data_2UVV
# 
_entry.id   2UVV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2UVV         
PDBE  EBI-31905    
WWPDB D_1290031905 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2ASD unspecified 'OXOG-MODIFIED INSERTION TERNARY COMPLEX' 
PDB 2ASJ unspecified 'OXOG-MODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2ASL unspecified 'OXOG-MODIFIED POSTINSERTION BINARY COMPLEX' 
PDB 2ATL unspecified 'UNMODIFIED INSERTION TERNARY COMPLEX' 
PDB 2AU0 unspecified 'UNMODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2R unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2J6S unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6T unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6U unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DGTP.' 
PDB 2JEF unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOTIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEG unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEI unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEJ unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2UVR unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2UVU unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2UVW unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2UVV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Irimia, A.' 1 
'Egli, M.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Hydrogen Bonding of 7,8-Dihydro-8-Oxodeoxyguanosine with a Charged Residue in the Little Finger Domain Determines Miscoding Events in Sulfolobus Solfataricus DNA Polymerase Dpo4.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                19831 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17468100 
_citation.pdbx_database_id_DOI      10.1074/JBC.M702290200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eoff, R.L.'       1 
primary 'Irimia, A.'       2 
primary 'Angel, K.C.'      3 
primary 'Egli, M.'         4 
primary 'Guengerich, F.P.' 5 
# 
_cell.entry_id           2UVV 
_cell.length_a           95.776 
_cell.length_b           103.725 
_cell.length_c           53.032 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2UVV 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                 41058.672 1   2.7.7.7 YES ? 
'R332E MUTANT OF DPO4'                  
2 polymer     syn 
;5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP *TP*TP*CP*C)-3'
;
4385.852  1   ?       ?   ? 'GGG GGA AGG ATT CC'                    
3 polymer     syn 
;5'-D(*TP*CP*AP*CP*8OGP*GP*AP*AP*TP*CP *CP*TP*TP*CP*CP*CP*CP*C)-3'
;
5388.480  1   ?       ?   ? 'T C A C 8OG G A A T C C T T C C C C C' 
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                 507.181   1   ?       ?   ? ? 
5 non-polymer syn 'CALCIUM ION'                                                       40.078    3   ?       ?   ? ? 
6 water       nat water                                                               18.015    182 ?       ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'POL IV'          
2 '14-MER PRIMER'   
3 '18-MER TEMPLATE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIREIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIREIGVRFSKFIEAIGLDKFFDT
;
A ? 
2 polydeoxyribonucleotide no no  '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DT)(DC)(DC)' GGGGGAAGGATTCC P ? 
3 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(DC)(8OG)(DG)(DA)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCACGGAATCCTTCCCCC T 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 GLU n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DC  n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   8OG n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B/DPO4-NHIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GENE DPO4' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2UVV        1 ? ? 2UVV   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2UVV        2 ? ? 2UVV   ? 
4 PDB 2UVV        3 ? ? 2UVV   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2UVV A 1 ? 6   ? 2UVV   -5 ? 0   ? -5 0   
2 2 2UVV A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 3 2UVV P 1 ? 14  ? 2UVV   1  ? 14  ? 1  14  
4 4 2UVV T 1 ? 18  ? 2UVV   1  ? 18  ? 1  18  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2UVV 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      338 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q97W02 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          332 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            332 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"         ?                                                       
'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2UVV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   55.3 
_exptl_crystal.description           'THE MODEL POSITION WAS OPTIMIZED BY SEVERAL ROUNDS OF RIGID BODY REFINEMENT.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.30 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '7% PEG 4000, 10 MM HEPES PH 7.3, 50 MM CA(CH3CO2)2, 50MM NACL, 3.5% GLYCEROL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-12-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 5ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   5ID-B 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2UVV 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.320 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   27480 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.6100 
_reflns.B_iso_Wilson_estimate        43.2 
_reflns.pdbx_redundancy              6.380 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           0.44000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.410 
_reflns_shell.pdbx_redundancy        6.57 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2UVV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27480 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1331600.58 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.32 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1345 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.3 
_refine.aniso_B[1][1]                            -1.12 
_refine.aniso_B[2][2]                            -1.68 
_refine.aniso_B[3][3]                            2.80 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.373696 
_refine.solvent_model_param_bsol                 70.1682 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2UVR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2UVV 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           29.32 
_refine_analyze.Luzzati_coordinate_error_free   0.35 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2751 
_refine_hist.pdbx_number_atoms_nucleic_acid   592 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             182 
_refine_hist.number_atoms_total               3559 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.32 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.48  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.95  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             4255 
_refine_ls_shell.R_factor_R_work                  0.280 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.278 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             235 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP   
'X-RAY DIFFRACTION' 2 DNA-RNA1.PARAM    DNA-RNA1.TOP  
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER_REP.TOP 
'X-RAY DIFFRACTION' 4 DGTP.PARAM        DGTP.TOP      
'X-RAY DIFFRACTION' 5 ION.PARAM         ION.TOP       
# 
_struct.entry_id                  2UVV 
_struct.title                     
'Crystal structures of mutant Dpo4 DNA polymerases with 8-oxoG containing DNA template-primer constructs' 
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2UVV 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, DNA-DIRECTED DNA POLYMERASE, P2 DNA POLYMERASE IV, NUCLEOTIDYLTRANSFERASE, 7, MAGNESIUM, DNA DAMAGE, DNA REPAIR, DNA-BINDING, TRANSLESION DNA POLYMERASE, METAL-BINDING, 8-DIHYDRO-8- OXODEOXYGUANOSINE, METAL- BINDING, MUTATOR PROTEIN, DNA REPLICATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 27  ? LYS A 30  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  AA3 ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  AA4 PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  AA5 ARG A 83  ? GLU A 100 ? ARG A 77  GLU A 94  1 ? 18 
HELX_P HELX_P6  AA6 ASP A 123 ? LYS A 143 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  AA7 ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  AA8 ASP A 173 ? LEU A 184 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  AA9 ASP A 185 ? VAL A 189 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 AB1 GLY A 193 ? LEU A 203 ? GLY A 187 LEU A 197 1 ? 11 
HELX_P HELX_P11 AB2 LYS A 207 ? ILE A 214 ? LYS A 201 ILE A 208 5 ? 8  
HELX_P HELX_P12 AB3 GLU A 215 ? GLY A 224 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 AB4 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 AB5 ASN A 263 ? ASP A 283 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 AB6 SER A 313 ? ASP A 332 ? SER A 307 ASP A 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 13  OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 7   A CA  402 1_555 ? ? ? ? ? ? ?            3.080 ? 
metalc2  metalc ?    ? A ASP 13  OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 7   A CA  403 1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc3  metalc ?    ? A ASP 13  OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 7   A CA  402 1_555 ? ? ? ? ? ? ?            2.978 ? 
metalc4  metalc ?    ? A PHE 14  O     ? ? ? 1_555 F CA  .  CA ? ? A PHE 8   A CA  403 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc5  metalc ?    ? A ASP 111 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 105 A CA  402 1_555 ? ? ? ? ? ? ?            2.952 ? 
metalc6  metalc ?    ? A ASP 111 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 105 A CA  403 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc7  metalc ?    ? A GLU 112 OE2   ? ? ? 1_555 E CA  .  CA ? ? A GLU 106 A CA  402 1_555 ? ? ? ? ? ? ?            2.569 ? 
metalc8  metalc ?    ? A ALA 187 O     ? ? ? 1_555 G CA  .  CA ? ? A ALA 181 A CA  404 1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc9  metalc ?    ? A ILE 192 O     ? ? ? 1_555 G CA  .  CA ? ? A ILE 186 A CA  404 1_555 ? ? ? ? ? ? ?            2.643 ? 
covale1  covale both ? C DC  4   "O3'" A ? ? 1_555 C 8OG 5  P  ? ? T DC  4   T 8OG 5   1_555 ? ? ? ? ? ? ?            1.611 ? 
covale2  covale both ? C DC  4   "O3'" B ? ? 1_555 C 8OG 5  P  ? ? T DC  4   T 8OG 5   1_555 ? ? ? ? ? ? ?            1.609 ? 
covale3  covale both ? C 8OG 5   "O3'" ? ? ? 1_555 C DG  6  P  ? ? T 8OG 5   T DG  6   1_555 ? ? ? ? ? ? ?            1.603 ? 
metalc10 metalc ?    ? D DGT .   O2G   ? ? ? 1_555 F CA  .  CA ? ? A DGT 401 A CA  403 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc11 metalc ?    ? D DGT .   O1B   ? ? ? 1_555 F CA  .  CA ? ? A DGT 401 A CA  403 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc12 metalc ?    ? D DGT .   O1A   ? ? ? 1_555 F CA  .  CA ? ? A DGT 401 A CA  403 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc13 metalc ?    ? D DGT .   O1A   ? ? ? 1_555 E CA  .  CA ? ? A DGT 401 A CA  402 1_555 ? ? ? ? ? ? ?            2.648 ? 
metalc14 metalc ?    ? E CA  .   CA    ? ? ? 1_555 H HOH .  O  ? ? A CA  402 A HOH 547 1_555 ? ? ? ? ? ? ?            2.142 ? 
metalc15 metalc ?    ? G CA  .   CA    ? ? ? 1_555 H HOH .  O  ? ? A CA  404 A HOH 594 1_555 ? ? ? ? ? ? ?            2.519 ? 
metalc16 metalc ?    ? G CA  .   CA    ? ? ? 1_555 H HOH .  O  ? ? A CA  404 A HOH 621 1_555 ? ? ? ? ? ? ?            2.735 ? 
metalc17 metalc ?    ? G CA  .   CA    ? ? ? 1_555 H HOH .  O  ? ? A CA  404 A HOH 633 1_555 ? ? ? ? ? ? ?            2.775 ? 
metalc18 metalc ?    ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  404 P HOH 107 1_555 ? ? ? ? ? ? ?            2.607 ? 
metalc19 metalc ?    ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  404 P HOH 109 1_555 ? ? ? ? ? ? ?            2.533 ? 
hydrog1  hydrog ?    ? B DG  1   N1    ? ? ? 1_555 C DC  18 N3 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DG  1   N2    ? ? ? 1_555 C DC  18 O2 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DG  1   O6    ? ? ? 1_555 C DC  18 N4 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DG  2   N1    ? ? ? 1_555 C DC  17 N3 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  2   N2    ? ? ? 1_555 C DC  17 O2 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  2   O6    ? ? ? 1_555 C DC  17 N4 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  3   N1    ? ? ? 1_555 C DC  16 N3 ? ? P DG  3   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  3   N2    ? ? ? 1_555 C DC  16 O2 ? ? P DG  3   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DG  3   O6    ? ? ? 1_555 C DC  16 N4 ? ? P DG  3   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DG  4   N1    ? ? ? 1_555 C DC  15 N3 ? ? P DG  4   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DG  4   N2    ? ? ? 1_555 C DC  15 O2 ? ? P DG  4   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DG  4   O6    ? ? ? 1_555 C DC  15 N4 ? ? P DG  4   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  5   N1    ? ? ? 1_555 C DC  14 N3 ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DG  5   N2    ? ? ? 1_555 C DC  14 O2 ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  5   O6    ? ? ? 1_555 C DC  14 N4 ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DA  6   N1    ? ? ? 1_555 C DT  13 N3 ? ? P DA  6   T DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DA  6   N6    ? ? ? 1_555 C DT  13 O4 ? ? P DA  6   T DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DA  7   N1    ? ? ? 1_555 C DT  12 N3 ? ? P DA  7   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DA  7   N6    ? ? ? 1_555 C DT  12 O4 ? ? P DA  7   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  8   N1    ? ? ? 1_555 C DC  11 N3 ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  8   N2    ? ? ? 1_555 C DC  11 O2 ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DG  8   O6    ? ? ? 1_555 C DC  11 N4 ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DG  9   N1    ? ? ? 1_555 C DC  10 N3 ? ? P DG  9   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DG  9   N2    ? ? ? 1_555 C DC  10 O2 ? ? P DG  9   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DG  9   O6    ? ? ? 1_555 C DC  10 N4 ? ? P DG  9   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DA  10  N1    ? ? ? 1_555 C DT  9  N3 ? ? P DA  10  T DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DA  10  N6    ? ? ? 1_555 C DT  9  O4 ? ? P DA  10  T DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DT  11  N3    ? ? ? 1_555 C DA  8  N1 ? ? P DT  11  T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DT  11  O4    ? ? ? 1_555 C DA  8  N6 ? ? P DT  11  T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DT  12  N3    ? ? ? 1_555 C DA  7  N1 ? ? P DT  12  T DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DT  12  O4    ? ? ? 1_555 C DA  7  N6 ? ? P DT  12  T DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DC  13  N3    ? ? ? 1_555 C DG  6  N1 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DC  13  N4    ? ? ? 1_555 C DG  6  O6 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DC  13  O2    ? ? ? 1_555 C DG  6  N2 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DC  14  N3    ? ? ? 1_555 C 8OG 5  N1 ? ? P DC  14  T 8OG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DC  14  N4    ? ? ? 1_555 C 8OG 5  O6 ? ? P DC  14  T 8OG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DC  14  O2    ? ? ? 1_555 C 8OG 5  N2 ? ? P DC  14  T 8OG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           165 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    166 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 105 ? SER A 109 ? ILE A 99  SER A 103 
AA1 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA1 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA1 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA1 5 ILE A 169 ? VAL A 171 ? ILE A 163 VAL A 165 
AA2 1 GLY A 47  ? ALA A 52  ? GLY A 41  ALA A 46  
AA2 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AA2 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AA3 1 SER A 250 ? SER A 261 ? SER A 244 SER A 255 
AA3 2 ILE A 336 ? PHE A 346 ? ILE A 330 PHE A 340 
AA3 3 PRO A 287 ? THR A 296 ? PRO A 281 THR A 290 
AA3 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 106 ? N GLU A 100 O TYR A 114 ? O TYR A 108 
AA1 2 3 O ALA A 113 ? O ALA A 107 N VAL A 12  ? N VAL A 6   
AA1 3 4 N PHE A 11  ? N PHE A 5   O GLY A 149 ? O GLY A 143 
AA1 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AA2 1 2 O ALA A 48  ? O ALA A 42  N VAL A 38  ? N VAL A 32  
AA2 2 3 N CYS A 37  ? N CYS A 31  O LEU A 80  ? O LEU A 74  
AA3 1 2 N ILE A 251 ? N ILE A 245 O PHE A 343 ? O PHE A 337 
AA3 2 3 O ARG A 337 ? O ARG A 331 N VAL A 295 ? N VAL A 289 
AA3 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DGT 401 ? 18 'binding site for residue DGT A 401' 
AC2 Software A CA  402 ? 6  'binding site for residue CA A 402'  
AC3 Software A CA  403 ? 4  'binding site for residue CA A 403'  
AC4 Software A CA  404 ? 7  'binding site for residue CA A 404'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 ASP A 13  ? ASP A 7   . ? 1_555 ? 
2  AC1 18 PHE A 14  ? PHE A 8   . ? 1_555 ? 
3  AC1 18 ASP A 15  ? ASP A 9   . ? 1_555 ? 
4  AC1 18 TYR A 16  ? TYR A 10  . ? 1_555 ? 
5  AC1 18 PHE A 17  ? PHE A 11  . ? 1_555 ? 
6  AC1 18 TYR A 18  ? TYR A 12  . ? 1_555 ? 
7  AC1 18 ALA A 50  ? ALA A 44  . ? 1_555 ? 
8  AC1 18 THR A 51  ? THR A 45  . ? 1_555 ? 
9  AC1 18 TYR A 54  ? TYR A 48  . ? 1_555 ? 
10 AC1 18 ARG A 57  ? ARG A 51  . ? 1_555 ? 
11 AC1 18 ASP A 111 ? ASP A 105 . ? 1_555 ? 
12 AC1 18 LYS A 165 ? LYS A 159 . ? 1_555 ? 
13 AC1 18 CA  E .   ? CA  A 402 . ? 1_555 ? 
14 AC1 18 CA  F .   ? CA  A 403 . ? 1_555 ? 
15 AC1 18 HOH H .   ? HOH A 511 . ? 1_555 ? 
16 AC1 18 DC  B 14  ? DC  P 14  . ? 1_555 ? 
17 AC1 18 DC  C 4   ? DC  T 4   . ? 1_555 ? 
18 AC1 18 8OG C 5   ? 8OG T 5   . ? 1_555 ? 
19 AC2 6  ASP A 13  ? ASP A 7   . ? 1_555 ? 
20 AC2 6  ASP A 111 ? ASP A 105 . ? 1_555 ? 
21 AC2 6  GLU A 112 ? GLU A 106 . ? 1_555 ? 
22 AC2 6  DGT D .   ? DGT A 401 . ? 1_555 ? 
23 AC2 6  HOH H .   ? HOH A 547 . ? 1_555 ? 
24 AC2 6  DC  B 14  ? DC  P 14  . ? 1_555 ? 
25 AC3 4  ASP A 13  ? ASP A 7   . ? 1_555 ? 
26 AC3 4  PHE A 14  ? PHE A 8   . ? 1_555 ? 
27 AC3 4  ASP A 111 ? ASP A 105 . ? 1_555 ? 
28 AC3 4  DGT D .   ? DGT A 401 . ? 1_555 ? 
29 AC4 7  ALA A 187 ? ALA A 181 . ? 1_555 ? 
30 AC4 7  ILE A 192 ? ILE A 186 . ? 1_555 ? 
31 AC4 7  HOH H .   ? HOH A 594 . ? 1_555 ? 
32 AC4 7  HOH H .   ? HOH A 621 . ? 1_555 ? 
33 AC4 7  HOH H .   ? HOH A 633 . ? 1_555 ? 
34 AC4 7  HOH I .   ? HOH P 107 . ? 1_555 ? 
35 AC4 7  HOH I .   ? HOH P 109 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2UVV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2UVV 
_atom_sites.fract_transf_matrix[1][1]   0.010441 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009641 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018857 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 7   ? -0.928 34.174 12.845  1.00 51.76 ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 7   ? 0.292  34.920 13.287  1.00 51.75 ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 7   ? 1.120  35.421 12.106  1.00 48.69 ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 7   ? 1.309  34.711 11.120  1.00 47.22 ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 7   ? 1.168  34.040 14.174  1.00 53.66 ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 7   ? 2.570  34.575 14.311  1.00 57.22 ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 7   ? 3.259  34.268 15.925  1.00 64.35 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 7   ? 4.886  33.573 15.509  1.00 61.60 ? 1   MET A CE    1 
ATOM   9    N  N     . ILE A 1 8   ? 1.624  36.644 12.212  1.00 45.39 ? 2   ILE A N     1 
ATOM   10   C  CA    . ILE A 1 8   ? 2.407  37.211 11.126  1.00 42.70 ? 2   ILE A CA    1 
ATOM   11   C  C     . ILE A 1 8   ? 3.789  37.654 11.577  1.00 38.07 ? 2   ILE A C     1 
ATOM   12   O  O     . ILE A 1 8   ? 3.922  38.445 12.506  1.00 36.59 ? 2   ILE A O     1 
ATOM   13   C  CB    . ILE A 1 8   ? 1.633  38.381 10.484  1.00 43.99 ? 2   ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 8   ? 0.449  37.810 9.699   1.00 45.06 ? 2   ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 8   ? 2.540  39.210 9.589   1.00 44.25 ? 2   ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 8   ? -0.383 38.849 8.985   1.00 47.57 ? 2   ILE A CD1   1 
ATOM   17   N  N     . VAL A 1 9   ? 4.817  37.119 10.921  1.00 36.38 ? 3   VAL A N     1 
ATOM   18   C  CA    . VAL A 1 9   ? 6.200  37.457 11.265  1.00 32.74 ? 3   VAL A CA    1 
ATOM   19   C  C     . VAL A 1 9   ? 6.888  38.196 10.126  1.00 31.57 ? 3   VAL A C     1 
ATOM   20   O  O     . VAL A 1 9   ? 6.810  37.802 8.954   1.00 29.58 ? 3   VAL A O     1 
ATOM   21   C  CB    . VAL A 1 9   ? 7.050  36.193 11.624  1.00 32.16 ? 3   VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 9   ? 8.459  36.614 12.052  1.00 29.73 ? 3   VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 9   ? 6.402  35.422 12.768  1.00 30.80 ? 3   VAL A CG2   1 
ATOM   24   N  N     . LEU A 1 10  ? 7.544  39.291 10.488  1.00 30.69 ? 4   LEU A N     1 
ATOM   25   C  CA    . LEU A 1 10  ? 8.279  40.112 9.537   1.00 30.13 ? 4   LEU A CA    1 
ATOM   26   C  C     . LEU A 1 10  ? 9.742  40.050 9.963   1.00 29.09 ? 4   LEU A C     1 
ATOM   27   O  O     . LEU A 1 10  ? 10.093 40.406 11.092  1.00 29.34 ? 4   LEU A O     1 
ATOM   28   C  CB    . LEU A 1 10  ? 7.760  41.558 9.563   1.00 31.45 ? 4   LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 10  ? 8.302  42.566 8.534   1.00 32.33 ? 4   LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 10  ? 7.204  43.564 8.149   1.00 28.03 ? 4   LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 10  ? 9.519  43.288 9.118   1.00 29.92 ? 4   LEU A CD2   1 
ATOM   32   N  N     . PHE A 1 11  ? 10.582 39.565 9.057   1.00 27.45 ? 5   PHE A N     1 
ATOM   33   C  CA    . PHE A 1 11  ? 12.010 39.425 9.315   1.00 25.96 ? 5   PHE A CA    1 
ATOM   34   C  C     . PHE A 1 11  ? 12.772 40.470 8.495   1.00 23.70 ? 5   PHE A C     1 
ATOM   35   O  O     . PHE A 1 11  ? 12.454 40.706 7.335   1.00 25.48 ? 5   PHE A O     1 
ATOM   36   C  CB    . PHE A 1 11  ? 12.448 38.000 8.933   1.00 24.26 ? 5   PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 11  ? 13.943 37.762 8.978   1.00 23.87 ? 5   PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 11  ? 14.617 37.675 10.187  1.00 22.05 ? 5   PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 11  ? 14.655 37.530 7.798   1.00 23.19 ? 5   PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 11  ? 15.985 37.346 10.229  1.00 21.36 ? 5   PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 11  ? 16.025 37.203 7.827   1.00 22.36 ? 5   PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 11  ? 16.684 37.109 9.048   1.00 20.26 ? 5   PHE A CZ    1 
ATOM   43   N  N     . VAL A 1 12  ? 13.761 41.105 9.113   1.00 24.90 ? 6   VAL A N     1 
ATOM   44   C  CA    . VAL A 1 12  ? 14.567 42.113 8.436   1.00 22.31 ? 6   VAL A CA    1 
ATOM   45   C  C     . VAL A 1 12  ? 16.029 41.690 8.475   1.00 22.21 ? 6   VAL A C     1 
ATOM   46   O  O     . VAL A 1 12  ? 16.557 41.340 9.529   1.00 23.79 ? 6   VAL A O     1 
ATOM   47   C  CB    . VAL A 1 12  ? 14.441 43.491 9.114   1.00 24.18 ? 6   VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 12  ? 15.228 44.520 8.337   1.00 23.62 ? 6   VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 12  ? 12.971 43.899 9.208   1.00 26.15 ? 6   VAL A CG2   1 
ATOM   50   N  N     . ASP A 1 13  ? 16.680 41.744 7.321   1.00 23.05 ? 7   ASP A N     1 
ATOM   51   C  CA    . ASP A 1 13  ? 18.080 41.355 7.187   1.00 21.62 ? 7   ASP A CA    1 
ATOM   52   C  C     . ASP A 1 13  ? 18.794 42.446 6.374   1.00 21.75 ? 7   ASP A C     1 
ATOM   53   O  O     . ASP A 1 13  ? 18.486 42.631 5.198   1.00 21.27 ? 7   ASP A O     1 
ATOM   54   C  CB    . ASP A 1 13  ? 18.115 40.010 6.464   1.00 22.77 ? 7   ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 13  ? 19.463 39.355 6.525   1.00 26.86 ? 7   ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 13  ? 19.563 38.145 6.263   1.00 32.44 ? 7   ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 13  ? 20.428 40.052 6.836   1.00 29.93 ? 7   ASP A OD2   1 
ATOM   58   N  N     . PHE A 1 14  ? 19.731 43.166 7.000   1.00 21.17 ? 8   PHE A N     1 
ATOM   59   C  CA    . PHE A 1 14  ? 20.450 44.280 6.349   1.00 21.41 ? 8   PHE A CA    1 
ATOM   60   C  C     . PHE A 1 14  ? 21.308 43.835 5.159   1.00 19.95 ? 8   PHE A C     1 
ATOM   61   O  O     . PHE A 1 14  ? 21.992 42.841 5.258   1.00 19.34 ? 8   PHE A O     1 
ATOM   62   C  CB    . PHE A 1 14  ? 21.343 44.995 7.384   1.00 21.20 ? 8   PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 14  ? 20.633 45.362 8.675   1.00 22.68 ? 8   PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 14  ? 19.247 45.400 8.750   1.00 20.73 ? 8   PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 14  ? 21.367 45.668 9.819   1.00 20.62 ? 8   PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 14  ? 18.596 45.735 9.948   1.00 21.44 ? 8   PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 14  ? 20.728 46.003 11.020  1.00 20.98 ? 8   PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 14  ? 19.346 46.035 11.086  1.00 19.79 ? 8   PHE A CZ    1 
ATOM   69   N  N     . ASP A 1 15  ? 21.322 44.557 4.042   1.00 22.05 ? 9   ASP A N     1 
ATOM   70   C  CA    . ASP A 1 15  ? 22.119 44.079 2.902   1.00 21.54 ? 9   ASP A CA    1 
ATOM   71   C  C     . ASP A 1 15  ? 23.636 44.290 3.054   1.00 19.83 ? 9   ASP A C     1 
ATOM   72   O  O     . ASP A 1 15  ? 24.075 45.363 3.485   1.00 18.75 ? 9   ASP A O     1 
ATOM   73   C  CB    . ASP A 1 15  ? 21.636 44.722 1.584   1.00 25.83 ? 9   ASP A CB    1 
ATOM   74   C  CG    . ASP A 1 15  ? 20.137 44.514 1.316   1.00 27.34 ? 9   ASP A CG    1 
ATOM   75   O  OD1   . ASP A 1 15  ? 19.567 43.472 1.700   1.00 28.94 ? 9   ASP A OD1   1 
ATOM   76   O  OD2   . ASP A 1 15  ? 19.526 45.407 0.691   1.00 29.37 ? 9   ASP A OD2   1 
ATOM   77   N  N     . TYR A 1 16  ? 24.420 43.273 2.676   1.00 19.79 ? 10  TYR A N     1 
ATOM   78   C  CA    . TYR A 1 16  ? 25.898 43.296 2.759   1.00 20.96 ? 10  TYR A CA    1 
ATOM   79   C  C     . TYR A 1 16  ? 26.332 44.299 3.810   1.00 19.97 ? 10  TYR A C     1 
ATOM   80   O  O     . TYR A 1 16  ? 27.180 45.169 3.579   1.00 20.54 ? 10  TYR A O     1 
ATOM   81   C  CB    . TYR A 1 16  ? 26.517 43.618 1.386   1.00 23.63 ? 10  TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 16  ? 26.168 44.964 0.771   1.00 27.38 ? 10  TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 16  ? 27.136 45.962 0.639   1.00 26.79 ? 10  TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 16  ? 24.876 45.244 0.320   1.00 29.00 ? 10  TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 16  ? 26.828 47.196 0.080   1.00 27.87 ? 10  TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 16  ? 24.559 46.490 -0.239  1.00 28.48 ? 10  TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 16  ? 25.540 47.455 -0.352  1.00 28.51 ? 10  TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 16  ? 25.233 48.694 -0.878  1.00 29.41 ? 10  TYR A OH    1 
ATOM   89   N  N     . PHE A 1 17  ? 25.747 44.127 4.991   1.00 18.98 ? 11  PHE A N     1 
ATOM   90   C  CA    . PHE A 1 17  ? 25.917 45.043 6.095   1.00 18.02 ? 11  PHE A CA    1 
ATOM   91   C  C     . PHE A 1 17  ? 27.210 45.782 6.355   1.00 18.28 ? 11  PHE A C     1 
ATOM   92   O  O     . PHE A 1 17  ? 27.234 46.999 6.211   1.00 20.97 ? 11  PHE A O     1 
ATOM   93   C  CB    . PHE A 1 17  ? 25.415 44.419 7.403   1.00 14.86 ? 11  PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 17  ? 25.109 45.449 8.460   1.00 17.27 ? 11  PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 17  ? 24.415 46.617 8.120   1.00 17.29 ? 11  PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 17  ? 25.548 45.292 9.769   1.00 15.90 ? 11  PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 17  ? 24.171 47.607 9.064   1.00 17.58 ? 11  PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 17  ? 25.303 46.290 10.733  1.00 17.43 ? 11  PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 17  ? 24.621 47.441 10.383  1.00 15.22 ? 11  PHE A CZ    1 
ATOM   100  N  N     . TYR A 1 18  ? 28.278 45.096 6.748   1.00 20.10 ? 12  TYR A N     1 
ATOM   101  C  CA    . TYR A 1 18  ? 29.521 45.809 7.048   1.00 19.87 ? 12  TYR A CA    1 
ATOM   102  C  C     . TYR A 1 18  ? 30.042 46.632 5.863   1.00 19.97 ? 12  TYR A C     1 
ATOM   103  O  O     . TYR A 1 18  ? 30.547 47.744 6.038   1.00 20.20 ? 12  TYR A O     1 
ATOM   104  C  CB    . TYR A 1 18  ? 30.618 44.840 7.475   1.00 20.70 ? 12  TYR A CB    1 
ATOM   105  C  CG    . TYR A 1 18  ? 30.375 44.044 8.733   1.00 23.09 ? 12  TYR A CG    1 
ATOM   106  C  CD1   . TYR A 1 18  ? 29.188 44.153 9.469   1.00 24.37 ? 12  TYR A CD1   1 
ATOM   107  C  CD2   . TYR A 1 18  ? 31.353 43.159 9.192   1.00 25.31 ? 12  TYR A CD2   1 
ATOM   108  C  CE1   . TYR A 1 18  ? 28.992 43.390 10.637  1.00 25.10 ? 12  TYR A CE1   1 
ATOM   109  C  CE2   . TYR A 1 18  ? 31.168 42.400 10.340  1.00 27.25 ? 12  TYR A CE2   1 
ATOM   110  C  CZ    . TYR A 1 18  ? 29.996 42.512 11.058  1.00 26.05 ? 12  TYR A CZ    1 
ATOM   111  O  OH    . TYR A 1 18  ? 29.862 41.726 12.185  1.00 29.08 ? 12  TYR A OH    1 
ATOM   112  N  N     . ALA A 1 19  ? 29.959 46.066 4.664   1.00 18.56 ? 13  ALA A N     1 
ATOM   113  C  CA    . ALA A 1 19  ? 30.423 46.756 3.466   1.00 18.16 ? 13  ALA A CA    1 
ATOM   114  C  C     . ALA A 1 19  ? 29.525 47.977 3.213   1.00 18.46 ? 13  ALA A C     1 
ATOM   115  O  O     . ALA A 1 19  ? 29.999 49.055 2.859   1.00 19.82 ? 13  ALA A O     1 
ATOM   116  C  CB    . ALA A 1 19  ? 30.374 45.796 2.249   1.00 17.46 ? 13  ALA A CB    1 
ATOM   117  N  N     . GLN A 1 20  ? 28.224 47.810 3.401   1.00 19.06 ? 14  GLN A N     1 
ATOM   118  C  CA    . GLN A 1 20  ? 27.318 48.915 3.148   1.00 22.43 ? 14  GLN A CA    1 
ATOM   119  C  C     . GLN A 1 20  ? 27.482 50.043 4.159   1.00 23.07 ? 14  GLN A C     1 
ATOM   120  O  O     . GLN A 1 20  ? 27.305 51.205 3.816   1.00 23.97 ? 14  GLN A O     1 
ATOM   121  C  CB    . GLN A 1 20  ? 25.854 48.458 3.115   1.00 22.61 ? 14  GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 20  ? 24.945 49.562 2.562   1.00 24.47 ? 14  GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 20  ? 23.464 49.214 2.552   1.00 26.06 ? 14  GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 20  ? 22.641 50.020 2.129   1.00 24.08 ? 14  GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 20  ? 23.117 48.021 3.029   1.00 24.33 ? 14  GLN A NE2   1 
ATOM   126  N  N     . VAL A 1 21  ? 27.815 49.713 5.403   1.00 22.13 ? 15  VAL A N     1 
ATOM   127  C  CA    . VAL A 1 21  ? 28.006 50.767 6.385   1.00 22.97 ? 15  VAL A CA    1 
ATOM   128  C  C     . VAL A 1 21  ? 29.233 51.583 5.966   1.00 24.86 ? 15  VAL A C     1 
ATOM   129  O  O     . VAL A 1 21  ? 29.233 52.814 6.060   1.00 25.59 ? 15  VAL A O     1 
ATOM   130  C  CB    . VAL A 1 21  ? 28.217 50.204 7.809   1.00 22.13 ? 15  VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 21  ? 28.696 51.310 8.736   1.00 22.07 ? 15  VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 21  ? 26.914 49.626 8.344   1.00 16.27 ? 15  VAL A CG2   1 
ATOM   133  N  N     . GLU A 1 22  ? 30.273 50.897 5.496   1.00 25.41 ? 16  GLU A N     1 
ATOM   134  C  CA    . GLU A 1 22  ? 31.483 51.586 5.050   1.00 26.65 ? 16  GLU A CA    1 
ATOM   135  C  C     . GLU A 1 22  ? 31.178 52.527 3.864   1.00 27.61 ? 16  GLU A C     1 
ATOM   136  O  O     . GLU A 1 22  ? 31.793 53.590 3.724   1.00 28.18 ? 16  GLU A O     1 
ATOM   137  C  CB    . GLU A 1 22  ? 32.563 50.573 4.644   1.00 26.99 ? 16  GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 22  ? 33.142 49.707 5.784   1.00 25.14 ? 16  GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 22  ? 33.984 50.486 6.789   1.00 27.43 ? 16  GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 22  ? 34.392 51.620 6.483   1.00 29.15 ? 16  GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 22  ? 34.258 49.958 7.889   1.00 26.88 ? 16  GLU A OE2   1 
ATOM   142  N  N     . GLU A 1 23  ? 30.239 52.134 3.010   1.00 27.35 ? 17  GLU A N     1 
ATOM   143  C  CA    . GLU A 1 23  ? 29.855 52.955 1.860   1.00 28.54 ? 17  GLU A CA    1 
ATOM   144  C  C     . GLU A 1 23  ? 29.090 54.174 2.337   1.00 28.88 ? 17  GLU A C     1 
ATOM   145  O  O     . GLU A 1 23  ? 29.221 55.263 1.779   1.00 30.67 ? 17  GLU A O     1 
ATOM   146  C  CB    . GLU A 1 23  ? 28.954 52.171 0.904   1.00 27.83 ? 17  GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 23  ? 29.638 51.053 0.157   1.00 31.01 ? 17  GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 23  ? 28.687 50.296 -0.758  1.00 31.32 ? 17  GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 23  ? 29.164 49.447 -1.538  1.00 31.55 ? 17  GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 23  ? 27.465 50.545 -0.689  1.00 32.60 ? 17  GLU A OE2   1 
ATOM   151  N  N     . VAL A 1 24  ? 28.265 53.980 3.360   1.00 28.16 ? 18  VAL A N     1 
ATOM   152  C  CA    . VAL A 1 24  ? 27.478 55.073 3.914   1.00 27.83 ? 18  VAL A CA    1 
ATOM   153  C  C     . VAL A 1 24  ? 28.431 56.095 4.521   1.00 28.82 ? 18  VAL A C     1 
ATOM   154  O  O     . VAL A 1 24  ? 28.256 57.295 4.323   1.00 28.09 ? 18  VAL A O     1 
ATOM   155  C  CB    . VAL A 1 24  ? 26.481 54.546 4.984   1.00 28.70 ? 18  VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 24  ? 25.759 55.709 5.675   1.00 28.88 ? 18  VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 24  ? 25.462 53.626 4.314   1.00 25.87 ? 18  VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 25  ? 29.450 55.613 5.238   1.00 27.50 ? 19  LEU A N     1 
ATOM   159  C  CA    . LEU A 1 25  ? 30.442 56.494 5.852   1.00 28.93 ? 19  LEU A CA    1 
ATOM   160  C  C     . LEU A 1 25  ? 31.414 57.068 4.825   1.00 27.87 ? 19  LEU A C     1 
ATOM   161  O  O     . LEU A 1 25  ? 32.092 58.045 5.089   1.00 30.12 ? 19  LEU A O     1 
ATOM   162  C  CB    . LEU A 1 25  ? 31.221 55.743 6.952   1.00 29.74 ? 19  LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 25  ? 30.647 55.814 8.377   1.00 30.85 ? 19  LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 25  ? 29.131 55.603 8.339   1.00 28.16 ? 19  LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 25  ? 31.325 54.781 9.270   1.00 29.74 ? 19  LEU A CD2   1 
ATOM   166  N  N     . ASN A 1 26  ? 31.480 56.461 3.647   1.00 29.66 ? 20  ASN A N     1 
ATOM   167  C  CA    . ASN A 1 26  ? 32.381 56.948 2.607   1.00 29.25 ? 20  ASN A CA    1 
ATOM   168  C  C     . ASN A 1 26  ? 31.771 56.635 1.254   1.00 29.53 ? 20  ASN A C     1 
ATOM   169  O  O     . ASN A 1 26  ? 32.158 55.676 0.582   1.00 29.66 ? 20  ASN A O     1 
ATOM   170  C  CB    . ASN A 1 26  ? 33.746 56.283 2.756   1.00 31.18 ? 20  ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 26  ? 34.791 56.878 1.842   1.00 33.73 ? 20  ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 26  ? 35.981 56.601 1.997   1.00 34.50 ? 20  ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 26  ? 34.357 57.688 0.874   1.00 32.93 ? 20  ASN A ND2   1 
ATOM   174  N  N     . PRO A 1 27  ? 30.799 57.454 0.830   1.00 30.55 ? 21  PRO A N     1 
ATOM   175  C  CA    . PRO A 1 27  ? 30.090 57.305 -0.443  1.00 30.14 ? 21  PRO A CA    1 
ATOM   176  C  C     . PRO A 1 27  ? 30.977 57.200 -1.672  1.00 31.13 ? 21  PRO A C     1 
ATOM   177  O  O     . PRO A 1 27  ? 30.558 56.648 -2.683  1.00 30.93 ? 21  PRO A O     1 
ATOM   178  C  CB    . PRO A 1 27  ? 29.193 58.536 -0.490  1.00 31.16 ? 21  PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 27  ? 28.917 58.807 0.944   1.00 30.33 ? 21  PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 27  ? 30.281 58.614 1.579   1.00 32.21 ? 21  PRO A CD    1 
ATOM   181  N  N     . SER A 1 28  ? 32.197 57.719 -1.602  1.00 31.63 ? 22  SER A N     1 
ATOM   182  C  CA    . SER A 1 28  ? 33.070 57.629 -2.763  1.00 32.78 ? 22  SER A CA    1 
ATOM   183  C  C     . SER A 1 28  ? 33.291 56.156 -3.102  1.00 33.54 ? 22  SER A C     1 
ATOM   184  O  O     . SER A 1 28  ? 33.638 55.819 -4.233  1.00 32.43 ? 22  SER A O     1 
ATOM   185  C  CB    . SER A 1 28  ? 34.410 58.335 -2.501  1.00 33.87 ? 22  SER A CB    1 
ATOM   186  O  OG    . SER A 1 28  ? 35.194 57.664 -1.530  1.00 34.96 ? 22  SER A OG    1 
ATOM   187  N  N     . LEU A 1 29  ? 33.056 55.280 -2.122  1.00 34.36 ? 23  LEU A N     1 
ATOM   188  C  CA    . LEU A 1 29  ? 33.218 53.836 -2.308  1.00 33.86 ? 23  LEU A CA    1 
ATOM   189  C  C     . LEU A 1 29  ? 32.085 53.192 -3.109  1.00 33.31 ? 23  LEU A C     1 
ATOM   190  O  O     . LEU A 1 29  ? 32.279 52.153 -3.737  1.00 33.85 ? 23  LEU A O     1 
ATOM   191  C  CB    . LEU A 1 29  ? 33.311 53.125 -0.952  1.00 33.52 ? 23  LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 29  ? 34.491 53.382 -0.015  1.00 33.49 ? 23  LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 29  ? 34.218 52.724 1.338   1.00 31.70 ? 23  LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 29  ? 35.766 52.848 -0.628  1.00 31.75 ? 23  LEU A CD2   1 
ATOM   195  N  N     . LYS A 1 30  ? 30.895 53.786 -3.079  1.00 35.02 ? 24  LYS A N     1 
ATOM   196  C  CA    . LYS A 1 30  ? 29.765 53.210 -3.811  1.00 35.10 ? 24  LYS A CA    1 
ATOM   197  C  C     . LYS A 1 30  ? 30.116 52.980 -5.274  1.00 36.40 ? 24  LYS A C     1 
ATOM   198  O  O     . LYS A 1 30  ? 30.846 53.764 -5.872  1.00 37.74 ? 24  LYS A O     1 
ATOM   199  C  CB    . LYS A 1 30  ? 28.541 54.123 -3.731  1.00 36.44 ? 24  LYS A CB    1 
ATOM   200  C  CG    . LYS A 1 30  ? 27.899 54.231 -2.363  0.50 35.69 ? 24  LYS A CG    1 
ATOM   201  C  CD    . LYS A 1 30  ? 26.658 55.110 -2.438  0.50 34.80 ? 24  LYS A CD    1 
ATOM   202  C  CE    . LYS A 1 30  ? 26.001 55.279 -1.079  0.50 34.44 ? 24  LYS A CE    1 
ATOM   203  N  NZ    . LYS A 1 30  ? 26.930 55.835 -0.061  0.50 32.42 ? 24  LYS A NZ    1 
ATOM   204  N  N     . GLY A 1 31  ? 29.612 51.901 -5.855  1.00 37.13 ? 25  GLY A N     1 
ATOM   205  C  CA    . GLY A 1 31  ? 29.908 51.648 -7.251  1.00 36.87 ? 25  GLY A CA    1 
ATOM   206  C  C     . GLY A 1 31  ? 31.063 50.701 -7.511  1.00 38.18 ? 25  GLY A C     1 
ATOM   207  O  O     . GLY A 1 31  ? 31.060 49.982 -8.512  1.00 38.21 ? 25  GLY A O     1 
ATOM   208  N  N     . LYS A 1 32  ? 32.066 50.695 -6.641  1.00 37.58 ? 26  LYS A N     1 
ATOM   209  C  CA    . LYS A 1 32  ? 33.189 49.785 -6.841  1.00 37.97 ? 26  LYS A CA    1 
ATOM   210  C  C     . LYS A 1 32  ? 33.208 48.631 -5.838  1.00 35.84 ? 26  LYS A C     1 
ATOM   211  O  O     . LYS A 1 32  ? 32.551 48.693 -4.799  1.00 36.40 ? 26  LYS A O     1 
ATOM   212  C  CB    . LYS A 1 32  ? 34.507 50.550 -6.785  1.00 38.96 ? 26  LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 32  ? 34.501 51.750 -5.877  1.00 42.43 ? 26  LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 32  ? 35.812 52.497 -6.010  1.00 43.54 ? 26  LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 32  ? 35.787 53.815 -5.268  1.00 45.39 ? 26  LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 32  ? 37.118 54.470 -5.335  1.00 48.36 ? 26  LYS A NZ    1 
ATOM   217  N  N     . PRO A 1 33  ? 33.957 47.553 -6.146  1.00 34.81 ? 27  PRO A N     1 
ATOM   218  C  CA    . PRO A 1 33  ? 34.024 46.410 -5.229  1.00 32.01 ? 27  PRO A CA    1 
ATOM   219  C  C     . PRO A 1 33  ? 34.627 46.800 -3.873  1.00 30.04 ? 27  PRO A C     1 
ATOM   220  O  O     . PRO A 1 33  ? 35.685 47.428 -3.807  1.00 30.40 ? 27  PRO A O     1 
ATOM   221  C  CB    . PRO A 1 33  ? 34.879 45.408 -5.999  1.00 32.29 ? 27  PRO A CB    1 
ATOM   222  C  CG    . PRO A 1 33  ? 35.804 46.294 -6.774  1.00 35.29 ? 27  PRO A CG    1 
ATOM   223  C  CD    . PRO A 1 33  ? 34.875 47.364 -7.287  1.00 33.52 ? 27  PRO A CD    1 
ATOM   224  N  N     . VAL A 1 34  ? 33.934 46.431 -2.797  1.00 27.84 ? 28  VAL A N     1 
ATOM   225  C  CA    . VAL A 1 34  ? 34.378 46.731 -1.437  1.00 25.75 ? 28  VAL A CA    1 
ATOM   226  C  C     . VAL A 1 34  ? 34.415 45.433 -0.647  1.00 24.50 ? 28  VAL A C     1 
ATOM   227  O  O     . VAL A 1 34  ? 33.415 44.732 -0.527  1.00 24.54 ? 28  VAL A O     1 
ATOM   228  C  CB    . VAL A 1 34  ? 33.426 47.728 -0.744  1.00 27.13 ? 28  VAL A CB    1 
ATOM   229  C  CG1   . VAL A 1 34  ? 33.894 47.986 0.692   1.00 23.93 ? 28  VAL A CG1   1 
ATOM   230  C  CG2   . VAL A 1 34  ? 33.369 49.033 -1.535  1.00 25.57 ? 28  VAL A CG2   1 
ATOM   231  N  N     . VAL A 1 35  ? 35.584 45.126 -0.107  1.00 25.45 ? 29  VAL A N     1 
ATOM   232  C  CA    . VAL A 1 35  ? 35.799 43.893 0.631   1.00 23.77 ? 29  VAL A CA    1 
ATOM   233  C  C     . VAL A 1 35  ? 36.233 44.210 2.060   1.00 25.64 ? 29  VAL A C     1 
ATOM   234  O  O     . VAL A 1 35  ? 37.305 44.781 2.273   1.00 26.02 ? 29  VAL A O     1 
ATOM   235  C  CB    . VAL A 1 35  ? 36.901 43.058 -0.080  1.00 23.36 ? 29  VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 35  ? 37.003 41.664 0.527   1.00 19.57 ? 29  VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 35  ? 36.595 42.989 -1.588  1.00 19.32 ? 29  VAL A CG2   1 
ATOM   238  N  N     . VAL A 1 36  ? 35.393 43.851 3.032   1.00 23.84 ? 30  VAL A N     1 
ATOM   239  C  CA    . VAL A 1 36  ? 35.705 44.095 4.434   1.00 20.58 ? 30  VAL A CA    1 
ATOM   240  C  C     . VAL A 1 36  ? 36.376 42.839 4.985   1.00 22.49 ? 30  VAL A C     1 
ATOM   241  O  O     . VAL A 1 36  ? 35.805 41.752 4.983   1.00 21.27 ? 30  VAL A O     1 
ATOM   242  C  CB    . VAL A 1 36  ? 34.430 44.426 5.242   1.00 22.15 ? 30  VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 36  ? 34.761 44.551 6.747   1.00 17.83 ? 30  VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 36  ? 33.843 45.749 4.737   1.00 18.59 ? 30  VAL A CG2   1 
ATOM   245  N  N     . CYS A 1 37  ? 37.584 43.010 5.494   1.00 22.13 ? 31  CYS A N     1 
ATOM   246  C  CA    . CYS A 1 37  ? 38.343 41.872 5.957   1.00 25.34 ? 31  CYS A CA    1 
ATOM   247  C  C     . CYS A 1 37  ? 38.721 41.848 7.428   1.00 24.67 ? 31  CYS A C     1 
ATOM   248  O  O     . CYS A 1 37  ? 38.714 42.867 8.130   1.00 21.68 ? 31  CYS A O     1 
ATOM   249  C  CB    . CYS A 1 37  ? 39.643 41.766 5.146   1.00 27.20 ? 31  CYS A CB    1 
ATOM   250  S  SG    . CYS A 1 37  ? 39.548 42.297 3.414   1.00 32.86 ? 31  CYS A SG    1 
ATOM   251  N  N     . VAL A 1 38  ? 39.078 40.653 7.866   1.00 25.41 ? 32  VAL A N     1 
ATOM   252  C  CA    . VAL A 1 38  ? 39.551 40.426 9.218   1.00 26.92 ? 32  VAL A CA    1 
ATOM   253  C  C     . VAL A 1 38  ? 40.980 39.929 9.041   1.00 27.21 ? 32  VAL A C     1 
ATOM   254  O  O     . VAL A 1 38  ? 41.196 38.762 8.735   1.00 27.60 ? 32  VAL A O     1 
ATOM   255  C  CB    . VAL A 1 38  ? 38.711 39.365 9.938   1.00 23.74 ? 32  VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 38  ? 39.334 39.041 11.311  1.00 26.68 ? 32  VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 38  ? 37.296 39.889 10.121  1.00 25.57 ? 32  VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 39  ? 41.945 40.835 9.194   1.00 30.38 ? 33  PHE A N     1 
ATOM   259  C  CA    . PHE A 1 39  ? 43.365 40.501 9.052   1.00 33.54 ? 33  PHE A CA    1 
ATOM   260  C  C     . PHE A 1 39  ? 43.861 39.777 10.304  1.00 37.18 ? 33  PHE A C     1 
ATOM   261  O  O     . PHE A 1 39  ? 43.802 40.329 11.403  1.00 38.06 ? 33  PHE A O     1 
ATOM   262  C  CB    . PHE A 1 39  ? 44.189 41.777 8.833   1.00 31.31 ? 33  PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 39  ? 43.858 42.509 7.555   1.00 31.80 ? 33  PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 39  ? 42.833 43.453 7.514   1.00 31.91 ? 33  PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 39  ? 44.550 42.225 6.376   1.00 32.15 ? 33  PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 39  ? 42.501 44.100 6.318   1.00 31.66 ? 33  PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 39  ? 44.221 42.868 5.178   1.00 31.53 ? 33  PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 39  ? 43.197 43.805 5.149   1.00 31.80 ? 33  PHE A CZ    1 
ATOM   269  N  N     . SER A 1 40  ? 44.354 38.552 10.140  1.00 39.86 ? 34  SER A N     1 
ATOM   270  C  CA    . SER A 1 40  ? 44.831 37.761 11.278  1.00 43.29 ? 34  SER A CA    1 
ATOM   271  C  C     . SER A 1 40  ? 46.254 38.086 11.746  1.00 44.51 ? 34  SER A C     1 
ATOM   272  O  O     . SER A 1 40  ? 46.652 37.702 12.850  1.00 44.99 ? 34  SER A O     1 
ATOM   273  C  CB    . SER A 1 40  ? 44.726 36.263 10.966  1.00 42.67 ? 34  SER A CB    1 
ATOM   274  O  OG    . SER A 1 40  ? 45.634 35.881 9.949   1.00 44.94 ? 34  SER A OG    1 
ATOM   275  N  N     . GLY A 1 41  ? 47.017 38.781 10.910  1.00 46.28 ? 35  GLY A N     1 
ATOM   276  C  CA    . GLY A 1 41  ? 48.371 39.161 11.280  1.00 47.49 ? 35  GLY A CA    1 
ATOM   277  C  C     . GLY A 1 41  ? 49.476 38.124 11.139  1.00 47.98 ? 35  GLY A C     1 
ATOM   278  O  O     . GLY A 1 41  ? 50.651 38.467 11.259  1.00 49.53 ? 35  GLY A O     1 
ATOM   279  N  N     . ARG A 1 42  ? 49.122 36.867 10.890  1.00 48.64 ? 36  ARG A N     1 
ATOM   280  C  CA    . ARG A 1 42  ? 50.128 35.817 10.740  1.00 49.87 ? 36  ARG A CA    1 
ATOM   281  C  C     . ARG A 1 42  ? 51.173 36.200 9.676   1.00 49.72 ? 36  ARG A C     1 
ATOM   282  O  O     . ARG A 1 42  ? 52.376 36.052 9.892   1.00 49.54 ? 36  ARG A O     1 
ATOM   283  C  CB    . ARG A 1 42  ? 49.454 34.500 10.364  1.00 52.32 ? 36  ARG A CB    1 
ATOM   284  C  CG    . ARG A 1 42  ? 50.296 33.276 10.673  1.00 57.09 ? 36  ARG A CG    1 
ATOM   285  C  CD    . ARG A 1 42  ? 50.233 32.913 12.155  1.00 58.71 ? 36  ARG A CD    1 
ATOM   286  N  NE    . ARG A 1 42  ? 50.784 31.583 12.408  1.00 60.79 ? 36  ARG A NE    1 
ATOM   287  C  CZ    . ARG A 1 42  ? 50.804 30.986 13.596  1.00 61.51 ? 36  ARG A CZ    1 
ATOM   288  N  NH1   . ARG A 1 42  ? 50.303 31.596 14.661  1.00 61.55 ? 36  ARG A NH1   1 
ATOM   289  N  NH2   . ARG A 1 42  ? 51.324 29.771 13.716  1.00 62.34 ? 36  ARG A NH2   1 
ATOM   290  N  N     . PHE A 1 43  ? 50.705 36.671 8.523   1.00 48.28 ? 37  PHE A N     1 
ATOM   291  C  CA    . PHE A 1 43  ? 51.579 37.122 7.445   1.00 47.24 ? 37  PHE A CA    1 
ATOM   292  C  C     . PHE A 1 43  ? 50.825 38.191 6.668   1.00 47.36 ? 37  PHE A C     1 
ATOM   293  O  O     . PHE A 1 43  ? 49.685 38.514 7.006   1.00 48.09 ? 37  PHE A O     1 
ATOM   294  C  CB    . PHE A 1 43  ? 51.998 35.968 6.513   1.00 46.50 ? 37  PHE A CB    1 
ATOM   295  C  CG    . PHE A 1 43  ? 50.849 35.183 5.939   1.00 45.30 ? 37  PHE A CG    1 
ATOM   296  C  CD1   . PHE A 1 43  ? 50.449 33.986 6.524   1.00 44.03 ? 37  PHE A CD1   1 
ATOM   297  C  CD2   . PHE A 1 43  ? 50.163 35.644 4.815   1.00 44.76 ? 37  PHE A CD2   1 
ATOM   298  C  CE1   . PHE A 1 43  ? 49.375 33.252 5.999   1.00 44.29 ? 37  PHE A CE1   1 
ATOM   299  C  CE2   . PHE A 1 43  ? 49.091 34.919 4.283   1.00 43.49 ? 37  PHE A CE2   1 
ATOM   300  C  CZ    . PHE A 1 43  ? 48.696 33.721 4.878   1.00 42.15 ? 37  PHE A CZ    1 
ATOM   301  N  N     . GLU A 1 44  ? 51.452 38.751 5.640   1.00 47.93 ? 38  GLU A N     1 
ATOM   302  C  CA    . GLU A 1 44  ? 50.810 39.791 4.845   1.00 46.70 ? 38  GLU A CA    1 
ATOM   303  C  C     . GLU A 1 44  ? 49.531 39.278 4.194   1.00 43.38 ? 38  GLU A C     1 
ATOM   304  O  O     . GLU A 1 44  ? 49.533 38.259 3.499   1.00 39.99 ? 38  GLU A O     1 
ATOM   305  C  CB    . GLU A 1 44  ? 51.761 40.321 3.767   1.00 51.48 ? 38  GLU A CB    1 
ATOM   306  C  CG    . GLU A 1 44  ? 51.184 41.493 2.987   1.00 56.94 ? 38  GLU A CG    1 
ATOM   307  C  CD    . GLU A 1 44  ? 52.180 42.101 2.023   1.00 60.87 ? 38  GLU A CD    1 
ATOM   308  O  OE1   . GLU A 1 44  ? 53.163 42.725 2.488   1.00 64.17 ? 38  GLU A OE1   1 
ATOM   309  O  OE2   . GLU A 1 44  ? 51.982 41.952 0.797   1.00 63.00 ? 38  GLU A OE2   1 
ATOM   310  N  N     . ASP A 1 45  ? 48.444 40.001 4.447   1.00 39.53 ? 39  ASP A N     1 
ATOM   311  C  CA    . ASP A 1 45  ? 47.128 39.666 3.933   1.00 36.58 ? 39  ASP A CA    1 
ATOM   312  C  C     . ASP A 1 45  ? 46.563 38.369 4.481   1.00 33.53 ? 39  ASP A C     1 
ATOM   313  O  O     . ASP A 1 45  ? 45.650 37.804 3.882   1.00 32.60 ? 39  ASP A O     1 
ATOM   314  C  CB    . ASP A 1 45  ? 47.122 39.607 2.397   1.00 36.07 ? 39  ASP A CB    1 
ATOM   315  C  CG    . ASP A 1 45  ? 47.426 40.945 1.764   1.00 37.13 ? 39  ASP A CG    1 
ATOM   316  O  OD1   . ASP A 1 45  ? 46.984 41.971 2.323   1.00 32.23 ? 39  ASP A OD1   1 
ATOM   317  O  OD2   . ASP A 1 45  ? 48.101 40.964 0.707   1.00 40.63 ? 39  ASP A OD2   1 
ATOM   318  N  N     . SER A 1 46  ? 47.098 37.874 5.599   1.00 31.59 ? 40  SER A N     1 
ATOM   319  C  CA    . SER A 1 46  ? 46.534 36.652 6.167   1.00 31.11 ? 40  SER A CA    1 
ATOM   320  C  C     . SER A 1 46  ? 45.227 37.054 6.831   1.00 29.60 ? 40  SER A C     1 
ATOM   321  O  O     . SER A 1 46  ? 45.092 38.155 7.350   1.00 28.22 ? 40  SER A O     1 
ATOM   322  C  CB    . SER A 1 46  ? 47.457 36.018 7.206   1.00 31.45 ? 40  SER A CB    1 
ATOM   323  O  OG    . SER A 1 46  ? 47.643 36.885 8.304   1.00 35.46 ? 40  SER A OG    1 
ATOM   324  N  N     . GLY A 1 47  ? 44.260 36.155 6.806   1.00 29.86 ? 41  GLY A N     1 
ATOM   325  C  CA    . GLY A 1 47  ? 42.979 36.461 7.396   1.00 28.92 ? 41  GLY A CA    1 
ATOM   326  C  C     . GLY A 1 47  ? 41.892 36.127 6.406   1.00 28.99 ? 41  GLY A C     1 
ATOM   327  O  O     . GLY A 1 47  ? 42.153 35.523 5.360   1.00 28.02 ? 41  GLY A O     1 
ATOM   328  N  N     . ALA A 1 48  ? 40.672 36.543 6.718   1.00 27.59 ? 42  ALA A N     1 
ATOM   329  C  CA    . ALA A 1 48  ? 39.541 36.243 5.862   1.00 26.20 ? 42  ALA A CA    1 
ATOM   330  C  C     . ALA A 1 48  ? 38.660 37.446 5.597   1.00 24.72 ? 42  ALA A C     1 
ATOM   331  O  O     . ALA A 1 48  ? 38.751 38.476 6.276   1.00 22.85 ? 42  ALA A O     1 
ATOM   332  C  CB    . ALA A 1 48  ? 38.706 35.129 6.495   1.00 26.58 ? 42  ALA A CB    1 
ATOM   333  N  N     . VAL A 1 49  ? 37.800 37.294 4.595   1.00 22.47 ? 43  VAL A N     1 
ATOM   334  C  CA    . VAL A 1 49  ? 36.842 38.323 4.228   1.00 21.90 ? 43  VAL A CA    1 
ATOM   335  C  C     . VAL A 1 49  ? 35.590 38.167 5.122   1.00 20.52 ? 43  VAL A C     1 
ATOM   336  O  O     . VAL A 1 49  ? 34.985 37.098 5.172   1.00 21.06 ? 43  VAL A O     1 
ATOM   337  C  CB    . VAL A 1 49  ? 36.402 38.170 2.752   1.00 20.99 ? 43  VAL A CB    1 
ATOM   338  C  CG1   . VAL A 1 49  ? 35.204 39.068 2.477   1.00 21.33 ? 43  VAL A CG1   1 
ATOM   339  C  CG2   . VAL A 1 49  ? 37.559 38.515 1.816   1.00 22.14 ? 43  VAL A CG2   1 
ATOM   340  N  N     . ALA A 1 50  ? 35.214 39.234 5.820   1.00 21.08 ? 44  ALA A N     1 
ATOM   341  C  CA    . ALA A 1 50  ? 34.033 39.218 6.688   1.00 22.90 ? 44  ALA A CA    1 
ATOM   342  C  C     . ALA A 1 50  ? 32.825 39.283 5.760   1.00 22.99 ? 44  ALA A C     1 
ATOM   343  O  O     . ALA A 1 50  ? 31.858 38.537 5.931   1.00 21.89 ? 44  ALA A O     1 
ATOM   344  C  CB    . ALA A 1 50  ? 34.045 40.424 7.643   1.00 21.78 ? 44  ALA A CB    1 
ATOM   345  N  N     . THR A 1 51  ? 32.899 40.184 4.778   1.00 22.08 ? 45  THR A N     1 
ATOM   346  C  CA    . THR A 1 51  ? 31.860 40.327 3.763   1.00 22.46 ? 45  THR A CA    1 
ATOM   347  C  C     . THR A 1 51  ? 32.305 41.237 2.617   1.00 22.31 ? 45  THR A C     1 
ATOM   348  O  O     . THR A 1 51  ? 33.341 41.899 2.698   1.00 23.00 ? 45  THR A O     1 
ATOM   349  C  CB    . THR A 1 51  ? 30.538 40.875 4.355   1.00 24.81 ? 45  THR A CB    1 
ATOM   350  O  OG1   . THR A 1 51  ? 29.474 40.656 3.419   1.00 25.11 ? 45  THR A OG1   1 
ATOM   351  C  CG2   . THR A 1 51  ? 30.639 42.360 4.623   1.00 24.04 ? 45  THR A CG2   1 
ATOM   352  N  N     . ALA A 1 52  ? 31.522 41.269 1.542   1.00 22.57 ? 46  ALA A N     1 
ATOM   353  C  CA    . ALA A 1 52  ? 31.848 42.121 0.402   1.00 22.10 ? 46  ALA A CA    1 
ATOM   354  C  C     . ALA A 1 52  ? 30.558 42.631 -0.239  1.00 21.70 ? 46  ALA A C     1 
ATOM   355  O  O     . ALA A 1 52  ? 29.515 41.970 -0.145  1.00 19.66 ? 46  ALA A O     1 
ATOM   356  C  CB    . ALA A 1 52  ? 32.684 41.326 -0.631  1.00 21.58 ? 46  ALA A CB    1 
ATOM   357  N  N     . ASN A 1 53  ? 30.613 43.801 -0.883  1.00 20.98 ? 47  ASN A N     1 
ATOM   358  C  CA    . ASN A 1 53  ? 29.409 44.323 -1.522  1.00 22.55 ? 47  ASN A CA    1 
ATOM   359  C  C     . ASN A 1 53  ? 29.119 43.501 -2.781  1.00 22.47 ? 47  ASN A C     1 
ATOM   360  O  O     . ASN A 1 53  ? 29.939 42.677 -3.198  1.00 21.87 ? 47  ASN A O     1 
ATOM   361  C  CB    . ASN A 1 53  ? 29.521 45.831 -1.834  1.00 20.33 ? 47  ASN A CB    1 
ATOM   362  C  CG    . ASN A 1 53  ? 30.599 46.159 -2.833  1.00 23.97 ? 47  ASN A CG    1 
ATOM   363  O  OD1   . ASN A 1 53  ? 31.223 45.276 -3.418  1.00 26.78 ? 47  ASN A OD1   1 
ATOM   364  N  ND2   . ASN A 1 53  ? 30.819 47.449 -3.044  1.00 24.17 ? 47  ASN A ND2   1 
ATOM   365  N  N     . TYR A 1 54  ? 27.946 43.689 -3.367  1.00 21.78 ? 48  TYR A N     1 
ATOM   366  C  CA    . TYR A 1 54  ? 27.593 42.894 -4.523  1.00 26.39 ? 48  TYR A CA    1 
ATOM   367  C  C     . TYR A 1 54  ? 28.500 43.050 -5.744  1.00 26.97 ? 48  TYR A C     1 
ATOM   368  O  O     . TYR A 1 54  ? 28.686 42.091 -6.488  1.00 28.63 ? 48  TYR A O     1 
ATOM   369  C  CB    . TYR A 1 54  ? 26.103 43.078 -4.855  1.00 28.89 ? 48  TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 54  ? 25.208 42.348 -3.846  1.00 32.44 ? 48  TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 54  ? 25.026 42.851 -2.554  1.00 34.60 ? 48  TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 54  ? 24.597 41.124 -4.165  1.00 35.41 ? 48  TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 54  ? 24.267 42.162 -1.602  1.00 35.04 ? 48  TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 54  ? 23.827 40.418 -3.212  1.00 36.60 ? 48  TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 54  ? 23.670 40.952 -1.928  1.00 37.23 ? 48  TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 54  ? 22.915 40.292 -0.971  1.00 36.52 ? 48  TYR A OH    1 
ATOM   377  N  N     . GLU A 1 55  ? 29.103 44.218 -5.935  1.00 29.81 ? 49  GLU A N     1 
ATOM   378  C  CA    . GLU A 1 55  ? 30.017 44.390 -7.066  1.00 32.02 ? 49  GLU A CA    1 
ATOM   379  C  C     . GLU A 1 55  ? 31.167 43.397 -6.921  1.00 33.80 ? 49  GLU A C     1 
ATOM   380  O  O     . GLU A 1 55  ? 31.684 42.885 -7.921  1.00 35.10 ? 49  GLU A O     1 
ATOM   381  C  CB    . GLU A 1 55  ? 30.596 45.810 -7.117  1.00 32.69 ? 49  GLU A CB    1 
ATOM   382  C  CG    . GLU A 1 55  ? 29.580 46.909 -7.419  0.50 36.33 ? 49  GLU A CG    1 
ATOM   383  C  CD    . GLU A 1 55  ? 28.501 47.041 -6.348  0.50 38.10 ? 49  GLU A CD    1 
ATOM   384  O  OE1   . GLU A 1 55  ? 28.844 47.232 -5.163  0.50 37.40 ? 49  GLU A OE1   1 
ATOM   385  O  OE2   . GLU A 1 55  ? 27.306 46.960 -6.699  0.50 40.48 ? 49  GLU A OE2   1 
ATOM   386  N  N     . ALA A 1 56  ? 31.573 43.116 -5.681  1.00 32.14 ? 50  ALA A N     1 
ATOM   387  C  CA    . ALA A 1 56  ? 32.671 42.176 -5.458  1.00 30.13 ? 50  ALA A CA    1 
ATOM   388  C  C     . ALA A 1 56  ? 32.215 40.726 -5.571  1.00 27.74 ? 50  ALA A C     1 
ATOM   389  O  O     . ALA A 1 56  ? 32.931 39.889 -6.118  1.00 26.81 ? 50  ALA A O     1 
ATOM   390  C  CB    . ALA A 1 56  ? 33.309 42.424 -4.099  1.00 31.76 ? 50  ALA A CB    1 
ATOM   391  N  N     . ARG A 1 57  ? 31.022 40.431 -5.057  1.00 27.72 ? 51  ARG A N     1 
ATOM   392  C  CA    . ARG A 1 57  ? 30.485 39.079 -5.098  1.00 26.80 ? 51  ARG A CA    1 
ATOM   393  C  C     . ARG A 1 57  ? 30.289 38.535 -6.510  1.00 29.07 ? 51  ARG A C     1 
ATOM   394  O  O     . ARG A 1 57  ? 30.310 37.316 -6.720  1.00 27.47 ? 51  ARG A O     1 
ATOM   395  C  CB    . ARG A 1 57  ? 29.155 39.009 -4.340  1.00 28.67 ? 51  ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 57  ? 29.298 39.224 -2.851  1.00 29.32 ? 51  ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 57  ? 27.971 39.081 -2.129  1.00 28.18 ? 51  ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 57  ? 28.023 39.762 -0.841  1.00 30.61 ? 51  ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 57  ? 27.111 39.638 0.116   1.00 29.47 ? 51  ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 57  ? 26.058 38.843 -0.061  1.00 24.10 ? 51  ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 57  ? 27.250 40.325 1.245   1.00 28.08 ? 51  ARG A NH2   1 
ATOM   402  N  N     . LYS A 1 58  ? 30.081 39.426 -7.473  1.00 28.79 ? 52  LYS A N     1 
ATOM   403  C  CA    . LYS A 1 58  ? 29.907 39.008 -8.857  1.00 31.89 ? 52  LYS A CA    1 
ATOM   404  C  C     . LYS A 1 58  ? 31.088 38.161 -9.287  1.00 31.92 ? 52  LYS A C     1 
ATOM   405  O  O     . LYS A 1 58  ? 30.939 37.232 -10.075 1.00 32.91 ? 52  LYS A O     1 
ATOM   406  C  CB    . LYS A 1 58  ? 29.813 40.215 -9.790  1.00 33.03 ? 52  LYS A CB    1 
ATOM   407  C  CG    . LYS A 1 58  ? 28.557 41.048 -9.610  1.00 34.61 ? 52  LYS A CG    1 
ATOM   408  C  CD    . LYS A 1 58  ? 28.382 42.044 -10.749 1.00 36.89 ? 52  LYS A CD    1 
ATOM   409  C  CE    . LYS A 1 58  ? 29.533 43.037 -10.823 0.50 34.64 ? 52  LYS A CE    1 
ATOM   410  N  NZ    . LYS A 1 58  ? 29.230 44.101 -11.820 0.50 35.97 ? 52  LYS A NZ    1 
ATOM   411  N  N     . PHE A 1 59  ? 32.263 38.451 -8.748  1.00 30.86 ? 53  PHE A N     1 
ATOM   412  C  CA    . PHE A 1 59  ? 33.431 37.697 -9.153  1.00 30.86 ? 53  PHE A CA    1 
ATOM   413  C  C     . PHE A 1 59  ? 33.909 36.624 -8.200  1.00 31.50 ? 53  PHE A C     1 
ATOM   414  O  O     . PHE A 1 59  ? 35.006 36.098 -8.355  1.00 33.92 ? 53  PHE A O     1 
ATOM   415  C  CB    . PHE A 1 59  ? 34.550 38.673 -9.476  1.00 32.38 ? 53  PHE A CB    1 
ATOM   416  C  CG    . PHE A 1 59  ? 34.120 39.772 -10.398 1.00 32.23 ? 53  PHE A CG    1 
ATOM   417  C  CD1   . PHE A 1 59  ? 33.735 41.010 -9.894  1.00 31.37 ? 53  PHE A CD1   1 
ATOM   418  C  CD2   . PHE A 1 59  ? 34.060 39.555 -11.771 1.00 34.02 ? 53  PHE A CD2   1 
ATOM   419  C  CE1   . PHE A 1 59  ? 33.298 42.022 -10.742 1.00 34.45 ? 53  PHE A CE1   1 
ATOM   420  C  CE2   . PHE A 1 59  ? 33.623 40.561 -12.634 1.00 34.49 ? 53  PHE A CE2   1 
ATOM   421  C  CZ    . PHE A 1 59  ? 33.241 41.799 -12.120 1.00 35.14 ? 53  PHE A CZ    1 
ATOM   422  N  N     . GLY A 1 60  ? 33.087 36.293 -7.212  1.00 32.57 ? 54  GLY A N     1 
ATOM   423  C  CA    . GLY A 1 60  ? 33.461 35.257 -6.269  1.00 30.97 ? 54  GLY A CA    1 
ATOM   424  C  C     . GLY A 1 60  ? 34.023 35.718 -4.935  1.00 31.50 ? 54  GLY A C     1 
ATOM   425  O  O     . GLY A 1 60  ? 34.319 34.892 -4.077  1.00 31.34 ? 54  GLY A O     1 
ATOM   426  N  N     . VAL A 1 61  ? 34.190 37.023 -4.744  1.00 31.07 ? 55  VAL A N     1 
ATOM   427  C  CA    . VAL A 1 61  ? 34.709 37.500 -3.471  1.00 28.16 ? 55  VAL A CA    1 
ATOM   428  C  C     . VAL A 1 61  ? 33.532 37.601 -2.521  1.00 30.84 ? 55  VAL A C     1 
ATOM   429  O  O     . VAL A 1 61  ? 32.642 38.439 -2.686  1.00 30.70 ? 55  VAL A O     1 
ATOM   430  C  CB    . VAL A 1 61  ? 35.389 38.861 -3.606  1.00 27.69 ? 55  VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 61  ? 35.869 39.351 -2.222  1.00 20.54 ? 55  VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 61  ? 36.551 38.742 -4.585  1.00 23.09 ? 55  VAL A CG2   1 
ATOM   433  N  N     . LYS A 1 62  ? 33.533 36.721 -1.532  1.00 29.68 ? 56  LYS A N     1 
ATOM   434  C  CA    . LYS A 1 62  ? 32.466 36.660 -0.555  1.00 31.40 ? 56  LYS A CA    1 
ATOM   435  C  C     . LYS A 1 62  ? 33.029 36.348 0.826   1.00 29.14 ? 56  LYS A C     1 
ATOM   436  O  O     . LYS A 1 62  ? 34.215 36.060 0.978   1.00 25.94 ? 56  LYS A O     1 
ATOM   437  C  CB    . LYS A 1 62  ? 31.487 35.562 -0.944  1.00 30.95 ? 56  LYS A CB    1 
ATOM   438  C  CG    . LYS A 1 62  ? 32.158 34.214 -1.085  1.00 34.44 ? 56  LYS A CG    1 
ATOM   439  C  CD    . LYS A 1 62  ? 31.138 33.136 -1.353  1.00 38.05 ? 56  LYS A CD    1 
ATOM   440  C  CE    . LYS A 1 62  ? 31.811 31.855 -1.804  1.00 40.61 ? 56  LYS A CE    1 
ATOM   441  N  NZ    . LYS A 1 62  ? 30.804 30.895 -2.343  1.00 44.80 ? 56  LYS A NZ    1 
ATOM   442  N  N     . ALA A 1 63  ? 32.148 36.388 1.820   1.00 30.21 ? 57  ALA A N     1 
ATOM   443  C  CA    . ALA A 1 63  ? 32.511 36.125 3.204   1.00 29.45 ? 57  ALA A CA    1 
ATOM   444  C  C     . ALA A 1 63  ? 33.112 34.752 3.380   1.00 29.75 ? 57  ALA A C     1 
ATOM   445  O  O     . ALA A 1 63  ? 32.617 33.778 2.816   1.00 29.49 ? 57  ALA A O     1 
ATOM   446  C  CB    . ALA A 1 63  ? 31.283 36.249 4.090   1.00 31.94 ? 57  ALA A CB    1 
ATOM   447  N  N     . GLY A 1 64  ? 34.180 34.672 4.169   1.00 30.60 ? 58  GLY A N     1 
ATOM   448  C  CA    . GLY A 1 64  ? 34.789 33.378 4.431   1.00 31.45 ? 58  GLY A CA    1 
ATOM   449  C  C     . GLY A 1 64  ? 35.974 32.963 3.584   1.00 31.48 ? 58  GLY A C     1 
ATOM   450  O  O     . GLY A 1 64  ? 36.729 32.079 3.977   1.00 32.04 ? 58  GLY A O     1 
ATOM   451  N  N     . ILE A 1 65  ? 36.153 33.570 2.419   1.00 30.42 ? 59  ILE A N     1 
ATOM   452  C  CA    . ILE A 1 65  ? 37.297 33.183 1.618   1.00 29.66 ? 59  ILE A CA    1 
ATOM   453  C  C     . ILE A 1 65  ? 38.514 33.932 2.134   1.00 29.19 ? 59  ILE A C     1 
ATOM   454  O  O     . ILE A 1 65  ? 38.389 34.988 2.751   1.00 27.14 ? 59  ILE A O     1 
ATOM   455  C  CB    . ILE A 1 65  ? 37.088 33.504 0.131   1.00 30.25 ? 59  ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 65  ? 37.182 35.012 -0.104  1.00 31.15 ? 59  ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 65  ? 35.731 32.960 -0.321  1.00 29.29 ? 59  ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 65  ? 37.293 35.386 -1.578  1.00 33.89 ? 59  ILE A CD1   1 
ATOM   459  N  N     . PRO A 1 66  ? 39.715 33.386 1.899   1.00 29.40 ? 60  PRO A N     1 
ATOM   460  C  CA    . PRO A 1 66  ? 40.958 34.022 2.346   1.00 27.84 ? 60  PRO A CA    1 
ATOM   461  C  C     . PRO A 1 66  ? 41.187 35.357 1.646   1.00 28.28 ? 60  PRO A C     1 
ATOM   462  O  O     . PRO A 1 66  ? 40.887 35.497 0.459   1.00 28.65 ? 60  PRO A O     1 
ATOM   463  C  CB    . PRO A 1 66  ? 42.026 32.996 1.971   1.00 28.59 ? 60  PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 66  ? 41.266 31.681 2.014   1.00 29.42 ? 60  PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 66  ? 39.975 32.046 1.342   1.00 28.92 ? 60  PRO A CD    1 
ATOM   466  N  N     . ILE A 1 67  ? 41.705 36.338 2.378   1.00 26.06 ? 61  ILE A N     1 
ATOM   467  C  CA    . ILE A 1 67  ? 41.957 37.637 1.793   1.00 26.25 ? 61  ILE A CA    1 
ATOM   468  C  C     . ILE A 1 67  ? 42.871 37.480 0.569   1.00 29.25 ? 61  ILE A C     1 
ATOM   469  O  O     . ILE A 1 67  ? 42.675 38.138 -0.453  1.00 27.70 ? 61  ILE A O     1 
ATOM   470  C  CB    . ILE A 1 67  ? 42.623 38.598 2.807   1.00 23.95 ? 61  ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 67  ? 41.696 38.806 4.021   1.00 22.28 ? 61  ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 67  ? 42.917 39.922 2.131   1.00 20.05 ? 61  ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 67  ? 42.286 39.649 5.131   1.00 18.63 ? 61  ILE A CD1   1 
ATOM   474  N  N     . VAL A 1 68  ? 43.855 36.587 0.678   1.00 30.17 ? 62  VAL A N     1 
ATOM   475  C  CA    . VAL A 1 68  ? 44.791 36.359 -0.413  1.00 30.42 ? 62  VAL A CA    1 
ATOM   476  C  C     . VAL A 1 68  ? 44.102 35.889 -1.694  1.00 30.00 ? 62  VAL A C     1 
ATOM   477  O  O     . VAL A 1 68  ? 44.525 36.249 -2.786  1.00 29.56 ? 62  VAL A O     1 
ATOM   478  C  CB    . VAL A 1 68  ? 45.889 35.344 -0.008  1.00 32.59 ? 62  VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 68  ? 46.802 35.974 1.053   1.00 32.56 ? 62  VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 68  ? 45.255 34.062 0.516   1.00 31.97 ? 62  VAL A CG2   1 
ATOM   481  N  N     . GLU A 1 69  ? 43.049 35.090 -1.565  1.00 30.24 ? 63  GLU A N     1 
ATOM   482  C  CA    . GLU A 1 69  ? 42.329 34.625 -2.742  1.00 31.27 ? 63  GLU A CA    1 
ATOM   483  C  C     . GLU A 1 69  ? 41.520 35.778 -3.325  1.00 31.08 ? 63  GLU A C     1 
ATOM   484  O  O     . GLU A 1 69  ? 41.407 35.921 -4.544  1.00 31.60 ? 63  GLU A O     1 
ATOM   485  C  CB    . GLU A 1 69  ? 41.398 33.455 -2.390  1.00 32.15 ? 63  GLU A CB    1 
ATOM   486  C  CG    . GLU A 1 69  ? 42.114 32.207 -1.865  1.00 32.76 ? 63  GLU A CG    1 
ATOM   487  C  CD    . GLU A 1 69  ? 43.235 31.728 -2.773  0.50 31.57 ? 63  GLU A CD    1 
ATOM   488  O  OE1   . GLU A 1 69  ? 44.020 30.861 -2.334  0.50 31.72 ? 63  GLU A OE1   1 
ATOM   489  O  OE2   . GLU A 1 69  ? 43.335 32.209 -3.918  0.50 30.61 ? 63  GLU A OE2   1 
ATOM   490  N  N     . ALA A 1 70  ? 40.969 36.610 -2.447  1.00 30.14 ? 64  ALA A N     1 
ATOM   491  C  CA    . ALA A 1 70  ? 40.175 37.750 -2.879  1.00 27.73 ? 64  ALA A CA    1 
ATOM   492  C  C     . ALA A 1 70  ? 41.021 38.683 -3.749  1.00 29.04 ? 64  ALA A C     1 
ATOM   493  O  O     . ALA A 1 70  ? 40.586 39.122 -4.815  1.00 26.60 ? 64  ALA A O     1 
ATOM   494  C  CB    . ALA A 1 70  ? 39.626 38.515 -1.656  1.00 23.57 ? 64  ALA A CB    1 
ATOM   495  N  N     . LYS A 1 71  ? 42.234 38.979 -3.295  1.00 29.22 ? 65  LYS A N     1 
ATOM   496  C  CA    . LYS A 1 71  ? 43.107 39.867 -4.042  1.00 32.39 ? 65  LYS A CA    1 
ATOM   497  C  C     . LYS A 1 71  ? 43.563 39.275 -5.371  1.00 32.56 ? 65  LYS A C     1 
ATOM   498  O  O     . LYS A 1 71  ? 43.910 40.005 -6.290  1.00 35.29 ? 65  LYS A O     1 
ATOM   499  C  CB    . LYS A 1 71  ? 44.299 40.284 -3.175  1.00 31.51 ? 65  LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 71  ? 43.855 41.180 -2.029  1.00 33.75 ? 65  LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 71  ? 45.004 41.700 -1.190  1.00 33.09 ? 65  LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 71  ? 44.514 42.786 -0.249  1.00 33.71 ? 65  LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 71  ? 45.635 43.418 0.486   1.00 33.69 ? 65  LYS A NZ    1 
ATOM   504  N  N     . LYS A 1 72  ? 43.556 37.954 -5.478  1.00 33.77 ? 66  LYS A N     1 
ATOM   505  C  CA    . LYS A 1 72  ? 43.937 37.322 -6.724  1.00 34.55 ? 66  LYS A CA    1 
ATOM   506  C  C     . LYS A 1 72  ? 42.849 37.616 -7.760  1.00 34.72 ? 66  LYS A C     1 
ATOM   507  O  O     . LYS A 1 72  ? 43.153 37.966 -8.903  1.00 35.21 ? 66  LYS A O     1 
ATOM   508  C  CB    . LYS A 1 72  ? 44.107 35.812 -6.537  1.00 34.79 ? 66  LYS A CB    1 
ATOM   509  C  CG    . LYS A 1 72  ? 45.426 35.431 -5.884  0.50 36.19 ? 66  LYS A CG    1 
ATOM   510  C  CD    . LYS A 1 72  ? 45.503 33.947 -5.566  0.50 35.34 ? 66  LYS A CD    1 
ATOM   511  C  CE    . LYS A 1 72  ? 46.586 33.685 -4.527  0.50 36.12 ? 66  LYS A CE    1 
ATOM   512  N  NZ    . LYS A 1 72  ? 46.353 32.434 -3.753  0.50 34.65 ? 66  LYS A NZ    1 
ATOM   513  N  N     . ILE A 1 73  ? 41.590 37.507 -7.338  1.00 32.05 ? 67  ILE A N     1 
ATOM   514  C  CA    . ILE A 1 73  ? 40.443 37.751 -8.203  1.00 29.75 ? 67  ILE A CA    1 
ATOM   515  C  C     . ILE A 1 73  ? 40.193 39.228 -8.493  1.00 30.18 ? 67  ILE A C     1 
ATOM   516  O  O     . ILE A 1 73  ? 39.915 39.610 -9.635  1.00 29.13 ? 67  ILE A O     1 
ATOM   517  C  CB    . ILE A 1 73  ? 39.148 37.173 -7.585  1.00 28.94 ? 67  ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 73  ? 39.338 35.695 -7.253  1.00 28.73 ? 67  ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 73  ? 37.997 37.339 -8.549  1.00 29.22 ? 67  ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 73  ? 38.190 35.094 -6.466  1.00 24.43 ? 67  ILE A CD1   1 
ATOM   521  N  N     . LEU A 1 74  ? 40.280 40.055 -7.455  1.00 28.86 ? 68  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 74  ? 40.034 41.479 -7.594  1.00 28.62 ? 68  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 74  ? 41.143 42.286 -6.962  1.00 29.83 ? 68  LEU A C     1 
ATOM   524  O  O     . LEU A 1 74  ? 40.928 43.011 -5.989  1.00 30.01 ? 68  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 74  ? 38.710 41.856 -6.931  1.00 28.18 ? 68  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 74  ? 37.458 41.178 -7.475  1.00 30.19 ? 68  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 74  ? 36.251 41.631 -6.657  1.00 27.58 ? 68  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 74  ? 37.278 41.537 -8.952  1.00 29.94 ? 68  LEU A CD2   1 
ATOM   529  N  N     . PRO A 1 75  ? 42.347 42.187 -7.517  1.00 30.60 ? 69  PRO A N     1 
ATOM   530  C  CA    . PRO A 1 75  ? 43.506 42.915 -7.002  1.00 31.68 ? 69  PRO A CA    1 
ATOM   531  C  C     . PRO A 1 75  ? 43.304 44.405 -6.768  1.00 30.72 ? 69  PRO A C     1 
ATOM   532  O  O     . PRO A 1 75  ? 43.949 44.988 -5.901  1.00 30.63 ? 69  PRO A O     1 
ATOM   533  C  CB    . PRO A 1 75  ? 44.576 42.643 -8.056  1.00 32.75 ? 69  PRO A CB    1 
ATOM   534  C  CG    . PRO A 1 75  ? 43.760 42.366 -9.311  1.00 32.91 ? 69  PRO A CG    1 
ATOM   535  C  CD    . PRO A 1 75  ? 42.685 41.483 -8.764  1.00 30.97 ? 69  PRO A CD    1 
ATOM   536  N  N     . ASN A 1 76  ? 42.411 45.027 -7.528  1.00 30.87 ? 70  ASN A N     1 
ATOM   537  C  CA    . ASN A 1 76  ? 42.202 46.458 -7.384  1.00 31.98 ? 70  ASN A CA    1 
ATOM   538  C  C     . ASN A 1 76  ? 40.970 46.908 -6.607  1.00 31.26 ? 70  ASN A C     1 
ATOM   539  O  O     . ASN A 1 76  ? 40.636 48.087 -6.612  1.00 30.46 ? 70  ASN A O     1 
ATOM   540  C  CB    . ASN A 1 76  ? 42.219 47.120 -8.759  1.00 35.28 ? 70  ASN A CB    1 
ATOM   541  C  CG    . ASN A 1 76  ? 43.553 46.937 -9.466  1.00 38.55 ? 70  ASN A CG    1 
ATOM   542  O  OD1   . ASN A 1 76  ? 44.607 47.333 -8.952  1.00 39.41 ? 70  ASN A OD1   1 
ATOM   543  N  ND2   . ASN A 1 76  ? 43.515 46.328 -10.644 1.00 38.64 ? 70  ASN A ND2   1 
ATOM   544  N  N     . ALA A 1 77  ? 40.309 45.984 -5.924  1.00 29.78 ? 71  ALA A N     1 
ATOM   545  C  CA    . ALA A 1 77  ? 39.140 46.335 -5.132  1.00 28.79 ? 71  ALA A CA    1 
ATOM   546  C  C     . ALA A 1 77  ? 39.592 47.099 -3.890  1.00 29.70 ? 71  ALA A C     1 
ATOM   547  O  O     . ALA A 1 77  ? 40.790 47.196 -3.596  1.00 28.89 ? 71  ALA A O     1 
ATOM   548  C  CB    . ALA A 1 77  ? 38.392 45.080 -4.725  1.00 27.96 ? 71  ALA A CB    1 
ATOM   549  N  N     . VAL A 1 78  ? 38.629 47.654 -3.167  1.00 29.21 ? 72  VAL A N     1 
ATOM   550  C  CA    . VAL A 1 78  ? 38.930 48.385 -1.946  1.00 28.29 ? 72  VAL A CA    1 
ATOM   551  C  C     . VAL A 1 78  ? 38.837 47.417 -0.771  1.00 27.58 ? 72  VAL A C     1 
ATOM   552  O  O     . VAL A 1 78  ? 37.775 46.852 -0.508  1.00 28.07 ? 72  VAL A O     1 
ATOM   553  C  CB    . VAL A 1 78  ? 37.942 49.534 -1.752  1.00 28.73 ? 72  VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 78  ? 38.206 50.233 -0.429  1.00 28.83 ? 72  VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 78  ? 38.085 50.519 -2.919  1.00 29.93 ? 72  VAL A CG2   1 
ATOM   556  N  N     . TYR A 1 79  ? 39.964 47.220 -0.089  1.00 27.53 ? 73  TYR A N     1 
ATOM   557  C  CA    . TYR A 1 79  ? 40.057 46.323 1.059   1.00 26.76 ? 73  TYR A CA    1 
ATOM   558  C  C     . TYR A 1 79  ? 40.088 47.125 2.344   1.00 27.79 ? 73  TYR A C     1 
ATOM   559  O  O     . TYR A 1 79  ? 40.969 47.952 2.548   1.00 29.56 ? 73  TYR A O     1 
ATOM   560  C  CB    . TYR A 1 79  ? 41.311 45.449 0.938   1.00 26.91 ? 73  TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 79  ? 41.189 44.453 -0.187  1.00 27.60 ? 73  TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 79  ? 41.579 44.782 -1.490  1.00 27.80 ? 73  TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 79  ? 40.583 43.218 0.026   1.00 25.47 ? 73  TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 79  ? 41.358 43.903 -2.550  1.00 27.71 ? 73  TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 79  ? 40.354 42.338 -1.019  1.00 28.22 ? 73  TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 79  ? 40.741 42.688 -2.304  1.00 26.26 ? 73  TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 79  ? 40.467 41.836 -3.335  1.00 27.91 ? 73  TYR A OH    1 
ATOM   568  N  N     . LEU A 1 80  ? 39.113 46.880 3.210   1.00 27.19 ? 74  LEU A N     1 
ATOM   569  C  CA    . LEU A 1 80  ? 39.006 47.610 4.462   1.00 27.25 ? 74  LEU A CA    1 
ATOM   570  C  C     . LEU A 1 80  ? 39.018 46.691 5.663   1.00 26.61 ? 74  LEU A C     1 
ATOM   571  O  O     . LEU A 1 80  ? 38.484 45.588 5.613   1.00 27.40 ? 74  LEU A O     1 
ATOM   572  C  CB    . LEU A 1 80  ? 37.696 48.406 4.503   1.00 25.50 ? 74  LEU A CB    1 
ATOM   573  C  CG    . LEU A 1 80  ? 37.429 49.411 3.392   1.00 26.14 ? 74  LEU A CG    1 
ATOM   574  C  CD1   . LEU A 1 80  ? 36.019 49.989 3.559   1.00 26.26 ? 74  LEU A CD1   1 
ATOM   575  C  CD2   . LEU A 1 80  ? 38.489 50.514 3.435   1.00 25.81 ? 74  LEU A CD2   1 
ATOM   576  N  N     . PRO A 1 81  ? 39.636 47.134 6.765   1.00 26.27 ? 75  PRO A N     1 
ATOM   577  C  CA    . PRO A 1 81  ? 39.652 46.280 7.950   1.00 26.23 ? 75  PRO A CA    1 
ATOM   578  C  C     . PRO A 1 81  ? 38.292 46.402 8.652   1.00 26.11 ? 75  PRO A C     1 
ATOM   579  O  O     . PRO A 1 81  ? 37.684 47.472 8.686   1.00 26.67 ? 75  PRO A O     1 
ATOM   580  C  CB    . PRO A 1 81  ? 40.809 46.853 8.778   1.00 26.42 ? 75  PRO A CB    1 
ATOM   581  C  CG    . PRO A 1 81  ? 40.811 48.283 8.408   1.00 28.24 ? 75  PRO A CG    1 
ATOM   582  C  CD    . PRO A 1 81  ? 40.580 48.256 6.911   1.00 26.04 ? 75  PRO A CD    1 
ATOM   583  N  N     . MET A 1 82  ? 37.807 45.297 9.192   1.00 25.23 ? 76  MET A N     1 
ATOM   584  C  CA    . MET A 1 82  ? 36.534 45.309 9.880   1.00 26.76 ? 76  MET A CA    1 
ATOM   585  C  C     . MET A 1 82  ? 36.547 46.238 11.102  1.00 27.20 ? 76  MET A C     1 
ATOM   586  O  O     . MET A 1 82  ? 37.459 46.184 11.923  1.00 29.56 ? 76  MET A O     1 
ATOM   587  C  CB    . MET A 1 82  ? 36.192 43.886 10.305  1.00 28.53 ? 76  MET A CB    1 
ATOM   588  C  CG    . MET A 1 82  ? 34.945 43.761 11.141  1.00 27.04 ? 76  MET A CG    1 
ATOM   589  S  SD    . MET A 1 82  ? 34.674 42.056 11.616  1.00 30.62 ? 76  MET A SD    1 
ATOM   590  C  CE    . MET A 1 82  ? 35.802 41.914 12.999  1.00 29.51 ? 76  MET A CE    1 
ATOM   591  N  N     . ARG A 1 83  ? 35.546 47.110 11.192  1.00 26.91 ? 77  ARG A N     1 
ATOM   592  C  CA    . ARG A 1 83  ? 35.390 48.040 12.316  1.00 27.92 ? 77  ARG A CA    1 
ATOM   593  C  C     . ARG A 1 83  ? 34.040 47.675 12.932  1.00 28.01 ? 77  ARG A C     1 
ATOM   594  O  O     . ARG A 1 83  ? 33.060 48.426 12.842  1.00 27.46 ? 77  ARG A O     1 
ATOM   595  C  CB    . ARG A 1 83  ? 35.366 49.484 11.817  1.00 27.36 ? 77  ARG A CB    1 
ATOM   596  C  CG    . ARG A 1 83  ? 36.658 49.939 11.161  1.00 32.46 ? 77  ARG A CG    1 
ATOM   597  C  CD    . ARG A 1 83  ? 36.634 51.437 10.899  1.00 32.86 ? 77  ARG A CD    1 
ATOM   598  N  NE    . ARG A 1 83  ? 35.631 51.835 9.915   1.00 34.21 ? 77  ARG A NE    1 
ATOM   599  C  CZ    . ARG A 1 83  ? 35.288 53.101 9.684   1.00 35.89 ? 77  ARG A CZ    1 
ATOM   600  N  NH1   . ARG A 1 83  ? 35.868 54.073 10.375  1.00 35.81 ? 77  ARG A NH1   1 
ATOM   601  N  NH2   . ARG A 1 83  ? 34.376 53.403 8.767   1.00 36.96 ? 77  ARG A NH2   1 
ATOM   602  N  N     . LYS A 1 84  ? 34.002 46.505 13.551  1.00 29.20 ? 78  LYS A N     1 
ATOM   603  C  CA    . LYS A 1 84  ? 32.779 45.976 14.126  1.00 32.33 ? 78  LYS A CA    1 
ATOM   604  C  C     . LYS A 1 84  ? 32.028 46.884 15.091  1.00 32.33 ? 78  LYS A C     1 
ATOM   605  O  O     . LYS A 1 84  ? 30.800 46.829 15.162  1.00 30.58 ? 78  LYS A O     1 
ATOM   606  C  CB    . LYS A 1 84  ? 33.059 44.634 14.801  1.00 35.59 ? 78  LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 84  ? 31.863 44.065 15.539  1.00 38.12 ? 78  LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 84  ? 30.890 43.433 14.574  1.00 43.19 ? 78  LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 84  ? 30.916 41.921 14.667  1.00 44.10 ? 78  LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 84  ? 30.630 41.484 16.056  1.00 47.97 ? 78  LYS A NZ    1 
ATOM   611  N  N     . GLU A 1 85  ? 32.759 47.710 15.835  1.00 33.42 ? 79  GLU A N     1 
ATOM   612  C  CA    . GLU A 1 85  ? 32.130 48.611 16.790  1.00 33.88 ? 79  GLU A CA    1 
ATOM   613  C  C     . GLU A 1 85  ? 31.259 49.636 16.081  1.00 34.19 ? 79  GLU A C     1 
ATOM   614  O  O     . GLU A 1 85  ? 30.156 49.938 16.539  1.00 33.55 ? 79  GLU A O     1 
ATOM   615  C  CB    . GLU A 1 85  ? 33.183 49.336 17.631  1.00 35.46 ? 79  GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 85  ? 33.950 48.429 18.572  1.00 37.23 ? 79  GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 85  ? 35.091 47.682 17.892  0.50 38.79 ? 79  GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 85  ? 35.746 46.866 18.577  0.50 39.76 ? 79  GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 85  ? 35.342 47.906 16.686  0.50 35.73 ? 79  GLU A OE2   1 
ATOM   620  N  N     . VAL A 1 86  ? 31.765 50.168 14.969  1.00 32.06 ? 80  VAL A N     1 
ATOM   621  C  CA    . VAL A 1 86  ? 31.029 51.150 14.192  1.00 30.76 ? 80  VAL A CA    1 
ATOM   622  C  C     . VAL A 1 86  ? 29.767 50.513 13.616  1.00 30.33 ? 80  VAL A C     1 
ATOM   623  O  O     . VAL A 1 86  ? 28.699 51.125 13.646  1.00 29.29 ? 80  VAL A O     1 
ATOM   624  C  CB    . VAL A 1 86  ? 31.881 51.718 13.025  1.00 31.44 ? 80  VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 86  ? 31.047 52.680 12.205  1.00 31.55 ? 80  VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 86  ? 33.115 52.428 13.567  1.00 31.24 ? 80  VAL A CG2   1 
ATOM   627  N  N     . TYR A 1 87  ? 29.883 49.292 13.089  1.00 28.20 ? 81  TYR A N     1 
ATOM   628  C  CA    . TYR A 1 87  ? 28.711 48.627 12.534  1.00 26.48 ? 81  TYR A CA    1 
ATOM   629  C  C     . TYR A 1 87  ? 27.714 48.288 13.652  1.00 27.19 ? 81  TYR A C     1 
ATOM   630  O  O     . TYR A 1 87  ? 26.500 48.301 13.443  1.00 26.03 ? 81  TYR A O     1 
ATOM   631  C  CB    . TYR A 1 87  ? 29.092 47.343 11.790  1.00 25.11 ? 81  TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 87  ? 30.363 47.436 10.966  1.00 23.23 ? 81  TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 87  ? 30.698 48.606 10.294  1.00 22.45 ? 81  TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 87  ? 31.240 46.358 10.889  1.00 21.12 ? 81  TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 87  ? 31.877 48.707 9.568   1.00 23.26 ? 81  TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 87  ? 32.430 46.445 10.162  1.00 21.23 ? 81  TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 87  ? 32.738 47.621 9.506   1.00 23.62 ? 81  TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 87  ? 33.889 47.728 8.775   1.00 21.20 ? 81  TYR A OH    1 
ATOM   639  N  N     . GLN A 1 88  ? 28.220 47.990 14.840  1.00 27.72 ? 82  GLN A N     1 
ATOM   640  C  CA    . GLN A 1 88  ? 27.327 47.654 15.934  1.00 31.28 ? 82  GLN A CA    1 
ATOM   641  C  C     . GLN A 1 88  ? 26.448 48.832 16.339  1.00 31.05 ? 82  GLN A C     1 
ATOM   642  O  O     . GLN A 1 88  ? 25.266 48.661 16.615  1.00 33.19 ? 82  GLN A O     1 
ATOM   643  C  CB    . GLN A 1 88  ? 28.120 47.167 17.151  1.00 33.71 ? 82  GLN A CB    1 
ATOM   644  C  CG    . GLN A 1 88  ? 27.238 46.880 18.370  1.00 38.06 ? 82  GLN A CG    1 
ATOM   645  C  CD    . GLN A 1 88  ? 26.224 45.776 18.122  1.00 39.10 ? 82  GLN A CD    1 
ATOM   646  O  OE1   . GLN A 1 88  ? 26.593 44.628 17.883  1.00 41.82 ? 82  GLN A OE1   1 
ATOM   647  N  NE2   . GLN A 1 88  ? 24.939 46.119 18.178  1.00 39.55 ? 82  GLN A NE2   1 
ATOM   648  N  N     . GLN A 1 89  ? 27.023 50.026 16.377  1.00 32.02 ? 83  GLN A N     1 
ATOM   649  C  CA    . GLN A 1 89  ? 26.256 51.195 16.758  1.00 33.69 ? 83  GLN A CA    1 
ATOM   650  C  C     . GLN A 1 89  ? 25.270 51.564 15.669  1.00 33.11 ? 83  GLN A C     1 
ATOM   651  O  O     . GLN A 1 89  ? 24.171 52.042 15.962  1.00 32.37 ? 83  GLN A O     1 
ATOM   652  C  CB    . GLN A 1 89  ? 27.181 52.376 17.067  1.00 36.56 ? 83  GLN A CB    1 
ATOM   653  C  CG    . GLN A 1 89  ? 28.159 52.063 18.190  1.00 41.35 ? 83  GLN A CG    1 
ATOM   654  C  CD    . GLN A 1 89  ? 28.888 53.288 18.717  1.00 45.25 ? 83  GLN A CD    1 
ATOM   655  O  OE1   . GLN A 1 89  ? 29.124 54.248 17.983  1.00 47.61 ? 83  GLN A OE1   1 
ATOM   656  N  NE2   . GLN A 1 89  ? 29.270 53.248 19.992  1.00 45.71 ? 83  GLN A NE2   1 
ATOM   657  N  N     . VAL A 1 90  ? 25.638 51.347 14.409  1.00 30.11 ? 84  VAL A N     1 
ATOM   658  C  CA    . VAL A 1 90  ? 24.699 51.678 13.361  1.00 28.58 ? 84  VAL A CA    1 
ATOM   659  C  C     . VAL A 1 90  ? 23.562 50.691 13.507  1.00 28.21 ? 84  VAL A C     1 
ATOM   660  O  O     . VAL A 1 90  ? 22.399 51.048 13.376  1.00 26.78 ? 84  VAL A O     1 
ATOM   661  C  CB    . VAL A 1 90  ? 25.288 51.533 11.952  1.00 29.91 ? 84  VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 90  ? 24.193 51.753 10.927  1.00 24.04 ? 84  VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 90  ? 26.414 52.535 11.744  1.00 30.24 ? 84  VAL A CG2   1 
ATOM   664  N  N     . SER A 1 91  ? 23.915 49.440 13.783  1.00 28.48 ? 85  SER A N     1 
ATOM   665  C  CA    . SER A 1 91  ? 22.924 48.390 13.948  1.00 27.87 ? 85  SER A CA    1 
ATOM   666  C  C     . SER A 1 91  ? 21.919 48.739 15.030  1.00 28.19 ? 85  SER A C     1 
ATOM   667  O  O     . SER A 1 91  ? 20.713 48.685 14.803  1.00 29.78 ? 85  SER A O     1 
ATOM   668  C  CB    . SER A 1 91  ? 23.590 47.060 14.318  1.00 25.84 ? 85  SER A CB    1 
ATOM   669  O  OG    . SER A 1 91  ? 22.592 46.080 14.568  1.00 22.52 ? 85  SER A OG    1 
ATOM   670  N  N     . SER A 1 92  ? 22.422 49.079 16.212  1.00 29.70 ? 86  SER A N     1 
ATOM   671  C  CA    . SER A 1 92  ? 21.552 49.431 17.336  1.00 31.39 ? 86  SER A CA    1 
ATOM   672  C  C     . SER A 1 92  ? 20.544 50.495 16.951  1.00 30.62 ? 86  SER A C     1 
ATOM   673  O  O     . SER A 1 92  ? 19.361 50.374 17.257  1.00 31.90 ? 86  SER A O     1 
ATOM   674  C  CB    . SER A 1 92  ? 22.388 49.904 18.525  1.00 31.77 ? 86  SER A CB    1 
ATOM   675  O  OG    . SER A 1 92  ? 23.146 48.822 19.044  1.00 35.61 ? 86  SER A OG    1 
ATOM   676  N  N     . ARG A 1 93  ? 21.004 51.536 16.270  1.00 29.88 ? 87  ARG A N     1 
ATOM   677  C  CA    . ARG A 1 93  ? 20.087 52.579 15.849  1.00 31.48 ? 87  ARG A CA    1 
ATOM   678  C  C     . ARG A 1 93  ? 18.982 51.993 14.966  1.00 33.13 ? 87  ARG A C     1 
ATOM   679  O  O     . ARG A 1 93  ? 17.804 52.307 15.148  1.00 34.02 ? 87  ARG A O     1 
ATOM   680  C  CB    . ARG A 1 93  ? 20.835 53.689 15.101  1.00 33.43 ? 87  ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 93  ? 21.903 54.382 15.944  1.00 31.94 ? 87  ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 93  ? 22.194 55.779 15.439  1.00 32.54 ? 87  ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 93  ? 22.845 55.823 14.128  1.00 30.99 ? 87  ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 93  ? 24.159 55.749 13.934  1.00 30.33 ? 87  ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 93  ? 24.987 55.623 14.963  1.00 28.15 ? 87  ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 93  ? 24.649 55.816 12.696  1.00 31.24 ? 87  ARG A NH2   1 
ATOM   687  N  N     . ILE A 1 94  ? 19.349 51.132 14.014  1.00 31.83 ? 88  ILE A N     1 
ATOM   688  C  CA    . ILE A 1 94  ? 18.334 50.544 13.149  1.00 31.70 ? 88  ILE A CA    1 
ATOM   689  C  C     . ILE A 1 94  ? 17.373 49.672 13.957  1.00 34.25 ? 88  ILE A C     1 
ATOM   690  O  O     . ILE A 1 94  ? 16.166 49.642 13.677  1.00 36.20 ? 88  ILE A O     1 
ATOM   691  C  CB    . ILE A 1 94  ? 18.950 49.689 12.013  1.00 30.87 ? 88  ILE A CB    1 
ATOM   692  C  CG1   . ILE A 1 94  ? 19.841 50.562 11.118  1.00 27.84 ? 88  ILE A CG1   1 
ATOM   693  C  CG2   . ILE A 1 94  ? 17.836 49.036 11.194  1.00 24.23 ? 88  ILE A CG2   1 
ATOM   694  C  CD1   . ILE A 1 94  ? 20.497 49.801 9.977   1.00 23.07 ? 88  ILE A CD1   1 
ATOM   695  N  N     . MET A 1 95  ? 17.895 48.960 14.953  1.00 33.79 ? 89  MET A N     1 
ATOM   696  C  CA    . MET A 1 95  ? 17.032 48.115 15.779  1.00 35.43 ? 89  MET A CA    1 
ATOM   697  C  C     . MET A 1 95  ? 16.006 48.973 16.530  1.00 37.74 ? 89  MET A C     1 
ATOM   698  O  O     . MET A 1 95  ? 14.852 48.564 16.713  1.00 38.34 ? 89  MET A O     1 
ATOM   699  C  CB    . MET A 1 95  ? 17.856 47.298 16.781  1.00 33.98 ? 89  MET A CB    1 
ATOM   700  C  CG    . MET A 1 95  ? 18.768 46.267 16.153  1.00 30.10 ? 89  MET A CG    1 
ATOM   701  S  SD    . MET A 1 95  ? 17.962 45.211 14.922  1.00 28.62 ? 89  MET A SD    1 
ATOM   702  C  CE    . MET A 1 95  ? 19.389 44.314 14.281  1.00 25.94 ? 89  MET A CE    1 
ATOM   703  N  N     . ASN A 1 96  ? 16.426 50.161 16.966  1.00 38.55 ? 90  ASN A N     1 
ATOM   704  C  CA    . ASN A 1 96  ? 15.520 51.053 17.671  1.00 38.56 ? 90  ASN A CA    1 
ATOM   705  C  C     . ASN A 1 96  ? 14.428 51.540 16.731  1.00 39.01 ? 90  ASN A C     1 
ATOM   706  O  O     . ASN A 1 96  ? 13.298 51.754 17.154  1.00 42.06 ? 90  ASN A O     1 
ATOM   707  C  CB    . ASN A 1 96  ? 16.283 52.231 18.272  1.00 39.45 ? 90  ASN A CB    1 
ATOM   708  C  CG    . ASN A 1 96  ? 17.120 51.825 19.464  1.00 40.28 ? 90  ASN A CG    1 
ATOM   709  O  OD1   . ASN A 1 96  ? 16.958 50.731 19.994  1.00 41.38 ? 90  ASN A OD1   1 
ATOM   710  N  ND2   . ASN A 1 96  ? 18.014 52.707 19.901  1.00 41.44 ? 90  ASN A ND2   1 
ATOM   711  N  N     . LEU A 1 97  ? 14.753 51.715 15.456  1.00 37.93 ? 91  LEU A N     1 
ATOM   712  C  CA    . LEU A 1 97  ? 13.750 52.143 14.496  1.00 38.17 ? 91  LEU A CA    1 
ATOM   713  C  C     . LEU A 1 97  ? 12.689 51.056 14.362  1.00 40.09 ? 91  LEU A C     1 
ATOM   714  O  O     . LEU A 1 97  ? 11.493 51.339 14.298  1.00 41.01 ? 91  LEU A O     1 
ATOM   715  C  CB    . LEU A 1 97  ? 14.361 52.382 13.111  1.00 37.99 ? 91  LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 97  ? 15.262 53.584 12.832  1.00 39.18 ? 91  LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 97  ? 15.500 53.667 11.325  1.00 38.41 ? 91  LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 97  ? 14.612 54.874 13.331  1.00 38.88 ? 91  LEU A CD2   1 
ATOM   719  N  N     . LEU A 1 98  ? 13.140 49.808 14.303  1.00 41.48 ? 92  LEU A N     1 
ATOM   720  C  CA    . LEU A 1 98  ? 12.237 48.676 14.165  1.00 41.66 ? 92  LEU A CA    1 
ATOM   721  C  C     . LEU A 1 98  ? 11.333 48.540 15.379  1.00 42.74 ? 92  LEU A C     1 
ATOM   722  O  O     . LEU A 1 98  ? 10.172 48.164 15.254  1.00 42.38 ? 92  LEU A O     1 
ATOM   723  C  CB    . LEU A 1 98  ? 13.036 47.381 13.967  1.00 39.96 ? 92  LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 98  ? 13.902 47.288 12.706  1.00 38.20 ? 92  LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 98  ? 14.681 45.977 12.718  1.00 36.22 ? 92  LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 98  ? 13.020 47.377 11.461  1.00 36.65 ? 92  LEU A CD2   1 
ATOM   727  N  N     . ARG A 1 99  ? 11.866 48.838 16.558  1.00 45.79 ? 93  ARG A N     1 
ATOM   728  C  CA    . ARG A 1 99  ? 11.070 48.737 17.778  1.00 48.12 ? 93  ARG A CA    1 
ATOM   729  C  C     . ARG A 1 99  ? 9.840  49.619 17.671  1.00 49.02 ? 93  ARG A C     1 
ATOM   730  O  O     . ARG A 1 99  ? 8.833  49.377 18.334  1.00 49.78 ? 93  ARG A O     1 
ATOM   731  C  CB    . ARG A 1 99  ? 11.878 49.161 19.005  1.00 49.02 ? 93  ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 99  ? 12.895 48.145 19.471  1.00 51.35 ? 93  ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 99  ? 13.543 48.612 20.757  1.00 54.33 ? 93  ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 99  ? 14.460 47.632 21.330  1.00 57.45 ? 93  ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 99  ? 15.627 47.288 20.798  1.00 58.32 ? 93  ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 99  ? 16.037 47.838 19.665  1.00 59.29 ? 93  ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 99  ? 16.395 46.401 21.414  1.00 59.76 ? 93  ARG A NH2   1 
ATOM   738  N  N     . GLU A 1 100 ? 9.922  50.639 16.826  1.00 49.33 ? 94  GLU A N     1 
ATOM   739  C  CA    . GLU A 1 100 ? 8.810  51.557 16.643  1.00 50.18 ? 94  GLU A CA    1 
ATOM   740  C  C     . GLU A 1 100 ? 7.719  50.915 15.794  1.00 51.29 ? 94  GLU A C     1 
ATOM   741  O  O     . GLU A 1 100 ? 6.762  51.578 15.389  1.00 53.03 ? 94  GLU A O     1 
ATOM   742  C  CB    . GLU A 1 100 ? 9.297  52.847 15.978  1.00 49.47 ? 94  GLU A CB    1 
ATOM   743  C  CG    . GLU A 1 100 ? 10.581 53.399 16.579  0.50 48.90 ? 94  GLU A CG    1 
ATOM   744  C  CD    . GLU A 1 100 ? 10.973 54.736 15.992  0.50 48.23 ? 94  GLU A CD    1 
ATOM   745  O  OE1   . GLU A 1 100 ? 10.829 54.913 14.765  0.50 49.27 ? 94  GLU A OE1   1 
ATOM   746  O  OE2   . GLU A 1 100 ? 11.438 55.607 16.755  0.50 47.97 ? 94  GLU A OE2   1 
ATOM   747  N  N     . TYR A 1 101 ? 7.869  49.626 15.516  1.00 50.30 ? 95  TYR A N     1 
ATOM   748  C  CA    . TYR A 1 101 ? 6.883  48.913 14.721  1.00 49.78 ? 95  TYR A CA    1 
ATOM   749  C  C     . TYR A 1 101 ? 6.310  47.731 15.482  1.00 49.60 ? 95  TYR A C     1 
ATOM   750  O  O     . TYR A 1 101 ? 5.356  47.102 15.032  1.00 50.28 ? 95  TYR A O     1 
ATOM   751  C  CB    . TYR A 1 101 ? 7.491  48.440 13.402  1.00 49.13 ? 95  TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 101 ? 7.736  49.556 12.420  1.00 50.01 ? 95  TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 101 ? 8.855  50.380 12.530  1.00 49.70 ? 95  TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 101 ? 6.825  49.815 11.400  1.00 50.03 ? 95  TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 101 ? 9.058  51.441 11.643  1.00 49.73 ? 95  TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 101 ? 7.014  50.873 10.511  1.00 50.61 ? 95  TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 101 ? 8.132  51.683 10.637  1.00 51.28 ? 95  TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 101 ? 8.310  52.735 9.764   1.00 50.99 ? 95  TYR A OH    1 
ATOM   759  N  N     . SER A 1 102 ? 6.897  47.423 16.633  1.00 49.51 ? 96  SER A N     1 
ATOM   760  C  CA    . SER A 1 102 ? 6.409  46.319 17.444  1.00 50.44 ? 96  SER A CA    1 
ATOM   761  C  C     . SER A 1 102 ? 7.188  46.141 18.739  1.00 51.77 ? 96  SER A C     1 
ATOM   762  O  O     . SER A 1 102 ? 8.402  46.323 18.778  1.00 52.45 ? 96  SER A O     1 
ATOM   763  C  CB    . SER A 1 102 ? 6.437  45.015 16.641  1.00 48.92 ? 96  SER A CB    1 
ATOM   764  O  OG    . SER A 1 102 ? 5.914  43.950 17.410  1.00 46.95 ? 96  SER A OG    1 
ATOM   765  N  N     . GLU A 1 103 ? 6.473  45.788 19.801  1.00 53.42 ? 97  GLU A N     1 
ATOM   766  C  CA    . GLU A 1 103 ? 7.083  45.571 21.105  0.50 54.02 ? 97  GLU A CA    1 
ATOM   767  C  C     . GLU A 1 103 ? 7.613  44.144 21.159  1.00 53.47 ? 97  GLU A C     1 
ATOM   768  O  O     . GLU A 1 103 ? 8.413  43.794 22.024  1.00 54.84 ? 97  GLU A O     1 
ATOM   769  C  CB    . GLU A 1 103 ? 6.050  45.776 22.218  0.50 55.15 ? 97  GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 103 ? 5.301  47.095 22.142  0.50 56.75 ? 97  GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 103 ? 4.262  47.113 21.039  0.50 57.78 ? 97  GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 103 ? 3.670  48.187 20.799  0.50 58.34 ? 97  GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 103 ? 4.033  46.054 20.417  0.50 57.41 ? 97  GLU A OE2   1 
ATOM   774  N  N     . LYS A 1 104 ? 7.145  43.320 20.231  1.00 52.45 ? 98  LYS A N     1 
ATOM   775  C  CA    . LYS A 1 104 ? 7.563  41.928 20.156  1.00 50.59 ? 98  LYS A CA    1 
ATOM   776  C  C     . LYS A 1 104 ? 8.631  41.841 19.066  1.00 48.67 ? 98  LYS A C     1 
ATOM   777  O  O     . LYS A 1 104 ? 8.327  41.617 17.893  1.00 46.65 ? 98  LYS A O     1 
ATOM   778  C  CB    . LYS A 1 104 ? 6.355  41.047 19.816  0.50 49.67 ? 98  LYS A CB    1 
ATOM   779  C  CG    . LYS A 1 104 ? 5.094  41.482 20.555  0.50 49.48 ? 98  LYS A CG    1 
ATOM   780  C  CD    . LYS A 1 104 ? 3.878  40.618 20.253  0.50 48.71 ? 98  LYS A CD    1 
ATOM   781  C  CE    . LYS A 1 104 ? 3.820  39.399 21.157  0.50 47.91 ? 98  LYS A CE    1 
ATOM   782  N  NZ    . LYS A 1 104 ? 2.436  38.855 21.249  0.50 47.42 ? 98  LYS A NZ    1 
ATOM   783  N  N     . ILE A 1 105 ? 9.883  42.037 19.471  1.00 47.36 ? 99  ILE A N     1 
ATOM   784  C  CA    . ILE A 1 105 ? 11.004 42.002 18.544  1.00 45.84 ? 99  ILE A CA    1 
ATOM   785  C  C     . ILE A 1 105 ? 12.136 41.105 19.023  1.00 44.24 ? 99  ILE A C     1 
ATOM   786  O  O     . ILE A 1 105 ? 12.543 41.165 20.181  1.00 43.81 ? 99  ILE A O     1 
ATOM   787  C  CB    . ILE A 1 105 ? 11.563 43.425 18.310  1.00 46.07 ? 99  ILE A CB    1 
ATOM   788  C  CG1   . ILE A 1 105 ? 12.745 43.376 17.337  1.00 46.81 ? 99  ILE A CG1   1 
ATOM   789  C  CG2   . ILE A 1 105 ? 11.988 44.036 19.632  1.00 46.05 ? 99  ILE A CG2   1 
ATOM   790  C  CD1   . ILE A 1 105 ? 13.279 44.747 16.942  1.00 44.85 ? 99  ILE A CD1   1 
ATOM   791  N  N     . GLU A 1 106 ? 12.638 40.268 18.121  1.00 43.07 ? 100 GLU A N     1 
ATOM   792  C  CA    . GLU A 1 106 ? 13.749 39.377 18.441  1.00 41.43 ? 100 GLU A CA    1 
ATOM   793  C  C     . GLU A 1 106 ? 14.981 39.767 17.614  1.00 39.89 ? 100 GLU A C     1 
ATOM   794  O  O     . GLU A 1 106 ? 15.070 39.473 16.419  1.00 36.51 ? 100 GLU A O     1 
ATOM   795  C  CB    . GLU A 1 106 ? 13.364 37.920 18.164  1.00 41.01 ? 100 GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 106 ? 14.481 36.908 18.409  1.00 43.84 ? 100 GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 106 ? 13.994 35.457 18.349  1.00 47.13 ? 100 GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 106 ? 14.780 34.581 17.924  1.00 49.48 ? 100 GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 106 ? 12.835 35.179 18.740  1.00 47.02 ? 100 GLU A OE2   1 
ATOM   800  N  N     . ILE A 1 107 ? 15.915 40.462 18.252  1.00 37.61 ? 101 ILE A N     1 
ATOM   801  C  CA    . ILE A 1 107 ? 17.136 40.862 17.575  1.00 37.12 ? 101 ILE A CA    1 
ATOM   802  C  C     . ILE A 1 107 ? 18.016 39.619 17.509  1.00 37.62 ? 101 ILE A C     1 
ATOM   803  O  O     . ILE A 1 107 ? 18.683 39.260 18.482  1.00 39.93 ? 101 ILE A O     1 
ATOM   804  C  CB    . ILE A 1 107 ? 17.840 41.991 18.344  1.00 36.14 ? 101 ILE A CB    1 
ATOM   805  C  CG1   . ILE A 1 107 ? 16.913 43.202 18.422  1.00 35.20 ? 101 ILE A CG1   1 
ATOM   806  C  CG2   . ILE A 1 107 ? 19.127 42.381 17.645  1.00 36.10 ? 101 ILE A CG2   1 
ATOM   807  C  CD1   . ILE A 1 107 ? 17.474 44.341 19.218  1.00 37.52 ? 101 ILE A CD1   1 
ATOM   808  N  N     . ALA A 1 108 ? 18.000 38.961 16.353  1.00 36.38 ? 102 ALA A N     1 
ATOM   809  C  CA    . ALA A 1 108 ? 18.754 37.726 16.140  1.00 36.93 ? 102 ALA A CA    1 
ATOM   810  C  C     . ALA A 1 108 ? 20.271 37.876 16.080  1.00 37.27 ? 102 ALA A C     1 
ATOM   811  O  O     . ALA A 1 108 ? 20.986 37.059 16.660  1.00 38.94 ? 102 ALA A O     1 
ATOM   812  C  CB    . ALA A 1 108 ? 18.247 37.013 14.878  1.00 34.17 ? 102 ALA A CB    1 
ATOM   813  N  N     . SER A 1 109 ? 20.763 38.894 15.374  1.00 35.65 ? 103 SER A N     1 
ATOM   814  C  CA    . SER A 1 109 ? 22.205 39.137 15.265  1.00 33.28 ? 103 SER A CA    1 
ATOM   815  C  C     . SER A 1 109 ? 22.447 40.607 14.965  1.00 31.36 ? 103 SER A C     1 
ATOM   816  O  O     . SER A 1 109 ? 21.510 41.400 14.955  1.00 32.39 ? 103 SER A O     1 
ATOM   817  C  CB    . SER A 1 109 ? 22.825 38.282 14.156  1.00 33.41 ? 103 SER A CB    1 
ATOM   818  O  OG    . SER A 1 109 ? 22.472 38.762 12.867  1.00 38.91 ? 103 SER A OG    1 
ATOM   819  N  N     . ILE A 1 110 ? 23.699 40.974 14.717  1.00 28.92 ? 104 ILE A N     1 
ATOM   820  C  CA    . ILE A 1 110 ? 24.032 42.365 14.428  1.00 27.40 ? 104 ILE A CA    1 
ATOM   821  C  C     . ILE A 1 110 ? 23.309 42.933 13.191  1.00 24.78 ? 104 ILE A C     1 
ATOM   822  O  O     . ILE A 1 110 ? 23.202 44.138 13.036  1.00 26.09 ? 104 ILE A O     1 
ATOM   823  C  CB    . ILE A 1 110 ? 25.576 42.549 14.263  1.00 26.98 ? 104 ILE A CB    1 
ATOM   824  C  CG1   . ILE A 1 110 ? 25.914 44.039 14.144  1.00 28.24 ? 104 ILE A CG1   1 
ATOM   825  C  CG2   . ILE A 1 110 ? 26.071 41.792 13.036  1.00 25.01 ? 104 ILE A CG2   1 
ATOM   826  C  CD1   . ILE A 1 110 ? 27.399 44.347 14.276  1.00 27.41 ? 104 ILE A CD1   1 
ATOM   827  N  N     . ASP A 1 111 ? 22.787 42.087 12.316  1.00 23.59 ? 105 ASP A N     1 
ATOM   828  C  CA    . ASP A 1 111 ? 22.118 42.644 11.149  1.00 25.71 ? 105 ASP A CA    1 
ATOM   829  C  C     . ASP A 1 111 ? 20.760 42.048 10.825  1.00 25.10 ? 105 ASP A C     1 
ATOM   830  O  O     . ASP A 1 111 ? 20.274 42.184 9.706   1.00 22.03 ? 105 ASP A O     1 
ATOM   831  C  CB    . ASP A 1 111 ? 23.011 42.504 9.936   1.00 26.25 ? 105 ASP A CB    1 
ATOM   832  C  CG    . ASP A 1 111 ? 22.864 41.174 9.279   1.00 26.71 ? 105 ASP A CG    1 
ATOM   833  O  OD1   . ASP A 1 111 ? 22.785 40.147 9.981   1.00 30.69 ? 105 ASP A OD1   1 
ATOM   834  O  OD2   . ASP A 1 111 ? 22.838 41.159 8.056   1.00 24.86 ? 105 ASP A OD2   1 
ATOM   835  N  N     . GLU A 1 112 ? 20.134 41.399 11.797  1.00 25.86 ? 106 GLU A N     1 
ATOM   836  C  CA    . GLU A 1 112 ? 18.838 40.811 11.512  1.00 27.81 ? 106 GLU A CA    1 
ATOM   837  C  C     . GLU A 1 112 ? 17.931 40.758 12.729  1.00 28.22 ? 106 GLU A C     1 
ATOM   838  O  O     . GLU A 1 112 ? 18.386 40.628 13.869  1.00 29.37 ? 106 GLU A O     1 
ATOM   839  C  CB    . GLU A 1 112 ? 19.025 39.413 10.903  1.00 28.61 ? 106 GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 112 ? 19.402 38.322 11.890  1.00 33.63 ? 106 GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 112 ? 19.655 36.979 11.199  1.00 33.52 ? 106 GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 112 ? 19.340 35.920 11.776  1.00 35.21 ? 106 GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 112 ? 20.182 36.983 10.082  1.00 26.62 ? 106 GLU A OE2   1 
ATOM   844  N  N     . ALA A 1 113 ? 16.636 40.875 12.475  1.00 28.55 ? 107 ALA A N     1 
ATOM   845  C  CA    . ALA A 1 113 ? 15.663 40.836 13.542  1.00 28.67 ? 107 ALA A CA    1 
ATOM   846  C  C     . ALA A 1 113 ? 14.308 40.338 13.056  1.00 27.52 ? 107 ALA A C     1 
ATOM   847  O  O     . ALA A 1 113 ? 13.983 40.429 11.866  1.00 27.23 ? 107 ALA A O     1 
ATOM   848  C  CB    . ALA A 1 113 ? 15.527 42.225 14.162  1.00 28.54 ? 107 ALA A CB    1 
ATOM   849  N  N     . TYR A 1 114 ? 13.542 39.779 13.988  1.00 28.65 ? 108 TYR A N     1 
ATOM   850  C  CA    . TYR A 1 114 ? 12.194 39.279 13.718  1.00 29.44 ? 108 TYR A CA    1 
ATOM   851  C  C     . TYR A 1 114 ? 11.206 40.162 14.475  1.00 30.69 ? 108 TYR A C     1 
ATOM   852  O  O     . TYR A 1 114 ? 11.447 40.529 15.629  1.00 29.40 ? 108 TYR A O     1 
ATOM   853  C  CB    . TYR A 1 114 ? 12.010 37.849 14.234  1.00 29.48 ? 108 TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 114 ? 12.879 36.815 13.578  1.00 28.85 ? 108 TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 114 ? 14.153 36.519 14.078  1.00 28.29 ? 108 TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 114 ? 12.419 36.115 12.468  1.00 27.10 ? 108 TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 114 ? 14.945 35.541 13.487  1.00 27.82 ? 108 TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 114 ? 13.196 35.140 11.867  1.00 28.99 ? 108 TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 114 ? 14.453 34.855 12.379  1.00 29.20 ? 108 TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 114 ? 15.196 33.874 11.777  1.00 30.87 ? 108 TYR A OH    1 
ATOM   861  N  N     . LEU A 1 115 ? 10.098 40.496 13.823  1.00 32.79 ? 109 LEU A N     1 
ATOM   862  C  CA    . LEU A 1 115 ? 9.046  41.293 14.448  1.00 33.91 ? 109 LEU A CA    1 
ATOM   863  C  C     . LEU A 1 115 ? 7.719  40.545 14.357  1.00 33.09 ? 109 LEU A C     1 
ATOM   864  O  O     . LEU A 1 115 ? 7.332  40.085 13.287  1.00 32.62 ? 109 LEU A O     1 
ATOM   865  C  CB    . LEU A 1 115 ? 8.879  42.651 13.747  1.00 33.84 ? 109 LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 115 ? 9.924  43.746 13.952  1.00 35.95 ? 109 LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 115 ? 9.628  44.900 13.025  1.00 37.59 ? 109 LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 115 ? 9.902  44.211 15.393  1.00 36.45 ? 109 LEU A CD2   1 
ATOM   869  N  N     . ASP A 1 116 ? 7.038  40.405 15.488  1.00 35.14 ? 110 ASP A N     1 
ATOM   870  C  CA    . ASP A 1 116 ? 5.725  39.774 15.497  1.00 34.94 ? 110 ASP A CA    1 
ATOM   871  C  C     . ASP A 1 116 ? 4.793  40.950 15.236  1.00 34.74 ? 110 ASP A C     1 
ATOM   872  O  O     . ASP A 1 116 ? 4.551  41.751 16.135  1.00 35.26 ? 110 ASP A O     1 
ATOM   873  C  CB    . ASP A 1 116 ? 5.400  39.191 16.872  1.00 37.90 ? 110 ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 116 ? 4.035  38.524 16.913  1.00 39.33 ? 110 ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 116 ? 3.074  39.056 16.310  1.00 39.49 ? 110 ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 116 ? 3.923  37.465 17.558  1.00 41.58 ? 110 ASP A OD2   1 
ATOM   877  N  N     . ILE A 1 117 ? 4.288  41.081 14.016  1.00 35.91 ? 111 ILE A N     1 
ATOM   878  C  CA    . ILE A 1 117 ? 3.399  42.196 13.712  1.00 37.78 ? 111 ILE A CA    1 
ATOM   879  C  C     . ILE A 1 117 ? 1.953  41.738 13.589  1.00 40.80 ? 111 ILE A C     1 
ATOM   880  O  O     . ILE A 1 117 ? 1.179  42.280 12.796  1.00 40.22 ? 111 ILE A O     1 
ATOM   881  C  CB    . ILE A 1 117 ? 3.813  42.915 12.407  1.00 35.42 ? 111 ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 117 ? 3.727  41.957 11.223  1.00 33.95 ? 111 ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 117 ? 5.230  43.470 12.549  1.00 35.30 ? 111 ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 117 ? 4.015  42.625 9.883   1.00 33.76 ? 111 ILE A CD1   1 
ATOM   885  N  N     . SER A 1 118 ? 1.598  40.729 14.381  1.00 43.17 ? 112 SER A N     1 
ATOM   886  C  CA    . SER A 1 118 ? 0.246  40.192 14.382  1.00 45.61 ? 112 SER A CA    1 
ATOM   887  C  C     . SER A 1 118 ? -0.755 41.201 14.953  1.00 47.02 ? 112 SER A C     1 
ATOM   888  O  O     . SER A 1 118 ? -1.774 41.485 14.328  1.00 47.17 ? 112 SER A O     1 
ATOM   889  C  CB    . SER A 1 118 ? 0.203  38.892 15.183  1.00 45.77 ? 112 SER A CB    1 
ATOM   890  O  OG    . SER A 1 118 ? 0.999  37.896 14.562  1.00 47.78 ? 112 SER A OG    1 
ATOM   891  N  N     . ASP A 1 119 ? -0.457 41.750 16.128  1.00 49.19 ? 113 ASP A N     1 
ATOM   892  C  CA    . ASP A 1 119 ? -1.346 42.726 16.755  1.00 50.37 ? 113 ASP A CA    1 
ATOM   893  C  C     . ASP A 1 119 ? -1.197 44.103 16.129  1.00 52.20 ? 113 ASP A C     1 
ATOM   894  O  O     . ASP A 1 119 ? -1.705 45.089 16.661  1.00 53.57 ? 113 ASP A O     1 
ATOM   895  C  CB    . ASP A 1 119 ? -1.069 42.836 18.258  1.00 49.21 ? 113 ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 119 ? -1.335 41.545 18.993  0.50 49.16 ? 113 ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 119 ? -2.179 40.756 18.521  0.50 48.36 ? 113 ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 119 ? -0.712 41.327 20.052  0.50 49.30 ? 113 ASP A OD2   1 
ATOM   899  N  N     . LYS A 1 120 ? -0.496 44.173 15.004  1.00 53.25 ? 114 LYS A N     1 
ATOM   900  C  CA    . LYS A 1 120 ? -0.296 45.434 14.314  1.00 54.15 ? 114 LYS A CA    1 
ATOM   901  C  C     . LYS A 1 120 ? -0.986 45.449 12.944  1.00 54.61 ? 114 LYS A C     1 
ATOM   902  O  O     . LYS A 1 120 ? -1.333 46.523 12.459  1.00 55.67 ? 114 LYS A O     1 
ATOM   903  C  CB    . LYS A 1 120 ? 1.202  45.714 14.136  1.00 54.44 ? 114 LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 120 ? 1.934  46.045 15.425  1.00 54.40 ? 114 LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 120 ? 1.470  47.378 15.985  0.50 53.94 ? 114 LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 120 ? 2.264  47.765 17.219  0.50 53.69 ? 114 LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 120 ? 1.900  49.126 17.699  0.50 54.49 ? 114 LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 121 ? -1.172 44.296 12.321  1.00 54.81 ? 115 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 121 ? -1.824 44.239 11.005  1.00 56.40 ? 115 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 121 ? -2.644 42.967 10.823  1.00 57.12 ? 115 VAL A C     1 
ATOM   911  O  O     . VAL A 1 121 ? -2.392 41.982 11.571  1.00 58.79 ? 115 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 121 ? -0.805 44.352 9.865   1.00 57.22 ? 115 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 121 ? -0.097 45.688 9.948   1.00 58.37 ? 115 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 121 ? 0.223  43.246 9.983   1.00 57.17 ? 115 VAL A CG2   1 
ATOM   915  N  N     . ARG A 1 122 ? -3.552 42.905 9.878   1.00 57.21 ? 116 ARG A N     1 
ATOM   916  C  CA    . ARG A 1 122 ? -4.378 41.701 9.832   1.00 56.97 ? 116 ARG A CA    1 
ATOM   917  C  C     . ARG A 1 122 ? -4.212 40.752 8.719   1.00 56.67 ? 116 ARG A C     1 
ATOM   918  O  O     . ARG A 1 122 ? -4.502 39.567 8.875   1.00 58.35 ? 116 ARG A O     1 
ATOM   919  C  CB    . ARG A 1 122 ? -5.879 42.006 9.921   0.50 57.13 ? 116 ARG A CB    1 
ATOM   920  C  CG    . ARG A 1 122 ? -6.370 43.151 9.054   0.50 57.21 ? 116 ARG A CG    1 
ATOM   921  C  CD    . ARG A 1 122 ? -7.819 43.472 9.425   0.50 57.95 ? 116 ARG A CD    1 
ATOM   922  N  NE    . ARG A 1 122 ? -8.448 44.533 8.622   0.50 57.99 ? 116 ARG A NE    1 
ATOM   923  C  CZ    . ARG A 1 122 ? -8.879 44.371 7.365   0.50 58.07 ? 116 ARG A CZ    1 
ATOM   924  N  NH1   . ARG A 1 122 ? -8.747 43.205 6.764   0.50 58.39 ? 116 ARG A NH1   1 
ATOM   925  N  NH2   . ARG A 1 122 ? -9.470 45.362 6.709   0.50 57.59 ? 116 ARG A NH2   1 
ATOM   926  N  N     . ASP A 1 123 ? -3.788 41.252 7.575   1.00 55.48 ? 117 ASP A N     1 
ATOM   927  C  CA    . ASP A 1 123 ? -3.636 40.389 6.432   1.00 54.67 ? 117 ASP A CA    1 
ATOM   928  C  C     . ASP A 1 123 ? -2.168 40.485 5.906   1.00 52.87 ? 117 ASP A C     1 
ATOM   929  O  O     . ASP A 1 123 ? -1.366 41.196 6.508   1.00 50.64 ? 117 ASP A O     1 
ATOM   930  C  CB    . ASP A 1 123 ? -4.801 40.682 5.398   1.00 56.73 ? 117 ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 123 ? -4.789 42.125 4.802   1.00 58.11 ? 117 ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 123 ? -3.755 42.812 4.885   1.00 58.36 ? 117 ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 123 ? -5.833 42.528 4.207   1.00 61.26 ? 117 ASP A OD2   1 
ATOM   934  N  N     . TYR A 1 124 ? -1.774 39.768 4.854   1.00 51.67 ? 118 TYR A N     1 
ATOM   935  C  CA    . TYR A 1 124 ? -0.370 39.855 4.401   1.00 51.04 ? 118 TYR A CA    1 
ATOM   936  C  C     . TYR A 1 124 ? -0.171 41.096 3.574   1.00 49.97 ? 118 TYR A C     1 
ATOM   937  O  O     . TYR A 1 124 ? 0.959  41.569 3.339   1.00 50.49 ? 118 TYR A O     1 
ATOM   938  C  CB    . TYR A 1 124 ? 0.054  38.611 3.605   1.00 50.80 ? 118 TYR A CB    1 
ATOM   939  C  CG    . TYR A 1 124 ? 0.491  37.417 4.449   1.00 51.59 ? 118 TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1 124 ? 1.357  37.574 5.545   1.00 50.22 ? 118 TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1 124 ? 0.042  36.119 4.154   1.00 51.61 ? 118 TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1 124 ? 1.759  36.477 6.323   1.00 52.42 ? 118 TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1 124 ? 0.436  35.015 4.918   1.00 52.32 ? 118 TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1 124 ? 1.293  35.205 6.001   1.00 53.19 ? 118 TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1 124 ? 1.680  34.123 6.766   1.00 54.05 ? 118 TYR A OH    1 
ATOM   946  N  N     . ARG A 1 125 ? -1.311 41.641 3.161   1.00 48.66 ? 119 ARG A N     1 
ATOM   947  C  CA    . ARG A 1 125 ? -1.371 42.851 2.366   1.00 47.36 ? 119 ARG A CA    1 
ATOM   948  C  C     . ARG A 1 125 ? -0.841 44.000 3.209   1.00 46.41 ? 119 ARG A C     1 
ATOM   949  O  O     . ARG A 1 125 ? 0.080  44.709 2.810   1.00 47.52 ? 119 ARG A O     1 
ATOM   950  C  CB    . ARG A 1 125 ? -2.813 43.166 1.945   1.00 45.87 ? 119 ARG A CB    1 
ATOM   951  C  CG    . ARG A 1 125 ? -2.929 44.491 1.169   1.00 46.84 ? 119 ARG A CG    1 
ATOM   952  C  CD    . ARG A 1 125 ? -4.371 44.874 0.824   1.00 45.66 ? 119 ARG A CD    1 
ATOM   953  N  NE    . ARG A 1 125 ? -5.111 45.357 1.985   1.00 45.25 ? 119 ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1 125 ? -5.001 46.580 2.500   1.00 45.67 ? 119 ARG A CZ    1 
ATOM   955  N  NH1   . ARG A 1 125 ? -4.182 47.468 1.956   1.00 47.09 ? 119 ARG A NH1   1 
ATOM   956  N  NH2   . ARG A 1 125 ? -5.704 46.912 3.577   1.00 45.41 ? 119 ARG A NH2   1 
ATOM   957  N  N     . GLU A 1 126 ? -1.433 44.179 4.381   1.00 44.58 ? 120 GLU A N     1 
ATOM   958  C  CA    . GLU A 1 126 ? -1.026 45.236 5.286   1.00 45.57 ? 120 GLU A CA    1 
ATOM   959  C  C     . GLU A 1 126 ? 0.373  44.956 5.842   1.00 44.79 ? 120 GLU A C     1 
ATOM   960  O  O     . GLU A 1 126 ? 1.082  45.875 6.257   1.00 44.88 ? 120 GLU A O     1 
ATOM   961  C  CB    . GLU A 1 126 ? -2.055 45.365 6.417   1.00 46.40 ? 120 GLU A CB    1 
ATOM   962  C  CG    . GLU A 1 126 ? -3.473 45.601 5.885   1.00 49.67 ? 120 GLU A CG    1 
ATOM   963  C  CD    . GLU A 1 126 ? -4.526 45.715 6.972   1.00 51.61 ? 120 GLU A CD    1 
ATOM   964  O  OE1   . GLU A 1 126 ? -5.731 45.692 6.625   1.00 53.46 ? 120 GLU A OE1   1 
ATOM   965  O  OE2   . GLU A 1 126 ? -4.158 45.832 8.163   1.00 51.70 ? 120 GLU A OE2   1 
ATOM   966  N  N     . ALA A 1 127 ? 0.758  43.683 5.846   1.00 42.50 ? 121 ALA A N     1 
ATOM   967  C  CA    . ALA A 1 127 ? 2.075  43.271 6.324   1.00 40.85 ? 121 ALA A CA    1 
ATOM   968  C  C     . ALA A 1 127 ? 3.114  43.744 5.310   1.00 38.72 ? 121 ALA A C     1 
ATOM   969  O  O     . ALA A 1 127 ? 4.093  44.395 5.659   1.00 38.69 ? 121 ALA A O     1 
ATOM   970  C  CB    . ALA A 1 127 ? 2.127  41.752 6.459   1.00 41.66 ? 121 ALA A CB    1 
ATOM   971  N  N     . TYR A 1 128 ? 2.877  43.413 4.049   1.00 37.93 ? 122 TYR A N     1 
ATOM   972  C  CA    . TYR A 1 128 ? 3.760  43.805 2.965   1.00 36.64 ? 122 TYR A CA    1 
ATOM   973  C  C     . TYR A 1 128 ? 3.956  45.321 2.988   1.00 37.87 ? 122 TYR A C     1 
ATOM   974  O  O     . TYR A 1 128 ? 5.091  45.811 2.905   1.00 38.29 ? 122 TYR A O     1 
ATOM   975  C  CB    . TYR A 1 128 ? 3.147  43.387 1.641   1.00 34.95 ? 122 TYR A CB    1 
ATOM   976  C  CG    . TYR A 1 128 ? 4.013  43.652 0.441   1.00 36.75 ? 122 TYR A CG    1 
ATOM   977  C  CD1   . TYR A 1 128 ? 4.889  42.681 -0.035  1.00 37.19 ? 122 TYR A CD1   1 
ATOM   978  C  CD2   . TYR A 1 128 ? 3.937  44.866 -0.243  1.00 38.13 ? 122 TYR A CD2   1 
ATOM   979  C  CE1   . TYR A 1 128 ? 5.667  42.904 -1.169  1.00 38.50 ? 122 TYR A CE1   1 
ATOM   980  C  CE2   . TYR A 1 128 ? 4.712  45.100 -1.375  1.00 38.12 ? 122 TYR A CE2   1 
ATOM   981  C  CZ    . TYR A 1 128 ? 5.571  44.113 -1.832  1.00 38.99 ? 122 TYR A CZ    1 
ATOM   982  O  OH    . TYR A 1 128 ? 6.326  44.326 -2.961  1.00 39.41 ? 122 TYR A OH    1 
ATOM   983  N  N     . ASN A 1 129 ? 2.848  46.057 3.109   1.00 36.53 ? 123 ASN A N     1 
ATOM   984  C  CA    . ASN A 1 129 ? 2.890  47.518 3.147   1.00 34.89 ? 123 ASN A CA    1 
ATOM   985  C  C     . ASN A 1 129 ? 3.662  48.029 4.349   1.00 33.12 ? 123 ASN A C     1 
ATOM   986  O  O     . ASN A 1 129 ? 4.357  49.033 4.254   1.00 31.41 ? 123 ASN A O     1 
ATOM   987  C  CB    . ASN A 1 129 ? 1.480  48.118 3.171   1.00 38.07 ? 123 ASN A CB    1 
ATOM   988  C  CG    . ASN A 1 129 ? 0.772  47.985 1.847   1.00 39.94 ? 123 ASN A CG    1 
ATOM   989  O  OD1   . ASN A 1 129 ? 1.400  48.005 0.788   1.00 41.33 ? 123 ASN A OD1   1 
ATOM   990  N  ND2   . ASN A 1 129 ? -0.551 47.868 1.896   1.00 43.04 ? 123 ASN A ND2   1 
ATOM   991  N  N     . LEU A 1 130 ? 3.522  47.356 5.486   1.00 31.61 ? 124 LEU A N     1 
ATOM   992  C  CA    . LEU A 1 130 ? 4.257  47.755 6.678   1.00 34.31 ? 124 LEU A CA    1 
ATOM   993  C  C     . LEU A 1 130 ? 5.742  47.515 6.380   1.00 35.27 ? 124 LEU A C     1 
ATOM   994  O  O     . LEU A 1 130 ? 6.613  48.287 6.792   1.00 35.65 ? 124 LEU A O     1 
ATOM   995  C  CB    . LEU A 1 130 ? 3.823  46.921 7.883   1.00 34.76 ? 124 LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 130 ? 4.448  47.380 9.198   1.00 37.18 ? 124 LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 130 ? 4.170  48.871 9.393   1.00 38.90 ? 124 LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 130 ? 3.889  46.582 10.354  1.00 34.48 ? 124 LEU A CD2   1 
ATOM   999  N  N     . GLY A 1 131 ? 6.013  46.441 5.643   1.00 35.34 ? 125 GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 131 ? 7.375  46.119 5.277   1.00 35.26 ? 125 GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 131 ? 8.001  47.218 4.442   1.00 35.54 ? 125 GLY A C     1 
ATOM   1002 O  O     . GLY A 1 131 ? 9.127  47.633 4.710   1.00 35.17 ? 125 GLY A O     1 
ATOM   1003 N  N     . LEU A 1 132 ? 7.281  47.693 3.429   1.00 37.10 ? 126 LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 132 ? 7.801  48.759 2.574   1.00 36.70 ? 126 LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 132 ? 8.087  50.017 3.386   1.00 36.80 ? 126 LEU A C     1 
ATOM   1006 O  O     . LEU A 1 132 ? 9.089  50.705 3.161   1.00 36.11 ? 126 LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 132 ? 6.811  49.095 1.460   1.00 37.75 ? 126 LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 132 ? 6.575  48.052 0.369   1.00 38.06 ? 126 LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 132 ? 5.550  48.586 -0.602  1.00 39.98 ? 126 LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 132 ? 7.867  47.746 -0.355  1.00 39.02 ? 126 LEU A CD2   1 
ATOM   1011 N  N     . GLU A 1 133 ? 7.208  50.318 4.334   1.00 36.74 ? 127 GLU A N     1 
ATOM   1012 C  CA    . GLU A 1 133 ? 7.391  51.497 5.169   1.00 36.77 ? 127 GLU A CA    1 
ATOM   1013 C  C     . GLU A 1 133 ? 8.644  51.354 6.046   1.00 35.69 ? 127 GLU A C     1 
ATOM   1014 O  O     . GLU A 1 133 ? 9.387  52.323 6.248   1.00 34.54 ? 127 GLU A O     1 
ATOM   1015 C  CB    . GLU A 1 133 ? 6.151  51.735 6.038   1.00 36.09 ? 127 GLU A CB    1 
ATOM   1016 C  CG    . GLU A 1 133 ? 4.891  52.162 5.275   0.50 36.98 ? 127 GLU A CG    1 
ATOM   1017 C  CD    . GLU A 1 133 ? 5.063  53.459 4.485   0.50 37.90 ? 127 GLU A CD    1 
ATOM   1018 O  OE1   . GLU A 1 133 ? 5.683  54.411 5.008   0.50 37.64 ? 127 GLU A OE1   1 
ATOM   1019 O  OE2   . GLU A 1 133 ? 4.563  53.529 3.341   0.50 38.33 ? 127 GLU A OE2   1 
ATOM   1020 N  N     . ILE A 1 134 ? 8.867  50.151 6.570   1.00 35.22 ? 128 ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 134 ? 10.041 49.892 7.397   1.00 34.22 ? 128 ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 134 ? 11.283 50.080 6.532   1.00 33.00 ? 128 ILE A C     1 
ATOM   1023 O  O     . ILE A 1 134 ? 12.237 50.723 6.948   1.00 33.57 ? 128 ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 134 ? 10.020 48.454 7.971   1.00 35.44 ? 128 ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 134 ? 9.000  48.373 9.109   1.00 36.48 ? 128 ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 134 ? 11.409 48.052 8.456   1.00 34.90 ? 128 ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 134 ? 8.895  47.009 9.753   1.00 35.54 ? 128 ILE A CD1   1 
ATOM   1028 N  N     . LYS A 1 135 ? 11.251 49.531 5.322   1.00 32.29 ? 129 LYS A N     1 
ATOM   1029 C  CA    . LYS A 1 135 ? 12.372 49.655 4.408   1.00 32.64 ? 129 LYS A CA    1 
ATOM   1030 C  C     . LYS A 1 135 ? 12.637 51.119 4.086   1.00 33.65 ? 129 LYS A C     1 
ATOM   1031 O  O     . LYS A 1 135 ? 13.786 51.576 4.135   1.00 31.92 ? 129 LYS A O     1 
ATOM   1032 C  CB    . LYS A 1 135 ? 12.103 48.880 3.109   1.00 31.45 ? 129 LYS A CB    1 
ATOM   1033 C  CG    . LYS A 1 135 ? 12.292 47.364 3.232   1.00 29.56 ? 129 LYS A CG    1 
ATOM   1034 C  CD    . LYS A 1 135 ? 11.761 46.613 2.020   1.00 26.63 ? 129 LYS A CD    1 
ATOM   1035 C  CE    . LYS A 1 135 ? 12.431 47.032 0.717   1.00 29.48 ? 129 LYS A CE    1 
ATOM   1036 N  NZ    . LYS A 1 135 ? 13.874 46.659 0.608   1.00 29.09 ? 129 LYS A NZ    1 
ATOM   1037 N  N     . ASN A 1 136 ? 11.576 51.855 3.757   1.00 34.34 ? 130 ASN A N     1 
ATOM   1038 C  CA    . ASN A 1 136 ? 11.719 53.272 3.423   1.00 34.72 ? 130 ASN A CA    1 
ATOM   1039 C  C     . ASN A 1 136 ? 12.274 54.045 4.609   1.00 34.02 ? 130 ASN A C     1 
ATOM   1040 O  O     . ASN A 1 136 ? 13.156 54.882 4.456   1.00 36.96 ? 130 ASN A O     1 
ATOM   1041 C  CB    . ASN A 1 136 ? 10.375 53.888 3.017   1.00 37.06 ? 130 ASN A CB    1 
ATOM   1042 C  CG    . ASN A 1 136 ? 10.504 55.366 2.641   1.00 41.88 ? 130 ASN A CG    1 
ATOM   1043 O  OD1   . ASN A 1 136 ? 11.054 55.705 1.594   1.00 43.04 ? 130 ASN A OD1   1 
ATOM   1044 N  ND2   . ASN A 1 136 ? 10.011 56.248 3.508   1.00 42.64 ? 130 ASN A ND2   1 
ATOM   1045 N  N     . LYS A 1 137 ? 11.757 53.759 5.795   1.00 32.30 ? 131 LYS A N     1 
ATOM   1046 C  CA    . LYS A 1 137 ? 12.201 54.438 7.002   1.00 33.13 ? 131 LYS A CA    1 
ATOM   1047 C  C     . LYS A 1 137 ? 13.695 54.263 7.254   1.00 33.72 ? 131 LYS A C     1 
ATOM   1048 O  O     . LYS A 1 137 ? 14.398 55.224 7.592   1.00 32.87 ? 131 LYS A O     1 
ATOM   1049 C  CB    . LYS A 1 137 ? 11.428 53.913 8.214   1.00 34.12 ? 131 LYS A CB    1 
ATOM   1050 C  CG    . LYS A 1 137 ? 11.628 54.730 9.479   1.00 38.27 ? 131 LYS A CG    1 
ATOM   1051 C  CD    . LYS A 1 137 ? 11.148 56.164 9.273   1.00 41.78 ? 131 LYS A CD    1 
ATOM   1052 C  CE    . LYS A 1 137 ? 10.045 56.525 10.265  1.00 44.38 ? 131 LYS A CE    1 
ATOM   1053 N  NZ    . LYS A 1 137 ? 10.531 56.519 11.678  1.00 47.03 ? 131 LYS A NZ    1 
ATOM   1054 N  N     . ILE A 1 138 ? 14.180 53.035 7.093   1.00 31.89 ? 132 ILE A N     1 
ATOM   1055 C  CA    . ILE A 1 138 ? 15.589 52.757 7.327   1.00 30.41 ? 132 ILE A CA    1 
ATOM   1056 C  C     . ILE A 1 138 ? 16.476 53.413 6.268   1.00 29.76 ? 132 ILE A C     1 
ATOM   1057 O  O     . ILE A 1 138 ? 17.507 54.005 6.596   1.00 29.71 ? 132 ILE A O     1 
ATOM   1058 C  CB    . ILE A 1 138 ? 15.838 51.225 7.391   1.00 30.59 ? 132 ILE A CB    1 
ATOM   1059 C  CG1   . ILE A 1 138 ? 15.088 50.647 8.602   1.00 30.61 ? 132 ILE A CG1   1 
ATOM   1060 C  CG2   . ILE A 1 138 ? 17.335 50.934 7.489   1.00 28.38 ? 132 ILE A CG2   1 
ATOM   1061 C  CD1   . ILE A 1 138 ? 15.099 49.141 8.702   1.00 30.07 ? 132 ILE A CD1   1 
ATOM   1062 N  N     . LEU A 1 139 ? 16.080 53.328 5.006   1.00 28.31 ? 133 LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 139 ? 16.868 53.946 3.950   1.00 31.86 ? 133 LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 139 ? 16.963 55.448 4.207   1.00 32.77 ? 133 LEU A C     1 
ATOM   1065 O  O     . LEU A 1 139 ? 18.038 56.038 4.177   1.00 32.55 ? 133 LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 139 ? 16.220 53.718 2.583   1.00 32.65 ? 133 LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 139 ? 17.056 54.242 1.408   1.00 34.42 ? 133 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 139 ? 18.424 53.589 1.435   1.00 31.54 ? 133 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 139 ? 16.356 53.954 0.089   1.00 33.65 ? 133 LEU A CD2   1 
ATOM   1070 N  N     . GLU A 1 140 ? 15.816 56.053 4.476   1.00 33.76 ? 134 GLU A N     1 
ATOM   1071 C  CA    . GLU A 1 140 ? 15.746 57.483 4.717   1.00 34.44 ? 134 GLU A CA    1 
ATOM   1072 C  C     . GLU A 1 140 ? 16.556 57.905 5.924   1.00 34.76 ? 134 GLU A C     1 
ATOM   1073 O  O     . GLU A 1 140 ? 17.317 58.872 5.855   1.00 34.96 ? 134 GLU A O     1 
ATOM   1074 C  CB    . GLU A 1 140 ? 14.289 57.904 4.901   1.00 35.48 ? 134 GLU A CB    1 
ATOM   1075 C  CG    . GLU A 1 140 ? 14.089 59.359 5.224   0.50 34.21 ? 134 GLU A CG    1 
ATOM   1076 C  CD    . GLU A 1 140 ? 12.655 59.650 5.587   0.50 35.10 ? 134 GLU A CD    1 
ATOM   1077 O  OE1   . GLU A 1 140 ? 11.772 59.433 4.731   0.50 32.95 ? 134 GLU A OE1   1 
ATOM   1078 O  OE2   . GLU A 1 140 ? 12.411 60.088 6.730   0.50 34.98 ? 134 GLU A OE2   1 
ATOM   1079 N  N     . LYS A 1 141 ? 16.418 57.179 7.026   1.00 34.13 ? 135 LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 141 ? 17.144 57.557 8.228   1.00 34.50 ? 135 LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 141 ? 18.605 57.136 8.312   1.00 34.25 ? 135 LYS A C     1 
ATOM   1082 O  O     . LYS A 1 141 ? 19.441 57.917 8.763   1.00 31.81 ? 135 LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 141 ? 16.394 57.063 9.464   1.00 37.66 ? 135 LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 141 ? 14.982 57.619 9.553   1.00 43.53 ? 135 LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 141 ? 14.961 59.087 9.946   1.00 49.16 ? 135 LYS A CD    1 
ATOM   1086 C  CE    . LYS A 1 141 ? 13.548 59.671 9.781   1.00 52.99 ? 135 LYS A CE    1 
ATOM   1087 N  NZ    . LYS A 1 141 ? 12.758 58.985 8.706   1.00 56.65 ? 135 LYS A NZ    1 
ATOM   1088 N  N     . GLU A 1 142 ? 18.928 55.916 7.893   1.00 32.65 ? 136 GLU A N     1 
ATOM   1089 C  CA    . GLU A 1 142 ? 20.313 55.472 7.985   1.00 31.98 ? 136 GLU A CA    1 
ATOM   1090 C  C     . GLU A 1 142 ? 20.971 55.208 6.645   1.00 30.68 ? 136 GLU A C     1 
ATOM   1091 O  O     . GLU A 1 142 ? 22.121 54.790 6.598   1.00 31.27 ? 136 GLU A O     1 
ATOM   1092 C  CB    . GLU A 1 142 ? 20.415 54.221 8.858   1.00 30.97 ? 136 GLU A CB    1 
ATOM   1093 C  CG    . GLU A 1 142 ? 20.028 54.425 10.315  1.00 32.07 ? 136 GLU A CG    1 
ATOM   1094 C  CD    . GLU A 1 142 ? 20.973 55.339 11.065  1.00 33.29 ? 136 GLU A CD    1 
ATOM   1095 O  OE1   . GLU A 1 142 ? 22.149 55.439 10.672  1.00 33.80 ? 136 GLU A OE1   1 
ATOM   1096 O  OE2   . GLU A 1 142 ? 20.547 55.947 12.071  1.00 31.95 ? 136 GLU A OE2   1 
ATOM   1097 N  N     . LYS A 1 143 ? 20.246 55.450 5.561   1.00 30.21 ? 137 LYS A N     1 
ATOM   1098 C  CA    . LYS A 1 143 ? 20.782 55.236 4.223   1.00 30.65 ? 137 LYS A CA    1 
ATOM   1099 C  C     . LYS A 1 143 ? 21.232 53.792 4.065   1.00 29.20 ? 137 LYS A C     1 
ATOM   1100 O  O     . LYS A 1 143 ? 22.192 53.498 3.361   1.00 29.05 ? 137 LYS A O     1 
ATOM   1101 C  CB    . LYS A 1 143 ? 21.960 56.183 3.974   1.00 31.54 ? 137 LYS A CB    1 
ATOM   1102 C  CG    . LYS A 1 143 ? 21.568 57.651 4.006   1.00 35.34 ? 137 LYS A CG    1 
ATOM   1103 C  CD    . LYS A 1 143 ? 20.637 57.994 2.859   0.50 34.95 ? 137 LYS A CD    1 
ATOM   1104 C  CE    . LYS A 1 143 ? 20.237 59.458 2.906   0.50 37.44 ? 137 LYS A CE    1 
ATOM   1105 N  NZ    . LYS A 1 143 ? 21.430 60.338 3.040   0.50 37.35 ? 137 LYS A NZ    1 
ATOM   1106 N  N     . ILE A 1 144 ? 20.522 52.894 4.733   1.00 28.35 ? 138 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 144 ? 20.828 51.472 4.687   1.00 27.41 ? 138 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 144 ? 19.672 50.713 4.017   1.00 28.37 ? 138 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 144 ? 18.519 50.843 4.440   1.00 30.39 ? 138 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 144 ? 21.017 50.917 6.133   1.00 26.24 ? 138 ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 144 ? 22.300 51.474 6.761   1.00 25.29 ? 138 ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 144 ? 21.033 49.409 6.125   1.00 23.28 ? 138 ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 144 ? 23.579 50.933 6.137   1.00 23.53 ? 138 ILE A CD1   1 
ATOM   1114 N  N     . THR A 1 145 ? 19.965 49.956 2.963   1.00 25.60 ? 139 THR A N     1 
ATOM   1115 C  CA    . THR A 1 145 ? 18.930 49.156 2.322   1.00 25.53 ? 139 THR A CA    1 
ATOM   1116 C  C     . THR A 1 145 ? 18.921 47.796 3.028   1.00 25.32 ? 139 THR A C     1 
ATOM   1117 O  O     . THR A 1 145 ? 19.963 47.302 3.478   1.00 23.37 ? 139 THR A O     1 
ATOM   1118 C  CB    . THR A 1 145 ? 19.181 48.940 0.799   1.00 26.87 ? 139 THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 145 ? 20.363 48.155 0.606   1.00 28.68 ? 139 THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 145 ? 19.350 50.280 0.085   1.00 26.36 ? 139 THR A CG2   1 
ATOM   1121 N  N     . VAL A 1 146 ? 17.740 47.203 3.144   1.00 25.66 ? 140 VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 146 ? 17.591 45.914 3.809   1.00 25.50 ? 140 VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 146 ? 16.604 45.035 3.040   1.00 26.78 ? 140 VAL A C     1 
ATOM   1124 O  O     . VAL A 1 146 ? 15.927 45.502 2.121   1.00 25.11 ? 140 VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 146 ? 17.054 46.088 5.252   1.00 24.74 ? 140 VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 146 ? 17.873 47.106 5.996   1.00 26.72 ? 140 VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 146 ? 15.595 46.518 5.225   1.00 26.49 ? 140 VAL A CG2   1 
ATOM   1128 N  N     . THR A 1 147 ? 16.533 43.759 3.408   1.00 23.63 ? 141 THR A N     1 
ATOM   1129 C  CA    . THR A 1 147 ? 15.601 42.856 2.757   1.00 23.81 ? 141 THR A CA    1 
ATOM   1130 C  C     . THR A 1 147 ? 14.593 42.385 3.799   1.00 22.32 ? 141 THR A C     1 
ATOM   1131 O  O     . THR A 1 147 ? 14.944 42.108 4.952   1.00 22.20 ? 141 THR A O     1 
ATOM   1132 C  CB    . THR A 1 147 ? 16.327 41.646 2.101   1.00 25.15 ? 141 THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 147 ? 17.084 42.097 0.973   1.00 25.64 ? 141 THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 147 ? 15.326 40.626 1.610   1.00 25.03 ? 141 THR A CG2   1 
ATOM   1135 N  N     . VAL A 1 148 ? 13.331 42.319 3.394   1.00 22.77 ? 142 VAL A N     1 
ATOM   1136 C  CA    . VAL A 1 148 ? 12.280 41.905 4.307   1.00 22.81 ? 142 VAL A CA    1 
ATOM   1137 C  C     . VAL A 1 148 ? 11.608 40.618 3.864   1.00 24.75 ? 142 VAL A C     1 
ATOM   1138 O  O     . VAL A 1 148 ? 11.314 40.436 2.687   1.00 24.70 ? 142 VAL A O     1 
ATOM   1139 C  CB    . VAL A 1 148 ? 11.214 43.014 4.448   1.00 25.16 ? 142 VAL A CB    1 
ATOM   1140 C  CG1   . VAL A 1 148 ? 10.012 42.497 5.240   1.00 23.79 ? 142 VAL A CG1   1 
ATOM   1141 C  CG2   . VAL A 1 148 ? 11.824 44.228 5.144   1.00 22.41 ? 142 VAL A CG2   1 
ATOM   1142 N  N     . GLY A 1 149 ? 11.395 39.721 4.826   1.00 25.45 ? 143 GLY A N     1 
ATOM   1143 C  CA    . GLY A 1 149 ? 10.738 38.459 4.561   1.00 24.04 ? 143 GLY A CA    1 
ATOM   1144 C  C     . GLY A 1 149 ? 9.529  38.380 5.469   1.00 25.45 ? 143 GLY A C     1 
ATOM   1145 O  O     . GLY A 1 149 ? 9.614  38.708 6.652   1.00 25.75 ? 143 GLY A O     1 
ATOM   1146 N  N     . ILE A 1 150 ? 8.396  37.959 4.919   1.00 28.71 ? 144 ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 150 ? 7.168  37.859 5.709   1.00 30.98 ? 144 ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 150 ? 6.480  36.508 5.510   1.00 30.72 ? 144 ILE A C     1 
ATOM   1149 O  O     . ILE A 1 150 ? 6.284  36.052 4.379   1.00 31.08 ? 144 ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 150 ? 6.185  39.001 5.331   1.00 31.54 ? 144 ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 150 ? 6.833  40.353 5.628   1.00 32.84 ? 144 ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 150 ? 4.893  38.872 6.118   1.00 32.16 ? 144 ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 150 ? 6.195  41.516 4.897   1.00 34.63 ? 144 ILE A CD1   1 
ATOM   1154 N  N     . SER A 1 151 ? 6.132  35.865 6.619   1.00 31.99 ? 145 SER A N     1 
ATOM   1155 C  CA    . SER A 1 151 ? 5.453  34.576 6.563   1.00 33.77 ? 145 SER A CA    1 
ATOM   1156 C  C     . SER A 1 151 ? 4.777  34.288 7.894   1.00 34.69 ? 145 SER A C     1 
ATOM   1157 O  O     . SER A 1 151 ? 4.684  35.173 8.748   1.00 35.79 ? 145 SER A O     1 
ATOM   1158 C  CB    . SER A 1 151 ? 6.445  33.463 6.223   1.00 33.56 ? 145 SER A CB    1 
ATOM   1159 O  OG    . SER A 1 151 ? 5.751  32.268 5.913   1.00 33.40 ? 145 SER A OG    1 
ATOM   1160 N  N     . LYS A 1 152 ? 4.320  33.049 8.080   1.00 34.91 ? 146 LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 152 ? 3.629  32.673 9.313   1.00 35.38 ? 146 LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 152 ? 4.535  32.419 10.516  1.00 36.72 ? 146 LYS A C     1 
ATOM   1163 O  O     . LYS A 1 152 ? 4.071  32.451 11.668  1.00 35.39 ? 146 LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 152 ? 2.750  31.439 9.076   1.00 36.87 ? 146 LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 152 ? 3.519  30.177 8.735   1.00 37.38 ? 146 LYS A CG    1 
ATOM   1166 C  CD    . LYS A 1 152 ? 2.610  28.959 8.758   1.00 40.25 ? 146 LYS A CD    1 
ATOM   1167 C  CE    . LYS A 1 152 ? 1.544  29.016 7.678   1.00 41.74 ? 146 LYS A CE    1 
ATOM   1168 N  NZ    . LYS A 1 152 ? 0.606  27.855 7.744   1.00 42.05 ? 146 LYS A NZ    1 
ATOM   1169 N  N     . ASN A 1 153 ? 5.818  32.148 10.271  1.00 35.33 ? 147 ASN A N     1 
ATOM   1170 C  CA    . ASN A 1 153 ? 6.736  31.912 11.385  1.00 34.71 ? 147 ASN A CA    1 
ATOM   1171 C  C     . ASN A 1 153 ? 8.143  32.415 11.090  1.00 32.43 ? 147 ASN A C     1 
ATOM   1172 O  O     . ASN A 1 153 ? 8.452  32.817 9.967   1.00 30.87 ? 147 ASN A O     1 
ATOM   1173 C  CB    . ASN A 1 153 ? 6.778  30.418 11.750  1.00 35.62 ? 147 ASN A CB    1 
ATOM   1174 C  CG    . ASN A 1 153 ? 7.126  29.534 10.568  1.00 35.91 ? 147 ASN A CG    1 
ATOM   1175 O  OD1   . ASN A 1 153 ? 8.094  29.785 9.853   1.00 39.19 ? 147 ASN A OD1   1 
ATOM   1176 N  ND2   . ASN A 1 153 ? 6.345  28.487 10.363  1.00 38.82 ? 147 ASN A ND2   1 
ATOM   1177 N  N     . LYS A 1 154 ? 8.994  32.392 12.108  1.00 30.36 ? 148 LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 154 ? 10.358 32.857 11.948  1.00 29.14 ? 148 LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 154 ? 11.116 32.191 10.818  1.00 29.22 ? 148 LYS A C     1 
ATOM   1180 O  O     . LYS A 1 154 ? 11.729 32.873 10.002  1.00 29.34 ? 148 LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 154 ? 11.117 32.690 13.259  1.00 30.00 ? 148 LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 154 ? 10.783 33.770 14.261  1.00 28.10 ? 148 LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 154 ? 11.719 33.730 15.444  1.00 31.33 ? 148 LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 154 ? 11.426 32.539 16.332  1.00 31.24 ? 148 LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 154 ? 12.354 32.536 17.483  1.00 34.04 ? 148 LYS A NZ    1 
ATOM   1186 N  N     . VAL A 1 155 ? 11.065 30.862 10.761  1.00 28.90 ? 149 VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 155 ? 11.767 30.112 9.728   1.00 28.76 ? 149 VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 155 ? 11.417 30.560 8.310   1.00 28.33 ? 149 VAL A C     1 
ATOM   1189 O  O     . VAL A 1 155 ? 12.300 30.924 7.538   1.00 29.22 ? 149 VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 155 ? 11.503 28.586 9.862   1.00 28.71 ? 149 VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 155 ? 12.063 27.849 8.660   1.00 26.01 ? 149 VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 155 ? 12.158 28.059 11.128  1.00 28.76 ? 149 VAL A CG2   1 
ATOM   1193 N  N     . PHE A 1 156 ? 10.138 30.538 7.963   1.00 28.49 ? 150 PHE A N     1 
ATOM   1194 C  CA    . PHE A 1 156 ? 9.752  30.942 6.624   1.00 28.85 ? 150 PHE A CA    1 
ATOM   1195 C  C     . PHE A 1 156 ? 9.869  32.433 6.367   1.00 27.29 ? 150 PHE A C     1 
ATOM   1196 O  O     . PHE A 1 156 ? 9.975  32.854 5.222   1.00 27.25 ? 150 PHE A O     1 
ATOM   1197 C  CB    . PHE A 1 156 ? 8.350  30.433 6.286   1.00 32.87 ? 150 PHE A CB    1 
ATOM   1198 C  CG    . PHE A 1 156 ? 8.319  28.968 5.980   1.00 33.51 ? 150 PHE A CG    1 
ATOM   1199 C  CD1   . PHE A 1 156 ? 7.895  28.052 6.935   1.00 35.12 ? 150 PHE A CD1   1 
ATOM   1200 C  CD2   . PHE A 1 156 ? 8.799  28.497 4.763   1.00 35.79 ? 150 PHE A CD2   1 
ATOM   1201 C  CE1   . PHE A 1 156 ? 7.953  26.692 6.690   1.00 33.46 ? 150 PHE A CE1   1 
ATOM   1202 C  CE2   . PHE A 1 156 ? 8.862  27.136 4.508   1.00 36.81 ? 150 PHE A CE2   1 
ATOM   1203 C  CZ    . PHE A 1 156 ? 8.435  26.231 5.481   1.00 34.59 ? 150 PHE A CZ    1 
ATOM   1204 N  N     . ALA A 1 157 ? 9.862  33.233 7.425   1.00 25.22 ? 151 ALA A N     1 
ATOM   1205 C  CA    . ALA A 1 157 ? 10.030 34.673 7.255   1.00 25.19 ? 151 ALA A CA    1 
ATOM   1206 C  C     . ALA A 1 157 ? 11.492 34.863 6.784   1.00 25.68 ? 151 ALA A C     1 
ATOM   1207 O  O     . ALA A 1 157 ? 11.786 35.633 5.848   1.00 23.09 ? 151 ALA A O     1 
ATOM   1208 C  CB    . ALA A 1 157 ? 9.788  35.384 8.585   1.00 23.59 ? 151 ALA A CB    1 
ATOM   1209 N  N     . LYS A 1 158 ? 12.396 34.129 7.431   1.00 25.39 ? 152 LYS A N     1 
ATOM   1210 C  CA    . LYS A 1 158 ? 13.812 34.176 7.095   1.00 26.04 ? 152 LYS A CA    1 
ATOM   1211 C  C     . LYS A 1 158 ? 14.070 33.599 5.700   1.00 24.02 ? 152 LYS A C     1 
ATOM   1212 O  O     . LYS A 1 158 ? 14.860 34.137 4.940   1.00 22.80 ? 152 LYS A O     1 
ATOM   1213 C  CB    . LYS A 1 158 ? 14.628 33.407 8.125   1.00 25.98 ? 152 LYS A CB    1 
ATOM   1214 C  CG    . LYS A 1 158 ? 16.106 33.371 7.793   1.00 32.12 ? 152 LYS A CG    1 
ATOM   1215 C  CD    . LYS A 1 158 ? 16.869 32.550 8.808   1.00 34.94 ? 152 LYS A CD    1 
ATOM   1216 C  CE    . LYS A 1 158 ? 17.977 33.365 9.427   1.00 38.59 ? 152 LYS A CE    1 
ATOM   1217 N  NZ    . LYS A 1 158 ? 18.952 33.829 8.397   1.00 40.12 ? 152 LYS A NZ    1 
ATOM   1218 N  N     . ILE A 1 159 ? 13.399 32.503 5.360   1.00 25.20 ? 153 ILE A N     1 
ATOM   1219 C  CA    . ILE A 1 159 ? 13.571 31.910 4.032   1.00 23.58 ? 153 ILE A CA    1 
ATOM   1220 C  C     . ILE A 1 159 ? 13.095 32.900 2.974   1.00 24.50 ? 153 ILE A C     1 
ATOM   1221 O  O     . ILE A 1 159 ? 13.707 33.033 1.914   1.00 24.40 ? 153 ILE A O     1 
ATOM   1222 C  CB    . ILE A 1 159 ? 12.772 30.597 3.901   1.00 24.81 ? 153 ILE A CB    1 
ATOM   1223 C  CG1   . ILE A 1 159 ? 13.413 29.526 4.794   1.00 25.53 ? 153 ILE A CG1   1 
ATOM   1224 C  CG2   . ILE A 1 159 ? 12.739 30.122 2.453   1.00 23.44 ? 153 ILE A CG2   1 
ATOM   1225 C  CD1   . ILE A 1 159 ? 12.677 28.184 4.775   1.00 25.58 ? 153 ILE A CD1   1 
ATOM   1226 N  N     . ALA A 1 160 ? 12.011 33.604 3.281   1.00 23.85 ? 154 ALA A N     1 
ATOM   1227 C  CA    . ALA A 1 160 ? 11.433 34.584 2.366   1.00 26.16 ? 154 ALA A CA    1 
ATOM   1228 C  C     . ALA A 1 160 ? 12.462 35.647 1.978   1.00 26.86 ? 154 ALA A C     1 
ATOM   1229 O  O     . ALA A 1 160 ? 12.665 35.936 0.791   1.00 28.64 ? 154 ALA A O     1 
ATOM   1230 C  CB    . ALA A 1 160 ? 10.214 35.241 3.013   1.00 27.01 ? 154 ALA A CB    1 
ATOM   1231 N  N     . ALA A 1 161 ? 13.104 36.220 2.988   1.00 25.61 ? 155 ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 161 ? 14.129 37.234 2.787   1.00 26.90 ? 155 ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 161 ? 15.293 36.663 1.969   1.00 28.88 ? 155 ALA A C     1 
ATOM   1234 O  O     . ALA A 1 161 ? 15.774 37.293 1.025   1.00 29.05 ? 155 ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 161 ? 14.635 37.728 4.139   1.00 25.41 ? 155 ALA A CB    1 
ATOM   1236 N  N     . ASP A 1 162 ? 15.749 35.472 2.338   1.00 30.10 ? 156 ASP A N     1 
ATOM   1237 C  CA    . ASP A 1 162 ? 16.850 34.853 1.613   1.00 31.31 ? 156 ASP A CA    1 
ATOM   1238 C  C     . ASP A 1 162 ? 16.499 34.822 0.138   1.00 31.83 ? 156 ASP A C     1 
ATOM   1239 O  O     . ASP A 1 162 ? 17.348 35.055 -0.713  1.00 33.28 ? 156 ASP A O     1 
ATOM   1240 C  CB    . ASP A 1 162 ? 17.096 33.427 2.105   1.00 29.73 ? 156 ASP A CB    1 
ATOM   1241 C  CG    . ASP A 1 162 ? 17.756 33.387 3.468   0.50 30.99 ? 156 ASP A CG    1 
ATOM   1242 O  OD1   . ASP A 1 162 ? 17.730 32.313 4.103   0.50 31.09 ? 156 ASP A OD1   1 
ATOM   1243 O  OD2   . ASP A 1 162 ? 18.307 34.422 3.899   0.50 29.32 ? 156 ASP A OD2   1 
ATOM   1244 N  N     . MET A 1 163 ? 15.236 34.551 -0.159  1.00 33.76 ? 157 MET A N     1 
ATOM   1245 C  CA    . MET A 1 163 ? 14.790 34.484 -1.542  1.00 35.56 ? 157 MET A CA    1 
ATOM   1246 C  C     . MET A 1 163 ? 14.692 35.857 -2.182  1.00 34.58 ? 157 MET A C     1 
ATOM   1247 O  O     . MET A 1 163 ? 14.786 35.979 -3.395  1.00 36.73 ? 157 MET A O     1 
ATOM   1248 C  CB    . MET A 1 163 ? 13.426 33.809 -1.623  1.00 37.14 ? 157 MET A CB    1 
ATOM   1249 C  CG    . MET A 1 163 ? 13.332 32.540 -0.814  1.00 41.01 ? 157 MET A CG    1 
ATOM   1250 S  SD    . MET A 1 163 ? 11.851 31.585 -1.181  1.00 40.04 ? 157 MET A SD    1 
ATOM   1251 C  CE    . MET A 1 163 ? 12.611 29.997 -1.530  1.00 41.41 ? 157 MET A CE    1 
ATOM   1252 N  N     . ALA A 1 164 ? 14.507 36.892 -1.371  1.00 34.44 ? 158 ALA A N     1 
ATOM   1253 C  CA    . ALA A 1 164 ? 14.373 38.241 -1.901  1.00 33.42 ? 158 ALA A CA    1 
ATOM   1254 C  C     . ALA A 1 164 ? 15.651 39.072 -1.961  1.00 33.53 ? 158 ALA A C     1 
ATOM   1255 O  O     . ALA A 1 164 ? 15.652 40.135 -2.567  1.00 34.11 ? 158 ALA A O     1 
ATOM   1256 C  CB    . ALA A 1 164 ? 13.308 38.995 -1.106  1.00 32.54 ? 158 ALA A CB    1 
ATOM   1257 N  N     . LYS A 1 165 ? 16.735 38.605 -1.346  1.00 33.46 ? 159 LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 165 ? 17.989 39.370 -1.348  1.00 34.24 ? 159 LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 165 ? 18.483 39.741 -2.757  1.00 34.63 ? 159 LYS A C     1 
ATOM   1260 O  O     . LYS A 1 165 ? 18.429 38.931 -3.672  1.00 34.89 ? 159 LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 165 ? 19.100 38.588 -0.618  1.00 32.86 ? 159 LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 165 ? 18.964 38.537 0.901   1.00 30.81 ? 159 LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 165 ? 20.181 37.863 1.567   1.00 30.32 ? 159 LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 165 ? 20.025 37.818 3.105   1.00 31.66 ? 159 LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 165 ? 21.207 37.251 3.874   1.00 28.20 ? 159 LYS A NZ    1 
ATOM   1266 N  N     . PRO A 1 166 ? 18.998 40.972 -2.938  1.00 34.51 ? 160 PRO A N     1 
ATOM   1267 C  CA    . PRO A 1 166 ? 19.151 42.035 -1.936  1.00 33.04 ? 160 PRO A CA    1 
ATOM   1268 C  C     . PRO A 1 166 ? 18.107 43.127 -2.136  1.00 31.92 ? 160 PRO A C     1 
ATOM   1269 O  O     . PRO A 1 166 ? 17.478 43.190 -3.183  1.00 32.57 ? 160 PRO A O     1 
ATOM   1270 C  CB    . PRO A 1 166 ? 20.544 42.560 -2.229  1.00 32.21 ? 160 PRO A CB    1 
ATOM   1271 C  CG    . PRO A 1 166 ? 20.518 42.583 -3.755  1.00 34.74 ? 160 PRO A CG    1 
ATOM   1272 C  CD    . PRO A 1 166 ? 19.826 41.264 -4.128  1.00 34.07 ? 160 PRO A CD    1 
ATOM   1273 N  N     . ASN A 1 167 ? 17.928 43.973 -1.127  1.00 33.32 ? 161 ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 167 ? 16.991 45.087 -1.204  1.00 33.14 ? 161 ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 167 ? 15.642 44.611 -1.723  1.00 33.71 ? 161 ASN A C     1 
ATOM   1276 O  O     . ASN A 1 167 ? 15.108 45.157 -2.687  1.00 33.67 ? 161 ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 167 ? 17.579 46.153 -2.139  1.00 34.73 ? 161 ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 167 ? 16.846 47.473 -2.068  1.00 36.17 ? 161 ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 167 ? 16.017 47.707 -1.182  1.00 37.70 ? 161 ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 167 ? 17.168 48.362 -3.000  1.00 37.25 ? 161 ASN A ND2   1 
ATOM   1281 N  N     . GLY A 1 168 ? 15.105 43.578 -1.085  1.00 32.98 ? 162 GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 168 ? 13.827 43.050 -1.497  1.00 29.38 ? 162 GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 168 ? 12.842 42.953 -0.357  1.00 29.94 ? 162 GLY A C     1 
ATOM   1284 O  O     . GLY A 1 168 ? 13.096 43.379 0.768   1.00 30.75 ? 162 GLY A O     1 
ATOM   1285 N  N     . ILE A 1 169 ? 11.684 42.404 -0.670  1.00 30.43 ? 163 ILE A N     1 
ATOM   1286 C  CA    . ILE A 1 169 ? 10.628 42.207 0.303   1.00 31.63 ? 163 ILE A CA    1 
ATOM   1287 C  C     . ILE A 1 169 ? 9.880  41.045 -0.298  1.00 32.47 ? 163 ILE A C     1 
ATOM   1288 O  O     . ILE A 1 169 ? 9.656  40.999 -1.508  1.00 34.88 ? 163 ILE A O     1 
ATOM   1289 C  CB    . ILE A 1 169 ? 9.713  43.438 0.424   1.00 32.15 ? 163 ILE A CB    1 
ATOM   1290 C  CG1   . ILE A 1 169 ? 8.535  43.110 1.351   1.00 30.41 ? 163 ILE A CG1   1 
ATOM   1291 C  CG2   . ILE A 1 169 ? 9.271  43.889 -0.960  1.00 31.63 ? 163 ILE A CG2   1 
ATOM   1292 C  CD1   . ILE A 1 169 ? 7.776  44.319 1.859   1.00 28.40 ? 163 ILE A CD1   1 
ATOM   1293 N  N     . LYS A 1 170 ? 9.506  40.092 0.534   1.00 33.18 ? 164 LYS A N     1 
ATOM   1294 C  CA    . LYS A 1 170 ? 8.855  38.920 0.005   1.00 34.39 ? 164 LYS A CA    1 
ATOM   1295 C  C     . LYS A 1 170 ? 8.024  38.254 1.074   1.00 33.60 ? 164 LYS A C     1 
ATOM   1296 O  O     . LYS A 1 170 ? 8.483  38.027 2.198   1.00 33.22 ? 164 LYS A O     1 
ATOM   1297 C  CB    . LYS A 1 170 ? 9.934  37.963 -0.510  1.00 36.74 ? 164 LYS A CB    1 
ATOM   1298 C  CG    . LYS A 1 170 ? 9.500  36.976 -1.563  1.00 40.71 ? 164 LYS A CG    1 
ATOM   1299 C  CD    . LYS A 1 170 ? 8.622  35.896 -1.002  1.00 43.17 ? 164 LYS A CD    1 
ATOM   1300 C  CE    . LYS A 1 170 ? 8.620  34.712 -1.939  1.00 46.74 ? 164 LYS A CE    1 
ATOM   1301 N  NZ    . LYS A 1 170 ? 10.029 34.272 -2.172  1.00 48.15 ? 164 LYS A NZ    1 
ATOM   1302 N  N     . VAL A 1 171 ? 6.783  37.970 0.719   1.00 34.49 ? 165 VAL A N     1 
ATOM   1303 C  CA    . VAL A 1 171 ? 5.870  37.296 1.620   1.00 36.71 ? 165 VAL A CA    1 
ATOM   1304 C  C     . VAL A 1 171 ? 5.747  35.853 1.137   1.00 36.01 ? 165 VAL A C     1 
ATOM   1305 O  O     . VAL A 1 171 ? 5.728  35.596 -0.068  1.00 35.85 ? 165 VAL A O     1 
ATOM   1306 C  CB    . VAL A 1 171 ? 4.459  37.933 1.586   1.00 39.02 ? 165 VAL A CB    1 
ATOM   1307 C  CG1   . VAL A 1 171 ? 3.443  36.978 2.218   1.00 39.39 ? 165 VAL A CG1   1 
ATOM   1308 C  CG2   . VAL A 1 171 ? 4.463  39.267 2.325   1.00 39.64 ? 165 VAL A CG2   1 
ATOM   1309 N  N     . ILE A 1 172 ? 5.710  34.918 2.076   1.00 36.70 ? 166 ILE A N     1 
ATOM   1310 C  CA    . ILE A 1 172 ? 5.511  33.514 1.740   1.00 37.26 ? 166 ILE A CA    1 
ATOM   1311 C  C     . ILE A 1 172 ? 4.201  33.182 2.452   1.00 39.15 ? 166 ILE A C     1 
ATOM   1312 O  O     . ILE A 1 172 ? 4.158  33.084 3.680   1.00 38.56 ? 166 ILE A O     1 
ATOM   1313 C  CB    . ILE A 1 172 ? 6.659  32.596 2.269   1.00 35.78 ? 166 ILE A CB    1 
ATOM   1314 C  CG1   . ILE A 1 172 ? 7.906  32.730 1.374   1.00 34.05 ? 166 ILE A CG1   1 
ATOM   1315 C  CG2   . ILE A 1 172 ? 6.188  31.137 2.298   1.00 34.58 ? 166 ILE A CG2   1 
ATOM   1316 C  CD1   . ILE A 1 172 ? 9.098  31.862 1.802   1.00 27.12 ? 166 ILE A CD1   1 
ATOM   1317 N  N     . ASP A 1 173 ? 3.127  33.050 1.679   1.00 41.80 ? 167 ASP A N     1 
ATOM   1318 C  CA    . ASP A 1 173 ? 1.816  32.754 2.249   1.00 46.15 ? 167 ASP A CA    1 
ATOM   1319 C  C     . ASP A 1 173 ? 1.597  31.259 2.436   1.00 46.78 ? 167 ASP A C     1 
ATOM   1320 O  O     . ASP A 1 173 ? 2.358  30.432 1.927   1.00 46.11 ? 167 ASP A O     1 
ATOM   1321 C  CB    . ASP A 1 173 ? 0.696  33.325 1.372   1.00 47.44 ? 167 ASP A CB    1 
ATOM   1322 C  CG    . ASP A 1 173 ? 0.687  32.731 -0.026  1.00 48.44 ? 167 ASP A CG    1 
ATOM   1323 O  OD1   . ASP A 1 173 ? 0.951  31.520 -0.156  1.00 48.19 ? 167 ASP A OD1   1 
ATOM   1324 O  OD2   . ASP A 1 173 ? 0.402  33.473 -0.992  1.00 51.04 ? 167 ASP A OD2   1 
ATOM   1325 N  N     . ASP A 1 174 ? 0.531  30.926 3.156   1.00 48.52 ? 168 ASP A N     1 
ATOM   1326 C  CA    . ASP A 1 174 ? 0.205  29.541 3.455   1.00 48.71 ? 168 ASP A CA    1 
ATOM   1327 C  C     . ASP A 1 174 ? 0.281  28.565 2.289   1.00 48.21 ? 168 ASP A C     1 
ATOM   1328 O  O     . ASP A 1 174 ? 0.792  27.456 2.452   1.00 48.34 ? 168 ASP A O     1 
ATOM   1329 C  CB    . ASP A 1 174 ? -1.163 29.474 4.124   1.00 50.28 ? 168 ASP A CB    1 
ATOM   1330 C  CG    . ASP A 1 174 ? -1.229 30.330 5.373   1.00 52.88 ? 168 ASP A CG    1 
ATOM   1331 O  OD1   . ASP A 1 174 ? -0.160 30.590 5.965   1.00 54.33 ? 168 ASP A OD1   1 
ATOM   1332 O  OD2   . ASP A 1 174 ? -2.340 30.737 5.773   1.00 54.72 ? 168 ASP A OD2   1 
ATOM   1333 N  N     . GLU A 1 175 ? -0.205 28.949 1.116   1.00 46.41 ? 169 GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 175 ? -0.127 28.024 -0.009  1.00 46.59 ? 169 GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 175 ? 1.314  27.783 -0.460  1.00 46.99 ? 169 GLU A C     1 
ATOM   1336 O  O     . GLU A 1 175 ? 1.650  26.674 -0.879  1.00 47.15 ? 169 GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 175 ? -0.972 28.503 -1.202  1.00 45.51 ? 169 GLU A CB    1 
ATOM   1338 C  CG    . GLU A 1 175 ? -2.487 28.393 -0.987  1.00 44.32 ? 169 GLU A CG    1 
ATOM   1339 C  CD    . GLU A 1 175 ? -2.914 27.024 -0.468  0.50 44.93 ? 169 GLU A CD    1 
ATOM   1340 O  OE1   . GLU A 1 175 ? -2.735 26.021 -1.193  0.50 43.21 ? 169 GLU A OE1   1 
ATOM   1341 O  OE2   . GLU A 1 175 ? -3.426 26.951 0.672   0.50 44.23 ? 169 GLU A OE2   1 
ATOM   1342 N  N     . GLU A 1 176 ? 2.171  28.802 -0.376  1.00 47.08 ? 170 GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 176 ? 3.557  28.608 -0.797  1.00 47.03 ? 170 GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 176 ? 4.364  27.876 0.267   1.00 44.37 ? 170 GLU A C     1 
ATOM   1345 O  O     . GLU A 1 176 ? 5.348  27.206 -0.044  1.00 45.25 ? 170 GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 176 ? 4.240  29.931 -1.139  1.00 49.80 ? 170 GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 176 ? 5.640  29.711 -1.716  1.00 53.67 ? 170 GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 176 ? 6.299  30.984 -2.187  1.00 56.09 ? 170 GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 176 ? 6.164  32.010 -1.486  1.00 59.20 ? 170 GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 176 ? 6.960  30.956 -3.249  1.00 57.98 ? 170 GLU A OE2   1 
ATOM   1351 N  N     . VAL A 1 177 ? 3.949  28.015 1.521   1.00 42.42 ? 171 VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 177 ? 4.605  27.324 2.621   1.00 41.14 ? 171 VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 177 ? 4.466  25.814 2.367   1.00 43.17 ? 171 VAL A C     1 
ATOM   1354 O  O     . VAL A 1 177 ? 5.363  25.025 2.679   1.00 42.56 ? 171 VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 177 ? 3.936  27.677 3.962   1.00 38.16 ? 171 VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 177 ? 4.226  26.599 4.996   1.00 38.34 ? 171 VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 177 ? 4.453  29.011 4.457   1.00 38.23 ? 171 VAL A CG2   1 
ATOM   1358 N  N     . LYS A 1 178 ? 3.331  25.423 1.791   1.00 42.91 ? 172 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 178 ? 3.073  24.023 1.492   1.00 43.31 ? 172 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 178 ? 3.908  23.550 0.317   1.00 43.30 ? 172 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 178 ? 4.452  22.449 0.346   1.00 43.00 ? 172 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 178 ? 1.583  23.821 1.226   1.00 44.97 ? 172 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 178 ? 0.747  23.923 2.499   1.00 46.69 ? 172 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 178 ? -0.745 24.016 2.203   1.00 51.53 ? 172 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 178 ? -1.581 23.823 3.459   1.00 53.81 ? 172 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 178 ? -3.026 23.816 3.115   1.00 57.64 ? 172 LYS A NZ    1 
ATOM   1367 N  N     . ARG A 1 179 ? 4.029  24.379 -0.716  1.00 44.48 ? 173 ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 179 ? 4.844  23.998 -1.870  1.00 44.45 ? 173 ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 179 ? 6.305  23.846 -1.450  1.00 44.09 ? 173 ARG A C     1 
ATOM   1370 O  O     . ARG A 1 179 ? 6.979  22.903 -1.866  1.00 44.70 ? 173 ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 179 ? 4.752  25.042 -2.984  1.00 45.47 ? 173 ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 179 ? 5.620  24.709 -4.199  1.00 47.26 ? 173 ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 179 ? 5.557  25.798 -5.262  0.50 47.40 ? 173 ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 179 ? 6.082  27.077 -4.785  0.50 48.19 ? 173 ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 179 ? 7.330  27.267 -4.364  0.50 49.16 ? 173 ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 179 ? 8.195  26.261 -4.355  0.50 49.27 ? 173 ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 179 ? 7.716  28.468 -3.951  0.50 48.66 ? 173 ARG A NH2   1 
ATOM   1378 N  N     . LEU A 1 180 ? 6.788  24.777 -0.626  1.00 42.61 ? 174 LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 180 ? 8.176  24.738 -0.156  1.00 41.15 ? 174 LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 180 ? 8.470  23.473 0.643   1.00 39.97 ? 174 LEU A C     1 
ATOM   1381 O  O     . LEU A 1 180 ? 9.485  22.818 0.435   1.00 39.76 ? 174 LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 180 ? 8.484  25.981 0.685   1.00 39.12 ? 174 LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 180 ? 8.564  27.240 -0.184  1.00 40.81 ? 174 LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 180 ? 8.774  28.488 0.673   1.00 40.10 ? 174 LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 180 ? 9.688  27.069 -1.187  1.00 39.10 ? 174 LEU A CD2   1 
ATOM   1386 N  N     . ILE A 1 181 ? 7.576  23.133 1.559   1.00 40.15 ? 175 ILE A N     1 
ATOM   1387 C  CA    . ILE A 1 181 ? 7.738  21.935 2.364   1.00 40.50 ? 175 ILE A CA    1 
ATOM   1388 C  C     . ILE A 1 181 ? 7.971  20.746 1.442   1.00 41.25 ? 175 ILE A C     1 
ATOM   1389 O  O     . ILE A 1 181 ? 8.699  19.810 1.769   1.00 41.83 ? 175 ILE A O     1 
ATOM   1390 C  CB    . ILE A 1 181 ? 6.478  21.679 3.196   1.00 39.84 ? 175 ILE A CB    1 
ATOM   1391 C  CG1   . ILE A 1 181 ? 6.383  22.739 4.299   1.00 38.12 ? 175 ILE A CG1   1 
ATOM   1392 C  CG2   . ILE A 1 181 ? 6.494  20.249 3.737   1.00 41.54 ? 175 ILE A CG2   1 
ATOM   1393 C  CD1   . ILE A 1 181 ? 5.128  22.686 5.136   1.00 36.24 ? 175 ILE A CD1   1 
ATOM   1394 N  N     . ARG A 1 182 ? 7.356  20.810 0.273   1.00 39.69 ? 176 ARG A N     1 
ATOM   1395 C  CA    . ARG A 1 182 ? 7.461  19.745 -0.699  1.00 39.25 ? 176 ARG A CA    1 
ATOM   1396 C  C     . ARG A 1 182 ? 8.623  19.928 -1.679  1.00 38.49 ? 176 ARG A C     1 
ATOM   1397 O  O     . ARG A 1 182 ? 9.292  18.960 -2.037  1.00 37.93 ? 176 ARG A O     1 
ATOM   1398 C  CB    . ARG A 1 182 ? 6.123  19.651 -1.452  1.00 41.71 ? 176 ARG A CB    1 
ATOM   1399 C  CG    . ARG A 1 182 ? 6.047  18.588 -2.534  1.00 42.83 ? 176 ARG A CG    1 
ATOM   1400 C  CD    . ARG A 1 182 ? 4.654  18.539 -3.168  1.00 41.30 ? 176 ARG A CD    1 
ATOM   1401 N  NE    . ARG A 1 182 ? 4.362  19.720 -3.979  1.00 41.20 ? 176 ARG A NE    1 
ATOM   1402 C  CZ    . ARG A 1 182 ? 3.344  20.551 -3.760  1.00 43.14 ? 176 ARG A CZ    1 
ATOM   1403 N  NH1   . ARG A 1 182 ? 2.506  20.343 -2.748  1.00 44.08 ? 176 ARG A NH1   1 
ATOM   1404 N  NH2   . ARG A 1 182 ? 3.159  21.594 -4.556  1.00 43.15 ? 176 ARG A NH2   1 
ATOM   1405 N  N     . GLU A 1 183 ? 8.889  21.169 -2.085  1.00 37.13 ? 177 GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 183 ? 9.935  21.437 -3.066  1.00 37.37 ? 177 GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 183 ? 11.266 22.023 -2.576  1.00 37.47 ? 177 GLU A C     1 
ATOM   1408 O  O     . GLU A 1 183 ? 12.267 21.959 -3.285  1.00 36.65 ? 177 GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 183 ? 9.367  22.348 -4.159  0.50 37.66 ? 177 GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 183 ? 8.035  21.869 -4.723  0.50 40.03 ? 177 GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 183 ? 7.584  22.657 -5.940  0.50 41.49 ? 177 GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 183 ? 6.439  22.446 -6.389  0.50 41.83 ? 177 GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 183 ? 8.375  23.480 -6.454  0.50 42.62 ? 177 GLU A OE2   1 
ATOM   1414 N  N     . LEU A 1 184 ? 11.290 22.576 -1.372  1.00 36.68 ? 178 LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 184 ? 12.511 23.195 -0.863  1.00 36.73 ? 178 LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 184 ? 13.611 22.224 -0.446  1.00 36.61 ? 178 LEU A C     1 
ATOM   1417 O  O     . LEU A 1 184 ? 13.412 21.381 0.426   1.00 38.02 ? 178 LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 184 ? 12.181 24.091 0.333   1.00 35.49 ? 178 LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 184 ? 12.874 25.450 0.471   1.00 36.40 ? 178 LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 184 ? 12.945 25.818 1.946   1.00 31.34 ? 178 LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 184 ? 14.255 25.413 -0.135  1.00 35.81 ? 178 LEU A CD2   1 
ATOM   1422 N  N     . ASP A 1 185 ? 14.775 22.345 -1.069  1.00 37.43 ? 179 ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 185 ? 15.910 21.507 -0.705  1.00 38.38 ? 179 ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 185 ? 16.014 21.644 0.821   1.00 37.02 ? 179 ASP A C     1 
ATOM   1425 O  O     . ASP A 1 185 ? 16.067 22.759 1.338   1.00 37.17 ? 179 ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 185 ? 17.175 22.050 -1.369  1.00 41.96 ? 179 ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 185 ? 18.383 21.149 -1.167  1.00 47.26 ? 179 ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 185 ? 18.405 20.368 -0.186  1.00 48.80 ? 179 ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 185 ? 19.325 21.233 -1.990  1.00 50.25 ? 179 ASP A OD2   1 
ATOM   1430 N  N     . ILE A 1 186 ? 16.036 20.531 1.548   1.00 37.09 ? 180 ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 186 ? 16.094 20.611 3.004   1.00 37.90 ? 180 ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 186 ? 17.367 21.294 3.514   1.00 38.69 ? 180 ILE A C     1 
ATOM   1433 O  O     . ILE A 1 186 ? 17.398 21.837 4.623   1.00 37.36 ? 180 ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 186 ? 15.924 19.212 3.657   1.00 37.18 ? 180 ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 186 ? 15.599 19.382 5.142   1.00 37.00 ? 180 ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 186 ? 17.177 18.377 3.474   1.00 37.80 ? 180 ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 186 ? 14.890 18.198 5.760   1.00 34.46 ? 180 ILE A CD1   1 
ATOM   1438 N  N     . ALA A 1 187 ? 18.412 21.277 2.695   1.00 39.10 ? 181 ALA A N     1 
ATOM   1439 C  CA    . ALA A 1 187 ? 19.656 21.920 3.067   1.00 39.43 ? 181 ALA A CA    1 
ATOM   1440 C  C     . ALA A 1 187 ? 19.389 23.414 3.184   1.00 38.91 ? 181 ALA A C     1 
ATOM   1441 O  O     . ALA A 1 187 ? 20.001 24.077 3.992   1.00 38.03 ? 181 ALA A O     1 
ATOM   1442 C  CB    . ALA A 1 187 ? 20.732 21.658 2.023   1.00 39.24 ? 181 ALA A CB    1 
ATOM   1443 N  N     . ASP A 1 188 ? 18.452 23.937 2.397   1.00 39.24 ? 182 ASP A N     1 
ATOM   1444 C  CA    . ASP A 1 188 ? 18.132 25.364 2.447   1.00 37.47 ? 182 ASP A CA    1 
ATOM   1445 C  C     . ASP A 1 188 ? 17.332 25.746 3.690   1.00 34.93 ? 182 ASP A C     1 
ATOM   1446 O  O     . ASP A 1 188 ? 16.950 26.901 3.867   1.00 34.09 ? 182 ASP A O     1 
ATOM   1447 C  CB    . ASP A 1 188 ? 17.370 25.791 1.185   1.00 41.50 ? 182 ASP A CB    1 
ATOM   1448 C  CG    . ASP A 1 188 ? 18.215 25.665 -0.081  1.00 45.73 ? 182 ASP A CG    1 
ATOM   1449 O  OD1   . ASP A 1 188 ? 19.461 25.656 0.030   1.00 46.78 ? 182 ASP A OD1   1 
ATOM   1450 O  OD2   . ASP A 1 188 ? 17.636 25.588 -1.191  1.00 49.02 ? 182 ASP A OD2   1 
ATOM   1451 N  N     . VAL A 1 189 ? 17.078 24.772 4.554   1.00 32.78 ? 183 VAL A N     1 
ATOM   1452 C  CA    . VAL A 1 189 ? 16.343 25.028 5.788   1.00 30.10 ? 183 VAL A CA    1 
ATOM   1453 C  C     . VAL A 1 189 ? 17.308 25.527 6.876   1.00 30.12 ? 183 VAL A C     1 
ATOM   1454 O  O     . VAL A 1 189 ? 18.364 24.932 7.115   1.00 27.20 ? 183 VAL A O     1 
ATOM   1455 C  CB    . VAL A 1 189 ? 15.633 23.745 6.295   1.00 31.48 ? 183 VAL A CB    1 
ATOM   1456 C  CG1   . VAL A 1 189 ? 14.943 24.019 7.633   1.00 29.09 ? 183 VAL A CG1   1 
ATOM   1457 C  CG2   . VAL A 1 189 ? 14.614 23.263 5.259   1.00 30.64 ? 183 VAL A CG2   1 
ATOM   1458 N  N     . PRO A 1 190 ? 16.958 26.640 7.538   1.00 28.65 ? 184 PRO A N     1 
ATOM   1459 C  CA    . PRO A 1 190 ? 17.788 27.213 8.596   1.00 28.93 ? 184 PRO A CA    1 
ATOM   1460 C  C     . PRO A 1 190 ? 18.098 26.182 9.686   1.00 29.62 ? 184 PRO A C     1 
ATOM   1461 O  O     . PRO A 1 190 ? 17.204 25.485 10.160  1.00 28.50 ? 184 PRO A O     1 
ATOM   1462 C  CB    . PRO A 1 190 ? 16.928 28.363 9.111   1.00 31.31 ? 184 PRO A CB    1 
ATOM   1463 C  CG    . PRO A 1 190 ? 16.215 28.820 7.865   1.00 29.24 ? 184 PRO A CG    1 
ATOM   1464 C  CD    . PRO A 1 190 ? 15.811 27.513 7.229   1.00 29.39 ? 184 PRO A CD    1 
ATOM   1465 N  N     . GLY A 1 191 ? 19.366 26.080 10.071  1.00 28.72 ? 185 GLY A N     1 
ATOM   1466 C  CA    . GLY A 1 191 ? 19.742 25.126 11.105  1.00 28.99 ? 185 GLY A CA    1 
ATOM   1467 C  C     . GLY A 1 191 ? 20.267 23.816 10.544  1.00 29.58 ? 185 GLY A C     1 
ATOM   1468 O  O     . GLY A 1 191 ? 20.790 22.966 11.270  1.00 28.69 ? 185 GLY A O     1 
ATOM   1469 N  N     . ILE A 1 192 ? 20.121 23.647 9.237   1.00 28.92 ? 186 ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 192 ? 20.598 22.447 8.583   1.00 28.73 ? 186 ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 192 ? 21.892 22.781 7.860   1.00 29.75 ? 186 ILE A C     1 
ATOM   1472 O  O     . ILE A 1 192 ? 21.879 23.423 6.816   1.00 27.79 ? 186 ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 192 ? 19.582 21.913 7.556   1.00 30.71 ? 186 ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 192 ? 18.269 21.552 8.265   1.00 29.76 ? 186 ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 192 ? 20.179 20.695 6.825   1.00 29.67 ? 186 ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 192 ? 18.434 20.487 9.341   1.00 30.16 ? 186 ILE A CD1   1 
ATOM   1477 N  N     . GLY A 1 193 ? 23.008 22.348 8.433   1.00 30.95 ? 187 GLY A N     1 
ATOM   1478 C  CA    . GLY A 1 193 ? 24.295 22.608 7.825   1.00 33.05 ? 187 GLY A CA    1 
ATOM   1479 C  C     . GLY A 1 193 ? 24.763 21.439 6.988   1.00 33.95 ? 187 GLY A C     1 
ATOM   1480 O  O     . GLY A 1 193 ? 24.054 20.441 6.825   1.00 33.22 ? 187 GLY A O     1 
ATOM   1481 N  N     . ASN A 1 194 ? 25.969 21.548 6.457   1.00 35.69 ? 188 ASN A N     1 
ATOM   1482 C  CA    . ASN A 1 194 ? 26.501 20.483 5.627   1.00 38.12 ? 188 ASN A CA    1 
ATOM   1483 C  C     . ASN A 1 194 ? 26.573 19.130 6.308   1.00 37.88 ? 188 ASN A C     1 
ATOM   1484 O  O     . ASN A 1 194 ? 26.348 18.107 5.665   1.00 38.13 ? 188 ASN A O     1 
ATOM   1485 C  CB    . ASN A 1 194 ? 27.865 20.892 5.086   1.00 43.03 ? 188 ASN A CB    1 
ATOM   1486 C  CG    . ASN A 1 194 ? 27.750 21.989 4.048   1.00 45.40 ? 188 ASN A CG    1 
ATOM   1487 O  OD1   . ASN A 1 194 ? 27.067 21.819 3.038   1.00 49.80 ? 188 ASN A OD1   1 
ATOM   1488 N  ND2   . ASN A 1 194 ? 28.401 23.122 4.291   1.00 47.60 ? 188 ASN A ND2   1 
ATOM   1489 N  N     . ILE A 1 195 ? 26.867 19.108 7.605   1.00 37.08 ? 189 ILE A N     1 
ATOM   1490 C  CA    . ILE A 1 195 ? 26.941 17.828 8.301   1.00 37.54 ? 189 ILE A CA    1 
ATOM   1491 C  C     . ILE A 1 195 ? 25.564 17.195 8.337   1.00 35.42 ? 189 ILE A C     1 
ATOM   1492 O  O     . ILE A 1 195 ? 25.374 16.057 7.899   1.00 35.02 ? 189 ILE A O     1 
ATOM   1493 C  CB    . ILE A 1 195 ? 27.412 17.970 9.755   1.00 37.45 ? 189 ILE A CB    1 
ATOM   1494 C  CG1   . ILE A 1 195 ? 28.859 18.483 9.804   1.00 41.08 ? 189 ILE A CG1   1 
ATOM   1495 C  CG2   . ILE A 1 195 ? 27.292 16.623 10.452  1.00 37.75 ? 189 ILE A CG2   1 
ATOM   1496 C  CD1   . ILE A 1 195 ? 29.900 17.509 9.265   1.00 40.61 ? 189 ILE A CD1   1 
ATOM   1497 N  N     . THR A 1 196 ? 24.608 17.946 8.873   1.00 33.52 ? 190 THR A N     1 
ATOM   1498 C  CA    . THR A 1 196 ? 23.239 17.471 8.982   1.00 32.16 ? 190 THR A CA    1 
ATOM   1499 C  C     . THR A 1 196 ? 22.625 17.137 7.618   1.00 31.11 ? 190 THR A C     1 
ATOM   1500 O  O     . THR A 1 196 ? 21.932 16.130 7.487   1.00 31.64 ? 190 THR A O     1 
ATOM   1501 C  CB    . THR A 1 196 ? 22.342 18.507 9.712   1.00 32.06 ? 190 THR A CB    1 
ATOM   1502 O  OG1   . THR A 1 196 ? 22.890 18.785 11.009  1.00 32.44 ? 190 THR A OG1   1 
ATOM   1503 C  CG2   . THR A 1 196 ? 20.924 17.961 9.888   1.00 29.01 ? 190 THR A CG2   1 
ATOM   1504 N  N     . ALA A 1 197 ? 22.878 17.969 6.610   1.00 29.85 ? 191 ALA A N     1 
ATOM   1505 C  CA    . ALA A 1 197 ? 22.332 17.739 5.265   1.00 31.22 ? 191 ALA A CA    1 
ATOM   1506 C  C     . ALA A 1 197 ? 22.799 16.416 4.653   1.00 32.19 ? 191 ALA A C     1 
ATOM   1507 O  O     . ALA A 1 197 ? 22.012 15.706 4.025   1.00 32.15 ? 191 ALA A O     1 
ATOM   1508 C  CB    . ALA A 1 197 ? 22.705 18.902 4.332   1.00 28.73 ? 191 ALA A CB    1 
ATOM   1509 N  N     . GLU A 1 198 ? 24.081 16.094 4.831   1.00 33.40 ? 192 GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 198 ? 24.638 14.853 4.301   1.00 32.73 ? 192 GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 198 ? 24.067 13.685 5.082   1.00 33.59 ? 192 GLU A C     1 
ATOM   1512 O  O     . GLU A 1 198 ? 23.833 12.613 4.519   1.00 33.90 ? 192 GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 198 ? 26.175 14.871 4.385   1.00 33.46 ? 192 GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 198 ? 26.831 15.873 3.435   0.50 33.10 ? 192 GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 198 ? 26.674 15.495 1.964   0.50 35.51 ? 192 GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 198 ? 26.917 16.361 1.092   0.50 35.44 ? 192 GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 198 ? 26.319 14.330 1.676   0.50 36.15 ? 192 GLU A OE2   1 
ATOM   1518 N  N     . LYS A 1 199 ? 23.834 13.886 6.379   1.00 31.58 ? 193 LYS A N     1 
ATOM   1519 C  CA    . LYS A 1 199 ? 23.246 12.829 7.195   1.00 32.95 ? 193 LYS A CA    1 
ATOM   1520 C  C     . LYS A 1 199 ? 21.822 12.566 6.712   1.00 33.06 ? 193 LYS A C     1 
ATOM   1521 O  O     . LYS A 1 199 ? 21.358 11.425 6.696   1.00 34.55 ? 193 LYS A O     1 
ATOM   1522 C  CB    . LYS A 1 199 ? 23.162 13.224 8.680   1.00 34.52 ? 193 LYS A CB    1 
ATOM   1523 C  CG    . LYS A 1 199 ? 24.477 13.318 9.429   1.00 37.58 ? 193 LYS A CG    1 
ATOM   1524 C  CD    . LYS A 1 199 ? 24.223 13.568 10.917  1.00 39.58 ? 193 LYS A CD    1 
ATOM   1525 C  CE    . LYS A 1 199 ? 25.482 14.054 11.628  1.00 42.02 ? 193 LYS A CE    1 
ATOM   1526 N  NZ    . LYS A 1 199 ? 25.270 14.370 13.071  1.00 40.17 ? 193 LYS A NZ    1 
ATOM   1527 N  N     . LEU A 1 200 ? 21.114 13.630 6.343   1.00 32.98 ? 194 LEU A N     1 
ATOM   1528 C  CA    . LEU A 1 200 ? 19.734 13.481 5.896   1.00 32.19 ? 194 LEU A CA    1 
ATOM   1529 C  C     . LEU A 1 200 ? 19.658 12.834 4.517   1.00 32.61 ? 194 LEU A C     1 
ATOM   1530 O  O     . LEU A 1 200 ? 18.757 12.046 4.261   1.00 31.75 ? 194 LEU A O     1 
ATOM   1531 C  CB    . LEU A 1 200 ? 19.025 14.841 5.910   1.00 31.01 ? 194 LEU A CB    1 
ATOM   1532 C  CG    . LEU A 1 200 ? 18.897 15.488 7.299   1.00 31.57 ? 194 LEU A CG    1 
ATOM   1533 C  CD1   . LEU A 1 200 ? 18.523 16.957 7.164   1.00 30.97 ? 194 LEU A CD1   1 
ATOM   1534 C  CD2   . LEU A 1 200 ? 17.860 14.747 8.130   1.00 29.15 ? 194 LEU A CD2   1 
ATOM   1535 N  N     . LYS A 1 201 ? 20.606 13.159 3.638   1.00 34.73 ? 195 LYS A N     1 
ATOM   1536 C  CA    . LYS A 1 201 ? 20.637 12.568 2.295   1.00 38.44 ? 195 LYS A CA    1 
ATOM   1537 C  C     . LYS A 1 201 ? 20.762 11.051 2.393   1.00 38.47 ? 195 LYS A C     1 
ATOM   1538 O  O     . LYS A 1 201 ? 20.071 10.311 1.693   1.00 38.55 ? 195 LYS A O     1 
ATOM   1539 C  CB    . LYS A 1 201 ? 21.831 13.081 1.487   1.00 39.59 ? 195 LYS A CB    1 
ATOM   1540 C  CG    . LYS A 1 201 ? 21.682 14.468 0.908   1.00 40.65 ? 195 LYS A CG    1 
ATOM   1541 C  CD    . LYS A 1 201 ? 22.962 14.859 0.192   0.50 40.45 ? 195 LYS A CD    1 
ATOM   1542 C  CE    . LYS A 1 201 ? 22.932 16.307 -0.254  0.50 41.80 ? 195 LYS A CE    1 
ATOM   1543 N  NZ    . LYS A 1 201 ? 24.251 16.718 -0.813  0.50 43.52 ? 195 LYS A NZ    1 
ATOM   1544 N  N     . LYS A 1 202 ? 21.660 10.604 3.265   1.00 39.22 ? 196 LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 202 ? 21.894 9.188  3.465   1.00 39.42 ? 196 LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 202 ? 20.631 8.481  3.940   1.00 39.55 ? 196 LYS A C     1 
ATOM   1547 O  O     . LYS A 1 202 ? 20.447 7.293  3.687   1.00 40.54 ? 196 LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 202 ? 23.024 8.973  4.476   1.00 40.85 ? 196 LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 202 ? 24.353 9.630  4.084   1.00 45.05 ? 196 LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 202 ? 25.516 9.101  4.934   1.00 46.80 ? 196 LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 202 ? 26.713 10.066 4.947   1.00 48.75 ? 196 LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 202 ? 26.484 11.289 5.796   1.00 47.45 ? 196 LYS A NZ    1 
ATOM   1553 N  N     . LEU A 1 203 ? 19.762 9.205  4.638   1.00 38.65 ? 197 LEU A N     1 
ATOM   1554 C  CA    . LEU A 1 203 ? 18.519 8.618  5.128   1.00 37.74 ? 197 LEU A CA    1 
ATOM   1555 C  C     . LEU A 1 203 ? 17.433 8.742  4.062   1.00 37.17 ? 197 LEU A C     1 
ATOM   1556 O  O     . LEU A 1 203 ? 16.291 8.325  4.268   1.00 36.79 ? 197 LEU A O     1 
ATOM   1557 C  CB    . LEU A 1 203 ? 18.072 9.315  6.425   1.00 39.11 ? 197 LEU A CB    1 
ATOM   1558 C  CG    . LEU A 1 203 ? 18.915 9.098  7.692   1.00 40.20 ? 197 LEU A CG    1 
ATOM   1559 C  CD1   . LEU A 1 203 ? 18.452 10.024 8.825   1.00 38.46 ? 197 LEU A CD1   1 
ATOM   1560 C  CD2   . LEU A 1 203 ? 18.796 7.644  8.117   1.00 37.86 ? 197 LEU A CD2   1 
ATOM   1561 N  N     . GLY A 1 204 ? 17.800 9.321  2.919   1.00 36.32 ? 198 GLY A N     1 
ATOM   1562 C  CA    . GLY A 1 204 ? 16.855 9.499  1.837   1.00 35.07 ? 198 GLY A CA    1 
ATOM   1563 C  C     . GLY A 1 204 ? 15.983 10.733 1.975   1.00 36.82 ? 198 GLY A C     1 
ATOM   1564 O  O     . GLY A 1 204 ? 15.009 10.885 1.238   1.00 38.56 ? 198 GLY A O     1 
ATOM   1565 N  N     . ILE A 1 205 ? 16.322 11.620 2.909   1.00 37.11 ? 199 ILE A N     1 
ATOM   1566 C  CA    . ILE A 1 205 ? 15.551 12.843 3.135   1.00 36.34 ? 199 ILE A CA    1 
ATOM   1567 C  C     . ILE A 1 205 ? 16.180 14.031 2.417   1.00 38.82 ? 199 ILE A C     1 
ATOM   1568 O  O     . ILE A 1 205 ? 17.274 14.479 2.769   1.00 37.68 ? 199 ILE A O     1 
ATOM   1569 C  CB    . ILE A 1 205 ? 15.452 13.156 4.641   1.00 36.14 ? 199 ILE A CB    1 
ATOM   1570 C  CG1   . ILE A 1 205 ? 14.756 11.993 5.360   1.00 35.22 ? 199 ILE A CG1   1 
ATOM   1571 C  CG2   . ILE A 1 205 ? 14.677 14.447 4.855   1.00 34.65 ? 199 ILE A CG2   1 
ATOM   1572 C  CD1   . ILE A 1 205 ? 14.820 12.065 6.854   1.00 33.24 ? 199 ILE A CD1   1 
ATOM   1573 N  N     . ASN A 1 206 ? 15.469 14.545 1.413   1.00 39.96 ? 200 ASN A N     1 
ATOM   1574 C  CA    . ASN A 1 206 ? 15.943 15.667 0.609   1.00 40.92 ? 200 ASN A CA    1 
ATOM   1575 C  C     . ASN A 1 206 ? 15.048 16.896 0.730   1.00 40.38 ? 200 ASN A C     1 
ATOM   1576 O  O     . ASN A 1 206 ? 15.433 17.988 0.319   1.00 39.53 ? 200 ASN A O     1 
ATOM   1577 C  CB    . ASN A 1 206 ? 16.023 15.248 -0.864  1.00 43.81 ? 200 ASN A CB    1 
ATOM   1578 C  CG    . ASN A 1 206 ? 16.902 14.018 -1.078  1.00 46.57 ? 200 ASN A CG    1 
ATOM   1579 O  OD1   . ASN A 1 206 ? 18.124 14.077 -0.928  1.00 48.26 ? 200 ASN A OD1   1 
ATOM   1580 N  ND2   . ASN A 1 206 ? 16.278 12.896 -1.423  1.00 47.52 ? 200 ASN A ND2   1 
ATOM   1581 N  N     . LYS A 1 207 ? 13.859 16.708 1.299   1.00 39.57 ? 201 LYS A N     1 
ATOM   1582 C  CA    . LYS A 1 207 ? 12.892 17.789 1.459   1.00 38.44 ? 201 LYS A CA    1 
ATOM   1583 C  C     . LYS A 1 207 ? 12.212 17.639 2.810   1.00 37.76 ? 201 LYS A C     1 
ATOM   1584 O  O     . LYS A 1 207 ? 12.150 16.541 3.353   1.00 39.37 ? 201 LYS A O     1 
ATOM   1585 C  CB    . LYS A 1 207 ? 11.834 17.712 0.355   1.00 39.16 ? 201 LYS A CB    1 
ATOM   1586 C  CG    . LYS A 1 207 ? 12.371 17.419 -1.037  1.00 39.47 ? 201 LYS A CG    1 
ATOM   1587 C  CD    . LYS A 1 207 ? 13.045 18.618 -1.653  1.00 41.16 ? 201 LYS A CD    1 
ATOM   1588 C  CE    . LYS A 1 207 ? 13.235 18.405 -3.139  1.00 41.28 ? 201 LYS A CE    1 
ATOM   1589 N  NZ    . LYS A 1 207 ? 13.853 19.589 -3.787  1.00 43.83 ? 201 LYS A NZ    1 
ATOM   1590 N  N     . LEU A 1 208 ? 11.695 18.738 3.351   1.00 36.38 ? 202 LEU A N     1 
ATOM   1591 C  CA    . LEU A 1 208 ? 11.025 18.683 4.641   1.00 36.39 ? 202 LEU A CA    1 
ATOM   1592 C  C     . LEU A 1 208 ? 9.975  17.591 4.621   1.00 37.55 ? 202 LEU A C     1 
ATOM   1593 O  O     . LEU A 1 208 ? 9.840  16.824 5.579   1.00 39.40 ? 202 LEU A O     1 
ATOM   1594 C  CB    . LEU A 1 208 ? 10.344 20.014 4.963   1.00 35.19 ? 202 LEU A CB    1 
ATOM   1595 C  CG    . LEU A 1 208 ? 11.205 21.196 5.414   1.00 34.63 ? 202 LEU A CG    1 
ATOM   1596 C  CD1   . LEU A 1 208 ? 10.335 22.428 5.560   1.00 32.35 ? 202 LEU A CD1   1 
ATOM   1597 C  CD2   . LEU A 1 208 ? 11.881 20.861 6.735   1.00 31.32 ? 202 LEU A CD2   1 
ATOM   1598 N  N     . VAL A 1 209 ? 9.233  17.523 3.520   1.00 37.67 ? 203 VAL A N     1 
ATOM   1599 C  CA    . VAL A 1 209 ? 8.166  16.538 3.391   1.00 39.34 ? 203 VAL A CA    1 
ATOM   1600 C  C     . VAL A 1 209 ? 8.639  15.126 3.750   1.00 37.20 ? 203 VAL A C     1 
ATOM   1601 O  O     . VAL A 1 209 ? 7.956  14.411 4.471   1.00 35.97 ? 203 VAL A O     1 
ATOM   1602 C  CB    . VAL A 1 209 ? 7.542  16.563 1.954   1.00 39.25 ? 203 VAL A CB    1 
ATOM   1603 C  CG1   . VAL A 1 209 ? 8.580  16.232 0.908   1.00 40.36 ? 203 VAL A CG1   1 
ATOM   1604 C  CG2   . VAL A 1 209 ? 6.376  15.599 1.881   1.00 42.72 ? 203 VAL A CG2   1 
ATOM   1605 N  N     . ASP A 1 210 ? 9.826  14.749 3.288   1.00 37.33 ? 204 ASP A N     1 
ATOM   1606 C  CA    . ASP A 1 210 ? 10.354 13.419 3.566   1.00 38.38 ? 204 ASP A CA    1 
ATOM   1607 C  C     . ASP A 1 210 ? 10.507 13.081 5.051   1.00 40.05 ? 204 ASP A C     1 
ATOM   1608 O  O     . ASP A 1 210 ? 10.339 11.925 5.441   1.00 41.62 ? 204 ASP A O     1 
ATOM   1609 C  CB    . ASP A 1 210 ? 11.689 13.230 2.846   1.00 37.38 ? 204 ASP A CB    1 
ATOM   1610 C  CG    . ASP A 1 210 ? 11.608 13.606 1.376   1.00 40.14 ? 204 ASP A CG    1 
ATOM   1611 O  OD1   . ASP A 1 210 ? 10.482 13.662 0.842   1.00 41.96 ? 204 ASP A OD1   1 
ATOM   1612 O  OD2   . ASP A 1 210 ? 12.663 13.837 0.750   1.00 39.31 ? 204 ASP A OD2   1 
ATOM   1613 N  N     . THR A 1 211 ? 10.807 14.073 5.882   1.00 39.76 ? 205 THR A N     1 
ATOM   1614 C  CA    . THR A 1 211 ? 10.978 13.814 7.307   1.00 40.13 ? 205 THR A CA    1 
ATOM   1615 C  C     . THR A 1 211 ? 9.730  13.159 7.898   1.00 42.05 ? 205 THR A C     1 
ATOM   1616 O  O     . THR A 1 211 ? 9.780  12.576 8.981   1.00 43.28 ? 205 THR A O     1 
ATOM   1617 C  CB    . THR A 1 211 ? 11.298 15.121 8.110   1.00 38.97 ? 205 THR A CB    1 
ATOM   1618 O  OG1   . THR A 1 211 ? 10.112 15.913 8.258   1.00 38.05 ? 205 THR A OG1   1 
ATOM   1619 C  CG2   . THR A 1 211 ? 12.350 15.952 7.385   1.00 38.39 ? 205 THR A CG2   1 
ATOM   1620 N  N     . LEU A 1 212 ? 8.610  13.242 7.186   1.00 42.88 ? 206 LEU A N     1 
ATOM   1621 C  CA    . LEU A 1 212 ? 7.369  12.655 7.682   1.00 44.84 ? 206 LEU A CA    1 
ATOM   1622 C  C     . LEU A 1 212 ? 7.223  11.163 7.365   1.00 45.43 ? 206 LEU A C     1 
ATOM   1623 O  O     . LEU A 1 212 ? 6.361  10.489 7.922   1.00 44.67 ? 206 LEU A O     1 
ATOM   1624 C  CB    . LEU A 1 212 ? 6.170  13.417 7.111   1.00 45.50 ? 206 LEU A CB    1 
ATOM   1625 C  CG    . LEU A 1 212 ? 6.171  14.934 7.321   1.00 46.54 ? 206 LEU A CG    1 
ATOM   1626 C  CD1   . LEU A 1 212 ? 4.970  15.551 6.614   1.00 45.75 ? 206 LEU A CD1   1 
ATOM   1627 C  CD2   . LEU A 1 212 ? 6.159  15.251 8.808   1.00 45.83 ? 206 LEU A CD2   1 
ATOM   1628 N  N     . SER A 1 213 ? 8.067  10.644 6.482   1.00 47.80 ? 207 SER A N     1 
ATOM   1629 C  CA    . SER A 1 213 ? 7.988  9.232  6.104   1.00 49.40 ? 207 SER A CA    1 
ATOM   1630 C  C     . SER A 1 213 ? 9.125  8.392  6.671   1.00 49.27 ? 207 SER A C     1 
ATOM   1631 O  O     . SER A 1 213 ? 9.568  7.431  6.044   1.00 50.99 ? 207 SER A O     1 
ATOM   1632 C  CB    . SER A 1 213 ? 7.979  9.104  4.583   1.00 49.99 ? 207 SER A CB    1 
ATOM   1633 O  OG    . SER A 1 213 ? 6.911  9.849  4.027   1.00 53.03 ? 207 SER A OG    1 
ATOM   1634 N  N     . ILE A 1 214 ? 9.603  8.760  7.852   1.00 47.30 ? 208 ILE A N     1 
ATOM   1635 C  CA    . ILE A 1 214 ? 10.681 8.018  8.489   1.00 44.86 ? 208 ILE A CA    1 
ATOM   1636 C  C     . ILE A 1 214 ? 10.339 7.883  9.958   1.00 44.49 ? 208 ILE A C     1 
ATOM   1637 O  O     . ILE A 1 214 ? 9.731  8.781  10.540  1.00 43.52 ? 208 ILE A O     1 
ATOM   1638 C  CB    . ILE A 1 214 ? 12.028 8.754  8.353   1.00 44.32 ? 208 ILE A CB    1 
ATOM   1639 C  CG1   . ILE A 1 214 ? 13.140 7.956  9.046   1.00 41.35 ? 208 ILE A CG1   1 
ATOM   1640 C  CG2   . ILE A 1 214 ? 11.920 10.139 8.966   1.00 43.71 ? 208 ILE A CG2   1 
ATOM   1641 C  CD1   . ILE A 1 214 ? 14.528 8.541  8.859   1.00 38.92 ? 208 ILE A CD1   1 
ATOM   1642 N  N     . GLU A 1 215 ? 10.707 6.761  10.560  1.00 44.73 ? 209 GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 215 ? 10.426 6.566  11.971  1.00 44.94 ? 209 GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 215 ? 11.219 7.600  12.747  1.00 43.92 ? 209 GLU A C     1 
ATOM   1645 O  O     . GLU A 1 215 ? 12.422 7.764  12.533  1.00 43.70 ? 209 GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 215 ? 10.813 5.154  12.407  1.00 47.05 ? 209 GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 215 ? 9.948  4.073  11.772  1.00 51.16 ? 209 GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 215 ? 8.508  4.107  12.264  1.00 54.45 ? 209 GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 215 ? 8.240  3.577  13.365  1.00 54.55 ? 209 GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 215 ? 7.644  4.675  11.554  1.00 57.85 ? 209 GLU A OE2   1 
ATOM   1651 N  N     . PHE A 1 216 ? 10.528 8.297  13.641  1.00 43.33 ? 210 PHE A N     1 
ATOM   1652 C  CA    . PHE A 1 216 ? 11.136 9.336  14.448  1.00 43.75 ? 210 PHE A CA    1 
ATOM   1653 C  C     . PHE A 1 216 ? 12.436 8.919  15.112  1.00 43.60 ? 210 PHE A C     1 
ATOM   1654 O  O     . PHE A 1 216 ? 13.428 9.647  15.058  1.00 41.68 ? 210 PHE A O     1 
ATOM   1655 C  CB    . PHE A 1 216 ? 10.170 9.805  15.532  1.00 43.34 ? 210 PHE A CB    1 
ATOM   1656 C  CG    . PHE A 1 216 ? 10.745 10.864 16.416  1.00 44.51 ? 210 PHE A CG    1 
ATOM   1657 C  CD1   . PHE A 1 216 ? 10.951 12.153 15.928  1.00 44.16 ? 210 PHE A CD1   1 
ATOM   1658 C  CD2   . PHE A 1 216 ? 11.123 10.568 17.723  1.00 44.46 ? 210 PHE A CD2   1 
ATOM   1659 C  CE1   . PHE A 1 216 ? 11.523 13.132 16.727  1.00 43.70 ? 210 PHE A CE1   1 
ATOM   1660 C  CE2   . PHE A 1 216 ? 11.699 11.541 18.534  1.00 44.58 ? 210 PHE A CE2   1 
ATOM   1661 C  CZ    . PHE A 1 216 ? 11.900 12.826 18.034  1.00 44.54 ? 210 PHE A CZ    1 
ATOM   1662 N  N     . ASP A 1 217 ? 12.424 7.755  15.749  1.00 44.32 ? 211 ASP A N     1 
ATOM   1663 C  CA    . ASP A 1 217 ? 13.603 7.258  16.442  1.00 45.04 ? 211 ASP A CA    1 
ATOM   1664 C  C     . ASP A 1 217 ? 14.807 7.112  15.540  1.00 43.90 ? 211 ASP A C     1 
ATOM   1665 O  O     . ASP A 1 217 ? 15.945 7.226  15.995  1.00 45.39 ? 211 ASP A O     1 
ATOM   1666 C  CB    . ASP A 1 217 ? 13.296 5.920  17.114  1.00 48.53 ? 211 ASP A CB    1 
ATOM   1667 C  CG    . ASP A 1 217 ? 12.445 6.079  18.351  1.00 52.27 ? 211 ASP A CG    1 
ATOM   1668 O  OD1   . ASP A 1 217 ? 12.844 6.853  19.252  1.00 54.57 ? 211 ASP A OD1   1 
ATOM   1669 O  OD2   . ASP A 1 217 ? 11.380 5.430  18.425  1.00 56.40 ? 211 ASP A OD2   1 
ATOM   1670 N  N     . LYS A 1 218 ? 14.562 6.853  14.262  1.00 43.35 ? 212 LYS A N     1 
ATOM   1671 C  CA    . LYS A 1 218 ? 15.649 6.703  13.300  1.00 42.06 ? 212 LYS A CA    1 
ATOM   1672 C  C     . LYS A 1 218 ? 16.209 8.091  12.988  1.00 40.02 ? 212 LYS A C     1 
ATOM   1673 O  O     . LYS A 1 218 ? 17.423 8.283  12.892  1.00 40.56 ? 212 LYS A O     1 
ATOM   1674 C  CB    . LYS A 1 218 ? 15.125 6.032  12.023  1.00 43.22 ? 212 LYS A CB    1 
ATOM   1675 C  CG    . LYS A 1 218 ? 16.166 5.810  10.934  0.50 41.76 ? 212 LYS A CG    1 
ATOM   1676 C  CD    . LYS A 1 218 ? 15.500 5.284  9.670   0.50 41.26 ? 212 LYS A CD    1 
ATOM   1677 C  CE    . LYS A 1 218 ? 16.485 5.148  8.519   0.50 41.72 ? 212 LYS A CE    1 
ATOM   1678 N  NZ    . LYS A 1 218 ? 17.556 4.161  8.815   0.50 41.50 ? 212 LYS A NZ    1 
ATOM   1679 N  N     . LEU A 1 219 ? 15.309 9.055  12.826  1.00 38.69 ? 213 LEU A N     1 
ATOM   1680 C  CA    . LEU A 1 219 ? 15.704 10.436 12.547  1.00 37.13 ? 213 LEU A CA    1 
ATOM   1681 C  C     . LEU A 1 219 ? 16.481 10.917 13.769  1.00 36.57 ? 213 LEU A C     1 
ATOM   1682 O  O     . LEU A 1 219 ? 17.608 11.392 13.666  1.00 35.30 ? 213 LEU A O     1 
ATOM   1683 C  CB    . LEU A 1 219 ? 14.468 11.320 12.379  1.00 36.32 ? 213 LEU A CB    1 
ATOM   1684 C  CG    . LEU A 1 219 ? 14.368 12.217 11.145  1.00 38.40 ? 213 LEU A CG    1 
ATOM   1685 C  CD1   . LEU A 1 219 ? 13.314 13.286 11.395  1.00 30.63 ? 213 LEU A CD1   1 
ATOM   1686 C  CD2   . LEU A 1 219 ? 15.718 12.852 10.836  1.00 36.23 ? 213 LEU A CD2   1 
ATOM   1687 N  N     . LYS A 1 220 ? 15.843 10.781 14.924  1.00 36.84 ? 214 LYS A N     1 
ATOM   1688 C  CA    . LYS A 1 220 ? 16.403 11.169 16.210  1.00 39.51 ? 214 LYS A CA    1 
ATOM   1689 C  C     . LYS A 1 220 ? 17.826 10.641 16.338  1.00 40.14 ? 214 LYS A C     1 
ATOM   1690 O  O     . LYS A 1 220 ? 18.775 11.406 16.515  1.00 40.35 ? 214 LYS A O     1 
ATOM   1691 C  CB    . LYS A 1 220 ? 15.523 10.591 17.312  1.00 40.47 ? 214 LYS A CB    1 
ATOM   1692 C  CG    . LYS A 1 220 ? 15.875 10.968 18.722  1.00 42.97 ? 214 LYS A CG    1 
ATOM   1693 C  CD    . LYS A 1 220 ? 14.711 10.579 19.625  1.00 45.01 ? 214 LYS A CD    1 
ATOM   1694 C  CE    . LYS A 1 220 ? 14.928 11.024 21.056  1.00 49.55 ? 214 LYS A CE    1 
ATOM   1695 N  NZ    . LYS A 1 220 ? 16.091 10.338 21.677  1.00 51.28 ? 214 LYS A NZ    1 
ATOM   1696 N  N     . GLY A 1 221 ? 17.968 9.327  16.220  1.00 40.11 ? 215 GLY A N     1 
ATOM   1697 C  CA    . GLY A 1 221 ? 19.281 8.717  16.324  1.00 39.92 ? 215 GLY A CA    1 
ATOM   1698 C  C     . GLY A 1 221 ? 20.311 9.256  15.347  1.00 39.21 ? 215 GLY A C     1 
ATOM   1699 O  O     . GLY A 1 221 ? 21.500 9.262  15.641  1.00 39.16 ? 215 GLY A O     1 
ATOM   1700 N  N     . MET A 1 222 ? 19.872 9.727  14.186  1.00 39.15 ? 216 MET A N     1 
ATOM   1701 C  CA    . MET A 1 222 ? 20.819 10.232 13.203  1.00 38.50 ? 216 MET A CA    1 
ATOM   1702 C  C     . MET A 1 222 ? 21.165 11.715 13.343  1.00 38.21 ? 216 MET A C     1 
ATOM   1703 O  O     . MET A 1 222 ? 22.321 12.098 13.153  1.00 39.07 ? 216 MET A O     1 
ATOM   1704 C  CB    . MET A 1 222 ? 20.299 9.949  11.793  1.00 41.50 ? 216 MET A CB    1 
ATOM   1705 C  CG    . MET A 1 222 ? 21.374 9.940  10.713  1.00 46.01 ? 216 MET A CG    1 
ATOM   1706 S  SD    . MET A 1 222 ? 22.782 8.858  11.119  1.00 55.85 ? 216 MET A SD    1 
ATOM   1707 C  CE    . MET A 1 222 ? 21.928 7.368  11.738  1.00 49.05 ? 216 MET A CE    1 
ATOM   1708 N  N     . ILE A 1 223 ? 20.189 12.561 13.672  1.00 35.89 ? 217 ILE A N     1 
ATOM   1709 C  CA    . ILE A 1 223 ? 20.484 13.989 13.800  1.00 34.15 ? 217 ILE A CA    1 
ATOM   1710 C  C     . ILE A 1 223 ? 20.217 14.567 15.183  1.00 32.82 ? 217 ILE A C     1 
ATOM   1711 O  O     . ILE A 1 223 ? 20.564 15.709 15.459  1.00 34.51 ? 217 ILE A O     1 
ATOM   1712 C  CB    . ILE A 1 223 ? 19.708 14.832 12.756  1.00 33.10 ? 217 ILE A CB    1 
ATOM   1713 C  CG1   . ILE A 1 223 ? 18.199 14.722 13.000  1.00 32.08 ? 217 ILE A CG1   1 
ATOM   1714 C  CG2   . ILE A 1 223 ? 20.066 14.364 11.341  1.00 32.99 ? 217 ILE A CG2   1 
ATOM   1715 C  CD1   . ILE A 1 223 ? 17.375 15.632 12.117  1.00 28.21 ? 217 ILE A CD1   1 
ATOM   1716 N  N     . GLY A 1 224 ? 19.598 13.778 16.052  1.00 33.91 ? 218 GLY A N     1 
ATOM   1717 C  CA    . GLY A 1 224 ? 19.312 14.249 17.395  1.00 31.11 ? 218 GLY A CA    1 
ATOM   1718 C  C     . GLY A 1 224 ? 17.853 14.606 17.589  1.00 30.95 ? 218 GLY A C     1 
ATOM   1719 O  O     . GLY A 1 224 ? 17.155 14.943 16.640  1.00 30.80 ? 218 GLY A O     1 
ATOM   1720 N  N     . GLU A 1 225 ? 17.398 14.537 18.831  1.00 31.26 ? 219 GLU A N     1 
ATOM   1721 C  CA    . GLU A 1 225 ? 16.015 14.836 19.171  1.00 34.03 ? 219 GLU A CA    1 
ATOM   1722 C  C     . GLU A 1 225 ? 15.579 16.241 18.763  1.00 34.30 ? 219 GLU A C     1 
ATOM   1723 O  O     . GLU A 1 225 ? 14.622 16.405 18.004  1.00 35.25 ? 219 GLU A O     1 
ATOM   1724 C  CB    . GLU A 1 225 ? 15.810 14.660 20.678  1.00 32.90 ? 219 GLU A CB    1 
ATOM   1725 C  CG    . GLU A 1 225 ? 14.361 14.742 21.142  1.00 34.75 ? 219 GLU A CG    1 
ATOM   1726 C  CD    . GLU A 1 225 ? 14.193 14.395 22.614  0.50 34.88 ? 219 GLU A CD    1 
ATOM   1727 O  OE1   . GLU A 1 225 ? 13.069 14.039 23.014  0.50 36.04 ? 219 GLU A OE1   1 
ATOM   1728 O  OE2   . GLU A 1 225 ? 15.178 14.488 23.376  0.50 35.66 ? 219 GLU A OE2   1 
ATOM   1729 N  N     . ALA A 1 226 ? 16.282 17.247 19.278  1.00 33.94 ? 220 ALA A N     1 
ATOM   1730 C  CA    . ALA A 1 226 ? 15.955 18.637 18.999  1.00 34.17 ? 220 ALA A CA    1 
ATOM   1731 C  C     . ALA A 1 226 ? 15.783 18.894 17.512  1.00 32.32 ? 220 ALA A C     1 
ATOM   1732 O  O     . ALA A 1 226 ? 14.745 19.377 17.070  1.00 30.92 ? 220 ALA A O     1 
ATOM   1733 C  CB    . ALA A 1 226 ? 17.039 19.552 19.565  1.00 33.64 ? 220 ALA A CB    1 
ATOM   1734 N  N     . LYS A 1 227 ? 16.807 18.555 16.744  1.00 32.20 ? 221 LYS A N     1 
ATOM   1735 C  CA    . LYS A 1 227 ? 16.778 18.761 15.302  1.00 31.14 ? 221 LYS A CA    1 
ATOM   1736 C  C     . LYS A 1 227 ? 15.676 17.962 14.611  1.00 29.53 ? 221 LYS A C     1 
ATOM   1737 O  O     . LYS A 1 227 ? 15.077 18.430 13.643  1.00 30.22 ? 221 LYS A O     1 
ATOM   1738 C  CB    . LYS A 1 227 ? 18.130 18.382 14.713  1.00 31.78 ? 221 LYS A CB    1 
ATOM   1739 C  CG    . LYS A 1 227 ? 18.310 18.795 13.276  1.00 34.20 ? 221 LYS A CG    1 
ATOM   1740 C  CD    . LYS A 1 227 ? 18.768 20.226 13.185  1.00 36.35 ? 221 LYS A CD    1 
ATOM   1741 C  CE    . LYS A 1 227 ? 20.154 20.388 13.787  1.00 36.79 ? 221 LYS A CE    1 
ATOM   1742 N  NZ    . LYS A 1 227 ? 20.588 21.802 13.675  1.00 37.85 ? 221 LYS A NZ    1 
ATOM   1743 N  N     . ALA A 1 228 ? 15.405 16.758 15.109  1.00 26.71 ? 222 ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 228 ? 14.378 15.906 14.510  1.00 27.85 ? 222 ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 228 ? 12.993 16.526 14.694  1.00 27.28 ? 222 ALA A C     1 
ATOM   1746 O  O     . ALA A 1 228 ? 12.210 16.636 13.748  1.00 26.28 ? 222 ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 228 ? 14.427 14.493 15.131  1.00 23.74 ? 222 ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 229 ? 12.697 16.933 15.919  1.00 27.12 ? 223 LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 229 ? 11.414 17.562 16.220  1.00 29.98 ? 223 LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 229 ? 11.264 18.860 15.427  1.00 31.16 ? 223 LYS A C     1 
ATOM   1751 O  O     . LYS A 1 229 ? 10.200 19.154 14.868  1.00 32.75 ? 223 LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 229 ? 11.321 17.839 17.722  1.00 31.03 ? 223 LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 229 ? 11.217 16.562 18.544  1.00 33.68 ? 223 LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 229 ? 11.018 16.856 20.018  1.00 38.35 ? 223 LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 229 ? 10.667 15.584 20.783  1.00 39.62 ? 223 LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 229 ? 10.314 15.859 22.205  1.00 42.99 ? 223 LYS A NZ    1 
ATOM   1757 N  N     . TYR A 1 230 ? 12.341 19.632 15.373  1.00 30.37 ? 224 TYR A N     1 
ATOM   1758 C  CA    . TYR A 1 230 ? 12.339 20.890 14.635  1.00 30.20 ? 224 TYR A CA    1 
ATOM   1759 C  C     . TYR A 1 230 ? 11.843 20.679 13.195  1.00 29.31 ? 224 TYR A C     1 
ATOM   1760 O  O     . TYR A 1 230 ? 10.866 21.286 12.760  1.00 28.64 ? 224 TYR A O     1 
ATOM   1761 C  CB    . TYR A 1 230 ? 13.764 21.455 14.627  1.00 28.90 ? 224 TYR A CB    1 
ATOM   1762 C  CG    . TYR A 1 230 ? 13.980 22.639 13.709  1.00 29.65 ? 224 TYR A CG    1 
ATOM   1763 C  CD1   . TYR A 1 230 ? 13.386 23.877 13.971  1.00 25.91 ? 224 TYR A CD1   1 
ATOM   1764 C  CD2   . TYR A 1 230 ? 14.841 22.539 12.622  1.00 26.72 ? 224 TYR A CD2   1 
ATOM   1765 C  CE1   . TYR A 1 230 ? 13.658 24.984 13.174  1.00 26.05 ? 224 TYR A CE1   1 
ATOM   1766 C  CE2   . TYR A 1 230 ? 15.122 23.629 11.822  1.00 26.02 ? 224 TYR A CE2   1 
ATOM   1767 C  CZ    . TYR A 1 230 ? 14.537 24.850 12.099  1.00 28.28 ? 224 TYR A CZ    1 
ATOM   1768 O  OH    . TYR A 1 230 ? 14.865 25.945 11.324  1.00 25.74 ? 224 TYR A OH    1 
ATOM   1769 N  N     . LEU A 1 231 ? 12.533 19.809 12.468  1.00 28.41 ? 225 LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 231 ? 12.194 19.511 11.086  1.00 28.36 ? 225 LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 231 ? 10.799 18.926 10.888  1.00 30.00 ? 225 LEU A C     1 
ATOM   1772 O  O     . LEU A 1 231 ? 10.135 19.210 9.887   1.00 30.88 ? 225 LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 231 ? 13.214 18.541 10.500  1.00 27.60 ? 225 LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 231 ? 14.614 19.095 10.261  1.00 26.31 ? 225 LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 231 ? 15.537 17.960 9.803   1.00 25.27 ? 225 LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 231 ? 14.540 20.200 9.211   1.00 21.92 ? 225 LEU A CD2   1 
ATOM   1777 N  N     . ILE A 1 232 ? 10.368 18.087 11.822  1.00 31.79 ? 226 ILE A N     1 
ATOM   1778 C  CA    . ILE A 1 232 ? 9.056  17.477 11.723  1.00 32.81 ? 226 ILE A CA    1 
ATOM   1779 C  C     . ILE A 1 232 ? 7.972  18.539 11.909  1.00 34.16 ? 226 ILE A C     1 
ATOM   1780 O  O     . ILE A 1 232 ? 6.966  18.520 11.204  1.00 33.72 ? 226 ILE A O     1 
ATOM   1781 C  CB    . ILE A 1 232 ? 8.922  16.322 12.738  1.00 33.07 ? 226 ILE A CB    1 
ATOM   1782 C  CG1   . ILE A 1 232 ? 9.811  15.159 12.270  1.00 33.80 ? 226 ILE A CG1   1 
ATOM   1783 C  CG2   . ILE A 1 232 ? 7.466  15.873 12.858  1.00 32.45 ? 226 ILE A CG2   1 
ATOM   1784 C  CD1   . ILE A 1 232 ? 10.134 14.126 13.338  1.00 36.24 ? 226 ILE A CD1   1 
ATOM   1785 N  N     . SER A 1 233 ? 8.190  19.467 12.838  1.00 34.64 ? 227 SER A N     1 
ATOM   1786 C  CA    . SER A 1 233 ? 7.246  20.554 13.063  1.00 36.22 ? 227 SER A CA    1 
ATOM   1787 C  C     . SER A 1 233 ? 7.030  21.304 11.756  1.00 37.88 ? 227 SER A C     1 
ATOM   1788 O  O     . SER A 1 233 ? 5.898  21.461 11.288  1.00 38.63 ? 227 SER A O     1 
ATOM   1789 C  CB    . SER A 1 233 ? 7.789  21.539 14.098  1.00 38.76 ? 227 SER A CB    1 
ATOM   1790 O  OG    . SER A 1 233 ? 7.700  21.005 15.404  1.00 40.74 ? 227 SER A OG    1 
ATOM   1791 N  N     . LEU A 1 234 ? 8.130  21.764 11.168  1.00 36.79 ? 228 LEU A N     1 
ATOM   1792 C  CA    . LEU A 1 234 ? 8.076  22.512 9.924   1.00 37.21 ? 228 LEU A CA    1 
ATOM   1793 C  C     . LEU A 1 234 ? 7.365  21.751 8.827   1.00 37.37 ? 228 LEU A C     1 
ATOM   1794 O  O     . LEU A 1 234 ? 6.588  22.321 8.064   1.00 36.20 ? 228 LEU A O     1 
ATOM   1795 C  CB    . LEU A 1 234 ? 9.488  22.840 9.444   1.00 35.43 ? 228 LEU A CB    1 
ATOM   1796 C  CG    . LEU A 1 234 ? 10.269 23.851 10.266  1.00 36.27 ? 228 LEU A CG    1 
ATOM   1797 C  CD1   . LEU A 1 234 ? 11.714 23.882 9.778   1.00 32.93 ? 228 LEU A CD1   1 
ATOM   1798 C  CD2   . LEU A 1 234 ? 9.605  25.219 10.138  1.00 35.75 ? 228 LEU A CD2   1 
ATOM   1799 N  N     . ALA A 1 235 ? 7.666  20.462 8.744   1.00 38.80 ? 229 ALA A N     1 
ATOM   1800 C  CA    . ALA A 1 235 ? 7.093  19.599 7.729   1.00 40.36 ? 229 ALA A CA    1 
ATOM   1801 C  C     . ALA A 1 235 ? 5.587  19.488 7.901   1.00 41.49 ? 229 ALA A C     1 
ATOM   1802 O  O     . ALA A 1 235 ? 4.843  19.423 6.923   1.00 40.94 ? 229 ALA A O     1 
ATOM   1803 C  CB    . ALA A 1 235 ? 7.736  18.221 7.803   1.00 40.55 ? 229 ALA A CB    1 
ATOM   1804 N  N     . ARG A 1 236 ? 5.146  19.463 9.150   1.00 41.89 ? 230 ARG A N     1 
ATOM   1805 C  CA    . ARG A 1 236 ? 3.731  19.363 9.442   1.00 45.33 ? 230 ARG A CA    1 
ATOM   1806 C  C     . ARG A 1 236 ? 3.068  20.733 9.381   1.00 47.29 ? 230 ARG A C     1 
ATOM   1807 O  O     . ARG A 1 236 ? 1.851  20.850 9.555   1.00 47.43 ? 230 ARG A O     1 
ATOM   1808 C  CB    . ARG A 1 236 ? 3.535  18.744 10.821  1.00 46.77 ? 230 ARG A CB    1 
ATOM   1809 C  CG    . ARG A 1 236 ? 3.821  17.259 10.846  1.00 48.53 ? 230 ARG A CG    1 
ATOM   1810 C  CD    . ARG A 1 236 ? 3.778  16.701 12.246  1.00 49.95 ? 230 ARG A CD    1 
ATOM   1811 N  NE    . ARG A 1 236 ? 3.705  15.244 12.213  1.00 54.38 ? 230 ARG A NE    1 
ATOM   1812 C  CZ    . ARG A 1 236 ? 3.976  14.457 13.249  1.00 56.08 ? 230 ARG A CZ    1 
ATOM   1813 N  NH1   . ARG A 1 236 ? 4.345  14.986 14.412  1.00 54.81 ? 230 ARG A NH1   1 
ATOM   1814 N  NH2   . ARG A 1 236 ? 3.871  13.140 13.124  1.00 56.89 ? 230 ARG A NH2   1 
ATOM   1815 N  N     . ASP A 1 237 ? 3.871  21.763 9.120   1.00 46.44 ? 231 ASP A N     1 
ATOM   1816 C  CA    . ASP A 1 237 ? 3.367  23.125 9.047   1.00 45.47 ? 231 ASP A CA    1 
ATOM   1817 C  C     . ASP A 1 237 ? 2.832  23.451 10.431  1.00 43.35 ? 231 ASP A C     1 
ATOM   1818 O  O     . ASP A 1 237 ? 1.721  23.953 10.579  1.00 41.12 ? 231 ASP A O     1 
ATOM   1819 C  CB    . ASP A 1 237 ? 2.242  23.219 8.006   1.00 48.81 ? 231 ASP A CB    1 
ATOM   1820 C  CG    . ASP A 1 237 ? 1.874  24.657 7.663   1.00 50.67 ? 231 ASP A CG    1 
ATOM   1821 O  OD1   . ASP A 1 237 ? 1.619  25.454 8.589   1.00 51.47 ? 231 ASP A OD1   1 
ATOM   1822 O  OD2   . ASP A 1 237 ? 1.833  24.986 6.458   1.00 52.87 ? 231 ASP A OD2   1 
ATOM   1823 N  N     . GLU A 1 238 ? 3.633  23.154 11.446  1.00 43.45 ? 232 GLU A N     1 
ATOM   1824 C  CA    . GLU A 1 238 ? 3.232  23.396 12.827  1.00 43.67 ? 232 GLU A CA    1 
ATOM   1825 C  C     . GLU A 1 238 ? 4.304  24.107 13.647  1.00 43.09 ? 232 GLU A C     1 
ATOM   1826 O  O     . GLU A 1 238 ? 4.119  24.349 14.841  1.00 42.85 ? 232 GLU A O     1 
ATOM   1827 C  CB    . GLU A 1 238 ? 2.870  22.064 13.493  1.00 45.45 ? 232 GLU A CB    1 
ATOM   1828 C  CG    . GLU A 1 238 ? 1.911  21.227 12.656  1.00 50.51 ? 232 GLU A CG    1 
ATOM   1829 C  CD    . GLU A 1 238 ? 1.636  19.857 13.248  1.00 53.35 ? 232 GLU A CD    1 
ATOM   1830 O  OE1   . GLU A 1 238 ? 2.601  19.185 13.671  1.00 54.33 ? 232 GLU A OE1   1 
ATOM   1831 O  OE2   . GLU A 1 238 ? 0.455  19.444 13.273  1.00 56.07 ? 232 GLU A OE2   1 
ATOM   1832 N  N     . TYR A 1 239 ? 5.438  24.419 13.019  1.00 42.65 ? 233 TYR A N     1 
ATOM   1833 C  CA    . TYR A 1 239 ? 6.508  25.116 13.721  1.00 42.04 ? 233 TYR A CA    1 
ATOM   1834 C  C     . TYR A 1 239 ? 5.925  26.466 14.106  1.00 42.24 ? 233 TYR A C     1 
ATOM   1835 O  O     . TYR A 1 239 ? 5.306  27.131 13.277  1.00 40.98 ? 233 TYR A O     1 
ATOM   1836 C  CB    . TYR A 1 239 ? 7.715  25.334 12.808  1.00 40.23 ? 233 TYR A CB    1 
ATOM   1837 C  CG    . TYR A 1 239 ? 8.738  26.281 13.400  1.00 39.61 ? 233 TYR A CG    1 
ATOM   1838 C  CD1   . TYR A 1 239 ? 9.658  25.842 14.350  1.00 38.71 ? 233 TYR A CD1   1 
ATOM   1839 C  CD2   . TYR A 1 239 ? 8.757  27.630 13.037  1.00 38.55 ? 233 TYR A CD2   1 
ATOM   1840 C  CE1   . TYR A 1 239 ? 10.574 26.722 14.921  1.00 39.89 ? 233 TYR A CE1   1 
ATOM   1841 C  CE2   . TYR A 1 239 ? 9.663  28.519 13.605  1.00 37.76 ? 233 TYR A CE2   1 
ATOM   1842 C  CZ    . TYR A 1 239 ? 10.568 28.060 14.545  1.00 39.95 ? 233 TYR A CZ    1 
ATOM   1843 O  OH    . TYR A 1 239 ? 11.460 28.932 15.125  1.00 38.35 ? 233 TYR A OH    1 
ATOM   1844 N  N     . ASN A 1 240 ? 6.132  26.893 15.344  1.00 43.78 ? 234 ASN A N     1 
ATOM   1845 C  CA    . ASN A 1 240 ? 5.564  28.159 15.757  1.00 46.13 ? 234 ASN A CA    1 
ATOM   1846 C  C     . ASN A 1 240 ? 6.251  28.772 16.969  1.00 46.94 ? 234 ASN A C     1 
ATOM   1847 O  O     . ASN A 1 240 ? 5.590  29.076 17.962  1.00 49.02 ? 234 ASN A O     1 
ATOM   1848 C  CB    . ASN A 1 240 ? 4.079  27.942 16.053  1.00 49.06 ? 234 ASN A CB    1 
ATOM   1849 C  CG    . ASN A 1 240 ? 3.276  29.214 15.978  1.00 52.23 ? 234 ASN A CG    1 
ATOM   1850 O  OD1   . ASN A 1 240 ? 3.292  29.907 14.961  1.00 55.45 ? 234 ASN A OD1   1 
ATOM   1851 N  ND2   . ASN A 1 240 ? 2.551  29.526 17.050  1.00 52.84 ? 234 ASN A ND2   1 
ATOM   1852 N  N     . GLU A 1 241 ? 7.565  28.969 16.900  1.00 45.72 ? 235 GLU A N     1 
ATOM   1853 C  CA    . GLU A 1 241 ? 8.276  29.552 18.033  1.00 46.39 ? 235 GLU A CA    1 
ATOM   1854 C  C     . GLU A 1 241 ? 8.075  31.057 18.132  1.00 46.94 ? 235 GLU A C     1 
ATOM   1855 O  O     . GLU A 1 241 ? 8.276  31.791 17.180  1.00 46.89 ? 235 GLU A O     1 
ATOM   1856 C  CB    . GLU A 1 241 ? 9.768  29.229 17.967  1.00 46.22 ? 235 GLU A CB    1 
ATOM   1857 C  CG    . GLU A 1 241 ? 10.080 27.748 18.129  1.00 46.57 ? 235 GLU A CG    1 
ATOM   1858 C  CD    . GLU A 1 241 ? 9.453  27.149 19.381  0.50 45.46 ? 235 GLU A CD    1 
ATOM   1859 O  OE1   . GLU A 1 241 ? 9.809  27.576 20.500  0.50 44.71 ? 235 GLU A OE1   1 
ATOM   1860 O  OE2   . GLU A 1 241 ? 8.601  26.248 19.240  0.50 44.67 ? 235 GLU A OE2   1 
ATOM   1861 N  N     . PRO A 1 242 ? 7.687  31.538 19.312  1.00 47.57 ? 236 PRO A N     1 
ATOM   1862 C  CA    . PRO A 1 242 ? 7.454  32.966 19.535  1.00 48.02 ? 236 PRO A CA    1 
ATOM   1863 C  C     . PRO A 1 242 ? 8.702  33.835 19.402  1.00 48.51 ? 236 PRO A C     1 
ATOM   1864 O  O     . PRO A 1 242 ? 9.830  33.367 19.587  1.00 48.82 ? 236 PRO A O     1 
ATOM   1865 C  CB    . PRO A 1 242 ? 6.897  32.993 20.947  1.00 48.04 ? 236 PRO A CB    1 
ATOM   1866 C  CG    . PRO A 1 242 ? 7.670  31.877 21.611  1.00 48.49 ? 236 PRO A CG    1 
ATOM   1867 C  CD    . PRO A 1 242 ? 7.577  30.783 20.574  1.00 47.97 ? 236 PRO A CD    1 
ATOM   1868 N  N     . ILE A 1 243 ? 8.483  35.107 19.083  1.00 46.42 ? 237 ILE A N     1 
ATOM   1869 C  CA    . ILE A 1 243 ? 9.564  36.070 18.953  1.00 46.14 ? 237 ILE A CA    1 
ATOM   1870 C  C     . ILE A 1 243 ? 9.891  36.546 20.365  1.00 46.72 ? 237 ILE A C     1 
ATOM   1871 O  O     . ILE A 1 243 ? 9.031  37.107 21.037  1.00 48.04 ? 237 ILE A O     1 
ATOM   1872 C  CB    . ILE A 1 243 ? 9.124  37.293 18.113  1.00 45.17 ? 237 ILE A CB    1 
ATOM   1873 C  CG1   . ILE A 1 243 ? 9.062  36.928 16.630  1.00 44.81 ? 237 ILE A CG1   1 
ATOM   1874 C  CG2   . ILE A 1 243 ? 10.071 38.452 18.343  1.00 45.84 ? 237 ILE A CG2   1 
ATOM   1875 C  CD1   . ILE A 1 243 ? 7.999  35.920 16.285  1.00 46.35 ? 237 ILE A CD1   1 
ATOM   1876 N  N     . ARG A 1 244 ? 11.116 36.326 20.827  1.00 45.96 ? 238 ARG A N     1 
ATOM   1877 C  CA    . ARG A 1 244 ? 11.465 36.766 22.167  1.00 46.21 ? 238 ARG A CA    1 
ATOM   1878 C  C     . ARG A 1 244 ? 12.833 37.418 22.221  1.00 47.52 ? 238 ARG A C     1 
ATOM   1879 O  O     . ARG A 1 244 ? 13.694 37.159 21.379  1.00 47.71 ? 238 ARG A O     1 
ATOM   1880 C  CB    . ARG A 1 244 ? 11.413 35.596 23.155  0.50 46.46 ? 238 ARG A CB    1 
ATOM   1881 C  CG    . ARG A 1 244 ? 12.524 34.585 22.991  0.50 47.67 ? 238 ARG A CG    1 
ATOM   1882 C  CD    . ARG A 1 244 ? 12.502 33.569 24.119  0.50 48.65 ? 238 ARG A CD    1 
ATOM   1883 N  NE    . ARG A 1 244 ? 13.648 32.672 24.046  0.50 49.81 ? 238 ARG A NE    1 
ATOM   1884 C  CZ    . ARG A 1 244 ? 13.841 31.634 24.852  0.50 50.44 ? 238 ARG A CZ    1 
ATOM   1885 N  NH1   . ARG A 1 244 ? 12.959 31.354 25.804  0.50 50.31 ? 238 ARG A NH1   1 
ATOM   1886 N  NH2   . ARG A 1 244 ? 14.918 30.874 24.702  0.50 50.31 ? 238 ARG A NH2   1 
ATOM   1887 N  N     . THR A 1 245 ? 13.018 38.268 23.224  1.00 47.80 ? 239 THR A N     1 
ATOM   1888 C  CA    . THR A 1 245 ? 14.266 38.978 23.419  1.00 49.02 ? 239 THR A CA    1 
ATOM   1889 C  C     . THR A 1 245 ? 15.373 37.996 23.752  1.00 49.29 ? 239 THR A C     1 
ATOM   1890 O  O     . THR A 1 245 ? 15.263 37.222 24.701  1.00 50.61 ? 239 THR A O     1 
ATOM   1891 C  CB    . THR A 1 245 ? 14.155 39.990 24.574  1.00 49.42 ? 239 THR A CB    1 
ATOM   1892 O  OG1   . THR A 1 245 ? 13.090 40.904 24.304  1.00 49.87 ? 239 THR A OG1   1 
ATOM   1893 C  CG2   . THR A 1 245 ? 15.455 40.773 24.729  1.00 49.58 ? 239 THR A CG2   1 
ATOM   1894 N  N     . ARG A 1 246 ? 16.437 38.027 22.963  1.00 48.69 ? 240 ARG A N     1 
ATOM   1895 C  CA    . ARG A 1 246 ? 17.566 37.144 23.188  1.00 47.99 ? 240 ARG A CA    1 
ATOM   1896 C  C     . ARG A 1 246 ? 18.514 37.868 24.131  1.00 46.88 ? 240 ARG A C     1 
ATOM   1897 O  O     . ARG A 1 246 ? 18.645 39.083 24.064  1.00 47.32 ? 240 ARG A O     1 
ATOM   1898 C  CB    . ARG A 1 246 ? 18.276 36.844 21.863  1.00 48.02 ? 240 ARG A CB    1 
ATOM   1899 C  CG    . ARG A 1 246 ? 17.392 36.186 20.809  1.00 47.08 ? 240 ARG A CG    1 
ATOM   1900 C  CD    . ARG A 1 246 ? 18.197 35.725 19.592  1.00 47.30 ? 240 ARG A CD    1 
ATOM   1901 N  NE    . ARG A 1 246 ? 17.353 35.026 18.624  1.00 48.73 ? 240 ARG A NE    1 
ATOM   1902 C  CZ    . ARG A 1 246 ? 17.792 34.443 17.511  1.00 49.88 ? 240 ARG A CZ    1 
ATOM   1903 N  NH1   . ARG A 1 246 ? 19.083 34.465 17.202  1.00 51.51 ? 240 ARG A NH1   1 
ATOM   1904 N  NH2   . ARG A 1 246 ? 16.937 33.826 16.706  1.00 49.49 ? 240 ARG A NH2   1 
ATOM   1905 N  N     . VAL A 1 247 ? 19.160 37.125 25.019  1.00 47.29 ? 241 VAL A N     1 
ATOM   1906 C  CA    . VAL A 1 247 ? 20.100 37.713 25.962  1.00 46.80 ? 241 VAL A CA    1 
ATOM   1907 C  C     . VAL A 1 247 ? 21.494 37.093 25.785  1.00 44.32 ? 241 VAL A C     1 
ATOM   1908 O  O     . VAL A 1 247 ? 21.608 35.862 25.756  1.00 44.10 ? 241 VAL A O     1 
ATOM   1909 C  CB    . VAL A 1 247 ? 19.641 37.478 27.426  1.00 48.09 ? 241 VAL A CB    1 
ATOM   1910 C  CG1   . VAL A 1 247 ? 18.381 38.279 27.715  1.00 48.37 ? 241 VAL A CG1   1 
ATOM   1911 C  CG2   . VAL A 1 247 ? 19.348 35.994 27.644  1.00 48.66 ? 241 VAL A CG2   1 
ATOM   1912 N  N     . ARG A 1 248 ? 22.539 37.923 25.660  1.00 43.05 ? 242 ARG A N     1 
ATOM   1913 C  CA    . ARG A 1 248 ? 23.903 37.378 25.493  1.00 43.36 ? 242 ARG A CA    1 
ATOM   1914 C  C     . ARG A 1 248 ? 24.153 36.441 26.628  1.00 43.48 ? 242 ARG A C     1 
ATOM   1915 O  O     . ARG A 1 248 ? 23.895 36.766 27.780  1.00 45.12 ? 242 ARG A O     1 
ATOM   1916 C  CB    . ARG A 1 248 ? 25.046 38.389 25.615  0.50 42.48 ? 242 ARG A CB    1 
ATOM   1917 C  CG    . ARG A 1 248 ? 25.040 39.570 24.708  0.50 42.97 ? 242 ARG A CG    1 
ATOM   1918 C  CD    . ARG A 1 248 ? 26.348 40.340 24.864  0.50 44.18 ? 242 ARG A CD    1 
ATOM   1919 N  NE    . ARG A 1 248 ? 26.169 41.776 24.673  0.50 45.66 ? 242 ARG A NE    1 
ATOM   1920 C  CZ    . ARG A 1 248 ? 27.130 42.680 24.884  0.50 45.96 ? 242 ARG A CZ    1 
ATOM   1921 N  NH1   . ARG A 1 248 ? 28.329 42.299 25.286  0.50 47.82 ? 242 ARG A NH1   1 
ATOM   1922 N  NH2   . ARG A 1 248 ? 26.885 43.967 24.700  0.50 47.09 ? 242 ARG A NH2   1 
ATOM   1923 N  N     . LYS A 1 249 ? 24.712 35.285 26.310  1.00 43.27 ? 243 LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 249 ? 25.000 34.312 27.336  1.00 42.79 ? 243 LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 249 ? 26.499 34.095 27.577  1.00 40.63 ? 243 LYS A C     1 
ATOM   1926 O  O     . LYS A 1 249 ? 26.888 33.395 28.506  1.00 41.11 ? 243 LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 249 ? 24.295 33.001 26.995  1.00 44.65 ? 243 LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 249 ? 22.772 33.144 27.044  1.00 46.69 ? 243 LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 249 ? 22.017 31.823 26.890  1.00 47.11 ? 243 LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 249 ? 20.507 32.046 27.012  1.00 47.94 ? 243 LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 249 ? 19.712 30.797 26.923  1.00 50.11 ? 243 LYS A NZ    1 
ATOM   1932 N  N     . SER A 1 250 ? 27.337 34.721 26.756  1.00 37.95 ? 244 SER A N     1 
ATOM   1933 C  CA    . SER A 1 250 ? 28.785 34.573 26.901  1.00 35.14 ? 244 SER A CA    1 
ATOM   1934 C  C     . SER A 1 250 ? 29.513 35.667 26.127  1.00 35.13 ? 244 SER A C     1 
ATOM   1935 O  O     . SER A 1 250 ? 29.002 36.179 25.125  1.00 34.73 ? 244 SER A O     1 
ATOM   1936 C  CB    . SER A 1 250 ? 29.245 33.204 26.388  1.00 35.23 ? 244 SER A CB    1 
ATOM   1937 O  OG    . SER A 1 250 ? 29.213 33.138 24.968  1.00 36.38 ? 244 SER A OG    1 
ATOM   1938 N  N     . ILE A 1 251 ? 30.704 36.020 26.603  1.00 32.70 ? 245 ILE A N     1 
ATOM   1939 C  CA    . ILE A 1 251 ? 31.535 37.032 25.973  1.00 33.05 ? 245 ILE A CA    1 
ATOM   1940 C  C     . ILE A 1 251 ? 32.926 36.428 25.989  1.00 33.86 ? 245 ILE A C     1 
ATOM   1941 O  O     . ILE A 1 251 ? 33.346 35.875 27.009  1.00 33.27 ? 245 ILE A O     1 
ATOM   1942 C  CB    . ILE A 1 251 ? 31.564 38.344 26.781  1.00 35.69 ? 245 ILE A CB    1 
ATOM   1943 C  CG1   . ILE A 1 251 ? 30.140 38.886 26.974  1.00 37.80 ? 245 ILE A CG1   1 
ATOM   1944 C  CG2   . ILE A 1 251 ? 32.436 39.375 26.066  1.00 35.46 ? 245 ILE A CG2   1 
ATOM   1945 C  CD1   . ILE A 1 251 ? 29.517 39.483 25.727  1.00 40.05 ? 245 ILE A CD1   1 
ATOM   1946 N  N     . GLY A 1 252 ? 33.635 36.526 24.867  1.00 32.80 ? 246 GLY A N     1 
ATOM   1947 C  CA    . GLY A 1 252 ? 34.967 35.956 24.785  1.00 33.95 ? 246 GLY A CA    1 
ATOM   1948 C  C     . GLY A 1 252 ? 35.829 36.572 23.702  1.00 35.66 ? 246 GLY A C     1 
ATOM   1949 O  O     . GLY A 1 252 ? 35.394 37.441 22.951  1.00 36.11 ? 246 GLY A O     1 
ATOM   1950 N  N     A ARG A 1 253 ? 37.070 36.105 23.635  0.50 36.39 ? 247 ARG A N     1 
ATOM   1951 N  N     B ARG A 1 253 ? 37.069 36.111 23.618  0.50 35.85 ? 247 ARG A N     1 
ATOM   1952 C  CA    A ARG A 1 253 ? 38.045 36.608 22.683  0.50 37.17 ? 247 ARG A CA    1 
ATOM   1953 C  CA    B ARG A 1 253 ? 38.004 36.597 22.618  0.50 36.30 ? 247 ARG A CA    1 
ATOM   1954 C  C     A ARG A 1 253 ? 39.125 35.562 22.446  0.50 38.44 ? 247 ARG A C     1 
ATOM   1955 C  C     B ARG A 1 253 ? 39.113 35.581 22.435  0.50 37.87 ? 247 ARG A C     1 
ATOM   1956 O  O     A ARG A 1 253 ? 39.752 35.088 23.393  0.50 37.29 ? 247 ARG A O     1 
ATOM   1957 O  O     B ARG A 1 253 ? 39.744 35.150 23.399  0.50 36.84 ? 247 ARG A O     1 
ATOM   1958 C  CB    A ARG A 1 253 ? 38.680 37.881 23.253  0.50 38.18 ? 247 ARG A CB    1 
ATOM   1959 C  CB    B ARG A 1 253 ? 38.592 37.949 23.034  0.50 36.02 ? 247 ARG A CB    1 
ATOM   1960 C  CG    A ARG A 1 253 ? 39.854 38.436 22.470  0.50 37.69 ? 247 ARG A CG    1 
ATOM   1961 C  CG    B ARG A 1 253 ? 37.645 39.132 22.839  0.50 34.60 ? 247 ARG A CG    1 
ATOM   1962 C  CD    A ARG A 1 253 ? 39.406 39.026 21.156  0.50 40.33 ? 247 ARG A CD    1 
ATOM   1963 C  CD    B ARG A 1 253 ? 37.227 39.271 21.378  0.50 32.06 ? 247 ARG A CD    1 
ATOM   1964 N  NE    A ARG A 1 253 ? 40.494 39.698 20.458  0.50 40.57 ? 247 ARG A NE    1 
ATOM   1965 N  NE    B ARG A 1 253 ? 36.445 40.478 21.120  0.50 31.07 ? 247 ARG A NE    1 
ATOM   1966 C  CZ    A ARG A 1 253 ? 40.362 40.271 19.268  0.50 42.16 ? 247 ARG A CZ    1 
ATOM   1967 C  CZ    B ARG A 1 253 ? 35.189 40.665 21.513  0.50 30.28 ? 247 ARG A CZ    1 
ATOM   1968 N  NH1   A ARG A 1 253 ? 39.187 40.247 18.653  0.50 42.43 ? 247 ARG A NH1   1 
ATOM   1969 N  NH1   B ARG A 1 253 ? 34.554 39.726 22.190  0.50 30.11 ? 247 ARG A NH1   1 
ATOM   1970 N  NH2   A ARG A 1 253 ? 41.399 40.864 18.695  0.50 42.26 ? 247 ARG A NH2   1 
ATOM   1971 N  NH2   B ARG A 1 253 ? 34.562 41.794 21.219  0.50 32.06 ? 247 ARG A NH2   1 
ATOM   1972 N  N     . ILE A 1 254 ? 39.335 35.194 21.186  1.00 39.01 ? 248 ILE A N     1 
ATOM   1973 C  CA    . ILE A 1 254 ? 40.363 34.225 20.848  1.00 42.31 ? 248 ILE A CA    1 
ATOM   1974 C  C     . ILE A 1 254 ? 41.251 34.879 19.800  1.00 46.11 ? 248 ILE A C     1 
ATOM   1975 O  O     . ILE A 1 254 ? 40.766 35.469 18.836  1.00 45.93 ? 248 ILE A O     1 
ATOM   1976 C  CB    . ILE A 1 254 ? 39.759 32.900 20.304  1.00 43.38 ? 248 ILE A CB    1 
ATOM   1977 C  CG1   . ILE A 1 254 ? 40.878 31.897 20.028  1.00 43.19 ? 248 ILE A CG1   1 
ATOM   1978 C  CG2   . ILE A 1 254 ? 38.948 33.158 19.037  1.00 44.51 ? 248 ILE A CG2   1 
ATOM   1979 C  CD1   . ILE A 1 254 ? 40.388 30.493 19.753  1.00 46.01 ? 248 ILE A CD1   1 
ATOM   1980 N  N     . VAL A 1 255 ? 42.559 34.789 19.998  1.00 49.54 ? 249 VAL A N     1 
ATOM   1981 C  CA    . VAL A 1 255 ? 43.484 35.413 19.070  1.00 53.43 ? 249 VAL A CA    1 
ATOM   1982 C  C     . VAL A 1 255 ? 44.508 34.470 18.464  1.00 54.97 ? 249 VAL A C     1 
ATOM   1983 O  O     . VAL A 1 255 ? 44.918 33.491 19.086  1.00 55.77 ? 249 VAL A O     1 
ATOM   1984 C  CB    . VAL A 1 255 ? 44.237 36.553 19.759  1.00 54.50 ? 249 VAL A CB    1 
ATOM   1985 C  CG1   . VAL A 1 255 ? 43.243 37.595 20.249  1.00 56.06 ? 249 VAL A CG1   1 
ATOM   1986 C  CG2   . VAL A 1 255 ? 45.059 36.003 20.923  1.00 54.11 ? 249 VAL A CG2   1 
ATOM   1987 N  N     . THR A 1 256 ? 44.912 34.781 17.238  1.00 57.09 ? 250 THR A N     1 
ATOM   1988 C  CA    . THR A 1 256 ? 45.914 33.997 16.528  1.00 57.99 ? 250 THR A CA    1 
ATOM   1989 C  C     . THR A 1 256 ? 47.257 34.562 16.960  1.00 57.64 ? 250 THR A C     1 
ATOM   1990 O  O     . THR A 1 256 ? 47.452 35.774 16.939  1.00 58.33 ? 250 THR A O     1 
ATOM   1991 C  CB    . THR A 1 256 ? 45.766 34.153 14.995  1.00 58.93 ? 250 THR A CB    1 
ATOM   1992 O  OG1   . THR A 1 256 ? 44.469 33.696 14.591  1.00 59.43 ? 250 THR A OG1   1 
ATOM   1993 C  CG2   . THR A 1 256 ? 46.835 33.344 14.264  1.00 58.41 ? 250 THR A CG2   1 
ATOM   1994 N  N     . MET A 1 257 ? 48.171 33.689 17.367  1.00 58.62 ? 251 MET A N     1 
ATOM   1995 C  CA    . MET A 1 257 ? 49.495 34.115 17.811  1.00 59.21 ? 251 MET A CA    1 
ATOM   1996 C  C     . MET A 1 257 ? 50.451 34.347 16.639  1.00 60.65 ? 251 MET A C     1 
ATOM   1997 O  O     . MET A 1 257 ? 50.136 34.015 15.497  1.00 61.05 ? 251 MET A O     1 
ATOM   1998 C  CB    . MET A 1 257 ? 50.078 33.075 18.767  1.00 56.77 ? 251 MET A CB    1 
ATOM   1999 C  CG    . MET A 1 257 ? 49.222 32.867 19.999  1.00 54.76 ? 251 MET A CG    1 
ATOM   2000 S  SD    . MET A 1 257 ? 49.944 31.728 21.179  1.00 50.66 ? 251 MET A SD    1 
ATOM   2001 C  CE    . MET A 1 257 ? 49.537 30.192 20.392  1.00 51.43 ? 251 MET A CE    1 
ATOM   2002 N  N     . LYS A 1 258 ? 51.615 34.922 16.929  1.00 62.10 ? 252 LYS A N     1 
ATOM   2003 C  CA    . LYS A 1 258 ? 52.609 35.205 15.898  1.00 62.83 ? 252 LYS A CA    1 
ATOM   2004 C  C     . LYS A 1 258 ? 52.987 33.905 15.194  1.00 63.21 ? 252 LYS A C     1 
ATOM   2005 O  O     . LYS A 1 258 ? 52.905 33.792 13.968  1.00 62.86 ? 252 LYS A O     1 
ATOM   2006 C  CB    . LYS A 1 258 ? 53.854 35.835 16.532  0.50 62.88 ? 252 LYS A CB    1 
ATOM   2007 C  CG    . LYS A 1 258 ? 54.469 36.957 15.711  0.50 63.21 ? 252 LYS A CG    1 
ATOM   2008 C  CD    . LYS A 1 258 ? 54.868 36.490 14.322  0.50 63.05 ? 252 LYS A CD    1 
ATOM   2009 C  CE    . LYS A 1 258 ? 55.326 37.656 13.460  0.50 63.16 ? 252 LYS A CE    1 
ATOM   2010 N  NZ    . LYS A 1 258 ? 54.247 38.669 13.279  0.50 62.59 ? 252 LYS A NZ    1 
ATOM   2011 N  N     . ARG A 1 259 ? 53.396 32.926 15.992  1.00 62.99 ? 253 ARG A N     1 
ATOM   2012 C  CA    . ARG A 1 259 ? 53.783 31.622 15.488  1.00 62.91 ? 253 ARG A CA    1 
ATOM   2013 C  C     . ARG A 1 259 ? 53.267 30.598 16.489  1.00 63.39 ? 253 ARG A C     1 
ATOM   2014 O  O     . ARG A 1 259 ? 52.943 30.949 17.621  1.00 63.91 ? 253 ARG A O     1 
ATOM   2015 C  CB    . ARG A 1 259 ? 55.302 31.528 15.406  0.50 62.13 ? 253 ARG A CB    1 
ATOM   2016 C  CG    . ARG A 1 259 ? 55.963 31.570 16.766  0.50 61.48 ? 253 ARG A CG    1 
ATOM   2017 C  CD    . ARG A 1 259 ? 57.466 31.575 16.652  0.50 60.51 ? 253 ARG A CD    1 
ATOM   2018 N  NE    . ARG A 1 259 ? 58.095 31.502 17.965  0.50 59.64 ? 253 ARG A NE    1 
ATOM   2019 C  CZ    . ARG A 1 259 ? 59.403 31.597 18.165  0.50 59.54 ? 253 ARG A CZ    1 
ATOM   2020 N  NH1   . ARG A 1 259 ? 60.219 31.770 17.135  0.50 59.83 ? 253 ARG A NH1   1 
ATOM   2021 N  NH2   . ARG A 1 259 ? 59.895 31.514 19.393  0.50 60.17 ? 253 ARG A NH2   1 
ATOM   2022 N  N     . ASN A 1 260 ? 53.184 29.339 16.071  1.00 63.78 ? 254 ASN A N     1 
ATOM   2023 C  CA    . ASN A 1 260 ? 52.725 28.276 16.956  1.00 63.39 ? 254 ASN A CA    1 
ATOM   2024 C  C     . ASN A 1 260 ? 53.611 28.252 18.180  1.00 62.67 ? 254 ASN A C     1 
ATOM   2025 O  O     . ASN A 1 260 ? 54.642 28.921 18.213  1.00 63.15 ? 254 ASN A O     1 
ATOM   2026 C  CB    . ASN A 1 260 ? 52.809 26.925 16.256  1.00 63.98 ? 254 ASN A CB    1 
ATOM   2027 C  CG    . ASN A 1 260 ? 51.631 26.668 15.356  1.00 65.56 ? 254 ASN A CG    1 
ATOM   2028 O  OD1   . ASN A 1 260 ? 50.914 27.594 14.970  1.00 66.19 ? 254 ASN A OD1   1 
ATOM   2029 N  ND2   . ASN A 1 260 ? 51.425 25.406 15.002  1.00 66.35 ? 254 ASN A ND2   1 
ATOM   2030 N  N     . SER A 1 261 ? 53.213 27.479 19.183  1.00 61.41 ? 255 SER A N     1 
ATOM   2031 C  CA    . SER A 1 261 ? 53.995 27.379 20.403  1.00 61.08 ? 255 SER A CA    1 
ATOM   2032 C  C     . SER A 1 261 ? 53.337 26.517 21.459  1.00 61.14 ? 255 SER A C     1 
ATOM   2033 O  O     . SER A 1 261 ? 52.143 26.245 21.409  1.00 61.02 ? 255 SER A O     1 
ATOM   2034 C  CB    . SER A 1 261 ? 54.243 28.767 20.995  1.00 60.93 ? 255 SER A CB    1 
ATOM   2035 O  OG    . SER A 1 261 ? 54.766 28.670 22.310  1.00 59.87 ? 255 SER A OG    1 
ATOM   2036 N  N     . ARG A 1 262 ? 54.147 26.093 22.418  1.00 62.25 ? 256 ARG A N     1 
ATOM   2037 C  CA    . ARG A 1 262 ? 53.685 25.288 23.532  1.00 63.23 ? 256 ARG A CA    1 
ATOM   2038 C  C     . ARG A 1 262 ? 54.373 25.853 24.764  1.00 63.15 ? 256 ARG A C     1 
ATOM   2039 O  O     . ARG A 1 262 ? 54.343 25.261 25.842  1.00 63.20 ? 256 ARG A O     1 
ATOM   2040 C  CB    . ARG A 1 262 ? 54.054 23.820 23.328  1.00 64.31 ? 256 ARG A CB    1 
ATOM   2041 C  CG    . ARG A 1 262 ? 53.513 23.250 22.028  1.00 66.16 ? 256 ARG A CG    1 
ATOM   2042 C  CD    . ARG A 1 262 ? 53.550 21.731 21.991  1.00 68.17 ? 256 ARG A CD    1 
ATOM   2043 N  NE    . ARG A 1 262 ? 52.584 21.124 22.907  1.00 68.80 ? 256 ARG A NE    1 
ATOM   2044 C  CZ    . ARG A 1 262 ? 52.795 20.925 24.203  1.00 68.59 ? 256 ARG A CZ    1 
ATOM   2045 N  NH1   . ARG A 1 262 ? 53.947 21.279 24.756  1.00 68.79 ? 256 ARG A NH1   1 
ATOM   2046 N  NH2   . ARG A 1 262 ? 51.849 20.372 24.948  1.00 69.16 ? 256 ARG A NH2   1 
ATOM   2047 N  N     . ASN A 1 263 ? 54.999 27.014 24.581  1.00 63.44 ? 257 ASN A N     1 
ATOM   2048 C  CA    . ASN A 1 263 ? 55.684 27.692 25.670  1.00 64.28 ? 257 ASN A CA    1 
ATOM   2049 C  C     . ASN A 1 263 ? 54.689 28.603 26.368  1.00 63.14 ? 257 ASN A C     1 
ATOM   2050 O  O     . ASN A 1 263 ? 54.147 29.527 25.759  1.00 62.95 ? 257 ASN A O     1 
ATOM   2051 C  CB    . ASN A 1 263 ? 56.857 28.524 25.146  1.00 66.49 ? 257 ASN A CB    1 
ATOM   2052 C  CG    . ASN A 1 263 ? 57.588 29.264 26.259  1.00 68.08 ? 257 ASN A CG    1 
ATOM   2053 O  OD1   . ASN A 1 263 ? 57.033 30.164 26.894  1.00 69.48 ? 257 ASN A OD1   1 
ATOM   2054 N  ND2   . ASN A 1 263 ? 58.836 28.879 26.505  1.00 69.14 ? 257 ASN A ND2   1 
ATOM   2055 N  N     . LEU A 1 264 ? 54.460 28.327 27.647  1.00 61.94 ? 258 LEU A N     1 
ATOM   2056 C  CA    . LEU A 1 264 ? 53.529 29.088 28.470  1.00 61.66 ? 258 LEU A CA    1 
ATOM   2057 C  C     . LEU A 1 264 ? 53.791 30.595 28.459  1.00 61.09 ? 258 LEU A C     1 
ATOM   2058 O  O     . LEU A 1 264 ? 52.883 31.394 28.210  1.00 60.93 ? 258 LEU A O     1 
ATOM   2059 C  CB    . LEU A 1 264 ? 53.591 28.569 29.909  1.00 61.64 ? 258 LEU A CB    1 
ATOM   2060 C  CG    . LEU A 1 264 ? 52.611 29.176 30.915  1.00 62.23 ? 258 LEU A CG    1 
ATOM   2061 C  CD1   . LEU A 1 264 ? 51.197 28.730 30.580  1.00 61.34 ? 258 LEU A CD1   1 
ATOM   2062 C  CD2   . LEU A 1 264 ? 52.987 28.737 32.326  1.00 61.76 ? 258 LEU A CD2   1 
ATOM   2063 N  N     . GLU A 1 265 ? 55.034 30.976 28.737  1.00 60.84 ? 259 GLU A N     1 
ATOM   2064 C  CA    . GLU A 1 265 ? 55.420 32.381 28.777  1.00 59.79 ? 259 GLU A CA    1 
ATOM   2065 C  C     . GLU A 1 265 ? 55.233 33.089 27.448  1.00 59.51 ? 259 GLU A C     1 
ATOM   2066 O  O     . GLU A 1 265 ? 55.141 34.313 27.396  1.00 60.17 ? 259 GLU A O     1 
ATOM   2067 C  CB    . GLU A 1 265 ? 56.874 32.512 29.224  1.00 59.42 ? 259 GLU A CB    1 
ATOM   2068 C  CG    . GLU A 1 265 ? 57.088 32.182 30.686  1.00 59.20 ? 259 GLU A CG    1 
ATOM   2069 C  CD    . GLU A 1 265 ? 56.137 32.945 31.591  1.00 59.65 ? 259 GLU A CD    1 
ATOM   2070 O  OE1   . GLU A 1 265 ? 55.843 34.121 31.285  1.00 59.69 ? 259 GLU A OE1   1 
ATOM   2071 O  OE2   . GLU A 1 265 ? 55.693 32.377 32.614  1.00 60.08 ? 259 GLU A OE2   1 
ATOM   2072 N  N     . GLU A 1 266 ? 55.177 32.316 26.374  1.00 58.47 ? 260 GLU A N     1 
ATOM   2073 C  CA    . GLU A 1 266 ? 55.002 32.882 25.047  1.00 57.87 ? 260 GLU A CA    1 
ATOM   2074 C  C     . GLU A 1 266 ? 53.517 32.998 24.709  1.00 56.83 ? 260 GLU A C     1 
ATOM   2075 O  O     . GLU A 1 266 ? 53.115 33.810 23.875  1.00 56.64 ? 260 GLU A O     1 
ATOM   2076 C  CB    . GLU A 1 266 ? 55.696 31.993 24.013  1.00 58.39 ? 260 GLU A CB    1 
ATOM   2077 C  CG    . GLU A 1 266 ? 55.756 32.576 22.613  1.00 59.46 ? 260 GLU A CG    1 
ATOM   2078 C  CD    . GLU A 1 266 ? 56.437 31.640 21.635  1.00 60.73 ? 260 GLU A CD    1 
ATOM   2079 O  OE1   . GLU A 1 266 ? 57.101 30.688 22.101  1.00 61.78 ? 260 GLU A OE1   1 
ATOM   2080 O  OE2   . GLU A 1 266 ? 56.316 31.859 20.408  1.00 59.93 ? 260 GLU A OE2   1 
ATOM   2081 N  N     . ILE A 1 267 ? 52.703 32.187 25.369  1.00 55.24 ? 261 ILE A N     1 
ATOM   2082 C  CA    . ILE A 1 267 ? 51.272 32.187 25.106  1.00 53.94 ? 261 ILE A CA    1 
ATOM   2083 C  C     . ILE A 1 267 ? 50.498 33.120 26.027  1.00 53.44 ? 261 ILE A C     1 
ATOM   2084 O  O     . ILE A 1 267 ? 49.562 33.794 25.595  1.00 54.03 ? 261 ILE A O     1 
ATOM   2085 C  CB    . ILE A 1 267 ? 50.704 30.761 25.251  1.00 53.97 ? 261 ILE A CB    1 
ATOM   2086 C  CG1   . ILE A 1 267 ? 51.432 29.819 24.285  1.00 53.45 ? 261 ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A 1 267 ? 49.200 30.772 25.003  1.00 53.21 ? 261 ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A 1 267 ? 51.127 28.353 24.488  1.00 51.83 ? 261 ILE A CD1   1 
ATOM   2089 N  N     . LYS A 1 268 ? 50.905 33.158 27.291  1.00 52.30 ? 262 LYS A N     1 
ATOM   2090 C  CA    . LYS A 1 268 ? 50.244 33.971 28.308  1.00 52.72 ? 262 LYS A CA    1 
ATOM   2091 C  C     . LYS A 1 268 ? 49.827 35.402 27.961  1.00 51.31 ? 262 LYS A C     1 
ATOM   2092 O  O     . LYS A 1 268 ? 48.703 35.805 28.257  1.00 51.52 ? 262 LYS A O     1 
ATOM   2093 C  CB    . LYS A 1 268 ? 51.093 33.971 29.574  1.00 53.04 ? 262 LYS A CB    1 
ATOM   2094 C  CG    . LYS A 1 268 ? 51.043 32.634 30.295  1.00 56.36 ? 262 LYS A CG    1 
ATOM   2095 C  CD    . LYS A 1 268 ? 52.155 32.485 31.325  1.00 58.53 ? 262 LYS A CD    1 
ATOM   2096 C  CE    . LYS A 1 268 ? 52.030 33.480 32.460  1.00 58.86 ? 262 LYS A CE    1 
ATOM   2097 N  NZ    . LYS A 1 268 ? 53.182 33.331 33.397  1.00 60.49 ? 262 LYS A NZ    1 
ATOM   2098 N  N     . PRO A 1 269 ? 50.715 36.187 27.331  1.00 50.15 ? 263 PRO A N     1 
ATOM   2099 C  CA    . PRO A 1 269 ? 50.374 37.568 26.974  1.00 48.35 ? 263 PRO A CA    1 
ATOM   2100 C  C     . PRO A 1 269 ? 49.200 37.652 26.004  1.00 46.72 ? 263 PRO A C     1 
ATOM   2101 O  O     . PRO A 1 269 ? 48.382 38.568 26.073  1.00 45.06 ? 263 PRO A O     1 
ATOM   2102 C  CB    . PRO A 1 269 ? 51.676 38.101 26.385  1.00 49.67 ? 263 PRO A CB    1 
ATOM   2103 C  CG    . PRO A 1 269 ? 52.310 36.880 25.809  1.00 51.18 ? 263 PRO A CG    1 
ATOM   2104 C  CD    . PRO A 1 269 ? 52.080 35.856 26.888  1.00 51.42 ? 263 PRO A CD    1 
ATOM   2105 N  N     . TYR A 1 270 ? 49.127 36.694 25.089  1.00 45.90 ? 264 TYR A N     1 
ATOM   2106 C  CA    . TYR A 1 270 ? 48.025 36.643 24.139  1.00 43.65 ? 264 TYR A CA    1 
ATOM   2107 C  C     . TYR A 1 270 ? 46.767 36.338 24.953  1.00 40.19 ? 264 TYR A C     1 
ATOM   2108 O  O     . TYR A 1 270 ? 45.725 36.970 24.774  1.00 37.15 ? 264 TYR A O     1 
ATOM   2109 C  CB    . TYR A 1 270 ? 48.257 35.525 23.121  1.00 44.55 ? 264 TYR A CB    1 
ATOM   2110 C  CG    . TYR A 1 270 ? 49.329 35.809 22.091  1.00 46.73 ? 264 TYR A CG    1 
ATOM   2111 C  CD1   . TYR A 1 270 ? 49.075 36.655 21.010  1.00 47.25 ? 264 TYR A CD1   1 
ATOM   2112 C  CD2   . TYR A 1 270 ? 50.574 35.182 22.160  1.00 46.90 ? 264 TYR A CD2   1 
ATOM   2113 C  CE1   . TYR A 1 270 ? 50.025 36.863 20.016  1.00 48.82 ? 264 TYR A CE1   1 
ATOM   2114 C  CE2   . TYR A 1 270 ? 51.538 35.385 21.172  1.00 48.17 ? 264 TYR A CE2   1 
ATOM   2115 C  CZ    . TYR A 1 270 ? 51.254 36.225 20.099  1.00 49.84 ? 264 TYR A CZ    1 
ATOM   2116 O  OH    . TYR A 1 270 ? 52.179 36.413 19.094  1.00 51.33 ? 264 TYR A OH    1 
ATOM   2117 N  N     . LEU A 1 271 ? 46.887 35.366 25.852  1.00 37.14 ? 265 LEU A N     1 
ATOM   2118 C  CA    . LEU A 1 271 ? 45.780 34.955 26.705  1.00 37.80 ? 265 LEU A CA    1 
ATOM   2119 C  C     . LEU A 1 271 ? 45.260 36.106 27.559  1.00 37.63 ? 265 LEU A C     1 
ATOM   2120 O  O     . LEU A 1 271 ? 44.058 36.366 27.593  1.00 36.61 ? 265 LEU A O     1 
ATOM   2121 C  CB    . LEU A 1 271 ? 46.212 33.807 27.625  1.00 37.76 ? 265 LEU A CB    1 
ATOM   2122 C  CG    . LEU A 1 271 ? 45.168 33.296 28.630  1.00 38.66 ? 265 LEU A CG    1 
ATOM   2123 C  CD1   . LEU A 1 271 ? 44.024 32.621 27.887  1.00 38.97 ? 265 LEU A CD1   1 
ATOM   2124 C  CD2   . LEU A 1 271 ? 45.813 32.310 29.597  1.00 39.38 ? 265 LEU A CD2   1 
ATOM   2125 N  N     . PHE A 1 272 ? 46.172 36.787 28.250  1.00 37.53 ? 266 PHE A N     1 
ATOM   2126 C  CA    . PHE A 1 272 ? 45.807 37.897 29.119  1.00 37.19 ? 266 PHE A CA    1 
ATOM   2127 C  C     . PHE A 1 272 ? 45.159 39.023 28.343  1.00 37.22 ? 266 PHE A C     1 
ATOM   2128 O  O     . PHE A 1 272 ? 44.176 39.616 28.793  1.00 37.69 ? 266 PHE A O     1 
ATOM   2129 C  CB    . PHE A 1 272 ? 47.039 38.402 29.873  1.00 39.32 ? 266 PHE A CB    1 
ATOM   2130 C  CG    . PHE A 1 272 ? 47.616 37.391 30.818  1.00 40.95 ? 266 PHE A CG    1 
ATOM   2131 C  CD1   . PHE A 1 272 ? 46.805 36.412 31.386  1.00 41.93 ? 266 PHE A CD1   1 
ATOM   2132 C  CD2   . PHE A 1 272 ? 48.962 37.428 31.163  1.00 44.44 ? 266 PHE A CD2   1 
ATOM   2133 C  CE1   . PHE A 1 272 ? 47.316 35.484 32.282  1.00 42.16 ? 266 PHE A CE1   1 
ATOM   2134 C  CE2   . PHE A 1 272 ? 49.491 36.502 32.064  1.00 44.30 ? 266 PHE A CE2   1 
ATOM   2135 C  CZ    . PHE A 1 272 ? 48.663 35.527 32.624  1.00 45.14 ? 266 PHE A CZ    1 
ATOM   2136 N  N     . ARG A 1 273 ? 45.714 39.310 27.172  1.00 36.77 ? 267 ARG A N     1 
ATOM   2137 C  CA    . ARG A 1 273 ? 45.187 40.341 26.295  1.00 36.02 ? 267 ARG A CA    1 
ATOM   2138 C  C     . ARG A 1 273 ? 43.745 39.966 25.985  1.00 35.44 ? 267 ARG A C     1 
ATOM   2139 O  O     . ARG A 1 273 ? 42.866 40.826 25.927  1.00 36.43 ? 267 ARG A O     1 
ATOM   2140 C  CB    . ARG A 1 273 ? 46.003 40.371 25.007  1.00 37.84 ? 267 ARG A CB    1 
ATOM   2141 C  CG    . ARG A 1 273 ? 45.670 41.487 24.037  1.00 39.88 ? 267 ARG A CG    1 
ATOM   2142 C  CD    . ARG A 1 273 ? 46.547 41.333 22.801  0.50 38.49 ? 267 ARG A CD    1 
ATOM   2143 N  NE    . ARG A 1 273 ? 47.916 40.989 23.180  0.50 37.89 ? 267 ARG A NE    1 
ATOM   2144 C  CZ    . ARG A 1 273 ? 48.837 40.527 22.343  0.50 37.29 ? 267 ARG A CZ    1 
ATOM   2145 N  NH1   . ARG A 1 273 ? 48.544 40.348 21.061  0.50 37.53 ? 267 ARG A NH1   1 
ATOM   2146 N  NH2   . ARG A 1 273 ? 50.048 40.231 22.791  0.50 36.43 ? 267 ARG A NH2   1 
ATOM   2147 N  N     . ALA A 1 274 ? 43.511 38.672 25.783  1.00 32.40 ? 268 ALA A N     1 
ATOM   2148 C  CA    . ALA A 1 274 ? 42.172 38.189 25.493  1.00 32.13 ? 268 ALA A CA    1 
ATOM   2149 C  C     . ALA A 1 274 ? 41.294 38.407 26.724  1.00 32.19 ? 268 ALA A C     1 
ATOM   2150 O  O     . ALA A 1 274 ? 40.125 38.779 26.615  1.00 30.66 ? 268 ALA A O     1 
ATOM   2151 C  CB    . ALA A 1 274 ? 42.209 36.713 25.127  1.00 29.31 ? 268 ALA A CB    1 
ATOM   2152 N  N     . ILE A 1 275 ? 41.859 38.171 27.902  1.00 32.17 ? 269 ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 275 ? 41.100 38.359 29.129  1.00 32.23 ? 269 ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 275 ? 40.787 39.839 29.306  1.00 32.36 ? 269 ILE A C     1 
ATOM   2155 O  O     . ILE A 1 275 ? 39.658 40.213 29.633  1.00 31.17 ? 269 ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 275 ? 41.878 37.839 30.356  1.00 32.37 ? 269 ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 275 ? 42.076 36.327 30.231  1.00 32.65 ? 269 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 275 ? 41.117 38.172 31.639  1.00 30.84 ? 269 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 275 ? 42.972 35.725 31.297  1.00 34.52 ? 269 ILE A CD1   1 
ATOM   2160 N  N     . GLU A 1 276 ? 41.793 40.676 29.076  1.00 34.24 ? 270 GLU A N     1 
ATOM   2161 C  CA    . GLU A 1 276 ? 41.633 42.120 29.199  1.00 37.39 ? 270 GLU A CA    1 
ATOM   2162 C  C     . GLU A 1 276 ? 40.524 42.636 28.291  1.00 38.78 ? 270 GLU A C     1 
ATOM   2163 O  O     . GLU A 1 276 ? 39.674 43.411 28.717  1.00 38.79 ? 270 GLU A O     1 
ATOM   2164 C  CB    . GLU A 1 276 ? 42.942 42.838 28.850  1.00 39.82 ? 270 GLU A CB    1 
ATOM   2165 C  CG    . GLU A 1 276 ? 44.015 42.765 29.923  1.00 43.33 ? 270 GLU A CG    1 
ATOM   2166 C  CD    . GLU A 1 276 ? 43.529 43.279 31.268  1.00 46.63 ? 270 GLU A CD    1 
ATOM   2167 O  OE1   . GLU A 1 276 ? 42.731 44.243 31.290  1.00 46.85 ? 270 GLU A OE1   1 
ATOM   2168 O  OE2   . GLU A 1 276 ? 43.954 42.727 32.307  1.00 48.20 ? 270 GLU A OE2   1 
ATOM   2169 N  N     . GLU A 1 277 ? 40.539 42.204 27.034  1.00 39.95 ? 271 GLU A N     1 
ATOM   2170 C  CA    . GLU A 1 277 ? 39.529 42.643 26.084  1.00 40.64 ? 271 GLU A CA    1 
ATOM   2171 C  C     . GLU A 1 277 ? 38.157 42.123 26.491  1.00 39.51 ? 271 GLU A C     1 
ATOM   2172 O  O     . GLU A 1 277 ? 37.157 42.832 26.391  1.00 40.60 ? 271 GLU A O     1 
ATOM   2173 C  CB    . GLU A 1 277 ? 39.862 42.150 24.673  1.00 40.67 ? 271 GLU A CB    1 
ATOM   2174 C  CG    . GLU A 1 277 ? 41.158 42.696 24.084  1.00 42.70 ? 271 GLU A CG    1 
ATOM   2175 C  CD    . GLU A 1 277 ? 41.337 42.306 22.618  0.50 42.70 ? 271 GLU A CD    1 
ATOM   2176 O  OE1   . GLU A 1 277 ? 42.456 42.463 22.083  0.50 43.05 ? 271 GLU A OE1   1 
ATOM   2177 O  OE2   . GLU A 1 277 ? 40.352 41.847 21.997  0.50 41.72 ? 271 GLU A OE2   1 
ATOM   2178 N  N     . SER A 1 278 ? 38.115 40.880 26.948  1.00 38.25 ? 272 SER A N     1 
ATOM   2179 C  CA    . SER A 1 278 ? 36.854 40.274 27.363  1.00 36.82 ? 272 SER A CA    1 
ATOM   2180 C  C     . SER A 1 278 ? 36.217 40.993 28.551  1.00 35.32 ? 272 SER A C     1 
ATOM   2181 O  O     . SER A 1 278 ? 35.000 41.144 28.606  1.00 33.39 ? 272 SER A O     1 
ATOM   2182 C  CB    . SER A 1 278 ? 37.070 38.798 27.700  1.00 36.94 ? 272 SER A CB    1 
ATOM   2183 O  OG    . SER A 1 278 ? 37.624 38.116 26.594  1.00 35.81 ? 272 SER A OG    1 
ATOM   2184 N  N     . TYR A 1 279 ? 37.035 41.425 29.506  1.00 37.17 ? 273 TYR A N     1 
ATOM   2185 C  CA    . TYR A 1 279 ? 36.517 42.135 30.674  1.00 38.78 ? 273 TYR A CA    1 
ATOM   2186 C  C     . TYR A 1 279 ? 36.025 43.525 30.301  1.00 40.40 ? 273 TYR A C     1 
ATOM   2187 O  O     . TYR A 1 279 ? 35.022 44.001 30.838  1.00 41.58 ? 273 TYR A O     1 
ATOM   2188 C  CB    . TYR A 1 279 ? 37.581 42.204 31.778  1.00 38.76 ? 273 TYR A CB    1 
ATOM   2189 C  CG    . TYR A 1 279 ? 37.412 41.089 32.780  1.00 38.20 ? 273 TYR A CG    1 
ATOM   2190 C  CD1   . TYR A 1 279 ? 36.720 41.297 33.972  1.00 37.84 ? 273 TYR A CD1   1 
ATOM   2191 C  CD2   . TYR A 1 279 ? 37.834 39.796 32.484  1.00 39.65 ? 273 TYR A CD2   1 
ATOM   2192 C  CE1   . TYR A 1 279 ? 36.441 40.237 34.844  1.00 38.23 ? 273 TYR A CE1   1 
ATOM   2193 C  CE2   . TYR A 1 279 ? 37.560 38.733 33.341  1.00 40.10 ? 273 TYR A CE2   1 
ATOM   2194 C  CZ    . TYR A 1 279 ? 36.861 38.955 34.518  1.00 39.02 ? 273 TYR A CZ    1 
ATOM   2195 O  OH    . TYR A 1 279 ? 36.562 37.891 35.349  1.00 37.19 ? 273 TYR A OH    1 
ATOM   2196 N  N     . TYR A 1 280 ? 36.724 44.177 29.380  1.00 42.17 ? 274 TYR A N     1 
ATOM   2197 C  CA    . TYR A 1 280 ? 36.300 45.495 28.926  1.00 44.01 ? 274 TYR A CA    1 
ATOM   2198 C  C     . TYR A 1 280 ? 34.899 45.323 28.342  1.00 44.62 ? 274 TYR A C     1 
ATOM   2199 O  O     . TYR A 1 280 ? 33.970 46.055 28.682  1.00 45.61 ? 274 TYR A O     1 
ATOM   2200 C  CB    . TYR A 1 280 ? 37.243 46.015 27.836  1.00 44.87 ? 274 TYR A CB    1 
ATOM   2201 C  CG    . TYR A 1 280 ? 36.782 47.302 27.182  0.50 45.17 ? 274 TYR A CG    1 
ATOM   2202 C  CD1   . TYR A 1 280 ? 37.026 48.538 27.778  0.50 45.26 ? 274 TYR A CD1   1 
ATOM   2203 C  CD2   . TYR A 1 280 ? 36.084 47.279 25.972  0.50 45.14 ? 274 TYR A CD2   1 
ATOM   2204 C  CE1   . TYR A 1 280 ? 36.588 49.721 27.185  0.50 45.45 ? 274 TYR A CE1   1 
ATOM   2205 C  CE2   . TYR A 1 280 ? 35.640 48.454 25.374  0.50 45.00 ? 274 TYR A CE2   1 
ATOM   2206 C  CZ    . TYR A 1 280 ? 35.896 49.670 25.986  0.50 45.26 ? 274 TYR A CZ    1 
ATOM   2207 O  OH    . TYR A 1 280 ? 35.455 50.835 25.404  0.50 46.94 ? 274 TYR A OH    1 
ATOM   2208 N  N     . LYS A 1 281 ? 34.753 44.328 27.472  1.00 44.88 ? 275 LYS A N     1 
ATOM   2209 C  CA    . LYS A 1 281 ? 33.475 44.059 26.828  1.00 44.72 ? 275 LYS A CA    1 
ATOM   2210 C  C     . LYS A 1 281 ? 32.409 43.587 27.823  1.00 45.39 ? 275 LYS A C     1 
ATOM   2211 O  O     . LYS A 1 281 ? 31.219 43.826 27.621  1.00 45.80 ? 275 LYS A O     1 
ATOM   2212 C  CB    . LYS A 1 281 ? 33.666 43.028 25.707  1.00 42.99 ? 275 LYS A CB    1 
ATOM   2213 C  CG    . LYS A 1 281 ? 32.453 42.864 24.801  0.50 44.12 ? 275 LYS A CG    1 
ATOM   2214 C  CD    . LYS A 1 281 ? 32.768 41.978 23.600  0.50 45.37 ? 275 LYS A CD    1 
ATOM   2215 C  CE    . LYS A 1 281 ? 31.552 41.798 22.701  0.50 44.50 ? 275 LYS A CE    1 
ATOM   2216 N  NZ    . LYS A 1 281 ? 31.853 40.933 21.529  0.50 44.31 ? 275 LYS A NZ    1 
ATOM   2217 N  N     . LEU A 1 282 ? 32.831 42.925 28.897  1.00 45.82 ? 276 LEU A N     1 
ATOM   2218 C  CA    . LEU A 1 282 ? 31.891 42.444 29.911  1.00 47.21 ? 276 LEU A CA    1 
ATOM   2219 C  C     . LEU A 1 282 ? 31.070 43.577 30.516  1.00 48.14 ? 276 LEU A C     1 
ATOM   2220 O  O     . LEU A 1 282 ? 29.878 43.414 30.796  1.00 48.50 ? 276 LEU A O     1 
ATOM   2221 C  CB    . LEU A 1 282 ? 32.632 41.725 31.044  1.00 44.56 ? 276 LEU A CB    1 
ATOM   2222 C  CG    . LEU A 1 282 ? 32.985 40.251 30.871  1.00 44.31 ? 276 LEU A CG    1 
ATOM   2223 C  CD1   . LEU A 1 282 ? 33.759 39.790 32.097  1.00 44.38 ? 276 LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A 1 282 ? 31.714 39.414 30.697  1.00 42.36 ? 276 LEU A CD2   1 
ATOM   2225 N  N     . ASP A 1 283 ? 31.722 44.718 30.725  1.00 50.14 ? 277 ASP A N     1 
ATOM   2226 C  CA    . ASP A 1 283 ? 31.085 45.896 31.311  1.00 51.57 ? 277 ASP A CA    1 
ATOM   2227 C  C     . ASP A 1 283 ? 30.728 45.642 32.772  1.00 51.07 ? 277 ASP A C     1 
ATOM   2228 O  O     . ASP A 1 283 ? 31.610 45.456 33.612  1.00 51.02 ? 277 ASP A O     1 
ATOM   2229 C  CB    . ASP A 1 283 ? 29.816 46.274 30.541  1.00 54.96 ? 277 ASP A CB    1 
ATOM   2230 C  CG    . ASP A 1 283 ? 29.808 47.731 30.110  1.00 58.26 ? 277 ASP A CG    1 
ATOM   2231 O  OD1   . ASP A 1 283 ? 30.241 48.592 30.910  1.00 59.06 ? 277 ASP A OD1   1 
ATOM   2232 O  OD2   . ASP A 1 283 ? 29.357 48.014 28.975  1.00 60.64 ? 277 ASP A OD2   1 
ATOM   2233 N  N     . LYS A 1 284 ? 29.433 45.620 33.071  1.00 50.17 ? 278 LYS A N     1 
ATOM   2234 C  CA    . LYS A 1 284 ? 28.986 45.396 34.437  1.00 49.27 ? 278 LYS A CA    1 
ATOM   2235 C  C     . LYS A 1 284 ? 28.599 43.952 34.711  1.00 47.78 ? 278 LYS A C     1 
ATOM   2236 O  O     . LYS A 1 284 ? 28.240 43.608 35.837  1.00 47.87 ? 278 LYS A O     1 
ATOM   2237 C  CB    . LYS A 1 284 ? 27.810 46.321 34.765  0.50 49.56 ? 278 LYS A CB    1 
ATOM   2238 C  CG    . LYS A 1 284 ? 28.190 47.791 34.850  0.50 50.47 ? 278 LYS A CG    1 
ATOM   2239 C  CD    . LYS A 1 284 ? 27.013 48.653 35.284  0.50 51.86 ? 278 LYS A CD    1 
ATOM   2240 C  CE    . LYS A 1 284 ? 25.972 48.771 34.189  0.50 52.31 ? 278 LYS A CE    1 
ATOM   2241 N  NZ    . LYS A 1 284 ? 26.524 49.475 32.997  0.50 52.37 ? 278 LYS A NZ    1 
ATOM   2242 N  N     . ARG A 1 285 ? 28.677 43.103 33.690  1.00 45.76 ? 279 ARG A N     1 
ATOM   2243 C  CA    . ARG A 1 285 ? 28.322 41.695 33.854  1.00 43.04 ? 279 ARG A CA    1 
ATOM   2244 C  C     . ARG A 1 285 ? 29.425 40.933 34.580  1.00 39.60 ? 279 ARG A C     1 
ATOM   2245 O  O     . ARG A 1 285 ? 30.603 41.152 34.316  1.00 38.81 ? 279 ARG A O     1 
ATOM   2246 C  CB    . ARG A 1 285 ? 28.090 41.047 32.490  1.00 46.70 ? 279 ARG A CB    1 
ATOM   2247 C  CG    . ARG A 1 285 ? 27.172 41.823 31.577  1.00 50.75 ? 279 ARG A CG    1 
ATOM   2248 C  CD    . ARG A 1 285 ? 26.957 41.067 30.274  1.00 54.96 ? 279 ARG A CD    1 
ATOM   2249 N  NE    . ARG A 1 285 ? 26.357 41.920 29.254  1.00 58.40 ? 279 ARG A NE    1 
ATOM   2250 C  CZ    . ARG A 1 285 ? 25.802 41.467 28.138  1.00 60.61 ? 279 ARG A CZ    1 
ATOM   2251 N  NH1   . ARG A 1 285 ? 25.769 40.164 27.897  1.00 61.43 ? 279 ARG A NH1   1 
ATOM   2252 N  NH2   . ARG A 1 285 ? 25.268 42.318 27.271  1.00 63.12 ? 279 ARG A NH2   1 
ATOM   2253 N  N     . ILE A 1 286 ? 29.044 40.031 35.480  1.00 36.67 ? 280 ILE A N     1 
ATOM   2254 C  CA    . ILE A 1 286 ? 30.022 39.248 36.226  1.00 34.19 ? 280 ILE A CA    1 
ATOM   2255 C  C     . ILE A 1 286 ? 29.813 37.760 35.952  1.00 32.91 ? 280 ILE A C     1 
ATOM   2256 O  O     . ILE A 1 286 ? 28.784 37.196 36.293  1.00 33.53 ? 280 ILE A O     1 
ATOM   2257 C  CB    . ILE A 1 286 ? 29.906 39.482 37.763  1.00 34.23 ? 280 ILE A CB    1 
ATOM   2258 C  CG1   . ILE A 1 286 ? 29.761 40.973 38.079  1.00 34.05 ? 280 ILE A CG1   1 
ATOM   2259 C  CG2   . ILE A 1 286 ? 31.147 38.948 38.447  1.00 33.17 ? 280 ILE A CG2   1 
ATOM   2260 C  CD1   . ILE A 1 286 ? 30.952 41.810 37.698  1.00 34.66 ? 280 ILE A CD1   1 
ATOM   2261 N  N     . PRO A 1 287 ? 30.797 37.102 35.331  1.00 32.02 ? 281 PRO A N     1 
ATOM   2262 C  CA    . PRO A 1 287 ? 30.621 35.674 35.049  1.00 32.39 ? 281 PRO A CA    1 
ATOM   2263 C  C     . PRO A 1 287 ? 30.992 34.745 36.199  1.00 32.43 ? 281 PRO A C     1 
ATOM   2264 O  O     . PRO A 1 287 ? 31.819 35.090 37.036  1.00 32.80 ? 281 PRO A O     1 
ATOM   2265 C  CB    . PRO A 1 287 ? 31.520 35.458 33.839  1.00 31.01 ? 281 PRO A CB    1 
ATOM   2266 C  CG    . PRO A 1 287 ? 32.672 36.390 34.126  1.00 31.14 ? 281 PRO A CG    1 
ATOM   2267 C  CD    . PRO A 1 287 ? 31.963 37.649 34.613  1.00 31.02 ? 281 PRO A CD    1 
ATOM   2268 N  N     . LYS A 1 288 ? 30.371 33.566 36.228  1.00 31.65 ? 282 LYS A N     1 
ATOM   2269 C  CA    . LYS A 1 288 ? 30.674 32.577 37.251  1.00 33.53 ? 282 LYS A CA    1 
ATOM   2270 C  C     . LYS A 1 288 ? 31.461 31.461 36.591  1.00 33.88 ? 282 LYS A C     1 
ATOM   2271 O  O     . LYS A 1 288 ? 32.002 30.588 37.273  1.00 33.06 ? 282 LYS A O     1 
ATOM   2272 C  CB    . LYS A 1 288 ? 29.396 31.997 37.870  1.00 35.05 ? 282 LYS A CB    1 
ATOM   2273 C  CG    . LYS A 1 288 ? 28.534 33.020 38.586  1.00 38.83 ? 282 LYS A CG    1 
ATOM   2274 C  CD    . LYS A 1 288 ? 27.640 32.378 39.655  1.00 42.19 ? 282 LYS A CD    1 
ATOM   2275 C  CE    . LYS A 1 288 ? 26.669 31.378 39.044  1.00 43.67 ? 282 LYS A CE    1 
ATOM   2276 N  NZ    . LYS A 1 288 ? 25.853 32.027 37.977  1.00 46.77 ? 282 LYS A NZ    1 
ATOM   2277 N  N     . ALA A 1 289 ? 31.537 31.508 35.258  1.00 32.45 ? 283 ALA A N     1 
ATOM   2278 C  CA    . ALA A 1 289 ? 32.245 30.486 34.486  1.00 30.52 ? 283 ALA A CA    1 
ATOM   2279 C  C     . ALA A 1 289 ? 33.300 31.035 33.527  1.00 29.51 ? 283 ALA A C     1 
ATOM   2280 O  O     . ALA A 1 289 ? 33.145 32.117 32.950  1.00 27.44 ? 283 ALA A O     1 
ATOM   2281 C  CB    . ALA A 1 289 ? 31.236 29.630 33.701  1.00 30.11 ? 283 ALA A CB    1 
ATOM   2282 N  N     . ILE A 1 290 ? 34.369 30.262 33.349  1.00 28.34 ? 284 ILE A N     1 
ATOM   2283 C  CA    . ILE A 1 290 ? 35.456 30.637 32.462  1.00 29.49 ? 284 ILE A CA    1 
ATOM   2284 C  C     . ILE A 1 290 ? 35.973 29.423 31.690  1.00 31.32 ? 284 ILE A C     1 
ATOM   2285 O  O     . ILE A 1 290 ? 36.124 28.326 32.241  1.00 33.15 ? 284 ILE A O     1 
ATOM   2286 C  CB    . ILE A 1 290 ? 36.642 31.261 33.241  1.00 29.91 ? 284 ILE A CB    1 
ATOM   2287 C  CG1   . ILE A 1 290 ? 37.710 31.753 32.259  1.00 28.58 ? 284 ILE A CG1   1 
ATOM   2288 C  CG2   . ILE A 1 290 ? 37.240 30.226 34.209  1.00 27.37 ? 284 ILE A CG2   1 
ATOM   2289 C  CD1   . ILE A 1 290 ? 38.997 32.237 32.919  1.00 29.93 ? 284 ILE A CD1   1 
ATOM   2290 N  N     . HIS A 1 291 ? 36.220 29.619 30.401  1.00 29.74 ? 285 HIS A N     1 
ATOM   2291 C  CA    . HIS A 1 291 ? 36.760 28.558 29.573  1.00 29.30 ? 285 HIS A CA    1 
ATOM   2292 C  C     . HIS A 1 291 ? 37.941 29.122 28.814  1.00 28.61 ? 285 HIS A C     1 
ATOM   2293 O  O     . HIS A 1 291 ? 37.891 30.252 28.336  1.00 30.13 ? 285 HIS A O     1 
ATOM   2294 C  CB    . HIS A 1 291 ? 35.721 28.046 28.563  1.00 30.02 ? 285 HIS A CB    1 
ATOM   2295 C  CG    . HIS A 1 291 ? 34.661 27.180 29.166  1.00 31.92 ? 285 HIS A CG    1 
ATOM   2296 N  ND1   . HIS A 1 291 ? 33.654 27.679 29.969  1.00 32.89 ? 285 HIS A ND1   1 
ATOM   2297 C  CD2   . HIS A 1 291 ? 34.471 25.840 29.111  1.00 30.83 ? 285 HIS A CD2   1 
ATOM   2298 C  CE1   . HIS A 1 291 ? 32.893 26.682 30.384  1.00 32.04 ? 285 HIS A CE1   1 
ATOM   2299 N  NE2   . HIS A 1 291 ? 33.367 25.555 29.877  1.00 33.87 ? 285 HIS A NE2   1 
ATOM   2300 N  N     . VAL A 1 292 ? 39.018 28.354 28.727  1.00 29.77 ? 286 VAL A N     1 
ATOM   2301 C  CA    . VAL A 1 292 ? 40.167 28.789 27.952  1.00 31.23 ? 286 VAL A CA    1 
ATOM   2302 C  C     . VAL A 1 292 ? 40.077 27.950 26.681  1.00 32.28 ? 286 VAL A C     1 
ATOM   2303 O  O     . VAL A 1 292 ? 39.871 26.740 26.743  1.00 31.30 ? 286 VAL A O     1 
ATOM   2304 C  CB    . VAL A 1 292 ? 41.501 28.533 28.684  1.00 30.05 ? 286 VAL A CB    1 
ATOM   2305 C  CG1   . VAL A 1 292 ? 42.658 28.697 27.717  1.00 29.10 ? 286 VAL A CG1   1 
ATOM   2306 C  CG2   . VAL A 1 292 ? 41.661 29.532 29.836  1.00 28.34 ? 286 VAL A CG2   1 
ATOM   2307 N  N     . VAL A 1 293 ? 40.203 28.602 25.530  1.00 33.75 ? 287 VAL A N     1 
ATOM   2308 C  CA    . VAL A 1 293 ? 40.090 27.901 24.261  1.00 33.33 ? 287 VAL A CA    1 
ATOM   2309 C  C     . VAL A 1 293 ? 41.368 27.948 23.457  1.00 35.72 ? 287 VAL A C     1 
ATOM   2310 O  O     . VAL A 1 293 ? 41.990 29.004 23.292  1.00 36.71 ? 287 VAL A O     1 
ATOM   2311 C  CB    . VAL A 1 293 ? 38.951 28.490 23.434  1.00 34.74 ? 287 VAL A CB    1 
ATOM   2312 C  CG1   . VAL A 1 293 ? 38.743 27.686 22.155  1.00 32.99 ? 287 VAL A CG1   1 
ATOM   2313 C  CG2   . VAL A 1 293 ? 37.693 28.507 24.268  1.00 35.22 ? 287 VAL A CG2   1 
ATOM   2314 N  N     . ALA A 1 294 ? 41.758 26.784 22.959  1.00 36.80 ? 288 ALA A N     1 
ATOM   2315 C  CA    . ALA A 1 294 ? 42.968 26.662 22.170  1.00 38.16 ? 288 ALA A CA    1 
ATOM   2316 C  C     . ALA A 1 294 ? 42.678 25.999 20.840  1.00 38.55 ? 288 ALA A C     1 
ATOM   2317 O  O     . ALA A 1 294 ? 41.875 25.071 20.749  1.00 38.80 ? 288 ALA A O     1 
ATOM   2318 C  CB    . ALA A 1 294 ? 44.014 25.843 22.934  1.00 35.77 ? 288 ALA A CB    1 
ATOM   2319 N  N     . VAL A 1 295 ? 43.341 26.500 19.810  1.00 40.15 ? 289 VAL A N     1 
ATOM   2320 C  CA    . VAL A 1 295 ? 43.223 25.961 18.470  1.00 42.79 ? 289 VAL A CA    1 
ATOM   2321 C  C     . VAL A 1 295 ? 44.594 25.351 18.200  1.00 44.75 ? 289 VAL A C     1 
ATOM   2322 O  O     . VAL A 1 295 ? 45.590 26.068 18.130  1.00 44.00 ? 289 VAL A O     1 
ATOM   2323 C  CB    . VAL A 1 295 ? 42.950 27.074 17.435  1.00 42.54 ? 289 VAL A CB    1 
ATOM   2324 C  CG1   . VAL A 1 295 ? 43.000 26.498 16.034  1.00 42.49 ? 289 VAL A CG1   1 
ATOM   2325 C  CG2   . VAL A 1 295 ? 41.593 27.707 17.694  1.00 41.41 ? 289 VAL A CG2   1 
ATOM   2326 N  N     . THR A 1 296 ? 44.649 24.030 18.073  1.00 47.59 ? 290 THR A N     1 
ATOM   2327 C  CA    . THR A 1 296 ? 45.915 23.355 17.817  1.00 50.26 ? 290 THR A CA    1 
ATOM   2328 C  C     . THR A 1 296 ? 46.444 23.667 16.419  1.00 51.26 ? 290 THR A C     1 
ATOM   2329 O  O     . THR A 1 296 ? 45.750 24.269 15.591  1.00 50.59 ? 290 THR A O     1 
ATOM   2330 C  CB    . THR A 1 296 ? 45.783 21.822 17.970  1.00 50.75 ? 290 THR A CB    1 
ATOM   2331 O  OG1   . THR A 1 296 ? 44.762 21.334 17.089  1.00 53.63 ? 290 THR A OG1   1 
ATOM   2332 C  CG2   . THR A 1 296 ? 45.426 21.460 19.401  1.00 51.51 ? 290 THR A CG2   1 
ATOM   2333 N  N     . GLU A 1 297 ? 47.683 23.260 16.167  1.00 53.04 ? 291 GLU A N     1 
ATOM   2334 C  CA    . GLU A 1 297 ? 48.302 23.496 14.874  1.00 54.30 ? 291 GLU A CA    1 
ATOM   2335 C  C     . GLU A 1 297 ? 47.472 22.849 13.770  1.00 55.60 ? 291 GLU A C     1 
ATOM   2336 O  O     . GLU A 1 297 ? 47.327 23.415 12.690  1.00 56.41 ? 291 GLU A O     1 
ATOM   2337 C  CB    . GLU A 1 297 ? 49.733 22.944 14.869  0.50 53.33 ? 291 GLU A CB    1 
ATOM   2338 C  CG    . GLU A 1 297 ? 49.851 21.467 15.212  0.50 52.61 ? 291 GLU A CG    1 
ATOM   2339 C  CD    . GLU A 1 297 ? 51.286 21.046 15.482  0.50 52.32 ? 291 GLU A CD    1 
ATOM   2340 O  OE1   . GLU A 1 297 ? 52.161 21.311 14.628  0.50 52.57 ? 291 GLU A OE1   1 
ATOM   2341 O  OE2   . GLU A 1 297 ? 51.540 20.448 16.548  0.50 50.58 ? 291 GLU A OE2   1 
ATOM   2342 N  N     . ASP A 1 298 ? 46.915 21.673 14.049  1.00 56.73 ? 292 ASP A N     1 
ATOM   2343 C  CA    . ASP A 1 298 ? 46.095 20.962 13.069  1.00 57.66 ? 292 ASP A CA    1 
ATOM   2344 C  C     . ASP A 1 298 ? 44.663 21.497 13.044  1.00 58.03 ? 292 ASP A C     1 
ATOM   2345 O  O     . ASP A 1 298 ? 43.722 20.776 12.708  1.00 59.44 ? 292 ASP A O     1 
ATOM   2346 C  CB    . ASP A 1 298 ? 46.082 19.469 13.385  1.00 58.11 ? 292 ASP A CB    1 
ATOM   2347 C  CG    . ASP A 1 298 ? 45.642 19.188 14.795  1.00 58.45 ? 292 ASP A CG    1 
ATOM   2348 O  OD1   . ASP A 1 298 ? 46.303 19.683 15.727  1.00 59.50 ? 292 ASP A OD1   1 
ATOM   2349 O  OD2   . ASP A 1 298 ? 44.635 18.477 14.977  1.00 59.61 ? 292 ASP A OD2   1 
ATOM   2350 N  N     . LEU A 1 299 ? 44.517 22.765 13.412  1.00 57.17 ? 293 LEU A N     1 
ATOM   2351 C  CA    . LEU A 1 299 ? 43.234 23.456 13.433  1.00 56.27 ? 293 LEU A CA    1 
ATOM   2352 C  C     . LEU A 1 299 ? 42.138 22.863 14.318  1.00 55.31 ? 293 LEU A C     1 
ATOM   2353 O  O     . LEU A 1 299 ? 40.965 23.208 14.177  1.00 55.19 ? 293 LEU A O     1 
ATOM   2354 C  CB    . LEU A 1 299 ? 42.721 23.637 12.002  1.00 56.24 ? 293 LEU A CB    1 
ATOM   2355 C  CG    . LEU A 1 299 ? 43.662 24.466 11.118  1.00 57.30 ? 293 LEU A CG    1 
ATOM   2356 C  CD1   . LEU A 1 299 ? 43.027 24.690 9.754   1.00 57.97 ? 293 LEU A CD1   1 
ATOM   2357 C  CD2   . LEU A 1 299 ? 43.958 25.803 11.783  1.00 57.21 ? 293 LEU A CD2   1 
ATOM   2358 N  N     . ASP A 1 300 ? 42.510 21.979 15.235  1.00 54.16 ? 294 ASP A N     1 
ATOM   2359 C  CA    . ASP A 1 300 ? 41.528 21.416 16.153  1.00 53.59 ? 294 ASP A CA    1 
ATOM   2360 C  C     . ASP A 1 300 ? 41.272 22.467 17.246  1.00 51.94 ? 294 ASP A C     1 
ATOM   2361 O  O     . ASP A 1 300 ? 42.135 23.306 17.517  1.00 50.85 ? 294 ASP A O     1 
ATOM   2362 C  CB    . ASP A 1 300 ? 42.061 20.121 16.771  1.00 55.07 ? 294 ASP A CB    1 
ATOM   2363 C  CG    . ASP A 1 300 ? 41.449 18.883 16.150  1.00 58.74 ? 294 ASP A CG    1 
ATOM   2364 O  OD1   . ASP A 1 300 ? 41.451 18.769 14.902  1.00 61.41 ? 294 ASP A OD1   1 
ATOM   2365 O  OD2   . ASP A 1 300 ? 40.970 18.015 16.913  1.00 60.78 ? 294 ASP A OD2   1 
ATOM   2366 N  N     . ILE A 1 301 ? 40.084 22.441 17.849  1.00 50.51 ? 295 ILE A N     1 
ATOM   2367 C  CA    . ILE A 1 301 ? 39.735 23.394 18.906  1.00 48.75 ? 295 ILE A CA    1 
ATOM   2368 C  C     . ILE A 1 301 ? 39.508 22.660 20.219  1.00 47.89 ? 295 ILE A C     1 
ATOM   2369 O  O     . ILE A 1 301 ? 38.555 21.886 20.358  1.00 47.41 ? 295 ILE A O     1 
ATOM   2370 C  CB    . ILE A 1 301 ? 38.448 24.190 18.582  1.00 49.10 ? 295 ILE A CB    1 
ATOM   2371 C  CG1   . ILE A 1 301 ? 38.677 25.136 17.398  1.00 50.46 ? 295 ILE A CG1   1 
ATOM   2372 C  CG2   . ILE A 1 301 ? 38.027 24.998 19.792  1.00 48.50 ? 295 ILE A CG2   1 
ATOM   2373 C  CD1   . ILE A 1 301 ? 38.819 24.442 16.059  1.00 51.80 ? 295 ILE A CD1   1 
ATOM   2374 N  N     . VAL A 1 302 ? 40.385 22.911 21.185  1.00 45.47 ? 296 VAL A N     1 
ATOM   2375 C  CA    . VAL A 1 302 ? 40.284 22.261 22.485  1.00 44.85 ? 296 VAL A CA    1 
ATOM   2376 C  C     . VAL A 1 302 ? 40.088 23.292 23.594  1.00 42.91 ? 296 VAL A C     1 
ATOM   2377 O  O     . VAL A 1 302 ? 40.648 24.393 23.550  1.00 42.21 ? 296 VAL A O     1 
ATOM   2378 C  CB    . VAL A 1 302 ? 41.546 21.412 22.781  1.00 44.17 ? 296 VAL A CB    1 
ATOM   2379 C  CG1   . VAL A 1 302 ? 42.770 22.298 22.852  1.00 43.97 ? 296 VAL A CG1   1 
ATOM   2380 C  CG2   . VAL A 1 302 ? 41.364 20.652 24.081  1.00 47.64 ? 296 VAL A CG2   1 
ATOM   2381 N  N     . SER A 1 303 ? 39.291 22.935 24.591  1.00 39.95 ? 297 SER A N     1 
ATOM   2382 C  CA    . SER A 1 303 ? 39.034 23.860 25.676  1.00 38.46 ? 297 SER A CA    1 
ATOM   2383 C  C     . SER A 1 303 ? 38.939 23.189 27.036  1.00 37.07 ? 297 SER A C     1 
ATOM   2384 O  O     . SER A 1 303 ? 38.712 21.986 27.151  1.00 34.97 ? 297 SER A O     1 
ATOM   2385 C  CB    . SER A 1 303 ? 37.748 24.623 25.408  1.00 36.38 ? 297 SER A CB    1 
ATOM   2386 O  OG    . SER A 1 303 ? 36.649 23.739 25.510  1.00 37.62 ? 297 SER A OG    1 
ATOM   2387 N  N     . ARG A 1 304 ? 39.124 23.997 28.069  1.00 35.98 ? 298 ARG A N     1 
ATOM   2388 C  CA    . ARG A 1 304 ? 39.056 23.532 29.442  1.00 34.54 ? 298 ARG A CA    1 
ATOM   2389 C  C     . ARG A 1 304 ? 38.451 24.692 30.205  1.00 33.25 ? 298 ARG A C     1 
ATOM   2390 O  O     . ARG A 1 304 ? 38.873 25.827 30.041  1.00 31.39 ? 298 ARG A O     1 
ATOM   2391 C  CB    . ARG A 1 304 ? 40.458 23.215 29.963  1.00 34.90 ? 298 ARG A CB    1 
ATOM   2392 C  CG    . ARG A 1 304 ? 41.110 22.008 29.306  1.00 34.52 ? 298 ARG A CG    1 
ATOM   2393 C  CD    . ARG A 1 304 ? 40.317 20.750 29.608  1.00 35.77 ? 298 ARG A CD    1 
ATOM   2394 N  NE    . ARG A 1 304 ? 41.021 19.541 29.199  1.00 37.34 ? 298 ARG A NE    1 
ATOM   2395 C  CZ    . ARG A 1 304 ? 41.136 19.119 27.944  1.00 37.23 ? 298 ARG A CZ    1 
ATOM   2396 N  NH1   . ARG A 1 304 ? 40.589 19.803 26.947  1.00 38.87 ? 298 ARG A NH1   1 
ATOM   2397 N  NH2   . ARG A 1 304 ? 41.812 18.009 27.684  1.00 38.69 ? 298 ARG A NH2   1 
ATOM   2398 N  N     . GLY A 1 305 ? 37.444 24.418 31.017  1.00 32.57 ? 299 GLY A N     1 
ATOM   2399 C  CA    . GLY A 1 305 ? 36.820 25.500 31.748  1.00 34.23 ? 299 GLY A CA    1 
ATOM   2400 C  C     . GLY A 1 305 ? 36.533 25.171 33.191  1.00 34.51 ? 299 GLY A C     1 
ATOM   2401 O  O     . GLY A 1 305 ? 36.876 24.094 33.691  1.00 34.83 ? 299 GLY A O     1 
ATOM   2402 N  N     . ARG A 1 306 ? 35.904 26.116 33.869  1.00 34.05 ? 300 ARG A N     1 
ATOM   2403 C  CA    . ARG A 1 306 ? 35.558 25.916 35.257  1.00 35.53 ? 300 ARG A CA    1 
ATOM   2404 C  C     . ARG A 1 306 ? 34.520 26.910 35.711  1.00 35.14 ? 300 ARG A C     1 
ATOM   2405 O  O     . ARG A 1 306 ? 34.578 28.097 35.385  1.00 35.23 ? 300 ARG A O     1 
ATOM   2406 C  CB    . ARG A 1 306 ? 36.805 26.023 36.144  1.00 36.83 ? 300 ARG A CB    1 
ATOM   2407 C  CG    . ARG A 1 306 ? 36.491 25.970 37.639  1.00 40.01 ? 300 ARG A CG    1 
ATOM   2408 C  CD    . ARG A 1 306 ? 37.759 25.985 38.478  1.00 42.01 ? 300 ARG A CD    1 
ATOM   2409 N  NE    . ARG A 1 306 ? 37.461 26.230 39.886  1.00 46.01 ? 300 ARG A NE    1 
ATOM   2410 C  CZ    . ARG A 1 306 ? 38.381 26.337 40.842  1.00 46.81 ? 300 ARG A CZ    1 
ATOM   2411 N  NH1   . ARG A 1 306 ? 39.674 26.215 40.550  1.00 45.30 ? 300 ARG A NH1   1 
ATOM   2412 N  NH2   . ARG A 1 306 ? 38.007 26.591 42.089  1.00 46.88 ? 300 ARG A NH2   1 
ATOM   2413 N  N     . THR A 1 307 ? 33.555 26.408 36.463  1.00 34.85 ? 301 THR A N     1 
ATOM   2414 C  CA    . THR A 1 307 ? 32.507 27.245 36.996  1.00 37.05 ? 301 THR A CA    1 
ATOM   2415 C  C     . THR A 1 307 ? 32.704 27.251 38.504  1.00 39.55 ? 301 THR A C     1 
ATOM   2416 O  O     . THR A 1 307 ? 32.896 26.194 39.102  1.00 38.72 ? 301 THR A O     1 
ATOM   2417 C  CB    . THR A 1 307 ? 31.131 26.657 36.687  1.00 38.53 ? 301 THR A CB    1 
ATOM   2418 O  OG1   . THR A 1 307 ? 31.051 26.351 35.290  1.00 40.23 ? 301 THR A OG1   1 
ATOM   2419 C  CG2   . THR A 1 307 ? 30.030 27.649 37.062  1.00 39.07 ? 301 THR A CG2   1 
ATOM   2420 N  N     . PHE A 1 308 ? 32.698 28.429 39.120  1.00 41.09 ? 302 PHE A N     1 
ATOM   2421 C  CA    . PHE A 1 308 ? 32.837 28.492 40.566  1.00 41.63 ? 302 PHE A CA    1 
ATOM   2422 C  C     . PHE A 1 308 ? 31.457 28.935 41.071  1.00 42.81 ? 302 PHE A C     1 
ATOM   2423 O  O     . PHE A 1 308 ? 30.624 29.393 40.285  1.00 41.95 ? 302 PHE A O     1 
ATOM   2424 C  CB    . PHE A 1 308 ? 33.887 29.519 41.028  1.00 43.05 ? 302 PHE A CB    1 
ATOM   2425 C  CG    . PHE A 1 308 ? 35.133 29.593 40.189  1.00 43.98 ? 302 PHE A CG    1 
ATOM   2426 C  CD1   . PHE A 1 308 ? 35.074 29.875 38.828  1.00 43.66 ? 302 PHE A CD1   1 
ATOM   2427 C  CD2   . PHE A 1 308 ? 36.383 29.457 40.790  1.00 43.48 ? 302 PHE A CD2   1 
ATOM   2428 C  CE1   . PHE A 1 308 ? 36.238 30.022 38.081  1.00 42.23 ? 302 PHE A CE1   1 
ATOM   2429 C  CE2   . PHE A 1 308 ? 37.550 29.602 40.050  1.00 43.75 ? 302 PHE A CE2   1 
ATOM   2430 C  CZ    . PHE A 1 308 ? 37.475 29.886 38.692  1.00 44.36 ? 302 PHE A CZ    1 
ATOM   2431 N  N     . PRO A 1 309 ? 31.202 28.821 42.388  1.00 42.81 ? 303 PRO A N     1 
ATOM   2432 C  CA    . PRO A 1 309 ? 29.910 29.215 42.965  1.00 43.17 ? 303 PRO A CA    1 
ATOM   2433 C  C     . PRO A 1 309 ? 29.689 30.713 43.140  1.00 41.48 ? 303 PRO A C     1 
ATOM   2434 O  O     . PRO A 1 309 ? 28.722 31.130 43.773  1.00 44.22 ? 303 PRO A O     1 
ATOM   2435 C  CB    . PRO A 1 309 ? 29.895 28.469 44.298  1.00 44.12 ? 303 PRO A CB    1 
ATOM   2436 C  CG    . PRO A 1 309 ? 31.332 28.509 44.701  1.00 43.55 ? 303 PRO A CG    1 
ATOM   2437 C  CD    . PRO A 1 309 ? 32.057 28.181 43.408  1.00 43.38 ? 303 PRO A CD    1 
ATOM   2438 N  N     . HIS A 1 310 ? 30.564 31.525 42.564  1.00 39.48 ? 304 HIS A N     1 
ATOM   2439 C  CA    . HIS A 1 310 ? 30.441 32.971 42.689  1.00 37.16 ? 304 HIS A CA    1 
ATOM   2440 C  C     . HIS A 1 310 ? 31.045 33.692 41.485  1.00 36.64 ? 304 HIS A C     1 
ATOM   2441 O  O     . HIS A 1 310 ? 31.604 33.063 40.591  1.00 36.45 ? 304 HIS A O     1 
ATOM   2442 C  CB    . HIS A 1 310 ? 31.151 33.413 43.967  1.00 35.97 ? 304 HIS A CB    1 
ATOM   2443 C  CG    . HIS A 1 310 ? 32.558 32.952 44.049  1.00 35.31 ? 304 HIS A CG    1 
ATOM   2444 N  ND1   . HIS A 1 310 ? 33.566 33.507 43.294  1.00 36.25 ? 304 HIS A ND1   1 
ATOM   2445 C  CD2   . HIS A 1 310 ? 33.111 31.922 44.726  1.00 37.19 ? 304 HIS A CD2   1 
ATOM   2446 C  CE1   . HIS A 1 310 ? 34.683 32.828 43.495  1.00 35.92 ? 304 HIS A CE1   1 
ATOM   2447 N  NE2   . HIS A 1 310 ? 34.433 31.861 44.360  1.00 35.59 ? 304 HIS A NE2   1 
ATOM   2448 N  N     . GLY A 1 311 ? 30.944 35.017 41.474  1.00 35.38 ? 305 GLY A N     1 
ATOM   2449 C  CA    . GLY A 1 311 ? 31.500 35.793 40.380  1.00 34.22 ? 305 GLY A CA    1 
ATOM   2450 C  C     . GLY A 1 311 ? 33.008 35.686 40.293  1.00 34.43 ? 305 GLY A C     1 
ATOM   2451 O  O     . GLY A 1 311 ? 33.701 35.458 41.294  1.00 33.77 ? 305 GLY A O     1 
ATOM   2452 N  N     . ILE A 1 312 ? 33.521 35.854 39.082  1.00 33.66 ? 306 ILE A N     1 
ATOM   2453 C  CA    . ILE A 1 312 ? 34.947 35.770 38.829  1.00 31.27 ? 306 ILE A CA    1 
ATOM   2454 C  C     . ILE A 1 312 ? 35.527 37.169 38.717  1.00 31.80 ? 306 ILE A C     1 
ATOM   2455 O  O     . ILE A 1 312 ? 35.047 37.986 37.922  1.00 31.92 ? 306 ILE A O     1 
ATOM   2456 C  CB    . ILE A 1 312 ? 35.221 34.998 37.507  1.00 32.06 ? 306 ILE A CB    1 
ATOM   2457 C  CG1   . ILE A 1 312 ? 34.584 33.603 37.583  1.00 29.92 ? 306 ILE A CG1   1 
ATOM   2458 C  CG2   . ILE A 1 312 ? 36.717 34.911 37.254  1.00 29.12 ? 306 ILE A CG2   1 
ATOM   2459 C  CD1   . ILE A 1 312 ? 34.741 32.744 36.326  1.00 29.57 ? 306 ILE A CD1   1 
ATOM   2460 N  N     . SER A 1 313 ? 36.547 37.455 39.518  1.00 29.83 ? 307 SER A N     1 
ATOM   2461 C  CA    . SER A 1 313 ? 37.189 38.762 39.474  1.00 28.54 ? 307 SER A CA    1 
ATOM   2462 C  C     . SER A 1 313 ? 38.289 38.667 38.425  1.00 27.91 ? 307 SER A C     1 
ATOM   2463 O  O     . SER A 1 313 ? 38.716 37.566 38.065  1.00 27.83 ? 307 SER A O     1 
ATOM   2464 C  CB    . SER A 1 313 ? 37.795 39.098 40.830  1.00 25.53 ? 307 SER A CB    1 
ATOM   2465 O  OG    . SER A 1 313 ? 38.829 38.186 41.141  1.00 26.89 ? 307 SER A OG    1 
ATOM   2466 N  N     . LYS A 1 314 ? 38.767 39.804 37.942  1.00 29.66 ? 308 LYS A N     1 
ATOM   2467 C  CA    . LYS A 1 314 ? 39.801 39.755 36.921  1.00 32.95 ? 308 LYS A CA    1 
ATOM   2468 C  C     . LYS A 1 314 ? 41.029 39.020 37.450  1.00 34.04 ? 308 LYS A C     1 
ATOM   2469 O  O     . LYS A 1 314 ? 41.681 38.263 36.722  1.00 33.51 ? 308 LYS A O     1 
ATOM   2470 C  CB    . LYS A 1 314 ? 40.200 41.161 36.460  1.00 34.31 ? 308 LYS A CB    1 
ATOM   2471 C  CG    . LYS A 1 314 ? 41.039 41.131 35.170  1.00 40.76 ? 308 LYS A CG    1 
ATOM   2472 C  CD    . LYS A 1 314 ? 41.747 42.451 34.883  1.00 43.70 ? 308 LYS A CD    1 
ATOM   2473 C  CE    . LYS A 1 314 ? 40.781 43.541 34.471  1.00 45.94 ? 308 LYS A CE    1 
ATOM   2474 N  NZ    . LYS A 1 314 ? 41.509 44.815 34.226  1.00 49.58 ? 308 LYS A NZ    1 
ATOM   2475 N  N     . GLU A 1 315 ? 41.339 39.235 38.724  1.00 32.60 ? 309 GLU A N     1 
ATOM   2476 C  CA    . GLU A 1 315 ? 42.491 38.584 39.326  1.00 33.57 ? 309 GLU A CA    1 
ATOM   2477 C  C     . GLU A 1 315 ? 42.285 37.074 39.279  1.00 32.22 ? 309 GLU A C     1 
ATOM   2478 O  O     . GLU A 1 315 ? 43.188 36.323 38.909  1.00 31.54 ? 309 GLU A O     1 
ATOM   2479 C  CB    . GLU A 1 315 ? 42.671 39.041 40.780  1.00 36.82 ? 309 GLU A CB    1 
ATOM   2480 C  CG    . GLU A 1 315 ? 42.822 40.549 40.968  1.00 42.08 ? 309 GLU A CG    1 
ATOM   2481 C  CD    . GLU A 1 315 ? 41.562 41.336 40.610  1.00 46.44 ? 309 GLU A CD    1 
ATOM   2482 O  OE1   . GLU A 1 315 ? 40.469 41.024 41.134  1.00 47.81 ? 309 GLU A OE1   1 
ATOM   2483 O  OE2   . GLU A 1 315 ? 41.668 42.282 39.807  1.00 51.12 ? 309 GLU A OE2   1 
ATOM   2484 N  N     . THR A 1 316 ? 41.090 36.632 39.656  1.00 31.57 ? 310 THR A N     1 
ATOM   2485 C  CA    . THR A 1 316 ? 40.778 35.208 39.637  1.00 32.54 ? 310 THR A CA    1 
ATOM   2486 C  C     . THR A 1 316 ? 40.838 34.664 38.197  1.00 33.08 ? 310 THR A C     1 
ATOM   2487 O  O     . THR A 1 316 ? 41.380 33.578 37.949  1.00 32.48 ? 310 THR A O     1 
ATOM   2488 C  CB    . THR A 1 316 ? 39.380 34.952 40.236  1.00 34.95 ? 310 THR A CB    1 
ATOM   2489 O  OG1   . THR A 1 316 ? 39.384 35.328 41.621  1.00 34.01 ? 310 THR A OG1   1 
ATOM   2490 C  CG2   . THR A 1 316 ? 38.993 33.474 40.102  1.00 34.91 ? 310 THR A CG2   1 
ATOM   2491 N  N     . ALA A 1 317 ? 40.310 35.437 37.253  1.00 31.96 ? 311 ALA A N     1 
ATOM   2492 C  CA    . ALA A 1 317 ? 40.299 35.036 35.845  1.00 32.77 ? 311 ALA A CA    1 
ATOM   2493 C  C     . ALA A 1 317 ? 41.712 34.764 35.355  1.00 33.24 ? 311 ALA A C     1 
ATOM   2494 O  O     . ALA A 1 317 ? 41.966 33.781 34.657  1.00 31.91 ? 311 ALA A O     1 
ATOM   2495 C  CB    . ALA A 1 317 ? 39.651 36.128 34.995  1.00 30.06 ? 311 ALA A CB    1 
ATOM   2496 N  N     . TYR A 1 318 ? 42.630 35.643 35.730  1.00 34.75 ? 312 TYR A N     1 
ATOM   2497 C  CA    . TYR A 1 318 ? 44.021 35.508 35.337  1.00 36.63 ? 312 TYR A CA    1 
ATOM   2498 C  C     . TYR A 1 318 ? 44.653 34.217 35.853  1.00 37.39 ? 312 TYR A C     1 
ATOM   2499 O  O     . TYR A 1 318 ? 45.182 33.421 35.076  1.00 38.13 ? 312 TYR A O     1 
ATOM   2500 C  CB    . TYR A 1 318 ? 44.826 36.706 35.851  1.00 39.23 ? 312 TYR A CB    1 
ATOM   2501 C  CG    . TYR A 1 318 ? 44.985 37.842 34.854  1.00 40.94 ? 312 TYR A CG    1 
ATOM   2502 C  CD1   . TYR A 1 318 ? 46.227 38.122 34.294  1.00 43.10 ? 312 TYR A CD1   1 
ATOM   2503 C  CD2   . TYR A 1 318 ? 43.903 38.639 34.482  1.00 41.04 ? 312 TYR A CD2   1 
ATOM   2504 C  CE1   . TYR A 1 318 ? 46.394 39.168 33.391  1.00 44.73 ? 312 TYR A CE1   1 
ATOM   2505 C  CE2   . TYR A 1 318 ? 44.059 39.689 33.575  1.00 42.89 ? 312 TYR A CE2   1 
ATOM   2506 C  CZ    . TYR A 1 318 ? 45.310 39.945 33.035  1.00 43.97 ? 312 TYR A CZ    1 
ATOM   2507 O  OH    . TYR A 1 318 ? 45.498 40.962 32.131  1.00 45.34 ? 312 TYR A OH    1 
ATOM   2508 N  N     . SER A 1 319 ? 44.604 34.004 37.164  1.00 38.14 ? 313 SER A N     1 
ATOM   2509 C  CA    . SER A 1 319 ? 45.212 32.805 37.727  1.00 37.95 ? 313 SER A CA    1 
ATOM   2510 C  C     . SER A 1 319 ? 44.543 31.526 37.233  1.00 37.69 ? 313 SER A C     1 
ATOM   2511 O  O     . SER A 1 319 ? 45.229 30.579 36.858  1.00 38.27 ? 313 SER A O     1 
ATOM   2512 C  CB    . SER A 1 319 ? 45.223 32.863 39.266  1.00 37.22 ? 313 SER A CB    1 
ATOM   2513 O  OG    . SER A 1 319 ? 43.954 33.173 39.801  1.00 40.48 ? 313 SER A OG    1 
ATOM   2514 N  N     . GLU A 1 320 ? 43.215 31.495 37.209  1.00 37.38 ? 314 GLU A N     1 
ATOM   2515 C  CA    . GLU A 1 320 ? 42.513 30.303 36.744  1.00 37.90 ? 314 GLU A CA    1 
ATOM   2516 C  C     . GLU A 1 320 ? 42.841 30.012 35.273  1.00 37.21 ? 314 GLU A C     1 
ATOM   2517 O  O     . GLU A 1 320 ? 43.163 28.882 34.913  1.00 36.97 ? 314 GLU A O     1 
ATOM   2518 C  CB    . GLU A 1 320 ? 41.006 30.482 36.941  1.00 38.99 ? 314 GLU A CB    1 
ATOM   2519 C  CG    . GLU A 1 320 ? 40.169 29.232 36.695  1.00 44.97 ? 314 GLU A CG    1 
ATOM   2520 C  CD    . GLU A 1 320 ? 40.662 28.014 37.470  1.00 47.35 ? 314 GLU A CD    1 
ATOM   2521 O  OE1   . GLU A 1 320 ? 41.169 28.178 38.608  1.00 46.96 ? 314 GLU A OE1   1 
ATOM   2522 O  OE2   . GLU A 1 320 ? 40.531 26.888 36.941  1.00 48.32 ? 314 GLU A OE2   1 
ATOM   2523 N  N     . SER A 1 321 ? 42.794 31.038 34.430  1.00 36.13 ? 315 SER A N     1 
ATOM   2524 C  CA    . SER A 1 321 ? 43.076 30.849 33.012  1.00 37.44 ? 315 SER A CA    1 
ATOM   2525 C  C     . SER A 1 321 ? 44.451 30.236 32.770  1.00 39.03 ? 315 SER A C     1 
ATOM   2526 O  O     . SER A 1 321 ? 44.639 29.471 31.818  1.00 37.42 ? 315 SER A O     1 
ATOM   2527 C  CB    . SER A 1 321 ? 42.963 32.181 32.246  1.00 37.81 ? 315 SER A CB    1 
ATOM   2528 O  OG    . SER A 1 321 ? 44.119 32.997 32.388  1.00 35.90 ? 315 SER A OG    1 
ATOM   2529 N  N     . VAL A 1 322 ? 45.412 30.568 33.627  1.00 39.79 ? 316 VAL A N     1 
ATOM   2530 C  CA    . VAL A 1 322 ? 46.764 30.035 33.481  1.00 40.77 ? 316 VAL A CA    1 
ATOM   2531 C  C     . VAL A 1 322 ? 46.762 28.526 33.694  1.00 40.28 ? 316 VAL A C     1 
ATOM   2532 O  O     . VAL A 1 322 ? 47.415 27.789 32.954  1.00 38.83 ? 316 VAL A O     1 
ATOM   2533 C  CB    . VAL A 1 322 ? 47.747 30.673 34.496  1.00 42.06 ? 316 VAL A CB    1 
ATOM   2534 C  CG1   . VAL A 1 322 ? 49.114 30.029 34.362  1.00 43.33 ? 316 VAL A CG1   1 
ATOM   2535 C  CG2   . VAL A 1 322 ? 47.864 32.168 34.246  1.00 43.78 ? 316 VAL A CG2   1 
ATOM   2536 N  N     . LYS A 1 323 ? 46.024 28.083 34.712  1.00 39.61 ? 317 LYS A N     1 
ATOM   2537 C  CA    . LYS A 1 323 ? 45.908 26.667 35.048  1.00 39.95 ? 317 LYS A CA    1 
ATOM   2538 C  C     . LYS A 1 323 ? 45.258 25.890 33.910  1.00 38.94 ? 317 LYS A C     1 
ATOM   2539 O  O     . LYS A 1 323 ? 45.743 24.834 33.519  1.00 38.10 ? 317 LYS A O     1 
ATOM   2540 C  CB    . LYS A 1 323 ? 45.053 26.470 36.305  1.00 42.21 ? 317 LYS A CB    1 
ATOM   2541 C  CG    . LYS A 1 323 ? 45.495 27.218 37.561  1.00 46.28 ? 317 LYS A CG    1 
ATOM   2542 C  CD    . LYS A 1 323 ? 44.659 26.755 38.763  1.00 47.05 ? 317 LYS A CD    1 
ATOM   2543 C  CE    . LYS A 1 323 ? 44.544 27.814 39.856  1.00 49.12 ? 317 LYS A CE    1 
ATOM   2544 N  NZ    . LYS A 1 323 ? 45.823 28.093 40.561  1.00 49.12 ? 317 LYS A NZ    1 
ATOM   2545 N  N     . LEU A 1 324 ? 44.144 26.415 33.401  1.00 39.07 ? 318 LEU A N     1 
ATOM   2546 C  CA    . LEU A 1 324 ? 43.403 25.787 32.304  1.00 37.79 ? 318 LEU A CA    1 
ATOM   2547 C  C     . LEU A 1 324 ? 44.255 25.651 31.052  1.00 38.29 ? 318 LEU A C     1 
ATOM   2548 O  O     . LEU A 1 324 ? 44.156 24.667 30.324  1.00 38.66 ? 318 LEU A O     1 
ATOM   2549 C  CB    . LEU A 1 324 ? 42.152 26.604 32.001  1.00 36.48 ? 318 LEU A CB    1 
ATOM   2550 C  CG    . LEU A 1 324 ? 41.179 26.630 33.175  1.00 34.59 ? 318 LEU A CG    1 
ATOM   2551 C  CD1   . LEU A 1 324 ? 40.096 27.661 32.929  1.00 32.88 ? 318 LEU A CD1   1 
ATOM   2552 C  CD2   . LEU A 1 324 ? 40.588 25.242 33.366  1.00 32.60 ? 318 LEU A CD2   1 
ATOM   2553 N  N     . LEU A 1 325 ? 45.097 26.643 30.793  1.00 39.36 ? 319 LEU A N     1 
ATOM   2554 C  CA    . LEU A 1 325 ? 45.968 26.585 29.628  1.00 41.26 ? 319 LEU A CA    1 
ATOM   2555 C  C     . LEU A 1 325 ? 46.989 25.488 29.879  1.00 44.02 ? 319 LEU A C     1 
ATOM   2556 O  O     . LEU A 1 325 ? 47.322 24.711 28.981  1.00 44.45 ? 319 LEU A O     1 
ATOM   2557 C  CB    . LEU A 1 325 ? 46.692 27.913 29.421  1.00 40.27 ? 319 LEU A CB    1 
ATOM   2558 C  CG    . LEU A 1 325 ? 47.881 27.848 28.459  1.00 38.76 ? 319 LEU A CG    1 
ATOM   2559 C  CD1   . LEU A 1 325 ? 47.435 27.331 27.095  1.00 38.62 ? 319 LEU A CD1   1 
ATOM   2560 C  CD2   . LEU A 1 325 ? 48.499 29.225 28.337  1.00 39.55 ? 319 LEU A CD2   1 
ATOM   2561 N  N     . GLN A 1 326 ? 47.480 25.437 31.114  1.00 44.54 ? 320 GLN A N     1 
ATOM   2562 C  CA    . GLN A 1 326 ? 48.460 24.436 31.512  1.00 45.85 ? 320 GLN A CA    1 
ATOM   2563 C  C     . GLN A 1 326 ? 47.834 23.057 31.413  1.00 45.81 ? 320 GLN A C     1 
ATOM   2564 O  O     . GLN A 1 326 ? 48.501 22.094 31.047  1.00 45.93 ? 320 GLN A O     1 
ATOM   2565 C  CB    . GLN A 1 326 ? 48.938 24.685 32.949  1.00 46.66 ? 320 GLN A CB    1 
ATOM   2566 C  CG    . GLN A 1 326 ? 49.590 26.056 33.157  1.00 46.46 ? 320 GLN A CG    1 
ATOM   2567 C  CD    . GLN A 1 326 ? 50.222 26.217 34.531  1.00 44.98 ? 320 GLN A CD    1 
ATOM   2568 O  OE1   . GLN A 1 326 ? 49.616 25.887 35.553  1.00 45.56 ? 320 GLN A OE1   1 
ATOM   2569 N  NE2   . GLN A 1 326 ? 51.444 26.740 34.560  1.00 45.19 ? 320 GLN A NE2   1 
ATOM   2570 N  N     . LYS A 1 327 ? 46.549 22.969 31.742  1.00 47.20 ? 321 LYS A N     1 
ATOM   2571 C  CA    . LYS A 1 327 ? 45.843 21.698 31.670  1.00 48.47 ? 321 LYS A CA    1 
ATOM   2572 C  C     . LYS A 1 327 ? 45.687 21.265 30.216  1.00 49.07 ? 321 LYS A C     1 
ATOM   2573 O  O     . LYS A 1 327 ? 45.693 20.077 29.915  1.00 50.33 ? 321 LYS A O     1 
ATOM   2574 C  CB    . LYS A 1 327 ? 44.463 21.797 32.322  1.00 47.68 ? 321 LYS A CB    1 
ATOM   2575 C  CG    . LYS A 1 327 ? 43.690 20.494 32.212  1.00 48.75 ? 321 LYS A CG    1 
ATOM   2576 C  CD    . LYS A 1 327 ? 42.354 20.533 32.913  1.00 49.99 ? 321 LYS A CD    1 
ATOM   2577 C  CE    . LYS A 1 327 ? 41.627 19.219 32.701  1.00 51.53 ? 321 LYS A CE    1 
ATOM   2578 N  NZ    . LYS A 1 327 ? 40.263 19.218 33.301  1.00 54.17 ? 321 LYS A NZ    1 
ATOM   2579 N  N     . ILE A 1 328 ? 45.536 22.235 29.321  1.00 49.55 ? 322 ILE A N     1 
ATOM   2580 C  CA    . ILE A 1 328 ? 45.397 21.945 27.904  1.00 49.89 ? 322 ILE A CA    1 
ATOM   2581 C  C     . ILE A 1 328 ? 46.720 21.395 27.369  1.00 51.36 ? 322 ILE A C     1 
ATOM   2582 O  O     . ILE A 1 328 ? 46.768 20.296 26.812  1.00 51.90 ? 322 ILE A O     1 
ATOM   2583 C  CB    . ILE A 1 328 ? 45.002 23.218 27.110  1.00 48.37 ? 322 ILE A CB    1 
ATOM   2584 C  CG1   . ILE A 1 328 ? 43.536 23.561 27.383  1.00 47.53 ? 322 ILE A CG1   1 
ATOM   2585 C  CG2   . ILE A 1 328 ? 45.233 23.011 25.627  1.00 46.43 ? 322 ILE A CG2   1 
ATOM   2586 C  CD1   . ILE A 1 328 ? 43.061 24.820 26.676  1.00 47.56 ? 322 ILE A CD1   1 
ATOM   2587 N  N     . LEU A 1 329 ? 47.796 22.154 27.553  1.00 52.21 ? 323 LEU A N     1 
ATOM   2588 C  CA    . LEU A 1 329 ? 49.111 21.736 27.083  1.00 53.10 ? 323 LEU A CA    1 
ATOM   2589 C  C     . LEU A 1 329 ? 49.544 20.379 27.625  1.00 53.67 ? 323 LEU A C     1 
ATOM   2590 O  O     . LEU A 1 329 ? 50.236 19.630 26.936  1.00 53.66 ? 323 LEU A O     1 
ATOM   2591 C  CB    . LEU A 1 329 ? 50.162 22.781 27.451  1.00 53.74 ? 323 LEU A CB    1 
ATOM   2592 C  CG    . LEU A 1 329 ? 50.091 24.102 26.689  1.00 54.38 ? 323 LEU A CG    1 
ATOM   2593 C  CD1   . LEU A 1 329 ? 50.931 25.146 27.396  1.00 53.86 ? 323 LEU A CD1   1 
ATOM   2594 C  CD2   . LEU A 1 329 ? 50.562 23.889 25.263  1.00 54.26 ? 323 LEU A CD2   1 
ATOM   2595 N  N     . GLU A 1 330 ? 49.152 20.053 28.854  1.00 52.92 ? 324 GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 330 ? 49.546 18.770 29.411  1.00 54.04 ? 324 GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 330 ? 48.713 17.605 28.879  1.00 54.80 ? 324 GLU A C     1 
ATOM   2598 O  O     . GLU A 1 330 ? 49.210 16.486 28.785  1.00 54.93 ? 324 GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 330 ? 49.488 18.785 30.945  1.00 54.08 ? 324 GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 330 ? 48.103 18.923 31.551  1.00 54.91 ? 324 GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 330 ? 48.053 18.413 32.983  0.50 54.69 ? 324 GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 330 ? 48.268 17.198 33.179  0.50 54.42 ? 324 GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 330 ? 47.809 19.217 33.911  0.50 53.90 ? 324 GLU A OE2   1 
ATOM   2604 N  N     . GLU A 1 331 ? 47.459 17.866 28.514  1.00 56.35 ? 325 GLU A N     1 
ATOM   2605 C  CA    . GLU A 1 331 ? 46.581 16.809 28.009  1.00 57.03 ? 325 GLU A CA    1 
ATOM   2606 C  C     . GLU A 1 331 ? 46.480 16.767 26.485  1.00 58.20 ? 325 GLU A C     1 
ATOM   2607 O  O     . GLU A 1 331 ? 45.617 16.082 25.933  1.00 59.34 ? 325 GLU A O     1 
ATOM   2608 C  CB    . GLU A 1 331 ? 45.179 16.947 28.614  1.00 55.87 ? 325 GLU A CB    1 
ATOM   2609 C  CG    . GLU A 1 331 ? 45.183 17.243 30.108  1.00 55.86 ? 325 GLU A CG    1 
ATOM   2610 C  CD    . GLU A 1 331 ? 43.820 17.080 30.756  1.00 55.94 ? 325 GLU A CD    1 
ATOM   2611 O  OE1   . GLU A 1 331 ? 42.798 17.446 30.134  1.00 54.68 ? 325 GLU A OE1   1 
ATOM   2612 O  OE2   . GLU A 1 331 ? 43.774 16.595 31.904  1.00 56.31 ? 325 GLU A OE2   1 
ATOM   2613 N  N     . ASP A 1 332 ? 47.358 17.501 25.809  1.00 58.82 ? 326 ASP A N     1 
ATOM   2614 C  CA    . ASP A 1 332 ? 47.378 17.518 24.350  1.00 60.16 ? 326 ASP A CA    1 
ATOM   2615 C  C     . ASP A 1 332 ? 48.823 17.686 23.900  1.00 60.76 ? 326 ASP A C     1 
ATOM   2616 O  O     . ASP A 1 332 ? 49.528 18.585 24.358  1.00 62.55 ? 326 ASP A O     1 
ATOM   2617 C  CB    . ASP A 1 332 ? 46.537 18.673 23.800  1.00 60.46 ? 326 ASP A CB    1 
ATOM   2618 C  CG    . ASP A 1 332 ? 46.135 18.462 22.348  1.00 60.00 ? 326 ASP A CG    1 
ATOM   2619 O  OD1   . ASP A 1 332 ? 45.091 17.822 22.105  1.00 60.04 ? 326 ASP A OD1   1 
ATOM   2620 O  OD2   . ASP A 1 332 ? 46.867 18.922 21.448  1.00 60.94 ? 326 ASP A OD2   1 
ATOM   2621 N  N     . GLU A 1 333 ? 49.268 16.826 22.999  1.00 60.34 ? 327 GLU A N     1 
ATOM   2622 C  CA    . GLU A 1 333 ? 50.638 16.908 22.535  1.00 60.60 ? 327 GLU A CA    1 
ATOM   2623 C  C     . GLU A 1 333 ? 50.833 17.948 21.445  1.00 60.75 ? 327 GLU A C     1 
ATOM   2624 O  O     . GLU A 1 333 ? 51.964 18.319 21.148  1.00 61.90 ? 327 GLU A O     1 
ATOM   2625 C  CB    . GLU A 1 333 ? 51.097 15.543 22.032  0.50 60.08 ? 327 GLU A CB    1 
ATOM   2626 C  CG    . GLU A 1 333 ? 50.882 14.433 23.035  0.50 59.12 ? 327 GLU A CG    1 
ATOM   2627 C  CD    . GLU A 1 333 ? 51.540 13.144 22.610  0.50 59.39 ? 327 GLU A CD    1 
ATOM   2628 O  OE1   . GLU A 1 333 ? 51.372 12.130 23.320  0.50 58.79 ? 327 GLU A OE1   1 
ATOM   2629 O  OE2   . GLU A 1 333 ? 52.228 13.148 21.566  0.50 58.27 ? 327 GLU A OE2   1 
ATOM   2630 N  N     . ARG A 1 334 ? 49.742 18.424 20.852  1.00 60.69 ? 328 ARG A N     1 
ATOM   2631 C  CA    . ARG A 1 334 ? 49.836 19.417 19.782  1.00 60.31 ? 328 ARG A CA    1 
ATOM   2632 C  C     . ARG A 1 334 ? 50.330 20.793 20.225  1.00 60.06 ? 328 ARG A C     1 
ATOM   2633 O  O     . ARG A 1 334 ? 50.378 21.107 21.415  1.00 59.19 ? 328 ARG A O     1 
ATOM   2634 C  CB    . ARG A 1 334 ? 48.479 19.598 19.083  1.00 61.13 ? 328 ARG A CB    1 
ATOM   2635 C  CG    . ARG A 1 334 ? 48.105 18.515 18.081  1.00 61.55 ? 328 ARG A CG    1 
ATOM   2636 C  CD    . ARG A 1 334 ? 47.576 17.265 18.758  1.00 61.85 ? 328 ARG A CD    1 
ATOM   2637 N  NE    . ARG A 1 334 ? 46.267 17.465 19.378  1.00 63.65 ? 328 ARG A NE    1 
ATOM   2638 C  CZ    . ARG A 1 334 ? 45.155 17.778 18.716  1.00 63.36 ? 328 ARG A CZ    1 
ATOM   2639 N  NH1   . ARG A 1 334 ? 45.179 17.936 17.402  1.00 64.37 ? 328 ARG A NH1   1 
ATOM   2640 N  NH2   . ARG A 1 334 ? 44.012 17.923 19.370  1.00 64.06 ? 328 ARG A NH2   1 
ATOM   2641 N  N     . LYS A 1 335 ? 50.704 21.605 19.240  1.00 60.34 ? 329 LYS A N     1 
ATOM   2642 C  CA    . LYS A 1 335 ? 51.157 22.968 19.481  1.00 60.65 ? 329 LYS A CA    1 
ATOM   2643 C  C     . LYS A 1 335 ? 49.891 23.813 19.427  1.00 59.71 ? 329 LYS A C     1 
ATOM   2644 O  O     . LYS A 1 335 ? 48.885 23.389 18.854  1.00 60.16 ? 329 LYS A O     1 
ATOM   2645 C  CB    . LYS A 1 335 ? 52.113 23.436 18.375  1.00 61.32 ? 329 LYS A CB    1 
ATOM   2646 C  CG    . LYS A 1 335 ? 53.397 22.635 18.251  1.00 63.74 ? 329 LYS A CG    1 
ATOM   2647 C  CD    . LYS A 1 335 ? 54.335 23.275 17.238  1.00 64.65 ? 329 LYS A CD    1 
ATOM   2648 C  CE    . LYS A 1 335 ? 55.697 22.601 17.239  1.00 65.87 ? 329 LYS A CE    1 
ATOM   2649 N  NZ    . LYS A 1 335 ? 56.661 23.303 16.344  1.00 67.20 ? 329 LYS A NZ    1 
ATOM   2650 N  N     . ILE A 1 336 ? 49.929 25.000 20.019  1.00 57.94 ? 330 ILE A N     1 
ATOM   2651 C  CA    . ILE A 1 336 ? 48.761 25.864 19.993  1.00 54.96 ? 330 ILE A CA    1 
ATOM   2652 C  C     . ILE A 1 336 ? 48.956 26.953 18.952  1.00 53.53 ? 330 ILE A C     1 
ATOM   2653 O  O     . ILE A 1 336 ? 49.993 27.613 18.904  1.00 53.16 ? 330 ILE A O     1 
ATOM   2654 C  CB    . ILE A 1 336 ? 48.492 26.490 21.375  1.00 54.86 ? 330 ILE A CB    1 
ATOM   2655 C  CG1   . ILE A 1 336 ? 48.208 25.383 22.390  1.00 54.04 ? 330 ILE A CG1   1 
ATOM   2656 C  CG2   . ILE A 1 336 ? 47.295 27.425 21.304  1.00 53.99 ? 330 ILE A CG2   1 
ATOM   2657 C  CD1   . ILE A 1 336 ? 47.903 25.893 23.770  1.00 54.48 ? 330 ILE A CD1   1 
ATOM   2658 N  N     . ARG A 1 337 ? 47.947 27.113 18.105  1.00 52.55 ? 331 ARG A N     1 
ATOM   2659 C  CA    . ARG A 1 337 ? 47.964 28.103 17.039  1.00 52.06 ? 331 ARG A CA    1 
ATOM   2660 C  C     . ARG A 1 337 ? 47.213 29.364 17.464  1.00 50.38 ? 331 ARG A C     1 
ATOM   2661 O  O     . ARG A 1 337 ? 47.627 30.486 17.151  1.00 50.18 ? 331 ARG A O     1 
ATOM   2662 C  CB    . ARG A 1 337 ? 47.320 27.508 15.782  1.00 52.51 ? 331 ARG A CB    1 
ATOM   2663 C  CG    . ARG A 1 337 ? 47.019 28.517 14.691  1.00 55.59 ? 331 ARG A CG    1 
ATOM   2664 C  CD    . ARG A 1 337 ? 46.205 27.880 13.586  1.00 58.25 ? 331 ARG A CD    1 
ATOM   2665 N  NE    . ARG A 1 337 ? 45.697 28.860 12.630  1.00 62.50 ? 331 ARG A NE    1 
ATOM   2666 C  CZ    . ARG A 1 337 ? 46.463 29.673 11.910  1.00 65.00 ? 331 ARG A CZ    1 
ATOM   2667 N  NH1   . ARG A 1 337 ? 47.784 29.630 12.036  1.00 66.95 ? 331 ARG A NH1   1 
ATOM   2668 N  NH2   . ARG A 1 337 ? 45.913 30.521 11.050  1.00 66.12 ? 331 ARG A NH2   1 
ATOM   2669 N  N     . GLU A 1 338 ? 46.105 29.173 18.174  1.00 48.16 ? 332 GLU A N     1 
ATOM   2670 C  CA    . GLU A 1 338 ? 45.288 30.290 18.645  1.00 46.59 ? 332 GLU A CA    1 
ATOM   2671 C  C     . GLU A 1 338 ? 44.883 30.043 20.096  1.00 44.18 ? 332 GLU A C     1 
ATOM   2672 O  O     . GLU A 1 338 ? 44.617 28.909 20.488  1.00 44.16 ? 332 GLU A O     1 
ATOM   2673 C  CB    . GLU A 1 338 ? 44.036 30.425 17.780  1.00 47.97 ? 332 GLU A CB    1 
ATOM   2674 C  CG    . GLU A 1 338 ? 44.299 30.340 16.287  1.00 50.05 ? 332 GLU A CG    1 
ATOM   2675 C  CD    . GLU A 1 338 ? 43.036 30.076 15.499  1.00 52.94 ? 332 GLU A CD    1 
ATOM   2676 O  OE1   . GLU A 1 338 ? 43.058 29.214 14.594  1.00 54.90 ? 332 GLU A OE1   1 
ATOM   2677 O  OE2   . GLU A 1 338 ? 42.015 30.731 15.784  1.00 55.95 ? 332 GLU A OE2   1 
ATOM   2678 N  N     . ILE A 1 339 ? 44.837 31.105 20.890  1.00 42.43 ? 333 ILE A N     1 
ATOM   2679 C  CA    . ILE A 1 339 ? 44.476 30.983 22.298  1.00 39.17 ? 333 ILE A CA    1 
ATOM   2680 C  C     . ILE A 1 339 ? 43.411 32.030 22.638  1.00 38.59 ? 333 ILE A C     1 
ATOM   2681 O  O     . ILE A 1 339 ? 43.407 33.135 22.089  1.00 38.60 ? 333 ILE A O     1 
ATOM   2682 C  CB    . ILE A 1 339 ? 45.734 31.170 23.202  1.00 37.98 ? 333 ILE A CB    1 
ATOM   2683 C  CG1   . ILE A 1 339 ? 45.423 30.800 24.655  1.00 38.20 ? 333 ILE A CG1   1 
ATOM   2684 C  CG2   . ILE A 1 339 ? 46.221 32.604 23.126  1.00 36.17 ? 333 ILE A CG2   1 
ATOM   2685 C  CD1   . ILE A 1 339 ? 45.199 29.325 24.895  1.00 37.52 ? 333 ILE A CD1   1 
ATOM   2686 N  N     . GLY A 1 340 ? 42.491 31.666 23.522  1.00 36.52 ? 334 GLY A N     1 
ATOM   2687 C  CA    . GLY A 1 340 ? 41.454 32.594 23.904  1.00 33.34 ? 334 GLY A CA    1 
ATOM   2688 C  C     . GLY A 1 340 ? 40.755 32.189 25.182  1.00 32.38 ? 334 GLY A C     1 
ATOM   2689 O  O     . GLY A 1 340 ? 41.098 31.171 25.787  1.00 30.05 ? 334 GLY A O     1 
ATOM   2690 N  N     . VAL A 1 341 ? 39.781 33.004 25.582  1.00 32.38 ? 335 VAL A N     1 
ATOM   2691 C  CA    . VAL A 1 341 ? 38.978 32.765 26.778  1.00 32.77 ? 335 VAL A CA    1 
ATOM   2692 C  C     . VAL A 1 341 ? 37.526 33.168 26.527  1.00 30.70 ? 335 VAL A C     1 
ATOM   2693 O  O     . VAL A 1 341 ? 37.241 34.079 25.745  1.00 28.47 ? 335 VAL A O     1 
ATOM   2694 C  CB    . VAL A 1 341 ? 39.483 33.593 27.994  1.00 32.62 ? 335 VAL A CB    1 
ATOM   2695 C  CG1   . VAL A 1 341 ? 39.201 35.072 27.780  1.00 31.59 ? 335 VAL A CG1   1 
ATOM   2696 C  CG2   . VAL A 1 341 ? 38.801 33.107 29.272  1.00 36.91 ? 335 VAL A CG2   1 
ATOM   2697 N  N     . ARG A 1 342 ? 36.609 32.482 27.197  1.00 29.21 ? 336 ARG A N     1 
ATOM   2698 C  CA    . ARG A 1 342 ? 35.202 32.807 27.089  1.00 28.29 ? 336 ARG A CA    1 
ATOM   2699 C  C     . ARG A 1 342 ? 34.608 32.795 28.493  1.00 28.29 ? 336 ARG A C     1 
ATOM   2700 O  O     . ARG A 1 342 ? 34.879 31.889 29.283  1.00 28.37 ? 336 ARG A O     1 
ATOM   2701 C  CB    . ARG A 1 342 ? 34.471 31.804 26.182  1.00 27.54 ? 336 ARG A CB    1 
ATOM   2702 C  CG    . ARG A 1 342 ? 32.997 32.137 25.944  1.00 29.34 ? 336 ARG A CG    1 
ATOM   2703 C  CD    . ARG A 1 342 ? 32.556 31.737 24.520  1.00 31.10 ? 336 ARG A CD    1 
ATOM   2704 N  NE    . ARG A 1 342 ? 33.175 32.619 23.528  1.00 29.72 ? 336 ARG A NE    1 
ATOM   2705 C  CZ    . ARG A 1 342 ? 32.678 33.799 23.175  1.00 30.28 ? 336 ARG A CZ    1 
ATOM   2706 N  NH1   . ARG A 1 342 ? 31.545 34.229 23.716  1.00 29.38 ? 336 ARG A NH1   1 
ATOM   2707 N  NH2   . ARG A 1 342 ? 33.342 34.575 22.325  1.00 31.81 ? 336 ARG A NH2   1 
ATOM   2708 N  N     . PHE A 1 343 ? 33.809 33.819 28.787  1.00 28.92 ? 337 PHE A N     1 
ATOM   2709 C  CA    . PHE A 1 343 ? 33.148 33.991 30.078  1.00 29.68 ? 337 PHE A CA    1 
ATOM   2710 C  C     . PHE A 1 343 ? 31.652 33.813 29.932  1.00 30.70 ? 337 PHE A C     1 
ATOM   2711 O  O     . PHE A 1 343 ? 31.053 34.335 28.991  1.00 29.64 ? 337 PHE A O     1 
ATOM   2712 C  CB    . PHE A 1 343 ? 33.442 35.387 30.628  1.00 30.31 ? 337 PHE A CB    1 
ATOM   2713 C  CG    . PHE A 1 343 ? 34.876 35.584 30.995  1.00 32.53 ? 337 PHE A CG    1 
ATOM   2714 C  CD1   . PHE A 1 343 ? 35.389 35.007 32.153  1.00 28.79 ? 337 PHE A CD1   1 
ATOM   2715 C  CD2   . PHE A 1 343 ? 35.736 36.272 30.148  1.00 30.45 ? 337 PHE A CD2   1 
ATOM   2716 C  CE1   . PHE A 1 343 ? 36.735 35.104 32.463  1.00 31.65 ? 337 PHE A CE1   1 
ATOM   2717 C  CE2   . PHE A 1 343 ? 37.099 36.374 30.450  1.00 33.39 ? 337 PHE A CE2   1 
ATOM   2718 C  CZ    . PHE A 1 343 ? 37.597 35.790 31.607  1.00 32.80 ? 337 PHE A CZ    1 
ATOM   2719 N  N     . SER A 1 344 ? 31.048 33.101 30.880  1.00 31.39 ? 338 SER A N     1 
ATOM   2720 C  CA    . SER A 1 344 ? 29.615 32.846 30.834  1.00 33.61 ? 338 SER A CA    1 
ATOM   2721 C  C     . SER A 1 344 ? 28.994 32.658 32.217  1.00 36.81 ? 338 SER A C     1 
ATOM   2722 O  O     . SER A 1 344 ? 29.652 32.874 33.240  1.00 37.52 ? 338 SER A O     1 
ATOM   2723 C  CB    . SER A 1 344 ? 29.357 31.603 30.002  1.00 31.54 ? 338 SER A CB    1 
ATOM   2724 O  OG    . SER A 1 344 ? 30.114 30.529 30.514  1.00 30.33 ? 338 SER A OG    1 
ATOM   2725 N  N     . LYS A 1 345 ? 27.730 32.238 32.224  1.00 38.30 ? 339 LYS A N     1 
ATOM   2726 C  CA    . LYS A 1 345 ? 26.969 32.016 33.448  1.00 41.06 ? 339 LYS A CA    1 
ATOM   2727 C  C     . LYS A 1 345 ? 27.055 33.268 34.302  1.00 42.79 ? 339 LYS A C     1 
ATOM   2728 O  O     . LYS A 1 345 ? 27.509 33.240 35.450  1.00 42.68 ? 339 LYS A O     1 
ATOM   2729 C  CB    . LYS A 1 345 ? 27.508 30.802 34.206  1.00 42.57 ? 339 LYS A CB    1 
ATOM   2730 C  CG    . LYS A 1 345 ? 27.291 29.486 33.475  1.00 43.56 ? 339 LYS A CG    1 
ATOM   2731 C  CD    . LYS A 1 345 ? 27.650 28.293 34.345  1.00 47.52 ? 339 LYS A CD    1 
ATOM   2732 C  CE    . LYS A 1 345 ? 27.511 26.986 33.573  1.00 47.26 ? 339 LYS A CE    1 
ATOM   2733 N  NZ    . LYS A 1 345 ? 27.935 25.801 34.371  1.00 48.86 ? 339 LYS A NZ    1 
ATOM   2734 N  N     . PHE A 1 346 ? 26.609 34.367 33.708  1.00 44.52 ? 340 PHE A N     1 
ATOM   2735 C  CA    . PHE A 1 346 ? 26.623 35.668 34.341  1.00 48.21 ? 340 PHE A CA    1 
ATOM   2736 C  C     . PHE A 1 346 ? 25.743 35.739 35.586  1.00 51.97 ? 340 PHE A C     1 
ATOM   2737 O  O     . PHE A 1 346 ? 24.694 35.098 35.669  1.00 51.06 ? 340 PHE A O     1 
ATOM   2738 C  CB    . PHE A 1 346 ? 26.168 36.744 33.346  1.00 47.52 ? 340 PHE A CB    1 
ATOM   2739 C  CG    . PHE A 1 346 ? 27.014 36.833 32.100  1.00 48.04 ? 340 PHE A CG    1 
ATOM   2740 C  CD1   . PHE A 1 346 ? 28.378 36.560 32.142  1.00 47.94 ? 340 PHE A CD1   1 
ATOM   2741 C  CD2   . PHE A 1 346 ? 26.453 37.250 30.896  1.00 48.23 ? 340 PHE A CD2   1 
ATOM   2742 C  CE1   . PHE A 1 346 ? 29.177 36.703 31.003  1.00 48.25 ? 340 PHE A CE1   1 
ATOM   2743 C  CE2   . PHE A 1 346 ? 27.238 37.397 29.751  1.00 48.68 ? 340 PHE A CE2   1 
ATOM   2744 C  CZ    . PHE A 1 346 ? 28.608 37.123 29.806  1.00 48.92 ? 340 PHE A CZ    1 
ATOM   2745 N  N     . ILE A 1 347 ? 26.184 36.531 36.555  1.00 55.25 ? 341 ILE A N     1 
ATOM   2746 C  CA    . ILE A 1 347 ? 25.419 36.712 37.775  1.00 60.20 ? 341 ILE A CA    1 
ATOM   2747 C  C     . ILE A 1 347 ? 24.483 37.885 37.565  1.00 63.23 ? 341 ILE A C     1 
ATOM   2748 O  O     . ILE A 1 347 ? 24.820 39.019 37.901  1.00 64.91 ? 341 ILE A O     1 
ATOM   2749 C  CB    . ILE A 1 347 ? 26.315 37.049 38.978  1.00 59.26 ? 341 ILE A CB    1 
ATOM   2750 C  CG1   . ILE A 1 347 ? 27.227 35.866 39.299  1.00 58.87 ? 341 ILE A CG1   1 
ATOM   2751 C  CG2   . ILE A 1 347 ? 25.445 37.413 40.178  1.00 59.55 ? 341 ILE A CG2   1 
ATOM   2752 C  CD1   . ILE A 1 347 ? 28.166 36.121 40.445  1.00 59.15 ? 341 ILE A CD1   1 
ATOM   2753 N  N     . GLU A 1 348 ? 23.315 37.631 36.998  1.00 66.60 ? 342 GLU A N     1 
ATOM   2754 C  CA    . GLU A 1 348 ? 22.375 38.718 36.795  1.00 70.28 ? 342 GLU A CA    1 
ATOM   2755 C  C     . GLU A 1 348 ? 21.221 38.585 37.776  1.00 71.25 ? 342 GLU A C     1 
ATOM   2756 O  O     . GLU A 1 348 ? 20.081 38.339 37.328  1.00 72.95 ? 342 GLU A O     1 
ATOM   2757 C  CB    . GLU A 1 348 ? 21.851 38.734 35.357  1.00 72.43 ? 342 GLU A CB    1 
ATOM   2758 C  CG    . GLU A 1 348 ? 20.969 39.939 35.074  1.00 75.37 ? 342 GLU A CG    1 
ATOM   2759 C  CD    . GLU A 1 348 ? 21.604 41.235 35.552  1.00 77.11 ? 342 GLU A CD    1 
ATOM   2760 O  OE1   . GLU A 1 348 ? 22.629 41.647 34.968  1.00 78.27 ? 342 GLU A OE1   1 
ATOM   2761 O  OE2   . GLU A 1 348 ? 21.084 41.835 36.519  1.00 77.86 ? 342 GLU A OE2   1 
ATOM   2762 N  N     . ALA A 1 349 ? 21.482 38.719 38.990  1.00 71.61 ? 343 ALA A N     1 
ATOM   2763 O  "O5'" . DG  B 2 1   ? 15.844 0.863  34.370  1.00 54.83 ? 1   DG  P "O5'" 1 
ATOM   2764 C  "C5'" . DG  B 2 1   ? 16.265 1.231  35.688  1.00 47.71 ? 1   DG  P "C5'" 1 
ATOM   2765 C  "C4'" . DG  B 2 1   ? 15.469 2.397  36.223  1.00 47.02 ? 1   DG  P "C4'" 1 
ATOM   2766 O  "O4'" . DG  B 2 1   ? 16.035 2.826  37.481  1.00 43.79 ? 1   DG  P "O4'" 1 
ATOM   2767 C  "C3'" . DG  B 2 1   ? 15.581 3.592  35.274  1.00 46.20 ? 1   DG  P "C3'" 1 
ATOM   2768 O  "O3'" . DG  B 2 1   ? 14.333 4.291  35.233  1.00 51.00 ? 1   DG  P "O3'" 1 
ATOM   2769 C  "C2'" . DG  B 2 1   ? 16.678 4.442  35.892  1.00 41.48 ? 1   DG  P "C2'" 1 
ATOM   2770 C  "C1'" . DG  B 2 1   ? 16.549 4.146  37.378  1.00 40.50 ? 1   DG  P "C1'" 1 
ATOM   2771 N  N9    . DG  B 2 1   ? 17.810 4.179  38.115  1.00 36.39 ? 1   DG  P N9    1 
ATOM   2772 C  C8    . DG  B 2 1   ? 18.974 3.520  37.796  1.00 32.79 ? 1   DG  P C8    1 
ATOM   2773 N  N7    . DG  B 2 1   ? 19.930 3.720  38.660  1.00 32.65 ? 1   DG  P N7    1 
ATOM   2774 C  C5    . DG  B 2 1   ? 19.367 4.566  39.607  1.00 31.22 ? 1   DG  P C5    1 
ATOM   2775 C  C6    . DG  B 2 1   ? 19.921 5.119  40.795  1.00 30.98 ? 1   DG  P C6    1 
ATOM   2776 O  O6    . DG  B 2 1   ? 21.059 4.962  41.268  1.00 31.30 ? 1   DG  P O6    1 
ATOM   2777 N  N1    . DG  B 2 1   ? 19.001 5.922  41.461  1.00 29.62 ? 1   DG  P N1    1 
ATOM   2778 C  C2    . DG  B 2 1   ? 17.710 6.160  41.048  1.00 31.69 ? 1   DG  P C2    1 
ATOM   2779 N  N2    . DG  B 2 1   ? 16.975 6.954  41.838  1.00 30.21 ? 1   DG  P N2    1 
ATOM   2780 N  N3    . DG  B 2 1   ? 17.180 5.650  39.944  1.00 32.73 ? 1   DG  P N3    1 
ATOM   2781 C  C4    . DG  B 2 1   ? 18.059 4.866  39.279  1.00 33.30 ? 1   DG  P C4    1 
ATOM   2782 P  P     . DG  B 2 2   ? 14.043 5.348  34.054  1.00 55.24 ? 2   DG  P P     1 
ATOM   2783 O  OP1   . DG  B 2 2   ? 12.597 5.256  33.753  1.00 57.83 ? 2   DG  P OP1   1 
ATOM   2784 O  OP2   . DG  B 2 2   ? 15.030 5.152  32.969  1.00 54.37 ? 2   DG  P OP2   1 
ATOM   2785 O  "O5'" . DG  B 2 2   ? 14.341 6.759  34.767  1.00 52.71 ? 2   DG  P "O5'" 1 
ATOM   2786 C  "C5'" . DG  B 2 2   ? 13.657 7.062  35.985  1.00 52.70 ? 2   DG  P "C5'" 1 
ATOM   2787 C  "C4'" . DG  B 2 2   ? 14.292 8.245  36.672  1.00 53.06 ? 2   DG  P "C4'" 1 
ATOM   2788 O  "O4'" . DG  B 2 2   ? 15.536 7.882  37.324  1.00 50.51 ? 2   DG  P "O4'" 1 
ATOM   2789 C  "C3'" . DG  B 2 2   ? 14.651 9.293  35.615  1.00 54.87 ? 2   DG  P "C3'" 1 
ATOM   2790 O  "O3'" . DG  B 2 2   ? 14.341 10.586 36.125  1.00 60.40 ? 2   DG  P "O3'" 1 
ATOM   2791 C  "C2'" . DG  B 2 2   ? 16.157 9.149  35.476  1.00 51.94 ? 2   DG  P "C2'" 1 
ATOM   2792 C  "C1'" . DG  B 2 2   ? 16.530 8.796  36.899  1.00 48.76 ? 2   DG  P "C1'" 1 
ATOM   2793 N  N9    . DG  B 2 2   ? 17.848 8.204  37.119  1.00 43.64 ? 2   DG  P N9    1 
ATOM   2794 C  C8    . DG  B 2 2   ? 18.548 7.350  36.301  1.00 40.64 ? 2   DG  P C8    1 
ATOM   2795 N  N7    . DG  B 2 2   ? 19.722 7.034  36.781  1.00 37.85 ? 2   DG  P N7    1 
ATOM   2796 C  C5    . DG  B 2 2   ? 19.796 7.713  37.989  1.00 36.84 ? 2   DG  P C5    1 
ATOM   2797 C  C6    . DG  B 2 2   ? 20.836 7.768  38.958  1.00 37.33 ? 2   DG  P C6    1 
ATOM   2798 O  O6    . DG  B 2 2   ? 21.935 7.193  38.952  1.00 36.99 ? 2   DG  P O6    1 
ATOM   2799 N  N1    . DG  B 2 2   ? 20.495 8.591  40.023  1.00 37.93 ? 2   DG  P N1    1 
ATOM   2800 C  C2    . DG  B 2 2   ? 19.310 9.269  40.152  1.00 38.48 ? 2   DG  P C2    1 
ATOM   2801 N  N2    . DG  B 2 2   ? 19.173 10.026 41.253  1.00 39.33 ? 2   DG  P N2    1 
ATOM   2802 N  N3    . DG  B 2 2   ? 18.332 9.216  39.266  1.00 39.34 ? 2   DG  P N3    1 
ATOM   2803 C  C4    . DG  B 2 2   ? 18.645 8.430  38.215  1.00 39.81 ? 2   DG  P C4    1 
ATOM   2804 P  P     . DG  B 2 3   ? 14.017 11.792 35.115  1.00 64.99 ? 3   DG  P P     1 
ATOM   2805 O  OP1   . DG  B 2 3   ? 12.566 11.732 34.828  1.00 64.78 ? 3   DG  P OP1   1 
ATOM   2806 O  OP2   . DG  B 2 3   ? 14.985 11.765 33.995  1.00 62.41 ? 3   DG  P OP2   1 
ATOM   2807 O  "O5'" . DG  B 2 3   ? 14.315 13.072 36.043  1.00 65.10 ? 3   DG  P "O5'" 1 
ATOM   2808 C  "C5'" . DG  B 2 3   ? 13.729 13.116 37.346  1.00 67.08 ? 3   DG  P "C5'" 1 
ATOM   2809 C  "C4'" . DG  B 2 3   ? 14.590 13.897 38.308  1.00 67.76 ? 3   DG  P "C4'" 1 
ATOM   2810 O  "O4'" . DG  B 2 3   ? 15.804 13.169 38.619  1.00 66.64 ? 3   DG  P "O4'" 1 
ATOM   2811 C  "C3'" . DG  B 2 3   ? 15.030 15.195 37.625  1.00 68.74 ? 3   DG  P "C3'" 1 
ATOM   2812 O  "O3'" . DG  B 2 3   ? 14.993 16.281 38.552  1.00 71.29 ? 3   DG  P "O3'" 1 
ATOM   2813 C  "C2'" . DG  B 2 3   ? 16.452 14.902 37.181  1.00 66.71 ? 3   DG  P "C2'" 1 
ATOM   2814 C  "C1'" . DG  B 2 3   ? 16.935 13.951 38.262  1.00 64.60 ? 3   DG  P "C1'" 1 
ATOM   2815 N  N9    . DG  B 2 3   ? 18.003 13.044 37.851  1.00 61.04 ? 3   DG  P N9    1 
ATOM   2816 C  C8    . DG  B 2 3   ? 18.004 12.189 36.776  1.00 60.10 ? 3   DG  P C8    1 
ATOM   2817 N  N7    . DG  B 2 3   ? 19.106 11.494 36.674  1.00 58.08 ? 3   DG  P N7    1 
ATOM   2818 C  C5    . DG  B 2 3   ? 19.880 11.919 37.744  1.00 57.17 ? 3   DG  P C5    1 
ATOM   2819 C  C6    . DG  B 2 3   ? 21.179 11.520 38.156  1.00 55.86 ? 3   DG  P C6    1 
ATOM   2820 O  O6    . DG  B 2 3   ? 21.929 10.680 37.638  1.00 53.03 ? 3   DG  P O6    1 
ATOM   2821 N  N1    . DG  B 2 3   ? 21.587 12.207 39.295  1.00 55.93 ? 3   DG  P N1    1 
ATOM   2822 C  C2    . DG  B 2 3   ? 20.843 13.157 39.953  1.00 57.38 ? 3   DG  P C2    1 
ATOM   2823 N  N2    . DG  B 2 3   ? 21.415 13.715 41.026  1.00 57.48 ? 3   DG  P N2    1 
ATOM   2824 N  N3    . DG  B 2 3   ? 19.631 13.534 39.583  1.00 57.50 ? 3   DG  P N3    1 
ATOM   2825 C  C4    . DG  B 2 3   ? 19.214 12.878 38.479  1.00 58.53 ? 3   DG  P C4    1 
ATOM   2826 P  P     . DG  B 2 4   ? 15.298 17.771 38.039  1.00 73.40 ? 4   DG  P P     1 
ATOM   2827 O  OP1   . DG  B 2 4   ? 14.553 18.697 38.922  1.00 73.11 ? 4   DG  P OP1   1 
ATOM   2828 O  OP2   . DG  B 2 4   ? 15.082 17.823 36.575  1.00 72.09 ? 4   DG  P OP2   1 
ATOM   2829 O  "O5'" . DG  B 2 4   ? 16.877 17.927 38.309  1.00 72.38 ? 4   DG  P "O5'" 1 
ATOM   2830 C  "C5'" . DG  B 2 4   ? 17.345 18.126 39.645  1.00 72.89 ? 4   DG  P "C5'" 1 
ATOM   2831 C  "C4'" . DG  B 2 4   ? 18.763 18.639 39.624  1.00 73.00 ? 4   DG  P "C4'" 1 
ATOM   2832 O  "O4'" . DG  B 2 4   ? 19.662 17.577 39.211  1.00 71.97 ? 4   DG  P "O4'" 1 
ATOM   2833 C  "C3'" . DG  B 2 4   ? 18.850 19.723 38.547  1.00 73.57 ? 4   DG  P "C3'" 1 
ATOM   2834 O  "O3'" . DG  B 2 4   ? 19.695 20.800 38.963  1.00 75.11 ? 4   DG  P "O3'" 1 
ATOM   2835 C  "C2'" . DG  B 2 4   ? 19.439 18.992 37.352  1.00 71.68 ? 4   DG  P "C2'" 1 
ATOM   2836 C  "C1'" . DG  B 2 4   ? 20.323 17.945 38.012  1.00 70.13 ? 4   DG  P "C1'" 1 
ATOM   2837 N  N9    . DG  B 2 4   ? 20.535 16.740 37.212  1.00 66.97 ? 4   DG  P N9    1 
ATOM   2838 C  C8    . DG  B 2 4   ? 19.702 16.232 36.244  1.00 65.76 ? 4   DG  P C8    1 
ATOM   2839 N  N7    . DG  B 2 4   ? 20.190 15.176 35.651  1.00 64.34 ? 4   DG  P N7    1 
ATOM   2840 C  C5    . DG  B 2 4   ? 21.413 14.965 36.273  1.00 62.82 ? 4   DG  P C5    1 
ATOM   2841 C  C6    . DG  B 2 4   ? 22.405 13.974 36.042  1.00 61.46 ? 4   DG  P C6    1 
ATOM   2842 O  O6    . DG  B 2 4   ? 22.408 13.063 35.207  1.00 59.92 ? 4   DG  P O6    1 
ATOM   2843 N  N1    . DG  B 2 4   ? 23.486 14.124 36.902  1.00 59.91 ? 4   DG  P N1    1 
ATOM   2844 C  C2    . DG  B 2 4   ? 23.606 15.103 37.855  1.00 61.16 ? 4   DG  P C2    1 
ATOM   2845 N  N2    . DG  B 2 4   ? 24.735 15.085 38.581  1.00 60.08 ? 4   DG  P N2    1 
ATOM   2846 N  N3    . DG  B 2 4   ? 22.693 16.035 38.078  1.00 62.11 ? 4   DG  P N3    1 
ATOM   2847 C  C4    . DG  B 2 4   ? 21.632 15.908 37.254  1.00 63.94 ? 4   DG  P C4    1 
ATOM   2848 P  P     . DG  B 2 5   ? 19.734 22.153 38.098  1.00 76.89 ? 5   DG  P P     1 
ATOM   2849 O  OP1   . DG  B 2 5   ? 19.355 23.259 39.004  1.00 77.53 ? 5   DG  P OP1   1 
ATOM   2850 O  OP2   . DG  B 2 5   ? 18.976 21.936 36.845  1.00 76.26 ? 5   DG  P OP2   1 
ATOM   2851 O  "O5'" . DG  B 2 5   ? 21.290 22.291 37.713  1.00 74.21 ? 5   DG  P "O5'" 1 
ATOM   2852 C  "C5'" . DG  B 2 5   ? 22.000 21.095 37.386  1.00 70.43 ? 5   DG  P "C5'" 1 
ATOM   2853 C  "C4'" . DG  B 2 5   ? 23.380 21.081 37.996  1.00 67.25 ? 5   DG  P "C4'" 1 
ATOM   2854 O  "O4'" . DG  B 2 5   ? 23.897 19.737 37.911  1.00 64.98 ? 5   DG  P "O4'" 1 
ATOM   2855 C  "C3'" . DG  B 2 5   ? 24.312 21.947 37.146  1.00 66.66 ? 5   DG  P "C3'" 1 
ATOM   2856 O  "O3'" . DG  B 2 5   ? 25.350 22.521 37.944  1.00 66.89 ? 5   DG  P "O3'" 1 
ATOM   2857 C  "C2'" . DG  B 2 5   ? 24.870 20.966 36.134  1.00 64.87 ? 5   DG  P "C2'" 1 
ATOM   2858 C  "C1'" . DG  B 2 5   ? 24.824 19.615 36.842  1.00 61.94 ? 5   DG  P "C1'" 1 
ATOM   2859 N  N9    . DG  B 2 5   ? 24.320 18.569 35.963  1.00 58.21 ? 5   DG  P N9    1 
ATOM   2860 C  C8    . DG  B 2 5   ? 23.081 18.540 35.370  1.00 56.45 ? 5   DG  P C8    1 
ATOM   2861 N  N7    . DG  B 2 5   ? 22.908 17.507 34.595  1.00 55.14 ? 5   DG  P N7    1 
ATOM   2862 C  C5    . DG  B 2 5   ? 24.101 16.805 34.687  1.00 53.97 ? 5   DG  P C5    1 
ATOM   2863 C  C6    . DG  B 2 5   ? 24.510 15.605 34.051  1.00 52.21 ? 5   DG  P C6    1 
ATOM   2864 O  O6    . DG  B 2 5   ? 23.882 14.909 33.250  1.00 52.56 ? 5   DG  P O6    1 
ATOM   2865 N  N1    . DG  B 2 5   ? 25.797 15.240 34.426  1.00 50.12 ? 5   DG  P N1    1 
ATOM   2866 C  C2    . DG  B 2 5   ? 26.593 15.940 35.294  1.00 48.99 ? 5   DG  P C2    1 
ATOM   2867 N  N2    . DG  B 2 5   ? 27.803 15.424 35.521  1.00 46.18 ? 5   DG  P N2    1 
ATOM   2868 N  N3    . DG  B 2 5   ? 26.228 17.066 35.892  1.00 52.22 ? 5   DG  P N3    1 
ATOM   2869 C  C4    . DG  B 2 5   ? 24.979 17.439 35.542  1.00 54.59 ? 5   DG  P C4    1 
ATOM   2870 P  P     . DA  B 2 6   ? 26.322 23.631 37.302  1.00 68.69 ? 6   DA  P P     1 
ATOM   2871 O  OP1   . DA  B 2 6   ? 26.830 24.458 38.419  1.00 68.08 ? 6   DA  P OP1   1 
ATOM   2872 O  OP2   . DA  B 2 6   ? 25.613 24.278 36.175  1.00 67.73 ? 6   DA  P OP2   1 
ATOM   2873 O  "O5'" . DA  B 2 6   ? 27.538 22.767 36.699  1.00 64.09 ? 6   DA  P "O5'" 1 
ATOM   2874 C  "C5'" . DA  B 2 6   ? 28.408 22.080 37.602  1.00 58.38 ? 6   DA  P "C5'" 1 
ATOM   2875 C  "C4'" . DA  B 2 6   ? 29.451 21.292 36.851  1.00 53.34 ? 6   DA  P "C4'" 1 
ATOM   2876 O  "O4'" . DA  B 2 6   ? 28.838 20.229 36.083  1.00 50.63 ? 6   DA  P "O4'" 1 
ATOM   2877 C  "C3'" . DA  B 2 6   ? 30.160 22.196 35.840  1.00 51.55 ? 6   DA  P "C3'" 1 
ATOM   2878 O  "O3'" . DA  B 2 6   ? 31.539 21.837 35.824  1.00 49.99 ? 6   DA  P "O3'" 1 
ATOM   2879 C  "C2'" . DA  B 2 6   ? 29.499 21.834 34.518  1.00 49.97 ? 6   DA  P "C2'" 1 
ATOM   2880 C  "C1'" . DA  B 2 6   ? 29.188 20.358 34.715  1.00 48.19 ? 6   DA  P "C1'" 1 
ATOM   2881 N  N9    . DA  B 2 6   ? 28.073 19.836 33.923  1.00 44.56 ? 6   DA  P N9    1 
ATOM   2882 C  C8    . DA  B 2 6   ? 26.824 20.380 33.774  1.00 43.72 ? 6   DA  P C8    1 
ATOM   2883 N  N7    . DA  B 2 6   ? 26.022 19.665 33.022  1.00 43.57 ? 6   DA  P N7    1 
ATOM   2884 C  C5    . DA  B 2 6   ? 26.801 18.582 32.640  1.00 41.36 ? 6   DA  P C5    1 
ATOM   2885 C  C6    . DA  B 2 6   ? 26.532 17.464 31.829  1.00 39.78 ? 6   DA  P C6    1 
ATOM   2886 N  N6    . DA  B 2 6   ? 25.363 17.252 31.228  1.00 40.17 ? 6   DA  P N6    1 
ATOM   2887 N  N1    . DA  B 2 6   ? 27.521 16.566 31.649  1.00 38.73 ? 6   DA  P N1    1 
ATOM   2888 C  C2    . DA  B 2 6   ? 28.703 16.792 32.238  1.00 39.17 ? 6   DA  P C2    1 
ATOM   2889 N  N3    . DA  B 2 6   ? 29.078 17.808 33.016  1.00 40.53 ? 6   DA  P N3    1 
ATOM   2890 C  C4    . DA  B 2 6   ? 28.068 18.677 33.182  1.00 41.58 ? 6   DA  P C4    1 
ATOM   2891 P  P     . DA  B 2 7   ? 32.617 22.831 35.188  1.00 49.97 ? 7   DA  P P     1 
ATOM   2892 O  OP1   . DA  B 2 7   ? 33.620 23.100 36.242  1.00 50.20 ? 7   DA  P OP1   1 
ATOM   2893 O  OP2   . DA  B 2 7   ? 31.896 23.960 34.557  1.00 50.56 ? 7   DA  P OP2   1 
ATOM   2894 O  "O5'" . DA  B 2 7   ? 33.281 21.920 34.040  1.00 48.81 ? 7   DA  P "O5'" 1 
ATOM   2895 C  "C5'" . DA  B 2 7   ? 33.812 20.648 34.416  1.00 49.27 ? 7   DA  P "C5'" 1 
ATOM   2896 C  "C4'" . DA  B 2 7   ? 34.015 19.752 33.218  1.00 48.02 ? 7   DA  P "C4'" 1 
ATOM   2897 O  "O4'" . DA  B 2 7   ? 32.752 19.302 32.674  1.00 47.03 ? 7   DA  P "O4'" 1 
ATOM   2898 C  "C3'" . DA  B 2 7   ? 34.712 20.534 32.104  1.00 47.89 ? 7   DA  P "C3'" 1 
ATOM   2899 O  "O3'" . DA  B 2 7   ? 35.727 19.715 31.530  1.00 49.49 ? 7   DA  P "O3'" 1 
ATOM   2900 C  "C2'" . DA  B 2 7   ? 33.597 20.801 31.105  1.00 47.62 ? 7   DA  P "C2'" 1 
ATOM   2901 C  "C1'" . DA  B 2 7   ? 32.717 19.578 31.288  1.00 46.55 ? 7   DA  P "C1'" 1 
ATOM   2902 N  N9    . DA  B 2 7   ? 31.314 19.721 30.890  1.00 44.99 ? 7   DA  P N9    1 
ATOM   2903 C  C8    . DA  B 2 7   ? 30.411 20.690 31.255  1.00 44.46 ? 7   DA  P C8    1 
ATOM   2904 N  N7    . DA  B 2 7   ? 29.216 20.521 30.737  1.00 42.98 ? 7   DA  P N7    1 
ATOM   2905 C  C5    . DA  B 2 7   ? 29.344 19.372 29.972  1.00 42.12 ? 7   DA  P C5    1 
ATOM   2906 C  C6    . DA  B 2 7   ? 28.435 18.666 29.164  1.00 42.92 ? 7   DA  P C6    1 
ATOM   2907 N  N6    . DA  B 2 7   ? 27.164 19.043 28.965  1.00 41.89 ? 7   DA  P N6    1 
ATOM   2908 N  N1    . DA  B 2 7   ? 28.881 17.547 28.552  1.00 41.85 ? 7   DA  P N1    1 
ATOM   2909 C  C2    . DA  B 2 7   ? 30.155 17.178 28.737  1.00 39.74 ? 7   DA  P C2    1 
ATOM   2910 N  N3    . DA  B 2 7   ? 31.103 17.762 29.461  1.00 41.40 ? 7   DA  P N3    1 
ATOM   2911 C  C4    . DA  B 2 7   ? 30.629 18.867 30.059  1.00 42.38 ? 7   DA  P C4    1 
ATOM   2912 P  P     . DG  B 2 8   ? 36.923 20.395 30.712  1.00 51.26 ? 8   DG  P P     1 
ATOM   2913 O  OP1   . DG  B 2 8   ? 38.188 19.802 31.198  1.00 52.20 ? 8   DG  P OP1   1 
ATOM   2914 O  OP2   . DG  B 2 8   ? 36.735 21.863 30.757  1.00 52.25 ? 8   DG  P OP2   1 
ATOM   2915 O  "O5'" . DG  B 2 8   ? 36.644 19.892 29.210  1.00 49.51 ? 8   DG  P "O5'" 1 
ATOM   2916 C  "C5'" . DG  B 2 8   ? 36.633 18.486 28.955  1.00 46.42 ? 8   DG  P "C5'" 1 
ATOM   2917 C  "C4'" . DG  B 2 8   ? 36.005 18.167 27.621  1.00 43.77 ? 8   DG  P "C4'" 1 
ATOM   2918 O  "O4'" . DG  B 2 8   ? 34.574 18.382 27.640  1.00 41.83 ? 8   DG  P "O4'" 1 
ATOM   2919 C  "C3'" . DG  B 2 8   ? 36.562 19.078 26.525  1.00 43.22 ? 8   DG  P "C3'" 1 
ATOM   2920 O  "O3'" . DG  B 2 8   ? 36.892 18.270 25.403  1.00 43.19 ? 8   DG  P "O3'" 1 
ATOM   2921 C  "C2'" . DG  B 2 8   ? 35.399 20.007 26.205  1.00 40.93 ? 8   DG  P "C2'" 1 
ATOM   2922 C  "C1'" . DG  B 2 8   ? 34.218 19.104 26.483  1.00 41.08 ? 8   DG  P "C1'" 1 
ATOM   2923 N  N9    . DG  B 2 8   ? 32.933 19.752 26.724  1.00 38.86 ? 8   DG  P N9    1 
ATOM   2924 C  C8    . DG  B 2 8   ? 32.681 20.887 27.458  1.00 38.43 ? 8   DG  P C8    1 
ATOM   2925 N  N7    . DG  B 2 8   ? 31.416 21.224 27.465  1.00 36.76 ? 8   DG  P N7    1 
ATOM   2926 C  C5    . DG  B 2 8   ? 30.795 20.251 26.691  1.00 35.04 ? 8   DG  P C5    1 
ATOM   2927 C  C6    . DG  B 2 8   ? 29.425 20.089 26.326  1.00 33.60 ? 8   DG  P C6    1 
ATOM   2928 O  O6    . DG  B 2 8   ? 28.452 20.808 26.612  1.00 31.49 ? 8   DG  P O6    1 
ATOM   2929 N  N1    . DG  B 2 8   ? 29.239 18.961 25.539  1.00 31.83 ? 8   DG  P N1    1 
ATOM   2930 C  C2    . DG  B 2 8   ? 30.232 18.101 25.138  1.00 36.02 ? 8   DG  P C2    1 
ATOM   2931 N  N2    . DG  B 2 8   ? 29.849 17.073 24.367  1.00 35.59 ? 8   DG  P N2    1 
ATOM   2932 N  N3    . DG  B 2 8   ? 31.507 18.240 25.463  1.00 37.43 ? 8   DG  P N3    1 
ATOM   2933 C  C4    . DG  B 2 8   ? 31.716 19.330 26.235  1.00 37.97 ? 8   DG  P C4    1 
ATOM   2934 P  P     . DG  B 2 9   ? 37.602 18.923 24.128  1.00 45.20 ? 9   DG  P P     1 
ATOM   2935 O  OP1   . DG  B 2 9   ? 38.839 18.149 23.886  1.00 44.10 ? 9   DG  P OP1   1 
ATOM   2936 O  OP2   . DG  B 2 9   ? 37.682 20.391 24.304  1.00 42.97 ? 9   DG  P OP2   1 
ATOM   2937 O  "O5'" . DG  B 2 9   ? 36.525 18.604 22.976  1.00 45.99 ? 9   DG  P "O5'" 1 
ATOM   2938 C  "C5'" . DG  B 2 9   ? 35.856 17.342 23.028  1.00 44.17 ? 9   DG  P "C5'" 1 
ATOM   2939 C  "C4'" . DG  B 2 9   ? 34.577 17.351 22.229  1.00 45.01 ? 9   DG  P "C4'" 1 
ATOM   2940 O  "O4'" . DG  B 2 9   ? 33.520 18.106 22.869  1.00 43.90 ? 9   DG  P "O4'" 1 
ATOM   2941 C  "C3'" . DG  B 2 9   ? 34.798 18.004 20.863  1.00 45.20 ? 9   DG  P "C3'" 1 
ATOM   2942 O  "O3'" . DG  B 2 9   ? 34.051 17.259 19.911  1.00 47.11 ? 9   DG  P "O3'" 1 
ATOM   2943 C  "C2'" . DG  B 2 9   ? 34.156 19.370 21.028  1.00 43.74 ? 9   DG  P "C2'" 1 
ATOM   2944 C  "C1'" . DG  B 2 9   ? 32.990 19.014 21.924  1.00 41.84 ? 9   DG  P "C1'" 1 
ATOM   2945 N  N9    . DG  B 2 9   ? 32.366 20.119 22.643  1.00 40.44 ? 9   DG  P N9    1 
ATOM   2946 C  C8    . DG  B 2 9   ? 32.970 21.062 23.437  1.00 39.21 ? 9   DG  P C8    1 
ATOM   2947 N  N7    . DG  B 2 9   ? 32.127 21.930 23.930  1.00 38.65 ? 9   DG  P N7    1 
ATOM   2948 C  C5    . DG  B 2 9   ? 30.895 21.533 23.433  1.00 37.19 ? 9   DG  P C5    1 
ATOM   2949 C  C6    . DG  B 2 9   ? 29.604 22.087 23.624  1.00 37.04 ? 9   DG  P C6    1 
ATOM   2950 O  O6    . DG  B 2 9   ? 29.284 23.073 24.290  1.00 34.80 ? 9   DG  P O6    1 
ATOM   2951 N  N1    . DG  B 2 9   ? 28.630 21.365 22.938  1.00 37.44 ? 9   DG  P N1    1 
ATOM   2952 C  C2    . DG  B 2 9   ? 28.874 20.256 22.162  1.00 37.42 ? 9   DG  P C2    1 
ATOM   2953 N  N2    . DG  B 2 9   ? 27.813 19.708 21.553  1.00 37.25 ? 9   DG  P N2    1 
ATOM   2954 N  N3    . DG  B 2 9   ? 30.070 19.727 21.986  1.00 38.31 ? 9   DG  P N3    1 
ATOM   2955 C  C4    . DG  B 2 9   ? 31.026 20.414 22.642  1.00 38.69 ? 9   DG  P C4    1 
ATOM   2956 P  P     . DA  B 2 10  ? 34.387 17.390 18.353  1.00 46.72 ? 10  DA  P P     1 
ATOM   2957 O  OP1   . DA  B 2 10  ? 35.056 16.127 17.968  1.00 49.69 ? 10  DA  P OP1   1 
ATOM   2958 O  OP2   . DA  B 2 10  ? 35.058 18.682 18.085  1.00 46.35 ? 10  DA  P OP2   1 
ATOM   2959 O  "O5'" . DA  B 2 10  ? 32.914 17.439 17.710  1.00 47.47 ? 10  DA  P "O5'" 1 
ATOM   2960 C  "C5'" . DA  B 2 10  ? 31.923 16.512 18.161  1.00 43.93 ? 10  DA  P "C5'" 1 
ATOM   2961 C  "C4'" . DA  B 2 10  ? 30.550 16.920 17.686  1.00 41.42 ? 10  DA  P "C4'" 1 
ATOM   2962 O  "O4'" . DA  B 2 10  ? 30.058 18.053 18.437  1.00 39.63 ? 10  DA  P "O4'" 1 
ATOM   2963 C  "C3'" . DA  B 2 10  ? 30.620 17.374 16.227  1.00 40.73 ? 10  DA  P "C3'" 1 
ATOM   2964 O  "O3'" . DA  B 2 10  ? 29.423 16.948 15.555  1.00 41.77 ? 10  DA  P "O3'" 1 
ATOM   2965 C  "C2'" . DA  B 2 10  ? 30.696 18.890 16.345  1.00 38.00 ? 10  DA  P "C2'" 1 
ATOM   2966 C  "C1'" . DA  B 2 10  ? 29.827 19.154 17.568  1.00 37.59 ? 10  DA  P "C1'" 1 
ATOM   2967 N  N9    . DA  B 2 10  ? 30.144 20.372 18.315  1.00 35.32 ? 10  DA  P N9    1 
ATOM   2968 C  C8    . DA  B 2 10  ? 31.387 20.813 18.701  1.00 33.39 ? 10  DA  P C8    1 
ATOM   2969 N  N7    . DA  B 2 10  ? 31.363 21.916 19.409  1.00 33.47 ? 10  DA  P N7    1 
ATOM   2970 C  C5    . DA  B 2 10  ? 30.016 22.233 19.483  1.00 32.07 ? 10  DA  P C5    1 
ATOM   2971 C  C6    . DA  B 2 10  ? 29.336 23.291 20.096  1.00 31.59 ? 10  DA  P C6    1 
ATOM   2972 N  N6    . DA  B 2 10  ? 29.952 24.265 20.771  1.00 29.37 ? 10  DA  P N6    1 
ATOM   2973 N  N1    . DA  B 2 10  ? 27.993 23.320 19.989  1.00 30.21 ? 10  DA  P N1    1 
ATOM   2974 C  C2    . DA  B 2 10  ? 27.384 22.344 19.298  1.00 33.14 ? 10  DA  P C2    1 
ATOM   2975 N  N3    . DA  B 2 10  ? 27.915 21.297 18.671  1.00 31.90 ? 10  DA  P N3    1 
ATOM   2976 C  C4    . DA  B 2 10  ? 29.252 21.298 18.804  1.00 32.15 ? 10  DA  P C4    1 
ATOM   2977 P  P     . DT  B 2 11  ? 29.401 16.809 13.950  1.00 40.53 ? 11  DT  P P     1 
ATOM   2978 O  OP1   . DT  B 2 11  ? 28.699 15.545 13.632  1.00 43.82 ? 11  DT  P OP1   1 
ATOM   2979 O  OP2   . DT  B 2 11  ? 30.761 17.051 13.417  1.00 40.67 ? 11  DT  P OP2   1 
ATOM   2980 O  "O5'" . DT  B 2 11  ? 28.472 18.041 13.505  1.00 38.57 ? 11  DT  P "O5'" 1 
ATOM   2981 C  "C5'" . DT  B 2 11  ? 28.322 19.116 14.431  1.00 36.89 ? 11  DT  P "C5'" 1 
ATOM   2982 C  "C4'" . DT  B 2 11  ? 27.062 19.887 14.162  1.00 34.08 ? 11  DT  P "C4'" 1 
ATOM   2983 O  "O4'" . DT  B 2 11  ? 27.032 20.956 15.130  1.00 30.71 ? 11  DT  P "O4'" 1 
ATOM   2984 C  "C3'" . DT  B 2 11  ? 27.187 20.539 12.784  1.00 33.59 ? 11  DT  P "C3'" 1 
ATOM   2985 O  "O3'" . DT  B 2 11  ? 25.914 20.513 12.129  1.00 33.63 ? 11  DT  P "O3'" 1 
ATOM   2986 C  "C2'" . DT  B 2 11  ? 27.695 21.941 13.085  1.00 30.09 ? 11  DT  P "C2'" 1 
ATOM   2987 C  "C1'" . DT  B 2 11  ? 27.211 22.214 14.504  1.00 31.04 ? 11  DT  P "C1'" 1 
ATOM   2988 N  N1    . DT  B 2 11  ? 28.139 23.001 15.349  1.00 30.09 ? 11  DT  P N1    1 
ATOM   2989 C  C2    . DT  B 2 11  ? 27.591 23.971 16.150  1.00 29.49 ? 11  DT  P C2    1 
ATOM   2990 O  O2    . DT  B 2 11  ? 26.391 24.187 16.197  1.00 31.22 ? 11  DT  P O2    1 
ATOM   2991 N  N3    . DT  B 2 11  ? 28.500 24.679 16.899  1.00 28.88 ? 11  DT  P N3    1 
ATOM   2992 C  C4    . DT  B 2 11  ? 29.870 24.509 16.926  1.00 29.72 ? 11  DT  P C4    1 
ATOM   2993 O  O4    . DT  B 2 11  ? 30.558 25.222 17.641  1.00 31.68 ? 11  DT  P O4    1 
ATOM   2994 C  C5    . DT  B 2 11  ? 30.382 23.465 16.069  1.00 30.12 ? 11  DT  P C5    1 
ATOM   2995 C  C7    . DT  B 2 11  ? 31.860 23.208 16.043  1.00 26.45 ? 11  DT  P C7    1 
ATOM   2996 C  C6    . DT  B 2 11  ? 29.501 22.771 15.330  1.00 28.82 ? 11  DT  P C6    1 
ATOM   2997 P  P     . DT  B 2 12  ? 25.731 21.228 10.708  1.00 31.81 ? 12  DT  P P     1 
ATOM   2998 O  OP1   . DT  B 2 12  ? 24.546 20.591 10.090  1.00 33.63 ? 12  DT  P OP1   1 
ATOM   2999 O  OP2   . DT  B 2 12  ? 27.019 21.253 9.981   1.00 31.23 ? 12  DT  P OP2   1 
ATOM   3000 O  "O5'" . DT  B 2 12  ? 25.361 22.738 11.120  1.00 33.62 ? 12  DT  P "O5'" 1 
ATOM   3001 C  "C5'" . DT  B 2 12  ? 24.277 22.947 12.028  1.00 33.72 ? 12  DT  P "C5'" 1 
ATOM   3002 C  "C4'" . DT  B 2 12  ? 24.027 24.419 12.248  1.00 32.64 ? 12  DT  P "C4'" 1 
ATOM   3003 O  "O4'" . DT  B 2 12  ? 24.983 24.952 13.195  1.00 32.73 ? 12  DT  P "O4'" 1 
ATOM   3004 C  "C3'" . DT  B 2 12  ? 24.253 25.159 10.927  1.00 33.78 ? 12  DT  P "C3'" 1 
ATOM   3005 O  "O3'" . DT  B 2 12  ? 23.153 25.998 10.596  1.00 37.13 ? 12  DT  P "O3'" 1 
ATOM   3006 C  "C2'" . DT  B 2 12  ? 25.501 25.993 11.172  1.00 34.65 ? 12  DT  P "C2'" 1 
ATOM   3007 C  "C1'" . DT  B 2 12  ? 25.538 26.147 12.685  1.00 33.04 ? 12  DT  P "C1'" 1 
ATOM   3008 N  N1    . DT  B 2 12  ? 26.907 26.284 13.228  1.00 30.72 ? 12  DT  P N1    1 
ATOM   3009 C  C2    . DT  B 2 12  ? 27.139 27.208 14.224  1.00 27.96 ? 12  DT  P C2    1 
ATOM   3010 O  O2    . DT  B 2 12  ? 26.270 27.877 14.733  1.00 27.07 ? 12  DT  P O2    1 
ATOM   3011 N  N3    . DT  B 2 12  ? 28.445 27.309 14.615  1.00 28.53 ? 12  DT  P N3    1 
ATOM   3012 C  C4    . DT  B 2 12  ? 29.513 26.589 14.143  1.00 28.41 ? 12  DT  P C4    1 
ATOM   3013 O  O4    . DT  B 2 12  ? 30.630 26.802 14.587  1.00 30.52 ? 12  DT  P O4    1 
ATOM   3014 C  C5    . DT  B 2 12  ? 29.200 25.613 13.123  1.00 31.22 ? 12  DT  P C5    1 
ATOM   3015 C  C7    . DT  B 2 12  ? 30.302 24.767 12.562  1.00 29.98 ? 12  DT  P C7    1 
ATOM   3016 C  C6    . DT  B 2 12  ? 27.929 25.512 12.723  1.00 30.35 ? 12  DT  P C6    1 
ATOM   3017 P  P     . DC  B 2 13  ? 23.088 26.664 9.138   1.00 33.97 ? 13  DC  P P     1 
ATOM   3018 O  OP1   . DC  B 2 13  ? 21.714 26.525 8.604   1.00 38.35 ? 13  DC  P OP1   1 
ATOM   3019 O  OP2   . DC  B 2 13  ? 24.227 26.134 8.357   1.00 39.34 ? 13  DC  P OP2   1 
ATOM   3020 O  "O5'" . DC  B 2 13  ? 23.356 28.213 9.467   1.00 37.40 ? 13  DC  P "O5'" 1 
ATOM   3021 C  "C5'" . DC  B 2 13  ? 22.652 28.773 10.577  1.00 39.35 ? 13  DC  P "C5'" 1 
ATOM   3022 C  "C4'" . DC  B 2 13  ? 23.218 30.120 10.941  1.00 41.74 ? 13  DC  P "C4'" 1 
ATOM   3023 O  "O4'" . DC  B 2 13  ? 24.459 30.003 11.679  1.00 39.91 ? 13  DC  P "O4'" 1 
ATOM   3024 C  "C3'" . DC  B 2 13  ? 23.542 30.879 9.652   1.00 44.11 ? 13  DC  P "C3'" 1 
ATOM   3025 O  "O3'" . DC  B 2 13  ? 23.085 32.215 9.792   1.00 50.33 ? 13  DC  P "O3'" 1 
ATOM   3026 C  "C2'" . DC  B 2 13  ? 25.059 30.853 9.596   1.00 42.79 ? 13  DC  P "C2'" 1 
ATOM   3027 C  "C1'" . DC  B 2 13  ? 25.424 30.835 11.071  1.00 39.52 ? 13  DC  P "C1'" 1 
ATOM   3028 N  N1    . DC  B 2 13  ? 26.762 30.306 11.384  1.00 35.29 ? 13  DC  P N1    1 
ATOM   3029 C  C2    . DC  B 2 13  ? 27.516 30.951 12.367  1.00 34.64 ? 13  DC  P C2    1 
ATOM   3030 O  O2    . DC  B 2 13  ? 27.009 31.906 12.971  1.00 34.02 ? 13  DC  P O2    1 
ATOM   3031 N  N3    . DC  B 2 13  ? 28.771 30.516 12.637  1.00 31.82 ? 13  DC  P N3    1 
ATOM   3032 C  C4    . DC  B 2 13  ? 29.269 29.476 11.973  1.00 31.53 ? 13  DC  P C4    1 
ATOM   3033 N  N4    . DC  B 2 13  ? 30.523 29.090 12.256  1.00 31.52 ? 13  DC  P N4    1 
ATOM   3034 C  C5    . DC  B 2 13  ? 28.511 28.781 10.981  1.00 34.04 ? 13  DC  P C5    1 
ATOM   3035 C  C6    . DC  B 2 13  ? 27.272 29.225 10.722  1.00 35.04 ? 13  DC  P C6    1 
ATOM   3036 P  P     . DC  B 2 14  ? 23.089 33.204 8.530   1.00 54.33 ? 14  DC  P P     1 
ATOM   3037 O  OP1   . DC  B 2 14  ? 21.663 33.445 8.215   1.00 53.55 ? 14  DC  P OP1   1 
ATOM   3038 O  OP2   . DC  B 2 14  ? 23.992 32.683 7.479   1.00 52.83 ? 14  DC  P OP2   1 
ATOM   3039 O  "O5'" . DC  B 2 14  ? 23.729 34.533 9.177   1.00 53.78 ? 14  DC  P "O5'" 1 
ATOM   3040 C  "C5'" . DC  B 2 14  ? 23.270 34.943 10.469  1.00 52.19 ? 14  DC  P "C5'" 1 
ATOM   3041 C  "C4'" . DC  B 2 14  ? 24.276 35.803 11.203  1.00 50.28 ? 14  DC  P "C4'" 1 
ATOM   3042 O  "O4'" . DC  B 2 14  ? 25.476 35.054 11.536  1.00 51.11 ? 14  DC  P "O4'" 1 
ATOM   3043 C  "C3'" . DC  B 2 14  ? 24.734 36.976 10.334  1.00 48.91 ? 14  DC  P "C3'" 1 
ATOM   3044 O  "O3'" . DC  B 2 14  ? 25.032 38.078 11.177  1.00 46.74 ? 14  DC  P "O3'" 1 
ATOM   3045 C  "C2'" . DC  B 2 14  ? 26.078 36.502 9.808   1.00 49.20 ? 14  DC  P "C2'" 1 
ATOM   3046 C  "C1'" . DC  B 2 14  ? 26.606 35.735 11.005  1.00 48.08 ? 14  DC  P "C1'" 1 
ATOM   3047 N  N1    . DC  B 2 14  ? 27.670 34.747 10.728  1.00 46.88 ? 14  DC  P N1    1 
ATOM   3048 C  C2    . DC  B 2 14  ? 28.909 34.891 11.387  1.00 45.27 ? 14  DC  P C2    1 
ATOM   3049 O  O2    . DC  B 2 14  ? 29.064 35.837 12.191  1.00 46.65 ? 14  DC  P O2    1 
ATOM   3050 N  N3    . DC  B 2 14  ? 29.900 34.004 11.133  1.00 40.92 ? 14  DC  P N3    1 
ATOM   3051 C  C4    . DC  B 2 14  ? 29.701 33.009 10.271  1.00 40.76 ? 14  DC  P C4    1 
ATOM   3052 N  N4    . DC  B 2 14  ? 30.713 32.167 10.054  1.00 40.57 ? 14  DC  P N4    1 
ATOM   3053 C  C5    . DC  B 2 14  ? 28.455 32.833 9.591   1.00 41.21 ? 14  DC  P C5    1 
ATOM   3054 C  C6    . DC  B 2 14  ? 27.474 33.716 9.849   1.00 43.74 ? 14  DC  P C6    1 
ATOM   3055 O  "O3'" A DA  C 3 3   ? 43.800 31.386 8.983   0.50 43.67 ? 3   DA  T "O3'" 1 
ATOM   3056 O  "O3'" B DA  C 3 3   ? 40.384 29.732 8.843   0.50 45.65 ? 3   DA  T "O3'" 1 
ATOM   3057 P  P     A DC  C 3 4   ? 44.130 32.853 8.765   0.50 43.57 ? 4   DC  T P     1 
ATOM   3058 P  P     B DC  C 3 4   ? 40.720 30.586 10.051  0.50 46.34 ? 4   DC  T P     1 
ATOM   3059 O  OP1   A DC  C 3 4   ? 43.863 33.305 7.339   0.50 43.50 ? 4   DC  T OP1   1 
ATOM   3060 O  OP1   B DC  C 3 4   ? 42.078 30.269 10.638  0.50 44.94 ? 4   DC  T OP1   1 
ATOM   3061 O  OP2   A DC  C 3 4   ? 45.517 33.246 9.250   0.50 45.36 ? 4   DC  T OP2   1 
ATOM   3062 O  OP2   B DC  C 3 4   ? 39.617 30.597 11.097  0.50 45.25 ? 4   DC  T OP2   1 
ATOM   3063 O  "O5'" A DC  C 3 4   ? 43.111 33.689 9.719   0.50 43.19 ? 4   DC  T "O5'" 1 
ATOM   3064 O  "O5'" B DC  C 3 4   ? 40.826 32.119 9.502   0.50 44.89 ? 4   DC  T "O5'" 1 
ATOM   3065 C  "C5'" A DC  C 3 4   ? 41.716 33.793 9.402   0.50 42.05 ? 4   DC  T "C5'" 1 
ATOM   3066 C  "C5'" B DC  C 3 4   ? 41.888 32.988 9.935   0.50 42.44 ? 4   DC  T "C5'" 1 
ATOM   3067 C  "C4'" A DC  C 3 4   ? 41.110 34.962 10.143  0.50 41.64 ? 4   DC  T "C4'" 1 
ATOM   3068 C  "C4'" B DC  C 3 4   ? 41.337 34.345 10.312  0.50 41.95 ? 4   DC  T "C4'" 1 
ATOM   3069 O  "O4'" A DC  C 3 4   ? 39.788 35.244 9.634   0.50 38.84 ? 4   DC  T "O4'" 1 
ATOM   3070 O  "O4'" B DC  C 3 4   ? 40.133 34.607 9.549   0.50 39.07 ? 4   DC  T "O4'" 1 
ATOM   3071 C  "C3'" A DC  C 3 4   ? 40.941 34.624 11.626  0.50 41.47 ? 4   DC  T "C3'" 1 
ATOM   3072 C  "C3'" B DC  C 3 4   ? 40.917 34.354 11.784  0.50 41.39 ? 4   DC  T "C3'" 1 
ATOM   3073 O  "O3'" A DC  C 3 4   ? 41.183 35.797 12.407  0.50 44.30 ? 4   DC  T "O3'" 1 
ATOM   3074 O  "O3'" B DC  C 3 4   ? 41.203 35.617 12.400  0.50 44.25 ? 4   DC  T "O3'" 1 
ATOM   3075 C  "C2'" A DC  C 3 4   ? 39.491 34.186 11.721  0.50 39.87 ? 4   DC  T "C2'" 1 
ATOM   3076 C  "C2'" B DC  C 3 4   ? 39.420 34.132 11.730  0.50 40.17 ? 4   DC  T "C2'" 1 
ATOM   3077 C  "C1'" A DC  C 3 4   ? 38.802 34.988 10.621  0.50 37.89 ? 4   DC  T "C1'" 1 
ATOM   3078 C  "C1'" B DC  C 3 4   ? 39.035 34.804 10.426  0.50 38.24 ? 4   DC  T "C1'" 1 
ATOM   3079 N  N1    A DC  C 3 4   ? 37.702 34.271 9.955   0.50 34.92 ? 4   DC  T N1    1 
ATOM   3080 N  N1    B DC  C 3 4   ? 37.843 34.218 9.795   0.50 35.16 ? 4   DC  T N1    1 
ATOM   3081 C  C2    A DC  C 3 4   ? 36.425 34.847 9.937   0.50 33.19 ? 4   DC  T C2    1 
ATOM   3082 C  C2    B DC  C 3 4   ? 36.639 34.933 9.830   0.50 33.32 ? 4   DC  T C2    1 
ATOM   3083 O  O2    A DC  C 3 4   ? 36.254 35.947 10.484  0.50 33.39 ? 4   DC  T O2    1 
ATOM   3084 O  O2    B DC  C 3 4   ? 36.620 36.051 10.369  0.50 33.13 ? 4   DC  T O2    1 
ATOM   3085 N  N3    A DC  C 3 4   ? 35.413 34.190 9.322   0.50 30.80 ? 4   DC  T N3    1 
ATOM   3086 N  N3    B DC  C 3 4   ? 35.532 34.391 9.272   0.50 31.18 ? 4   DC  T N3    1 
ATOM   3087 C  C4    A DC  C 3 4   ? 35.639 33.012 8.737   0.50 30.71 ? 4   DC  T C4    1 
ATOM   3088 C  C4    B DC  C 3 4   ? 35.597 33.192 8.689   0.50 30.72 ? 4   DC  T C4    1 
ATOM   3089 N  N4    A DC  C 3 4   ? 34.616 32.407 8.136   0.50 30.51 ? 4   DC  T N4    1 
ATOM   3090 N  N4    B DC  C 3 4   ? 34.483 32.701 8.150   0.50 29.97 ? 4   DC  T N4    1 
ATOM   3091 C  C5    A DC  C 3 4   ? 36.930 32.403 8.740   0.50 31.63 ? 4   DC  T C5    1 
ATOM   3092 C  C5    B DC  C 3 4   ? 36.813 32.445 8.631   0.50 31.83 ? 4   DC  T C5    1 
ATOM   3093 C  C6    A DC  C 3 4   ? 37.922 33.061 9.355   0.50 32.61 ? 4   DC  T C6    1 
ATOM   3094 C  C6    B DC  C 3 4   ? 37.901 32.992 9.191   0.50 32.86 ? 4   DC  T C6    1 
HETATM 3095 P  P     . 8OG C 3 5   ? 41.530 35.669 13.975  1.00 48.81 ? 5   8OG T P     1 
HETATM 3096 O  OP1   . 8OG C 3 5   ? 42.164 36.948 14.369  1.00 44.78 ? 5   8OG T OP1   1 
HETATM 3097 O  OP2   . 8OG C 3 5   ? 42.224 34.393 14.264  1.00 45.11 ? 5   8OG T OP2   1 
HETATM 3098 O  "O5'" . 8OG C 3 5   ? 40.091 35.673 14.696  1.00 44.58 ? 5   8OG T "O5'" 1 
HETATM 3099 C  "C5'" . 8OG C 3 5   ? 39.339 36.887 14.724  1.00 45.94 ? 5   8OG T "C5'" 1 
HETATM 3100 C  "C4'" . 8OG C 3 5   ? 37.890 36.622 15.052  1.00 46.52 ? 5   8OG T "C4'" 1 
HETATM 3101 O  "O4'" . 8OG C 3 5   ? 37.322 35.849 13.979  1.00 46.10 ? 5   8OG T "O4'" 1 
HETATM 3102 C  "C3'" . 8OG C 3 5   ? 37.772 35.749 16.304  1.00 46.24 ? 5   8OG T "C3'" 1 
HETATM 3103 O  "O3'" . 8OG C 3 5   ? 36.608 36.089 17.049  1.00 46.60 ? 5   8OG T "O3'" 1 
HETATM 3104 C  "C2'" . 8OG C 3 5   ? 37.591 34.352 15.712  1.00 47.13 ? 5   8OG T "C2'" 1 
HETATM 3105 C  "C1'" . 8OG C 3 5   ? 36.613 34.777 14.619  1.00 46.19 ? 5   8OG T "C1'" 1 
HETATM 3106 N  N9    . 8OG C 3 5   ? 36.189 33.717 13.674  1.00 45.09 ? 5   8OG T N9    1 
HETATM 3107 C  C8    . 8OG C 3 5   ? 36.855 32.629 13.292  1.00 46.46 ? 5   8OG T C8    1 
HETATM 3108 N  N7    . 8OG C 3 5   ? 36.137 31.898 12.445  1.00 44.22 ? 5   8OG T N7    1 
HETATM 3109 C  C5    . 8OG C 3 5   ? 34.979 32.532 12.279  1.00 43.79 ? 5   8OG T C5    1 
HETATM 3110 C  C6    . 8OG C 3 5   ? 33.844 32.246 11.534  1.00 42.90 ? 5   8OG T C6    1 
HETATM 3111 O  O6    . 8OG C 3 5   ? 33.789 31.224 10.852  1.00 43.35 ? 5   8OG T O6    1 
HETATM 3112 N  N1    . 8OG C 3 5   ? 32.761 33.135 11.584  1.00 40.54 ? 5   8OG T N1    1 
HETATM 3113 C  C2    . 8OG C 3 5   ? 32.850 34.284 12.384  1.00 41.93 ? 5   8OG T C2    1 
HETATM 3114 N  N2    . 8OG C 3 5   ? 31.819 35.122 12.466  1.00 41.52 ? 5   8OG T N2    1 
HETATM 3115 N  N3    . 8OG C 3 5   ? 33.966 34.527 13.089  1.00 42.24 ? 5   8OG T N3    1 
HETATM 3116 C  C4    . 8OG C 3 5   ? 35.014 33.688 13.055  1.00 43.79 ? 5   8OG T C4    1 
HETATM 3117 O  O8    . 8OG C 3 5   ? 37.983 32.310 13.662  1.00 49.75 ? 5   8OG T O8    1 
ATOM   3118 P  P     . DG  C 3 6   ? 36.757 36.720 18.515  1.00 46.34 ? 6   DG  T P     1 
ATOM   3119 O  OP1   . DG  C 3 6   ? 37.418 38.041 18.418  1.00 45.96 ? 6   DG  T OP1   1 
ATOM   3120 O  OP2   . DG  C 3 6   ? 37.323 35.677 19.400  1.00 46.13 ? 6   DG  T OP2   1 
ATOM   3121 O  "O5'" . DG  C 3 6   ? 35.231 36.999 18.933  1.00 45.20 ? 6   DG  T "O5'" 1 
ATOM   3122 C  "C5'" . DG  C 3 6   ? 34.539 38.094 18.331  1.00 41.81 ? 6   DG  T "C5'" 1 
ATOM   3123 C  "C4'" . DG  C 3 6   ? 33.061 37.805 18.293  1.00 38.63 ? 6   DG  T "C4'" 1 
ATOM   3124 O  "O4'" . DG  C 3 6   ? 32.759 36.841 17.253  1.00 39.65 ? 6   DG  T "O4'" 1 
ATOM   3125 C  "C3'" . DG  C 3 6   ? 32.681 37.146 19.620  1.00 37.34 ? 6   DG  T "C3'" 1 
ATOM   3126 O  "O3'" . DG  C 3 6   ? 31.477 37.715 20.103  1.00 36.72 ? 6   DG  T "O3'" 1 
ATOM   3127 C  "C2'" . DG  C 3 6   ? 32.502 35.677 19.265  1.00 35.73 ? 6   DG  T "C2'" 1 
ATOM   3128 C  "C1'" . DG  C 3 6   ? 32.067 35.735 17.805  1.00 35.76 ? 6   DG  T "C1'" 1 
ATOM   3129 N  N9    . DG  C 3 6   ? 32.393 34.555 17.000  1.00 33.70 ? 6   DG  T N9    1 
ATOM   3130 C  C8    . DG  C 3 6   ? 33.613 33.932 16.894  1.00 34.14 ? 6   DG  T C8    1 
ATOM   3131 N  N7    . DG  C 3 6   ? 33.595 32.894 16.102  1.00 32.75 ? 6   DG  T N7    1 
ATOM   3132 C  C5    . DG  C 3 6   ? 32.283 32.827 15.655  1.00 33.54 ? 6   DG  T C5    1 
ATOM   3133 C  C6    . DG  C 3 6   ? 31.656 31.908 14.764  1.00 33.89 ? 6   DG  T C6    1 
ATOM   3134 O  O6    . DG  C 3 6   ? 32.153 30.939 14.173  1.00 38.12 ? 6   DG  T O6    1 
ATOM   3135 N  N1    . DG  C 3 6   ? 30.313 32.207 14.584  1.00 33.08 ? 6   DG  T N1    1 
ATOM   3136 C  C2    . DG  C 3 6   ? 29.650 33.252 15.179  1.00 33.87 ? 6   DG  T C2    1 
ATOM   3137 N  N2    . DG  C 3 6   ? 28.343 33.358 14.893  1.00 31.41 ? 6   DG  T N2    1 
ATOM   3138 N  N3    . DG  C 3 6   ? 30.223 34.121 16.000  1.00 32.19 ? 6   DG  T N3    1 
ATOM   3139 C  C4    . DG  C 3 6   ? 31.528 33.846 16.196  1.00 33.25 ? 6   DG  T C4    1 
ATOM   3140 P  P     . DA  C 3 7   ? 31.091 37.551 21.646  1.00 35.09 ? 7   DA  T P     1 
ATOM   3141 O  OP1   . DA  C 3 7   ? 30.457 38.824 22.053  1.00 36.06 ? 7   DA  T OP1   1 
ATOM   3142 O  OP2   . DA  C 3 7   ? 32.271 37.045 22.383  1.00 35.57 ? 7   DA  T OP2   1 
ATOM   3143 O  "O5'" . DA  C 3 7   ? 29.973 36.395 21.590  1.00 34.91 ? 7   DA  T "O5'" 1 
ATOM   3144 C  "C5'" . DA  C 3 7   ? 28.855 36.622 20.730  1.00 35.17 ? 7   DA  T "C5'" 1 
ATOM   3145 C  "C4'" . DA  C 3 7   ? 28.085 35.358 20.441  1.00 33.04 ? 7   DA  T "C4'" 1 
ATOM   3146 O  "O4'" . DA  C 3 7   ? 28.771 34.505 19.494  1.00 31.55 ? 7   DA  T "O4'" 1 
ATOM   3147 C  "C3'" . DA  C 3 7   ? 27.895 34.526 21.712  1.00 34.57 ? 7   DA  T "C3'" 1 
ATOM   3148 O  "O3'" . DA  C 3 7   ? 26.541 34.112 21.783  1.00 36.63 ? 7   DA  T "O3'" 1 
ATOM   3149 C  "C2'" . DA  C 3 7   ? 28.733 33.285 21.453  1.00 32.93 ? 7   DA  T "C2'" 1 
ATOM   3150 C  "C1'" . DA  C 3 7   ? 28.608 33.181 19.946  1.00 31.72 ? 7   DA  T "C1'" 1 
ATOM   3151 N  N9    . DA  C 3 7   ? 29.579 32.323 19.271  1.00 29.38 ? 7   DA  T N9    1 
ATOM   3152 C  C8    . DA  C 3 7   ? 30.923 32.190 19.498  1.00 27.91 ? 7   DA  T C8    1 
ATOM   3153 N  N7    . DA  C 3 7   ? 31.489 31.257 18.772  1.00 29.51 ? 7   DA  T N7    1 
ATOM   3154 C  C5    . DA  C 3 7   ? 30.449 30.764 17.993  1.00 28.98 ? 7   DA  T C5    1 
ATOM   3155 C  C6    . DA  C 3 7   ? 30.390 29.752 17.014  1.00 26.91 ? 7   DA  T C6    1 
ATOM   3156 N  N6    . DA  C 3 7   ? 31.440 29.041 16.618  1.00 26.81 ? 7   DA  T N6    1 
ATOM   3157 N  N1    . DA  C 3 7   ? 29.194 29.500 16.444  1.00 26.51 ? 7   DA  T N1    1 
ATOM   3158 C  C2    . DA  C 3 7   ? 28.141 30.233 16.815  1.00 26.62 ? 7   DA  T C2    1 
ATOM   3159 N  N3    . DA  C 3 7   ? 28.072 31.213 17.710  1.00 29.88 ? 7   DA  T N3    1 
ATOM   3160 C  C4    . DA  C 3 7   ? 29.274 31.425 18.277  1.00 28.50 ? 7   DA  T C4    1 
ATOM   3161 P  P     . DA  C 3 8   ? 25.867 33.814 23.201  1.00 38.66 ? 8   DA  T P     1 
ATOM   3162 O  OP1   . DA  C 3 8   ? 25.351 35.094 23.732  1.00 40.51 ? 8   DA  T OP1   1 
ATOM   3163 O  OP2   . DA  C 3 8   ? 26.807 33.008 24.011  1.00 35.30 ? 8   DA  T OP2   1 
ATOM   3164 O  "O5'" . DA  C 3 8   ? 24.604 32.918 22.767  1.00 40.19 ? 8   DA  T "O5'" 1 
ATOM   3165 C  "C5'" . DA  C 3 8   ? 23.890 33.290 21.585  1.00 39.76 ? 8   DA  T "C5'" 1 
ATOM   3166 C  "C4'" . DA  C 3 8   ? 23.167 32.108 20.991  1.00 38.70 ? 8   DA  T "C4'" 1 
ATOM   3167 O  "O4'" . DA  C 3 8   ? 24.033 31.302 20.155  1.00 38.44 ? 8   DA  T "O4'" 1 
ATOM   3168 C  "C3'" . DA  C 3 8   ? 22.693 31.207 22.132  1.00 39.02 ? 8   DA  T "C3'" 1 
ATOM   3169 O  "O3'" . DA  C 3 8   ? 21.341 30.846 21.908  1.00 44.21 ? 8   DA  T "O3'" 1 
ATOM   3170 C  "C2'" . DA  C 3 8   ? 23.634 30.012 22.079  1.00 39.46 ? 8   DA  T "C2'" 1 
ATOM   3171 C  "C1'" . DA  C 3 8   ? 24.098 29.964 20.628  1.00 36.44 ? 8   DA  T "C1'" 1 
ATOM   3172 N  N9    . DA  C 3 8   ? 25.487 29.520 20.474  1.00 35.58 ? 8   DA  T N9    1 
ATOM   3173 C  C8    . DA  C 3 8   ? 26.577 30.021 21.137  1.00 34.98 ? 8   DA  T C8    1 
ATOM   3174 N  N7    . DA  C 3 8   ? 27.709 29.447 20.808  1.00 33.69 ? 8   DA  T N7    1 
ATOM   3175 C  C5    . DA  C 3 8   ? 27.344 28.503 19.863  1.00 31.82 ? 8   DA  T C5    1 
ATOM   3176 C  C6    . DA  C 3 8   ? 28.090 27.557 19.130  1.00 30.20 ? 8   DA  T C6    1 
ATOM   3177 N  N6    . DA  C 3 8   ? 29.411 27.405 19.240  1.00 27.20 ? 8   DA  T N6    1 
ATOM   3178 N  N1    . DA  C 3 8   ? 27.418 26.759 18.272  1.00 29.49 ? 8   DA  T N1    1 
ATOM   3179 C  C2    . DA  C 3 8   ? 26.091 26.905 18.170  1.00 30.19 ? 8   DA  T C2    1 
ATOM   3180 N  N3    . DA  C 3 8   ? 25.283 27.750 18.801  1.00 30.17 ? 8   DA  T N3    1 
ATOM   3181 C  C4    . DA  C 3 8   ? 25.977 28.533 19.646  1.00 33.20 ? 8   DA  T C4    1 
ATOM   3182 P  P     . DT  C 3 9   ? 20.564 29.968 22.994  1.00 46.04 ? 9   DT  T P     1 
ATOM   3183 O  OP1   . DT  C 3 9   ? 19.160 30.437 23.002  1.00 48.41 ? 9   DT  T OP1   1 
ATOM   3184 O  OP2   . DT  C 3 9   ? 21.341 29.955 24.254  1.00 50.45 ? 9   DT  T OP2   1 
ATOM   3185 O  "O5'" . DT  C 3 9   ? 20.603 28.513 22.313  1.00 46.96 ? 9   DT  T "O5'" 1 
ATOM   3186 C  "C5'" . DT  C 3 9   ? 20.177 28.409 20.952  1.00 46.08 ? 9   DT  T "C5'" 1 
ATOM   3187 C  "C4'" . DT  C 3 9   ? 20.390 27.012 20.434  1.00 46.12 ? 9   DT  T "C4'" 1 
ATOM   3188 O  "O4'" . DT  C 3 9   ? 21.800 26.743 20.259  1.00 43.11 ? 9   DT  T "O4'" 1 
ATOM   3189 C  "C3'" . DT  C 3 9   ? 19.884 26.016 21.479  1.00 47.03 ? 9   DT  T "C3'" 1 
ATOM   3190 O  "O3'" . DT  C 3 9   ? 19.158 24.997 20.804  1.00 51.91 ? 9   DT  T "O3'" 1 
ATOM   3191 C  "C2'" . DT  C 3 9   ? 21.160 25.464 22.097  1.00 44.40 ? 9   DT  T "C2'" 1 
ATOM   3192 C  "C1'" . DT  C 3 9   ? 22.131 25.545 20.934  1.00 42.12 ? 9   DT  T "C1'" 1 
ATOM   3193 N  N1    . DT  C 3 9   ? 23.570 25.591 21.263  1.00 38.55 ? 9   DT  T N1    1 
ATOM   3194 C  C2    . DT  C 3 9   ? 24.406 24.765 20.545  1.00 37.72 ? 9   DT  T C2    1 
ATOM   3195 O  O2    . DT  C 3 9   ? 24.011 24.018 19.677  1.00 38.85 ? 9   DT  T O2    1 
ATOM   3196 N  N3    . DT  C 3 9   ? 25.730 24.851 20.875  1.00 35.54 ? 9   DT  T N3    1 
ATOM   3197 C  C4    . DT  C 3 9   ? 26.300 25.667 21.821  1.00 37.00 ? 9   DT  T C4    1 
ATOM   3198 O  O4    . DT  C 3 9   ? 27.521 25.647 21.983  1.00 36.88 ? 9   DT  T O4    1 
ATOM   3199 C  C5    . DT  C 3 9   ? 25.366 26.508 22.554  1.00 37.83 ? 9   DT  T C5    1 
ATOM   3200 C  C7    . DT  C 3 9   ? 25.889 27.419 23.622  1.00 37.76 ? 9   DT  T C7    1 
ATOM   3201 C  C6    . DT  C 3 9   ? 24.063 26.427 22.240  1.00 37.64 ? 9   DT  T C6    1 
ATOM   3202 P  P     . DC  C 3 10  ? 18.180 24.028 21.624  1.00 53.57 ? 10  DC  T P     1 
ATOM   3203 O  OP1   . DC  C 3 10  ? 16.870 24.045 20.934  1.00 54.86 ? 10  DC  T OP1   1 
ATOM   3204 O  OP2   . DC  C 3 10  ? 18.259 24.356 23.065  1.00 53.35 ? 10  DC  T OP2   1 
ATOM   3205 O  "O5'" . DC  C 3 10  ? 18.850 22.589 21.365  1.00 51.63 ? 10  DC  T "O5'" 1 
ATOM   3206 C  "C5'" . DC  C 3 10  ? 19.312 22.294 20.047  1.00 46.68 ? 10  DC  T "C5'" 1 
ATOM   3207 C  "C4'" . DC  C 3 10  ? 20.440 21.296 20.078  1.00 44.72 ? 10  DC  T "C4'" 1 
ATOM   3208 O  "O4'" . DC  C 3 10  ? 21.685 21.881 20.530  1.00 44.90 ? 10  DC  T "O4'" 1 
ATOM   3209 C  "C3'" . DC  C 3 10  ? 20.122 20.153 21.045  1.00 45.21 ? 10  DC  T "C3'" 1 
ATOM   3210 O  "O3'" . DC  C 3 10  ? 20.402 18.937 20.368  1.00 45.12 ? 10  DC  T "O3'" 1 
ATOM   3211 C  "C2'" . DC  C 3 10  ? 21.122 20.355 22.176  1.00 45.35 ? 10  DC  T "C2'" 1 
ATOM   3212 C  "C1'" . DC  C 3 10  ? 22.289 20.973 21.432  1.00 43.92 ? 10  DC  T "C1'" 1 
ATOM   3213 N  N1    . DC  C 3 10  ? 23.274 21.705 22.251  1.00 42.76 ? 10  DC  T N1    1 
ATOM   3214 C  C2    . DC  C 3 10  ? 24.645 21.425 22.074  1.00 41.96 ? 10  DC  T C2    1 
ATOM   3215 O  O2    . DC  C 3 10  ? 24.992 20.595 21.222  1.00 42.03 ? 10  DC  T O2    1 
ATOM   3216 N  N3    . DC  C 3 10  ? 25.556 22.068 22.835  1.00 42.48 ? 10  DC  T N3    1 
ATOM   3217 C  C4    . DC  C 3 10  ? 25.157 22.961 23.743  1.00 41.47 ? 10  DC  T C4    1 
ATOM   3218 N  N4    . DC  C 3 10  ? 26.101 23.557 24.477  1.00 40.96 ? 10  DC  T N4    1 
ATOM   3219 C  C5    . DC  C 3 10  ? 23.775 23.278 23.938  1.00 41.59 ? 10  DC  T C5    1 
ATOM   3220 C  C6    . DC  C 3 10  ? 22.876 22.633 23.177  1.00 42.24 ? 10  DC  T C6    1 
ATOM   3221 P  P     . DC  C 3 11  ? 19.905 17.538 20.970  1.00 46.23 ? 11  DC  T P     1 
ATOM   3222 O  OP1   . DC  C 3 11  ? 19.118 16.898 19.892  1.00 45.48 ? 11  DC  T OP1   1 
ATOM   3223 O  OP2   . DC  C 3 11  ? 19.298 17.707 22.309  1.00 45.14 ? 11  DC  T OP2   1 
ATOM   3224 O  "O5'" . DC  C 3 11  ? 21.304 16.764 21.139  1.00 46.27 ? 11  DC  T "O5'" 1 
ATOM   3225 C  "C5'" . DC  C 3 11  ? 22.170 16.671 20.005  1.00 46.78 ? 11  DC  T "C5'" 1 
ATOM   3226 C  "C4'" . DC  C 3 11  ? 23.451 15.972 20.377  1.00 48.48 ? 11  DC  T "C4'" 1 
ATOM   3227 O  "O4'" . DC  C 3 11  ? 24.339 16.867 21.091  1.00 47.75 ? 11  DC  T "O4'" 1 
ATOM   3228 C  "C3'" . DC  C 3 11  ? 23.091 14.848 21.350  1.00 49.57 ? 11  DC  T "C3'" 1 
ATOM   3229 O  "O3'" . DC  C 3 11  ? 23.803 13.663 21.037  1.00 53.75 ? 11  DC  T "O3'" 1 
ATOM   3230 C  "C2'" . DC  C 3 11  ? 23.519 15.383 22.704  1.00 47.91 ? 11  DC  T "C2'" 1 
ATOM   3231 C  "C1'" . DC  C 3 11  ? 24.669 16.312 22.354  1.00 45.74 ? 11  DC  T "C1'" 1 
ATOM   3232 N  N1    . DC  C 3 11  ? 24.852 17.425 23.307  1.00 41.73 ? 11  DC  T N1    1 
ATOM   3233 C  C2    . DC  C 3 11  ? 26.142 17.704 23.787  1.00 40.31 ? 11  DC  T C2    1 
ATOM   3234 O  O2    . DC  C 3 11  ? 27.099 17.028 23.376  1.00 41.23 ? 11  DC  T O2    1 
ATOM   3235 N  N3    . DC  C 3 11  ? 26.313 18.701 24.681  1.00 38.05 ? 11  DC  T N3    1 
ATOM   3236 C  C4    . DC  C 3 11  ? 25.264 19.413 25.094  1.00 37.25 ? 11  DC  T C4    1 
ATOM   3237 N  N4    . DC  C 3 11  ? 25.481 20.381 25.985  1.00 34.19 ? 11  DC  T N4    1 
ATOM   3238 C  C5    . DC  C 3 11  ? 23.944 19.162 24.612  1.00 37.19 ? 11  DC  T C5    1 
ATOM   3239 C  C6    . DC  C 3 11  ? 23.786 18.170 23.728  1.00 38.50 ? 11  DC  T C6    1 
ATOM   3240 P  P     . DT  C 3 12  ? 23.494 12.329 21.860  1.00 57.29 ? 12  DT  T P     1 
ATOM   3241 O  OP1   . DT  C 3 12  ? 23.198 11.274 20.866  1.00 59.99 ? 12  DT  T OP1   1 
ATOM   3242 O  OP2   . DT  C 3 12  ? 22.508 12.633 22.921  1.00 58.59 ? 12  DT  T OP2   1 
ATOM   3243 O  "O5'" . DT  C 3 12  ? 24.901 12.026 22.578  1.00 56.81 ? 12  DT  T "O5'" 1 
ATOM   3244 C  "C5'" . DT  C 3 12  ? 26.100 12.085 21.802  1.00 55.24 ? 12  DT  T "C5'" 1 
ATOM   3245 C  "C4'" . DT  C 3 12  ? 27.307 11.934 22.693  1.00 55.01 ? 12  DT  T "C4'" 1 
ATOM   3246 O  "O4'" . DT  C 3 12  ? 27.494 13.124 23.497  1.00 52.17 ? 12  DT  T "O4'" 1 
ATOM   3247 C  "C3'" . DT  C 3 12  ? 27.043 10.788 23.672  1.00 55.03 ? 12  DT  T "C3'" 1 
ATOM   3248 O  "O3'" . DT  C 3 12  ? 28.238 10.038 23.860  1.00 59.26 ? 12  DT  T "O3'" 1 
ATOM   3249 C  "C2'" . DT  C 3 12  ? 26.646 11.498 24.956  1.00 53.04 ? 12  DT  T "C2'" 1 
ATOM   3250 C  "C1'" . DT  C 3 12  ? 27.452 12.783 24.870  1.00 49.32 ? 12  DT  T "C1'" 1 
ATOM   3251 N  N1    . DT  C 3 12  ? 26.889 13.928 25.600  1.00 45.29 ? 12  DT  T N1    1 
ATOM   3252 C  C2    . DT  C 3 12  ? 27.757 14.682 26.353  1.00 42.43 ? 12  DT  T C2    1 
ATOM   3253 O  O2    . DT  C 3 12  ? 28.951 14.441 26.432  1.00 41.34 ? 12  DT  T O2    1 
ATOM   3254 N  N3    . DT  C 3 12  ? 27.177 15.732 27.017  1.00 39.42 ? 12  DT  T N3    1 
ATOM   3255 C  C4    . DT  C 3 12  ? 25.844 16.091 27.005  1.00 40.42 ? 12  DT  T C4    1 
ATOM   3256 O  O4    . DT  C 3 12  ? 25.467 17.057 27.659  1.00 38.88 ? 12  DT  T O4    1 
ATOM   3257 C  C5    . DT  C 3 12  ? 24.987 15.257 26.190  1.00 41.18 ? 12  DT  T C5    1 
ATOM   3258 C  C7    . DT  C 3 12  ? 23.527 15.570 26.121  1.00 42.54 ? 12  DT  T C7    1 
ATOM   3259 C  C6    . DT  C 3 12  ? 25.546 14.231 25.534  1.00 42.76 ? 12  DT  T C6    1 
ATOM   3260 P  P     . DT  C 3 13  ? 28.183 8.650  24.657  1.00 60.85 ? 13  DT  T P     1 
ATOM   3261 O  OP1   . DT  C 3 13  ? 28.848 7.622  23.827  1.00 61.94 ? 13  DT  T OP1   1 
ATOM   3262 O  OP2   . DT  C 3 13  ? 26.781 8.458  25.093  1.00 60.99 ? 13  DT  T OP2   1 
ATOM   3263 O  "O5'" . DT  C 3 13  ? 29.115 8.946  25.934  1.00 61.19 ? 13  DT  T "O5'" 1 
ATOM   3264 C  "C5'" . DT  C 3 13  ? 30.348 9.635  25.721  1.00 60.15 ? 13  DT  T "C5'" 1 
ATOM   3265 C  "C4'" . DT  C 3 13  ? 30.866 10.248 26.998  1.00 59.88 ? 13  DT  T "C4'" 1 
ATOM   3266 O  "O4'" . DT  C 3 13  ? 30.100 11.414 27.386  1.00 59.23 ? 13  DT  T "O4'" 1 
ATOM   3267 C  "C3'" . DT  C 3 13  ? 30.748 9.248  28.149  1.00 60.01 ? 13  DT  T "C3'" 1 
ATOM   3268 O  "O3'" . DT  C 3 13  ? 31.996 9.185  28.833  1.00 62.24 ? 13  DT  T "O3'" 1 
ATOM   3269 C  "C2'" . DT  C 3 13  ? 29.670 9.844  29.044  1.00 58.59 ? 13  DT  T "C2'" 1 
ATOM   3270 C  "C1'" . DT  C 3 13  ? 29.801 11.330 28.764  1.00 56.68 ? 13  DT  T "C1'" 1 
ATOM   3271 N  N1    . DT  C 3 13  ? 28.598 12.153 29.027  1.00 54.51 ? 13  DT  T N1    1 
ATOM   3272 C  C2    . DT  C 3 13  ? 28.768 13.337 29.724  1.00 53.73 ? 13  DT  T C2    1 
ATOM   3273 O  O2    . DT  C 3 13  ? 29.852 13.722 30.134  1.00 53.02 ? 13  DT  T O2    1 
ATOM   3274 N  N3    . DT  C 3 13  ? 27.613 14.056 29.929  1.00 50.70 ? 13  DT  T N3    1 
ATOM   3275 C  C4    . DT  C 3 13  ? 26.339 13.717 29.530  1.00 50.33 ? 13  DT  T C4    1 
ATOM   3276 O  O4    . DT  C 3 13  ? 25.401 14.460 29.795  1.00 48.23 ? 13  DT  T O4    1 
ATOM   3277 C  C5    . DT  C 3 13  ? 26.230 12.459 28.810  1.00 52.00 ? 13  DT  T C5    1 
ATOM   3278 C  C7    . DT  C 3 13  ? 24.882 12.000 28.350  1.00 50.91 ? 13  DT  T C7    1 
ATOM   3279 C  C6    . DT  C 3 13  ? 27.352 11.755 28.592  1.00 52.37 ? 13  DT  T C6    1 
ATOM   3280 P  P     . DC  C 3 14  ? 32.231 8.074  29.961  1.00 63.68 ? 14  DC  T P     1 
ATOM   3281 O  OP1   . DC  C 3 14  ? 33.560 7.464  29.734  1.00 62.80 ? 14  DC  T OP1   1 
ATOM   3282 O  OP2   . DC  C 3 14  ? 31.029 7.212  30.019  1.00 63.94 ? 14  DC  T OP2   1 
ATOM   3283 O  "O5'" . DC  C 3 14  ? 32.314 8.977  31.289  1.00 62.65 ? 14  DC  T "O5'" 1 
ATOM   3284 C  "C5'" . DC  C 3 14  ? 33.075 10.185 31.232  1.00 62.01 ? 14  DC  T "C5'" 1 
ATOM   3285 C  "C4'" . DC  C 3 14  ? 32.793 11.054 32.431  1.00 61.01 ? 14  DC  T "C4'" 1 
ATOM   3286 O  "O4'" . DC  C 3 14  ? 31.521 11.734 32.292  1.00 58.93 ? 14  DC  T "O4'" 1 
ATOM   3287 C  "C3'" . DC  C 3 14  ? 32.675 10.155 33.664  1.00 61.24 ? 14  DC  T "C3'" 1 
ATOM   3288 O  "O3'" . DC  C 3 14  ? 33.437 10.693 34.742  1.00 62.99 ? 14  DC  T "O3'" 1 
ATOM   3289 C  "C2'" . DC  C 3 14  ? 31.186 10.162 33.979  1.00 59.89 ? 14  DC  T "C2'" 1 
ATOM   3290 C  "C1'" . DC  C 3 14  ? 30.750 11.519 33.456  1.00 57.70 ? 14  DC  T "C1'" 1 
ATOM   3291 N  N1    . DC  C 3 14  ? 29.326 11.640 33.093  1.00 54.56 ? 14  DC  T N1    1 
ATOM   3292 C  C2    . DC  C 3 14  ? 28.610 12.750 33.562  1.00 52.07 ? 14  DC  T C2    1 
ATOM   3293 O  O2    . DC  C 3 14  ? 29.197 13.588 34.259  1.00 50.73 ? 14  DC  T O2    1 
ATOM   3294 N  N3    . DC  C 3 14  ? 27.302 12.880 33.246  1.00 49.07 ? 14  DC  T N3    1 
ATOM   3295 C  C4    . DC  C 3 14  ? 26.704 11.953 32.498  1.00 50.18 ? 14  DC  T C4    1 
ATOM   3296 N  N4    . DC  C 3 14  ? 25.411 12.120 32.223  1.00 49.10 ? 14  DC  T N4    1 
ATOM   3297 C  C5    . DC  C 3 14  ? 27.406 10.811 32.003  1.00 50.82 ? 14  DC  T C5    1 
ATOM   3298 C  C6    . DC  C 3 14  ? 28.706 10.697 32.320  1.00 53.76 ? 14  DC  T C6    1 
ATOM   3299 P  P     . DC  C 3 15  ? 33.743 9.783  36.029  1.00 62.81 ? 15  DC  T P     1 
ATOM   3300 O  OP1   . DC  C 3 15  ? 35.207 9.731  36.243  1.00 64.23 ? 15  DC  T OP1   1 
ATOM   3301 O  OP2   . DC  C 3 15  ? 32.981 8.524  35.868  1.00 63.31 ? 15  DC  T OP2   1 
ATOM   3302 O  "O5'" . DC  C 3 15  ? 33.096 10.660 37.211  1.00 61.75 ? 15  DC  T "O5'" 1 
ATOM   3303 C  "C5'" . DC  C 3 15  ? 31.978 11.488 36.886  1.00 59.26 ? 15  DC  T "C5'" 1 
ATOM   3304 C  "C4'" . DC  C 3 15  ? 31.508 12.262 38.089  1.00 57.54 ? 15  DC  T "C4'" 1 
ATOM   3305 O  "O4'" . DC  C 3 15  ? 30.223 12.826 37.746  1.00 57.36 ? 15  DC  T "O4'" 1 
ATOM   3306 C  "C3'" . DC  C 3 15  ? 31.246 11.272 39.224  1.00 57.91 ? 15  DC  T "C3'" 1 
ATOM   3307 O  "O3'" . DC  C 3 15  ? 31.510 11.873 40.490  1.00 59.64 ? 15  DC  T "O3'" 1 
ATOM   3308 C  "C2'" . DC  C 3 15  ? 29.776 10.935 39.078  1.00 56.59 ? 15  DC  T "C2'" 1 
ATOM   3309 C  "C1'" . DC  C 3 15  ? 29.185 12.196 38.477  1.00 53.84 ? 15  DC  T "C1'" 1 
ATOM   3310 N  N1    . DC  C 3 15  ? 28.084 11.919 37.544  1.00 49.74 ? 15  DC  T N1    1 
ATOM   3311 C  C2    . DC  C 3 15  ? 26.963 12.742 37.571  1.00 47.18 ? 15  DC  T C2    1 
ATOM   3312 O  O2    . DC  C 3 15  ? 26.961 13.719 38.333  1.00 47.10 ? 15  DC  T O2    1 
ATOM   3313 N  N3    . DC  C 3 15  ? 25.915 12.457 36.770  1.00 45.79 ? 15  DC  T N3    1 
ATOM   3314 C  C4    . DC  C 3 15  ? 25.968 11.402 35.954  1.00 46.24 ? 15  DC  T C4    1 
ATOM   3315 N  N4    . DC  C 3 15  ? 24.897 11.133 35.205  1.00 44.56 ? 15  DC  T N4    1 
ATOM   3316 C  C5    . DC  C 3 15  ? 27.119 10.569 35.876  1.00 46.79 ? 15  DC  T C5    1 
ATOM   3317 C  C6    . DC  C 3 15  ? 28.146 10.862 36.680  1.00 47.10 ? 15  DC  T C6    1 
ATOM   3318 P  P     . DC  C 3 16  ? 31.472 10.972 41.823  1.00 60.60 ? 16  DC  T P     1 
ATOM   3319 O  OP1   . DC  C 3 16  ? 32.824 11.010 42.425  1.00 61.94 ? 16  DC  T OP1   1 
ATOM   3320 O  OP2   . DC  C 3 16  ? 30.852 9.666  41.503  1.00 59.20 ? 16  DC  T OP2   1 
ATOM   3321 O  "O5'" . DC  C 3 16  ? 30.477 11.802 42.775  1.00 58.83 ? 16  DC  T "O5'" 1 
ATOM   3322 C  "C5'" . DC  C 3 16  ? 30.366 13.219 42.616  1.00 54.62 ? 16  DC  T "C5'" 1 
ATOM   3323 C  "C4'" . DC  C 3 16  ? 29.005 13.683 43.072  1.00 53.00 ? 16  DC  T "C4'" 1 
ATOM   3324 O  "O4'" . DC  C 3 16  ? 27.998 13.426 42.063  1.00 50.37 ? 16  DC  T "O4'" 1 
ATOM   3325 C  "C3'" . DC  C 3 16  ? 28.604 12.863 44.301  1.00 53.70 ? 16  DC  T "C3'" 1 
ATOM   3326 O  "O3'" . DC  C 3 16  ? 28.030 13.710 45.295  1.00 57.71 ? 16  DC  T "O3'" 1 
ATOM   3327 C  "C2'" . DC  C 3 16  ? 27.574 11.882 43.764  1.00 50.96 ? 16  DC  T "C2'" 1 
ATOM   3328 C  "C1'" . DC  C 3 16  ? 26.934 12.680 42.640  1.00 50.35 ? 16  DC  T "C1'" 1 
ATOM   3329 N  N1    . DC  C 3 16  ? 26.307 11.878 41.571  1.00 46.51 ? 16  DC  T N1    1 
ATOM   3330 C  C2    . DC  C 3 16  ? 25.010 12.205 41.150  1.00 45.21 ? 16  DC  T C2    1 
ATOM   3331 O  O2    . DC  C 3 16  ? 24.419 13.154 41.696  1.00 44.55 ? 16  DC  T O2    1 
ATOM   3332 N  N3    . DC  C 3 16  ? 24.435 11.480 40.159  1.00 42.25 ? 16  DC  T N3    1 
ATOM   3333 C  C4    . DC  C 3 16  ? 25.105 10.475 39.593  1.00 40.37 ? 16  DC  T C4    1 
ATOM   3334 N  N4    . DC  C 3 16  ? 24.509 9.801  38.607  1.00 38.74 ? 16  DC  T N4    1 
ATOM   3335 C  C5    . DC  C 3 16  ? 26.417 10.118 40.009  1.00 42.13 ? 16  DC  T C5    1 
ATOM   3336 C  C6    . DC  C 3 16  ? 26.975 10.837 40.992  1.00 44.24 ? 16  DC  T C6    1 
ATOM   3337 P  P     . DC  C 3 17  ? 27.555 13.077 46.690  1.00 61.10 ? 17  DC  T P     1 
ATOM   3338 O  OP1   . DC  C 3 17  ? 27.567 14.165 47.692  1.00 60.93 ? 17  DC  T OP1   1 
ATOM   3339 O  OP2   . DC  C 3 17  ? 28.344 11.848 46.934  1.00 58.91 ? 17  DC  T OP2   1 
ATOM   3340 O  "O5'" . DC  C 3 17  ? 26.033 12.654 46.378  1.00 61.41 ? 17  DC  T "O5'" 1 
ATOM   3341 C  "C5'" . DC  C 3 17  ? 25.110 13.646 45.922  1.00 60.89 ? 17  DC  T "C5'" 1 
ATOM   3342 C  "C4'" . DC  C 3 17  ? 23.707 13.090 45.874  1.00 60.48 ? 17  DC  T "C4'" 1 
ATOM   3343 O  "O4'" . DC  C 3 17  ? 23.466 12.315 44.670  1.00 59.29 ? 17  DC  T "O4'" 1 
ATOM   3344 C  "C3'" . DC  C 3 17  ? 23.538 12.123 47.047  1.00 61.15 ? 17  DC  T "C3'" 1 
ATOM   3345 O  "O3'" . DC  C 3 17  ? 22.265 12.304 47.664  1.00 62.81 ? 17  DC  T "O3'" 1 
ATOM   3346 C  "C2'" . DC  C 3 17  ? 23.613 10.753 46.392  1.00 59.57 ? 17  DC  T "C2'" 1 
ATOM   3347 C  "C1'" . DC  C 3 17  ? 22.987 11.031 45.038  1.00 56.88 ? 17  DC  T "C1'" 1 
ATOM   3348 N  N1    . DC  C 3 17  ? 23.320 10.074 43.963  1.00 52.36 ? 17  DC  T N1    1 
ATOM   3349 C  C2    . DC  C 3 17  ? 22.386 9.867  42.942  1.00 49.83 ? 17  DC  T C2    1 
ATOM   3350 O  O2    . DC  C 3 17  ? 21.322 10.497 42.966  1.00 50.94 ? 17  DC  T O2    1 
ATOM   3351 N  N3    . DC  C 3 17  ? 22.662 8.986  41.959  1.00 47.45 ? 17  DC  T N3    1 
ATOM   3352 C  C4    . DC  C 3 17  ? 23.814 8.319  41.967  1.00 46.65 ? 17  DC  T C4    1 
ATOM   3353 N  N4    . DC  C 3 17  ? 24.038 7.452  40.975  1.00 43.21 ? 17  DC  T N4    1 
ATOM   3354 C  C5    . DC  C 3 17  ? 24.789 8.509  42.991  1.00 47.26 ? 17  DC  T C5    1 
ATOM   3355 C  C6    . DC  C 3 17  ? 24.504 9.391  43.960  1.00 49.14 ? 17  DC  T C6    1 
ATOM   3356 P  P     . DC  C 3 18  ? 22.053 11.847 49.187  1.00 62.10 ? 18  DC  T P     1 
ATOM   3357 O  OP1   . DC  C 3 18  ? 22.074 13.086 49.998  1.00 63.29 ? 18  DC  T OP1   1 
ATOM   3358 O  OP2   . DC  C 3 18  ? 23.004 10.754 49.490  1.00 63.00 ? 18  DC  T OP2   1 
ATOM   3359 O  "O5'" . DC  C 3 18  ? 20.570 11.222 49.178  1.00 58.90 ? 18  DC  T "O5'" 1 
ATOM   3360 C  "C5'" . DC  C 3 18  ? 19.480 12.024 48.717  1.00 53.04 ? 18  DC  T "C5'" 1 
ATOM   3361 C  "C4'" . DC  C 3 18  ? 18.368 11.155 48.184  1.00 48.82 ? 18  DC  T "C4'" 1 
ATOM   3362 O  "O4'" . DC  C 3 18  ? 18.799 10.503 46.965  1.00 46.06 ? 18  DC  T "O4'" 1 
ATOM   3363 C  "C3'" . DC  C 3 18  ? 18.068 10.044 49.194  1.00 47.52 ? 18  DC  T "C3'" 1 
ATOM   3364 O  "O3'" . DC  C 3 18  ? 16.675 9.978  49.540  1.00 48.02 ? 18  DC  T "O3'" 1 
ATOM   3365 C  "C2'" . DC  C 3 18  ? 18.580 8.785  48.515  1.00 45.93 ? 18  DC  T "C2'" 1 
ATOM   3366 C  "C1'" . DC  C 3 18  ? 18.469 9.133  47.041  1.00 44.19 ? 18  DC  T "C1'" 1 
ATOM   3367 N  N1    . DC  C 3 18  ? 19.381 8.388  46.153  1.00 40.97 ? 18  DC  T N1    1 
ATOM   3368 C  C2    . DC  C 3 18  ? 18.886 7.903  44.937  1.00 39.04 ? 18  DC  T C2    1 
ATOM   3369 O  O2    . DC  C 3 18  ? 17.711 8.143  44.632  1.00 38.72 ? 18  DC  T O2    1 
ATOM   3370 N  N3    . DC  C 3 18  ? 19.699 7.183  44.131  1.00 34.93 ? 18  DC  T N3    1 
ATOM   3371 C  C4    . DC  C 3 18  ? 20.956 6.937  44.503  1.00 35.45 ? 18  DC  T C4    1 
ATOM   3372 N  N4    . DC  C 3 18  ? 21.708 6.186  43.699  1.00 34.96 ? 18  DC  T N4    1 
ATOM   3373 C  C5    . DC  C 3 18  ? 21.494 7.440  45.723  1.00 35.84 ? 18  DC  T C5    1 
ATOM   3374 C  C6    . DC  C 3 18  ? 20.681 8.154  46.509  1.00 38.45 ? 18  DC  T C6    1 
HETATM 3375 P  PG    . DGT D 4 .   ? 23.807 39.772 2.513   1.00 31.85 ? 401 DGT A PG    1 
HETATM 3376 O  O1G   . DGT D 4 .   ? 23.263 40.905 1.731   1.00 29.50 ? 401 DGT A O1G   1 
HETATM 3377 O  O2G   . DGT D 4 .   ? 22.890 39.435 3.790   1.00 28.35 ? 401 DGT A O2G   1 
HETATM 3378 O  O3G   . DGT D 4 .   ? 23.839 38.404 1.667   1.00 30.10 ? 401 DGT A O3G   1 
HETATM 3379 O  O3B   . DGT D 4 .   ? 25.329 40.003 2.997   1.00 29.68 ? 401 DGT A O3B   1 
HETATM 3380 P  PB    . DGT D 4 .   ? 25.792 40.204 4.528   1.00 26.24 ? 401 DGT A PB    1 
HETATM 3381 O  O1B   . DGT D 4 .   ? 24.786 41.012 5.249   1.00 27.25 ? 401 DGT A O1B   1 
HETATM 3382 O  O2B   . DGT D 4 .   ? 27.171 40.741 4.480   1.00 24.95 ? 401 DGT A O2B   1 
HETATM 3383 O  O3A   . DGT D 4 .   ? 25.889 38.689 5.071   1.00 26.27 ? 401 DGT A O3A   1 
HETATM 3384 P  PA    . DGT D 4 .   ? 25.012 37.971 6.219   1.00 26.42 ? 401 DGT A PA    1 
HETATM 3385 O  O1A   . DGT D 4 .   ? 23.723 38.794 6.717   1.00 21.83 ? 401 DGT A O1A   1 
HETATM 3386 O  O2A   . DGT D 4 .   ? 25.133 36.515 6.449   1.00 29.53 ? 401 DGT A O2A   1 
HETATM 3387 O  "O5'" . DGT D 4 .   ? 25.961 38.464 7.423   1.00 21.92 ? 401 DGT A "O5'" 1 
HETATM 3388 C  "C5'" . DGT D 4 .   ? 25.806 39.730 8.070   1.00 23.44 ? 401 DGT A "C5'" 1 
HETATM 3389 C  "C4'" . DGT D 4 .   ? 27.149 40.240 8.598   1.00 21.50 ? 401 DGT A "C4'" 1 
HETATM 3390 O  "O4'" . DGT D 4 .   ? 27.788 39.280 9.459   1.00 24.15 ? 401 DGT A "O4'" 1 
HETATM 3391 C  "C3'" . DGT D 4 .   ? 28.140 40.441 7.450   1.00 23.44 ? 401 DGT A "C3'" 1 
HETATM 3392 O  "O3'" . DGT D 4 .   ? 27.908 41.718 6.852   1.00 18.05 ? 401 DGT A "O3'" 1 
HETATM 3393 C  "C2'" . DGT D 4 .   ? 29.431 40.500 8.264   1.00 21.84 ? 401 DGT A "C2'" 1 
HETATM 3394 C  "C1'" . DGT D 4 .   ? 29.212 39.341 9.241   1.00 23.07 ? 401 DGT A "C1'" 1 
HETATM 3395 N  N9    . DGT D 4 .   ? 29.674 38.048 8.679   1.00 25.32 ? 401 DGT A N9    1 
HETATM 3396 C  C8    . DGT D 4 .   ? 28.974 37.230 7.896   1.00 25.25 ? 401 DGT A C8    1 
HETATM 3397 N  N7    . DGT D 4 .   ? 29.701 36.151 7.615   1.00 27.39 ? 401 DGT A N7    1 
HETATM 3398 C  C5    . DGT D 4 .   ? 30.879 36.278 8.220   1.00 23.91 ? 401 DGT A C5    1 
HETATM 3399 C  C6    . DGT D 4 .   ? 32.016 35.479 8.280   1.00 27.52 ? 401 DGT A C6    1 
HETATM 3400 O  O6    . DGT D 4 .   ? 32.046 34.382 7.723   1.00 28.98 ? 401 DGT A O6    1 
HETATM 3401 N  N1    . DGT D 4 .   ? 33.118 35.924 9.021   1.00 24.51 ? 401 DGT A N1    1 
HETATM 3402 C  C2    . DGT D 4 .   ? 33.046 37.153 9.689   1.00 25.09 ? 401 DGT A C2    1 
HETATM 3403 N  N2    . DGT D 4 .   ? 34.069 37.572 10.427  1.00 22.88 ? 401 DGT A N2    1 
HETATM 3404 N  N3    . DGT D 4 .   ? 31.929 37.892 9.607   1.00 24.41 ? 401 DGT A N3    1 
HETATM 3405 C  C4    . DGT D 4 .   ? 30.862 37.491 8.899   1.00 25.47 ? 401 DGT A C4    1 
HETATM 3406 CA CA    . CA  E 5 .   ? 21.829 37.892 8.333   1.00 40.69 ? 402 CA  A CA    1 
HETATM 3407 CA CA    . CA  F 5 .   ? 22.564 40.608 5.757   1.00 23.56 ? 403 CA  A CA    1 
HETATM 3408 CA CA    . CA  G 5 .   ? 22.231 24.940 4.681   1.00 43.33 ? 404 CA  A CA    1 
HETATM 3409 O  O     . HOH H 6 .   ? 12.099 12.296 22.154  1.00 63.14 ? 501 HOH A O     1 
HETATM 3410 O  O     . HOH H 6 .   ? 33.190 31.621 41.218  1.00 54.73 ? 502 HOH A O     1 
HETATM 3411 O  O     . HOH H 6 .   ? 7.883  31.753 14.968  1.00 35.65 ? 503 HOH A O     1 
HETATM 3412 O  O     . HOH H 6 .   ? 17.923 34.192 12.284  1.00 41.79 ? 504 HOH A O     1 
HETATM 3413 O  O     . HOH H 6 .   ? 23.045 51.923 0.897   1.00 33.85 ? 505 HOH A O     1 
HETATM 3414 O  O     . HOH H 6 .   ? 35.672 49.796 15.377  1.00 34.32 ? 506 HOH A O     1 
HETATM 3415 O  O     . HOH H 6 .   ? 4.654  31.706 14.354  1.00 51.24 ? 507 HOH A O     1 
HETATM 3416 O  O     . HOH H 6 .   ? 13.897 12.860 -1.150  1.00 51.17 ? 508 HOH A O     1 
HETATM 3417 O  O     . HOH H 6 .   ? 43.963 31.297 12.236  1.00 49.30 ? 509 HOH A O     1 
HETATM 3418 O  O     . HOH H 6 .   ? 23.339 56.431 8.817   1.00 31.12 ? 510 HOH A O     1 
HETATM 3419 O  O     . HOH H 6 .   ? 31.445 32.533 6.224   1.00 45.18 ? 511 HOH A O     1 
HETATM 3420 O  O     . HOH H 6 .   ? 43.380 44.473 23.215  1.00 52.86 ? 512 HOH A O     1 
HETATM 3421 O  O     . HOH H 6 .   ? 6.906  25.386 17.176  1.00 43.95 ? 513 HOH A O     1 
HETATM 3422 O  O     . HOH H 6 .   ? 3.779  26.487 9.313   1.00 45.28 ? 514 HOH A O     1 
HETATM 3423 O  O     . HOH H 6 .   ? 24.923 56.845 1.041   1.00 45.24 ? 515 HOH A O     1 
HETATM 3424 O  O     . HOH H 6 .   ? 44.556 35.573 3.442   1.00 23.46 ? 516 HOH A O     1 
HETATM 3425 O  O     . HOH H 6 .   ? 11.435 21.039 1.957   1.00 53.17 ? 517 HOH A O     1 
HETATM 3426 O  O     . HOH H 6 .   ? 1.143  39.901 19.102  1.00 49.01 ? 518 HOH A O     1 
HETATM 3427 O  O     . HOH H 6 .   ? 18.682 35.362 6.399   1.00 46.52 ? 519 HOH A O     1 
HETATM 3428 O  O     . HOH H 6 .   ? 2.355  32.072 5.428   1.00 48.83 ? 520 HOH A O     1 
HETATM 3429 O  O     . HOH H 6 .   ? 26.270 39.752 35.946  1.00 47.63 ? 521 HOH A O     1 
HETATM 3430 O  O     . HOH H 6 .   ? 34.022 53.919 4.909   1.00 30.19 ? 522 HOH A O     1 
HETATM 3431 O  O     . HOH H 6 .   ? 39.255 44.459 11.372  1.00 52.20 ? 523 HOH A O     1 
HETATM 3432 O  O     . HOH H 6 .   ? 15.452 50.007 -0.197  1.00 40.82 ? 524 HOH A O     1 
HETATM 3433 O  O     . HOH H 6 .   ? 39.998 32.282 15.455  1.00 52.55 ? 525 HOH A O     1 
HETATM 3434 O  O     . HOH H 6 .   ? 43.171 16.633 23.325  1.00 59.58 ? 526 HOH A O     1 
HETATM 3435 O  O     . HOH H 6 .   ? 22.430 45.126 16.951  1.00 36.33 ? 527 HOH A O     1 
HETATM 3436 O  O     . HOH H 6 .   ? 32.914 30.137 29.601  1.00 40.84 ? 528 HOH A O     1 
HETATM 3437 O  O     . HOH H 6 .   ? 9.958  5.850  16.288  1.00 51.17 ? 529 HOH A O     1 
HETATM 3438 O  O     . HOH H 6 .   ? 0.318  26.610 5.080   1.00 46.09 ? 530 HOH A O     1 
HETATM 3439 O  O     . HOH H 6 .   ? 23.580 16.952 12.743  1.00 40.05 ? 531 HOH A O     1 
HETATM 3440 O  O     . HOH H 6 .   ? 28.848 28.238 30.706  1.00 51.92 ? 532 HOH A O     1 
HETATM 3441 O  O     . HOH H 6 .   ? 39.536 16.204 18.168  1.00 62.44 ? 533 HOH A O     1 
HETATM 3442 O  O     . HOH H 6 .   ? 28.617 42.531 27.895  1.00 60.31 ? 534 HOH A O     1 
HETATM 3443 O  O     . HOH H 6 .   ? 48.373 31.507 10.280  1.00 57.08 ? 535 HOH A O     1 
HETATM 3444 O  O     . HOH H 6 .   ? 14.501 31.329 11.593  1.00 44.12 ? 536 HOH A O     1 
HETATM 3445 O  O     . HOH H 6 .   ? 19.018 54.918 18.808  1.00 52.20 ? 537 HOH A O     1 
HETATM 3446 O  O     . HOH H 6 .   ? 3.446  33.375 -0.946  1.00 45.71 ? 538 HOH A O     1 
HETATM 3447 O  O     . HOH H 6 .   ? 26.155 58.394 3.074   1.00 38.51 ? 539 HOH A O     1 
HETATM 3448 O  O     . HOH H 6 .   ? 36.755 35.650 42.055  1.00 27.16 ? 540 HOH A O     1 
HETATM 3449 O  O     . HOH H 6 .   ? 42.196 29.809 40.484  1.00 50.29 ? 541 HOH A O     1 
HETATM 3450 O  O     . HOH H 6 .   ? 43.585 46.882 -4.021  1.00 40.10 ? 542 HOH A O     1 
HETATM 3451 O  O     . HOH H 6 .   ? 29.732 35.157 -8.833  1.00 60.26 ? 543 HOH A O     1 
HETATM 3452 O  O     . HOH H 6 .   ? 28.233 49.708 -4.135  1.00 43.47 ? 544 HOH A O     1 
HETATM 3453 O  O     . HOH H 6 .   ? 33.557 60.298 0.527   1.00 35.93 ? 545 HOH A O     1 
HETATM 3454 O  O     . HOH H 6 .   ? 45.671 37.730 -9.988  1.00 59.38 ? 546 HOH A O     1 
HETATM 3455 O  O     . HOH H 6 .   ? 21.249 36.173 7.194   1.00 32.83 ? 547 HOH A O     1 
HETATM 3456 O  O     . HOH H 6 .   ? 38.825 22.192 33.257  1.00 47.71 ? 548 HOH A O     1 
HETATM 3457 O  O     . HOH H 6 .   ? 31.420 39.458 12.450  1.00 35.96 ? 549 HOH A O     1 
HETATM 3458 O  O     . HOH H 6 .   ? 13.268 21.272 18.438  1.00 33.90 ? 550 HOH A O     1 
HETATM 3459 O  O     . HOH H 6 .   ? 37.495 50.060 7.724   1.00 30.10 ? 551 HOH A O     1 
HETATM 3460 O  O     . HOH H 6 .   ? 45.861 43.770 -4.302  1.00 46.71 ? 552 HOH A O     1 
HETATM 3461 O  O     . HOH H 6 .   ? 8.314  54.962 5.728   1.00 36.42 ? 553 HOH A O     1 
HETATM 3462 O  O     . HOH H 6 .   ? 12.921 29.985 18.445  1.00 45.80 ? 554 HOH A O     1 
HETATM 3463 O  O     . HOH H 6 .   ? 42.172 48.782 -0.753  1.00 36.54 ? 555 HOH A O     1 
HETATM 3464 O  O     . HOH H 6 .   ? 38.210 17.981 17.347  1.00 64.46 ? 556 HOH A O     1 
HETATM 3465 O  O     . HOH H 6 .   ? 30.061 33.178 1.852   1.00 51.87 ? 557 HOH A O     1 
HETATM 3466 O  O     . HOH H 6 .   ? 46.911 37.617 -3.349  1.00 36.86 ? 558 HOH A O     1 
HETATM 3467 O  O     . HOH H 6 .   ? 17.127 54.995 15.695  1.00 37.99 ? 559 HOH A O     1 
HETATM 3468 O  O     . HOH H 6 .   ? 45.036 45.644 2.138   1.00 49.71 ? 560 HOH A O     1 
HETATM 3469 O  O     . HOH H 6 .   ? 2.097  42.100 17.535  1.00 42.90 ? 561 HOH A O     1 
HETATM 3470 O  O     . HOH H 6 .   ? -0.029 48.222 7.433   1.00 45.57 ? 562 HOH A O     1 
HETATM 3471 O  O     . HOH H 6 .   ? 36.690 54.368 3.621   1.00 36.09 ? 563 HOH A O     1 
HETATM 3472 O  O     . HOH H 6 .   ? 49.163 40.787 27.693  1.00 43.28 ? 564 HOH A O     1 
HETATM 3473 O  O     . HOH H 6 .   ? 30.068 35.348 -4.662  1.00 38.95 ? 565 HOH A O     1 
HETATM 3474 O  O     . HOH H 6 .   ? 15.939 49.777 3.572   1.00 27.48 ? 566 HOH A O     1 
HETATM 3475 O  O     . HOH H 6 .   ? 36.389 45.230 14.555  1.00 33.94 ? 567 HOH A O     1 
HETATM 3476 O  O     . HOH H 6 .   ? 35.816 22.728 28.089  1.00 51.79 ? 568 HOH A O     1 
HETATM 3477 O  O     . HOH H 6 .   ? 16.253 40.533 21.127  1.00 38.95 ? 569 HOH A O     1 
HETATM 3478 O  O     . HOH H 6 .   ? 31.594 24.011 31.569  1.00 53.40 ? 570 HOH A O     1 
HETATM 3479 O  O     . HOH H 6 .   ? 15.614 48.717 1.696   1.00 29.48 ? 571 HOH A O     1 
HETATM 3480 O  O     . HOH H 6 .   ? 41.623 24.299 37.719  1.00 58.99 ? 572 HOH A O     1 
HETATM 3481 O  O     . HOH H 6 .   ? 47.479 14.605 22.325  1.00 71.91 ? 573 HOH A O     1 
HETATM 3482 O  O     . HOH H 6 .   ? -1.388 48.514 4.654   1.00 47.55 ? 574 HOH A O     1 
HETATM 3483 O  O     . HOH H 6 .   ? 12.708 53.065 19.742  1.00 52.31 ? 575 HOH A O     1 
HETATM 3484 O  O     . HOH H 6 .   ? 27.330 38.257 23.805  1.00 55.56 ? 576 HOH A O     1 
HETATM 3485 O  O     . HOH H 6 .   ? 22.625 37.332 -1.195  1.00 39.95 ? 577 HOH A O     1 
HETATM 3486 O  O     . HOH H 6 .   ? 40.186 44.432 -9.427  1.00 32.35 ? 578 HOH A O     1 
HETATM 3487 O  O     . HOH H 6 .   ? 47.167 40.206 8.288   1.00 37.81 ? 579 HOH A O     1 
HETATM 3488 O  O     . HOH H 6 .   ? 18.952 48.507 20.145  1.00 37.65 ? 580 HOH A O     1 
HETATM 3489 O  O     . HOH H 6 .   ? 20.019 40.908 3.287   1.00 38.14 ? 581 HOH A O     1 
HETATM 3490 O  O     . HOH H 6 .   ? 15.342 24.029 -3.488  1.00 50.14 ? 582 HOH A O     1 
HETATM 3491 O  O     . HOH H 6 .   ? 48.755 38.873 -1.359  1.00 46.53 ? 583 HOH A O     1 
HETATM 3492 O  O     . HOH H 6 .   ? 25.452 52.781 -0.339  1.00 41.74 ? 584 HOH A O     1 
HETATM 3493 O  O     . HOH H 6 .   ? 27.502 13.900 8.190   1.00 55.77 ? 585 HOH A O     1 
HETATM 3494 O  O     . HOH H 6 .   ? 16.993 29.704 2.593   1.00 43.73 ? 586 HOH A O     1 
HETATM 3495 O  O     . HOH H 6 .   ? 25.008 33.951 31.106  1.00 41.95 ? 587 HOH A O     1 
HETATM 3496 O  O     . HOH H 6 .   ? 19.578 16.557 2.325   1.00 41.95 ? 588 HOH A O     1 
HETATM 3497 O  O     . HOH H 6 .   ? 25.796 30.852 29.896  1.00 47.37 ? 589 HOH A O     1 
HETATM 3498 O  O     . HOH H 6 .   ? 26.222 46.270 -3.222  1.00 36.34 ? 590 HOH A O     1 
HETATM 3499 O  O     . HOH H 6 .   ? 14.783 31.859 15.630  1.00 39.41 ? 591 HOH A O     1 
HETATM 3500 O  O     . HOH H 6 .   ? 52.691 31.153 35.590  1.00 44.02 ? 592 HOH A O     1 
HETATM 3501 O  O     . HOH H 6 .   ? 29.474 38.005 1.373   1.00 37.21 ? 593 HOH A O     1 
HETATM 3502 O  O     . HOH H 6 .   ? 23.491 22.827 4.141   1.00 46.52 ? 594 HOH A O     1 
HETATM 3503 O  O     . HOH H 6 .   ? 15.822 27.994 13.577  1.00 48.77 ? 595 HOH A O     1 
HETATM 3504 O  O     . HOH H 6 .   ? 19.758 50.839 21.833  1.00 48.14 ? 596 HOH A O     1 
HETATM 3505 O  O     . HOH H 6 .   ? 24.975 36.626 -2.105  1.00 36.31 ? 597 HOH A O     1 
HETATM 3506 O  O     . HOH H 6 .   ? 48.065 42.407 6.532   1.00 51.45 ? 598 HOH A O     1 
HETATM 3507 O  O     . HOH H 6 .   ? 5.926  25.076 9.568   1.00 35.92 ? 599 HOH A O     1 
HETATM 3508 O  O     . HOH H 6 .   ? 26.144 49.163 20.146  1.00 55.42 ? 600 HOH A O     1 
HETATM 3509 O  O     . HOH H 6 .   ? 41.249 43.559 10.753  1.00 38.74 ? 601 HOH A O     1 
HETATM 3510 O  O     . HOH H 6 .   ? -1.217 32.251 10.226  1.00 57.37 ? 602 HOH A O     1 
HETATM 3511 O  O     . HOH H 6 .   ? 40.010 48.187 12.385  1.00 43.48 ? 603 HOH A O     1 
HETATM 3512 O  O     . HOH H 6 .   ? 24.151 53.201 19.044  1.00 44.71 ? 604 HOH A O     1 
HETATM 3513 O  O     . HOH H 6 .   ? 42.071 34.059 43.098  1.00 42.08 ? 605 HOH A O     1 
HETATM 3514 O  O     . HOH H 6 .   ? 22.124 49.119 -2.046  1.00 54.17 ? 606 HOH A O     1 
HETATM 3515 O  O     . HOH H 6 .   ? 22.799 42.977 17.594  1.00 43.83 ? 607 HOH A O     1 
HETATM 3516 O  O     . HOH H 6 .   ? 21.129 46.158 19.318  1.00 44.20 ? 608 HOH A O     1 
HETATM 3517 O  O     . HOH H 6 .   ? 33.645 40.397 14.971  1.00 51.98 ? 609 HOH A O     1 
HETATM 3518 O  O     . HOH H 6 .   ? 26.079 40.009 -7.073  1.00 40.80 ? 610 HOH A O     1 
HETATM 3519 O  O     . HOH H 6 .   ? 22.935 35.558 30.801  1.00 45.04 ? 611 HOH A O     1 
HETATM 3520 O  O     . HOH H 6 .   ? 24.945 58.344 -1.387  1.00 66.03 ? 612 HOH A O     1 
HETATM 3521 O  O     . HOH H 6 .   ? 16.564 41.418 -6.049  1.00 47.64 ? 613 HOH A O     1 
HETATM 3522 O  O     . HOH H 6 .   ? 14.085 30.841 13.740  1.00 49.31 ? 614 HOH A O     1 
HETATM 3523 O  O     . HOH H 6 .   ? 11.988 42.028 -4.201  1.00 39.16 ? 615 HOH A O     1 
HETATM 3524 O  O     . HOH H 6 .   ? 17.609 57.975 1.213   1.00 46.48 ? 616 HOH A O     1 
HETATM 3525 O  O     . HOH H 6 .   ? 34.984 56.506 6.933   1.00 46.59 ? 617 HOH A O     1 
HETATM 3526 O  O     . HOH H 6 .   ? 48.342 45.618 1.613   1.00 61.56 ? 618 HOH A O     1 
HETATM 3527 O  O     . HOH H 6 .   ? 38.947 29.151 3.802   1.00 52.39 ? 619 HOH A O     1 
HETATM 3528 O  O     . HOH H 6 .   ? 25.716 52.291 20.262  1.00 59.57 ? 620 HOH A O     1 
HETATM 3529 O  O     . HOH H 6 .   ? 21.925 27.114 3.050   1.00 38.29 ? 621 HOH A O     1 
HETATM 3530 O  O     . HOH H 6 .   ? 31.489 31.349 -5.981  1.00 47.52 ? 622 HOH A O     1 
HETATM 3531 O  O     . HOH H 6 .   ? -3.253 38.373 12.231  1.00 36.55 ? 623 HOH A O     1 
HETATM 3532 O  O     . HOH H 6 .   ? 17.651 23.813 14.977  1.00 49.88 ? 624 HOH A O     1 
HETATM 3533 O  O     . HOH H 6 .   ? 38.349 45.608 -9.228  1.00 41.96 ? 625 HOH A O     1 
HETATM 3534 O  O     . HOH H 6 .   ? 27.557 35.616 -9.072  1.00 43.03 ? 626 HOH A O     1 
HETATM 3535 O  O     . HOH H 6 .   ? 2.407  50.692 -1.834  1.00 49.49 ? 627 HOH A O     1 
HETATM 3536 O  O     . HOH H 6 .   ? 17.094 30.488 12.103  1.00 51.82 ? 628 HOH A O     1 
HETATM 3537 O  O     . HOH H 6 .   ? 38.910 54.074 1.107   1.00 43.27 ? 629 HOH A O     1 
HETATM 3538 O  O     . HOH H 6 .   ? 39.193 52.136 8.111   1.00 49.61 ? 630 HOH A O     1 
HETATM 3539 O  O     . HOH H 6 .   ? 29.385 15.505 6.084   1.00 58.21 ? 631 HOH A O     1 
HETATM 3540 O  O     . HOH H 6 .   ? 22.054 52.990 20.352  1.00 49.07 ? 632 HOH A O     1 
HETATM 3541 O  O     . HOH H 6 .   ? 23.607 24.938 2.271   1.00 47.74 ? 633 HOH A O     1 
HETATM 3542 O  O     . HOH H 6 .   ? 39.639 42.781 12.846  1.00 42.48 ? 634 HOH A O     1 
HETATM 3543 O  O     . HOH H 6 .   ? 17.112 22.712 16.369  1.00 48.91 ? 635 HOH A O     1 
HETATM 3544 O  O     . HOH H 6 .   ? 54.027 36.651 3.030   1.00 54.98 ? 636 HOH A O     1 
HETATM 3545 O  O     . HOH H 6 .   ? 36.970 43.307 40.377  1.00 51.79 ? 637 HOH A O     1 
HETATM 3546 O  O     . HOH H 6 .   ? 38.175 54.738 5.139   1.00 58.47 ? 638 HOH A O     1 
HETATM 3547 O  O     . HOH H 6 .   ? 23.605 23.973 -0.274  1.00 49.02 ? 639 HOH A O     1 
HETATM 3548 O  O     . HOH H 6 .   ? 38.739 30.273 -1.628  1.00 41.24 ? 640 HOH A O     1 
HETATM 3549 O  O     . HOH H 6 .   ? 40.289 50.740 11.192  1.00 65.80 ? 641 HOH A O     1 
HETATM 3550 O  O     . HOH H 6 .   ? 40.994 51.844 6.203   1.00 56.97 ? 642 HOH A O     1 
HETATM 3551 O  O     . HOH H 6 .   ? 21.044 33.864 30.582  1.00 50.69 ? 643 HOH A O     1 
HETATM 3552 O  O     . HOH H 6 .   ? 18.648 56.542 -0.982  1.00 52.70 ? 644 HOH A O     1 
HETATM 3553 O  O     . HOH I 6 .   ? 17.213 23.862 38.778  1.00 62.15 ? 101 HOH P O     1 
HETATM 3554 O  O     . HOH I 6 .   ? 36.254 21.953 23.562  1.00 50.45 ? 102 HOH P O     1 
HETATM 3555 O  O     . HOH I 6 .   ? 21.359 12.559 33.277  1.00 61.07 ? 103 HOH P O     1 
HETATM 3556 O  O     . HOH I 6 .   ? 20.795 5.512  35.373  1.00 47.01 ? 104 HOH P O     1 
HETATM 3557 O  O     . HOH I 6 .   ? 41.101 17.788 24.436  1.00 62.92 ? 105 HOH P O     1 
HETATM 3558 O  O     . HOH I 6 .   ? 14.503 16.882 40.819  1.00 52.79 ? 106 HOH P O     1 
HETATM 3559 O  O     . HOH I 6 .   ? 24.277 26.043 5.861   1.00 35.92 ? 107 HOH P O     1 
HETATM 3560 O  O     . HOH I 6 .   ? 20.180 10.049 34.828  1.00 56.80 ? 108 HOH P O     1 
HETATM 3561 O  O     . HOH I 6 .   ? 20.689 26.426 6.034   1.00 35.32 ? 109 HOH P O     1 
HETATM 3562 O  O     . HOH I 6 .   ? 32.960 15.940 24.797  1.00 57.71 ? 110 HOH P O     1 
HETATM 3563 O  O     . HOH I 6 .   ? 25.039 34.968 14.389  1.00 52.05 ? 111 HOH P O     1 
HETATM 3564 O  O     . HOH I 6 .   ? 31.539 24.794 25.533  1.00 48.22 ? 112 HOH P O     1 
HETATM 3565 O  O     . HOH I 6 .   ? 36.638 22.514 36.649  1.00 62.38 ? 113 HOH P O     1 
HETATM 3566 O  O     . HOH I 6 .   ? 16.995 11.436 43.106  1.00 55.87 ? 114 HOH P O     1 
HETATM 3567 O  O     . HOH I 6 .   ? 14.105 4.896  40.327  1.00 47.81 ? 115 HOH P O     1 
HETATM 3568 O  O     . HOH I 6 .   ? 23.996 23.713 33.415  1.00 52.23 ? 116 HOH P O     1 
HETATM 3569 O  O     . HOH I 6 .   ? 29.123 13.322 11.072  1.00 50.80 ? 117 HOH P O     1 
HETATM 3570 O  O     . HOH I 6 .   ? 19.917 30.124 8.256   1.00 38.13 ? 118 HOH P O     1 
HETATM 3571 O  O     . HOH I 6 .   ? 18.247 12.924 32.478  1.00 57.77 ? 119 HOH P O     1 
HETATM 3572 O  O     . HOH I 6 .   ? 31.425 21.182 12.686  1.00 39.77 ? 120 HOH P O     1 
HETATM 3573 O  O     . HOH J 6 .   ? 27.012 30.805 24.858  1.00 44.12 ? 101 HOH T O     1 
HETATM 3574 O  O     . HOH J 6 .   ? 31.300 13.680 26.257  1.00 51.73 ? 102 HOH T O     1 
HETATM 3575 O  O     . HOH J 6 .   ? 46.093 30.527 8.290   1.00 55.68 ? 103 HOH T O     1 
HETATM 3576 O  O     . HOH J 6 .   ? 26.339 6.434  40.512  1.00 37.27 ? 104 HOH T O     1 
HETATM 3577 O  O     . HOH J 6 .   ? 19.224 17.684 17.429  1.00 32.58 ? 105 HOH T O     1 
HETATM 3578 O  O     . HOH J 6 .   ? 35.951 34.022 20.872  1.00 38.50 ? 106 HOH T O     1 
HETATM 3579 O  O     . HOH J 6 .   ? 40.625 30.490 13.543  1.00 54.17 ? 107 HOH T O     1 
HETATM 3580 O  O     . HOH J 6 .   ? 30.098 29.962 22.114  1.00 40.20 ? 108 HOH T O     1 
HETATM 3581 O  O     . HOH J 6 .   ? 44.282 37.887 16.027  1.00 56.80 ? 109 HOH T O     1 
HETATM 3582 O  O     . HOH J 6 .   ? 25.707 32.842 17.789  1.00 39.96 ? 110 HOH T O     1 
HETATM 3583 O  O     . HOH J 6 .   ? 25.591 37.871 22.480  1.00 49.36 ? 111 HOH T O     1 
HETATM 3584 O  O     . HOH J 6 .   ? 36.548 40.490 16.463  1.00 58.65 ? 112 HOH T O     1 
HETATM 3585 O  O     . HOH J 6 .   ? 29.947 5.308  27.554  1.00 54.02 ? 113 HOH T O     1 
HETATM 3586 O  O     . HOH J 6 .   ? 38.283 30.438 16.382  1.00 52.71 ? 114 HOH T O     1 
HETATM 3587 O  O     . HOH J 6 .   ? 21.830 26.793 25.420  1.00 43.48 ? 115 HOH T O     1 
HETATM 3588 O  O     . HOH J 6 .   ? 33.610 38.234 14.100  1.00 49.78 ? 116 HOH T O     1 
HETATM 3589 O  O     . HOH J 6 .   ? 24.292 25.233 27.321  1.00 48.44 ? 117 HOH T O     1 
HETATM 3590 O  O     . HOH J 6 .   ? 39.174 28.534 14.270  1.00 51.77 ? 118 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 GLU 338 332 332 GLU GLU A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 343 ALA ALA A . n 
A 1 350 ILE 350 344 ?   ?   ?   A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DT  11  11  11  DT  DT  P . n 
B 2 12  DT  12  12  12  DT  DT  P . n 
B 2 13  DC  13  13  13  DC  DC  P . n 
B 2 14  DC  14  14  14  DC  DC  P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DC  2   2   ?   ?   ?   T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   8OG 5   5   5   8OG 8OG T . n 
C 3 6   DG  6   6   6   DG  DG  T . n 
C 3 7   DA  7   7   7   DA  DA  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DC  10  10  10  DC  DC  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DT  13  13  13  DT  DT  T . n 
C 3 14  DC  14  14  14  DC  DC  T . n 
C 3 15  DC  15  15  15  DC  DC  T . n 
C 3 16  DC  16  16  16  DC  DC  T . n 
C 3 17  DC  17  17  17  DC  DC  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DGT 1   401 1000 DGT DGT A . 
E 5 CA  1   402 3000 CA  CA  A . 
F 5 CA  1   403 3001 CA  CA  A . 
G 5 CA  1   404 3002 CA  CA  A . 
H 6 HOH 1   501 2103 HOH HOH A . 
H 6 HOH 2   502 2129 HOH HOH A . 
H 6 HOH 3   503 2114 HOH HOH A . 
H 6 HOH 4   504 2073 HOH HOH A . 
H 6 HOH 5   505 2021 HOH HOH A . 
H 6 HOH 6   506 2061 HOH HOH A . 
H 6 HOH 7   507 2113 HOH HOH A . 
H 6 HOH 8   508 2101 HOH HOH A . 
H 6 HOH 9   509 2138 HOH HOH A . 
H 6 HOH 10  510 2086 HOH HOH A . 
H 6 HOH 11  511 2143 HOH HOH A . 
H 6 HOH 12  512 2122 HOH HOH A . 
H 6 HOH 13  513 2112 HOH HOH A . 
H 6 HOH 14  514 2109 HOH HOH A . 
H 6 HOH 15  515 2029 HOH HOH A . 
H 6 HOH 16  516 2035 HOH HOH A . 
H 6 HOH 17  517 2094 HOH HOH A . 
H 6 HOH 18  518 2077 HOH HOH A . 
H 6 HOH 19  519 2089 HOH HOH A . 
H 6 HOH 20  520 2078 HOH HOH A . 
H 6 HOH 21  521 2142 HOH HOH A . 
H 6 HOH 22  522 2023 HOH HOH A . 
H 6 HOH 23  523 2056 HOH HOH A . 
H 6 HOH 24  524 2091 HOH HOH A . 
H 6 HOH 25  525 2139 HOH HOH A . 
H 6 HOH 26  526 2135 HOH HOH A . 
H 6 HOH 27  527 2063 HOH HOH A . 
H 6 HOH 28  528 2123 HOH HOH A . 
H 6 HOH 29  529 2102 HOH HOH A . 
H 6 HOH 30  530 2110 HOH HOH A . 
H 6 HOH 31  531 2099 HOH HOH A . 
H 6 HOH 32  532 2140 HOH HOH A . 
H 6 HOH 33  533 2125 HOH HOH A . 
H 6 HOH 34  534 2116 HOH HOH A . 
H 6 HOH 35  535 2137 HOH HOH A . 
H 6 HOH 36  536 2074 HOH HOH A . 
H 6 HOH 37  537 2070 HOH HOH A . 
H 6 HOH 38  538 2093 HOH HOH A . 
H 6 HOH 39  539 2025 HOH HOH A . 
H 6 HOH 40  540 2131 HOH HOH A . 
H 6 HOH 41  541 2133 HOH HOH A . 
H 6 HOH 42  542 2052 HOH HOH A . 
H 6 HOH 43  543 2042 HOH HOH A . 
H 6 HOH 44  544 2039 HOH HOH A . 
H 6 HOH 45  545 2026 HOH HOH A . 
H 6 HOH 46  546 2050 HOH HOH A . 
H 6 HOH 47  547 2009 HOH HOH A . 
H 6 HOH 48  548 2128 HOH HOH A . 
H 6 HOH 49  549 2019 HOH HOH A . 
H 6 HOH 50  550 2104 HOH HOH A . 
H 6 HOH 51  551 2055 HOH HOH A . 
H 6 HOH 52  552 2051 HOH HOH A . 
H 6 HOH 53  553 2082 HOH HOH A . 
H 6 HOH 54  554 2088 HOH HOH A . 
H 6 HOH 55  555 2054 HOH HOH A . 
H 6 HOH 56  556 2126 HOH HOH A . 
H 6 HOH 57  557 2044 HOH HOH A . 
H 6 HOH 58  558 2048 HOH HOH A . 
H 6 HOH 59  559 2066 HOH HOH A . 
H 6 HOH 60  560 2049 HOH HOH A . 
H 6 HOH 61  561 2075 HOH HOH A . 
H 6 HOH 62  562 2079 HOH HOH A . 
H 6 HOH 63  563 2027 HOH HOH A . 
H 6 HOH 64  564 2121 HOH HOH A . 
H 6 HOH 65  565 2040 HOH HOH A . 
H 6 HOH 66  566 2083 HOH HOH A . 
H 6 HOH 67  567 2060 HOH HOH A . 
H 6 HOH 68  568 2127 HOH HOH A . 
H 6 HOH 69  569 2071 HOH HOH A . 
H 6 HOH 70  570 2124 HOH HOH A . 
H 6 HOH 71  571 2084 HOH HOH A . 
H 6 HOH 72  572 2134 HOH HOH A . 
H 6 HOH 73  573 2136 HOH HOH A . 
H 6 HOH 74  574 2080 HOH HOH A . 
H 6 HOH 75  575 2068 HOH HOH A . 
H 6 HOH 76  576 2119 HOH HOH A . 
H 6 HOH 77  577 2038 HOH HOH A . 
H 6 HOH 78  578 2053 HOH HOH A . 
H 6 HOH 79  579 2031 HOH HOH A . 
H 6 HOH 80  580 2069 HOH HOH A . 
H 6 HOH 81  581 2008 HOH HOH A . 
H 6 HOH 82  582 2095 HOH HOH A . 
H 6 HOH 83  583 2034 HOH HOH A . 
H 6 HOH 84  584 2024 HOH HOH A . 
H 6 HOH 85  585 2098 HOH HOH A . 
H 6 HOH 86  586 2096 HOH HOH A . 
H 6 HOH 87  587 2141 HOH HOH A . 
H 6 HOH 88  588 2100 HOH HOH A . 
H 6 HOH 89  589 2118 HOH HOH A . 
H 6 HOH 90  590 2036 HOH HOH A . 
H 6 HOH 91  591 2115 HOH HOH A . 
H 6 HOH 92  592 2120 HOH HOH A . 
H 6 HOH 93  593 2045 HOH HOH A . 
H 6 HOH 94  594 2097 HOH HOH A . 
H 6 HOH 95  595 2107 HOH HOH A . 
H 6 HOH 96  596 2067 HOH HOH A . 
H 6 HOH 97  597 2041 HOH HOH A . 
H 6 HOH 98  598 2033 HOH HOH A . 
H 6 HOH 99  599 2108 HOH HOH A . 
H 6 HOH 100 600 2065 HOH HOH A . 
H 6 HOH 101 601 2030 HOH HOH A . 
H 6 HOH 102 602 2001 HOH HOH A . 
H 6 HOH 103 603 2057 HOH HOH A . 
H 6 HOH 104 604 2062 HOH HOH A . 
H 6 HOH 105 605 2132 HOH HOH A . 
H 6 HOH 106 606 2087 HOH HOH A . 
H 6 HOH 107 607 2072 HOH HOH A . 
H 6 HOH 108 608 2064 HOH HOH A . 
H 6 HOH 109 609 2059 HOH HOH A . 
H 6 HOH 110 610 2037 HOH HOH A . 
H 6 HOH 111 611 2117 HOH HOH A . 
H 6 HOH 112 612 2028 HOH HOH A . 
H 6 HOH 113 613 2090 HOH HOH A . 
H 6 HOH 114 614 2111 HOH HOH A . 
H 6 HOH 115 615 2092 HOH HOH A . 
H 6 HOH 116 616 2085 HOH HOH A . 
H 6 HOH 117 617 2058 HOH HOH A . 
H 6 HOH 118 618 2010 HOH HOH A . 
H 6 HOH 119 619 2046 HOH HOH A . 
H 6 HOH 120 620 2017 HOH HOH A . 
H 6 HOH 121 621 2005 HOH HOH A . 
H 6 HOH 122 622 2043 HOH HOH A . 
H 6 HOH 123 623 2076 HOH HOH A . 
H 6 HOH 124 624 2106 HOH HOH A . 
H 6 HOH 125 625 2011 HOH HOH A . 
H 6 HOH 126 626 2007 HOH HOH A . 
H 6 HOH 127 627 2081 HOH HOH A . 
H 6 HOH 128 628 2018 HOH HOH A . 
H 6 HOH 129 629 2004 HOH HOH A . 
H 6 HOH 130 630 2014 HOH HOH A . 
H 6 HOH 131 631 2013 HOH HOH A . 
H 6 HOH 132 632 2016 HOH HOH A . 
H 6 HOH 133 633 2012 HOH HOH A . 
H 6 HOH 134 634 2006 HOH HOH A . 
H 6 HOH 135 635 2105 HOH HOH A . 
H 6 HOH 136 636 2032 HOH HOH A . 
H 6 HOH 137 637 2130 HOH HOH A . 
H 6 HOH 138 638 2005 HOH HOH A . 
H 6 HOH 139 639 2003 HOH HOH A . 
H 6 HOH 140 640 2047 HOH HOH A . 
H 6 HOH 141 641 2015 HOH HOH A . 
H 6 HOH 142 642 2002 HOH HOH A . 
H 6 HOH 143 643 2020 HOH HOH A . 
H 6 HOH 144 644 2022 HOH HOH A . 
I 6 HOH 1   101 2009 HOH HOH P . 
I 6 HOH 2   102 2014 HOH HOH P . 
I 6 HOH 3   103 2008 HOH HOH P . 
I 6 HOH 4   104 2004 HOH HOH P . 
I 6 HOH 5   105 2013 HOH HOH P . 
I 6 HOH 6   106 2007 HOH HOH P . 
I 6 HOH 7   107 2019 HOH HOH P . 
I 6 HOH 8   108 2006 HOH HOH P . 
I 6 HOH 9   109 2018 HOH HOH P . 
I 6 HOH 10  110 2012 HOH HOH P . 
I 6 HOH 11  111 2021 HOH HOH P . 
I 6 HOH 12  112 2015 HOH HOH P . 
I 6 HOH 13  113 2011 HOH HOH P . 
I 6 HOH 14  114 2003 HOH HOH P . 
I 6 HOH 15  115 2001 HOH HOH P . 
I 6 HOH 16  116 2010 HOH HOH P . 
I 6 HOH 17  117 2016 HOH HOH P . 
I 6 HOH 18  118 2020 HOH HOH P . 
I 6 HOH 19  119 2002 HOH HOH P . 
I 6 HOH 20  120 2017 HOH HOH P . 
J 6 HOH 1   101 2012 HOH HOH T . 
J 6 HOH 2   102 2016 HOH HOH T . 
J 6 HOH 3   103 2003 HOH HOH T . 
J 6 HOH 4   104 2018 HOH HOH T . 
J 6 HOH 5   105 2015 HOH HOH T . 
J 6 HOH 6   106 2007 HOH HOH T . 
J 6 HOH 7   107 2004 HOH HOH T . 
J 6 HOH 8   108 2013 HOH HOH T . 
J 6 HOH 9   109 2006 HOH HOH T . 
J 6 HOH 10  110 2010 HOH HOH T . 
J 6 HOH 11  111 2011 HOH HOH T . 
J 6 HOH 12  112 2008 HOH HOH T . 
J 6 HOH 13  113 2017 HOH HOH T . 
J 6 HOH 14  114 2005 HOH HOH T . 
J 6 HOH 15  115 2014 HOH HOH T . 
J 6 HOH 16  116 2009 HOH HOH T . 
J 6 HOH 17  117 2002 HOH HOH T . 
J 6 HOH 18  118 2001 HOH HOH T . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    C 
_pdbx_struct_mod_residue.label_comp_id    8OG 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     T 
_pdbx_struct_mod_residue.auth_comp_id     8OG 
_pdbx_struct_mod_residue.auth_seq_id      5 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 42.0  ? 
2  OD1 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1 ? A ASP 111 ? A ASP 105 ? 1_555 123.4 ? 
3  OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1 ? A ASP 111 ? A ASP 105 ? 1_555 83.0  ? 
4  OD1 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OE2 ? A GLU 112 ? A GLU 106 ? 1_555 90.9  ? 
5  OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OE2 ? A GLU 112 ? A GLU 106 ? 1_555 107.3 ? 
6  OD1 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OE2 ? A GLU 112 ? A GLU 106 ? 1_555 95.6  ? 
7  OD1 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 95.1  ? 
8  OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 77.4  ? 
9  OD1 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 81.3  ? 
10 OE2 ? A GLU 112 ? A GLU 106 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 174.1 ? 
11 OD1 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O   ? H HOH .   ? A HOH 547 ? 1_555 60.6  ? 
12 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O   ? H HOH .   ? A HOH 547 ? 1_555 100.8 ? 
13 OD1 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O   ? H HOH .   ? A HOH 547 ? 1_555 175.9 ? 
14 OE2 ? A GLU 112 ? A GLU 106 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O   ? H HOH .   ? A HOH 547 ? 1_555 84.5  ? 
15 O1A ? D DGT .   ? A DGT 401 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O   ? H HOH .   ? A HOH 547 ? 1_555 98.2  ? 
16 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O   ? A PHE 14  ? A PHE 8   ? 1_555 95.5  ? 
17 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 OD2 ? A ASP 111 ? A ASP 105 ? 1_555 74.2  ? 
18 O   ? A PHE 14  ? A PHE 8   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 OD2 ? A ASP 111 ? A ASP 105 ? 1_555 90.8  ? 
19 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O2G ? D DGT .   ? A DGT 401 ? 1_555 112.4 ? 
20 O   ? A PHE 14  ? A PHE 8   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O2G ? D DGT .   ? A DGT 401 ? 1_555 109.5 ? 
21 OD2 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O2G ? D DGT .   ? A DGT 401 ? 1_555 157.3 ? 
22 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1B ? D DGT .   ? A DGT 401 ? 1_555 166.0 ? 
23 O   ? A PHE 14  ? A PHE 8   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1B ? D DGT .   ? A DGT 401 ? 1_555 91.2  ? 
24 OD2 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1B ? D DGT .   ? A DGT 401 ? 1_555 93.5  ? 
25 O2G ? D DGT .   ? A DGT 401 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1B ? D DGT .   ? A DGT 401 ? 1_555 76.5  ? 
26 OD2 ? A ASP 13  ? A ASP 7   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 94.3  ? 
27 O   ? A PHE 14  ? A PHE 8   ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 159.1 ? 
28 OD2 ? A ASP 111 ? A ASP 105 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 74.2  ? 
29 O2G ? D DGT .   ? A DGT 401 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 83.5  ? 
30 O1B ? D DGT .   ? A DGT 401 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O1A ? D DGT .   ? A DGT 401 ? 1_555 75.6  ? 
31 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? A ILE 192 ? A ILE 186 ? 1_555 84.6  ? 
32 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 594 ? 1_555 95.6  ? 
33 O   ? A ILE 192 ? A ILE 186 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 594 ? 1_555 76.0  ? 
34 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 621 ? 1_555 90.6  ? 
35 O   ? A ILE 192 ? A ILE 186 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 621 ? 1_555 157.4 ? 
36 O   ? H HOH .   ? A HOH 594 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 621 ? 1_555 126.5 ? 
37 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 633 ? 1_555 101.7 ? 
38 O   ? A ILE 192 ? A ILE 186 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 633 ? 1_555 140.1 ? 
39 O   ? H HOH .   ? A HOH 594 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 633 ? 1_555 64.2  ? 
40 O   ? H HOH .   ? A HOH 621 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? H HOH .   ? A HOH 633 ? 1_555 62.5  ? 
41 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 107 ? 1_555 167.3 ? 
42 O   ? A ILE 192 ? A ILE 186 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 107 ? 1_555 89.0  ? 
43 O   ? H HOH .   ? A HOH 594 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 107 ? 1_555 93.4  ? 
44 O   ? H HOH .   ? A HOH 621 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 107 ? 1_555 91.2  ? 
45 O   ? H HOH .   ? A HOH 633 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 107 ? 1_555 90.2  ? 
46 O   ? A ALA 187 ? A ALA 181 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 78.8  ? 
47 O   ? A ILE 192 ? A ILE 186 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 79.9  ? 
48 O   ? H HOH .   ? A HOH 594 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 155.7 ? 
49 O   ? H HOH .   ? A HOH 621 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 77.5  ? 
50 O   ? H HOH .   ? A HOH 633 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 140.0 ? 
51 O   ? I HOH .   ? P HOH 107 ? 1_555 CA ? G CA . ? A CA 404 ? 1_555 O   ? I HOH .   ? P HOH 109 ? 1_555 89.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-08 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2017-06-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                       
2  4 'Structure model' pdbx_struct_conn_angle          
3  4 'Structure model' pdbx_struct_sheet_hbond         
4  4 'Structure model' pdbx_unobs_or_zero_occ_atoms    
5  4 'Structure model' pdbx_unobs_or_zero_occ_residues 
6  4 'Structure model' pdbx_validate_close_contact     
7  4 'Structure model' struct_conf                     
8  4 'Structure model' struct_conn                     
9  4 'Structure model' struct_sheet                    
10 4 'Structure model' struct_sheet_order              
11 4 'Structure model' struct_sheet_range              
12 4 'Structure model' struct_site                     
13 4 'Structure model' struct_site_gen                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                      
2  4 'Structure model' '_atom_site.Cartn_x'                             
3  4 'Structure model' '_atom_site.Cartn_y'                             
4  4 'Structure model' '_atom_site.Cartn_z'                             
5  4 'Structure model' '_atom_site.auth_asym_id'                        
6  4 'Structure model' '_atom_site.auth_atom_id'                        
7  4 'Structure model' '_atom_site.auth_comp_id'                        
8  4 'Structure model' '_atom_site.auth_seq_id'                         
9  4 'Structure model' '_atom_site.label_asym_id'                       
10 4 'Structure model' '_atom_site.label_atom_id'                       
11 4 'Structure model' '_atom_site.label_comp_id'                       
12 4 'Structure model' '_atom_site.label_seq_id'                        
13 4 'Structure model' '_atom_site.type_symbol'                         
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'     
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'     
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'      
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id'    
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id'    
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id'    
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'     
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'      
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'     
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'     
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'      
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id'    
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id'    
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id'    
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'     
29 4 'Structure model' '_pdbx_struct_conn_angle.value'                  
30 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_atom_id'  
31 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id'  
32 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id'   
33 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_atom_id' 
34 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 
35 4 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id'  
36 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_atom_id'  
37 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id'  
38 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id'   
39 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_atom_id' 
40 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 
41 4 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id'  
42 4 'Structure model' '_pdbx_struct_sheet_hbond.sheet_id'              
43 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'     
44 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'     
45 4 'Structure model' '_struct_conf.beg_auth_comp_id'                  
46 4 'Structure model' '_struct_conf.beg_auth_seq_id'                   
47 4 'Structure model' '_struct_conf.beg_label_comp_id'                 
48 4 'Structure model' '_struct_conf.beg_label_seq_id'                  
49 4 'Structure model' '_struct_conf.pdbx_PDB_helix_id'                 
50 4 'Structure model' '_struct_conf.pdbx_PDB_helix_length'             
51 4 'Structure model' '_struct_conn.conn_type_id'                      
52 4 'Structure model' '_struct_conn.id'                                
53 4 'Structure model' '_struct_conn.pdbx_dist_value'                   
54 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'            
55 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id'           
56 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'                
57 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'                
58 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'                 
59 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'               
60 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'               
61 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'               
62 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'                
63 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'                
64 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'                
65 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                 
66 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'               
67 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'               
68 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'               
69 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'                
70 4 'Structure model' '_struct_sheet.id'                               
71 4 'Structure model' '_struct_sheet_order.sheet_id'                   
72 4 'Structure model' '_struct_sheet_range.sheet_id'                   
73 4 'Structure model' '_struct_site.details'                           
74 4 'Structure model' '_struct_site.pdbx_auth_asym_id'                 
75 4 'Structure model' '_struct_site.pdbx_auth_comp_id'                 
76 4 'Structure model' '_struct_site.pdbx_auth_seq_id'                  
77 4 'Structure model' '_struct_site.pdbx_num_residues'                 
78 4 'Structure model' '_struct_site_gen.auth_asym_id'                  
79 4 'Structure model' '_struct_site_gen.auth_comp_id'                  
80 4 'Structure model' '_struct_site_gen.auth_seq_id'                   
81 4 'Structure model' '_struct_site_gen.label_asym_id'                 
82 4 'Structure model' '_struct_site_gen.label_comp_id'                 
83 4 'Structure model' '_struct_site_gen.label_seq_id'                  
84 4 'Structure model' '_struct_site_gen.pdbx_num_res'                  
85 4 'Structure model' '_struct_site_gen.site_id'                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS refinement       1.1 ? 1 
XDS 'data reduction' .   ? 2 
XDS 'data scaling'   .   ? 3 
CNS phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2UVV 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ARG 332 TO GLU' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 624 ? ? O A HOH 635 ? ? 1.85 
2 1 O   A HOH 563 ? ? O A HOH 638 ? ? 2.16 
3 1 OE1 A GLU 219 ? ? O A HOH 501 ? ? 2.17 
4 1 O   A HOH 566 ? ? O A HOH 571 ? ? 2.18 
5 1 O   A HOH 604 ? ? O A HOH 620 ? ? 2.18 
6 1 O   A HOH 578 ? ? O A HOH 625 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" T DA 3 ? A P T DC 4 ? A 1.519 1.607 -0.088 0.012 Y 
2 1 "O3'" T DA 3 ? B P T DC 4 ? B 1.517 1.607 -0.090 0.012 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 23.57   52.30   
2  1 ARG A 77  ? ? -119.41 69.58   
3  1 SER A 96  ? ? -178.67 142.59  
4  1 SER A 145 ? ? -161.48 -168.35 
5  1 ASN A 234 ? ? -159.26 55.49   
6  1 ASN A 254 ? ? -56.93  170.14  
7  1 SER A 255 ? ? 176.51  162.10  
8  1 ASP A 277 ? ? 67.83   -114.27 
9  1 LEU A 293 ? ? 58.88   15.90   
10 1 GLU A 342 ? ? -107.45 65.64   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ALA 343 ? CA    ? A ALA 349 CA    
2  1 Y 1 A ALA 343 ? C     ? A ALA 349 C     
3  1 Y 1 A ALA 343 ? O     ? A ALA 349 O     
4  1 Y 1 A ALA 343 ? CB    ? A ALA 349 CB    
5  1 Y 1 T DA  3   ? P     ? C DA  3   P     
6  1 Y 1 T DA  3   ? OP1   ? C DA  3   OP1   
7  1 Y 1 T DA  3   ? OP2   ? C DA  3   OP2   
8  1 Y 1 T DA  3   ? "O5'" ? C DA  3   "O5'" 
9  1 Y 1 T DA  3   ? "C5'" ? C DA  3   "C5'" 
10 1 Y 1 T DA  3   ? "C4'" ? C DA  3   "C4'" 
11 1 Y 1 T DA  3   ? "O4'" ? C DA  3   "O4'" 
12 1 Y 1 T DA  3   ? "C3'" ? C DA  3   "C3'" 
13 1 Y 1 T DA  3   ? "C2'" ? C DA  3   "C2'" 
14 1 Y 1 T DA  3   ? "C1'" ? C DA  3   "C1'" 
15 1 Y 1 T DA  3   ? N9    ? C DA  3   N9    
16 1 Y 1 T DA  3   ? C8    ? C DA  3   C8    
17 1 Y 1 T DA  3   ? N7    ? C DA  3   N7    
18 1 Y 1 T DA  3   ? C5    ? C DA  3   C5    
19 1 Y 1 T DA  3   ? C6    ? C DA  3   C6    
20 1 Y 1 T DA  3   ? N6    ? C DA  3   N6    
21 1 Y 1 T DA  3   ? N1    ? C DA  3   N1    
22 1 Y 1 T DA  3   ? C2    ? C DA  3   C2    
23 1 Y 1 T DA  3   ? N3    ? C DA  3   N3    
24 1 Y 1 T DA  3   ? C4    ? C DA  3   C4    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A ILE 344 ? A ILE 350 
8  1 Y 1 A GLY 345 ? A GLY 351 
9  1 Y 1 A LEU 346 ? A LEU 352 
10 1 Y 1 A ASP 347 ? A ASP 353 
11 1 Y 1 A LYS 348 ? A LYS 354 
12 1 Y 1 A PHE 349 ? A PHE 355 
13 1 Y 1 A PHE 350 ? A PHE 356 
14 1 Y 1 A ASP 351 ? A ASP 357 
15 1 Y 1 A THR 352 ? A THR 358 
16 1 Y 1 T DT  1   ? C DT  1   
17 1 Y 1 T DC  2   ? C DC  2   
# 
_ndb_struct_conf_na.entry_id   2UVV 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC  18 1_555 0.266  -0.002 0.008  -3.928 2.307   -5.693 1  P_DG1:DC18_T  P 1  ? T 18 ? 19 1 
1 B DG 2  1_555 C DC  17 1_555 -0.307 -0.120 -0.137 2.944  -4.291  0.730  2  P_DG2:DC17_T  P 2  ? T 17 ? 19 1 
1 B DG 3  1_555 C DC  16 1_555 -0.200 -0.017 0.020  2.850  -7.308  -4.440 3  P_DG3:DC16_T  P 3  ? T 16 ? 19 1 
1 B DG 4  1_555 C DC  15 1_555 -0.020 0.001  -0.059 2.673  -3.046  5.216  4  P_DG4:DC15_T  P 4  ? T 15 ? 19 1 
1 B DG 5  1_555 C DC  14 1_555 -0.106 0.114  -0.073 2.368  -7.372  7.812  5  P_DG5:DC14_T  P 5  ? T 14 ? 19 1 
1 B DA 6  1_555 C DT  13 1_555 0.392  0.107  -0.168 -2.732 -9.712  0.161  6  P_DA6:DT13_T  P 6  ? T 13 ? 20 1 
1 B DA 7  1_555 C DT  12 1_555 0.189  -0.053 0.234  -1.219 -6.252  -2.884 7  P_DA7:DT12_T  P 7  ? T 12 ? 20 1 
1 B DG 8  1_555 C DC  11 1_555 -0.490 -0.022 0.015  3.161  -5.767  0.538  8  P_DG8:DC11_T  P 8  ? T 11 ? 19 1 
1 B DG 9  1_555 C DC  10 1_555 0.201  0.189  -0.212 -5.209 -9.642  2.150  9  P_DG9:DC10_T  P 9  ? T 10 ? 19 1 
1 B DA 10 1_555 C DT  9  1_555 0.796  -0.084 -0.104 -8.524 -11.020 1.837  10 P_DA10:DT9_T  P 10 ? T 9  ? 20 1 
1 B DT 11 1_555 C DA  8  1_555 -0.014 -0.215 -0.230 -0.347 -2.087  3.639  11 P_DT11:DA8_T  P 11 ? T 8  ? 20 1 
1 B DT 12 1_555 C DA  7  1_555 -0.219 0.011  -0.345 0.188  -2.724  2.884  12 P_DT12:DA7_T  P 12 ? T 7  ? 20 1 
1 B DC 13 1_555 C DG  6  1_555 0.267  0.015  -0.198 8.197  3.169   3.306  13 P_DC13:DG6_T  P 13 ? T 6  ? 19 1 
1 B DC 14 1_555 C 8OG 5  1_555 -1.447 -0.104 -0.120 -2.324 -4.941  3.261  14 P_DC14:8OG5_T P 14 ? T 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC  17 1_555 0.801  0.080  3.328 0.851  7.175  26.305 -1.668 -1.481 3.259 15.400 
-1.826 27.263 1  PP_DG1DG2:DC17DC18_TT  P 1  ? T 18 ? P 2  ? T 17 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC  16 1_555 -1.309 -0.214 3.367 -5.664 6.584  33.563 -1.430 1.277  3.434 11.171 
9.609  34.637 2  PP_DG2DG3:DC16DC17_TT  P 2  ? T 17 ? P 3  ? T 16 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC  15 1_555 0.561  -0.035 3.475 2.244  5.921  33.251 -1.079 -0.578 3.447 10.231 
-3.878 33.832 3  PP_DG3DG4:DC15DC16_TT  P 3  ? T 16 ? P 4  ? T 15 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC  14 1_555 0.093  -0.941 3.237 -0.997 9.633  28.958 -3.601 -0.365 2.783 18.618 
1.926  30.502 4  PP_DG4DG5:DC14DC15_TT  P 4  ? T 15 ? P 5  ? T 14 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT  13 1_555 -0.626 -0.137 3.439 0.476  5.354  34.912 -1.055 1.106  3.373 8.858  
-0.788 35.311 5  PP_DG5DA6:DT13DC14_TT  P 5  ? T 14 ? P 6  ? T 13 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT  12 1_555 -0.437 -0.335 3.151 -4.756 1.665  32.687 -0.861 -0.012 3.161 2.936  
8.388  33.063 6  PP_DA6DA7:DT12DT13_TT  P 6  ? T 13 ? P 7  ? T 12 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC  11 1_555 0.366  -0.343 3.285 2.108  4.004  30.261 -1.444 -0.277 3.231 7.615  
-4.009 30.590 7  PP_DA7DG8:DC11DT12_TT  P 7  ? T 12 ? P 8  ? T 11 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC  10 1_555 0.510  -0.589 3.538 2.001  4.326  36.415 -1.570 -0.515 3.470 6.886  
-3.185 36.715 8  PP_DG8DG9:DC10DC11_TT  P 8  ? T 11 ? P 9  ? T 10 ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT  9  1_555 -0.745 -0.159 3.414 -0.894 -1.410 39.587 -0.062 0.990  3.433 -2.080 
1.319  39.621 9  PP_DG9DA10:DT9DC10_TT  P 9  ? T 10 ? P 10 ? T 9  ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA  8  1_555 0.345  -0.694 3.169 1.881  2.006  25.228 -2.138 -0.263 3.122 4.576  
-4.291 25.375 10 PP_DA10DT11:DA8DT9_TT  P 10 ? T 9  ? P 11 ? T 8  ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA  7  1_555 0.908  -0.232 3.362 1.859  4.135  34.306 -1.048 -1.231 3.355 6.973  
-3.134 34.596 11 PP_DT11DT12:DA7DA8_TT  P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DT 12 1_555 C DA 7  1_555 B DC 13 1_555 C DG  6  1_555 -0.117 -0.419 3.309 -0.925 8.384  25.340 -3.080 0.014  3.020 18.470 
2.038  26.685 12 PP_DT12DC13:DG6DA7_TT  P 12 ? T 7  ? P 13 ? T 6  ? 
1 B DC 13 1_555 C DG 6  1_555 B DC 14 1_555 C 8OG 5  1_555 0.476  -0.482 3.611 1.047  4.592  31.560 -1.791 -0.657 3.521 8.384  
-1.911 31.900 13 PP_DC13DC14:8OG5DG6_TT P 13 ? T 6  ? P 14 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
#