3.337   1.00 0.00 ? 6   VAL A O    6  
ATOM 9851  C CB   . VAL A 1 6   ? 4.288   -13.581 4.343   1.00 0.00 ? 6   VAL A CB   6  
ATOM 9852  C CG1  . VAL A 1 6   ? 4.222   -14.062 2.891   1.00 0.00 ? 6   VAL A CG1  6  
ATOM 9853  C CG2  . VAL A 1 6   ? 5.449   -14.244 5.087   1.00 0.00 ? 6   VAL A CG2  6  
ATOM 9854  H H    . VAL A 1 6   ? 3.104   -11.127 3.062   1.00 0.00 ? 6   VAL A H    6  
ATOM 9855  H HA   . VAL A 1 6   ? 4.569   -11.777 5.450   1.00 0.00 ? 6   VAL A HA   6  
ATOM 9856  H HB   . VAL A 1 6   ? 3.362   -13.877 4.836   1.00 0.00 ? 6   VAL A HB   6  
ATOM 9857  H HG11 . VAL A 1 6   ? 4.338   -13.210 2.221   1.00 0.00 ? 6   VAL A HG11 6  
ATOM 9858  H HG12 . VAL A 1 6   ? 5.022   -14.779 2.710   1.00 0.00 ? 6   VAL A HG12 6  
ATOM 9859  H HG13 . VAL A 1 6   ? 3.258   -14.539 2.710   1.00 0.00 ? 6   VAL A HG13 6  
ATOM 9860  H HG21 . VAL A 1 6   ? 6.273   -13.535 5.178   1.00 0.00 ? 6   VAL A HG21 6  
ATOM 9861  H HG22 . VAL A 1 6   ? 5.119   -14.546 6.081   1.00 0.00 ? 6   VAL A HG22 6  
ATOM 9862  H HG23 . VAL A 1 6   ? 5.784   -15.120 4.533   1.00 0.00 ? 6   VAL A HG23 6  
ATOM 9863  N N    . HIS A 1 7   ? 6.364   -12.397 3.070   1.00 0.00 ? 7   HIS A N    6  
ATOM 9864  C CA   . HIS A 1 7   ? 7.486   -12.006 2.235   1.00 0.00 ? 7   HIS A CA   6  
ATOM 9865  C C    . HIS A 1 7   ? 8.028   -10.654 2.702   1.00 0.00 ? 7   HIS A C    6  
ATOM 9866  O O    . HIS A 1 7   ? 7.603   -9.608  2.214   1.00 0.00 ? 7   HIS A O    6  
ATOM 9867  C CB   . HIS A 1 7   ? 7.088   -12.007 0.757   1.00 0.00 ? 7   HIS A CB   6  
ATOM 9868  C CG   . HIS A 1 7   ? 5.634   -11.679 0.512   1.00 0.00 ? 7   HIS A CG   6  
ATOM 9869  N ND1  . HIS A 1 7   ? 4.754   -12.570 -0.076  1.00 0.00 ? 7   HIS A ND1  6  
ATOM 9870  C CD2  . HIS A 1 7   ? 4.917   -10.550 0.783   1.00 0.00 ? 7   HIS A CD2  6  
ATOM 9871  C CE1  . HIS A 1 7   ? 3.564   -11.993 -0.153  1.00 0.00 ? 7   HIS A CE1  6  
ATOM 9872  N NE2  . HIS A 1 7   ? 3.667   -10.742 0.381   1.00 0.00 ? 7   HIS A NE2  6  
ATOM 9873  H H    . HIS A 1 7   ? 6.290   -13.379 3.247   1.00 0.00 ? 7   HIS A H    6  
ATOM 9874  H HA   . HIS A 1 7   ? 8.257   -12.764 2.372   1.00 0.00 ? 7   HIS A HA   6  
ATOM 9875  H HB2  . HIS A 1 7   ? 7.707   -11.284 0.225   1.00 0.00 ? 7   HIS A HB2  6  
ATOM 9876  H HB3  . HIS A 1 7   ? 7.306   -12.986 0.333   1.00 0.00 ? 7   HIS A HB3  6  
ATOM 9877  H HD1  . HIS A 1 7   ? 4.979   -13.492 -0.391  1.00 0.00 ? 7   HIS A HD1  6  
ATOM 9878  H HD2  . HIS A 1 7   ? 5.305   -9.646  1.251   1.00 0.00 ? 7   HIS A HD2  6  
ATOM 9879  H HE1  . HIS A 1 7   ? 2.660   -12.440 -0.567  1.00 0.00 ? 7   HIS A HE1  6  
ATOM 9880  N N    . PRO A 1 8   ? 8.983   -10.721 3.668   1.00 0.00 ? 8   PRO A N    6  
ATOM 9881  C CA   . PRO A 1 8   ? 9.587   -9.515  4.208   1.00 0.00 ? 8   PRO A CA   6  
ATOM 9882  C C    . PRO A 1 8   ? 10.584  -8.910  3.217   1.00 0.00 ? 8   PRO A C    6  
ATOM 9883  O O    . PRO A 1 8   ? 11.229  -7.906  3.514   1.00 0.00 ? 8   PRO A O    6  
ATOM 9884  C CB   . PRO A 1 8   ? 10.237  -9.949  5.512   1.00 0.00 ? 8   PRO A CB   6  
ATOM 9885  C CG   . PRO A 1 8   ? 10.372  -11.461 5.426   1.00 0.00 ? 8   PRO A CG   6  
ATOM 9886  C CD   . PRO A 1 8   ? 9.511   -11.942 4.271   1.00 0.00 ? 8   PRO A CD   6  
ATOM 9887  H HA   . PRO A 1 8   ? 8.890   -8.814  4.356   1.00 0.00 ? 8   PRO A HA   6  
ATOM 9888  H HB2  . PRO A 1 8   ? 11.210  -9.476  5.640   1.00 0.00 ? 8   PRO A HB2  6  
ATOM 9889  H HB3  . PRO A 1 8   ? 9.626   -9.661  6.368   1.00 0.00 ? 8   PRO A HB3  6  
ATOM 9890  H HG2  . PRO A 1 8   ? 11.414  -11.742 5.267   1.00 0.00 ? 8   PRO A HG2  6  
ATOM 9891  H HG3  . PRO A 1 8   ? 10.055  -11.927 6.359   1.00 0.00 ? 8   PRO A HG3  6  
ATOM 9892  H HD2  . PRO A 1 8   ? 10.095  -12.517 3.553   1.00 0.00 ? 8   PRO A HD2  6  
ATOM 9893  H HD3  . PRO A 1 8   ? 8.707   -12.591 4.619   1.00 0.00 ? 8   PRO A HD3  6  
ATOM 9894  N N    . GLN A 1 9   ? 10.678  -9.547  2.059   1.00 0.00 ? 9   GLN A N    6  
ATOM 9895  C CA   . GLN A 1 9   ? 11.585  -9.086  1.022   1.00 0.00 ? 9   GLN A CA   6  
ATOM 9896  C C    . GLN A 1 9   ? 10.907  -9.160  -0.348  1.00 0.00 ? 9   GLN A C    6  
ATOM 9897  O O    . GLN A 1 9   ? 11.034  -8.242  -1.158  1.00 0.00 ? 9   GLN A O    6  
ATOM 9898  C CB   . GLN A 1 9   ? 12.887  -9.888  1.034   1.00 0.00 ? 9   GLN A CB   6  
ATOM 9899  C CG   . GLN A 1 9   ? 13.779  -9.505  -0.149  1.00 0.00 ? 9   GLN A CG   6  
ATOM 9900  C CD   . GLN A 1 9   ? 14.162  -8.025  -0.090  1.00 0.00 ? 9   GLN A CD   6  
ATOM 9901  O OE1  . GLN A 1 9   ? 14.059  -7.292  -1.060  1.00 0.00 ? 9   GLN A OE1  6  
ATOM 9902  N NE2  . GLN A 1 9   ? 14.608  -7.630  1.098   1.00 0.00 ? 9   GLN A NE2  6  
ATOM 9903  H H    . GLN A 1 9   ? 10.150  -10.364 1.825   1.00 0.00 ? 9   GLN A H    6  
ATOM 9904  H HA   . GLN A 1 9   ? 11.804  -8.047  1.271   1.00 0.00 ? 9   GLN A HA   6  
ATOM 9905  H HB2  . GLN A 1 9   ? 13.420  -9.710  1.968   1.00 0.00 ? 9   GLN A HB2  6  
ATOM 9906  H HB3  . GLN A 1 9   ? 12.661  -10.954 0.994   1.00 0.00 ? 9   GLN A HB3  6  
ATOM 9907  H HG2  . GLN A 1 9   ? 14.679  -10.119 -0.144  1.00 0.00 ? 9   GLN A HG2  6  
ATOM 9908  H HG3  . GLN A 1 9   ? 13.257  -9.714  -1.084  1.00 0.00 ? 9   GLN A HG3  6  
ATOM 9909  H HE21 . GLN A 1 9   ? 14.667  -8.282  1.853   1.00 0.00 ? 9   GLN A HE21 6  
ATOM 9910  H HE22 . GLN A 1 9   ? 14.883  -6.677  1.236   1.00 0.00 ? 9   GLN A HE22 6  
ATOM 9911  N N    . GLN A 1 10  ? 10.203  -10.260 -0.564  1.00 0.00 ? 10  GLN A N    6  
ATOM 9912  C CA   . GLN A 1 10  ? 9.505   -10.466 -1.823  1.00 0.00 ? 10  GLN A CA   6  
ATOM 9913  C C    . GLN A 1 10  ? 8.402   -9.419  -1.995  1.00 0.00 ? 10  GLN A C    6  
ATOM 9914  O O    . GLN A 1 10  ? 7.778   -9.338  -3.052  1.00 0.00 ? 10  GLN A O    6  
ATOM 9915  C CB   . GLN A 1 10  ? 8.934   -11.883 -1.907  1.00 0.00 ? 10  GLN A CB   6  
ATOM 9916  C CG   . GLN A 1 10  ? 7.417   -11.853 -2.102  1.00 0.00 ? 10  GLN A CG   6  
ATOM 9917  C CD   . GLN A 1 10  ? 7.056   -11.728 -3.584  1.00 0.00 ? 10  GLN A CD   6  
ATOM 9918  O OE1  . GLN A 1 10  ? 7.902   -11.529 -4.440  1.00 0.00 ? 10  GLN A OE1  6  
ATOM 9919  N NE2  . GLN A 1 10  ? 5.757   -11.854 -3.837  1.00 0.00 ? 10  GLN A NE2  6  
ATOM 9920  H H    . GLN A 1 10  ? 10.105  -11.002 0.099   1.00 0.00 ? 10  GLN A H    6  
ATOM 9921  H HA   . GLN A 1 10  ? 10.260  -10.339 -2.598  1.00 0.00 ? 10  GLN A HA   6  
ATOM 9922  H HB2  . GLN A 1 10  ? 9.400   -12.417 -2.735  1.00 0.00 ? 10  GLN A HB2  6  
ATOM 9923  H HB3  . GLN A 1 10  ? 9.177   -12.431 -0.997  1.00 0.00 ? 10  GLN A HB3  6  
ATOM 9924  H HG2  . GLN A 1 10  ? 6.976   -12.761 -1.692  1.00 0.00 ? 10  GLN A HG2  6  
ATOM 9925  H HG3  . GLN A 1 10  ? 6.992   -11.015 -1.548  1.00 0.00 ? 10  GLN A HG3  6  
ATOM 9926  H HE21 . GLN A 1 10  ? 5.115   -12.015 -3.088  1.00 0.00 ? 10  GLN A HE21 6  
ATOM 9927  H HE22 . GLN A 1 10  ? 5.423   -11.788 -4.777  1.00 0.00 ? 10  GLN A HE22 6  
ATOM 9928  N N    . ALA A 1 11  ? 8.194   -8.646  -0.940  1.00 0.00 ? 11  ALA A N    6  
ATOM 9929  C CA   . ALA A 1 11  ? 7.177   -7.607  -0.962  1.00 0.00 ? 11  ALA A CA   6  
ATOM 9930  C C    . ALA A 1 11  ? 7.749   -6.353  -1.625  1.00 0.00 ? 11  ALA A C    6  
ATOM 9931  O O    . ALA A 1 11  ? 7.024   -5.609  -2.283  1.00 0.00 ? 11  ALA A O    6  
ATOM 9932  C CB   . ALA A 1 11  ? 6.689   -7.342  0.463   1.00 0.00 ? 11  ALA A CB   6  
ATOM 9933  H H    . ALA A 1 11  ? 8.705   -8.718  -0.084  1.00 0.00 ? 11  ALA A H    6  
ATOM 9934  H HA   . ALA A 1 11  ? 6.341   -7.974  -1.557  1.00 0.00 ? 11  ALA A HA   6  
ATOM 9935  H HB1  . ALA A 1 11  ? 7.389   -7.780  1.175   1.00 0.00 ? 11  ALA A HB1  6  
ATOM 9936  H HB2  . ALA A 1 11  ? 6.625   -6.267  0.631   1.00 0.00 ? 11  ALA A HB2  6  
ATOM 9937  H HB3  . ALA A 1 11  ? 5.704   -7.789  0.599   1.00 0.00 ? 11  ALA A HB3  6  
ATOM 9938  N N    . PHE A 1 12  ? 9.045   -6.158  -1.430  1.00 0.00 ? 12  PHE A N    6  
ATOM 9939  C CA   . PHE A 1 12  ? 9.723   -5.006  -2.001  1.00 0.00 ? 12  PHE A CA   6  
ATOM 9940  C C    . PHE A 1 12  ? 10.312  -5.342  -3.373  1.00 0.00 ? 12  PHE A C    6  
ATOM 9941  O O    . PHE A 1 12  ? 10.876  -4.475  -4.039  1.00 0.00 ? 12  PHE A O    6  
ATOM 9942  C CB   . PHE A 1 12  ? 10.860  -4.637  -1.047  1.00 0.00 ? 12  PHE A CB   6  
ATOM 9943  C CG   . PHE A 1 12  ? 10.389  -4.160  0.328   1.00 0.00 ? 12  PHE A CG   6  
ATOM 9944  C CD1  . PHE A 1 12  ? 9.528   -4.922  1.054   1.00 0.00 ? 12  PHE A CD1  6  
ATOM 9945  C CD2  . PHE A 1 12  ? 10.830  -2.973  0.824   1.00 0.00 ? 12  PHE A CD2  6  
ATOM 9946  C CE1  . PHE A 1 12  ? 9.090   -4.480  2.331   1.00 0.00 ? 12  PHE A CE1  6  
ATOM 9947  C CE2  . PHE A 1 12  ? 10.392  -2.530  2.100   1.00 0.00 ? 12  PHE A CE2  6  
ATOM 9948  C CZ   . PHE A 1 12  ? 9.532   -3.293  2.827   1.00 0.00 ? 12  PHE A CZ   6  
ATOM 9949  H H    . PHE A 1 12  ? 9.629   -6.768  -0.894  1.00 0.00 ? 12  PHE A H    6  
ATOM 9950  H HA   . PHE A 1 12  ? 8.981   -4.215  -2.110  1.00 0.00 ? 12  PHE A HA   6  
ATOM 9951  H HB2  . PHE A 1 12  ? 11.508  -5.504  -0.917  1.00 0.00 ? 12  PHE A HB2  6  
ATOM 9952  H HB3  . PHE A 1 12  ? 11.465  -3.854  -1.504  1.00 0.00 ? 12  PHE A HB3  6  
ATOM 9953  H HD1  . PHE A 1 12  ? 9.174   -5.873  0.656   1.00 0.00 ? 12  PHE A HD1  6  
ATOM 9954  H HD2  . PHE A 1 12  ? 11.520  -2.361  0.242   1.00 0.00 ? 12  PHE A HD2  6  
ATOM 9955  H HE1  . PHE A 1 12  ? 8.400   -5.091  2.912   1.00 0.00 ? 12  PHE A HE1  6  
ATOM 9956  H HE2  . PHE A 1 12  ? 10.746  -1.579  2.498   1.00 0.00 ? 12  PHE A HE2  6  
ATOM 9957  H HZ   . PHE A 1 12  ? 9.196   -2.952  3.806   1.00 0.00 ? 12  PHE A HZ   6  
ATOM 9958  N N    . CYS A 1 13  ? 10.161  -6.601  -3.754  1.00 0.00 ? 13  CYS A N    6  
ATOM 9959  C CA   . CYS A 1 13  ? 10.672  -7.062  -5.034  1.00 0.00 ? 13  CYS A CA   6  
ATOM 9960  C C    . CYS A 1 13  ? 9.489   -7.230  -5.991  1.00 0.00 ? 13  CYS A C    6  
ATOM 9961  O O    . CYS A 1 13  ? 9.679   -7.438  -7.188  1.00 0.00 ? 13  CYS A O    6  
ATOM 9962  C CB   . CYS A 1 13  ? 11.477  -8.355  -4.890  1.00 0.00 ? 13  CYS A CB   6  
ATOM 9963  S SG   . CYS A 1 13  ? 13.242  -8.119  -4.468  1.00 0.00 ? 13  CYS A SG   6  
ATOM 9964  H H    . CYS A 1 13  ? 9.701   -7.301  -3.206  1.00 0.00 ? 13  CYS A H    6  
ATOM 9965  H HA   . CYS A 1 13  ? 11.355  -6.293  -5.394  1.00 0.00 ? 13  CYS A HA   6  
ATOM 9966  H HB2  . CYS A 1 13  ? 11.013  -8.972  -4.119  1.00 0.00 ? 13  CYS A HB2  6  
ATOM 9967  H HB3  . CYS A 1 13  ? 11.413  -8.913  -5.824  1.00 0.00 ? 13  CYS A HB3  6  
ATOM 9968  N N    . ASN A 1 14  ? 8.295   -7.132  -5.426  1.00 0.00 ? 14  ASN A N    6  
ATOM 9969  C CA   . ASN A 1 14  ? 7.082   -7.270  -6.214  1.00 0.00 ? 14  ASN A CA   6  
ATOM 9970  C C    . ASN A 1 14  ? 6.470   -5.887  -6.447  1.00 0.00 ? 14  ASN A C    6  
ATOM 9971  O O    . ASN A 1 14  ? 6.004   -5.588  -7.547  1.00 0.00 ? 14  ASN A O    6  
ATOM 9972  C CB   . ASN A 1 14  ? 6.045   -8.127  -5.485  1.00 0.00 ? 14  ASN A CB   6  
ATOM 9973  C CG   . ASN A 1 14  ? 5.542   -9.261  -6.381  1.00 0.00 ? 14  ASN A CG   6  
ATOM 9974  O OD1  . ASN A 1 14  ? 4.521   -9.158  -7.040  1.00 0.00 ? 14  ASN A OD1  6  
ATOM 9975  N ND2  . ASN A 1 14  ? 6.314   -10.343 -6.369  1.00 0.00 ? 14  ASN A ND2  6  
ATOM 9976  H H    . ASN A 1 14  ? 8.149   -6.962  -4.452  1.00 0.00 ? 14  ASN A H    6  
ATOM 9977  H HA   . ASN A 1 14  ? 7.396   -7.749  -7.141  1.00 0.00 ? 14  ASN A HA   6  
ATOM 9978  H HB2  . ASN A 1 14  ? 6.485   -8.544  -4.578  1.00 0.00 ? 14  ASN A HB2  6  
ATOM 9979  H HB3  . ASN A 1 14  ? 5.206   -7.505  -5.174  1.00 0.00 ? 14  ASN A HB3  6  
ATOM 9980  H HD21 . ASN A 1 14  ? 7.141   -10.362 -5.805  1.00 0.00 ? 14  ASN A HD21 6  
ATOM 9981  H HD22 . ASN A 1 14  ? 6.069   -11.138 -6.923  1.00 0.00 ? 14  ASN A HD22 6  
ATOM 9982  N N    . ALA A 1 15  ? 6.493   -5.080  -5.397  1.00 0.00 ? 15  ALA A N    6  
ATOM 9983  C CA   . ALA A 1 15  ? 5.947   -3.735  -5.474  1.00 0.00 ? 15  ALA A CA   6  
ATOM 9984  C C    . ALA A 1 15  ? 6.583   -2.998  -6.654  1.00 0.00 ? 15  ALA A C    6  
ATOM 9985  O O    . ALA A 1 15  ? 7.501   -3.513  -7.290  1.00 0.00 ? 15  ALA A O    6  
ATOM 9986  C CB   . ALA A 1 15  ? 6.176   -3.014  -4.145  1.00 0.00 ? 15  ALA A CB   6  
ATOM 9987  H H    . ALA A 1 15  ? 6.874   -5.330  -4.507  1.00 0.00 ? 15  ALA A H    6  
ATOM 9988  H HA   . ALA A 1 15  ? 4.875   -3.823  -5.646  1.00 0.00 ? 15  ALA A HA   6  
ATOM 9989  H HB1  . ALA A 1 15  ? 7.232   -3.066  -3.880  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 9990  H HB2  . ALA A 1 15  ? 5.875   -1.971  -4.241  1.00 0.00 ? 15  ALA A HB2  6  
ATOM 9991  H HB3  . ALA A 1 15  ? 5.583   -3.493  -3.365  1.00 0.00 ? 15  ALA A HB3  6  
ATOM 9992  N N    . ASP A 1 16  ? 6.069   -1.804  -6.912  1.00 0.00 ? 16  ASP A N    6  
ATOM 9993  C CA   . ASP A 1 16  ? 6.575   -0.991  -8.004  1.00 0.00 ? 16  ASP A CA   6  
ATOM 9994  C C    . ASP A 1 16  ? 6.307   0.484   -7.703  1.00 0.00 ? 16  ASP A C    6  
ATOM 9995  O O    . ASP A 1 16  ? 6.361   1.325   -8.599  1.00 0.00 ? 16  ASP A O    6  
ATOM 9996  C CB   . ASP A 1 16  ? 5.876   -1.340  -9.320  1.00 0.00 ? 16  ASP A CB   6  
ATOM 9997  C CG   . ASP A 1 16  ? 6.581   -2.404  -10.164 1.00 0.00 ? 16  ASP A CG   6  
ATOM 9998  O OD1  . ASP A 1 16  ? 6.802   -3.506  -9.619  1.00 0.00 ? 16  ASP A OD1  6  
ATOM 9999  O OD2  . ASP A 1 16  ? 6.883   -2.089  -11.336 1.00 0.00 ? 16  ASP A OD2  6  
ATOM 10000 H H    . ASP A 1 16  ? 5.322   -1.393  -6.390  1.00 0.00 ? 16  ASP A H    6  
ATOM 10001 H HA   . ASP A 1 16  ? 7.639   -1.218  -8.061  1.00 0.00 ? 16  ASP A HA   6  
ATOM 10002 H HB2  . ASP A 1 16  ? 4.866   -1.685  -9.097  1.00 0.00 ? 16  ASP A HB2  6  
ATOM 10003 H HB3  . ASP A 1 16  ? 5.779   -0.431  -9.914  1.00 0.00 ? 16  ASP A HB3  6  
ATOM 10004 N N    . VAL A 1 17  ? 6.023   0.754   -6.437  1.00 0.00 ? 17  VAL A N    6  
ATOM 10005 C CA   . VAL A 1 17  ? 5.746   2.114   -6.006  1.00 0.00 ? 17  VAL A CA   6  
ATOM 10006 C C    . VAL A 1 17  ? 5.809   2.184   -4.479  1.00 0.00 ? 17  VAL A C    6  
ATOM 10007 O O    . VAL A 1 17  ? 4.780   2.127   -3.808  1.00 0.00 ? 17  VAL A O    6  
ATOM 10008 C CB   . VAL A 1 17  ? 4.401   2.579   -6.571  1.00 0.00 ? 17  VAL A CB   6  
ATOM 10009 C CG1  . VAL A 1 17  ? 3.255   1.721   -6.030  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 10010 C CG2  . VAL A 1 17  ? 4.165   4.061   -6.275  1.00 0.00 ? 17  VAL A CG2  6  
ATOM 10011 H H    . VAL A 1 17  ? 5.982   0.066   -5.713  1.00 0.00 ? 17  VAL A H    6  
ATOM 10012 H HA   . VAL A 1 17  ? 6.525   2.756   -6.420  1.00 0.00 ? 17  VAL A HA   6  
ATOM 10013 H HB   . VAL A 1 17  ? 4.431   2.454   -7.653  1.00 0.00 ? 17  VAL A HB   6  
ATOM 10014 H HG11 . VAL A 1 17  ? 3.558   0.675   -6.017  1.00 0.00 ? 17  VAL A HG11 6  
ATOM 10015 H HG12 . VAL A 1 17  ? 3.009   2.041   -5.017  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 10016 H HG13 . VAL A 1 17  ? 2.381   1.838   -6.670  1.00 0.00 ? 17  VAL A HG13 6  
ATOM 10017 H HG21 . VAL A 1 17  ? 5.122   4.581   -6.237  1.00 0.00 ? 17  VAL A HG21 6  
ATOM 10018 H HG22 . VAL A 1 17  ? 3.546   4.494   -7.060  1.00 0.00 ? 17  VAL A HG22 6  
ATOM 10019 H HG23 . VAL A 1 17  ? 3.658   4.164   -5.315  1.00 0.00 ? 17  VAL A HG23 6  
ATOM 10020 N N    . VAL A 1 18  ? 7.028   2.306   -3.974  1.00 0.00 ? 18  VAL A N    6  
ATOM 10021 C CA   . VAL A 1 18  ? 7.239   2.385   -2.539  1.00 0.00 ? 18  VAL A CA   6  
ATOM 10022 C C    . VAL A 1 18  ? 7.344   3.853   -2.122  1.00 0.00 ? 18  VAL A C    6  
ATOM 10023 O O    . VAL A 1 18  ? 8.238   4.568   -2.575  1.00 0.00 ? 18  VAL A O    6  
ATOM 10024 C CB   . VAL A 1 18  ? 8.468   1.562   -2.145  1.00 0.00 ? 18  VAL A CB   6  
ATOM 10025 C CG1  . VAL A 1 18  ? 8.277   0.915   -0.772  1.00 0.00 ? 18  VAL A CG1  6  
ATOM 10026 C CG2  . VAL A 1 18  ? 8.786   0.508   -3.208  1.00 0.00 ? 18  VAL A CG2  6  
ATOM 10027 H H    . VAL A 1 18  ? 7.860   2.352   -4.527  1.00 0.00 ? 18  VAL A H    6  
ATOM 10028 H HA   . VAL A 1 18  ? 6.369   1.944   -2.054  1.00 0.00 ? 18  VAL A HA   6  
ATOM 10029 H HB   . VAL A 1 18  ? 9.319   2.239   -2.081  1.00 0.00 ? 18  VAL A HB   6  
ATOM 10030 H HG11 . VAL A 1 18  ? 7.221   0.941   -0.501  1.00 0.00 ? 18  VAL A HG11 6  
ATOM 10031 H HG12 . VAL A 1 18  ? 8.618   -0.119  -0.807  1.00 0.00 ? 18  VAL A HG12 6  
ATOM 10032 H HG13 . VAL A 1 18  ? 8.856   1.464   -0.028  1.00 0.00 ? 18  VAL A HG13 6  
ATOM 10033 H HG21 . VAL A 1 18  ? 8.007   0.515   -3.970  1.00 0.00 ? 18  VAL A HG21 6  
ATOM 10034 H HG22 . VAL A 1 18  ? 9.747   0.735   -3.668  1.00 0.00 ? 18  VAL A HG22 6  
ATOM 10035 H HG23 . VAL A 1 18  ? 8.828   -0.477  -2.742  1.00 0.00 ? 18  VAL A HG23 6  
ATOM 10036 N N    . ILE A 1 19  ? 6.421   4.259   -1.264  1.00 0.00 ? 19  ILE A N    6  
ATOM 10037 C CA   . ILE A 1 19  ? 6.398   5.630   -0.781  1.00 0.00 ? 19  ILE A CA   6  
ATOM 10038 C C    . ILE A 1 19  ? 5.942   5.644   0.678   1.00 0.00 ? 19  ILE A C    6  
ATOM 10039 O O    . ILE A 1 19  ? 4.866   5.142   1.001   1.00 0.00 ? 19  ILE A O    6  
ATOM 10040 C CB   . ILE A 1 19  ? 5.548   6.507   -1.701  1.00 0.00 ? 19  ILE A CB   6  
ATOM 10041 C CG1  . ILE A 1 19  ? 4.058   6.229   -1.501  1.00 0.00 ? 19  ILE A CG1  6  
ATOM 10042 C CG2  . ILE A 1 19  ? 5.971   6.343   -3.162  1.00 0.00 ? 19  ILE A CG2  6  
ATOM 10043 C CD1  . ILE A 1 19  ? 3.270   6.511   -2.782  1.00 0.00 ? 19  ILE A CD1  6  
ATOM 10044 H H    . ILE A 1 19  ? 5.699   3.671   -0.901  1.00 0.00 ? 19  ILE A H    6  
ATOM 10045 H HA   . ILE A 1 19  ? 7.420   6.008   -0.827  1.00 0.00 ? 19  ILE A HA   6  
ATOM 10046 H HB   . ILE A 1 19  ? 5.720   7.550   -1.432  1.00 0.00 ? 19  ILE A HB   6  
ATOM 10047 H HG12 . ILE A 1 19  ? 3.915   5.189   -1.204  1.00 0.00 ? 19  ILE A HG12 6  
ATOM 10048 H HG13 . ILE A 1 19  ? 3.673   6.847   -0.689  1.00 0.00 ? 19  ILE A HG13 6  
ATOM 10049 H HG21 . ILE A 1 19  ? 7.053   6.449   -3.241  1.00 0.00 ? 19  ILE A HG21 6  
ATOM 10050 H HG22 . ILE A 1 19  ? 5.675   5.356   -3.517  1.00 0.00 ? 19  ILE A HG22 6  
ATOM 10051 H HG23 . ILE A 1 19  ? 5.487   7.108   -3.769  1.00 0.00 ? 19  ILE A HG23 6  
ATOM 10052 H HD11 . ILE A 1 19  ? 3.615   7.447   -3.221  1.00 0.00 ? 19  ILE A HD11 6  
ATOM 10053 H HD12 . ILE A 1 19  ? 3.425   5.698   -3.491  1.00 0.00 ? 19  ILE A HD12 6  
ATOM 10054 H HD13 . ILE A 1 19  ? 2.209   6.590   -2.546  1.00 0.00 ? 19  ILE A HD13 6  
ATOM 10055 N N    . ARG A 1 20  ? 6.781   6.225   1.523   1.00 0.00 ? 20  ARG A N    6  
ATOM 10056 C CA   . ARG A 1 20  ? 6.477   6.311   2.941   1.00 0.00 ? 20  ARG A CA   6  
ATOM 10057 C C    . ARG A 1 20  ? 5.414   7.383   3.192   1.00 0.00 ? 20  ARG A C    6  
ATOM 10058 O O    . ARG A 1 20  ? 5.492   8.123   4.171   1.00 0.00 ? 20  ARG A O    6  
ATOM 10059 C CB   . ARG A 1 20  ? 7.729   6.645   3.754   1.00 0.00 ? 20  ARG A CB   6  
ATOM 10060 C CG   . ARG A 1 20  ? 8.900   5.748   3.350   1.00 0.00 ? 20  ARG A CG   6  
ATOM 10061 C CD   . ARG A 1 20  ? 10.239  6.442   3.612   1.00 0.00 ? 20  ARG A CD   6  
ATOM 10062 N NE   . ARG A 1 20  ? 10.152  7.258   4.844   1.00 0.00 ? 20  ARG A NE   6  
ATOM 10063 C CZ   . ARG A 1 20  ? 11.213  7.641   5.567   1.00 0.00 ? 20  ARG A CZ   6  
ATOM 10064 N NH1  . ARG A 1 20  ? 12.448  7.284   5.186   1.00 0.00 ? 20  ARG A NH1  6  
ATOM 10065 N NH2  . ARG A 1 20  ? 11.041  8.380   6.671   1.00 0.00 ? 20  ARG A NH2  6  
ATOM 10066 H H    . ARG A 1 20  ? 7.654   6.631   1.253   1.00 0.00 ? 20  ARG A H    6  
ATOM 10067 H HA   . ARG A 1 20  ? 6.105   5.321   3.208   1.00 0.00 ? 20  ARG A HA   6  
ATOM 10068 H HB2  . ARG A 1 20  ? 7.998   7.691   3.602   1.00 0.00 ? 20  ARG A HB2  6  
ATOM 10069 H HB3  . ARG A 1 20  ? 7.521   6.521   4.817   1.00 0.00 ? 20  ARG A HB3  6  
ATOM 10070 H HG2  . ARG A 1 20  ? 8.856   4.812   3.907   1.00 0.00 ? 20  ARG A HG2  6  
ATOM 10071 H HG3  . ARG A 1 20  ? 8.820   5.493   2.293   1.00 0.00 ? 20  ARG A HG3  6  
ATOM 10072 H HD2  . ARG A 1 20  ? 11.029  5.698   3.714   1.00 0.00 ? 20  ARG A HD2  6  
ATOM 10073 H HD3  . ARG A 1 20  ? 10.503  7.074   2.765   1.00 0.00 ? 20  ARG A HD3  6  
ATOM 10074 H HE   . ARG A 1 20  ? 9.245   7.540   5.158   1.00 0.00 ? 20  ARG A HE   6  
ATOM 10075 H HH11 . ARG A 1 20  ? 12.577  6.733   4.363   1.00 0.00 ? 20  ARG A HH11 6  
ATOM 10076 H HH12 . ARG A 1 20  ? 13.240  7.571   5.726   1.00 0.00 ? 20  ARG A HH12 6  
ATOM 10077 H HH21 . ARG A 1 20  ? 10.119  8.646   6.956   1.00 0.00 ? 20  ARG A HH21 6  
ATOM 10078 H HH22 . ARG A 1 20  ? 11.832  8.666   7.211   1.00 0.00 ? 20  ARG A HH22 6  
ATOM 10079 N N    . THR A 1 21  ? 4.445   7.433   2.288   1.00 0.00 ? 21  THR A N    6  
ATOM 10080 C CA   . THR A 1 21  ? 3.368   8.402   2.399   1.00 0.00 ? 21  THR A CA   6  
ATOM 10081 C C    . THR A 1 21  ? 2.593   8.191   3.701   1.00 0.00 ? 21  THR A C    6  
ATOM 10082 O O    . THR A 1 21  ? 2.836   7.226   4.423   1.00 0.00 ? 21  THR A O    6  
ATOM 10083 C CB   . THR A 1 21  ? 2.497   8.285   1.147   1.00 0.00 ? 21  THR A CB   6  
ATOM 10084 O OG1  . THR A 1 21  ? 1.343   9.065   1.452   1.00 0.00 ? 21  THR A OG1  6  
ATOM 10085 C CG2  . THR A 1 21  ? 1.947   6.871   0.946   1.00 0.00 ? 21  THR A CG2  6  
ATOM 10086 H H    . THR A 1 21  ? 4.389   6.828   1.495   1.00 0.00 ? 21  THR A H    6  
ATOM 10087 H HA   . THR A 1 21  ? 3.806   9.399   2.446   1.00 0.00 ? 21  THR A HA   6  
ATOM 10088 H HB   . THR A 1 21  ? 3.038   8.622   0.264   1.00 0.00 ? 21  THR A HB   6  
ATOM 10089 H HG1  . THR A 1 21  ? 1.598   10.027  1.549   1.00 0.00 ? 21  THR A HG1  6  
ATOM 10090 H HG21 . THR A 1 21  ? 2.729   6.144   1.165   1.00 0.00 ? 21  THR A HG21 6  
ATOM 10091 H HG22 . THR A 1 21  ? 1.103   6.710   1.615   1.00 0.00 ? 21  THR A HG22 6  
ATOM 10092 H HG23 . THR A 1 21  ? 1.620   6.752   -0.087  1.00 0.00 ? 21  THR A HG23 6  
ATOM 10093 N N    . LYS A 1 22  ? 1.674   9.110   3.961   1.00 0.00 ? 22  LYS A N    6  
ATOM 10094 C CA   . LYS A 1 22  ? 0.862   9.037   5.163   1.00 0.00 ? 22  LYS A CA   6  
ATOM 10095 C C    . LYS A 1 22  ? -0.615  9.171   4.785   1.00 0.00 ? 22  LYS A C    6  
ATOM 10096 O O    . LYS A 1 22  ? -1.028  10.190  4.233   1.00 0.00 ? 22  LYS A O    6  
ATOM 10097 C CB   . LYS A 1 22  ? 1.329   10.071  6.190   1.00 0.00 ? 22  LYS A CB   6  
ATOM 10098 C CG   . LYS A 1 22  ? 1.109   11.493  5.675   1.00 0.00 ? 22  LYS A CG   6  
ATOM 10099 C CD   . LYS A 1 22  ? 1.379   12.523  6.774   1.00 0.00 ? 22  LYS A CD   6  
ATOM 10100 C CE   . LYS A 1 22  ? 0.738   12.094  8.096   1.00 0.00 ? 22  LYS A CE   6  
ATOM 10101 N NZ   . LYS A 1 22  ? 0.723   13.222  9.054   1.00 0.00 ? 22  LYS A NZ   6  
ATOM 10102 H H    . LYS A 1 22  ? 1.483   9.893   3.368   1.00 0.00 ? 22  LYS A H    6  
ATOM 10103 H HA   . LYS A 1 22  ? 1.017   8.052   5.604   1.00 0.00 ? 22  LYS A HA   6  
ATOM 10104 H HB2  . LYS A 1 22  ? 0.788   9.931   7.125   1.00 0.00 ? 22  LYS A HB2  6  
ATOM 10105 H HB3  . LYS A 1 22  ? 2.387   9.918   6.408   1.00 0.00 ? 22  LYS A HB3  6  
ATOM 10106 H HG2  . LYS A 1 22  ? 1.766   11.683  4.825   1.00 0.00 ? 22  LYS A HG2  6  
ATOM 10107 H HG3  . LYS A 1 22  ? 0.086   11.600  5.315   1.00 0.00 ? 22  LYS A HG3  6  
ATOM 10108 H HD2  . LYS A 1 22  ? 2.454   12.642  6.910   1.00 0.00 ? 22  LYS A HD2  6  
ATOM 10109 H HD3  . LYS A 1 22  ? 0.986   13.494  6.473   1.00 0.00 ? 22  LYS A HD3  6  
ATOM 10110 H HE2  . LYS A 1 22  ? -0.279  11.748  7.917   1.00 0.00 ? 22  LYS A HE2  6  
ATOM 10111 H HE3  . LYS A 1 22  ? 1.290   11.256  8.520   1.00 0.00 ? 22  LYS A HE3  6  
ATOM 10112 H HZ1  . LYS A 1 22  ? 0.360   14.038  8.604   1.00 0.00 ? 22  LYS A HZ1  6  
ATOM 10113 H HZ2  . LYS A 1 22  ? 0.144   12.988  9.836   1.00 0.00 ? 22  LYS A HZ2  6  
ATOM 10114 H HZ3  . LYS A 1 22  ? 1.654   13.403  9.371   1.00 0.00 ? 22  LYS A HZ3  6  
ATOM 10115 N N    . ALA A 1 23  ? -1.369  8.128   5.095   1.00 0.00 ? 23  ALA A N    6  
ATOM 10116 C CA   . ALA A 1 23  ? -2.791  8.116   4.794   1.00 0.00 ? 23  ALA A CA   6  
ATOM 10117 C C    . ALA A 1 23  ? -3.565  8.687   5.985   1.00 0.00 ? 23  ALA A C    6  
ATOM 10118 O O    . ALA A 1 23  ? -3.746  8.008   6.994   1.00 0.00 ? 23  ALA A O    6  
ATOM 10119 C CB   . ALA A 1 23  ? -3.227  6.693   4.444   1.00 0.00 ? 23  ALA A CB   6  
ATOM 10120 H H    . ALA A 1 23  ? -1.026  7.302   5.543   1.00 0.00 ? 23  ALA A H    6  
ATOM 10121 H HA   . ALA A 1 23  ? -2.952  8.757   3.927   1.00 0.00 ? 23  ALA A HA   6  
ATOM 10122 H HB1  . ALA A 1 23  ? -2.666  6.343   3.578   1.00 0.00 ? 23  ALA A HB1  6  
ATOM 10123 H HB2  . ALA A 1 23  ? -3.035  6.034   5.291   1.00 0.00 ? 23  ALA A HB2  6  
ATOM 10124 H HB3  . ALA A 1 23  ? -4.294  6.686   4.213   1.00 0.00 ? 23  ALA A HB3  6  
ATOM 10125 N N    . VAL A 1 24  ? -4.000  9.929   5.826   1.00 0.00 ? 24  VAL A N    6  
ATOM 10126 C CA   . VAL A 1 24  ? -4.749  10.599  6.876   1.00 0.00 ? 24  VAL A CA   6  
ATOM 10127 C C    . VAL A 1 24  ? -6.228  10.644  6.490   1.00 0.00 ? 24  VAL A C    6  
ATOM 10128 O O    . VAL A 1 24  ? -7.102  10.533  7.349   1.00 0.00 ? 24  VAL A O    6  
ATOM 10129 C CB   . VAL A 1 24  ? -4.157  11.984  7.139   1.00 0.00 ? 24  VAL A CB   6  
ATOM 10130 C CG1  . VAL A 1 24  ? -2.956  11.897  8.084   1.00 0.00 ? 24  VAL A CG1  6  
ATOM 10131 C CG2  . VAL A 1 24  ? -3.774  12.675  5.828   1.00 0.00 ? 24  VAL A CG2  6  
ATOM 10132 H H    . VAL A 1 24  ? -3.847  10.474  5.002   1.00 0.00 ? 24  VAL A H    6  
ATOM 10133 H HA   . VAL A 1 24  ? -4.641  10.007  7.785   1.00 0.00 ? 24  VAL A HA   6  
ATOM 10134 H HB   . VAL A 1 24  ? -4.923  12.589  7.625   1.00 0.00 ? 24  VAL A HB   6  
ATOM 10135 H HG11 . VAL A 1 24  ? -2.195  11.254  7.645   1.00 0.00 ? 24  VAL A HG11 6  
ATOM 10136 H HG12 . VAL A 1 24  ? -2.544  12.894  8.240   1.00 0.00 ? 24  VAL A HG12 6  
ATOM 10137 H HG13 . VAL A 1 24  ? -3.277  11.482  9.040   1.00 0.00 ? 24  VAL A HG13 6  
ATOM 10138 H HG21 . VAL A 1 24  ? -4.526  12.458  5.071   1.00 0.00 ? 24  VAL A HG21 6  
ATOM 10139 H HG22 . VAL A 1 24  ? -3.719  13.752  5.988   1.00 0.00 ? 24  VAL A HG22 6  
ATOM 10140 H HG23 . VAL A 1 24  ? -2.804  12.308  5.494   1.00 0.00 ? 24  VAL A HG23 6  
ATOM 10141 N N    . SER A 1 25  ? -6.465  10.807  5.196   1.00 0.00 ? 25  SER A N    6  
ATOM 10142 C CA   . SER A 1 25  ? -7.824  10.869  4.685   1.00 0.00 ? 25  SER A CA   6  
ATOM 10143 C C    . SER A 1 25  ? -8.079  9.701   3.730   1.00 0.00 ? 25  SER A C    6  
ATOM 10144 O O    . SER A 1 25  ? -7.147  8.995   3.345   1.00 0.00 ? 25  SER A O    6  
ATOM 10145 C CB   . SER A 1 25  ? -8.087  12.200  3.978   1.00 0.00 ? 25  SER A CB   6  
ATOM 10146 O OG   . SER A 1 25  ? -9.191  12.119  3.081   1.00 0.00 ? 25  SER A OG   6  
ATOM 10147 H H    . SER A 1 25  ? -5.749  10.897  4.504   1.00 0.00 ? 25  SER A H    6  
ATOM 10148 H HA   . SER A 1 25  ? -8.466  10.792  5.564   1.00 0.00 ? 25  SER A HA   6  
ATOM 10149 H HB2  . SER A 1 25  ? -8.281  12.973  4.722   1.00 0.00 ? 25  SER A HB2  6  
ATOM 10150 H HB3  . SER A 1 25  ? -7.196  12.501  3.430   1.00 0.00 ? 25  SER A HB3  6  
ATOM 10151 H HG   . SER A 1 25  ? -9.013  11.426  2.382   1.00 0.00 ? 25  SER A HG   6  
ATOM 10152 N N    . GLU A 1 26  ? -9.344  9.532   3.376   1.00 0.00 ? 26  GLU A N    6  
ATOM 10153 C CA   . GLU A 1 26  ? -9.731  8.462   2.473   1.00 0.00 ? 26  GLU A CA   6  
ATOM 10154 C C    . GLU A 1 26  ? -10.969 8.867   1.671   1.00 0.00 ? 26  GLU A C    6  
ATOM 10155 O O    . GLU A 1 26  ? -11.464 9.985   1.807   1.00 0.00 ? 26  GLU A O    6  
ATOM 10156 C CB   . GLU A 1 26  ? -9.976  7.160   3.239   1.00 0.00 ? 26  GLU A CB   6  
ATOM 10157 C CG   . GLU A 1 26  ? -8.653  6.488   3.614   1.00 0.00 ? 26  GLU A CG   6  
ATOM 10158 C CD   . GLU A 1 26  ? -8.372  6.630   5.111   1.00 0.00 ? 26  GLU A CD   6  
ATOM 10159 O OE1  . GLU A 1 26  ? -9.104  5.984   5.891   1.00 0.00 ? 26  GLU A OE1  6  
ATOM 10160 O OE2  . GLU A 1 26  ? -7.429  7.382   5.443   1.00 0.00 ? 26  GLU A OE2  6  
ATOM 10161 H H    . GLU A 1 26  ? -10.095 10.110  3.695   1.00 0.00 ? 26  GLU A H    6  
ATOM 10162 H HA   . GLU A 1 26  ? -8.883  8.327   1.802   1.00 0.00 ? 26  GLU A HA   6  
ATOM 10163 H HB2  . GLU A 1 26  ? -10.551 7.367   4.141   1.00 0.00 ? 26  GLU A HB2  6  
ATOM 10164 H HB3  . GLU A 1 26  ? -10.573 6.481   2.630   1.00 0.00 ? 26  GLU A HB3  6  
ATOM 10165 H HG2  . GLU A 1 26  ? -8.689  5.433   3.346   1.00 0.00 ? 26  GLU A HG2  6  
ATOM 10166 H HG3  . GLU A 1 26  ? -7.839  6.935   3.043   1.00 0.00 ? 26  GLU A HG3  6  
ATOM 10167 N N    . LYS A 1 27  ? -11.436 7.935   0.853   1.00 0.00 ? 27  LYS A N    6  
ATOM 10168 C CA   . LYS A 1 27  ? -12.606 8.181   0.028   1.00 0.00 ? 27  LYS A CA   6  
ATOM 10169 C C    . LYS A 1 27  ? -13.363 6.867   -0.180  1.00 0.00 ? 27  LYS A C    6  
ATOM 10170 O O    . LYS A 1 27  ? -12.881 5.973   -0.874  1.00 0.00 ? 27  LYS A O    6  
ATOM 10171 C CB   . LYS A 1 27  ? -12.208 8.875   -1.276  1.00 0.00 ? 27  LYS A CB   6  
ATOM 10172 C CG   . LYS A 1 27  ? -13.445 9.275   -2.084  1.00 0.00 ? 27  LYS A CG   6  
ATOM 10173 C CD   . LYS A 1 27  ? -13.204 10.581  -2.843  1.00 0.00 ? 27  LYS A CD   6  
ATOM 10174 C CE   . LYS A 1 27  ? -11.867 10.546  -3.587  1.00 0.00 ? 27  LYS A CE   6  
ATOM 10175 N NZ   . LYS A 1 27  ? -11.718 11.745  -4.443  1.00 0.00 ? 27  LYS A NZ   6  
ATOM 10176 H H    . LYS A 1 27  ? -11.028 7.028   0.747   1.00 0.00 ? 27  LYS A H    6  
ATOM 10177 H HA   . LYS A 1 27  ? -13.252 8.869   0.574   1.00 0.00 ? 27  LYS A HA   6  
ATOM 10178 H HB2  . LYS A 1 27  ? -11.612 9.760   -1.054  1.00 0.00 ? 27  LYS A HB2  6  
ATOM 10179 H HB3  . LYS A 1 27  ? -11.581 8.209   -1.869  1.00 0.00 ? 27  LYS A HB3  6  
ATOM 10180 H HG2  . LYS A 1 27  ? -13.694 8.482   -2.789  1.00 0.00 ? 27  LYS A HG2  6  
ATOM 10181 H HG3  . LYS A 1 27  ? -14.298 9.390   -1.416  1.00 0.00 ? 27  LYS A HG3  6  
ATOM 10182 H HD2  . LYS A 1 27  ? -14.015 10.749  -3.553  1.00 0.00 ? 27  LYS A HD2  6  
ATOM 10183 H HD3  . LYS A 1 27  ? -13.212 11.419  -2.145  1.00 0.00 ? 27  LYS A HD3  6  
ATOM 10184 H HE2  . LYS A 1 27  ? -11.047 10.497  -2.872  1.00 0.00 ? 27  LYS A HE2  6  
ATOM 10185 H HE3  . LYS A 1 27  ? -11.810 9.646   -4.200  1.00 0.00 ? 27  LYS A HE3  6  
ATOM 10186 H HZ1  . LYS A 1 27  ? -12.551 12.295  -4.393  1.00 0.00 ? 27  LYS A HZ1  6  
ATOM 10187 H HZ2  . LYS A 1 27  ? -10.941 12.286  -4.123  1.00 0.00 ? 27  LYS A HZ2  6  
ATOM 10188 H HZ3  . LYS A 1 27  ? -11.560 11.462  -5.388  1.00 0.00 ? 27  LYS A HZ3  6  
ATOM 10189 N N    . GLU A 1 28  ? -14.535 6.793   0.433   1.00 0.00 ? 28  GLU A N    6  
ATOM 10190 C CA   . GLU A 1 28  ? -15.363 5.604   0.323   1.00 0.00 ? 28  GLU A CA   6  
ATOM 10191 C C    . GLU A 1 28  ? -16.013 5.535   -1.061  1.00 0.00 ? 28  GLU A C    6  
ATOM 10192 O O    . GLU A 1 28  ? -17.110 6.054   -1.262  1.00 0.00 ? 28  GLU A O    6  
ATOM 10193 C CB   . GLU A 1 28  ? -16.421 5.568   1.427   1.00 0.00 ? 28  GLU A CB   6  
ATOM 10194 C CG   . GLU A 1 28  ? -17.420 4.434   1.193   1.00 0.00 ? 28  GLU A CG   6  
ATOM 10195 C CD   . GLU A 1 28  ? -18.802 4.799   1.737   1.00 0.00 ? 28  GLU A CD   6  
ATOM 10196 O OE1  . GLU A 1 28  ? -18.863 5.177   2.928   1.00 0.00 ? 28  GLU A OE1  6  
ATOM 10197 O OE2  . GLU A 1 28  ? -19.769 4.694   0.951   1.00 0.00 ? 28  GLU A OE2  6  
ATOM 10198 H H    . GLU A 1 28  ? -14.920 7.525   0.995   1.00 0.00 ? 28  GLU A H    6  
ATOM 10199 H HA   . GLU A 1 28  ? -14.681 4.763   0.453   1.00 0.00 ? 28  GLU A HA   6  
ATOM 10200 H HB2  . GLU A 1 28  ? -15.937 5.437   2.395   1.00 0.00 ? 28  GLU A HB2  6  
ATOM 10201 H HB3  . GLU A 1 28  ? -16.948 6.522   1.461   1.00 0.00 ? 28  GLU A HB3  6  
ATOM 10202 H HG2  . GLU A 1 28  ? -17.490 4.220   0.126   1.00 0.00 ? 28  GLU A HG2  6  
ATOM 10203 H HG3  . GLU A 1 28  ? -17.064 3.525   1.677   1.00 0.00 ? 28  GLU A HG3  6  
ATOM 10204 N N    . VAL A 1 29  ? -15.308 4.890   -1.979  1.00 0.00 ? 29  VAL A N    6  
ATOM 10205 C CA   . VAL A 1 29  ? -15.802 4.747   -3.337  1.00 0.00 ? 29  VAL A CA   6  
ATOM 10206 C C    . VAL A 1 29  ? -16.336 3.327   -3.534  1.00 0.00 ? 29  VAL A C    6  
ATOM 10207 O O    . VAL A 1 29  ? -15.623 2.353   -3.294  1.00 0.00 ? 29  VAL A O    6  
ATOM 10208 C CB   . VAL A 1 29  ? -14.703 5.116   -4.336  1.00 0.00 ? 29  VAL A CB   6  
ATOM 10209 C CG1  . VAL A 1 29  ? -14.263 6.571   -4.155  1.00 0.00 ? 29  VAL A CG1  6  
ATOM 10210 C CG2  . VAL A 1 29  ? -13.511 4.164   -4.216  1.00 0.00 ? 29  VAL A CG2  6  
ATOM 10211 H H    . VAL A 1 29  ? -14.417 4.471   -1.807  1.00 0.00 ? 29  VAL A H    6  
ATOM 10212 H HA   . VAL A 1 29  ? -16.624 5.452   -3.465  1.00 0.00 ? 29  VAL A HA   6  
ATOM 10213 H HB   . VAL A 1 29  ? -15.114 5.013   -5.341  1.00 0.00 ? 29  VAL A HB   6  
ATOM 10214 H HG11 . VAL A 1 29  ? -14.970 7.085   -3.503  1.00 0.00 ? 29  VAL A HG11 6  
ATOM 10215 H HG12 . VAL A 1 29  ? -13.271 6.597   -3.707  1.00 0.00 ? 29  VAL A HG12 6  
ATOM 10216 H HG13 . VAL A 1 29  ? -14.237 7.065   -5.125  1.00 0.00 ? 29  VAL A HG13 6  
ATOM 10217 H HG21 . VAL A 1 29  ? -13.683 3.469   -3.395  1.00 0.00 ? 29  VAL A HG21 6  
ATOM 10218 H HG22 . VAL A 1 29  ? -13.396 3.607   -5.146  1.00 0.00 ? 29  VAL A HG22 6  
ATOM 10219 H HG23 . VAL A 1 29  ? -12.605 4.738   -4.023  1.00 0.00 ? 29  VAL A HG23 6  
ATOM 10220 N N    . ASP A 1 30  ? -17.585 3.253   -3.970  1.00 0.00 ? 30  ASP A N    6  
ATOM 10221 C CA   . ASP A 1 30  ? -18.222 1.968   -4.202  1.00 0.00 ? 30  ASP A CA   6  
ATOM 10222 C C    . ASP A 1 30  ? -17.541 1.271   -5.381  1.00 0.00 ? 30  ASP A C    6  
ATOM 10223 O O    . ASP A 1 30  ? -16.878 1.918   -6.191  1.00 0.00 ? 30  ASP A O    6  
ATOM 10224 C CB   . ASP A 1 30  ? -19.703 2.142   -4.546  1.00 0.00 ? 30  ASP A CB   6  
ATOM 10225 C CG   . ASP A 1 30  ? -20.655 2.097   -3.350  1.00 0.00 ? 30  ASP A CG   6  
ATOM 10226 O OD1  . ASP A 1 30  ? -20.815 0.991   -2.792  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 10227 O OD2  . ASP A 1 30  ? -21.201 3.172   -3.019  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 10228 H H    . ASP A 1 30  ? -18.157 4.050   -4.163  1.00 0.00 ? 30  ASP A H    6  
ATOM 10229 H HA   . ASP A 1 30  ? -18.105 1.418   -3.268  1.00 0.00 ? 30  ASP A HA   6  
ATOM 10230 H HB2  . ASP A 1 30  ? -19.831 3.095   -5.059  1.00 0.00 ? 30  ASP A HB2  6  
ATOM 10231 H HB3  . ASP A 1 30  ? -19.991 1.361   -5.250  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 10232 N N    . SER A 1 31  ? -17.728 -0.039  -5.441  1.00 0.00 ? 31  SER A N    6  
ATOM 10233 C CA   . SER A 1 31  ? -17.140 -0.831  -6.508  1.00 0.00 ? 31  SER A CA   6  
ATOM 10234 C C    . SER A 1 31  ? -18.070 -1.990  -6.873  1.00 0.00 ? 31  SER A C    6  
ATOM 10235 O O    . SER A 1 31  ? -17.637 -2.971  -7.475  1.00 0.00 ? 31  SER A O    6  
ATOM 10236 C CB   . SER A 1 31  ? -15.763 -1.362  -6.104  1.00 0.00 ? 31  SER A CB   6  
ATOM 10237 O OG   . SER A 1 31  ? -15.331 -2.424  -6.951  1.00 0.00 ? 31  SER A OG   6  
ATOM 10238 H H    . SER A 1 31  ? -18.269 -0.558  -4.779  1.00 0.00 ? 31  SER A H    6  
ATOM 10239 H HA   . SER A 1 31  ? -17.033 -0.147  -7.350  1.00 0.00 ? 31  SER A HA   6  
ATOM 10240 H HB2  . SER A 1 31  ? -15.036 -0.550  -6.143  1.00 0.00 ? 31  SER A HB2  6  
ATOM 10241 H HB3  . SER A 1 31  ? -15.797 -1.711  -5.072  1.00 0.00 ? 31  SER A HB3  6  
ATOM 10242 H HG   . SER A 1 31  ? -15.783 -2.357  -7.840  1.00 0.00 ? 31  SER A HG   6  
ATOM 10243 N N    . GLY A 1 32  ? -19.330 -1.838  -6.494  1.00 0.00 ? 32  GLY A N    6  
ATOM 10244 C CA   . GLY A 1 32  ? -20.324 -2.860  -6.774  1.00 0.00 ? 32  GLY A CA   6  
ATOM 10245 C C    . GLY A 1 32  ? -20.193 -4.033  -5.801  1.00 0.00 ? 32  GLY A C    6  
ATOM 10246 O O    . GLY A 1 32  ? -19.293 -4.052  -4.962  1.00 0.00 ? 32  GLY A O    6  
ATOM 10247 H H    . GLY A 1 32  ? -19.674 -1.036  -6.005  1.00 0.00 ? 32  GLY A H    6  
ATOM 10248 H HA2  . GLY A 1 32  ? -21.323 -2.430  -6.698  1.00 0.00 ? 32  GLY A HA2  6  
ATOM 10249 H HA3  . GLY A 1 32  ? -20.207 -3.216  -7.797  1.00 0.00 ? 32  GLY A HA3  6  
ATOM 10250 N N    . ASN A 1 33  ? -21.103 -4.986  -5.947  1.00 0.00 ? 33  ASN A N    6  
ATOM 10251 C CA   . ASN A 1 33  ? -21.100 -6.161  -5.092  1.00 0.00 ? 33  ASN A CA   6  
ATOM 10252 C C    . ASN A 1 33  ? -20.113 -7.189  -5.648  1.00 0.00 ? 33  ASN A C    6  
ATOM 10253 O O    . ASN A 1 33  ? -19.704 -7.099  -6.805  1.00 0.00 ? 33  ASN A O    6  
ATOM 10254 C CB   . ASN A 1 33  ? -22.484 -6.811  -5.045  1.00 0.00 ? 33  ASN A CB   6  
ATOM 10255 C CG   . ASN A 1 33  ? -23.588 -5.752  -5.036  1.00 0.00 ? 33  ASN A CG   6  
ATOM 10256 O OD1  . ASN A 1 33  ? -23.651 -4.892  -4.174  1.00 0.00 ? 33  ASN A OD1  6  
ATOM 10257 N ND2  . ASN A 1 33  ? -24.451 -5.862  -6.042  1.00 0.00 ? 33  ASN A ND2  6  
ATOM 10258 H H    . ASN A 1 33  ? -21.831 -4.963  -6.632  1.00 0.00 ? 33  ASN A H    6  
ATOM 10259 H HA   . ASN A 1 33  ? -20.812 -5.796  -4.105  1.00 0.00 ? 33  ASN A HA   6  
ATOM 10260 H HB2  . ASN A 1 33  ? -22.611 -7.467  -5.907  1.00 0.00 ? 33  ASN A HB2  6  
ATOM 10261 H HB3  . ASN A 1 33  ? -22.566 -7.435  -4.155  1.00 0.00 ? 33  ASN A HB3  6  
ATOM 10262 H HD21 . ASN A 1 33  ? -24.342 -6.591  -6.718  1.00 0.00 ? 33  ASN A HD21 6  
ATOM 10263 H HD22 . ASN A 1 33  ? -25.209 -5.215  -6.123  1.00 0.00 ? 33  ASN A HD22 6  
ATOM 10264 N N    . ASP A 1 34  ? -19.758 -8.141  -4.799  1.00 0.00 ? 34  ASP A N    6  
ATOM 10265 C CA   . ASP A 1 34  ? -18.827 -9.185  -5.191  1.00 0.00 ? 34  ASP A CA   6  
ATOM 10266 C C    . ASP A 1 34  ? -19.611 -10.406 -5.675  1.00 0.00 ? 34  ASP A C    6  
ATOM 10267 O O    . ASP A 1 34  ? -20.789 -10.300 -6.009  1.00 0.00 ? 34  ASP A O    6  
ATOM 10268 C CB   . ASP A 1 34  ? -17.956 -9.619  -4.010  1.00 0.00 ? 34  ASP A CB   6  
ATOM 10269 C CG   . ASP A 1 34  ? -16.560 -10.119 -4.385  1.00 0.00 ? 34  ASP A CG   6  
ATOM 10270 O OD1  . ASP A 1 34  ? -15.898 -9.413  -5.178  1.00 0.00 ? 34  ASP A OD1  6  
ATOM 10271 O OD2  . ASP A 1 34  ? -16.184 -11.195 -3.870  1.00 0.00 ? 34  ASP A OD2  6  
ATOM 10272 H H    . ASP A 1 34  ? -20.095 -8.207  -3.859  1.00 0.00 ? 34  ASP A H    6  
ATOM 10273 H HA   . ASP A 1 34  ? -18.216 -8.742  -5.978  1.00 0.00 ? 34  ASP A HA   6  
ATOM 10274 H HB2  . ASP A 1 34  ? -17.852 -8.777  -3.325  1.00 0.00 ? 34  ASP A HB2  6  
ATOM 10275 H HB3  . ASP A 1 34  ? -18.475 -10.409 -3.467  1.00 0.00 ? 34  ASP A HB3  6  
ATOM 10276 N N    . ILE A 1 35  ? -18.923 -11.540 -5.698  1.00 0.00 ? 35  ILE A N    6  
ATOM 10277 C CA   . ILE A 1 35  ? -19.541 -12.780 -6.135  1.00 0.00 ? 35  ILE A CA   6  
ATOM 10278 C C    . ILE A 1 35  ? -20.357 -13.372 -4.985  1.00 0.00 ? 35  ILE A C    6  
ATOM 10279 O O    . ILE A 1 35  ? -20.953 -14.438 -5.126  1.00 0.00 ? 35  ILE A O    6  
ATOM 10280 C CB   . ILE A 1 35  ? -18.485 -13.735 -6.695  1.00 0.00 ? 35  ILE A CB   6  
ATOM 10281 C CG1  . ILE A 1 35  ? -17.680 -13.069 -7.813  1.00 0.00 ? 35  ILE A CG1  6  
ATOM 10282 C CG2  . ILE A 1 35  ? -19.121 -15.049 -7.152  1.00 0.00 ? 35  ILE A CG2  6  
ATOM 10283 C CD1  . ILE A 1 35  ? -16.730 -12.011 -7.249  1.00 0.00 ? 35  ILE A CD1  6  
ATOM 10284 H H    . ILE A 1 35  ? -17.965 -11.618 -5.425  1.00 0.00 ? 35  ILE A H    6  
ATOM 10285 H HA   . ILE A 1 35  ? -20.221 -12.537 -6.952  1.00 0.00 ? 35  ILE A HA   6  
ATOM 10286 H HB   . ILE A 1 35  ? -17.785 -13.978 -5.895  1.00 0.00 ? 35  ILE A HB   6  
ATOM 10287 H HG12 . ILE A 1 35  ? -17.110 -13.824 -8.354  1.00 0.00 ? 35  ILE A HG12 6  
ATOM 10288 H HG13 . ILE A 1 35  ? -18.359 -12.608 -8.530  1.00 0.00 ? 35  ILE A HG13 6  
ATOM 10289 H HG21 . ILE A 1 35  ? -20.063 -14.840 -7.660  1.00 0.00 ? 35  ILE A HG21 6  
ATOM 10290 H HG22 . ILE A 1 35  ? -18.445 -15.562 -7.836  1.00 0.00 ? 35  ILE A HG22 6  
ATOM 10291 H HG23 . ILE A 1 35  ? -19.310 -15.683 -6.285  1.00 0.00 ? 35  ILE A HG23 6  
ATOM 10292 H HD11 . ILE A 1 35  ? -16.385 -12.321 -6.263  1.00 0.00 ? 35  ILE A HD11 6  
ATOM 10293 H HD12 . ILE A 1 35  ? -15.874 -11.899 -7.915  1.00 0.00 ? 35  ILE A HD12 6  
ATOM 10294 H HD13 . ILE A 1 35  ? -17.254 -11.058 -7.167  1.00 0.00 ? 35  ILE A HD13 6  
ATOM 10295 N N    . TYR A 1 36  ? -20.358 -12.653 -3.871  1.00 0.00 ? 36  TYR A N    6  
ATOM 10296 C CA   . TYR A 1 36  ? -21.091 -13.094 -2.697  1.00 0.00 ? 36  TYR A CA   6  
ATOM 10297 C C    . TYR A 1 36  ? -22.326 -12.221 -2.462  1.00 0.00 ? 36  TYR A C    6  
ATOM 10298 O O    . TYR A 1 36  ? -23.085 -12.452 -1.522  1.00 0.00 ? 36  TYR A O    6  
ATOM 10299 C CB   . TYR A 1 36  ? -20.134 -12.931 -1.515  1.00 0.00 ? 36  TYR A CB   6  
ATOM 10300 C CG   . TYR A 1 36  ? -20.358 -13.941 -0.388  1.00 0.00 ? 36  TYR A CG   6  
ATOM 10301 C CD1  . TYR A 1 36  ? -20.252 -15.293 -0.641  1.00 0.00 ? 36  TYR A CD1  6  
ATOM 10302 C CD2  . TYR A 1 36  ? -20.670 -13.498 0.882   1.00 0.00 ? 36  TYR A CD2  6  
ATOM 10303 C CE1  . TYR A 1 36  ? -20.464 -16.243 0.421   1.00 0.00 ? 36  TYR A CE1  6  
ATOM 10304 C CE2  . TYR A 1 36  ? -20.881 -14.448 1.944   1.00 0.00 ? 36  TYR A CE2  6  
ATOM 10305 C CZ   . TYR A 1 36  ? -20.768 -15.773 1.660   1.00 0.00 ? 36  TYR A CZ   6  
ATOM 10306 O OH   . TYR A 1 36  ? -20.969 -16.671 2.662   1.00 0.00 ? 36  TYR A OH   6  
ATOM 10307 H H    . TYR A 1 36  ? -19.871 -11.787 -3.765  1.00 0.00 ? 36  TYR A H    6  
ATOM 10308 H HA   . TYR A 1 36  ? -21.410 -14.122 -2.866  1.00 0.00 ? 36  TYR A HA   6  
ATOM 10309 H HB2  . TYR A 1 36  ? -19.110 -13.027 -1.876  1.00 0.00 ? 36  TYR A HB2  6  
ATOM 10310 H HB3  . TYR A 1 36  ? -20.237 -11.924 -1.113  1.00 0.00 ? 36  TYR A HB3  6  
ATOM 10311 H HD1  . TYR A 1 36  ? -20.007 -15.643 -1.644  1.00 0.00 ? 36  TYR A HD1  6  
ATOM 10312 H HD2  . TYR A 1 36  ? -20.754 -12.430 1.082   1.00 0.00 ? 36  TYR A HD2  6  
ATOM 10313 H HE1  . TYR A 1 36  ? -20.382 -17.314 0.235   1.00 0.00 ? 36  TYR A HE1  6  
ATOM 10314 H HE2  . TYR A 1 36  ? -21.127 -14.113 2.951   1.00 0.00 ? 36  TYR A HE2  6  
ATOM 10315 H HH   . TYR A 1 36  ? -21.338 -16.207 3.468   1.00 0.00 ? 36  TYR A HH   6  
ATOM 10316 N N    . GLY A 1 37  ? -22.488 -11.235 -3.331  1.00 0.00 ? 37  GLY A N    6  
ATOM 10317 C CA   . GLY A 1 37  ? -23.617 -10.326 -3.230  1.00 0.00 ? 37  GLY A CA   6  
ATOM 10318 C C    . GLY A 1 37  ? -23.292 -9.149  -2.308  1.00 0.00 ? 37  GLY A C    6  
ATOM 10319 O O    . GLY A 1 37  ? -24.066 -8.198  -2.214  1.00 0.00 ? 37  GLY A O    6  
ATOM 10320 H H    . GLY A 1 37  ? -21.866 -11.053 -4.093  1.00 0.00 ? 37  GLY A H    6  
ATOM 10321 H HA2  . GLY A 1 37  ? -23.879 -9.954  -4.221  1.00 0.00 ? 37  GLY A HA2  6  
ATOM 10322 H HA3  . GLY A 1 37  ? -24.487 -10.862 -2.850  1.00 0.00 ? 37  GLY A HA3  6  
ATOM 10323 N N    . ASN A 1 38  ? -22.147 -9.252  -1.650  1.00 0.00 ? 38  ASN A N    6  
ATOM 10324 C CA   . ASN A 1 38  ? -21.710 -8.208  -0.739  1.00 0.00 ? 38  ASN A CA   6  
ATOM 10325 C C    . ASN A 1 38  ? -21.108 -7.055  -1.543  1.00 0.00 ? 38  ASN A C    6  
ATOM 10326 O O    . ASN A 1 38  ? -20.628 -7.254  -2.658  1.00 0.00 ? 38  ASN A O    6  
ATOM 10327 C CB   . ASN A 1 38  ? -20.637 -8.728  0.220   1.00 0.00 ? 38  ASN A CB   6  
ATOM 10328 C CG   . ASN A 1 38  ? -19.575 -9.534  -0.531  1.00 0.00 ? 38  ASN A CG   6  
ATOM 10329 O OD1  . ASN A 1 38  ? -19.724 -9.875  -1.693  1.00 0.00 ? 38  ASN A OD1  6  
ATOM 10330 N ND2  . ASN A 1 38  ? -18.498 -9.818  0.196   1.00 0.00 ? 38  ASN A ND2  6  
ATOM 10331 H H    . ASN A 1 38  ? -21.523 -10.030 -1.733  1.00 0.00 ? 38  ASN A H    6  
ATOM 10332 H HA   . ASN A 1 38  ? -22.606 -7.913  -0.192  1.00 0.00 ? 38  ASN A HA   6  
ATOM 10333 H HB2  . ASN A 1 38  ? -20.166 -7.890  0.734   1.00 0.00 ? 38  ASN A HB2  6  
ATOM 10334 H HB3  . ASN A 1 38  ? -21.099 -9.352  0.985   1.00 0.00 ? 38  ASN A HB3  6  
ATOM 10335 H HD21 . ASN A 1 38  ? -18.438 -9.509  1.145   1.00 0.00 ? 38  ASN A HD21 6  
ATOM 10336 H HD22 . ASN A 1 38  ? -17.747 -10.342 -0.207  1.00 0.00 ? 38  ASN A HD22 6  
ATOM 10337 N N    . PRO A 1 39  ? -21.152 -5.841  -0.929  1.00 0.00 ? 39  PRO A N    6  
ATOM 10338 C CA   . PRO A 1 39  ? -20.617 -4.656  -1.576  1.00 0.00 ? 39  PRO A CA   6  
ATOM 10339 C C    . PRO A 1 39  ? -19.087 -4.656  -1.540  1.00 0.00 ? 39  PRO A C    6  
ATOM 10340 O O    . PRO A 1 39  ? -18.487 -4.877  -0.490  1.00 0.00 ? 39  PRO A O    6  
ATOM 10341 C CB   . PRO A 1 39  ? -21.229 -3.486  -0.821  1.00 0.00 ? 39  PRO A CB   6  
ATOM 10342 C CG   . PRO A 1 39  ? -21.712 -4.052  0.505   1.00 0.00 ? 39  PRO A CG   6  
ATOM 10343 C CD   . PRO A 1 39  ? -21.712 -5.568  0.391   1.00 0.00 ? 39  PRO A CD   6  
ATOM 10344 H HA   . PRO A 1 39  ? -20.867 -4.645  -2.543  1.00 0.00 ? 39  PRO A HA   6  
ATOM 10345 H HB2  . PRO A 1 39  ? -20.495 -2.696  -0.664  1.00 0.00 ? 39  PRO A HB2  6  
ATOM 10346 H HB3  . PRO A 1 39  ? -22.053 -3.048  -1.382  1.00 0.00 ? 39  PRO A HB3  6  
ATOM 10347 H HG2  . PRO A 1 39  ? -21.062 -3.730  1.318   1.00 0.00 ? 39  PRO A HG2  6  
ATOM 10348 H HG3  . PRO A 1 39  ? -22.713 -3.686  0.733   1.00 0.00 ? 39  PRO A HG3  6  
ATOM 10349 H HD2  . PRO A 1 39  ? -21.112 -6.024  1.178   1.00 0.00 ? 39  PRO A HD2  6  
ATOM 10350 H HD3  . PRO A 1 39  ? -22.720 -5.973  0.486   1.00 0.00 ? 39  PRO A HD3  6  
ATOM 10351 N N    . ILE A 1 40  ? -18.500 -4.405  -2.701  1.00 0.00 ? 40  ILE A N    6  
ATOM 10352 C CA   . ILE A 1 40  ? -17.052 -4.373  -2.817  1.00 0.00 ? 40  ILE A CA   6  
ATOM 10353 C C    . ILE A 1 40  ? -16.505 -3.212  -1.983  1.00 0.00 ? 40  ILE A C    6  
ATOM 10354 O O    . ILE A 1 40  ? -16.049 -3.412  -0.859  1.00 0.00 ? 40  ILE A O    6  
ATOM 10355 C CB   . ILE A 1 40  ? -16.633 -4.326  -4.287  1.00 0.00 ? 40  ILE A CB   6  
ATOM 10356 C CG1  . ILE A 1 40  ? -17.019 -5.618  -5.009  1.00 0.00 ? 40  ILE A CG1  6  
ATOM 10357 C CG2  . ILE A 1 40  ? -15.140 -4.017  -4.422  1.00 0.00 ? 40  ILE A CG2  6  
ATOM 10358 C CD1  . ILE A 1 40  ? -16.790 -5.494  -6.517  1.00 0.00 ? 40  ILE A CD1  6  
ATOM 10359 H H    . ILE A 1 40  ? -18.997 -4.225  -3.551  1.00 0.00 ? 40  ILE A H    6  
ATOM 10360 H HA   . ILE A 1 40  ? -16.672 -5.305  -2.402  1.00 0.00 ? 40  ILE A HA   6  
ATOM 10361 H HB   . ILE A 1 40  ? -17.174 -3.513  -4.771  1.00 0.00 ? 40  ILE A HB   6  
ATOM 10362 H HG12 . ILE A 1 40  ? -16.432 -6.448  -4.615  1.00 0.00 ? 40  ILE A HG12 6  
ATOM 10363 H HG13 . ILE A 1 40  ? -18.066 -5.849  -4.815  1.00 0.00 ? 40  ILE A HG13 6  
ATOM 10364 H HG21 . ILE A 1 40  ? -14.889 -3.160  -3.798  1.00 0.00 ? 40  ILE A HG21 6  
ATOM 10365 H HG22 . ILE A 1 40  ? -14.560 -4.883  -4.101  1.00 0.00 ? 40  ILE A HG22 6  
ATOM 10366 H HG23 . ILE A 1 40  ? -14.908 -3.791  -5.462  1.00 0.00 ? 40  ILE A HG23 6  
ATOM 10367 H HD11 . ILE A 1 40  ? -15.963 -4.808  -6.703  1.00 0.00 ? 40  ILE A HD11 6  
ATOM 10368 H HD12 . ILE A 1 40  ? -16.552 -6.473  -6.930  1.00 0.00 ? 40  ILE A HD12 6  
ATOM 10369 H HD13 . ILE A 1 40  ? -17.694 -5.109  -6.990  1.00 0.00 ? 40  ILE A HD13 6  
ATOM 10370 N N    . LYS A 1 41  ? -16.566 -2.025  -2.568  1.00 0.00 ? 41  LYS A N    6  
ATOM 10371 C CA   . LYS A 1 41  ? -16.081 -0.833  -1.893  1.00 0.00 ? 41  LYS A CA   6  
ATOM 10372 C C    . LYS A 1 41  ? -14.552 -0.854  -1.864  1.00 0.00 ? 41  LYS A C    6  
ATOM 10373 O O    . LYS A 1 41  ? -13.950 -1.813  -1.383  1.00 0.00 ? 41  LYS A O    6  
ATOM 10374 C CB   . LYS A 1 41  ? -16.721 -0.703  -0.509  1.00 0.00 ? 41  LYS A CB   6  
ATOM 10375 C CG   . LYS A 1 41  ? -16.248 0.570   0.196   1.00 0.00 ? 41  LYS A CG   6  
ATOM 10376 C CD   . LYS A 1 41  ? -16.879 1.813   -0.434  1.00 0.00 ? 41  LYS A CD   6  
ATOM 10377 C CE   . LYS A 1 41  ? -18.352 1.942   -0.036  1.00 0.00 ? 41  LYS A CE   6  
ATOM 10378 N NZ   . LYS A 1 41  ? -19.045 2.905   -0.921  1.00 0.00 ? 41  LYS A NZ   6  
ATOM 10379 H H    . LYS A 1 41  ? -16.938 -1.871  -3.483  1.00 0.00 ? 41  LYS A H    6  
ATOM 10380 H HA   . LYS A 1 41  ? -16.404 0.028   -2.480  1.00 0.00 ? 41  LYS A HA   6  
ATOM 10381 H HB2  . LYS A 1 41  ? -17.807 -0.687  -0.606  1.00 0.00 ? 41  LYS A HB2  6  
ATOM 10382 H HB3  . LYS A 1 41  ? -16.468 -1.573  0.096   1.00 0.00 ? 41  LYS A HB3  6  
ATOM 10383 H HG2  . LYS A 1 41  ? -16.508 0.522   1.253   1.00 0.00 ? 41  LYS A HG2  6  
ATOM 10384 H HG3  . LYS A 1 41  ? -15.162 0.641   0.137   1.00 0.00 ? 41  LYS A HG3  6  
ATOM 10385 H HD2  . LYS A 1 41  ? -16.335 2.702   -0.117  1.00 0.00 ? 41  LYS A HD2  6  
ATOM 10386 H HD3  . LYS A 1 41  ? -16.796 1.758   -1.519  1.00 0.00 ? 41  LYS A HD3  6  
ATOM 10387 H HE2  . LYS A 1 41  ? -18.837 0.968   -0.097  1.00 0.00 ? 41  LYS A HE2  6  
ATOM 10388 H HE3  . LYS A 1 41  ? -18.426 2.271   1.000   1.00 0.00 ? 41  LYS A HE3  6  
ATOM 10389 H HZ1  . LYS A 1 41  ? -18.459 3.122   -1.701  1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 10390 H HZ2  . LYS A 1 41  ? -19.900 2.502   -1.247  1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 10391 H HZ3  . LYS A 1 41  ? -19.243 3.742   -0.411  1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 10392 N N    . ARG A 1 42  ? -13.967 0.214   -2.387  1.00 0.00 ? 42  ARG A N    6  
ATOM 10393 C CA   . ARG A 1 42  ? -12.519 0.329   -2.427  1.00 0.00 ? 42  ARG A CA   6  
ATOM 10394 C C    . ARG A 1 42  ? -12.079 1.682   -1.862  1.00 0.00 ? 42  ARG A C    6  
ATOM 10395 O O    . ARG A 1 42  ? -11.546 2.519   -2.590  1.00 0.00 ? 42  ARG A O    6  
ATOM 10396 C CB   . ARG A 1 42  ? -11.995 0.187   -3.856  1.00 0.00 ? 42  ARG A CB   6  
ATOM 10397 C CG   . ARG A 1 42  ? -13.112 0.418   -4.876  1.00 0.00 ? 42  ARG A CG   6  
ATOM 10398 C CD   . ARG A 1 42  ? -12.649 0.055   -6.288  1.00 0.00 ? 42  ARG A CD   6  
ATOM 10399 N NE   . ARG A 1 42  ? -13.455 0.790   -7.290  1.00 0.00 ? 42  ARG A NE   6  
ATOM 10400 C CZ   . ARG A 1 42  ? -13.270 2.080   -7.603  1.00 0.00 ? 42  ARG A CZ   6  
ATOM 10401 N NH1  . ARG A 1 42  ? -12.305 2.785   -6.996  1.00 0.00 ? 42  ARG A NH1  6  
ATOM 10402 N NH2  . ARG A 1 42  ? -14.048 2.664   -8.524  1.00 0.00 ? 42  ARG A NH2  6  
ATOM 10403 H H    . ARG A 1 42  ? -14.464 0.990   -2.776  1.00 0.00 ? 42  ARG A H    6  
ATOM 10404 H HA   . ARG A 1 42  ? -12.157 -0.491  -1.807  1.00 0.00 ? 42  ARG A HA   6  
ATOM 10405 H HB2  . ARG A 1 42  ? -11.189 0.902   -4.026  1.00 0.00 ? 42  ARG A HB2  6  
ATOM 10406 H HB3  . ARG A 1 42  ? -11.572 -0.808  -3.995  1.00 0.00 ? 42  ARG A HB3  6  
ATOM 10407 H HG2  . ARG A 1 42  ? -13.982 -0.182  -4.610  1.00 0.00 ? 42  ARG A HG2  6  
ATOM 10408 H HG3  . ARG A 1 42  ? -13.424 1.462   -4.849  1.00 0.00 ? 42  ARG A HG3  6  
ATOM 10409 H HD2  . ARG A 1 42  ? -11.594 0.300   -6.409  1.00 0.00 ? 42  ARG A HD2  6  
ATOM 10410 H HD3  . ARG A 1 42  ? -12.747 -1.019  -6.448  1.00 0.00 ? 42  ARG A HD3  6  
ATOM 10411 H HE   . ARG A 1 42  ? -14.183 0.293   -7.762  1.00 0.00 ? 42  ARG A HE   6  
ATOM 10412 H HH11 . ARG A 1 42  ? -11.725 2.349   -6.309  1.00 0.00 ? 42  ARG A HH11 6  
ATOM 10413 H HH12 . ARG A 1 42  ? -12.167 3.747   -7.230  1.00 0.00 ? 42  ARG A HH12 6  
ATOM 10414 H HH21 . ARG A 1 42  ? -14.768 2.137   -8.977  1.00 0.00 ? 42  ARG A HH21 6  
ATOM 10415 H HH22 . ARG A 1 42  ? -13.910 3.626   -8.758  1.00 0.00 ? 42  ARG A HH22 6  
ATOM 10416 N N    . ILE A 1 43  ? -12.318 1.853   -0.570  1.00 0.00 ? 43  ILE A N    6  
ATOM 10417 C CA   . ILE A 1 43  ? -11.952 3.090   0.101   1.00 0.00 ? 43  ILE A CA   6  
ATOM 10418 C C    . ILE A 1 43  ? -10.621 3.594   -0.458  1.00 0.00 ? 43  ILE A C    6  
ATOM 10419 O O    . ILE A 1 43  ? -9.732  2.800   -0.767  1.00 0.00 ? 43  ILE A O    6  
ATOM 10420 C CB   . ILE A 1 43  ? -11.948 2.895   1.618   1.00 0.00 ? 43  ILE A CB   6  
ATOM 10421 C CG1  . ILE A 1 43  ? -13.183 3.535   2.257   1.00 0.00 ? 43  ILE A CG1  6  
ATOM 10422 C CG2  . ILE A 1 43  ? -10.649 3.417   2.234   1.00 0.00 ? 43  ILE A CG2  6  
ATOM 10423 C CD1  . ILE A 1 43  ? -14.425 2.671   2.033   1.00 0.00 ? 43  ILE A CD1  6  
ATOM 10424 H H    . ILE A 1 43  ? -12.751 1.168   0.014   1.00 0.00 ? 43  ILE A H    6  
ATOM 10425 H HA   . ILE A 1 43  ? -12.723 3.825   -0.128  1.00 0.00 ? 43  ILE A HA   6  
ATOM 10426 H HB   . ILE A 1 43  ? -11.996 1.826   1.825   1.00 0.00 ? 43  ILE A HB   6  
ATOM 10427 H HG12 . ILE A 1 43  ? -13.016 3.668   3.325   1.00 0.00 ? 43  ILE A HG12 6  
ATOM 10428 H HG13 . ILE A 1 43  ? -13.343 4.526   1.833   1.00 0.00 ? 43  ILE A HG13 6  
ATOM 10429 H HG21 . ILE A 1 43  ? -9.798  2.956   1.733   1.00 0.00 ? 43  ILE A HG21 6  
ATOM 10430 H HG22 . ILE A 1 43  ? -10.599 4.499   2.114   1.00 0.00 ? 43  ILE A HG22 6  
ATOM 10431 H HG23 . ILE A 1 43  ? -10.624 3.168   3.296   1.00 0.00 ? 43  ILE A HG23 6  
ATOM 10432 H HD11 . ILE A 1 43  ? -14.148 1.768   1.489   1.00 0.00 ? 43  ILE A HD11 6  
ATOM 10433 H HD12 . ILE A 1 43  ? -14.856 2.397   2.996   1.00 0.00 ? 43  ILE A HD12 6  
ATOM 10434 H HD13 . ILE A 1 43  ? -15.159 3.233   1.452   1.00 0.00 ? 43  ILE A HD13 6  
ATOM 10435 N N    . GLN A 1 44  ? -10.523 4.910   -0.573  1.00 0.00 ? 44  GLN A N    6  
ATOM 10436 C CA   . GLN A 1 44  ? -9.314  5.530   -1.089  1.00 0.00 ? 44  GLN A CA   6  
ATOM 10437 C C    . GLN A 1 44  ? -8.310  5.757   0.043   1.00 0.00 ? 44  GLN A C    6  
ATOM 10438 O O    . GLN A 1 44  ? -8.572  5.404   1.191   1.00 0.00 ? 44  GLN A O    6  
ATOM 10439 C CB   . GLN A 1 44  ? -9.635  6.841   -1.811  1.00 0.00 ? 44  GLN A CB   6  
ATOM 10440 C CG   . GLN A 1 44  ? -10.419 6.580   -3.098  1.00 0.00 ? 44  GLN A CG   6  
ATOM 10441 C CD   . GLN A 1 44  ? -9.839  5.388   -3.861  1.00 0.00 ? 44  GLN A CD   6  
ATOM 10442 O OE1  . GLN A 1 44  ? -9.056  5.531   -4.785  1.00 0.00 ? 44  GLN A OE1  6  
ATOM 10443 N NE2  . GLN A 1 44  ? -10.267 4.206   -3.426  1.00 0.00 ? 44  GLN A NE2  6  
ATOM 10444 H H    . GLN A 1 44  ? -11.250 5.549   -0.319  1.00 0.00 ? 44  GLN A H    6  
ATOM 10445 H HA   . GLN A 1 44  ? -8.908  4.817   -1.807  1.00 0.00 ? 44  GLN A HA   6  
ATOM 10446 H HB2  . GLN A 1 44  ? -10.213 7.489   -1.152  1.00 0.00 ? 44  GLN A HB2  6  
ATOM 10447 H HB3  . GLN A 1 44  ? -8.710  7.366   -2.044  1.00 0.00 ? 44  GLN A HB3  6  
ATOM 10448 H HG2  . GLN A 1 44  ? -11.465 6.389   -2.858  1.00 0.00 ? 44  GLN A HG2  6  
ATOM 10449 H HG3  . GLN A 1 44  ? -10.394 7.468   -3.729  1.00 0.00 ? 44  GLN A HG3  6  
ATOM 10450 H HE21 . GLN A 1 44  ? -10.911 4.158   -2.662  1.00 0.00 ? 44  GLN A HE21 6  
ATOM 10451 H HE22 . GLN A 1 44  ? -9.945  3.365   -3.861  1.00 0.00 ? 44  GLN A HE22 6  
ATOM 10452 N N    . TYR A 1 45  ? -7.180  6.346   -0.322  1.00 0.00 ? 45  TYR A N    6  
ATOM 10453 C CA   . TYR A 1 45  ? -6.135  6.625   0.648   1.00 0.00 ? 45  TYR A CA   6  
ATOM 10454 C C    . TYR A 1 45  ? -5.549  8.023   0.437   1.00 0.00 ? 45  TYR A C    6  
ATOM 10455 O O    . TYR A 1 45  ? -4.382  8.164   0.074   1.00 0.00 ? 45  TYR A O    6  
ATOM 10456 C CB   . TYR A 1 45  ? -5.041  5.585   0.400   1.00 0.00 ? 45  TYR A CB   6  
ATOM 10457 C CG   . TYR A 1 45  ? -5.138  4.353   1.303   1.00 0.00 ? 45  TYR A CG   6  
ATOM 10458 C CD1  . TYR A 1 45  ? -5.606  4.480   2.595   1.00 0.00 ? 45  TYR A CD1  6  
ATOM 10459 C CD2  . TYR A 1 45  ? -4.759  3.115   0.825   1.00 0.00 ? 45  TYR A CD2  6  
ATOM 10460 C CE1  . TYR A 1 45  ? -5.696  3.321   3.444   1.00 0.00 ? 45  TYR A CE1  6  
ATOM 10461 C CE2  . TYR A 1 45  ? -4.850  1.957   1.673   1.00 0.00 ? 45  TYR A CE2  6  
ATOM 10462 C CZ   . TYR A 1 45  ? -5.314  2.116   2.942   1.00 0.00 ? 45  TYR A CZ   6  
ATOM 10463 O OH   . TYR A 1 45  ? -5.401  1.021   3.744   1.00 0.00 ? 45  TYR A OH   6  
ATOM 10464 H H    . TYR A 1 45  ? -6.974  6.630   -1.259  1.00 0.00 ? 45  TYR A H    6  
ATOM 10465 H HA   . TYR A 1 45  ? -6.576  6.571   1.643   1.00 0.00 ? 45  TYR A HA   6  
ATOM 10466 H HB2  . TYR A 1 45  ? -5.087  5.265   -0.641  1.00 0.00 ? 45  TYR A HB2  6  
ATOM 10467 H HB3  . TYR A 1 45  ? -4.068  6.054   0.546   1.00 0.00 ? 45  TYR A HB3  6  
ATOM 10468 H HD1  . TYR A 1 45  ? -5.905  5.457   2.973   1.00 0.00 ? 45  TYR A HD1  6  
ATOM 10469 H HD2  . TYR A 1 45  ? -4.390  3.016   -0.197  1.00 0.00 ? 45  TYR A HD2  6  
ATOM 10470 H HE1  . TYR A 1 45  ? -6.064  3.406   4.467   1.00 0.00 ? 45  TYR A HE1  6  
ATOM 10471 H HE2  . TYR A 1 45  ? -4.554  0.973   1.308   1.00 0.00 ? 45  TYR A HE2  6  
ATOM 10472 H HH   . TYR A 1 45  ? -4.600  0.969   4.340   1.00 0.00 ? 45  TYR A HH   6  
ATOM 10473 N N    . GLU A 1 46  ? -6.388  9.023   0.671   1.00 0.00 ? 46  GLU A N    6  
ATOM 10474 C CA   . GLU A 1 46  ? -5.968  10.404  0.511   1.00 0.00 ? 46  GLU A CA   6  
ATOM 10475 C C    . GLU A 1 46  ? -4.818  10.724  1.468   1.00 0.00 ? 46  GLU A C    6  
ATOM 10476 O O    . GLU A 1 46  ? -5.011  11.414  2.467   1.00 0.00 ? 46  GLU A O    6  
ATOM 10477 C CB   . GLU A 1 46  ? -7.141  11.362  0.726   1.00 0.00 ? 46  GLU A CB   6  
ATOM 10478 C CG   . GLU A 1 46  ? -6.994  12.613  -0.143  1.00 0.00 ? 46  GLU A CG   6  
ATOM 10479 C CD   . GLU A 1 46  ? -8.305  13.401  -0.196  1.00 0.00 ? 46  GLU A CD   6  
ATOM 10480 O OE1  . GLU A 1 46  ? -9.366  12.742  -0.150  1.00 0.00 ? 46  GLU A OE1  6  
ATOM 10481 O OE2  . GLU A 1 46  ? -8.216  14.645  -0.281  1.00 0.00 ? 46  GLU A OE2  6  
ATOM 10482 H H    . GLU A 1 46  ? -7.335  8.900   0.965   1.00 0.00 ? 46  GLU A H    6  
ATOM 10483 H HA   . GLU A 1 46  ? -5.625  10.485  -0.520  1.00 0.00 ? 46  GLU A HA   6  
ATOM 10484 H HB2  . GLU A 1 46  ? -8.077  10.857  0.485   1.00 0.00 ? 46  GLU A HB2  6  
ATOM 10485 H HB3  . GLU A 1 46  ? -7.195  11.649  1.776   1.00 0.00 ? 46  GLU A HB3  6  
ATOM 10486 H HG2  . GLU A 1 46  ? -6.202  13.246  0.256   1.00 0.00 ? 46  GLU A HG2  6  
ATOM 10487 H HG3  . GLU A 1 46  ? -6.696  12.327  -1.152  1.00 0.00 ? 46  GLU A HG3  6  
ATOM 10488 N N    . ILE A 1 47  ? -3.647  10.207  1.127   1.00 0.00 ? 47  ILE A N    6  
ATOM 10489 C CA   . ILE A 1 47  ? -2.465  10.429  1.944   1.00 0.00 ? 47  ILE A CA   6  
ATOM 10490 C C    . ILE A 1 47  ? -2.050  11.898  1.845   1.00 0.00 ? 47  ILE A C    6  
ATOM 10491 O O    . ILE A 1 47  ? -2.800  12.725  1.327   1.00 0.00 ? 47  ILE A O    6  
ATOM 10492 C CB   . ILE A 1 47  ? -1.355  9.449   1.558   1.00 0.00 ? 47  ILE A CB   6  
ATOM 10493 C CG1  . ILE A 1 47  ? -0.934  9.645   0.100   1.00 0.00 ? 47  ILE A CG1  6  
ATOM 10494 C CG2  . ILE A 1 47  ? -1.774  8.006   1.845   1.00 0.00 ? 47  ILE A CG2  6  
ATOM 10495 C CD1  . ILE A 1 47  ? -0.233  8.398   -0.440  1.00 0.00 ? 47  ILE A CD1  6  
ATOM 10496 H H    . ILE A 1 47  ? -3.497  9.646   0.313   1.00 0.00 ? 47  ILE A H    6  
ATOM 10497 H HA   . ILE A 1 47  ? -2.737  10.216  2.978   1.00 0.00 ? 47  ILE A HA   6  
ATOM 10498 H HB   . ILE A 1 47  ? -0.483  9.660   2.176   1.00 0.00 ? 47  ILE A HB   6  
ATOM 10499 H HG12 . ILE A 1 47  ? -1.810  9.868   -0.509  1.00 0.00 ? 47  ILE A HG12 6  
ATOM 10500 H HG13 . ILE A 1 47  ? -0.266  10.503  0.023   1.00 0.00 ? 47  ILE A HG13 6  
ATOM 10501 H HG21 . ILE A 1 47  ? -2.757  7.999   2.314   1.00 0.00 ? 47  ILE A HG21 6  
ATOM 10502 H HG22 . ILE A 1 47  ? -1.814  7.447   0.909   1.00 0.00 ? 47  ILE A HG22 6  
ATOM 10503 H HG23 . ILE A 1 47  ? -1.048  7.543   2.513   1.00 0.00 ? 47  ILE A HG23 6  
ATOM 10504 H HD11 . ILE A 1 47  ? -0.010  7.719   0.384   1.00 0.00 ? 47  ILE A HD11 6  
ATOM 10505 H HD12 . ILE A 1 47  ? -0.884  7.896   -1.157  1.00 0.00 ? 47  ILE A HD12 6  
ATOM 10506 H HD13 . ILE A 1 47  ? 0.695   8.686   -0.934  1.00 0.00 ? 47  ILE A HD13 6  
ATOM 10507 N N    . LYS A 1 48  ? -0.858  12.179  2.350   1.00 0.00 ? 48  LYS A N    6  
ATOM 10508 C CA   . LYS A 1 48  ? -0.335  13.534  2.324   1.00 0.00 ? 48  LYS A CA   6  
ATOM 10509 C C    . LYS A 1 48  ? 1.084   13.518  1.753   1.00 0.00 ? 48  LYS A C    6  
ATOM 10510 O O    . LYS A 1 48  ? 1.771   14.539  1.756   1.00 0.00 ? 48  LYS A O    6  
ATOM 10511 C CB   . LYS A 1 48  ? -0.430  14.172  3.712   1.00 0.00 ? 48  LYS A CB   6  
ATOM 10512 C CG   . LYS A 1 48  ? -0.621  15.686  3.607   1.00 0.00 ? 48  LYS A CG   6  
ATOM 10513 C CD   . LYS A 1 48  ? -1.111  16.271  4.933   1.00 0.00 ? 48  LYS A CD   6  
ATOM 10514 C CE   . LYS A 1 48  ? -0.542  15.489  6.119   1.00 0.00 ? 48  LYS A CE   6  
ATOM 10515 N NZ   . LYS A 1 48  ? -0.800  16.209  7.386   1.00 0.00 ? 48  LYS A NZ   6  
ATOM 10516 H H    . LYS A 1 48  ? -0.255  11.501  2.769   1.00 0.00 ? 48  LYS A H    6  
ATOM 10517 H HA   . LYS A 1 48  ? -0.969  14.117  1.656   1.00 0.00 ? 48  LYS A HA   6  
ATOM 10518 H HB2  . LYS A 1 48  ? -1.265  13.735  4.260   1.00 0.00 ? 48  LYS A HB2  6  
ATOM 10519 H HB3  . LYS A 1 48  ? 0.473   13.954  4.280   1.00 0.00 ? 48  LYS A HB3  6  
ATOM 10520 H HG2  . LYS A 1 48  ? 0.322   16.156  3.325   1.00 0.00 ? 48  LYS A HG2  6  
ATOM 10521 H HG3  . LYS A 1 48  ? -1.339  15.913  2.819   1.00 0.00 ? 48  LYS A HG3  6  
ATOM 10522 H HD2  . LYS A 1 48  ? -0.814  17.317  5.006   1.00 0.00 ? 48  LYS A HD2  6  
ATOM 10523 H HD3  . LYS A 1 48  ? -2.201  16.246  4.966   1.00 0.00 ? 48  LYS A HD3  6  
ATOM 10524 H HE2  . LYS A 1 48  ? -0.994  14.497  6.160   1.00 0.00 ? 48  LYS A HE2  6  
ATOM 10525 H HE3  . LYS A 1 48  ? 0.530   15.345  5.989   1.00 0.00 ? 48  LYS A HE3  6  
ATOM 10526 H HZ1  . LYS A 1 48  ? -1.634  16.756  7.295   1.00 0.00 ? 48  LYS A HZ1  6  
ATOM 10527 H HZ2  . LYS A 1 48  ? -0.915  15.549  8.128   1.00 0.00 ? 48  LYS A HZ2  6  
ATOM 10528 H HZ3  . LYS A 1 48  ? -0.028  16.811  7.592   1.00 0.00 ? 48  LYS A HZ3  6  
ATOM 10529 N N    . GLN A 1 49  ? 1.481   12.348  1.274   1.00 0.00 ? 49  GLN A N    6  
ATOM 10530 C CA   . GLN A 1 49  ? 2.806   12.185  0.700   1.00 0.00 ? 49  GLN A CA   6  
ATOM 10531 C C    . GLN A 1 49  ? 3.867   12.763  1.639   1.00 0.00 ? 49  GLN A C    6  
ATOM 10532 O O    . GLN A 1 49  ? 3.903   13.971  1.873   1.00 0.00 ? 49  GLN A O    6  
ATOM 10533 C CB   . GLN A 1 49  ? 2.888   12.834  -0.684  1.00 0.00 ? 49  GLN A CB   6  
ATOM 10534 C CG   . GLN A 1 49  ? 4.302   13.341  -0.969  1.00 0.00 ? 49  GLN A CG   6  
ATOM 10535 C CD   . GLN A 1 49  ? 4.670   13.142  -2.440  1.00 0.00 ? 49  GLN A CD   6  
ATOM 10536 O OE1  . GLN A 1 49  ? 4.790   14.082  -3.210  1.00 0.00 ? 49  GLN A OE1  6  
ATOM 10537 N NE2  . GLN A 1 49  ? 4.842   11.870  -2.788  1.00 0.00 ? 49  GLN A NE2  6  
ATOM 10538 H H    . GLN A 1 49  ? 0.917   11.522  1.275   1.00 0.00 ? 49  GLN A H    6  
ATOM 10539 H HA   . GLN A 1 49  ? 2.948   11.110  0.599   1.00 0.00 ? 49  GLN A HA   6  
ATOM 10540 H HB2  . GLN A 1 49  ? 2.597   12.110  -1.446  1.00 0.00 ? 49  GLN A HB2  6  
ATOM 10541 H HB3  . GLN A 1 49  ? 2.181   13.661  -0.744  1.00 0.00 ? 49  GLN A HB3  6  
ATOM 10542 H HG2  . GLN A 1 49  ? 4.371   14.399  -0.713  1.00 0.00 ? 49  GLN A HG2  6  
ATOM 10543 H HG3  . GLN A 1 49  ? 5.017   12.813  -0.337  1.00 0.00 ? 49  GLN A HG3  6  
ATOM 10544 H HE21 . GLN A 1 49  ? 4.729   11.146  -2.107  1.00 0.00 ? 49  GLN A HE21 6  
ATOM 10545 H HE22 . GLN A 1 49  ? 5.085   11.637  -3.730  1.00 0.00 ? 49  GLN A HE22 6  
ATOM 10546 N N    . ILE A 1 50  ? 4.704   11.874  2.152   1.00 0.00 ? 50  ILE A N    6  
ATOM 10547 C CA   . ILE A 1 50  ? 5.762   12.281  3.061   1.00 0.00 ? 50  ILE A CA   6  
ATOM 10548 C C    . ILE A 1 50  ? 7.113   11.840  2.494   1.00 0.00 ? 50  ILE A C    6  
ATOM 10549 O O    . ILE A 1 50  ? 8.140   12.461  2.769   1.00 0.00 ? 50  ILE A O    6  
ATOM 10550 C CB   . ILE A 1 50  ? 5.489   11.758  4.473   1.00 0.00 ? 50  ILE A CB   6  
ATOM 10551 C CG1  . ILE A 1 50  ? 6.579   10.781  4.917   1.00 0.00 ? 50  ILE A CG1  6  
ATOM 10552 C CG2  . ILE A 1 50  ? 4.093   11.138  4.566   1.00 0.00 ? 50  ILE A CG2  6  
ATOM 10553 C CD1  . ILE A 1 50  ? 6.183   10.068  6.211   1.00 0.00 ? 50  ILE A CD1  6  
ATOM 10554 H H    . ILE A 1 50  ? 4.668   10.894  1.958   1.00 0.00 ? 50  ILE A H    6  
ATOM 10555 H HA   . ILE A 1 50  ? 5.749   13.370  3.113   1.00 0.00 ? 50  ILE A HA   6  
ATOM 10556 H HB   . ILE A 1 50  ? 5.512   12.602  5.161   1.00 0.00 ? 50  ILE A HB   6  
ATOM 10557 H HG12 . ILE A 1 50  ? 6.756   10.046  4.131   1.00 0.00 ? 50  ILE A HG12 6  
ATOM 10558 H HG13 . ILE A 1 50  ? 7.515   11.320  5.066   1.00 0.00 ? 50  ILE A HG13 6  
ATOM 10559 H HG21 . ILE A 1 50  ? 3.432   11.619  3.843   1.00 0.00 ? 50  ILE A HG21 6  
ATOM 10560 H HG22 . ILE A 1 50  ? 4.153   10.072  4.349   1.00 0.00 ? 50  ILE A HG22 6  
ATOM 10561 H HG23 . ILE A 1 50  ? 3.697   11.283  5.570   1.00 0.00 ? 50  ILE A HG23 6  
ATOM 10562 H HD11 . ILE A 1 50  ? 5.197   10.410  6.526   1.00 0.00 ? 50  ILE A HD11 6  
ATOM 10563 H HD12 . ILE A 1 50  ? 6.157   8.992   6.039   1.00 0.00 ? 50  ILE A HD12 6  
ATOM 10564 H HD13 . ILE A 1 50  ? 6.912   10.295  6.989   1.00 0.00 ? 50  ILE A HD13 6  
ATOM 10565 N N    . LYS A 1 51  ? 7.071   10.771  1.711   1.00 0.00 ? 51  LYS A N    6  
ATOM 10566 C CA   . LYS A 1 51  ? 8.278   10.241  1.103   1.00 0.00 ? 51  LYS A CA   6  
ATOM 10567 C C    . LYS A 1 51  ? 7.906   9.443   -0.148  1.00 0.00 ? 51  LYS A C    6  
ATOM 10568 O O    . LYS A 1 51  ? 6.731   9.163   -0.383  1.00 0.00 ? 51  LYS A O    6  
ATOM 10569 C CB   . LYS A 1 51  ? 9.087   9.439   2.126   1.00 0.00 ? 51  LYS A CB   6  
ATOM 10570 C CG   . LYS A 1 51  ? 10.520  9.963   2.226   1.00 0.00 ? 51  LYS A CG   6  
ATOM 10571 C CD   . LYS A 1 51  ? 11.099  9.714   3.619   1.00 0.00 ? 51  LYS A CD   6  
ATOM 10572 C CE   . LYS A 1 51  ? 11.874  10.935  4.118   1.00 0.00 ? 51  LYS A CE   6  
ATOM 10573 N NZ   . LYS A 1 51  ? 12.613  10.610  5.358   1.00 0.00 ? 51  LYS A NZ   6  
ATOM 10574 H H    . LYS A 1 51  ? 6.232   10.272  1.493   1.00 0.00 ? 51  LYS A H    6  
ATOM 10575 H HA   . LYS A 1 51  ? 8.893   11.089  0.801   1.00 0.00 ? 51  LYS A HA   6  
ATOM 10576 H HB2  . LYS A 1 51  ? 8.605   9.498   3.102   1.00 0.00 ? 51  LYS A HB2  6  
ATOM 10577 H HB3  . LYS A 1 51  ? 9.099   8.387   1.841   1.00 0.00 ? 51  LYS A HB3  6  
ATOM 10578 H HG2  . LYS A 1 51  ? 11.143  9.476   1.476   1.00 0.00 ? 51  LYS A HG2  6  
ATOM 10579 H HG3  . LYS A 1 51  ? 10.536  11.032  2.007   1.00 0.00 ? 51  LYS A HG3  6  
ATOM 10580 H HD2  . LYS A 1 51  ? 10.294  9.481   4.316   1.00 0.00 ? 51  LYS A HD2  6  
ATOM 10581 H HD3  . LYS A 1 51  ? 11.758  8.846   3.593   1.00 0.00 ? 51  LYS A HD3  6  
ATOM 10582 H HE2  . LYS A 1 51  ? 12.572  11.269  3.349   1.00 0.00 ? 51  LYS A HE2  6  
ATOM 10583 H HE3  . LYS A 1 51  ? 11.185  11.759  4.304   1.00 0.00 ? 51  LYS A HE3  6  
ATOM 10584 H HZ1  . LYS A 1 51  ? 13.174  9.796   5.208   1.00 0.00 ? 51  LYS A HZ1  6  
ATOM 10585 H HZ2  . LYS A 1 51  ? 13.201  11.378  5.607   1.00 0.00 ? 51  LYS A HZ2  6  
ATOM 10586 H HZ3  . LYS A 1 51  ? 11.963  10.434  6.097   1.00 0.00 ? 51  LYS A HZ3  6  
ATOM 10587 N N    . MET A 1 52  ? 8.927   9.097   -0.918  1.00 0.00 ? 52  MET A N    6  
ATOM 10588 C CA   . MET A 1 52  ? 8.722   8.337   -2.138  1.00 0.00 ? 52  MET A CA   6  
ATOM 10589 C C    . MET A 1 52  ? 9.898   7.394   -2.402  1.00 0.00 ? 52  MET A C    6  
ATOM 10590 O O    . MET A 1 52  ? 10.660  7.595   -3.346  1.00 0.00 ? 52  MET A O    6  
ATOM 10591 C CB   . MET A 1 52  ? 8.564   9.299   -3.318  1.00 0.00 ? 52  MET A CB   6  
ATOM 10592 C CG   . MET A 1 52  ? 7.339   8.938   -4.160  1.00 0.00 ? 52  MET A CG   6  
ATOM 10593 S SD   . MET A 1 52  ? 7.037   10.209  -5.376  1.00 0.00 ? 52  MET A SD   6  
ATOM 10594 C CE   . MET A 1 52  ? 8.714   10.724  -5.707  1.00 0.00 ? 52  MET A CE   6  
ATOM 10595 H H    . MET A 1 52  ? 9.880   9.330   -0.719  1.00 0.00 ? 52  MET A H    6  
ATOM 10596 H HA   . MET A 1 52  ? 7.812   7.759   -1.973  1.00 0.00 ? 52  MET A HA   6  
ATOM 10597 H HB2  . MET A 1 52  ? 8.469   10.320  -2.950  1.00 0.00 ? 52  MET A HB2  6  
ATOM 10598 H HB3  . MET A 1 52  ? 9.459   9.267   -3.940  1.00 0.00 ? 52  MET A HB3  6  
ATOM 10599 H HG2  . MET A 1 52  ? 7.496   7.980   -4.654  1.00 0.00 ? 52  MET A HG2  6  
ATOM 10600 H HG3  . MET A 1 52  ? 6.466   8.825   -3.516  1.00 0.00 ? 52  MET A HG3  6  
ATOM 10601 H HE1  . MET A 1 52  ? 9.316   9.855   -5.973  1.00 0.00 ? 52  MET A HE1  6  
ATOM 10602 H HE2  . MET A 1 52  ? 8.719   11.436  -6.534  1.00 0.00 ? 52  MET A HE2  6  
ATOM 10603 H HE3  . MET A 1 52  ? 9.132   11.197  -4.819  1.00 0.00 ? 52  MET A HE3  6  
ATOM 10604 N N    . PHE A 1 53  ? 10.007  6.385   -1.549  1.00 0.00 ? 53  PHE A N    6  
ATOM 10605 C CA   . PHE A 1 53  ? 11.077  5.410   -1.678  1.00 0.00 ? 53  PHE A CA   6  
ATOM 10606 C C    . PHE A 1 53  ? 11.321  5.055   -3.145  1.00 0.00 ? 53  PHE A C    6  
ATOM 10607 O O    . PHE A 1 53  ? 12.277  5.535   -3.754  1.00 0.00 ? 53  PHE A O    6  
ATOM 10608 C CB   . PHE A 1 53  ? 10.630  4.154   -0.929  1.00 0.00 ? 53  PHE A CB   6  
ATOM 10609 C CG   . PHE A 1 53  ? 11.218  4.025   0.477   1.00 0.00 ? 53  PHE A CG   6  
ATOM 10610 C CD1  . PHE A 1 53  ? 12.539  4.276   0.687   1.00 0.00 ? 53  PHE A CD1  6  
ATOM 10611 C CD2  . PHE A 1 53  ? 10.421  3.659   1.517   1.00 0.00 ? 53  PHE A CD2  6  
ATOM 10612 C CE1  . PHE A 1 53  ? 13.085  4.156   1.992   1.00 0.00 ? 53  PHE A CE1  6  
ATOM 10613 C CE2  . PHE A 1 53  ? 10.968  3.540   2.822   1.00 0.00 ? 53  PHE A CE2  6  
ATOM 10614 C CZ   . PHE A 1 53  ? 12.288  3.790   3.032   1.00 0.00 ? 53  PHE A CZ   6  
ATOM 10615 H H    . PHE A 1 53  ? 9.383   6.230   -0.785  1.00 0.00 ? 53  PHE A H    6  
ATOM 10616 H HA   . PHE A 1 53  ? 11.977  5.861   -1.260  1.00 0.00 ? 53  PHE A HA   6  
ATOM 10617 H HB2  . PHE A 1 53  ? 9.541   4.153   -0.857  1.00 0.00 ? 53  PHE A HB2  6  
ATOM 10618 H HB3  . PHE A 1 53  ? 10.910  3.276   -1.512  1.00 0.00 ? 53  PHE A HB3  6  
ATOM 10619 H HD1  . PHE A 1 53  ? 13.177  4.568   -0.146  1.00 0.00 ? 53  PHE A HD1  6  
ATOM 10620 H HD2  . PHE A 1 53  ? 9.363   3.459   1.349   1.00 0.00 ? 53  PHE A HD2  6  
ATOM 10621 H HE1  . PHE A 1 53  ? 14.143  4.357   2.161   1.00 0.00 ? 53  PHE A HE1  6  
ATOM 10622 H HE2  . PHE A 1 53  ? 10.329  3.247   3.656   1.00 0.00 ? 53  PHE A HE2  6  
ATOM 10623 H HZ   . PHE A 1 53  ? 12.707  3.699   4.035   1.00 0.00 ? 53  PHE A HZ   6  
ATOM 10624 N N    . LYS A 1 54  ? 10.441  4.216   -3.673  1.00 0.00 ? 54  LYS A N    6  
ATOM 10625 C CA   . LYS A 1 54  ? 10.549  3.790   -5.057  1.00 0.00 ? 54  LYS A CA   6  
ATOM 10626 C C    . LYS A 1 54  ? 9.199   3.980   -5.752  1.00 0.00 ? 54  LYS A C    6  
ATOM 10627 O O    . LYS A 1 54  ? 8.558   3.007   -6.148  1.00 0.00 ? 54  LYS A O    6  
ATOM 10628 C CB   . LYS A 1 54  ? 11.087  2.360   -5.139  1.00 0.00 ? 54  LYS A CB   6  
ATOM 10629 C CG   . LYS A 1 54  ? 11.980  2.178   -6.367  1.00 0.00 ? 54  LYS A CG   6  
ATOM 10630 C CD   . LYS A 1 54  ? 13.252  3.020   -6.248  1.00 0.00 ? 54  LYS A CD   6  
ATOM 10631 C CE   . LYS A 1 54  ? 13.280  4.125   -7.306  1.00 0.00 ? 54  LYS A CE   6  
ATOM 10632 N NZ   . LYS A 1 54  ? 14.372  3.889   -8.275  1.00 0.00 ? 54  LYS A NZ   6  
ATOM 10633 H H    . LYS A 1 54  ? 9.668   3.829   -3.172  1.00 0.00 ? 54  LYS A H    6  
ATOM 10634 H HA   . LYS A 1 54  ? 11.281  4.437   -5.542  1.00 0.00 ? 54  LYS A HA   6  
ATOM 10635 H HB2  . LYS A 1 54  ? 11.651  2.127   -4.235  1.00 0.00 ? 54  LYS A HB2  6  
ATOM 10636 H HB3  . LYS A 1 54  ? 10.254  1.657   -5.183  1.00 0.00 ? 54  LYS A HB3  6  
ATOM 10637 H HG2  . LYS A 1 54  ? 12.245  1.126   -6.475  1.00 0.00 ? 54  LYS A HG2  6  
ATOM 10638 H HG3  . LYS A 1 54  ? 11.433  2.463   -7.265  1.00 0.00 ? 54  LYS A HG3  6  
ATOM 10639 H HD2  . LYS A 1 54  ? 13.309  3.462   -5.254  1.00 0.00 ? 54  LYS A HD2  6  
ATOM 10640 H HD3  . LYS A 1 54  ? 14.128  2.381   -6.362  1.00 0.00 ? 54  LYS A HD3  6  
ATOM 10641 H HE2  . LYS A 1 54  ? 12.323  4.160   -7.828  1.00 0.00 ? 54  LYS A HE2  6  
ATOM 10642 H HE3  . LYS A 1 54  ? 13.414  5.094   -6.825  1.00 0.00 ? 54  LYS A HE3  6  
ATOM 10643 H HZ1  . LYS A 1 54  ? 14.779  2.991   -8.106  1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 10644 H HZ2  . LYS A 1 54  ? 14.006  3.918   -9.206  1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 10645 H HZ3  . LYS A 1 54  ? 15.071  4.596   -8.169  1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 10646 N N    . GLY A 1 55  ? 8.807   5.239   -5.879  1.00 0.00 ? 55  GLY A N    6  
ATOM 10647 C CA   . GLY A 1 55  ? 7.545   5.570   -6.519  1.00 0.00 ? 55  GLY A CA   6  
ATOM 10648 C C    . GLY A 1 55  ? 7.769   6.439   -7.758  1.00 0.00 ? 55  GLY A C    6  
ATOM 10649 O O    . GLY A 1 55  ? 8.857   6.442   -8.330  1.00 0.00 ? 55  GLY A O    6  
ATOM 10650 H H    . GLY A 1 55  ? 9.335   6.025   -5.555  1.00 0.00 ? 55  GLY A H    6  
ATOM 10651 H HA2  . GLY A 1 55  ? 7.026   4.654   -6.802  1.00 0.00 ? 55  GLY A HA2  6  
ATOM 10652 H HA3  . GLY A 1 55  ? 6.902   6.095   -5.813  1.00 0.00 ? 55  GLY A HA3  6  
ATOM 10653 N N    . PRO A 1 56  ? 6.693   7.176   -8.144  1.00 0.00 ? 56  PRO A N    6  
ATOM 10654 C CA   . PRO A 1 56  ? 6.762   8.047   -9.305  1.00 0.00 ? 56  PRO A CA   6  
ATOM 10655 C C    . PRO A 1 56  ? 7.560   9.314   -8.993  1.00 0.00 ? 56  PRO A C    6  
ATOM 10656 O O    . PRO A 1 56  ? 8.153   9.431   -7.921  1.00 0.00 ? 56  PRO A O    6  
ATOM 10657 C CB   . PRO A 1 56  ? 5.314   8.332   -9.669  1.00 0.00 ? 56  PRO A CB   6  
ATOM 10658 C CG   . PRO A 1 56  ? 4.499   7.994   -8.431  1.00 0.00 ? 56  PRO A CG   6  
ATOM 10659 C CD   . PRO A 1 56  ? 5.388   7.198   -7.491  1.00 0.00 ? 56  PRO A CD   6  
ATOM 10660 H HA   . PRO A 1 56  ? 7.249   7.594   -10.051 1.00 0.00 ? 56  PRO A HA   6  
ATOM 10661 H HB2  . PRO A 1 56  ? 5.181   9.377   -9.952  1.00 0.00 ? 56  PRO A HB2  6  
ATOM 10662 H HB3  . PRO A 1 56  ? 4.999   7.729   -10.521 1.00 0.00 ? 56  PRO A HB3  6  
ATOM 10663 H HG2  . PRO A 1 56  ? 4.147   8.904   -7.946  1.00 0.00 ? 56  PRO A HG2  6  
ATOM 10664 H HG3  . PRO A 1 56  ? 3.616   7.416   -8.703  1.00 0.00 ? 56  PRO A HG3  6  
ATOM 10665 H HD2  . PRO A 1 56  ? 5.446   7.666   -6.509  1.00 0.00 ? 56  PRO A HD2  6  
ATOM 10666 H HD3  . PRO A 1 56  ? 5.003   6.189   -7.341  1.00 0.00 ? 56  PRO A HD3  6  
ATOM 10667 N N    . GLU A 1 57  ? 7.550   10.233  -9.948  1.00 0.00 ? 57  GLU A N    6  
ATOM 10668 C CA   . GLU A 1 57  ? 8.266   11.486  -9.788  1.00 0.00 ? 57  GLU A CA   6  
ATOM 10669 C C    . GLU A 1 57  ? 7.352   12.543  -9.164  1.00 0.00 ? 57  GLU A C    6  
ATOM 10670 O O    . GLU A 1 57  ? 7.807   13.381  -8.386  1.00 0.00 ? 57  GLU A O    6  
ATOM 10671 C CB   . GLU A 1 57  ? 8.831   11.970  -11.126 1.00 0.00 ? 57  GLU A CB   6  
ATOM 10672 C CG   . GLU A 1 57  ? 9.108   10.792  -12.062 1.00 0.00 ? 57  GLU A CG   6  
ATOM 10673 C CD   . GLU A 1 57  ? 9.971   11.225  -13.247 1.00 0.00 ? 57  GLU A CD   6  
ATOM 10674 O OE1  . GLU A 1 57  ? 9.653   12.289  -13.823 1.00 0.00 ? 57  GLU A OE1  6  
ATOM 10675 O OE2  . GLU A 1 57  ? 10.930  10.483  -13.553 1.00 0.00 ? 57  GLU A OE2  6  
ATOM 10676 H H    . GLU A 1 57  ? 7.065   10.131  -10.817 1.00 0.00 ? 57  GLU A H    6  
ATOM 10677 H HA   . GLU A 1 57  ? 9.091   11.266  -9.111  1.00 0.00 ? 57  GLU A HA   6  
ATOM 10678 H HB2  . GLU A 1 57  ? 8.126   12.655  -11.595 1.00 0.00 ? 57  GLU A HB2  6  
ATOM 10679 H HB3  . GLU A 1 57  ? 9.752   12.528  -10.955 1.00 0.00 ? 57  GLU A HB3  6  
ATOM 10680 H HG2  . GLU A 1 57  ? 9.611   9.996   -11.512 1.00 0.00 ? 57  GLU A HG2  6  
ATOM 10681 H HG3  . GLU A 1 57  ? 8.165   10.382  -12.424 1.00 0.00 ? 57  GLU A HG3  6  
ATOM 10682 N N    . LYS A 1 58  ? 6.081   12.471  -9.530  1.00 0.00 ? 58  LYS A N    6  
ATOM 10683 C CA   . LYS A 1 58  ? 5.099   13.411  -9.017  1.00 0.00 ? 58  LYS A CA   6  
ATOM 10684 C C    . LYS A 1 58  ? 4.682   12.987  -7.607  1.00 0.00 ? 58  LYS A C    6  
ATOM 10685 O O    . LYS A 1 58  ? 5.163   13.543  -6.620  1.00 0.00 ? 58  LYS A O    6  
ATOM 10686 C CB   . LYS A 1 58  ? 3.926   13.546  -9.990  1.00 0.00 ? 58  LYS A CB   6  
ATOM 10687 C CG   . LYS A 1 58  ? 3.322   14.951  -9.929  1.00 0.00 ? 58  LYS A CG   6  
ATOM 10688 C CD   . LYS A 1 58  ? 3.618   15.732  -11.211 1.00 0.00 ? 58  LYS A CD   6  
ATOM 10689 C CE   . LYS A 1 58  ? 5.119   15.986  -11.365 1.00 0.00 ? 58  LYS A CE   6  
ATOM 10690 N NZ   . LYS A 1 58  ? 5.368   17.375  -11.809 1.00 0.00 ? 58  LYS A NZ   6  
ATOM 10691 H H    . LYS A 1 58  ? 5.719   11.786  -10.163 1.00 0.00 ? 58  LYS A H    6  
ATOM 10692 H HA   . LYS A 1 58  ? 5.582   14.387  -8.956  1.00 0.00 ? 58  LYS A HA   6  
ATOM 10693 H HB2  . LYS A 1 58  ? 4.265   13.337  -11.005 1.00 0.00 ? 58  LYS A HB2  6  
ATOM 10694 H HB3  . LYS A 1 58  ? 3.163   12.808  -9.750  1.00 0.00 ? 58  LYS A HB3  6  
ATOM 10695 H HG2  . LYS A 1 58  ? 2.245   14.881  -9.782  1.00 0.00 ? 58  LYS A HG2  6  
ATOM 10696 H HG3  . LYS A 1 58  ? 3.727   15.488  -9.070  1.00 0.00 ? 58  LYS A HG3  6  
ATOM 10697 H HD2  . LYS A 1 58  ? 3.250   15.175  -12.073 1.00 0.00 ? 58  LYS A HD2  6  
ATOM 10698 H HD3  . LYS A 1 58  ? 3.085   16.682  -11.193 1.00 0.00 ? 58  LYS A HD3  6  
ATOM 10699 H HE2  . LYS A 1 58  ? 5.624   15.805  -10.415 1.00 0.00 ? 58  LYS A HE2  6  
ATOM 10700 H HE3  . LYS A 1 58  ? 5.540   15.286  -12.086 1.00 0.00 ? 58  LYS A HE3  6  
ATOM 10701 H HZ1  . LYS A 1 58  ? 4.494   17.839  -11.956 1.00 0.00 ? 58  LYS A HZ1  6  
ATOM 10702 H HZ2  . LYS A 1 58  ? 5.889   17.861  -11.108 1.00 0.00 ? 58  LYS A HZ2  6  
ATOM 10703 H HZ3  . LYS A 1 58  ? 5.887   17.364  -12.663 1.00 0.00 ? 58  LYS A HZ3  6  
ATOM 10704 N N    . ASP A 1 59  ? 3.792   12.007  -7.557  1.00 0.00 ? 59  ASP A N    6  
ATOM 10705 C CA   . ASP A 1 59  ? 3.305   11.502  -6.284  1.00 0.00 ? 59  ASP A CA   6  
ATOM 10706 C C    . ASP A 1 59  ? 1.906   10.914  -6.476  1.00 0.00 ? 59  ASP A C    6  
ATOM 10707 O O    . ASP A 1 59  ? 1.298   11.080  -7.532  1.00 0.00 ? 59  ASP A O    6  
ATOM 10708 C CB   . ASP A 1 59  ? 3.210   12.623  -5.248  1.00 0.00 ? 59  ASP A CB   6  
ATOM 10709 C CG   . ASP A 1 59  ? 2.362   12.295  -4.018  1.00 0.00 ? 59  ASP A CG   6  
ATOM 10710 O OD1  . ASP A 1 59  ? 2.561   11.190  -3.468  1.00 0.00 ? 59  ASP A OD1  6  
ATOM 10711 O OD2  . ASP A 1 59  ? 1.533   13.157  -3.653  1.00 0.00 ? 59  ASP A OD2  6  
ATOM 10712 H H    . ASP A 1 59  ? 3.406   11.561  -8.364  1.00 0.00 ? 59  ASP A H    6  
ATOM 10713 H HA   . ASP A 1 59  ? 4.034   10.753  -5.976  1.00 0.00 ? 59  ASP A HA   6  
ATOM 10714 H HB2  . ASP A 1 59  ? 4.216   12.880  -4.919  1.00 0.00 ? 59  ASP A HB2  6  
ATOM 10715 H HB3  . ASP A 1 59  ? 2.796   13.510  -5.730  1.00 0.00 ? 59  ASP A HB3  6  
ATOM 10716 N N    . ILE A 1 60  ? 1.435   10.239  -5.438  1.00 0.00 ? 60  ILE A N    6  
ATOM 10717 C CA   . ILE A 1 60  ? 0.119   9.625   -5.478  1.00 0.00 ? 60  ILE A CA   6  
ATOM 10718 C C    . ILE A 1 60  ? -0.870  10.497  -4.703  1.00 0.00 ? 60  ILE A C    6  
ATOM 10719 O O    . ILE A 1 60  ? -1.723  11.154  -5.297  1.00 0.00 ? 60  ILE A O    6  
ATOM 10720 C CB   . ILE A 1 60  ? 0.186   8.180   -4.980  1.00 0.00 ? 60  ILE A CB   6  
ATOM 10721 C CG1  . ILE A 1 60  ? 1.556   7.564   -5.268  1.00 0.00 ? 60  ILE A CG1  6  
ATOM 10722 C CG2  . ILE A 1 60  ? -0.953  7.344   -5.568  1.00 0.00 ? 60  ILE A CG2  6  
ATOM 10723 C CD1  . ILE A 1 60  ? 1.677   7.156   -6.737  1.00 0.00 ? 60  ILE A CD1  6  
ATOM 10724 H H    . ILE A 1 60  ? 1.937   10.109  -4.582  1.00 0.00 ? 60  ILE A H    6  
ATOM 10725 H HA   . ILE A 1 60  ? -0.194  9.592   -6.522  1.00 0.00 ? 60  ILE A HA   6  
ATOM 10726 H HB   . ILE A 1 60  ? 0.056   8.186   -3.898  1.00 0.00 ? 60  ILE A HB   6  
ATOM 10727 H HG12 . ILE A 1 60  ? 2.341   8.280   -5.020  1.00 0.00 ? 60  ILE A HG12 6  
ATOM 10728 H HG13 . ILE A 1 60  ? 1.708   6.692   -4.632  1.00 0.00 ? 60  ILE A HG13 6  
ATOM 10729 H HG21 . ILE A 1 60  ? -1.889  7.898   -5.487  1.00 0.00 ? 60  ILE A HG21 6  
ATOM 10730 H HG22 . ILE A 1 60  ? -0.745  7.133   -6.617  1.00 0.00 ? 60  ILE A HG22 6  
ATOM 10731 H HG23 . ILE A 1 60  ? -1.036  6.407   -5.019  1.00 0.00 ? 60  ILE A HG23 6  
ATOM 10732 H HD11 . ILE A 1 60  ? 1.303   7.962   -7.370  1.00 0.00 ? 60  ILE A HD11 6  
ATOM 10733 H HD12 . ILE A 1 60  ? 2.723   6.964   -6.977  1.00 0.00 ? 60  ILE A HD12 6  
ATOM 10734 H HD13 . ILE A 1 60  ? 1.092   6.254   -6.914  1.00 0.00 ? 60  ILE A HD13 6  
ATOM 10735 N N    . GLU A 1 61  ? -0.722  10.477  -3.387  1.00 0.00 ? 61  GLU A N    6  
ATOM 10736 C CA   . GLU A 1 61  ? -1.591  11.257  -2.522  1.00 0.00 ? 61  GLU A CA   6  
ATOM 10737 C C    . GLU A 1 61  ? -2.978  10.617  -2.446  1.00 0.00 ? 61  GLU A C    6  
ATOM 10738 O O    . GLU A 1 61  ? -3.818  11.038  -1.652  1.00 0.00 ? 61  GLU A O    6  
ATOM 10739 C CB   . GLU A 1 61  ? -1.682  12.707  -3.003  1.00 0.00 ? 61  GLU A CB   6  
ATOM 10740 C CG   . GLU A 1 61  ? -0.979  13.654  -2.028  1.00 0.00 ? 61  GLU A CG   6  
ATOM 10741 C CD   . GLU A 1 61  ? -0.262  14.779  -2.777  1.00 0.00 ? 61  GLU A CD   6  
ATOM 10742 O OE1  . GLU A 1 61  ? -0.468  14.863  -4.008  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 10743 O OE2  . GLU A 1 61  ? 0.476   15.529  -2.103  1.00 0.00 ? 61  GLU A OE2  6  
ATOM 10744 H H    . GLU A 1 61  ? -0.025  9.940   -2.910  1.00 0.00 ? 61  GLU A H    6  
ATOM 10745 H HA   . GLU A 1 61  ? -1.119  11.236  -1.540  1.00 0.00 ? 61  GLU A HA   6  
ATOM 10746 H HB2  . GLU A 1 61  ? -1.230  12.796  -3.991  1.00 0.00 ? 61  GLU A HB2  6  
ATOM 10747 H HB3  . GLU A 1 61  ? -2.729  12.995  -3.104  1.00 0.00 ? 61  GLU A HB3  6  
ATOM 10748 H HG2  . GLU A 1 61  ? -1.709  14.079  -1.338  1.00 0.00 ? 61  GLU A HG2  6  
ATOM 10749 H HG3  . GLU A 1 61  ? -0.261  13.096  -1.428  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 10750 N N    . PHE A 1 62  ? -3.176  9.608   -3.283  1.00 0.00 ? 62  PHE A N    6  
ATOM 10751 C CA   . PHE A 1 62  ? -4.447  8.906   -3.320  1.00 0.00 ? 62  PHE A CA   6  
ATOM 10752 C C    . PHE A 1 62  ? -4.251  7.440   -3.713  1.00 0.00 ? 62  PHE A C    6  
ATOM 10753 O O    . PHE A 1 62  ? -4.109  7.122   -4.892  1.00 0.00 ? 62  PHE A O    6  
ATOM 10754 C CB   . PHE A 1 62  ? -5.309  9.594   -4.380  1.00 0.00 ? 62  PHE A CB   6  
ATOM 10755 C CG   . PHE A 1 62  ? -6.412  10.483  -3.804  1.00 0.00 ? 62  PHE A CG   6  
ATOM 10756 C CD1  . PHE A 1 62  ? -7.438  9.928   -3.106  1.00 0.00 ? 62  PHE A CD1  6  
ATOM 10757 C CD2  . PHE A 1 62  ? -6.367  11.830  -3.991  1.00 0.00 ? 62  PHE A CD2  6  
ATOM 10758 C CE1  . PHE A 1 62  ? -8.463  10.753  -2.571  1.00 0.00 ? 62  PHE A CE1  6  
ATOM 10759 C CE2  . PHE A 1 62  ? -7.391  12.656  -3.456  1.00 0.00 ? 62  PHE A CE2  6  
ATOM 10760 C CZ   . PHE A 1 62  ? -8.417  12.099  -2.758  1.00 0.00 ? 62  PHE A CZ   6  
ATOM 10761 H H    . PHE A 1 62  ? -2.488  9.272   -3.926  1.00 0.00 ? 62  PHE A H    6  
ATOM 10762 H HA   . PHE A 1 62  ? -4.875  8.957   -2.319  1.00 0.00 ? 62  PHE A HA   6  
ATOM 10763 H HB2  . PHE A 1 62  ? -4.665  10.199  -5.020  1.00 0.00 ? 62  PHE A HB2  6  
ATOM 10764 H HB3  . PHE A 1 62  ? -5.763  8.833   -5.014  1.00 0.00 ? 62  PHE A HB3  6  
ATOM 10765 H HD1  . PHE A 1 62  ? -7.474  8.848   -2.956  1.00 0.00 ? 62  PHE A HD1  6  
ATOM 10766 H HD2  . PHE A 1 62  ? -5.545  12.276  -4.550  1.00 0.00 ? 62  PHE A HD2  6  
ATOM 10767 H HE1  . PHE A 1 62  ? -9.285  10.307  -2.011  1.00 0.00 ? 62  PHE A HE1  6  
ATOM 10768 H HE2  . PHE A 1 62  ? -7.356  13.734  -3.605  1.00 0.00 ? 62  PHE A HE2  6  
ATOM 10769 H HZ   . PHE A 1 62  ? -9.204  12.733  -2.348  1.00 0.00 ? 62  PHE A HZ   6  
ATOM 10770 N N    . ILE A 1 63  ? -4.250  6.584   -2.700  1.00 0.00 ? 63  ILE A N    6  
ATOM 10771 C CA   . ILE A 1 63  ? -4.074  5.160   -2.925  1.00 0.00 ? 63  ILE A CA   6  
ATOM 10772 C C    . ILE A 1 63  ? -5.428  4.458   -2.805  1.00 0.00 ? 63  ILE A C    6  
ATOM 10773 O O    . ILE A 1 63  ? -6.410  5.064   -2.378  1.00 0.00 ? 63  ILE A O    6  
ATOM 10774 C CB   . ILE A 1 63  ? -3.005  4.597   -1.985  1.00 0.00 ? 63  ILE A CB   6  
ATOM 10775 C CG1  . ILE A 1 63  ? -1.962  5.663   -1.642  1.00 0.00 ? 63  ILE A CG1  6  
ATOM 10776 C CG2  . ILE A 1 63  ? -2.365  3.338   -2.574  1.00 0.00 ? 63  ILE A CG2  6  
ATOM 10777 C CD1  . ILE A 1 63  ? -0.690  5.473   -2.472  1.00 0.00 ? 63  ILE A CD1  6  
ATOM 10778 H H    . ILE A 1 63  ? -4.366  6.850   -1.743  1.00 0.00 ? 63  ILE A H    6  
ATOM 10779 H HA   . ILE A 1 63  ? -3.708  5.031   -3.943  1.00 0.00 ? 63  ILE A HA   6  
ATOM 10780 H HB   . ILE A 1 63  ? -3.488  4.308   -1.053  1.00 0.00 ? 63  ILE A HB   6  
ATOM 10781 H HG12 . ILE A 1 63  ? -2.375  6.654   -1.826  1.00 0.00 ? 63  ILE A HG12 6  
ATOM 10782 H HG13 . ILE A 1 63  ? -1.719  5.610   -0.580  1.00 0.00 ? 63  ILE A HG13 6  
ATOM 10783 H HG21 . ILE A 1 63  ? -2.249  3.459   -3.651  1.00 0.00 ? 63  ILE A HG21 6  
ATOM 10784 H HG22 . ILE A 1 63  ? -1.388  3.180   -2.119  1.00 0.00 ? 63  ILE A HG22 6  
ATOM 10785 H HG23 . ILE A 1 63  ? -3.004  2.478   -2.372  1.00 0.00 ? 63  ILE A HG23 6  
ATOM 10786 H HD11 . ILE A 1 63  ? -0.960  5.238   -3.501  1.00 0.00 ? 63  ILE A HD11 6  
ATOM 10787 H HD12 . ILE A 1 63  ? -0.102  6.391   -2.451  1.00 0.00 ? 63  ILE A HD12 6  
ATOM 10788 H HD13 . ILE A 1 63  ? -0.102  4.655   -2.054  1.00 0.00 ? 63  ILE A HD13 6  
ATOM 10789 N N    . TYR A 1 64  ? -5.438  3.190   -3.189  1.00 0.00 ? 64  TYR A N    6  
ATOM 10790 C CA   . TYR A 1 64  ? -6.655  2.399   -3.129  1.00 0.00 ? 64  TYR A CA   6  
ATOM 10791 C C    . TYR A 1 64  ? -6.463  1.162   -2.250  1.00 0.00 ? 64  TYR A C    6  
ATOM 10792 O O    . TYR A 1 64  ? -5.351  0.651   -2.125  1.00 0.00 ? 64  TYR A O    6  
ATOM 10793 C CB   . TYR A 1 64  ? -6.937  1.951   -4.565  1.00 0.00 ? 64  TYR A CB   6  
ATOM 10794 C CG   . TYR A 1 64  ? -7.501  0.533   -4.675  1.00 0.00 ? 64  TYR A CG   6  
ATOM 10795 C CD1  . TYR A 1 64  ? -6.709  -0.551  -4.355  1.00 0.00 ? 64  TYR A CD1  6  
ATOM 10796 C CD2  . TYR A 1 64  ? -8.801  0.338   -5.094  1.00 0.00 ? 64  TYR A CD2  6  
ATOM 10797 C CE1  . TYR A 1 64  ? -7.239  -1.886  -4.458  1.00 0.00 ? 64  TYR A CE1  6  
ATOM 10798 C CE2  . TYR A 1 64  ? -9.331  -0.998  -5.198  1.00 0.00 ? 64  TYR A CE2  6  
ATOM 10799 C CZ   . TYR A 1 64  ? -8.525  -2.043  -4.874  1.00 0.00 ? 64  TYR A CZ   6  
ATOM 10800 O OH   . TYR A 1 64  ? -9.025  -3.304  -4.973  1.00 0.00 ? 64  TYR A OH   6  
ATOM 10801 H H    . TYR A 1 64  ? -4.635  2.704   -3.534  1.00 0.00 ? 64  TYR A H    6  
ATOM 10802 H HA   . TYR A 1 64  ? -7.441  3.022   -2.702  1.00 0.00 ? 64  TYR A HA   6  
ATOM 10803 H HB2  . TYR A 1 64  ? -7.642  2.647   -5.021  1.00 0.00 ? 64  TYR A HB2  6  
ATOM 10804 H HB3  . TYR A 1 64  ? -6.014  2.010   -5.141  1.00 0.00 ? 64  TYR A HB3  6  
ATOM 10805 H HD1  . TYR A 1 64  ? -5.682  -0.397  -4.024  1.00 0.00 ? 64  TYR A HD1  6  
ATOM 10806 H HD2  . TYR A 1 64  ? -9.426  1.193   -5.348  1.00 0.00 ? 64  TYR A HD2  6  
ATOM 10807 H HE1  . TYR A 1 64  ? -6.625  -2.751  -4.208  1.00 0.00 ? 64  TYR A HE1  6  
ATOM 10808 H HE2  . TYR A 1 64  ? -10.356 -1.166  -5.528  1.00 0.00 ? 64  TYR A HE2  6  
ATOM 10809 H HH   . TYR A 1 64  ? -8.668  -3.751  -5.792  1.00 0.00 ? 64  TYR A HH   6  
ATOM 10810 N N    . THR A 1 65  ? -7.565  0.716   -1.663  1.00 0.00 ? 65  THR A N    6  
ATOM 10811 C CA   . THR A 1 65  ? -7.531  -0.452  -0.799  1.00 0.00 ? 65  THR A CA   6  
ATOM 10812 C C    . THR A 1 65  ? -8.952  -0.935  -0.502  1.00 0.00 ? 65  THR A C    6  
ATOM 10813 O O    . THR A 1 65  ? -9.886  -0.620  -1.237  1.00 0.00 ? 65  THR A O    6  
ATOM 10814 C CB   . THR A 1 65  ? -6.738  -0.088  0.457   1.00 0.00 ? 65  THR A CB   6  
ATOM 10815 O OG1  . THR A 1 65  ? -6.810  -1.260  1.264   1.00 0.00 ? 65  THR A OG1  6  
ATOM 10816 C CG2  . THR A 1 65  ? -7.430  0.987   1.297   1.00 0.00 ? 65  THR A CG2  6  
ATOM 10817 H H    . THR A 1 65  ? -8.465  1.138   -1.771  1.00 0.00 ? 65  THR A H    6  
ATOM 10818 H HA   . THR A 1 65  ? -7.025  -1.257  -1.330  1.00 0.00 ? 65  THR A HA   6  
ATOM 10819 H HB   . THR A 1 65  ? -5.721  0.212   0.201   1.00 0.00 ? 65  THR A HB   6  
ATOM 10820 H HG1  . THR A 1 65  ? -6.502  -1.054  2.193   1.00 0.00 ? 65  THR A HG1  6  
ATOM 10821 H HG21 . THR A 1 65  ? -8.508  0.926   1.148   1.00 0.00 ? 65  THR A HG21 6  
ATOM 10822 H HG22 . THR A 1 65  ? -7.199  0.831   2.350   1.00 0.00 ? 65  THR A HG22 6  
ATOM 10823 H HG23 . THR A 1 65  ? -7.077  1.972   0.989   1.00 0.00 ? 65  THR A HG23 6  
ATOM 10824 N N    . ALA A 1 66  ? -9.071  -1.692  0.579   1.00 0.00 ? 66  ALA A N    6  
ATOM 10825 C CA   . ALA A 1 66  ? -10.362 -2.223  0.983   1.00 0.00 ? 66  ALA A CA   6  
ATOM 10826 C C    . ALA A 1 66  ? -10.814 -1.527  2.269   1.00 0.00 ? 66  ALA A C    6  
ATOM 10827 O O    . ALA A 1 66  ? -9.987  -1.072  3.056   1.00 0.00 ? 66  ALA A O    6  
ATOM 10828 C CB   . ALA A 1 66  ? -10.263 -3.741  1.146   1.00 0.00 ? 66  ALA A CB   6  
ATOM 10829 H H    . ALA A 1 66  ? -8.307  -1.945  1.172   1.00 0.00 ? 66  ALA A H    6  
ATOM 10830 H HA   . ALA A 1 66  ? -11.075 -2.000  0.189   1.00 0.00 ? 66  ALA A HA   6  
ATOM 10831 H HB1  . ALA A 1 66  ? -9.214  -4.033  1.191   1.00 0.00 ? 66  ALA A HB1  6  
ATOM 10832 H HB2  . ALA A 1 66  ? -10.765 -4.041  2.065   1.00 0.00 ? 66  ALA A HB2  6  
ATOM 10833 H HB3  . ALA A 1 66  ? -10.740 -4.229  0.296   1.00 0.00 ? 66  ALA A HB3  6  
ATOM 10834 N N    . PRO A 1 67  ? -12.161 -1.465  2.446   1.00 0.00 ? 67  PRO A N    6  
ATOM 10835 C CA   . PRO A 1 67  ? -12.733 -0.833  3.622   1.00 0.00 ? 67  PRO A CA   6  
ATOM 10836 C C    . PRO A 1 67  ? -12.578 -1.725  4.854   1.00 0.00 ? 67  PRO A C    6  
ATOM 10837 O O    . PRO A 1 67  ? -11.739 -2.625  4.872   1.00 0.00 ? 67  PRO A O    6  
ATOM 10838 C CB   . PRO A 1 67  ? -14.186 -0.568  3.259   1.00 0.00 ? 67  PRO A CB   6  
ATOM 10839 C CG   . PRO A 1 67  ? -14.492 -1.474  2.079   1.00 0.00 ? 67  PRO A CG   6  
ATOM 10840 C CD   . PRO A 1 67  ? -13.172 -1.993  1.534   1.00 0.00 ? 67  PRO A CD   6  
ATOM 10841 H HA   . PRO A 1 67  ? -12.244 0.014   3.833   1.00 0.00 ? 67  PRO A HA   6  
ATOM 10842 H HB2  . PRO A 1 67  ? -14.844 -0.785  4.100   1.00 0.00 ? 67  PRO A HB2  6  
ATOM 10843 H HB3  . PRO A 1 67  ? -14.338 0.480   2.998   1.00 0.00 ? 67  PRO A HB3  6  
ATOM 10844 H HG2  . PRO A 1 67  ? -15.129 -2.304  2.389   1.00 0.00 ? 67  PRO A HG2  6  
ATOM 10845 H HG3  . PRO A 1 67  ? -15.035 -0.928  1.308   1.00 0.00 ? 67  PRO A HG3  6  
ATOM 10846 H HD2  . PRO A 1 67  ? -13.153 -3.082  1.510   1.00 0.00 ? 67  PRO A HD2  6  
ATOM 10847 H HD3  . PRO A 1 67  ? -13.002 -1.649  0.513   1.00 0.00 ? 67  PRO A HD3  6  
ATOM 10848 N N    . SER A 1 68  ? -13.399 -1.444  5.856   1.00 0.00 ? 68  SER A N    6  
ATOM 10849 C CA   . SER A 1 68  ? -13.363 -2.211  7.090   1.00 0.00 ? 68  SER A CA   6  
ATOM 10850 C C    . SER A 1 68  ? -11.955 -2.177  7.687   1.00 0.00 ? 68  SER A C    6  
ATOM 10851 O O    . SER A 1 68  ? -11.098 -1.428  7.221   1.00 0.00 ? 68  SER A O    6  
ATOM 10852 C CB   . SER A 1 68  ? -13.804 -3.657  6.853   1.00 0.00 ? 68  SER A CB   6  
ATOM 10853 O OG   . SER A 1 68  ? -15.195 -3.839  7.103   1.00 0.00 ? 68  SER A OG   6  
ATOM 10854 H H    . SER A 1 68  ? -14.078 -0.711  5.834   1.00 0.00 ? 68  SER A H    6  
ATOM 10855 H HA   . SER A 1 68  ? -14.073 -1.721  7.756   1.00 0.00 ? 68  SER A HA   6  
ATOM 10856 H HB2  . SER A 1 68  ? -13.581 -3.940  5.824   1.00 0.00 ? 68  SER A HB2  6  
ATOM 10857 H HB3  . SER A 1 68  ? -13.229 -4.321  7.498   1.00 0.00 ? 68  SER A HB3  6  
ATOM 10858 H HG   . SER A 1 68  ? -15.395 -3.665  8.068   1.00 0.00 ? 68  SER A HG   6  
ATOM 10859 N N    . SER A 1 69  ? -11.760 -2.997  8.710   1.00 0.00 ? 69  SER A N    6  
ATOM 10860 C CA   . SER A 1 69  ? -10.471 -3.070  9.375   1.00 0.00 ? 69  SER A CA   6  
ATOM 10861 C C    . SER A 1 69  ? -9.450  -3.754  8.465   1.00 0.00 ? 69  SER A C    6  
ATOM 10862 O O    . SER A 1 69  ? -8.828  -4.741  8.855   1.00 0.00 ? 69  SER A O    6  
ATOM 10863 C CB   . SER A 1 69  ? -10.579 -3.815  10.706  1.00 0.00 ? 69  SER A CB   6  
ATOM 10864 O OG   . SER A 1 69  ? -9.430  -3.619  11.524  1.00 0.00 ? 69  SER A OG   6  
ATOM 10865 H H    . SER A 1 69  ? -12.463 -3.602  9.082   1.00 0.00 ? 69  SER A H    6  
ATOM 10866 H HA   . SER A 1 69  ? -10.183 -2.034  9.562   1.00 0.00 ? 69  SER A HA   6  
ATOM 10867 H HB2  . SER A 1 69  ? -11.467 -3.476  11.241  1.00 0.00 ? 69  SER A HB2  6  
ATOM 10868 H HB3  . SER A 1 69  ? -10.711 -4.881  10.516  1.00 0.00 ? 69  SER A HB3  6  
ATOM 10869 H HG   . SER A 1 69  ? -9.661  -3.044  12.308  1.00 0.00 ? 69  SER A HG   6  
ATOM 10870 N N    . ALA A 1 70  ? -9.308  -3.204  7.268   1.00 0.00 ? 70  ALA A N    6  
ATOM 10871 C CA   . ALA A 1 70  ? -8.374  -3.749  6.298   1.00 0.00 ? 70  ALA A CA   6  
ATOM 10872 C C    . ALA A 1 70  ? -8.737  -5.207  6.010   1.00 0.00 ? 70  ALA A C    6  
ATOM 10873 O O    . ALA A 1 70  ? -8.443  -6.095  6.808   1.00 0.00 ? 70  ALA A O    6  
ATOM 10874 C CB   . ALA A 1 70  ? -6.945  -3.599  6.826   1.00 0.00 ? 70  ALA A CB   6  
ATOM 10875 H H    . ALA A 1 70  ? -9.818  -2.401  6.958   1.00 0.00 ? 70  ALA A H    6  
ATOM 10876 H HA   . ALA A 1 70  ? -8.472  -3.170  5.380   1.00 0.00 ? 70  ALA A HA   6  
ATOM 10877 H HB1  . ALA A 1 70  ? -6.945  -2.928  7.686   1.00 0.00 ? 70  ALA A HB1  6  
ATOM 10878 H HB2  . ALA A 1 70  ? -6.564  -4.576  7.126   1.00 0.00 ? 70  ALA A HB2  6  
ATOM 10879 H HB3  . ALA A 1 70  ? -6.310  -3.186  6.042   1.00 0.00 ? 70  ALA A HB3  6  
ATOM 10880 N N    . VAL A 1 71  ? -9.375  -5.409  4.866   1.00 0.00 ? 71  VAL A N    6  
ATOM 10881 C CA   . VAL A 1 71  ? -9.782  -6.743  4.461   1.00 0.00 ? 71  VAL A CA   6  
ATOM 10882 C C    . VAL A 1 71  ? -8.958  -7.179  3.248   1.00 0.00 ? 71  VAL A C    6  
ATOM 10883 O O    . VAL A 1 71  ? -8.668  -8.362  3.083   1.00 0.00 ? 71  VAL A O    6  
ATOM 10884 C CB   . VAL A 1 71  ? -11.290 -6.774  4.201   1.00 0.00 ? 71  VAL A CB   6  
ATOM 10885 C CG1  . VAL A 1 71  ? -11.990 -5.608  4.902   1.00 0.00 ? 71  VAL A CG1  6  
ATOM 10886 C CG2  . VAL A 1 71  ? -11.587 -6.770  2.700   1.00 0.00 ? 71  VAL A CG2  6  
ATOM 10887 H H    . VAL A 1 71  ? -9.611  -4.682  4.221   1.00 0.00 ? 71  VAL A H    6  
ATOM 10888 H HA   . VAL A 1 71  ? -9.569  -7.418  5.290   1.00 0.00 ? 71  VAL A HA   6  
ATOM 10889 H HB   . VAL A 1 71  ? -11.683 -7.701  4.618   1.00 0.00 ? 71  VAL A HB   6  
ATOM 10890 H HG11 . VAL A 1 71  ? -11.453 -5.359  5.816   1.00 0.00 ? 71  VAL A HG11 6  
ATOM 10891 H HG12 . VAL A 1 71  ? -12.005 -4.741  4.241   1.00 0.00 ? 71  VAL A HG12 6  
ATOM 10892 H HG13 . VAL A 1 71  ? -13.013 -5.895  5.149   1.00 0.00 ? 71  VAL A HG13 6  
ATOM 10893 H HG21 . VAL A 1 71  ? -10.989 -5.998  2.213   1.00 0.00 ? 71  VAL A HG21 6  
ATOM 10894 H HG22 . VAL A 1 71  ? -11.339 -7.743  2.278   1.00 0.00 ? 71  VAL A HG22 6  
ATOM 10895 H HG23 . VAL A 1 71  ? -12.646 -6.563  2.541   1.00 0.00 ? 71  VAL A HG23 6  
ATOM 10896 N N    . CYS A 1 72  ? -8.603  -6.197  2.431   1.00 0.00 ? 72  CYS A N    6  
ATOM 10897 C CA   . CYS A 1 72  ? -7.817  -6.463  1.238   1.00 0.00 ? 72  CYS A CA   6  
ATOM 10898 C C    . CYS A 1 72  ? -6.612  -5.523  1.237   1.00 0.00 ? 72  CYS A C    6  
ATOM 10899 O O    . CYS A 1 72  ? -5.870  -5.459  0.256   1.00 0.00 ? 72  CYS A O    6  
ATOM 10900 C CB   . CYS A 1 72  ? -8.655  -6.320  -0.035  1.00 0.00 ? 72  CYS A CB   6  
ATOM 10901 S SG   . CYS A 1 72  ? -10.312 -7.092  0.045   1.00 0.00 ? 72  CYS A SG   6  
ATOM 10902 H H    . CYS A 1 72  ? -8.843  -5.237  2.572   1.00 0.00 ? 72  CYS A H    6  
ATOM 10903 H HA   . CYS A 1 72  ? -7.498  -7.504  1.299   1.00 0.00 ? 72  CYS A HA   6  
ATOM 10904 H HB2  . CYS A 1 72  ? -8.774  -5.259  -0.256  1.00 0.00 ? 72  CYS A HB2  6  
ATOM 10905 H HB3  . CYS A 1 72  ? -8.104  -6.759  -0.866  1.00 0.00 ? 72  CYS A HB3  6  
ATOM 10906 N N    . GLY A 1 73  ? -6.451  -4.817  2.346   1.00 0.00 ? 73  GLY A N    6  
ATOM 10907 C CA   . GLY A 1 73  ? -5.348  -3.882  2.486   1.00 0.00 ? 73  GLY A CA   6  
ATOM 10908 C C    . GLY A 1 73  ? -4.870  -3.811  3.938   1.00 0.00 ? 73  GLY A C    6  
ATOM 10909 O O    . GLY A 1 73  ? -4.995  -4.781  4.685   1.00 0.00 ? 73  GLY A O    6  
ATOM 10910 H H    . GLY A 1 73  ? -7.058  -4.876  3.139   1.00 0.00 ? 73  GLY A H    6  
ATOM 10911 H HA2  . GLY A 1 73  ? -4.523  -4.190  1.842   1.00 0.00 ? 73  GLY A HA2  6  
ATOM 10912 H HA3  . GLY A 1 73  ? -5.660  -2.893  2.153   1.00 0.00 ? 73  GLY A HA3  6  
ATOM 10913 N N    . VAL A 1 74  ? -4.331  -2.655  4.294   1.00 0.00 ? 74  VAL A N    6  
ATOM 10914 C CA   . VAL A 1 74  ? -3.834  -2.444  5.642   1.00 0.00 ? 74  VAL A CA   6  
ATOM 10915 C C    . VAL A 1 74  ? -4.632  -1.321  6.307   1.00 0.00 ? 74  VAL A C    6  
ATOM 10916 O O    . VAL A 1 74  ? -4.303  -0.889  7.411   1.00 0.00 ? 74  VAL A O    6  
ATOM 10917 C CB   . VAL A 1 74  ? -2.329  -2.169  5.609   1.00 0.00 ? 74  VAL A CB   6  
ATOM 10918 C CG1  . VAL A 1 74  ? -1.787  -1.911  7.016   1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10919 C CG2  . VAL A 1 74  ? -1.577  -3.317  4.933   1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10920 H H    . VAL A 1 74  ? -4.233  -1.870  3.680   1.00 0.00 ? 74  VAL A H    6  
ATOM 10921 H HA   . VAL A 1 74  ? -3.995  -3.367  6.200   1.00 0.00 ? 74  VAL A HA   6  
ATOM 10922 H HB   . VAL A 1 74  ? -2.167  -1.268  5.017   1.00 0.00 ? 74  VAL A HB   6  
ATOM 10923 H HG11 . VAL A 1 74  ? -2.173  -2.669  7.698   1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10924 H HG12 . VAL A 1 74  ? -0.698  -1.958  7.001   1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10925 H HG13 . VAL A 1 74  ? -2.104  -0.924  7.352   1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10926 H HG21 . VAL A 1 74  ? -2.218  -3.779  4.182   1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10927 H HG22 . VAL A 1 74  ? -0.677  -2.931  4.455   1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10928 H HG23 . VAL A 1 74  ? -1.300  -4.061  5.681   1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10929 N N    . SER A 1 75  ? -5.666  -0.879  5.606   1.00 0.00 ? 75  SER A N    6  
ATOM 10930 C CA   . SER A 1 75  ? -6.515  0.186   6.114   1.00 0.00 ? 75  SER A CA   6  
ATOM 10931 C C    . SER A 1 75  ? -5.711  1.093   7.050   1.00 0.00 ? 75  SER A C    6  
ATOM 10932 O O    . SER A 1 75  ? -5.712  0.894   8.264   1.00 0.00 ? 75  SER A O    6  
ATOM 10933 C CB   . SER A 1 75  ? -7.735  -0.381  6.842   1.00 0.00 ? 75  SER A CB   6  
ATOM 10934 O OG   . SER A 1 75  ? -8.924  0.342   6.533   1.00 0.00 ? 75  SER A OG   6  
ATOM 10935 H H    . SER A 1 75  ? -5.927  -1.236  4.709   1.00 0.00 ? 75  SER A H    6  
ATOM 10936 H HA   . SER A 1 75  ? -6.842  0.740   5.234   1.00 0.00 ? 75  SER A HA   6  
ATOM 10937 H HB2  . SER A 1 75  ? -7.865  -1.428  6.569   1.00 0.00 ? 75  SER A HB2  6  
ATOM 10938 H HB3  . SER A 1 75  ? -7.561  -0.351  7.918   1.00 0.00 ? 75  SER A HB3  6  
ATOM 10939 H HG   . SER A 1 75  ? -9.724  -0.164  6.856   1.00 0.00 ? 75  SER A HG   6  
ATOM 10940 N N    . LEU A 1 76  ? -5.048  2.069   6.450   1.00 0.00 ? 76  LEU A N    6  
ATOM 10941 C CA   . LEU A 1 76  ? -4.242  3.007   7.214   1.00 0.00 ? 76  LEU A CA   6  
ATOM 10942 C C    . LEU A 1 76  ? -4.957  4.359   7.270   1.00 0.00 ? 76  LEU A C    6  
ATOM 10943 O O    . LEU A 1 76  ? -5.427  4.859   6.248   1.00 0.00 ? 76  LEU A O    6  
ATOM 10944 C CB   . LEU A 1 76  ? -2.825  3.084   6.645   1.00 0.00 ? 76  LEU A CB   6  
ATOM 10945 C CG   . LEU A 1 76  ? -2.338  1.848   5.886   1.00 0.00 ? 76  LEU A CG   6  
ATOM 10946 C CD1  . LEU A 1 76  ? -2.463  2.048   4.375   1.00 0.00 ? 76  LEU A CD1  6  
ATOM 10947 C CD2  . LEU A 1 76  ? -0.912  1.477   6.299   1.00 0.00 ? 76  LEU A CD2  6  
ATOM 10948 H H    . LEU A 1 76  ? -5.053  2.224   5.462   1.00 0.00 ? 76  LEU A H    6  
ATOM 10949 H HA   . LEU A 1 76  ? -4.162  2.617   8.228   1.00 0.00 ? 76  LEU A HA   6  
ATOM 10950 H HB2  . LEU A 1 76  ? -2.769  3.943   5.975   1.00 0.00 ? 76  LEU A HB2  6  
ATOM 10951 H HB3  . LEU A 1 76  ? -2.135  3.276   7.467   1.00 0.00 ? 76  LEU A HB3  6  
ATOM 10952 H HG   . LEU A 1 76  ? -2.980  1.008   6.154   1.00 0.00 ? 76  LEU A HG   6  
ATOM 10953 H HD11 . LEU A 1 76  ? -3.235  2.791   4.169   1.00 0.00 ? 76  LEU A HD11 6  
ATOM 10954 H HD12 . LEU A 1 76  ? -1.511  2.393   3.973   1.00 0.00 ? 76  LEU A HD12 6  
ATOM 10955 H HD13 . LEU A 1 76  ? -2.736  1.103   3.904   1.00 0.00 ? 76  LEU A HD13 6  
ATOM 10956 H HD21 . LEU A 1 76  ? -0.587  2.129   7.108   1.00 0.00 ? 76  LEU A HD21 6  
ATOM 10957 H HD22 . LEU A 1 76  ? -0.890  0.441   6.636   1.00 0.00 ? 76  LEU A HD22 6  
ATOM 10958 H HD23 . LEU A 1 76  ? -0.245  1.596   5.445   1.00 0.00 ? 76  LEU A HD23 6  
ATOM 10959 N N    . ASP A 1 77  ? -5.018  4.912   8.472   1.00 0.00 ? 77  ASP A N    6  
ATOM 10960 C CA   . ASP A 1 77  ? -5.667  6.195   8.674   1.00 0.00 ? 77  ASP A CA   6  
ATOM 10961 C C    . ASP A 1 77  ? -4.658  7.187   9.256   1.00 0.00 ? 77  ASP A C    6  
ATOM 10962 O O    . ASP A 1 77  ? -5.006  8.328   9.558   1.00 0.00 ? 77  ASP A O    6  
ATOM 10963 C CB   . ASP A 1 77  ? -6.832  6.074   9.659   1.00 0.00 ? 77  ASP A CB   6  
ATOM 10964 C CG   . ASP A 1 77  ? -6.437  6.118   11.137  1.00 0.00 ? 77  ASP A CG   6  
ATOM 10965 O OD1  . ASP A 1 77  ? -6.043  7.216   11.586  1.00 0.00 ? 77  ASP A OD1  6  
ATOM 10966 O OD2  . ASP A 1 77  ? -6.539  5.053   11.783  1.00 0.00 ? 77  ASP A OD2  6  
ATOM 10967 H H    . ASP A 1 77  ? -4.633  4.497   9.298   1.00 0.00 ? 77  ASP A H    6  
ATOM 10968 H HA   . ASP A 1 77  ? -6.024  6.494   7.689   1.00 0.00 ? 77  ASP A HA   6  
ATOM 10969 H HB2  . ASP A 1 77  ? -7.538  6.881   9.463   1.00 0.00 ? 77  ASP A HB2  6  
ATOM 10970 H HB3  . ASP A 1 77  ? -7.356  5.139   9.466   1.00 0.00 ? 77  ASP A HB3  6  
ATOM 10971 N N    . VAL A 1 78  ? -3.427  6.716   9.396   1.00 0.00 ? 78  VAL A N    6  
ATOM 10972 C CA   . VAL A 1 78  ? -2.365  7.547   9.936   1.00 0.00 ? 78  VAL A CA   6  
ATOM 10973 C C    . VAL A 1 78  ? -2.640  7.821   11.416  1.00 0.00 ? 78  VAL A C    6  
ATOM 10974 O O    . VAL A 1 78  ? -1.813  7.513   12.272  1.00 0.00 ? 78  VAL A O    6  
ATOM 10975 C CB   . VAL A 1 78  ? -2.227  8.825   9.106   1.00 0.00 ? 78  VAL A CB   6  
ATOM 10976 C CG1  . VAL A 1 78  ? -1.632  9.960   9.943   1.00 0.00 ? 78  VAL A CG1  6  
ATOM 10977 C CG2  . VAL A 1 78  ? -1.392  8.576   7.848   1.00 0.00 ? 78  VAL A CG2  6  
ATOM 10978 H H    . VAL A 1 78  ? -3.152  5.787   9.148   1.00 0.00 ? 78  VAL A H    6  
ATOM 10979 H HA   . VAL A 1 78  ? -1.433  6.987   9.850   1.00 0.00 ? 78  VAL A HA   6  
ATOM 10980 H HB   . VAL A 1 78  ? -3.225  9.129   8.790   1.00 0.00 ? 78  VAL A HB   6  
ATOM 10981 H HG11 . VAL A 1 78  ? -0.855  9.563   10.594  1.00 0.00 ? 78  VAL A HG11 6  
ATOM 10982 H HG12 . VAL A 1 78  ? -1.204  10.713  9.281   1.00 0.00 ? 78  VAL A HG12 6  
ATOM 10983 H HG13 . VAL A 1 78  ? -2.417  10.414  10.548  1.00 0.00 ? 78  VAL A HG13 6  
ATOM 10984 H HG21 . VAL A 1 78  ? -1.655  7.606   7.425   1.00 0.00 ? 78  VAL A HG21 6  
ATOM 10985 H HG22 . VAL A 1 78  ? -1.593  9.358   7.117   1.00 0.00 ? 78  VAL A HG22 6  
ATOM 10986 H HG23 . VAL A 1 78  ? -0.334  8.583   8.108   1.00 0.00 ? 78  VAL A HG23 6  
ATOM 10987 N N    . GLY A 1 79  ? -3.805  8.398   11.671  1.00 0.00 ? 79  GLY A N    6  
ATOM 10988 C CA   . GLY A 1 79  ? -4.200  8.718   13.032  1.00 0.00 ? 79  GLY A CA   6  
ATOM 10989 C C    . GLY A 1 79  ? -4.171  7.471   13.918  1.00 0.00 ? 79  GLY A C    6  
ATOM 10990 O O    . GLY A 1 79  ? -4.286  7.570   15.139  1.00 0.00 ? 79  GLY A O    6  
ATOM 10991 H H    . GLY A 1 79  ? -4.471  8.647   10.968  1.00 0.00 ? 79  GLY A H    6  
ATOM 10992 H HA2  . GLY A 1 79  ? -3.530  9.474   13.441  1.00 0.00 ? 79  GLY A HA2  6  
ATOM 10993 H HA3  . GLY A 1 79  ? -5.202  9.146   13.034  1.00 0.00 ? 79  GLY A HA3  6  
ATOM 10994 N N    . GLY A 1 80  ? -4.016  6.327   13.270  1.00 0.00 ? 80  GLY A N    6  
ATOM 10995 C CA   . GLY A 1 80  ? -3.970  5.062   13.984  1.00 0.00 ? 80  GLY A CA   6  
ATOM 10996 C C    . GLY A 1 80  ? -2.628  4.359   13.769  1.00 0.00 ? 80  GLY A C    6  
ATOM 10997 O O    . GLY A 1 80  ? -2.262  3.468   14.534  1.00 0.00 ? 80  GLY A O    6  
ATOM 10998 H H    . GLY A 1 80  ? -3.922  6.255   12.276  1.00 0.00 ? 80  GLY A H    6  
ATOM 10999 H HA2  . GLY A 1 80  ? -4.128  5.236   15.048  1.00 0.00 ? 80  GLY A HA2  6  
ATOM 11000 H HA3  . GLY A 1 80  ? -4.780  4.418   13.642  1.00 0.00 ? 80  GLY A HA3  6  
ATOM 11001 N N    . LYS A 1 81  ? -1.932  4.787   12.726  1.00 0.00 ? 81  LYS A N    6  
ATOM 11002 C CA   . LYS A 1 81  ? -0.639  4.211   12.402  1.00 0.00 ? 81  LYS A CA   6  
ATOM 11003 C C    . LYS A 1 81  ? 0.421   5.313   12.403  1.00 0.00 ? 81  LYS A C    6  
ATOM 11004 O O    . LYS A 1 81  ? 1.058   5.566   13.424  1.00 0.00 ? 81  LYS A O    6  
ATOM 11005 C CB   . LYS A 1 81  ? -0.714  3.432   11.087  1.00 0.00 ? 81  LYS A CB   6  
ATOM 11006 C CG   . LYS A 1 81  ? -2.119  3.505   10.485  1.00 0.00 ? 81  LYS A CG   6  
ATOM 11007 C CD   . LYS A 1 81  ? -3.089  2.599   11.245  1.00 0.00 ? 81  LYS A CD   6  
ATOM 11008 C CE   . LYS A 1 81  ? -4.503  3.184   11.240  1.00 0.00 ? 81  LYS A CE   6  
ATOM 11009 N NZ   . LYS A 1 81  ? -5.304  2.613   12.346  1.00 0.00 ? 81  LYS A NZ   6  
ATOM 11010 H H    . LYS A 1 81  ? -2.238  5.513   12.109  1.00 0.00 ? 81  LYS A H    6  
ATOM 11011 H HA   . LYS A 1 81  ? -0.394  3.494   13.187  1.00 0.00 ? 81  LYS A HA   6  
ATOM 11012 H HB2  . LYS A 1 81  ? 0.011   3.833   10.379  1.00 0.00 ? 81  LYS A HB2  6  
ATOM 11013 H HB3  . LYS A 1 81  ? -0.444  2.389   11.261  1.00 0.00 ? 81  LYS A HB3  6  
ATOM 11014 H HG2  . LYS A 1 81  ? -2.477  4.535   10.515  1.00 0.00 ? 81  LYS A HG2  6  
ATOM 11015 H HG3  . LYS A 1 81  ? -2.085  3.210   9.437   1.00 0.00 ? 81  LYS A HG3  6  
ATOM 11016 H HD2  . LYS A 1 81  ? -3.100  1.609   10.790  1.00 0.00 ? 81  LYS A HD2  6  
ATOM 11017 H HD3  . LYS A 1 81  ? -2.747  2.474   12.272  1.00 0.00 ? 81  LYS A HD3  6  
ATOM 11018 H HE2  . LYS A 1 81  ? -4.455  4.268   11.341  1.00 0.00 ? 81  LYS A HE2  6  
ATOM 11019 H HE3  . LYS A 1 81  ? -4.987  2.973   10.286  1.00 0.00 ? 81  LYS A HE3  6  
ATOM 11020 H HZ1  . LYS A 1 81  ? -4.709  2.427   13.127  1.00 0.00 ? 81  LYS A HZ1  6  
ATOM 11021 H HZ2  . LYS A 1 81  ? -6.013  3.264   12.615  1.00 0.00 ? 81  LYS A HZ2  6  
ATOM 11022 H HZ3  . LYS A 1 81  ? -5.732  1.761   12.042  1.00 0.00 ? 81  LYS A HZ3  6  
ATOM 11023 N N    . LYS A 1 82  ? 0.579   5.940   11.246  1.00 0.00 ? 82  LYS A N    6  
ATOM 11024 C CA   . LYS A 1 82  ? 1.551   7.010   11.102  1.00 0.00 ? 82  LYS A CA   6  
ATOM 11025 C C    . LYS A 1 82  ? 1.862   7.214   9.618   1.00 0.00 ? 82  LYS A C    6  
ATOM 11026 O O    . LYS A 1 82  ? 1.499   8.236   9.038   1.00 0.00 ? 82  LYS A O    6  
ATOM 11027 C CB   . LYS A 1 82  ? 2.789   6.729   11.956  1.00 0.00 ? 82  LYS A CB   6  
ATOM 11028 C CG   . LYS A 1 82  ? 3.263   5.285   11.776  1.00 0.00 ? 82  LYS A CG   6  
ATOM 11029 C CD   . LYS A 1 82  ? 3.585   4.642   13.127  1.00 0.00 ? 82  LYS A CD   6  
ATOM 11030 C CE   . LYS A 1 82  ? 2.704   3.417   13.373  1.00 0.00 ? 82  LYS A CE   6  
ATOM 11031 N NZ   . LYS A 1 82  ? 3.479   2.345   14.038  1.00 0.00 ? 82  LYS A NZ   6  
ATOM 11032 H H    . LYS A 1 82  ? 0.057   5.729   10.421  1.00 0.00 ? 82  LYS A H    6  
ATOM 11033 H HA   . LYS A 1 82  ? 1.093   7.922   11.487  1.00 0.00 ? 82  LYS A HA   6  
ATOM 11034 H HB2  . LYS A 1 82  ? 3.589   7.416   11.681  1.00 0.00 ? 82  LYS A HB2  6  
ATOM 11035 H HB3  . LYS A 1 82  ? 2.559   6.913   13.006  1.00 0.00 ? 82  LYS A HB3  6  
ATOM 11036 H HG2  . LYS A 1 82  ? 2.493   4.707   11.267  1.00 0.00 ? 82  LYS A HG2  6  
ATOM 11037 H HG3  . LYS A 1 82  ? 4.148   5.267   11.140  1.00 0.00 ? 82  LYS A HG3  6  
ATOM 11038 H HD2  . LYS A 1 82  ? 4.635   4.351   13.153  1.00 0.00 ? 82  LYS A HD2  6  
ATOM 11039 H HD3  . LYS A 1 82  ? 3.436   5.369   13.925  1.00 0.00 ? 82  LYS A HD3  6  
ATOM 11040 H HE2  . LYS A 1 82  ? 1.850   3.693   13.992  1.00 0.00 ? 82  LYS A HE2  6  
ATOM 11041 H HE3  . LYS A 1 82  ? 2.305   3.051   12.426  1.00 0.00 ? 82  LYS A HE3  6  
ATOM 11042 H HZ1  . LYS A 1 82  ? 4.340   2.205   13.549  1.00 0.00 ? 82  LYS A HZ1  6  
ATOM 11043 H HZ2  . LYS A 1 82  ? 3.672   2.611   14.982  1.00 0.00 ? 82  LYS A HZ2  6  
ATOM 11044 H HZ3  . LYS A 1 82  ? 2.949   1.497   14.031  1.00 0.00 ? 82  LYS A HZ3  6  
ATOM 11045 N N    . GLU A 1 83  ? 2.530   6.224   9.045   1.00 0.00 ? 83  GLU A N    6  
ATOM 11046 C CA   . GLU A 1 83  ? 2.894   6.280   7.639   1.00 0.00 ? 83  GLU A CA   6  
ATOM 11047 C C    . GLU A 1 83  ? 3.331   4.899   7.147   1.00 0.00 ? 83  GLU A C    6  
ATOM 11048 O O    . GLU A 1 83  ? 3.653   4.024   7.949   1.00 0.00 ? 83  GLU A O    6  
ATOM 11049 C CB   . GLU A 1 83  ? 3.990   7.320   7.398   1.00 0.00 ? 83  GLU A CB   6  
ATOM 11050 C CG   . GLU A 1 83  ? 4.590   7.801   8.721   1.00 0.00 ? 83  GLU A CG   6  
ATOM 11051 C CD   . GLU A 1 83  ? 3.917   9.094   9.190   1.00 0.00 ? 83  GLU A CD   6  
ATOM 11052 O OE1  . GLU A 1 83  ? 3.476   9.857   8.305   1.00 0.00 ? 83  GLU A OE1  6  
ATOM 11053 O OE2  . GLU A 1 83  ? 3.859   9.287   10.423  1.00 0.00 ? 83  GLU A OE2  6  
ATOM 11054 H H    . GLU A 1 83  ? 2.821   5.395   9.523   1.00 0.00 ? 83  GLU A H    6  
ATOM 11055 H HA   . GLU A 1 83  ? 1.987   6.589   7.118   1.00 0.00 ? 83  GLU A HA   6  
ATOM 11056 H HB2  . GLU A 1 83  ? 4.774   6.890   6.775   1.00 0.00 ? 83  GLU A HB2  6  
ATOM 11057 H HB3  . GLU A 1 83  ? 3.578   8.169   6.852   1.00 0.00 ? 83  GLU A HB3  6  
ATOM 11058 H HG2  . GLU A 1 83  ? 4.470   7.029   9.480   1.00 0.00 ? 83  GLU A HG2  6  
ATOM 11059 H HG3  . GLU A 1 83  ? 5.660   7.967   8.600   1.00 0.00 ? 83  GLU A HG3  6  
ATOM 11060 N N    . TYR A 1 84  ? 3.327   4.746   5.832   1.00 0.00 ? 84  TYR A N    6  
ATOM 11061 C CA   . TYR A 1 84  ? 3.719   3.486   5.223   1.00 0.00 ? 84  TYR A CA   6  
ATOM 11062 C C    . TYR A 1 84  ? 4.413   3.718   3.879   1.00 0.00 ? 84  TYR A C    6  
ATOM 11063 O O    . TYR A 1 84  ? 4.147   4.711   3.203   1.00 0.00 ? 84  TYR A O    6  
ATOM 11064 C CB   . TYR A 1 84  ? 2.422   2.710   4.986   1.00 0.00 ? 84  TYR A CB   6  
ATOM 11065 C CG   . TYR A 1 84  ? 1.380   3.474   4.168   1.00 0.00 ? 84  TYR A CG   6  
ATOM 11066 C CD1  . TYR A 1 84  ? 1.653   3.828   2.862   1.00 0.00 ? 84  TYR A CD1  6  
ATOM 11067 C CD2  . TYR A 1 84  ? 0.168   3.811   4.735   1.00 0.00 ? 84  TYR A CD2  6  
ATOM 11068 C CE1  . TYR A 1 84  ? 0.671   4.547   2.091   1.00 0.00 ? 84  TYR A CE1  6  
ATOM 11069 C CE2  . TYR A 1 84  ? -0.813  4.530   3.965   1.00 0.00 ? 84  TYR A CE2  6  
ATOM 11070 C CZ   . TYR A 1 84  ? -0.513  4.864   2.681   1.00 0.00 ? 84  TYR A CZ   6  
ATOM 11071 O OH   . TYR A 1 84  ? -1.439  5.543   1.953   1.00 0.00 ? 84  TYR A OH   6  
ATOM 11072 H H    . TYR A 1 84  ? 3.064   5.463   5.186   1.00 0.00 ? 84  TYR A H    6  
ATOM 11073 H HA   . TYR A 1 84  ? 4.413   2.988   5.900   1.00 0.00 ? 84  TYR A HA   6  
ATOM 11074 H HB2  . TYR A 1 84  ? 2.658   1.777   4.476   1.00 0.00 ? 84  TYR A HB2  6  
ATOM 11075 H HB3  . TYR A 1 84  ? 1.989   2.445   5.951   1.00 0.00 ? 84  TYR A HB3  6  
ATOM 11076 H HD1  . TYR A 1 84  ? 2.610   3.562   2.414   1.00 0.00 ? 84  TYR A HD1  6  
ATOM 11077 H HD2  . TYR A 1 84  ? -0.047  3.532   5.767   1.00 0.00 ? 84  TYR A HD2  6  
ATOM 11078 H HE1  . TYR A 1 84  ? 0.874   4.833   1.059   1.00 0.00 ? 84  TYR A HE1  6  
ATOM 11079 H HE2  . TYR A 1 84  ? -1.774  4.803   4.401   1.00 0.00 ? 84  TYR A HE2  6  
ATOM 11080 H HH   . TYR A 1 84  ? -2.140  4.913   1.619   1.00 0.00 ? 84  TYR A HH   6  
ATOM 11081 N N    . LEU A 1 85  ? 5.288   2.786   3.532   1.00 0.00 ? 85  LEU A N    6  
ATOM 11082 C CA   . LEU A 1 85  ? 6.021   2.877   2.281   1.00 0.00 ? 85  LEU A CA   6  
ATOM 11083 C C    . LEU A 1 85  ? 5.158   2.321   1.147   1.00 0.00 ? 85  LEU A C    6  
ATOM 11084 O O    . LEU A 1 85  ? 5.608   2.233   0.005   1.00 0.00 ? 85  LEU A O    6  
ATOM 11085 C CB   . LEU A 1 85  ? 7.385   2.193   2.408   1.00 0.00 ? 85  LEU A CB   6  
ATOM 11086 C CG   . LEU A 1 85  ? 7.365   0.743   2.896   1.00 0.00 ? 85  LEU A CG   6  
ATOM 11087 C CD1  . LEU A 1 85  ? 7.503   0.675   4.418   1.00 0.00 ? 85  LEU A CD1  6  
ATOM 11088 C CD2  . LEU A 1 85  ? 6.113   0.015   2.401   1.00 0.00 ? 85  LEU A CD2  6  
ATOM 11089 H H    . LEU A 1 85  ? 5.499   1.983   4.088   1.00 0.00 ? 85  LEU A H    6  
ATOM 11090 H HA   . LEU A 1 85  ? 6.208   3.933   2.087   1.00 0.00 ? 85  LEU A HA   6  
ATOM 11091 H HB2  . LEU A 1 85  ? 7.875   2.221   1.435   1.00 0.00 ? 85  LEU A HB2  6  
ATOM 11092 H HB3  . LEU A 1 85  ? 7.999   2.778   3.093   1.00 0.00 ? 85  LEU A HB3  6  
ATOM 11093 H HG   . LEU A 1 85  ? 8.226   0.228   2.471   1.00 0.00 ? 85  LEU A HG   6  
ATOM 11094 H HD11 . LEU A 1 85  ? 7.944   1.602   4.785   1.00 0.00 ? 85  LEU A HD11 6  
ATOM 11095 H HD12 . LEU A 1 85  ? 6.519   0.539   4.866   1.00 0.00 ? 85  LEU A HD12 6  
ATOM 11096 H HD13 . LEU A 1 85  ? 8.144   -0.165  4.687   1.00 0.00 ? 85  LEU A HD13 6  
ATOM 11097 H HD21 . LEU A 1 85  ? 5.225   0.525   2.773   1.00 0.00 ? 85  LEU A HD21 6  
ATOM 11098 H HD22 . LEU A 1 85  ? 6.101   0.014   1.311   1.00 0.00 ? 85  LEU A HD22 6  
ATOM 11099 H HD23 . LEU A 1 85  ? 6.123   -1.012  2.765   1.00 0.00 ? 85  LEU A HD23 6  
ATOM 11100 N N    . ILE A 1 86  ? 3.934   1.960   1.502   1.00 0.00 ? 86  ILE A N    6  
ATOM 11101 C CA   . ILE A 1 86  ? 3.003   1.414   0.528   1.00 0.00 ? 86  ILE A CA   6  
ATOM 11102 C C    . ILE A 1 86  ? 3.748   1.125   -0.778  1.00 0.00 ? 86  ILE A C    6  
ATOM 11103 O O    . ILE A 1 86  ? 4.047   2.042   -1.541  1.00 0.00 ? 86  ILE A O    6  
ATOM 11104 C CB   . ILE A 1 86  ? 1.800   2.344   0.357   1.00 0.00 ? 86  ILE A CB   6  
ATOM 11105 C CG1  . ILE A 1 86  ? 0.550   1.750   1.006   1.00 0.00 ? 86  ILE A CG1  6  
ATOM 11106 C CG2  . ILE A 1 86  ? 1.575   2.683   -1.119  1.00 0.00 ? 86  ILE A CG2  6  
ATOM 11107 C CD1  . ILE A 1 86  ? 0.841   1.288   2.436   1.00 0.00 ? 86  ILE A CD1  6  
ATOM 11108 H H    . ILE A 1 86  ? 3.576   2.034   2.432   1.00 0.00 ? 86  ILE A H    6  
ATOM 11109 H HA   . ILE A 1 86  ? 2.628   0.472   0.927   1.00 0.00 ? 86  ILE A HA   6  
ATOM 11110 H HB   . ILE A 1 86  ? 2.017   3.280   0.872   1.00 0.00 ? 86  ILE A HB   6  
ATOM 11111 H HG12 . ILE A 1 86  ? -0.248  2.492   1.014   1.00 0.00 ? 86  ILE A HG12 6  
ATOM 11112 H HG13 . ILE A 1 86  ? 0.194   0.907   0.414   1.00 0.00 ? 86  ILE A HG13 6  
ATOM 11113 H HG21 . ILE A 1 86  ? 1.741   1.792   -1.725  1.00 0.00 ? 86  ILE A HG21 6  
ATOM 11114 H HG22 . ILE A 1 86  ? 0.553   3.032   -1.259  1.00 0.00 ? 86  ILE A HG22 6  
ATOM 11115 H HG23 . ILE A 1 86  ? 2.271   3.464   -1.423  1.00 0.00 ? 86  ILE A HG23 6  
ATOM 11116 H HD11 . ILE A 1 86  ? 1.865   1.550   2.700   1.00 0.00 ? 86  ILE A HD11 6  
ATOM 11117 H HD12 . ILE A 1 86  ? 0.152   1.780   3.123   1.00 0.00 ? 86  ILE A HD12 6  
ATOM 11118 H HD13 . ILE A 1 86  ? 0.712   0.208   2.503   1.00 0.00 ? 86  ILE A HD13 6  
ATOM 11119 N N    . ALA A 1 87  ? 4.026   -0.153  -0.992  1.00 0.00 ? 87  ALA A N    6  
ATOM 11120 C CA   . ALA A 1 87  ? 4.731   -0.574  -2.191  1.00 0.00 ? 87  ALA A CA   6  
ATOM 11121 C C    . ALA A 1 87  ? 3.946   -1.699  -2.869  1.00 0.00 ? 87  ALA A C    6  
ATOM 11122 O O    . ALA A 1 87  ? 3.855   -2.804  -2.337  1.00 0.00 ? 87  ALA A O    6  
ATOM 11123 C CB   . ALA A 1 87  ? 6.155   -0.994  -1.826  1.00 0.00 ? 87  ALA A CB   6  
ATOM 11124 H H    . ALA A 1 87  ? 3.779   -0.892  -0.365  1.00 0.00 ? 87  ALA A H    6  
ATOM 11125 H HA   . ALA A 1 87  ? 4.778   0.281   -2.866  1.00 0.00 ? 87  ALA A HA   6  
ATOM 11126 H HB1  . ALA A 1 87  ? 6.223   -1.151  -0.749  1.00 0.00 ? 87  ALA A HB1  6  
ATOM 11127 H HB2  . ALA A 1 87  ? 6.406   -1.919  -2.344  1.00 0.00 ? 87  ALA A HB2  6  
ATOM 11128 H HB3  . ALA A 1 87  ? 6.852   -0.211  -2.123  1.00 0.00 ? 87  ALA A HB3  6  
ATOM 11129 N N    . GLY A 1 88  ? 3.401   -1.379  -4.033  1.00 0.00 ? 88  GLY A N    6  
ATOM 11130 C CA   . GLY A 1 88  ? 2.628   -2.350  -4.789  1.00 0.00 ? 88  GLY A CA   6  
ATOM 11131 C C    . GLY A 1 88  ? 2.830   -2.160  -6.294  1.00 0.00 ? 88  GLY A C    6  
ATOM 11132 O O    . GLY A 1 88  ? 3.632   -1.328  -6.716  1.00 0.00 ? 88  GLY A O    6  
ATOM 11133 H H    . GLY A 1 88  ? 3.479   -0.478  -4.459  1.00 0.00 ? 88  GLY A H    6  
ATOM 11134 H HA2  . GLY A 1 88  ? 2.924   -3.359  -4.503  1.00 0.00 ? 88  GLY A HA2  6  
ATOM 11135 H HA3  . GLY A 1 88  ? 1.570   -2.248  -4.545  1.00 0.00 ? 88  GLY A HA3  6  
ATOM 11136 N N    . LYS A 1 89  ? 2.088   -2.946  -7.062  1.00 0.00 ? 89  LYS A N    6  
ATOM 11137 C CA   . LYS A 1 89  ? 2.176   -2.875  -8.511  1.00 0.00 ? 89  LYS A CA   6  
ATOM 11138 C C    . LYS A 1 89  ? 1.965   -1.427  -8.959  1.00 0.00 ? 89  LYS A C    6  
ATOM 11139 O O    . LYS A 1 89  ? 2.593   -0.971  -9.914  1.00 0.00 ? 89  LYS A O    6  
ATOM 11140 C CB   . LYS A 1 89  ? 1.207   -3.866  -9.155  1.00 0.00 ? 89  LYS A CB   6  
ATOM 11141 C CG   . LYS A 1 89  ? 1.190   -5.192  -8.391  1.00 0.00 ? 89  LYS A CG   6  
ATOM 11142 C CD   . LYS A 1 89  ? 0.749   -6.342  -9.299  1.00 0.00 ? 89  LYS A CD   6  
ATOM 11143 C CE   . LYS A 1 89  ? 1.847   -6.698  -10.304 1.00 0.00 ? 89  LYS A CE   6  
ATOM 11144 N NZ   . LYS A 1 89  ? 1.261   -6.980  -11.633 1.00 0.00 ? 89  LYS A NZ   6  
ATOM 11145 H H    . LYS A 1 89  ? 1.439   -3.619  -6.710  1.00 0.00 ? 89  LYS A H    6  
ATOM 11146 H HA   . LYS A 1 89  ? 3.185   -3.179  -8.792  1.00 0.00 ? 89  LYS A HA   6  
ATOM 11147 H HB2  . LYS A 1 89  ? 0.204   -3.440  -9.175  1.00 0.00 ? 89  LYS A HB2  6  
ATOM 11148 H HB3  . LYS A 1 89  ? 1.497   -4.043  -10.192 1.00 0.00 ? 89  LYS A HB3  6  
ATOM 11149 H HG2  . LYS A 1 89  ? 2.183   -5.398  -7.992  1.00 0.00 ? 89  LYS A HG2  6  
ATOM 11150 H HG3  . LYS A 1 89  ? 0.513   -5.116  -7.541  1.00 0.00 ? 89  LYS A HG3  6  
ATOM 11151 H HD2  . LYS A 1 89  ? 0.508   -7.215  -8.694  1.00 0.00 ? 89  LYS A HD2  6  
ATOM 11152 H HD3  . LYS A 1 89  ? -0.160  -6.062  -9.831  1.00 0.00 ? 89  LYS A HD3  6  
ATOM 11153 H HE2  . LYS A 1 89  ? 2.559   -5.876  -10.380 1.00 0.00 ? 89  LYS A HE2  6  
ATOM 11154 H HE3  . LYS A 1 89  ? 2.401   -7.569  -9.952  1.00 0.00 ? 89  LYS A HE3  6  
ATOM 11155 H HZ1  . LYS A 1 89  ? 0.284   -6.768  -11.619 1.00 0.00 ? 89  LYS A HZ1  6  
ATOM 11156 H HZ2  . LYS A 1 89  ? 1.714   -6.415  -12.323 1.00 0.00 ? 89  LYS A HZ2  6  
ATOM 11157 H HZ3  . LYS A 1 89  ? 1.390   -7.945  -11.856 1.00 0.00 ? 89  LYS A HZ3  6  
ATOM 11158 N N    . ALA A 1 90  ? 1.078   -0.744  -8.250  1.00 0.00 ? 90  ALA A N    6  
ATOM 11159 C CA   . ALA A 1 90  ? 0.776   0.642   -8.563  1.00 0.00 ? 90  ALA A CA   6  
ATOM 11160 C C    . ALA A 1 90  ? -0.280  0.692   -9.668  1.00 0.00 ? 90  ALA A C    6  
ATOM 11161 O O    . ALA A 1 90  ? -0.641  -0.339  -10.234 1.00 0.00 ? 90  ALA A O    6  
ATOM 11162 C CB   . ALA A 1 90  ? 2.064   1.369   -8.954  1.00 0.00 ? 90  ALA A CB   6  
ATOM 11163 H H    . ALA A 1 90  ? 0.572   -1.122  -7.475  1.00 0.00 ? 90  ALA A H    6  
ATOM 11164 H HA   . ALA A 1 90  ? 0.371   1.105   -7.664  1.00 0.00 ? 90  ALA A HA   6  
ATOM 11165 H HB1  . ALA A 1 90  ? 2.905   0.938   -8.410  1.00 0.00 ? 90  ALA A HB1  6  
ATOM 11166 H HB2  . ALA A 1 90  ? 2.231   1.261   -10.025 1.00 0.00 ? 90  ALA A HB2  6  
ATOM 11167 H HB3  . ALA A 1 90  ? 1.974   2.427   -8.705  1.00 0.00 ? 90  ALA A HB3  6  
ATOM 11168 N N    . GLU A 1 91  ? -0.747  1.901   -9.943  1.00 0.00 ? 91  GLU A N    6  
ATOM 11169 C CA   . GLU A 1 91  ? -1.755  2.098   -10.971 1.00 0.00 ? 91  GLU A CA   6  
ATOM 11170 C C    . GLU A 1 91  ? -1.352  3.249   -11.896 1.00 0.00 ? 91  GLU A C    6  
ATOM 11171 O O    . GLU A 1 91  ? -2.108  3.627   -12.789 1.00 0.00 ? 91  GLU A O    6  
ATOM 11172 C CB   . GLU A 1 91  ? -3.129  2.352   -10.348 1.00 0.00 ? 91  GLU A CB   6  
ATOM 11173 C CG   . GLU A 1 91  ? -4.249  1.888   -11.284 1.00 0.00 ? 91  GLU A CG   6  
ATOM 11174 C CD   . GLU A 1 91  ? -4.082  0.412   -11.649 1.00 0.00 ? 91  GLU A CD   6  
ATOM 11175 O OE1  . GLU A 1 91  ? -3.778  -0.370  -10.723 1.00 0.00 ? 91  GLU A OE1  6  
ATOM 11176 O OE2  . GLU A 1 91  ? -4.263  0.099   -12.846 1.00 0.00 ? 91  GLU A OE2  6  
ATOM 11177 H H    . GLU A 1 91  ? -0.448  2.735   -9.478  1.00 0.00 ? 91  GLU A H    6  
ATOM 11178 H HA   . GLU A 1 91  ? -1.783  1.165   -11.532 1.00 0.00 ? 91  GLU A HA   6  
ATOM 11179 H HB2  . GLU A 1 91  ? -3.205  1.825   -9.398  1.00 0.00 ? 91  GLU A HB2  6  
ATOM 11180 H HB3  . GLU A 1 91  ? -3.246  3.414   -10.135 1.00 0.00 ? 91  GLU A HB3  6  
ATOM 11181 H HG2  . GLU A 1 91  ? -5.215  2.041   -10.805 1.00 0.00 ? 91  GLU A HG2  6  
ATOM 11182 H HG3  . GLU A 1 91  ? -4.242  2.493   -12.191 1.00 0.00 ? 91  GLU A HG3  6  
ATOM 11183 N N    . GLY A 1 92  ? -0.160  3.773   -11.650 1.00 0.00 ? 92  GLY A N    6  
ATOM 11184 C CA   . GLY A 1 92  ? 0.353   4.873   -12.450 1.00 0.00 ? 92  GLY A CA   6  
ATOM 11185 C C    . GLY A 1 92  ? 0.875   6.002   -11.559 1.00 0.00 ? 92  GLY A C    6  
ATOM 11186 O O    . GLY A 1 92  ? 1.784   5.794   -10.755 1.00 0.00 ? 92  GLY A O    6  
ATOM 11187 H H    . GLY A 1 92  ? 0.450   3.460   -10.922 1.00 0.00 ? 92  GLY A H    6  
ATOM 11188 H HA2  . GLY A 1 92  ? 1.154   4.514   -13.096 1.00 0.00 ? 92  GLY A HA2  6  
ATOM 11189 H HA3  . GLY A 1 92  ? -0.435  5.253   -13.100 1.00 0.00 ? 92  GLY A HA3  6  
ATOM 11190 N N    . ASP A 1 93  ? 0.279   7.172   -11.731 1.00 0.00 ? 93  ASP A N    6  
ATOM 11191 C CA   . ASP A 1 93  ? 0.673   8.335   -10.953 1.00 0.00 ? 93  ASP A CA   6  
ATOM 11192 C C    . ASP A 1 93  ? -0.576  9.009   -10.383 1.00 0.00 ? 93  ASP A C    6  
ATOM 11193 O O    . ASP A 1 93  ? -1.601  9.096   -11.058 1.00 0.00 ? 93  ASP A O    6  
ATOM 11194 C CB   . ASP A 1 93  ? 1.407   9.356   -11.823 1.00 0.00 ? 93  ASP A CB   6  
ATOM 11195 C CG   . ASP A 1 93  ? 2.872   9.026   -12.112 1.00 0.00 ? 93  ASP A CG   6  
ATOM 11196 O OD1  . ASP A 1 93  ? 3.098   8.031   -12.835 1.00 0.00 ? 93  ASP A OD1  6  
ATOM 11197 O OD2  . ASP A 1 93  ? 3.735   9.776   -11.606 1.00 0.00 ? 93  ASP A OD2  6  
ATOM 11198 H H    . ASP A 1 93  ? -0.459  7.333   -12.386 1.00 0.00 ? 93  ASP A H    6  
ATOM 11199 H HA   . ASP A 1 93  ? 1.331   7.948   -10.174 1.00 0.00 ? 93  ASP A HA   6  
ATOM 11200 H HB2  . ASP A 1 93  ? 0.877   9.452   -12.770 1.00 0.00 ? 93  ASP A HB2  6  
ATOM 11201 H HB3  . ASP A 1 93  ? 1.360   10.329  -11.332 1.00 0.00 ? 93  ASP A HB3  6  
ATOM 11202 N N    . GLY A 1 94  ? -0.450  9.469   -9.147  1.00 0.00 ? 94  GLY A N    6  
ATOM 11203 C CA   . GLY A 1 94  ? -1.557  10.132  -8.479  1.00 0.00 ? 94  GLY A CA   6  
ATOM 11204 C C    . GLY A 1 94  ? -2.538  9.112   -7.898  1.00 0.00 ? 94  GLY A C    6  
ATOM 11205 O O    . GLY A 1 94  ? -3.506  9.484   -7.235  1.00 0.00 ? 94  GLY A O    6  
ATOM 11206 H H    . GLY A 1 94  ? 0.387   9.393   -8.605  1.00 0.00 ? 94  GLY A H    6  
ATOM 11207 H HA2  . GLY A 1 94  ? -1.175  10.770  -7.681  1.00 0.00 ? 94  GLY A HA2  6  
ATOM 11208 H HA3  . GLY A 1 94  ? -2.076  10.780  -9.185  1.00 0.00 ? 94  GLY A HA3  6  
ATOM 11209 N N    . LYS A 1 95  ? -2.255  7.846   -8.169  1.00 0.00 ? 95  LYS A N    6  
ATOM 11210 C CA   . LYS A 1 95  ? -3.101  6.771   -7.681  1.00 0.00 ? 95  LYS A CA   6  
ATOM 11211 C C    . LYS A 1 95  ? -2.464  5.425   -8.038  1.00 0.00 ? 95  LYS A C    6  
ATOM 11212 O O    . LYS A 1 95  ? -1.873  5.278   -9.106  1.00 0.00 ? 95  LYS A O    6  
ATOM 11213 C CB   . LYS A 1 95  ? -4.530  6.932   -8.205  1.00 0.00 ? 95  LYS A CB   6  
ATOM 11214 C CG   . LYS A 1 95  ? -4.675  6.318   -9.600  1.00 0.00 ? 95  LYS A CG   6  
ATOM 11215 C CD   . LYS A 1 95  ? -3.948  7.162   -10.649 1.00 0.00 ? 95  LYS A CD   6  
ATOM 11216 C CE   . LYS A 1 95  ? -4.448  8.607   -10.633 1.00 0.00 ? 95  LYS A CE   6  
ATOM 11217 N NZ   . LYS A 1 95  ? -5.927  8.644   -10.665 1.00 0.00 ? 95  LYS A NZ   6  
ATOM 11218 H H    . LYS A 1 95  ? -1.467  7.552   -8.709  1.00 0.00 ? 95  LYS A H    6  
ATOM 11219 H HA   . LYS A 1 95  ? -3.145  6.855   -6.595  1.00 0.00 ? 95  LYS A HA   6  
ATOM 11220 H HB2  . LYS A 1 95  ? -5.229  6.455   -7.520  1.00 0.00 ? 95  LYS A HB2  6  
ATOM 11221 H HB3  . LYS A 1 95  ? -4.790  7.989   -8.241  1.00 0.00 ? 95  LYS A HB3  6  
ATOM 11222 H HG2  . LYS A 1 95  ? -4.271  5.305   -9.599  1.00 0.00 ? 95  LYS A HG2  6  
ATOM 11223 H HG3  . LYS A 1 95  ? -5.731  6.241   -9.858  1.00 0.00 ? 95  LYS A HG3  6  
ATOM 11224 H HD2  . LYS A 1 95  ? -2.875  7.142   -10.456 1.00 0.00 ? 95  LYS A HD2  6  
ATOM 11225 H HD3  . LYS A 1 95  ? -4.102  6.730   -11.637 1.00 0.00 ? 95  LYS A HD3  6  
ATOM 11226 H HE2  . LYS A 1 95  ? -4.086  9.114   -9.738  1.00 0.00 ? 95  LYS A HE2  6  
ATOM 11227 H HE3  . LYS A 1 95  ? -4.046  9.147   -11.490 1.00 0.00 ? 95  LYS A HE3  6  
ATOM 11228 H HZ1  . LYS A 1 95  ? -6.265  7.937   -11.288 1.00 0.00 ? 95  LYS A HZ1  6  
ATOM 11229 H HZ2  . LYS A 1 95  ? -6.286  8.478   -9.746  1.00 0.00 ? 95  LYS A HZ2  6  
ATOM 11230 H HZ3  . LYS A 1 95  ? -6.231  9.542   -10.985 1.00 0.00 ? 95  LYS A HZ3  6  
ATOM 11231 N N    . MET A 1 96  ? -2.606  4.479   -7.122  1.00 0.00 ? 96  MET A N    6  
ATOM 11232 C CA   . MET A 1 96  ? -2.051  3.151   -7.326  1.00 0.00 ? 96  MET A CA   6  
ATOM 11233 C C    . MET A 1 96  ? -2.954  2.079   -6.712  1.00 0.00 ? 96  MET A C    6  
ATOM 11234 O O    . MET A 1 96  ? -4.086  2.364   -6.324  1.00 0.00 ? 96  MET A O    6  
ATOM 11235 C CB   . MET A 1 96  ? -0.662  3.074   -6.689  1.00 0.00 ? 96  MET A CB   6  
ATOM 11236 C CG   . MET A 1 96  ? -0.559  4.011   -5.485  1.00 0.00 ? 96  MET A CG   6  
ATOM 11237 S SD   . MET A 1 96  ? 0.211   3.162   -4.116  1.00 0.00 ? 96  MET A SD   6  
ATOM 11238 C CE   . MET A 1 96  ? 1.695   4.139   -3.940  1.00 0.00 ? 96  MET A CE   6  
ATOM 11239 H H    . MET A 1 96  ? -3.087  4.607   -6.255  1.00 0.00 ? 96  MET A H    6  
ATOM 11240 H HA   . MET A 1 96  ? -2.000  3.018   -8.406  1.00 0.00 ? 96  MET A HA   6  
ATOM 11241 H HB2  . MET A 1 96  ? -0.457  2.051   -6.378  1.00 0.00 ? 96  MET A HB2  6  
ATOM 11242 H HB3  . MET A 1 96  ? 0.095   3.340   -7.427  1.00 0.00 ? 96  MET A HB3  6  
ATOM 11243 H HG2  . MET A 1 96  ? 0.024   4.895   -5.749  1.00 0.00 ? 96  MET A HG2  6  
ATOM 11244 H HG3  . MET A 1 96  ? -1.551  4.358   -5.196  1.00 0.00 ? 96  MET A HG3  6  
ATOM 11245 H HE1  . MET A 1 96  ? 1.857   4.722   -4.847  1.00 0.00 ? 96  MET A HE1  6  
ATOM 11246 H HE2  . MET A 1 96  ? 1.588   4.813   -3.090  1.00 0.00 ? 96  MET A HE2  6  
ATOM 11247 H HE3  . MET A 1 96  ? 2.547   3.479   -3.775  1.00 0.00 ? 96  MET A HE3  6  
ATOM 11248 N N    . HIS A 1 97  ? -2.420  0.869   -6.642  1.00 0.00 ? 97  HIS A N    6  
ATOM 11249 C CA   . HIS A 1 97  ? -3.163  -0.247  -6.081  1.00 0.00 ? 97  HIS A CA   6  
ATOM 11250 C C    . HIS A 1 97  ? -2.313  -0.947  -5.020  1.00 0.00 ? 97  HIS A C    6  
ATOM 11251 O O    . HIS A 1 97  ? -1.165  -1.309  -5.278  1.00 0.00 ? 97  HIS A O    6  
ATOM 11252 C CB   . HIS A 1 97  ? -3.634  -1.195  -7.186  1.00 0.00 ? 97  HIS A CB   6  
ATOM 11253 C CG   . HIS A 1 97  ? -5.133  -1.252  -7.348  1.00 0.00 ? 97  HIS A CG   6  
ATOM 11254 N ND1  . HIS A 1 97  ? -5.785  -2.330  -7.922  1.00 0.00 ? 97  HIS A ND1  6  
ATOM 11255 C CD2  . HIS A 1 97  ? -6.102  -0.355  -7.006  1.00 0.00 ? 97  HIS A CD2  6  
ATOM 11256 C CE1  . HIS A 1 97  ? -7.086  -2.081  -7.920  1.00 0.00 ? 97  HIS A CE1  6  
ATOM 11257 N NE2  . HIS A 1 97  ? -7.281  -0.856  -7.353  1.00 0.00 ? 97  HIS A NE2  6  
ATOM 11258 H H    . HIS A 1 97  ? -1.498  0.646   -6.960  1.00 0.00 ? 97  HIS A H    6  
ATOM 11259 H HA   . HIS A 1 97  ? -4.048  0.175   -5.606  1.00 0.00 ? 97  HIS A HA   6  
ATOM 11260 H HB2  . HIS A 1 97  ? -3.188  -0.886  -8.132  1.00 0.00 ? 97  HIS A HB2  6  
ATOM 11261 H HB3  . HIS A 1 97  ? -3.263  -2.198  -6.972  1.00 0.00 ? 97  HIS A HB3  6  
ATOM 11262 H HD1  . HIS A 1 97  ? -5.348  -3.156  -8.278  1.00 0.00 ? 97  HIS A HD1  6  
ATOM 11263 H HD2  . HIS A 1 97  ? -5.935  0.610   -6.528  1.00 0.00 ? 97  HIS A HD2  6  
ATOM 11264 H HE1  . HIS A 1 97  ? -7.865  -2.740  -8.306  1.00 0.00 ? 97  HIS A HE1  6  
ATOM 11265 N N    . ILE A 1 98  ? -2.909  -1.119  -3.849  1.00 0.00 ? 98  ILE A N    6  
ATOM 11266 C CA   . ILE A 1 98  ? -2.222  -1.771  -2.748  1.00 0.00 ? 98  ILE A CA   6  
ATOM 11267 C C    . ILE A 1 98  ? -3.203  -2.680  -2.006  1.00 0.00 ? 98  ILE A C    6  
ATOM 11268 O O    . ILE A 1 98  ? -4.385  -2.359  -1.889  1.00 0.00 ? 98  ILE A O    6  
ATOM 11269 C CB   . ILE A 1 98  ? -1.546  -0.733  -1.850  1.00 0.00 ? 98  ILE A CB   6  
ATOM 11270 C CG1  . ILE A 1 98  ? -2.582  0.058   -1.049  1.00 0.00 ? 98  ILE A CG1  6  
ATOM 11271 C CG2  . ILE A 1 98  ? -0.629  0.183   -2.664  1.00 0.00 ? 98  ILE A CG2  6  
ATOM 11272 C CD1  . ILE A 1 98  ? -1.952  1.296   -0.409  1.00 0.00 ? 98  ILE A CD1  6  
ATOM 11273 H H    . ILE A 1 98  ? -3.842  -0.823  -3.649  1.00 0.00 ? 98  ILE A H    6  
ATOM 11274 H HA   . ILE A 1 98  ? -1.433  -2.390  -3.176  1.00 0.00 ? 98  ILE A HA   6  
ATOM 11275 H HB   . ILE A 1 98  ? -0.917  -1.260  -1.132  1.00 0.00 ? 98  ILE A HB   6  
ATOM 11276 H HG12 . ILE A 1 98  ? -3.400  0.358   -1.704  1.00 0.00 ? 98  ILE A HG12 6  
ATOM 11277 H HG13 . ILE A 1 98  ? -3.010  -0.578  -0.274  1.00 0.00 ? 98  ILE A HG13 6  
ATOM 11278 H HG21 . ILE A 1 98  ? -0.300  -0.339  -3.562  1.00 0.00 ? 98  ILE A HG21 6  
ATOM 11279 H HG22 . ILE A 1 98  ? -1.174  1.084   -2.946  1.00 0.00 ? 98  ILE A HG22 6  
ATOM 11280 H HG23 . ILE A 1 98  ? 0.238   0.456   -2.063  1.00 0.00 ? 98  ILE A HG23 6  
ATOM 11281 H HD11 . ILE A 1 98  ? -1.037  1.555   -0.943  1.00 0.00 ? 98  ILE A HD11 6  
ATOM 11282 H HD12 . ILE A 1 98  ? -2.653  2.129   -0.464  1.00 0.00 ? 98  ILE A HD12 6  
ATOM 11283 H HD13 . ILE A 1 98  ? -1.717  1.087   0.634   1.00 0.00 ? 98  ILE A HD13 6  
ATOM 11284 N N    . THR A 1 99  ? -2.678  -3.797  -1.523  1.00 0.00 ? 99  THR A N    6  
ATOM 11285 C CA   . THR A 1 99  ? -3.492  -4.754  -0.796  1.00 0.00 ? 99  THR A CA   6  
ATOM 11286 C C    . THR A 1 99  ? -2.702  -5.349  0.371   1.00 0.00 ? 99  THR A C    6  
ATOM 11287 O O    . THR A 1 99  ? -1.478  -5.243  0.415   1.00 0.00 ? 99  THR A O    6  
ATOM 11288 C CB   . THR A 1 99  ? -3.990  -5.804  -1.792  1.00 0.00 ? 99  THR A CB   6  
ATOM 11289 O OG1  . THR A 1 99  ? -3.015  -5.787  -2.830  1.00 0.00 ? 99  THR A OG1  6  
ATOM 11290 C CG2  . THR A 1 99  ? -5.285  -5.382  -2.488  1.00 0.00 ? 99  THR A CG2  6  
ATOM 11291 H H    . THR A 1 99  ? -1.715  -4.050  -1.622  1.00 0.00 ? 99  THR A H    6  
ATOM 11292 H HA   . THR A 1 99  ? -4.345  -4.226  -0.368  1.00 0.00 ? 99  THR A HA   6  
ATOM 11293 H HB   . THR A 1 99  ? -4.106  -6.774  -1.308  1.00 0.00 ? 99  THR A HB   6  
ATOM 11294 H HG1  . THR A 1 99  ? -3.201  -6.518  -3.486  1.00 0.00 ? 99  THR A HG1  6  
ATOM 11295 H HG21 . THR A 1 99  ? -5.748  -4.567  -1.933  1.00 0.00 ? 99  THR A HG21 6  
ATOM 11296 H HG22 . THR A 1 99  ? -5.061  -5.050  -3.502  1.00 0.00 ? 99  THR A HG22 6  
ATOM 11297 H HG23 . THR A 1 99  ? -5.969  -6.230  -2.527  1.00 0.00 ? 99  THR A HG23 6  
ATOM 11298 N N    . LEU A 1 100 ? -3.435  -5.964  1.288   1.00 0.00 ? 100 LEU A N    6  
ATOM 11299 C CA   . LEU A 1 100 ? -2.819  -6.576  2.453   1.00 0.00 ? 100 LEU A CA   6  
ATOM 11300 C C    . LEU A 1 100 ? -1.809  -7.631  1.993   1.00 0.00 ? 100 LEU A C    6  
ATOM 11301 O O    . LEU A 1 100 ? -0.687  -7.680  2.495   1.00 0.00 ? 100 LEU A O    6  
ATOM 11302 C CB   . LEU A 1 100 ? -3.888  -7.121  3.401   1.00 0.00 ? 100 LEU A CB   6  
ATOM 11303 C CG   . LEU A 1 100 ? -4.320  -8.569  3.163   1.00 0.00 ? 100 LEU A CG   6  
ATOM 11304 C CD1  . LEU A 1 100 ? -4.818  -9.212  4.460   1.00 0.00 ? 100 LEU A CD1  6  
ATOM 11305 C CD2  . LEU A 1 100 ? -5.361  -8.654  2.044   1.00 0.00 ? 100 LEU A CD2  6  
ATOM 11306 H H    . LEU A 1 100 ? -4.431  -6.046  1.245   1.00 0.00 ? 100 LEU A H    6  
ATOM 11307 H HA   . LEU A 1 100 ? -2.281  -5.794  2.987   1.00 0.00 ? 100 LEU A HA   6  
ATOM 11308 H HB2  . LEU A 1 100 ? -3.516  -7.037  4.422   1.00 0.00 ? 100 LEU A HB2  6  
ATOM 11309 H HB3  . LEU A 1 100 ? -4.768  -6.483  3.329   1.00 0.00 ? 100 LEU A HB3  6  
ATOM 11310 H HG   . LEU A 1 100 ? -3.449  -9.137  2.837   1.00 0.00 ? 100 LEU A HG   6  
ATOM 11311 H HD11 . LEU A 1 100 ? -5.163  -8.436  5.141   1.00 0.00 ? 100 LEU A HD11 6  
ATOM 11312 H HD12 . LEU A 1 100 ? -5.641  -9.891  4.235   1.00 0.00 ? 100 LEU A HD12 6  
ATOM 11313 H HD13 . LEU A 1 100 ? -4.005  -9.769  4.924   1.00 0.00 ? 100 LEU A HD13 6  
ATOM 11314 H HD21 . LEU A 1 100 ? -5.318  -7.748  1.440   1.00 0.00 ? 100 LEU A HD21 6  
ATOM 11315 H HD22 . LEU A 1 100 ? -5.150  -9.521  1.418   1.00 0.00 ? 100 LEU A HD22 6  
ATOM 11316 H HD23 . LEU A 1 100 ? -6.355  -8.753  2.480   1.00 0.00 ? 100 LEU A HD23 6  
ATOM 11317 N N    . CYS A 1 101 ? -2.244  -8.447  1.045   1.00 0.00 ? 101 CYS A N    6  
ATOM 11318 C CA   . CYS A 1 101 ? -1.392  -9.497  0.513   1.00 0.00 ? 101 CYS A CA   6  
ATOM 11319 C C    . CYS A 1 101 ? -0.181  -8.842  -0.154  1.00 0.00 ? 101 CYS A C    6  
ATOM 11320 O O    . CYS A 1 101 ? 0.912   -9.407  -0.157  1.00 0.00 ? 101 CYS A O    6  
ATOM 11321 C CB   . CYS A 1 101 ? -2.152  -10.407 -0.453  1.00 0.00 ? 101 CYS A CB   6  
ATOM 11322 S SG   . CYS A 1 101 ? -1.695  -12.176 -0.364  1.00 0.00 ? 101 CYS A SG   6  
ATOM 11323 H H    . CYS A 1 101 ? -3.158  -8.400  0.643   1.00 0.00 ? 101 CYS A H    6  
ATOM 11324 H HA   . CYS A 1 101 ? -1.084  -10.110 1.361   1.00 0.00 ? 101 CYS A HA   6  
ATOM 11325 H HB2  . CYS A 1 101 ? -3.220  -10.312 -0.256  1.00 0.00 ? 101 CYS A HB2  6  
ATOM 11326 H HB3  . CYS A 1 101 ? -1.983  -10.054 -1.471  1.00 0.00 ? 101 CYS A HB3  6  
ATOM 11327 N N    . ASP A 1 102 ? -0.415  -7.658  -0.702  1.00 0.00 ? 102 ASP A N    6  
ATOM 11328 C CA   . ASP A 1 102 ? 0.644   -6.920  -1.368  1.00 0.00 ? 102 ASP A CA   6  
ATOM 11329 C C    . ASP A 1 102 ? 1.593   -6.338  -0.319  1.00 0.00 ? 102 ASP A C    6  
ATOM 11330 O O    . ASP A 1 102 ? 1.282   -6.333  0.870   1.00 0.00 ? 102 ASP A O    6  
ATOM 11331 C CB   . ASP A 1 102 ? 0.074   -5.760  -2.187  1.00 0.00 ? 102 ASP A CB   6  
ATOM 11332 C CG   . ASP A 1 102 ? 0.876   -5.395  -3.438  1.00 0.00 ? 102 ASP A CG   6  
ATOM 11333 O OD1  . ASP A 1 102 ? 2.093   -5.682  -3.434  1.00 0.00 ? 102 ASP A OD1  6  
ATOM 11334 O OD2  . ASP A 1 102 ? 0.256   -4.837  -4.368  1.00 0.00 ? 102 ASP A OD2  6  
ATOM 11335 H H    . ASP A 1 102 ? -1.306  -7.206  -0.694  1.00 0.00 ? 102 ASP A H    6  
ATOM 11336 H HA   . ASP A 1 102 ? 1.134   -7.645  -2.018  1.00 0.00 ? 102 ASP A HA   6  
ATOM 11337 H HB2  . ASP A 1 102 ? -0.943  -6.012  -2.487  1.00 0.00 ? 102 ASP A HB2  6  
ATOM 11338 H HB3  . ASP A 1 102 ? 0.008   -4.881  -1.547  1.00 0.00 ? 102 ASP A HB3  6  
ATOM 11339 N N    . PHE A 1 103 ? 2.732   -5.860  -0.800  1.00 0.00 ? 103 PHE A N    6  
ATOM 11340 C CA   . PHE A 1 103 ? 3.729   -5.276  0.082   1.00 0.00 ? 103 PHE A CA   6  
ATOM 11341 C C    . PHE A 1 103 ? 3.257   -3.926  0.626   1.00 0.00 ? 103 PHE A C    6  
ATOM 11342 O O    . PHE A 1 103 ? 3.031   -2.989  -0.139  1.00 0.00 ? 103 PHE A O    6  
ATOM 11343 C CB   . PHE A 1 103 ? 4.993   -5.062  -0.752  1.00 0.00 ? 103 PHE A CB   6  
ATOM 11344 C CG   . PHE A 1 103 ? 6.006   -4.109  -0.115  1.00 0.00 ? 103 PHE A CG   6  
ATOM 11345 C CD1  . PHE A 1 103 ? 5.983   -3.891  1.228   1.00 0.00 ? 103 PHE A CD1  6  
ATOM 11346 C CD2  . PHE A 1 103 ? 6.928   -3.478  -0.891  1.00 0.00 ? 103 PHE A CD2  6  
ATOM 11347 C CE1  . PHE A 1 103 ? 6.922   -3.005  1.819   1.00 0.00 ? 103 PHE A CE1  6  
ATOM 11348 C CE2  . PHE A 1 103 ? 7.868   -2.593  -0.299  1.00 0.00 ? 103 PHE A CE2  6  
ATOM 11349 C CZ   . PHE A 1 103 ? 7.845   -2.375  1.043   1.00 0.00 ? 103 PHE A CZ   6  
ATOM 11350 H H    . PHE A 1 103 ? 2.977   -5.867  -1.769  1.00 0.00 ? 103 PHE A H    6  
ATOM 11351 H HA   . PHE A 1 103 ? 3.873   -5.969  0.911   1.00 0.00 ? 103 PHE A HA   6  
ATOM 11352 H HB2  . PHE A 1 103 ? 5.473   -6.026  -0.920  1.00 0.00 ? 103 PHE A HB2  6  
ATOM 11353 H HB3  . PHE A 1 103 ? 4.710   -4.674  -1.731  1.00 0.00 ? 103 PHE A HB3  6  
ATOM 11354 H HD1  . PHE A 1 103 ? 5.244   -4.396  1.849   1.00 0.00 ? 103 PHE A HD1  6  
ATOM 11355 H HD2  . PHE A 1 103 ? 6.946   -3.652  -1.967  1.00 0.00 ? 103 PHE A HD2  6  
ATOM 11356 H HE1  . PHE A 1 103 ? 6.904   -2.832  2.895   1.00 0.00 ? 103 PHE A HE1  6  
ATOM 11357 H HE2  . PHE A 1 103 ? 8.607   -2.088  -0.920  1.00 0.00 ? 103 PHE A HE2  6  
ATOM 11358 H HZ   . PHE A 1 103 ? 8.566   -1.696  1.498   1.00 0.00 ? 103 PHE A HZ   6  
ATOM 11359 N N    . ILE A 1 104 ? 3.121   -3.869  1.943   1.00 0.00 ? 104 ILE A N    6  
ATOM 11360 C CA   . ILE A 1 104 ? 2.680   -2.649  2.597   1.00 0.00 ? 104 ILE A CA   6  
ATOM 11361 C C    . ILE A 1 104 ? 2.961   -2.751  4.098   1.00 0.00 ? 104 ILE A C    6  
ATOM 11362 O O    . ILE A 1 104 ? 2.685   -3.777  4.717   1.00 0.00 ? 104 ILE A O    6  
ATOM 11363 C CB   . ILE A 1 104 ? 1.214   -2.363  2.265   1.00 0.00 ? 104 ILE A CB   6  
ATOM 11364 C CG1  . ILE A 1 104 ? 0.376   -3.641  2.335   1.00 0.00 ? 104 ILE A CG1  6  
ATOM 11365 C CG2  . ILE A 1 104 ? 1.086   -1.666  0.909   1.00 0.00 ? 104 ILE A CG2  6  
ATOM 11366 C CD1  . ILE A 1 104 ? -1.103  -3.340  2.080   1.00 0.00 ? 104 ILE A CD1  6  
ATOM 11367 H H    . ILE A 1 104 ? 3.306   -4.636  2.557   1.00 0.00 ? 104 ILE A H    6  
ATOM 11368 H HA   . ILE A 1 104 ? 3.269   -1.829  2.190   1.00 0.00 ? 104 ILE A HA   6  
ATOM 11369 H HB   . ILE A 1 104 ? 0.821   -1.678  3.017   1.00 0.00 ? 104 ILE A HB   6  
ATOM 11370 H HG12 . ILE A 1 104 ? 0.737   -4.358  1.597   1.00 0.00 ? 104 ILE A HG12 6  
ATOM 11371 H HG13 . ILE A 1 104 ? 0.493   -4.104  3.313   1.00 0.00 ? 104 ILE A HG13 6  
ATOM 11372 H HG21 . ILE A 1 104 ? 2.045   -1.228  0.633   1.00 0.00 ? 104 ILE A HG21 6  
ATOM 11373 H HG22 . ILE A 1 104 ? 0.788   -2.393  0.153   1.00 0.00 ? 104 ILE A HG22 6  
ATOM 11374 H HG23 . ILE A 1 104 ? 0.333   -0.881  0.973   1.00 0.00 ? 104 ILE A HG23 6  
ATOM 11375 H HD11 . ILE A 1 104 ? -1.412  -2.493  2.692   1.00 0.00 ? 104 ILE A HD11 6  
ATOM 11376 H HD12 . ILE A 1 104 ? -1.250  -3.101  1.027   1.00 0.00 ? 104 ILE A HD12 6  
ATOM 11377 H HD13 . ILE A 1 104 ? -1.701  -4.214  2.341   1.00 0.00 ? 104 ILE A HD13 6  
ATOM 11378 N N    . VAL A 1 105 ? 3.508   -1.673  4.639   1.00 0.00 ? 105 VAL A N    6  
ATOM 11379 C CA   . VAL A 1 105 ? 3.829   -1.628  6.056   1.00 0.00 ? 105 VAL A CA   6  
ATOM 11380 C C    . VAL A 1 105 ? 3.811   -0.174  6.533   1.00 0.00 ? 105 VAL A C    6  
ATOM 11381 O O    . VAL A 1 105 ? 3.947   0.748   5.729   1.00 0.00 ? 105 VAL A O    6  
ATOM 11382 C CB   . VAL A 1 105 ? 5.168   -2.324  6.311   1.00 0.00 ? 105 VAL A CB   6  
ATOM 11383 C CG1  . VAL A 1 105 ? 4.956   -3.718  6.904   1.00 0.00 ? 105 VAL A CG1  6  
ATOM 11384 C CG2  . VAL A 1 105 ? 6.002   -2.393  5.031   1.00 0.00 ? 105 VAL A CG2  6  
ATOM 11385 H H    . VAL A 1 105 ? 3.729   -0.842  4.129   1.00 0.00 ? 105 VAL A H    6  
ATOM 11386 H HA   . VAL A 1 105 ? 3.054   -2.180  6.587   1.00 0.00 ? 105 VAL A HA   6  
ATOM 11387 H HB   . VAL A 1 105 ? 5.721   -1.731  7.039   1.00 0.00 ? 105 VAL A HB   6  
ATOM 11388 H HG11 . VAL A 1 105 ? 4.373   -4.324  6.209   1.00 0.00 ? 105 VAL A HG11 6  
ATOM 11389 H HG12 . VAL A 1 105 ? 5.923   -4.192  7.075   1.00 0.00 ? 105 VAL A HG12 6  
ATOM 11390 H HG13 . VAL A 1 105 ? 4.420   -3.633  7.850   1.00 0.00 ? 105 VAL A HG13 6  
ATOM 11391 H HG21 . VAL A 1 105 ? 5.430   -2.897  4.251   1.00 0.00 ? 105 VAL A HG21 6  
ATOM 11392 H HG22 . VAL A 1 105 ? 6.252   -1.384  4.704   1.00 0.00 ? 105 VAL A HG22 6  
ATOM 11393 H HG23 . VAL A 1 105 ? 6.920   -2.949  5.224   1.00 0.00 ? 105 VAL A HG23 6  
ATOM 11394 N N    . PRO A 1 106 ? 3.638   -0.010  7.871   1.00 0.00 ? 106 PRO A N    6  
ATOM 11395 C CA   . PRO A 1 106 ? 3.601   1.316   8.464   1.00 0.00 ? 106 PRO A CA   6  
ATOM 11396 C C    . PRO A 1 106 ? 5.003   1.924   8.536   1.00 0.00 ? 106 PRO A C    6  
ATOM 11397 O O    . PRO A 1 106 ? 5.205   2.951   9.182   1.00 0.00 ? 106 PRO A O    6  
ATOM 11398 C CB   . PRO A 1 106 ? 2.968   1.117   9.832   1.00 0.00 ? 106 PRO A CB   6  
ATOM 11399 C CG   . PRO A 1 106 ? 3.101   -0.365  10.142  1.00 0.00 ? 106 PRO A CG   6  
ATOM 11400 C CD   . PRO A 1 106 ? 3.474   -1.078  8.853   1.00 0.00 ? 106 PRO A CD   6  
ATOM 11401 H HA   . PRO A 1 106 ? 3.062   1.936   7.894   1.00 0.00 ? 106 PRO A HA   6  
ATOM 11402 H HB2  . PRO A 1 106 ? 3.473   1.720   10.587  1.00 0.00 ? 106 PRO A HB2  6  
ATOM 11403 H HB3  . PRO A 1 106 ? 1.922   1.423   9.828   1.00 0.00 ? 106 PRO A HB3  6  
ATOM 11404 H HG2  . PRO A 1 106 ? 3.864   -0.530  10.903  1.00 0.00 ? 106 PRO A HG2  6  
ATOM 11405 H HG3  . PRO A 1 106 ? 2.166   -0.758  10.539  1.00 0.00 ? 106 PRO A HG3  6  
ATOM 11406 H HD2  . PRO A 1 106 ? 4.393   -1.653  8.969   1.00 0.00 ? 106 PRO A HD2  6  
ATOM 11407 H HD3  . PRO A 1 106 ? 2.696   -1.779  8.549   1.00 0.00 ? 106 PRO A HD3  6  
ATOM 11408 N N    . TRP A 1 107 ? 5.934   1.264   7.864   1.00 0.00 ? 107 TRP A N    6  
ATOM 11409 C CA   . TRP A 1 107 ? 7.312   1.727   7.843   1.00 0.00 ? 107 TRP A CA   6  
ATOM 11410 C C    . TRP A 1 107 ? 7.912   1.486   9.230   1.00 0.00 ? 107 TRP A C    6  
ATOM 11411 O O    . TRP A 1 107 ? 8.896   0.761   9.367   1.00 0.00 ? 107 TRP A O    6  
ATOM 11412 C CB   . TRP A 1 107 ? 7.392   3.190   7.403   1.00 0.00 ? 107 TRP A CB   6  
ATOM 11413 C CG   . TRP A 1 107 ? 8.817   3.687   7.153   1.00 0.00 ? 107 TRP A CG   6  
ATOM 11414 C CD1  . TRP A 1 107 ? 9.714   3.214   6.278   1.00 0.00 ? 107 TRP A CD1  6  
ATOM 11415 C CD2  . TRP A 1 107 ? 9.476   4.782   7.825   1.00 0.00 ? 107 TRP A CD2  6  
ATOM 11416 N NE1  . TRP A 1 107 ? 10.900  3.920   6.337   1.00 0.00 ? 107 TRP A NE1  6  
ATOM 11417 C CE2  . TRP A 1 107 ? 10.749  4.903   7.308   1.00 0.00 ? 107 TRP A CE2  6  
ATOM 11418 C CE3  . TRP A 1 107 ? 9.012   5.640   8.837   1.00 0.00 ? 107 TRP A CE3  6  
ATOM 11419 C CZ2  . TRP A 1 107 ? 11.664  5.872   7.740   1.00 0.00 ? 107 TRP A CZ2  6  
ATOM 11420 C CZ3  . TRP A 1 107 ? 9.937   6.602   9.258   1.00 0.00 ? 107 TRP A CZ3  6  
ATOM 11421 C CH2  . TRP A 1 107 ? 11.223  6.738   8.747   1.00 0.00 ? 107 TRP A CH2  6  
ATOM 11422 H H    . TRP A 1 107 ? 5.762   0.430   7.342   1.00 0.00 ? 107 TRP A H    6  
ATOM 11423 H HA   . TRP A 1 107 ? 7.849   1.141   7.098   1.00 0.00 ? 107 TRP A HA   6  
ATOM 11424 H HB2  . TRP A 1 107 ? 6.809   3.317   6.491   1.00 0.00 ? 107 TRP A HB2  6  
ATOM 11425 H HB3  . TRP A 1 107 ? 6.929   3.815   8.167   1.00 0.00 ? 107 TRP A HB3  6  
ATOM 11426 H HD1  . TRP A 1 107 ? 9.532   2.377   5.605   1.00 0.00 ? 107 TRP A HD1  6  
ATOM 11427 H HE1  . TRP A 1 107 ? 11.788  3.739   5.733   1.00 0.00 ? 107 TRP A HE1  6  
ATOM 11428 H HE3  . TRP A 1 107 ? 8.011   5.565   9.263   1.00 0.00 ? 107 TRP A HE3  6  
ATOM 11429 H HZ2  . TRP A 1 107 ? 12.664  5.947   7.314   1.00 0.00 ? 107 TRP A HZ2  6  
ATOM 11430 H HZ3  . TRP A 1 107 ? 9.628   7.294   10.041  1.00 0.00 ? 107 TRP A HZ3  6  
ATOM 11431 H HH2  . TRP A 1 107 ? 11.885  7.515   9.130   1.00 0.00 ? 107 TRP A HH2  6  
ATOM 11432 N N    . ASP A 1 108 ? 7.294   2.110   10.223  1.00 0.00 ? 108 ASP A N    6  
ATOM 11433 C CA   . ASP A 1 108 ? 7.756   1.972   11.594  1.00 0.00 ? 108 ASP A CA   6  
ATOM 11434 C C    . ASP A 1 108 ? 7.471   0.551   12.084  1.00 0.00 ? 108 ASP A C    6  
ATOM 11435 O O    . ASP A 1 108 ? 6.868   0.363   13.139  1.00 0.00 ? 108 ASP A O    6  
ATOM 11436 C CB   . ASP A 1 108 ? 7.026   2.946   12.521  1.00 0.00 ? 108 ASP A CB   6  
ATOM 11437 C CG   . ASP A 1 108 ? 7.450   2.882   13.990  1.00 0.00 ? 108 ASP A CG   6  
ATOM 11438 O OD1  . ASP A 1 108 ? 8.572   3.353   14.278  1.00 0.00 ? 108 ASP A OD1  6  
ATOM 11439 O OD2  . ASP A 1 108 ? 6.642   2.364   14.791  1.00 0.00 ? 108 ASP A OD2  6  
ATOM 11440 H H    . ASP A 1 108 ? 6.496   2.699   10.103  1.00 0.00 ? 108 ASP A H    6  
ATOM 11441 H HA   . ASP A 1 108 ? 8.823   2.196   11.562  1.00 0.00 ? 108 ASP A HA   6  
ATOM 11442 H HB2  . ASP A 1 108 ? 7.187   3.961   12.157  1.00 0.00 ? 108 ASP A HB2  6  
ATOM 11443 H HB3  . ASP A 1 108 ? 5.955   2.752   12.459  1.00 0.00 ? 108 ASP A HB3  6  
ATOM 11444 N N    . THR A 1 109 ? 7.918   -0.414  11.293  1.00 0.00 ? 109 THR A N    6  
ATOM 11445 C CA   . THR A 1 109 ? 7.718   -1.813  11.633  1.00 0.00 ? 109 THR A CA   6  
ATOM 11446 C C    . THR A 1 109 ? 8.749   -2.687  10.916  1.00 0.00 ? 109 THR A C    6  
ATOM 11447 O O    . THR A 1 109 ? 9.478   -3.444  11.555  1.00 0.00 ? 109 THR A O    6  
ATOM 11448 C CB   . THR A 1 109 ? 6.271   -2.179  11.297  1.00 0.00 ? 109 THR A CB   6  
ATOM 11449 O OG1  . THR A 1 109 ? 6.000   -1.457  10.099  1.00 0.00 ? 109 THR A OG1  6  
ATOM 11450 C CG2  . THR A 1 109 ? 5.274   -1.610  12.308  1.00 0.00 ? 109 THR A CG2  6  
ATOM 11451 H H    . THR A 1 109 ? 8.408   -0.252  10.436  1.00 0.00 ? 109 THR A H    6  
ATOM 11452 H HA   . THR A 1 109 ? 7.886   -1.934  12.703  1.00 0.00 ? 109 THR A HA   6  
ATOM 11453 H HB   . THR A 1 109 ? 6.156   -3.258  11.200  1.00 0.00 ? 109 THR A HB   6  
ATOM 11454 H HG1  . THR A 1 109 ? 5.963   -0.477  10.290  1.00 0.00 ? 109 THR A HG1  6  
ATOM 11455 H HG21 . THR A 1 109 ? 5.602   -1.856  13.319  1.00 0.00 ? 109 THR A HG21 6  
ATOM 11456 H HG22 . THR A 1 109 ? 5.221   -0.527  12.196  1.00 0.00 ? 109 THR A HG22 6  
ATOM 11457 H HG23 . THR A 1 109 ? 4.290   -2.043  12.130  1.00 0.00 ? 109 THR A HG23 6  
ATOM 11458 N N    . LEU A 1 110 ? 8.777   -2.554  9.598   1.00 0.00 ? 110 LEU A N    6  
ATOM 11459 C CA   . LEU A 1 110 ? 9.705   -3.323  8.787   1.00 0.00 ? 110 LEU A CA   6  
ATOM 11460 C C    . LEU A 1 110 ? 10.374  -4.388  9.657   1.00 0.00 ? 110 LEU A C    6  
ATOM 11461 O O    . LEU A 1 110 ? 9.740   -5.371  10.040  1.00 0.00 ? 110 LEU A O    6  
ATOM 11462 C CB   . LEU A 1 110 ? 10.697  -2.394  8.082   1.00 0.00 ? 110 LEU A CB   6  
ATOM 11463 C CG   . LEU A 1 110 ? 10.084  -1.318  7.183   1.00 0.00 ? 110 LEU A CG   6  
ATOM 11464 C CD1  . LEU A 1 110 ? 11.140  -0.297  6.754   1.00 0.00 ? 110 LEU A CD1  6  
ATOM 11465 C CD2  . LEU A 1 110 ? 9.374   -1.947  5.982   1.00 0.00 ? 110 LEU A CD2  6  
ATOM 11466 H H    . LEU A 1 110 ? 8.180   -1.935  9.086   1.00 0.00 ? 110 LEU A H    6  
ATOM 11467 H HA   . LEU A 1 110 ? 9.126   -3.823  8.012   1.00 0.00 ? 110 LEU A HA   6  
ATOM 11468 H HB2  . LEU A 1 110 ? 11.306  -1.903  8.840   1.00 0.00 ? 110 LEU A HB2  6  
ATOM 11469 H HB3  . LEU A 1 110 ? 11.369  -3.005  7.479   1.00 0.00 ? 110 LEU A HB3  6  
ATOM 11470 H HG   . LEU A 1 110 ? 9.331   -0.781  7.758   1.00 0.00 ? 110 LEU A HG   6  
ATOM 11471 H HD11 . LEU A 1 110 ? 11.846  -0.140  7.570   1.00 0.00 ? 110 LEU A HD11 6  
ATOM 11472 H HD12 . LEU A 1 110 ? 11.672  -0.669  5.880   1.00 0.00 ? 110 LEU A HD12 6  
ATOM 11473 H HD13 . LEU A 1 110 ? 10.653  0.647   6.509   1.00 0.00 ? 110 LEU A HD13 6  
ATOM 11474 H HD21 . LEU A 1 110 ? 9.405   -3.033  6.068   1.00 0.00 ? 110 LEU A HD21 6  
ATOM 11475 H HD22 . LEU A 1 110 ? 8.336   -1.613  5.958   1.00 0.00 ? 110 LEU A HD22 6  
ATOM 11476 H HD23 . LEU A 1 110 ? 9.874   -1.640  5.063   1.00 0.00 ? 110 LEU A HD23 6  
ATOM 11477 N N    . SER A 1 111 ? 11.646  -4.159  9.946   1.00 0.00 ? 111 SER A N    6  
ATOM 11478 C CA   . SER A 1 111 ? 12.408  -5.088  10.764  1.00 0.00 ? 111 SER A CA   6  
ATOM 11479 C C    . SER A 1 111 ? 13.864  -5.124  10.297  1.00 0.00 ? 111 SER A C    6  
ATOM 11480 O O    . SER A 1 111 ? 14.782  -5.153  11.116  1.00 0.00 ? 111 SER A O    6  
ATOM 11481 C CB   . SER A 1 111 ? 11.799  -6.490  10.717  1.00 0.00 ? 111 SER A CB   6  
ATOM 11482 O OG   . SER A 1 111 ? 10.783  -6.664  11.700  1.00 0.00 ? 111 SER A OG   6  
ATOM 11483 H H    . SER A 1 111 ? 12.155  -3.358  9.632   1.00 0.00 ? 111 SER A H    6  
ATOM 11484 H HA   . SER A 1 111 ? 12.342  -4.698  11.780  1.00 0.00 ? 111 SER A HA   6  
ATOM 11485 H HB2  . SER A 1 111 ? 11.380  -6.671  9.728   1.00 0.00 ? 111 SER A HB2  6  
ATOM 11486 H HB3  . SER A 1 111 ? 12.584  -7.231  10.872  1.00 0.00 ? 111 SER A HB3  6  
ATOM 11487 H HG   . SER A 1 111 ? 10.925  -6.026  12.457  1.00 0.00 ? 111 SER A HG   6  
ATOM 11488 N N    . THR A 1 112 ? 14.030  -5.123  8.982   1.00 0.00 ? 112 THR A N    6  
ATOM 11489 C CA   . THR A 1 112 ? 15.360  -5.156  8.396   1.00 0.00 ? 112 THR A CA   6  
ATOM 11490 C C    . THR A 1 112 ? 15.292  -5.650  6.950   1.00 0.00 ? 112 THR A C    6  
ATOM 11491 O O    . THR A 1 112 ? 15.636  -4.917  6.024   1.00 0.00 ? 112 THR A O    6  
ATOM 11492 C CB   . THR A 1 112 ? 16.250  -6.019  9.292   1.00 0.00 ? 112 THR A CB   6  
ATOM 11493 O OG1  . THR A 1 112 ? 16.971  -5.075  10.079  1.00 0.00 ? 112 THR A OG1  6  
ATOM 11494 C CG2  . THR A 1 112 ? 17.335  -6.755  8.504   1.00 0.00 ? 112 THR A CG2  6  
ATOM 11495 H H    . THR A 1 112 ? 13.279  -5.099  8.323   1.00 0.00 ? 112 THR A H    6  
ATOM 11496 H HA   . THR A 1 112 ? 15.749  -4.139  8.369   1.00 0.00 ? 112 THR A HA   6  
ATOM 11497 H HB   . THR A 1 112 ? 15.652  -6.718  9.877   1.00 0.00 ? 112 THR A HB   6  
ATOM 11498 H HG1  . THR A 1 112 ? 17.297  -5.507  10.919  1.00 0.00 ? 112 THR A HG1  6  
ATOM 11499 H HG21 . THR A 1 112 ? 17.686  -6.122  7.689   1.00 0.00 ? 112 THR A HG21 6  
ATOM 11500 H HG22 . THR A 1 112 ? 18.169  -6.990  9.166   1.00 0.00 ? 112 THR A HG22 6  
ATOM 11501 H HG23 . THR A 1 112 ? 16.925  -7.679  8.096   1.00 0.00 ? 112 THR A HG23 6  
ATOM 11502 N N    . THR A 1 113 ? 14.847  -6.888  6.801   1.00 0.00 ? 113 THR A N    6  
ATOM 11503 C CA   . THR A 1 113 ? 14.730  -7.489  5.483   1.00 0.00 ? 113 THR A CA   6  
ATOM 11504 C C    . THR A 1 113 ? 13.984  -6.550  4.533   1.00 0.00 ? 113 THR A C    6  
ATOM 11505 O O    . THR A 1 113 ? 14.146  -6.634  3.318   1.00 0.00 ? 113 THR A O    6  
ATOM 11506 C CB   . THR A 1 113 ? 14.055  -8.853  5.644   1.00 0.00 ? 113 THR A CB   6  
ATOM 11507 O OG1  . THR A 1 113 ? 15.020  -9.639  6.338   1.00 0.00 ? 113 THR A OG1  6  
ATOM 11508 C CG2  . THR A 1 113 ? 13.877  -9.578  4.307   1.00 0.00 ? 113 THR A CG2  6  
ATOM 11509 H H    . THR A 1 113 ? 14.569  -7.478  7.560   1.00 0.00 ? 113 THR A H    6  
ATOM 11510 H HA   . THR A 1 113 ? 15.732  -7.624  5.077   1.00 0.00 ? 113 THR A HA   6  
ATOM 11511 H HB   . THR A 1 113 ? 13.103  -8.758  6.165   1.00 0.00 ? 113 THR A HB   6  
ATOM 11512 H HG1  . THR A 1 113 ? 15.855  -9.717  5.792   1.00 0.00 ? 113 THR A HG1  6  
ATOM 11513 H HG21 . THR A 1 113 ? 14.682  -9.294  3.629   1.00 0.00 ? 113 THR A HG21 6  
ATOM 11514 H HG22 . THR A 1 113 ? 13.905  -10.655 4.472   1.00 0.00 ? 113 THR A HG22 6  
ATOM 11515 H HG23 . THR A 1 113 ? 12.918  -9.301  3.869   1.00 0.00 ? 113 THR A HG23 6  
ATOM 11516 N N    . GLN A 1 114 ? 13.182  -5.677  5.125   1.00 0.00 ? 114 GLN A N    6  
ATOM 11517 C CA   . GLN A 1 114 ? 12.410  -4.723  4.347   1.00 0.00 ? 114 GLN A CA   6  
ATOM 11518 C C    . GLN A 1 114 ? 13.229  -3.455  4.099   1.00 0.00 ? 114 GLN A C    6  
ATOM 11519 O O    . GLN A 1 114 ? 13.147  -2.859  3.026   1.00 0.00 ? 114 GLN A O    6  
ATOM 11520 C CB   . GLN A 1 114 ? 11.086  -4.394  5.040   1.00 0.00 ? 114 GLN A CB   6  
ATOM 11521 C CG   . GLN A 1 114 ? 10.025  -5.451  4.725   1.00 0.00 ? 114 GLN A CG   6  
ATOM 11522 C CD   . GLN A 1 114 ? 9.967   -6.514  5.824   1.00 0.00 ? 114 GLN A CD   6  
ATOM 11523 O OE1  . GLN A 1 114 ? 8.952   -6.724  6.468   1.00 0.00 ? 114 GLN A OE1  6  
ATOM 11524 N NE2  . GLN A 1 114 ? 11.110  -7.171  6.001   1.00 0.00 ? 114 GLN A NE2  6  
ATOM 11525 H H    . GLN A 1 114 ? 13.055  -5.615  6.116   1.00 0.00 ? 114 GLN A H    6  
ATOM 11526 H HA   . GLN A 1 114 ? 12.203  -5.221  3.400   1.00 0.00 ? 114 GLN A HA   6  
ATOM 11527 H HB2  . GLN A 1 114 ? 11.239  -4.338  6.118   1.00 0.00 ? 114 GLN A HB2  6  
ATOM 11528 H HB3  . GLN A 1 114 ? 10.735  -3.414  4.716   1.00 0.00 ? 114 GLN A HB3  6  
ATOM 11529 H HG2  . GLN A 1 114 ? 9.050   -4.973  4.624   1.00 0.00 ? 114