data_2UVW
# 
_entry.id   2UVW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2UVW         
PDBE  EBI-31903    
WWPDB D_1290031903 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2ASD unspecified 'OXOG-MODIFIED INSERTION TERNARY COMPLEX' 
PDB 2ASJ unspecified 'OXOG-MODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2ASL unspecified 'OXOG-MODIFIED POSTINSERTION BINARY COMPLEX' 
PDB 2ATL unspecified 'UNMODIFIED INSERTION TERNARY COMPLEX' 
PDB 2AU0 unspecified 'UNMODIFIED PREINSERTION BINARY COMPLEX' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2R unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2J6S unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6T unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DATP.' 
PDB 2J6U unspecified 'TERNARY COMPLEX OF SULFOLOBUS SOLFATARICUS DPO4 DNA POLYMERASE, O6-METHYLGUANINE MODIFIED DNA, AND DGTP.' 
PDB 2JEF unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOTIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEG unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEI unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2JEJ unspecified 
;THE MOLECULAR BASIS OF SELECTIVITY OF NUCLEOSIDE TRIPHOSPHATE INCORPORATION OPPOSITE O6-BENZYLGUANINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE IV: STEADY-STATE AND PRE- STEADY-STATE KINETICS AND X-RAY CRYSTALLOGRAPHY OF CORRECT AND INCORRECT PAIRING
;
PDB 2UVR unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2UVU unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
PDB 2UVV unspecified 'CRYSTAL STRUCTURES OF MUTANT DPO4 DNA POLYMERASES WITH 8-OXOG CONTAINING DNA TEMPLATE-PRIMER CONSTRUCTS' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2UVW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Irimia, A.' 1 
'Egli, M.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Hydrogen Bonding of 7,8-Dihydro-8-Oxodeoxyguanosine with a Charged Residue in the Little Finger Domain Determines Miscoding Events in Sulfolobus Solfataricus DNA Polymerase Dpo4.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                19831 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17468100 
_citation.pdbx_database_id_DOI      10.1074/JBC.M702290200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eoff, R.L.'       1 
primary 'Irimia, A.'       2 
primary 'Angel, K.C.'      3 
primary 'Egli, M.'         4 
primary 'Guengerich, F.P.' 5 
# 
_cell.entry_id           2UVW 
_cell.length_a           96.778 
_cell.length_b           103.728 
_cell.length_c           52.915 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2UVW 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                 41058.672 1   2.7.7.7 YES ? 
'R332E MUTANT OF DPO4'                  
2 polymer     syn 
;5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP *TP*TP*CP*A)-3'
;
4409.877  1   ?       ?   ? 'GGG GGA AGG ATT CA'                    
3 polymer     syn 
;5'-D(*TP*CP*AP*CP*8OGP*GP*AP*AP*TP*CP *CP*TP*TP*CP*CP*CP*CP*C)-3'
;
5388.480  1   ?       ?   ? 'T C A C 8OG G A A T C C T T C C C C C' 
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                 507.181   1   ?       ?   ? ? 
5 non-polymer syn 'CALCIUM ION'                                                       40.078    3   ?       ?   ? ? 
6 water       nat water                                                               18.015    224 ?       ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'POL IV'          
2 '14-MER PRIMER'   
3 '18-MER TEMPLATE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIREIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIREIGVRFSKFIEAIGLDKFFDT
;
A ? 
2 polydeoxyribonucleotide no no  '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DT)(DC)(DA)' GGGGGAAGGATTCA P ? 
3 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(DC)(8OG)(DG)(DA)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCACGGAATCCTTCCCCC T 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 GLU n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DA  n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   8OG n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B/DPO4-NHIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GENE DPO4' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2UVW        1 ? ? 2UVW   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2UVW        2 ? ? 2UVW   ? 
4 PDB 2UVW        3 ? ? 2UVW   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2UVW A 1 ? 6   ? 2UVW   -5 ? 0   ? -5 0   
2 2 2UVW A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 3 2UVW P 1 ? 14  ? 2UVW   1  ? 14  ? 1  14  
4 4 2UVW T 1 ? 18  ? 2UVW   1  ? 18  ? 1  18  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2UVW 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      338 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q97W02 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          332 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            332 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"         ?                                                       
'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2UVW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   54.7 
_exptl_crystal.description           'THE MODEL POSITION WAS OPTIMIZED BY SEVERAL ROUNDS OF RIGID BODY REFINEMENT.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '8% PEG 3350, 10 MM TRIS-HCL PH 7.5, 50 MM CA(CH3CO2)2, 50MM NACL, 3.5% GLYCEROL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-10-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 5ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   5ID-B 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2UVW 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.260 
_reflns.d_resolution_high            2.090 
_reflns.number_obs                   29759 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.3 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.4300 
_reflns.B_iso_Wilson_estimate        46.6 
_reflns.pdbx_redundancy              3.450 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.09 
_reflns_shell.d_res_low              2.17 
_reflns_shell.percent_possible_all   70.2 
_reflns_shell.Rmerge_I_obs           0.44000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.500 
_reflns_shell.pdbx_redundancy        2.80 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2UVW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     29750 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1361457.40 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.81 
_refine.ls_d_res_high                            2.09 
_refine.ls_percent_reflns_obs                    92.3 
_refine.ls_R_factor_obs                          0.249 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.249 
_refine.ls_R_factor_R_free                       0.274 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1468 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.1 
_refine.aniso_B[1][1]                            1.54 
_refine.aniso_B[2][2]                            -0.43 
_refine.aniso_B[3][3]                            -1.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.349736 
_refine.solvent_model_param_bsol                 66.3822 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2UVR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2UVW 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.46 
_refine_analyze.Luzzati_d_res_low_obs           30.81 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.50 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2742 
_refine_hist.pdbx_number_atoms_nucleic_acid   634 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               3634 
_refine_hist.d_res_high                       2.09 
_refine_hist.d_res_low                        30.81 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.49  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.38  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.95  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.95  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.09 
_refine_ls_shell.d_res_low                        2.22 
_refine_ls_shell.number_reflns_R_work             3664 
_refine_ls_shell.R_factor_R_work                  0.387 
_refine_ls_shell.percent_reflns_obs               73.4 
_refine_ls_shell.R_factor_R_free                  0.413 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             214 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP   
'X-RAY DIFFRACTION' 2 DNA-RNA1.PARAM    DNA-RNA1.TOP  
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER_REP.TOP 
'X-RAY DIFFRACTION' 4 DGTP.PARAM        DGTP.TOP      
'X-RAY DIFFRACTION' 5 ION.PARAM         ION.TOP       
# 
_struct.entry_id                  2UVW 
_struct.title                     
'Crystal structures of mutant Dpo4 DNA polymerases with 8-oxoG containing DNA template-primer constructs' 
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2UVW 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;TRANSFERASE, DNA-DIRECTED DNA POLYMERASE, P2 DNA POLYMERASE IV, NUCLEOTIDYLTRANSFERASE, 7, MAGNESIUM, DNA DAMAGE, DNA REPAIR, DNA-BINDING, TRANSLESION DNA POLYMERASE, METAL-BINDING, 8-DIHYDRO-8- OXODEOXYGUANOSINE, METAL- BINDING, MUTATOR PROTEIN, DNA REPLICATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 27  ? LYS A 30  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 83  ? ARG A 99  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P6  6  GLU A 100 ? SER A 102 ? GLU A 94  SER A 96  5 ? 3  
HELX_P HELX_P7  7  SER A 118 ? VAL A 121 ? SER A 112 VAL A 115 5 ? 4  
HELX_P HELX_P8  8  ARG A 122 ? LYS A 143 ? ARG A 116 LYS A 137 1 ? 22 
HELX_P HELX_P9  9  ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P10 10 ASP A 173 ? LEU A 184 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P11 11 ILE A 186 ? VAL A 189 ? ILE A 180 VAL A 183 5 ? 4  
HELX_P HELX_P12 12 GLY A 193 ? LEU A 203 ? GLY A 187 LEU A 197 1 ? 11 
HELX_P HELX_P13 13 LEU A 208 ? SER A 213 ? LEU A 202 SER A 207 5 ? 6  
HELX_P HELX_P14 14 GLU A 215 ? GLY A 224 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P15 15 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P16 16 ASN A 263 ? ASP A 283 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P17 17 SER A 313 ? GLU A 330 ? SER A 307 GLU A 324 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E CA  .  CA    ? ? ? 1_555 H HOH .   O   ? ? A CA  3000 A HOH 2071 1_555 ? ? ? ? ? ? ?                2.643 ? 
metalc2  metalc ? ? E CA  .  CA    ? ? ? 1_555 H HOH .   O   ? ? A CA  3000 A HOH 2089 1_555 ? ? ? ? ? ? ?                3.358 ? 
metalc3  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 13  OD2 ? ? A CA  3000 A ASP 7    1_555 ? ? ? ? ? ? ?                3.318 ? 
metalc4  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD2 ? ? A CA  3000 A ASP 105  1_555 ? ? ? ? ? ? ?                3.125 ? 
metalc5  metalc ? ? E CA  .  CA    ? ? ? 1_555 D DGT .   O1A ? ? A CA  3000 A DGT 1000 1_555 ? ? ? ? ? ? ?                2.541 ? 
metalc6  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD1 ? ? A CA  3000 A ASP 105  1_555 ? ? ? ? ? ? ?                2.752 ? 
metalc7  metalc ? ? F CA  .  CA    ? ? ? 1_555 A ASP 13  OD2 ? ? A CA  3001 A ASP 7    1_555 ? ? ? ? ? ? ?                2.324 ? 
metalc8  metalc ? ? F CA  .  CA    ? ? ? 1_555 D DGT .   O2B ? ? A CA  3001 A DGT 1000 1_555 ? ? ? ? ? ? ?                2.434 ? 
metalc9  metalc ? ? F CA  .  CA    ? ? ? 1_555 A PHE 14  O   ? ? A CA  3001 A PHE 8    1_555 ? ? ? ? ? ? ?                2.422 ? 
metalc10 metalc ? ? F CA  .  CA    ? ? ? 1_555 A ASP 111 OD2 ? ? A CA  3001 A ASP 105  1_555 ? ? ? ? ? ? ?                2.410 ? 
metalc11 metalc ? ? F CA  .  CA    ? ? ? 1_555 D DGT .   O2G ? ? A CA  3001 A DGT 1000 1_555 ? ? ? ? ? ? ?                2.437 ? 
metalc12 metalc ? ? F CA  .  CA    ? ? ? 1_555 D DGT .   O1A ? ? A CA  3001 A DGT 1000 1_555 ? ? ? ? ? ? ?                2.409 ? 
metalc13 metalc ? ? G CA  .  CA    ? ? ? 1_555 A ALA 187 O   ? ? A CA  3002 A ALA 181  1_555 ? ? ? ? ? ? ?                2.431 ? 
metalc14 metalc ? ? G CA  .  CA    ? ? ? 1_555 A ILE 192 O   ? ? A CA  3002 A ILE 186  1_555 ? ? ? ? ? ? ?                2.610 ? 
metalc15 metalc ? ? G CA  .  CA    ? ? ? 1_555 H HOH .   O   ? ? A CA  3002 A HOH 2101 1_555 ? ? ? ? ? ? ?                2.510 ? 
metalc16 metalc ? ? G CA  .  CA    ? ? ? 1_555 H HOH .   O   ? ? A CA  3002 A HOH 2099 1_555 ? ? ? ? ? ? ?                2.445 ? 
metalc17 metalc ? ? G CA  .  CA    ? ? ? 1_555 I HOH .   O   ? ? A CA  3002 P HOH 2027 1_555 ? ? ? ? ? ? ?                2.636 ? 
metalc18 metalc ? ? G CA  .  CA    ? ? ? 1_555 I HOH .   O   ? ? A CA  3002 P HOH 2026 1_555 ? ? ? ? ? ? ?                2.592 ? 
covale1  covale ? ? C DC  4  "O3'" ? ? ? 1_555 C 8OG 5   P   ? ? T DC  4    T 8OG 5    1_555 ? ? ? ? ? ? ?                1.611 ? 
covale2  covale ? ? C 8OG 5  "O3'" ? ? ? 1_555 C DG  6   P   ? ? T 8OG 5    T DG  6    1_555 ? ? ? ? ? ? ?                1.602 ? 
hydrog1  hydrog ? ? B DG  1  N1    ? ? ? 1_555 C DC  18  N3  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog2  hydrog ? ? B DG  1  N2    ? ? ? 1_555 C DC  18  O2  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog3  hydrog ? ? B DG  1  O6    ? ? ? 1_555 C DC  18  N4  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog4  hydrog ? ? B DG  2  N1    ? ? ? 1_555 C DC  17  N3  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog5  hydrog ? ? B DG  2  N2    ? ? ? 1_555 C DC  17  O2  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog6  hydrog ? ? B DG  2  O6    ? ? ? 1_555 C DC  17  N4  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog7  hydrog ? ? B DG  3  N1    ? ? ? 1_555 C DC  16  N3  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog8  hydrog ? ? B DG  3  N2    ? ? ? 1_555 C DC  16  O2  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog9  hydrog ? ? B DG  3  O6    ? ? ? 1_555 C DC  16  N4  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog10 hydrog ? ? B DG  4  N1    ? ? ? 1_555 C DC  15  N3  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog11 hydrog ? ? B DG  4  N2    ? ? ? 1_555 C DC  15  O2  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog12 hydrog ? ? B DG  4  O6    ? ? ? 1_555 C DC  15  N4  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog13 hydrog ? ? B DG  5  N1    ? ? ? 1_555 C DC  14  N3  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog14 hydrog ? ? B DG  5  N2    ? ? ? 1_555 C DC  14  O2  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog15 hydrog ? ? B DG  5  O6    ? ? ? 1_555 C DC  14  N4  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog16 hydrog ? ? B DA  6  N1    ? ? ? 1_555 C DT  13  N3  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog17 hydrog ? ? B DA  6  N6    ? ? ? 1_555 C DT  13  O4  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog18 hydrog ? ? B DA  7  N1    ? ? ? 1_555 C DT  12  N3  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog19 hydrog ? ? B DA  7  N6    ? ? ? 1_555 C DT  12  O4  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog20 hydrog ? ? B DG  8  N1    ? ? ? 1_555 C DC  11  N3  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog21 hydrog ? ? B DG  8  N2    ? ? ? 1_555 C DC  11  O2  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog22 hydrog ? ? B DG  8  O6    ? ? ? 1_555 C DC  11  N4  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog23 hydrog ? ? B DG  9  N1    ? ? ? 1_555 C DC  10  N3  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog24 hydrog ? ? B DG  9  N2    ? ? ? 1_555 C DC  10  O2  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog25 hydrog ? ? B DG  9  O6    ? ? ? 1_555 C DC  10  N4  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog26 hydrog ? ? B DA  10 N1    ? ? ? 1_555 C DT  9   N3  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog27 hydrog ? ? B DA  10 N6    ? ? ? 1_555 C DT  9   O4  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog28 hydrog ? ? B DT  11 N3    ? ? ? 1_555 C DA  8   N1  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog29 hydrog ? ? B DT  11 O4    ? ? ? 1_555 C DA  8   N6  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog30 hydrog ? ? B DT  12 N3    ? ? ? 1_555 C DA  7   N1  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog31 hydrog ? ? B DT  12 O4    ? ? ? 1_555 C DA  7   N6  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog32 hydrog ? ? B DC  13 N3    ? ? ? 1_555 C DG  6   N1  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog33 hydrog ? ? B DC  13 N4    ? ? ? 1_555 C DG  6   O6  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog34 hydrog ? ? B DC  13 O2    ? ? ? 1_555 C DG  6   N2  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog35 hydrog ? ? B DA  14 N6    ? ? ? 1_555 C 8OG 5   O6  ? ? P DA  14   T 8OG 5    1_555 ? ? ? ? ? ? 'DA-8OG MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           165 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    166 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 105 ? SER A 109 ? ILE A 99  SER A 103 
AA 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA 5 ILE A 169 ? ILE A 172 ? ILE A 163 ILE A 166 
AB 1 GLY A 47  ? ALA A 52  ? GLY A 41  ALA A 46  
AB 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AB 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AC 1 SER A 250 ? SER A 261 ? SER A 244 SER A 255 
AC 2 ILE A 336 ? PHE A 346 ? ILE A 330 PHE A 340 
AC 3 PRO A 287 ? THR A 296 ? PRO A 281 THR A 290 
AC 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 108 ? N ALA A 102 O GLU A 112 ? O GLU A 106 
AA 2 3 N LEU A 115 ? N LEU A 109 O LEU A 10  ? O LEU A 4   
AA 3 4 N ASP A 13  ? N ASP A 7   O THR A 147 ? O THR A 141 
AA 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AB 1 2 N ALA A 50  ? N ALA A 44  O VAL A 36  ? O VAL A 30  
AB 2 3 N VAL A 35  ? N VAL A 29  O VAL A 78  ? O VAL A 72  
AC 1 2 N SER A 261 ? N SER A 255 O ILE A 336 ? O ILE A 330 
AC 2 3 O SER A 344 ? O SER A 338 N LYS A 288 ? N LYS A 282 
AC 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A3000'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A3001'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A3002'  
AC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE DGT A1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 13  ? ASP A 7    . ? 1_555 ? 
2  AC1 7  ASP A 111 ? ASP A 105  . ? 1_555 ? 
3  AC1 7  GLU A 112 ? GLU A 106  . ? 1_555 ? 
4  AC1 7  DGT D .   ? DGT A 1000 . ? 1_555 ? 
5  AC1 7  HOH H .   ? HOH A 2071 . ? 1_555 ? 
6  AC1 7  CA  F .   ? CA  A 3001 . ? 1_555 ? 
7  AC1 7  DA  B 14  ? DA  P 14   . ? 1_555 ? 
8  AC2 5  ASP A 13  ? ASP A 7    . ? 1_555 ? 
9  AC2 5  PHE A 14  ? PHE A 8    . ? 1_555 ? 
10 AC2 5  ASP A 111 ? ASP A 105  . ? 1_555 ? 
11 AC2 5  DGT D .   ? DGT A 1000 . ? 1_555 ? 
12 AC2 5  CA  E .   ? CA  A 3000 . ? 1_555 ? 
13 AC3 6  ALA A 187 ? ALA A 181  . ? 1_555 ? 
14 AC3 6  ILE A 192 ? ILE A 186  . ? 1_555 ? 
15 AC3 6  HOH H .   ? HOH A 2099 . ? 1_555 ? 
16 AC3 6  HOH H .   ? HOH A 2101 . ? 1_555 ? 
17 AC3 6  HOH I .   ? HOH P 2026 . ? 1_555 ? 
18 AC3 6  HOH I .   ? HOH P 2027 . ? 1_555 ? 
19 AC4 22 PHE A 14  ? PHE A 8    . ? 1_555 ? 
20 AC4 22 ASP A 15  ? ASP A 9    . ? 1_555 ? 
21 AC4 22 TYR A 16  ? TYR A 10   . ? 1_555 ? 
22 AC4 22 PHE A 17  ? PHE A 11   . ? 1_555 ? 
23 AC4 22 TYR A 18  ? TYR A 12   . ? 1_555 ? 
24 AC4 22 ALA A 50  ? ALA A 44   . ? 1_555 ? 
25 AC4 22 THR A 51  ? THR A 45   . ? 1_555 ? 
26 AC4 22 TYR A 54  ? TYR A 48   . ? 1_555 ? 
27 AC4 22 ARG A 57  ? ARG A 51   . ? 1_555 ? 
28 AC4 22 ASP A 111 ? ASP A 105  . ? 1_555 ? 
29 AC4 22 LYS A 165 ? LYS A 159  . ? 1_555 ? 
30 AC4 22 HOH H .   ? HOH A 2018 . ? 1_555 ? 
31 AC4 22 HOH H .   ? HOH A 2036 . ? 1_555 ? 
32 AC4 22 HOH H .   ? HOH A 2170 . ? 1_555 ? 
33 AC4 22 HOH H .   ? HOH A 2171 . ? 1_555 ? 
34 AC4 22 HOH H .   ? HOH A 2172 . ? 1_555 ? 
35 AC4 22 HOH H .   ? HOH A 2173 . ? 1_555 ? 
36 AC4 22 CA  E .   ? CA  A 3000 . ? 1_555 ? 
37 AC4 22 CA  F .   ? CA  A 3001 . ? 1_555 ? 
38 AC4 22 DA  B 14  ? DA  P 14   . ? 1_555 ? 
39 AC4 22 DC  C 4   ? DC  T 4    . ? 1_555 ? 
40 AC4 22 8OG C 5   ? 8OG T 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2UVW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2UVW 
_atom_sites.fract_transf_matrix[1][1]   0.010333 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009641 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018898 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 7   ? -0.272 34.058 13.944  1.00 52.24 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 7   ? 1.007  34.811 14.086  1.00 50.91 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 7   ? 1.498  35.338 12.735  1.00 49.64 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 7   ? 1.436  34.646 11.723  1.00 50.08 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 7   ? 2.062  33.903 14.722  1.00 53.40 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 7   ? 3.436  34.527 14.878  1.00 58.53 ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 7   ? 4.555  33.563 15.949  1.00 65.57 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 7   ? 4.879  32.072 14.900  1.00 61.19 ? 1    MET A CE    1 
ATOM   9    N  N     . ILE A 1 8   ? 1.959  36.583 12.726  1.00 48.54 ? 2    ILE A N     1 
ATOM   10   C  CA    . ILE A 1 8   ? 2.483  37.217 11.514  1.00 47.94 ? 2    ILE A CA    1 
ATOM   11   C  C     . ILE A 1 8   ? 3.865  37.782 11.840  1.00 45.29 ? 2    ILE A C     1 
ATOM   12   O  O     . ILE A 1 8   ? 3.976  38.784 12.549  1.00 44.36 ? 2    ILE A O     1 
ATOM   13   C  CB    . ILE A 1 8   ? 1.569  38.375 11.033  1.00 48.17 ? 2    ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 8   ? 0.261  37.806 10.478  1.00 49.80 ? 2    ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 8   ? 2.288  39.213 9.976   1.00 47.15 ? 2    ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 8   ? -0.707 38.874 9.979   1.00 51.86 ? 2    ILE A CD1   1 
ATOM   17   N  N     . VAL A 1 9   ? 4.914  37.143 11.324  1.00 43.34 ? 3    VAL A N     1 
ATOM   18   C  CA    . VAL A 1 9   ? 6.277  37.591 11.604  1.00 40.88 ? 3    VAL A CA    1 
ATOM   19   C  C     . VAL A 1 9   ? 6.909  38.371 10.458  1.00 40.17 ? 3    VAL A C     1 
ATOM   20   O  O     . VAL A 1 9   ? 6.854  37.970 9.296   1.00 38.31 ? 3    VAL A O     1 
ATOM   21   C  CB    . VAL A 1 9   ? 7.213  36.387 11.973  1.00 41.20 ? 3    VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 9   ? 8.642  36.875 12.208  1.00 39.94 ? 3    VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 9   ? 6.714  35.697 13.223  1.00 37.65 ? 3    VAL A CG2   1 
ATOM   24   N  N     . LEU A 1 10  ? 7.505  39.507 10.806  1.00 41.74 ? 4    LEU A N     1 
ATOM   25   C  CA    . LEU A 1 10  ? 8.193  40.349 9.832   1.00 40.61 ? 4    LEU A CA    1 
ATOM   26   C  C     . LEU A 1 10  ? 9.671  40.282 10.233  1.00 39.00 ? 4    LEU A C     1 
ATOM   27   O  O     . LEU A 1 10  ? 10.031 40.626 11.355  1.00 39.99 ? 4    LEU A O     1 
ATOM   28   C  CB    . LEU A 1 10  ? 7.653  41.785 9.906   1.00 41.04 ? 4    LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 10  ? 8.188  42.849 8.937   1.00 41.57 ? 4    LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 10  ? 7.144  43.948 8.734   1.00 41.01 ? 4    LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 10  ? 9.486  43.423 9.478   1.00 39.10 ? 4    LEU A CD2   1 
ATOM   32   N  N     . PHE A 1 11  ? 10.512 39.801 9.326   1.00 38.67 ? 5    PHE A N     1 
ATOM   33   C  CA    . PHE A 1 11  ? 11.952 39.660 9.590   1.00 35.89 ? 5    PHE A CA    1 
ATOM   34   C  C     . PHE A 1 11  ? 12.757 40.675 8.775   1.00 33.28 ? 5    PHE A C     1 
ATOM   35   O  O     . PHE A 1 11  ? 12.496 40.872 7.588   1.00 30.68 ? 5    PHE A O     1 
ATOM   36   C  CB    . PHE A 1 11  ? 12.399 38.228 9.241   1.00 34.80 ? 5    PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 11  ? 13.899 38.006 9.299   1.00 34.50 ? 5    PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 11  ? 14.574 37.970 10.517  1.00 34.18 ? 5    PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 11  ? 14.633 37.814 8.124   1.00 35.74 ? 5    PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 11  ? 15.966 37.743 10.565  1.00 34.65 ? 5    PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 11  ? 16.021 37.590 8.161   1.00 33.24 ? 5    PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 11  ? 16.689 37.554 9.382   1.00 30.25 ? 5    PHE A CZ    1 
ATOM   43   N  N     . VAL A 1 12  ? 13.721 41.323 9.424   1.00 32.98 ? 6    VAL A N     1 
ATOM   44   C  CA    . VAL A 1 12  ? 14.575 42.303 8.754   1.00 32.49 ? 6    VAL A CA    1 
ATOM   45   C  C     . VAL A 1 12  ? 16.028 41.840 8.791   1.00 31.59 ? 6    VAL A C     1 
ATOM   46   O  O     . VAL A 1 12  ? 16.507 41.370 9.821   1.00 29.23 ? 6    VAL A O     1 
ATOM   47   C  CB    . VAL A 1 12  ? 14.497 43.694 9.418   1.00 34.71 ? 6    VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 12  ? 15.269 44.706 8.571   1.00 34.02 ? 6    VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 12  ? 13.040 44.128 9.569   1.00 35.32 ? 6    VAL A CG2   1 
ATOM   50   N  N     . ASP A 1 13  ? 16.713 41.998 7.659   1.00 29.84 ? 7    ASP A N     1 
ATOM   51   C  CA    . ASP A 1 13  ? 18.104 41.585 7.479   1.00 30.12 ? 7    ASP A CA    1 
ATOM   52   C  C     . ASP A 1 13  ? 18.838 42.685 6.676   1.00 29.66 ? 7    ASP A C     1 
ATOM   53   O  O     . ASP A 1 13  ? 18.527 42.903 5.507   1.00 30.11 ? 7    ASP A O     1 
ATOM   54   C  CB    . ASP A 1 13  ? 18.096 40.234 6.723   1.00 30.61 ? 7    ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 13  ? 19.458 39.561 6.678   1.00 34.05 ? 7    ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 13  ? 19.549 38.337 6.392   1.00 34.99 ? 7    ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 13  ? 20.439 40.255 6.928   1.00 30.31 ? 7    ASP A OD2   1 
ATOM   58   N  N     . PHE A 1 14  ? 19.806 43.365 7.292   1.00 28.64 ? 8    PHE A N     1 
ATOM   59   C  CA    . PHE A 1 14  ? 20.533 44.457 6.626   1.00 26.63 ? 8    PHE A CA    1 
ATOM   60   C  C     . PHE A 1 14  ? 21.429 44.004 5.469   1.00 28.12 ? 8    PHE A C     1 
ATOM   61   O  O     . PHE A 1 14  ? 22.223 43.107 5.622   1.00 27.35 ? 8    PHE A O     1 
ATOM   62   C  CB    . PHE A 1 14  ? 21.388 45.221 7.639   1.00 24.57 ? 8    PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 14  ? 20.655 45.605 8.898   1.00 23.73 ? 8    PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 14  ? 19.271 45.695 8.919   1.00 22.33 ? 8    PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 14  ? 21.361 45.862 10.075  1.00 22.48 ? 8    PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 14  ? 18.599 46.032 10.095  1.00 21.89 ? 8    PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 14  ? 20.699 46.197 11.249  1.00 21.09 ? 8    PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 14  ? 19.318 46.282 11.259  1.00 22.52 ? 8    PHE A CZ    1 
ATOM   69   N  N     . ASP A 1 15  ? 21.341 44.663 4.317   1.00 29.58 ? 9    ASP A N     1 
ATOM   70   C  CA    . ASP A 1 15  ? 22.146 44.257 3.162   1.00 27.88 ? 9    ASP A CA    1 
ATOM   71   C  C     . ASP A 1 15  ? 23.675 44.455 3.296   1.00 26.73 ? 9    ASP A C     1 
ATOM   72   O  O     . ASP A 1 15  ? 24.130 45.518 3.721   1.00 24.95 ? 9    ASP A O     1 
ATOM   73   C  CB    . ASP A 1 15  ? 21.636 44.978 1.906   1.00 29.67 ? 9    ASP A CB    1 
ATOM   74   C  CG    . ASP A 1 15  ? 20.178 44.618 1.558   1.00 34.25 ? 9    ASP A CG    1 
ATOM   75   O  OD1   . ASP A 1 15  ? 19.702 43.509 1.906   1.00 30.54 ? 9    ASP A OD1   1 
ATOM   76   O  OD2   . ASP A 1 15  ? 19.515 45.453 0.907   1.00 36.39 ? 9    ASP A OD2   1 
ATOM   77   N  N     . TYR A 1 16  ? 24.449 43.429 2.925   1.00 23.46 ? 10   TYR A N     1 
ATOM   78   C  CA    . TYR A 1 16  ? 25.925 43.464 2.999   1.00 26.60 ? 10   TYR A CA    1 
ATOM   79   C  C     . TYR A 1 16  ? 26.382 44.488 4.028   1.00 26.33 ? 10   TYR A C     1 
ATOM   80   O  O     . TYR A 1 16  ? 27.297 45.284 3.801   1.00 25.30 ? 10   TYR A O     1 
ATOM   81   C  CB    . TYR A 1 16  ? 26.526 43.792 1.621   1.00 28.83 ? 10   TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 16  ? 26.221 45.182 1.053   1.00 31.19 ? 10   TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 16  ? 27.226 46.160 0.968   1.00 33.64 ? 10   TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 16  ? 24.965 45.491 0.532   1.00 33.09 ? 10   TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 16  ? 26.989 47.398 0.373   1.00 29.73 ? 10   TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 16  ? 24.711 46.740 -0.070  1.00 31.93 ? 10   TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 16  ? 25.726 47.683 -0.146  1.00 34.24 ? 10   TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 16  ? 25.494 48.907 -0.746  1.00 34.31 ? 10   TYR A OH    1 
ATOM   89   N  N     . PHE A 1 17  ? 25.746 44.400 5.188   1.00 25.86 ? 11   PHE A N     1 
ATOM   90   C  CA    . PHE A 1 17  ? 25.921 45.329 6.279   1.00 24.86 ? 11   PHE A CA    1 
ATOM   91   C  C     . PHE A 1 17  ? 27.240 46.039 6.570   1.00 23.42 ? 11   PHE A C     1 
ATOM   92   O  O     . PHE A 1 17  ? 27.276 47.261 6.483   1.00 23.72 ? 11   PHE A O     1 
ATOM   93   C  CB    . PHE A 1 17  ? 25.354 44.711 7.561   1.00 23.14 ? 11   PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 17  ? 25.166 45.709 8.657   1.00 23.33 ? 11   PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 17  ? 24.485 46.898 8.410   1.00 24.83 ? 11   PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 17  ? 25.687 45.481 9.921   1.00 23.67 ? 11   PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 17  ? 24.326 47.859 9.415   1.00 28.49 ? 11   PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 17  ? 25.540 46.432 10.948  1.00 23.76 ? 11   PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 17  ? 24.860 47.623 10.697  1.00 26.25 ? 11   PHE A CZ    1 
ATOM   100  N  N     . TYR A 1 18  ? 28.312 45.336 6.928   1.00 22.44 ? 12   TYR A N     1 
ATOM   101  C  CA    . TYR A 1 18  ? 29.560 46.051 7.217   1.00 22.02 ? 12   TYR A CA    1 
ATOM   102  C  C     . TYR A 1 18  ? 30.050 46.880 6.023   1.00 24.32 ? 12   TYR A C     1 
ATOM   103  O  O     . TYR A 1 18  ? 30.474 48.030 6.182   1.00 24.94 ? 12   TYR A O     1 
ATOM   104  C  CB    . TYR A 1 18  ? 30.675 45.089 7.631   1.00 21.61 ? 12   TYR A CB    1 
ATOM   105  C  CG    . TYR A 1 18  ? 30.487 44.356 8.950   1.00 26.69 ? 12   TYR A CG    1 
ATOM   106  C  CD1   . TYR A 1 18  ? 29.265 44.356 9.635   1.00 24.42 ? 12   TYR A CD1   1 
ATOM   107  C  CD2   . TYR A 1 18  ? 31.540 43.617 9.492   1.00 26.05 ? 12   TYR A CD2   1 
ATOM   108  C  CE1   . TYR A 1 18  ? 29.115 43.635 10.821  1.00 28.18 ? 12   TYR A CE1   1 
ATOM   109  C  CE2   . TYR A 1 18  ? 31.398 42.897 10.670  1.00 28.90 ? 12   TYR A CE2   1 
ATOM   110  C  CZ    . TYR A 1 18  ? 30.191 42.907 11.328  1.00 27.54 ? 12   TYR A CZ    1 
ATOM   111  O  OH    . TYR A 1 18  ? 30.087 42.175 12.480  1.00 31.65 ? 12   TYR A OH    1 
ATOM   112  N  N     . ALA A 1 19  ? 30.003 46.302 4.829   1.00 23.16 ? 13   ALA A N     1 
ATOM   113  C  CA    . ALA A 1 19  ? 30.464 47.027 3.658   1.00 24.36 ? 13   ALA A CA    1 
ATOM   114  C  C     . ALA A 1 19  ? 29.565 48.241 3.394   1.00 26.27 ? 13   ALA A C     1 
ATOM   115  O  O     . ALA A 1 19  ? 30.054 49.330 3.053   1.00 27.76 ? 13   ALA A O     1 
ATOM   116  C  CB    . ALA A 1 19  ? 30.497 46.088 2.438   1.00 22.00 ? 13   ALA A CB    1 
ATOM   117  N  N     . GLN A 1 20  ? 28.257 48.077 3.572   1.00 24.57 ? 14   GLN A N     1 
ATOM   118  C  CA    . GLN A 1 20  ? 27.349 49.196 3.333   1.00 25.75 ? 14   GLN A CA    1 
ATOM   119  C  C     . GLN A 1 20  ? 27.557 50.344 4.327   1.00 27.99 ? 14   GLN A C     1 
ATOM   120  O  O     . GLN A 1 20  ? 27.366 51.519 3.985   1.00 26.46 ? 14   GLN A O     1 
ATOM   121  C  CB    . GLN A 1 20  ? 25.885 48.733 3.376   1.00 26.68 ? 14   GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 20  ? 24.928 49.753 2.762   1.00 28.22 ? 14   GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 20  ? 23.450 49.402 2.910   1.00 31.67 ? 14   GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 20  ? 22.588 50.220 2.595   1.00 33.37 ? 14   GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 20  ? 23.150 48.192 3.389   1.00 29.82 ? 14   GLN A NE2   1 
ATOM   126  N  N     . VAL A 1 21  ? 27.937 50.019 5.560   1.00 28.57 ? 15   VAL A N     1 
ATOM   127  C  CA    . VAL A 1 21  ? 28.162 51.071 6.542   1.00 29.34 ? 15   VAL A CA    1 
ATOM   128  C  C     . VAL A 1 21  ? 29.388 51.889 6.119   1.00 31.46 ? 15   VAL A C     1 
ATOM   129  O  O     . VAL A 1 21  ? 29.399 53.124 6.236   1.00 29.04 ? 15   VAL A O     1 
ATOM   130  C  CB    . VAL A 1 21  ? 28.367 50.485 7.969   1.00 28.34 ? 15   VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 21  ? 28.852 51.569 8.927   1.00 28.00 ? 15   VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 21  ? 27.050 49.885 8.479   1.00 27.56 ? 15   VAL A CG2   1 
ATOM   133  N  N     . GLU A 1 22  ? 30.417 51.207 5.620   1.00 30.60 ? 16   GLU A N     1 
ATOM   134  C  CA    . GLU A 1 22  ? 31.615 51.905 5.178   1.00 33.55 ? 16   GLU A CA    1 
ATOM   135  C  C     . GLU A 1 22  ? 31.265 52.842 4.004   1.00 34.29 ? 16   GLU A C     1 
ATOM   136  O  O     . GLU A 1 22  ? 31.859 53.907 3.843   1.00 33.33 ? 16   GLU A O     1 
ATOM   137  C  CB    . GLU A 1 22  ? 32.698 50.895 4.769   1.00 33.24 ? 16   GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 22  ? 33.253 50.050 5.921   1.00 33.65 ? 16   GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 22  ? 34.118 50.852 6.885   1.00 38.20 ? 16   GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 22  ? 34.313 52.060 6.641   1.00 39.50 ? 16   GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 22  ? 34.609 50.284 7.888   1.00 37.40 ? 16   GLU A OE2   1 
ATOM   142  N  N     . GLU A 1 23  ? 30.294 52.444 3.190   1.00 35.26 ? 17   GLU A N     1 
ATOM   143  C  CA    . GLU A 1 23  ? 29.878 53.269 2.064   1.00 37.65 ? 17   GLU A CA    1 
ATOM   144  C  C     . GLU A 1 23  ? 29.158 54.514 2.576   1.00 38.48 ? 17   GLU A C     1 
ATOM   145  O  O     . GLU A 1 23  ? 29.452 55.627 2.146   1.00 40.83 ? 17   GLU A O     1 
ATOM   146  C  CB    . GLU A 1 23  ? 28.956 52.482 1.122   1.00 36.38 ? 17   GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 23  ? 29.685 51.428 0.295   1.00 37.77 ? 17   GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 23  ? 28.788 50.711 -0.716  1.00 39.36 ? 17   GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 23  ? 29.328 49.896 -1.494  1.00 40.37 ? 17   GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 23  ? 27.554 50.945 -0.733  1.00 38.50 ? 17   GLU A OE2   1 
ATOM   151  N  N     . VAL A 1 24  ? 28.216 54.320 3.494   1.00 37.16 ? 18   VAL A N     1 
ATOM   152  C  CA    . VAL A 1 24  ? 27.466 55.429 4.072   1.00 37.02 ? 18   VAL A CA    1 
ATOM   153  C  C     . VAL A 1 24  ? 28.441 56.450 4.643   1.00 36.86 ? 18   VAL A C     1 
ATOM   154  O  O     . VAL A 1 24  ? 28.274 57.651 4.446   1.00 37.50 ? 18   VAL A O     1 
ATOM   155  C  CB    . VAL A 1 24  ? 26.500 54.943 5.202   1.00 35.36 ? 18   VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 24  ? 25.958 56.120 5.990   1.00 34.37 ? 18   VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 24  ? 25.340 54.169 4.592   1.00 37.14 ? 18   VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 25  ? 29.461 55.970 5.348   1.00 38.18 ? 19   LEU A N     1 
ATOM   159  C  CA    . LEU A 1 25  ? 30.465 56.852 5.940   1.00 37.73 ? 19   LEU A CA    1 
ATOM   160  C  C     . LEU A 1 25  ? 31.428 57.465 4.926   1.00 38.55 ? 19   LEU A C     1 
ATOM   161  O  O     . LEU A 1 25  ? 32.009 58.518 5.179   1.00 39.37 ? 19   LEU A O     1 
ATOM   162  C  CB    . LEU A 1 25  ? 31.249 56.103 7.020   1.00 37.66 ? 19   LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 25  ? 30.617 56.186 8.416   1.00 38.42 ? 19   LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 25  ? 29.098 56.061 8.327   1.00 37.11 ? 19   LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 25  ? 31.204 55.103 9.292   1.00 37.44 ? 19   LEU A CD2   1 
ATOM   166  N  N     . ASN A 1 26  ? 31.598 56.803 3.786   1.00 37.81 ? 20   ASN A N     1 
ATOM   167  C  CA    . ASN A 1 26  ? 32.480 57.300 2.743   1.00 38.84 ? 20   ASN A CA    1 
ATOM   168  C  C     . ASN A 1 26  ? 31.872 56.944 1.396   1.00 39.49 ? 20   ASN A C     1 
ATOM   169  O  O     . ASN A 1 26  ? 32.278 55.983 0.742   1.00 37.77 ? 20   ASN A O     1 
ATOM   170  C  CB    . ASN A 1 26  ? 33.867 56.686 2.881   1.00 40.38 ? 20   ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 26  ? 34.830 57.187 1.827   1.00 43.93 ? 20   ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 26  ? 36.024 56.908 1.891   1.00 47.30 ? 20   ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 26  ? 34.318 57.922 0.845   1.00 41.71 ? 20   ASN A ND2   1 
ATOM   174  N  N     . PRO A 1 27  ? 30.873 57.731 0.967   1.00 40.89 ? 21   PRO A N     1 
ATOM   175  C  CA    . PRO A 1 27  ? 30.128 57.594 -0.287  1.00 39.73 ? 21   PRO A CA    1 
ATOM   176  C  C     . PRO A 1 27  ? 30.969 57.413 -1.553  1.00 40.30 ? 21   PRO A C     1 
ATOM   177  O  O     . PRO A 1 27  ? 30.511 56.794 -2.512  1.00 38.72 ? 21   PRO A O     1 
ATOM   178  C  CB    . PRO A 1 27  ? 29.291 58.866 -0.321  1.00 41.77 ? 21   PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 27  ? 29.005 59.100 1.131   1.00 40.52 ? 21   PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 27  ? 30.355 58.865 1.759   1.00 39.98 ? 21   PRO A CD    1 
ATOM   181  N  N     . SER A 1 28  ? 32.190 57.942 -1.563  1.00 39.45 ? 22   SER A N     1 
ATOM   182  C  CA    . SER A 1 28  ? 33.039 57.804 -2.742  1.00 41.31 ? 22   SER A CA    1 
ATOM   183  C  C     . SER A 1 28  ? 33.345 56.343 -3.039  1.00 41.32 ? 22   SER A C     1 
ATOM   184  O  O     . SER A 1 28  ? 33.803 56.016 -4.133  1.00 42.45 ? 22   SER A O     1 
ATOM   185  C  CB    . SER A 1 28  ? 34.349 58.564 -2.561  1.00 40.98 ? 22   SER A CB    1 
ATOM   186  O  OG    . SER A 1 28  ? 35.146 57.954 -1.566  1.00 45.16 ? 22   SER A OG    1 
ATOM   187  N  N     . LEU A 1 29  ? 33.091 55.471 -2.062  1.00 41.14 ? 23   LEU A N     1 
ATOM   188  C  CA    . LEU A 1 29  ? 33.330 54.039 -2.209  1.00 39.98 ? 23   LEU A CA    1 
ATOM   189  C  C     . LEU A 1 29  ? 32.230 53.364 -3.012  1.00 39.70 ? 23   LEU A C     1 
ATOM   190  O  O     . LEU A 1 29  ? 32.472 52.364 -3.700  1.00 38.22 ? 23   LEU A O     1 
ATOM   191  C  CB    . LEU A 1 29  ? 33.407 53.366 -0.836  1.00 40.01 ? 23   LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 29  ? 34.617 53.686 0.039   1.00 40.40 ? 23   LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 29  ? 34.436 53.030 1.407   1.00 41.29 ? 23   LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 29  ? 35.888 53.194 -0.643  1.00 38.75 ? 23   LEU A CD2   1 
ATOM   195  N  N     . LYS A 1 30  ? 31.017 53.901 -2.909  1.00 39.27 ? 24   LYS A N     1 
ATOM   196  C  CA    . LYS A 1 30  ? 29.886 53.327 -3.614  1.00 40.35 ? 24   LYS A CA    1 
ATOM   197  C  C     . LYS A 1 30  ? 30.193 53.112 -5.086  1.00 40.90 ? 24   LYS A C     1 
ATOM   198  O  O     . LYS A 1 30  ? 30.819 53.952 -5.728  1.00 41.42 ? 24   LYS A O     1 
ATOM   199  C  CB    . LYS A 1 30  ? 28.649 54.216 -3.465  1.00 41.10 ? 24   LYS A CB    1 
ATOM   200  C  CG    . LYS A 1 30  ? 27.990 54.133 -2.102  0.50 39.65 ? 24   LYS A CG    1 
ATOM   201  C  CD    . LYS A 1 30  ? 26.527 54.548 -2.172  0.50 39.01 ? 24   LYS A CD    1 
ATOM   202  C  CE    . LYS A 1 30  ? 25.847 54.425 -0.813  0.50 38.31 ? 24   LYS A CE    1 
ATOM   203  N  NZ    . LYS A 1 30  ? 25.859 53.028 -0.283  0.50 35.29 ? 24   LYS A NZ    1 
ATOM   204  N  N     . GLY A 1 31  ? 29.763 51.973 -5.612  1.00 41.62 ? 25   GLY A N     1 
ATOM   205  C  CA    . GLY A 1 31  ? 30.001 51.691 -7.013  1.00 43.05 ? 25   GLY A CA    1 
ATOM   206  C  C     . GLY A 1 31  ? 31.132 50.723 -7.274  1.00 43.80 ? 25   GLY A C     1 
ATOM   207  O  O     . GLY A 1 31  ? 31.016 49.871 -8.151  1.00 45.50 ? 25   GLY A O     1 
ATOM   208  N  N     . LYS A 1 32  ? 32.231 50.842 -6.533  1.00 43.54 ? 26   LYS A N     1 
ATOM   209  C  CA    . LYS A 1 32  ? 33.355 49.934 -6.739  1.00 42.91 ? 26   LYS A CA    1 
ATOM   210  C  C     . LYS A 1 32  ? 33.317 48.807 -5.712  1.00 40.74 ? 26   LYS A C     1 
ATOM   211  O  O     . LYS A 1 32  ? 32.608 48.895 -4.725  1.00 39.34 ? 26   LYS A O     1 
ATOM   212  C  CB    . LYS A 1 32  ? 34.691 50.686 -6.639  1.00 45.10 ? 26   LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 32  ? 34.584 52.162 -6.298  1.00 47.91 ? 26   LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 32  ? 35.942 52.718 -5.880  1.00 49.67 ? 26   LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 32  ? 35.812 54.118 -5.288  1.00 51.69 ? 26   LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 32  ? 37.087 54.619 -4.687  1.00 52.93 ? 26   LYS A NZ    1 
ATOM   217  N  N     . PRO A 1 33  ? 34.072 47.724 -5.946  1.00 40.75 ? 27   PRO A N     1 
ATOM   218  C  CA    . PRO A 1 33  ? 34.064 46.621 -4.977  1.00 37.64 ? 27   PRO A CA    1 
ATOM   219  C  C     . PRO A 1 33  ? 34.717 47.024 -3.649  1.00 35.59 ? 27   PRO A C     1 
ATOM   220  O  O     . PRO A 1 33  ? 35.779 47.654 -3.622  1.00 34.62 ? 27   PRO A O     1 
ATOM   221  C  CB    . PRO A 1 33  ? 34.817 45.517 -5.708  1.00 37.22 ? 27   PRO A CB    1 
ATOM   222  C  CG    . PRO A 1 33  ? 35.791 46.274 -6.541  1.00 41.85 ? 27   PRO A CG    1 
ATOM   223  C  CD    . PRO A 1 33  ? 34.973 47.436 -7.074  1.00 40.86 ? 27   PRO A CD    1 
ATOM   224  N  N     . VAL A 1 34  ? 34.047 46.687 -2.550  1.00 32.23 ? 28   VAL A N     1 
ATOM   225  C  CA    . VAL A 1 34  ? 34.533 47.009 -1.214  1.00 29.87 ? 28   VAL A CA    1 
ATOM   226  C  C     . VAL A 1 34  ? 34.597 45.724 -0.411  1.00 27.35 ? 28   VAL A C     1 
ATOM   227  O  O     . VAL A 1 34  ? 33.621 44.984 -0.333  1.00 26.10 ? 28   VAL A O     1 
ATOM   228  C  CB    . VAL A 1 34  ? 33.599 48.016 -0.513  1.00 30.56 ? 28   VAL A CB    1 
ATOM   229  C  CG1   . VAL A 1 34  ? 34.062 48.256 0.928   1.00 30.34 ? 28   VAL A CG1   1 
ATOM   230  C  CG2   . VAL A 1 34  ? 33.578 49.330 -1.300  1.00 29.21 ? 28   VAL A CG2   1 
ATOM   231  N  N     . VAL A 1 35  ? 35.757 45.460 0.174   1.00 23.37 ? 29   VAL A N     1 
ATOM   232  C  CA    . VAL A 1 35  ? 35.966 44.244 0.949   1.00 22.03 ? 29   VAL A CA    1 
ATOM   233  C  C     . VAL A 1 35  ? 36.358 44.586 2.402   1.00 24.69 ? 29   VAL A C     1 
ATOM   234  O  O     . VAL A 1 35  ? 37.369 45.242 2.652   1.00 23.24 ? 29   VAL A O     1 
ATOM   235  C  CB    . VAL A 1 35  ? 37.072 43.377 0.283   1.00 22.54 ? 29   VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 35  ? 37.130 41.984 0.926   1.00 21.26 ? 29   VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 35  ? 36.804 43.261 -1.252  1.00 19.72 ? 29   VAL A CG2   1 
ATOM   238  N  N     . VAL A 1 36  ? 35.556 44.145 3.361   1.00 24.38 ? 30   VAL A N     1 
ATOM   239  C  CA    . VAL A 1 36  ? 35.872 44.435 4.750   1.00 24.36 ? 30   VAL A CA    1 
ATOM   240  C  C     . VAL A 1 36  ? 36.592 43.215 5.293   1.00 23.70 ? 30   VAL A C     1 
ATOM   241  O  O     . VAL A 1 36  ? 36.038 42.111 5.282   1.00 21.66 ? 30   VAL A O     1 
ATOM   242  C  CB    . VAL A 1 36  ? 34.591 44.744 5.552   1.00 24.89 ? 30   VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 36  ? 34.937 45.052 6.999   1.00 24.74 ? 30   VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 36  ? 33.879 45.961 4.928   1.00 25.40 ? 30   VAL A CG2   1 
ATOM   245  N  N     . CYS A 1 37  ? 37.821 43.432 5.767   1.00 22.69 ? 31   CYS A N     1 
ATOM   246  C  CA    . CYS A 1 37  ? 38.675 42.351 6.239   1.00 27.74 ? 31   CYS A CA    1 
ATOM   247  C  C     . CYS A 1 37  ? 39.098 42.343 7.707   1.00 28.75 ? 31   CYS A C     1 
ATOM   248  O  O     . CYS A 1 37  ? 39.173 43.376 8.372   1.00 27.82 ? 31   CYS A O     1 
ATOM   249  C  CB    . CYS A 1 37  ? 39.981 42.324 5.438   1.00 31.12 ? 31   CYS A CB    1 
ATOM   250  S  SG    . CYS A 1 37  ? 39.880 42.620 3.660   1.00 37.66 ? 31   CYS A SG    1 
ATOM   251  N  N     . VAL A 1 38  ? 39.421 41.140 8.168   1.00 30.17 ? 32   VAL A N     1 
ATOM   252  C  CA    . VAL A 1 38  ? 39.923 40.917 9.503   1.00 31.45 ? 32   VAL A CA    1 
ATOM   253  C  C     . VAL A 1 38  ? 41.393 40.552 9.274   1.00 31.88 ? 32   VAL A C     1 
ATOM   254  O  O     . VAL A 1 38  ? 41.707 39.414 8.932   1.00 34.06 ? 32   VAL A O     1 
ATOM   255  C  CB    . VAL A 1 38  ? 39.209 39.734 10.185  1.00 31.78 ? 32   VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 38  ? 39.707 39.580 11.617  1.00 28.49 ? 32   VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 38  ? 37.703 39.952 10.158  1.00 31.52 ? 32   VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 39  ? 42.278 41.531 9.427   1.00 34.88 ? 33   PHE A N     1 
ATOM   259  C  CA    . PHE A 1 39  ? 43.709 41.328 9.253   1.00 36.10 ? 33   PHE A CA    1 
ATOM   260  C  C     . PHE A 1 39  ? 44.267 40.747 10.550  1.00 40.41 ? 33   PHE A C     1 
ATOM   261  O  O     . PHE A 1 39  ? 44.335 41.442 11.562  1.00 42.58 ? 33   PHE A O     1 
ATOM   262  C  CB    . PHE A 1 39  ? 44.384 42.659 8.931   1.00 35.16 ? 33   PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 39  ? 44.000 43.231 7.591   1.00 33.30 ? 33   PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 39  ? 43.048 44.240 7.491   1.00 34.35 ? 33   PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 39  ? 44.608 42.770 6.429   1.00 32.22 ? 33   PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 39  ? 42.712 44.784 6.244   1.00 33.18 ? 33   PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 39  ? 44.283 43.300 5.186   1.00 28.87 ? 33   PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 39  ? 43.335 44.308 5.091   1.00 31.40 ? 33   PHE A CZ    1 
ATOM   269  N  N     . SER A 1 40  ? 44.670 39.479 10.514  1.00 42.74 ? 34   SER A N     1 
ATOM   270  C  CA    . SER A 1 40  ? 45.167 38.788 11.706  1.00 46.88 ? 34   SER A CA    1 
ATOM   271  C  C     . SER A 1 40  ? 46.508 39.257 12.255  1.00 49.54 ? 34   SER A C     1 
ATOM   272  O  O     . SER A 1 40  ? 46.917 38.840 13.340  1.00 51.69 ? 34   SER A O     1 
ATOM   273  C  CB    . SER A 1 40  ? 45.229 37.286 11.456  1.00 44.49 ? 34   SER A CB    1 
ATOM   274  O  OG    . SER A 1 40  ? 46.290 36.975 10.583  1.00 46.27 ? 34   SER A OG    1 
ATOM   275  N  N     . GLY A 1 41  ? 47.199 40.113 11.510  1.00 51.57 ? 35   GLY A N     1 
ATOM   276  C  CA    . GLY A 1 41  ? 48.469 40.628 11.980  1.00 53.52 ? 35   GLY A CA    1 
ATOM   277  C  C     . GLY A 1 41  ? 49.662 39.696 11.867  1.00 55.55 ? 35   GLY A C     1 
ATOM   278  O  O     . GLY A 1 41  ? 50.782 40.110 12.152  1.00 56.42 ? 35   GLY A O     1 
ATOM   279  N  N     . ARG A 1 42  ? 49.432 38.446 11.469  1.00 55.90 ? 36   ARG A N     1 
ATOM   280  C  CA    . ARG A 1 42  ? 50.517 37.485 11.319  1.00 56.02 ? 36   ARG A CA    1 
ATOM   281  C  C     . ARG A 1 42  ? 51.445 38.072 10.263  1.00 57.05 ? 36   ARG A C     1 
ATOM   282  O  O     . ARG A 1 42  ? 52.444 38.706 10.606  1.00 57.31 ? 36   ARG A O     1 
ATOM   283  C  CB    . ARG A 1 42  ? 49.960 36.137 10.867  1.00 55.64 ? 36   ARG A CB    1 
ATOM   284  C  CG    . ARG A 1 42  ? 50.668 34.929 11.455  1.00 56.78 ? 36   ARG A CG    1 
ATOM   285  C  CD    . ARG A 1 42  ? 49.826 33.671 11.255  1.00 56.96 ? 36   ARG A CD    1 
ATOM   286  N  NE    . ARG A 1 42  ? 50.427 32.474 11.842  1.00 57.70 ? 36   ARG A NE    1 
ATOM   287  C  CZ    . ARG A 1 42  ? 50.826 32.371 13.107  1.00 58.92 ? 36   ARG A CZ    1 
ATOM   288  N  NH1   . ARG A 1 42  ? 50.698 33.395 13.934  1.00 59.61 ? 36   ARG A NH1   1 
ATOM   289  N  NH2   . ARG A 1 42  ? 51.340 31.232 13.552  1.00 60.21 ? 36   ARG A NH2   1 
ATOM   290  N  N     . PHE A 1 43  ? 51.128 37.873 8.986   1.00 57.52 ? 37   PHE A N     1 
ATOM   291  C  CA    . PHE A 1 43  ? 51.953 38.451 7.933   1.00 57.06 ? 37   PHE A CA    1 
ATOM   292  C  C     . PHE A 1 43  ? 51.284 39.638 7.226   1.00 57.68 ? 37   PHE A C     1 
ATOM   293  O  O     . PHE A 1 43  ? 50.425 40.296 7.813   1.00 58.22 ? 37   PHE A O     1 
ATOM   294  C  CB    . PHE A 1 43  ? 52.450 37.380 6.937   1.00 56.82 ? 37   PHE A CB    1 
ATOM   295  C  CG    . PHE A 1 43  ? 51.405 36.401 6.459   1.00 58.13 ? 37   PHE A CG    1 
ATOM   296  C  CD1   . PHE A 1 43  ? 50.580 36.703 5.375   1.00 59.85 ? 37   PHE A CD1   1 
ATOM   297  C  CD2   . PHE A 1 43  ? 51.320 35.127 7.019   1.00 58.08 ? 37   PHE A CD2   1 
ATOM   298  C  CE1   . PHE A 1 43  ? 49.689 35.746 4.843   1.00 57.75 ? 37   PHE A CE1   1 
ATOM   299  C  CE2   . PHE A 1 43  ? 50.434 34.163 6.496   1.00 58.75 ? 37   PHE A CE2   1 
ATOM   300  C  CZ    . PHE A 1 43  ? 49.621 34.476 5.404   1.00 57.24 ? 37   PHE A CZ    1 
ATOM   301  N  N     . GLU A 1 44  ? 51.679 39.930 5.990   1.00 57.61 ? 38   GLU A N     1 
ATOM   302  C  CA    . GLU A 1 44  ? 51.132 41.080 5.254   1.00 57.06 ? 38   GLU A CA    1 
ATOM   303  C  C     . GLU A 1 44  ? 49.606 41.097 5.144   1.00 54.37 ? 38   GLU A C     1 
ATOM   304  O  O     . GLU A 1 44  ? 48.932 41.924 5.763   1.00 54.32 ? 38   GLU A O     1 
ATOM   305  C  CB    . GLU A 1 44  ? 51.736 41.148 3.845   1.00 60.69 ? 38   GLU A CB    1 
ATOM   306  C  CG    . GLU A 1 44  ? 51.422 42.440 3.100   1.00 64.84 ? 38   GLU A CG    1 
ATOM   307  C  CD    . GLU A 1 44  ? 52.244 43.620 3.599   1.00 68.51 ? 38   GLU A CD    1 
ATOM   308  O  OE1   . GLU A 1 44  ? 53.465 43.662 3.318   1.00 70.05 ? 38   GLU A OE1   1 
ATOM   309  O  OE2   . GLU A 1 44  ? 51.674 44.505 4.279   1.00 70.07 ? 38   GLU A OE2   1 
ATOM   310  N  N     . ASP A 1 45  ? 49.065 40.192 4.339   1.00 48.52 ? 39   ASP A N     1 
ATOM   311  C  CA    . ASP A 1 45  ? 47.629 40.114 4.164   1.00 42.56 ? 39   ASP A CA    1 
ATOM   312  C  C     . ASP A 1 45  ? 47.049 38.833 4.767   1.00 38.76 ? 39   ASP A C     1 
ATOM   313  O  O     . ASP A 1 45  ? 46.201 38.169 4.169   1.00 36.05 ? 39   ASP A O     1 
ATOM   314  C  CB    . ASP A 1 45  ? 47.280 40.237 2.675   0.50 42.17 ? 39   ASP A CB    1 
ATOM   315  C  CG    . ASP A 1 45  ? 47.609 41.611 2.118   0.50 40.71 ? 39   ASP A CG    1 
ATOM   316  O  OD1   . ASP A 1 45  ? 47.225 42.619 2.747   0.50 41.49 ? 39   ASP A OD1   1 
ATOM   317  O  OD2   . ASP A 1 45  ? 48.248 41.691 1.052   0.50 42.13 ? 39   ASP A OD2   1 
ATOM   318  N  N     . SER A 1 46  ? 47.523 38.479 5.954   1.00 35.69 ? 40   SER A N     1 
ATOM   319  C  CA    . SER A 1 46  ? 47.008 37.297 6.622   1.00 34.31 ? 40   SER A CA    1 
ATOM   320  C  C     . SER A 1 46  ? 45.651 37.708 7.192   1.00 31.77 ? 40   SER A C     1 
ATOM   321  O  O     . SER A 1 46  ? 45.467 38.846 7.616   1.00 33.11 ? 40   SER A O     1 
ATOM   322  C  CB    . SER A 1 46  ? 47.968 36.836 7.739   1.00 34.26 ? 40   SER A CB    1 
ATOM   323  O  OG    . SER A 1 46  ? 48.086 37.789 8.786   1.00 36.28 ? 40   SER A OG    1 
ATOM   324  N  N     . GLY A 1 47  ? 44.688 36.798 7.158   1.00 31.07 ? 41   GLY A N     1 
ATOM   325  C  CA    . GLY A 1 47  ? 43.369 37.112 7.674   1.00 30.81 ? 41   GLY A CA    1 
ATOM   326  C  C     . GLY A 1 47  ? 42.266 36.709 6.717   1.00 31.80 ? 41   GLY A C     1 
ATOM   327  O  O     . GLY A 1 47  ? 42.529 36.203 5.626   1.00 33.80 ? 41   GLY A O     1 
ATOM   328  N  N     . ALA A 1 48  ? 41.022 36.953 7.113   1.00 29.25 ? 42   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 48  ? 39.894 36.587 6.284   1.00 28.50 ? 42   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 48  ? 38.983 37.765 6.004   1.00 26.92 ? 42   ALA A C     1 
ATOM   331  O  O     . ALA A 1 48  ? 39.111 38.829 6.608   1.00 25.36 ? 42   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 48  ? 39.107 35.471 6.954   1.00 32.63 ? 42   ALA A CB    1 
ATOM   333  N  N     . VAL A 1 49  ? 38.063 37.565 5.064   1.00 27.73 ? 43   VAL A N     1 
ATOM   334  C  CA    . VAL A 1 49  ? 37.098 38.594 4.702   1.00 26.08 ? 43   VAL A CA    1 
ATOM   335  C  C     . VAL A 1 49  ? 35.879 38.493 5.625   1.00 25.63 ? 43   VAL A C     1 
ATOM   336  O  O     . VAL A 1 49  ? 35.367 37.401 5.860   1.00 26.59 ? 43   VAL A O     1 
ATOM   337  C  CB    . VAL A 1 49  ? 36.659 38.425 3.219   1.00 27.22 ? 43   VAL A CB    1 
ATOM   338  C  CG1   . VAL A 1 49  ? 35.496 39.374 2.885   1.00 22.16 ? 43   VAL A CG1   1 
ATOM   339  C  CG2   . VAL A 1 49  ? 37.851 38.707 2.305   1.00 25.25 ? 43   VAL A CG2   1 
ATOM   340  N  N     . ALA A 1 50  ? 35.432 39.620 6.177   1.00 26.08 ? 44   ALA A N     1 
ATOM   341  C  CA    . ALA A 1 50  ? 34.244 39.608 7.039   1.00 25.77 ? 44   ALA A CA    1 
ATOM   342  C  C     . ALA A 1 50  ? 33.026 39.635 6.129   1.00 26.05 ? 44   ALA A C     1 
ATOM   343  O  O     . ALA A 1 50  ? 32.016 38.973 6.404   1.00 26.10 ? 44   ALA A O     1 
ATOM   344  C  CB    . ALA A 1 50  ? 34.235 40.823 7.972   1.00 27.49 ? 44   ALA A CB    1 
ATOM   345  N  N     . THR A 1 51  ? 33.130 40.426 5.056   1.00 22.40 ? 45   THR A N     1 
ATOM   346  C  CA    . THR A 1 51  ? 32.084 40.536 4.035   1.00 23.68 ? 45   THR A CA    1 
ATOM   347  C  C     . THR A 1 51  ? 32.522 41.462 2.907   1.00 23.33 ? 45   THR A C     1 
ATOM   348  O  O     . THR A 1 51  ? 33.567 42.104 2.979   1.00 22.49 ? 45   THR A O     1 
ATOM   349  C  CB    . THR A 1 51  ? 30.747 41.074 4.597   1.00 24.81 ? 45   THR A CB    1 
ATOM   350  O  OG1   . THR A 1 51  ? 29.695 40.766 3.674   1.00 25.40 ? 45   THR A OG1   1 
ATOM   351  C  CG2   . THR A 1 51  ? 30.796 42.600 4.773   1.00 23.11 ? 45   THR A CG2   1 
ATOM   352  N  N     . ALA A 1 52  ? 31.704 41.553 1.866   1.00 24.84 ? 46   ALA A N     1 
ATOM   353  C  CA    . ALA A 1 52  ? 32.027 42.414 0.736   1.00 24.05 ? 46   ALA A CA    1 
ATOM   354  C  C     . ALA A 1 52  ? 30.740 42.884 0.072   1.00 26.54 ? 46   ALA A C     1 
ATOM   355  O  O     . ALA A 1 52  ? 29.720 42.190 0.137   1.00 24.99 ? 46   ALA A O     1 
ATOM   356  C  CB    . ALA A 1 52  ? 32.885 41.645 -0.265  1.00 23.59 ? 46   ALA A CB    1 
ATOM   357  N  N     . ASN A 1 53  ? 30.767 44.064 -0.549  1.00 24.24 ? 47   ASN A N     1 
ATOM   358  C  CA    . ASN A 1 53  ? 29.564 44.515 -1.224  1.00 27.87 ? 47   ASN A CA    1 
ATOM   359  C  C     . ASN A 1 53  ? 29.305 43.626 -2.452  1.00 29.47 ? 47   ASN A C     1 
ATOM   360  O  O     . ASN A 1 53  ? 30.171 42.843 -2.879  1.00 26.99 ? 47   ASN A O     1 
ATOM   361  C  CB    . ASN A 1 53  ? 29.644 45.998 -1.621  1.00 26.55 ? 47   ASN A CB    1 
ATOM   362  C  CG    . ASN A 1 53  ? 30.786 46.314 -2.585  1.00 27.85 ? 47   ASN A CG    1 
ATOM   363  O  OD1   . ASN A 1 53  ? 31.432 45.433 -3.141  1.00 26.72 ? 47   ASN A OD1   1 
ATOM   364  N  ND2   . ASN A 1 53  ? 31.025 47.605 -2.784  1.00 28.67 ? 47   ASN A ND2   1 
ATOM   365  N  N     . TYR A 1 54  ? 28.105 43.727 -3.006  1.00 30.93 ? 48   TYR A N     1 
ATOM   366  C  CA    . TYR A 1 54  ? 27.754 42.891 -4.135  1.00 34.98 ? 48   TYR A CA    1 
ATOM   367  C  C     . TYR A 1 54  ? 28.667 43.104 -5.349  1.00 34.48 ? 48   TYR A C     1 
ATOM   368  O  O     . TYR A 1 54  ? 28.907 42.171 -6.107  1.00 35.56 ? 48   TYR A O     1 
ATOM   369  C  CB    . TYR A 1 54  ? 26.260 43.061 -4.469  1.00 37.38 ? 48   TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 54  ? 25.345 42.370 -3.452  1.00 41.08 ? 48   TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 54  ? 25.145 42.902 -2.172  1.00 42.29 ? 48   TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 54  ? 24.712 41.160 -3.763  1.00 41.80 ? 48   TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 54  ? 24.334 42.249 -1.229  1.00 43.06 ? 48   TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 54  ? 23.904 40.496 -2.830  1.00 44.67 ? 48   TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 54  ? 23.717 41.048 -1.566  1.00 46.13 ? 48   TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 54  ? 22.905 40.399 -0.655  1.00 43.36 ? 48   TYR A OH    1 
ATOM   377  N  N     . GLU A 1 55  ? 29.206 44.309 -5.509  1.00 34.61 ? 49   GLU A N     1 
ATOM   378  C  CA    . GLU A 1 55  ? 30.117 44.570 -6.621  1.00 37.29 ? 49   GLU A CA    1 
ATOM   379  C  C     . GLU A 1 55  ? 31.275 43.570 -6.519  1.00 38.30 ? 49   GLU A C     1 
ATOM   380  O  O     . GLU A 1 55  ? 31.764 43.056 -7.528  1.00 37.95 ? 49   GLU A O     1 
ATOM   381  C  CB    . GLU A 1 55  ? 30.673 45.997 -6.551  0.50 37.22 ? 49   GLU A CB    1 
ATOM   382  C  CG    . GLU A 1 55  ? 29.704 47.114 -6.947  0.50 39.45 ? 49   GLU A CG    1 
ATOM   383  C  CD    . GLU A 1 55  ? 28.516 47.247 -6.010  0.50 40.86 ? 49   GLU A CD    1 
ATOM   384  O  OE1   . GLU A 1 55  ? 28.713 47.233 -4.777  0.50 39.22 ? 49   GLU A OE1   1 
ATOM   385  O  OE2   . GLU A 1 55  ? 27.380 47.380 -6.516  0.50 43.02 ? 49   GLU A OE2   1 
ATOM   386  N  N     . ALA A 1 56  ? 31.703 43.294 -5.290  1.00 35.46 ? 50   ALA A N     1 
ATOM   387  C  CA    . ALA A 1 56  ? 32.797 42.363 -5.048  1.00 32.26 ? 50   ALA A CA    1 
ATOM   388  C  C     . ALA A 1 56  ? 32.357 40.910 -5.156  1.00 30.71 ? 50   ALA A C     1 
ATOM   389  O  O     . ALA A 1 56  ? 33.111 40.070 -5.641  1.00 31.10 ? 50   ALA A O     1 
ATOM   390  C  CB    . ALA A 1 56  ? 33.407 42.617 -3.666  1.00 33.66 ? 50   ALA A CB    1 
ATOM   391  N  N     . ARG A 1 57  ? 31.148 40.606 -4.695  1.00 31.02 ? 51   ARG A N     1 
ATOM   392  C  CA    . ARG A 1 57  ? 30.648 39.230 -4.739  1.00 33.18 ? 51   ARG A CA    1 
ATOM   393  C  C     . ARG A 1 57  ? 30.478 38.669 -6.143  1.00 34.84 ? 51   ARG A C     1 
ATOM   394  O  O     . ARG A 1 57  ? 30.564 37.454 -6.346  1.00 33.86 ? 51   ARG A O     1 
ATOM   395  C  CB    . ARG A 1 57  ? 29.320 39.114 -3.980  1.00 35.38 ? 51   ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 57  ? 29.502 38.684 -2.540  1.00 35.53 ? 51   ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 57  ? 28.804 39.591 -1.534  1.00 39.65 ? 51   ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 57  ? 27.535 39.036 -1.082  1.00 38.98 ? 51   ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 57  ? 26.940 39.351 0.068   1.00 37.76 ? 51   ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 57  ? 27.492 40.221 0.910   1.00 35.04 ? 51   ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 57  ? 25.783 38.790 0.377   1.00 32.23 ? 51   ARG A NH2   1 
ATOM   402  N  N     . LYS A 1 58  ? 30.227 39.558 -7.102  1.00 36.88 ? 52   LYS A N     1 
ATOM   403  C  CA    . LYS A 1 58  ? 30.050 39.164 -8.489  1.00 38.54 ? 52   LYS A CA    1 
ATOM   404  C  C     . LYS A 1 58  ? 31.222 38.302 -8.920  1.00 38.61 ? 52   LYS A C     1 
ATOM   405  O  O     . LYS A 1 58  ? 31.078 37.428 -9.767  1.00 41.26 ? 52   LYS A O     1 
ATOM   406  C  CB    . LYS A 1 58  ? 29.973 40.398 -9.387  1.00 39.63 ? 52   LYS A CB    1 
ATOM   407  C  CG    . LYS A 1 58  ? 28.753 41.266 -9.155  1.00 42.61 ? 52   LYS A CG    1 
ATOM   408  C  CD    . LYS A 1 58  ? 27.483 40.497 -9.481  1.00 43.99 ? 52   LYS A CD    1 
ATOM   409  C  CE    . LYS A 1 58  ? 26.229 41.296 -9.138  0.50 42.42 ? 52   LYS A CE    1 
ATOM   410  N  NZ    . LYS A 1 58  ? 24.998 40.542 -9.493  0.50 39.94 ? 52   LYS A NZ    1 
ATOM   411  N  N     . PHE A 1 59  ? 32.386 38.544 -8.334  1.00 37.38 ? 53   PHE A N     1 
ATOM   412  C  CA    . PHE A 1 59  ? 33.558 37.758 -8.688  1.00 38.20 ? 53   PHE A CA    1 
ATOM   413  C  C     . PHE A 1 59  ? 33.982 36.729 -7.658  1.00 38.15 ? 53   PHE A C     1 
ATOM   414  O  O     . PHE A 1 59  ? 35.117 36.263 -7.684  1.00 41.40 ? 53   PHE A O     1 
ATOM   415  C  CB    . PHE A 1 59  ? 34.729 38.676 -8.993  1.00 37.18 ? 53   PHE A CB    1 
ATOM   416  C  CG    . PHE A 1 59  ? 34.395 39.748 -9.969  1.00 40.25 ? 53   PHE A CG    1 
ATOM   417  C  CD1   . PHE A 1 59  ? 34.045 41.018 -9.529  1.00 38.92 ? 53   PHE A CD1   1 
ATOM   418  C  CD2   . PHE A 1 59  ? 34.383 39.476 -11.334 1.00 41.24 ? 53   PHE A CD2   1 
ATOM   419  C  CE1   . PHE A 1 59  ? 33.682 42.009 -10.431 1.00 40.75 ? 53   PHE A CE1   1 
ATOM   420  C  CE2   . PHE A 1 59  ? 34.022 40.458 -12.247 1.00 40.37 ? 53   PHE A CE2   1 
ATOM   421  C  CZ    . PHE A 1 59  ? 33.670 41.729 -11.796 1.00 41.76 ? 53   PHE A CZ    1 
ATOM   422  N  N     . GLY A 1 60  ? 33.084 36.377 -6.747  1.00 38.04 ? 54   GLY A N     1 
ATOM   423  C  CA    . GLY A 1 60  ? 33.422 35.369 -5.764  1.00 37.07 ? 54   GLY A CA    1 
ATOM   424  C  C     . GLY A 1 60  ? 34.054 35.842 -4.464  1.00 37.40 ? 54   GLY A C     1 
ATOM   425  O  O     . GLY A 1 60  ? 34.321 35.017 -3.593  1.00 39.08 ? 54   GLY A O     1 
ATOM   426  N  N     . VAL A 1 61  ? 34.327 37.135 -4.322  1.00 34.69 ? 55   VAL A N     1 
ATOM   427  C  CA    . VAL A 1 61  ? 34.905 37.620 -3.071  1.00 34.40 ? 55   VAL A CA    1 
ATOM   428  C  C     . VAL A 1 61  ? 33.756 37.756 -2.078  1.00 34.00 ? 55   VAL A C     1 
ATOM   429  O  O     . VAL A 1 61  ? 32.870 38.591 -2.244  1.00 32.94 ? 55   VAL A O     1 
ATOM   430  C  CB    . VAL A 1 61  ? 35.599 38.980 -3.249  1.00 33.27 ? 55   VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 61  ? 36.074 39.504 -1.897  1.00 26.34 ? 55   VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 61  ? 36.784 38.824 -4.200  1.00 32.34 ? 55   VAL A CG2   1 
ATOM   433  N  N     . LYS A 1 62  ? 33.776 36.921 -1.048  1.00 34.90 ? 56   LYS A N     1 
ATOM   434  C  CA    . LYS A 1 62  ? 32.719 36.917 -0.049  1.00 34.92 ? 56   LYS A CA    1 
ATOM   435  C  C     . LYS A 1 62  ? 33.260 36.576 1.330   1.00 34.54 ? 56   LYS A C     1 
ATOM   436  O  O     . LYS A 1 62  ? 34.405 36.157 1.471   1.00 31.74 ? 56   LYS A O     1 
ATOM   437  C  CB    . LYS A 1 62  ? 31.670 35.894 -0.452  1.00 38.65 ? 56   LYS A CB    1 
ATOM   438  C  CG    . LYS A 1 62  ? 32.299 34.562 -0.816  1.00 42.85 ? 56   LYS A CG    1 
ATOM   439  C  CD    . LYS A 1 62  ? 31.289 33.537 -1.311  1.00 44.39 ? 56   LYS A CD    1 
ATOM   440  C  CE    . LYS A 1 62  ? 32.019 32.249 -1.654  1.00 46.95 ? 56   LYS A CE    1 
ATOM   441  N  NZ    . LYS A 1 62  ? 31.109 31.102 -1.911  1.00 50.96 ? 56   LYS A NZ    1 
ATOM   442  N  N     . ALA A 1 63  ? 32.414 36.739 2.340   1.00 34.79 ? 57   ALA A N     1 
ATOM   443  C  CA    . ALA A 1 63  ? 32.798 36.471 3.718   1.00 36.45 ? 57   ALA A CA    1 
ATOM   444  C  C     . ALA A 1 63  ? 33.390 35.089 3.878   1.00 37.38 ? 57   ALA A C     1 
ATOM   445  O  O     . ALA A 1 63  ? 32.868 34.113 3.336   1.00 38.30 ? 57   ALA A O     1 
ATOM   446  C  CB    . ALA A 1 63  ? 31.589 36.614 4.636   1.00 35.97 ? 57   ALA A CB    1 
ATOM   447  N  N     . GLY A 1 64  ? 34.498 35.020 4.606   1.00 37.18 ? 58   GLY A N     1 
ATOM   448  C  CA    . GLY A 1 64  ? 35.121 33.742 4.870   1.00 37.50 ? 58   GLY A CA    1 
ATOM   449  C  C     . GLY A 1 64  ? 36.355 33.361 4.079   1.00 37.24 ? 58   GLY A C     1 
ATOM   450  O  O     . GLY A 1 64  ? 37.113 32.499 4.524   1.00 40.64 ? 58   GLY A O     1 
ATOM   451  N  N     . ILE A 1 65  ? 36.577 33.968 2.917   1.00 34.57 ? 59   ILE A N     1 
ATOM   452  C  CA    . ILE A 1 65  ? 37.750 33.600 2.147   1.00 32.73 ? 59   ILE A CA    1 
ATOM   453  C  C     . ILE A 1 65  ? 38.977 34.384 2.558   1.00 31.49 ? 59   ILE A C     1 
ATOM   454  O  O     . ILE A 1 65  ? 38.890 35.539 2.991   1.00 32.12 ? 59   ILE A O     1 
ATOM   455  C  CB    . ILE A 1 65  ? 37.536 33.772 0.612   1.00 32.59 ? 59   ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 65  ? 37.612 35.242 0.213   1.00 31.85 ? 59   ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 65  ? 36.198 33.168 0.204   1.00 32.64 ? 59   ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 65  ? 37.549 35.450 -1.292  1.00 36.12 ? 59   ILE A CD1   1 
ATOM   459  N  N     . PRO A 1 66  ? 40.149 33.757 2.433   1.00 31.11 ? 60   PRO A N     1 
ATOM   460  C  CA    . PRO A 1 66  ? 41.403 34.418 2.797   1.00 30.18 ? 60   PRO A CA    1 
ATOM   461  C  C     . PRO A 1 66  ? 41.546 35.745 2.053   1.00 30.28 ? 60   PRO A C     1 
ATOM   462  O  O     . PRO A 1 66  ? 41.210 35.852 0.866   1.00 30.32 ? 60   PRO A O     1 
ATOM   463  C  CB    . PRO A 1 66  ? 42.465 33.412 2.362   1.00 29.77 ? 60   PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 66  ? 41.752 32.094 2.487   1.00 32.79 ? 60   PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 66  ? 40.389 32.394 1.928   1.00 30.87 ? 60   PRO A CD    1 
ATOM   466  N  N     . ILE A 1 67  ? 42.053 36.751 2.747   1.00 28.53 ? 61   ILE A N     1 
ATOM   467  C  CA    . ILE A 1 67  ? 42.246 38.042 2.128   1.00 29.70 ? 61   ILE A CA    1 
ATOM   468  C  C     . ILE A 1 67  ? 43.132 37.874 0.891   1.00 32.89 ? 61   ILE A C     1 
ATOM   469  O  O     . ILE A 1 67  ? 42.865 38.457 -0.171  1.00 32.40 ? 61   ILE A O     1 
ATOM   470  C  CB    . ILE A 1 67  ? 42.880 39.016 3.122   1.00 29.08 ? 61   ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 67  ? 41.955 39.167 4.337   1.00 27.39 ? 61   ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 67  ? 43.107 40.367 2.476   1.00 27.33 ? 61   ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 67  ? 42.563 39.976 5.466   1.00 23.59 ? 61   ILE A CD1   1 
ATOM   474  N  N     . VAL A 1 68  ? 44.170 37.055 1.011   1.00 33.57 ? 62   VAL A N     1 
ATOM   475  C  CA    . VAL A 1 68  ? 45.073 36.845 -0.113  1.00 35.81 ? 62   VAL A CA    1 
ATOM   476  C  C     . VAL A 1 68  ? 44.370 36.336 -1.372  1.00 36.76 ? 62   VAL A C     1 
ATOM   477  O  O     . VAL A 1 68  ? 44.726 36.725 -2.482  1.00 37.77 ? 62   VAL A O     1 
ATOM   478  C  CB    . VAL A 1 68  ? 46.210 35.883 0.267   1.00 34.96 ? 62   VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 68  ? 47.095 36.543 1.318   1.00 36.49 ? 62   VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 68  ? 45.641 34.567 0.789   1.00 32.55 ? 62   VAL A CG2   1 
ATOM   481  N  N     . GLU A 1 69  ? 43.367 35.481 -1.201  1.00 36.78 ? 63   GLU A N     1 
ATOM   482  C  CA    . GLU A 1 69  ? 42.639 34.950 -2.341  1.00 38.35 ? 63   GLU A CA    1 
ATOM   483  C  C     . GLU A 1 69  ? 41.790 36.059 -2.966  1.00 39.47 ? 63   GLU A C     1 
ATOM   484  O  O     . GLU A 1 69  ? 41.697 36.173 -4.195  1.00 38.72 ? 63   GLU A O     1 
ATOM   485  C  CB    . GLU A 1 69  ? 41.774 33.764 -1.900  1.00 37.90 ? 63   GLU A CB    1 
ATOM   486  C  CG    . GLU A 1 69  ? 40.779 33.239 -2.951  1.00 41.10 ? 63   GLU A CG    1 
ATOM   487  C  CD    . GLU A 1 69  ? 41.426 32.829 -4.283  0.50 39.20 ? 63   GLU A CD    1 
ATOM   488  O  OE1   . GLU A 1 69  ? 41.947 33.705 -5.002  0.50 40.16 ? 63   GLU A OE1   1 
ATOM   489  O  OE2   . GLU A 1 69  ? 41.404 31.630 -4.619  0.50 39.16 ? 63   GLU A OE2   1 
ATOM   490  N  N     . ALA A 1 70  ? 41.191 36.893 -2.119  1.00 38.16 ? 64   ALA A N     1 
ATOM   491  C  CA    . ALA A 1 70  ? 40.381 38.003 -2.601  1.00 36.52 ? 64   ALA A CA    1 
ATOM   492  C  C     . ALA A 1 70  ? 41.280 38.944 -3.421  1.00 36.36 ? 64   ALA A C     1 
ATOM   493  O  O     . ALA A 1 70  ? 40.885 39.428 -4.484  1.00 32.13 ? 64   ALA A O     1 
ATOM   494  C  CB    . ALA A 1 70  ? 39.751 38.761 -1.421  1.00 34.56 ? 64   ALA A CB    1 
ATOM   495  N  N     . LYS A 1 71  ? 42.487 39.189 -2.922  1.00 37.11 ? 65   LYS A N     1 
ATOM   496  C  CA    . LYS A 1 71  ? 43.443 40.069 -3.596  1.00 38.59 ? 65   LYS A CA    1 
ATOM   497  C  C     . LYS A 1 71  ? 43.754 39.568 -5.007  1.00 40.49 ? 65   LYS A C     1 
ATOM   498  O  O     . LYS A 1 71  ? 43.857 40.357 -5.952  1.00 40.71 ? 65   LYS A O     1 
ATOM   499  C  CB    . LYS A 1 71  ? 44.750 40.159 -2.799  1.00 37.77 ? 65   LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 71  ? 44.665 40.923 -1.476  1.00 41.99 ? 65   LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 71  ? 44.327 42.379 -1.688  1.00 42.00 ? 65   LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 71  ? 44.357 43.174 -0.389  1.00 44.39 ? 65   LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 71  ? 45.718 43.564 0.069   1.00 44.89 ? 65   LYS A NZ    1 
ATOM   504  N  N     . LYS A 1 72  ? 43.916 38.257 -5.150  1.00 40.15 ? 66   LYS A N     1 
ATOM   505  C  CA    . LYS A 1 72  ? 44.211 37.695 -6.456  1.00 42.05 ? 66   LYS A CA    1 
ATOM   506  C  C     . LYS A 1 72  ? 43.084 38.035 -7.428  1.00 42.41 ? 66   LYS A C     1 
ATOM   507  O  O     . LYS A 1 72  ? 43.339 38.444 -8.563  1.00 42.11 ? 66   LYS A O     1 
ATOM   508  C  CB    . LYS A 1 72  ? 44.393 36.171 -6.357  1.00 42.33 ? 66   LYS A CB    1 
ATOM   509  C  CG    . LYS A 1 72  ? 45.619 35.769 -5.550  0.50 42.94 ? 66   LYS A CG    1 
ATOM   510  C  CD    . LYS A 1 72  ? 45.746 34.264 -5.365  0.50 43.84 ? 66   LYS A CD    1 
ATOM   511  C  CE    . LYS A 1 72  ? 46.925 33.944 -4.443  0.50 43.87 ? 66   LYS A CE    1 
ATOM   512  N  NZ    . LYS A 1 72  ? 46.961 32.525 -3.975  0.50 44.38 ? 66   LYS A NZ    1 
ATOM   513  N  N     . ILE A 1 73  ? 41.845 37.896 -6.970  1.00 40.79 ? 67   ILE A N     1 
ATOM   514  C  CA    . ILE A 1 73  ? 40.688 38.166 -7.806  1.00 40.78 ? 67   ILE A CA    1 
ATOM   515  C  C     . ILE A 1 73  ? 40.498 39.650 -8.118  1.00 40.75 ? 67   ILE A C     1 
ATOM   516  O  O     . ILE A 1 73  ? 40.335 40.033 -9.279  1.00 40.43 ? 67   ILE A O     1 
ATOM   517  C  CB    . ILE A 1 73  ? 39.417 37.598 -7.151  1.00 40.68 ? 67   ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 73  ? 39.641 36.124 -6.808  1.00 40.69 ? 67   ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 73  ? 38.236 37.719 -8.090  1.00 39.61 ? 67   ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 73  ? 38.495 35.496 -6.048  1.00 41.68 ? 67   ILE A CD1   1 
ATOM   521  N  N     . LEU A 1 74  ? 40.536 40.482 -7.087  1.00 39.69 ? 68   LEU A N     1 
ATOM   522  C  CA    . LEU A 1 74  ? 40.348 41.918 -7.244  1.00 39.42 ? 68   LEU A CA    1 
ATOM   523  C  C     . LEU A 1 74  ? 41.483 42.695 -6.590  1.00 40.52 ? 68   LEU A C     1 
ATOM   524  O  O     . LEU A 1 74  ? 41.297 43.344 -5.562  1.00 41.67 ? 68   LEU A O     1 
ATOM   525  C  CB    . LEU A 1 74  ? 39.015 42.339 -6.617  1.00 39.48 ? 68   LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 74  ? 37.772 41.622 -7.144  1.00 40.83 ? 68   LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 74  ? 36.518 42.121 -6.415  1.00 39.38 ? 68   LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 74  ? 37.665 41.868 -8.647  1.00 40.16 ? 68   LEU A CD2   1 
ATOM   529  N  N     . PRO A 1 75  ? 42.676 42.650 -7.185  1.00 41.35 ? 69   PRO A N     1 
ATOM   530  C  CA    . PRO A 1 75  ? 43.813 43.374 -6.608  1.00 39.94 ? 69   PRO A CA    1 
ATOM   531  C  C     . PRO A 1 75  ? 43.583 44.871 -6.468  1.00 39.37 ? 69   PRO A C     1 
ATOM   532  O  O     . PRO A 1 75  ? 44.248 45.539 -5.677  1.00 37.88 ? 69   PRO A O     1 
ATOM   533  C  CB    . PRO A 1 75  ? 44.951 43.044 -7.571  1.00 40.10 ? 69   PRO A CB    1 
ATOM   534  C  CG    . PRO A 1 75  ? 44.241 42.843 -8.870  1.00 40.67 ? 69   PRO A CG    1 
ATOM   535  C  CD    . PRO A 1 75  ? 43.048 42.022 -8.465  1.00 41.06 ? 69   PRO A CD    1 
ATOM   536  N  N     . ASN A 1 76  ? 42.639 45.399 -7.232  1.00 39.99 ? 70   ASN A N     1 
ATOM   537  C  CA    . ASN A 1 76  ? 42.367 46.824 -7.183  1.00 40.32 ? 70   ASN A CA    1 
ATOM   538  C  C     . ASN A 1 76  ? 41.123 47.207 -6.394  1.00 39.52 ? 70   ASN A C     1 
ATOM   539  O  O     . ASN A 1 76  ? 40.740 48.381 -6.370  1.00 39.20 ? 70   ASN A O     1 
ATOM   540  C  CB    . ASN A 1 76  ? 42.279 47.377 -8.607  1.00 42.41 ? 70   ASN A CB    1 
ATOM   541  C  CG    . ASN A 1 76  ? 43.586 47.210 -9.370  1.00 46.26 ? 70   ASN A CG    1 
ATOM   542  O  OD1   . ASN A 1 76  ? 44.636 47.708 -8.939  1.00 45.88 ? 70   ASN A OD1   1 
ATOM   543  N  ND2   . ASN A 1 76  ? 43.533 46.500 -10.503 1.00 45.25 ? 70   ASN A ND2   1 
ATOM   544  N  N     . ALA A 1 77  ? 40.486 46.232 -5.748  1.00 35.52 ? 71   ALA A N     1 
ATOM   545  C  CA    . ALA A 1 77  ? 39.295 46.538 -4.959  1.00 33.39 ? 71   ALA A CA    1 
ATOM   546  C  C     . ALA A 1 77  ? 39.735 47.364 -3.755  1.00 31.35 ? 71   ALA A C     1 
ATOM   547  O  O     . ALA A 1 77  ? 40.939 47.539 -3.524  1.00 31.28 ? 71   ALA A O     1 
ATOM   548  C  CB    . ALA A 1 77  ? 38.605 45.240 -4.505  1.00 30.07 ? 71   ALA A CB    1 
ATOM   549  N  N     . VAL A 1 78  ? 38.778 47.917 -3.018  1.00 29.47 ? 72   VAL A N     1 
ATOM   550  C  CA    . VAL A 1 78  ? 39.126 48.678 -1.824  1.00 28.58 ? 72   VAL A CA    1 
ATOM   551  C  C     . VAL A 1 78  ? 39.034 47.722 -0.626  1.00 29.74 ? 72   VAL A C     1 
ATOM   552  O  O     . VAL A 1 78  ? 37.993 47.098 -0.396  1.00 27.71 ? 72   VAL A O     1 
ATOM   553  C  CB    . VAL A 1 78  ? 38.166 49.874 -1.598  1.00 29.74 ? 72   VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 78  ? 38.549 50.610 -0.317  1.00 27.48 ? 72   VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 78  ? 38.224 50.832 -2.788  1.00 29.47 ? 72   VAL A CG2   1 
ATOM   556  N  N     . TYR A 1 79  ? 40.134 47.590 0.114   1.00 30.59 ? 73   TYR A N     1 
ATOM   557  C  CA    . TYR A 1 79  ? 40.188 46.723 1.288   1.00 30.31 ? 73   TYR A CA    1 
ATOM   558  C  C     . TYR A 1 79  ? 40.215 47.590 2.528   1.00 31.26 ? 73   TYR A C     1 
ATOM   559  O  O     . TYR A 1 79  ? 41.068 48.465 2.660   1.00 32.59 ? 73   TYR A O     1 
ATOM   560  C  CB    . TYR A 1 79  ? 41.423 45.830 1.246   1.00 29.64 ? 73   TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 79  ? 41.361 44.859 0.113   1.00 30.74 ? 73   TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 79  ? 41.694 45.254 -1.181  1.00 32.47 ? 73   TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 79  ? 40.877 43.568 0.309   1.00 31.30 ? 73   TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 79  ? 41.538 44.385 -2.253  1.00 31.07 ? 73   TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 79  ? 40.716 42.698 -0.754  1.00 30.76 ? 73   TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 79  ? 41.047 43.117 -2.030  1.00 30.82 ? 73   TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 79  ? 40.871 42.273 -3.089  1.00 30.50 ? 73   TYR A OH    1 
ATOM   568  N  N     . LEU A 1 80  ? 39.280 47.343 3.433   1.00 30.90 ? 74   LEU A N     1 
ATOM   569  C  CA    . LEU A 1 80  ? 39.163 48.137 4.648   1.00 31.04 ? 74   LEU A CA    1 
ATOM   570  C  C     . LEU A 1 80  ? 39.187 47.252 5.886   1.00 31.00 ? 74   LEU A C     1 
ATOM   571  O  O     . LEU A 1 80  ? 38.668 46.132 5.881   1.00 31.34 ? 74   LEU A O     1 
ATOM   572  C  CB    . LEU A 1 80  ? 37.853 48.918 4.618   1.00 30.32 ? 74   LEU A CB    1 
ATOM   573  C  CG    . LEU A 1 80  ? 37.543 49.806 3.404   1.00 31.96 ? 74   LEU A CG    1 
ATOM   574  C  CD1   . LEU A 1 80  ? 36.080 50.257 3.452   1.00 28.24 ? 74   LEU A CD1   1 
ATOM   575  C  CD2   . LEU A 1 80  ? 38.452 51.010 3.413   1.00 30.82 ? 74   LEU A CD2   1 
ATOM   576  N  N     . PRO A 1 81  ? 39.804 47.736 6.972   1.00 31.68 ? 75   PRO A N     1 
ATOM   577  C  CA    . PRO A 1 81  ? 39.839 46.922 8.185   1.00 31.93 ? 75   PRO A CA    1 
ATOM   578  C  C     . PRO A 1 81  ? 38.464 46.959 8.834   1.00 30.71 ? 75   PRO A C     1 
ATOM   579  O  O     . PRO A 1 81  ? 37.792 47.984 8.824   1.00 30.39 ? 75   PRO A O     1 
ATOM   580  C  CB    . PRO A 1 81  ? 40.893 47.618 9.033   1.00 30.56 ? 75   PRO A CB    1 
ATOM   581  C  CG    . PRO A 1 81  ? 40.672 49.034 8.698   1.00 33.90 ? 75   PRO A CG    1 
ATOM   582  C  CD    . PRO A 1 81  ? 40.524 49.002 7.176   1.00 32.27 ? 75   PRO A CD    1 
ATOM   583  N  N     . MET A 1 82  ? 38.040 45.830 9.374   1.00 30.19 ? 76   MET A N     1 
ATOM   584  C  CA    . MET A 1 82  ? 36.748 45.762 10.030  1.00 31.58 ? 76   MET A CA    1 
ATOM   585  C  C     . MET A 1 82  ? 36.728 46.661 11.267  1.00 31.80 ? 76   MET A C     1 
ATOM   586  O  O     . MET A 1 82  ? 37.644 46.608 12.086  1.00 31.63 ? 76   MET A O     1 
ATOM   587  C  CB    . MET A 1 82  ? 36.456 44.320 10.449  1.00 34.91 ? 76   MET A CB    1 
ATOM   588  C  CG    . MET A 1 82  ? 35.100 44.128 11.101  1.00 36.15 ? 76   MET A CG    1 
ATOM   589  S  SD    . MET A 1 82  ? 34.990 42.520 11.849  1.00 38.78 ? 76   MET A SD    1 
ATOM   590  C  CE    . MET A 1 82  ? 35.836 42.880 13.426  1.00 38.40 ? 76   MET A CE    1 
ATOM   591  N  N     . ARG A 1 83  ? 35.688 47.487 11.382  1.00 31.73 ? 77   ARG A N     1 
ATOM   592  C  CA    . ARG A 1 83  ? 35.492 48.395 12.523  1.00 31.19 ? 77   ARG A CA    1 
ATOM   593  C  C     . ARG A 1 83  ? 34.178 48.022 13.209  1.00 30.40 ? 77   ARG A C     1 
ATOM   594  O  O     . ARG A 1 83  ? 33.186 48.748 13.109  1.00 29.42 ? 77   ARG A O     1 
ATOM   595  C  CB    . ARG A 1 83  ? 35.395 49.837 12.052  1.00 30.76 ? 77   ARG A CB    1 
ATOM   596  C  CG    . ARG A 1 83  ? 36.682 50.409 11.552  1.00 33.89 ? 77   ARG A CG    1 
ATOM   597  C  CD    . ARG A 1 83  ? 36.521 51.885 11.310  1.00 33.93 ? 77   ARG A CD    1 
ATOM   598  N  NE    . ARG A 1 83  ? 35.876 52.174 10.037  1.00 35.97 ? 77   ARG A NE    1 
ATOM   599  C  CZ    . ARG A 1 83  ? 35.470 53.385 9.681   1.00 37.13 ? 77   ARG A CZ    1 
ATOM   600  N  NH1   . ARG A 1 83  ? 35.636 54.400 10.511  1.00 40.13 ? 77   ARG A NH1   1 
ATOM   601  N  NH2   . ARG A 1 83  ? 34.925 53.592 8.491   1.00 39.54 ? 77   ARG A NH2   1 
ATOM   602  N  N     . LYS A 1 84  ? 34.196 46.886 13.901  1.00 31.01 ? 78   LYS A N     1 
ATOM   603  C  CA    . LYS A 1 84  ? 33.036 46.325 14.600  1.00 33.77 ? 78   LYS A CA    1 
ATOM   604  C  C     . LYS A 1 84  ? 32.220 47.311 15.454  1.00 34.39 ? 78   LYS A C     1 
ATOM   605  O  O     . LYS A 1 84  ? 30.989 47.353 15.356  1.00 34.50 ? 78   LYS A O     1 
ATOM   606  C  CB    . LYS A 1 84  ? 33.514 45.138 15.450  1.00 37.08 ? 78   LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 84  ? 32.438 44.284 16.100  1.00 38.41 ? 78   LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 84  ? 31.612 43.551 15.066  1.00 40.35 ? 78   LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 84  ? 30.610 42.614 15.721  1.00 40.67 ? 78   LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 84  ? 31.249 41.391 16.285  1.00 41.54 ? 78   LYS A NZ    1 
ATOM   611  N  N     . GLU A 1 85  ? 32.894 48.110 16.280  1.00 34.82 ? 79   GLU A N     1 
ATOM   612  C  CA    . GLU A 1 85  ? 32.189 49.061 17.137  1.00 36.67 ? 79   GLU A CA    1 
ATOM   613  C  C     . GLU A 1 85  ? 31.345 50.078 16.358  1.00 36.34 ? 79   GLU A C     1 
ATOM   614  O  O     . GLU A 1 85  ? 30.272 50.486 16.814  1.00 36.91 ? 79   GLU A O     1 
ATOM   615  C  CB    . GLU A 1 85  ? 33.174 49.809 18.045  1.00 38.32 ? 79   GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 85  ? 33.543 49.088 19.342  1.00 38.89 ? 79   GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 85  ? 34.220 47.744 19.118  0.50 40.85 ? 79   GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 85  ? 33.528 46.771 18.747  0.50 41.02 ? 79   GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 85  ? 35.451 47.661 19.310  0.50 41.51 ? 79   GLU A OE2   1 
ATOM   620  N  N     . VAL A 1 86  ? 31.830 50.492 15.193  1.00 34.18 ? 80   VAL A N     1 
ATOM   621  C  CA    . VAL A 1 86  ? 31.097 51.445 14.383  1.00 30.73 ? 80   VAL A CA    1 
ATOM   622  C  C     . VAL A 1 86  ? 29.820 50.802 13.873  1.00 32.39 ? 80   VAL A C     1 
ATOM   623  O  O     . VAL A 1 86  ? 28.732 51.384 13.990  1.00 31.05 ? 80   VAL A O     1 
ATOM   624  C  CB    . VAL A 1 86  ? 31.927 51.917 13.178  1.00 32.14 ? 80   VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 86  ? 31.045 52.735 12.211  1.00 30.48 ? 80   VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 86  ? 33.105 52.761 13.666  1.00 28.59 ? 80   VAL A CG2   1 
ATOM   627  N  N     . TYR A 1 87  ? 29.949 49.595 13.319  1.00 31.63 ? 81   TYR A N     1 
ATOM   628  C  CA    . TYR A 1 87  ? 28.795 48.894 12.773  1.00 30.30 ? 81   TYR A CA    1 
ATOM   629  C  C     . TYR A 1 87  ? 27.775 48.642 13.873  1.00 30.86 ? 81   TYR A C     1 
ATOM   630  O  O     . TYR A 1 87  ? 26.574 48.746 13.652  1.00 29.24 ? 81   TYR A O     1 
ATOM   631  C  CB    . TYR A 1 87  ? 29.218 47.570 12.112  1.00 29.04 ? 81   TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 87  ? 30.456 47.685 11.228  1.00 26.89 ? 81   TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 87  ? 30.701 48.833 10.495  1.00 25.88 ? 81   TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 87  ? 31.393 46.649 11.156  1.00 27.16 ? 81   TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 87  ? 31.840 48.966 9.720   1.00 24.01 ? 81   TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 87  ? 32.544 46.774 10.376  1.00 24.59 ? 81   TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 87  ? 32.755 47.944 9.662   1.00 26.80 ? 81   TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 87  ? 33.888 48.106 8.886   1.00 24.42 ? 81   TYR A OH    1 
ATOM   639  N  N     . GLN A 1 88  ? 28.258 48.345 15.072  1.00 32.56 ? 82   GLN A N     1 
ATOM   640  C  CA    . GLN A 1 88  ? 27.360 48.089 16.189  1.00 37.73 ? 82   GLN A CA    1 
ATOM   641  C  C     . GLN A 1 88  ? 26.474 49.302 16.544  1.00 38.20 ? 82   GLN A C     1 
ATOM   642  O  O     . GLN A 1 88  ? 25.266 49.164 16.738  1.00 38.62 ? 82   GLN A O     1 
ATOM   643  C  CB    . GLN A 1 88  ? 28.170 47.658 17.415  1.00 39.73 ? 82   GLN A CB    1 
ATOM   644  C  CG    . GLN A 1 88  ? 27.302 47.299 18.600  1.00 41.43 ? 82   GLN A CG    1 
ATOM   645  C  CD    . GLN A 1 88  ? 26.396 46.131 18.305  1.00 42.78 ? 82   GLN A CD    1 
ATOM   646  O  OE1   . GLN A 1 88  ? 26.837 44.977 18.286  1.00 44.37 ? 82   GLN A OE1   1 
ATOM   647  N  NE2   . GLN A 1 88  ? 25.121 46.421 18.054  1.00 42.70 ? 82   GLN A NE2   1 
ATOM   648  N  N     . GLN A 1 89  ? 27.062 50.490 16.618  1.00 38.32 ? 83   GLN A N     1 
ATOM   649  C  CA    . GLN A 1 89  ? 26.277 51.667 16.958  1.00 39.12 ? 83   GLN A CA    1 
ATOM   650  C  C     . GLN A 1 89  ? 25.223 51.980 15.889  1.00 38.33 ? 83   GLN A C     1 
ATOM   651  O  O     . GLN A 1 89  ? 24.077 52.318 16.218  1.00 37.48 ? 83   GLN A O     1 
ATOM   652  C  CB    . GLN A 1 89  ? 27.196 52.867 17.180  1.00 41.65 ? 83   GLN A CB    1 
ATOM   653  C  CG    . GLN A 1 89  ? 28.266 52.596 18.218  1.00 46.71 ? 83   GLN A CG    1 
ATOM   654  C  CD    . GLN A 1 89  ? 28.949 53.861 18.722  1.00 49.46 ? 83   GLN A CD    1 
ATOM   655  O  OE1   . GLN A 1 89  ? 29.249 54.775 17.951  1.00 51.05 ? 83   GLN A OE1   1 
ATOM   656  N  NE2   . GLN A 1 89  ? 29.210 53.907 20.023  1.00 49.16 ? 83   GLN A NE2   1 
ATOM   657  N  N     . VAL A 1 90  ? 25.597 51.870 14.613  1.00 35.22 ? 84   VAL A N     1 
ATOM   658  C  CA    . VAL A 1 90  ? 24.638 52.118 13.551  1.00 32.07 ? 84   VAL A CA    1 
ATOM   659  C  C     . VAL A 1 90  ? 23.549 51.070 13.684  1.00 31.80 ? 84   VAL A C     1 
ATOM   660  O  O     . VAL A 1 90  ? 22.373 51.365 13.517  1.00 33.43 ? 84   VAL A O     1 
ATOM   661  C  CB    . VAL A 1 90  ? 25.248 51.971 12.138  1.00 31.96 ? 84   VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 90  ? 24.154 52.130 11.105  1.00 29.92 ? 84   VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 90  ? 26.325 53.012 11.904  1.00 28.33 ? 84   VAL A CG2   1 
ATOM   664  N  N     . SER A 1 91  ? 23.952 49.841 13.986  1.00 31.61 ? 85   SER A N     1 
ATOM   665  C  CA    . SER A 1 91  ? 23.008 48.745 14.128  1.00 32.73 ? 85   SER A CA    1 
ATOM   666  C  C     . SER A 1 91  ? 22.018 49.044 15.240  1.00 34.18 ? 85   SER A C     1 
ATOM   667  O  O     . SER A 1 91  ? 20.806 48.908 15.056  1.00 34.87 ? 85   SER A O     1 
ATOM   668  C  CB    . SER A 1 91  ? 23.732 47.433 14.440  1.00 30.08 ? 85   SER A CB    1 
ATOM   669  O  OG    . SER A 1 91  ? 22.790 46.404 14.680  1.00 26.08 ? 85   SER A OG    1 
ATOM   670  N  N     . SER A 1 92  ? 22.545 49.448 16.393  1.00 34.56 ? 86   SER A N     1 
ATOM   671  C  CA    . SER A 1 92  ? 21.710 49.773 17.539  1.00 35.08 ? 86   SER A CA    1 
ATOM   672  C  C     . SER A 1 92  ? 20.681 50.832 17.209  1.00 35.02 ? 86   SER A C     1 
ATOM   673  O  O     . SER A 1 92  ? 19.543 50.753 17.666  1.00 37.79 ? 86   SER A O     1 
ATOM   674  C  CB    . SER A 1 92  ? 22.571 50.239 18.699  1.00 36.02 ? 86   SER A CB    1 
ATOM   675  O  OG    . SER A 1 92  ? 23.241 49.134 19.268  1.00 38.27 ? 86   SER A OG    1 
ATOM   676  N  N     . ARG A 1 93  ? 21.072 51.820 16.413  1.00 33.92 ? 87   ARG A N     1 
ATOM   677  C  CA    . ARG A 1 93  ? 20.143 52.865 16.035  1.00 34.78 ? 87   ARG A CA    1 
ATOM   678  C  C     . ARG A 1 93  ? 19.028 52.288 15.177  1.00 36.79 ? 87   ARG A C     1 
ATOM   679  O  O     . ARG A 1 93  ? 17.852 52.627 15.356  1.00 40.63 ? 87   ARG A O     1 
ATOM   680  C  CB    . ARG A 1 93  ? 20.847 53.984 15.265  1.00 34.44 ? 87   ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 93  ? 21.954 54.683 16.027  1.00 33.81 ? 87   ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 93  ? 22.154 56.093 15.504  1.00 37.02 ? 87   ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 93  ? 22.781 56.176 14.183  1.00 37.74 ? 87   ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 93  ? 24.092 56.083 13.983  1.00 36.25 ? 87   ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 93  ? 24.901 55.902 15.013  1.00 34.72 ? 87   ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 93  ? 24.599 56.200 12.759  1.00 35.78 ? 87   ARG A NH2   1 
ATOM   687  N  N     . ILE A 1 94  ? 19.378 51.418 14.238  1.00 36.82 ? 88   ILE A N     1 
ATOM   688  C  CA    . ILE A 1 94  ? 18.356 50.844 13.383  1.00 36.12 ? 88   ILE A CA    1 
ATOM   689  C  C     . ILE A 1 94  ? 17.423 49.988 14.236  1.00 37.63 ? 88   ILE A C     1 
ATOM   690  O  O     . ILE A 1 94  ? 16.208 49.966 14.016  1.00 36.98 ? 88   ILE A O     1 
ATOM   691  C  CB    . ILE A 1 94  ? 18.973 49.988 12.254  1.00 36.09 ? 88   ILE A CB    1 
ATOM   692  C  CG1   . ILE A 1 94  ? 19.818 50.876 11.324  1.00 33.61 ? 88   ILE A CG1   1 
ATOM   693  C  CG2   . ILE A 1 94  ? 17.855 49.279 11.470  1.00 31.76 ? 88   ILE A CG2   1 
ATOM   694  C  CD1   . ILE A 1 94  ? 20.565 50.109 10.227  1.00 30.17 ? 88   ILE A CD1   1 
ATOM   695  N  N     . MET A 1 95  ? 17.978 49.296 15.222  1.00 38.28 ? 89   MET A N     1 
ATOM   696  C  CA    . MET A 1 95  ? 17.143 48.458 16.078  1.00 40.88 ? 89   MET A CA    1 
ATOM   697  C  C     . MET A 1 95  ? 16.157 49.318 16.881  1.00 42.77 ? 89   MET A C     1 
ATOM   698  O  O     . MET A 1 95  ? 15.007 48.909 17.106  1.00 43.44 ? 89   MET A O     1 
ATOM   699  C  CB    . MET A 1 95  ? 18.016 47.605 17.001  1.00 37.79 ? 89   MET A CB    1 
ATOM   700  C  CG    . MET A 1 95  ? 19.004 46.730 16.234  1.00 38.31 ? 89   MET A CG    1 
ATOM   701  S  SD    . MET A 1 95  ? 18.318 45.272 15.368  1.00 37.14 ? 89   MET A SD    1 
ATOM   702  C  CE    . MET A 1 95  ? 17.384 45.911 14.207  1.00 36.10 ? 89   MET A CE    1 
ATOM   703  N  N     . ASN A 1 96  ? 16.587 50.503 17.304  1.00 43.20 ? 90   ASN A N     1 
ATOM   704  C  CA    . ASN A 1 96  ? 15.679 51.376 18.032  1.00 43.94 ? 90   ASN A CA    1 
ATOM   705  C  C     . ASN A 1 96  ? 14.566 51.856 17.109  1.00 44.59 ? 90   ASN A C     1 
ATOM   706  O  O     . ASN A 1 96  ? 13.466 52.135 17.573  1.00 47.50 ? 90   ASN A O     1 
ATOM   707  C  CB    . ASN A 1 96  ? 16.417 52.566 18.639  1.00 43.54 ? 90   ASN A CB    1 
ATOM   708  C  CG    . ASN A 1 96  ? 17.251 52.169 19.837  1.00 43.95 ? 90   ASN A CG    1 
ATOM   709  O  OD1   . ASN A 1 96  ? 16.953 51.185 20.513  1.00 45.01 ? 90   ASN A OD1   1 
ATOM   710  N  ND2   . ASN A 1 96  ? 18.291 52.934 20.116  1.00 46.04 ? 90   ASN A ND2   1 
ATOM   711  N  N     . LEU A 1 97  ? 14.837 51.944 15.808  1.00 44.53 ? 91   LEU A N     1 
ATOM   712  C  CA    . LEU A 1 97  ? 13.804 52.362 14.855  1.00 44.84 ? 91   LEU A CA    1 
ATOM   713  C  C     . LEU A 1 97  ? 12.760 51.267 14.646  1.00 46.40 ? 91   LEU A C     1 
ATOM   714  O  O     . LEU A 1 97  ? 11.571 51.548 14.491  1.00 46.86 ? 91   LEU A O     1 
ATOM   715  C  CB    . LEU A 1 97  ? 14.394 52.708 13.488  1.00 44.41 ? 91   LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 97  ? 15.197 53.990 13.261  1.00 47.00 ? 91   LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 97  ? 15.262 54.234 11.754  1.00 44.05 ? 91   LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 97  ? 14.547 55.188 13.966  1.00 46.44 ? 91   LEU A CD2   1 
ATOM   719  N  N     . LEU A 1 98  ? 13.200 50.016 14.618  1.00 47.53 ? 92   LEU A N     1 
ATOM   720  C  CA    . LEU A 1 98  ? 12.267 48.911 14.425  1.00 47.52 ? 92   LEU A CA    1 
ATOM   721  C  C     . LEU A 1 98  ? 11.368 48.764 15.650  1.00 49.10 ? 92   LEU A C     1 
ATOM   722  O  O     . LEU A 1 98  ? 10.225 48.319 15.535  1.00 48.89 ? 92   LEU A O     1 
ATOM   723  C  CB    . LEU A 1 98  ? 13.030 47.612 14.158  1.00 43.26 ? 92   LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 98  ? 13.762 47.546 12.817  1.00 41.17 ? 92   LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 98  ? 14.673 46.345 12.797  1.00 38.47 ? 92   LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 98  ? 12.764 47.483 11.675  1.00 39.72 ? 92   LEU A CD2   1 
ATOM   727  N  N     . ARG A 1 99  ? 11.885 49.142 16.819  1.00 52.55 ? 93   ARG A N     1 
ATOM   728  C  CA    . ARG A 1 99  ? 11.109 49.062 18.055  1.00 56.25 ? 93   ARG A CA    1 
ATOM   729  C  C     . ARG A 1 99  ? 9.889  49.968 17.989  1.00 57.65 ? 93   ARG A C     1 
ATOM   730  O  O     . ARG A 1 99  ? 8.932  49.787 18.739  1.00 59.38 ? 93   ARG A O     1 
ATOM   731  C  CB    . ARG A 1 99  ? 11.948 49.461 19.270  1.00 56.33 ? 93   ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 99  ? 12.937 48.416 19.713  1.00 58.82 ? 93   ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 99  ? 13.082 48.424 21.221  1.00 61.89 ? 93   ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 99  ? 14.108 47.490 21.673  1.00 64.72 ? 93   ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 99  ? 15.407 47.633 21.425  1.00 65.92 ? 93   ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 99  ? 15.841 48.675 20.726  1.00 67.35 ? 93   ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 99  ? 16.273 46.738 21.879  1.00 66.53 ? 93   ARG A NH2   1 
ATOM   738  N  N     . GLU A 1 100 ? 9.933  50.949 17.095  1.00 59.03 ? 94   GLU A N     1 
ATOM   739  C  CA    . GLU A 1 100 ? 8.823  51.874 16.936  1.00 59.41 ? 94   GLU A CA    1 
ATOM   740  C  C     . GLU A 1 100 ? 7.751  51.210 16.091  1.00 60.13 ? 94   GLU A C     1 
ATOM   741  O  O     . GLU A 1 100 ? 6.813  51.866 15.624  1.00 60.31 ? 94   GLU A O     1 
ATOM   742  C  CB    . GLU A 1 100 ? 9.284  53.166 16.255  1.00 58.94 ? 94   GLU A CB    1 
ATOM   743  C  CG    . GLU A 1 100 ? 10.508 53.800 16.887  0.50 57.99 ? 94   GLU A CG    1 
ATOM   744  C  CD    . GLU A 1 100 ? 10.696 55.240 16.464  0.50 57.83 ? 94   GLU A CD    1 
ATOM   745  O  OE1   . GLU A 1 100 ? 10.533 55.538 15.261  0.50 57.05 ? 94   GLU A OE1   1 
ATOM   746  O  OE2   . GLU A 1 100 ? 11.015 56.073 17.338  0.50 58.12 ? 94   GLU A OE2   1 
ATOM   747  N  N     . TYR A 1 101 ? 7.900  49.905 15.879  1.00 59.02 ? 95   TYR A N     1 
ATOM   748  C  CA    . TYR A 1 101 ? 6.931  49.169 15.091  1.00 57.33 ? 95   TYR A CA    1 
ATOM   749  C  C     . TYR A 1 101 ? 6.390  47.973 15.840  1.00 57.38 ? 95   TYR A C     1 
ATOM   750  O  O     . TYR A 1 101 ? 5.425  47.352 15.402  1.00 57.71 ? 95   TYR A O     1 
ATOM   751  C  CB    . TYR A 1 101 ? 7.532  48.725 13.766  1.00 55.60 ? 95   TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 101 ? 7.811  49.865 12.818  1.00 54.18 ? 95   TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 101 ? 8.933  50.670 12.975  1.00 54.04 ? 95   TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 101 ? 6.967  50.119 11.741  1.00 54.05 ? 95   TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 101 ? 9.215  51.699 12.078  1.00 53.92 ? 95   TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 101 ? 7.237  51.144 10.839  1.00 54.46 ? 95   TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 101 ? 8.366  51.929 11.013  1.00 54.40 ? 95   TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 101 ? 8.649  52.936 10.115  1.00 55.30 ? 95   TYR A OH    1 
ATOM   759  N  N     . SER A 1 102 ? 7.014  47.647 16.968  1.00 57.48 ? 96   SER A N     1 
ATOM   760  C  CA    . SER A 1 102 ? 6.553  46.535 17.784  1.00 58.08 ? 96   SER A CA    1 
ATOM   761  C  C     . SER A 1 102 ? 7.338  46.338 19.064  1.00 59.54 ? 96   SER A C     1 
ATOM   762  O  O     . SER A 1 102 ? 8.569  46.339 19.065  1.00 60.21 ? 96   SER A O     1 
ATOM   763  C  CB    . SER A 1 102 ? 6.573  45.229 17.000  1.00 57.22 ? 96   SER A CB    1 
ATOM   764  O  OG    . SER A 1 102 ? 6.193  44.159 17.847  1.00 55.11 ? 96   SER A OG    1 
ATOM   765  N  N     . GLU A 1 103 ? 6.604  46.168 20.158  1.00 60.95 ? 97   GLU A N     1 
ATOM   766  C  CA    . GLU A 1 103 ? 7.206  45.942 21.460  1.00 62.72 ? 97   GLU A CA    1 
ATOM   767  C  C     . GLU A 1 103 ? 7.858  44.566 21.383  1.00 61.56 ? 97   GLU A C     1 
ATOM   768  O  O     . GLU A 1 103 ? 9.013  44.387 21.777  1.00 62.85 ? 97   GLU A O     1 
ATOM   769  C  CB    . GLU A 1 103 ? 6.133  45.941 22.560  1.00 65.15 ? 97   GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 103 ? 5.140  47.102 22.507  1.00 68.40 ? 97   GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 103 ? 4.223  47.042 21.294  1.00 69.69 ? 97   GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 103 ? 3.622  45.974 21.056  1.00 69.74 ? 97   GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 103 ? 4.099  48.064 20.583  1.00 71.17 ? 97   GLU A OE2   1 
ATOM   774  N  N     . LYS A 1 104 ? 7.101  43.599 20.868  1.00 59.56 ? 98   LYS A N     1 
ATOM   775  C  CA    . LYS A 1 104 ? 7.576  42.224 20.708  1.00 57.93 ? 98   LYS A CA    1 
ATOM   776  C  C     . LYS A 1 104 ? 8.663  42.215 19.636  1.00 56.35 ? 98   LYS A C     1 
ATOM   777  O  O     . LYS A 1 104 ? 8.357  42.159 18.442  1.00 55.49 ? 98   LYS A O     1 
ATOM   778  C  CB    . LYS A 1 104 ? 6.437  41.313 20.240  0.50 58.24 ? 98   LYS A CB    1 
ATOM   779  C  CG    . LYS A 1 104 ? 5.172  41.338 21.076  0.50 57.88 ? 98   LYS A CG    1 
ATOM   780  C  CD    . LYS A 1 104 ? 4.054  40.630 20.315  0.50 58.09 ? 98   LYS A CD    1 
ATOM   781  C  CE    . LYS A 1 104 ? 2.731  40.659 21.064  0.50 58.27 ? 98   LYS A CE    1 
ATOM   782  N  NZ    . LYS A 1 104 ? 2.784  39.856 22.316  0.50 58.64 ? 98   LYS A NZ    1 
ATOM   783  N  N     . ILE A 1 105 ? 9.926  42.260 20.048  1.00 54.48 ? 99   ILE A N     1 
ATOM   784  C  CA    . ILE A 1 105 ? 11.009 42.268 19.076  1.00 52.87 ? 99   ILE A CA    1 
ATOM   785  C  C     . ILE A 1 105 ? 12.178 41.397 19.500  1.00 50.43 ? 99   ILE A C     1 
ATOM   786  O  O     . ILE A 1 105 ? 12.590 41.421 20.657  1.00 51.01 ? 99   ILE A O     1 
ATOM   787  C  CB    . ILE A 1 105 ? 11.505 43.708 18.836  1.00 54.18 ? 99   ILE A CB    1 
ATOM   788  C  CG1   . ILE A 1 105 ? 12.573 43.718 17.740  1.00 55.10 ? 99   ILE A CG1   1 
ATOM   789  C  CG2   . ILE A 1 105 ? 12.044 44.294 20.138  1.00 54.82 ? 99   ILE A CG2   1 
ATOM   790  C  CD1   . ILE A 1 105 ? 13.126 45.099 17.427  1.00 54.58 ? 99   ILE A CD1   1 
ATOM   791  N  N     . GLU A 1 106 ? 12.705 40.618 18.561  1.00 48.55 ? 100  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 106 ? 13.840 39.740 18.845  1.00 46.38 ? 100  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 106 ? 15.082 40.070 18.016  1.00 44.27 ? 100  GLU A C     1 
ATOM   794  O  O     . GLU A 1 106 ? 15.133 39.780 16.819  1.00 43.78 ? 100  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 106 ? 13.457 38.272 18.613  1.00 45.90 ? 100  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 106 ? 14.617 37.295 18.815  1.00 45.63 ? 100  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 106 ? 14.162 35.849 18.959  1.00 48.63 ? 100  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 106 ? 15.027 34.949 18.891  1.00 48.67 ? 100  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 106 ? 12.945 35.605 19.150  1.00 48.12 ? 100  GLU A OE2   1 
ATOM   800  N  N     . ILE A 1 107 ? 16.076 40.683 18.651  1.00 42.60 ? 101  ILE A N     1 
ATOM   801  C  CA    . ILE A 1 107 ? 17.316 41.015 17.962  1.00 40.90 ? 101  ILE A CA    1 
ATOM   802  C  C     . ILE A 1 107 ? 18.110 39.726 17.846  1.00 38.63 ? 101  ILE A C     1 
ATOM   803  O  O     . ILE A 1 107 ? 18.589 39.199 18.840  1.00 38.17 ? 101  ILE A O     1 
ATOM   804  C  CB    . ILE A 1 107 ? 18.164 42.048 18.747  1.00 42.17 ? 101  ILE A CB    1 
ATOM   805  C  CG1   . ILE A 1 107 ? 17.355 43.322 18.992  1.00 43.50 ? 101  ILE A CG1   1 
ATOM   806  C  CG2   . ILE A 1 107 ? 19.404 42.416 17.940  1.00 43.99 ? 101  ILE A CG2   1 
ATOM   807  C  CD1   . ILE A 1 107 ? 18.155 44.430 19.653  1.00 46.31 ? 101  ILE A CD1   1 
ATOM   808  N  N     . ALA A 1 108 ? 18.251 39.214 16.629  1.00 36.04 ? 102  ALA A N     1 
ATOM   809  C  CA    . ALA A 1 108 ? 18.971 37.964 16.421  1.00 33.78 ? 102  ALA A CA    1 
ATOM   810  C  C     . ALA A 1 108 ? 20.485 38.089 16.251  1.00 34.10 ? 102  ALA A C     1 
ATOM   811  O  O     . ALA A 1 108 ? 21.214 37.167 16.602  1.00 36.13 ? 102  ALA A O     1 
ATOM   812  C  CB    . ALA A 1 108 ? 18.383 37.227 15.231  1.00 32.46 ? 102  ALA A CB    1 
ATOM   813  N  N     . SER A 1 109 ? 20.961 39.208 15.706  1.00 33.71 ? 103  SER A N     1 
ATOM   814  C  CA    . SER A 1 109 ? 22.402 39.423 15.495  1.00 30.72 ? 103  SER A CA    1 
ATOM   815  C  C     . SER A 1 109 ? 22.664 40.907 15.265  1.00 30.52 ? 103  SER A C     1 
ATOM   816  O  O     . SER A 1 109 ? 21.759 41.722 15.386  1.00 32.14 ? 103  SER A O     1 
ATOM   817  C  CB    . SER A 1 109 ? 22.883 38.654 14.265  1.00 30.54 ? 103  SER A CB    1 
ATOM   818  O  OG    . SER A 1 109 ? 22.556 39.358 13.076  1.00 29.16 ? 103  SER A OG    1 
ATOM   819  N  N     . ILE A 1 110 ? 23.889 41.259 14.897  1.00 28.50 ? 104  ILE A N     1 
ATOM   820  C  CA    . ILE A 1 110 ? 24.198 42.657 14.656  1.00 26.68 ? 104  ILE A CA    1 
ATOM   821  C  C     . ILE A 1 110 ? 23.365 43.234 13.510  1.00 27.67 ? 104  ILE A C     1 
ATOM   822  O  O     . ILE A 1 110 ? 23.206 44.439 13.410  1.00 27.72 ? 104  ILE A O     1 
ATOM   823  C  CB    . ILE A 1 110 ? 25.696 42.855 14.324  1.00 26.92 ? 104  ILE A CB    1 
ATOM   824  C  CG1   . ILE A 1 110 ? 26.045 44.344 14.384  1.00 26.25 ? 104  ILE A CG1   1 
ATOM   825  C  CG2   . ILE A 1 110 ? 26.013 42.302 12.926  1.00 24.74 ? 104  ILE A CG2   1 
ATOM   826  C  CD1   . ILE A 1 110 ? 27.545 44.607 14.449  1.00 22.82 ? 104  ILE A CD1   1 
ATOM   827  N  N     . ASP A 1 111 ? 22.812 42.381 12.655  1.00 26.70 ? 105  ASP A N     1 
ATOM   828  C  CA    . ASP A 1 111 ? 22.045 42.903 11.529  1.00 29.05 ? 105  ASP A CA    1 
ATOM   829  C  C     . ASP A 1 111 ? 20.753 42.168 11.223  1.00 29.50 ? 105  ASP A C     1 
ATOM   830  O  O     . ASP A 1 111 ? 20.297 42.165 10.076  1.00 29.55 ? 105  ASP A O     1 
ATOM   831  C  CB    . ASP A 1 111 ? 22.921 42.893 10.289  1.00 28.25 ? 105  ASP A CB    1 
ATOM   832  C  CG    . ASP A 1 111 ? 23.038 41.523 9.688   1.00 29.24 ? 105  ASP A CG    1 
ATOM   833  O  OD1   . ASP A 1 111 ? 23.140 40.532 10.438  1.00 29.97 ? 105  ASP A OD1   1 
ATOM   834  O  OD2   . ASP A 1 111 ? 23.034 41.438 8.458   1.00 28.59 ? 105  ASP A OD2   1 
ATOM   835  N  N     . GLU A 1 112 ? 20.163 41.553 12.239  1.00 29.54 ? 106  GLU A N     1 
ATOM   836  C  CA    . GLU A 1 112 ? 18.921 40.814 12.057  1.00 33.75 ? 106  GLU A CA    1 
ATOM   837  C  C     . GLU A 1 112 ? 17.952 41.032 13.189  1.00 32.52 ? 106  GLU A C     1 
ATOM   838  O  O     . GLU A 1 112 ? 18.357 41.130 14.344  1.00 35.64 ? 106  GLU A O     1 
ATOM   839  C  CB    . GLU A 1 112 ? 19.169 39.314 12.000  1.00 35.41 ? 106  GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 112 ? 19.791 38.791 10.760  1.00 40.64 ? 106  GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 112 ? 20.019 37.319 10.890  1.00 40.48 ? 106  GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 112 ? 20.512 36.907 11.953  1.00 46.41 ? 106  GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 112 ? 19.706 36.571 9.953   1.00 45.21 ? 106  GLU A OE2   1 
ATOM   844  N  N     . ALA A 1 113 ? 16.670 41.057 12.856  1.00 32.94 ? 107  ALA A N     1 
ATOM   845  C  CA    . ALA A 1 113 ? 15.639 41.223 13.865  1.00 34.50 ? 107  ALA A CA    1 
ATOM   846  C  C     . ALA A 1 113 ? 14.305 40.684 13.397  1.00 34.08 ? 107  ALA A C     1 
ATOM   847  O  O     . ALA A 1 113 ? 13.942 40.796 12.224  1.00 33.94 ? 107  ALA A O     1 
ATOM   848  C  CB    . ALA A 1 113 ? 15.503 42.699 14.254  1.00 34.81 ? 107  ALA A CB    1 
ATOM   849  N  N     . TYR A 1 114 ? 13.596 40.072 14.337  1.00 35.81 ? 108  TYR A N     1 
ATOM   850  C  CA    . TYR A 1 114 ? 12.271 39.531 14.096  1.00 38.94 ? 108  TYR A CA    1 
ATOM   851  C  C     . TYR A 1 114 ? 11.310 40.400 14.885  1.00 39.47 ? 108  TYR A C     1 
ATOM   852  O  O     . TYR A 1 114 ? 11.547 40.687 16.060  1.00 39.32 ? 108  TYR A O     1 
ATOM   853  C  CB    . TYR A 1 114 ? 12.126 38.102 14.626  1.00 38.64 ? 108  TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 114 ? 13.032 37.085 13.990  1.00 40.31 ? 108  TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 114 ? 14.308 36.855 14.500  1.00 37.47 ? 108  TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 114 ? 12.616 36.352 12.876  1.00 37.52 ? 108  TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 114 ? 15.143 35.927 13.921  1.00 39.33 ? 108  TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 114 ? 13.449 35.419 12.287  1.00 38.29 ? 108  TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 114 ? 14.712 35.212 12.815  1.00 37.92 ? 108  TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 114 ? 15.560 34.298 12.244  1.00 38.11 ? 108  TYR A OH    1 
ATOM   861  N  N     . LEU A 1 115 ? 10.237 40.817 14.230  1.00 40.58 ? 109  LEU A N     1 
ATOM   862  C  CA    . LEU A 1 115 ? 9.212  41.624 14.871  1.00 42.48 ? 109  LEU A CA    1 
ATOM   863  C  C     . LEU A 1 115 ? 7.927  40.809 14.863  1.00 43.35 ? 109  LEU A C     1 
ATOM   864  O  O     . LEU A 1 115 ? 7.578  40.201 13.846  1.00 41.75 ? 109  LEU A O     1 
ATOM   865  C  CB    . LEU A 1 115 ? 8.949  42.926 14.099  1.00 42.87 ? 109  LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 115 ? 10.006 44.017 13.932  1.00 43.55 ? 109  LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 115 ? 9.368  45.205 13.241  1.00 41.82 ? 109  LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 115 ? 10.545 44.440 15.282  1.00 45.18 ? 109  LEU A CD2   1 
ATOM   869  N  N     . ASP A 1 116 ? 7.237  40.776 15.999  1.00 46.01 ? 110  ASP A N     1 
ATOM   870  C  CA    . ASP A 1 116 ? 5.966  40.071 16.065  1.00 48.15 ? 110  ASP A CA    1 
ATOM   871  C  C     . ASP A 1 116 ? 4.897  41.135 15.869  1.00 48.35 ? 110  ASP A C     1 
ATOM   872  O  O     . ASP A 1 116 ? 4.501  41.814 16.811  1.00 47.84 ? 110  ASP A O     1 
ATOM   873  C  CB    . ASP A 1 116 ? 5.759  39.397 17.414  1.00 49.84 ? 110  ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 116 ? 4.503  38.538 17.435  1.00 53.36 ? 110  ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 116 ? 3.510  38.919 16.770  1.00 50.86 ? 110  ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 116 ? 4.502  37.487 18.114  1.00 55.33 ? 110  ASP A OD2   1 
ATOM   877  N  N     . ILE A 1 117 ? 4.445  41.281 14.633  1.00 49.81 ? 111  ILE A N     1 
ATOM   878  C  CA    . ILE A 1 117 ? 3.446  42.283 14.300  1.00 51.48 ? 111  ILE A CA    1 
ATOM   879  C  C     . ILE A 1 117 ? 2.053  41.691 14.169  1.00 53.92 ? 111  ILE A C     1 
ATOM   880  O  O     . ILE A 1 117 ? 1.242  42.175 13.371  1.00 55.15 ? 111  ILE A O     1 
ATOM   881  C  CB    . ILE A 1 117 ? 3.790  42.954 12.977  1.00 50.13 ? 111  ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 117 ? 3.695  41.928 11.841  1.00 49.40 ? 111  ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 117 ? 5.183  43.552 13.064  1.00 51.79 ? 111  ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 117 ? 3.833  42.504 10.448  1.00 47.88 ? 111  ILE A CD1   1 
ATOM   885  N  N     . SER A 1 118 ? 1.776  40.645 14.939  1.00 55.21 ? 112  SER A N     1 
ATOM   886  C  CA    . SER A 1 118 ? 0.470  39.999 14.888  1.00 57.26 ? 112  SER A CA    1 
ATOM   887  C  C     . SER A 1 118 ? -0.650 40.961 15.292  1.00 58.05 ? 112  SER A C     1 
ATOM   888  O  O     . SER A 1 118 ? -1.525 41.279 14.484  1.00 57.34 ? 112  SER A O     1 
ATOM   889  C  CB    . SER A 1 118 ? 0.458  38.766 15.792  1.00 57.03 ? 112  SER A CB    1 
ATOM   890  O  OG    . SER A 1 118 ? 1.330  37.769 15.291  1.00 58.78 ? 112  SER A OG    1 
ATOM   891  N  N     . ASP A 1 119 ? -0.622 41.437 16.533  1.00 58.86 ? 113  ASP A N     1 
ATOM   892  C  CA    . ASP A 1 119 ? -1.656 42.351 16.983  1.00 60.65 ? 113  ASP A CA    1 
ATOM   893  C  C     . ASP A 1 119 ? -1.363 43.801 16.591  1.00 62.03 ? 113  ASP A C     1 
ATOM   894  O  O     . ASP A 1 119 ? -1.842 44.737 17.227  1.00 63.41 ? 113  ASP A O     1 
ATOM   895  C  CB    . ASP A 1 119 ? -1.868 42.216 18.503  1.00 60.21 ? 113  ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 119 ? -0.676 42.680 19.315  0.50 59.64 ? 113  ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 119 ? -0.598 42.311 20.506  0.50 59.22 ? 113  ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 119 ? 0.173  43.419 18.778  0.50 59.65 ? 113  ASP A OD2   1 
ATOM   899  N  N     . LYS A 1 120 ? -0.578 43.983 15.532  1.00 62.92 ? 114  LYS A N     1 
ATOM   900  C  CA    . LYS A 1 120 ? -0.247 45.320 15.052  1.00 63.81 ? 114  LYS A CA    1 
ATOM   901  C  C     . LYS A 1 120 ? -0.755 45.500 13.626  1.00 64.75 ? 114  LYS A C     1 
ATOM   902  O  O     . LYS A 1 120 ? -0.699 46.595 13.068  1.00 63.94 ? 114  LYS A O     1 
ATOM   903  C  CB    . LYS A 1 120 ? 1.267  45.551 15.080  1.00 64.19 ? 114  LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 120 ? 1.871  45.644 16.470  1.00 65.90 ? 114  LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 120 ? 1.419  46.905 17.193  0.50 65.95 ? 114  LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 120 ? 2.048  47.000 18.574  0.50 66.44 ? 114  LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 120 ? 1.614  48.219 19.317  0.50 66.78 ? 114  LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 121 ? -1.255 44.417 13.045  1.00 65.88 ? 115  VAL A N     1 
ATOM   909  C  CA    . VAL A 1 121 ? -1.765 44.442 11.681  1.00 68.36 ? 115  VAL A CA    1 
ATOM   910  C  C     . VAL A 1 121 ? -2.495 43.135 11.408  1.00 69.35 ? 115  VAL A C     1 
ATOM   911  O  O     . VAL A 1 121 ? -2.185 42.115 12.020  1.00 70.52 ? 115  VAL A O     1 
ATOM   912  C  CB    . VAL A 1 121 ? -0.599 44.601 10.668  1.00 69.18 ? 115  VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 121 ? -0.693 43.542 9.565   1.00 70.47 ? 115  VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 121 ? -0.618 46.000 10.073  1.00 69.20 ? 115  VAL A CG2   1 
ATOM   915  N  N     . ARG A 1 122 ? -3.470 43.163 10.504  1.00 70.14 ? 116  ARG A N     1 
ATOM   916  C  CA    . ARG A 1 122 ? -4.198 41.947 10.157  1.00 71.13 ? 116  ARG A CA    1 
ATOM   917  C  C     . ARG A 1 122 ? -3.808 41.560 8.726   1.00 69.79 ? 116  ARG A C     1 
ATOM   918  O  O     . ARG A 1 122 ? -3.321 42.398 7.973   1.00 70.75 ? 116  ARG A O     1 
ATOM   919  C  CB    . ARG A 1 122 ? -5.719 42.157 10.282  1.00 74.15 ? 116  ARG A CB    1 
ATOM   920  C  CG    . ARG A 1 122 ? -6.359 43.070 9.240   1.00 77.13 ? 116  ARG A CG    1 
ATOM   921  C  CD    . ARG A 1 122 ? -6.149 44.557 9.520   1.00 80.00 ? 116  ARG A CD    1 
ATOM   922  N  NE    . ARG A 1 122 ? -7.028 45.088 10.558  1.00 82.58 ? 116  ARG A NE    1 
ATOM   923  C  CZ    . ARG A 1 122 ? -7.299 46.383 10.716  1.00 84.31 ? 116  ARG A CZ    1 
ATOM   924  N  NH1   . ARG A 1 122 ? -6.761 47.281 9.898   1.00 85.25 ? 116  ARG A NH1   1 
ATOM   925  N  NH2   . ARG A 1 122 ? -8.101 46.783 11.695  1.00 84.90 ? 116  ARG A NH2   1 
ATOM   926  N  N     . ASP A 1 123 ? -4.005 40.296 8.363   1.00 67.89 ? 117  ASP A N     1 
ATOM   927  C  CA    . ASP A 1 123 ? -3.649 39.780 7.033   1.00 66.57 ? 117  ASP A CA    1 
ATOM   928  C  C     . ASP A 1 123 ? -2.239 40.161 6.550   1.00 65.26 ? 117  ASP A C     1 
ATOM   929  O  O     . ASP A 1 123 ? -1.523 40.925 7.205   1.00 65.15 ? 117  ASP A O     1 
ATOM   930  C  CB    . ASP A 1 123 ? -4.687 40.201 5.985   1.00 65.55 ? 117  ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 123 ? -4.754 41.701 5.787   1.00 66.40 ? 117  ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 123 ? -3.757 42.305 5.331   1.00 65.41 ? 117  ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 123 ? -5.818 42.280 6.086   1.00 67.23 ? 117  ASP A OD2   1 
ATOM   934  N  N     . TYR A 1 124 ? -1.841 39.621 5.401   1.00 62.79 ? 118  TYR A N     1 
ATOM   935  C  CA    . TYR A 1 124 ? -0.513 39.891 4.862   1.00 61.03 ? 118  TYR A CA    1 
ATOM   936  C  C     . TYR A 1 124 ? -0.376 41.178 4.083   1.00 59.04 ? 118  TYR A C     1 
ATOM   937  O  O     . TYR A 1 124 ? 0.715  41.729 4.002   1.00 58.43 ? 118  TYR A O     1 
ATOM   938  C  CB    . TYR A 1 124 ? -0.031 38.718 4.002   1.00 61.38 ? 118  TYR A CB    1 
ATOM   939  C  CG    . TYR A 1 124 ? 0.404  37.531 4.831   1.00 62.88 ? 118  TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1 124 ? 1.219  37.705 5.956   1.00 62.65 ? 118  TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1 124 ? -0.002 36.238 4.504   1.00 62.95 ? 118  TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1 124 ? 1.615  36.619 6.736   1.00 63.84 ? 118  TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1 124 ? 0.389  35.144 5.274   1.00 63.25 ? 118  TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1 124 ? 1.196  35.340 6.387   1.00 63.77 ? 118  TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1 124 ? 1.591  34.258 7.139   1.00 63.14 ? 118  TYR A OH    1 
ATOM   946  N  N     . ARG A 1 125 ? -1.475 41.654 3.507   1.00 58.58 ? 119  ARG A N     1 
ATOM   947  C  CA    . ARG A 1 125 ? -1.451 42.897 2.743   1.00 56.14 ? 119  ARG A CA    1 
ATOM   948  C  C     . ARG A 1 125 ? -0.924 44.008 3.641   1.00 55.21 ? 119  ARG A C     1 
ATOM   949  O  O     . ARG A 1 125 ? 0.016  44.712 3.288   1.00 54.39 ? 119  ARG A O     1 
ATOM   950  C  CB    . ARG A 1 125 ? -2.860 43.253 2.252   1.00 55.73 ? 119  ARG A CB    1 
ATOM   951  C  CG    . ARG A 1 125 ? -2.909 44.456 1.295   1.00 55.99 ? 119  ARG A CG    1 
ATOM   952  C  CD    . ARG A 1 125 ? -4.346 44.886 0.984   1.00 54.03 ? 119  ARG A CD    1 
ATOM   953  N  NE    . ARG A 1 125 ? -5.023 45.431 2.159   1.00 53.32 ? 119  ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1 125 ? -4.739 46.611 2.707   1.00 53.47 ? 119  ARG A CZ    1 
ATOM   955  N  NH1   . ARG A 1 125 ? -3.797 47.377 2.181   1.00 54.24 ? 119  ARG A NH1   1 
ATOM   956  N  NH2   . ARG A 1 125 ? -5.386 47.019 3.789   1.00 53.48 ? 119  ARG A NH2   1 
ATOM   957  N  N     . GLU A 1 126 ? -1.525 44.155 4.816   1.00 54.96 ? 120  GLU A N     1 
ATOM   958  C  CA    . GLU A 1 126 ? -1.092 45.185 5.746   1.00 55.27 ? 120  GLU A CA    1 
ATOM   959  C  C     . GLU A 1 126 ? 0.315  44.932 6.274   1.00 53.81 ? 120  GLU A C     1 
ATOM   960  O  O     . GLU A 1 126 ? 1.072  45.872 6.516   1.00 53.84 ? 120  GLU A O     1 
ATOM   961  C  CB    . GLU A 1 126 ? -2.085 45.307 6.908   1.00 57.28 ? 120  GLU A CB    1 
ATOM   962  C  CG    . GLU A 1 126 ? -3.301 46.163 6.564   1.00 61.56 ? 120  GLU A CG    1 
ATOM   963  C  CD    . GLU A 1 126 ? -4.346 46.212 7.664   1.00 63.10 ? 120  GLU A CD    1 
ATOM   964  O  OE1   . GLU A 1 126 ? -3.969 46.271 8.859   1.00 63.13 ? 120  GLU A OE1   1 
ATOM   965  O  OE2   . GLU A 1 126 ? -5.552 46.211 7.324   1.00 65.23 ? 120  GLU A OE2   1 
ATOM   966  N  N     . ALA A 1 127 ? 0.672  43.664 6.448   1.00 52.09 ? 121  ALA A N     1 
ATOM   967  C  CA    . ALA A 1 127 ? 2.002  43.321 6.947   1.00 49.47 ? 121  ALA A CA    1 
ATOM   968  C  C     . ALA A 1 127 ? 3.058  43.779 5.943   1.00 47.94 ? 121  ALA A C     1 
ATOM   969  O  O     . ALA A 1 127 ? 4.039  44.427 6.307   1.00 45.31 ? 121  ALA A O     1 
ATOM   970  C  CB    . ALA A 1 127 ? 2.106  41.820 7.178   1.00 49.93 ? 121  ALA A CB    1 
ATOM   971  N  N     . TYR A 1 128 ? 2.833  43.440 4.677   1.00 46.18 ? 122  TYR A N     1 
ATOM   972  C  CA    . TYR A 1 128 ? 3.725  43.809 3.590   1.00 45.42 ? 122  TYR A CA    1 
ATOM   973  C  C     . TYR A 1 128 ? 3.953  45.322 3.574   1.00 47.52 ? 122  TYR A C     1 
ATOM   974  O  O     . TYR A 1 128 ? 5.103  45.789 3.519   1.00 47.60 ? 122  TYR A O     1 
ATOM   975  C  CB    . TYR A 1 128 ? 3.104  43.364 2.271   1.00 44.71 ? 122  TYR A CB    1 
ATOM   976  C  CG    . TYR A 1 128 ? 3.899  43.714 1.039   1.00 46.27 ? 122  TYR A CG    1 
ATOM   977  C  CD1   . TYR A 1 128 ? 4.773  42.796 0.468   1.00 46.14 ? 122  TYR A CD1   1 
ATOM   978  C  CD2   . TYR A 1 128 ? 3.753  44.957 0.424   1.00 47.40 ? 122  TYR A CD2   1 
ATOM   979  C  CE1   . TYR A 1 128 ? 5.478  43.099 -0.688  1.00 45.46 ? 122  TYR A CE1   1 
ATOM   980  C  CE2   . TYR A 1 128 ? 4.456  45.272 -0.733  1.00 47.36 ? 122  TYR A CE2   1 
ATOM   981  C  CZ    . TYR A 1 128 ? 5.314  44.337 -1.282  1.00 46.64 ? 122  TYR A CZ    1 
ATOM   982  O  OH    . TYR A 1 128 ? 6.006  44.634 -2.427  1.00 46.64 ? 122  TYR A OH    1 
ATOM   983  N  N     . ASN A 1 129 ? 2.860  46.084 3.619   1.00 46.73 ? 123  ASN A N     1 
ATOM   984  C  CA    . ASN A 1 129 ? 2.949  47.542 3.614   1.00 46.32 ? 123  ASN A CA    1 
ATOM   985  C  C     . ASN A 1 129 ? 3.742  48.042 4.814   1.00 45.59 ? 123  ASN A C     1 
ATOM   986  O  O     . ASN A 1 129 ? 4.407  49.075 4.736   1.00 45.64 ? 123  ASN A O     1 
ATOM   987  C  CB    . ASN A 1 129 ? 1.553  48.180 3.614   1.00 47.26 ? 123  ASN A CB    1 
ATOM   988  C  CG    . ASN A 1 129 ? 0.811  47.967 2.306   1.00 47.58 ? 123  ASN A CG    1 
ATOM   989  O  OD1   . ASN A 1 129 ? 1.414  47.946 1.230   1.00 48.87 ? 123  ASN A OD1   1 
ATOM   990  N  ND2   . ASN A 1 129 ? -0.507 47.826 2.389   1.00 48.40 ? 123  ASN A ND2   1 
ATOM   991  N  N     . LEU A 1 130 ? 3.662  47.322 5.928   1.00 44.59 ? 124  LEU A N     1 
ATOM   992  C  CA    . LEU A 1 130 ? 4.423  47.714 7.107   1.00 45.71 ? 124  LEU A CA    1 
ATOM   993  C  C     . LEU A 1 130 ? 5.896  47.466 6.778   1.00 46.30 ? 124  LEU A C     1 
ATOM   994  O  O     . LEU A 1 130 ? 6.795  48.117 7.315   1.00 45.07 ? 124  LEU A O     1 
ATOM   995  C  CB    . LEU A 1 130 ? 4.011  46.888 8.327   1.00 44.80 ? 124  LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 130 ? 4.816  47.228 9.581   1.00 46.67 ? 124  LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 130 ? 4.732  48.722 9.845   1.00 46.34 ? 124  LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 130 ? 4.299  46.435 10.771  1.00 45.33 ? 124  LEU A CD2   1 
ATOM   999  N  N     . GLY A 1 131 ? 6.120  46.518 5.872   1.00 47.12 ? 125  GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 131 ? 7.466  46.195 5.452   1.00 48.55 ? 125  GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 131 ? 8.059  47.387 4.742   1.00 49.39 ? 125  GLY A C     1 
ATOM   1002 O  O     . GLY A 1 131 ? 9.123  47.876 5.118   1.00 48.72 ? 125  GLY A O     1 
ATOM   1003 N  N     . LEU A 1 132 ? 7.358  47.856 3.711   1.00 50.33 ? 126  LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 132 ? 7.800  49.014 2.939   1.00 49.95 ? 126  LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 132 ? 8.038  50.244 3.813   1.00 48.92 ? 126  LEU A C     1 
ATOM   1006 O  O     . LEU A 1 132 ? 9.047  50.938 3.656   1.00 48.67 ? 126  LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 132 ? 6.778  49.347 1.863   1.00 50.97 ? 126  LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 132 ? 6.567  48.280 0.788   1.00 53.53 ? 126  LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 132 ? 5.438  48.719 -0.129  1.00 54.03 ? 126  LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 132 ? 7.850  48.064 0.002   1.00 53.05 ? 126  LEU A CD2   1 
ATOM   1011 N  N     A GLU A 1 133 ? 7.118  50.509 4.734   0.50 48.03 ? 127  GLU A N     1 
ATOM   1012 N  N     B GLU A 1 133 ? 7.120  50.528 4.730   0.50 47.23 ? 127  GLU A N     1 
ATOM   1013 C  CA    A GLU A 1 133 ? 7.271  51.653 5.624   0.50 48.17 ? 127  GLU A CA    1 
ATOM   1014 C  CA    B GLU A 1 133 ? 7.304  51.692 5.590   0.50 46.80 ? 127  GLU A CA    1 
ATOM   1015 C  C     A GLU A 1 133 ? 8.583  51.532 6.392   0.50 47.53 ? 127  GLU A C     1 
ATOM   1016 C  C     B GLU A 1 133 ? 8.591  51.543 6.404   0.50 46.65 ? 127  GLU A C     1 
ATOM   1017 O  O     A GLU A 1 133 ? 9.387  52.467 6.431   0.50 46.48 ? 127  GLU A O     1 
ATOM   1018 O  O     B GLU A 1 133 ? 9.392  52.478 6.489   0.50 45.64 ? 127  GLU A O     1 
ATOM   1019 C  CB    A GLU A 1 133 ? 6.108  51.725 6.614   0.50 48.66 ? 127  GLU A CB    1 
ATOM   1020 C  CB    B GLU A 1 133 ? 6.101  51.886 6.516   0.50 45.53 ? 127  GLU A CB    1 
ATOM   1021 C  CG    A GLU A 1 133 ? 6.281  52.780 7.697   0.50 51.22 ? 127  GLU A CG    1 
ATOM   1022 C  CG    B GLU A 1 133 ? 4.778  52.150 5.791   0.50 45.80 ? 127  GLU A CG    1 
ATOM   1023 C  CD    A GLU A 1 133 ? 6.469  54.177 7.129   0.50 53.38 ? 127  GLU A CD    1 
ATOM   1024 C  CD    B GLU A 1 133 ? 4.890  53.193 4.684   0.50 46.07 ? 127  GLU A CD    1 
ATOM   1025 O  OE1   A GLU A 1 133 ? 5.605  54.619 6.339   0.50 53.87 ? 127  GLU A OE1   1 
ATOM   1026 O  OE1   B GLU A 1 133 ? 5.420  54.295 4.935   0.50 45.02 ? 127  GLU A OE1   1 
ATOM   1027 O  OE2   A GLU A 1 133 ? 7.477  54.834 7.475   0.50 54.42 ? 127  GLU A OE2   1 
ATOM   1028 O  OE2   B GLU A 1 133 ? 4.435  52.910 3.556   0.50 46.82 ? 127  GLU A OE2   1 
ATOM   1029 N  N     . ILE A 1 134 ? 8.790  50.366 6.998   1.00 46.87 ? 128  ILE A N     1 
ATOM   1030 C  CA    . ILE A 1 134 ? 9.987  50.099 7.779   1.00 44.65 ? 128  ILE A CA    1 
ATOM   1031 C  C     . ILE A 1 134 ? 11.225 50.301 6.907   1.00 43.66 ? 128  ILE A C     1 
ATOM   1032 O  O     . ILE A 1 134 ? 12.141 51.028 7.281   1.00 43.63 ? 128  ILE A O     1 
ATOM   1033 C  CB    . ILE A 1 134 ? 9.968  48.657 8.346   1.00 45.63 ? 128  ILE A CB    1 
ATOM   1034 C  CG1   . ILE A 1 134 ? 8.949  48.572 9.485   1.00 45.46 ? 128  ILE A CG1   1 
ATOM   1035 C  CG2   . ILE A 1 134 ? 11.366 48.245 8.806   1.00 43.07 ? 128  ILE A CG2   1 
ATOM   1036 C  CD1   . ILE A 1 134 ? 8.909  47.238 10.213  1.00 45.35 ? 128  ILE A CD1   1 
ATOM   1037 N  N     . LYS A 1 135 ? 11.246 49.664 5.742   1.00 43.37 ? 129  LYS A N     1 
ATOM   1038 C  CA    . LYS A 1 135 ? 12.373 49.802 4.834   1.00 43.84 ? 129  LYS A CA    1 
ATOM   1039 C  C     . LYS A 1 135 ? 12.636 51.274 4.545   1.00 45.25 ? 129  LYS A C     1 
ATOM   1040 O  O     . LYS A 1 135 ? 13.706 51.802 4.860   1.00 44.86 ? 129  LYS A O     1 
ATOM   1041 C  CB    . LYS A 1 135 ? 12.098 49.070 3.516   1.00 42.50 ? 129  LYS A CB    1 
ATOM   1042 C  CG    . LYS A 1 135 ? 12.018 47.558 3.645   1.00 41.43 ? 129  LYS A CG    1 
ATOM   1043 C  CD    . LYS A 1 135 ? 11.954 46.884 2.281   1.00 40.23 ? 129  LYS A CD    1 
ATOM   1044 C  CE    . LYS A 1 135 ? 13.130 47.321 1.414   1.00 42.42 ? 129  LYS A CE    1 
ATOM   1045 N  NZ    . LYS A 1 135 ? 13.224 46.578 0.135   1.00 41.17 ? 129  LYS A NZ    1 
ATOM   1046 N  N     . ASN A 1 136 ? 11.647 51.932 3.952   1.00 47.13 ? 130  ASN A N     1 
ATOM   1047 C  CA    . ASN A 1 136 ? 11.762 53.337 3.609   1.00 49.00 ? 130  ASN A CA    1 
ATOM   1048 C  C     . ASN A 1 136 ? 12.268 54.176 4.772   1.00 48.28 ? 130  ASN A C     1 
ATOM   1049 O  O     . ASN A 1 136 ? 13.149 55.012 4.610   1.00 49.62 ? 130  ASN A O     1 
ATOM   1050 C  CB    . ASN A 1 136 ? 10.413 53.878 3.152   1.00 52.80 ? 130  ASN A CB    1 
ATOM   1051 C  CG    . ASN A 1 136 ? 10.555 54.920 2.069   1.00 56.62 ? 130  ASN A CG    1 
ATOM   1052 O  OD1   . ASN A 1 136 ? 10.933 54.601 0.937   1.00 59.61 ? 130  ASN A OD1   1 
ATOM   1053 N  ND2   . ASN A 1 136 ? 10.269 56.177 2.409   1.00 58.01 ? 130  ASN A ND2   1 
ATOM   1054 N  N     . LYS A 1 137 ? 11.709 53.956 5.951   1.00 47.79 ? 131  LYS A N     1 
ATOM   1055 C  CA    . LYS A 1 137 ? 12.135 54.715 7.114   1.00 48.86 ? 131  LYS A CA    1 
ATOM   1056 C  C     . LYS A 1 137 ? 13.628 54.522 7.391   1.00 48.04 ? 131  LYS A C     1 
ATOM   1057 O  O     . LYS A 1 137 ? 14.373 55.503 7.496   1.00 48.43 ? 131  LYS A O     1 
ATOM   1058 C  CB    . LYS A 1 137 ? 11.326 54.298 8.343   1.00 50.51 ? 131  LYS A CB    1 
ATOM   1059 C  CG    . LYS A 1 137 ? 11.787 54.934 9.649   1.00 53.42 ? 131  LYS A CG    1 
ATOM   1060 C  CD    . LYS A 1 137 ? 11.160 56.304 9.904   1.00 55.97 ? 131  LYS A CD    1 
ATOM   1061 C  CE    . LYS A 1 137 ? 11.456 56.770 11.335  1.00 57.49 ? 131  LYS A CE    1 
ATOM   1062 N  NZ    . LYS A 1 137 ? 10.530 57.838 11.823  1.00 58.45 ? 131  LYS A NZ    1 
ATOM   1063 N  N     . ILE A 1 138 ? 14.061 53.266 7.515   1.00 46.54 ? 132  ILE A N     1 
ATOM   1064 C  CA    . ILE A 1 138 ? 15.472 52.961 7.789   1.00 43.20 ? 132  ILE A CA    1 
ATOM   1065 C  C     . ILE A 1 138 ? 16.381 53.601 6.737   1.00 41.66 ? 132  ILE A C     1 
ATOM   1066 O  O     . ILE A 1 138 ? 17.388 54.219 7.065   1.00 39.30 ? 132  ILE A O     1 
ATOM   1067 C  CB    . ILE A 1 138 ? 15.730 51.416 7.829   1.00 42.62 ? 132  ILE A CB    1 
ATOM   1068 C  CG1   . ILE A 1 138 ? 15.115 50.814 9.094   1.00 39.67 ? 132  ILE A CG1   1 
ATOM   1069 C  CG2   . ILE A 1 138 ? 17.227 51.125 7.820   1.00 42.31 ? 132  ILE A CG2   1 
ATOM   1070 C  CD1   . ILE A 1 138 ? 15.222 49.310 9.178   1.00 36.44 ? 132  ILE A CD1   1 
ATOM   1071 N  N     . LEU A 1 139 ? 16.004 53.465 5.475   1.00 42.33 ? 133  LEU A N     1 
ATOM   1072 C  CA    . LEU A 1 139 ? 16.780 54.019 4.380   1.00 42.95 ? 133  LEU A CA    1 
ATOM   1073 C  C     . LEU A 1 139 ? 16.922 55.534 4.474   1.00 44.38 ? 133  LEU A C     1 
ATOM   1074 O  O     . LEU A 1 139 ? 17.970 56.089 4.148   1.00 44.28 ? 133  LEU A O     1 
ATOM   1075 C  CB    . LEU A 1 139 ? 16.133 53.638 3.049   1.00 43.38 ? 133  LEU A CB    1 
ATOM   1076 C  CG    . LEU A 1 139 ? 16.776 54.184 1.775   1.00 44.03 ? 133  LEU A CG    1 
ATOM   1077 C  CD1   . LEU A 1 139 ? 18.248 53.840 1.749   1.00 42.21 ? 133  LEU A CD1   1 
ATOM   1078 C  CD2   . LEU A 1 139 ? 16.064 53.612 0.562   1.00 42.84 ? 133  LEU A CD2   1 
ATOM   1079 N  N     . GLU A 1 140 ? 15.870 56.206 4.926   1.00 45.99 ? 134  GLU A N     1 
ATOM   1080 C  CA    . GLU A 1 140 ? 15.905 57.657 5.039   1.00 45.56 ? 134  GLU A CA    1 
ATOM   1081 C  C     . GLU A 1 140 ? 16.642 58.118 6.277   1.00 46.08 ? 134  GLU A C     1 
ATOM   1082 O  O     . GLU A 1 140 ? 17.331 59.133 6.244   1.00 45.67 ? 134  GLU A O     1 
ATOM   1083 C  CB    . GLU A 1 140 ? 14.487 58.226 5.055   1.00 45.79 ? 134  GLU A CB    1 
ATOM   1084 C  CG    . GLU A 1 140 ? 13.621 57.777 3.887   0.50 44.76 ? 134  GLU A CG    1 
ATOM   1085 C  CD    . GLU A 1 140 ? 12.282 58.486 3.860   0.50 44.33 ? 134  GLU A CD    1 
ATOM   1086 O  OE1   . GLU A 1 140 ? 11.683 58.672 4.941   0.50 43.32 ? 134  GLU A OE1   1 
ATOM   1087 O  OE2   . GLU A 1 140 ? 11.827 58.852 2.756   0.50 44.27 ? 134  GLU A OE2   1 
ATOM   1088 N  N     . LYS A 1 141 ? 16.500 57.368 7.366   1.00 45.38 ? 135  LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 141 ? 17.145 57.719 8.623   1.00 45.35 ? 135  LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 141 ? 18.627 57.344 8.712   1.00 45.48 ? 135  LYS A C     1 
ATOM   1091 O  O     . LYS A 1 141 ? 19.408 58.047 9.359   1.00 44.63 ? 135  LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 141 ? 16.397 57.074 9.795   1.00 47.88 ? 135  LYS A CB    1 
ATOM   1093 C  CG    . LYS A 1 141 ? 15.028 57.660 10.083  1.00 49.31 ? 135  LYS A CG    1 
ATOM   1094 C  CD    . LYS A 1 141 ? 15.146 59.028 10.739  1.00 52.66 ? 135  LYS A CD    1 
ATOM   1095 C  CE    . LYS A 1 141 ? 13.804 59.742 10.796  1.00 54.71 ? 135  LYS A CE    1 
ATOM   1096 N  NZ    . LYS A 1 141 ? 13.262 60.018 9.428   1.00 55.12 ? 135  LYS A NZ    1 
ATOM   1097 N  N     . GLU A 1 142 ? 19.018 56.241 8.072   1.00 43.84 ? 136  GLU A N     1 
ATOM   1098 C  CA    . GLU A 1 142 ? 20.409 55.791 8.123   1.00 39.65 ? 136  GLU A CA    1 
ATOM   1099 C  C     . GLU A 1 142 ? 21.061 55.509 6.768   1.00 38.84 ? 136  GLU A C     1 
ATOM   1100 O  O     . GLU A 1 142 ? 22.236 55.179 6.710   1.00 38.03 ? 136  GLU A O     1 
ATOM   1101 C  CB    . GLU A 1 142 ? 20.517 54.534 8.982   1.00 40.66 ? 136  GLU A CB    1 
ATOM   1102 C  CG    . GLU A 1 142 ? 20.067 54.687 10.426  1.00 40.64 ? 136  GLU A CG    1 
ATOM   1103 C  CD    . GLU A 1 142 ? 20.947 55.616 11.231  1.00 43.26 ? 136  GLU A CD    1 
ATOM   1104 O  OE1   . GLU A 1 142 ? 22.146 55.746 10.888  1.00 42.69 ? 136  GLU A OE1   1 
ATOM   1105 O  OE2   . GLU A 1 142 ? 20.447 56.203 12.225  1.00 44.44 ? 136  GLU A OE2   1 
ATOM   1106 N  N     . LYS A 1 143 ? 20.305 55.636 5.683   1.00 38.20 ? 137  LYS A N     1 
ATOM   1107 C  CA    . LYS A 1 143 ? 20.839 55.385 4.345   1.00 38.67 ? 137  LYS A CA    1 
ATOM   1108 C  C     . LYS A 1 143 ? 21.289 53.925 4.247   1.00 37.52 ? 137  LYS A C     1 
ATOM   1109 O  O     . LYS A 1 143 ? 22.304 53.610 3.630   1.00 37.86 ? 137  LYS A O     1 
ATOM   1110 C  CB    . LYS A 1 143 ? 22.027 56.321 4.035   1.00 38.61 ? 137  LYS A CB    1 
ATOM   1111 C  CG    . LYS A 1 143 ? 21.772 57.826 4.285   1.00 41.57 ? 137  LYS A CG    1 
ATOM   1112 C  CD    . LYS A 1 143 ? 20.827 58.462 3.267   0.50 41.21 ? 137  LYS A CD    1 
ATOM   1113 C  CE    . LYS A 1 143 ? 21.575 59.130 2.111   0.50 41.89 ? 137  LYS A CE    1 
ATOM   1114 N  NZ    . LYS A 1 143 ? 22.271 60.395 2.501   0.50 42.65 ? 137  LYS A NZ    1 
ATOM   1115 N  N     . ILE A 1 144 ? 20.524 53.037 4.863   1.00 35.80 ? 138  ILE A N     1 
ATOM   1116 C  CA    . ILE A 1 144 ? 20.840 51.615 4.840   1.00 32.58 ? 138  ILE A CA    1 
ATOM   1117 C  C     . ILE A 1 144 ? 19.674 50.858 4.213   1.00 33.27 ? 138  ILE A C     1 
ATOM   1118 O  O     . ILE A 1 144 ? 18.523 51.013 4.648   1.00 29.54 ? 138  ILE A O     1 
ATOM   1119 C  CB    . ILE A 1 144 ? 21.052 51.066 6.271   1.00 31.89 ? 138  ILE A CB    1 
ATOM   1120 C  CG1   . ILE A 1 144 ? 22.328 51.653 6.879   1.00 30.61 ? 138  ILE A CG1   1 
ATOM   1121 C  CG2   . ILE A 1 144 ? 21.080 49.545 6.245   1.00 28.57 ? 138  ILE A CG2   1 
ATOM   1122 C  CD1   . ILE A 1 144 ? 23.600 51.222 6.168   1.00 27.84 ? 138  ILE A CD1   1 
ATOM   1123 N  N     . THR A 1 145 ? 19.961 50.060 3.186   1.00 30.41 ? 139  THR A N     1 
ATOM   1124 C  CA    . THR A 1 145 ? 18.922 49.263 2.556   1.00 31.46 ? 139  THR A CA    1 
ATOM   1125 C  C     . THR A 1 145 ? 18.942 47.893 3.256   1.00 31.08 ? 139  THR A C     1 
ATOM   1126 O  O     . THR A 1 145 ? 20.006 47.392 3.634   1.00 29.22 ? 139  THR A O     1 
ATOM   1127 C  CB    . THR A 1 145 ? 19.163 49.092 1.026   1.00 34.19 ? 139  THR A CB    1 
ATOM   1128 O  OG1   . THR A 1 145 ? 20.222 48.154 0.800   1.00 38.34 ? 139  THR A OG1   1 
ATOM   1129 C  CG2   . THR A 1 145 ? 19.557 50.427 0.389   1.00 34.21 ? 139  THR A CG2   1 
ATOM   1130 N  N     . VAL A 1 146 ? 17.757 47.318 3.452   1.00 29.36 ? 140  VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 146 ? 17.597 46.031 4.114   1.00 31.48 ? 140  VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 146 ? 16.604 45.176 3.323   1.00 33.12 ? 140  VAL A C     1 
ATOM   1133 O  O     . VAL A 1 146 ? 15.912 45.677 2.436   1.00 34.16 ? 140  VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 146 ? 17.036 46.218 5.543   1.00 29.95 ? 140  VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 146 ? 17.806 47.308 6.258   1.00 28.54 ? 140  VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 146 ? 15.538 46.587 5.479   1.00 28.96 ? 140  VAL A CG2   1 
ATOM   1137 N  N     . THR A 1 147 ? 16.542 43.884 3.642   1.00 34.63 ? 141  THR A N     1 
ATOM   1138 C  CA    . THR A 1 147 ? 15.612 42.971 2.979   1.00 33.76 ? 141  THR A CA    1 
ATOM   1139 C  C     . THR A 1 147 ? 14.613 42.481 4.009   1.00 35.33 ? 141  THR A C     1 
ATOM   1140 O  O     . THR A 1 147 ? 14.980 42.113 5.131   1.00 35.53 ? 141  THR A O     1 
ATOM   1141 C  CB    . THR A 1 147 ? 16.318 41.762 2.371   1.00 32.96 ? 141  THR A CB    1 
ATOM   1142 O  OG1   . THR A 1 147 ? 17.073 42.189 1.243   1.00 32.81 ? 141  THR A OG1   1 
ATOM   1143 C  CG2   . THR A 1 147 ? 15.310 40.711 1.919   1.00 31.82 ? 141  THR A CG2   1 
ATOM   1144 N  N     . VAL A 1 148 ? 13.344 42.476 3.624   1.00 35.24 ? 142  VAL A N     1 
ATOM   1145 C  CA    . VAL A 1 148 ? 12.305 42.051 4.541   1.00 33.73 ? 142  VAL A CA    1 
ATOM   1146 C  C     . VAL A 1 148 ? 11.662 40.747 4.129   1.00 31.85 ? 142  VAL A C     1 
ATOM   1147 O  O     . VAL A 1 148 ? 11.424 40.511 2.947   1.00 32.32 ? 142  VAL A O     1 
ATOM   1148 C  CB    . VAL A 1 148 ? 11.224 43.141 4.679   1.00 34.77 ? 142  VAL A CB    1 
ATOM   1149 C  CG1   . VAL A 1 148 ? 10.054 42.628 5.529   1.00 35.48 ? 142  VAL A CG1   1 
ATOM   1150 C  CG2   . VAL A 1 148 ? 11.831 44.373 5.325   1.00 31.42 ? 142  VAL A CG2   1 
ATOM   1151 N  N     . GLY A 1 149 ? 11.415 39.901 5.126   1.00 30.20 ? 143  GLY A N     1 
ATOM   1152 C  CA    . GLY A 1 149 ? 10.782 38.613 4.914   1.00 30.79 ? 143  GLY A CA    1 
ATOM   1153 C  C     . GLY A 1 149 ? 9.600  38.496 5.863   1.00 30.76 ? 143  GLY A C     1 
ATOM   1154 O  O     . GLY A 1 149 ? 9.722  38.811 7.044   1.00 29.42 ? 143  GLY A O     1 
ATOM   1155 N  N     . ILE A 1 150 ? 8.456  38.047 5.350   1.00 33.72 ? 144  ILE A N     1 
ATOM   1156 C  CA    . ILE A 1 150 ? 7.246  37.914 6.159   1.00 35.43 ? 144  ILE A CA    1 
ATOM   1157 C  C     . ILE A 1 150 ? 6.535  36.579 5.949   1.00 36.55 ? 144  ILE A C     1 
ATOM   1158 O  O     . ILE A 1 150 ? 6.365  36.125 4.814   1.00 37.70 ? 144  ILE A O     1 
ATOM   1159 C  CB    . ILE A 1 150 ? 6.239  39.062 5.835   1.00 37.34 ? 144  ILE A CB    1 
ATOM   1160 C  CG1   . ILE A 1 150 ? 6.883  40.417 6.109   1.00 39.19 ? 144  ILE A CG1   1 
ATOM   1161 C  CG2   . ILE A 1 150 ? 4.980  38.927 6.689   1.00 37.42 ? 144  ILE A CG2   1 
ATOM   1162 C  CD1   . ILE A 1 150 ? 6.108  41.588 5.527   1.00 42.24 ? 144  ILE A CD1   1 
ATOM   1163 N  N     . SER A 1 151 ? 6.117  35.959 7.052   1.00 37.71 ? 145  SER A N     1 
ATOM   1164 C  CA    . SER A 1 151 ? 5.393  34.688 7.008   1.00 40.05 ? 145  SER A CA    1 
ATOM   1165 C  C     . SER A 1 151 ? 4.776  34.373 8.365   1.00 40.53 ? 145  SER A C     1 
ATOM   1166 O  O     . SER A 1 151 ? 4.711  35.242 9.239   1.00 39.13 ? 145  SER A O     1 
ATOM   1167 C  CB    . SER A 1 151 ? 6.311  33.538 6.585   1.00 41.92 ? 145  SER A CB    1 
ATOM   1168 O  OG    . SER A 1 151 ? 5.555  32.355 6.380   1.00 42.43 ? 145  SER A OG    1 
ATOM   1169 N  N     . LYS A 1 152 ? 4.339  33.127 8.553   1.00 41.51 ? 146  LYS A N     1 
ATOM   1170 C  CA    . LYS A 1 152 ? 3.694  32.740 9.810   1.00 41.68 ? 146  LYS A CA    1 
ATOM   1171 C  C     . LYS A 1 152 ? 4.619  32.470 10.986  1.00 41.66 ? 146  LYS A C     1 
ATOM   1172 O  O     . LYS A 1 152 ? 4.177  32.492 12.134  1.00 41.49 ? 146  LYS A O     1 
ATOM   1173 C  CB    . LYS A 1 152 ? 2.769  31.541 9.587   1.00 41.71 ? 146  LYS A CB    1 
ATOM   1174 C  CG    . LYS A 1 152 ? 3.472  30.261 9.223   1.00 43.68 ? 146  LYS A CG    1 
ATOM   1175 C  CD    . LYS A 1 152 ? 2.526  29.285 8.549   1.00 46.12 ? 146  LYS A CD    1 
ATOM   1176 C  CE    . LYS A 1 152 ? 1.372  28.878 9.449   1.00 44.87 ? 146  LYS A CE    1 
ATOM   1177 N  NZ    . LYS A 1 152 ? 0.500  27.920 8.730   1.00 48.27 ? 146  LYS A NZ    1 
ATOM   1178 N  N     . ASN A 1 153 ? 5.893  32.199 10.721  1.00 41.53 ? 147  ASN A N     1 
ATOM   1179 C  CA    . ASN A 1 153 ? 6.837  31.978 11.821  1.00 41.35 ? 147  ASN A CA    1 
ATOM   1180 C  C     . ASN A 1 153 ? 8.218  32.503 11.446  1.00 39.74 ? 147  ASN A C     1 
ATOM   1181 O  O     . ASN A 1 153 ? 8.466  32.849 10.289  1.00 39.07 ? 147  ASN A O     1 
ATOM   1182 C  CB    . ASN A 1 153 ? 6.926  30.494 12.202  1.00 41.33 ? 147  ASN A CB    1 
ATOM   1183 C  CG    . ASN A 1 153 ? 7.295  29.618 11.034  1.00 45.05 ? 147  ASN A CG    1 
ATOM   1184 O  OD1   . ASN A 1 153 ? 8.222  29.919 10.279  1.00 46.76 ? 147  ASN A OD1   1 
ATOM   1185 N  ND2   . ASN A 1 153 ? 6.577  28.514 10.877  1.00 45.85 ? 147  ASN A ND2   1 
ATOM   1186 N  N     . LYS A 1 154 ? 9.108  32.555 12.432  1.00 37.17 ? 148  LYS A N     1 
ATOM   1187 C  CA    . LYS A 1 154 ? 10.460 33.052 12.238  1.00 36.47 ? 148  LYS A CA    1 
ATOM   1188 C  C     . LYS A 1 154 ? 11.237 32.374 11.120  1.00 35.31 ? 148  LYS A C     1 
ATOM   1189 O  O     . LYS A 1 154 ? 11.859 33.053 10.300  1.00 35.25 ? 148  LYS A O     1 
ATOM   1190 C  CB    . LYS A 1 154 ? 11.242 32.952 13.550  1.00 37.05 ? 148  LYS A CB    1 
ATOM   1191 C  CG    . LYS A 1 154 ? 10.656 33.814 14.655  1.00 38.93 ? 148  LYS A CG    1 
ATOM   1192 C  CD    . LYS A 1 154 ? 11.650 34.086 15.764  1.00 39.32 ? 148  LYS A CD    1 
ATOM   1193 C  CE    . LYS A 1 154 ? 11.822 32.887 16.681  1.00 43.58 ? 148  LYS A CE    1 
ATOM   1194 N  NZ    . LYS A 1 154 ? 12.792 33.195 17.780  1.00 44.36 ? 148  LYS A NZ    1 
ATOM   1195 N  N     . VAL A 1 155 ? 11.196 31.044 11.088  1.00 33.39 ? 149  VAL A N     1 
ATOM   1196 C  CA    . VAL A 1 155 ? 11.902 30.275 10.074  1.00 31.25 ? 149  VAL A CA    1 
ATOM   1197 C  C     . VAL A 1 155 ? 11.530 30.667 8.641   1.00 30.34 ? 149  VAL A C     1 
ATOM   1198 O  O     . VAL A 1 155 ? 12.404 30.968 7.841   1.00 29.81 ? 149  VAL A O     1 
ATOM   1199 C  CB    . VAL A 1 155 ? 11.670 28.749 10.265  1.00 30.85 ? 149  VAL A CB    1 
ATOM   1200 C  CG1   . VAL A 1 155 ? 12.218 27.974 9.077   1.00 29.44 ? 149  VAL A CG1   1 
ATOM   1201 C  CG2   . VAL A 1 155 ? 12.353 28.278 11.528  1.00 30.38 ? 149  VAL A CG2   1 
ATOM   1202 N  N     . PHE A 1 156 ? 10.245 30.660 8.301   1.00 31.20 ? 150  PHE A N     1 
ATOM   1203 C  CA    . PHE A 1 156 ? 9.868  31.029 6.938   1.00 32.72 ? 150  PHE A CA    1 
ATOM   1204 C  C     . PHE A 1 156 ? 9.971  32.523 6.663   1.00 31.16 ? 150  PHE A C     1 
ATOM   1205 O  O     . PHE A 1 156 ? 10.025 32.944 5.503   1.00 28.24 ? 150  PHE A O     1 
ATOM   1206 C  CB    . PHE A 1 156 ? 8.472  30.508 6.595   1.00 34.85 ? 150  PHE A CB    1 
ATOM   1207 C  CG    . PHE A 1 156 ? 8.443  29.033 6.364   1.00 38.32 ? 150  PHE A CG    1 
ATOM   1208 C  CD1   . PHE A 1 156 ? 8.082  28.161 7.386   1.00 37.82 ? 150  PHE A CD1   1 
ATOM   1209 C  CD2   . PHE A 1 156 ? 8.864  28.506 5.146   1.00 39.75 ? 150  PHE A CD2   1 
ATOM   1210 C  CE1   . PHE A 1 156 ? 8.147  26.781 7.204   1.00 39.19 ? 150  PHE A CE1   1 
ATOM   1211 C  CE2   . PHE A 1 156 ? 8.936  27.127 4.948   1.00 40.53 ? 150  PHE A CE2   1 
ATOM   1212 C  CZ    . PHE A 1 156 ? 8.577  26.260 5.985   1.00 40.52 ? 150  PHE A CZ    1 
ATOM   1213 N  N     . ALA A 1 157 ? 10.002 33.316 7.730   1.00 30.58 ? 151  ALA A N     1 
ATOM   1214 C  CA    . ALA A 1 157 ? 10.156 34.753 7.590   1.00 32.92 ? 151  ALA A CA    1 
ATOM   1215 C  C     . ALA A 1 157 ? 11.613 34.939 7.135   1.00 32.76 ? 151  ALA A C     1 
ATOM   1216 O  O     . ALA A 1 157 ? 11.897 35.668 6.174   1.00 34.68 ? 151  ALA A O     1 
ATOM   1217 C  CB    . ALA A 1 157 ? 9.905  35.447 8.924   1.00 32.36 ? 151  ALA A CB    1 
ATOM   1218 N  N     . LYS A 1 158 ? 12.531 34.251 7.808   1.00 32.90 ? 152  LYS A N     1 
ATOM   1219 C  CA    . LYS A 1 158 ? 13.951 34.316 7.451   1.00 33.03 ? 152  LYS A CA    1 
ATOM   1220 C  C     . LYS A 1 158 ? 14.183 33.740 6.047   1.00 31.57 ? 152  LYS A C     1 
ATOM   1221 O  O     . LYS A 1 158 ? 14.987 34.265 5.267   1.00 28.22 ? 152  LYS A O     1 
ATOM   1222 C  CB    . LYS A 1 158 ? 14.777 33.530 8.460   1.00 34.96 ? 152  LYS A CB    1 
ATOM   1223 C  CG    . LYS A 1 158 ? 15.937 32.791 7.834   1.00 38.79 ? 152  LYS A CG    1 
ATOM   1224 C  CD    . LYS A 1 158 ? 17.245 33.481 8.101   1.00 40.10 ? 152  LYS A CD    1 
ATOM   1225 C  CE    . LYS A 1 158 ? 17.661 33.303 9.548   1.00 39.01 ? 152  LYS A CE    1 
ATOM   1226 N  NZ    . LYS A 1 158 ? 19.031 33.839 9.746   1.00 40.01 ? 152  LYS A NZ    1 
ATOM   1227 N  N     . ILE A 1 159 ? 13.490 32.645 5.733   1.00 30.59 ? 153  ILE A N     1 
ATOM   1228 C  CA    . ILE A 1 159 ? 13.616 32.036 4.412   1.00 30.55 ? 153  ILE A CA    1 
ATOM   1229 C  C     . ILE A 1 159 ? 13.096 33.042 3.395   1.00 31.34 ? 153  ILE A C     1 
ATOM   1230 O  O     . ILE A 1 159 ? 13.634 33.168 2.290   1.00 32.42 ? 153  ILE A O     1 
ATOM   1231 C  CB    . ILE A 1 159 ? 12.802 30.715 4.321   1.00 30.32 ? 153  ILE A CB    1 
ATOM   1232 C  CG1   . ILE A 1 159 ? 13.502 29.618 5.146   1.00 28.24 ? 153  ILE A CG1   1 
ATOM   1233 C  CG2   . ILE A 1 159 ? 12.652 30.286 2.873   1.00 26.21 ? 153  ILE A CG2   1 
ATOM   1234 C  CD1   . ILE A 1 159 ? 12.713 28.308 5.261   1.00 22.04 ? 153  ILE A CD1   1 
ATOM   1235 N  N     . ALA A 1 160 ? 12.052 33.768 3.784   1.00 32.68 ? 154  ALA A N     1 
ATOM   1236 C  CA    . ALA A 1 160 ? 11.452 34.784 2.918   1.00 33.69 ? 154  ALA A CA    1 
ATOM   1237 C  C     . ALA A 1 160 ? 12.517 35.803 2.543   1.00 34.58 ? 154  ALA A C     1 
ATOM   1238 O  O     . ALA A 1 160 ? 12.701 36.128 1.369   1.00 36.98 ? 154  ALA A O     1 
ATOM   1239 C  CB    . ALA A 1 160 ? 10.294 35.481 3.643   1.00 33.79 ? 154  ALA A CB    1 
ATOM   1240 N  N     . ALA A 1 161 ? 13.226 36.296 3.555   1.00 34.02 ? 155  ALA A N     1 
ATOM   1241 C  CA    . ALA A 1 161 ? 14.282 37.279 3.349   1.00 33.91 ? 155  ALA A CA    1 
ATOM   1242 C  C     . ALA A 1 161 ? 15.424 36.758 2.473   1.00 33.69 ? 155  ALA A C     1 
ATOM   1243 O  O     . ALA A 1 161 ? 15.860 37.449 1.549   1.00 33.94 ? 155  ALA A O     1 
ATOM   1244 C  CB    . ALA A 1 161 ? 14.824 37.747 4.698   1.00 30.59 ? 155  ALA A CB    1 
ATOM   1245 N  N     . ASP A 1 162 ? 15.913 35.554 2.764   1.00 34.12 ? 156  ASP A N     1 
ATOM   1246 C  CA    . ASP A 1 162 ? 17.009 34.984 1.981   1.00 34.42 ? 156  ASP A CA    1 
ATOM   1247 C  C     . ASP A 1 162 ? 16.611 34.949 0.524   1.00 35.31 ? 156  ASP A C     1 
ATOM   1248 O  O     . ASP A 1 162 ? 17.446 35.109 -0.363  1.00 35.73 ? 156  ASP A O     1 
ATOM   1249 C  CB    . ASP A 1 162 ? 17.355 33.557 2.430   1.00 30.85 ? 156  ASP A CB    1 
ATOM   1250 C  CG    . ASP A 1 162 ? 17.887 33.496 3.840   0.50 27.75 ? 156  ASP A CG    1 
ATOM   1251 O  OD1   . ASP A 1 162 ? 18.462 34.500 4.304   0.50 25.21 ? 156  ASP A OD1   1 
ATOM   1252 O  OD2   . ASP A 1 162 ? 17.744 32.431 4.477   0.50 28.09 ? 156  ASP A OD2   1 
ATOM   1253 N  N     . MET A 1 163 ? 15.328 34.735 0.277   1.00 38.02 ? 157  MET A N     1 
ATOM   1254 C  CA    . MET A 1 163 ? 14.834 34.680 -1.089  1.00 39.64 ? 157  MET A CA    1 
ATOM   1255 C  C     . MET A 1 163 ? 14.741 36.045 -1.771  1.00 40.16 ? 157  MET A C     1 
ATOM   1256 O  O     . MET A 1 163 ? 14.816 36.135 -2.990  1.00 40.76 ? 157  MET A O     1 
ATOM   1257 C  CB    . MET A 1 163 ? 13.470 34.002 -1.114  1.00 42.45 ? 157  MET A CB    1 
ATOM   1258 C  CG    . MET A 1 163 ? 13.513 32.497 -0.890  1.00 43.23 ? 157  MET A CG    1 
ATOM   1259 S  SD    . MET A 1 163 ? 11.859 31.779 -0.790  1.00 45.23 ? 157  MET A SD    1 
ATOM   1260 C  CE    . MET A 1 163 ? 11.383 31.812 -2.523  1.00 47.83 ? 157  MET A CE    1 
ATOM   1261 N  N     . ALA A 1 164 ? 14.600 37.112 -0.994  1.00 39.94 ? 158  ALA A N     1 
ATOM   1262 C  CA    . ALA A 1 164 ? 14.470 38.440 -1.581  1.00 40.06 ? 158  ALA A CA    1 
ATOM   1263 C  C     . ALA A 1 164 ? 15.740 39.280 -1.633  1.00 41.08 ? 158  ALA A C     1 
ATOM   1264 O  O     . ALA A 1 164 ? 15.770 40.305 -2.303  1.00 41.44 ? 158  ALA A O     1 
ATOM   1265 C  CB    . ALA A 1 164 ? 13.380 39.210 -0.863  1.00 37.59 ? 158  ALA A CB    1 
ATOM   1266 N  N     . LYS A 1 165 ? 16.782 38.862 -0.927  1.00 42.20 ? 159  LYS A N     1 
ATOM   1267 C  CA    . LYS A 1 165 ? 18.037 39.604 -0.935  1.00 43.56 ? 159  LYS A CA    1 
ATOM   1268 C  C     . LYS A 1 165 ? 18.519 39.837 -2.365  1.00 44.05 ? 159  LYS A C     1 
ATOM   1269 O  O     . LYS A 1 165 ? 18.385 38.965 -3.220  1.00 45.67 ? 159  LYS A O     1 
ATOM   1270 C  CB    . LYS A 1 165 ? 19.126 38.837 -0.172  1.00 44.69 ? 159  LYS A CB    1 
ATOM   1271 C  CG    . LYS A 1 165 ? 18.996 38.842 1.339   1.00 45.32 ? 159  LYS A CG    1 
ATOM   1272 C  CD    . LYS A 1 165 ? 20.156 38.083 1.977   1.00 43.38 ? 159  LYS A CD    1 
ATOM   1273 C  CE    . LYS A 1 165 ? 20.126 38.191 3.494   1.00 45.26 ? 159  LYS A CE    1 
ATOM   1274 N  NZ    . LYS A 1 165 ? 21.321 37.565 4.146   1.00 41.47 ? 159  LYS A NZ    1 
ATOM   1275 N  N     . PRO A 1 166 ? 19.098 41.020 -2.638  1.00 43.55 ? 160  PRO A N     1 
ATOM   1276 C  CA    . PRO A 1 166 ? 19.316 42.128 -1.701  1.00 42.55 ? 160  PRO A CA    1 
ATOM   1277 C  C     . PRO A 1 166 ? 18.249 43.211 -1.859  1.00 42.31 ? 160  PRO A C     1 
ATOM   1278 O  O     . PRO A 1 166 ? 17.521 43.222 -2.841  1.00 42.15 ? 160  PRO A O     1 
ATOM   1279 C  CB    . PRO A 1 166 ? 20.683 42.639 -2.112  1.00 41.58 ? 160  PRO A CB    1 
ATOM   1280 C  CG    . PRO A 1 166 ? 20.589 42.556 -3.597  1.00 42.03 ? 160  PRO A CG    1 
ATOM   1281 C  CD    . PRO A 1 166 ? 19.931 41.201 -3.844  1.00 42.72 ? 160  PRO A CD    1 
ATOM   1282 N  N     . ASN A 1 167 ? 18.164 44.117 -0.895  1.00 42.09 ? 161  ASN A N     1 
ATOM   1283 C  CA    . ASN A 1 167 ? 17.200 45.211 -0.953  1.00 44.87 ? 161  ASN A CA    1 
ATOM   1284 C  C     . ASN A 1 167 ? 15.804 44.775 -1.397  1.00 45.25 ? 161  ASN A C     1 
ATOM   1285 O  O     . ASN A 1 167 ? 15.183 45.418 -2.245  1.00 45.98 ? 161  ASN A O     1 
ATOM   1286 C  CB    . ASN A 1 167 ? 17.736 46.305 -1.891  1.00 46.18 ? 161  ASN A CB    1 
ATOM   1287 C  CG    . ASN A 1 167 ? 16.866 47.553 -1.900  1.00 48.45 ? 161  ASN A CG    1 
ATOM   1288 O  OD1   . ASN A 1 167 ? 16.233 47.898 -0.902  1.00 50.42 ? 161  ASN A OD1   1 
ATOM   1289 N  ND2   . ASN A 1 167 ? 16.852 48.246 -3.031  1.00 50.13 ? 161  ASN A ND2   1 
ATOM   1290 N  N     . GLY A 1 168 ? 15.305 43.694 -0.813  1.00 44.26 ? 162  GLY A N     1 
ATOM   1291 C  CA    . GLY A 1 168 ? 13.988 43.217 -1.186  1.00 42.72 ? 162  GLY A CA    1 
ATOM   1292 C  C     . GLY A 1 168 ? 12.977 43.117 -0.060  1.00 42.96 ? 162  GLY A C     1 
ATOM   1293 O  O     . GLY A 1 168 ? 13.207 43.568 1.068   1.00 43.54 ? 162  GLY A O     1 
ATOM   1294 N  N     . ILE A 1 169 ? 11.837 42.528 -0.394  1.00 42.71 ? 163  ILE A N     1 
ATOM   1295 C  CA    . ILE A 1 169 ? 10.743 42.313 0.539   1.00 43.10 ? 163  ILE A CA    1 
ATOM   1296 C  C     . ILE A 1 169 ? 9.896  41.207 -0.061  1.00 43.96 ? 163  ILE A C     1 
ATOM   1297 O  O     . ILE A 1 169 ? 9.607  41.209 -1.256  1.00 44.95 ? 163  ILE A O     1 
ATOM   1298 C  CB    . ILE A 1 169 ? 9.876  43.570 0.730   1.00 42.74 ? 163  ILE A CB    1 
ATOM   1299 C  CG1   . ILE A 1 169 ? 8.728  43.252 1.688   1.00 41.34 ? 163  ILE A CG1   1 
ATOM   1300 C  CG2   . ILE A 1 169 ? 9.345  44.055 -0.607  1.00 44.05 ? 163  ILE A CG2   1 
ATOM   1301 C  CD1   . ILE A 1 169 ? 7.943  44.448 2.111   1.00 40.85 ? 163  ILE A CD1   1 
ATOM   1302 N  N     . LYS A 1 170 ? 9.506  40.253 0.773   1.00 45.31 ? 164  LYS A N     1 
ATOM   1303 C  CA    . LYS A 1 170 ? 8.727  39.127 0.298   1.00 45.16 ? 164  LYS A CA    1 
ATOM   1304 C  C     . LYS A 1 170 ? 7.909  38.513 1.409   1.00 44.99 ? 164  LYS A C     1 
ATOM   1305 O  O     . LYS A 1 170 ? 8.322  38.489 2.569   1.00 44.85 ? 164  LYS A O     1 
ATOM   1306 C  CB    . LYS A 1 170 ? 9.658  38.070 -0.284  1.00 46.55 ? 164  LYS A CB    1 
ATOM   1307 C  CG    . LYS A 1 170 ? 8.959  36.842 -0.810  1.00 49.01 ? 164  LYS A CG    1 
ATOM   1308 C  CD    . LYS A 1 170 ? 9.961  35.759 -1.174  1.00 51.59 ? 164  LYS A CD    1 
ATOM   1309 C  CE    . LYS A 1 170 ? 9.268  34.587 -1.839  1.00 53.93 ? 164  LYS A CE    1 
ATOM   1310 N  NZ    . LYS A 1 170 ? 8.045  34.187 -1.079  1.00 53.15 ? 164  LYS A NZ    1 
ATOM   1311 N  N     . VAL A 1 171 ? 6.739  38.018 1.029   1.00 45.27 ? 165  VAL A N     1 
ATOM   1312 C  CA    . VAL A 1 171 ? 5.823  37.371 1.950   1.00 45.35 ? 165  VAL A CA    1 
ATOM   1313 C  C     . VAL A 1 171 ? 5.718  35.913 1.528   1.00 44.61 ? 165  VAL A C     1 
ATOM   1314 O  O     . VAL A 1 171 ? 5.741  35.602 0.341   1.00 43.50 ? 165  VAL A O     1 
ATOM   1315 C  CB    . VAL A 1 171 ? 4.393  37.977 1.863   1.00 46.18 ? 165  VAL A CB    1 
ATOM   1316 C  CG1   . VAL A 1 171 ? 3.459  37.238 2.807   1.00 46.75 ? 165  VAL A CG1   1 
ATOM   1317 C  CG2   . VAL A 1 171 ? 4.414  39.455 2.191   1.00 46.22 ? 165  VAL A CG2   1 
ATOM   1318 N  N     . ILE A 1 172 ? 5.644  35.020 2.505   1.00 44.99 ? 166  ILE A N     1 
ATOM   1319 C  CA    . ILE A 1 172 ? 5.461  33.603 2.220   1.00 45.41 ? 166  ILE A CA    1 
ATOM   1320 C  C     . ILE A 1 172 ? 4.182  33.269 2.978   1.00 46.69 ? 166  ILE A C     1 
ATOM   1321 O  O     . ILE A 1 172 ? 4.222  32.960 4.170   1.00 46.78 ? 166  ILE A O     1 
ATOM   1322 C  CB    . ILE A 1 172 ? 6.633  32.739 2.746   1.00 43.13 ? 166  ILE A CB    1 
ATOM   1323 C  CG1   . ILE A 1 172 ? 7.857  32.916 1.838   1.00 42.04 ? 166  ILE A CG1   1 
ATOM   1324 C  CG2   . ILE A 1 172 ? 6.224  31.271 2.788   1.00 40.60 ? 166  ILE A CG2   1 
ATOM   1325 C  CD1   . ILE A 1 172 ? 9.029  32.025 2.189   1.00 35.96 ? 166  ILE A CD1   1 
ATOM   1326 N  N     . ASP A 1 173 ? 3.046  33.367 2.283   1.00 49.61 ? 167  ASP A N     1 
ATOM   1327 C  CA    . ASP A 1 173 ? 1.736  33.105 2.890   1.00 52.93 ? 167  ASP A CA    1 
ATOM   1328 C  C     . ASP A 1 173 ? 1.482  31.637 3.191   1.00 53.90 ? 167  ASP A C     1 
ATOM   1329 O  O     . ASP A 1 173 ? 2.159  30.754 2.657   1.00 54.45 ? 167  ASP A O     1 
ATOM   1330 C  CB    . ASP A 1 173 ? 0.605  33.623 1.991   1.00 53.42 ? 167  ASP A CB    1 
ATOM   1331 C  CG    . ASP A 1 173 ? 0.508  32.870 0.676   1.00 54.63 ? 167  ASP A CG    1 
ATOM   1332 O  OD1   . ASP A 1 173 ? 0.568  31.623 0.694   1.00 55.91 ? 167  ASP A OD1   1 
ATOM   1333 O  OD2   . ASP A 1 173 ? 0.361  33.520 -0.381  1.00 56.25 ? 167  ASP A OD2   1 
ATOM   1334 N  N     . ASP A 1 174 ? 0.480  31.386 4.029   1.00 55.74 ? 168  ASP A N     1 
ATOM   1335 C  CA    . ASP A 1 174 ? 0.129  30.030 4.422   1.00 57.22 ? 168  ASP A CA    1 
ATOM   1336 C  C     . ASP A 1 174 ? 0.166  29.060 3.249   1.00 57.33 ? 168  ASP A C     1 
ATOM   1337 O  O     . ASP A 1 174 ? 0.492  27.894 3.425   1.00 58.69 ? 168  ASP A O     1 
ATOM   1338 C  CB    . ASP A 1 174 ? -1.254 29.998 5.080   1.00 59.75 ? 168  ASP A CB    1 
ATOM   1339 C  CG    . ASP A 1 174 ? -1.308 30.802 6.377   1.00 63.26 ? 168  ASP A CG    1 
ATOM   1340 O  OD1   . ASP A 1 174 ? -0.369 30.688 7.194   1.00 65.32 ? 168  ASP A OD1   1 
ATOM   1341 O  OD2   . ASP A 1 174 ? -2.296 31.540 6.588   1.00 64.87 ? 168  ASP A OD2   1 
ATOM   1342 N  N     . GLU A 1 175 ? -0.147 29.535 2.051   1.00 57.00 ? 169  GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 175 ? -0.130 28.657 0.890   1.00 56.26 ? 169  GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 175 ? 1.276  28.258 0.466   1.00 56.80 ? 169  GLU A C     1 
ATOM   1345 O  O     . GLU A 1 175 ? 1.549  27.073 0.269   1.00 57.59 ? 169  GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 175 ? -0.852 29.303 -0.298  1.00 57.22 ? 169  GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 175 ? -0.976 28.383 -1.517  1.00 56.44 ? 169  GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 175 ? -1.911 28.931 -2.581  0.50 57.12 ? 169  GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 175 ? -3.060 29.280 -2.238  0.50 56.79 ? 169  GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 175 ? -1.506 29.002 -3.762  0.50 57.84 ? 169  GLU A OE2   1 
ATOM   1351 N  N     . GLU A 1 176 ? 2.173  29.233 0.320   1.00 56.11 ? 170  GLU A N     1 
ATOM   1352 C  CA    . GLU A 1 176 ? 3.530  28.906 -0.107  1.00 55.37 ? 170  GLU A CA    1 
ATOM   1353 C  C     . GLU A 1 176 ? 4.325  28.137 0.948   1.00 52.92 ? 170  GLU A C     1 
ATOM   1354 O  O     . GLU A 1 176 ? 5.261  27.412 0.614   1.00 50.79 ? 170  GLU A O     1 
ATOM   1355 C  CB    . GLU A 1 176 ? 4.292  30.164 -0.535  1.00 56.70 ? 170  GLU A CB    1 
ATOM   1356 C  CG    . GLU A 1 176 ? 5.663  29.842 -1.111  1.00 60.46 ? 170  GLU A CG    1 
ATOM   1357 C  CD    . GLU A 1 176 ? 6.251  30.970 -1.933  1.00 63.49 ? 170  GLU A CD    1 
ATOM   1358 O  OE1   . GLU A 1 176 ? 6.105  32.142 -1.523  1.00 65.78 ? 170  GLU A OE1   1 
ATOM   1359 O  OE2   . GLU A 1 176 ? 6.874  30.681 -2.981  1.00 64.31 ? 170  GLU A OE2   1 
ATOM   1360 N  N     . VAL A 1 177 ? 3.950  28.289 2.213   1.00 51.33 ? 171  VAL A N     1 
ATOM   1361 C  CA    . VAL A 1 177 ? 4.624  27.572 3.285   1.00 50.84 ? 171  VAL A CA    1 
ATOM   1362 C  C     . VAL A 1 177 ? 4.448  26.079 3.020   1.00 52.45 ? 171  VAL A C     1 
ATOM   1363 O  O     . VAL A 1 177 ? 5.407  25.306 3.078   1.00 53.09 ? 171  VAL A O     1 
ATOM   1364 C  CB    . VAL A 1 177 ? 4.018  27.928 4.659   1.00 50.19 ? 171  VAL A CB    1 
ATOM   1365 C  CG1   . VAL A 1 177 ? 4.352  26.849 5.680   1.00 49.21 ? 171  VAL A CG1   1 
ATOM   1366 C  CG2   . VAL A 1 177 ? 4.553  29.275 5.123   1.00 48.95 ? 171  VAL A CG2   1 
ATOM   1367 N  N     . LYS A 1 178 ? 3.212  25.690 2.717   1.00 53.51 ? 172  LYS A N     1 
ATOM   1368 C  CA    . LYS A 1 178 ? 2.876  24.300 2.422   1.00 53.80 ? 172  LYS A CA    1 
ATOM   1369 C  C     . LYS A 1 178 ? 3.636  23.860 1.183   1.00 52.11 ? 172  LYS A C     1 
ATOM   1370 O  O     . LYS A 1 178 ? 4.145  22.751 1.108   1.00 51.71 ? 172  LYS A O     1 
ATOM   1371 C  CB    . LYS A 1 178 ? 1.364  24.153 2.181   1.00 56.50 ? 172  LYS A CB    1 
ATOM   1372 C  CG    . LYS A 1 178 ? 0.598  23.440 3.304   1.00 58.31 ? 172  LYS A CG    1 
ATOM   1373 C  CD    . LYS A 1 178 ? 0.666  24.204 4.615   1.00 60.05 ? 172  LYS A CD    1 
ATOM   1374 C  CE    . LYS A 1 178 ? -0.184 25.464 4.559   1.00 62.35 ? 172  LYS A CE    1 
ATOM   1375 N  NZ    . LYS A 1 178 ? 0.128  26.434 5.661   1.00 64.19 ? 172  LYS A NZ    1 
ATOM   1376 N  N     . ARG A 1 179 ? 3.709  24.749 0.209   1.00 52.03 ? 173  ARG A N     1 
ATOM   1377 C  CA    . ARG A 1 179 ? 4.412  24.474 -1.034  1.00 52.35 ? 173  ARG A CA    1 
ATOM   1378 C  C     . ARG A 1 179 ? 5.904  24.195 -0.814  1.00 51.10 ? 173  ARG A C     1 
ATOM   1379 O  O     . ARG A 1 179 ? 6.432  23.178 -1.274  1.00 50.35 ? 173  ARG A O     1 
ATOM   1380 C  CB    . ARG A 1 179 ? 4.234  25.669 -1.968  1.00 55.31 ? 173  ARG A CB    1 
ATOM   1381 C  CG    . ARG A 1 179 ? 5.044  25.631 -3.248  1.00 59.62 ? 173  ARG A CG    1 
ATOM   1382 C  CD    . ARG A 1 179 ? 4.723  26.867 -4.064  1.00 64.40 ? 173  ARG A CD    1 
ATOM   1383 N  NE    . ARG A 1 179 ? 5.536  26.977 -5.266  1.00 69.47 ? 173  ARG A NE    1 
ATOM   1384 C  CZ    . ARG A 1 179 ? 6.852  27.173 -5.267  1.00 72.35 ? 173  ARG A CZ    1 
ATOM   1385 N  NH1   . ARG A 1 179 ? 7.513  27.283 -4.120  1.00 73.46 ? 173  ARG A NH1   1 
ATOM   1386 N  NH2   . ARG A 1 179 ? 7.504  27.258 -6.421  1.00 72.86 ? 173  ARG A NH2   1 
ATOM   1387 N  N     . LEU A 1 180 ? 6.576  25.101 -0.111  1.00 49.17 ? 174  LEU A N     1 
ATOM   1388 C  CA    . LEU A 1 180 ? 8.007  24.964 0.161   1.00 48.12 ? 174  LEU A CA    1 
ATOM   1389 C  C     . LEU A 1 180 ? 8.352  23.702 0.958   1.00 47.59 ? 174  LEU A C     1 
ATOM   1390 O  O     . LEU A 1 180 ? 9.420  23.119 0.774   1.00 48.88 ? 174  LEU A O     1 
ATOM   1391 C  CB    . LEU A 1 180 ? 8.521  26.207 0.900   1.00 45.34 ? 174  LEU A CB    1 
ATOM   1392 C  CG    . LEU A 1 180 ? 8.382  27.535 0.150   1.00 45.40 ? 174  LEU A CG    1 
ATOM   1393 C  CD1   . LEU A 1 180 ? 8.774  28.685 1.070   1.00 45.66 ? 174  LEU A CD1   1 
ATOM   1394 C  CD2   . LEU A 1 180 ? 9.251  27.528 -1.111  1.00 45.39 ? 174  LEU A CD2   1 
ATOM   1395 N  N     . ILE A 1 181 ? 7.451  23.279 1.838   1.00 46.70 ? 175  ILE A N     1 
ATOM   1396 C  CA    . ILE A 1 181 ? 7.681  22.087 2.643   1.00 47.32 ? 175  ILE A CA    1 
ATOM   1397 C  C     . ILE A 1 181 ? 7.920  20.874 1.746   1.00 48.11 ? 175  ILE A C     1 
ATOM   1398 O  O     . ILE A 1 181 ? 8.576  19.908 2.145   1.00 48.90 ? 175  ILE A O     1 
ATOM   1399 C  CB    . ILE A 1 181 ? 6.477  21.814 3.582   1.00 46.29 ? 175  ILE A CB    1 
ATOM   1400 C  CG1   . ILE A 1 181 ? 6.384  22.930 4.623   1.00 44.96 ? 175  ILE A CG1   1 
ATOM   1401 C  CG2   . ILE A 1 181 ? 6.615  20.449 4.259   1.00 47.44 ? 175  ILE A CG2   1 
ATOM   1402 C  CD1   . ILE A 1 181 ? 5.234  22.778 5.597   1.00 42.41 ? 175  ILE A CD1   1 
ATOM   1403 N  N     . ARG A 1 182 ? 7.401  20.945 0.525   1.00 48.36 ? 176  ARG A N     1 
ATOM   1404 C  CA    . ARG A 1 182 ? 7.545  19.860 -0.434  1.00 49.30 ? 176  ARG A CA    1 
ATOM   1405 C  C     . ARG A 1 182 ? 8.604  20.150 -1.496  1.00 48.20 ? 176  ARG A C     1 
ATOM   1406 O  O     . ARG A 1 182 ? 9.187  19.226 -2.053  1.00 47.55 ? 176  ARG A O     1 
ATOM   1407 C  CB    . ARG A 1 182 ? 6.192  19.585 -1.111  1.00 52.61 ? 176  ARG A CB    1 
ATOM   1408 C  CG    . ARG A 1 182 ? 6.202  18.458 -2.148  1.00 55.81 ? 176  ARG A CG    1 
ATOM   1409 C  CD    . ARG A 1 182 ? 4.823  18.276 -2.790  1.00 58.65 ? 176  ARG A CD    1 
ATOM   1410 N  NE    . ARG A 1 182 ? 4.409  19.462 -3.538  1.00 60.88 ? 176  ARG A NE    1 
ATOM   1411 C  CZ    . ARG A 1 182 ? 4.871  19.798 -4.742  1.00 62.62 ? 176  ARG A CZ    1 
ATOM   1412 N  NH1   . ARG A 1 182 ? 5.768  19.037 -5.362  1.00 62.45 ? 176  ARG A NH1   1 
ATOM   1413 N  NH2   . ARG A 1 182 ? 4.454  20.922 -5.315  1.00 65.35 ? 176  ARG A NH2   1 
ATOM   1414 N  N     . GLU A 1 183 ? 8.868  21.425 -1.773  1.00 47.03 ? 177  GLU A N     1 
ATOM   1415 C  CA    . GLU A 1 183 ? 9.854  21.770 -2.797  1.00 46.05 ? 177  GLU A CA    1 
ATOM   1416 C  C     . GLU A 1 183 ? 11.236 22.244 -2.300  1.00 46.51 ? 177  GLU A C     1 
ATOM   1417 O  O     . GLU A 1 183 ? 12.263 21.892 -2.885  1.00 47.66 ? 177  GLU A O     1 
ATOM   1418 C  CB    . GLU A 1 183 ? 9.266  22.828 -3.735  0.50 45.12 ? 177  GLU A CB    1 
ATOM   1419 C  CG    . GLU A 1 183 ? 7.950  22.413 -4.373  0.50 45.46 ? 177  GLU A CG    1 
ATOM   1420 C  CD    . GLU A 1 183 ? 7.450  23.410 -5.401  0.50 44.71 ? 177  GLU A CD    1 
ATOM   1421 O  OE1   . GLU A 1 183 ? 8.186  23.684 -6.373  0.50 45.76 ? 177  GLU A OE1   1 
ATOM   1422 O  OE2   . GLU A 1 183 ? 6.320  23.914 -5.244  0.50 42.72 ? 177  GLU A OE2   1 
ATOM   1423 N  N     . LEU A 1 184 ? 11.260 23.027 -1.228  1.00 44.93 ? 178  LEU A N     1 
ATOM   1424 C  CA    . LEU A 1 184 ? 12.506 23.572 -0.683  1.00 43.39 ? 178  LEU A CA    1 
ATOM   1425 C  C     . LEU A 1 184 ? 13.587 22.567 -0.283  1.00 41.51 ? 178  LEU A C     1 
ATOM   1426 O  O     . LEU A 1 184 ? 13.373 21.722 0.587   1.00 42.26 ? 178  LEU A O     1 
ATOM   1427 C  CB    . LEU A 1 184 ? 12.204 24.453 0.537   1.00 41.59 ? 178  LEU A CB    1 
ATOM   1428 C  CG    . LEU A 1 184 ? 13.358 25.348 0.985   1.00 40.81 ? 178  LEU A CG    1 
ATOM   1429 C  CD1   . LEU A 1 184 ? 13.437 26.549 0.064   1.00 35.63 ? 178  LEU A CD1   1 
ATOM   1430 C  CD2   . LEU A 1 184 ? 13.147 25.798 2.419   1.00 40.12 ? 178  LEU A CD2   1 
ATOM   1431 N  N     . ASP A 1 185 ? 14.747 22.667 -0.927  1.00 40.06 ? 179  ASP A N     1 
ATOM   1432 C  CA    . ASP A 1 185 ? 15.882 21.813 -0.602  1.00 37.80 ? 179  ASP A CA    1 
ATOM   1433 C  C     . ASP A 1 185 ? 16.041 21.956 0.915   1.00 36.23 ? 179  ASP A C     1 
ATOM   1434 O  O     . ASP A 1 185 ? 16.099 23.074 1.426   1.00 35.54 ? 179  ASP A O     1 
ATOM   1435 C  CB    . ASP A 1 185 ? 17.124 22.337 -1.310  1.00 40.98 ? 179  ASP A CB    1 
ATOM   1436 C  CG    . ASP A 1 185 ? 18.337 21.482 -1.061  1.00 45.87 ? 179  ASP A CG    1 
ATOM   1437 O  OD1   . ASP A 1 185 ? 18.507 20.992 0.078   1.00 48.03 ? 179  ASP A OD1   1 
ATOM   1438 O  OD2   . ASP A 1 185 ? 19.131 21.306 -2.006  1.00 49.80 ? 179  ASP A OD2   1 
ATOM   1439 N  N     . ILE A 1 186 ? 16.109 20.846 1.640   1.00 34.95 ? 180  ILE A N     1 
ATOM   1440 C  CA    . ILE A 1 186 ? 16.194 20.938 3.089   1.00 36.84 ? 180  ILE A CA    1 
ATOM   1441 C  C     . ILE A 1 186 ? 17.456 21.648 3.585   1.00 38.23 ? 180  ILE A C     1 
ATOM   1442 O  O     . ILE A 1 186 ? 17.473 22.218 4.674   1.00 37.80 ? 180  ILE A O     1 
ATOM   1443 C  CB    . ILE A 1 186 ? 16.024 19.548 3.740   1.00 35.10 ? 180  ILE A CB    1 
ATOM   1444 C  CG1   . ILE A 1 186 ? 15.564 19.727 5.185   1.00 34.46 ? 180  ILE A CG1   1 
ATOM   1445 C  CG2   . ILE A 1 186 ? 17.314 18.740 3.634   1.00 34.11 ? 180  ILE A CG2   1 
ATOM   1446 C  CD1   . ILE A 1 186 ? 14.939 18.496 5.791   1.00 32.88 ? 180  ILE A CD1   1 
ATOM   1447 N  N     . ALA A 1 187 ? 18.495 21.651 2.758   1.00 39.53 ? 181  ALA A N     1 
ATOM   1448 C  CA    . ALA A 1 187 ? 19.730 22.320 3.110   1.00 38.31 ? 181  ALA A CA    1 
ATOM   1449 C  C     . ALA A 1 187 ? 19.457 23.810 3.235   1.00 39.19 ? 181  ALA A C     1 
ATOM   1450 O  O     . ALA A 1 187 ? 20.149 24.495 3.954   1.00 38.23 ? 181  ALA A O     1 
ATOM   1451 C  CB    . ALA A 1 187 ? 20.788 22.075 2.041   1.00 39.39 ? 181  ALA A CB    1 
ATOM   1452 N  N     . ASP A 1 188 ? 18.446 24.325 2.546   1.00 39.25 ? 182  ASP A N     1 
ATOM   1453 C  CA    . ASP A 1 188 ? 18.179 25.756 2.637   1.00 37.56 ? 182  ASP A CA    1 
ATOM   1454 C  C     . ASP A 1 188 ? 17.460 26.153 3.920   1.00 35.28 ? 182  ASP A C     1 
ATOM   1455 O  O     . ASP A 1 188 ? 17.241 27.333 4.179   1.00 33.40 ? 182  ASP A O     1 
ATOM   1456 C  CB    . ASP A 1 188 ? 17.402 26.237 1.408   1.00 41.70 ? 182  ASP A CB    1 
ATOM   1457 C  CG    . ASP A 1 188 ? 18.204 26.093 0.119   1.00 45.55 ? 182  ASP A CG    1 
ATOM   1458 O  OD1   . ASP A 1 188 ? 19.435 26.287 0.160   1.00 49.76 ? 182  ASP A OD1   1 
ATOM   1459 O  OD2   . ASP A 1 188 ? 17.612 25.797 -0.940  1.00 49.48 ? 182  ASP A OD2   1 
ATOM   1460 N  N     . VAL A 1 189 ? 17.114 25.167 4.737   1.00 33.20 ? 183  VAL A N     1 
ATOM   1461 C  CA    . VAL A 1 189 ? 16.439 25.441 6.001   1.00 32.50 ? 183  VAL A CA    1 
ATOM   1462 C  C     . VAL A 1 189 ? 17.404 25.955 7.075   1.00 31.33 ? 183  VAL A C     1 
ATOM   1463 O  O     . VAL A 1 189 ? 18.448 25.364 7.335   1.00 30.89 ? 183  VAL A O     1 
ATOM   1464 C  CB    . VAL A 1 189 ? 15.710 24.182 6.517   1.00 31.94 ? 183  VAL A CB    1 
ATOM   1465 C  CG1   . VAL A 1 189 ? 15.125 24.437 7.904   1.00 28.74 ? 183  VAL A CG1   1 
ATOM   1466 C  CG2   . VAL A 1 189 ? 14.616 23.796 5.526   1.00 30.64 ? 183  VAL A CG2   1 
ATOM   1467 N  N     . PRO A 1 190 ? 17.065 27.080 7.707   1.00 30.30 ? 184  PRO A N     1 
ATOM   1468 C  CA    . PRO A 1 190 ? 17.951 27.612 8.741   1.00 30.14 ? 184  PRO A CA    1 
ATOM   1469 C  C     . PRO A 1 190 ? 18.316 26.578 9.807   1.00 30.41 ? 184  PRO A C     1 
ATOM   1470 O  O     . PRO A 1 190 ? 17.451 25.891 10.345  1.00 30.06 ? 184  PRO A O     1 
ATOM   1471 C  CB    . PRO A 1 190 ? 17.153 28.789 9.296   1.00 30.38 ? 184  PRO A CB    1 
ATOM   1472 C  CG    . PRO A 1 190 ? 16.457 29.304 8.055   1.00 29.54 ? 184  PRO A CG    1 
ATOM   1473 C  CD    . PRO A 1 190 ? 15.954 28.013 7.431   1.00 30.55 ? 184  PRO A CD    1 
ATOM   1474 N  N     . GLY A 1 191 ? 19.605 26.467 10.103  1.00 30.70 ? 185  GLY A N     1 
ATOM   1475 C  CA    . GLY A 1 191 ? 20.042 25.511 11.110  1.00 29.58 ? 185  GLY A CA    1 
ATOM   1476 C  C     . GLY A 1 191 ? 20.526 24.189 10.550  1.00 28.51 ? 185  GLY A C     1 
ATOM   1477 O  O     . GLY A 1 191 ? 20.995 23.327 11.289  1.00 28.07 ? 185  GLY A O     1 
ATOM   1478 N  N     . ILE A 1 192 ? 20.400 24.006 9.245   1.00 27.69 ? 186  ILE A N     1 
ATOM   1479 C  CA    . ILE A 1 192 ? 20.876 22.771 8.632   1.00 28.66 ? 186  ILE A CA    1 
ATOM   1480 C  C     . ILE A 1 192 ? 22.152 23.120 7.863   1.00 30.25 ? 186  ILE A C     1 
ATOM   1481 O  O     . ILE A 1 192 ? 22.084 23.651 6.763   1.00 29.21 ? 186  ILE A O     1 
ATOM   1482 C  CB    . ILE A 1 192 ? 19.853 22.186 7.646   1.00 29.60 ? 186  ILE A CB    1 
ATOM   1483 C  CG1   . ILE A 1 192 ? 18.518 21.912 8.356   1.00 27.56 ? 186  ILE A CG1   1 
ATOM   1484 C  CG2   . ILE A 1 192 ? 20.426 20.926 7.015   1.00 30.38 ? 186  ILE A CG2   1 
ATOM   1485 C  CD1   . ILE A 1 192 ? 18.592 20.904 9.503   1.00 29.80 ? 186  ILE A CD1   1 
ATOM   1486 N  N     . GLY A 1 193 ? 23.308 22.843 8.462   1.00 29.72 ? 187  GLY A N     1 
ATOM   1487 C  CA    . GLY A 1 193 ? 24.569 23.152 7.816   1.00 31.38 ? 187  GLY A CA    1 
ATOM   1488 C  C     . GLY A 1 193 ? 25.072 22.012 6.958   1.00 32.98 ? 187  GLY A C     1 
ATOM   1489 O  O     . GLY A 1 193 ? 24.337 21.069 6.675   1.00 33.93 ? 187  GLY A O     1 
ATOM   1490 N  N     . ASN A 1 194 ? 26.334 22.084 6.549   1.00 34.22 ? 188  ASN A N     1 
ATOM   1491 C  CA    . ASN A 1 194 ? 26.900 21.044 5.705   1.00 33.95 ? 188  ASN A CA    1 
ATOM   1492 C  C     . ASN A 1 194 ? 26.904 19.665 6.352   1.00 33.96 ? 188  ASN A C     1 
ATOM   1493 O  O     . ASN A 1 194 ? 26.542 18.680 5.711   1.00 33.58 ? 188  ASN A O     1 
ATOM   1494 C  CB    . ASN A 1 194 ? 28.311 21.437 5.274   1.00 33.78 ? 188  ASN A CB    1 
ATOM   1495 C  CG    . ASN A 1 194 ? 28.322 22.684 4.411   0.50 34.25 ? 188  ASN A CG    1 
ATOM   1496 O  OD1   . ASN A 1 194 ? 27.757 22.698 3.319   0.50 34.80 ? 188  ASN A OD1   1 
ATOM   1497 N  ND2   . ASN A 1 194 ? 28.960 23.740 4.903   0.50 34.75 ? 188  ASN A ND2   1 
ATOM   1498 N  N     . ILE A 1 195 ? 27.299 19.597 7.620   1.00 34.98 ? 189  ILE A N     1 
ATOM   1499 C  CA    . ILE A 1 195 ? 27.345 18.328 8.332   1.00 35.04 ? 189  ILE A CA    1 
ATOM   1500 C  C     . ILE A 1 195 ? 25.979 17.651 8.364   1.00 35.78 ? 189  ILE A C     1 
ATOM   1501 O  O     . ILE A 1 195 ? 25.848 16.471 8.021   1.00 36.49 ? 189  ILE A O     1 
ATOM   1502 C  CB    . ILE A 1 195 ? 27.834 18.516 9.782   1.00 35.16 ? 189  ILE A CB    1 
ATOM   1503 C  CG1   . ILE A 1 195 ? 29.307 18.929 9.792   1.00 35.31 ? 189  ILE A CG1   1 
ATOM   1504 C  CG2   . ILE A 1 195 ? 27.647 17.232 10.560  1.00 34.38 ? 189  ILE A CG2   1 
ATOM   1505 C  CD1   . ILE A 1 195 ? 30.240 17.900 9.192   1.00 36.61 ? 189  ILE A CD1   1 
ATOM   1506 N  N     . THR A 1 196 ? 24.967 18.404 8.782   1.00 35.20 ? 190  THR A N     1 
ATOM   1507 C  CA    . THR A 1 196 ? 23.607 17.889 8.876   1.00 35.02 ? 190  THR A CA    1 
ATOM   1508 C  C     . THR A 1 196 ? 22.995 17.605 7.505   1.00 34.85 ? 190  THR A C     1 
ATOM   1509 O  O     . THR A 1 196 ? 22.251 16.638 7.343   1.00 35.72 ? 190  THR A O     1 
ATOM   1510 C  CB    . THR A 1 196 ? 22.699 18.875 9.615   1.00 33.83 ? 190  THR A CB    1 
ATOM   1511 O  OG1   . THR A 1 196 ? 23.301 19.226 10.863  1.00 34.25 ? 190  THR A OG1   1 
ATOM   1512 C  CG2   . THR A 1 196 ? 21.327 18.263 9.863   1.00 31.50 ? 190  THR A CG2   1 
ATOM   1513 N  N     . ALA A 1 197 ? 23.293 18.445 6.520   1.00 35.11 ? 191  ALA A N     1 
ATOM   1514 C  CA    . ALA A 1 197 ? 22.747 18.229 5.180   1.00 37.74 ? 191  ALA A CA    1 
ATOM   1515 C  C     . ALA A 1 197 ? 23.134 16.852 4.614   1.00 38.38 ? 191  ALA A C     1 
ATOM   1516 O  O     . ALA A 1 197 ? 22.321 16.179 3.980   1.00 40.16 ? 191  ALA A O     1 
ATOM   1517 C  CB    . ALA A 1 197 ? 23.215 19.340 4.234   1.00 35.25 ? 191  ALA A CB    1 
ATOM   1518 N  N     . GLU A 1 198 ? 24.380 16.448 4.858   1.00 39.81 ? 192  GLU A N     1 
ATOM   1519 C  CA    . GLU A 1 198 ? 24.915 15.181 4.384   1.00 39.27 ? 192  GLU A CA    1 
ATOM   1520 C  C     . GLU A 1 198 ? 24.318 13.973 5.091   1.00 40.21 ? 192  GLU A C     1 
ATOM   1521 O  O     . GLU A 1 198 ? 24.086 12.933 4.467   1.00 40.88 ? 192  GLU A O     1 
ATOM   1522 C  CB    . GLU A 1 198 ? 26.438 15.174 4.544   1.00 40.27 ? 192  GLU A CB    1 
ATOM   1523 C  CG    . GLU A 1 198 ? 27.157 16.094 3.567   0.50 40.40 ? 192  GLU A CG    1 
ATOM   1524 C  CD    . GLU A 1 198 ? 27.265 15.492 2.180   0.50 41.12 ? 192  GLU A CD    1 
ATOM   1525 O  OE1   . GLU A 1 198 ? 27.500 16.243 1.213   0.50 42.59 ? 192  GLU A OE1   1 
ATOM   1526 O  OE2   . GLU A 1 198 ? 27.127 14.260 2.058   0.50 41.30 ? 192  GLU A OE2   1 
ATOM   1527 N  N     . LYS A 1 199 ? 24.081 14.094 6.389   1.00 39.45 ? 193  LYS A N     1 
ATOM   1528 C  CA    . LYS A 1 199 ? 23.497 12.984 7.124   1.00 40.00 ? 193  LYS A CA    1 
ATOM   1529 C  C     . LYS A 1 199 ? 22.077 12.753 6.614   1.00 39.17 ? 193  LYS A C     1 
ATOM   1530 O  O     . LYS A 1 199 ? 21.615 11.614 6.518   1.00 39.31 ? 193  LYS A O     1 
ATOM   1531 C  CB    . LYS A 1 199 ? 23.444 13.286 8.621   1.00 39.33 ? 193  LYS A CB    1 
ATOM   1532 C  CG    . LYS A 1 199 ? 24.775 13.390 9.326   1.00 39.10 ? 193  LYS A CG    1 
ATOM   1533 C  CD    . LYS A 1 199 ? 24.538 13.986 10.707  1.00 39.97 ? 193  LYS A CD    1 
ATOM   1534 C  CE    . LYS A 1 199 ? 25.803 14.108 11.525  1.00 41.44 ? 193  LYS A CE    1 
ATOM   1535 N  NZ    . LYS A 1 199 ? 25.495 14.643 12.893  1.00 43.04 ? 193  LYS A NZ    1 
ATOM   1536 N  N     . LEU A 1 200 ? 21.385 13.843 6.299   1.00 38.23 ? 194  LEU A N     1 
ATOM   1537 C  CA    . LEU A 1 200 ? 20.016 13.756 5.810   1.00 38.28 ? 194  LEU A CA    1 
ATOM   1538 C  C     . LEU A 1 200 ? 20.017 13.116 4.425   1.00 39.25 ? 194  LEU A C     1 
ATOM   1539 O  O     . LEU A 1 200 ? 19.199 12.239 4.152   1.00 37.68 ? 194  LEU A O     1 
ATOM   1540 C  CB    . LEU A 1 200 ? 19.381 15.151 5.769   1.00 35.66 ? 194  LEU A CB    1 
ATOM   1541 C  CG    . LEU A 1 200 ? 19.186 15.812 7.142   1.00 36.16 ? 194  LEU A CG    1 
ATOM   1542 C  CD1   . LEU A 1 200 ? 18.763 17.266 6.956   1.00 34.47 ? 194  LEU A CD1   1 
ATOM   1543 C  CD2   . LEU A 1 200 ? 18.139 15.042 7.957   1.00 35.38 ? 194  LEU A CD2   1 
ATOM   1544 N  N     . LYS A 1 201 ? 20.938 13.557 3.567   1.00 40.59 ? 195  LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 201 ? 21.084 13.006 2.216   1.00 43.77 ? 195  LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 201 ? 21.201 11.492 2.294   1.00 42.86 ? 195  LYS A C     1 
ATOM   1547 O  O     . LYS A 1 201 ? 20.517 10.759 1.587   1.00 41.74 ? 195  LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 201 ? 22.368 13.498 1.553   1.00 46.28 ? 195  LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 201 ? 22.366 14.909 1.025   1.00 51.99 ? 195  LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 201 ? 23.667 15.138 0.249   1.00 53.77 ? 195  LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 201 ? 23.688 16.484 -0.460  1.00 56.27 ? 195  LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 201 ? 24.893 16.623 -1.335  1.00 59.64 ? 195  LYS A NZ    1 
ATOM   1553 N  N     . LYS A 1 202 ? 22.102 11.035 3.153   1.00 43.65 ? 196  LYS A N     1 
ATOM   1554 C  CA    . LYS A 1 202 ? 22.334 9.616  3.316   1.00 44.75 ? 196  LYS A CA    1 
ATOM   1555 C  C     . LYS A 1 202 ? 21.136 8.868  3.875   1.00 45.39 ? 196  LYS A C     1 
ATOM   1556 O  O     . LYS A 1 202 ? 21.077 7.643  3.792   1.00 46.51 ? 196  LYS A O     1 
ATOM   1557 C  CB    . LYS A 1 202 ? 23.584 9.377  4.167   1.00 45.49 ? 196  LYS A CB    1 
ATOM   1558 C  CG    . LYS A 1 202 ? 24.866 9.458  3.351   0.50 45.72 ? 196  LYS A CG    1 
ATOM   1559 C  CD    . LYS A 1 202 ? 26.109 9.192  4.181   0.50 46.96 ? 196  LYS A CD    1 
ATOM   1560 C  CE    . LYS A 1 202 ? 27.217 8.587  3.320   0.50 47.66 ? 196  LYS A CE    1 
ATOM   1561 N  NZ    . LYS A 1 202 ? 27.447 9.332  2.050   0.50 45.90 ? 196  LYS A NZ    1 
ATOM   1562 N  N     . LEU A 1 203 ? 20.178 9.596  4.440   1.00 44.48 ? 197  LEU A N     1 
ATOM   1563 C  CA    . LEU A 1 203 ? 18.969 8.964  4.961   1.00 44.08 ? 197  LEU A CA    1 
ATOM   1564 C  C     . LEU A 1 203 ? 17.900 9.071  3.872   1.00 43.85 ? 197  LEU A C     1 
ATOM   1565 O  O     . LEU A 1 203 ? 16.835 8.478  3.974   1.00 42.65 ? 197  LEU A O     1 
ATOM   1566 C  CB    . LEU A 1 203 ? 18.479 9.673  6.235   1.00 44.49 ? 197  LEU A CB    1 
ATOM   1567 C  CG    . LEU A 1 203 ? 19.307 9.567  7.525   1.00 44.27 ? 197  LEU A CG    1 
ATOM   1568 C  CD1   . LEU A 1 203 ? 18.724 10.472 8.613   1.00 40.51 ? 197  LEU A CD1   1 
ATOM   1569 C  CD2   . LEU A 1 203 ? 19.321 8.125  8.000   1.00 44.25 ? 197  LEU A CD2   1 
ATOM   1570 N  N     . GLY A 1 204 ? 18.203 9.830  2.825   1.00 43.95 ? 198  GLY A N     1 
ATOM   1571 C  CA    . GLY A 1 204 ? 17.247 10.020 1.750   1.00 45.07 ? 198  GLY A CA    1 
ATOM   1572 C  C     . GLY A 1 204 ? 16.351 11.237 1.945   1.00 46.52 ? 198  GLY A C     1 
ATOM   1573 O  O     . GLY A 1 204 ? 15.503 11.532 1.103   1.00 48.77 ? 198  GLY A O     1 
ATOM   1574 N  N     . ILE A 1 205 ? 16.530 11.953 3.048   1.00 45.50 ? 199  ILE A N     1 
ATOM   1575 C  CA    . ILE A 1 205 ? 15.723 13.136 3.328   1.00 46.04 ? 199  ILE A CA    1 
ATOM   1576 C  C     . ILE A 1 205 ? 16.237 14.344 2.558   1.00 46.18 ? 199  ILE A C     1 
ATOM   1577 O  O     . ILE A 1 205 ? 17.285 14.887 2.893   1.00 47.20 ? 199  ILE A O     1 
ATOM   1578 C  CB    . ILE A 1 205 ? 15.737 13.457 4.830   1.00 45.15 ? 199  ILE A CB    1 
ATOM   1579 C  CG1   . ILE A 1 205 ? 15.106 12.298 5.602   1.00 45.65 ? 199  ILE A CG1   1 
ATOM   1580 C  CG2   . ILE A 1 205 ? 14.993 14.741 5.089   1.00 43.55 ? 199  ILE A CG2   1 
ATOM   1581 C  CD1   . ILE A 1 205 ? 15.173 12.438 7.098   1.00 49.10 ? 199  ILE A CD1   1 
ATOM   1582 N  N     . ASN A 1 206 ? 15.493 14.766 1.538   1.00 46.30 ? 200  ASN A N     1 
ATOM   1583 C  CA    . ASN A 1 206 ? 15.880 15.913 0.706   1.00 45.80 ? 200  ASN A CA    1 
ATOM   1584 C  C     . ASN A 1 206 ? 15.018 17.159 0.893   1.00 44.05 ? 200  ASN A C     1 
ATOM   1585 O  O     . ASN A 1 206 ? 15.440 18.273 0.574   1.00 42.52 ? 200  ASN A O     1 
ATOM   1586 C  CB    . ASN A 1 206 ? 15.827 15.526 -0.770  1.00 48.93 ? 200  ASN A CB    1 
ATOM   1587 C  CG    . ASN A 1 206 ? 16.896 14.532 -1.148  1.00 52.24 ? 200  ASN A CG    1 
ATOM   1588 O  OD1   . ASN A 1 206 ? 18.091 14.840 -1.090  1.00 55.86 ? 200  ASN A OD1   1 
ATOM   1589 N  ND2   . ASN A 1 206 ? 16.479 13.329 -1.536  1.00 51.68 ? 200  ASN A ND2   1 
ATOM   1590 N  N     . LYS A 1 207 ? 13.807 16.958 1.402   1.00 42.18 ? 201  LYS A N     1 
ATOM   1591 C  CA    . LYS A 1 207 ? 12.858 18.038 1.600   1.00 41.48 ? 201  LYS A CA    1 
ATOM   1592 C  C     . LYS A 1 207 ? 12.250 17.891 2.984   1.00 40.81 ? 201  LYS A C     1 
ATOM   1593 O  O     . LYS A 1 207 ? 12.239 16.804 3.547   1.00 39.46 ? 201  LYS A O     1 
ATOM   1594 C  CB    . LYS A 1 207 ? 11.752 17.946 0.545   1.00 44.51 ? 201  LYS A CB    1 
ATOM   1595 C  CG    . LYS A 1 207 ? 12.242 17.858 -0.904  1.00 44.14 ? 201  LYS A CG    1 
ATOM   1596 C  CD    . LYS A 1 207 ? 12.813 19.187 -1.370  1.00 49.95 ? 201  LYS A CD    1 
ATOM   1597 C  CE    . LYS A 1 207 ? 13.037 19.218 -2.880  1.00 50.96 ? 201  LYS A CE    1 
ATOM   1598 N  NZ    . LYS A 1 207 ? 14.038 18.221 -3.331  1.00 53.32 ? 201  LYS A NZ    1 
ATOM   1599 N  N     . LEU A 1 208 ? 11.731 18.981 3.530   1.00 40.78 ? 202  LEU A N     1 
ATOM   1600 C  CA    . LEU A 1 208 ? 11.141 18.919 4.855   1.00 42.68 ? 202  LEU A CA    1 
ATOM   1601 C  C     . LEU A 1 208 ? 10.114 17.802 4.960   1.00 43.48 ? 202  LEU A C     1 
ATOM   1602 O  O     . LEU A 1 208 ? 10.075 17.075 5.954   1.00 45.58 ? 202  LEU A O     1 
ATOM   1603 C  CB    . LEU A 1 208 ? 10.479 20.250 5.204   1.00 41.76 ? 202  LEU A CB    1 
ATOM   1604 C  CG    . LEU A 1 208 ? 11.384 21.362 5.717   1.00 41.28 ? 202  LEU A CG    1 
ATOM   1605 C  CD1   . LEU A 1 208 ? 10.630 22.695 5.678   1.00 37.23 ? 202  LEU A CD1   1 
ATOM   1606 C  CD2   . LEU A 1 208 ? 11.840 21.018 7.133   1.00 37.80 ? 202  LEU A CD2   1 
ATOM   1607 N  N     . VAL A 1 209 ? 9.292  17.668 3.927   1.00 44.03 ? 203  VAL A N     1 
ATOM   1608 C  CA    . VAL A 1 209 ? 8.237  16.664 3.903   1.00 44.68 ? 203  VAL A CA    1 
ATOM   1609 C  C     . VAL A 1 209 ? 8.728  15.242 4.211   1.00 44.23 ? 203  VAL A C     1 
ATOM   1610 O  O     . VAL A 1 209 ? 8.051  14.481 4.901   1.00 43.66 ? 203  VAL A O     1 
ATOM   1611 C  CB    . VAL A 1 209 ? 7.481  16.700 2.534   1.00 44.70 ? 203  VAL A CB    1 
ATOM   1612 C  CG1   . VAL A 1 209 ? 8.419  16.376 1.402   1.00 42.30 ? 203  VAL A CG1   1 
ATOM   1613 C  CG2   . VAL A 1 209 ? 6.316  15.735 2.554   1.00 45.85 ? 203  VAL A CG2   1 
ATOM   1614 N  N     . ASP A 1 210 ? 9.919  14.900 3.742   1.00 44.64 ? 204  ASP A N     1 
ATOM   1615 C  CA    . ASP A 1 210 ? 10.459 13.563 3.967   1.00 45.51 ? 204  ASP A CA    1 
ATOM   1616 C  C     . ASP A 1 210 ? 10.645 13.141 5.416   1.00 45.67 ? 204  ASP A C     1 
ATOM   1617 O  O     . ASP A 1 210 ? 10.625 11.949 5.725   1.00 45.85 ? 204  ASP A O     1 
ATOM   1618 C  CB    . ASP A 1 210 ? 11.787 13.417 3.249   1.00 44.98 ? 204  ASP A CB    1 
ATOM   1619 C  CG    . ASP A 1 210 ? 11.718 13.887 1.824   1.00 45.44 ? 204  ASP A CG    1 
ATOM   1620 O  OD1   . ASP A 1 210 ? 10.592 14.052 1.307   1.00 46.62 ? 204  ASP A OD1   1 
ATOM   1621 O  OD2   . ASP A 1 210 ? 12.789 14.088 1.225   1.00 45.13 ? 204  ASP A OD2   1 
ATOM   1622 N  N     . THR A 1 211 ? 10.831 14.112 6.300   1.00 45.25 ? 205  THR A N     1 
ATOM   1623 C  CA    . THR A 1 211 ? 11.048 13.818 7.709   1.00 45.80 ? 205  THR A CA    1 
ATOM   1624 C  C     . THR A 1 211 ? 9.799  13.237 8.343   1.00 46.91 ? 205  THR A C     1 
ATOM   1625 O  O     . THR A 1 211 ? 9.829  12.771 9.489   1.00 46.07 ? 205  THR A O     1 
ATOM   1626 C  CB    . THR A 1 211 ? 11.414 15.088 8.494   1.00 45.16 ? 205  THR A CB    1 
ATOM   1627 O  OG1   . THR A 1 211 ? 10.266 15.938 8.562   1.00 45.03 ? 205  THR A OG1   1 
ATOM   1628 C  CG2   . THR A 1 211 ? 12.547 15.831 7.816   1.00 42.76 ? 205  THR A CG2   1 
ATOM   1629 N  N     . LEU A 1 212 ? 8.699  13.273 7.597   1.00 47.73 ? 206  LEU A N     1 
ATOM   1630 C  CA    . LEU A 1 212 ? 7.430  12.769 8.102   1.00 49.00 ? 206  LEU A CA    1 
ATOM   1631 C  C     . LEU A 1 212 ? 7.223  11.277 7.873   1.00 49.80 ? 206  LEU A C     1 
ATOM   1632 O  O     . LEU A 1 212 ? 6.457  10.640 8.582   1.00 49.91 ? 206  LEU A O     1 
ATOM   1633 C  CB    . LEU A 1 212 ? 6.270  13.550 7.476   1.00 48.05 ? 206  LEU A CB    1 
ATOM   1634 C  CG    . LEU A 1 212 ? 6.226  15.049 7.787   1.00 48.05 ? 206  LEU A CG    1 
ATOM   1635 C  CD1   . LEU A 1 212 ? 5.055  15.683 7.068   1.00 47.41 ? 206  LEU A CD1   1 
ATOM   1636 C  CD2   . LEU A 1 212 ? 6.110  15.264 9.288   1.00 47.82 ? 206  LEU A CD2   1 
ATOM   1637 N  N     . SER A 1 213 ? 7.912  10.716 6.888   1.00 50.47 ? 207  SER A N     1 
ATOM   1638 C  CA    . SER A 1 213 ? 7.754  9.301  6.596   1.00 51.76 ? 207  SER A CA    1 
ATOM   1639 C  C     . SER A 1 213 ? 8.870  8.435  7.165   1.00 51.41 ? 207  SER A C     1 
ATOM   1640 O  O     . SER A 1 213 ? 8.931  7.239  6.884   1.00 51.33 ? 207  SER A O     1 
ATOM   1641 C  CB    . SER A 1 213 ? 7.654  9.093  5.085   1.00 52.93 ? 207  SER A CB    1 
ATOM   1642 O  OG    . SER A 1 213 ? 8.736  9.716  4.420   1.00 55.10 ? 207  SER A OG    1 
ATOM   1643 N  N     . ILE A 1 214 ? 9.745  9.035  7.968   1.00 50.11 ? 208  ILE A N     1 
ATOM   1644 C  CA    . ILE A 1 214 ? 10.850 8.307  8.578   1.00 48.92 ? 208  ILE A CA    1 
ATOM   1645 C  C     . ILE A 1 214 ? 10.611 8.128  10.076  1.00 48.91 ? 208  ILE A C     1 
ATOM   1646 O  O     . ILE A 1 214 ? 10.089 9.016  10.747  1.00 47.71 ? 208  ILE A O     1 
ATOM   1647 C  CB    . ILE A 1 214 ? 12.191 9.047  8.359   1.00 49.36 ? 208  ILE A CB    1 
ATOM   1648 C  CG1   . ILE A 1 214 ? 13.353 8.195  8.877   1.00 49.45 ? 208  ILE A CG1   1 
ATOM   1649 C  CG2   . ILE A 1 214 ? 12.169 10.397 9.075   1.00 48.41 ? 208  ILE A CG2   1 
ATOM   1650 C  CD1   . ILE A 1 214 ? 14.722 8.787  8.595   1.00 48.38 ? 208  ILE A CD1   1 
ATOM   1651 N  N     . GLU A 1 215 ? 10.991 6.971  10.597  1.00 50.11 ? 209  GLU A N     1 
ATOM   1652 C  CA    . GLU A 1 215 ? 10.807 6.698  12.009  1.00 52.83 ? 209  GLU A CA    1 
ATOM   1653 C  C     . GLU A 1 215 ? 11.608 7.718  12.795  1.00 52.05 ? 209  GLU A C     1 
ATOM   1654 O  O     . GLU A 1 215 ? 12.802 7.903  12.561  1.00 51.05 ? 209  GLU A O     1 
ATOM   1655 C  CB    . GLU A 1 215 ? 11.277 5.283  12.343  1.00 57.16 ? 209  GLU A CB    1 
ATOM   1656 C  CG    . GLU A 1 215 ? 10.870 4.252  11.298  1.00 63.90 ? 209  GLU A CG    1 
ATOM   1657 C  CD    . GLU A 1 215 ? 11.688 4.376  10.015  1.00 68.69 ? 209  GLU A CD    1 
ATOM   1658 O  OE1   . GLU A 1 215 ? 12.895 4.037  10.041  1.00 70.43 ? 209  GLU A OE1   1 
ATOM   1659 O  OE2   . GLU A 1 215 ? 11.130 4.821  8.983   1.00 70.58 ? 209  GLU A OE2   1 
ATOM   1660 N  N     . PHE A 1 216 ? 10.937 8.382  13.727  1.00 52.11 ? 210  PHE A N     1 
ATOM   1661 C  CA    . PHE A 1 216 ? 11.574 9.400  14.543  1.00 52.48 ? 210  PHE A CA    1 
ATOM   1662 C  C     . PHE A 1 216 ? 12.895 8.948  15.161  1.00 51.54 ? 210  PHE A C     1 
ATOM   1663 O  O     . PHE A 1 216 ? 13.881 9.672  15.114  1.00 53.21 ? 210  PHE A O     1 
ATOM   1664 C  CB    . PHE A 1 216 ? 10.629 9.856  15.658  1.00 51.90 ? 210  PHE A CB    1 
ATOM   1665 C  CG    . PHE A 1 216 ? 11.227 10.893 16.565  1.00 52.05 ? 210  PHE A CG    1 
ATOM   1666 C  CD1   . PHE A 1 216 ? 11.340 12.214 16.152  1.00 51.71 ? 210  PHE A CD1   1 
ATOM   1667 C  CD2   . PHE A 1 216 ? 11.710 10.538 17.821  1.00 52.82 ? 210  PHE A CD2   1 
ATOM   1668 C  CE1   . PHE A 1 216 ? 11.925 13.171 16.974  1.00 52.69 ? 210  PHE A CE1   1 
ATOM   1669 C  CE2   . PHE A 1 216 ? 12.300 11.488 18.656  1.00 53.75 ? 210  PHE A CE2   1 
ATOM   1670 C  CZ    . PHE A 1 216 ? 12.407 12.808 18.229  1.00 53.13 ? 210  PHE A CZ    1 
ATOM   1671 N  N     . ASP A 1 217 ? 12.912 7.757  15.742  1.00 51.10 ? 211  ASP A N     1 
ATOM   1672 C  CA    . ASP A 1 217 ? 14.115 7.247  16.381  1.00 51.37 ? 211  ASP A CA    1 
ATOM   1673 C  C     . ASP A 1 217 ? 15.306 7.188  15.442  1.00 49.88 ? 211  ASP A C     1 
ATOM   1674 O  O     . ASP A 1 217 ? 16.447 7.413  15.854  1.00 50.18 ? 211  ASP A O     1 
ATOM   1675 C  CB    . ASP A 1 217 ? 13.838 5.870  16.971  1.00 55.70 ? 211  ASP A CB    1 
ATOM   1676 C  CG    . ASP A 1 217 ? 13.045 5.944  18.262  1.00 60.38 ? 211  ASP A CG    1 
ATOM   1677 O  OD1   . ASP A 1 217 ? 12.017 6.657  18.300  1.00 61.97 ? 211  ASP A OD1   1 
ATOM   1678 O  OD2   . ASP A 1 217 ? 13.451 5.286  19.243  1.00 62.70 ? 211  ASP A OD2   1 
ATOM   1679 N  N     . LYS A 1 218 ? 15.034 6.888  14.175  1.00 47.87 ? 212  LYS A N     1 
ATOM   1680 C  CA    . LYS A 1 218 ? 16.070 6.807  13.150  1.00 45.50 ? 212  LYS A CA    1 
ATOM   1681 C  C     . LYS A 1 218 ? 16.642 8.220  12.978  1.00 44.25 ? 212  LYS A C     1 
ATOM   1682 O  O     . LYS A 1 218 ? 17.833 8.459  13.194  1.00 43.84 ? 212  LYS A O     1 
ATOM   1683 C  CB    . LYS A 1 218 ? 15.441 6.317  11.837  1.00 44.78 ? 212  LYS A CB    1 
ATOM   1684 C  CG    . LYS A 1 218 ? 16.410 5.739  10.822  0.50 43.72 ? 212  LYS A CG    1 
ATOM   1685 C  CD    . LYS A 1 218 ? 15.659 5.193  9.609   0.50 43.01 ? 212  LYS A CD    1 
ATOM   1686 C  CE    . LYS A 1 218 ? 16.565 4.369  8.705   0.50 41.06 ? 212  LYS A CE    1 
ATOM   1687 N  NZ    . LYS A 1 218 ? 17.761 5.142  8.275   0.50 42.13 ? 212  LYS A NZ    1 
ATOM   1688 N  N     . LEU A 1 219 ? 15.773 9.151  12.603  1.00 43.17 ? 213  LEU A N     1 
ATOM   1689 C  CA    . LEU A 1 219 ? 16.158 10.541 12.416  1.00 42.09 ? 213  LEU A CA    1 
ATOM   1690 C  C     . LEU A 1 219 ? 16.866 11.018 13.678  1.00 41.06 ? 213  LEU A C     1 
ATOM   1691 O  O     . LEU A 1 219 ? 17.960 11.561 13.616  1.00 40.54 ? 213  LEU A O     1 
ATOM   1692 C  CB    . LEU A 1 219 ? 14.913 11.394 12.155  1.00 40.21 ? 213  LEU A CB    1 
ATOM   1693 C  CG    . LEU A 1 219 ? 15.099 12.874 11.803  1.00 40.11 ? 213  LEU A CG    1 
ATOM   1694 C  CD1   . LEU A 1 219 ? 16.064 13.015 10.617  1.00 38.86 ? 213  LEU A CD1   1 
ATOM   1695 C  CD2   . LEU A 1 219 ? 13.740 13.486 11.472  1.00 36.46 ? 213  LEU A CD2   1 
ATOM   1696 N  N     A LYS A 1 220 ? 16.225 10.794 14.821  0.50 42.04 ? 214  LYS A N     1 
ATOM   1697 N  N     B LYS A 1 220 ? 16.232 10.799 14.827  0.50 41.76 ? 214  LYS A N     1 
ATOM   1698 C  CA    A LYS A 1 220 ? 16.765 11.185 16.117  0.50 42.79 ? 214  LYS A CA    1 
ATOM   1699 C  CA    B LYS A 1 220 ? 16.791 11.214 16.109  0.50 42.28 ? 214  LYS A CA    1 
ATOM   1700 C  C     A LYS A 1 220 ? 18.207 10.721 16.282  0.50 43.46 ? 214  LYS A C     1 
ATOM   1701 C  C     B LYS A 1 220 ? 18.224 10.727 16.267  0.50 43.14 ? 214  LYS A C     1 
ATOM   1702 O  O     A LYS A 1 220 ? 19.086 11.504 16.644  0.50 43.18 ? 214  LYS A O     1 
ATOM   1703 O  O     B LYS A 1 220 ? 19.117 11.502 16.614  0.50 42.80 ? 214  LYS A O     1 
ATOM   1704 C  CB    A LYS A 1 220 ? 15.899 10.591 17.231  0.50 43.79 ? 214  LYS A CB    1 
ATOM   1705 C  CB    B LYS A 1 220 ? 15.933 10.674 17.261  0.50 42.65 ? 214  LYS A CB    1 
ATOM   1706 C  CG    A LYS A 1 220 ? 16.371 10.888 18.647  0.50 44.52 ? 214  LYS A CG    1 
ATOM   1707 C  CG    B LYS A 1 220 ? 16.208 11.322 18.621  0.50 42.68 ? 214  LYS A CG    1 
ATOM   1708 C  CD    A LYS A 1 220 ? 15.363 10.360 19.663  0.50 46.25 ? 214  LYS A CD    1 
ATOM   1709 C  CD    B LYS A 1 220 ? 17.505 10.834 19.263  0.50 42.59 ? 214  LYS A CD    1 
ATOM   1710 C  CE    A LYS A 1 220 ? 15.799 10.615 21.101  0.50 45.28 ? 214  LYS A CE    1 
ATOM   1711 C  CE    B LYS A 1 220 ? 17.380 9.399  19.752  0.50 42.79 ? 214  LYS A CE    1 
ATOM   1712 N  NZ    A LYS A 1 220 ? 14.747 10.165 22.058  0.50 45.44 ? 214  LYS A NZ    1 
ATOM   1713 N  NZ    B LYS A 1 220 ? 18.628 8.915  20.396  0.50 41.50 ? 214  LYS A NZ    1 
ATOM   1714 N  N     . GLY A 1 221 ? 18.445 9.443  16.006  1.00 43.46 ? 215  GLY A N     1 
ATOM   1715 C  CA    . GLY A 1 221 ? 19.782 8.892  16.136  1.00 43.45 ? 215  GLY A CA    1 
ATOM   1716 C  C     . GLY A 1 221 ? 20.864 9.466  15.230  1.00 43.33 ? 215  GLY A C     1 
ATOM   1717 O  O     . GLY A 1 221 ? 22.034 9.503  15.614  1.00 44.02 ? 215  GLY A O     1 
ATOM   1718 N  N     A MET A 1 222 ? 20.488 9.922  14.041  0.50 42.21 ? 216  MET A N     1 
ATOM   1719 N  N     B MET A 1 222 ? 20.478 9.915  14.040  0.50 42.27 ? 216  MET A N     1 
ATOM   1720 C  CA    A MET A 1 222 ? 21.472 10.474 13.118  0.50 41.62 ? 216  MET A CA    1 
ATOM   1721 C  CA    B MET A 1 222 ? 21.431 10.472 13.082  0.50 41.73 ? 216  MET A CA    1 
ATOM   1722 C  C     A MET A 1 222 ? 21.749 11.970 13.275  0.50 41.11 ? 216  MET A C     1 
ATOM   1723 C  C     B MET A 1 222 ? 21.740 11.960 13.271  0.50 41.19 ? 216  MET A C     1 
ATOM   1724 O  O     A MET A 1 222 ? 22.878 12.414 13.065  0.50 41.14 ? 216  MET A O     1 
ATOM   1725 O  O     B MET A 1 222 ? 22.880 12.386 13.081  0.50 41.26 ? 216  MET A O     1 
ATOM   1726 C  CB    A MET A 1 222 ? 21.061 10.173 11.674  0.50 42.26 ? 216  MET A CB    1 
ATOM   1727 C  CB    B MET A 1 222 ? 20.922 10.249 11.653  0.50 42.51 ? 216  MET A CB    1 
ATOM   1728 C  CG    A MET A 1 222 ? 20.983 8.685  11.367  0.50 43.37 ? 216  MET A CG    1 
ATOM   1729 C  CG    B MET A 1 222 ? 21.834 10.805 10.566  0.50 43.38 ? 216  MET A CG    1 
ATOM   1730 S  SD    A MET A 1 222 ? 22.406 7.781  12.032  0.50 45.08 ? 216  MET A SD    1 
ATOM   1731 S  SD    B MET A 1 222 ? 23.307 9.803  10.259  0.50 46.74 ? 216  MET A SD    1 
ATOM   1732 C  CE    A MET A 1 222 ? 23.706 8.314  10.923  0.50 41.54 ? 216  MET A CE    1 
ATOM   1733 C  CE    B MET A 1 222 ? 22.949 9.180  8.605   0.50 42.09 ? 216  MET A CE    1 
ATOM   1734 N  N     . ILE A 1 223 ? 20.737 12.752 13.640  1.00 40.15 ? 217  ILE A N     1 
ATOM   1735 C  CA    . ILE A 1 223 ? 20.943 14.194 13.802  1.00 38.18 ? 217  ILE A CA    1 
ATOM   1736 C  C     . ILE A 1 223 ? 20.602 14.798 15.156  1.00 37.76 ? 217  ILE A C     1 
ATOM   1737 O  O     . ILE A 1 223 ? 20.762 15.991 15.358  1.00 39.22 ? 217  ILE A O     1 
ATOM   1738 C  CB    . ILE A 1 223 ? 20.168 14.991 12.726  1.00 37.19 ? 217  ILE A CB    1 
ATOM   1739 C  CG1   . ILE A 1 223 ? 18.658 14.935 13.009  1.00 37.75 ? 217  ILE A CG1   1 
ATOM   1740 C  CG2   . ILE A 1 223 ? 20.483 14.432 11.353  1.00 33.23 ? 217  ILE A CG2   1 
ATOM   1741 C  CD1   . ILE A 1 223 ? 17.807 15.843 12.107  1.00 32.57 ? 217  ILE A CD1   1 
ATOM   1742 N  N     . GLY A 1 224 ? 20.127 13.982 16.087  1.00 38.68 ? 218  GLY A N     1 
ATOM   1743 C  CA    . GLY A 1 224 ? 19.782 14.504 17.392  1.00 36.30 ? 218  GLY A CA    1 
ATOM   1744 C  C     . GLY A 1 224 ? 18.297 14.741 17.563  1.00 36.49 ? 218  GLY A C     1 
ATOM   1745 O  O     . GLY A 1 224 ? 17.575 15.056 16.615  1.00 36.00 ? 218  GLY A O     1 
ATOM   1746 N  N     . GLU A 1 225 ? 17.843 14.586 18.797  1.00 37.00 ? 219  GLU A N     1 
ATOM   1747 C  CA    . GLU A 1 225 ? 16.443 14.776 19.131  1.00 37.57 ? 219  GLU A CA    1 
ATOM   1748 C  C     . GLU A 1 225 ? 15.966 16.191 18.797  1.00 37.75 ? 219  GLU A C     1 
ATOM   1749 O  O     . GLU A 1 225 ? 14.922 16.366 18.171  1.00 39.66 ? 219  GLU A O     1 
ATOM   1750 C  CB    . GLU A 1 225 ? 16.230 14.486 20.625  1.00 37.66 ? 219  GLU A CB    1 
ATOM   1751 C  CG    . GLU A 1 225 ? 14.835 14.819 21.124  1.00 40.48 ? 219  GLU A CG    1 
ATOM   1752 C  CD    . GLU A 1 225 ? 14.636 14.502 22.592  0.50 39.49 ? 219  GLU A CD    1 
ATOM   1753 O  OE1   . GLU A 1 225 ? 15.481 14.910 23.414  0.50 38.35 ? 219  GLU A OE1   1 
ATOM   1754 O  OE2   . GLU A 1 225 ? 13.626 13.852 22.922  0.50 40.11 ? 219  GLU A OE2   1 
ATOM   1755 N  N     . ALA A 1 226 ? 16.739 17.194 19.212  1.00 37.24 ? 220  ALA A N     1 
ATOM   1756 C  CA    . ALA A 1 226 ? 16.400 18.607 18.994  1.00 37.23 ? 220  ALA A CA    1 
ATOM   1757 C  C     . ALA A 1 226 ? 16.193 18.964 17.528  1.00 34.65 ? 220  ALA A C     1 
ATOM   1758 O  O     . ALA A 1 226 ? 15.169 19.524 17.137  1.00 33.84 ? 220  ALA A O     1 
ATOM   1759 C  CB    . ALA A 1 226 ? 17.500 19.498 19.584  1.00 37.00 ? 220  ALA A CB    1 
ATOM   1760 N  N     . LYS A 1 227 ? 17.200 18.643 16.733  1.00 35.03 ? 221  LYS A N     1 
ATOM   1761 C  CA    . LYS A 1 227 ? 17.194 18.904 15.308  1.00 33.02 ? 221  LYS A CA    1 
ATOM   1762 C  C     . LYS A 1 227 ? 16.071 18.122 14.615  1.00 31.45 ? 221  LYS A C     1 
ATOM   1763 O  O     . LYS A 1 227 ? 15.465 18.611 13.666  1.00 29.64 ? 221  LYS A O     1 
ATOM   1764 C  CB    . LYS A 1 227 ? 18.559 18.515 14.735  1.00 31.49 ? 221  LYS A CB    1 
ATOM   1765 C  CG    . LYS A 1 227 ? 18.821 19.011 13.327  1.00 33.43 ? 221  LYS A CG    1 
ATOM   1766 C  CD    . LYS A 1 227 ? 19.294 20.449 13.317  1.00 34.19 ? 221  LYS A CD    1 
ATOM   1767 C  CE    . LYS A 1 227 ? 20.737 20.586 13.799  1.00 33.43 ? 221  LYS A CE    1 
ATOM   1768 N  NZ    . LYS A 1 227 ? 21.122 22.033 13.858  1.00 32.07 ? 221  LYS A NZ    1 
ATOM   1769 N  N     . ALA A 1 228 ? 15.789 16.915 15.098  1.00 31.48 ? 222  ALA A N     1 
ATOM   1770 C  CA    . ALA A 1 228 ? 14.743 16.074 14.509  1.00 33.25 ? 222  ALA A CA    1 
ATOM   1771 C  C     . ALA A 1 228 ? 13.345 16.632 14.754  1.00 34.22 ? 222  ALA A C     1 
ATOM   1772 O  O     . ALA A 1 228 ? 12.506 16.682 13.853  1.00 34.13 ? 222  ALA A O     1 
ATOM   1773 C  CB    . ALA A 1 228 ? 14.839 14.649 15.068  1.00 33.88 ? 222  ALA A CB    1 
ATOM   1774 N  N     . LYS A 1 229 ? 13.084 17.041 15.988  1.00 36.88 ? 223  LYS A N     1 
ATOM   1775 C  CA    . LYS A 1 229 ? 11.790 17.601 16.324  1.00 37.21 ? 223  LYS A CA    1 
ATOM   1776 C  C     . LYS A 1 229 ? 11.602 18.908 15.564  1.00 36.90 ? 223  LYS A C     1 
ATOM   1777 O  O     . LYS A 1 229 ? 10.521 19.194 15.048  1.00 37.44 ? 223  LYS A O     1 
ATOM   1778 C  CB    . LYS A 1 229 ? 11.710 17.817 17.833  1.00 39.42 ? 223  LYS A CB    1 
ATOM   1779 C  CG    . LYS A 1 229 ? 11.654 16.506 18.591  1.00 42.55 ? 223  LYS A CG    1 
ATOM   1780 C  CD    . LYS A 1 229 ? 11.695 16.714 20.087  1.00 46.61 ? 223  LYS A CD    1 
ATOM   1781 C  CE    . LYS A 1 229 ? 11.422 15.419 20.816  1.00 48.14 ? 223  LYS A CE    1 
ATOM   1782 N  NZ    . LYS A 1 229 ? 11.676 15.577 22.270  1.00 53.26 ? 223  LYS A NZ    1 
ATOM   1783 N  N     . TYR A 1 230 ? 12.670 19.689 15.482  1.00 37.43 ? 224  TYR A N     1 
ATOM   1784 C  CA    . TYR A 1 230 ? 12.647 20.960 14.769  1.00 37.60 ? 224  TYR A CA    1 
ATOM   1785 C  C     . TYR A 1 230 ? 12.174 20.752 13.332  1.00 37.09 ? 224  TYR A C     1 
ATOM   1786 O  O     . TYR A 1 230 ? 11.185 21.339 12.907  1.00 37.16 ? 224  TYR A O     1 
ATOM   1787 C  CB    . TYR A 1 230 ? 14.054 21.583 14.789  1.00 36.57 ? 224  TYR A CB    1 
ATOM   1788 C  CG    . TYR A 1 230 ? 14.253 22.771 13.866  1.00 36.93 ? 224  TYR A CG    1 
ATOM   1789 C  CD1   . TYR A 1 230 ? 13.471 23.924 13.983  1.00 35.92 ? 224  TYR A CD1   1 
ATOM   1790 C  CD2   . TYR A 1 230 ? 15.272 22.765 12.913  1.00 35.09 ? 224  TYR A CD2   1 
ATOM   1791 C  CE1   . TYR A 1 230 ? 13.716 25.050 13.170  1.00 37.29 ? 224  TYR A CE1   1 
ATOM   1792 C  CE2   . TYR A 1 230 ? 15.522 23.874 12.107  1.00 34.64 ? 224  TYR A CE2   1 
ATOM   1793 C  CZ    . TYR A 1 230 ? 14.748 25.012 12.241  1.00 35.06 ? 224  TYR A CZ    1 
ATOM   1794 O  OH    . TYR A 1 230 ? 15.032 26.106 11.456  1.00 33.68 ? 224  TYR A OH    1 
ATOM   1795 N  N     . LEU A 1 231 ? 12.878 19.899 12.593  1.00 37.59 ? 225  LEU A N     1 
ATOM   1796 C  CA    . LEU A 1 231 ? 12.526 19.625 11.208  1.00 37.63 ? 225  LEU A CA    1 
ATOM   1797 C  C     . LEU A 1 231 ? 11.112 19.066 11.029  1.00 39.57 ? 225  LEU A C     1 
ATOM   1798 O  O     . LEU A 1 231 ? 10.407 19.443 10.096  1.00 39.63 ? 225  LEU A O     1 
ATOM   1799 C  CB    . LEU A 1 231 ? 13.547 18.668 10.586  1.00 36.98 ? 225  LEU A CB    1 
ATOM   1800 C  CG    . LEU A 1 231 ? 14.951 19.234 10.369  1.00 36.34 ? 225  LEU A CG    1 
ATOM   1801 C  CD1   . LEU A 1 231 ? 15.862 18.192 9.719   1.00 34.93 ? 225  LEU A CD1   1 
ATOM   1802 C  CD2   . LEU A 1 231 ? 14.852 20.462 9.486   1.00 35.05 ? 225  LEU A CD2   1 
ATOM   1803 N  N     . ILE A 1 232 ? 10.691 18.164 11.909  1.00 41.78 ? 226  ILE A N     1 
ATOM   1804 C  CA    . ILE A 1 232 ? 9.350  17.592 11.792  1.00 43.90 ? 226  ILE A CA    1 
ATOM   1805 C  C     . ILE A 1 232 ? 8.301  18.653 12.116  1.00 44.61 ? 226  ILE A C     1 
ATOM   1806 O  O     . ILE A 1 232 ? 7.255  18.731 11.477  1.00 43.01 ? 226  ILE A O     1 
ATOM   1807 C  CB    . ILE A 1 232 ? 9.181  16.383 12.740  1.00 44.24 ? 226  ILE A CB    1 
ATOM   1808 C  CG1   . ILE A 1 232 ? 10.059 15.226 12.252  1.00 44.49 ? 226  ILE A CG1   1 
ATOM   1809 C  CG2   . ILE A 1 232 ? 7.720  15.954 12.788  1.00 42.45 ? 226  ILE A CG2   1 
ATOM   1810 C  CD1   . ILE A 1 232 ? 10.408 14.203 13.331  1.00 44.77 ? 226  ILE A CD1   1 
ATOM   1811 N  N     . SER A 1 233 ? 8.606  19.466 13.120  1.00 45.88 ? 227  SER A N     1 
ATOM   1812 C  CA    . SER A 1 233 ? 7.734  20.539 13.560  1.00 46.88 ? 227  SER A CA    1 
ATOM   1813 C  C     . SER A 1 233 ? 7.384  21.423 12.371  1.00 47.13 ? 227  SER A C     1 
ATOM   1814 O  O     . SER A 1 233 ? 6.228  21.784 12.169  1.00 47.57 ? 227  SER A O     1 
ATOM   1815 C  CB    . SER A 1 233 ? 8.448  21.362 14.633  1.00 48.41 ? 227  SER A CB    1 
ATOM   1816 O  OG    . SER A 1 233 ? 7.592  22.327 15.211  1.00 54.04 ? 227  SER A OG    1 
ATOM   1817 N  N     . LEU A 1 234 ? 8.395  21.761 11.580  1.00 46.52 ? 228  LEU A N     1 
ATOM   1818 C  CA    . LEU A 1 234 ? 8.207  22.598 10.406  1.00 44.83 ? 228  LEU A CA    1 
ATOM   1819 C  C     . LEU A 1 234 ? 7.464  21.847 9.323   1.00 45.06 ? 228  LEU A C     1 
ATOM   1820 O  O     . LEU A 1 234 ? 6.718  22.434 8.550   1.00 44.94 ? 228  LEU A O     1 
ATOM   1821 C  CB    . LEU A 1 234 ? 9.558  23.045 9.857   1.00 43.73 ? 228  LEU A CB    1 
ATOM   1822 C  CG    . LEU A 1 234 ? 10.356 24.052 10.683  1.00 43.77 ? 228  LEU A CG    1 
ATOM   1823 C  CD1   . LEU A 1 234 ? 11.830 23.991 10.286  1.00 39.99 ? 228  LEU A CD1   1 
ATOM   1824 C  CD2   . LEU A 1 234 ? 9.782  25.449 10.468  1.00 40.97 ? 228  LEU A CD2   1 
ATOM   1825 N  N     . ALA A 1 235 ? 7.691  20.541 9.258   1.00 46.65 ? 229  ALA A N     1 
ATOM   1826 C  CA    . ALA A 1 235 ? 7.041  19.703 8.260   1.00 47.90 ? 229  ALA A CA    1 
ATOM   1827 C  C     . ALA A 1 235 ? 5.539  19.651 8.508   1.00 48.42 ? 229  ALA A C     1 
ATOM   1828 O  O     . ALA A 1 235 ? 4.754  19.609 7.568   1.00 50.19 ? 229  ALA A O     1 
ATOM   1829 C  CB    . ALA A 1 235 ? 7.630  18.295 8.294   1.00 45.92 ? 229  ALA A CB    1 
ATOM   1830 N  N     . ARG A 1 236 ? 5.148  19.663 9.779   1.00 50.50 ? 230  ARG A N     1 
ATOM   1831 C  CA    . ARG A 1 236 ? 3.740  19.617 10.163  1.00 52.18 ? 230  ARG A CA    1 
ATOM   1832 C  C     . ARG A 1 236 ? 3.165  21.005 10.389  1.00 53.57 ? 230  ARG A C     1 
ATOM   1833 O  O     . ARG A 1 236 ? 2.168  21.151 11.097  1.00 55.44 ? 230  ARG A O     1 
ATOM   1834 C  CB    . ARG A 1 236 ? 3.561  18.822 11.455  1.00 51.13 ? 230  ARG A CB    1 
ATOM   1835 C  CG    . ARG A 1 236 ? 3.890  17.354 11.351  1.00 51.07 ? 230  ARG A CG    1 
ATOM   1836 C  CD    . ARG A 1 236 ? 3.953  16.762 12.734  1.00 51.89 ? 230  ARG A CD    1 
ATOM   1837 N  NE    . ARG A 1 236 ? 4.266  15.338 12.709  1.00 54.32 ? 230  ARG A NE    1 
ATOM   1838 C  CZ    . ARG A 1 236 ? 4.691  14.653 13.766  1.00 52.84 ? 230  ARG A CZ    1 
ATOM   1839 N  NH1   . ARG A 1 236 ? 4.856  15.268 14.934  1.00 51.10 ? 230  ARG A NH1   1 
ATOM   1840 N  NH2   . ARG A 1 236 ? 4.953  13.357 13.656  1.00 51.75 ? 230  ARG A NH2   1 
ATOM   1841 N  N     . ASP A 1 237 ? 3.799  22.019 9.806   1.00 52.87 ? 231  ASP A N     1 
ATOM   1842 C  CA    . ASP A 1 237 ? 3.338  23.390 9.957   1.00 52.30 ? 231  ASP A CA    1 
ATOM   1843 C  C     . ASP A 1 237 ? 3.030  23.669 11.422  1.00 52.01 ? 231  ASP A C     1 
ATOM   1844 O  O     . ASP A 1 237 ? 2.110  24.421 11.740  1.00 51.53 ? 231  ASP A O     1 
ATOM   1845 C  CB    . ASP A 1 237 ? 2.073  23.614 9.129   1.00 53.45 ? 231  ASP A CB    1 
ATOM   1846 C  CG    . ASP A 1 237 ? 2.020  24.998 8.505   1.00 55.45 ? 231  ASP A CG    1 
ATOM   1847 O  OD1   . ASP A 1 237 ? 2.389  25.984 9.186   1.00 53.03 ? 231  ASP A OD1   1 
ATOM   1848 O  OD2   . ASP A 1 237 ? 1.600  25.096 7.330   1.00 55.54 ? 231  ASP A OD2   1 
ATOM   1849 N  N     . GLU A 1 238 ? 3.799  23.060 12.313  1.00 52.39 ? 232  GLU A N     1 
ATOM   1850 C  CA    . GLU A 1 238 ? 3.582  23.236 13.740  1.00 54.38 ? 232  GLU A CA    1 
ATOM   1851 C  C     . GLU A 1 238 ? 4.659  24.049 14.448  1.00 54.65 ? 232  GLU A C     1 
ATOM   1852 O  O     . GLU A 1 238 ? 4.698  24.089 15.678  1.00 55.72 ? 232  GLU A O     1 
ATOM   1853 C  CB    . GLU A 1 238 ? 3.437  21.864 14.415  1.00 56.46 ? 232  GLU A CB    1 
ATOM   1854 C  CG    . GLU A 1 238 ? 2.081  21.194 14.167  1.00 60.26 ? 232  GLU A CG    1 
ATOM   1855 C  CD    . GLU A 1 238 ? 2.039  19.738 14.602  1.00 61.83 ? 232  GLU A CD    1 
ATOM   1856 O  OE1   . GLU A 1 238 ? 2.548  19.424 15.701  1.00 61.23 ? 232  GLU A OE1   1 
ATOM   1857 O  OE2   . GLU A 1 238 ? 1.483  18.911 13.843  1.00 62.59 ? 232  GLU A OE2   1 
ATOM   1858 N  N     . TYR A 1 239 ? 5.526  24.700 13.679  1.00 54.50 ? 233  TYR A N     1 
ATOM   1859 C  CA    . TYR A 1 239 ? 6.590  25.511 14.268  1.00 52.76 ? 233  TYR A CA    1 
ATOM   1860 C  C     . TYR A 1 239 ? 6.017  26.865 14.664  1.00 52.79 ? 233  TYR A C     1 
ATOM   1861 O  O     . TYR A 1 239 ? 5.415  27.548 13.835  1.00 51.71 ? 233  TYR A O     1 
ATOM   1862 C  CB    . TYR A 1 239 ? 7.737  25.719 13.268  1.00 51.07 ? 233  TYR A CB    1 
ATOM   1863 C  CG    . TYR A 1 239 ? 8.855  26.582 13.817  1.00 49.88 ? 233  TYR A CG    1 
ATOM   1864 C  CD1   . TYR A 1 239 ? 9.917  26.020 14.518  1.00 48.68 ? 233  TYR A CD1   1 
ATOM   1865 C  CD2   . TYR A 1 239 ? 8.817  27.972 13.686  1.00 49.94 ? 233  TYR A CD2   1 
ATOM   1866 C  CE1   . TYR A 1 239 ? 10.916 26.819 15.080  1.00 49.52 ? 233  TYR A CE1   1 
ATOM   1867 C  CE2   . TYR A 1 239 ? 9.808  28.782 14.246  1.00 50.14 ? 233  TYR A CE2   1 
ATOM   1868 C  CZ    . TYR A 1 239 ? 10.853 28.198 14.942  1.00 49.90 ? 233  TYR A CZ    1 
ATOM   1869 O  OH    . TYR A 1 239 ? 11.828 28.991 15.503  1.00 51.68 ? 233  TYR A OH    1 
ATOM   1870 N  N     . ASN A 1 240 ? 6.208  27.258 15.921  1.00 53.14 ? 234  ASN A N     1 
ATOM   1871 C  CA    . ASN A 1 240 ? 5.694  28.542 16.388  1.00 54.67 ? 234  ASN A CA    1 
ATOM   1872 C  C     . ASN A 1 240 ? 6.475  29.172 17.530  1.00 54.04 ? 234  ASN A C     1 
ATOM   1873 O  O     . ASN A 1 240 ? 5.884  29.733 18.449  1.00 55.31 ? 234  ASN A O     1 
ATOM   1874 C  CB    . ASN A 1 240 ? 4.230  28.404 16.816  1.00 56.64 ? 234  ASN A CB    1 
ATOM   1875 C  CG    . ASN A 1 240 ? 3.310  28.111 15.654  1.00 58.78 ? 234  ASN A CG    1 
ATOM   1876 O  OD1   . ASN A 1 240 ? 2.544  27.146 15.685  1.00 60.86 ? 234  ASN A OD1   1 
ATOM   1877 N  ND2   . ASN A 1 240 ? 3.376  28.945 14.617  1.00 60.99 ? 234  ASN A ND2   1 
ATOM   1878 N  N     . GLU A 1 241 ? 7.799  29.094 17.482  1.00 52.81 ? 235  GLU A N     1 
ATOM   1879 C  CA    . GLU A 1 241 ? 8.585  29.691 18.545  1.00 52.33 ? 235  GLU A CA    1 
ATOM   1880 C  C     . GLU A 1 241 ? 8.294  31.179 18.623  1.00 52.64 ? 235  GLU A C     1 
ATOM   1881 O  O     . GLU A 1 241 ? 8.308  31.889 17.615  1.00 51.59 ? 235  GLU A O     1 
ATOM   1882 C  CB    . GLU A 1 241 ? 10.072 29.450 18.321  1.00 52.33 ? 235  GLU A CB    1 
ATOM   1883 C  CG    . GLU A 1 241 ? 10.499 28.028 18.641  1.00 53.60 ? 235  GLU A CG    1 
ATOM   1884 C  CD    . GLU A 1 241 ? 10.271 27.674 20.100  0.50 53.17 ? 235  GLU A CD    1 
ATOM   1885 O  OE1   . GLU A 1 241 ? 10.834 28.367 20.974  0.50 53.51 ? 235  GLU A OE1   1 
ATOM   1886 O  OE2   . GLU A 1 241 ? 9.531  26.707 20.371  0.50 51.04 ? 235  GLU A OE2   1 
ATOM   1887 N  N     . PRO A 1 242 ? 8.003  31.668 19.835  1.00 52.31 ? 236  PRO A N     1 
ATOM   1888 C  CA    . PRO A 1 242 ? 7.699  33.080 20.058  1.00 52.20 ? 236  PRO A CA    1 
ATOM   1889 C  C     . PRO A 1 242 ? 8.890  34.020 19.892  1.00 50.94 ? 236  PRO A C     1 
ATOM   1890 O  O     . PRO A 1 242 ? 10.050 33.625 20.052  1.00 50.19 ? 236  PRO A O     1 
ATOM   1891 C  CB    . PRO A 1 242 ? 7.147  33.087 21.485  1.00 53.49 ? 236  PRO A CB    1 
ATOM   1892 C  CG    . PRO A 1 242 ? 7.880  31.958 22.133  1.00 52.75 ? 236  PRO A CG    1 
ATOM   1893 C  CD    . PRO A 1 242 ? 7.836  30.889 21.075  1.00 51.94 ? 236  PRO A CD    1 
ATOM   1894 N  N     . ILE A 1 243 ? 8.588  35.268 19.550  1.00 49.50 ? 237  ILE A N     1 
ATOM   1895 C  CA    . ILE A 1 243 ? 9.620  36.274 19.399  1.00 47.91 ? 237  ILE A CA    1 
ATOM   1896 C  C     . ILE A 1 243 ? 9.953  36.611 20.836  1.00 48.06 ? 237  ILE A C     1 
ATOM   1897 O  O     . ILE A 1 243 ? 9.060  36.907 21.621  1.00 49.36 ? 237  ILE A O     1 
ATOM   1898 C  CB    . ILE A 1 243 ? 9.072  37.509 18.651  1.00 46.64 ? 237  ILE A CB    1 
ATOM   1899 C  CG1   . ILE A 1 243 ? 9.079  37.243 17.144  1.00 45.88 ? 237  ILE A CG1   1 
ATOM   1900 C  CG2   . ILE A 1 243 ? 9.882  38.740 18.994  1.00 45.71 ? 237  ILE A CG2   1 
ATOM   1901 C  CD1   . ILE A 1 243 ? 8.371  35.968 16.727  1.00 44.84 ? 237  ILE A CD1   1 
ATOM   1902 N  N     . ARG A 1 244 ? 11.225 36.523 21.198  1.00 48.25 ? 238  ARG A N     1 
ATOM   1903 C  CA    . ARG A 1 244 ? 11.619 36.807 22.568  1.00 48.55 ? 238  ARG A CA    1 
ATOM   1904 C  C     . ARG A 1 244 ? 12.929 37.572 22.598  1.00 50.49 ? 238  ARG A C     1 
ATOM   1905 O  O     . ARG A 1 244 ? 13.714 37.525 21.654  1.00 50.28 ? 238  ARG A O     1 
ATOM   1906 C  CB    . ARG A 1 244 ? 11.779 35.510 23.361  0.50 48.26 ? 238  ARG A CB    1 
ATOM   1907 C  CG    . ARG A 1 244 ? 12.912 34.620 22.872  0.50 48.98 ? 238  ARG A CG    1 
ATOM   1908 C  CD    . ARG A 1 244 ? 13.498 33.801 24.010  0.50 49.75 ? 238  ARG A CD    1 
ATOM   1909 N  NE    . ARG A 1 244 ? 14.640 32.994 23.586  0.50 50.08 ? 238  ARG A NE    1 
ATOM   1910 C  CZ    . ARG A 1 244 ? 15.437 32.333 24.422  0.50 50.02 ? 238  ARG A CZ    1 
ATOM   1911 N  NH1   . ARG A 1 244 ? 15.222 32.388 25.729  0.50 49.67 ? 238  ARG A NH1   1 
ATOM   1912 N  NH2   . ARG A 1 244 ? 16.452 31.620 23.955  0.50 49.80 ? 238  ARG A NH2   1 
ATOM   1913 N  N     . THR A 1 245 ? 13.168 38.274 23.696  1.00 51.17 ? 239  THR A N     1 
ATOM   1914 C  CA    . THR A 1 245 ? 14.389 39.036 23.830  1.00 53.04 ? 239  THR A CA    1 
ATOM   1915 C  C     . THR A 1 245 ? 15.533 38.104 24.202  1.00 54.31 ? 239  THR A C     1 
ATOM   1916 O  O     . THR A 1 245 ? 15.385 37.224 25.049  1.00 55.44 ? 239  THR A O     1 
ATOM   1917 C  CB    . THR A 1 245 ? 14.238 40.116 24.908  1.00 53.01 ? 239  THR A CB    1 
ATOM   1918 O  OG1   . THR A 1 245 ? 13.067 40.889 24.635  1.00 55.18 ? 239  THR A OG1   1 
ATOM   1919 C  CG2   . THR A 1 245 ? 15.442 41.042 24.909  1.00 54.17 ? 239  THR A CG2   1 
ATOM   1920 N  N     . ARG A 1 246 ? 16.673 38.282 23.545  1.00 54.05 ? 240  ARG A N     1 
ATOM   1921 C  CA    . ARG A 1 246 ? 17.839 37.467 23.836  1.00 53.33 ? 240  ARG A CA    1 
ATOM   1922 C  C     . ARG A 1 246 ? 18.791 38.349 24.628  1.00 52.45 ? 240  ARG A C     1 
ATOM   1923 O  O     . ARG A 1 246 ? 18.775 39.572 24.488  1.00 53.97 ? 240  ARG A O     1 
ATOM   1924 C  CB    . ARG A 1 246 ? 18.523 37.015 22.543  1.00 53.02 ? 240  ARG A CB    1 
ATOM   1925 C  CG    . ARG A 1 246 ? 17.667 36.176 21.605  1.00 53.83 ? 240  ARG A CG    1 
ATOM   1926 C  CD    . ARG A 1 246 ? 18.445 35.842 20.324  1.00 55.00 ? 240  ARG A CD    1 
ATOM   1927 N  NE    . ARG A 1 246 ? 17.593 35.301 19.268  1.00 54.75 ? 240  ARG A NE    1 
ATOM   1928 C  CZ    . ARG A 1 246 ? 18.026 34.930 18.065  1.00 54.49 ? 240  ARG A CZ    1 
ATOM   1929 N  NH1   . ARG A 1 246 ? 19.310 35.039 17.758  1.00 55.85 ? 240  ARG A NH1   1 
ATOM   1930 N  NH2   . ARG A 1 246 ? 17.173 34.453 17.166  1.00 53.92 ? 240  ARG A NH2   1 
ATOM   1931 N  N     . VAL A 1 247 ? 19.612 37.737 25.470  1.00 51.28 ? 241  VAL A N     1 
ATOM   1932 C  CA    . VAL A 1 247 ? 20.581 38.490 26.252  1.00 49.35 ? 241  VAL A CA    1 
ATOM   1933 C  C     . VAL A 1 247 ? 21.926 37.795 26.137  1.00 47.55 ? 241  VAL A C     1 
ATOM   1934 O  O     . VAL A 1 247 ? 21.988 36.571 26.083  1.00 46.09 ? 241  VAL A O     1 
ATOM   1935 C  CB    . VAL A 1 247 ? 20.151 38.602 27.735  1.00 49.60 ? 241  VAL A CB    1 
ATOM   1936 C  CG1   . VAL A 1 247 ? 19.073 39.672 27.870  1.00 50.98 ? 241  VAL A CG1   1 
ATOM   1937 C  CG2   . VAL A 1 247 ? 19.619 37.263 28.239  1.00 47.30 ? 241  VAL A CG2   1 
ATOM   1938 N  N     . ARG A 1 248 ? 22.994 38.582 26.065  1.00 48.09 ? 242  ARG A N     1 
ATOM   1939 C  CA    . ARG A 1 248 ? 24.337 38.035 25.941  1.00 47.55 ? 242  ARG A CA    1 
ATOM   1940 C  C     . ARG A 1 248 ? 24.541 36.963 27.000  1.00 47.74 ? 242  ARG A C     1 
ATOM   1941 O  O     . ARG A 1 248 ? 24.107 37.121 28.137  1.00 48.58 ? 242  ARG A O     1 
ATOM   1942 C  CB    . ARG A 1 248 ? 25.382 39.136 26.116  0.50 46.27 ? 242  ARG A CB    1 
ATOM   1943 C  CG    . ARG A 1 248 ? 25.095 40.398 25.329  0.50 46.28 ? 242  ARG A CG    1 
ATOM   1944 C  CD    . ARG A 1 248 ? 26.296 41.330 25.344  0.50 46.21 ? 242  ARG A CD    1 
ATOM   1945 N  NE    . ARG A 1 248 ? 25.920 42.711 25.060  0.50 46.89 ? 242  ARG A NE    1 
ATOM   1946 C  CZ    . ARG A 1 248 ? 26.776 43.729 25.061  0.50 46.61 ? 242  ARG A CZ    1 
ATOM   1947 N  NH1   . ARG A 1 248 ? 28.057 43.517 25.324  0.50 46.79 ? 242  ARG A NH1   1 
ATOM   1948 N  NH2   . ARG A 1 248 ? 26.346 44.959 24.821  0.50 47.31 ? 242  ARG A NH2   1 
ATOM   1949 N  N     . LYS A 1 249 ? 25.201 35.874 26.630  1.00 45.87 ? 243  LYS A N     1 
ATOM   1950 C  CA    . LYS A 1 249 ? 25.437 34.797 27.573  1.00 45.33 ? 243  LYS A CA    1 
ATOM   1951 C  C     . LYS A 1 249 ? 26.909 34.564 27.850  1.00 44.41 ? 243  LYS A C     1 
ATOM   1952 O  O     . LYS A 1 249 ? 27.272 33.982 28.872  1.00 44.41 ? 243  LYS A O     1 
ATOM   1953 C  CB    . LYS A 1 249 ? 24.767 33.515 27.081  1.00 44.34 ? 243  LYS A CB    1 
ATOM   1954 C  CG    . LYS A 1 249 ? 23.253 33.613 27.182  1.00 46.64 ? 243  LYS A CG    1 
ATOM   1955 C  CD    . LYS A 1 249 ? 22.546 32.285 26.982  1.00 48.02 ? 243  LYS A CD    1 
ATOM   1956 C  CE    . LYS A 1 249 ? 21.037 32.485 27.083  1.00 48.79 ? 243  LYS A CE    1 
ATOM   1957 N  NZ    . LYS A 1 249 ? 20.265 31.245 26.809  1.00 47.71 ? 243  LYS A NZ    1 
ATOM   1958 N  N     . SER A 1 250 ? 27.757 35.036 26.946  1.00 42.80 ? 244  SER A N     1 
ATOM   1959 C  CA    . SER A 1 250 ? 29.193 34.896 27.106  1.00 42.91 ? 244  SER A CA    1 
ATOM   1960 C  C     . SER A 1 250 ? 29.876 36.055 26.404  1.00 42.35 ? 244  SER A C     1 
ATOM   1961 O  O     . SER A 1 250 ? 29.358 36.599 25.430  1.00 44.41 ? 244  SER A O     1 
ATOM   1962 C  CB    . SER A 1 250 ? 29.690 33.567 26.519  1.00 42.92 ? 244  SER A CB    1 
ATOM   1963 O  OG    . SER A 1 250 ? 29.689 33.575 25.102  1.00 44.00 ? 244  SER A OG    1 
ATOM   1964 N  N     . ILE A 1 251 ? 31.039 36.437 26.906  1.00 40.97 ? 245  ILE A N     1 
ATOM   1965 C  CA    . ILE A 1 251 ? 31.789 37.526 26.320  1.00 40.25 ? 245  ILE A CA    1 
ATOM   1966 C  C     . ILE A 1 251 ? 33.225 37.101 26.341  1.00 40.54 ? 245  ILE A C     1 
ATOM   1967 O  O     . ILE A 1 251 ? 33.704 36.552 27.336  1.00 40.95 ? 245  ILE A O     1 
ATOM   1968 C  CB    . ILE A 1 251 ? 31.608 38.816 27.120  1.00 42.11 ? 245  ILE A CB    1 
ATOM   1969 C  CG1   . ILE A 1 251 ? 30.144 39.256 27.021  1.00 43.83 ? 245  ILE A CG1   1 
ATOM   1970 C  CG2   . ILE A 1 251 ? 32.533 39.903 26.586  1.00 40.90 ? 245  ILE A CG2   1 
ATOM   1971 C  CD1   . ILE A 1 251 ? 29.793 40.397 27.925  1.00 46.09 ? 245  ILE A CD1   1 
ATOM   1972 N  N     . GLY A 1 252 ? 33.915 37.346 25.239  1.00 38.64 ? 246  GLY A N     1 
ATOM   1973 C  CA    . GLY A 1 252 ? 35.296 36.936 25.167  1.00 37.45 ? 246  GLY A CA    1 
ATOM   1974 C  C     . GLY A 1 252 ? 36.062 37.602 24.058  1.00 37.09 ? 246  GLY A C     1 
ATOM   1975 O  O     . GLY A 1 252 ? 35.532 38.402 23.290  1.00 39.12 ? 246  GLY A O     1 
ATOM   1976 N  N     . ARG A 1 253 ? 37.332 37.246 23.988  1.00 37.15 ? 247  ARG A N     1 
ATOM   1977 C  CA    . ARG A 1 253 ? 38.244 37.790 23.013  1.00 37.48 ? 247  ARG A CA    1 
ATOM   1978 C  C     . ARG A 1 253 ? 39.213 36.688 22.639  1.00 38.53 ? 247  ARG A C     1 
ATOM   1979 O  O     . ARG A 1 253 ? 39.531 35.820 23.454  1.00 37.54 ? 247  ARG A O     1 
ATOM   1980 C  CB    . ARG A 1 253 ? 39.020 38.952 23.631  1.00 38.79 ? 247  ARG A CB    1 
ATOM   1981 C  CG    . ARG A 1 253 ? 39.927 39.669 22.664  1.00 44.09 ? 247  ARG A CG    1 
ATOM   1982 C  CD    . ARG A 1 253 ? 39.160 40.742 21.896  1.00 47.78 ? 247  ARG A CD    1 
ATOM   1983 N  NE    . ARG A 1 253 ? 40.028 41.451 20.967  1.00 51.69 ? 247  ARG A NE    1 
ATOM   1984 C  CZ    . ARG A 1 253 ? 40.566 40.898 19.886  1.00 53.43 ? 247  ARG A CZ    1 
ATOM   1985 N  NH1   . ARG A 1 253 ? 40.318 39.628 19.604  1.00 54.99 ? 247  ARG A NH1   1 
ATOM   1986 N  NH2   . ARG A 1 253 ? 41.353 41.613 19.093  1.00 54.51 ? 247  ARG A NH2   1 
ATOM   1987 N  N     . ILE A 1 254 ? 39.678 36.722 21.399  1.00 38.33 ? 248  ILE A N     1 
ATOM   1988 C  CA    . ILE A 1 254 ? 40.633 35.741 20.927  1.00 38.45 ? 248  ILE A CA    1 
ATOM   1989 C  C     . ILE A 1 254 ? 41.489 36.451 19.892  1.00 40.18 ? 248  ILE A C     1 
ATOM   1990 O  O     . ILE A 1 254 ? 40.967 37.171 19.035  1.00 40.64 ? 248  ILE A O     1 
ATOM   1991 C  CB    . ILE A 1 254 ? 39.917 34.509 20.321  1.00 38.49 ? 248  ILE A CB    1 
ATOM   1992 C  CG1   . ILE A 1 254 ? 40.947 33.460 19.922  1.00 34.67 ? 248  ILE A CG1   1 
ATOM   1993 C  CG2   . ILE A 1 254 ? 39.042 34.927 19.136  1.00 37.98 ? 248  ILE A CG2   1 
ATOM   1994 C  CD1   . ILE A 1 254 ? 40.333 32.110 19.649  1.00 36.82 ? 248  ILE A CD1   1 
ATOM   1995 N  N     . VAL A 1 255 ? 42.800 36.260 19.988  1.00 41.77 ? 249  VAL A N     1 
ATOM   1996 C  CA    . VAL A 1 255 ? 43.746 36.906 19.092  1.00 43.40 ? 249  VAL A CA    1 
ATOM   1997 C  C     . VAL A 1 255 ? 44.721 35.917 18.466  1.00 45.56 ? 249  VAL A C     1 
ATOM   1998 O  O     . VAL A 1 255 ? 45.032 34.877 19.051  1.00 46.68 ? 249  VAL A O     1 
ATOM   1999 C  CB    . VAL A 1 255 ? 44.565 37.982 19.846  1.00 44.61 ? 249  VAL A CB    1 
ATOM   2000 C  CG1   . VAL A 1 255 ? 43.640 39.062 20.392  1.00 41.84 ? 249  VAL A CG1   1 
ATOM   2001 C  CG2   . VAL A 1 255 ? 45.348 37.334 20.981  1.00 43.61 ? 249  VAL A CG2   1 
ATOM   2002 N  N     . THR A 1 256 ? 45.203 36.259 17.275  1.00 46.55 ? 250  THR A N     1 
ATOM   2003 C  CA    . THR A 1 256 ? 46.156 35.424 16.549  1.00 47.72 ? 250  THR A CA    1 
ATOM   2004 C  C     . THR A 1 256 ? 47.558 35.884 16.895  1.00 47.38 ? 250  THR A C     1 
ATOM   2005 O  O     . THR A 1 256 ? 47.893 37.043 16.694  1.00 46.89 ? 250  THR A O     1 
ATOM   2006 C  CB    . THR A 1 256 ? 45.980 35.556 15.023  1.00 48.42 ? 250  THR A CB    1 
ATOM   2007 O  OG1   . THR A 1 256 ? 44.666 35.127 14.652  1.00 47.84 ? 250  THR A OG1   1 
ATOM   2008 C  CG2   . THR A 1 256 ? 47.014 34.702 14.288  1.00 47.46 ? 250  THR A CG2   1 
ATOM   2009 N  N     . MET A 1 257 ? 48.382 34.979 17.409  1.00 48.41 ? 251  MET A N     1 
ATOM   2010 C  CA    . MET A 1 257 ? 49.748 35.338 17.772  1.00 49.18 ? 251  MET A CA    1 
ATOM   2011 C  C     . MET A 1 257 ? 50.581 35.640 16.523  1.00 49.58 ? 251  MET A C     1 
ATOM   2012 O  O     . MET A 1 257 ? 50.144 35.358 15.407  1.00 46.84 ? 251  MET A O     1 
ATOM   2013 C  CB    . MET A 1 257 ? 50.365 34.204 18.592  1.00 50.15 ? 251  MET A CB    1 
ATOM   2014 C  CG    . MET A 1 257 ? 49.522 33.870 19.822  1.00 51.32 ? 251  MET A CG    1 
ATOM   2015 S  SD    . MET A 1 257 ? 50.281 32.716 20.959  1.00 49.49 ? 251  MET A SD    1 
ATOM   2016 C  CE    . MET A 1 257 ? 49.582 31.198 20.378  1.00 51.93 ? 251  MET A CE    1 
ATOM   2017 N  N     . LYS A 1 258 ? 51.759 36.239 16.697  1.00 50.73 ? 252  LYS A N     1 
ATOM   2018 C  CA    . LYS A 1 258 ? 52.598 36.551 15.542  1.00 52.89 ? 252  LYS A CA    1 
ATOM   2019 C  C     . LYS A 1 258 ? 53.201 35.286 14.941  1.00 53.23 ? 252  LYS A C     1 
ATOM   2020 O  O     . LYS A 1 258 ? 53.560 35.257 13.765  1.00 54.03 ? 252  LYS A O     1 
ATOM   2021 C  CB    . LYS A 1 258 ? 53.706 37.551 15.911  0.50 53.34 ? 252  LYS A CB    1 
ATOM   2022 C  CG    . LYS A 1 258 ? 54.386 37.300 17.244  0.50 54.89 ? 252  LYS A CG    1 
ATOM   2023 C  CD    . LYS A 1 258 ? 55.124 35.977 17.282  0.50 55.30 ? 252  LYS A CD    1 
ATOM   2024 C  CE    . LYS A 1 258 ? 55.016 35.358 18.663  0.50 55.01 ? 252  LYS A CE    1 
ATOM   2025 N  NZ    . LYS A 1 258 ? 53.591 35.078 18.991  0.50 53.44 ? 252  LYS A NZ    1 
ATOM   2026 N  N     . ARG A 1 259 ? 53.305 34.242 15.754  1.00 53.32 ? 253  ARG A N     1 
ATOM   2027 C  CA    . ARG A 1 259 ? 53.837 32.972 15.293  1.00 53.54 ? 253  ARG A CA    1 
ATOM   2028 C  C     . ARG A 1 259 ? 53.346 31.881 16.228  1.00 53.07 ? 253  ARG A C     1 
ATOM   2029 O  O     . ARG A 1 259 ? 52.947 32.172 17.352  1.00 52.56 ? 253  ARG A O     1 
ATOM   2030 C  CB    . ARG A 1 259 ? 55.371 33.014 15.248  1.00 54.80 ? 253  ARG A CB    1 
ATOM   2031 C  CG    . ARG A 1 259 ? 56.109 32.831 16.576  1.00 55.78 ? 253  ARG A CG    1 
ATOM   2032 C  CD    . ARG A 1 259 ? 57.618 32.882 16.312  0.50 55.47 ? 253  ARG A CD    1 
ATOM   2033 N  NE    . ARG A 1 259 ? 58.440 32.388 17.418  0.50 55.80 ? 253  ARG A NE    1 
ATOM   2034 C  CZ    . ARG A 1 259 ? 58.656 33.044 18.554  0.50 55.29 ? 253  ARG A CZ    1 
ATOM   2035 N  NH1   . ARG A 1 259 ? 58.111 34.236 18.753  0.50 55.83 ? 253  ARG A NH1   1 
ATOM   2036 N  NH2   . ARG A 1 259 ? 59.426 32.505 19.492  0.50 55.35 ? 253  ARG A NH2   1 
ATOM   2037 N  N     . ASN A 1 260 ? 53.348 30.636 15.757  1.00 53.82 ? 254  ASN A N     1 
ATOM   2038 C  CA    . ASN A 1 260 ? 52.895 29.512 16.576  1.00 55.69 ? 254  ASN A CA    1 
ATOM   2039 C  C     . ASN A 1 260 ? 53.869 29.263 17.713  1.00 55.25 ? 254  ASN A C     1 
ATOM   2040 O  O     . ASN A 1 260 ? 55.059 29.533 17.587  1.00 54.70 ? 254  ASN A O     1 
ATOM   2041 C  CB    . ASN A 1 260 ? 52.754 28.241 15.736  1.00 55.64 ? 254  ASN A CB    1 
ATOM   2042 C  CG    . ASN A 1 260 ? 51.719 28.378 14.651  1.00 58.04 ? 254  ASN A CG    1 
ATOM   2043 O  OD1   . ASN A 1 260 ? 50.686 29.011 14.852  1.00 59.52 ? 254  ASN A OD1   1 
ATOM   2044 N  ND2   . ASN A 1 260 ? 51.980 27.777 13.497  1.00 58.67 ? 254  ASN A ND2   1 
ATOM   2045 N  N     . SER A 1 261 ? 53.368 28.734 18.820  1.00 56.10 ? 255  SER A N     1 
ATOM   2046 C  CA    . SER A 1 261 ? 54.220 28.488 19.967  1.00 56.85 ? 255  SER A CA    1 
ATOM   2047 C  C     . SER A 1 261 ? 53.571 27.576 21.003  1.00 57.66 ? 255  SER A C     1 
ATOM   2048 O  O     . SER A 1 261 ? 52.363 27.345 20.979  1.00 57.99 ? 255  SER A O     1 
ATOM   2049 C  CB    . SER A 1 261 ? 54.583 29.835 20.607  1.00 57.52 ? 255  SER A CB    1 
ATOM   2050 O  OG    . SER A 1 261 ? 55.278 29.682 21.829  1.00 56.91 ? 255  SER A OG    1 
ATOM   2051 N  N     . ARG A 1 262 ? 54.399 27.043 21.894  1.00 59.08 ? 256  ARG A N     1 
ATOM   2052 C  CA    . ARG A 1 262 ? 53.946 26.189 22.986  1.00 60.39 ? 256  ARG A CA    1 
ATOM   2053 C  C     . ARG A 1 262 ? 54.631 26.762 24.217  1.00 60.35 ? 256  ARG A C     1 
ATOM   2054 O  O     . ARG A 1 262 ? 54.603 26.178 25.299  1.00 58.47 ? 256  ARG A O     1 
ATOM   2055 C  CB    . ARG A 1 262 ? 54.399 24.741 22.794  1.00 62.58 ? 256  ARG A CB    1 
ATOM   2056 C  CG    . ARG A 1 262 ? 54.015 24.126 21.468  1.00 64.97 ? 256  ARG A CG    1 
ATOM   2057 C  CD    . ARG A 1 262 ? 53.929 22.603 21.563  1.00 67.52 ? 256  ARG A CD    1 
ATOM   2058 N  NE    . ARG A 1 262 ? 52.827 22.171 22.424  1.00 68.13 ? 256  ARG A NE    1 
ATOM   2059 C  CZ    . ARG A 1 262 ? 52.945 21.886 23.714  1.00 68.43 ? 256  ARG A CZ    1 
ATOM   2060 N  NH1   . ARG A 1 262 ? 54.126 21.977 24.310  1.00 69.22 ? 256  ARG A NH1   1 
ATOM   2061 N  NH2   . ARG A 1 262 ? 51.879 21.523 24.415  1.00 68.58 ? 256  ARG A NH2   1 
ATOM   2062 N  N     . ASN A 1 263 ? 55.252 27.919 24.020  1.00 60.80 ? 257  ASN A N     1 
ATOM   2063 C  CA    . ASN A 1 263 ? 55.983 28.617 25.063  1.00 62.41 ? 257  ASN A CA    1 
ATOM   2064 C  C     . ASN A 1 263 ? 55.053 29.482 25.905  1.00 61.93 ? 257  ASN A C     1 
ATOM   2065 O  O     . ASN A 1 263 ? 54.572 30.521 25.446  1.00 62.70 ? 257  ASN A O     1 
ATOM   2066 C  CB    . ASN A 1 263 ? 57.060 29.490 24.423  1.00 65.39 ? 257  ASN A CB    1 
ATOM   2067 C  CG    . ASN A 1 263 ? 58.112 29.933 25.410  1.00 67.12 ? 257  ASN A CG    1 
ATOM   2068 O  OD1   . ASN A 1 263 ? 57.807 30.519 26.454  1.00 68.74 ? 257  ASN A OD1   1 
ATOM   2069 N  ND2   . ASN A 1 263 ? 59.367 29.654 25.087  1.00 68.44 ? 257  ASN A ND2   1 
ATOM   2070 N  N     . LEU A 1 264 ? 54.815 29.054 27.139  1.00 61.37 ? 258  LEU A N     1 
ATOM   2071 C  CA    . LEU A 1 264 ? 53.938 29.773 28.052  1.00 60.37 ? 258  LEU A CA    1 
ATOM   2072 C  C     . LEU A 1 264 ? 54.259 31.263 28.128  1.00 59.72 ? 258  LEU A C     1 
ATOM   2073 O  O     . LEU A 1 264 ? 53.363 32.105 28.044  1.00 60.42 ? 258  LEU A O     1 
ATOM   2074 C  CB    . LEU A 1 264 ? 54.034 29.170 29.450  1.00 61.20 ? 258  LEU A CB    1 
ATOM   2075 C  CG    . LEU A 1 264 ? 52.900 29.586 30.386  1.00 61.88 ? 258  LEU A CG    1 
ATOM   2076 C  CD1   . LEU A 1 264 ? 51.618 28.916 29.919  1.00 61.81 ? 258  LEU A CD1   1 
ATOM   2077 C  CD2   . LEU A 1 264 ? 53.211 29.184 31.821  1.00 62.76 ? 258  LEU A CD2   1 
ATOM   2078 N  N     . GLU A 1 265 ? 55.537 31.589 28.289  1.00 58.46 ? 259  GLU A N     1 
ATOM   2079 C  CA    . GLU A 1 265 ? 55.955 32.982 28.383  1.00 58.21 ? 259  GLU A CA    1 
ATOM   2080 C  C     . GLU A 1 265 ? 55.648 33.751 27.119  1.00 57.47 ? 259  GLU A C     1 
ATOM   2081 O  O     . GLU A 1 265 ? 55.342 34.940 27.156  1.00 57.47 ? 259  GLU A O     1 
ATOM   2082 C  CB    . GLU A 1 265 ? 57.453 33.080 28.657  1.00 57.43 ? 259  GLU A CB    1 
ATOM   2083 C  CG    . GLU A 1 265 ? 57.838 32.646 30.040  1.00 59.00 ? 259  GLU A CG    1 
ATOM   2084 C  CD    . GLU A 1 265 ? 56.876 33.159 31.092  1.00 59.21 ? 259  GLU A CD    1 
ATOM   2085 O  OE1   . GLU A 1 265 ? 56.596 34.380 31.120  1.00 59.86 ? 259  GLU A OE1   1 
ATOM   2086 O  OE2   . GLU A 1 265 ? 56.402 32.333 31.897  1.00 59.18 ? 259  GLU A OE2   1 
ATOM   2087 N  N     . GLU A 1 266 ? 55.740 33.059 25.997  1.00 57.75 ? 260  GLU A N     1 
ATOM   2088 C  CA    . GLU A 1 266 ? 55.496 33.668 24.705  1.00 57.00 ? 260  GLU A CA    1 
ATOM   2089 C  C     . GLU A 1 266 ? 53.999 33.874 24.481  1.00 55.80 ? 260  GLU A C     1 
ATOM   2090 O  O     . GLU A 1 266 ? 53.580 34.852 23.864  1.00 55.55 ? 260  GLU A O     1 
ATOM   2091 C  CB    . GLU A 1 266 ? 56.071 32.761 23.621  1.00 59.13 ? 260  GLU A CB    1 
ATOM   2092 C  CG    . GLU A 1 266 ? 56.555 33.467 22.381  1.00 60.51 ? 260  GLU A CG    1 
ATOM   2093 C  CD    . GLU A 1 266 ? 56.851 32.489 21.267  1.00 62.87 ? 260  GLU A CD    1 
ATOM   2094 O  OE1   . GLU A 1 266 ? 57.431 31.422 21.553  1.00 63.81 ? 260  GLU A OE1   1 
ATOM   2095 O  OE2   . GLU A 1 266 ? 56.509 32.783 20.107  1.00 64.47 ? 260  GLU A OE2   1 
ATOM   2096 N  N     . ILE A 1 267 ? 53.196 32.957 25.008  1.00 54.07 ? 261  ILE A N     1 
ATOM   2097 C  CA    . ILE A 1 267 ? 51.746 33.008 24.836  1.00 52.33 ? 261  ILE A CA    1 
ATOM   2098 C  C     . ILE A 1 267 ? 50.987 33.915 25.804  1.00 51.77 ? 261  ILE A C     1 
ATOM   2099 O  O     . ILE A 1 267 ? 50.039 34.590 25.411  1.00 51.24 ? 261  ILE A O     1 
ATOM   2100 C  CB    . ILE A 1 267 ? 51.151 31.596 24.960  1.00 50.96 ? 261  ILE A CB    1 
ATOM   2101 C  CG1   . ILE A 1 267 ? 51.778 30.674 23.914  1.00 49.83 ? 261  ILE A CG1   1 
ATOM   2102 C  CG2   . ILE A 1 267 ? 49.638 31.649 24.808  1.00 49.97 ? 261  ILE A CG2   1 
ATOM   2103 C  CD1   . ILE A 1 267 ? 51.464 29.200 24.128  1.00 47.92 ? 261  ILE A CD1   1 
ATOM   2104 N  N     . LYS A 1 268 ? 51.408 33.912 27.063  1.00 52.22 ? 262  LYS A N     1 
ATOM   2105 C  CA    . LYS A 1 268 ? 50.765 34.688 28.129  1.00 52.40 ? 262  LYS A CA    1 
ATOM   2106 C  C     . LYS A 1 268 ? 50.332 36.136 27.868  1.00 49.29 ? 262  LYS A C     1 
ATOM   2107 O  O     . LYS A 1 268 ? 49.215 36.517 28.199  1.00 49.19 ? 262  LYS A O     1 
ATOM   2108 C  CB    . LYS A 1 268 ? 51.646 34.643 29.382  1.00 55.46 ? 262  LYS A CB    1 
ATOM   2109 C  CG    . LYS A 1 268 ? 51.766 33.248 29.981  1.00 58.10 ? 262  LYS A CG    1 
ATOM   2110 C  CD    . LYS A 1 268 ? 52.727 33.216 31.162  1.00 60.77 ? 262  LYS A CD    1 
ATOM   2111 C  CE    . LYS A 1 268 ? 52.246 34.113 32.289  1.00 62.22 ? 262  LYS A CE    1 
ATOM   2112 N  NZ    . LYS A 1 268 ? 53.181 34.102 33.451  1.00 63.19 ? 262  LYS A NZ    1 
ATOM   2113 N  N     . PRO A 1 269 ? 51.206 36.963 27.288  1.00 46.88 ? 263  PRO A N     1 
ATOM   2114 C  CA    . PRO A 1 269 ? 50.807 38.352 27.033  1.00 44.71 ? 263  PRO A CA    1 
ATOM   2115 C  C     . PRO A 1 269 ? 49.598 38.500 26.113  1.00 43.03 ? 263  PRO A C     1 
ATOM   2116 O  O     . PRO A 1 269 ? 48.804 39.433 26.253  1.00 40.19 ? 263  PRO A O     1 
ATOM   2117 C  CB    . PRO A 1 269 ? 52.079 38.981 26.464  1.00 45.21 ? 263  PRO A CB    1 
ATOM   2118 C  CG    . PRO A 1 269 ? 52.844 37.807 25.913  1.00 47.98 ? 263  PRO A CG    1 
ATOM   2119 C  CD    . PRO A 1 269 ? 52.614 36.737 26.926  1.00 47.22 ? 263  PRO A CD    1 
ATOM   2120 N  N     . TYR A 1 270 ? 49.465 37.584 25.164  1.00 41.57 ? 264  TYR A N     1 
ATOM   2121 C  CA    . TYR A 1 270 ? 48.330 37.611 24.254  1.00 40.57 ? 264  TYR A CA    1 
ATOM   2122 C  C     . TYR A 1 270 ? 47.108 37.261 25.103  1.00 39.01 ? 264  TYR A C     1 
ATOM   2123 O  O     . TYR A 1 270 ? 46.065 37.922 25.043  1.00 36.30 ? 264  TYR A O     1 
ATOM   2124 C  CB    . TYR A 1 270 ? 48.517 36.568 23.151  1.00 43.47 ? 264  TYR A CB    1 
ATOM   2125 C  CG    . TYR A 1 270 ? 49.602 36.883 22.134  1.00 45.68 ? 264  TYR A CG    1 
ATOM   2126 C  CD1   . TYR A 1 270 ? 49.347 37.726 21.055  1.00 47.34 ? 264  TYR A CD1   1 
ATOM   2127 C  CD2   . TYR A 1 270 ? 50.862 36.292 22.224  1.00 46.23 ? 264  TYR A CD2   1 
ATOM   2128 C  CE1   . TYR A 1 270 ? 50.312 37.966 20.082  1.00 48.24 ? 264  TYR A CE1   1 
ATOM   2129 C  CE2   . TYR A 1 270 ? 51.837 36.525 21.261  1.00 48.05 ? 264  TYR A CE2   1 
ATOM   2130 C  CZ    . TYR A 1 270 ? 51.551 37.359 20.188  1.00 49.55 ? 264  TYR A CZ    1 
ATOM   2131 O  OH    . TYR A 1 270 ? 52.479 37.549 19.192  1.00 49.76 ? 264  TYR A OH    1 
ATOM   2132 N  N     . LEU A 1 271 ? 47.258 36.217 25.909  1.00 38.31 ? 265  LEU A N     1 
ATOM   2133 C  CA    . LEU A 1 271 ? 46.185 35.775 26.778  1.00 37.17 ? 265  LEU A CA    1 
ATOM   2134 C  C     . LEU A 1 271 ? 45.732 36.905 27.694  1.00 38.20 ? 265  LEU A C     1 
ATOM   2135 O  O     . LEU A 1 271 ? 44.539 37.242 27.736  1.00 36.89 ? 265  LEU A O     1 
ATOM   2136 C  CB    . LEU A 1 271 ? 46.639 34.581 27.620  1.00 37.62 ? 265  LEU A CB    1 
ATOM   2137 C  CG    . LEU A 1 271 ? 45.579 34.017 28.579  1.00 39.52 ? 265  LEU A CG    1 
ATOM   2138 C  CD1   . LEU A 1 271 ? 44.362 33.589 27.788  1.00 37.89 ? 265  LEU A CD1   1 
ATOM   2139 C  CD2   . LEU A 1 271 ? 46.143 32.829 29.358  1.00 42.05 ? 265  LEU A CD2   1 
ATOM   2140 N  N     . PHE A 1 272 ? 46.679 37.500 28.421  1.00 38.03 ? 266  PHE A N     1 
ATOM   2141 C  CA    . PHE A 1 272 ? 46.340 38.580 29.343  1.00 38.96 ? 266  PHE A CA    1 
ATOM   2142 C  C     . PHE A 1 272 ? 45.672 39.723 28.607  1.00 37.53 ? 266  PHE A C     1 
ATOM   2143 O  O     . PHE A 1 272 ? 44.750 40.350 29.131  1.00 37.04 ? 266  PHE A O     1 
ATOM   2144 C  CB    . PHE A 1 272 ? 47.583 39.047 30.117  1.00 41.04 ? 266  PHE A CB    1 
ATOM   2145 C  CG    . PHE A 1 272 ? 48.183 37.974 30.976  1.00 41.19 ? 266  PHE A CG    1 
ATOM   2146 C  CD1   . PHE A 1 272 ? 47.392 36.937 31.458  1.00 44.05 ? 266  PHE A CD1   1 
ATOM   2147 C  CD2   . PHE A 1 272 ? 49.536 37.974 31.281  1.00 44.35 ? 266  PHE A CD2   1 
ATOM   2148 C  CE1   . PHE A 1 272 ? 47.935 35.909 32.228  1.00 45.10 ? 266  PHE A CE1   1 
ATOM   2149 C  CE2   . PHE A 1 272 ? 50.093 36.952 32.052  1.00 45.13 ? 266  PHE A CE2   1 
ATOM   2150 C  CZ    . PHE A 1 272 ? 49.289 35.917 32.524  1.00 46.35 ? 266  PHE A CZ    1 
ATOM   2151 N  N     A ARG A 1 273 ? 46.137 40.003 27.394  0.50 37.61 ? 267  ARG A N     1 
ATOM   2152 N  N     B ARG A 1 273 ? 46.142 39.996 27.391  0.50 37.45 ? 267  ARG A N     1 
ATOM   2153 C  CA    A ARG A 1 273 ? 45.539 41.056 26.584  0.50 36.35 ? 267  ARG A CA    1 
ATOM   2154 C  CA    B ARG A 1 273 ? 45.557 41.041 26.556  0.50 36.09 ? 267  ARG A CA    1 
ATOM   2155 C  C     A ARG A 1 273 ? 44.080 40.668 26.342  0.50 35.19 ? 267  ARG A C     1 
ATOM   2156 C  C     B ARG A 1 273 ? 44.092 40.669 26.328  0.50 35.03 ? 267  ARG A C     1 
ATOM   2157 O  O     A ARG A 1 273 ? 43.181 41.507 26.431  0.50 34.00 ? 267  ARG A O     1 
ATOM   2158 O  O     B ARG A 1 273 ? 43.202 41.517 26.416  0.50 33.90 ? 267  ARG A O     1 
ATOM   2159 C  CB    A ARG A 1 273 ? 46.272 41.174 25.245  0.50 38.75 ? 267  ARG A CB    1 
ATOM   2160 C  CB    B ARG A 1 273 ? 46.281 41.122 25.202  0.50 38.00 ? 267  ARG A CB    1 
ATOM   2161 C  CG    A ARG A 1 273 ? 45.616 42.128 24.260  0.50 40.58 ? 267  ARG A CG    1 
ATOM   2162 C  CG    B ARG A 1 273 ? 47.591 41.909 25.211  0.50 39.60 ? 267  ARG A CG    1 
ATOM   2163 C  CD    A ARG A 1 273 ? 46.290 42.056 22.900  0.50 43.74 ? 267  ARG A CD    1 
ATOM   2164 C  CD    B ARG A 1 273 ? 48.251 41.946 23.830  0.50 41.38 ? 267  ARG A CD    1 
ATOM   2165 N  NE    A ARG A 1 273 ? 45.447 42.618 21.849  0.50 45.42 ? 267  ARG A NE    1 
ATOM   2166 N  NE    B ARG A 1 273 ? 49.408 41.056 23.750  0.50 43.57 ? 267  ARG A NE    1 
ATOM   2167 C  CZ    A ARG A 1 273 ? 45.675 42.460 20.549  0.50 45.87 ? 267  ARG A CZ    1 
ATOM   2168 C  CZ    B ARG A 1 273 ? 50.214 40.959 22.700  0.50 44.95 ? 267  ARG A CZ    1 
ATOM   2169 N  NH1   A ARG A 1 273 ? 46.722 41.760 20.138  0.50 47.86 ? 267  ARG A NH1   1 
ATOM   2170 N  NH1   B ARG A 1 273 ? 49.994 41.701 21.622  0.50 46.72 ? 267  ARG A NH1   1 
ATOM   2171 N  NH2   A ARG A 1 273 ? 44.850 42.994 19.663  0.50 46.51 ? 267  ARG A NH2   1 
ATOM   2172 N  NH2   B ARG A 1 273 ? 51.247 40.126 22.726  0.50 45.61 ? 267  ARG A NH2   1 
ATOM   2173 N  N     . ALA A 1 274 ? 43.855 39.387 26.046  1.00 33.96 ? 268  ALA A N     1 
ATOM   2174 C  CA    . ALA A 1 274 ? 42.506 38.880 25.791  1.00 33.45 ? 268  ALA A CA    1 
ATOM   2175 C  C     . ALA A 1 274 ? 41.632 39.035 27.024  1.00 33.47 ? 268  ALA A C     1 
ATOM   2176 O  O     . ALA A 1 274 ? 40.434 39.327 26.921  1.00 33.10 ? 268  ALA A O     1 
ATOM   2177 C  CB    . ALA A 1 274 ? 42.557 37.415 25.365  1.00 28.75 ? 268  ALA A CB    1 
ATOM   2178 N  N     . ILE A 1 275 ? 42.233 38.834 28.193  1.00 32.68 ? 269  ILE A N     1 
ATOM   2179 C  CA    . ILE A 1 275 ? 41.497 38.978 29.440  1.00 34.77 ? 269  ILE A CA    1 
ATOM   2180 C  C     . ILE A 1 275 ? 41.133 40.447 29.673  1.00 34.60 ? 269  ILE A C     1 
ATOM   2181 O  O     . ILE A 1 275 ? 39.979 40.769 29.962  1.00 34.90 ? 269  ILE A O     1 
ATOM   2182 C  CB    . ILE A 1 275 ? 42.325 38.423 30.620  1.00 35.40 ? 269  ILE A CB    1 
ATOM   2183 C  CG1   . ILE A 1 275 ? 42.346 36.898 30.535  1.00 35.83 ? 269  ILE A CG1   1 
ATOM   2184 C  CG2   . ILE A 1 275 ? 41.731 38.877 31.952  1.00 34.85 ? 269  ILE A CG2   1 
ATOM   2185 C  CD1   . ILE A 1 275 ? 43.188 36.224 31.594  1.00 39.03 ? 269  ILE A CD1   1 
ATOM   2186 N  N     . GLU A 1 276 ? 42.111 41.338 29.526  1.00 36.21 ? 270  GLU A N     1 
ATOM   2187 C  CA    . GLU A 1 276 ? 41.870 42.767 29.711  1.00 38.79 ? 270  GLU A CA    1 
ATOM   2188 C  C     . GLU A 1 276 ? 40.740 43.278 28.821  1.00 38.54 ? 270  GLU A C     1 
ATOM   2189 O  O     . GLU A 1 276 ? 39.833 43.970 29.281  1.00 38.17 ? 270  GLU A O     1 
ATOM   2190 C  CB    . GLU A 1 276 ? 43.139 43.575 29.414  1.00 41.64 ? 270  GLU A CB    1 
ATOM   2191 C  CG    . GLU A 1 276 ? 44.221 43.501 30.488  1.00 47.15 ? 270  GLU A CG    1 
ATOM   2192 C  CD    . GLU A 1 276 ? 43.728 43.939 31.863  1.00 49.60 ? 270  GLU A CD    1 
ATOM   2193 O  OE1   . GLU A 1 276 ? 43.044 44.979 31.955  1.00 49.90 ? 270  GLU A OE1   1 
ATOM   2194 O  OE2   . GLU A 1 276 ? 44.034 43.246 32.859  1.00 53.32 ? 270  GLU A OE2   1 
ATOM   2195 N  N     . GLU A 1 277 ? 40.789 42.938 27.541  1.00 39.09 ? 271  GLU A N     1 
ATOM   2196 C  CA    . GLU A 1 277 ? 39.761 43.399 26.632  1.00 40.03 ? 271  GLU A CA    1 
ATOM   2197 C  C     . GLU A 1 277 ? 38.389 42.837 27.006  1.00 39.00 ? 271  GLU A C     1 
ATOM   2198 O  O     . GLU A 1 277 ? 37.397 43.566 27.039  1.00 38.04 ? 271  GLU A O     1 
ATOM   2199 C  CB    . GLU A 1 277 ? 40.154 43.041 25.194  1.00 42.33 ? 271  GLU A CB    1 
ATOM   2200 C  CG    . GLU A 1 277 ? 41.289 43.926 24.663  1.00 49.07 ? 271  GLU A CG    1 
ATOM   2201 C  CD    . GLU A 1 277 ? 41.693 43.611 23.225  1.00 52.09 ? 271  GLU A CD    1 
ATOM   2202 O  OE1   . GLU A 1 277 ? 40.790 43.425 22.376  1.00 52.54 ? 271  GLU A OE1   1 
ATOM   2203 O  OE2   . GLU A 1 277 ? 42.916 43.565 22.944  1.00 53.68 ? 271  GLU A OE2   1 
ATOM   2204 N  N     . SER A 1 278 ? 38.336 41.547 27.307  1.00 39.29 ? 272  SER A N     1 
ATOM   2205 C  CA    . SER A 1 278 ? 37.073 40.920 27.678  1.00 40.99 ? 272  SER A CA    1 
ATOM   2206 C  C     . SER A 1 278 ? 36.455 41.597 28.897  1.00 41.05 ? 272  SER A C     1 
ATOM   2207 O  O     . SER A 1 278 ? 35.238 41.787 28.961  1.00 40.75 ? 272  SER A O     1 
ATOM   2208 C  CB    . SER A 1 278 ? 37.280 39.435 27.978  1.00 40.69 ? 272  SER A CB    1 
ATOM   2209 O  OG    . SER A 1 278 ? 37.697 38.736 26.830  1.00 39.59 ? 272  SER A OG    1 
ATOM   2210 N  N     . TYR A 1 279 ? 37.286 41.952 29.875  1.00 42.14 ? 273  TYR A N     1 
ATOM   2211 C  CA    . TYR A 1 279 ? 36.761 42.606 31.065  1.00 43.62 ? 273  TYR A CA    1 
ATOM   2212 C  C     . TYR A 1 279 ? 36.188 43.963 30.747  1.00 45.25 ? 273  TYR A C     1 
ATOM   2213 O  O     . TYR A 1 279 ? 35.148 44.342 31.287  1.00 45.26 ? 273  TYR A O     1 
ATOM   2214 C  CB    . TYR A 1 279 ? 37.831 42.706 32.145  1.00 44.14 ? 273  TYR A CB    1 
ATOM   2215 C  CG    . TYR A 1 279 ? 37.671 41.601 33.140  1.00 43.87 ? 273  TYR A CG    1 
ATOM   2216 C  CD1   . TYR A 1 279 ? 36.882 41.771 34.284  1.00 43.91 ? 273  TYR A CD1   1 
ATOM   2217 C  CD2   . TYR A 1 279 ? 38.178 40.335 32.870  1.00 45.38 ? 273  TYR A CD2   1 
ATOM   2218 C  CE1   . TYR A 1 279 ? 36.595 40.695 35.124  1.00 43.44 ? 273  TYR A CE1   1 
ATOM   2219 C  CE2   . TYR A 1 279 ? 37.896 39.260 33.696  1.00 46.72 ? 273  TYR A CE2   1 
ATOM   2220 C  CZ    . TYR A 1 279 ? 37.100 39.442 34.815  1.00 43.52 ? 273  TYR A CZ    1 
ATOM   2221 O  OH    . TYR A 1 279 ? 36.777 38.347 35.580  1.00 43.88 ? 273  TYR A OH    1 
ATOM   2222 N  N     . TYR A 1 280 ? 36.850 44.699 29.859  1.00 47.17 ? 274  TYR A N     1 
ATOM   2223 C  CA    . TYR A 1 280 ? 36.331 46.003 29.480  1.00 49.88 ? 274  TYR A CA    1 
ATOM   2224 C  C     . TYR A 1 280 ? 34.955 45.843 28.839  1.00 50.51 ? 274  TYR A C     1 
ATOM   2225 O  O     . TYR A 1 280 ? 34.076 46.686 29.021  1.00 51.92 ? 274  TYR A O     1 
ATOM   2226 C  CB    . TYR A 1 280 ? 37.255 46.686 28.477  1.00 52.88 ? 274  TYR A CB    1 
ATOM   2227 C  CG    . TYR A 1 280 ? 36.655 47.934 27.861  1.00 56.46 ? 274  TYR A CG    1 
ATOM   2228 C  CD1   . TYR A 1 280 ? 36.622 49.142 28.564  1.00 58.83 ? 274  TYR A CD1   1 
ATOM   2229 C  CD2   . TYR A 1 280 ? 36.124 47.910 26.572  1.00 57.86 ? 274  TYR A CD2   1 
ATOM   2230 C  CE1   . TYR A 1 280 ? 36.079 50.296 27.996  1.00 60.17 ? 274  TYR A CE1   1 
ATOM   2231 C  CE2   . TYR A 1 280 ? 35.577 49.056 25.993  1.00 60.81 ? 274  TYR A CE2   1 
ATOM   2232 C  CZ    . TYR A 1 280 ? 35.559 50.246 26.709  1.00 61.48 ? 274  TYR A CZ    1 
ATOM   2233 O  OH    . TYR A 1 280 ? 35.023 51.383 26.135  1.00 64.67 ? 274  TYR A OH    1 
ATOM   2234 N  N     . LYS A 1 281 ? 34.774 44.767 28.080  1.00 49.98 ? 275  LYS A N     1 
ATOM   2235 C  CA    . LYS A 1 281 ? 33.502 44.526 27.410  1.00 50.72 ? 275  LYS A CA    1 
ATOM   2236 C  C     . LYS A 1 281 ? 32.446 43.997 28.378  1.00 51.27 ? 275  LYS A C     1 
ATOM   2237 O  O     . LYS A 1 281 ? 31.244 44.117 28.126  1.00 50.88 ? 275  LYS A O     1 
ATOM   2238 C  CB    . LYS A 1 281 ? 33.690 43.546 26.245  1.00 51.70 ? 275  LYS A CB    1 
ATOM   2239 C  CG    . LYS A 1 281 ? 34.712 44.005 25.216  1.00 53.13 ? 275  LYS A CG    1 
ATOM   2240 C  CD    . LYS A 1 281 ? 34.520 43.327 23.858  1.00 56.51 ? 275  LYS A CD    1 
ATOM   2241 C  CE    . LYS A 1 281 ? 34.876 41.844 23.884  1.00 58.31 ? 275  LYS A CE    1 
ATOM   2242 N  NZ    . LYS A 1 281 ? 34.709 41.185 22.542  1.00 57.89 ? 275  LYS A NZ    1 
ATOM   2243 N  N     . LEU A 1 282 ? 32.896 43.414 29.485  1.00 52.02 ? 276  LEU A N     1 
ATOM   2244 C  CA    . LEU A 1 282 ? 31.978 42.879 30.484  1.00 53.52 ? 276  LEU A CA    1 
ATOM   2245 C  C     . LEU A 1 282 ? 31.218 43.987 31.186  1.00 54.35 ? 276  LEU A C     1 
ATOM   2246 O  O     . LEU A 1 282 ? 30.066 43.804 31.586  1.00 53.74 ? 276  LEU A O     1 
ATOM   2247 C  CB    . LEU A 1 282 ? 32.737 42.089 31.552  1.00 53.14 ? 276  LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1 282 ? 33.148 40.640 31.310  1.00 54.51 ? 276  LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1 282 ? 34.073 40.215 32.425  1.00 54.38 ? 276  LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1 282 ? 31.927 39.733 31.259  1.00 54.34 ? 276  LEU A CD2   1 
ATOM   2251 N  N     A ASP A 1 283 ? 31.881 45.129 31.348  0.50 54.68 ? 277  ASP A N     1 
ATOM   2252 N  N     B ASP A 1 283 ? 31.862 45.143 31.319  0.50 55.30 ? 277  ASP A N     1 
ATOM   2253 C  CA    A ASP A 1 283 ? 31.304 46.285 32.020  0.50 55.20 ? 277  ASP A CA    1 
ATOM   2254 C  CA    B ASP A 1 283 ? 31.290 46.296 32.008  0.50 56.29 ? 277  ASP A CA    1 
ATOM   2255 C  C     A ASP A 1 283 ? 30.764 45.906 33.401  0.50 55.36 ? 277  ASP A C     1 
ATOM   2256 C  C     B ASP A 1 283 ? 30.760 45.909 33.391  0.50 56.06 ? 277  ASP A C     1 
ATOM   2257 O  O     A ASP A 1 283 ? 31.508 45.415 34.251  0.50 55.40 ? 277  ASP A O     1 
ATOM   2258 O  O     B ASP A 1 283 ? 31.510 45.415 34.233  0.50 56.02 ? 277  ASP A O     1 
ATOM   2259 C  CB    A ASP A 1 283 ? 30.186 46.895 31.171  0.50 55.27 ? 277  ASP A CB    1 
ATOM   2260 C  CB    B ASP A 1 283 ? 30.184 46.975 31.169  0.50 57.80 ? 277  ASP A CB    1 
ATOM   2261 C  CG    A ASP A 1 283 ? 29.705 48.228 31.717  0.50 55.69 ? 277  ASP A CG    1 
ATOM   2262 C  CG    B ASP A 1 283 ? 28.950 46.103 30.973  0.50 59.66 ? 277  ASP A CG    1 
ATOM   2263 O  OD1   A ASP A 1 283 ? 30.510 49.183 31.745  0.50 54.76 ? 277  ASP A OD1   1 
ATOM   2264 O  OD1   B ASP A 1 283 ? 28.949 45.266 30.045  0.50 61.00 ? 277  ASP A OD1   1 
ATOM   2265 O  OD2   A ASP A 1 283 ? 28.526 48.317 32.124  0.50 55.67 ? 277  ASP A OD2   1 
ATOM   2266 O  OD2   B ASP A 1 283 ? 27.975 46.257 31.744  0.50 59.53 ? 277  ASP A OD2   1 
ATOM   2267 N  N     . LYS A 1 284 ? 29.473 46.127 33.626  1.00 55.56 ? 278  LYS A N     1 
ATOM   2268 C  CA    . LYS A 1 284 ? 28.876 45.804 34.913  1.00 56.53 ? 278  LYS A CA    1 
ATOM   2269 C  C     . LYS A 1 284 ? 28.728 44.301 35.173  1.00 56.48 ? 278  LYS A C     1 
ATOM   2270 O  O     . LYS A 1 284 ? 28.614 43.887 36.321  1.00 58.00 ? 278  LYS A O     1 
ATOM   2271 C  CB    . LYS A 1 284 ? 27.502 46.470 35.044  1.00 57.86 ? 278  LYS A CB    1 
ATOM   2272 C  CG    . LYS A 1 284 ? 27.500 48.003 35.062  1.00 59.40 ? 278  LYS A CG    1 
ATOM   2273 C  CD    . LYS A 1 284 ? 26.053 48.523 35.155  1.00 62.74 ? 278  LYS A CD    1 
ATOM   2274 C  CE    . LYS A 1 284 ? 25.946 50.051 35.247  1.00 63.71 ? 278  LYS A CE    1 
ATOM   2275 N  NZ    . LYS A 1 284 ? 26.344 50.767 33.993  1.00 65.52 ? 278  LYS A NZ    1 
ATOM   2276 N  N     . ARG A 1 285 ? 28.744 43.486 34.121  1.00 55.92 ? 279  ARG A N     1 
ATOM   2277 C  CA    . ARG A 1 285 ? 28.567 42.037 34.273  1.00 54.03 ? 279  ARG A CA    1 
ATOM   2278 C  C     . ARG A 1 285 ? 29.701 41.309 34.985  1.00 52.08 ? 279  ARG A C     1 
ATOM   2279 O  O     . ARG A 1 285 ? 30.878 41.567 34.733  1.00 52.06 ? 279  ARG A O     1 
ATOM   2280 C  CB    . ARG A 1 285 ? 28.356 41.378 32.910  1.00 56.42 ? 279  ARG A CB    1 
ATOM   2281 C  CG    . ARG A 1 285 ? 27.405 42.105 31.967  1.00 60.69 ? 279  ARG A CG    1 
ATOM   2282 C  CD    . ARG A 1 285 ? 27.148 41.247 30.727  1.00 65.36 ? 279  ARG A CD    1 
ATOM   2283 N  NE    . ARG A 1 285 ? 26.827 42.022 29.528  1.00 69.63 ? 279  ARG A NE    1 
ATOM   2284 C  CZ    . ARG A 1 285 ? 27.696 42.780 28.861  1.00 72.04 ? 279  ARG A CZ    1 
ATOM   2285 N  NH1   . ARG A 1 285 ? 28.954 42.880 29.271  1.00 73.07 ? 279  ARG A NH1   1 
ATOM   2286 N  NH2   . ARG A 1 285 ? 27.310 43.430 27.772  1.00 73.59 ? 279  ARG A NH2   1 
ATOM   2287 N  N     . ILE A 1 286 ? 29.331 40.382 35.866  1.00 48.89 ? 280  ILE A N     1 
ATOM   2288 C  CA    . ILE A 1 286 ? 30.295 39.584 36.617  1.00 46.86 ? 280  ILE A CA    1 
ATOM   2289 C  C     . ILE A 1 286 ? 30.089 38.120 36.226  1.00 44.87 ? 280  ILE A C     1 
ATOM   2290 O  O     . ILE A 1 286 ? 29.010 37.562 36.442  1.00 45.06 ? 280  ILE A O     1 
ATOM   2291 C  CB    . ILE A 1 286 ? 30.070 39.698 38.154  1.00 47.46 ? 280  ILE A CB    1 
ATOM   2292 C  CG1   . ILE A 1 286 ? 29.986 41.164 38.586  1.00 47.72 ? 280  ILE A CG1   1 
ATOM   2293 C  CG2   . ILE A 1 286 ? 31.202 39.004 38.893  1.00 46.81 ? 280  ILE A CG2   1 
ATOM   2294 C  CD1   . ILE A 1 286 ? 31.267 41.941 38.403  1.00 48.30 ? 280  ILE A CD1   1 
ATOM   2295 N  N     . PRO A 1 287 ? 31.112 37.478 35.639  1.00 43.58 ? 281  PRO A N     1 
ATOM   2296 C  CA    . PRO A 1 287 ? 30.958 36.073 35.248  1.00 42.66 ? 281  PRO A CA    1 
ATOM   2297 C  C     . PRO A 1 287 ? 31.318 35.096 36.358  1.00 41.59 ? 281  PRO A C     1 
ATOM   2298 O  O     . PRO A 1 287 ? 32.095 35.417 37.254  1.00 39.48 ? 281  PRO A O     1 
ATOM   2299 C  CB    . PRO A 1 287 ? 31.906 35.946 34.057  1.00 41.67 ? 281  PRO A CB    1 
ATOM   2300 C  CG    . PRO A 1 287 ? 33.038 36.814 34.473  1.00 41.17 ? 281  PRO A CG    1 
ATOM   2301 C  CD    . PRO A 1 287 ? 32.317 38.055 35.013  1.00 42.56 ? 281  PRO A CD    1 
ATOM   2302 N  N     . LYS A 1 288 ? 30.747 33.900 36.285  1.00 41.51 ? 282  LYS A N     1 
ATOM   2303 C  CA    . LYS A 1 288 ? 31.032 32.860 37.263  1.00 42.13 ? 282  LYS A CA    1 
ATOM   2304 C  C     . LYS A 1 288 ? 31.834 31.760 36.585  1.00 40.46 ? 282  LYS A C     1 
ATOM   2305 O  O     . LYS A 1 288 ? 32.411 30.904 37.248  1.00 39.51 ? 282  LYS A O     1 
ATOM   2306 C  CB    . LYS A 1 288 ? 29.728 32.296 37.855  1.00 43.74 ? 282  LYS A CB    1 
ATOM   2307 C  CG    . LYS A 1 288 ? 28.991 33.285 38.773  1.00 44.35 ? 282  LYS A CG    1 
ATOM   2308 C  CD    . LYS A 1 288 ? 27.970 32.599 39.690  1.00 46.41 ? 282  LYS A CD    1 
ATOM   2309 C  CE    . LYS A 1 288 ? 26.561 32.550 39.084  1.00 48.11 ? 282  LYS A CE    1 
ATOM   2310 N  NZ    . LYS A 1 288 ? 26.462 31.731 37.838  1.00 49.80 ? 282  LYS A NZ    1 
ATOM   2311 N  N     . ALA A 1 289 ? 31.878 31.801 35.253  1.00 39.93 ? 283  ALA A N     1 
ATOM   2312 C  CA    . ALA A 1 289 ? 32.617 30.806 34.475  1.00 38.54 ? 283  ALA A CA    1 
ATOM   2313 C  C     . ALA A 1 289 ? 33.630 31.433 33.510  1.00 37.37 ? 283  ALA A C     1 
ATOM   2314 O  O     . ALA A 1 289 ? 33.396 32.505 32.956  1.00 35.15 ? 283  ALA A O     1 
ATOM   2315 C  CB    . ALA A 1 289 ? 31.634 29.912 33.695  1.00 37.46 ? 283  ALA A CB    1 
ATOM   2316 N  N     . ILE A 1 290 ? 34.751 30.744 33.323  1.00 37.41 ? 284  ILE A N     1 
ATOM   2317 C  CA    . ILE A 1 290 ? 35.803 31.190 32.427  1.00 37.80 ? 284  ILE A CA    1 
ATOM   2318 C  C     . ILE A 1 290 ? 36.336 29.991 31.644  1.00 38.95 ? 284  ILE A C     1 
ATOM   2319 O  O     . ILE A 1 290 ? 36.492 28.897 32.188  1.00 39.34 ? 284  ILE A O     1 
ATOM   2320 C  CB    . ILE A 1 290 ? 36.993 31.815 33.192  1.00 37.71 ? 284  ILE A CB    1 
ATOM   2321 C  CG1   . ILE A 1 290 ? 38.079 32.241 32.193  1.00 38.01 ? 284  ILE A CG1   1 
ATOM   2322 C  CG2   . ILE A 1 290 ? 37.568 30.807 34.190  1.00 36.22 ? 284  ILE A CG2   1 
ATOM   2323 C  CD1   . ILE A 1 290 ? 39.347 32.838 32.819  1.00 38.45 ? 284  ILE A CD1   1 
ATOM   2324 N  N     . HIS A 1 291 ? 36.596 30.205 30.358  1.00 37.91 ? 285  HIS A N     1 
ATOM   2325 C  CA    . HIS A 1 291 ? 37.133 29.165 29.505  1.00 37.93 ? 285  HIS A CA    1 
ATOM   2326 C  C     . HIS A 1 291 ? 38.297 29.754 28.734  1.00 38.64 ? 285  HIS A C     1 
ATOM   2327 O  O     . HIS A 1 291 ? 38.238 30.896 28.282  1.00 38.91 ? 285  HIS A O     1 
ATOM   2328 C  CB    . HIS A 1 291 ? 36.088 28.678 28.495  1.00 39.79 ? 285  HIS A CB    1 
ATOM   2329 C  CG    . HIS A 1 291 ? 35.044 27.777 29.076  1.00 40.50 ? 285  HIS A CG    1 
ATOM   2330 N  ND1   . HIS A 1 291 ? 33.998 28.242 29.842  1.00 41.63 ? 285  HIS A ND1   1 
ATOM   2331 C  CD2   . HIS A 1 291 ? 34.886 26.433 28.999  1.00 40.85 ? 285  HIS A CD2   1 
ATOM   2332 C  CE1   . HIS A 1 291 ? 33.241 27.225 30.215  1.00 41.14 ? 285  HIS A CE1   1 
ATOM   2333 N  NE2   . HIS A 1 291 ? 33.757 26.116 29.715  1.00 43.16 ? 285  HIS A NE2   1 
ATOM   2334 N  N     . VAL A 1 292 ? 39.368 28.985 28.608  1.00 38.09 ? 286  VAL A N     1 
ATOM   2335 C  CA    . VAL A 1 292 ? 40.510 29.428 27.830  1.00 37.14 ? 286  VAL A CA    1 
ATOM   2336 C  C     . VAL A 1 292 ? 40.393 28.652 26.525  1.00 38.16 ? 286  VAL A C     1 
ATOM   2337 O  O     . VAL A 1 292 ? 40.271 27.427 26.518  1.00 37.35 ? 286  VAL A O     1 
ATOM   2338 C  CB    . VAL A 1 292 ? 41.841 29.127 28.542  1.00 36.67 ? 286  VAL A CB    1 
ATOM   2339 C  CG1   . VAL A 1 292 ? 43.000 29.288 27.581  1.00 34.81 ? 286  VAL A CG1   1 
ATOM   2340 C  CG2   . VAL A 1 292 ? 42.024 30.104 29.698  1.00 35.24 ? 286  VAL A CG2   1 
ATOM   2341 N  N     . VAL A 1 293 ? 40.392 29.385 25.421  1.00 38.51 ? 287  VAL A N     1 
ATOM   2342 C  CA    . VAL A 1 293 ? 40.249 28.789 24.106  1.00 38.55 ? 287  VAL A CA    1 
ATOM   2343 C  C     . VAL A 1 293 ? 41.502 28.952 23.276  1.00 39.05 ? 287  VAL A C     1 
ATOM   2344 O  O     . VAL A 1 293 ? 42.022 30.062 23.122  1.00 38.63 ? 287  VAL A O     1 
ATOM   2345 C  CB    . VAL A 1 293 ? 39.094 29.430 23.334  1.00 38.11 ? 287  VAL A CB    1 
ATOM   2346 C  CG1   . VAL A 1 293 ? 38.728 28.556 22.152  1.00 42.51 ? 287  VAL A CG1   1 
ATOM   2347 C  CG2   . VAL A 1 293 ? 37.897 29.625 24.244  1.00 39.76 ? 287  VAL A CG2   1 
ATOM   2348 N  N     . ALA A 1 294 ? 41.968 27.836 22.729  1.00 39.47 ? 288  ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 294 ? 43.159 27.822 21.899  1.00 40.27 ? 288  ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 294 ? 42.869 27.246 20.512  1.00 40.72 ? 288  ALA A C     1 
ATOM   2351 O  O     . ALA A 1 294 ? 42.051 26.345 20.354  1.00 39.73 ? 288  ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 294 ? 44.245 26.999 22.576  1.00 39.97 ? 288  ALA A CB    1 
ATOM   2353 N  N     . VAL A 1 295 ? 43.539 27.784 19.505  1.00 42.57 ? 289  VAL A N     1 
ATOM   2354 C  CA    . VAL A 1 295 ? 43.383 27.292 18.147  1.00 43.30 ? 289  VAL A CA    1 
ATOM   2355 C  C     . VAL A 1 295 ? 44.744 26.734 17.771  1.00 44.42 ? 289  VAL A C     1 
ATOM   2356 O  O     . VAL A 1 295 ? 45.719 27.476 17.679  1.00 42.48 ? 289  VAL A O     1 
ATOM   2357 C  CB    . VAL A 1 295 ? 42.990 28.418 17.172  1.00 44.25 ? 289  VAL A CB    1 
ATOM   2358 C  CG1   . VAL A 1 295 ? 43.127 27.938 15.737  1.00 45.21 ? 289  VAL A CG1   1 
ATOM   2359 C  CG2   . VAL A 1 295 ? 41.556 28.849 17.439  1.00 41.75 ? 289  VAL A CG2   1 
ATOM   2360 N  N     . THR A 1 296 ? 44.802 25.421 17.576  1.00 47.01 ? 290  THR A N     1 
ATOM   2361 C  CA    . THR A 1 296 ? 46.048 24.739 17.234  1.00 49.24 ? 290  THR A CA    1 
ATOM   2362 C  C     . THR A 1 296 ? 46.657 25.123 15.893  1.00 50.64 ? 290  THR A C     1 
ATOM   2363 O  O     . THR A 1 296 ? 46.050 25.827 15.085  1.00 50.64 ? 290  THR A O     1 
ATOM   2364 C  CB    . THR A 1 296 ? 45.871 23.205 17.233  1.00 49.47 ? 290  THR A CB    1 
ATOM   2365 O  OG1   . THR A 1 296 ? 44.717 22.859 16.460  1.00 50.29 ? 290  THR A OG1   1 
ATOM   2366 C  CG2   . THR A 1 296 ? 45.703 22.686 18.635  1.00 49.71 ? 290  THR A CG2   1 
ATOM   2367 N  N     . GLU A 1 297 ? 47.874 24.641 15.680  1.00 52.32 ? 291  GLU A N     1 
ATOM   2368 C  CA    . GLU A 1 297 ? 48.617 24.884 14.460  1.00 53.38 ? 291  GLU A CA    1 
ATOM   2369 C  C     . GLU A 1 297 ? 47.833 24.361 13.256  1.00 55.05 ? 291  GLU A C     1 
ATOM   2370 O  O     . GLU A 1 297 ? 47.916 24.933 12.167  1.00 54.89 ? 291  GLU A O     1 
ATOM   2371 C  CB    . GLU A 1 297 ? 49.980 24.190 14.548  0.50 52.56 ? 291  GLU A CB    1 
ATOM   2372 C  CG    . GLU A 1 297 ? 49.889 22.732 14.988  0.50 51.95 ? 291  GLU A CG    1 
ATOM   2373 C  CD    . GLU A 1 297 ? 51.243 22.109 15.267  0.50 51.01 ? 291  GLU A CD    1 
ATOM   2374 O  OE1   . GLU A 1 297 ? 51.286 20.934 15.688  0.50 50.15 ? 291  GLU A OE1   1 
ATOM   2375 O  OE2   . GLU A 1 297 ? 52.264 22.793 15.066  0.50 50.38 ? 291  GLU A OE2   1 
ATOM   2376 N  N     . ASP A 1 298 ? 47.075 23.283 13.458  1.00 56.17 ? 292  ASP A N     1 
ATOM   2377 C  CA    . ASP A 1 298 ? 46.278 22.689 12.380  1.00 57.97 ? 292  ASP A CA    1 
ATOM   2378 C  C     . ASP A 1 298 ? 44.844 23.229 12.340  1.00 57.75 ? 292  ASP A C     1 
ATOM   2379 O  O     . ASP A 1 298 ? 43.911 22.549 11.914  1.00 58.04 ? 292  ASP A O     1 
ATOM   2380 C  CB    . ASP A 1 298 ? 46.280 21.156 12.503  1.00 58.66 ? 292  ASP A CB    1 
ATOM   2381 C  CG    . ASP A 1 298 ? 45.748 20.667 13.842  1.00 61.29 ? 292  ASP A CG    1 
ATOM   2382 O  OD1   . ASP A 1 298 ? 46.090 19.536 14.246  1.00 62.20 ? 292  ASP A OD1   1 
ATOM   2383 O  OD2   . ASP A 1 298 ? 44.977 21.405 14.486  1.00 63.31 ? 292  ASP A OD2   1 
ATOM   2384 N  N     . LEU A 1 299 ? 44.687 24.469 12.785  1.00 58.56 ? 293  LEU A N     1 
ATOM   2385 C  CA    . LEU A 1 299 ? 43.397 25.144 12.795  1.00 57.89 ? 293  LEU A CA    1 
ATOM   2386 C  C     . LEU A 1 299 ? 42.304 24.398 13.551  1.00 57.35 ? 293  LEU A C     1 
ATOM   2387 O  O     . LEU A 1 299 ? 41.129 24.475 13.196  1.00 58.48 ? 293  LEU A O     1 
ATOM   2388 C  CB    . LEU A 1 299 ? 42.953 25.430 11.357  1.00 58.16 ? 293  LEU A CB    1 
ATOM   2389 C  CG    . LEU A 1 299 ? 43.716 26.525 10.591  1.00 59.19 ? 293  LEU A CG    1 
ATOM   2390 C  CD1   . LEU A 1 299 ? 43.364 27.896 11.147  1.00 58.55 ? 293  LEU A CD1   1 
ATOM   2391 C  CD2   . LEU A 1 299 ? 45.214 26.283 10.684  1.00 58.78 ? 293  LEU A CD2   1 
ATOM   2392 N  N     . ASP A 1 300 ? 42.695 23.685 14.602  1.00 57.05 ? 294  ASP A N     1 
ATOM   2393 C  CA    . ASP A 1 300 ? 41.746 22.947 15.432  1.00 55.93 ? 294  ASP A CA    1 
ATOM   2394 C  C     . ASP A 1 300 ? 41.479 23.765 16.712  1.00 53.86 ? 294  ASP A C     1 
ATOM   2395 O  O     . ASP A 1 300 ? 42.312 24.582 17.112  1.00 51.78 ? 294  ASP A O     1 
ATOM   2396 C  CB    . ASP A 1 300 ? 42.326 21.573 15.759  1.00 58.00 ? 294  ASP A CB    1 
ATOM   2397 C  CG    . ASP A 1 300 ? 41.270 20.574 16.151  1.00 61.10 ? 294  ASP A CG    1 
ATOM   2398 O  OD1   . ASP A 1 300 ? 40.087 20.800 15.810  1.00 62.50 ? 294  ASP A OD1   1 
ATOM   2399 O  OD2   . ASP A 1 300 ? 41.626 19.559 16.786  1.00 62.27 ? 294  ASP A OD2   1 
ATOM   2400 N  N     . ILE A 1 301 ? 40.328 23.552 17.350  1.00 53.09 ? 295  ILE A N     1 
ATOM   2401 C  CA    . ILE A 1 301 ? 39.960 24.316 18.553  1.00 52.51 ? 295  ILE A CA    1 
ATOM   2402 C  C     . ILE A 1 301 ? 39.826 23.504 19.841  1.00 52.96 ? 295  ILE A C     1 
ATOM   2403 O  O     . ILE A 1 301 ? 39.011 22.588 19.935  1.00 54.45 ? 295  ILE A O     1 
ATOM   2404 C  CB    . ILE A 1 301 ? 38.626 25.069 18.340  1.00 51.37 ? 295  ILE A CB    1 
ATOM   2405 C  CG1   . ILE A 1 301 ? 38.672 25.850 17.024  1.00 51.55 ? 295  ILE A CG1   1 
ATOM   2406 C  CG2   . ILE A 1 301 ? 38.363 26.012 19.504  1.00 49.84 ? 295  ILE A CG2   1 
ATOM   2407 C  CD1   . ILE A 1 301 ? 37.314 26.327 16.543  1.00 50.15 ? 295  ILE A CD1   1 
ATOM   2408 N  N     . VAL A 1 302 ? 40.609 23.872 20.846  1.00 52.90 ? 296  VAL A N     1 
ATOM   2409 C  CA    . VAL A 1 302 ? 40.585 23.185 22.133  1.00 53.20 ? 296  VAL A CA    1 
ATOM   2410 C  C     . VAL A 1 302 ? 40.301 24.176 23.255  1.00 52.00 ? 296  VAL A C     1 
ATOM   2411 O  O     . VAL A 1 302 ? 40.713 25.338 23.189  1.00 54.37 ? 296  VAL A O     1 
ATOM   2412 C  CB    . VAL A 1 302 ? 41.937 22.496 22.404  1.00 53.82 ? 296  VAL A CB    1 
ATOM   2413 C  CG1   . VAL A 1 302 ? 41.863 21.684 23.683  1.00 55.34 ? 296  VAL A CG1   1 
ATOM   2414 C  CG2   . VAL A 1 302 ? 42.306 21.610 21.218  1.00 55.30 ? 296  VAL A CG2   1 
ATOM   2415 N  N     . SER A 1 303 ? 39.594 23.728 24.287  1.00 49.21 ? 297  SER A N     1 
ATOM   2416 C  CA    . SER A 1 303 ? 39.283 24.620 25.392  1.00 46.54 ? 297  SER A CA    1 
ATOM   2417 C  C     . SER A 1 303 ? 39.195 23.923 26.736  1.00 45.82 ? 297  SER A C     1 
ATOM   2418 O  O     . SER A 1 303 ? 38.932 22.722 26.827  1.00 42.59 ? 297  SER A O     1 
ATOM   2419 C  CB    . SER A 1 303 ? 37.972 25.361 25.137  1.00 46.10 ? 297  SER A CB    1 
ATOM   2420 O  OG    . SER A 1 303 ? 36.865 24.519 25.391  1.00 47.09 ? 297  SER A OG    1 
ATOM   2421 N  N     . ARG A 1 304 ? 39.419 24.712 27.777  1.00 45.52 ? 298  ARG A N     1 
ATOM   2422 C  CA    . ARG A 1 304 ? 39.372 24.248 29.153  1.00 45.13 ? 298  ARG A CA    1 
ATOM   2423 C  C     . ARG A 1 304 ? 38.733 25.363 29.958  1.00 44.80 ? 298  ARG A C     1 
ATOM   2424 O  O     . ARG A 1 304 ? 39.071 26.531 29.778  1.00 46.41 ? 298  ARG A O     1 
ATOM   2425 C  CB    . ARG A 1 304 ? 40.782 23.978 29.659  1.00 44.57 ? 298  ARG A CB    1 
ATOM   2426 C  CG    . ARG A 1 304 ? 41.443 22.798 28.997  1.00 45.03 ? 298  ARG A CG    1 
ATOM   2427 C  CD    . ARG A 1 304 ? 40.705 21.502 29.308  1.00 47.03 ? 298  ARG A CD    1 
ATOM   2428 N  NE    . ARG A 1 304 ? 41.448 20.332 28.846  1.00 51.61 ? 298  ARG A NE    1 
ATOM   2429 C  CZ    . ARG A 1 304 ? 41.548 19.951 27.575  1.00 53.94 ? 298  ARG A CZ    1 
ATOM   2430 N  NH1   . ARG A 1 304 ? 40.944 20.639 26.614  1.00 56.35 ? 298  ARG A NH1   1 
ATOM   2431 N  NH2   . ARG A 1 304 ? 42.273 18.888 27.259  1.00 56.91 ? 298  ARG A NH2   1 
ATOM   2432 N  N     . GLY A 1 305 ? 37.809 25.011 30.839  1.00 43.07 ? 299  GLY A N     1 
ATOM   2433 C  CA    . GLY A 1 305 ? 37.151 26.035 31.620  1.00 43.04 ? 299  GLY A CA    1 
ATOM   2434 C  C     . GLY A 1 305 ? 36.918 25.652 33.059  1.00 43.68 ? 299  GLY A C     1 
ATOM   2435 O  O     . GLY A 1 305 ? 37.327 24.581 33.504  1.00 44.47 ? 299  GLY A O     1 
ATOM   2436 N  N     . ARG A 1 306 ? 36.252 26.542 33.784  1.00 44.41 ? 300  ARG A N     1 
ATOM   2437 C  CA    . ARG A 1 306 ? 35.957 26.320 35.182  1.00 46.21 ? 300  ARG A CA    1 
ATOM   2438 C  C     . ARG A 1 306 ? 34.881 27.262 35.699  1.00 46.26 ? 300  ARG A C     1 
ATOM   2439 O  O     . ARG A 1 306 ? 34.897 28.465 35.426  1.00 45.00 ? 300  ARG A O     1 
ATOM   2440 C  CB    . ARG A 1 306 ? 37.230 26.484 36.001  1.00 47.47 ? 300  ARG A CB    1 
ATOM   2441 C  CG    . ARG A 1 306 ? 37.002 26.436 37.485  1.00 51.84 ? 300  ARG A CG    1 
ATOM   2442 C  CD    . ARG A 1 306 ? 38.314 26.324 38.221  1.00 52.63 ? 300  ARG A CD    1 
ATOM   2443 N  NE    . ARG A 1 306 ? 38.165 26.741 39.608  1.00 56.48 ? 300  ARG A NE    1 
ATOM   2444 C  CZ    . ARG A 1 306 ? 39.155 26.760 40.489  1.00 58.15 ? 300  ARG A CZ    1 
ATOM   2445 N  NH1   . ARG A 1 306 ? 40.376 26.382 40.125  1.00 59.37 ? 300  ARG A NH1   1 
ATOM   2446 N  NH2   . ARG A 1 306 ? 38.930 27.166 41.731  1.00 58.29 ? 300  ARG A NH2   1 
ATOM   2447 N  N     . THR A 1 307 ? 33.934 26.703 36.440  1.00 46.79 ? 301  THR A N     1 
ATOM   2448 C  CA    . THR A 1 307 ? 32.858 27.495 37.009  1.00 48.44 ? 301  THR A CA    1 
ATOM   2449 C  C     . THR A 1 307 ? 33.098 27.642 38.508  1.00 49.52 ? 301  THR A C     1 
ATOM   2450 O  O     . THR A 1 307 ? 33.447 26.676 39.180  1.00 49.92 ? 301  THR A O     1 
ATOM   2451 C  CB    . THR A 1 307 ? 31.499 26.828 36.807  1.00 49.19 ? 301  THR A CB    1 
ATOM   2452 O  OG1   . THR A 1 307 ? 31.365 26.417 35.441  1.00 51.57 ? 301  THR A OG1   1 
ATOM   2453 C  CG2   . THR A 1 307 ? 30.383 27.803 37.152  1.00 49.73 ? 301  THR A CG2   1 
ATOM   2454 N  N     . PHE A 1 308 ? 32.908 28.853 39.019  1.00 49.28 ? 302  PHE A N     1 
ATOM   2455 C  CA    . PHE A 1 308 ? 33.100 29.137 40.428  1.00 47.80 ? 302  PHE A CA    1 
ATOM   2456 C  C     . PHE A 1 308 ? 31.756 29.390 41.088  1.00 48.82 ? 302  PHE A C     1 
ATOM   2457 O  O     . PHE A 1 308 ? 30.783 29.731 40.414  1.00 46.76 ? 302  PHE A O     1 
ATOM   2458 C  CB    . PHE A 1 308 ? 33.978 30.376 40.608  1.00 48.22 ? 302  PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1 308 ? 35.382 30.205 40.116  1.00 48.63 ? 302  PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1 308 ? 35.672 30.258 38.760  1.00 50.19 ? 302  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1 308 ? 36.419 29.978 41.012  1.00 49.04 ? 302  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1 308 ? 36.979 30.086 38.299  1.00 49.42 ? 302  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1 308 ? 37.723 29.805 40.565  1.00 49.50 ? 302  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1 308 ? 38.004 29.859 39.204  1.00 50.98 ? 302  PHE A CZ    1 
ATOM   2465 N  N     . PRO A 1 309 ? 31.680 29.222 42.422  1.00 48.80 ? 303  PRO A N     1 
ATOM   2466 C  CA    . PRO A 1 309 ? 30.431 29.450 43.157  1.00 49.10 ? 303  PRO A CA    1 
ATOM   2467 C  C     . PRO A 1 309 ? 30.160 30.943 43.349  1.00 48.91 ? 303  PRO A C     1 
ATOM   2468 O  O     . PRO A 1 309 ? 29.125 31.341 43.885  1.00 49.73 ? 303  PRO A O     1 
ATOM   2469 C  CB    . PRO A 1 309 ? 30.672 28.723 44.480  1.00 49.57 ? 303  PRO A CB    1 
ATOM   2470 C  CG    . PRO A 1 309 ? 32.150 28.863 44.671  1.00 50.18 ? 303  PRO A CG    1 
ATOM   2471 C  CD    . PRO A 1 309 ? 32.690 28.584 43.286  1.00 48.63 ? 303  PRO A CD    1 
ATOM   2472 N  N     . HIS A 1 310 ? 31.095 31.762 42.891  1.00 47.53 ? 304  HIS A N     1 
ATOM   2473 C  CA    . HIS A 1 310 ? 30.985 33.211 43.023  1.00 47.34 ? 304  HIS A CA    1 
ATOM   2474 C  C     . HIS A 1 310 ? 31.550 33.868 41.763  1.00 46.71 ? 304  HIS A C     1 
ATOM   2475 O  O     . HIS A 1 310 ? 32.068 33.185 40.872  1.00 47.21 ? 304  HIS A O     1 
ATOM   2476 C  CB    . HIS A 1 310 ? 31.796 33.654 44.232  1.00 47.05 ? 304  HIS A CB    1 
ATOM   2477 C  CG    . HIS A 1 310 ? 33.216 33.186 44.181  1.00 49.08 ? 304  HIS A CG    1 
ATOM   2478 N  ND1   . HIS A 1 310 ? 34.177 33.810 43.414  1.00 49.06 ? 304  HIS A ND1   1 
ATOM   2479 C  CD2   . HIS A 1 310 ? 33.813 32.093 44.714  1.00 51.29 ? 304  HIS A CD2   1 
ATOM   2480 C  CE1   . HIS A 1 310 ? 35.302 33.119 43.472  1.00 51.07 ? 304  HIS A CE1   1 
ATOM   2481 N  NE2   . HIS A 1 310 ? 35.107 32.073 44.256  1.00 52.75 ? 304  HIS A NE2   1 
ATOM   2482 N  N     . GLY A 1 311 ? 31.463 35.196 41.707  1.00 46.06 ? 305  GLY A N     1 
ATOM   2483 C  CA    . GLY A 1 311 ? 31.966 35.936 40.567  1.00 44.15 ? 305  GLY A CA    1 
ATOM   2484 C  C     . GLY A 1 311 ? 33.478 35.888 40.496  1.00 44.47 ? 305  GLY A C     1 
ATOM   2485 O  O     . GLY A 1 311 ? 34.152 35.654 41.503  1.00 44.54 ? 305  GLY A O     1 
ATOM   2486 N  N     . ILE A 1 312 ? 34.014 36.119 39.303  1.00 42.35 ? 306  ILE A N     1 
ATOM   2487 C  CA    . ILE A 1 312 ? 35.450 36.097 39.087  1.00 40.66 ? 306  ILE A CA    1 
ATOM   2488 C  C     . ILE A 1 312 ? 36.022 37.509 38.983  1.00 41.49 ? 306  ILE A C     1 
ATOM   2489 O  O     . ILE A 1 312 ? 35.588 38.298 38.141  1.00 42.50 ? 306  ILE A O     1 
ATOM   2490 C  CB    . ILE A 1 312 ? 35.789 35.342 37.787  1.00 41.37 ? 306  ILE A CB    1 
ATOM   2491 C  CG1   . ILE A 1 312 ? 35.140 33.949 37.817  1.00 41.38 ? 306  ILE A CG1   1 
ATOM   2492 C  CG2   . ILE A 1 312 ? 37.303 35.268 37.608  1.00 38.17 ? 306  ILE A CG2   1 
ATOM   2493 C  CD1   . ILE A 1 312 ? 35.286 33.152 36.519  1.00 43.27 ? 306  ILE A CD1   1 
ATOM   2494 N  N     . SER A 1 313 ? 36.978 37.837 39.847  1.00 39.48 ? 307  SER A N     1 
ATOM   2495 C  CA    . SER A 1 313 ? 37.606 39.151 39.781  1.00 37.60 ? 307  SER A CA    1 
ATOM   2496 C  C     . SER A 1 313 ? 38.636 39.025 38.665  1.00 36.50 ? 307  SER A C     1 
ATOM   2497 O  O     . SER A 1 313 ? 39.064 37.914 38.336  1.00 35.89 ? 307  SER A O     1 
ATOM   2498 C  CB    . SER A 1 313 ? 38.311 39.503 41.100  1.00 34.76 ? 307  SER A CB    1 
ATOM   2499 O  OG    . SER A 1 313 ? 39.403 38.630 41.361  1.00 34.68 ? 307  SER A OG    1 
ATOM   2500 N  N     . LYS A 1 314 ? 39.031 40.143 38.074  1.00 37.11 ? 308  LYS A N     1 
ATOM   2501 C  CA    . LYS A 1 314 ? 40.017 40.083 37.007  1.00 37.98 ? 308  LYS A CA    1 
ATOM   2502 C  C     . LYS A 1 314 ? 41.249 39.359 37.531  1.00 39.11 ? 308  LYS A C     1 
ATOM   2503 O  O     . LYS A 1 314 ? 41.882 38.579 36.808  1.00 39.63 ? 308  LYS A O     1 
ATOM   2504 C  CB    . LYS A 1 314 ? 40.404 41.490 36.536  1.00 40.38 ? 308  LYS A CB    1 
ATOM   2505 C  CG    . LYS A 1 314 ? 41.487 41.502 35.453  1.00 45.20 ? 308  LYS A CG    1 
ATOM   2506 C  CD    . LYS A 1 314 ? 42.073 42.903 35.225  1.00 46.80 ? 308  LYS A CD    1 
ATOM   2507 C  CE    . LYS A 1 314 ? 41.027 43.863 34.680  1.00 49.29 ? 308  LYS A CE    1 
ATOM   2508 N  NZ    . LYS A 1 314 ? 41.519 45.270 34.645  1.00 48.85 ? 308  LYS A NZ    1 
ATOM   2509 N  N     A GLU A 1 315 ? 41.589 39.615 38.792  0.50 39.09 ? 309  GLU A N     1 
ATOM   2510 N  N     B GLU A 1 315 ? 41.598 39.613 38.790  0.50 39.20 ? 309  GLU A N     1 
ATOM   2511 C  CA    A GLU A 1 315 ? 42.749 38.987 39.406  0.50 38.90 ? 309  GLU A CA    1 
ATOM   2512 C  CA    B GLU A 1 315 ? 42.758 38.967 39.392  0.50 39.09 ? 309  GLU A CA    1 
ATOM   2513 C  C     A GLU A 1 315 ? 42.603 37.465 39.370  0.50 38.48 ? 309  GLU A C     1 
ATOM   2514 C  C     B GLU A 1 315 ? 42.602 37.453 39.356  0.50 38.56 ? 309  GLU A C     1 
ATOM   2515 O  O     A GLU A 1 315 ? 43.552 36.752 39.060  0.50 37.13 ? 309  GLU A O     1 
ATOM   2516 O  O     B GLU A 1 315 ? 43.542 36.733 39.037  0.50 37.09 ? 309  GLU A O     1 
ATOM   2517 C  CB    A GLU A 1 315 ? 42.912 39.464 40.854  0.50 40.76 ? 309  GLU A CB    1 
ATOM   2518 C  CB    B GLU A 1 315 ? 42.945 39.432 40.839  0.50 41.31 ? 309  GLU A CB    1 
ATOM   2519 C  CG    A GLU A 1 315 ? 43.032 40.980 41.031  0.50 42.13 ? 309  GLU A CG    1 
ATOM   2520 C  CG    B GLU A 1 315 ? 43.905 40.599 41.001  0.50 43.11 ? 309  GLU A CG    1 
ATOM   2521 C  CD    A GLU A 1 315 ? 41.716 41.716 40.810  0.50 43.06 ? 309  GLU A CD    1 
ATOM   2522 C  CD    B GLU A 1 315 ? 45.320 40.241 40.592  0.50 45.20 ? 309  GLU A CD    1 
ATOM   2523 O  OE1   A GLU A 1 315 ? 40.688 41.288 41.370  0.50 43.60 ? 309  GLU A OE1   1 
ATOM   2524 O  OE1   B GLU A 1 315 ? 46.221 41.089 40.759  0.50 46.50 ? 309  GLU A OE1   1 
ATOM   2525 O  OE2   A GLU A 1 315 ? 41.711 42.734 40.088  0.50 45.79 ? 309  GLU A OE2   1 
ATOM   2526 O  OE2   B GLU A 1 315 ? 45.533 39.112 40.102  0.50 47.92 ? 309  GLU A OE2   1 
ATOM   2527 N  N     . THR A 1 316 ? 41.407 36.974 39.684  1.00 38.05 ? 310  THR A N     1 
ATOM   2528 C  CA    . THR A 1 316 ? 41.143 35.538 39.676  1.00 38.58 ? 310  THR A CA    1 
ATOM   2529 C  C     . THR A 1 316 ? 41.163 35.000 38.245  1.00 37.85 ? 310  THR A C     1 
ATOM   2530 O  O     . THR A 1 316 ? 41.495 33.841 38.021  1.00 37.19 ? 310  THR A O     1 
ATOM   2531 C  CB    . THR A 1 316 ? 39.783 35.221 40.316  1.00 38.71 ? 310  THR A CB    1 
ATOM   2532 O  OG1   . THR A 1 316 ? 39.769 35.718 41.659  1.00 42.41 ? 310  THR A OG1   1 
ATOM   2533 C  CG2   . THR A 1 316 ? 39.532 33.714 40.333  1.00 38.53 ? 310  THR A CG2   1 
ATOM   2534 N  N     . ALA A 1 317 ? 40.835 35.850 37.275  1.00 38.17 ? 311  ALA A N     1 
ATOM   2535 C  CA    . ALA A 1 317 ? 40.842 35.442 35.868  1.00 37.89 ? 311  ALA A CA    1 
ATOM   2536 C  C     . ALA A 1 317 ? 42.264 35.182 35.371  1.00 38.25 ? 311  ALA A C     1 
ATOM   2537 O  O     . ALA A 1 317 ? 42.536 34.160 34.730  1.00 37.30 ? 311  ALA A O     1 
ATOM   2538 C  CB    . ALA A 1 317 ? 40.179 36.508 35.019  1.00 36.10 ? 311  ALA A CB    1 
ATOM   2539 N  N     . TYR A 1 318 ? 43.169 36.108 35.677  1.00 39.65 ? 312  TYR A N     1 
ATOM   2540 C  CA    . TYR A 1 318 ? 44.568 35.990 35.272  1.00 41.14 ? 312  TYR A CA    1 
ATOM   2541 C  C     . TYR A 1 318 ? 45.219 34.648 35.646  1.00 40.96 ? 312  TYR A C     1 
ATOM   2542 O  O     . TYR A 1 318 ? 45.628 33.897 34.768  1.00 42.32 ? 312  TYR A O     1 
ATOM   2543 C  CB    . TYR A 1 318 ? 45.370 37.163 35.852  1.00 43.57 ? 312  TYR A CB    1 
ATOM   2544 C  CG    . TYR A 1 318 ? 45.493 38.360 34.919  1.00 46.85 ? 312  TYR A CG    1 
ATOM   2545 C  CD1   . TYR A 1 318 ? 46.721 38.680 34.335  1.00 47.89 ? 312  TYR A CD1   1 
ATOM   2546 C  CD2   . TYR A 1 318 ? 44.389 39.161 34.610  1.00 46.07 ? 312  TYR A CD2   1 
ATOM   2547 C  CE1   . TYR A 1 318 ? 46.854 39.762 33.470  1.00 48.86 ? 312  TYR A CE1   1 
ATOM   2548 C  CE2   . TYR A 1 318 ? 44.508 40.248 33.737  1.00 47.46 ? 312  TYR A CE2   1 
ATOM   2549 C  CZ    . TYR A 1 318 ? 45.748 40.539 33.171  1.00 50.01 ? 312  TYR A CZ    1 
ATOM   2550 O  OH    . TYR A 1 318 ? 45.900 41.591 32.291  1.00 50.89 ? 312  TYR A OH    1 
ATOM   2551 N  N     . SER A 1 319 ? 45.322 34.351 36.941  1.00 41.31 ? 313  SER A N     1 
ATOM   2552 C  CA    . SER A 1 319 ? 45.905 33.091 37.412  1.00 42.33 ? 313  SER A CA    1 
ATOM   2553 C  C     . SER A 1 319 ? 45.107 31.854 36.979  1.00 41.94 ? 313  SER A C     1 
ATOM   2554 O  O     . SER A 1 319 ? 45.686 30.865 36.540  1.00 44.34 ? 313  SER A O     1 
ATOM   2555 C  CB    . SER A 1 319 ? 46.043 33.098 38.945  1.00 42.75 ? 313  SER A CB    1 
ATOM   2556 O  OG    . SER A 1 319 ? 44.782 33.183 39.595  1.00 42.98 ? 313  SER A OG    1 
ATOM   2557 N  N     . GLU A 1 320 ? 43.785 31.895 37.103  1.00 41.81 ? 314  GLU A N     1 
ATOM   2558 C  CA    . GLU A 1 320 ? 42.989 30.740 36.698  1.00 43.00 ? 314  GLU A CA    1 
ATOM   2559 C  C     . GLU A 1 320 ? 43.171 30.446 35.208  1.00 42.51 ? 314  GLU A C     1 
ATOM   2560 O  O     . GLU A 1 320 ? 43.235 29.288 34.803  1.00 41.03 ? 314  GLU A O     1 
ATOM   2561 C  CB    . GLU A 1 320 ? 41.505 30.970 37.002  1.00 44.80 ? 314  GLU A CB    1 
ATOM   2562 C  CG    . GLU A 1 320 ? 40.611 29.766 36.707  1.00 49.91 ? 314  GLU A CG    1 
ATOM   2563 C  CD    . GLU A 1 320 ? 41.206 28.453 37.207  1.00 53.12 ? 314  GLU A CD    1 
ATOM   2564 O  OE1   . GLU A 1 320 ? 41.740 28.428 38.337  1.00 54.62 ? 314  GLU A OE1   1 
ATOM   2565 O  OE2   . GLU A 1 320 ? 41.135 27.444 36.473  1.00 52.63 ? 314  GLU A OE2   1 
ATOM   2566 N  N     . SER A 1 321 ? 43.272 31.496 34.398  1.00 41.69 ? 315  SER A N     1 
ATOM   2567 C  CA    . SER A 1 321 ? 43.437 31.316 32.960  1.00 42.53 ? 315  SER A CA    1 
ATOM   2568 C  C     . SER A 1 321 ? 44.814 30.770 32.631  1.00 43.35 ? 315  SER A C     1 
ATOM   2569 O  O     . SER A 1 321 ? 45.002 30.136 31.598  1.00 43.34 ? 315  SER A O     1 
ATOM   2570 C  CB    . SER A 1 321 ? 43.221 32.636 32.221  1.00 39.77 ? 315  SER A CB    1 
ATOM   2571 O  OG    . SER A 1 321 ? 44.334 33.490 32.377  1.00 38.87 ? 315  SER A OG    1 
ATOM   2572 N  N     . VAL A 1 322 ? 45.784 31.018 33.504  1.00 45.26 ? 316  VAL A N     1 
ATOM   2573 C  CA    . VAL A 1 322 ? 47.134 30.517 33.263  1.00 46.72 ? 316  VAL A CA    1 
ATOM   2574 C  C     . VAL A 1 322 ? 47.152 29.001 33.454  1.00 46.63 ? 316  VAL A C     1 
ATOM   2575 O  O     . VAL A 1 322 ? 47.803 28.274 32.706  1.00 43.51 ? 316  VAL A O     1 
ATOM   2576 C  CB    . VAL A 1 322 ? 48.161 31.146 34.228  1.00 48.59 ? 316  VAL A CB    1 
ATOM   2577 C  CG1   . VAL A 1 322 ? 49.566 30.669 33.865  1.00 50.22 ? 316  VAL A CG1   1 
ATOM   2578 C  CG2   . VAL A 1 322 ? 48.097 32.654 34.151  1.00 49.51 ? 316  VAL A CG2   1 
ATOM   2579 N  N     . LYS A 1 323 ? 46.438 28.538 34.470  1.00 47.71 ? 317  LYS A N     1 
ATOM   2580 C  CA    . LYS A 1 323 ? 46.356 27.117 34.753  1.00 50.30 ? 317  LYS A CA    1 
ATOM   2581 C  C     . LYS A 1 323 ? 45.729 26.403 33.554  1.00 49.76 ? 317  LYS A C     1 
ATOM   2582 O  O     . LYS A 1 323 ? 46.317 25.479 32.986  1.00 49.68 ? 317  LYS A O     1 
ATOM   2583 C  CB    . LYS A 1 323 ? 45.514 26.889 36.006  1.00 52.88 ? 317  LYS A CB    1 
ATOM   2584 C  CG    . LYS A 1 323 ? 46.152 27.444 37.276  1.00 57.14 ? 317  LYS A CG    1 
ATOM   2585 C  CD    . LYS A 1 323 ? 45.216 27.319 38.465  1.00 59.15 ? 317  LYS A CD    1 
ATOM   2586 C  CE    . LYS A 1 323 ? 45.936 27.656 39.762  1.00 61.32 ? 317  LYS A CE    1 
ATOM   2587 N  NZ    . LYS A 1 323 ? 46.535 29.024 39.745  1.00 62.81 ? 317  LYS A NZ    1 
ATOM   2588 N  N     . LEU A 1 324 ? 44.538 26.848 33.170  1.00 48.36 ? 318  LEU A N     1 
ATOM   2589 C  CA    . LEU A 1 324 ? 43.836 26.265 32.038  1.00 46.72 ? 318  LEU A CA    1 
ATOM   2590 C  C     . LEU A 1 324 ? 44.751 26.172 30.816  1.00 47.07 ? 318  LEU A C     1 
ATOM   2591 O  O     . LEU A 1 324 ? 44.739 25.176 30.099  1.00 46.12 ? 318  LEU A O     1 
ATOM   2592 C  CB    . LEU A 1 324 ? 42.600 27.103 31.724  1.00 44.52 ? 318  LEU A CB    1 
ATOM   2593 C  CG    . LEU A 1 324 ? 41.607 27.126 32.888  1.00 42.82 ? 318  LEU A CG    1 
ATOM   2594 C  CD1   . LEU A 1 324 ? 40.529 28.184 32.663  1.00 39.99 ? 318  LEU A CD1   1 
ATOM   2595 C  CD2   . LEU A 1 324 ? 41.004 25.740 33.046  1.00 42.08 ? 318  LEU A CD2   1 
ATOM   2596 N  N     . LEU A 1 325 ? 45.552 27.203 30.586  1.00 47.44 ? 319  LEU A N     1 
ATOM   2597 C  CA    . LEU A 1 325 ? 46.466 27.199 29.452  1.00 49.76 ? 319  LEU A CA    1 
ATOM   2598 C  C     . LEU A 1 325 ? 47.547 26.127 29.609  1.00 51.41 ? 319  LEU A C     1 
ATOM   2599 O  O     . LEU A 1 325 ? 47.975 25.501 28.629  1.00 51.72 ? 319  LEU A O     1 
ATOM   2600 C  CB    . LEU A 1 325 ? 47.127 28.566 29.302  1.00 47.53 ? 319  LEU A CB    1 
ATOM   2601 C  CG    . LEU A 1 325 ? 48.198 28.661 28.216  1.00 47.38 ? 319  LEU A CG    1 
ATOM   2602 C  CD1   . LEU A 1 325 ? 47.649 28.175 26.875  1.00 45.89 ? 319  LEU A CD1   1 
ATOM   2603 C  CD2   . LEU A 1 325 ? 48.678 30.106 28.127  1.00 45.65 ? 319  LEU A CD2   1 
ATOM   2604 N  N     . GLN A 1 326 ? 47.995 25.942 30.849  1.00 51.93 ? 320  GLN A N     1 
ATOM   2605 C  CA    . GLN A 1 326 ? 49.022 24.956 31.171  1.00 52.68 ? 320  GLN A CA    1 
ATOM   2606 C  C     . GLN A 1 326 ? 48.426 23.575 30.988  1.00 53.30 ? 320  GLN A C     1 
ATOM   2607 O  O     . GLN A 1 326 ? 49.104 22.641 30.543  1.00 52.69 ? 320  GLN A O     1 
ATOM   2608 C  CB    . GLN A 1 326 ? 49.491 25.137 32.615  1.00 51.39 ? 320  GLN A CB    1 
ATOM   2609 C  CG    . GLN A 1 326 ? 50.141 26.489 32.874  1.00 52.78 ? 320  GLN A CG    1 
ATOM   2610 C  CD    . GLN A 1 326 ? 50.809 26.578 34.233  1.00 52.31 ? 320  GLN A CD    1 
ATOM   2611 O  OE1   . GLN A 1 326 ? 50.172 26.378 35.269  1.00 49.93 ? 320  GLN A OE1   1 
ATOM   2612 N  NE2   . GLN A 1 326 ? 52.107 26.885 34.235  1.00 53.89 ? 320  GLN A NE2   1 
ATOM   2613 N  N     . LYS A 1 327 ? 47.147 23.469 31.333  1.00 53.89 ? 321  LYS A N     1 
ATOM   2614 C  CA    . LYS A 1 327 ? 46.401 22.229 31.208  1.00 54.74 ? 321  LYS A CA    1 
ATOM   2615 C  C     . LYS A 1 327 ? 46.223 21.912 29.723  1.00 54.19 ? 321  LYS A C     1 
ATOM   2616 O  O     . LYS A 1 327 ? 46.300 20.753 29.319  1.00 54.85 ? 321  LYS A O     1 
ATOM   2617 C  CB    . LYS A 1 327 ? 45.041 22.367 31.895  1.00 54.44 ? 321  LYS A CB    1 
ATOM   2618 C  CG    . LYS A 1 327 ? 44.279 21.060 32.022  1.00 56.85 ? 321  LYS A CG    1 
ATOM   2619 C  CD    . LYS A 1 327 ? 42.945 21.244 32.738  1.00 58.81 ? 321  LYS A CD    1 
ATOM   2620 C  CE    . LYS A 1 327 ? 43.124 21.725 34.176  1.00 60.84 ? 321  LYS A CE    1 
ATOM   2621 N  NZ    . LYS A 1 327 ? 41.816 21.910 34.888  1.00 61.06 ? 321  LYS A NZ    1 
ATOM   2622 N  N     . ILE A 1 328 ? 45.989 22.936 28.907  1.00 53.78 ? 322  ILE A N     1 
ATOM   2623 C  CA    . ILE A 1 328 ? 45.837 22.716 27.472  1.00 53.22 ? 322  ILE A CA    1 
ATOM   2624 C  C     . ILE A 1 328 ? 47.159 22.212 26.916  1.00 53.71 ? 322  ILE A C     1 
ATOM   2625 O  O     . ILE A 1 328 ? 47.200 21.212 26.203  1.00 54.24 ? 322  ILE A O     1 
ATOM   2626 C  CB    . ILE A 1 328 ? 45.428 24.008 26.713  1.00 51.93 ? 322  ILE A CB    1 
ATOM   2627 C  CG1   . ILE A 1 328 ? 43.963 24.347 26.999  1.00 51.33 ? 322  ILE A CG1   1 
ATOM   2628 C  CG2   . ILE A 1 328 ? 45.628 23.819 25.213  1.00 51.04 ? 322  ILE A CG2   1 
ATOM   2629 C  CD1   . ILE A 1 328 ? 43.465 25.590 26.272  1.00 50.92 ? 322  ILE A CD1   1 
ATOM   2630 N  N     . LEU A 1 329 ? 48.242 22.902 27.251  1.00 55.08 ? 323  LEU A N     1 
ATOM   2631 C  CA    . LEU A 1 329 ? 49.564 22.509 26.776  1.00 58.37 ? 323  LEU A CA    1 
ATOM   2632 C  C     . LEU A 1 329 ? 49.946 21.087 27.196  1.00 60.20 ? 323  LEU A C     1 
ATOM   2633 O  O     . LEU A 1 329 ? 50.578 20.359 26.432  1.00 60.55 ? 323  LEU A O     1 
ATOM   2634 C  CB    . LEU A 1 329 ? 50.614 23.500 27.282  1.00 57.88 ? 323  LEU A CB    1 
ATOM   2635 C  CG    . LEU A 1 329 ? 50.591 24.882 26.627  1.00 57.80 ? 323  LEU A CG    1 
ATOM   2636 C  CD1   . LEU A 1 329 ? 51.402 25.861 27.453  1.00 56.98 ? 323  LEU A CD1   1 
ATOM   2637 C  CD2   . LEU A 1 329 ? 51.146 24.782 25.214  1.00 57.09 ? 323  LEU A CD2   1 
ATOM   2638 N  N     . GLU A 1 330 ? 49.552 20.691 28.404  1.00 62.58 ? 324  GLU A N     1 
ATOM   2639 C  CA    . GLU A 1 330 ? 49.877 19.361 28.910  1.00 65.12 ? 324  GLU A CA    1 
ATOM   2640 C  C     . GLU A 1 330 ? 48.853 18.293 28.530  1.00 66.73 ? 324  GLU A C     1 
ATOM   2641 O  O     . GLU A 1 330 ? 48.802 17.232 29.153  1.00 68.11 ? 324  GLU A O     1 
ATOM   2642 C  CB    . GLU A 1 330 ? 50.027 19.389 30.438  1.00 63.96 ? 324  GLU A CB    1 
ATOM   2643 C  CG    . GLU A 1 330 ? 48.746 19.728 31.188  1.00 63.46 ? 324  GLU A CG    1 
ATOM   2644 C  CD    . GLU A 1 330 ? 48.900 19.638 32.702  0.50 62.55 ? 324  GLU A CD    1 
ATOM   2645 O  OE1   . GLU A 1 330 ? 49.085 18.513 33.216  0.50 61.38 ? 324  GLU A OE1   1 
ATOM   2646 O  OE2   . GLU A 1 330 ? 48.838 20.689 33.377  0.50 60.80 ? 324  GLU A OE2   1 
ATOM   2647 N  N     . GLU A 1 331 ? 48.040 18.566 27.518  1.00 67.72 ? 325  GLU A N     1 
ATOM   2648 C  CA    . GLU A 1 331 ? 47.034 17.603 27.083  1.00 68.34 ? 325  GLU A CA    1 
ATOM   2649 C  C     . GLU A 1 331 ? 46.848 17.654 25.575  1.00 68.55 ? 325  GLU A C     1 
ATOM   2650 O  O     . GLU A 1 331 ? 45.890 17.103 25.034  1.00 69.80 ? 325  GLU A O     1 
ATOM   2651 C  CB    . GLU A 1 331 ? 45.702 17.868 27.793  1.00 68.81 ? 325  GLU A CB    1 
ATOM   2652 C  CG    . GLU A 1 331 ? 45.628 17.288 29.203  1.00 70.43 ? 325  GLU A CG    1 
ATOM   2653 C  CD    . GLU A 1 331 ? 44.406 17.757 29.983  1.00 71.51 ? 325  GLU A CD    1 
ATOM   2654 O  OE1   . GLU A 1 331 ? 43.303 17.802 29.400  1.00 71.27 ? 325  GLU A OE1   1 
ATOM   2655 O  OE2   . GLU A 1 331 ? 44.548 18.068 31.187  1.00 72.75 ? 325  GLU A OE2   1 
ATOM   2656 N  N     . ASP A 1 332 ? 47.777 18.325 24.907  1.00 67.87 ? 326  ASP A N     1 
ATOM   2657 C  CA    . ASP A 1 332 ? 47.752 18.463 23.459  1.00 67.40 ? 326  ASP A CA    1 
ATOM   2658 C  C     . ASP A 1 332 ? 49.151 18.924 23.063  1.00 67.15 ? 326  ASP A C     1 
ATOM   2659 O  O     . ASP A 1 332 ? 49.579 20.014 23.442  1.00 67.63 ? 326  ASP A O     1 
ATOM   2660 C  CB    . ASP A 1 332 ? 46.711 19.505 23.045  1.00 67.89 ? 326  ASP A CB    1 
ATOM   2661 C  CG    . ASP A 1 332 ? 46.251 19.339 21.603  1.00 68.44 ? 326  ASP A CG    1 
ATOM   2662 O  OD1   . ASP A 1 332 ? 45.117 18.849 21.394  1.00 68.19 ? 326  ASP A OD1   1 
ATOM   2663 O  OD2   . ASP A 1 332 ? 47.027 19.690 20.684  1.00 68.23 ? 326  ASP A OD2   1 
ATOM   2664 N  N     . GLU A 1 333 ? 49.860 18.095 22.308  1.00 66.43 ? 327  GLU A N     1 
ATOM   2665 C  CA    . GLU A 1 333 ? 51.226 18.415 21.902  1.00 65.47 ? 327  GLU A CA    1 
ATOM   2666 C  C     . GLU A 1 333 ? 51.372 19.491 20.827  1.00 64.31 ? 327  GLU A C     1 
ATOM   2667 O  O     . GLU A 1 333 ? 52.448 20.061 20.671  1.00 65.11 ? 327  GLU A O     1 
ATOM   2668 C  CB    . GLU A 1 333 ? 51.937 17.145 21.427  0.50 66.02 ? 327  GLU A CB    1 
ATOM   2669 C  CG    . GLU A 1 333 ? 51.875 15.983 22.404  0.50 67.10 ? 327  GLU A CG    1 
ATOM   2670 C  CD    . GLU A 1 333 ? 52.586 14.747 21.882  0.50 68.06 ? 327  GLU A CD    1 
ATOM   2671 O  OE1   . GLU A 1 333 ? 52.503 13.686 22.538  0.50 69.23 ? 327  GLU A OE1   1 
ATOM   2672 O  OE2   . GLU A 1 333 ? 53.232 14.836 20.817  0.50 68.28 ? 327  GLU A OE2   1 
ATOM   2673 N  N     . ARG A 1 334 ? 50.309 19.775 20.082  1.00 63.38 ? 328  ARG A N     1 
ATOM   2674 C  CA    . ARG A 1 334 ? 50.406 20.770 19.015  1.00 62.10 ? 328  ARG A CA    1 
ATOM   2675 C  C     . ARG A 1 334 ? 50.711 22.171 19.510  1.00 60.73 ? 328  ARG A C     1 
ATOM   2676 O  O     . ARG A 1 334 ? 50.399 22.524 20.645  1.00 59.96 ? 328  ARG A O     1 
ATOM   2677 C  CB    . ARG A 1 334 ? 49.117 20.813 18.193  1.00 62.75 ? 328  ARG A CB    1 
ATOM   2678 C  CG    . ARG A 1 334 ? 48.797 19.521 17.480  1.00 63.35 ? 328  ARG A CG    1 
ATOM   2679 C  CD    . ARG A 1 334 ? 47.471 18.989 17.950  1.00 63.80 ? 328  ARG A CD    1 
ATOM   2680 N  NE    . ARG A 1 334 ? 46.399 19.237 16.995  1.00 64.44 ? 328  ARG A NE    1 
ATOM   2681 C  CZ    . ARG A 1 334 ? 45.110 19.218 17.317  1.00 65.57 ? 328  ARG A CZ    1 
ATOM   2682 N  NH1   . ARG A 1 334 ? 44.744 18.973 18.569  1.00 64.76 ? 328  ARG A NH1   1 
ATOM   2683 N  NH2   . ARG A 1 334 ? 44.186 19.417 16.386  1.00 66.10 ? 328  ARG A NH2   1 
ATOM   2684 N  N     . LYS A 1 335 ? 51.335 22.966 18.646  1.00 59.10 ? 329  LYS A N     1 
ATOM   2685 C  CA    . LYS A 1 335 ? 51.650 24.342 18.988  1.00 57.97 ? 329  LYS A CA    1 
ATOM   2686 C  C     . LYS A 1 335 ? 50.322 25.084 18.968  1.00 56.90 ? 329  LYS A C     1 
ATOM   2687 O  O     . LYS A 1 335 ? 49.316 24.553 18.491  1.00 56.02 ? 329  LYS A O     1 
ATOM   2688 C  CB    . LYS A 1 335 ? 52.588 24.959 17.944  1.00 59.10 ? 329  LYS A CB    1 
ATOM   2689 C  CG    . LYS A 1 335 ? 53.899 24.221 17.751  1.00 60.04 ? 329  LYS A CG    1 
ATOM   2690 C  CD    . LYS A 1 335 ? 54.790 24.942 16.751  1.00 61.49 ? 329  LYS A CD    1 
ATOM   2691 C  CE    . LYS A 1 335 ? 56.061 24.151 16.477  1.00 62.45 ? 329  LYS A CE    1 
ATOM   2692 N  NZ    . LYS A 1 335 ? 56.925 24.810 15.455  1.00 62.82 ? 329  LYS A NZ    1 
ATOM   2693 N  N     . ILE A 1 336 ? 50.304 26.305 19.490  1.00 54.69 ? 330  ILE A N     1 
ATOM   2694 C  CA    . ILE A 1 336 ? 49.078 27.086 19.479  1.00 51.34 ? 330  ILE A CA    1 
ATOM   2695 C  C     . ILE A 1 336 ? 49.264 28.229 18.495  1.00 49.83 ? 330  ILE A C     1 
ATOM   2696 O  O     . ILE A 1 336 ? 50.357 28.787 18.376  1.00 49.74 ? 330  ILE A O     1 
ATOM   2697 C  CB    . ILE A 1 336 ? 48.739 27.608 20.881  1.00 50.40 ? 330  ILE A CB    1 
ATOM   2698 C  CG1   . ILE A 1 336 ? 48.480 26.416 21.802  1.00 47.49 ? 330  ILE A CG1   1 
ATOM   2699 C  CG2   . ILE A 1 336 ? 47.517 28.519 20.830  1.00 49.43 ? 330  ILE A CG2   1 
ATOM   2700 C  CD1   . ILE A 1 336 ? 48.109 26.798 23.200  1.00 49.47 ? 330  ILE A CD1   1 
ATOM   2701 N  N     . ARG A 1 337 ? 48.195 28.553 17.775  1.00 48.08 ? 331  ARG A N     1 
ATOM   2702 C  CA    . ARG A 1 337 ? 48.220 29.607 16.773  1.00 46.90 ? 331  ARG A CA    1 
ATOM   2703 C  C     . ARG A 1 337 ? 47.404 30.835 17.184  1.00 46.80 ? 331  ARG A C     1 
ATOM   2704 O  O     . ARG A 1 337 ? 47.748 31.971 16.850  1.00 45.34 ? 331  ARG A O     1 
ATOM   2705 C  CB    . ARG A 1 337 ? 47.699 29.044 15.448  1.00 46.68 ? 331  ARG A CB    1 
ATOM   2706 C  CG    . ARG A 1 337 ? 47.265 30.098 14.452  1.00 47.82 ? 331  ARG A CG    1 
ATOM   2707 C  CD    . ARG A 1 337 ? 46.939 29.490 13.108  1.00 47.02 ? 331  ARG A CD    1 
ATOM   2708 N  NE    . ARG A 1 337 ? 46.560 30.516 12.146  1.00 47.42 ? 331  ARG A NE    1 
ATOM   2709 C  CZ    . ARG A 1 337 ? 46.681 30.381 10.832  1.00 46.91 ? 331  ARG A CZ    1 
ATOM   2710 N  NH1   . ARG A 1 337 ? 47.176 29.260 10.327  1.00 48.84 ? 331  ARG A NH1   1 
ATOM   2711 N  NH2   . ARG A 1 337 ? 46.304 31.358 10.021  1.00 45.90 ? 331  ARG A NH2   1 
ATOM   2712 N  N     . GLU A 1 338 ? 46.316 30.590 17.912  1.00 46.26 ? 332  GLU A N     1 
ATOM   2713 C  CA    . GLU A 1 338 ? 45.433 31.644 18.385  1.00 45.54 ? 332  GLU A CA    1 
ATOM   2714 C  C     . GLU A 1 338 ? 45.059 31.320 19.834  1.00 45.15 ? 332  GLU A C     1 
ATOM   2715 O  O     . GLU A 1 338 ? 44.808 30.161 20.174  1.00 45.93 ? 332  GLU A O     1 
ATOM   2716 C  CB    . GLU A 1 338 ? 44.173 31.691 17.512  1.00 47.01 ? 332  GLU A CB    1 
ATOM   2717 C  CG    . GLU A 1 338 ? 44.457 31.862 16.020  1.00 49.66 ? 332  GLU A CG    1 
ATOM   2718 C  CD    . GLU A 1 338 ? 43.201 31.814 15.156  1.00 52.76 ? 332  GLU A CD    1 
ATOM   2719 O  OE1   . GLU A 1 338 ? 42.283 32.634 15.376  1.00 53.10 ? 332  GLU A OE1   1 
ATOM   2720 O  OE2   . GLU A 1 338 ? 43.135 30.958 14.246  1.00 53.89 ? 332  GLU A OE2   1 
ATOM   2721 N  N     . ILE A 1 339 ? 45.035 32.333 20.695  1.00 42.15 ? 333  ILE A N     1 
ATOM   2722 C  CA    . ILE A 1 339 ? 44.685 32.103 22.094  1.00 39.49 ? 333  ILE A CA    1 
ATOM   2723 C  C     . ILE A 1 339 ? 43.623 33.109 22.502  1.00 37.77 ? 333  ILE A C     1 
ATOM   2724 O  O     . ILE A 1 339 ? 43.646 34.261 22.067  1.00 37.69 ? 333  ILE A O     1 
ATOM   2725 C  CB    . ILE A 1 339 ? 45.932 32.232 23.026  1.00 39.52 ? 333  ILE A CB    1 
ATOM   2726 C  CG1   . ILE A 1 339 ? 45.575 31.770 24.440  1.00 37.88 ? 333  ILE A CG1   1 
ATOM   2727 C  CG2   . ILE A 1 339 ? 46.441 33.665 23.054  1.00 37.44 ? 333  ILE A CG2   1 
ATOM   2728 C  CD1   . ILE A 1 339 ? 45.267 30.291 24.532  1.00 38.85 ? 333  ILE A CD1   1 
ATOM   2729 N  N     . GLY A 1 340 ? 42.673 32.670 23.316  1.00 35.12 ? 334  GLY A N     1 
ATOM   2730 C  CA    . GLY A 1 340 ? 41.626 33.577 23.734  1.00 34.74 ? 334  GLY A CA    1 
ATOM   2731 C  C     . GLY A 1 340 ? 40.925 33.130 24.994  1.00 33.81 ? 334  GLY A C     1 
ATOM   2732 O  O     . GLY A 1 340 ? 41.221 32.072 25.542  1.00 34.63 ? 334  GLY A O     1 
ATOM   2733 N  N     . VAL A 1 341 ? 39.988 33.943 25.452  1.00 33.37 ? 335  VAL A N     1 
ATOM   2734 C  CA    . VAL A 1 341 ? 39.247 33.617 26.649  1.00 33.31 ? 335  VAL A CA    1 
ATOM   2735 C  C     . VAL A 1 341 ? 37.799 34.014 26.491  1.00 33.61 ? 335  VAL A C     1 
ATOM   2736 O  O     . VAL A 1 341 ? 37.473 34.931 25.733  1.00 31.21 ? 335  VAL A O     1 
ATOM   2737 C  CB    . VAL A 1 341 ? 39.807 34.349 27.872  1.00 33.92 ? 335  VAL A CB    1 
ATOM   2738 C  CG1   . VAL A 1 341 ? 41.258 33.982 28.061  1.00 37.88 ? 335  VAL A CG1   1 
ATOM   2739 C  CG2   . VAL A 1 341 ? 39.659 35.855 27.696  1.00 32.60 ? 335  VAL A CG2   1 
ATOM   2740 N  N     . ARG A 1 342 ? 36.938 33.324 27.230  1.00 32.65 ? 336  ARG A N     1 
ATOM   2741 C  CA    . ARG A 1 342 ? 35.521 33.602 27.196  1.00 33.40 ? 336  ARG A CA    1 
ATOM   2742 C  C     . ARG A 1 342 ? 34.979 33.468 28.608  1.00 33.44 ? 336  ARG A C     1 
ATOM   2743 O  O     . ARG A 1 342 ? 35.360 32.558 29.353  1.00 33.55 ? 336  ARG A O     1 
ATOM   2744 C  CB    . ARG A 1 342 ? 34.818 32.629 26.240  1.00 33.15 ? 336  ARG A CB    1 
ATOM   2745 C  CG    . ARG A 1 342 ? 33.362 32.951 25.977  1.00 35.34 ? 336  ARG A CG    1 
ATOM   2746 C  CD    . ARG A 1 342 ? 32.902 32.295 24.667  1.00 39.59 ? 336  ARG A CD    1 
ATOM   2747 N  NE    . ARG A 1 342 ? 33.489 32.941 23.492  1.00 39.74 ? 336  ARG A NE    1 
ATOM   2748 C  CZ    . ARG A 1 342 ? 33.158 34.157 23.074  1.00 41.67 ? 336  ARG A CZ    1 
ATOM   2749 N  NH1   . ARG A 1 342 ? 32.240 34.861 23.724  1.00 41.51 ? 336  ARG A NH1   1 
ATOM   2750 N  NH2   . ARG A 1 342 ? 33.756 34.677 22.015  1.00 41.97 ? 336  ARG A NH2   1 
ATOM   2751 N  N     . PHE A 1 343 ? 34.084 34.389 28.955  1.00 33.68 ? 337  PHE A N     1 
ATOM   2752 C  CA    . PHE A 1 343 ? 33.461 34.458 30.266  1.00 34.59 ? 337  PHE A CA    1 
ATOM   2753 C  C     . PHE A 1 343 ? 31.960 34.255 30.150  1.00 36.58 ? 337  PHE A C     1 
ATOM   2754 O  O     . PHE A 1 343 ? 31.316 34.802 29.244  1.00 34.39 ? 337  PHE A O     1 
ATOM   2755 C  CB    . PHE A 1 343 ? 33.750 35.821 30.897  1.00 32.64 ? 337  PHE A CB    1 
ATOM   2756 C  CG    . PHE A 1 343 ? 35.205 36.050 31.196  1.00 34.09 ? 337  PHE A CG    1 
ATOM   2757 C  CD1   . PHE A 1 343 ? 35.801 35.460 32.314  1.00 32.12 ? 337  PHE A CD1   1 
ATOM   2758 C  CD2   . PHE A 1 343 ? 35.991 36.818 30.344  1.00 30.39 ? 337  PHE A CD2   1 
ATOM   2759 C  CE1   . PHE A 1 343 ? 37.160 35.630 32.576  1.00 34.06 ? 337  PHE A CE1   1 
ATOM   2760 C  CE2   . PHE A 1 343 ? 37.351 36.992 30.598  1.00 34.57 ? 337  PHE A CE2   1 
ATOM   2761 C  CZ    . PHE A 1 343 ? 37.940 36.399 31.714  1.00 34.91 ? 337  PHE A CZ    1 
ATOM   2762 N  N     . SER A 1 344 ? 31.404 33.474 31.074  1.00 36.93 ? 338  SER A N     1 
ATOM   2763 C  CA    . SER A 1 344 ? 29.975 33.197 31.060  1.00 40.43 ? 338  SER A CA    1 
ATOM   2764 C  C     . SER A 1 344 ? 29.379 32.915 32.441  1.00 42.83 ? 338  SER A C     1 
ATOM   2765 O  O     . SER A 1 344 ? 30.089 32.903 33.455  1.00 41.55 ? 338  SER A O     1 
ATOM   2766 C  CB    . SER A 1 344 ? 29.677 32.021 30.121  1.00 39.37 ? 338  SER A CB    1 
ATOM   2767 O  OG    . SER A 1 344 ? 30.294 30.822 30.558  1.00 36.79 ? 338  SER A OG    1 
ATOM   2768 N  N     . LYS A 1 345 ? 28.069 32.680 32.450  1.00 44.37 ? 339  LYS A N     1 
ATOM   2769 C  CA    . LYS A 1 345 ? 27.313 32.412 33.665  1.00 48.71 ? 339  LYS A CA    1 
ATOM   2770 C  C     . LYS A 1 345 ? 27.347 33.683 34.506  1.00 50.61 ? 339  LYS A C     1 
ATOM   2771 O  O     . LYS A 1 345 ? 27.917 33.732 35.600  1.00 50.93 ? 339  LYS A O     1 
ATOM   2772 C  CB    . LYS A 1 345 ? 27.914 31.217 34.415  1.00 49.51 ? 339  LYS A CB    1 
ATOM   2773 C  CG    . LYS A 1 345 ? 27.955 29.957 33.559  1.00 50.46 ? 339  LYS A CG    1 
ATOM   2774 C  CD    . LYS A 1 345 ? 28.119 28.692 34.395  1.00 53.07 ? 339  LYS A CD    1 
ATOM   2775 C  CE    . LYS A 1 345 ? 28.163 27.447 33.511  1.00 52.14 ? 339  LYS A CE    1 
ATOM   2776 N  NZ    . LYS A 1 345 ? 28.250 26.207 34.320  1.00 51.74 ? 339  LYS A NZ    1 
ATOM   2777 N  N     . PHE A 1 346 ? 26.723 34.718 33.959  1.00 52.03 ? 340  PHE A N     1 
ATOM   2778 C  CA    . PHE A 1 346 ? 26.675 36.015 34.595  1.00 54.20 ? 340  PHE A CA    1 
ATOM   2779 C  C     . PHE A 1 346 ? 25.747 36.078 35.796  1.00 55.53 ? 340  PHE A C     1 
ATOM   2780 O  O     . PHE A 1 346 ? 24.664 35.500 35.795  1.00 55.26 ? 340  PHE A O     1 
ATOM   2781 C  CB    . PHE A 1 346 ? 26.244 37.069 33.578  1.00 54.89 ? 340  PHE A CB    1 
ATOM   2782 C  CG    . PHE A 1 346 ? 27.089 37.103 32.338  1.00 55.90 ? 340  PHE A CG    1 
ATOM   2783 C  CD1   . PHE A 1 346 ? 28.462 36.880 32.405  1.00 56.09 ? 340  PHE A CD1   1 
ATOM   2784 C  CD2   . PHE A 1 346 ? 26.523 37.420 31.109  1.00 55.31 ? 340  PHE A CD2   1 
ATOM   2785 C  CE1   . PHE A 1 346 ? 29.260 36.976 31.262  1.00 56.71 ? 340  PHE A CE1   1 
ATOM   2786 C  CE2   . PHE A 1 346 ? 27.312 37.520 29.963  1.00 56.20 ? 340  PHE A CE2   1 
ATOM   2787 C  CZ    . PHE A 1 346 ? 28.682 37.299 30.041  1.00 55.53 ? 340  PHE A CZ    1 
ATOM   2788 N  N     . ILE A 1 347 ? 26.186 36.794 36.822  1.00 56.89 ? 341  ILE A N     1 
ATOM   2789 C  CA    . ILE A 1 347 ? 25.393 36.978 38.030  1.00 58.40 ? 341  ILE A CA    1 
ATOM   2790 C  C     . ILE A 1 347 ? 24.246 37.926 37.691  1.00 58.97 ? 341  ILE A C     1 
ATOM   2791 O  O     . ILE A 1 347 ? 24.541 39.039 37.211  1.00 59.64 ? 341  ILE A O     1 
ATOM   2792 C  CB    . ILE A 1 347 ? 26.253 37.597 39.148  1.00 57.84 ? 341  ILE A CB    1 
ATOM   2793 C  CG1   . ILE A 1 347 ? 27.297 36.576 39.614  1.00 58.67 ? 341  ILE A CG1   1 
ATOM   2794 C  CG2   . ILE A 1 347 ? 25.373 38.062 40.287  1.00 57.90 ? 341  ILE A CG2   1 
ATOM   2795 C  CD1   . ILE A 1 347 ? 28.366 37.157 40.530  1.00 60.20 ? 341  ILE A CD1   1 
ATOM   2796 N  N     . GLU A 1 348 ? 23.071 37.555 37.900  1.00 60.20 ? 342  GLU A N     1 
ATOM   2797 O  "O5'" . DG  B 2 1   ? 15.717 1.273  34.462  1.00 57.13 ? 1    DG  P "O5'" 1 
ATOM   2798 C  "C5'" . DG  B 2 1   ? 16.445 1.756  35.581  1.00 53.92 ? 1    DG  P "C5'" 1 
ATOM   2799 C  "C4'" . DG  B 2 1   ? 15.765 3.008  36.076  1.00 52.30 ? 1    DG  P "C4'" 1 
ATOM   2800 O  "O4'" . DG  B 2 1   ? 16.363 3.436  37.320  1.00 51.00 ? 1    DG  P "O4'" 1 
ATOM   2801 C  "C3'" . DG  B 2 1   ? 15.985 4.145  35.075  1.00 52.74 ? 1    DG  P "C3'" 1 
ATOM   2802 O  "O3'" . DG  B 2 1   ? 14.785 4.923  34.976  1.00 56.99 ? 1    DG  P "O3'" 1 
ATOM   2803 C  "C2'" . DG  B 2 1   ? 17.136 4.933  35.679  1.00 50.35 ? 1    DG  P "C2'" 1 
ATOM   2804 C  "C1'" . DG  B 2 1   ? 16.977 4.707  37.177  1.00 47.88 ? 1    DG  P "C1'" 1 
ATOM   2805 N  N9    . DG  B 2 1   ? 18.238 4.666  37.919  1.00 44.94 ? 1    DG  P N9    1 
ATOM   2806 C  C8    . DG  B 2 1   ? 19.377 3.980  37.572  1.00 41.98 ? 1    DG  P C8    1 
ATOM   2807 N  N7    . DG  B 2 1   ? 20.346 4.128  38.432  1.00 42.77 ? 1    DG  P N7    1 
ATOM   2808 C  C5    . DG  B 2 1   ? 19.819 4.961  39.410  1.00 40.85 ? 1    DG  P C5    1 
ATOM   2809 C  C6    . DG  B 2 1   ? 20.404 5.467  40.604  1.00 40.05 ? 1    DG  P C6    1 
ATOM   2810 O  O6    . DG  B 2 1   ? 21.538 5.268  41.054  1.00 40.14 ? 1    DG  P O6    1 
ATOM   2811 N  N1    . DG  B 2 1   ? 19.517 6.277  41.302  1.00 39.18 ? 1    DG  P N1    1 
ATOM   2812 C  C2    . DG  B 2 1   ? 18.236 6.567  40.913  1.00 39.83 ? 1    DG  P C2    1 
ATOM   2813 N  N2    . DG  B 2 1   ? 17.546 7.379  41.727  1.00 39.89 ? 1    DG  P N2    1 
ATOM   2814 N  N3    . DG  B 2 1   ? 17.674 6.096  39.806  1.00 41.81 ? 1    DG  P N3    1 
ATOM   2815 C  C4    . DG  B 2 1   ? 18.518 5.305  39.108  1.00 42.50 ? 1    DG  P C4    1 
ATOM   2816 P  P     . DG  B 2 2   ? 14.683 6.120  33.906  1.00 59.54 ? 2    DG  P P     1 
ATOM   2817 O  OP1   . DG  B 2 2   ? 13.285 6.142  33.421  1.00 59.81 ? 2    DG  P OP1   1 
ATOM   2818 O  OP2   . DG  B 2 2   ? 15.793 6.023  32.931  1.00 59.71 ? 2    DG  P OP2   1 
ATOM   2819 O  "O5'" . DG  B 2 2   ? 14.956 7.421  34.810  1.00 58.55 ? 2    DG  P "O5'" 1 
ATOM   2820 C  "C5'" . DG  B 2 2   ? 14.265 7.569  36.052  1.00 59.50 ? 2    DG  P "C5'" 1 
ATOM   2821 C  "C4'" . DG  B 2 2   ? 14.882 8.686  36.853  1.00 59.92 ? 2    DG  P "C4'" 1 
ATOM   2822 O  "O4'" . DG  B 2 2   ? 16.141 8.266  37.436  1.00 58.49 ? 2    DG  P "O4'" 1 
ATOM   2823 C  "C3'" . DG  B 2 2   ? 15.219 9.826  35.888  1.00 62.54 ? 2    DG  P "C3'" 1 
ATOM   2824 O  "O3'" . DG  B 2 2   ? 14.942 11.084 36.501  1.00 69.44 ? 2    DG  P "O3'" 1 
ATOM   2825 C  "C2'" . DG  B 2 2   ? 16.718 9.682  35.688  1.00 58.65 ? 2    DG  P "C2'" 1 
ATOM   2826 C  "C1'" . DG  B 2 2   ? 17.133 9.206  37.062  1.00 55.38 ? 2    DG  P "C1'" 1 
ATOM   2827 N  N9    . DG  B 2 2   ? 18.445 8.573  37.155  1.00 49.18 ? 2    DG  P N9    1 
ATOM   2828 C  C8    . DG  B 2 2   ? 19.055 7.754  36.240  1.00 48.75 ? 2    DG  P C8    1 
ATOM   2829 N  N7    . DG  B 2 2   ? 20.254 7.387  36.603  1.00 46.62 ? 2    DG  P N7    1 
ATOM   2830 C  C5    . DG  B 2 2   ? 20.441 7.995  37.836  1.00 44.75 ? 2    DG  P C5    1 
ATOM   2831 C  C6    . DG  B 2 2   ? 21.555 7.979  38.716  1.00 43.53 ? 2    DG  P C6    1 
ATOM   2832 O  O6    . DG  B 2 2   ? 22.650 7.409  38.580  1.00 42.63 ? 2    DG  P O6    1 
ATOM   2833 N  N1    . DG  B 2 2   ? 21.310 8.731  39.858  1.00 43.46 ? 2    DG  P N1    1 
ATOM   2834 C  C2    . DG  B 2 2   ? 20.153 9.411  40.120  1.00 43.34 ? 2    DG  P C2    1 
ATOM   2835 N  N2    . DG  B 2 2   ? 20.109 10.076 41.281  1.00 45.53 ? 2    DG  P N2    1 
ATOM   2836 N  N3    . DG  B 2 2   ? 19.118 9.440  39.312  1.00 46.05 ? 2    DG  P N3    1 
ATOM   2837 C  C4    . DG  B 2 2   ? 19.328 8.718  38.195  1.00 46.04 ? 2    DG  P C4    1 
ATOM   2838 P  P     . DG  B 2 3   ? 14.622 12.365 35.584  1.00 73.61 ? 3    DG  P P     1 
ATOM   2839 O  OP1   . DG  B 2 3   ? 13.224 12.236 35.114  1.00 73.27 ? 3    DG  P OP1   1 
ATOM   2840 O  OP2   . DG  B 2 3   ? 15.713 12.540 34.600  1.00 72.91 ? 3    DG  P OP2   1 
ATOM   2841 O  "O5'" . DG  B 2 3   ? 14.733 13.583 36.628  1.00 73.59 ? 3    DG  P "O5'" 1 
ATOM   2842 C  "C5'" . DG  B 2 3   ? 14.294 13.402 37.976  1.00 74.96 ? 3    DG  P "C5'" 1 
ATOM   2843 C  "C4'" . DG  B 2 3   ? 15.195 14.167 38.912  1.00 75.74 ? 3    DG  P "C4'" 1 
ATOM   2844 O  "O4'" . DG  B 2 3   ? 16.449 13.466 39.095  1.00 75.42 ? 3    DG  P "O4'" 1 
ATOM   2845 C  "C3'" . DG  B 2 3   ? 15.544 15.497 38.239  1.00 77.01 ? 3    DG  P "C3'" 1 
ATOM   2846 O  "O3'" . DG  B 2 3   ? 15.542 16.559 39.190  1.00 79.56 ? 3    DG  P "O3'" 1 
ATOM   2847 C  "C2'" . DG  B 2 3   ? 16.945 15.266 37.692  1.00 75.04 ? 3    DG  P "C2'" 1 
ATOM   2848 C  "C1'" . DG  B 2 3   ? 17.523 14.315 38.721  1.00 73.55 ? 3    DG  P "C1'" 1 
ATOM   2849 N  N9    . DG  B 2 3   ? 18.617 13.475 38.242  1.00 70.53 ? 3    DG  P N9    1 
ATOM   2850 C  C8    . DG  B 2 3   ? 18.634 12.698 37.109  1.00 70.04 ? 3    DG  P C8    1 
ATOM   2851 N  N7    . DG  B 2 3   ? 19.752 12.044 36.955  1.00 68.36 ? 3    DG  P N7    1 
ATOM   2852 C  C5    . DG  B 2 3   ? 20.522 12.413 38.048  1.00 67.16 ? 3    DG  P C5    1 
ATOM   2853 C  C6    . DG  B 2 3   ? 21.832 12.019 38.423  1.00 66.49 ? 3    DG  P C6    1 
ATOM   2854 O  O6    . DG  B 2 3   ? 22.594 11.236 37.848  1.00 65.41 ? 3    DG  P O6    1 
ATOM   2855 N  N1    . DG  B 2 3   ? 22.235 12.639 39.601  1.00 65.60 ? 3    DG  P N1    1 
ATOM   2856 C  C2    . DG  B 2 3   ? 21.473 13.520 40.329  1.00 66.43 ? 3    DG  P C2    1 
ATOM   2857 N  N2    . DG  B 2 3   ? 22.040 14.015 41.436  1.00 67.72 ? 3    DG  P N2    1 
ATOM   2858 N  N3    . DG  B 2 3   ? 20.248 13.890 39.995  1.00 67.40 ? 3    DG  P N3    1 
ATOM   2859 C  C4    . DG  B 2 3   ? 19.839 13.301 38.850  1.00 68.34 ? 3    DG  P C4    1 
ATOM   2860 P  P     . DG  B 2 4   ? 15.837 18.056 38.700  1.00 81.20 ? 4    DG  P P     1 
ATOM   2861 O  OP1   . DG  B 2 4   ? 15.285 18.952 39.742  1.00 81.37 ? 4    DG  P OP1   1 
ATOM   2862 O  OP2   . DG  B 2 4   ? 15.383 18.197 37.298  1.00 80.66 ? 4    DG  P OP2   1 
ATOM   2863 O  "O5'" . DG  B 2 4   ? 17.445 18.138 38.714  1.00 82.13 ? 4    DG  P "O5'" 1 
ATOM   2864 C  "C5'" . DG  B 2 4   ? 18.121 18.396 39.948  1.00 81.41 ? 4    DG  P "C5'" 1 
ATOM   2865 C  "C4'" . DG  B 2 4   ? 19.526 18.896 39.707  1.00 80.45 ? 4    DG  P "C4'" 1 
ATOM   2866 O  "O4'" . DG  B 2 4   ? 20.407 17.803 39.340  1.00 78.96 ? 4    DG  P "O4'" 1 
ATOM   2867 C  "C3'" . DG  B 2 4   ? 19.524 19.870 38.526  1.00 80.84 ? 4    DG  P "C3'" 1 
ATOM   2868 O  "O3'" . DG  B 2 4   ? 20.396 20.977 38.786  1.00 83.43 ? 4    DG  P "O3'" 1 
ATOM   2869 C  "C2'" . DG  B 2 4   ? 20.070 19.034 37.384  1.00 78.46 ? 4    DG  P "C2'" 1 
ATOM   2870 C  "C1'" . DG  B 2 4   ? 21.036 18.115 38.111  1.00 76.25 ? 4    DG  P "C1'" 1 
ATOM   2871 N  N9    . DG  B 2 4   ? 21.341 16.869 37.411  1.00 72.45 ? 4    DG  P N9    1 
ATOM   2872 C  C8    . DG  B 2 4   ? 20.574 16.243 36.456  1.00 71.49 ? 4    DG  P C8    1 
ATOM   2873 N  N7    . DG  B 2 4   ? 21.149 15.189 35.946  1.00 68.94 ? 4    DG  P N7    1 
ATOM   2874 C  C5    . DG  B 2 4   ? 22.360 15.101 36.618  1.00 68.12 ? 4    DG  P C5    1 
ATOM   2875 C  C6    . DG  B 2 4   ? 23.416 14.170 36.480  1.00 65.85 ? 4    DG  P C6    1 
ATOM   2876 O  O6    . DG  B 2 4   ? 23.507 13.225 35.695  1.00 64.30 ? 4    DG  P O6    1 
ATOM   2877 N  N1    . DG  B 2 4   ? 24.452 14.435 37.371  1.00 65.17 ? 4    DG  P N1    1 
ATOM   2878 C  C2    . DG  B 2 4   ? 24.472 15.474 38.270  1.00 67.41 ? 4    DG  P C2    1 
ATOM   2879 N  N2    . DG  B 2 4   ? 25.560 15.561 39.052  1.00 65.40 ? 4    DG  P N2    1 
ATOM   2880 N  N3    . DG  B 2 4   ? 23.497 16.363 38.397  1.00 68.48 ? 4    DG  P N3    1 
ATOM   2881 C  C4    . DG  B 2 4   ? 22.480 16.116 37.545  1.00 69.44 ? 4    DG  P C4    1 
ATOM   2882 P  P     . DG  B 2 5   ? 20.302 22.304 37.876  1.00 85.19 ? 5    DG  P P     1 
ATOM   2883 O  OP1   . DG  B 2 5   ? 19.806 23.391 38.749  1.00 85.69 ? 5    DG  P OP1   1 
ATOM   2884 O  OP2   . DG  B 2 5   ? 19.580 21.980 36.625  1.00 83.99 ? 5    DG  P OP2   1 
ATOM   2885 O  "O5'" . DG  B 2 5   ? 21.838 22.580 37.483  1.00 82.79 ? 5    DG  P "O5'" 1 
ATOM   2886 C  "C5'" . DG  B 2 5   ? 22.647 21.450 37.156  1.00 80.16 ? 5    DG  P "C5'" 1 
ATOM   2887 C  "C4'" . DG  B 2 5   ? 23.976 21.495 37.865  1.00 78.27 ? 5    DG  P "C4'" 1 
ATOM   2888 O  "O4'" . DG  B 2 5   ? 24.527 20.163 37.849  1.00 76.71 ? 5    DG  P "O4'" 1 
ATOM   2889 C  "C3'" . DG  B 2 5   ? 24.944 22.364 37.060  1.00 77.59 ? 5    DG  P "C3'" 1 
ATOM   2890 O  "O3'" . DG  B 2 5   ? 25.919 22.965 37.921  1.00 77.97 ? 5    DG  P "O3'" 1 
ATOM   2891 C  "C2'" . DG  B 2 5   ? 25.563 21.377 36.087  1.00 76.67 ? 5    DG  P "C2'" 1 
ATOM   2892 C  "C1'" . DG  B 2 5   ? 25.472 20.025 36.800  1.00 75.41 ? 5    DG  P "C1'" 1 
ATOM   2893 N  N9    . DG  B 2 5   ? 24.998 18.944 35.938  1.00 72.90 ? 5    DG  P N9    1 
ATOM   2894 C  C8    . DG  B 2 5   ? 23.754 18.831 35.362  1.00 71.56 ? 5    DG  P C8    1 
ATOM   2895 N  N7    . DG  B 2 5   ? 23.624 17.763 34.624  1.00 69.74 ? 5    DG  P N7    1 
ATOM   2896 C  C5    . DG  B 2 5   ? 24.857 17.129 34.719  1.00 69.63 ? 5    DG  P C5    1 
ATOM   2897 C  C6    . DG  B 2 5   ? 25.324 15.929 34.121  1.00 68.00 ? 5    DG  P C6    1 
ATOM   2898 O  O6    . DG  B 2 5   ? 24.726 15.168 33.358  1.00 67.45 ? 5    DG  P O6    1 
ATOM   2899 N  N1    . DG  B 2 5   ? 26.636 15.650 34.487  1.00 67.51 ? 5    DG  P N1    1 
ATOM   2900 C  C2    . DG  B 2 5   ? 27.405 16.429 35.319  1.00 68.44 ? 5    DG  P C2    1 
ATOM   2901 N  N2    . DG  B 2 5   ? 28.648 15.994 35.556  1.00 66.31 ? 5    DG  P N2    1 
ATOM   2902 N  N3    . DG  B 2 5   ? 26.986 17.553 35.877  1.00 69.46 ? 5    DG  P N3    1 
ATOM   2903 C  C4    . DG  B 2 5   ? 25.712 17.841 35.535  1.00 70.79 ? 5    DG  P C4    1 
ATOM   2904 P  P     . DA  B 2 6   ? 26.917 24.087 37.341  1.00 78.32 ? 6    DA  P P     1 
ATOM   2905 O  OP1   . DA  B 2 6   ? 27.433 24.851 38.499  1.00 77.11 ? 6    DA  P OP1   1 
ATOM   2906 O  OP2   . DA  B 2 6   ? 26.223 24.802 36.246  1.00 78.51 ? 6    DA  P OP2   1 
ATOM   2907 O  "O5'" . DA  B 2 6   ? 28.113 23.226 36.694  1.00 73.71 ? 6    DA  P "O5'" 1 
ATOM   2908 C  "C5'" . DA  B 2 6   ? 28.983 22.495 37.560  1.00 67.64 ? 6    DA  P "C5'" 1 
ATOM   2909 C  "C4'" . DA  B 2 6   ? 29.965 21.654 36.780  1.00 64.79 ? 6    DA  P "C4'" 1 
ATOM   2910 O  "O4'" . DA  B 2 6   ? 29.279 20.631 36.022  1.00 63.55 ? 6    DA  P "O4'" 1 
ATOM   2911 C  "C3'" . DA  B 2 6   ? 30.729 22.499 35.757  1.00 63.05 ? 6    DA  P "C3'" 1 
ATOM   2912 O  "O3'" . DA  B 2 6   ? 32.095 22.088 35.751  1.00 60.62 ? 6    DA  P "O3'" 1 
ATOM   2913 C  "C2'" . DA  B 2 6   ? 30.079 22.124 34.435  1.00 62.91 ? 6    DA  P "C2'" 1 
ATOM   2914 C  "C1'" . DA  B 2 6   ? 29.730 20.672 34.681  1.00 61.24 ? 6    DA  P "C1'" 1 
ATOM   2915 N  N9    . DA  B 2 6   ? 28.679 20.108 33.837  1.00 59.15 ? 6    DA  P N9    1 
ATOM   2916 C  C8    . DA  B 2 6   ? 27.419 20.599 33.606  1.00 59.39 ? 6    DA  P C8    1 
ATOM   2917 N  N7    . DA  B 2 6   ? 26.689 19.836 32.827  1.00 58.05 ? 6    DA  P N7    1 
ATOM   2918 C  C5    . DA  B 2 6   ? 27.527 18.776 32.515  1.00 57.13 ? 6    DA  P C5    1 
ATOM   2919 C  C6    . DA  B 2 6   ? 27.349 17.625 31.727  1.00 55.57 ? 6    DA  P C6    1 
ATOM   2920 N  N6    . DA  B 2 6   ? 26.224 17.340 31.069  1.00 54.10 ? 6    DA  P N6    1 
ATOM   2921 N  N1    . DA  B 2 6   ? 28.383 16.764 31.630  1.00 55.33 ? 6    DA  P N1    1 
ATOM   2922 C  C2    . DA  B 2 6   ? 29.520 17.056 32.272  1.00 56.08 ? 6    DA  P C2    1 
ATOM   2923 N  N3    . DA  B 2 6   ? 29.813 18.106 33.036  1.00 57.11 ? 6    DA  P N3    1 
ATOM   2924 C  C4    . DA  B 2 6   ? 28.761 18.936 33.122  1.00 57.68 ? 6    DA  P C4    1 
ATOM   2925 P  P     . DA  B 2 7   ? 33.215 23.055 35.132  1.00 60.75 ? 7    DA  P P     1 
ATOM   2926 O  OP1   . DA  B 2 7   ? 34.240 23.259 36.180  1.00 59.24 ? 7    DA  P OP1   1 
ATOM   2927 O  OP2   . DA  B 2 7   ? 32.538 24.227 34.533  1.00 59.61 ? 7    DA  P OP2   1 
ATOM   2928 O  "O5'" . DA  B 2 7   ? 33.844 22.172 33.941  1.00 58.59 ? 7    DA  P "O5'" 1 
ATOM   2929 C  "C5'" . DA  B 2 7   ? 34.459 20.922 34.259  1.00 56.75 ? 7    DA  P "C5'" 1 
ATOM   2930 C  "C4'" . DA  B 2 7   ? 34.684 20.079 33.027  1.00 54.66 ? 7    DA  P "C4'" 1 
ATOM   2931 O  "O4'" . DA  B 2 7   ? 33.427 19.639 32.465  1.00 54.63 ? 7    DA  P "O4'" 1 
ATOM   2932 C  "C3'" . DA  B 2 7   ? 35.374 20.892 31.931  1.00 55.33 ? 7    DA  P "C3'" 1 
ATOM   2933 O  "O3'" . DA  B 2 7   ? 36.383 20.098 31.319  1.00 54.97 ? 7    DA  P "O3'" 1 
ATOM   2934 C  "C2'" . DA  B 2 7   ? 34.264 21.172 30.931  1.00 54.45 ? 7    DA  P "C2'" 1 
ATOM   2935 C  "C1'" . DA  B 2 7   ? 33.393 19.940 31.079  1.00 52.83 ? 7    DA  P "C1'" 1 
ATOM   2936 N  N9    . DA  B 2 7   ? 31.987 20.094 30.697  1.00 51.13 ? 7    DA  P N9    1 
ATOM   2937 C  C8    . DA  B 2 7   ? 31.122 21.091 31.066  1.00 50.30 ? 7    DA  P C8    1 
ATOM   2938 N  N7    . DA  B 2 7   ? 29.901 20.925 30.624  1.00 49.96 ? 7    DA  P N7    1 
ATOM   2939 C  C5    . DA  B 2 7   ? 29.967 19.744 29.898  1.00 48.58 ? 7    DA  P C5    1 
ATOM   2940 C  C6    . DA  B 2 7   ? 28.998 19.016 29.182  1.00 47.21 ? 7    DA  P C6    1 
ATOM   2941 N  N6    . DA  B 2 7   ? 27.717 19.389 29.082  1.00 43.34 ? 7    DA  P N6    1 
ATOM   2942 N  N1    . DA  B 2 7   ? 29.392 17.874 28.568  1.00 46.11 ? 7    DA  P N1    1 
ATOM   2943 C  C2    . DA  B 2 7   ? 30.672 17.506 28.671  1.00 45.68 ? 7    DA  P C2    1 
ATOM   2944 N  N3    . DA  B 2 7   ? 31.677 18.106 29.316  1.00 49.62 ? 7    DA  P N3    1 
ATOM   2945 C  C4    . DA  B 2 7   ? 31.252 19.231 29.918  1.00 48.38 ? 7    DA  P C4    1 
ATOM   2946 P  P     . DG  B 2 8   ? 37.516 20.811 30.443  1.00 58.28 ? 8    DG  P P     1 
ATOM   2947 O  OP1   . DG  B 2 8   ? 38.806 20.210 30.849  1.00 59.48 ? 8    DG  P OP1   1 
ATOM   2948 O  OP2   . DG  B 2 8   ? 37.324 22.275 30.548  1.00 58.57 ? 8    DG  P OP2   1 
ATOM   2949 O  "O5'" . DG  B 2 8   ? 37.166 20.364 28.938  1.00 56.58 ? 8    DG  P "O5'" 1 
ATOM   2950 C  "C5'" . DG  B 2 8   ? 37.380 19.002 28.560  1.00 54.94 ? 8    DG  P "C5'" 1 
ATOM   2951 C  "C4'" . DG  B 2 8   ? 36.754 18.685 27.223  1.00 53.62 ? 8    DG  P "C4'" 1 
ATOM   2952 O  "O4'" . DG  B 2 8   ? 35.314 18.847 27.281  1.00 51.54 ? 8    DG  P "O4'" 1 
ATOM   2953 C  "C3'" . DG  B 2 8   ? 37.259 19.641 26.140  1.00 53.12 ? 8    DG  P "C3'" 1 
ATOM   2954 O  "O3'" . DG  B 2 8   ? 37.674 18.879 25.004  1.00 53.26 ? 8    DG  P "O3'" 1 
ATOM   2955 C  "C2'" . DG  B 2 8   ? 36.048 20.513 25.827  1.00 51.13 ? 8    DG  P "C2'" 1 
ATOM   2956 C  "C1'" . DG  B 2 8   ? 34.880 19.601 26.164  1.00 50.71 ? 8    DG  P "C1'" 1 
ATOM   2957 N  N9    . DG  B 2 8   ? 33.632 20.274 26.524  1.00 48.52 ? 8    DG  P N9    1 
ATOM   2958 C  C8    . DG  B 2 8   ? 33.489 21.408 27.289  1.00 48.94 ? 8    DG  P C8    1 
ATOM   2959 N  N7    . DG  B 2 8   ? 32.244 21.787 27.421  1.00 47.67 ? 8    DG  P N7    1 
ATOM   2960 C  C5    . DG  B 2 8   ? 31.519 20.843 26.708  1.00 47.60 ? 8    DG  P C5    1 
ATOM   2961 C  C6    . DG  B 2 8   ? 30.117 20.735 26.484  1.00 48.05 ? 8    DG  P C6    1 
ATOM   2962 O  O6    . DG  B 2 8   ? 29.209 21.476 26.887  1.00 50.39 ? 8    DG  P O6    1 
ATOM   2963 N  N1    . DG  B 2 8   ? 29.808 19.628 25.703  1.00 46.32 ? 8    DG  P N1    1 
ATOM   2964 C  C2    . DG  B 2 8   ? 30.723 18.735 25.205  1.00 47.95 ? 8    DG  P C2    1 
ATOM   2965 N  N2    . DG  B 2 8   ? 30.221 17.715 24.496  1.00 48.57 ? 8    DG  P N2    1 
ATOM   2966 N  N3    . DG  B 2 8   ? 32.032 18.828 25.396  1.00 47.57 ? 8    DG  P N3    1 
ATOM   2967 C  C4    . DG  B 2 8   ? 32.357 19.898 26.152  1.00 47.83 ? 8    DG  P C4    1 
ATOM   2968 P  P     . DG  B 2 9   ? 38.248 19.622 23.698  1.00 55.47 ? 9    DG  P P     1 
ATOM   2969 O  OP1   . DG  B 2 9   ? 39.528 18.961 23.355  1.00 55.46 ? 9    DG  P OP1   1 
ATOM   2970 O  OP2   . DG  B 2 9   ? 38.221 21.088 23.899  1.00 53.94 ? 9    DG  P OP2   1 
ATOM   2971 O  "O5'" . DG  B 2 9   ? 37.135 19.244 22.598  1.00 54.37 ? 9    DG  P "O5'" 1 
ATOM   2972 C  "C5'" . DG  B 2 9   ? 36.515 17.959 22.690  1.00 52.28 ? 9    DG  P "C5'" 1 
ATOM   2973 C  "C4'" . DG  B 2 9   ? 35.215 17.896 21.926  1.00 50.94 ? 9    DG  P "C4'" 1 
ATOM   2974 O  "O4'" . DG  B 2 9   ? 34.142 18.598 22.597  1.00 50.33 ? 9    DG  P "O4'" 1 
ATOM   2975 C  "C3'" . DG  B 2 9   ? 35.351 18.534 20.542  1.00 50.67 ? 9    DG  P "C3'" 1 
ATOM   2976 O  "O3'" . DG  B 2 9   ? 34.747 17.654 19.602  1.00 52.84 ? 9    DG  P "O3'" 1 
ATOM   2977 C  "C2'" . DG  B 2 9   ? 34.540 19.816 20.656  1.00 47.95 ? 9    DG  P "C2'" 1 
ATOM   2978 C  "C1'" . DG  B 2 9   ? 33.468 19.407 21.649  1.00 48.34 ? 9    DG  P "C1'" 1 
ATOM   2979 N  N9    . DG  B 2 9   ? 32.794 20.486 22.373  1.00 45.85 ? 9    DG  P N9    1 
ATOM   2980 C  C8    . DG  B 2 9   ? 33.371 21.446 23.170  1.00 44.39 ? 9    DG  P C8    1 
ATOM   2981 N  N7    . DG  B 2 9   ? 32.499 22.267 23.697  1.00 43.33 ? 9    DG  P N7    1 
ATOM   2982 C  C5    . DG  B 2 9   ? 31.273 21.822 23.218  1.00 41.51 ? 9    DG  P C5    1 
ATOM   2983 C  C6    . DG  B 2 9   ? 29.956 22.312 23.450  1.00 39.97 ? 9    DG  P C6    1 
ATOM   2984 O  O6    . DG  B 2 9   ? 29.600 23.256 24.155  1.00 37.95 ? 9    DG  P O6    1 
ATOM   2985 N  N1    . DG  B 2 9   ? 29.003 21.572 22.759  1.00 40.78 ? 9    DG  P N1    1 
ATOM   2986 C  C2    . DG  B 2 9   ? 29.275 20.498 21.953  1.00 42.16 ? 9    DG  P C2    1 
ATOM   2987 N  N2    . DG  B 2 9   ? 28.214 19.925 21.361  1.00 44.62 ? 9    DG  P N2    1 
ATOM   2988 N  N3    . DG  B 2 9   ? 30.495 20.021 21.735  1.00 43.86 ? 9    DG  P N3    1 
ATOM   2989 C  C4    . DG  B 2 9   ? 31.438 20.729 22.394  1.00 43.18 ? 9    DG  P C4    1 
ATOM   2990 P  P     . DA  B 2 10  ? 34.962 17.892 18.037  1.00 51.58 ? 10   DA  P P     1 
ATOM   2991 O  OP1   . DA  B 2 10  ? 35.597 16.668 17.499  1.00 54.92 ? 10   DA  P OP1   1 
ATOM   2992 O  OP2   . DA  B 2 10  ? 35.609 19.204 17.815  1.00 53.05 ? 10   DA  P OP2   1 
ATOM   2993 O  "O5'" . DA  B 2 10  ? 33.440 17.982 17.525  1.00 49.83 ? 10   DA  P "O5'" 1 
ATOM   2994 C  "C5'" . DA  B 2 10  ? 32.501 17.013 17.998  1.00 46.91 ? 10   DA  P "C5'" 1 
ATOM   2995 C  "C4'" . DA  B 2 10  ? 31.099 17.340 17.546  1.00 43.93 ? 10   DA  P "C4'" 1 
ATOM   2996 O  "O4'" . DA  B 2 10  ? 30.552 18.431 18.316  1.00 43.06 ? 10   DA  P "O4'" 1 
ATOM   2997 C  "C3'" . DA  B 2 10  ? 31.112 17.807 16.089  1.00 42.53 ? 10   DA  P "C3'" 1 
ATOM   2998 O  "O3'" . DA  B 2 10  ? 29.941 17.304 15.439  1.00 42.56 ? 10   DA  P "O3'" 1 
ATOM   2999 C  "C2'" . DA  B 2 10  ? 31.079 19.324 16.209  1.00 39.82 ? 10   DA  P "C2'" 1 
ATOM   3000 C  "C1'" . DA  B 2 10  ? 30.258 19.532 17.473  1.00 39.67 ? 10   DA  P "C1'" 1 
ATOM   3001 N  N9    . DA  B 2 10  ? 30.564 20.744 18.227  1.00 38.70 ? 10   DA  P N9    1 
ATOM   3002 C  C8    . DA  B 2 10  ? 31.798 21.197 18.633  1.00 38.22 ? 10   DA  P C8    1 
ATOM   3003 N  N7    . DA  B 2 10  ? 31.750 22.304 19.332  1.00 38.11 ? 10   DA  P N7    1 
ATOM   3004 C  C5    . DA  B 2 10  ? 30.398 22.603 19.387  1.00 36.04 ? 10   DA  P C5    1 
ATOM   3005 C  C6    . DA  B 2 10  ? 29.695 23.652 19.980  1.00 37.20 ? 10   DA  P C6    1 
ATOM   3006 N  N6    . DA  B 2 10  ? 30.281 24.635 20.664  1.00 36.97 ? 10   DA  P N6    1 
ATOM   3007 N  N1    . DA  B 2 10  ? 28.352 23.664 19.847  1.00 37.96 ? 10   DA  P N1    1 
ATOM   3008 C  C2    . DA  B 2 10  ? 27.768 22.676 19.154  1.00 37.65 ? 10   DA  P C2    1 
ATOM   3009 N  N3    . DA  B 2 10  ? 28.322 21.635 18.548  1.00 34.87 ? 10   DA  P N3    1 
ATOM   3010 C  C4    . DA  B 2 10  ? 29.656 21.656 18.704  1.00 36.60 ? 10   DA  P C4    1 
ATOM   3011 P  P     . DT  B 2 11  ? 29.802 17.404 13.844  1.00 41.49 ? 11   DT  P P     1 
ATOM   3012 O  OP1   . DT  B 2 11  ? 28.969 16.248 13.444  1.00 41.84 ? 11   DT  P OP1   1 
ATOM   3013 O  OP2   . DT  B 2 11  ? 31.145 17.586 13.252  1.00 39.85 ? 11   DT  P OP2   1 
ATOM   3014 O  "O5'" . DT  B 2 11  ? 28.967 18.763 13.639  1.00 37.14 ? 11   DT  P "O5'" 1 
ATOM   3015 C  "C5'" . DT  B 2 11  ? 27.701 18.870 14.291  1.00 35.49 ? 11   DT  P "C5'" 1 
ATOM   3016 C  "C4'" . DT  B 2 11  ? 27.078 20.232 14.098  1.00 35.76 ? 11   DT  P "C4'" 1 
ATOM   3017 O  "O4'" . DT  B 2 11  ? 27.546 21.197 15.072  1.00 35.47 ? 11   DT  P "O4'" 1 
ATOM   3018 C  "C3'" . DT  B 2 11  ? 27.355 20.819 12.711  1.00 34.83 ? 11   DT  P "C3'" 1 
ATOM   3019 O  "O3'" . DT  B 2 11  ? 26.090 21.021 12.072  1.00 36.20 ? 11   DT  P "O3'" 1 
ATOM   3020 C  "C2'" . DT  B 2 11  ? 28.080 22.135 13.004  1.00 34.67 ? 11   DT  P "C2'" 1 
ATOM   3021 C  "C1'" . DT  B 2 11  ? 27.669 22.455 14.440  1.00 35.28 ? 11   DT  P "C1'" 1 
ATOM   3022 N  N1    . DT  B 2 11  ? 28.601 23.285 15.252  1.00 34.67 ? 11   DT  P N1    1 
ATOM   3023 C  C2    . DT  B 2 11  ? 28.057 24.268 16.071  1.00 32.80 ? 11   DT  P C2    1 
ATOM   3024 O  O2    . DT  B 2 11  ? 26.871 24.493 16.156  1.00 30.39 ? 11   DT  P O2    1 
ATOM   3025 N  N3    . DT  B 2 11  ? 28.971 24.981 16.802  1.00 33.38 ? 11   DT  P N3    1 
ATOM   3026 C  C4    . DT  B 2 11  ? 30.334 24.822 16.812  1.00 32.83 ? 11   DT  P C4    1 
ATOM   3027 O  O4    . DT  B 2 11  ? 31.017 25.522 17.546  1.00 33.91 ? 11   DT  P O4    1 
ATOM   3028 C  C5    . DT  B 2 11  ? 30.844 23.795 15.932  1.00 34.31 ? 11   DT  P C5    1 
ATOM   3029 C  C7    . DT  B 2 11  ? 32.321 23.574 15.871  1.00 30.54 ? 11   DT  P C7    1 
ATOM   3030 C  C6    . DT  B 2 11  ? 29.963 23.084 15.203  1.00 33.55 ? 11   DT  P C6    1 
ATOM   3031 P  P     . DT  B 2 12  ? 26.004 21.662 10.605  1.00 34.42 ? 12   DT  P P     1 
ATOM   3032 O  OP1   . DT  B 2 12  ? 24.868 20.969 9.957   1.00 35.57 ? 12   DT  P OP1   1 
ATOM   3033 O  OP2   . DT  B 2 12  ? 27.327 21.653 9.944   1.00 34.94 ? 12   DT  P OP2   1 
ATOM   3034 O  "O5'" . DT  B 2 12  ? 25.579 23.176 10.943  1.00 30.95 ? 12   DT  P "O5'" 1 
ATOM   3035 C  "C5'" . DT  B 2 12  ? 24.501 23.381 11.859  1.00 31.18 ? 12   DT  P "C5'" 1 
ATOM   3036 C  "C4'" . DT  B 2 12  ? 24.272 24.845 12.157  1.00 31.49 ? 12   DT  P "C4'" 1 
ATOM   3037 O  "O4'" . DT  B 2 12  ? 25.215 25.334 13.150  1.00 33.52 ? 12   DT  P "O4'" 1 
ATOM   3038 C  "C3'" . DT  B 2 12  ? 24.481 25.675 10.887  1.00 32.49 ? 12   DT  P "C3'" 1 
ATOM   3039 O  "O3'" . DT  B 2 12  ? 23.291 26.389 10.527  1.00 32.84 ? 12   DT  P "O3'" 1 
ATOM   3040 C  "C2'" . DT  B 2 12  ? 25.634 26.619 11.231  1.00 33.51 ? 12   DT  P "C2'" 1 
ATOM   3041 C  "C1'" . DT  B 2 12  ? 25.694 26.619 12.756  1.00 33.27 ? 12   DT  P "C1'" 1 
ATOM   3042 N  N1    . DT  B 2 12  ? 27.069 26.799 13.318  1.00 32.19 ? 12   DT  P N1    1 
ATOM   3043 C  C2    . DT  B 2 12  ? 27.249 27.657 14.395  1.00 30.10 ? 12   DT  P C2    1 
ATOM   3044 O  O2    . DT  B 2 12  ? 26.343 28.262 14.920  1.00 28.23 ? 12   DT  P O2    1 
ATOM   3045 N  N3    . DT  B 2 12  ? 28.555 27.779 14.830  1.00 30.08 ? 12   DT  P N3    1 
ATOM   3046 C  C4    . DT  B 2 12  ? 29.675 27.151 14.303  1.00 32.13 ? 12   DT  P C4    1 
ATOM   3047 O  O4    . DT  B 2 12  ? 30.794 27.370 14.785  1.00 28.18 ? 12   DT  P O4    1 
ATOM   3048 C  C5    . DT  B 2 12  ? 29.410 26.265 13.180  1.00 31.80 ? 12   DT  P C5    1 
ATOM   3049 C  C7    . DT  B 2 12  ? 30.558 25.553 12.535  1.00 31.28 ? 12   DT  P C7    1 
ATOM   3050 C  C6    . DT  B 2 12  ? 28.141 26.129 12.759  1.00 31.53 ? 12   DT  P C6    1 
ATOM   3051 P  P     . DC  B 2 13  ? 23.247 27.214 9.151   1.00 31.29 ? 13   DC  P P     1 
ATOM   3052 O  OP1   . DC  B 2 13  ? 21.902 27.084 8.549   1.00 36.63 ? 13   DC  P OP1   1 
ATOM   3053 O  OP2   . DC  B 2 13  ? 24.436 26.832 8.358   1.00 36.65 ? 13   DC  P OP2   1 
ATOM   3054 O  "O5'" . DC  B 2 13  ? 23.450 28.727 9.655   1.00 33.57 ? 13   DC  P "O5'" 1 
ATOM   3055 C  "C5'" . DC  B 2 13  ? 22.674 29.170 10.769  1.00 33.87 ? 13   DC  P "C5'" 1 
ATOM   3056 C  "C4'" . DC  B 2 13  ? 23.155 30.511 11.261  1.00 36.64 ? 13   DC  P "C4'" 1 
ATOM   3057 O  "O4'" . DC  B 2 13  ? 24.372 30.385 12.042  1.00 35.21 ? 13   DC  P "O4'" 1 
ATOM   3058 C  "C3'" . DC  B 2 13  ? 23.477 31.424 10.075  1.00 37.84 ? 13   DC  P "C3'" 1 
ATOM   3059 O  "O3'" . DC  B 2 13  ? 22.848 32.692 10.262  1.00 44.84 ? 13   DC  P "O3'" 1 
ATOM   3060 C  "C2'" . DC  B 2 13  ? 24.990 31.565 10.123  1.00 37.42 ? 13   DC  P "C2'" 1 
ATOM   3061 C  "C1'" . DC  B 2 13  ? 25.296 31.363 11.602  1.00 35.67 ? 13   DC  P "C1'" 1 
ATOM   3062 N  N1    . DC  B 2 13  ? 26.663 30.885 11.896  1.00 34.34 ? 13   DC  P N1    1 
ATOM   3063 C  C2    . DC  B 2 13  ? 27.403 31.535 12.902  1.00 33.95 ? 13   DC  P C2    1 
ATOM   3064 O  O2    . DC  B 2 13  ? 26.857 32.424 13.570  1.00 36.29 ? 13   DC  P O2    1 
ATOM   3065 N  N3    . DC  B 2 13  ? 28.684 31.171 13.120  1.00 30.05 ? 13   DC  P N3    1 
ATOM   3066 C  C4    . DC  B 2 13  ? 29.231 30.193 12.394  1.00 31.95 ? 13   DC  P C4    1 
ATOM   3067 N  N4    . DC  B 2 13  ? 30.520 29.910 12.605  1.00 35.15 ? 13   DC  P N4    1 
ATOM   3068 C  C5    . DC  B 2 13  ? 28.489 29.476 11.405  1.00 32.54 ? 13   DC  P C5    1 
ATOM   3069 C  C6    . DC  B 2 13  ? 27.221 29.854 11.190  1.00 33.85 ? 13   DC  P C6    1 
ATOM   3070 P  P     . DA  B 2 14  ? 22.856 33.780 9.075   1.00 47.49 ? 14   DA  P P     1 
ATOM   3071 O  OP1   . DA  B 2 14  ? 21.455 34.209 8.869   1.00 47.79 ? 14   DA  P OP1   1 
ATOM   3072 O  OP2   . DA  B 2 14  ? 23.638 33.260 7.932   1.00 46.66 ? 14   DA  P OP2   1 
ATOM   3073 O  "O5'" . DA  B 2 14  ? 23.685 34.988 9.742   1.00 45.80 ? 14   DA  P "O5'" 1 
ATOM   3074 C  "C5'" . DA  B 2 14  ? 23.370 35.370 11.084  1.00 41.99 ? 14   DA  P "C5'" 1 
ATOM   3075 C  "C4'" . DA  B 2 14  ? 24.451 36.231 11.697  1.00 41.85 ? 14   DA  P "C4'" 1 
ATOM   3076 O  "O4'" . DA  B 2 14  ? 25.650 35.468 11.987  1.00 38.51 ? 14   DA  P "O4'" 1 
ATOM   3077 C  "C3'" . DA  B 2 14  ? 24.862 37.352 10.740  1.00 39.84 ? 14   DA  P "C3'" 1 
ATOM   3078 O  "O3'" . DA  B 2 14  ? 24.809 38.626 11.390  1.00 41.77 ? 14   DA  P "O3'" 1 
ATOM   3079 C  "C2'" . DA  B 2 14  ? 26.271 36.971 10.311  1.00 39.03 ? 14   DA  P "C2'" 1 
ATOM   3080 C  "C1'" . DA  B 2 14  ? 26.778 36.178 11.502  1.00 38.50 ? 14   DA  P "C1'" 1 
ATOM   3081 N  N9    . DA  B 2 14  ? 27.833 35.206 11.192  1.00 36.97 ? 14   DA  P N9    1 
ATOM   3082 C  C8    . DA  B 2 14  ? 27.746 34.078 10.412  1.00 36.34 ? 14   DA  P C8    1 
ATOM   3083 N  N7    . DA  B 2 14  ? 28.872 33.408 10.325  1.00 34.98 ? 14   DA  P N7    1 
ATOM   3084 C  C5    . DA  B 2 14  ? 29.759 34.141 11.101  1.00 32.37 ? 14   DA  P C5    1 
ATOM   3085 C  C6    . DA  B 2 14  ? 31.121 33.955 11.418  1.00 34.49 ? 14   DA  P C6    1 
ATOM   3086 N  N6    . DA  B 2 14  ? 31.853 32.925 10.981  1.00 33.91 ? 14   DA  P N6    1 
ATOM   3087 N  N1    . DA  B 2 14  ? 31.714 34.875 12.209  1.00 31.56 ? 14   DA  P N1    1 
ATOM   3088 C  C2    . DA  B 2 14  ? 30.980 35.903 12.651  1.00 32.16 ? 14   DA  P C2    1 
ATOM   3089 N  N3    . DA  B 2 14  ? 29.692 36.183 12.429  1.00 32.25 ? 14   DA  P N3    1 
ATOM   3090 C  C4    . DA  B 2 14  ? 29.135 35.252 11.638  1.00 32.65 ? 14   DA  P C4    1 
ATOM   3091 O  OP3   . DC  C 3 2   ? 49.460 28.650 2.435   0.70 78.88 ? 2    DC  T OP3   1 
ATOM   3092 P  P     . DC  C 3 2   ? 50.421 29.655 3.050   0.70 79.15 ? 2    DC  T P     1 
ATOM   3093 O  OP1   . DC  C 3 2   ? 51.239 30.392 2.002   0.70 79.31 ? 2    DC  T OP1   1 
ATOM   3094 O  OP2   . DC  C 3 2   ? 51.263 29.073 4.176   0.70 78.71 ? 2    DC  T OP2   1 
ATOM   3095 O  "O5'" . DC  C 3 2   ? 49.492 30.808 3.724   0.70 77.12 ? 2    DC  T "O5'" 1 
ATOM   3096 C  "C5'" . DC  C 3 2   ? 49.006 31.904 2.933   0.70 74.88 ? 2    DC  T "C5'" 1 
ATOM   3097 C  "C4'" . DC  C 3 2   ? 47.560 32.179 3.261   0.70 72.78 ? 2    DC  T "C4'" 1 
ATOM   3098 O  "O4'" . DC  C 3 2   ? 46.719 31.138 2.700   0.70 71.99 ? 2    DC  T "O4'" 1 
ATOM   3099 C  "C3'" . DC  C 3 2   ? 47.374 32.123 4.780   0.70 71.69 ? 2    DC  T "C3'" 1 
ATOM   3100 O  "O3'" . DC  C 3 2   ? 46.559 33.207 5.237   0.70 69.76 ? 2    DC  T "O3'" 1 
ATOM   3101 C  "C2'" . DC  C 3 2   ? 46.695 30.783 5.009   0.70 71.52 ? 2    DC  T "C2'" 1 
ATOM   3102 C  "C1'" . DC  C 3 2   ? 45.921 30.569 3.721   0.70 71.89 ? 2    DC  T "C1'" 1 
ATOM   3103 N  N1    . DC  C 3 2   ? 45.690 29.146 3.406   0.70 71.66 ? 2    DC  T N1    1 
ATOM   3104 C  C2    . DC  C 3 2   ? 44.399 28.732 3.057   0.70 71.43 ? 2    DC  T C2    1 
ATOM   3105 O  O2    . DC  C 3 2   ? 43.510 29.587 2.930   0.70 72.56 ? 2    DC  T O2    1 
ATOM   3106 N  N3    . DC  C 3 2   ? 44.153 27.414 2.864   0.70 70.87 ? 2    DC  T N3    1 
ATOM   3107 C  C4    . DC  C 3 2   ? 45.141 26.527 2.992   0.70 70.22 ? 2    DC  T C4    1 
ATOM   3108 N  N4    . DC  C 3 2   ? 44.844 25.238 2.836   0.70 69.58 ? 2    DC  T N4    1 
ATOM   3109 C  C5    . DC  C 3 2   ? 46.476 26.924 3.294   0.70 70.65 ? 2    DC  T C5    1 
ATOM   3110 C  C6    . DC  C 3 2   ? 46.704 28.232 3.489   0.70 71.01 ? 2    DC  T C6    1 
ATOM   3111 P  P     . DA  C 3 3   ? 46.177 33.324 6.799   1.00 66.52 ? 3    DA  T P     1 
ATOM   3112 O  OP1   . DA  C 3 3   ? 46.541 34.675 7.280   1.00 65.78 ? 3    DA  T OP1   1 
ATOM   3113 O  OP2   . DA  C 3 3   ? 46.716 32.138 7.501   1.00 67.28 ? 3    DA  T OP2   1 
ATOM   3114 O  "O5'" . DA  C 3 3   ? 44.569 33.252 6.768   1.00 68.03 ? 3    DA  T "O5'" 1 
ATOM   3115 C  "C5'" . DA  C 3 3   ? 43.929 32.283 5.934   1.00 67.28 ? 3    DA  T "C5'" 1 
ATOM   3116 C  "C4'" . DA  C 3 3   ? 42.641 31.818 6.562   1.00 67.21 ? 3    DA  T "C4'" 1 
ATOM   3117 O  "O4'" . DA  C 3 3   ? 42.353 30.475 6.090   1.00 70.04 ? 3    DA  T "O4'" 1 
ATOM   3118 C  "C3'" . DA  C 3 3   ? 42.904 31.688 8.063   1.00 65.15 ? 3    DA  T "C3'" 1 
ATOM   3119 O  "O3'" . DA  C 3 3   ? 41.747 32.024 8.817   1.00 60.03 ? 3    DA  T "O3'" 1 
ATOM   3120 C  "C2'" . DA  C 3 3   ? 43.249 30.227 8.249   1.00 68.41 ? 3    DA  T "C2'" 1 
ATOM   3121 C  "C1'" . DA  C 3 3   ? 42.426 29.554 7.171   1.00 71.49 ? 3    DA  T "C1'" 1 
ATOM   3122 N  N9    . DA  C 3 3   ? 43.011 28.302 6.683   1.00 75.09 ? 3    DA  T N9    1 
ATOM   3123 C  C8    . DA  C 3 3   ? 42.368 27.284 6.018   1.00 75.88 ? 3    DA  T C8    1 
ATOM   3124 N  N7    . DA  C 3 3   ? 43.131 26.246 5.771   1.00 77.13 ? 3    DA  T N7    1 
ATOM   3125 C  C5    . DA  C 3 3   ? 44.366 26.609 6.294   1.00 78.08 ? 3    DA  T C5    1 
ATOM   3126 C  C6    . DA  C 3 3   ? 45.602 25.934 6.359   1.00 79.52 ? 3    DA  T C6    1 
ATOM   3127 N  N6    . DA  C 3 3   ? 45.796 24.700 5.880   1.00 80.09 ? 3    DA  T N6    1 
ATOM   3128 N  N1    . DA  C 3 3   ? 46.641 26.577 6.940   1.00 79.64 ? 3    DA  T N1    1 
ATOM   3129 C  C2    . DA  C 3 3   ? 46.442 27.814 7.421   1.00 78.74 ? 3    DA  T C2    1 
ATOM   3130 N  N3    . DA  C 3 3   ? 45.330 28.549 7.421   1.00 77.32 ? 3    DA  T N3    1 
ATOM   3131 C  C4    . DA  C 3 3   ? 44.314 27.881 6.840   1.00 76.60 ? 3    DA  T C4    1 
ATOM   3132 P  P     . DC  C 3 4   ? 41.855 32.144 10.415  1.00 57.31 ? 4    DC  T P     1 
ATOM   3133 O  OP1   . DC  C 3 4   ? 43.281 32.064 10.801  1.00 54.37 ? 4    DC  T OP1   1 
ATOM   3134 O  OP2   . DC  C 3 4   ? 40.888 31.172 10.973  1.00 56.58 ? 4    DC  T OP2   1 
ATOM   3135 O  "O5'" . DC  C 3 4   ? 41.327 33.633 10.717  1.00 53.06 ? 4    DC  T "O5'" 1 
ATOM   3136 C  "C5'" . DC  C 3 4   ? 42.143 34.752 10.365  1.00 49.14 ? 4    DC  T "C5'" 1 
ATOM   3137 C  "C4'" . DC  C 3 4   ? 41.501 36.023 10.860  1.00 48.51 ? 4    DC  T "C4'" 1 
ATOM   3138 O  "O4'" . DC  C 3 4   ? 40.191 36.149 10.261  1.00 47.14 ? 4    DC  T "O4'" 1 
ATOM   3139 C  "C3'" . DC  C 3 4   ? 41.261 35.907 12.366  1.00 46.14 ? 4    DC  T "C3'" 1 
ATOM   3140 O  "O3'" . DC  C 3 4   ? 41.288 37.224 12.928  1.00 50.77 ? 4    DC  T "O3'" 1 
ATOM   3141 C  "C2'" . DC  C 3 4   ? 39.864 35.321 12.442  1.00 46.04 ? 4    DC  T "C2'" 1 
ATOM   3142 C  "C1'" . DC  C 3 4   ? 39.179 35.973 11.246  1.00 44.10 ? 4    DC  T "C1'" 1 
ATOM   3143 N  N1    . DC  C 3 4   ? 38.094 35.191 10.625  1.00 40.98 ? 4    DC  T N1    1 
ATOM   3144 C  C2    . DC  C 3 4   ? 36.794 35.716 10.622  1.00 37.41 ? 4    DC  T C2    1 
ATOM   3145 O  O2    . DC  C 3 4   ? 36.576 36.799 11.200  1.00 35.19 ? 4    DC  T O2    1 
ATOM   3146 N  N3    . DC  C 3 4   ? 35.810 35.030 9.998   1.00 36.36 ? 4    DC  T N3    1 
ATOM   3147 C  C4    . DC  C 3 4   ? 36.077 33.858 9.418   1.00 35.86 ? 4    DC  T C4    1 
ATOM   3148 N  N4    . DC  C 3 4   ? 35.074 33.216 8.816   1.00 32.46 ? 4    DC  T N4    1 
ATOM   3149 C  C5    . DC  C 3 4   ? 37.382 33.289 9.430   1.00 37.13 ? 4    DC  T C5    1 
ATOM   3150 C  C6    . DC  C 3 4   ? 38.352 33.982 10.037  1.00 39.26 ? 4    DC  T C6    1 
HETATM 3151 P  P     . 8OG C 3 5   ? 41.865 37.461 14.413  1.00 50.82 ? 5    8OG T P     1 
HETATM 3152 O  OP1   . 8OG C 3 5   ? 42.452 38.817 14.498  1.00 48.82 ? 5    8OG T OP1   1 
HETATM 3153 O  OP2   . 8OG C 3 5   ? 42.703 36.296 14.775  1.00 52.14 ? 5    8OG T OP2   1 
HETATM 3154 O  "O5'" . 8OG C 3 5   ? 40.561 37.471 15.355  1.00 49.39 ? 5    8OG T "O5'" 1 
HETATM 3155 C  "C5'" . 8OG C 3 5   ? 39.264 37.354 14.769  1.00 47.66 ? 5    8OG T "C5'" 1 
HETATM 3156 C  "C4'" . 8OG C 3 5   ? 38.278 38.299 15.411  1.00 45.26 ? 5    8OG T "C4'" 1 
HETATM 3157 O  "O4'" . 8OG C 3 5   ? 37.019 38.126 14.737  1.00 42.41 ? 5    8OG T "O4'" 1 
HETATM 3158 C  "C3'" . 8OG C 3 5   ? 37.978 37.882 16.850  1.00 43.73 ? 5    8OG T "C3'" 1 
HETATM 3159 O  "O3'" . 8OG C 3 5   ? 37.202 38.872 17.520  1.00 45.60 ? 5    8OG T "O3'" 1 
HETATM 3160 C  "C2'" . 8OG C 3 5   ? 37.177 36.604 16.604  1.00 44.02 ? 5    8OG T "C2'" 1 
HETATM 3161 C  "C1'" . 8OG C 3 5   ? 36.270 37.127 15.472  1.00 42.32 ? 5    8OG T "C1'" 1 
HETATM 3162 N  N9    . 8OG C 3 5   ? 35.645 36.090 14.599  1.00 39.22 ? 5    8OG T N9    1 
HETATM 3163 C  C8    . 8OG C 3 5   ? 34.450 36.223 13.999  1.00 37.70 ? 5    8OG T C8    1 
HETATM 3164 N  N7    . 8OG C 3 5   ? 34.221 35.136 13.265  1.00 37.99 ? 5    8OG T N7    1 
HETATM 3165 C  C5    . 8OG C 3 5   ? 35.270 34.322 13.395  1.00 39.74 ? 5    8OG T C5    1 
HETATM 3166 C  C6    . 8OG C 3 5   ? 35.663 33.088 12.898  1.00 38.96 ? 5    8OG T C6    1 
HETATM 3167 O  O6    . 8OG C 3 5   ? 34.879 32.524 12.151  1.00 41.34 ? 5    8OG T O6    1 
HETATM 3168 N  N1    . 8OG C 3 5   ? 36.893 32.522 13.260  1.00 42.31 ? 5    8OG T N1    1 
HETATM 3169 C  C2    . 8OG C 3 5   ? 37.772 33.163 14.129  1.00 43.44 ? 5    8OG T C2    1 
HETATM 3170 N  N2    . 8OG C 3 5   ? 38.940 32.632 14.471  1.00 46.61 ? 5    8OG T N2    1 
HETATM 3171 N  N3    . 8OG C 3 5   ? 37.360 34.359 14.585  1.00 41.69 ? 5    8OG T N3    1 
HETATM 3172 C  C4    . 8OG C 3 5   ? 36.186 34.921 14.250  1.00 39.77 ? 5    8OG T C4    1 
HETATM 3173 O  O8    . 8OG C 3 5   ? 33.742 37.227 14.108  1.00 36.62 ? 5    8OG T O8    1 
ATOM   3174 P  P     . DG  C 3 6   ? 36.965 38.770 19.101  1.00 45.90 ? 6    DG  T P     1 
ATOM   3175 O  OP1   . DG  C 3 6   ? 37.111 40.135 19.651  1.00 45.12 ? 6    DG  T OP1   1 
ATOM   3176 O  OP2   . DG  C 3 6   ? 37.796 37.657 19.612  1.00 48.42 ? 6    DG  T OP2   1 
ATOM   3177 O  "O5'" . DG  C 3 6   ? 35.409 38.385 19.214  1.00 44.55 ? 6    DG  T "O5'" 1 
ATOM   3178 C  "C5'" . DG  C 3 6   ? 34.471 39.282 18.619  1.00 42.14 ? 6    DG  T "C5'" 1 
ATOM   3179 C  "C4'" . DG  C 3 6   ? 33.097 38.670 18.586  1.00 40.05 ? 6    DG  T "C4'" 1 
ATOM   3180 O  "O4'" . DG  C 3 6   ? 32.987 37.667 17.545  1.00 37.10 ? 6    DG  T "O4'" 1 
ATOM   3181 C  "C3'" . DG  C 3 6   ? 32.825 37.960 19.914  1.00 37.54 ? 6    DG  T "C3'" 1 
ATOM   3182 O  "O3'" . DG  C 3 6   ? 31.569 38.400 20.423  1.00 37.94 ? 6    DG  T "O3'" 1 
ATOM   3183 C  "C2'" . DG  C 3 6   ? 32.765 36.488 19.531  1.00 36.45 ? 6    DG  T "C2'" 1 
ATOM   3184 C  "C1'" . DG  C 3 6   ? 32.297 36.567 18.085  1.00 36.70 ? 6    DG  T "C1'" 1 
ATOM   3185 N  N9    . DG  C 3 6   ? 32.580 35.398 17.261  1.00 34.56 ? 6    DG  T N9    1 
ATOM   3186 C  C8    . DG  C 3 6   ? 33.772 34.738 17.127  1.00 33.89 ? 6    DG  T C8    1 
ATOM   3187 N  N7    . DG  C 3 6   ? 33.688 33.679 16.366  1.00 34.32 ? 6    DG  T N7    1 
ATOM   3188 C  C5    . DG  C 3 6   ? 32.360 33.649 15.961  1.00 34.63 ? 6    DG  T C5    1 
ATOM   3189 C  C6    . DG  C 3 6   ? 31.666 32.720 15.133  1.00 34.19 ? 6    DG  T C6    1 
ATOM   3190 O  O6    . DG  C 3 6   ? 32.093 31.695 14.599  1.00 35.54 ? 6    DG  T O6    1 
ATOM   3191 N  N1    . DG  C 3 6   ? 30.337 33.079 14.963  1.00 34.21 ? 6    DG  T N1    1 
ATOM   3192 C  C2    . DG  C 3 6   ? 29.738 34.179 15.532  1.00 37.23 ? 6    DG  T C2    1 
ATOM   3193 N  N2    . DG  C 3 6   ? 28.432 34.354 15.250  1.00 32.99 ? 6    DG  T N2    1 
ATOM   3194 N  N3    . DG  C 3 6   ? 30.367 35.041 16.321  1.00 34.44 ? 6    DG  T N3    1 
ATOM   3195 C  C4    . DG  C 3 6   ? 31.667 34.714 16.487  1.00 34.31 ? 6    DG  T C4    1 
ATOM   3196 P  P     . DA  C 3 7   ? 31.169 38.080 21.939  1.00 36.00 ? 7    DA  T P     1 
ATOM   3197 O  OP1   . DA  C 3 7   ? 30.479 39.291 22.437  1.00 40.84 ? 7    DA  T OP1   1 
ATOM   3198 O  OP2   . DA  C 3 7   ? 32.350 37.559 22.662  1.00 37.11 ? 7    DA  T OP2   1 
ATOM   3199 O  "O5'" . DA  C 3 7   ? 30.102 36.890 21.763  1.00 36.16 ? 7    DA  T "O5'" 1 
ATOM   3200 C  "C5'" . DA  C 3 7   ? 29.015 37.093 20.859  1.00 36.73 ? 7    DA  T "C5'" 1 
ATOM   3201 C  "C4'" . DA  C 3 7   ? 28.271 35.811 20.575  1.00 36.80 ? 7    DA  T "C4'" 1 
ATOM   3202 O  "O4'" . DA  C 3 7   ? 28.960 34.989 19.604  1.00 34.31 ? 7    DA  T "O4'" 1 
ATOM   3203 C  "C3'" . DA  C 3 7   ? 28.117 34.958 21.838  1.00 38.13 ? 7    DA  T "C3'" 1 
ATOM   3204 O  "O3'" . DA  C 3 7   ? 26.757 34.559 21.965  1.00 43.46 ? 7    DA  T "O3'" 1 
ATOM   3205 C  "C2'" . DA  C 3 7   ? 28.939 33.715 21.525  1.00 37.44 ? 7    DA  T "C2'" 1 
ATOM   3206 C  "C1'" . DA  C 3 7   ? 28.800 33.652 20.014  1.00 35.18 ? 7    DA  T "C1'" 1 
ATOM   3207 N  N9    . DA  C 3 7   ? 29.771 32.807 19.309  1.00 32.58 ? 7    DA  T N9    1 
ATOM   3208 C  C8    . DA  C 3 7   ? 31.135 32.726 19.465  1.00 32.24 ? 7    DA  T C8    1 
ATOM   3209 N  N7    . DA  C 3 7   ? 31.692 31.777 18.753  1.00 30.34 ? 7    DA  T N7    1 
ATOM   3210 C  C5    . DA  C 3 7   ? 30.628 31.209 18.062  1.00 31.99 ? 7    DA  T C5    1 
ATOM   3211 C  C6    . DA  C 3 7   ? 30.539 30.120 17.157  1.00 30.18 ? 7    DA  T C6    1 
ATOM   3212 N  N6    . DA  C 3 7   ? 31.569 29.363 16.789  1.00 27.96 ? 7    DA  T N6    1 
ATOM   3213 N  N1    . DA  C 3 7   ? 29.328 29.829 16.650  1.00 29.18 ? 7    DA  T N1    1 
ATOM   3214 C  C2    . DA  C 3 7   ? 28.284 30.569 17.026  1.00 29.79 ? 7    DA  T C2    1 
ATOM   3215 N  N3    . DA  C 3 7   ? 28.233 31.593 17.873  1.00 30.37 ? 7    DA  T N3    1 
ATOM   3216 C  C4    . DA  C 3 7   ? 29.448 31.862 18.366  1.00 31.29 ? 7    DA  T C4    1 
ATOM   3217 P  P     . DA  C 3 8   ? 26.152 34.182 23.404  1.00 42.46 ? 8    DA  T P     1 
ATOM   3218 O  OP1   . DA  C 3 8   ? 25.606 35.433 23.974  1.00 43.85 ? 8    DA  T OP1   1 
ATOM   3219 O  OP2   . DA  C 3 8   ? 27.135 33.393 24.180  1.00 42.69 ? 8    DA  T OP2   1 
ATOM   3220 O  "O5'" . DA  C 3 8   ? 24.922 33.234 22.985  1.00 41.50 ? 8    DA  T "O5'" 1 
ATOM   3221 C  "C5'" . DA  C 3 8   ? 24.148 33.605 21.843  1.00 42.28 ? 8    DA  T "C5'" 1 
ATOM   3222 C  "C4'" . DA  C 3 8   ? 23.453 32.410 21.235  1.00 43.26 ? 8    DA  T "C4'" 1 
ATOM   3223 O  "O4'" . DA  C 3 8   ? 24.343 31.674 20.366  1.00 40.52 ? 8    DA  T "O4'" 1 
ATOM   3224 C  "C3'" . DA  C 3 8   ? 23.024 31.454 22.350  1.00 43.95 ? 8    DA  T "C3'" 1 
ATOM   3225 O  "O3'" . DA  C 3 8   ? 21.694 31.007 22.137  1.00 48.33 ? 8    DA  T "O3'" 1 
ATOM   3226 C  "C2'" . DA  C 3 8   ? 23.994 30.292 22.237  1.00 42.05 ? 8    DA  T "C2'" 1 
ATOM   3227 C  "C1'" . DA  C 3 8   ? 24.414 30.313 20.773  1.00 39.98 ? 8    DA  T "C1'" 1 
ATOM   3228 N  N9    . DA  C 3 8   ? 25.798 29.867 20.590  1.00 37.78 ? 8    DA  T N9    1 
ATOM   3229 C  C8    . DA  C 3 8   ? 26.895 30.320 21.284  1.00 37.46 ? 8    DA  T C8    1 
ATOM   3230 N  N7    . DA  C 3 8   ? 28.013 29.725 20.953  1.00 37.51 ? 8    DA  T N7    1 
ATOM   3231 C  C5    . DA  C 3 8   ? 27.633 28.821 19.969  1.00 33.53 ? 8    DA  T C5    1 
ATOM   3232 C  C6    . DA  C 3 8   ? 28.358 27.875 19.232  1.00 33.49 ? 8    DA  T C6    1 
ATOM   3233 N  N6    . DA  C 3 8   ? 29.673 27.662 19.391  1.00 25.47 ? 8    DA  T N6    1 
ATOM   3234 N  N1    . DA  C 3 8   ? 27.681 27.136 18.324  1.00 32.13 ? 8    DA  T N1    1 
ATOM   3235 C  C2    . DA  C 3 8   ? 26.370 27.334 18.185  1.00 31.80 ? 8    DA  T C2    1 
ATOM   3236 N  N3    . DA  C 3 8   ? 25.574 28.184 18.827  1.00 32.94 ? 8    DA  T N3    1 
ATOM   3237 C  C4    . DA  C 3 8   ? 26.275 28.908 19.721  1.00 35.52 ? 8    DA  T C4    1 
ATOM   3238 P  P     . DT  C 3 9   ? 20.965 30.127 23.261  1.00 50.56 ? 9    DT  T P     1 
ATOM   3239 O  OP1   . DT  C 3 9   ? 19.567 30.607 23.344  1.00 51.33 ? 9    DT  T OP1   1 
ATOM   3240 O  OP2   . DT  C 3 9   ? 21.804 30.089 24.479  1.00 49.21 ? 9    DT  T OP2   1 
ATOM   3241 O  "O5'" . DT  C 3 9   ? 20.949 28.668 22.589  1.00 48.61 ? 9    DT  T "O5'" 1 
ATOM   3242 C  "C5'" . DT  C 3 9   ? 20.466 28.549 21.250  1.00 47.15 ? 9    DT  T "C5'" 1 
ATOM   3243 C  "C4'" . DT  C 3 9   ? 20.729 27.166 20.720  1.00 45.68 ? 9    DT  T "C4'" 1 
ATOM   3244 O  "O4'" . DT  C 3 9   ? 22.144 26.969 20.515  1.00 43.21 ? 9    DT  T "O4'" 1 
ATOM   3245 C  "C3'" . DT  C 3 9   ? 20.300 26.141 21.772  1.00 47.47 ? 9    DT  T "C3'" 1 
ATOM   3246 O  "O3'" . DT  C 3 9   ? 19.602 25.091 21.116  1.00 54.20 ? 9    DT  T "O3'" 1 
ATOM   3247 C  "C2'" . DT  C 3 9   ? 21.614 25.632 22.343  1.00 44.24 ? 9    DT  T "C2'" 1 
ATOM   3248 C  "C1'" . DT  C 3 9   ? 22.533 25.768 21.148  1.00 42.27 ? 9    DT  T "C1'" 1 
ATOM   3249 N  N1    . DT  C 3 9   ? 23.974 25.857 21.435  1.00 39.56 ? 9    DT  T N1    1 
ATOM   3250 C  C2    . DT  C 3 9   ? 24.804 25.098 20.649  1.00 37.86 ? 9    DT  T C2    1 
ATOM   3251 O  O2    . DT  C 3 9   ? 24.388 24.377 19.759  1.00 40.37 ? 9    DT  T O2    1 
ATOM   3252 N  N3    . DT  C 3 9   ? 26.137 25.219 20.939  1.00 34.21 ? 9    DT  T N3    1 
ATOM   3253 C  C4    . DT  C 3 9   ? 26.706 26.012 21.913  1.00 36.70 ? 9    DT  T C4    1 
ATOM   3254 O  O4    . DT  C 3 9   ? 27.923 26.034 22.049  1.00 36.00 ? 9    DT  T O4    1 
ATOM   3255 C  C5    . DT  C 3 9   ? 25.773 26.774 22.711  1.00 37.08 ? 9    DT  T C5    1 
ATOM   3256 C  C7    . DT  C 3 9   ? 26.304 27.648 23.804  1.00 39.40 ? 9    DT  T C7    1 
ATOM   3257 C  C6    . DT  C 3 9   ? 24.469 26.662 22.436  1.00 37.48 ? 9    DT  T C6    1 
ATOM   3258 P  P     . DC  C 3 10  ? 18.786 24.018 21.975  1.00 56.08 ? 10   DC  T P     1 
ATOM   3259 O  OP1   . DC  C 3 10  ? 17.398 23.999 21.463  1.00 53.75 ? 10   DC  T OP1   1 
ATOM   3260 O  OP2   . DC  C 3 10  ? 19.041 24.289 23.408  1.00 56.56 ? 10   DC  T OP2   1 
ATOM   3261 O  "O5'" . DC  C 3 10  ? 19.508 22.645 21.548  1.00 53.76 ? 10   DC  T "O5'" 1 
ATOM   3262 C  "C5'" . DC  C 3 10  ? 19.862 22.474 20.175  1.00 52.13 ? 10   DC  T "C5'" 1 
ATOM   3263 C  "C4'" . DC  C 3 10  ? 20.975 21.467 20.026  1.00 50.93 ? 10   DC  T "C4'" 1 
ATOM   3264 O  "O4'" . DC  C 3 10  ? 22.254 22.026 20.417  1.00 50.83 ? 10   DC  T "O4'" 1 
ATOM   3265 C  "C3'" . DC  C 3 10  ? 20.714 20.277 20.954  1.00 50.68 ? 10   DC  T "C3'" 1 
ATOM   3266 O  "O3'" . DC  C 3 10  ? 20.876 19.069 20.215  1.00 49.31 ? 10   DC  T "O3'" 1 
ATOM   3267 C  "C2'" . DC  C 3 10  ? 21.788 20.416 22.025  1.00 50.60 ? 10   DC  T "C2'" 1 
ATOM   3268 C  "C1'" . DC  C 3 10  ? 22.909 21.104 21.266  1.00 48.92 ? 10   DC  T "C1'" 1 
ATOM   3269 N  N1    . DC  C 3 10  ? 23.905 21.833 22.087  1.00 45.35 ? 10   DC  T N1    1 
ATOM   3270 C  C2    . DC  C 3 10  ? 25.277 21.591 21.858  1.00 45.64 ? 10   DC  T C2    1 
ATOM   3271 O  O2    . DC  C 3 10  ? 25.611 20.815 20.946  1.00 49.29 ? 10   DC  T O2    1 
ATOM   3272 N  N3    . DC  C 3 10  ? 26.198 22.207 22.631  1.00 43.28 ? 10   DC  T N3    1 
ATOM   3273 C  C4    . DC  C 3 10  ? 25.808 23.044 23.592  1.00 43.71 ? 10   DC  T C4    1 
ATOM   3274 N  N4    . DC  C 3 10  ? 26.759 23.616 24.342  1.00 42.59 ? 10   DC  T N4    1 
ATOM   3275 C  C5    . DC  C 3 10  ? 24.427 23.332 23.830  1.00 42.00 ? 10   DC  T C5    1 
ATOM   3276 C  C6    . DC  C 3 10  ? 23.519 22.710 23.059  1.00 44.22 ? 10   DC  T C6    1 
ATOM   3277 P  P     . DC  C 3 11  ? 20.438 17.664 20.857  1.00 47.33 ? 11   DC  T P     1 
ATOM   3278 O  OP1   . DC  C 3 11  ? 19.688 16.944 19.803  1.00 49.45 ? 11   DC  T OP1   1 
ATOM   3279 O  OP2   . DC  C 3 11  ? 19.799 17.891 22.172  1.00 46.34 ? 11   DC  T OP2   1 
ATOM   3280 O  "O5'" . DC  C 3 11  ? 21.865 16.953 21.070  1.00 48.92 ? 11   DC  T "O5'" 1 
ATOM   3281 C  "C5'" . DC  C 3 11  ? 22.760 16.873 19.957  1.00 50.97 ? 11   DC  T "C5'" 1 
ATOM   3282 C  "C4'" . DC  C 3 11  ? 24.029 16.141 20.319  1.00 53.90 ? 11   DC  T "C4'" 1 
ATOM   3283 O  "O4'" . DC  C 3 11  ? 24.956 17.006 21.026  1.00 53.36 ? 11   DC  T "O4'" 1 
ATOM   3284 C  "C3'" . DC  C 3 11  ? 23.664 15.010 21.283  1.00 54.82 ? 11   DC  T "C3'" 1 
ATOM   3285 O  "O3'" . DC  C 3 11  ? 24.341 13.802 20.956  1.00 58.40 ? 11   DC  T "O3'" 1 
ATOM   3286 C  "C2'" . DC  C 3 11  ? 24.118 15.526 22.637  1.00 53.75 ? 11   DC  T "C2'" 1 
ATOM   3287 C  "C1'" . DC  C 3 11  ? 25.284 16.436 22.287  1.00 52.15 ? 11   DC  T "C1'" 1 
ATOM   3288 N  N1    . DC  C 3 11  ? 25.473 17.537 23.251  1.00 47.88 ? 11   DC  T N1    1 
ATOM   3289 C  C2    . DC  C 3 11  ? 26.767 17.851 23.685  1.00 44.29 ? 11   DC  T C2    1 
ATOM   3290 O  O2    . DC  C 3 11  ? 27.727 17.204 23.248  1.00 43.95 ? 11   DC  T O2    1 
ATOM   3291 N  N3    . DC  C 3 11  ? 26.941 18.850 24.572  1.00 44.84 ? 11   DC  T N3    1 
ATOM   3292 C  C4    . DC  C 3 11  ? 25.884 19.528 25.029  1.00 45.63 ? 11   DC  T C4    1 
ATOM   3293 N  N4    . DC  C 3 11  ? 26.106 20.508 25.910  1.00 44.38 ? 11   DC  T N4    1 
ATOM   3294 C  C5    . DC  C 3 11  ? 24.554 19.231 24.603  1.00 46.33 ? 11   DC  T C5    1 
ATOM   3295 C  C6    . DC  C 3 11  ? 24.396 18.240 23.722  1.00 46.75 ? 11   DC  T C6    1 
ATOM   3296 P  P     . DT  C 3 12  ? 23.982 12.459 21.762  1.00 61.25 ? 12   DT  T P     1 
ATOM   3297 O  OP1   . DT  C 3 12  ? 23.643 11.434 20.750  1.00 64.19 ? 12   DT  T OP1   1 
ATOM   3298 O  OP2   . DT  C 3 12  ? 23.006 12.785 22.826  1.00 58.36 ? 12   DT  T OP2   1 
ATOM   3299 O  "O5'" . DT  C 3 12  ? 25.377 12.077 22.467  1.00 60.43 ? 12   DT  T "O5'" 1 
ATOM   3300 C  "C5'" . DT  C 3 12  ? 26.574 12.136 21.689  1.00 60.95 ? 12   DT  T "C5'" 1 
ATOM   3301 C  "C4'" . DT  C 3 12  ? 27.796 12.129 22.575  1.00 61.61 ? 12   DT  T "C4'" 1 
ATOM   3302 O  "O4'" . DT  C 3 12  ? 27.904 13.355 23.344  1.00 60.60 ? 12   DT  T "O4'" 1 
ATOM   3303 C  "C3'" . DT  C 3 12  ? 27.669 10.993 23.592  1.00 62.46 ? 12   DT  T "C3'" 1 
ATOM   3304 O  "O3'" . DT  C 3 12  ? 28.934 10.348 23.714  1.00 65.03 ? 12   DT  T "O3'" 1 
ATOM   3305 C  "C2'" . DT  C 3 12  ? 27.286 11.706 24.881  1.00 60.32 ? 12   DT  T "C2'" 1 
ATOM   3306 C  "C1'" . DT  C 3 12  ? 27.995 13.042 24.724  1.00 58.43 ? 12   DT  T "C1'" 1 
ATOM   3307 N  N1    . DT  C 3 12  ? 27.410 14.162 25.488  1.00 53.91 ? 12   DT  T N1    1 
ATOM   3308 C  C2    . DT  C 3 12  ? 28.268 14.993 26.177  1.00 53.23 ? 12   DT  T C2    1 
ATOM   3309 O  O2    . DT  C 3 12  ? 29.482 14.858 26.176  1.00 52.35 ? 12   DT  T O2    1 
ATOM   3310 N  N3    . DT  C 3 12  ? 27.650 16.000 26.873  1.00 51.80 ? 12   DT  T N3    1 
ATOM   3311 C  C4    . DT  C 3 12  ? 26.298 16.254 26.948  1.00 51.43 ? 12   DT  T C4    1 
ATOM   3312 O  O4    . DT  C 3 12  ? 25.890 17.195 27.622  1.00 48.92 ? 12   DT  T O4    1 
ATOM   3313 C  C5    . DT  C 3 12  ? 25.460 15.348 26.200  1.00 51.83 ? 12   DT  T C5    1 
ATOM   3314 C  C7    . DT  C 3 12  ? 23.981 15.553 26.222  1.00 53.65 ? 12   DT  T C7    1 
ATOM   3315 C  C6    . DT  C 3 12  ? 26.049 14.361 25.515  1.00 51.25 ? 12   DT  T C6    1 
ATOM   3316 P  P     . DT  C 3 13  ? 29.061 8.999  24.570  1.00 66.84 ? 13   DT  T P     1 
ATOM   3317 O  OP1   . DT  C 3 13  ? 29.951 8.083  23.823  1.00 65.76 ? 13   DT  T OP1   1 
ATOM   3318 O  OP2   . DT  C 3 13  ? 27.694 8.563  24.933  1.00 66.06 ? 13   DT  T OP2   1 
ATOM   3319 O  "O5'" . DT  C 3 13  ? 29.835 9.511  25.885  1.00 64.51 ? 13   DT  T "O5'" 1 
ATOM   3320 C  "C5'" . DT  C 3 13  ? 30.903 10.445 25.714  1.00 62.83 ? 13   DT  T "C5'" 1 
ATOM   3321 C  "C4'" . DT  C 3 13  ? 31.350 11.013 27.037  1.00 61.96 ? 13   DT  T "C4'" 1 
ATOM   3322 O  "O4'" . DT  C 3 13  ? 30.524 12.122 27.464  1.00 59.53 ? 13   DT  T "O4'" 1 
ATOM   3323 C  "C3'" . DT  C 3 13  ? 31.248 9.946  28.129  1.00 62.37 ? 13   DT  T "C3'" 1 
ATOM   3324 O  "O3'" . DT  C 3 13  ? 32.473 9.920  28.847  1.00 66.89 ? 13   DT  T "O3'" 1 
ATOM   3325 C  "C2'" . DT  C 3 13  ? 30.116 10.443 29.018  1.00 59.14 ? 13   DT  T "C2'" 1 
ATOM   3326 C  "C1'" . DT  C 3 13  ? 30.186 11.948 28.823  1.00 56.28 ? 13   DT  T "C1'" 1 
ATOM   3327 N  N1    . DT  C 3 13  ? 28.933 12.696 29.081  1.00 54.13 ? 13   DT  T N1    1 
ATOM   3328 C  C2    . DT  C 3 13  ? 29.010 13.866 29.816  1.00 52.50 ? 13   DT  T C2    1 
ATOM   3329 O  O2    . DT  C 3 13  ? 30.057 14.310 30.257  1.00 52.93 ? 13   DT  T O2    1 
ATOM   3330 N  N3    . DT  C 3 13  ? 27.808 14.498 30.018  1.00 50.26 ? 13   DT  T N3    1 
ATOM   3331 C  C4    . DT  C 3 13  ? 26.567 14.092 29.571  1.00 50.71 ? 13   DT  T C4    1 
ATOM   3332 O  O4    . DT  C 3 13  ? 25.573 14.767 29.831  1.00 49.68 ? 13   DT  T O4    1 
ATOM   3333 C  C5    . DT  C 3 13  ? 26.558 12.859 28.808  1.00 50.87 ? 13   DT  T C5    1 
ATOM   3334 C  C7    . DT  C 3 13  ? 25.258 12.338 28.286  1.00 51.52 ? 13   DT  T C7    1 
ATOM   3335 C  C6    . DT  C 3 13  ? 27.725 12.235 28.602  1.00 52.12 ? 13   DT  T C6    1 
ATOM   3336 P  P     . DC  C 3 14  ? 32.770 8.732  29.876  1.00 70.06 ? 14   DC  T P     1 
ATOM   3337 O  OP1   . DC  C 3 14  ? 34.093 8.169  29.524  1.00 68.98 ? 14   DC  T OP1   1 
ATOM   3338 O  OP2   . DC  C 3 14  ? 31.587 7.845  29.929  1.00 70.17 ? 14   DC  T OP2   1 
ATOM   3339 O  "O5'" . DC  C 3 14  ? 32.914 9.541  31.258  1.00 68.31 ? 14   DC  T "O5'" 1 
ATOM   3340 C  "C5'" . DC  C 3 14  ? 33.759 10.694 31.256  1.00 67.53 ? 14   DC  T "C5'" 1 
ATOM   3341 C  "C4'" . DC  C 3 14  ? 33.464 11.594 32.427  1.00 67.33 ? 14   DC  T "C4'" 1 
ATOM   3342 O  "O4'" . DC  C 3 14  ? 32.180 12.250 32.283  1.00 65.63 ? 14   DC  T "O4'" 1 
ATOM   3343 C  "C3'" . DC  C 3 14  ? 33.383 10.768 33.712  1.00 67.61 ? 14   DC  T "C3'" 1 
ATOM   3344 O  "O3'" . DC  C 3 14  ? 34.101 11.450 34.734  1.00 70.60 ? 14   DC  T "O3'" 1 
ATOM   3345 C  "C2'" . DC  C 3 14  ? 31.893 10.746 34.025  1.00 65.43 ? 14   DC  T "C2'" 1 
ATOM   3346 C  "C1'" . DC  C 3 14  ? 31.448 12.087 33.481  1.00 62.71 ? 14   DC  T "C1'" 1 
ATOM   3347 N  N1    . DC  C 3 14  ? 30.017 12.211 33.158  1.00 59.28 ? 14   DC  T N1    1 
ATOM   3348 C  C2    . DC  C 3 14  ? 29.277 13.224 33.773  1.00 57.55 ? 14   DC  T C2    1 
ATOM   3349 O  O2    . DC  C 3 14  ? 29.847 13.980 34.568  1.00 57.47 ? 14   DC  T O2    1 
ATOM   3350 N  N3    . DC  C 3 14  ? 27.963 13.355 33.488  1.00 56.28 ? 14   DC  T N3    1 
ATOM   3351 C  C4    . DC  C 3 14  ? 27.385 12.520 32.626  1.00 55.66 ? 14   DC  T C4    1 
ATOM   3352 N  N4    . DC  C 3 14  ? 26.089 12.692 32.369  1.00 56.40 ? 14   DC  T N4    1 
ATOM   3353 C  C5    . DC  C 3 14  ? 28.112 11.475 31.984  1.00 56.25 ? 14   DC  T C5    1 
ATOM   3354 C  C6    . DC  C 3 14  ? 29.416 11.358 32.275  1.00 58.50 ? 14   DC  T C6    1 
ATOM   3355 P  P     . DC  C 3 15  ? 34.756 10.617 35.935  1.00 73.60 ? 15   DC  T P     1 
ATOM   3356 O  OP1   . DC  C 3 15  ? 36.094 11.191 36.200  1.00 73.83 ? 15   DC  T OP1   1 
ATOM   3357 O  OP2   . DC  C 3 15  ? 34.625 9.181  35.602  1.00 73.13 ? 15   DC  T OP2   1 
ATOM   3358 O  "O5'" . DC  C 3 15  ? 33.790 10.977 37.169  1.00 72.26 ? 15   DC  T "O5'" 1 
ATOM   3359 C  "C5'" . DC  C 3 15  ? 32.536 11.603 36.890  1.00 71.22 ? 15   DC  T "C5'" 1 
ATOM   3360 C  "C4'" . DC  C 3 15  ? 32.231 12.668 37.908  1.00 70.12 ? 15   DC  T "C4'" 1 
ATOM   3361 O  "O4'" . DC  C 3 15  ? 30.975 13.293 37.569  1.00 68.33 ? 15   DC  T "O4'" 1 
ATOM   3362 C  "C3'" . DC  C 3 15  ? 32.020 11.981 39.258  1.00 70.92 ? 15   DC  T "C3'" 1 
ATOM   3363 O  "O3'" . DC  C 3 15  ? 32.535 12.785 40.318  1.00 73.40 ? 15   DC  T "O3'" 1 
ATOM   3364 C  "C2'" . DC  C 3 15  ? 30.515 11.790 39.341  1.00 68.29 ? 15   DC  T "C2'" 1 
ATOM   3365 C  "C1'" . DC  C 3 15  ? 29.943 12.895 38.460  1.00 65.20 ? 15   DC  T "C1'" 1 
ATOM   3366 N  N1    . DC  C 3 15  ? 28.810 12.449 37.634  1.00 60.47 ? 15   DC  T N1    1 
ATOM   3367 C  C2    . DC  C 3 15  ? 27.613 13.155 37.688  1.00 57.91 ? 15   DC  T C2    1 
ATOM   3368 O  O2    . DC  C 3 15  ? 27.534 14.135 38.437  1.00 58.20 ? 15   DC  T O2    1 
ATOM   3369 N  N3    . DC  C 3 15  ? 26.574 12.752 36.925  1.00 55.60 ? 15   DC  T N3    1 
ATOM   3370 C  C4    . DC  C 3 15  ? 26.705 11.688 36.128  1.00 54.71 ? 15   DC  T C4    1 
ATOM   3371 N  N4    . DC  C 3 15  ? 25.660 11.327 35.386  1.00 53.94 ? 15   DC  T N4    1 
ATOM   3372 C  C5    . DC  C 3 15  ? 27.916 10.950 36.056  1.00 54.54 ? 15   DC  T C5    1 
ATOM   3373 C  C6    . DC  C 3 15  ? 28.933 11.359 36.818  1.00 56.99 ? 15   DC  T C6    1 
ATOM   3374 P  P     . DC  C 3 16  ? 32.523 12.217 41.816  1.00 75.35 ? 16   DC  T P     1 
ATOM   3375 O  OP1   . DC  C 3 16  ? 33.543 12.952 42.597  1.00 74.74 ? 16   DC  T OP1   1 
ATOM   3376 O  OP2   . DC  C 3 16  ? 32.583 10.740 41.734  1.00 73.96 ? 16   DC  T OP2   1 
ATOM   3377 O  "O5'" . DC  C 3 16  ? 31.072 12.666 42.345  1.00 73.21 ? 16   DC  T "O5'" 1 
ATOM   3378 C  "C5'" . DC  C 3 16  ? 30.802 14.054 42.552  1.00 70.46 ? 16   DC  T "C5'" 1 
ATOM   3379 C  "C4'" . DC  C 3 16  ? 29.476 14.226 43.246  1.00 68.65 ? 16   DC  T "C4'" 1 
ATOM   3380 O  "O4'" . DC  C 3 16  ? 28.402 13.947 42.315  1.00 66.47 ? 16   DC  T "O4'" 1 
ATOM   3381 C  "C3'" . DC  C 3 16  ? 29.374 13.173 44.352  1.00 69.00 ? 16   DC  T "C3'" 1 
ATOM   3382 O  "O3'" . DC  C 3 16  ? 28.864 13.746 45.558  1.00 70.92 ? 16   DC  T "O3'" 1 
ATOM   3383 C  "C2'" . DC  C 3 16  ? 28.421 12.132 43.783  1.00 66.11 ? 16   DC  T "C2'" 1 
ATOM   3384 C  "C1'" . DC  C 3 16  ? 27.548 12.958 42.860  1.00 64.37 ? 16   DC  T "C1'" 1 
ATOM   3385 N  N1    . DC  C 3 16  ? 26.930 12.221 41.743  1.00 59.81 ? 16   DC  T N1    1 
ATOM   3386 C  C2    . DC  C 3 16  ? 25.652 12.592 41.329  1.00 57.35 ? 16   DC  T C2    1 
ATOM   3387 O  O2    . DC  C 3 16  ? 25.089 13.535 41.903  1.00 56.56 ? 16   DC  T O2    1 
ATOM   3388 N  N3    . DC  C 3 16  ? 25.063 11.917 40.316  1.00 55.47 ? 16   DC  T N3    1 
ATOM   3389 C  C4    . DC  C 3 16  ? 25.702 10.910 39.724  1.00 53.31 ? 16   DC  T C4    1 
ATOM   3390 N  N4    . DC  C 3 16  ? 25.080 10.269 38.730  1.00 51.59 ? 16   DC  T N4    1 
ATOM   3391 C  C5    . DC  C 3 16  ? 27.010 10.513 40.120  1.00 54.49 ? 16   DC  T C5    1 
ATOM   3392 C  C6    . DC  C 3 16  ? 27.583 11.191 41.124  1.00 57.57 ? 16   DC  T C6    1 
ATOM   3393 P  P     . DC  C 3 17  ? 28.579 12.801 46.826  1.00 71.58 ? 17   DC  T P     1 
ATOM   3394 O  OP1   . DC  C 3 17  ? 28.778 13.628 48.037  1.00 72.52 ? 17   DC  T OP1   1 
ATOM   3395 O  OP2   . DC  C 3 17  ? 29.345 11.544 46.674  1.00 71.52 ? 17   DC  T OP2   1 
ATOM   3396 O  "O5'" . DC  C 3 17  ? 27.015 12.470 46.640  1.00 71.44 ? 17   DC  T "O5'" 1 
ATOM   3397 C  "C5'" . DC  C 3 17  ? 26.162 13.506 46.147  1.00 70.67 ? 17   DC  T "C5'" 1 
ATOM   3398 C  "C4'" . DC  C 3 17  ? 24.721 13.063 46.108  1.00 70.64 ? 17   DC  T "C4'" 1 
ATOM   3399 O  "O4'" . DC  C 3 17  ? 24.375 12.375 44.881  1.00 69.03 ? 17   DC  T "O4'" 1 
ATOM   3400 C  "C3'" . DC  C 3 17  ? 24.446 12.082 47.249  1.00 70.44 ? 17   DC  T "C3'" 1 
ATOM   3401 O  "O3'" . DC  C 3 17  ? 23.170 12.392 47.802  1.00 71.56 ? 17   DC  T "O3'" 1 
ATOM   3402 C  "C2'" . DC  C 3 17  ? 24.398 10.734 46.544  1.00 68.11 ? 17   DC  T "C2'" 1 
ATOM   3403 C  "C1'" . DC  C 3 17  ? 23.791 11.122 45.207  1.00 66.80 ? 17   DC  T "C1'" 1 
ATOM   3404 N  N1    . DC  C 3 17  ? 24.033 10.200 44.083  1.00 63.44 ? 17   DC  T N1    1 
ATOM   3405 C  C2    . DC  C 3 17  ? 23.098 10.161 43.053  1.00 62.21 ? 17   DC  T C2    1 
ATOM   3406 O  O2    . DC  C 3 17  ? 22.099 10.886 43.132  1.00 62.83 ? 17   DC  T O2    1 
ATOM   3407 N  N3    . DC  C 3 17  ? 23.300 9.339  42.000  1.00 61.07 ? 17   DC  T N3    1 
ATOM   3408 C  C4    . DC  C 3 17  ? 24.388 8.571  41.957  1.00 60.72 ? 17   DC  T C4    1 
ATOM   3409 N  N4    . DC  C 3 17  ? 24.552 7.780  40.894  1.00 59.58 ? 17   DC  T N4    1 
ATOM   3410 C  C5    . DC  C 3 17  ? 25.357 8.582  43.001  1.00 61.20 ? 17   DC  T C5    1 
ATOM   3411 C  C6    . DC  C 3 17  ? 25.142 9.404  44.036  1.00 62.28 ? 17   DC  T C6    1 
ATOM   3412 P  P     . DC  C 3 18  ? 22.786 11.883 49.271  1.00 72.40 ? 18   DC  T P     1 
ATOM   3413 O  OP1   . DC  C 3 18  ? 22.802 13.082 50.139  1.00 71.87 ? 18   DC  T OP1   1 
ATOM   3414 O  OP2   . DC  C 3 18  ? 23.622 10.713 49.623  1.00 72.88 ? 18   DC  T OP2   1 
ATOM   3415 O  "O5'" . DC  C 3 18  ? 21.269 11.389 49.059  1.00 69.41 ? 18   DC  T "O5'" 1 
ATOM   3416 C  "C5'" . DC  C 3 18  ? 20.338 12.293 48.459  1.00 64.05 ? 18   DC  T "C5'" 1 
ATOM   3417 C  "C4'" . DC  C 3 18  ? 19.192 11.571 47.792  1.00 59.85 ? 18   DC  T "C4'" 1 
ATOM   3418 O  "O4'" . DC  C 3 18  ? 19.622 10.875 46.596  1.00 57.37 ? 18   DC  T "O4'" 1 
ATOM   3419 C  "C3'" . DC  C 3 18  ? 18.613 10.505 48.724  1.00 59.18 ? 18   DC  T "C3'" 1 
ATOM   3420 O  "O3'" . DC  C 3 18  ? 17.209 10.468 48.488  1.00 62.95 ? 18   DC  T "O3'" 1 
ATOM   3421 C  "C2'" . DC  C 3 18  ? 19.180 9.212  48.166  1.00 55.64 ? 18   DC  T "C2'" 1 
ATOM   3422 C  "C1'" . DC  C 3 18  ? 19.206 9.523  46.681  1.00 53.57 ? 18   DC  T "C1'" 1 
ATOM   3423 N  N1    . DC  C 3 18  ? 20.124 8.703  45.869  1.00 47.83 ? 18   DC  T N1    1 
ATOM   3424 C  C2    . DC  C 3 18  ? 19.658 8.167  44.665  1.00 44.39 ? 18   DC  T C2    1 
ATOM   3425 O  O2    . DC  C 3 18  ? 18.498 8.410  44.310  1.00 45.17 ? 18   DC  T O2    1 
ATOM   3426 N  N3    . DC  C 3 18  ? 20.481 7.403  43.921  1.00 42.20 ? 18   DC  T N3    1 
ATOM   3427 C  C4    . DC  C 3 18  ? 21.727 7.164  44.335  1.00 42.11 ? 18   DC  T C4    1 
ATOM   3428 N  N4    . DC  C 3 18  ? 22.502 6.392  43.572  1.00 38.54 ? 18   DC  T N4    1 
ATOM   3429 C  C5    . DC  C 3 18  ? 22.233 7.706  45.553  1.00 42.01 ? 18   DC  T C5    1 
ATOM   3430 C  C6    . DC  C 3 18  ? 21.406 8.463  46.280  1.00 45.31 ? 18   DC  T C6    1 
HETATM 3431 P  PG    . DGT D 4 .   ? 23.912 39.876 2.871   1.00 30.22 ? 1000 DGT A PG    1 
HETATM 3432 O  O1G   . DGT D 4 .   ? 23.939 38.532 1.988   1.00 29.48 ? 1000 DGT A O1G   1 
HETATM 3433 O  O2G   . DGT D 4 .   ? 23.097 39.471 4.195   1.00 32.24 ? 1000 DGT A O2G   1 
HETATM 3434 O  O3G   . DGT D 4 .   ? 23.262 40.992 2.149   1.00 32.83 ? 1000 DGT A O3G   1 
HETATM 3435 O  O3B   . DGT D 4 .   ? 25.442 40.175 3.291   1.00 28.91 ? 1000 DGT A O3B   1 
HETATM 3436 P  PB    . DGT D 4 .   ? 25.938 40.503 4.791   1.00 27.24 ? 1000 DGT A PB    1 
HETATM 3437 O  O1B   . DGT D 4 .   ? 27.252 41.168 4.657   1.00 27.06 ? 1000 DGT A O1B   1 
HETATM 3438 O  O2B   . DGT D 4 .   ? 24.879 41.227 5.529   1.00 27.32 ? 1000 DGT A O2B   1 
HETATM 3439 O  O3A   . DGT D 4 .   ? 26.231 39.053 5.431   1.00 27.41 ? 1000 DGT A O3A   1 
HETATM 3440 P  PA    . DGT D 4 .   ? 25.361 38.265 6.535   1.00 28.49 ? 1000 DGT A PA    1 
HETATM 3441 O  O1A   . DGT D 4 .   ? 23.969 38.959 6.934   1.00 19.61 ? 1000 DGT A O1A   1 
HETATM 3442 O  O2A   . DGT D 4 .   ? 25.608 36.829 6.794   1.00 28.69 ? 1000 DGT A O2A   1 
HETATM 3443 O  "O5'" . DGT D 4 .   ? 26.159 38.863 7.799   1.00 26.70 ? 1000 DGT A "O5'" 1 
HETATM 3444 C  "C5'" . DGT D 4 .   ? 25.956 40.187 8.299   1.00 27.34 ? 1000 DGT A "C5'" 1 
HETATM 3445 C  "C4'" . DGT D 4 .   ? 27.272 40.713 8.879   1.00 26.37 ? 1000 DGT A "C4'" 1 
HETATM 3446 O  "O4'" . DGT D 4 .   ? 27.838 39.780 9.815   1.00 26.52 ? 1000 DGT A "O4'" 1 
HETATM 3447 C  "C3'" . DGT D 4 .   ? 28.329 40.824 7.781   1.00 25.88 ? 1000 DGT A "C3'" 1 
HETATM 3448 O  "O3'" . DGT D 4 .   ? 28.155 42.067 7.094   1.00 23.92 ? 1000 DGT A "O3'" 1 
HETATM 3449 C  "C2'" . DGT D 4 .   ? 29.566 40.927 8.670   1.00 25.72 ? 1000 DGT A "C2'" 1 
HETATM 3450 C  "C1'" . DGT D 4 .   ? 29.273 39.843 9.710   1.00 26.83 ? 1000 DGT A "C1'" 1 
HETATM 3451 N  N9    . DGT D 4 .   ? 29.796 38.531 9.262   1.00 26.10 ? 1000 DGT A N9    1 
HETATM 3452 C  C8    . DGT D 4 .   ? 29.157 37.642 8.504   1.00 25.95 ? 1000 DGT A C8    1 
HETATM 3453 N  N7    . DGT D 4 .   ? 29.959 36.609 8.258   1.00 26.42 ? 1000 DGT A N7    1 
HETATM 3454 C  C5    . DGT D 4 .   ? 31.119 36.839 8.865   1.00 26.30 ? 1000 DGT A C5    1 
HETATM 3455 C  C6    . DGT D 4 .   ? 32.319 36.139 8.928   1.00 26.56 ? 1000 DGT A C6    1 
HETATM 3456 O  O6    . DGT D 4 .   ? 32.460 35.079 8.320   1.00 29.18 ? 1000 DGT A O6    1 
HETATM 3457 N  N1    . DGT D 4 .   ? 33.385 36.680 9.656   1.00 27.60 ? 1000 DGT A N1    1 
HETATM 3458 C  C2    . DGT D 4 .   ? 33.220 37.913 10.299  1.00 27.22 ? 1000 DGT A C2    1 
HETATM 3459 N  N2    . DGT D 4 .   ? 34.235 38.435 10.980  1.00 26.93 ? 1000 DGT A N2    1 
HETATM 3460 N  N3    . DGT D 4 .   ? 32.048 38.565 10.211  1.00 27.81 ? 1000 DGT A N3    1 
HETATM 3461 C  C4    . DGT D 4 .   ? 31.015 38.063 9.516   1.00 24.99 ? 1000 DGT A C4    1 
HETATM 3462 CA CA    . CA  E 5 .   ? 22.404 38.403 8.857   1.00 66.82 ? 3000 CA  A CA    1 
HETATM 3463 CA CA    . CA  F 5 .   ? 22.578 40.778 6.185   1.00 29.36 ? 3001 CA  A CA    1 
HETATM 3464 CA CA    . CA  G 5 .   ? 22.378 25.163 4.656   1.00 41.47 ? 3002 CA  A CA    1 
HETATM 3465 O  O     . HOH H 6 .   ? -1.162 31.760 12.901  1.00 50.36 ? 2001 HOH A O     1 
HETATM 3466 O  O     . HOH H 6 .   ? -1.126 32.187 10.687  1.00 45.87 ? 2002 HOH A O     1 
HETATM 3467 O  O     . HOH H 6 .   ? 36.890 44.608 40.999  1.00 55.46 ? 2003 HOH A O     1 
HETATM 3468 O  O     . HOH H 6 .   ? 34.617 28.820 -5.368  1.00 60.05 ? 2004 HOH A O     1 
HETATM 3469 O  O     . HOH H 6 .   ? 29.577 13.498 9.705   1.00 56.49 ? 2005 HOH A O     1 
HETATM 3470 O  O     . HOH H 6 .   ? 38.453 46.512 -8.952  1.00 47.83 ? 2006 HOH A O     1 
HETATM 3471 O  O     . HOH H 6 .   ? 39.036 52.440 7.867   1.00 45.18 ? 2007 HOH A O     1 
HETATM 3472 O  O     . HOH H 6 .   ? 37.267 47.863 15.763  1.00 65.58 ? 2008 HOH A O     1 
HETATM 3473 O  O     . HOH H 6 .   ? 35.932 50.974 15.519  1.00 51.01 ? 2009 HOH A O     1 
HETATM 3474 O  O     . HOH H 6 .   ? 6.964  6.691  11.569  1.00 71.20 ? 2010 HOH A O     1 
HETATM 3475 O  O     . HOH H 6 .   ? 20.126 41.026 3.219   1.00 38.16 ? 2011 HOH A O     1 
HETATM 3476 O  O     . HOH H 6 .   ? 14.714 55.887 17.193  1.00 45.39 ? 2012 HOH A O     1 
HETATM 3477 O  O     . HOH H 6 .   ? 9.091  11.908 20.878  1.00 56.34 ? 2013 HOH A O     1 
HETATM 3478 O  O     . HOH H 6 .   ? 19.079 28.501 13.723  1.00 56.93 ? 2014 HOH A O     1 
HETATM 3479 O  O     . HOH H 6 .   ? 7.996  12.640 18.209  1.00 54.29 ? 2015 HOH A O     1 
HETATM 3480 O  O     . HOH H 6 .   ? 17.270 30.334 12.300  1.00 53.19 ? 2016 HOH A O     1 
HETATM 3481 O  O     . HOH H 6 .   ? 22.189 36.409 20.657  1.00 43.41 ? 2017 HOH A O     1 
HETATM 3482 O  O     . HOH H 6 .   ? 31.688 40.299 12.559  1.00 33.62 ? 2018 HOH A O     1 
HETATM 3483 O  O     . HOH H 6 .   ? 2.669  48.976 -2.726  1.00 67.37 ? 2019 HOH A O     1 
HETATM 3484 O  O     . HOH H 6 .   ? 2.730  51.130 -2.166  1.00 58.25 ? 2020 HOH A O     1 
HETATM 3485 O  O     . HOH H 6 .   ? 26.675 39.283 23.132  1.00 60.56 ? 2021 HOH A O     1 
HETATM 3486 O  O     . HOH H 6 .   ? 33.959 54.293 5.044   1.00 44.37 ? 2022 HOH A O     1 
HETATM 3487 O  O     . HOH H 6 .   ? 26.177 58.846 3.425   1.00 46.14 ? 2023 HOH A O     1 
HETATM 3488 O  O     . HOH H 6 .   ? 30.190 26.018 41.435  1.00 47.07 ? 2024 HOH A O     1 
HETATM 3489 O  O     . HOH H 6 .   ? 36.618 54.564 3.500   1.00 35.75 ? 2025 HOH A O     1 
HETATM 3490 O  O     . HOH H 6 .   ? 34.655 50.784 -3.851  1.00 52.44 ? 2026 HOH A O     1 
HETATM 3491 O  O     . HOH H 6 .   ? 28.513 50.015 -4.256  1.00 43.24 ? 2027 HOH A O     1 
HETATM 3492 O  O     . HOH H 6 .   ? 41.588 43.814 10.866  1.00 37.57 ? 2028 HOH A O     1 
HETATM 3493 O  O     . HOH H 6 .   ? 49.347 30.864 10.387  1.00 69.77 ? 2029 HOH A O     1 
HETATM 3494 O  O     . HOH H 6 .   ? 47.553 40.895 8.586   1.00 34.00 ? 2030 HOH A O     1 
HETATM 3495 O  O     . HOH H 6 .   ? 48.125 43.899 5.185   1.00 60.38 ? 2031 HOH A O     1 
HETATM 3496 O  O     . HOH H 6 .   ? 45.080 36.210 3.759   1.00 33.76 ? 2032 HOH A O     1 
HETATM 3497 O  O     . HOH H 6 .   ? 50.037 38.280 3.432   1.00 49.30 ? 2033 HOH A O     1 
HETATM 3498 O  O     . HOH H 6 .   ? 49.273 44.298 -0.047  1.00 70.52 ? 2034 HOH A O     1 
HETATM 3499 O  O     . HOH H 6 .   ? 29.727 38.379 2.088   1.00 42.59 ? 2035 HOH A O     1 
HETATM 3500 O  O     . HOH H 6 .   ? 22.919 37.936 -0.470  1.00 50.06 ? 2036 HOH A O     1 
HETATM 3501 O  O     . HOH H 6 .   ? 26.502 46.369 -2.995  1.00 38.67 ? 2037 HOH A O     1 
HETATM 3502 O  O     . HOH H 6 .   ? 25.256 37.154 -2.016  1.00 40.27 ? 2038 HOH A O     1 
HETATM 3503 O  O     . HOH H 6 .   ? 30.480 36.145 -4.258  1.00 42.19 ? 2039 HOH A O     1 
HETATM 3504 O  O     . HOH H 6 .   ? 28.311 35.358 -8.697  1.00 57.20 ? 2040 HOH A O     1 
HETATM 3505 O  O     . HOH H 6 .   ? 32.211 30.982 -4.965  1.00 59.19 ? 2041 HOH A O     1 
HETATM 3506 O  O     . HOH H 6 .   ? 30.090 33.534 2.407   1.00 43.81 ? 2042 HOH A O     1 
HETATM 3507 O  O     . HOH H 6 .   ? 39.471 31.380 5.638   1.00 46.51 ? 2043 HOH A O     1 
HETATM 3508 O  O     . HOH H 6 .   ? 45.468 46.342 2.346   1.00 55.80 ? 2044 HOH A O     1 
HETATM 3509 O  O     . HOH H 6 .   ? 44.563 32.287 -2.747  1.00 57.60 ? 2045 HOH A O     1 
HETATM 3510 O  O     . HOH H 6 .   ? 43.937 47.418 -3.479  1.00 40.36 ? 2046 HOH A O     1 
HETATM 3511 O  O     . HOH H 6 .   ? 40.685 44.595 -9.086  1.00 31.67 ? 2047 HOH A O     1 
HETATM 3512 O  O     . HOH H 6 .   ? 42.590 48.951 -0.365  1.00 35.28 ? 2048 HOH A O     1 
HETATM 3513 O  O     . HOH H 6 .   ? 37.738 50.428 7.803   1.00 41.69 ? 2049 HOH A O     1 
HETATM 3514 O  O     . HOH H 6 .   ? 39.937 44.396 12.374  1.00 52.55 ? 2050 HOH A O     1 
HETATM 3515 O  O     . HOH H 6 .   ? 39.767 49.244 12.275  1.00 55.60 ? 2051 HOH A O     1 
HETATM 3516 O  O     . HOH H 6 .   ? 37.702 54.195 13.057  1.00 54.44 ? 2052 HOH A O     1 
HETATM 3517 O  O     . HOH H 6 .   ? 36.640 45.587 15.068  1.00 43.37 ? 2053 HOH A O     1 
HETATM 3518 O  O     . HOH H 6 .   ? 34.504 40.939 15.476  1.00 77.73 ? 2054 HOH A O     1 
HETATM 3519 O  O     . HOH H 6 .   ? 35.540 48.775 16.896  1.00 69.17 ? 2055 HOH A O     1 
HETATM 3520 O  O     . HOH H 6 .   ? 31.045 46.729 19.185  1.00 51.51 ? 2056 HOH A O     1 
HETATM 3521 O  O     . HOH H 6 .   ? 29.955 44.785 19.035  1.00 40.21 ? 2057 HOH A O     1 
HETATM 3522 O  O     . HOH H 6 .   ? 22.503 45.312 17.545  1.00 35.13 ? 2058 HOH A O     1 
HETATM 3523 O  O     . HOH H 6 .   ? 24.627 54.071 18.761  1.00 42.99 ? 2059 HOH A O     1 
HETATM 3524 O  O     . HOH H 6 .   ? 21.173 46.832 19.580  1.00 46.34 ? 2060 HOH A O     1 
HETATM 3525 O  O     . HOH H 6 .   ? 25.188 56.388 17.529  1.00 57.20 ? 2061 HOH A O     1 
HETATM 3526 O  O     . HOH H 6 .   ? 17.600 55.517 16.289  1.00 56.99 ? 2062 HOH A O     1 
HETATM 3527 O  O     . HOH H 6 .   ? 18.859 55.147 18.855  1.00 47.70 ? 2063 HOH A O     1 
HETATM 3528 O  O     . HOH H 6 .   ? 19.887 50.876 22.622  1.00 60.60 ? 2064 HOH A O     1 
HETATM 3529 O  O     . HOH H 6 .   ? 15.628 54.704 22.085  1.00 51.99 ? 2065 HOH A O     1 
HETATM 3530 O  O     . HOH H 6 .   ? 16.364 44.716 23.672  1.00 69.17 ? 2066 HOH A O     1 
HETATM 3531 O  O     . HOH H 6 .   ? 8.315  47.286 24.361  1.00 53.45 ? 2067 HOH A O     1 
HETATM 3532 O  O     . HOH H 6 .   ? 23.063 43.092 18.171  1.00 45.28 ? 2068 HOH A O     1 
HETATM 3533 O  O     . HOH H 6 .   ? 26.000 39.284 15.759  1.00 47.31 ? 2069 HOH A O     1 
HETATM 3534 O  O     . HOH H 6 .   ? 20.163 34.522 12.054  1.00 52.57 ? 2070 HOH A O     1 
HETATM 3535 O  O     . HOH H 6 .   ? 20.801 36.468 8.039   1.00 28.89 ? 2071 HOH A O     1 
HETATM 3536 O  O     . HOH H 6 .   ? 14.748 31.313 12.214  1.00 50.71 ? 2072 HOH A O     1 
HETATM 3537 O  O     . HOH H 6 .   ? 17.909 33.648 13.103  1.00 43.50 ? 2073 HOH A O     1 
HETATM 3538 O  O     . HOH H 6 .   ? 2.164  42.167 17.695  1.00 69.47 ? 2074 HOH A O     1 
HETATM 3539 O  O     . HOH H 6 .   ? -3.236 36.104 7.827   1.00 64.82 ? 2075 HOH A O     1 
HETATM 3540 O  O     . HOH H 6 .   ? 0.860  41.146 0.674   1.00 50.16 ? 2076 HOH A O     1 
HETATM 3541 O  O     . HOH H 6 .   ? -2.802 47.821 -0.072  1.00 45.33 ? 2077 HOH A O     1 
HETATM 3542 O  O     . HOH H 6 .   ? 0.796  48.062 -1.515  1.00 48.74 ? 2078 HOH A O     1 
HETATM 3543 O  O     . HOH H 6 .   ? 1.473  51.083 -0.303  1.00 67.09 ? 2079 HOH A O     1 
HETATM 3544 O  O     . HOH H 6 .   ? 1.699  50.669 6.978   1.00 50.47 ? 2080 HOH A O     1 
HETATM 3545 O  O     . HOH H 6 .   ? 9.326  56.979 7.027   1.00 51.64 ? 2081 HOH A O     1 
HETATM 3546 O  O     . HOH H 6 .   ? 3.034  51.480 1.305   1.00 59.69 ? 2082 HOH A O     1 
HETATM 3547 O  O     . HOH H 6 .   ? 23.497 56.711 8.758   1.00 42.20 ? 2083 HOH A O     1 
HETATM 3548 O  O     . HOH H 6 .   ? 16.185 50.145 4.049   1.00 43.16 ? 2084 HOH A O     1 
HETATM 3549 O  O     . HOH H 6 .   ? 15.542 49.048 2.069   1.00 40.81 ? 2085 HOH A O     1 
HETATM 3550 O  O     . HOH H 6 .   ? 19.653 31.431 6.550   1.00 46.20 ? 2086 HOH A O     1 
HETATM 3551 O  O     . HOH H 6 .   ? 20.981 33.116 5.670   1.00 54.79 ? 2087 HOH A O     1 
HETATM 3552 O  O     . HOH H 6 .   ? 18.853 35.500 6.606   1.00 46.18 ? 2088 HOH A O     1 
HETATM 3553 O  O     . HOH H 6 .   ? 22.204 36.277 6.266   1.00 55.22 ? 2089 HOH A O     1 
HETATM 3554 O  O     . HOH H 6 .   ? 14.534 50.623 -0.114  1.00 58.86 ? 2090 HOH A O     1 
HETATM 3555 O  O     . HOH H 6 .   ? 16.778 51.605 -1.596  1.00 63.75 ? 2091 HOH A O     1 
HETATM 3556 O  O     . HOH H 6 .   ? 0.829  31.522 -1.778  1.00 48.17 ? 2092 HOH A O     1 
HETATM 3557 O  O     . HOH H 6 .   ? 3.401  33.934 -0.511  1.00 45.36 ? 2093 HOH A O     1 
HETATM 3558 O  O     . HOH H 6 .   ? -2.129 33.493 4.320   1.00 58.68 ? 2094 HOH A O     1 
HETATM 3559 O  O     . HOH H 6 .   ? 1.912  31.882 5.959   1.00 61.80 ? 2095 HOH A O     1 
HETATM 3560 O  O     . HOH H 6 .   ? 11.693 21.647 2.190   1.00 55.91 ? 2096 HOH A O     1 
HETATM 3561 O  O     . HOH H 6 .   ? 15.085 24.558 -3.062  1.00 47.46 ? 2097 HOH A O     1 
HETATM 3562 O  O     . HOH H 6 .   ? 19.723 23.590 -2.921  1.00 59.77 ? 2098 HOH A O     1 
HETATM 3563 O  O     . HOH H 6 .   ? 22.358 27.057 3.110   1.00 37.54 ? 2099 HOH A O     1 
HETATM 3564 O  O     . HOH H 6 .   ? 16.811 29.965 2.934   1.00 34.29 ? 2100 HOH A O     1 
HETATM 3565 O  O     . HOH H 6 .   ? 23.946 23.281 4.107   1.00 38.02 ? 2101 HOH A O     1 
HETATM 3566 O  O     . HOH H 6 .   ? 27.808 24.570 7.312   1.00 49.44 ? 2102 HOH A O     1 
HETATM 3567 O  O     . HOH H 6 .   ? 27.904 14.735 7.640   1.00 41.07 ? 2103 HOH A O     1 
HETATM 3568 O  O     . HOH H 6 .   ? 24.151 17.201 12.574  1.00 49.43 ? 2104 HOH A O     1 
HETATM 3569 O  O     . HOH H 6 .   ? 15.608 20.565 -3.495  1.00 50.01 ? 2105 HOH A O     1 
HETATM 3570 O  O     . HOH H 6 .   ? 16.333 18.856 -2.182  1.00 52.77 ? 2106 HOH A O     1 
HETATM 3571 O  O     . HOH H 6 .   ? 12.531 13.530 -0.987  1.00 53.93 ? 2107 HOH A O     1 
HETATM 3572 O  O     . HOH H 6 .   ? 9.694  11.496 11.780  1.00 45.97 ? 2108 HOH A O     1 
HETATM 3573 O  O     . HOH H 6 .   ? 11.092 7.196  6.086   1.00 70.96 ? 2109 HOH A O     1 
HETATM 3574 O  O     . HOH H 6 .   ? 7.297  11.948 4.724   1.00 60.07 ? 2110 HOH A O     1 
HETATM 3575 O  O     . HOH H 6 .   ? 9.039  4.255  7.381   1.00 54.50 ? 2111 HOH A O     1 
HETATM 3576 O  O     . HOH H 6 .   ? 8.075  7.998  14.690  1.00 51.46 ? 2112 HOH A O     1 
HETATM 3577 O  O     . HOH H 6 .   ? 10.027 5.887  16.125  1.00 62.46 ? 2113 HOH A O     1 
HETATM 3578 O  O     . HOH H 6 .   ? 9.605  7.457  18.686  1.00 65.44 ? 2114 HOH A O     1 
HETATM 3579 O  O     . HOH H 6 .   ? 18.839 6.072  12.201  1.00 66.93 ? 2115 HOH A O     1 
HETATM 3580 O  O     . HOH H 6 .   ? 24.248 13.154 16.239  1.00 58.38 ? 2116 HOH A O     1 
HETATM 3581 O  O     . HOH H 6 .   ? 12.262 12.244 21.949  1.00 76.96 ? 2117 HOH A O     1 
HETATM 3582 O  O     . HOH H 6 .   ? 20.956 20.437 16.971  1.00 48.53 ? 2118 HOH A O     1 
HETATM 3583 O  O     . HOH H 6 .   ? 18.370 24.228 14.759  1.00 45.00 ? 2119 HOH A O     1 
HETATM 3584 O  O     . HOH H 6 .   ? 11.202 14.479 24.521  1.00 62.17 ? 2120 HOH A O     1 
HETATM 3585 O  O     . HOH H 6 .   ? 13.325 18.191 21.970  1.00 69.14 ? 2121 HOH A O     1 
HETATM 3586 O  O     . HOH H 6 .   ? 16.262 28.144 14.200  1.00 56.37 ? 2122 HOH A O     1 
HETATM 3587 O  O     . HOH H 6 .   ? 5.481  18.124 15.224  1.00 54.89 ? 2123 HOH A O     1 
HETATM 3588 O  O     . HOH H 6 .   ? 6.684  12.600 15.348  1.00 54.08 ? 2124 HOH A O     1 
HETATM 3589 O  O     . HOH H 6 .   ? 0.918  16.315 15.484  1.00 51.10 ? 2125 HOH A O     1 
HETATM 3590 O  O     . HOH H 6 .   ? 2.203  17.223 16.995  1.00 52.13 ? 2126 HOH A O     1 
HETATM 3591 O  O     . HOH H 6 .   ? 4.235  27.288 11.430  1.00 54.77 ? 2127 HOH A O     1 
HETATM 3592 O  O     . HOH H 6 .   ? 14.218 30.653 14.758  1.00 55.23 ? 2128 HOH A O     1 
HETATM 3593 O  O     . HOH H 6 .   ? 12.997 29.464 18.664  1.00 61.71 ? 2129 HOH A O     1 
HETATM 3594 O  O     . HOH H 6 .   ? 10.289 40.828 23.389  1.00 51.20 ? 2130 HOH A O     1 
HETATM 3595 O  O     . HOH H 6 .   ? 21.565 35.259 18.744  1.00 46.70 ? 2131 HOH A O     1 
HETATM 3596 O  O     . HOH H 6 .   ? 29.089 45.579 26.356  1.00 60.67 ? 2132 HOH A O     1 
HETATM 3597 O  O     . HOH H 6 .   ? 23.187 39.562 29.673  1.00 56.65 ? 2133 HOH A O     1 
HETATM 3598 O  O     . HOH H 6 .   ? 22.240 42.165 26.015  1.00 57.95 ? 2134 HOH A O     1 
HETATM 3599 O  O     . HOH H 6 .   ? 28.372 38.526 24.367  1.00 75.54 ? 2135 HOH A O     1 
HETATM 3600 O  O     . HOH H 6 .   ? 47.053 38.959 17.660  1.00 57.20 ? 2136 HOH A O     1 
HETATM 3601 O  O     . HOH H 6 .   ? 48.996 38.588 14.951  1.00 34.83 ? 2137 HOH A O     1 
HETATM 3602 O  O     . HOH H 6 .   ? 54.148 30.661 13.011  1.00 58.06 ? 2138 HOH A O     1 
HETATM 3603 O  O     . HOH H 6 .   ? 55.094 37.615 22.598  1.00 43.38 ? 2139 HOH A O     1 
HETATM 3604 O  O     . HOH H 6 .   ? 59.952 32.422 22.852  1.00 52.97 ? 2140 HOH A O     1 
HETATM 3605 O  O     . HOH H 6 .   ? 42.548 44.586 20.099  1.00 52.04 ? 2141 HOH A O     1 
HETATM 3606 O  O     . HOH H 6 .   ? 44.461 44.802 24.481  1.00 59.59 ? 2142 HOH A O     1 
HETATM 3607 O  O     . HOH H 6 .   ? 34.687 44.371 34.188  1.00 45.97 ? 2143 HOH A O     1 
HETATM 3608 O  O     . HOH H 6 .   ? 24.929 40.879 29.142  1.00 65.34 ? 2144 HOH A O     1 
HETATM 3609 O  O     . HOH H 6 .   ? 26.881 28.775 37.614  1.00 62.06 ? 2145 HOH A O     1 
HETATM 3610 O  O     . HOH H 6 .   ? 27.233 29.803 40.363  1.00 65.62 ? 2146 HOH A O     1 
HETATM 3611 O  O     . HOH H 6 .   ? 32.691 24.023 31.275  1.00 41.63 ? 2147 HOH A O     1 
HETATM 3612 O  O     . HOH H 6 .   ? 49.039 27.292 11.802  1.00 49.70 ? 2148 HOH A O     1 
HETATM 3613 O  O     . HOH H 6 .   ? 53.324 24.697 13.844  1.00 72.11 ? 2149 HOH A O     1 
HETATM 3614 O  O     . HOH H 6 .   ? 39.540 18.800 18.285  1.00 51.09 ? 2150 HOH A O     1 
HETATM 3615 O  O     . HOH H 6 .   ? 42.220 17.509 14.155  1.00 55.88 ? 2151 HOH A O     1 
HETATM 3616 O  O     . HOH H 6 .   ? 39.963 16.717 16.333  1.00 55.48 ? 2152 HOH A O     1 
HETATM 3617 O  O     . HOH H 6 .   ? 43.687 21.570 28.476  1.00 70.48 ? 2153 HOH A O     1 
HETATM 3618 O  O     . HOH H 6 .   ? 35.803 25.770 40.843  1.00 48.31 ? 2154 HOH A O     1 
HETATM 3619 O  O     . HOH H 6 .   ? 28.826 28.287 40.129  1.00 59.12 ? 2155 HOH A O     1 
HETATM 3620 O  O     . HOH H 6 .   ? 36.859 42.479 38.809  1.00 48.15 ? 2156 HOH A O     1 
HETATM 3621 O  O     . HOH H 6 .   ? 48.158 38.539 38.392  1.00 65.09 ? 2157 HOH A O     1 
HETATM 3622 O  O     . HOH H 6 .   ? 37.217 35.805 42.118  1.00 40.51 ? 2158 HOH A O     1 
HETATM 3623 O  O     . HOH H 6 .   ? 43.311 35.049 37.617  1.00 54.31 ? 2159 HOH A O     1 
HETATM 3624 O  O     . HOH H 6 .   ? 42.654 30.148 40.473  1.00 72.11 ? 2160 HOH A O     1 
HETATM 3625 O  O     . HOH H 6 .   ? 39.936 22.456 32.764  1.00 41.54 ? 2161 HOH A O     1 
HETATM 3626 O  O     . HOH H 6 .   ? 37.068 33.762 22.704  1.00 33.94 ? 2162 HOH A O     1 
HETATM 3627 O  O     . HOH H 6 .   ? 35.819 35.610 21.233  1.00 60.63 ? 2163 HOH A O     1 
HETATM 3628 O  O     . HOH H 6 .   ? 35.767 32.063 21.835  1.00 34.11 ? 2164 HOH A O     1 
HETATM 3629 O  O     . HOH H 6 .   ? 29.097 28.513 30.688  1.00 44.39 ? 2165 HOH A O     1 
HETATM 3630 O  O     . HOH H 6 .   ? 32.603 30.699 30.012  1.00 35.04 ? 2166 HOH A O     1 
HETATM 3631 O  O     . HOH H 6 .   ? 25.441 33.606 31.638  1.00 70.02 ? 2167 HOH A O     1 
HETATM 3632 O  O     . HOH H 6 .   ? 21.069 39.816 38.471  1.00 67.63 ? 2168 HOH A O     1 
HETATM 3633 O  O     . HOH H 6 .   ? 23.999 34.446 40.505  1.00 57.76 ? 2169 HOH A O     1 
HETATM 3634 O  O     . HOH H 6 .   ? 28.713 34.405 6.477   1.00 41.95 ? 2170 HOH A O     1 
HETATM 3635 O  O     . HOH H 6 .   ? 24.145 35.288 5.344   1.00 42.33 ? 2171 HOH A O     1 
HETATM 3636 O  O     . HOH H 6 .   ? 25.879 34.415 7.557   1.00 43.34 ? 2172 HOH A O     1 
HETATM 3637 O  O     . HOH H 6 .   ? 31.242 32.973 7.078   1.00 43.77 ? 2173 HOH A O     1 
HETATM 3638 O  O     . HOH I 6 .   ? 14.967 0.947  32.249  1.00 55.50 ? 2001 HOH P O     1 
HETATM 3639 O  O     . HOH I 6 .   ? 20.873 11.722 31.843  1.00 52.28 ? 2002 HOH P O     1 
HETATM 3640 O  O     . HOH I 6 .   ? 21.141 9.828  33.064  1.00 66.33 ? 2003 HOH P O     1 
HETATM 3641 O  O     . HOH I 6 .   ? 18.460 13.493 31.357  1.00 58.96 ? 2004 HOH P O     1 
HETATM 3642 O  O     . HOH I 6 .   ? 20.993 5.922  34.951  1.00 53.87 ? 2005 HOH P O     1 
HETATM 3643 O  O     . HOH I 6 .   ? 31.316 21.520 12.594  1.00 36.22 ? 2006 HOH P O     1 
HETATM 3644 O  O     . HOH I 6 .   ? 20.668 28.581 3.453   1.00 61.28 ? 2007 HOH P O     1 
HETATM 3645 O  O     . HOH I 6 .   ? 14.963 11.325 32.712  1.00 52.05 ? 2008 HOH P O     1 
HETATM 3646 O  O     . HOH I 6 .   ? 20.611 10.990 35.175  1.00 63.27 ? 2009 HOH P O     1 
HETATM 3647 O  O     . HOH I 6 .   ? 22.085 13.188 33.222  1.00 56.19 ? 2010 HOH P O     1 
HETATM 3648 O  O     . HOH I 6 .   ? 19.609 14.174 33.285  1.00 67.50 ? 2011 HOH P O     1 
HETATM 3649 O  O     . HOH I 6 .   ? 17.009 17.525 35.593  1.00 67.01 ? 2012 HOH P O     1 
HETATM 3650 O  O     . HOH I 6 .   ? 37.049 22.631 36.014  1.00 40.11 ? 2013 HOH P O     1 
HETATM 3651 O  O     . HOH I 6 .   ? 30.015 24.133 27.278  1.00 62.90 ? 2014 HOH P O     1 
HETATM 3652 O  O     . HOH I 6 .   ? 33.484 16.922 24.854  1.00 48.12 ? 2015 HOH P O     1 
HETATM 3653 O  O     . HOH I 6 .   ? 32.003 25.038 25.611  1.00 50.73 ? 2016 HOH P O     1 
HETATM 3654 O  O     . HOH I 6 .   ? 42.094 18.244 24.012  1.00 70.84 ? 2017 HOH P O     1 
HETATM 3655 O  O     . HOH I 6 .   ? 36.276 22.641 22.648  1.00 50.62 ? 2018 HOH P O     1 
HETATM 3656 O  O     . HOH I 6 .   ? 35.080 15.992 14.456  1.00 61.59 ? 2019 HOH P O     1 
HETATM 3657 O  O     . HOH I 6 .   ? 37.988 19.440 16.769  1.00 59.33 ? 2020 HOH P O     1 
HETATM 3658 O  O     . HOH I 6 .   ? 38.671 15.400 19.516  1.00 52.26 ? 2021 HOH P O     1 
HETATM 3659 O  O     . HOH I 6 .   ? 32.112 13.801 16.205  1.00 65.51 ? 2022 HOH P O     1 
HETATM 3660 O  O     . HOH I 6 .   ? 32.166 19.415 12.410  1.00 47.97 ? 2023 HOH P O     1 
HETATM 3661 O  O     . HOH I 6 .   ? 33.539 26.153 18.106  1.00 35.15 ? 2024 HOH P O     1 
HETATM 3662 O  O     . HOH I 6 .   ? 33.491 27.242 14.580  1.00 51.25 ? 2025 HOH P O     1 
HETATM 3663 O  O     . HOH I 6 .   ? 24.312 26.432 5.826   1.00 38.05 ? 2026 HOH P O     1 
HETATM 3664 O  O     . HOH I 6 .   ? 20.844 26.527 6.309   1.00 35.26 ? 2027 HOH P O     1 
HETATM 3665 O  O     . HOH I 6 .   ? 28.424 38.727 13.401  1.00 54.28 ? 2028 HOH P O     1 
HETATM 3666 O  O     . HOH I 6 .   ? 30.489 31.430 9.101   1.00 44.89 ? 2029 HOH P O     1 
HETATM 3667 O  O     . HOH I 6 .   ? 23.764 32.859 5.726   1.00 42.42 ? 2030 HOH P O     1 
HETATM 3668 O  O     . HOH J 6 .   ? 45.913 40.757 16.410  1.00 49.43 ? 2001 HOH T O     1 
HETATM 3669 O  O     . HOH J 6 .   ? 40.862 34.818 15.226  1.00 61.18 ? 2002 HOH T O     1 
HETATM 3670 O  O     . HOH J 6 .   ? 41.963 41.712 14.160  1.00 46.96 ? 2003 HOH T O     1 
HETATM 3671 O  O     . HOH J 6 .   ? 34.620 30.100 10.827  1.00 52.39 ? 2004 HOH T O     1 
HETATM 3672 O  O     . HOH J 6 .   ? 44.567 38.947 16.195  1.00 37.06 ? 2005 HOH T O     1 
HETATM 3673 O  O     . HOH J 6 .   ? 28.759 37.002 16.900  1.00 47.60 ? 2006 HOH T O     1 
HETATM 3674 O  O     . HOH J 6 .   ? 26.338 32.789 18.040  1.00 43.95 ? 2007 HOH T O     1 
HETATM 3675 O  O     . HOH J 6 .   ? 31.951 41.563 22.274  1.00 53.38 ? 2008 HOH T O     1 
HETATM 3676 O  O     . HOH J 6 .   ? 30.305 30.568 22.401  1.00 45.98 ? 2009 HOH T O     1 
HETATM 3677 O  O     . HOH J 6 .   ? 27.802 30.617 24.931  1.00 49.87 ? 2010 HOH T O     1 
HETATM 3678 O  O     . HOH J 6 .   ? 22.503 27.411 25.542  1.00 45.55 ? 2011 HOH T O     1 
HETATM 3679 O  O     . HOH J 6 .   ? 22.044 25.148 17.468  1.00 66.64 ? 2012 HOH T O     1 
HETATM 3680 O  O     . HOH J 6 .   ? 16.320 23.378 18.752  1.00 45.24 ? 2013 HOH T O     1 
HETATM 3681 O  O     . HOH J 6 .   ? 25.806 19.620 18.251  1.00 56.87 ? 2014 HOH T O     1 
HETATM 3682 O  O     . HOH J 6 .   ? 19.696 17.908 17.454  1.00 46.00 ? 2015 HOH T O     1 
HETATM 3683 O  O     . HOH J 6 .   ? 23.883 21.082 26.863  1.00 52.87 ? 2016 HOH T O     1 
HETATM 3684 O  O     . HOH J 6 .   ? 17.202 18.532 22.781  1.00 58.42 ? 2017 HOH T O     1 
HETATM 3685 O  O     . HOH J 6 .   ? 31.852 14.203 25.488  1.00 53.30 ? 2018 HOH T O     1 
HETATM 3686 O  O     . HOH J 6 .   ? 28.464 12.527 19.714  1.00 69.00 ? 2019 HOH T O     1 
HETATM 3687 O  O     . HOH J 6 .   ? 37.323 10.949 31.764  1.00 52.34 ? 2020 HOH T O     1 
HETATM 3688 O  O     . HOH J 6 .   ? 29.923 8.616  41.205  1.00 60.07 ? 2021 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 GLU 338 332 332 GLU GLU A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 ?   ?   ?   A . n 
A 1 350 ILE 350 344 ?   ?   ?   A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DT  11  11  11  DT  DT  P . n 
B 2 12  DT  12  12  12  DT  DT  P . n 
B 2 13  DC  13  13  13  DC  DC  P . n 
B 2 14  DA  14  14  14  DA  DA  P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DC  2   2   2   DC  DC  T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   8OG 5   5   5   8OG 8OG T . n 
C 3 6   DG  6   6   6   DG  DG  T . n 
C 3 7   DA  7   7   7   DA  DA  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DC  10  10  10  DC  DC  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DT  13  13  13  DT  DT  T . n 
C 3 14  DC  14  14  14  DC  DC  T . n 
C 3 15  DC  15  15  15  DC  DC  T . n 
C 3 16  DC  16  16  16  DC  DC  T . n 
C 3 17  DC  17  17  17  DC  DC  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DGT 1   1000 1000 DGT DGT A . 
E 5 CA  1   3000 3000 CA  CA  A . 
F 5 CA  1   3001 3001 CA  CA  A . 
G 5 CA  1   3002 3002 CA  CA  A . 
H 6 HOH 1   2001 2001 HOH HOH A . 
H 6 HOH 2   2002 2002 HOH HOH A . 
H 6 HOH 3   2003 2003 HOH HOH A . 
H 6 HOH 4   2004 2004 HOH HOH A . 
H 6 HOH 5   2005 2005 HOH HOH A . 
H 6 HOH 6   2006 2006 HOH HOH A . 
H 6 HOH 7   2007 2007 HOH HOH A . 
H 6 HOH 8   2008 2008 HOH HOH A . 
H 6 HOH 9   2009 2009 HOH HOH A . 
H 6 HOH 10  2010 2010 HOH HOH A . 
H 6 HOH 11  2011 2011 HOH HOH A . 
H 6 HOH 12  2012 2012 HOH HOH A . 
H 6 HOH 13  2013 2013 HOH HOH A . 
H 6 HOH 14  2014 2014 HOH HOH A . 
H 6 HOH 15  2015 2015 HOH HOH A . 
H 6 HOH 16  2016 2016 HOH HOH A . 
H 6 HOH 17  2017 2017 HOH HOH A . 
H 6 HOH 18  2018 2018 HOH HOH A . 
H 6 HOH 19  2019 2019 HOH HOH A . 
H 6 HOH 20  2020 2020 HOH HOH A . 
H 6 HOH 21  2021 2021 HOH HOH A . 
H 6 HOH 22  2022 2022 HOH HOH A . 
H 6 HOH 23  2023 2023 HOH HOH A . 
H 6 HOH 24  2024 2024 HOH HOH A . 
H 6 HOH 25  2025 2025 HOH HOH A . 
H 6 HOH 26  2026 2026 HOH HOH A . 
H 6 HOH 27  2027 2027 HOH HOH A . 
H 6 HOH 28  2028 2028 HOH HOH A . 
H 6 HOH 29  2029 2029 HOH HOH A . 
H 6 HOH 30  2030 2030 HOH HOH A . 
H 6 HOH 31  2031 2031 HOH HOH A . 
H 6 HOH 32  2032 2032 HOH HOH A . 
H 6 HOH 33  2033 2033 HOH HOH A . 
H 6 HOH 34  2034 2034 HOH HOH A . 
H 6 HOH 35  2035 2035 HOH HOH A . 
H 6 HOH 36  2036 2036 HOH HOH A . 
H 6 HOH 37  2037 2037 HOH HOH A . 
H 6 HOH 38  2038 2038 HOH HOH A . 
H 6 HOH 39  2039 2039 HOH HOH A . 
H 6 HOH 40  2040 2040 HOH HOH A . 
H 6 HOH 41  2041 2041 HOH HOH A . 
H 6 HOH 42  2042 2042 HOH HOH A . 
H 6 HOH 43  2043 2043 HOH HOH A . 
H 6 HOH 44  2044 2044 HOH HOH A . 
H 6 HOH 45  2045 2045 HOH HOH A . 
H 6 HOH 46  2046 2046 HOH HOH A . 
H 6 HOH 47  2047 2047 HOH HOH A . 
H 6 HOH 48  2048 2048 HOH HOH A . 
H 6 HOH 49  2049 2049 HOH HOH A . 
H 6 HOH 50  2050 2050 HOH HOH A . 
H 6 HOH 51  2051 2051 HOH HOH A . 
H 6 HOH 52  2052 2052 HOH HOH A . 
H 6 HOH 53  2053 2053 HOH HOH A . 
H 6 HOH 54  2054 2054 HOH HOH A . 
H 6 HOH 55  2055 2055 HOH HOH A . 
H 6 HOH 56  2056 2056 HOH HOH A . 
H 6 HOH 57  2057 2057 HOH HOH A . 
H 6 HOH 58  2058 2058 HOH HOH A . 
H 6 HOH 59  2059 2059 HOH HOH A . 
H 6 HOH 60  2060 2060 HOH HOH A . 
H 6 HOH 61  2061 2061 HOH HOH A . 
H 6 HOH 62  2062 2062 HOH HOH A . 
H 6 HOH 63  2063 2063 HOH HOH A . 
H 6 HOH 64  2064 2064 HOH HOH A . 
H 6 HOH 65  2065 2065 HOH HOH A . 
H 6 HOH 66  2066 2066 HOH HOH A . 
H 6 HOH 67  2067 2067 HOH HOH A . 
H 6 HOH 68  2068 2068 HOH HOH A . 
H 6 HOH 69  2069 2069 HOH HOH A . 
H 6 HOH 70  2070 2070 HOH HOH A . 
H 6 HOH 71  2071 2071 HOH HOH A . 
H 6 HOH 72  2072 2072 HOH HOH A . 
H 6 HOH 73  2073 2073 HOH HOH A . 
H 6 HOH 74  2074 2074 HOH HOH A . 
H 6 HOH 75  2075 2075 HOH HOH A . 
H 6 HOH 76  2076 2076 HOH HOH A . 
H 6 HOH 77  2077 2077 HOH HOH A . 
H 6 HOH 78  2078 2078 HOH HOH A . 
H 6 HOH 79  2079 2079 HOH HOH A . 
H 6 HOH 80  2080 2080 HOH HOH A . 
H 6 HOH 81  2081 2081 HOH HOH A . 
H 6 HOH 82  2082 2082 HOH HOH A . 
H 6 HOH 83  2083 2083 HOH HOH A . 
H 6 HOH 84  2084 2084 HOH HOH A . 
H 6 HOH 85  2085 2085 HOH HOH A . 
H 6 HOH 86  2086 2086 HOH HOH A . 
H 6 HOH 87  2087 2087 HOH HOH A . 
H 6 HOH 88  2088 2088 HOH HOH A . 
H 6 HOH 89  2089 2089 HOH HOH A . 
H 6 HOH 90  2090 2090 HOH HOH A . 
H 6 HOH 91  2091 2091 HOH HOH A . 
H 6 HOH 92  2092 2092 HOH HOH A . 
H 6 HOH 93  2093 2093 HOH HOH A . 
H 6 HOH 94  2094 2094 HOH HOH A . 
H 6 HOH 95  2095 2095 HOH HOH A . 
H 6 HOH 96  2096 2096 HOH HOH A . 
H 6 HOH 97  2097 2097 HOH HOH A . 
H 6 HOH 98  2098 2098 HOH HOH A . 
H 6 HOH 99  2099 2099 HOH HOH A . 
H 6 HOH 100 2100 2100 HOH HOH A . 
H 6 HOH 101 2101 2101 HOH HOH A . 
H 6 HOH 102 2102 2102 HOH HOH A . 
H 6 HOH 103 2103 2103 HOH HOH A . 
H 6 HOH 104 2104 2104 HOH HOH A . 
H 6 HOH 105 2105 2105 HOH HOH A . 
H 6 HOH 106 2106 2106 HOH HOH A . 
H 6 HOH 107 2107 2107 HOH HOH A . 
H 6 HOH 108 2108 2108 HOH HOH A . 
H 6 HOH 109 2109 2109 HOH HOH A . 
H 6 HOH 110 2110 2110 HOH HOH A . 
H 6 HOH 111 2111 2111 HOH HOH A . 
H 6 HOH 112 2112 2112 HOH HOH A . 
H 6 HOH 113 2113 2113 HOH HOH A . 
H 6 HOH 114 2114 2114 HOH HOH A . 
H 6 HOH 115 2115 2115 HOH HOH A . 
H 6 HOH 116 2116 2116 HOH HOH A . 
H 6 HOH 117 2117 2117 HOH HOH A . 
H 6 HOH 118 2118 2118 HOH HOH A . 
H 6 HOH 119 2119 2119 HOH HOH A . 
H 6 HOH 120 2120 2120 HOH HOH A . 
H 6 HOH 121 2121 2121 HOH HOH A . 
H 6 HOH 122 2122 2122 HOH HOH A . 
H 6 HOH 123 2123 2123 HOH HOH A . 
H 6 HOH 124 2124 2124 HOH HOH A . 
H 6 HOH 125 2125 2125 HOH HOH A . 
H 6 HOH 126 2126 2126 HOH HOH A . 
H 6 HOH 127 2127 2127 HOH HOH A . 
H 6 HOH 128 2128 2128 HOH HOH A . 
H 6 HOH 129 2129 2129 HOH HOH A . 
H 6 HOH 130 2130 2130 HOH HOH A . 
H 6 HOH 131 2131 2131 HOH HOH A . 
H 6 HOH 132 2132 2132 HOH HOH A . 
H 6 HOH 133 2133 2133 HOH HOH A . 
H 6 HOH 134 2134 2134 HOH HOH A . 
H 6 HOH 135 2135 2135 HOH HOH A . 
H 6 HOH 136 2136 2136 HOH HOH A . 
H 6 HOH 137 2137 2137 HOH HOH A . 
H 6 HOH 138 2138 2138 HOH HOH A . 
H 6 HOH 139 2139 2139 HOH HOH A . 
H 6 HOH 140 2140 2140 HOH HOH A . 
H 6 HOH 141 2141 2141 HOH HOH A . 
H 6 HOH 142 2142 2142 HOH HOH A . 
H 6 HOH 143 2143 2143 HOH HOH A . 
H 6 HOH 144 2144 2144 HOH HOH A . 
H 6 HOH 145 2145 2145 HOH HOH A . 
H 6 HOH 146 2146 2146 HOH HOH A . 
H 6 HOH 147 2147 2147 HOH HOH A . 
H 6 HOH 148 2148 2148 HOH HOH A . 
H 6 HOH 149 2149 2149 HOH HOH A . 
H 6 HOH 150 2150 2150 HOH HOH A . 
H 6 HOH 151 2151 2151 HOH HOH A . 
H 6 HOH 152 2152 2152 HOH HOH A . 
H 6 HOH 153 2153 2153 HOH HOH A . 
H 6 HOH 154 2154 2154 HOH HOH A . 
H 6 HOH 155 2155 2155 HOH HOH A . 
H 6 HOH 156 2156 2156 HOH HOH A . 
H 6 HOH 157 2157 2157 HOH HOH A . 
H 6 HOH 158 2158 2158 HOH HOH A . 
H 6 HOH 159 2159 2159 HOH HOH A . 
H 6 HOH 160 2160 2160 HOH HOH A . 
H 6 HOH 161 2161 2161 HOH HOH A . 
H 6 HOH 162 2162 2162 HOH HOH A . 
H 6 HOH 163 2163 2163 HOH HOH A . 
H 6 HOH 164 2164 2164 HOH HOH A . 
H 6 HOH 165 2165 2165 HOH HOH A . 
H 6 HOH 166 2166 2166 HOH HOH A . 
H 6 HOH 167 2167 2167 HOH HOH A . 
H 6 HOH 168 2168 2168 HOH HOH A . 
H 6 HOH 169 2169 2169 HOH HOH A . 
H 6 HOH 170 2170 2170 HOH HOH A . 
H 6 HOH 171 2171 2171 HOH HOH A . 
H 6 HOH 172 2172 2172 HOH HOH A . 
H 6 HOH 173 2173 2173 HOH HOH A . 
I 6 HOH 1   2001 2001 HOH HOH P . 
I 6 HOH 2   2002 2002 HOH HOH P . 
I 6 HOH 3   2003 2003 HOH HOH P . 
I 6 HOH 4   2004 2004 HOH HOH P . 
I 6 HOH 5   2005 2005 HOH HOH P . 
I 6 HOH 6   2006 2006 HOH HOH P . 
I 6 HOH 7   2007 2007 HOH HOH P . 
I 6 HOH 8   2008 2008 HOH HOH P . 
I 6 HOH 9   2009 2009 HOH HOH P . 
I 6 HOH 10  2010 2010 HOH HOH P . 
I 6 HOH 11  2011 2011 HOH HOH P . 
I 6 HOH 12  2012 2012 HOH HOH P . 
I 6 HOH 13  2013 2013 HOH HOH P . 
I 6 HOH 14  2014 2014 HOH HOH P . 
I 6 HOH 15  2015 2015 HOH HOH P . 
I 6 HOH 16  2016 2016 HOH HOH P . 
I 6 HOH 17  2017 2017 HOH HOH P . 
I 6 HOH 18  2018 2018 HOH HOH P . 
I 6 HOH 19  2019 2019 HOH HOH P . 
I 6 HOH 20  2020 2020 HOH HOH P . 
I 6 HOH 21  2021 2021 HOH HOH P . 
I 6 HOH 22  2022 2022 HOH HOH P . 
I 6 HOH 23  2023 2023 HOH HOH P . 
I 6 HOH 24  2024 2024 HOH HOH P . 
I 6 HOH 25  2025 2025 HOH HOH P . 
I 6 HOH 26  2026 2026 HOH HOH P . 
I 6 HOH 27  2027 2027 HOH HOH P . 
I 6 HOH 28  2028 2028 HOH HOH P . 
I 6 HOH 29  2029 2029 HOH HOH P . 
I 6 HOH 30  2030 2030 HOH HOH P . 
J 6 HOH 1   2001 2001 HOH HOH T . 
J 6 HOH 2   2002 2002 HOH HOH T . 
J 6 HOH 3   2003 2003 HOH HOH T . 
J 6 HOH 4   2004 2004 HOH HOH T . 
J 6 HOH 5   2005 2005 HOH HOH T . 
J 6 HOH 6   2006 2006 HOH HOH T . 
J 6 HOH 7   2007 2007 HOH HOH T . 
J 6 HOH 8   2008 2008 HOH HOH T . 
J 6 HOH 9   2009 2009 HOH HOH T . 
J 6 HOH 10  2010 2010 HOH HOH T . 
J 6 HOH 11  2011 2011 HOH HOH T . 
J 6 HOH 12  2012 2012 HOH HOH T . 
J 6 HOH 13  2013 2013 HOH HOH T . 
J 6 HOH 14  2014 2014 HOH HOH T . 
J 6 HOH 15  2015 2015 HOH HOH T . 
J 6 HOH 16  2016 2016 HOH HOH T . 
J 6 HOH 17  2017 2017 HOH HOH T . 
J 6 HOH 18  2018 2018 HOH HOH T . 
J 6 HOH 19  2019 2019 HOH HOH T . 
J 6 HOH 20  2020 2020 HOH HOH T . 
J 6 HOH 21  2021 2021 HOH HOH T . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    C 
_pdbx_struct_mod_residue.label_comp_id    8OG 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     T 
_pdbx_struct_mod_residue.auth_comp_id     8OG 
_pdbx_struct_mod_residue.auth_seq_id      5 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? H HOH .   ? A HOH 2071 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 O   ? H HOH .   ? A HOH 2089 ? 1_555 42.4  ? 
2  O   ? H HOH .   ? A HOH 2071 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 82.5  ? 
3  O   ? H HOH .   ? A HOH 2089 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 82.5  ? 
4  O   ? H HOH .   ? A HOH 2071 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 142.5 ? 
5  O   ? H HOH .   ? A HOH 2089 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 121.9 ? 
6  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 60.2  ? 
7  O   ? H HOH .   ? A HOH 2071 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 107.4 ? 
8  O   ? H HOH .   ? A HOH 2089 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 65.9  ? 
9  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 78.6  ? 
10 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 64.3  ? 
11 O   ? H HOH .   ? A HOH 2071 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 155.0 ? 
12 O   ? H HOH .   ? A HOH 2089 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 161.6 ? 
13 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 93.5  ? 
14 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 43.0  ? 
15 O1A ? D DGT .   ? A DGT 1000 ? 1_555 CA ? E CA . ? A CA 3000 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 95.8  ? 
16 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O2B ? D DGT .   ? A DGT 1000 ? 1_555 176.0 ? 
17 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 99.0  ? 
18 O2B ? D DGT .   ? A DGT 1000 ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O   ? A PHE 14  ? A PHE 8    ? 1_555 84.2  ? 
19 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 86.2  ? 
20 O2B ? D DGT .   ? A DGT 1000 ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 91.4  ? 
21 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 89.1  ? 
22 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O2G ? D DGT .   ? A DGT 1000 ? 1_555 109.7 ? 
23 O2B ? D DGT .   ? A DGT 1000 ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O2G ? D DGT .   ? A DGT 1000 ? 1_555 71.2  ? 
24 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O2G ? D DGT .   ? A DGT 1000 ? 1_555 110.9 ? 
25 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O2G ? D DGT .   ? A DGT 1000 ? 1_555 151.2 ? 
26 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 105.2 ? 
27 O2B ? D DGT .   ? A DGT 1000 ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 71.2  ? 
28 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 152.0 ? 
29 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 78.7  ? 
30 O2G ? D DGT .   ? A DGT 1000 ? 1_555 CA ? F CA . ? A CA 3001 ? 1_555 O1A ? D DGT .   ? A DGT 1000 ? 1_555 74.1  ? 
31 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 88.3  ? 
32 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? H HOH .   ? A HOH 2101 ? 1_555 107.7 ? 
33 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? H HOH .   ? A HOH 2101 ? 1_555 79.2  ? 
34 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? H HOH .   ? A HOH 2099 ? 1_555 91.3  ? 
35 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? H HOH .   ? A HOH 2099 ? 1_555 163.4 ? 
36 O   ? H HOH .   ? A HOH 2101 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? H HOH .   ? A HOH 2099 ? 1_555 116.6 ? 
37 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2027 ? 1_555 77.9  ? 
38 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2027 ? 1_555 74.2  ? 
39 O   ? H HOH .   ? A HOH 2101 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2027 ? 1_555 152.7 ? 
40 O   ? H HOH .   ? A HOH 2099 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2027 ? 1_555 89.5  ? 
41 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2026 ? 1_555 161.6 ? 
42 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2026 ? 1_555 90.2  ? 
43 O   ? H HOH .   ? A HOH 2101 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2026 ? 1_555 90.0  ? 
44 O   ? H HOH .   ? A HOH 2099 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2026 ? 1_555 85.0  ? 
45 O   ? I HOH .   ? P HOH 2027 ? 1_555 CA ? G CA . ? A CA 3002 ? 1_555 O   ? I HOH .   ? P HOH 2026 ? 1_555 84.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-08 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS   refinement       1.1 ? 1 
X-GEN 'data reduction' .   ? 2 
X-GEN 'data scaling'   .   ? 3 
CNS   phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2UVW 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ARG 332 TO GLU' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2125 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2126 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            T 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             2 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            T 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.520 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.087 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 23.39   47.66   
2  1 ARG A 36  ? ? -60.80  -82.92  
3  1 PHE A 37  ? ? -107.08 -156.08 
4  1 GLU A 38  ? ? -54.82  -71.25  
5  1 ARG A 77  ? ? -119.16 72.38   
6  1 SER A 96  ? ? -177.45 132.79  
7  1 LYS A 98  ? ? -68.10  96.73   
8  1 ASP A 117 ? ? 47.58   174.63  
9  1 SER A 145 ? ? -167.40 -165.95 
10 1 ASN A 234 ? ? -152.27 40.63   
11 1 ASP A 277 ? A 52.99   -121.28 
12 1 ASP A 277 ? B 50.81   -121.11 
13 1 GLU A 325 ? ? -144.82 13.05   
14 1 ASP A 326 ? ? -163.97 115.94  
15 1 LYS A 339 ? ? 65.77   65.18   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     7 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.053 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 342 ? CA  ? A GLU 348 CA  
2 1 Y 1 A GLU 342 ? C   ? A GLU 348 C   
3 1 Y 1 A GLU 342 ? O   ? A GLU 348 O   
4 1 Y 1 A GLU 342 ? CB  ? A GLU 348 CB  
5 1 Y 1 A GLU 342 ? CG  ? A GLU 348 CG  
6 1 Y 1 A GLU 342 ? CD  ? A GLU 348 CD  
7 1 Y 1 A GLU 342 ? OE1 ? A GLU 348 OE1 
8 1 Y 1 A GLU 342 ? OE2 ? A GLU 348 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A ALA 343 ? A ALA 349 
8  1 Y 1 A ILE 344 ? A ILE 350 
9  1 Y 1 A GLY 345 ? A GLY 351 
10 1 Y 1 A LEU 346 ? A LEU 352 
11 1 Y 1 A ASP 347 ? A ASP 353 
12 1 Y 1 A LYS 348 ? A LYS 354 
13 1 Y 1 A PHE 349 ? A PHE 355 
14 1 Y 1 A PHE 350 ? A PHE 356 
15 1 Y 1 A ASP 351 ? A ASP 357 
16 1 Y 1 A THR 352 ? A THR 358 
17 1 Y 1 T DT  1   ? C DT  1   
# 
_ndb_struct_conf_na.entry_id   2UVW 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC  18 1_555 -0.088 -0.027 0.060  -1.005  1.182   -1.955  1  P_DG1:DC18_T  P 1  ? T 18 ? 19 1 
1 B DG 2  1_555 C DC  17 1_555 0.255  -0.006 -0.314 -2.670  -7.877  2.017   2  P_DG2:DC17_T  P 2  ? T 17 ? 19 1 
1 B DG 3  1_555 C DC  16 1_555 -0.227 -0.096 -0.057 1.144   -10.313 -5.042  3  P_DG3:DC16_T  P 3  ? T 16 ? 19 1 
1 B DG 4  1_555 C DC  15 1_555 -0.530 -0.327 -0.004 6.619   -3.457  3.353   4  P_DG4:DC15_T  P 4  ? T 15 ? 19 1 
1 B DG 5  1_555 C DC  14 1_555 -0.110 -0.130 0.302  8.727   -1.092  4.024   5  P_DG5:DC14_T  P 5  ? T 14 ? 19 1 
1 B DA 6  1_555 C DT  13 1_555 -0.430 -0.214 0.082  0.753   -11.688 -0.329  6  P_DA6:DT13_T  P 6  ? T 13 ? 20 1 
1 B DA 7  1_555 C DT  12 1_555 0.171  0.136  0.000  -1.169  -9.859  0.806   7  P_DA7:DT12_T  P 7  ? T 12 ? 20 1 
1 B DG 8  1_555 C DC  11 1_555 0.109  0.251  -0.052 3.593   -5.863  5.791   8  P_DG8:DC11_T  P 8  ? T 11 ? 19 1 
1 B DG 9  1_555 C DC  10 1_555 0.255  -0.109 -0.305 -4.527  -11.032 0.690   9  P_DG9:DC10_T  P 9  ? T 10 ? 19 1 
1 B DA 10 1_555 C DT  9  1_555 0.635  -0.015 -0.132 -12.849 -10.966 0.737   10 P_DA10:DT9_T  P 10 ? T 9  ? 20 1 
1 B DT 11 1_555 C DA  8  1_555 0.138  -0.021 -0.146 -1.029  -6.128  3.001   11 P_DT11:DA8_T  P 11 ? T 8  ? 20 1 
1 B DT 12 1_555 C DA  7  1_555 -0.361 -0.078 -0.417 9.134   -3.812  0.843   12 P_DT12:DA7_T  P 12 ? T 7  ? 20 1 
1 B DC 13 1_555 C DG  6  1_555 0.296  0.088  -0.350 9.439   -3.066  -0.090  13 P_DC13:DG6_T  P 13 ? T 6  ? 19 1 
1 B DA 14 1_555 C 8OG 5  1_555 0.290  4.905  0.260  -11.560 1.422   -73.915 14 P_DA14:8OG5_T P 14 ? T 5  ? ?  3 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC  17 1_555 0.694  0.050  3.450 3.804  6.225  31.042 -1.122 -0.523 3.454 11.434 
-6.988 31.867 1  PP_DG1DG2:DC17DC18_TT  P 1  ? T 18 ? P 2  ? T 17 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC  16 1_555 -1.536 -0.196 3.283 -6.934 5.447  29.889 -1.460 1.468  3.456 10.282 
13.089 31.134 2  PP_DG2DG3:DC16DC17_TT  P 2  ? T 17 ? P 3  ? T 16 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC  15 1_555 0.699  -0.382 3.241 -0.206 9.872  27.851 -2.793 -1.414 2.932 19.740 
0.411  29.517 3  PP_DG3DG4:DC15DC16_TT  P 3  ? T 16 ? P 4  ? T 15 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC  14 1_555 0.107  -0.938 3.338 -3.292 5.753  32.765 -2.579 -0.728 3.108 10.070 
5.762  33.411 4  PP_DG4DG5:DC14DC15_TT  P 4  ? T 15 ? P 5  ? T 14 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT  13 1_555 -0.261 -0.381 3.485 3.108  3.987  32.253 -1.407 1.034  3.376 7.122  
-5.552 32.636 5  PP_DG5DA6:DT13DC14_TT  P 5  ? T 14 ? P 6  ? T 13 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT  12 1_555 -0.508 -0.329 3.287 -1.399 5.520  36.587 -1.261 0.613  3.222 8.728  
2.212  37.013 6  PP_DA6DA7:DT12DT13_TT  P 6  ? T 13 ? P 7  ? T 12 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC  11 1_555 0.249  0.049  3.290 0.488  4.394  32.225 -0.687 -0.359 3.271 7.870  
-0.874 32.519 7  PP_DA7DG8:DC11DT12_TT  P 7  ? T 12 ? P 8  ? T 11 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC  10 1_555 0.050  -0.627 3.569 0.387  6.081  33.483 -2.115 -0.019 3.406 10.448 
-0.664 34.017 8  PP_DG8DG9:DC10DC11_TT  P 8  ? T 11 ? P 9  ? T 10 ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT  9  1_555 -0.621 -0.262 3.483 -1.913 -1.847 39.340 -0.155 0.678  3.517 -2.740 
2.837  39.426 9  PP_DG9DA10:DT9DC10_TT  P 9  ? T 10 ? P 10 ? T 9  ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA  8  1_555 0.318  -0.611 3.057 0.775  3.416  26.230 -2.172 -0.504 2.963 7.485  
-1.697 26.459 10 PP_DA10DT11:DA8DT9_TT  P 10 ? T 9  ? P 11 ? T 8  ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA  7  1_555 0.698  -0.388 3.117 1.921  1.379  33.102 -0.901 -0.914 3.133 2.417  
-3.366 33.184 11 PP_DT11DT12:DA7DA8_TT  P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DT 12 1_555 C DA 7  1_555 B DC 13 1_555 C DG  6  1_555 -0.359 -0.740 3.463 -1.552 9.459  26.720 -3.748 0.366  3.043 19.680 
3.229  28.358 12 PP_DT12DC13:DG6DA7_TT  P 12 ? T 7  ? P 13 ? T 6  ? 
1 B DC 13 1_555 C DG 6  1_555 B DA 14 1_555 C 8OG 5  1_555 0.997  -2.969 3.472 3.005  7.905  69.078 -2.895 -0.763 3.194 6.945  
-2.640 69.530 13 PP_DC13DA14:8OG5DG6_TT P 13 ? T 6  ? P 14 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
#