data_2UYC
# 
_entry.id   2UYC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2UYC         
PDBE  EBI-32189    
WWPDB D_1290032189 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 10MH unspecified 
;TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH ADOHCY AND HEMIMETHYLATED DEOXYRIBONUCLEIC ACID CONTAINING 5,6-DIHYDRO-5-AZACYTOSINE AT THE TARGET
;
PDB 1FJX unspecified 'STRUCTURE OF TERNARY COMPLEX OF HHAI METHYLTRANSFERASEMUTANT (T250G) IN COMPLEX WITH DNA AND ADOHCY' 
PDB 1HMY unspecified 'HHAI DEOXYRIBONUCLEIC ACID (CYTOSINE-C5-)- METHYLTRANSFERASE COMPLEX WITH S-ADENOSYL-L- METHIONINE' 
PDB 1M0E unspecified 'ZEBULARINE: A NOVEL DNA METHYLATION INHIBITOR THAT FORMS ACOVALENT COMPLEX WITH DNA METHYLTRANSFERASE' 
PDB 1MHT unspecified 'COVALENT TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE, DEOXYRIBONUCLEIC ACID AND S- ADENOSYL-L-HOMOCYSTEINE' 
PDB 1SKM unspecified 'HHAI METHYLTRANSFERASE IN COMPLEX WITH DNA CONTAINING ANABASIC SOUTH CARBOCYCLIC SUGAR AT ITS TARGET SITE' 
PDB 1SVU unspecified 'STRUCTURE OF THE Q237W MUTANT OF HHAI DNAMETHYLTRANSFERASE: AN INSIGHT INTO PROTEIN- PROTEININTERACTIONS' 
PDB 2C7O unspecified 
;HHAI DNA METHYLTRANSFERASE COMPLEX WITH 13MER OLIGONUCLEOTIDE CONTAINING 2-AMINOPURINE ADJACENT TO THE TARGET BASE (PCGC:GMGC) AND SAH
;
PDB 2C7P unspecified 
'HHAI DNA METHYLTRANSFERASE COMPLEX WITH OLIGONUCLEOTIDE CONTAINING 2-AMINOPURINE OPPOSITE TO THE TARGET BASE (GCGC:GMPC) AND SAH' 
PDB 2C7Q unspecified 
;HHAI DNA METHYLTRANSFERASE COMPLEX WITH OLIGONUCLEOTIDE CONTAINING 2-AMINOPURINE OUTSIDE THE RECOGNITION SEQUENCE (PAIRED WITH G) AND SAH
;
PDB 2C7R unspecified 
;HHAI DNA METHYLTRANSFERASE (T250G MUTANT) COMPLEX WITH OLIGONUCLEOTIDE CONTAINING 2- AMINOPURINE AS A TARGET BASE (GPGC:GMGC) AND SAH
;
PDB 2HMY unspecified 
;BINARY COMPLEX OF HHAI METHYLTRANSFERASE WITH ADOMET FORMED IN THE PRESENCE OF A SHORT NONPSECIFIC DEOXYRIBONUCLEIC ACID OLIGONUCLEOTIDE
;
PDB 3MHT unspecified 'TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH UNMODIFIED DEOXYRIBONUCLEIC ACID AND ADOHCY' 
PDB 4MHT unspecified 'TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH NATIVE DEOXYRIBONUCLEIC ACID AND ADOHCY' 
PDB 5MHT unspecified 'TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH HEMIMETHYLATED DEOXYRIBONUCLEIC ACID AND ADOHCY' 
PDB 6MHT unspecified 
;TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH ADOHCY AND DEOXYRIBONUCLEIC ACID CONTAINING 4'-THIO-2'DEOXYCYTIDINE AT THE TARGET
;
PDB 7MHT unspecified 'CYTOSINE-SPECIFIC METHYLTRANSFERASE HHAI/ DEOXYRIBONUCLEIC ACID COMPLEX' 
PDB 8MHT unspecified 'CYTOSINE-SPECIFIC METHYLTRANSFERASE HHAI/ DEOXYRIBONUCLEIC ACID COMPLEX' 
PDB 9MHT unspecified 'CYTOSINE-SPECIFIC METHYLTRANSFERASE HHAI/ DEOXYRIBONUCLEIC ACID COMPLEX' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2UYC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Daujotyte, D.' 1 
'Grazulis, S.'  2 
# 
_citation.id                        primary 
_citation.title                     'HhaI DNA Methyltransferase R163N Mutant Complex with 13mer Gcgc-Gmgc Oligonucleotide and Sah' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Daujotyte, D.' 1 ? 
primary 'Grazulis, S.'  2 ? 
# 
_cell.entry_id           2UYC 
_cell.length_a           94.990 
_cell.length_b           94.990 
_cell.length_c           312.903 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2UYC 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MODIFICATION METHYLASE HHAI'                        36999.117 1   2.1.1.37 YES ? ? 
2 polymer     syn 
;5'-D(*TP*GP*GP*AP*TP*GP*5CMP*GP*CP*TP *GP*AP*C)-3'
;
4021.636  1   ?        ?   ? ? 
3 polymer     syn 
;5'-D(*GP*TP*CP*AP*GP*CP*GP*CP*AP*TP *CP*C)-3'
;
3623.368  1   ?        ?   ? ? 
4 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                            384.411   1   ?        ?   ? ? 
5 non-polymer syn 'SULFATE ION'                                        96.063    6   ?        ?   ? ? 
6 non-polymer syn GLYCEROL                                             92.094    5   ?        ?   ? ? 
7 water       nat water                                                18.015    234 ?        ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CYTOSINE-SPECIFIC METHYLTRANSFERASE HHAI, MHHAI, HHAI DNA METHYLTRANSFERASE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP
CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP
QKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER
IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS
SLNFKPY
;
;MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP
CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP
QKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER
IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS
SLNFKPY
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(DG)(DG)(DA)(DT)(DG)(5CM)(DG)(DC)(DT)(DG)(DA)(DC)' TGGATGCGCTGAC C ? 
3 polydeoxyribonucleotide no no  '(DG)(DT)(DC)(DA)(DG)(DC)(DG)(DC)(DA)(DT)(DC)(DC)' GTCAGCGCATCC D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   GLU n 
1 4   ILE n 
1 5   LYS n 
1 6   ASP n 
1 7   LYS n 
1 8   GLN n 
1 9   LEU n 
1 10  THR n 
1 11  GLY n 
1 12  LEU n 
1 13  ARG n 
1 14  PHE n 
1 15  ILE n 
1 16  ASP n 
1 17  LEU n 
1 18  PHE n 
1 19  ALA n 
1 20  GLY n 
1 21  LEU n 
1 22  GLY n 
1 23  GLY n 
1 24  PHE n 
1 25  ARG n 
1 26  LEU n 
1 27  ALA n 
1 28  LEU n 
1 29  GLU n 
1 30  SER n 
1 31  CYS n 
1 32  GLY n 
1 33  ALA n 
1 34  GLU n 
1 35  CYS n 
1 36  VAL n 
1 37  TYR n 
1 38  SER n 
1 39  ASN n 
1 40  GLU n 
1 41  TRP n 
1 42  ASP n 
1 43  LYS n 
1 44  TYR n 
1 45  ALA n 
1 46  GLN n 
1 47  GLU n 
1 48  VAL n 
1 49  TYR n 
1 50  GLU n 
1 51  MET n 
1 52  ASN n 
1 53  PHE n 
1 54  GLY n 
1 55  GLU n 
1 56  LYS n 
1 57  PRO n 
1 58  GLU n 
1 59  GLY n 
1 60  ASP n 
1 61  ILE n 
1 62  THR n 
1 63  GLN n 
1 64  VAL n 
1 65  ASN n 
1 66  GLU n 
1 67  LYS n 
1 68  THR n 
1 69  ILE n 
1 70  PRO n 
1 71  ASP n 
1 72  HIS n 
1 73  ASP n 
1 74  ILE n 
1 75  LEU n 
1 76  CYS n 
1 77  ALA n 
1 78  GLY n 
1 79  PHE n 
1 80  PRO n 
1 81  CYS n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  SER n 
1 86  ILE n 
1 87  SER n 
1 88  GLY n 
1 89  LYS n 
1 90  GLN n 
1 91  LYS n 
1 92  GLY n 
1 93  PHE n 
1 94  GLU n 
1 95  ASP n 
1 96  SER n 
1 97  ARG n 
1 98  GLY n 
1 99  THR n 
1 100 LEU n 
1 101 PHE n 
1 102 PHE n 
1 103 ASP n 
1 104 ILE n 
1 105 ALA n 
1 106 ARG n 
1 107 ILE n 
1 108 VAL n 
1 109 ARG n 
1 110 GLU n 
1 111 LYS n 
1 112 LYS n 
1 113 PRO n 
1 114 LYS n 
1 115 VAL n 
1 116 VAL n 
1 117 PHE n 
1 118 MET n 
1 119 GLU n 
1 120 ASN n 
1 121 VAL n 
1 122 LYS n 
1 123 ASN n 
1 124 PHE n 
1 125 ALA n 
1 126 SER n 
1 127 HIS n 
1 128 ASP n 
1 129 ASN n 
1 130 GLY n 
1 131 ASN n 
1 132 THR n 
1 133 LEU n 
1 134 GLU n 
1 135 VAL n 
1 136 VAL n 
1 137 LYS n 
1 138 ASN n 
1 139 THR n 
1 140 MET n 
1 141 ASN n 
1 142 GLU n 
1 143 LEU n 
1 144 ASP n 
1 145 TYR n 
1 146 SER n 
1 147 PHE n 
1 148 HIS n 
1 149 ALA n 
1 150 LYS n 
1 151 VAL n 
1 152 LEU n 
1 153 ASN n 
1 154 ALA n 
1 155 LEU n 
1 156 ASP n 
1 157 TYR n 
1 158 GLY n 
1 159 ILE n 
1 160 PRO n 
1 161 GLN n 
1 162 LYS n 
1 163 ASN n 
1 164 GLU n 
1 165 ARG n 
1 166 ILE n 
1 167 TYR n 
1 168 MET n 
1 169 ILE n 
1 170 CYS n 
1 171 PHE n 
1 172 ARG n 
1 173 ASN n 
1 174 ASP n 
1 175 LEU n 
1 176 ASN n 
1 177 ILE n 
1 178 GLN n 
1 179 ASN n 
1 180 PHE n 
1 181 GLN n 
1 182 PHE n 
1 183 PRO n 
1 184 LYS n 
1 185 PRO n 
1 186 PHE n 
1 187 GLU n 
1 188 LEU n 
1 189 ASN n 
1 190 THR n 
1 191 PHE n 
1 192 VAL n 
1 193 LYS n 
1 194 ASP n 
1 195 LEU n 
1 196 LEU n 
1 197 LEU n 
1 198 PRO n 
1 199 ASP n 
1 200 SER n 
1 201 GLU n 
1 202 VAL n 
1 203 GLU n 
1 204 HIS n 
1 205 LEU n 
1 206 VAL n 
1 207 ILE n 
1 208 ASP n 
1 209 ARG n 
1 210 LYS n 
1 211 ASP n 
1 212 LEU n 
1 213 VAL n 
1 214 MET n 
1 215 THR n 
1 216 ASN n 
1 217 GLN n 
1 218 GLU n 
1 219 ILE n 
1 220 GLU n 
1 221 GLN n 
1 222 THR n 
1 223 THR n 
1 224 PRO n 
1 225 LYS n 
1 226 THR n 
1 227 VAL n 
1 228 ARG n 
1 229 LEU n 
1 230 GLY n 
1 231 ILE n 
1 232 VAL n 
1 233 GLY n 
1 234 LYS n 
1 235 GLY n 
1 236 GLY n 
1 237 GLN n 
1 238 GLY n 
1 239 GLU n 
1 240 ARG n 
1 241 ILE n 
1 242 TYR n 
1 243 SER n 
1 244 THR n 
1 245 ARG n 
1 246 GLY n 
1 247 ILE n 
1 248 ALA n 
1 249 ILE n 
1 250 THR n 
1 251 LEU n 
1 252 SER n 
1 253 ALA n 
1 254 TYR n 
1 255 GLY n 
1 256 GLY n 
1 257 GLY n 
1 258 ILE n 
1 259 PHE n 
1 260 ALA n 
1 261 LYS n 
1 262 THR n 
1 263 GLY n 
1 264 GLY n 
1 265 TYR n 
1 266 LEU n 
1 267 VAL n 
1 268 ASN n 
1 269 GLY n 
1 270 LYS n 
1 271 THR n 
1 272 ARG n 
1 273 LYS n 
1 274 LEU n 
1 275 HIS n 
1 276 PRO n 
1 277 ARG n 
1 278 GLU n 
1 279 CYS n 
1 280 ALA n 
1 281 ARG n 
1 282 VAL n 
1 283 MET n 
1 284 GLY n 
1 285 TYR n 
1 286 PRO n 
1 287 ASP n 
1 288 SER n 
1 289 TYR n 
1 290 LYS n 
1 291 VAL n 
1 292 HIS n 
1 293 PRO n 
1 294 SER n 
1 295 THR n 
1 296 SER n 
1 297 GLN n 
1 298 ALA n 
1 299 TYR n 
1 300 LYS n 
1 301 GLN n 
1 302 PHE n 
1 303 GLY n 
1 304 ASN n 
1 305 SER n 
1 306 VAL n 
1 307 VAL n 
1 308 ILE n 
1 309 ASN n 
1 310 VAL n 
1 311 LEU n 
1 312 GLN n 
1 313 TYR n 
1 314 ILE n 
1 315 ALA n 
1 316 TYR n 
1 317 ASN n 
1 318 ILE n 
1 319 GLY n 
1 320 SER n 
1 321 SER n 
1 322 LEU n 
1 323 ASN n 
1 324 PHE n 
1 325 LYS n 
1 326 PRO n 
1 327 TYR n 
2 1   DT  n 
2 2   DG  n 
2 3   DG  n 
2 4   DA  n 
2 5   DT  n 
2 6   DG  n 
2 7   5CM n 
2 8   DG  n 
2 9   DC  n 
2 10  DT  n 
2 11  DG  n 
2 12  DA  n 
2 13  DC  n 
3 1   DG  n 
3 2   DT  n 
3 3   DC  n 
3 4   DA  n 
3 5   DG  n 
3 6   DC  n 
3 7   DG  n 
3 8   DC  n 
3 9   DA  n 
3 10  DT  n 
3 11  DC  n 
3 12  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HAEMOPHILUS HAEMOLYTICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     726 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ER2267 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHH5.3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MTH1_HAEPH 1 ? ? P05102 ? 
2 PDB 2UYC       2 ? ? 2UYC   ? 
3 PDB 2UYC       3 ? ? 2UYC   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2UYC A 1 ? 327 ? P05102 1   ? 327 ? 1   327 
2 2 2UYC C 1 ? 13  ? 2UYC   401 ? 413 ? 401 413 
3 3 2UYC D 1 ? 12  ? 2UYC   422 ? 433 ? 422 433 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2UYC 
_struct_ref_seq_dif.mon_id                       ASN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      163 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P05102 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          163 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            163 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5CM 'DNA linking'       n "5-METHYL-2'-DEOXY-CYTIDINE-5'-MONOPHOSPHATE" ?                               'C10 H16 N3 O7 P' 321.224 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                         ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE                     ?                               'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                 ?                               'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2UYC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50 MM NA CITRATE PH 5.6, 1.8 M AMMONIUM SULFATE, 5% GLUCOSE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-14 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8063 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X13' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X13 
_diffrn_source.pdbx_wavelength             0.8063 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2UYC 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.15 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   36938 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.60 
_reflns.B_iso_Wilson_estimate        13.6 
_reflns.pdbx_redundancy              5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.33 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.60 
_reflns_shell.pdbx_redundancy        5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2UYC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36937 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               32293104.37 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.41 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  3722 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               19.5 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[3][3]                            -0.04 
_refine.aniso_B[1][2]                            0.92 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.397357 
_refine.solvent_model_param_bsol                 45.5062 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'RESOLUTION-DEPENDENT WEIGHTING SCHEME USED OTHER REFINEMENT REMARKS BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 3MHT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2UYC 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2603 
_refine_hist.pdbx_number_atoms_nucleic_acid   511 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               3434 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.41 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.04  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.69  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             0.94  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             5299 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.percent_reflns_obs               95.6 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.R_factor_R_free_error            0.011 
_refine_ls_shell.percent_reflns_R_free            9.5 
_refine_ls_shell.number_reflns_R_free             555 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 DNA-RNA_REP.PARAM DNA-RNA.TOP 
'X-RAY DIFFRACTION' 3 WATER.PARAM       WATER.TOP   
'X-RAY DIFFRACTION' 4 2AP.PAR           2AP.TOP     
'X-RAY DIFFRACTION' 5 5MC.PAR           5MC.TOP     
'X-RAY DIFFRACTION' 6 SAH.PAR           SAH.TOP     
'X-RAY DIFFRACTION' 7 SO4.PAR           SO4.TOP     
'X-RAY DIFFRACTION' 8 GOL.PAR           GOL.TOP     
# 
_struct.entry_id                  2UYC 
_struct.title                     'HhaI DNA methyltransferase R163N mutant complex with 13mer GCGC-GMGC oligonucleotide and SAH' 
_struct.pdbx_descriptor           'MODIFICATION METHYLASE HHAI (E.C.2.1.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2UYC 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'TRANSFERASE, S-ADENOSYL-L-METHIONINE, BASE FLIPPING, METHYLTRANSFERASE, RESTRICTION SYSTEM, DNA METHYLTRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;REMARK: BASED ON PREVIOUS STRUCTURES OF HHAI                 
  METHYLTRANSFERASEAND BIOCHEMICAL EXPERIMENTS, THE                   
 TERNARY COMPLEX HHAIMETHYLTRANSFERASE-DNA-SAH IS                     
 MONOMERIC
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 22  ? CYS A 31  ? GLY A 22  CYS A 31  1 ? 10 
HELX_P HELX_P2  2  ASP A 42  ? GLY A 54  ? ASP A 42  GLY A 54  1 ? 13 
HELX_P HELX_P3  3  ASP A 60  ? VAL A 64  ? ASP A 60  VAL A 64  5 ? 5  
HELX_P HELX_P4  4  ASN A 65  ? ILE A 69  ? ASN A 65  ILE A 69  5 ? 5  
HELX_P HELX_P5  5  LYS A 91  ? ASP A 95  ? LYS A 91  ASP A 95  5 ? 5  
HELX_P HELX_P6  6  LEU A 100 ? LYS A 112 ? LEU A 100 LYS A 112 1 ? 13 
HELX_P HELX_P7  7  ASN A 123 ? SER A 126 ? ASN A 123 SER A 126 5 ? 4  
HELX_P HELX_P8  8  GLY A 130 ? LEU A 143 ? GLY A 130 LEU A 143 1 ? 14 
HELX_P HELX_P9  9  LEU A 155 ? TYR A 157 ? LEU A 155 TYR A 157 5 ? 3  
HELX_P HELX_P10 10 ASN A 173 ? ASN A 176 ? ASN A 173 ASN A 176 5 ? 4  
HELX_P HELX_P11 11 PHE A 191 ? LEU A 196 ? PHE A 191 LEU A 196 1 ? 6  
HELX_P HELX_P12 12 PRO A 198 ? VAL A 202 ? PRO A 198 VAL A 202 5 ? 5  
HELX_P HELX_P13 13 VAL A 202 ? LEU A 205 ? VAL A 202 LEU A 205 5 ? 4  
HELX_P HELX_P14 14 HIS A 275 ? MET A 283 ? HIS A 275 MET A 283 1 ? 9  
HELX_P HELX_P15 15 SER A 294 ? SER A 305 ? SER A 294 SER A 305 1 ? 12 
HELX_P HELX_P16 16 VAL A 307 ? PHE A 324 ? VAL A 307 PHE A 324 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? B DG  6  "O3'" ? ? ? 1_555 B 5CM 7  P  ? ? C DG  406 C 5CM 407 1_555 ? ? ? ? ? ? ?            1.605 ? 
covale2  covale both ? B 5CM 7  "O3'" ? ? ? 1_555 B DG  8  P  ? ? C 5CM 407 C DG  408 1_555 ? ? ? ? ? ? ?            1.602 ? 
hydrog1  hydrog ?    ? B DG  2  N1    ? ? ? 1_555 C DC  12 N3 ? ? C DG  402 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DG  2  N2    ? ? ? 1_555 C DC  12 O2 ? ? C DG  402 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DG  2  O6    ? ? ? 1_555 C DC  12 N4 ? ? C DG  402 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DG  3  N1    ? ? ? 1_555 C DC  11 N3 ? ? C DG  403 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  3  N2    ? ? ? 1_555 C DC  11 O2 ? ? C DG  403 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  3  O6    ? ? ? 1_555 C DC  11 N4 ? ? C DG  403 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DA  4  N1    ? ? ? 1_555 C DT  10 N3 ? ? C DA  404 D DT  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DA  4  N6    ? ? ? 1_555 C DT  10 O4 ? ? C DA  404 D DT  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DT  5  N3    ? ? ? 1_555 C DA  9  N1 ? ? C DT  405 D DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DT  5  O4    ? ? ? 1_555 C DA  9  N6 ? ? C DT  405 D DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DG  6  N1    ? ? ? 1_555 C DC  8  N3 ? ? C DG  406 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DG  6  N2    ? ? ? 1_555 C DC  8  O2 ? ? C DG  406 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  6  O6    ? ? ? 1_555 C DC  8  N4 ? ? C DG  406 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B 5CM 7  N3    ? ? ? 1_555 C DG  7  N1 ? ? C 5CM 407 D DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B 5CM 7  N4    ? ? ? 1_555 C DG  7  O6 ? ? C 5CM 407 D DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B 5CM 7  O2    ? ? ? 1_555 C DG  7  N2 ? ? C 5CM 407 D DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DC  9  N3    ? ? ? 1_555 C DG  5  N1 ? ? C DC  409 D DG  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  9  N4    ? ? ? 1_555 C DG  5  O6 ? ? C DC  409 D DG  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DC  9  O2    ? ? ? 1_555 C DG  5  N2 ? ? C DC  409 D DG  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DT  10 N3    ? ? ? 1_555 C DA  4  N1 ? ? C DT  410 D DA  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DT  10 O4    ? ? ? 1_555 C DA  4  N6 ? ? C DT  410 D DA  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DG  11 N1    ? ? ? 1_555 C DC  3  N3 ? ? C DG  411 D DC  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DG  11 N2    ? ? ? 1_555 C DC  3  O2 ? ? C DG  411 D DC  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DG  11 O6    ? ? ? 1_555 C DC  3  N4 ? ? C DG  411 D DC  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DA  12 N1    ? ? ? 1_555 C DT  2  N3 ? ? C DA  412 D DT  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DA  12 N6    ? ? ? 1_555 C DT  2  O4 ? ? C DA  412 D DT  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DC  13 N3    ? ? ? 1_555 C DG  1  N1 ? ? C DC  413 D DG  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DC  13 N4    ? ? ? 1_555 C DG  1  O6 ? ? C DC  413 D DG  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DC  13 O2    ? ? ? 1_555 C DG  1  N2 ? ? C DC  413 D DG  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AB 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 34  ? ASN A 39  ? GLU A 34  ASN A 39  
AA 2 ARG A 13  ? LEU A 17  ? ARG A 13  LEU A 17  
AA 3 ILE A 74  ? GLY A 78  ? ILE A 74  GLY A 78  
AA 4 VAL A 115 ? VAL A 121 ? VAL A 115 VAL A 121 
AA 5 GLU A 164 ? PHE A 171 ? GLU A 164 PHE A 171 
AA 6 HIS A 148 ? ASN A 153 ? HIS A 148 ASN A 153 
AB 1 VAL A 213 ? MET A 214 ? VAL A 213 MET A 214 
AB 2 ARG A 228 ? ILE A 231 ? ARG A 228 ILE A 231 
AB 3 ARG A 240 ? SER A 243 ? ARG A 240 SER A 243 
AB 4 GLY A 264 ? VAL A 267 ? GLY A 264 VAL A 267 
AB 5 LYS A 270 ? LYS A 273 ? LYS A 270 LYS A 273 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 36  ? N VAL A 36  O PHE A 14  ? O PHE A 14  
AA 2 3 N ILE A 15  ? N ILE A 15  O ILE A 74  ? O ILE A 74  
AA 3 4 N LEU A 75  ? N LEU A 75  O VAL A 115 ? O VAL A 115 
AA 4 5 N ASN A 120 ? N ASN A 120 O ILE A 166 ? O ILE A 166 
AA 5 6 N ILE A 169 ? N ILE A 169 O HIS A 148 ? O HIS A 148 
AB 1 2 N VAL A 213 ? N VAL A 213 O ILE A 231 ? O ILE A 231 
AB 2 3 N LEU A 229 ? N LEU A 229 O ILE A 241 ? O ILE A 241 
AB 3 4 N TYR A 242 ? N TYR A 242 O GLY A 264 ? O GLY A 264 
AB 4 5 N VAL A 267 ? N VAL A 267 O LYS A 270 ? O LYS A 270 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE SAH A1328' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A1329' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1330' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1331' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1332' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1333' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A1334' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A1335' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A1336' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A1337' 
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A1338' 
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A1339' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 PHE A 18  ? PHE A 18   . ? 1_555 ? 
2  AC1 23 ALA A 19  ? ALA A 19   . ? 1_555 ? 
3  AC1 23 LEU A 21  ? LEU A 21   . ? 1_555 ? 
4  AC1 23 GLY A 23  ? GLY A 23   . ? 1_555 ? 
5  AC1 23 ASN A 39  ? ASN A 39   . ? 1_555 ? 
6  AC1 23 GLU A 40  ? GLU A 40   . ? 1_555 ? 
7  AC1 23 TRP A 41  ? TRP A 41   . ? 1_555 ? 
8  AC1 23 ASP A 42  ? ASP A 42   . ? 1_555 ? 
9  AC1 23 ASP A 60  ? ASP A 60   . ? 1_555 ? 
10 AC1 23 ILE A 61  ? ILE A 61   . ? 1_555 ? 
11 AC1 23 GLY A 78  ? GLY A 78   . ? 1_555 ? 
12 AC1 23 PRO A 80  ? PRO A 80   . ? 1_555 ? 
13 AC1 23 TYR A 285 ? TYR A 285  . ? 1_555 ? 
14 AC1 23 ASN A 304 ? ASN A 304  . ? 1_555 ? 
15 AC1 23 SER A 305 ? SER A 305  . ? 1_555 ? 
16 AC1 23 VAL A 306 ? VAL A 306  . ? 1_555 ? 
17 AC1 23 HOH P .   ? HOH A 2192 . ? 1_555 ? 
18 AC1 23 HOH P .   ? HOH A 2193 . ? 1_555 ? 
19 AC1 23 HOH P .   ? HOH A 2204 . ? 1_555 ? 
20 AC1 23 HOH P .   ? HOH A 2205 . ? 1_555 ? 
21 AC1 23 HOH P .   ? HOH A 2206 . ? 1_555 ? 
22 AC1 23 HOH P .   ? HOH A 2207 . ? 1_555 ? 
23 AC1 23 HOH P .   ? HOH A 2208 . ? 1_555 ? 
24 AC2 3  PRO A 198 ? PRO A 198  . ? 1_555 ? 
25 AC2 3  ASP A 199 ? ASP A 199  . ? 1_555 ? 
26 AC2 3  HOH P .   ? HOH A 2209 . ? 1_555 ? 
27 AC3 4  PRO A 286 ? PRO A 286  . ? 1_555 ? 
28 AC3 4  ASP A 287 ? ASP A 287  . ? 1_555 ? 
29 AC3 4  SER A 288 ? SER A 288  . ? 1_555 ? 
30 AC3 4  HOH P .   ? HOH A 2181 . ? 1_555 ? 
31 AC4 4  LYS A 193 ? LYS A 193  . ? 1_555 ? 
32 AC4 4  ARG A 245 ? ARG A 245  . ? 1_555 ? 
33 AC4 4  LYS A 290 ? LYS A 290  . ? 1_555 ? 
34 AC4 4  HOH P .   ? HOH A 2126 . ? 1_555 ? 
35 AC5 4  LYS A 114 ? LYS A 114  . ? 1_555 ? 
36 AC5 4  ARG A 172 ? ARG A 172  . ? 1_555 ? 
37 AC5 4  HOH P .   ? HOH A 2077 . ? 1_555 ? 
38 AC5 4  HOH P .   ? HOH A 2211 . ? 1_555 ? 
39 AC6 4  ILE A 219 ? ILE A 219  . ? 1_555 ? 
40 AC6 4  GLU A 220 ? GLU A 220  . ? 1_555 ? 
41 AC6 4  GLN A 221 ? GLN A 221  . ? 1_555 ? 
42 AC6 4  HOH P .   ? HOH A 2212 . ? 1_555 ? 
43 AC7 3  ASN A 216 ? ASN A 216  . ? 1_555 ? 
44 AC7 3  GLN A 217 ? GLN A 217  . ? 1_555 ? 
45 AC7 3  HOH P .   ? HOH A 2213 . ? 1_555 ? 
46 AC8 8  VAL A 151 ? VAL A 151  . ? 1_555 ? 
47 AC8 8  LEU A 152 ? LEU A 152  . ? 1_555 ? 
48 AC8 8  ASN A 153 ? ASN A 153  . ? 1_555 ? 
49 AC8 8  ASP A 156 ? ASP A 156  . ? 1_555 ? 
50 AC8 8  TYR A 157 ? TYR A 157  . ? 1_555 ? 
51 AC8 8  PRO A 185 ? PRO A 185  . ? 1_555 ? 
52 AC8 8  HOH P .   ? HOH A 2098 . ? 1_555 ? 
53 AC8 8  HOH P .   ? HOH A 2119 . ? 1_555 ? 
54 AC9 7  GLU A 3   ? GLU A 3    . ? 1_555 ? 
55 AC9 7  ILE A 4   ? ILE A 4    . ? 1_555 ? 
56 AC9 7  LYS A 5   ? LYS A 5    . ? 1_555 ? 
57 AC9 7  ASP A 6   ? ASP A 6    . ? 1_555 ? 
58 AC9 7  TYR A 316 ? TYR A 316  . ? 1_555 ? 
59 AC9 7  TYR A 327 ? TYR A 327  . ? 1_555 ? 
60 AC9 7  GOL M .   ? GOL A 1337 . ? 1_555 ? 
61 BC1 5  TYR A 316 ? TYR A 316  . ? 1_555 ? 
62 BC1 5  LYS A 325 ? LYS A 325  . ? 1_555 ? 
63 BC1 5  PRO A 326 ? PRO A 326  . ? 1_555 ? 
64 BC1 5  TYR A 327 ? TYR A 327  . ? 1_555 ? 
65 BC1 5  GOL L .   ? GOL A 1336 . ? 1_555 ? 
66 BC2 7  LYS A 261 ? LYS A 261  . ? 1_555 ? 
67 BC2 7  LYS A 273 ? LYS A 273  . ? 1_555 ? 
68 BC2 7  SER A 296 ? SER A 296  . ? 1_555 ? 
69 BC2 7  HOH P .   ? HOH A 2166 . ? 1_555 ? 
70 BC2 7  DA  B 4   ? DA  C 404  . ? 1_555 ? 
71 BC2 7  DT  B 5   ? DT  C 405  . ? 1_555 ? 
72 BC2 7  HOH Q .   ? HOH C 2005 . ? 1_555 ? 
73 BC3 6  ASP A 199 ? ASP A 199  . ? 1_555 ? 
74 BC3 6  SER A 200 ? SER A 200  . ? 1_555 ? 
75 BC3 6  GLU A 203 ? GLU A 203  . ? 1_555 ? 
76 BC3 6  HIS A 275 ? HIS A 275  . ? 1_555 ? 
77 BC3 6  HOH P .   ? HOH A 2214 . ? 1_555 ? 
78 BC3 6  HOH P .   ? HOH A 2215 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2UYC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2UYC 
_atom_sites.fract_transf_matrix[1][1]   0.010527 
_atom_sites.fract_transf_matrix[1][2]   0.006078 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012156 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003196 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? -29.451 31.787 70.516  1.00 15.69 ? 1    MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? -28.407 31.583 69.475  1.00 16.01 ? 1    MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? -29.053 31.461 68.100  1.00 17.03 ? 1    MET A C     1 
ATOM   4    O O     . MET A 1 1   ? -30.241 31.163 67.985  1.00 17.28 ? 1    MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? -27.585 30.331 69.799  1.00 16.49 ? 1    MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? -28.310 29.005 69.637  1.00 16.39 ? 1    MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? -27.377 27.609 70.339  1.00 16.82 ? 1    MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? -26.099 27.384 69.144  1.00 16.83 ? 1    MET A CE    1 
ATOM   9    N N     . ILE A 1 2   ? -28.283 31.706 67.050  1.00 17.94 ? 2    ILE A N     1 
ATOM   10   C CA    . ILE A 1 2   ? -28.834 31.615 65.705  1.00 18.93 ? 2    ILE A CA    1 
ATOM   11   C C     . ILE A 1 2   ? -28.460 30.304 65.035  1.00 20.37 ? 2    ILE A C     1 
ATOM   12   O O     . ILE A 1 2   ? -27.626 29.544 65.530  1.00 19.65 ? 2    ILE A O     1 
ATOM   13   C CB    . ILE A 1 2   ? -28.324 32.747 64.797  1.00 18.01 ? 2    ILE A CB    1 
ATOM   14   C CG1   . ILE A 1 2   ? -26.816 32.599 64.610  1.00 17.70 ? 2    ILE A CG1   1 
ATOM   15   C CG2   . ILE A 1 2   ? -28.681 34.094 65.388  1.00 17.82 ? 2    ILE A CG2   1 
ATOM   16   C CD1   . ILE A 1 2   ? -26.257 33.388 63.464  1.00 18.38 ? 2    ILE A CD1   1 
ATOM   17   N N     . GLU A 1 3   ? -29.089 30.056 63.893  1.00 22.63 ? 3    GLU A N     1 
ATOM   18   C CA    . GLU A 1 3   ? -28.829 28.864 63.102  1.00 24.59 ? 3    GLU A CA    1 
ATOM   19   C C     . GLU A 1 3   ? -27.718 29.206 62.107  1.00 23.71 ? 3    GLU A C     1 
ATOM   20   O O     . GLU A 1 3   ? -27.707 30.290 61.533  1.00 23.04 ? 3    GLU A O     1 
ATOM   21   C CB    . GLU A 1 3   ? -30.101 28.464 62.355  1.00 27.30 ? 3    GLU A CB    1 
ATOM   22   C CG    . GLU A 1 3   ? -29.952 27.253 61.456  1.00 31.30 ? 3    GLU A CG    1 
ATOM   23   C CD    . GLU A 1 3   ? -31.182 27.027 60.587  1.00 33.58 ? 3    GLU A CD    1 
ATOM   24   O OE1   . GLU A 1 3   ? -31.481 27.892 59.729  1.00 34.22 ? 3    GLU A OE1   1 
ATOM   25   O OE2   . GLU A 1 3   ? -31.850 25.984 60.769  1.00 35.38 ? 3    GLU A OE2   1 
ATOM   26   N N     . ILE A 1 4   ? -26.777 28.291 61.921  1.00 23.72 ? 4    ILE A N     1 
ATOM   27   C CA    . ILE A 1 4   ? -25.667 28.508 60.989  1.00 23.78 ? 4    ILE A CA    1 
ATOM   28   C C     . ILE A 1 4   ? -25.747 27.469 59.875  1.00 23.96 ? 4    ILE A C     1 
ATOM   29   O O     . ILE A 1 4   ? -25.541 26.286 60.124  1.00 23.43 ? 4    ILE A O     1 
ATOM   30   C CB    . ILE A 1 4   ? -24.297 28.350 61.693  1.00 22.93 ? 4    ILE A CB    1 
ATOM   31   C CG1   . ILE A 1 4   ? -24.193 29.305 62.890  1.00 22.88 ? 4    ILE A CG1   1 
ATOM   32   C CG2   . ILE A 1 4   ? -23.183 28.620 60.704  1.00 22.54 ? 4    ILE A CG2   1 
ATOM   33   C CD1   . ILE A 1 4   ? -24.151 30.776 62.513  1.00 22.10 ? 4    ILE A CD1   1 
ATOM   34   N N     . LYS A 1 5   ? -26.049 27.900 58.653  1.00 25.35 ? 5    LYS A N     1 
ATOM   35   C CA    . LYS A 1 5   ? -26.147 26.963 57.531  1.00 26.89 ? 5    LYS A CA    1 
ATOM   36   C C     . LYS A 1 5   ? -24.784 26.564 56.967  1.00 26.38 ? 5    LYS A C     1 
ATOM   37   O O     . LYS A 1 5   ? -24.530 25.380 56.764  1.00 26.44 ? 5    LYS A O     1 
ATOM   38   C CB    . LYS A 1 5   ? -27.043 27.543 56.431  1.00 28.58 ? 5    LYS A CB    1 
ATOM   39   C CG    . LYS A 1 5   ? -28.533 27.496 56.793  1.00 30.87 ? 5    LYS A CG    1 
ATOM   40   C CD    . LYS A 1 5   ? -29.408 28.172 55.744  1.00 32.57 ? 5    LYS A CD    1 
ATOM   41   C CE    . LYS A 1 5   ? -30.892 28.022 56.075  1.00 33.68 ? 5    LYS A CE    1 
ATOM   42   N NZ    . LYS A 1 5   ? -31.774 28.713 55.082  1.00 34.37 ? 5    LYS A NZ    1 
ATOM   43   N N     . ASP A 1 6   ? -23.919 27.548 56.717  1.00 26.30 ? 6    ASP A N     1 
ATOM   44   C CA    . ASP A 1 6   ? -22.564 27.298 56.218  1.00 26.40 ? 6    ASP A CA    1 
ATOM   45   C C     . ASP A 1 6   ? -21.716 26.962 57.434  1.00 24.83 ? 6    ASP A C     1 
ATOM   46   O O     . ASP A 1 6   ? -21.287 27.856 58.163  1.00 23.54 ? 6    ASP A O     1 
ATOM   47   C CB    . ASP A 1 6   ? -21.960 28.546 55.569  1.00 29.14 ? 6    ASP A CB    1 
ATOM   48   C CG    . ASP A 1 6   ? -22.560 28.866 54.227  1.00 31.74 ? 6    ASP A CG    1 
ATOM   49   O OD1   . ASP A 1 6   ? -22.147 29.893 53.638  1.00 33.75 ? 6    ASP A OD1   1 
ATOM   50   O OD2   . ASP A 1 6   ? -23.431 28.102 53.755  1.00 33.03 ? 6    ASP A OD2   1 
ATOM   51   N N     . LYS A 1 7   ? -21.464 25.682 57.654  1.00 23.23 ? 7    LYS A N     1 
ATOM   52   C CA    . LYS A 1 7   ? -20.688 25.293 58.808  1.00 22.02 ? 7    LYS A CA    1 
ATOM   53   C C     . LYS A 1 7   ? -19.190 25.373 58.560  1.00 21.36 ? 7    LYS A C     1 
ATOM   54   O O     . LYS A 1 7   ? -18.518 24.378 58.282  1.00 21.30 ? 7    LYS A O     1 
ATOM   55   C CB    . LYS A 1 7   ? -21.154 23.918 59.264  1.00 22.08 ? 7    LYS A CB    1 
ATOM   56   C CG    . LYS A 1 7   ? -22.651 23.977 59.593  1.00 22.34 ? 7    LYS A CG    1 
ATOM   57   C CD    . LYS A 1 7   ? -23.114 22.884 60.517  1.00 22.85 ? 7    LYS A CD    1 
ATOM   58   C CE    . LYS A 1 7   ? -24.622 22.961 60.747  1.00 23.11 ? 7    LYS A CE    1 
ATOM   59   N NZ    . LYS A 1 7   ? -25.050 24.134 61.543  1.00 22.49 ? 7    LYS A NZ    1 
ATOM   60   N N     . GLN A 1 8   ? -18.693 26.603 58.686  1.00 20.22 ? 8    GLN A N     1 
ATOM   61   C CA    . GLN A 1 8   ? -17.295 26.959 58.474  1.00 19.61 ? 8    GLN A CA    1 
ATOM   62   C C     . GLN A 1 8   ? -16.271 26.170 59.281  1.00 18.99 ? 8    GLN A C     1 
ATOM   63   O O     . GLN A 1 8   ? -15.116 26.054 58.874  1.00 19.13 ? 8    GLN A O     1 
ATOM   64   C CB    . GLN A 1 8   ? -17.094 28.448 58.771  1.00 20.10 ? 8    GLN A CB    1 
ATOM   65   C CG    . GLN A 1 8   ? -17.888 29.402 57.904  1.00 20.57 ? 8    GLN A CG    1 
ATOM   66   C CD    . GLN A 1 8   ? -17.501 29.324 56.444  1.00 20.87 ? 8    GLN A CD    1 
ATOM   67   O OE1   . GLN A 1 8   ? -16.323 29.228 56.107  1.00 20.74 ? 8    GLN A OE1   1 
ATOM   68   N NE2   . GLN A 1 8   ? -18.496 29.380 55.568  1.00 21.47 ? 8    GLN A NE2   1 
ATOM   69   N N     . LEU A 1 9   ? -16.674 25.640 60.427  1.00 18.13 ? 9    LEU A N     1 
ATOM   70   C CA    . LEU A 1 9   ? -15.732 24.901 61.254  1.00 17.80 ? 9    LEU A CA    1 
ATOM   71   C C     . LEU A 1 9   ? -15.830 23.382 61.148  1.00 18.32 ? 9    LEU A C     1 
ATOM   72   O O     . LEU A 1 9   ? -15.252 22.665 61.969  1.00 18.28 ? 9    LEU A O     1 
ATOM   73   C CB    . LEU A 1 9   ? -15.872 25.330 62.722  1.00 16.91 ? 9    LEU A CB    1 
ATOM   74   C CG    . LEU A 1 9   ? -15.653 26.821 63.002  1.00 16.19 ? 9    LEU A CG    1 
ATOM   75   C CD1   . LEU A 1 9   ? -15.718 27.059 64.504  1.00 15.93 ? 9    LEU A CD1   1 
ATOM   76   C CD2   . LEU A 1 9   ? -14.301 27.270 62.447  1.00 15.06 ? 9    LEU A CD2   1 
ATOM   77   N N     . THR A 1 10  ? -16.546 22.880 60.148  1.00 19.05 ? 10   THR A N     1 
ATOM   78   C CA    . THR A 1 10  ? -16.657 21.429 59.996  1.00 21.19 ? 10   THR A CA    1 
ATOM   79   C C     . THR A 1 10  ? -15.269 20.813 59.810  1.00 20.32 ? 10   THR A C     1 
ATOM   80   O O     . THR A 1 10  ? -14.455 21.321 59.043  1.00 20.99 ? 10   THR A O     1 
ATOM   81   C CB    . THR A 1 10  ? -17.547 21.053 58.791  1.00 22.47 ? 10   THR A CB    1 
ATOM   82   O OG1   . THR A 1 10  ? -18.889 21.485 59.046  1.00 24.65 ? 10   THR A OG1   1 
ATOM   83   C CG2   . THR A 1 10  ? -17.545 19.544 58.565  1.00 22.28 ? 10   THR A CG2   1 
ATOM   84   N N     . GLY A 1 11  ? -15.000 19.732 60.534  1.00 20.37 ? 11   GLY A N     1 
ATOM   85   C CA    . GLY A 1 11  ? -13.714 19.065 60.436  1.00 19.41 ? 11   GLY A CA    1 
ATOM   86   C C     . GLY A 1 11  ? -12.647 19.588 61.384  1.00 19.61 ? 11   GLY A C     1 
ATOM   87   O O     . GLY A 1 11  ? -11.520 19.081 61.404  1.00 19.77 ? 11   GLY A O     1 
ATOM   88   N N     . LEU A 1 12  ? -12.989 20.602 62.171  1.00 18.85 ? 12   LEU A N     1 
ATOM   89   C CA    . LEU A 1 12  ? -12.039 21.187 63.112  1.00 18.39 ? 12   LEU A CA    1 
ATOM   90   C C     . LEU A 1 12  ? -12.324 20.753 64.546  1.00 18.09 ? 12   LEU A C     1 
ATOM   91   O O     . LEU A 1 12  ? -13.480 20.650 64.954  1.00 18.22 ? 12   LEU A O     1 
ATOM   92   C CB    . LEU A 1 12  ? -12.076 22.713 63.002  1.00 18.07 ? 12   LEU A CB    1 
ATOM   93   C CG    . LEU A 1 12  ? -11.584 23.267 61.662  1.00 18.11 ? 12   LEU A CG    1 
ATOM   94   C CD1   . LEU A 1 12  ? -11.732 24.781 61.625  1.00 18.06 ? 12   LEU A CD1   1 
ATOM   95   C CD2   . LEU A 1 12  ? -10.128 22.872 61.466  1.00 18.72 ? 12   LEU A CD2   1 
ATOM   96   N N     . ARG A 1 13  ? -11.265 20.491 65.305  1.00 18.03 ? 13   ARG A N     1 
ATOM   97   C CA    . ARG A 1 13  ? -11.406 20.052 66.692  1.00 18.68 ? 13   ARG A CA    1 
ATOM   98   C C     . ARG A 1 13  ? -11.074 21.206 67.629  1.00 18.02 ? 13   ARG A C     1 
ATOM   99   O O     . ARG A 1 13  ? -10.207 22.024 67.323  1.00 17.85 ? 13   ARG A O     1 
ATOM   100  C CB    . ARG A 1 13  ? -10.448 18.895 66.980  1.00 19.13 ? 13   ARG A CB    1 
ATOM   101  C CG    . ARG A 1 13  ? -10.620 17.689 66.083  1.00 20.74 ? 13   ARG A CG    1 
ATOM   102  C CD    . ARG A 1 13  ? -9.288  16.959 65.916  1.00 22.05 ? 13   ARG A CD    1 
ATOM   103  N NE    . ARG A 1 13  ? -8.681  16.581 67.193  1.00 23.94 ? 13   ARG A NE    1 
ATOM   104  C CZ    . ARG A 1 13  ? -8.940  15.452 67.855  1.00 24.89 ? 13   ARG A CZ    1 
ATOM   105  N NH1   . ARG A 1 13  ? -9.803  14.568 67.359  1.00 25.36 ? 13   ARG A NH1   1 
ATOM   106  N NH2   . ARG A 1 13  ? -8.334  15.204 69.018  1.00 24.41 ? 13   ARG A NH2   1 
ATOM   107  N N     . PHE A 1 14  ? -11.757 21.278 68.767  1.00 16.38 ? 14   PHE A N     1 
ATOM   108  C CA    . PHE A 1 14  ? -11.479 22.345 69.716  1.00 15.41 ? 14   PHE A CA    1 
ATOM   109  C C     . PHE A 1 14  ? -11.613 21.865 71.143  1.00 14.91 ? 14   PHE A C     1 
ATOM   110  O O     . PHE A 1 14  ? -12.222 20.833 71.408  1.00 14.80 ? 14   PHE A O     1 
ATOM   111  C CB    . PHE A 1 14  ? -12.408 23.549 69.490  1.00 14.93 ? 14   PHE A CB    1 
ATOM   112  C CG    . PHE A 1 14  ? -13.843 23.317 69.898  1.00 15.24 ? 14   PHE A CG    1 
ATOM   113  C CD1   . PHE A 1 14  ? -14.721 22.619 69.070  1.00 15.16 ? 14   PHE A CD1   1 
ATOM   114  C CD2   . PHE A 1 14  ? -14.322 23.805 71.112  1.00 15.18 ? 14   PHE A CD2   1 
ATOM   115  C CE1   . PHE A 1 14  ? -16.057 22.413 69.452  1.00 14.81 ? 14   PHE A CE1   1 
ATOM   116  C CE2   . PHE A 1 14  ? -15.650 23.604 71.499  1.00 14.68 ? 14   PHE A CE2   1 
ATOM   117  C CZ    . PHE A 1 14  ? -16.517 22.907 70.667  1.00 14.88 ? 14   PHE A CZ    1 
ATOM   118  N N     . ILE A 1 15  ? -11.013 22.608 72.065  1.00 15.39 ? 15   ILE A N     1 
ATOM   119  C CA    . ILE A 1 15  ? -11.112 22.265 73.471  1.00 14.84 ? 15   ILE A CA    1 
ATOM   120  C C     . ILE A 1 15  ? -11.835 23.408 74.175  1.00 14.82 ? 15   ILE A C     1 
ATOM   121  O O     . ILE A 1 15  ? -11.711 24.581 73.803  1.00 14.44 ? 15   ILE A O     1 
ATOM   122  C CB    . ILE A 1 15  ? -9.723  21.976 74.129  1.00 14.93 ? 15   ILE A CB    1 
ATOM   123  C CG1   . ILE A 1 15  ? -8.843  23.226 74.140  1.00 14.49 ? 15   ILE A CG1   1 
ATOM   124  C CG2   . ILE A 1 15  ? -9.035  20.820 73.401  1.00 14.58 ? 15   ILE A CG2   1 
ATOM   125  C CD1   . ILE A 1 15  ? -7.583  23.054 74.990  1.00 13.44 ? 15   ILE A CD1   1 
ATOM   126  N N     . ASP A 1 16  ? -12.607 23.037 75.187  1.00 13.92 ? 16   ASP A N     1 
ATOM   127  C CA    . ASP A 1 16  ? -13.433 23.959 75.948  1.00 13.40 ? 16   ASP A CA    1 
ATOM   128  C C     . ASP A 1 16  ? -12.845 24.186 77.341  1.00 12.84 ? 16   ASP A C     1 
ATOM   129  O O     . ASP A 1 16  ? -13.237 23.526 78.297  1.00 13.58 ? 16   ASP A O     1 
ATOM   130  C CB    . ASP A 1 16  ? -14.841 23.341 76.028  1.00 13.31 ? 16   ASP A CB    1 
ATOM   131  C CG    . ASP A 1 16  ? -15.925 24.338 76.372  1.00 13.33 ? 16   ASP A CG    1 
ATOM   132  O OD1   . ASP A 1 16  ? -15.663 25.553 76.404  1.00 14.00 ? 16   ASP A OD1   1 
ATOM   133  O OD2   . ASP A 1 16  ? -17.065 23.888 76.600  1.00 13.81 ? 16   ASP A OD2   1 
ATOM   134  N N     . LEU A 1 17  ? -11.900 25.115 77.457  1.00 12.45 ? 17   LEU A N     1 
ATOM   135  C CA    . LEU A 1 17  ? -11.283 25.405 78.755  1.00 12.33 ? 17   LEU A CA    1 
ATOM   136  C C     . LEU A 1 17  ? -12.138 26.372 79.574  1.00 11.78 ? 17   LEU A C     1 
ATOM   137  O O     . LEU A 1 17  ? -12.809 27.232 79.008  1.00 11.30 ? 17   LEU A O     1 
ATOM   138  C CB    . LEU A 1 17  ? -9.884  25.991 78.560  1.00 12.33 ? 17   LEU A CB    1 
ATOM   139  C CG    . LEU A 1 17  ? -8.860  25.068 77.899  1.00 12.43 ? 17   LEU A CG    1 
ATOM   140  C CD1   . LEU A 1 17  ? -7.507  25.760 77.914  1.00 13.23 ? 17   LEU A CD1   1 
ATOM   141  C CD2   . LEU A 1 17  ? -8.789  23.735 78.639  1.00 11.85 ? 17   LEU A CD2   1 
ATOM   142  N N     . PHE A 1 18  ? -12.099 26.232 80.902  1.00 11.56 ? 18   PHE A N     1 
ATOM   143  C CA    . PHE A 1 18  ? -12.886 27.080 81.802  1.00 12.04 ? 18   PHE A CA    1 
ATOM   144  C C     . PHE A 1 18  ? -14.286 27.013 81.224  1.00 12.10 ? 18   PHE A C     1 
ATOM   145  O O     . PHE A 1 18  ? -14.983 28.021 81.108  1.00 12.60 ? 18   PHE A O     1 
ATOM   146  C CB    . PHE A 1 18  ? -12.351 28.518 81.771  1.00 11.72 ? 18   PHE A CB    1 
ATOM   147  C CG    . PHE A 1 18  ? -10.875 28.612 82.041  1.00 11.51 ? 18   PHE A CG    1 
ATOM   148  C CD1   . PHE A 1 18  ? -10.382 28.498 83.335  1.00 11.19 ? 18   PHE A CD1   1 
ATOM   149  C CD2   . PHE A 1 18  ? -9.971  28.736 80.989  1.00 11.79 ? 18   PHE A CD2   1 
ATOM   150  C CE1   . PHE A 1 18  ? -9.009  28.498 83.581  1.00 11.05 ? 18   PHE A CE1   1 
ATOM   151  C CE2   . PHE A 1 18  ? -8.595  28.738 81.224  1.00 10.91 ? 18   PHE A CE2   1 
ATOM   152  C CZ    . PHE A 1 18  ? -8.116  28.617 82.526  1.00 11.24 ? 18   PHE A CZ    1 
ATOM   153  N N     . ALA A 1 19  ? -14.663 25.790 80.857  1.00 11.97 ? 19   ALA A N     1 
ATOM   154  C CA    . ALA A 1 19  ? -15.935 25.479 80.217  1.00 11.33 ? 19   ALA A CA    1 
ATOM   155  C C     . ALA A 1 19  ? -17.192 26.140 80.746  1.00 10.96 ? 19   ALA A C     1 
ATOM   156  O O     . ALA A 1 19  ? -17.980 26.652 79.950  1.00 11.17 ? 19   ALA A O     1 
ATOM   157  C CB    . ALA A 1 19  ? -16.132 23.967 80.184  1.00 11.08 ? 19   ALA A CB    1 
ATOM   158  N N     . GLY A 1 20  ? -17.389 26.120 82.065  1.00 9.78  ? 20   GLY A N     1 
ATOM   159  C CA    . GLY A 1 20  ? -18.592 26.699 82.642  1.00 8.65  ? 20   GLY A CA    1 
ATOM   160  C C     . GLY A 1 20  ? -19.814 25.975 82.092  1.00 9.85  ? 20   GLY A C     1 
ATOM   161  O O     . GLY A 1 20  ? -19.914 24.753 82.187  1.00 9.50  ? 20   GLY A O     1 
ATOM   162  N N     . LEU A 1 21  ? -20.741 26.725 81.500  1.00 9.94  ? 21   LEU A N     1 
ATOM   163  C CA    . LEU A 1 21  ? -21.951 26.152 80.909  1.00 10.88 ? 21   LEU A CA    1 
ATOM   164  C C     . LEU A 1 21  ? -21.680 25.542 79.536  1.00 10.92 ? 21   LEU A C     1 
ATOM   165  O O     . LEU A 1 21  ? -22.494 24.784 79.017  1.00 10.83 ? 21   LEU A O     1 
ATOM   166  C CB    . LEU A 1 21  ? -23.027 27.232 80.749  1.00 11.26 ? 21   LEU A CB    1 
ATOM   167  C CG    . LEU A 1 21  ? -23.620 27.797 82.038  1.00 11.97 ? 21   LEU A CG    1 
ATOM   168  C CD1   . LEU A 1 21  ? -24.315 29.122 81.753  1.00 12.15 ? 21   LEU A CD1   1 
ATOM   169  C CD2   . LEU A 1 21  ? -24.585 26.771 82.634  1.00 11.57 ? 21   LEU A CD2   1 
ATOM   170  N N     . GLY A 1 22  ? -20.549 25.892 78.937  1.00 10.71 ? 22   GLY A N     1 
ATOM   171  C CA    . GLY A 1 22  ? -20.234 25.361 77.625  1.00 11.05 ? 22   GLY A CA    1 
ATOM   172  C C     . GLY A 1 22  ? -20.686 26.275 76.506  1.00 11.02 ? 22   GLY A C     1 
ATOM   173  O O     . GLY A 1 22  ? -20.984 25.813 75.403  1.00 11.78 ? 22   GLY A O     1 
ATOM   174  N N     . GLY A 1 23  ? -20.733 27.575 76.788  1.00 11.32 ? 23   GLY A N     1 
ATOM   175  C CA    . GLY A 1 23  ? -21.135 28.547 75.784  1.00 10.53 ? 23   GLY A CA    1 
ATOM   176  C C     . GLY A 1 23  ? -20.268 28.502 74.541  1.00 10.31 ? 23   GLY A C     1 
ATOM   177  O O     . GLY A 1 23  ? -20.765 28.623 73.422  1.00 10.75 ? 23   GLY A O     1 
ATOM   178  N N     . PHE A 1 24  ? -18.962 28.346 74.724  1.00 11.03 ? 24   PHE A N     1 
ATOM   179  C CA    . PHE A 1 24  ? -18.059 28.263 73.581  1.00 11.46 ? 24   PHE A CA    1 
ATOM   180  C C     . PHE A 1 24  ? -18.364 26.993 72.784  1.00 11.25 ? 24   PHE A C     1 
ATOM   181  O O     . PHE A 1 24  ? -18.256 26.980 71.560  1.00 10.99 ? 24   PHE A O     1 
ATOM   182  C CB    . PHE A 1 24  ? -16.596 28.248 74.031  1.00 11.32 ? 24   PHE A CB    1 
ATOM   183  C CG    . PHE A 1 24  ? -16.003 29.622 74.247  1.00 12.16 ? 24   PHE A CG    1 
ATOM   184  C CD1   . PHE A 1 24  ? -16.041 30.229 75.501  1.00 11.46 ? 24   PHE A CD1   1 
ATOM   185  C CD2   . PHE A 1 24  ? -15.384 30.299 73.193  1.00 11.52 ? 24   PHE A CD2   1 
ATOM   186  C CE1   . PHE A 1 24  ? -15.466 31.488 75.703  1.00 11.91 ? 24   PHE A CE1   1 
ATOM   187  C CE2   . PHE A 1 24  ? -14.809 31.556 73.386  1.00 11.26 ? 24   PHE A CE2   1 
ATOM   188  C CZ    . PHE A 1 24  ? -14.850 32.151 74.643  1.00 11.52 ? 24   PHE A CZ    1 
ATOM   189  N N     . ARG A 1 25  ? -18.751 25.931 73.483  1.00 11.15 ? 25   ARG A N     1 
ATOM   190  C CA    . ARG A 1 25  ? -19.085 24.673 72.828  1.00 11.53 ? 25   ARG A CA    1 
ATOM   191  C C     . ARG A 1 25  ? -20.332 24.801 71.960  1.00 11.81 ? 25   ARG A C     1 
ATOM   192  O O     . ARG A 1 25  ? -20.356 24.311 70.832  1.00 11.88 ? 25   ARG A O     1 
ATOM   193  C CB    . ARG A 1 25  ? -19.288 23.573 73.867  1.00 11.67 ? 25   ARG A CB    1 
ATOM   194  C CG    . ARG A 1 25  ? -19.563 22.214 73.269  1.00 11.29 ? 25   ARG A CG    1 
ATOM   195  C CD    . ARG A 1 25  ? -19.265 21.145 74.286  1.00 11.57 ? 25   ARG A CD    1 
ATOM   196  N NE    . ARG A 1 25  ? -19.489 19.803 73.765  1.00 11.76 ? 25   ARG A NE    1 
ATOM   197  C CZ    . ARG A 1 25  ? -19.070 18.700 74.372  1.00 11.80 ? 25   ARG A CZ    1 
ATOM   198  N NH1   . ARG A 1 25  ? -18.403 18.787 75.517  1.00 10.71 ? 25   ARG A NH1   1 
ATOM   199  N NH2   . ARG A 1 25  ? -19.322 17.511 73.839  1.00 12.76 ? 25   ARG A NH2   1 
ATOM   200  N N     . LEU A 1 26  ? -21.371 25.449 72.481  1.00 11.95 ? 26   LEU A N     1 
ATOM   201  C CA    . LEU A 1 26  ? -22.591 25.642 71.696  1.00 12.45 ? 26   LEU A CA    1 
ATOM   202  C C     . LEU A 1 26  ? -22.258 26.439 70.437  1.00 12.42 ? 26   LEU A C     1 
ATOM   203  O O     . LEU A 1 26  ? -22.648 26.066 69.330  1.00 12.22 ? 26   LEU A O     1 
ATOM   204  C CB    . LEU A 1 26  ? -23.653 26.409 72.490  1.00 11.78 ? 26   LEU A CB    1 
ATOM   205  C CG    . LEU A 1 26  ? -24.281 25.730 73.706  1.00 12.08 ? 26   LEU A CG    1 
ATOM   206  C CD1   . LEU A 1 26  ? -25.251 26.688 74.366  1.00 12.04 ? 26   LEU A CD1   1 
ATOM   207  C CD2   . LEU A 1 26  ? -24.991 24.459 73.273  1.00 11.82 ? 26   LEU A CD2   1 
ATOM   208  N N     . ALA A 1 27  ? -21.533 27.538 70.618  1.00 12.49 ? 27   ALA A N     1 
ATOM   209  C CA    . ALA A 1 27  ? -21.158 28.398 69.504  1.00 12.11 ? 27   ALA A CA    1 
ATOM   210  C C     . ALA A 1 27  ? -20.321 27.684 68.447  1.00 12.00 ? 27   ALA A C     1 
ATOM   211  O O     . ALA A 1 27  ? -20.646 27.730 67.268  1.00 11.77 ? 27   ALA A O     1 
ATOM   212  C CB    . ALA A 1 27  ? -20.418 29.630 70.023  1.00 10.97 ? 27   ALA A CB    1 
ATOM   213  N N     . LEU A 1 28  ? -19.242 27.025 68.856  1.00 12.98 ? 28   LEU A N     1 
ATOM   214  C CA    . LEU A 1 28  ? -18.401 26.339 67.883  1.00 13.56 ? 28   LEU A CA    1 
ATOM   215  C C     . LEU A 1 28  ? -19.051 25.121 67.237  1.00 14.10 ? 28   LEU A C     1 
ATOM   216  O O     . LEU A 1 28  ? -18.833 24.863 66.049  1.00 14.21 ? 28   LEU A O     1 
ATOM   217  C CB    . LEU A 1 28  ? -17.051 25.963 68.494  1.00 12.55 ? 28   LEU A CB    1 
ATOM   218  C CG    . LEU A 1 28  ? -16.013 27.077 68.319  1.00 12.18 ? 28   LEU A CG    1 
ATOM   219  C CD1   . LEU A 1 28  ? -16.362 28.264 69.223  1.00 11.20 ? 28   LEU A CD1   1 
ATOM   220  C CD2   . LEU A 1 28  ? -14.628 26.539 68.643  1.00 11.58 ? 28   LEU A CD2   1 
ATOM   221  N N     . GLU A 1 29  ? -19.844 24.373 67.999  1.00 14.74 ? 29   GLU A N     1 
ATOM   222  C CA    . GLU A 1 29  ? -20.521 23.211 67.427  1.00 15.18 ? 29   GLU A CA    1 
ATOM   223  C C     . GLU A 1 29  ? -21.565 23.664 66.406  1.00 15.42 ? 29   GLU A C     1 
ATOM   224  O O     . GLU A 1 29  ? -21.765 22.999 65.385  1.00 15.46 ? 29   GLU A O     1 
ATOM   225  C CB    . GLU A 1 29  ? -21.182 22.357 68.514  1.00 15.13 ? 29   GLU A CB    1 
ATOM   226  C CG    . GLU A 1 29  ? -20.187 21.770 69.500  1.00 16.98 ? 29   GLU A CG    1 
ATOM   227  C CD    . GLU A 1 29  ? -20.786 20.713 70.417  1.00 17.88 ? 29   GLU A CD    1 
ATOM   228  O OE1   . GLU A 1 29  ? -21.990 20.786 70.732  1.00 17.42 ? 29   GLU A OE1   1 
ATOM   229  O OE2   . GLU A 1 29  ? -20.037 19.813 70.840  1.00 19.14 ? 29   GLU A OE2   1 
ATOM   230  N N     . SER A 1 30  ? -22.218 24.800 66.662  1.00 14.47 ? 30   SER A N     1 
ATOM   231  C CA    . SER A 1 30  ? -23.227 25.291 65.725  1.00 14.52 ? 30   SER A CA    1 
ATOM   232  C C     . SER A 1 30  ? -22.579 25.560 64.377  1.00 15.02 ? 30   SER A C     1 
ATOM   233  O O     . SER A 1 30  ? -23.247 25.526 63.346  1.00 14.77 ? 30   SER A O     1 
ATOM   234  C CB    . SER A 1 30  ? -23.902 26.568 66.240  1.00 14.08 ? 30   SER A CB    1 
ATOM   235  O OG    . SER A 1 30  ? -23.047 27.687 66.127  1.00 13.73 ? 30   SER A OG    1 
ATOM   236  N N     . CYS A 1 31  ? -21.272 25.820 64.389  1.00 16.14 ? 31   CYS A N     1 
ATOM   237  C CA    . CYS A 1 31  ? -20.530 26.075 63.157  1.00 16.84 ? 31   CYS A CA    1 
ATOM   238  C C     . CYS A 1 31  ? -19.900 24.798 62.608  1.00 16.92 ? 31   CYS A C     1 
ATOM   239  O O     . CYS A 1 31  ? -19.140 24.842 61.643  1.00 16.98 ? 31   CYS A O     1 
ATOM   240  C CB    . CYS A 1 31  ? -19.438 27.123 63.384  1.00 16.94 ? 31   CYS A CB    1 
ATOM   241  S SG    . CYS A 1 31  ? -20.035 28.818 63.559  1.00 18.56 ? 31   CYS A SG    1 
ATOM   242  N N     . GLY A 1 32  ? -20.204 23.666 63.237  1.00 16.52 ? 32   GLY A N     1 
ATOM   243  C CA    . GLY A 1 32  ? -19.681 22.396 62.767  1.00 16.81 ? 32   GLY A CA    1 
ATOM   244  C C     . GLY A 1 32  ? -18.435 21.824 63.420  1.00 17.01 ? 32   GLY A C     1 
ATOM   245  O O     . GLY A 1 32  ? -18.011 20.727 63.054  1.00 18.05 ? 32   GLY A O     1 
ATOM   246  N N     . ALA A 1 33  ? -17.839 22.537 64.372  1.00 16.66 ? 33   ALA A N     1 
ATOM   247  C CA    . ALA A 1 33  ? -16.630 22.042 65.034  1.00 15.98 ? 33   ALA A CA    1 
ATOM   248  C C     . ALA A 1 33  ? -16.931 20.929 66.031  1.00 15.86 ? 33   ALA A C     1 
ATOM   249  O O     . ALA A 1 33  ? -18.040 20.819 66.549  1.00 16.29 ? 33   ALA A O     1 
ATOM   250  C CB    . ALA A 1 33  ? -15.901 23.187 65.741  1.00 15.77 ? 33   ALA A CB    1 
ATOM   251  N N     . GLU A 1 34  ? -15.920 20.119 66.305  1.00 15.32 ? 34   GLU A N     1 
ATOM   252  C CA    . GLU A 1 34  ? -16.050 19.001 67.224  1.00 16.04 ? 34   GLU A CA    1 
ATOM   253  C C     . GLU A 1 34  ? -15.252 19.264 68.496  1.00 15.13 ? 34   GLU A C     1 
ATOM   254  O O     . GLU A 1 34  ? -14.079 19.621 68.431  1.00 15.28 ? 34   GLU A O     1 
ATOM   255  C CB    . GLU A 1 34  ? -15.531 17.736 66.547  1.00 17.24 ? 34   GLU A CB    1 
ATOM   256  C CG    . GLU A 1 34  ? -15.632 16.477 67.382  1.00 19.78 ? 34   GLU A CG    1 
ATOM   257  C CD    . GLU A 1 34  ? -14.757 15.365 66.842  1.00 21.52 ? 34   GLU A CD    1 
ATOM   258  O OE1   . GLU A 1 34  ? -14.451 15.385 65.628  1.00 22.84 ? 34   GLU A OE1   1 
ATOM   259  O OE2   . GLU A 1 34  ? -14.378 14.470 67.627  1.00 22.84 ? 34   GLU A OE2   1 
ATOM   260  N N     . CYS A 1 35  ? -15.886 19.094 69.649  1.00 14.40 ? 35   CYS A N     1 
ATOM   261  C CA    . CYS A 1 35  ? -15.209 19.311 70.921  1.00 14.40 ? 35   CYS A CA    1 
ATOM   262  C C     . CYS A 1 35  ? -14.508 18.016 71.306  1.00 14.83 ? 35   CYS A C     1 
ATOM   263  O O     . CYS A 1 35  ? -15.127 16.955 71.298  1.00 14.94 ? 35   CYS A O     1 
ATOM   264  C CB    . CYS A 1 35  ? -16.223 19.697 72.000  1.00 13.73 ? 35   CYS A CB    1 
ATOM   265  S SG    . CYS A 1 35  ? -15.506 20.070 73.625  1.00 14.60 ? 35   CYS A SG    1 
ATOM   266  N N     . VAL A 1 36  ? -13.223 18.099 71.643  1.00 14.75 ? 36   VAL A N     1 
ATOM   267  C CA    . VAL A 1 36  ? -12.474 16.909 72.017  1.00 14.25 ? 36   VAL A CA    1 
ATOM   268  C C     . VAL A 1 36  ? -11.906 16.950 73.429  1.00 15.17 ? 36   VAL A C     1 
ATOM   269  O O     . VAL A 1 36  ? -11.183 16.037 73.844  1.00 15.22 ? 36   VAL A O     1 
ATOM   270  C CB    . VAL A 1 36  ? -11.335 16.644 71.023  1.00 14.04 ? 36   VAL A CB    1 
ATOM   271  C CG1   . VAL A 1 36  ? -11.911 16.575 69.606  1.00 13.16 ? 36   VAL A CG1   1 
ATOM   272  C CG2   . VAL A 1 36  ? -10.269 17.725 71.135  1.00 13.91 ? 36   VAL A CG2   1 
ATOM   273  N N     . TYR A 1 37  ? -12.239 18.002 74.173  1.00 15.26 ? 37   TYR A N     1 
ATOM   274  C CA    . TYR A 1 37  ? -11.768 18.141 75.552  1.00 14.86 ? 37   TYR A CA    1 
ATOM   275  C C     . TYR A 1 37  ? -12.432 19.336 76.215  1.00 14.46 ? 37   TYR A C     1 
ATOM   276  O O     . TYR A 1 37  ? -12.671 20.356 75.570  1.00 13.82 ? 37   TYR A O     1 
ATOM   277  C CB    . TYR A 1 37  ? -10.250 18.335 75.588  1.00 15.51 ? 37   TYR A CB    1 
ATOM   278  C CG    . TYR A 1 37  ? -9.677  18.509 76.984  1.00 16.49 ? 37   TYR A CG    1 
ATOM   279  C CD1   . TYR A 1 37  ? -9.527  17.419 77.848  1.00 16.72 ? 37   TYR A CD1   1 
ATOM   280  C CD2   . TYR A 1 37  ? -9.286  19.765 77.443  1.00 16.12 ? 37   TYR A CD2   1 
ATOM   281  C CE1   . TYR A 1 37  ? -8.999  17.588 79.133  1.00 16.77 ? 37   TYR A CE1   1 
ATOM   282  C CE2   . TYR A 1 37  ? -8.761  19.939 78.717  1.00 16.22 ? 37   TYR A CE2   1 
ATOM   283  C CZ    . TYR A 1 37  ? -8.621  18.855 79.554  1.00 16.67 ? 37   TYR A CZ    1 
ATOM   284  O OH    . TYR A 1 37  ? -8.110  19.048 80.817  1.00 17.63 ? 37   TYR A OH    1 
ATOM   285  N N     . SER A 1 38  ? -12.732 19.194 77.502  1.00 13.81 ? 38   SER A N     1 
ATOM   286  C CA    . SER A 1 38  ? -13.341 20.263 78.278  1.00 13.70 ? 38   SER A CA    1 
ATOM   287  C C     . SER A 1 38  ? -12.738 20.223 79.673  1.00 13.79 ? 38   SER A C     1 
ATOM   288  O O     . SER A 1 38  ? -12.409 19.152 80.193  1.00 14.09 ? 38   SER A O     1 
ATOM   289  C CB    . SER A 1 38  ? -14.868 20.101 78.345  1.00 13.71 ? 38   SER A CB    1 
ATOM   290  O OG    . SER A 1 38  ? -15.257 18.994 79.141  1.00 15.31 ? 38   SER A OG    1 
ATOM   291  N N     . ASN A 1 39  ? -12.577 21.398 80.270  1.00 13.53 ? 39   ASN A N     1 
ATOM   292  C CA    . ASN A 1 39  ? -12.003 21.507 81.599  1.00 13.38 ? 39   ASN A CA    1 
ATOM   293  C C     . ASN A 1 39  ? -12.779 22.545 82.400  1.00 13.41 ? 39   ASN A C     1 
ATOM   294  O O     . ASN A 1 39  ? -12.977 23.676 81.949  1.00 14.28 ? 39   ASN A O     1 
ATOM   295  C CB    . ASN A 1 39  ? -10.523 21.895 81.493  1.00 13.47 ? 39   ASN A CB    1 
ATOM   296  C CG    . ASN A 1 39  ? -9.792  21.804 82.824  1.00 14.01 ? 39   ASN A CG    1 
ATOM   297  O OD1   . ASN A 1 39  ? -9.916  22.685 83.673  1.00 13.76 ? 39   ASN A OD1   1 
ATOM   298  N ND2   . ASN A 1 39  ? -9.026  20.729 83.012  1.00 13.90 ? 39   ASN A ND2   1 
ATOM   299  N N     . GLU A 1 40  ? -13.218 22.142 83.588  1.00 13.10 ? 40   GLU A N     1 
ATOM   300  C CA    . GLU A 1 40  ? -13.992 22.989 84.490  1.00 13.28 ? 40   GLU A CA    1 
ATOM   301  C C     . GLU A 1 40  ? -13.900 22.352 85.871  1.00 13.25 ? 40   GLU A C     1 
ATOM   302  O O     . GLU A 1 40  ? -14.288 21.200 86.045  1.00 13.79 ? 40   GLU A O     1 
ATOM   303  C CB    . GLU A 1 40  ? -15.459 23.036 84.035  1.00 13.16 ? 40   GLU A CB    1 
ATOM   304  C CG    . GLU A 1 40  ? -16.428 23.604 85.068  1.00 12.48 ? 40   GLU A CG    1 
ATOM   305  C CD    . GLU A 1 40  ? -16.085 25.025 85.457  1.00 12.62 ? 40   GLU A CD    1 
ATOM   306  O OE1   . GLU A 1 40  ? -15.991 25.866 84.540  1.00 12.02 ? 40   GLU A OE1   1 
ATOM   307  O OE2   . GLU A 1 40  ? -15.909 25.298 86.669  1.00 11.90 ? 40   GLU A OE2   1 
ATOM   308  N N     . TRP A 1 41  ? -13.406 23.101 86.852  1.00 13.61 ? 41   TRP A N     1 
ATOM   309  C CA    . TRP A 1 41  ? -13.247 22.559 88.195  1.00 13.64 ? 41   TRP A CA    1 
ATOM   310  C C     . TRP A 1 41  ? -14.387 22.795 89.170  1.00 13.68 ? 41   TRP A C     1 
ATOM   311  O O     . TRP A 1 41  ? -14.344 22.310 90.294  1.00 14.52 ? 41   TRP A O     1 
ATOM   312  C CB    . TRP A 1 41  ? -11.948 23.074 88.813  1.00 13.81 ? 41   TRP A CB    1 
ATOM   313  C CG    . TRP A 1 41  ? -11.989 24.484 89.344  1.00 14.24 ? 41   TRP A CG    1 
ATOM   314  C CD1   . TRP A 1 41  ? -12.936 25.440 89.092  1.00 14.59 ? 41   TRP A CD1   1 
ATOM   315  C CD2   . TRP A 1 41  ? -10.993 25.116 90.160  1.00 14.32 ? 41   TRP A CD2   1 
ATOM   316  N NE1   . TRP A 1 41  ? -12.585 26.629 89.691  1.00 14.92 ? 41   TRP A NE1   1 
ATOM   317  C CE2   . TRP A 1 41  ? -11.397 26.456 90.354  1.00 15.18 ? 41   TRP A CE2   1 
ATOM   318  C CE3   . TRP A 1 41  ? -9.796  24.680 90.742  1.00 14.71 ? 41   TRP A CE3   1 
ATOM   319  C CZ2   . TRP A 1 41  ? -10.641 27.366 91.108  1.00 15.30 ? 41   TRP A CZ2   1 
ATOM   320  C CZ3   . TRP A 1 41  ? -9.045  25.584 91.490  1.00 14.80 ? 41   TRP A CZ3   1 
ATOM   321  C CH2   . TRP A 1 41  ? -9.472  26.912 91.665  1.00 15.33 ? 41   TRP A CH2   1 
ATOM   322  N N     . ASP A 1 42  ? -15.403 23.547 88.772  1.00 13.97 ? 42   ASP A N     1 
ATOM   323  C CA    . ASP A 1 42  ? -16.502 23.785 89.690  1.00 14.55 ? 42   ASP A CA    1 
ATOM   324  C C     . ASP A 1 42  ? -17.466 22.604 89.649  1.00 14.89 ? 42   ASP A C     1 
ATOM   325  O O     . ASP A 1 42  ? -17.897 22.170 88.579  1.00 14.53 ? 42   ASP A O     1 
ATOM   326  C CB    . ASP A 1 42  ? -17.219 25.094 89.353  1.00 14.20 ? 42   ASP A CB    1 
ATOM   327  C CG    . ASP A 1 42  ? -18.368 25.391 90.302  1.00 13.28 ? 42   ASP A CG    1 
ATOM   328  O OD1   . ASP A 1 42  ? -19.497 24.932 90.039  1.00 13.07 ? 42   ASP A OD1   1 
ATOM   329  O OD2   . ASP A 1 42  ? -18.142 26.068 91.324  1.00 13.22 ? 42   ASP A OD2   1 
ATOM   330  N N     . LYS A 1 43  ? -17.774 22.082 90.831  1.00 15.11 ? 43   LYS A N     1 
ATOM   331  C CA    . LYS A 1 43  ? -18.670 20.941 90.990  1.00 15.94 ? 43   LYS A CA    1 
ATOM   332  C C     . LYS A 1 43  ? -19.989 21.083 90.245  1.00 15.54 ? 43   LYS A C     1 
ATOM   333  O O     . LYS A 1 43  ? -20.383 20.198 89.485  1.00 15.83 ? 43   LYS A O     1 
ATOM   334  C CB    . LYS A 1 43  ? -18.972 20.728 92.475  1.00 16.97 ? 43   LYS A CB    1 
ATOM   335  C CG    . LYS A 1 43  ? -19.992 19.643 92.760  1.00 18.82 ? 43   LYS A CG    1 
ATOM   336  C CD    . LYS A 1 43  ? -20.193 19.465 94.260  1.00 19.69 ? 43   LYS A CD    1 
ATOM   337  C CE    . LYS A 1 43  ? -20.993 18.212 94.563  1.00 20.22 ? 43   LYS A CE    1 
ATOM   338  N NZ    . LYS A 1 43  ? -22.326 18.238 93.901  1.00 22.07 ? 43   LYS A NZ    1 
ATOM   339  N N     . TYR A 1 44  ? -20.669 22.200 90.480  1.00 14.40 ? 44   TYR A N     1 
ATOM   340  C CA    . TYR A 1 44  ? -21.972 22.468 89.877  1.00 13.37 ? 44   TYR A CA    1 
ATOM   341  C C     . TYR A 1 44  ? -21.913 22.786 88.401  1.00 13.03 ? 44   TYR A C     1 
ATOM   342  O O     . TYR A 1 44  ? -22.819 22.426 87.656  1.00 13.15 ? 44   TYR A O     1 
ATOM   343  C CB    . TYR A 1 44  ? -22.644 23.587 90.663  1.00 13.57 ? 44   TYR A CB    1 
ATOM   344  C CG    . TYR A 1 44  ? -22.662 23.254 92.132  1.00 13.46 ? 44   TYR A CG    1 
ATOM   345  C CD1   . TYR A 1 44  ? -23.482 22.239 92.616  1.00 13.70 ? 44   TYR A CD1   1 
ATOM   346  C CD2   . TYR A 1 44  ? -21.793 23.883 93.019  1.00 13.42 ? 44   TYR A CD2   1 
ATOM   347  C CE1   . TYR A 1 44  ? -23.435 21.851 93.943  1.00 14.80 ? 44   TYR A CE1   1 
ATOM   348  C CE2   . TYR A 1 44  ? -21.737 23.506 94.352  1.00 14.57 ? 44   TYR A CE2   1 
ATOM   349  C CZ    . TYR A 1 44  ? -22.562 22.485 94.809  1.00 14.96 ? 44   TYR A CZ    1 
ATOM   350  O OH    . TYR A 1 44  ? -22.519 22.093 96.129  1.00 15.93 ? 44   TYR A OH    1 
ATOM   351  N N     . ALA A 1 45  ? -20.851 23.462 87.973  1.00 12.95 ? 45   ALA A N     1 
ATOM   352  C CA    . ALA A 1 45  ? -20.685 23.770 86.559  1.00 13.02 ? 45   ALA A CA    1 
ATOM   353  C C     . ALA A 1 45  ? -20.450 22.434 85.829  1.00 13.19 ? 45   ALA A C     1 
ATOM   354  O O     . ALA A 1 45  ? -20.928 22.232 84.708  1.00 12.85 ? 45   ALA A O     1 
ATOM   355  C CB    . ALA A 1 45  ? -19.506 24.717 86.359  1.00 11.36 ? 45   ALA A CB    1 
ATOM   356  N N     . GLN A 1 46  ? -19.724 21.521 86.477  1.00 13.68 ? 46   GLN A N     1 
ATOM   357  C CA    . GLN A 1 46  ? -19.457 20.202 85.895  1.00 14.36 ? 46   GLN A CA    1 
ATOM   358  C C     . GLN A 1 46  ? -20.766 19.420 85.736  1.00 14.25 ? 46   GLN A C     1 
ATOM   359  O O     . GLN A 1 46  ? -20.958 18.702 84.747  1.00 14.06 ? 46   GLN A O     1 
ATOM   360  C CB    . GLN A 1 46  ? -18.497 19.386 86.774  1.00 14.76 ? 46   GLN A CB    1 
ATOM   361  C CG    . GLN A 1 46  ? -17.095 19.954 86.918  1.00 15.94 ? 46   GLN A CG    1 
ATOM   362  C CD    . GLN A 1 46  ? -16.194 19.050 87.742  1.00 16.97 ? 46   GLN A CD    1 
ATOM   363  O OE1   . GLN A 1 46  ? -16.653 18.385 88.672  1.00 17.83 ? 46   GLN A OE1   1 
ATOM   364  N NE2   . GLN A 1 46  ? -14.908 19.033 87.417  1.00 17.19 ? 46   GLN A NE2   1 
ATOM   365  N N     . GLU A 1 47  ? -21.659 19.555 86.715  1.00 13.96 ? 47   GLU A N     1 
ATOM   366  C CA    . GLU A 1 47  ? -22.947 18.869 86.670  1.00 13.69 ? 47   GLU A CA    1 
ATOM   367  C C     . GLU A 1 47  ? -23.814 19.378 85.524  1.00 13.53 ? 47   GLU A C     1 
ATOM   368  O O     . GLU A 1 47  ? -24.349 18.582 84.759  1.00 13.70 ? 47   GLU A O     1 
ATOM   369  C CB    . GLU A 1 47  ? -23.699 19.035 87.994  1.00 13.63 ? 47   GLU A CB    1 
ATOM   370  C CG    . GLU A 1 47  ? -22.926 18.505 89.194  1.00 15.03 ? 47   GLU A CG    1 
ATOM   371  C CD    . GLU A 1 47  ? -23.645 18.715 90.516  1.00 16.29 ? 47   GLU A CD    1 
ATOM   372  O OE1   . GLU A 1 47  ? -24.544 19.583 90.585  1.00 15.80 ? 47   GLU A OE1   1 
ATOM   373  O OE2   . GLU A 1 47  ? -23.295 18.016 91.494  1.00 17.33 ? 47   GLU A OE2   1 
ATOM   374  N N     . VAL A 1 48  ? -23.955 20.696 85.394  1.00 13.16 ? 48   VAL A N     1 
ATOM   375  C CA    . VAL A 1 48  ? -24.783 21.233 84.318  1.00 12.73 ? 48   VAL A CA    1 
ATOM   376  C C     . VAL A 1 48  ? -24.130 20.954 82.972  1.00 12.60 ? 48   VAL A C     1 
ATOM   377  O O     . VAL A 1 48  ? -24.814 20.700 81.982  1.00 11.66 ? 48   VAL A O     1 
ATOM   378  C CB    . VAL A 1 48  ? -25.026 22.760 84.469  1.00 12.92 ? 48   VAL A CB    1 
ATOM   379  C CG1   . VAL A 1 48  ? -23.750 23.535 84.173  1.00 13.35 ? 48   VAL A CG1   1 
ATOM   380  C CG2   . VAL A 1 48  ? -26.153 23.197 83.541  1.00 12.21 ? 48   VAL A CG2   1 
ATOM   381  N N     . TYR A 1 49  ? -22.803 20.989 82.934  1.00 12.81 ? 49   TYR A N     1 
ATOM   382  C CA    . TYR A 1 49  ? -22.096 20.720 81.689  1.00 13.19 ? 49   TYR A CA    1 
ATOM   383  C C     . TYR A 1 49  ? -22.393 19.288 81.270  1.00 13.58 ? 49   TYR A C     1 
ATOM   384  O O     . TYR A 1 49  ? -22.702 19.020 80.118  1.00 13.48 ? 49   TYR A O     1 
ATOM   385  C CB    . TYR A 1 49  ? -20.587 20.893 81.874  1.00 12.47 ? 49   TYR A CB    1 
ATOM   386  C CG    . TYR A 1 49  ? -19.834 20.970 80.561  1.00 12.56 ? 49   TYR A CG    1 
ATOM   387  C CD1   . TYR A 1 49  ? -19.591 22.195 79.943  1.00 12.39 ? 49   TYR A CD1   1 
ATOM   388  C CD2   . TYR A 1 49  ? -19.380 19.813 79.930  1.00 12.40 ? 49   TYR A CD2   1 
ATOM   389  C CE1   . TYR A 1 49  ? -18.909 22.262 78.728  1.00 13.17 ? 49   TYR A CE1   1 
ATOM   390  C CE2   . TYR A 1 49  ? -18.699 19.866 78.719  1.00 12.49 ? 49   TYR A CE2   1 
ATOM   391  C CZ    . TYR A 1 49  ? -18.464 21.089 78.124  1.00 12.62 ? 49   TYR A CZ    1 
ATOM   392  O OH    . TYR A 1 49  ? -17.765 21.136 76.942  1.00 12.75 ? 49   TYR A OH    1 
ATOM   393  N N     . GLU A 1 50  ? -22.314 18.365 82.220  1.00 14.75 ? 50   GLU A N     1 
ATOM   394  C CA    . GLU A 1 50  ? -22.572 16.965 81.914  1.00 16.88 ? 50   GLU A CA    1 
ATOM   395  C C     . GLU A 1 50  ? -24.022 16.748 81.532  1.00 16.76 ? 50   GLU A C     1 
ATOM   396  O O     . GLU A 1 50  ? -24.340 15.924 80.673  1.00 16.10 ? 50   GLU A O     1 
ATOM   397  C CB    . GLU A 1 50  ? -22.236 16.083 83.111  1.00 18.48 ? 50   GLU A CB    1 
ATOM   398  C CG    . GLU A 1 50  ? -22.313 14.610 82.783  1.00 21.66 ? 50   GLU A CG    1 
ATOM   399  C CD    . GLU A 1 50  ? -21.761 13.739 83.884  1.00 23.96 ? 50   GLU A CD    1 
ATOM   400  O OE1   . GLU A 1 50  ? -21.497 12.549 83.608  1.00 25.86 ? 50   GLU A OE1   1 
ATOM   401  O OE2   . GLU A 1 50  ? -21.591 14.239 85.018  1.00 25.22 ? 50   GLU A OE2   1 
ATOM   402  N N     . MET A 1 51  ? -24.895 17.497 82.189  1.00 16.73 ? 51   MET A N     1 
ATOM   403  C CA    . MET A 1 51  ? -26.323 17.423 81.953  1.00 17.05 ? 51   MET A CA    1 
ATOM   404  C C     . MET A 1 51  ? -26.632 17.758 80.498  1.00 15.95 ? 51   MET A C     1 
ATOM   405  O O     . MET A 1 51  ? -27.523 17.172 79.888  1.00 15.54 ? 51   MET A O     1 
ATOM   406  C CB    . MET A 1 51  ? -27.019 18.416 82.874  1.00 18.96 ? 51   MET A CB    1 
ATOM   407  C CG    . MET A 1 51  ? -28.421 18.042 83.292  1.00 21.98 ? 51   MET A CG    1 
ATOM   408  S SD    . MET A 1 51  ? -29.079 19.297 84.411  1.00 24.91 ? 51   MET A SD    1 
ATOM   409  C CE    . MET A 1 51  ? -27.977 19.121 85.814  1.00 22.58 ? 51   MET A CE    1 
ATOM   410  N N     . ASN A 1 52  ? -25.871 18.692 79.939  1.00 14.82 ? 52   ASN A N     1 
ATOM   411  C CA    . ASN A 1 52  ? -26.083 19.136 78.567  1.00 14.53 ? 52   ASN A CA    1 
ATOM   412  C C     . ASN A 1 52  ? -25.221 18.527 77.481  1.00 14.48 ? 52   ASN A C     1 
ATOM   413  O O     . ASN A 1 52  ? -25.647 18.462 76.336  1.00 15.15 ? 52   ASN A O     1 
ATOM   414  C CB    . ASN A 1 52  ? -25.951 20.651 78.504  1.00 13.86 ? 52   ASN A CB    1 
ATOM   415  C CG    . ASN A 1 52  ? -27.146 21.346 79.077  1.00 13.64 ? 52   ASN A CG    1 
ATOM   416  O OD1   . ASN A 1 52  ? -28.166 21.508 78.399  1.00 13.99 ? 52   ASN A OD1   1 
ATOM   417  N ND2   . ASN A 1 52  ? -27.049 21.745 80.343  1.00 12.88 ? 52   ASN A ND2   1 
ATOM   418  N N     . PHE A 1 53  ? -24.020 18.083 77.825  1.00 14.63 ? 53   PHE A N     1 
ATOM   419  C CA    . PHE A 1 53  ? -23.133 17.508 76.825  1.00 15.85 ? 53   PHE A CA    1 
ATOM   420  C C     . PHE A 1 53  ? -22.783 16.057 77.098  1.00 17.06 ? 53   PHE A C     1 
ATOM   421  O O     . PHE A 1 53  ? -22.107 15.414 76.293  1.00 17.98 ? 53   PHE A O     1 
ATOM   422  C CB    . PHE A 1 53  ? -21.870 18.357 76.722  1.00 14.83 ? 53   PHE A CB    1 
ATOM   423  C CG    . PHE A 1 53  ? -22.147 19.776 76.350  1.00 14.41 ? 53   PHE A CG    1 
ATOM   424  C CD1   . PHE A 1 53  ? -22.464 20.112 75.037  1.00 13.98 ? 53   PHE A CD1   1 
ATOM   425  C CD2   . PHE A 1 53  ? -22.148 20.775 77.320  1.00 13.98 ? 53   PHE A CD2   1 
ATOM   426  C CE1   . PHE A 1 53  ? -22.779 21.422 74.696  1.00 13.61 ? 53   PHE A CE1   1 
ATOM   427  C CE2   . PHE A 1 53  ? -22.462 22.080 76.985  1.00 13.54 ? 53   PHE A CE2   1 
ATOM   428  C CZ    . PHE A 1 53  ? -22.779 22.403 75.667  1.00 13.28 ? 53   PHE A CZ    1 
ATOM   429  N N     . GLY A 1 54  ? -23.229 15.552 78.241  1.00 17.57 ? 54   GLY A N     1 
ATOM   430  C CA    . GLY A 1 54  ? -22.995 14.162 78.577  1.00 19.78 ? 54   GLY A CA    1 
ATOM   431  C C     . GLY A 1 54  ? -21.603 13.764 79.016  1.00 21.41 ? 54   GLY A C     1 
ATOM   432  O O     . GLY A 1 54  ? -21.272 12.585 79.018  1.00 22.81 ? 54   GLY A O     1 
ATOM   433  N N     . GLU A 1 55  ? -20.782 14.732 79.392  1.00 22.46 ? 55   GLU A N     1 
ATOM   434  C CA    . GLU A 1 55  ? -19.431 14.432 79.835  1.00 23.25 ? 55   GLU A CA    1 
ATOM   435  C C     . GLU A 1 55  ? -19.058 15.356 80.974  1.00 22.88 ? 55   GLU A C     1 
ATOM   436  O O     . GLU A 1 55  ? -19.467 16.517 81.003  1.00 22.38 ? 55   GLU A O     1 
ATOM   437  C CB    . GLU A 1 55  ? -18.439 14.616 78.684  1.00 25.56 ? 55   GLU A CB    1 
ATOM   438  C CG    . GLU A 1 55  ? -18.522 15.984 78.000  1.00 28.28 ? 55   GLU A CG    1 
ATOM   439  C CD    . GLU A 1 55  ? -17.440 16.188 76.944  1.00 30.31 ? 55   GLU A CD    1 
ATOM   440  O OE1   . GLU A 1 55  ? -16.340 16.692 77.285  1.00 29.73 ? 55   GLU A OE1   1 
ATOM   441  O OE2   . GLU A 1 55  ? -17.695 15.831 75.769  1.00 32.00 ? 55   GLU A OE2   1 
ATOM   442  N N     . LYS A 1 56  ? -18.285 14.832 81.915  1.00 22.86 ? 56   LYS A N     1 
ATOM   443  C CA    . LYS A 1 56  ? -17.833 15.607 83.060  1.00 22.82 ? 56   LYS A CA    1 
ATOM   444  C C     . LYS A 1 56  ? -16.488 16.215 82.681  1.00 21.46 ? 56   LYS A C     1 
ATOM   445  O O     . LYS A 1 56  ? -15.556 15.491 82.337  1.00 21.09 ? 56   LYS A O     1 
ATOM   446  C CB    . LYS A 1 56  ? -17.674 14.686 84.269  1.00 24.52 ? 56   LYS A CB    1 
ATOM   447  C CG    . LYS A 1 56  ? -17.209 15.360 85.552  1.00 26.76 ? 56   LYS A CG    1 
ATOM   448  C CD    . LYS A 1 56  ? -17.019 14.320 86.651  1.00 28.05 ? 56   LYS A CD    1 
ATOM   449  C CE    . LYS A 1 56  ? -16.541 14.940 87.959  1.00 29.59 ? 56   LYS A CE    1 
ATOM   450  N NZ    . LYS A 1 56  ? -16.359 13.916 89.034  1.00 30.06 ? 56   LYS A NZ    1 
ATOM   451  N N     . PRO A 1 57  ? -16.377 17.557 82.697  1.00 20.49 ? 57   PRO A N     1 
ATOM   452  C CA    . PRO A 1 57  ? -15.098 18.183 82.344  1.00 19.48 ? 57   PRO A CA    1 
ATOM   453  C C     . PRO A 1 57  ? -13.999 17.796 83.333  1.00 19.12 ? 57   PRO A C     1 
ATOM   454  O O     . PRO A 1 57  ? -14.277 17.503 84.500  1.00 18.03 ? 57   PRO A O     1 
ATOM   455  C CB    . PRO A 1 57  ? -15.416 19.674 82.408  1.00 19.27 ? 57   PRO A CB    1 
ATOM   456  C CG    . PRO A 1 57  ? -16.855 19.724 82.022  1.00 19.49 ? 57   PRO A CG    1 
ATOM   457  C CD    . PRO A 1 57  ? -17.441 18.572 82.803  1.00 19.91 ? 57   PRO A CD    1 
ATOM   458  N N     . GLU A 1 58  ? -12.754 17.780 82.867  1.00 18.53 ? 58   GLU A N     1 
ATOM   459  C CA    . GLU A 1 58  ? -11.645 17.454 83.748  1.00 18.31 ? 58   GLU A CA    1 
ATOM   460  C C     . GLU A 1 58  ? -11.480 18.631 84.707  1.00 17.70 ? 58   GLU A C     1 
ATOM   461  O O     . GLU A 1 58  ? -11.803 19.760 84.357  1.00 18.14 ? 58   GLU A O     1 
ATOM   462  C CB    . GLU A 1 58  ? -10.372 17.226 82.931  1.00 18.89 ? 58   GLU A CB    1 
ATOM   463  C CG    . GLU A 1 58  ? -9.113  17.088 83.772  1.00 19.21 ? 58   GLU A CG    1 
ATOM   464  C CD    . GLU A 1 58  ? -7.969  16.440 83.014  1.00 20.10 ? 58   GLU A CD    1 
ATOM   465  O OE1   . GLU A 1 58  ? -7.734  16.809 81.846  1.00 19.63 ? 58   GLU A OE1   1 
ATOM   466  O OE2   . GLU A 1 58  ? -7.297  15.561 83.597  1.00 21.30 ? 58   GLU A OE2   1 
ATOM   467  N N     . GLY A 1 59  ? -10.993 18.365 85.916  1.00 17.66 ? 59   GLY A N     1 
ATOM   468  C CA    . GLY A 1 59  ? -10.823 19.417 86.907  1.00 16.55 ? 59   GLY A CA    1 
ATOM   469  C C     . GLY A 1 59  ? -9.569  20.273 86.822  1.00 16.49 ? 59   GLY A C     1 
ATOM   470  O O     . GLY A 1 59  ? -8.778  20.157 85.884  1.00 16.10 ? 59   GLY A O     1 
ATOM   471  N N     . ASP A 1 60  ? -9.407  21.132 87.830  1.00 16.62 ? 60   ASP A N     1 
ATOM   472  C CA    . ASP A 1 60  ? -8.295  22.080 87.968  1.00 16.53 ? 60   ASP A CA    1 
ATOM   473  C C     . ASP A 1 60  ? -7.235  22.028 86.884  1.00 16.87 ? 60   ASP A C     1 
ATOM   474  O O     . ASP A 1 60  ? -6.352  21.168 86.898  1.00 17.17 ? 60   ASP A O     1 
ATOM   475  C CB    . ASP A 1 60  ? -7.614  21.909 89.325  1.00 16.77 ? 60   ASP A CB    1 
ATOM   476  C CG    . ASP A 1 60  ? -6.694  23.065 89.657  1.00 17.38 ? 60   ASP A CG    1 
ATOM   477  O OD1   . ASP A 1 60  ? -6.356  23.843 88.738  1.00 17.49 ? 60   ASP A OD1   1 
ATOM   478  O OD2   . ASP A 1 60  ? -6.302  23.197 90.835  1.00 18.28 ? 60   ASP A OD2   1 
ATOM   479  N N     . ILE A 1 61  ? -7.318  22.984 85.966  1.00 16.79 ? 61   ILE A N     1 
ATOM   480  C CA    . ILE A 1 61  ? -6.399  23.087 84.840  1.00 16.99 ? 61   ILE A CA    1 
ATOM   481  C C     . ILE A 1 61  ? -4.936  23.282 85.252  1.00 17.77 ? 61   ILE A C     1 
ATOM   482  O O     . ILE A 1 61  ? -4.023  22.904 84.513  1.00 18.35 ? 61   ILE A O     1 
ATOM   483  C CB    . ILE A 1 61  ? -6.809  24.259 83.915  1.00 15.92 ? 61   ILE A CB    1 
ATOM   484  C CG1   . ILE A 1 61  ? -6.009  24.206 82.619  1.00 15.03 ? 61   ILE A CG1   1 
ATOM   485  C CG2   . ILE A 1 61  ? -6.581  25.591 84.624  1.00 15.33 ? 61   ILE A CG2   1 
ATOM   486  C CD1   . ILE A 1 61  ? -6.355  23.032 81.740  1.00 14.99 ? 61   ILE A CD1   1 
ATOM   487  N N     . THR A 1 62  ? -4.705  23.865 86.426  1.00 18.61 ? 62   THR A N     1 
ATOM   488  C CA    . THR A 1 62  ? -3.335  24.094 86.877  1.00 19.46 ? 62   THR A CA    1 
ATOM   489  C C     . THR A 1 62  ? -2.610  22.806 87.233  1.00 20.70 ? 62   THR A C     1 
ATOM   490  O O     . THR A 1 62  ? -1.389  22.801 87.371  1.00 21.14 ? 62   THR A O     1 
ATOM   491  C CB    . THR A 1 62  ? -3.269  25.028 88.107  1.00 18.77 ? 62   THR A CB    1 
ATOM   492  O OG1   . THR A 1 62  ? -3.811  24.362 89.251  1.00 18.45 ? 62   THR A OG1   1 
ATOM   493  C CG2   . THR A 1 62  ? -4.041  26.308 87.849  1.00 17.86 ? 62   THR A CG2   1 
ATOM   494  N N     . GLN A 1 63  ? -3.351  21.712 87.379  1.00 21.44 ? 63   GLN A N     1 
ATOM   495  C CA    . GLN A 1 63  ? -2.736  20.433 87.725  1.00 22.24 ? 63   GLN A CA    1 
ATOM   496  C C     . GLN A 1 63  ? -2.758  19.452 86.556  1.00 21.17 ? 63   GLN A C     1 
ATOM   497  O O     . GLN A 1 63  ? -2.406  18.288 86.707  1.00 20.88 ? 63   GLN A O     1 
ATOM   498  C CB    . GLN A 1 63  ? -3.449  19.809 88.933  1.00 23.92 ? 63   GLN A CB    1 
ATOM   499  C CG    . GLN A 1 63  ? -3.443  20.675 90.188  1.00 26.60 ? 63   GLN A CG    1 
ATOM   500  C CD    . GLN A 1 63  ? -2.055  21.196 90.531  1.00 28.70 ? 63   GLN A CD    1 
ATOM   501  O OE1   . GLN A 1 63  ? -1.106  20.420 90.662  1.00 30.38 ? 63   GLN A OE1   1 
ATOM   502  N NE2   . GLN A 1 63  ? -1.928  22.516 90.680  1.00 29.48 ? 63   GLN A NE2   1 
ATOM   503  N N     . VAL A 1 64  ? -3.164  19.929 85.388  1.00 20.90 ? 64   VAL A N     1 
ATOM   504  C CA    . VAL A 1 64  ? -3.248  19.077 84.205  1.00 20.38 ? 64   VAL A CA    1 
ATOM   505  C C     . VAL A 1 64  ? -1.995  19.145 83.350  1.00 20.69 ? 64   VAL A C     1 
ATOM   506  O O     . VAL A 1 64  ? -1.561  20.228 82.969  1.00 20.41 ? 64   VAL A O     1 
ATOM   507  C CB    . VAL A 1 64  ? -4.457  19.474 83.326  1.00 19.48 ? 64   VAL A CB    1 
ATOM   508  C CG1   . VAL A 1 64  ? -4.375  18.789 81.967  1.00 18.52 ? 64   VAL A CG1   1 
ATOM   509  C CG2   . VAL A 1 64  ? -5.742  19.106 84.035  1.00 18.28 ? 64   VAL A CG2   1 
ATOM   510  N N     . ASN A 1 65  ? -1.415  17.987 83.053  1.00 21.79 ? 65   ASN A N     1 
ATOM   511  C CA    . ASN A 1 65  ? -0.227  17.937 82.210  1.00 23.10 ? 65   ASN A CA    1 
ATOM   512  C C     . ASN A 1 65  ? -0.685  18.288 80.792  1.00 22.75 ? 65   ASN A C     1 
ATOM   513  O O     . ASN A 1 65  ? -1.388  17.508 80.152  1.00 22.00 ? 65   ASN A O     1 
ATOM   514  C CB    . ASN A 1 65  ? 0.373   16.531 82.232  1.00 24.96 ? 65   ASN A CB    1 
ATOM   515  C CG    . ASN A 1 65  ? 1.690   16.445 81.488  1.00 26.47 ? 65   ASN A CG    1 
ATOM   516  O OD1   . ASN A 1 65  ? 1.816   16.917 80.359  1.00 27.05 ? 65   ASN A OD1   1 
ATOM   517  N ND2   . ASN A 1 65  ? 2.680   15.829 82.117  1.00 28.24 ? 65   ASN A ND2   1 
ATOM   518  N N     . GLU A 1 66  ? -0.285  19.461 80.308  1.00 23.41 ? 66   GLU A N     1 
ATOM   519  C CA    . GLU A 1 66  ? -0.683  19.928 78.984  1.00 24.30 ? 66   GLU A CA    1 
ATOM   520  C C     . GLU A 1 66  ? -0.418  18.921 77.878  1.00 25.03 ? 66   GLU A C     1 
ATOM   521  O O     . GLU A 1 66  ? -0.995  19.023 76.798  1.00 25.08 ? 66   GLU A O     1 
ATOM   522  C CB    . GLU A 1 66  ? 0.011   21.251 78.640  1.00 24.53 ? 66   GLU A CB    1 
ATOM   523  C CG    . GLU A 1 66  ? 1.518   21.163 78.572  1.00 25.94 ? 66   GLU A CG    1 
ATOM   524  C CD    . GLU A 1 66  ? 2.176   21.330 79.932  1.00 27.21 ? 66   GLU A CD    1 
ATOM   525  O OE1   . GLU A 1 66  ? 1.522   21.057 80.964  1.00 27.45 ? 66   GLU A OE1   1 
ATOM   526  O OE2   . GLU A 1 66  ? 3.358   21.730 79.969  1.00 27.97 ? 66   GLU A OE2   1 
ATOM   527  N N     . LYS A 1 67  ? 0.456   17.954 78.142  1.00 25.94 ? 67   LYS A N     1 
ATOM   528  C CA    . LYS A 1 67  ? 0.778   16.931 77.153  1.00 26.41 ? 67   LYS A CA    1 
ATOM   529  C C     . LYS A 1 67  ? -0.357  15.918 77.041  1.00 25.57 ? 67   LYS A C     1 
ATOM   530  O O     . LYS A 1 67  ? -0.508  15.246 76.017  1.00 24.82 ? 67   LYS A O     1 
ATOM   531  C CB    . LYS A 1 67  ? 2.078   16.215 77.534  1.00 27.98 ? 67   LYS A CB    1 
ATOM   532  C CG    . LYS A 1 67  ? 3.319   17.099 77.492  1.00 29.14 ? 67   LYS A CG    1 
ATOM   533  C CD    . LYS A 1 67  ? 4.545   16.334 77.963  1.00 30.57 ? 67   LYS A CD    1 
ATOM   534  C CE    . LYS A 1 67  ? 5.804   17.169 77.824  1.00 31.81 ? 67   LYS A CE    1 
ATOM   535  N NZ    . LYS A 1 67  ? 7.011   16.441 78.324  1.00 33.51 ? 67   LYS A NZ    1 
ATOM   536  N N     . THR A 1 68  ? -1.157  15.824 78.100  1.00 24.88 ? 68   THR A N     1 
ATOM   537  C CA    . THR A 1 68  ? -2.283  14.895 78.138  1.00 24.54 ? 68   THR A CA    1 
ATOM   538  C C     . THR A 1 68  ? -3.514  15.441 77.420  1.00 23.48 ? 68   THR A C     1 
ATOM   539  O O     . THR A 1 68  ? -4.486  14.725 77.211  1.00 23.92 ? 68   THR A O     1 
ATOM   540  C CB    . THR A 1 68  ? -2.684  14.566 79.587  1.00 24.82 ? 68   THR A CB    1 
ATOM   541  O OG1   . THR A 1 68  ? -3.371  15.683 80.167  1.00 24.71 ? 68   THR A OG1   1 
ATOM   542  C CG2   . THR A 1 68  ? -1.443  14.249 80.415  1.00 25.49 ? 68   THR A CG2   1 
ATOM   543  N N     . ILE A 1 69  ? -3.476  16.714 77.056  1.00 22.13 ? 69   ILE A N     1 
ATOM   544  C CA    . ILE A 1 69  ? -4.592  17.333 76.362  1.00 20.94 ? 69   ILE A CA    1 
ATOM   545  C C     . ILE A 1 69  ? -4.581  16.944 74.883  1.00 20.75 ? 69   ILE A C     1 
ATOM   546  O O     . ILE A 1 69  ? -3.563  17.071 74.204  1.00 20.87 ? 69   ILE A O     1 
ATOM   547  C CB    . ILE A 1 69  ? -4.532  18.863 76.503  1.00 20.24 ? 69   ILE A CB    1 
ATOM   548  C CG1   . ILE A 1 69  ? -4.792  19.251 77.960  1.00 19.49 ? 69   ILE A CG1   1 
ATOM   549  C CG2   . ILE A 1 69  ? -5.558  19.516 75.585  1.00 20.82 ? 69   ILE A CG2   1 
ATOM   550  C CD1   . ILE A 1 69  ? -4.594  20.706 78.248  1.00 18.64 ? 69   ILE A CD1   1 
ATOM   551  N N     . PRO A 1 70  ? -5.721  16.462 74.368  1.00 20.33 ? 70   PRO A N     1 
ATOM   552  C CA    . PRO A 1 70  ? -5.887  16.037 72.974  1.00 20.79 ? 70   PRO A CA    1 
ATOM   553  C C     . PRO A 1 70  ? -5.480  17.077 71.929  1.00 20.97 ? 70   PRO A C     1 
ATOM   554  O O     . PRO A 1 70  ? -5.536  18.283 72.186  1.00 20.76 ? 70   PRO A O     1 
ATOM   555  C CB    . PRO A 1 70  ? -7.379  15.723 72.889  1.00 20.31 ? 70   PRO A CB    1 
ATOM   556  C CG    . PRO A 1 70  ? -7.707  15.283 74.268  1.00 20.74 ? 70   PRO A CG    1 
ATOM   557  C CD    . PRO A 1 70  ? -6.978  16.282 75.115  1.00 20.38 ? 70   PRO A CD    1 
ATOM   558  N N     . ASP A 1 71  ? -5.070  16.602 70.753  1.00 20.72 ? 71   ASP A N     1 
ATOM   559  C CA    . ASP A 1 71  ? -4.709  17.501 69.663  1.00 20.63 ? 71   ASP A CA    1 
ATOM   560  C C     . ASP A 1 71  ? -5.991  18.247 69.318  1.00 19.49 ? 71   ASP A C     1 
ATOM   561  O O     . ASP A 1 71  ? -7.073  17.665 69.329  1.00 18.69 ? 71   ASP A O     1 
ATOM   562  C CB    . ASP A 1 71  ? -4.273  16.723 68.420  1.00 22.20 ? 71   ASP A CB    1 
ATOM   563  C CG    . ASP A 1 71  ? -2.984  15.957 68.620  1.00 23.69 ? 71   ASP A CG    1 
ATOM   564  O OD1   . ASP A 1 71  ? -2.606  15.226 67.681  1.00 23.48 ? 71   ASP A OD1   1 
ATOM   565  O OD2   . ASP A 1 71  ? -2.352  16.084 69.696  1.00 24.63 ? 71   ASP A OD2   1 
ATOM   566  N N     . HIS A 1 72  ? -5.870  19.530 69.005  1.00 19.06 ? 72   HIS A N     1 
ATOM   567  C CA    . HIS A 1 72  ? -7.035  20.332 68.657  1.00 18.01 ? 72   HIS A CA    1 
ATOM   568  C C     . HIS A 1 72  ? -6.612  21.482 67.748  1.00 18.09 ? 72   HIS A C     1 
ATOM   569  O O     . HIS A 1 72  ? -5.435  21.861 67.711  1.00 17.86 ? 72   HIS A O     1 
ATOM   570  C CB    . HIS A 1 72  ? -7.709  20.871 69.923  1.00 17.27 ? 72   HIS A CB    1 
ATOM   571  C CG    . HIS A 1 72  ? -6.808  21.706 70.775  1.00 17.01 ? 72   HIS A CG    1 
ATOM   572  N ND1   . HIS A 1 72  ? -5.801  21.167 71.547  1.00 17.28 ? 72   HIS A ND1   1 
ATOM   573  C CD2   . HIS A 1 72  ? -6.734  23.047 70.946  1.00 16.62 ? 72   HIS A CD2   1 
ATOM   574  C CE1   . HIS A 1 72  ? -5.143  22.139 72.153  1.00 17.02 ? 72   HIS A CE1   1 
ATOM   575  N NE2   . HIS A 1 72  ? -5.689  23.290 71.805  1.00 16.84 ? 72   HIS A NE2   1 
ATOM   576  N N     . ASP A 1 73  ? -7.578  22.027 67.014  1.00 17.65 ? 73   ASP A N     1 
ATOM   577  C CA    . ASP A 1 73  ? -7.322  23.112 66.080  1.00 17.32 ? 73   ASP A CA    1 
ATOM   578  C C     . ASP A 1 73  ? -7.596  24.483 66.685  1.00 16.81 ? 73   ASP A C     1 
ATOM   579  O O     . ASP A 1 73  ? -6.937  25.470 66.345  1.00 17.35 ? 73   ASP A O     1 
ATOM   580  C CB    . ASP A 1 73  ? -8.190  22.915 64.841  1.00 17.59 ? 73   ASP A CB    1 
ATOM   581  C CG    . ASP A 1 73  ? -7.906  21.607 64.144  1.00 18.51 ? 73   ASP A CG    1 
ATOM   582  O OD1   . ASP A 1 73  ? -6.805  21.471 63.572  1.00 19.12 ? 73   ASP A OD1   1 
ATOM   583  O OD2   . ASP A 1 73  ? -8.773  20.711 64.172  1.00 18.54 ? 73   ASP A OD2   1 
ATOM   584  N N     . ILE A 1 74  ? -8.565  24.533 67.592  1.00 15.99 ? 74   ILE A N     1 
ATOM   585  C CA    . ILE A 1 74  ? -8.960  25.780 68.227  1.00 14.42 ? 74   ILE A CA    1 
ATOM   586  C C     . ILE A 1 74  ? -9.092  25.613 69.733  1.00 14.31 ? 74   ILE A C     1 
ATOM   587  O O     . ILE A 1 74  ? -9.787  24.718 70.209  1.00 13.85 ? 74   ILE A O     1 
ATOM   588  C CB    . ILE A 1 74  ? -10.314 26.252 67.676  1.00 14.43 ? 74   ILE A CB    1 
ATOM   589  C CG1   . ILE A 1 74  ? -10.242 26.379 66.156  1.00 13.33 ? 74   ILE A CG1   1 
ATOM   590  C CG2   . ILE A 1 74  ? -10.717 27.569 68.329  1.00 14.03 ? 74   ILE A CG2   1 
ATOM   591  C CD1   . ILE A 1 74  ? -11.568 26.693 65.519  1.00 12.94 ? 74   ILE A CD1   1 
ATOM   592  N N     . LEU A 1 75  ? -8.417  26.480 70.475  1.00 13.42 ? 75   LEU A N     1 
ATOM   593  C CA    . LEU A 1 75  ? -8.475  26.453 71.928  1.00 12.65 ? 75   LEU A CA    1 
ATOM   594  C C     . LEU A 1 75  ? -9.422  27.567 72.348  1.00 12.39 ? 75   LEU A C     1 
ATOM   595  O O     . LEU A 1 75  ? -9.235  28.719 71.959  1.00 11.91 ? 75   LEU A O     1 
ATOM   596  C CB    . LEU A 1 75  ? -7.083  26.693 72.518  1.00 12.10 ? 75   LEU A CB    1 
ATOM   597  C CG    . LEU A 1 75  ? -6.935  26.617 74.040  1.00 12.24 ? 75   LEU A CG    1 
ATOM   598  C CD1   . LEU A 1 75  ? -5.488  26.295 74.395  1.00 12.23 ? 75   LEU A CD1   1 
ATOM   599  C CD2   . LEU A 1 75  ? -7.373  27.928 74.678  1.00 12.20 ? 75   LEU A CD2   1 
ATOM   600  N N     . CYS A 1 76  ? -10.446 27.217 73.120  1.00 12.20 ? 76   CYS A N     1 
ATOM   601  C CA    . CYS A 1 76  ? -11.423 28.194 73.600  1.00 12.82 ? 76   CYS A CA    1 
ATOM   602  C C     . CYS A 1 76  ? -11.224 28.441 75.091  1.00 13.50 ? 76   CYS A C     1 
ATOM   603  O O     . CYS A 1 76  ? -11.015 27.502 75.858  1.00 14.02 ? 76   CYS A O     1 
ATOM   604  C CB    . CYS A 1 76  ? -12.844 27.692 73.349  1.00 12.17 ? 76   CYS A CB    1 
ATOM   605  S SG    . CYS A 1 76  ? -13.275 27.638 71.611  1.00 11.62 ? 76   CYS A SG    1 
ATOM   606  N N     . ALA A 1 77  ? -11.289 29.698 75.510  1.00 13.09 ? 77   ALA A N     1 
ATOM   607  C CA    . ALA A 1 77  ? -11.089 29.986 76.917  1.00 12.49 ? 77   ALA A CA    1 
ATOM   608  C C     . ALA A 1 77  ? -11.613 31.325 77.396  1.00 12.24 ? 77   ALA A C     1 
ATOM   609  O O     . ALA A 1 77  ? -11.027 32.365 77.126  1.00 12.26 ? 77   ALA A O     1 
ATOM   610  C CB    . ALA A 1 77  ? -9.608  29.867 77.257  1.00 12.82 ? 77   ALA A CB    1 
ATOM   611  N N     . GLY A 1 78  ? -12.741 31.289 78.090  1.00 12.04 ? 78   GLY A N     1 
ATOM   612  C CA    . GLY A 1 78  ? -13.284 32.495 78.670  1.00 11.32 ? 78   GLY A CA    1 
ATOM   613  C C     . GLY A 1 78  ? -12.739 32.341 80.074  1.00 11.99 ? 78   GLY A C     1 
ATOM   614  O O     . GLY A 1 78  ? -13.397 31.754 80.934  1.00 11.54 ? 78   GLY A O     1 
ATOM   615  N N     . PHE A 1 79  ? -11.525 32.833 80.309  1.00 11.65 ? 79   PHE A N     1 
ATOM   616  C CA    . PHE A 1 79  ? -10.910 32.664 81.620  1.00 12.41 ? 79   PHE A CA    1 
ATOM   617  C C     . PHE A 1 79  ? -11.445 33.574 82.731  1.00 12.26 ? 79   PHE A C     1 
ATOM   618  O O     . PHE A 1 79  ? -12.155 34.541 82.457  1.00 13.65 ? 79   PHE A O     1 
ATOM   619  C CB    . PHE A 1 79  ? -9.369  32.739 81.509  1.00 12.27 ? 79   PHE A CB    1 
ATOM   620  C CG    . PHE A 1 79  ? -8.839  33.975 80.826  1.00 12.43 ? 79   PHE A CG    1 
ATOM   621  C CD1   . PHE A 1 79  ? -8.942  34.134 79.448  1.00 12.03 ? 79   PHE A CD1   1 
ATOM   622  C CD2   . PHE A 1 79  ? -8.180  34.958 81.565  1.00 12.44 ? 79   PHE A CD2   1 
ATOM   623  C CE1   . PHE A 1 79  ? -8.393  35.255 78.815  1.00 12.97 ? 79   PHE A CE1   1 
ATOM   624  C CE2   . PHE A 1 79  ? -7.632  36.078 80.945  1.00 12.32 ? 79   PHE A CE2   1 
ATOM   625  C CZ    . PHE A 1 79  ? -7.737  36.226 79.566  1.00 12.90 ? 79   PHE A CZ    1 
ATOM   626  N N     . PRO A 1 80  ? -11.136 33.250 84.007  1.00 11.81 ? 80   PRO A N     1 
ATOM   627  C CA    . PRO A 1 80  ? -11.593 34.028 85.161  1.00 12.43 ? 80   PRO A CA    1 
ATOM   628  C C     . PRO A 1 80  ? -11.420 35.524 85.016  1.00 13.15 ? 80   PRO A C     1 
ATOM   629  O O     . PRO A 1 80  ? -10.403 35.999 84.519  1.00 13.55 ? 80   PRO A O     1 
ATOM   630  C CB    . PRO A 1 80  ? -10.778 33.447 86.312  1.00 11.57 ? 80   PRO A CB    1 
ATOM   631  C CG    . PRO A 1 80  ? -10.672 32.031 85.930  1.00 11.41 ? 80   PRO A CG    1 
ATOM   632  C CD    . PRO A 1 80  ? -10.314 32.116 84.462  1.00 11.65 ? 80   PRO A CD    1 
ATOM   633  N N     . CYS A 1 81  ? -12.416 36.266 85.481  1.00 14.19 ? 81   CYS A N     1 
ATOM   634  C CA    . CYS A 1 81  ? -12.390 37.714 85.371  1.00 15.40 ? 81   CYS A CA    1 
ATOM   635  C C     . CYS A 1 81  ? -12.522 38.480 86.686  1.00 14.96 ? 81   CYS A C     1 
ATOM   636  O O     . CYS A 1 81  ? -12.441 39.703 86.675  1.00 15.67 ? 81   CYS A O     1 
ATOM   637  C CB    . CYS A 1 81  ? -13.523 38.164 84.471  1.00 16.91 ? 81   CYS A CB    1 
ATOM   638  S SG    . CYS A 1 81  ? -15.078 38.164 85.389  1.00 20.28 ? 81   CYS A SG    1 
ATOM   639  N N     . GLN A 1 82  ? -12.739 37.800 87.809  1.00 14.19 ? 82   GLN A N     1 
ATOM   640  C CA    . GLN A 1 82  ? -12.896 38.529 89.067  1.00 14.44 ? 82   GLN A CA    1 
ATOM   641  C C     . GLN A 1 82  ? -11.739 39.487 89.325  1.00 14.99 ? 82   GLN A C     1 
ATOM   642  O O     . GLN A 1 82  ? -11.931 40.573 89.874  1.00 15.08 ? 82   GLN A O     1 
ATOM   643  C CB    . GLN A 1 82  ? -13.014 37.574 90.262  1.00 14.09 ? 82   GLN A CB    1 
ATOM   644  C CG    . GLN A 1 82  ? -14.038 36.475 90.100  1.00 13.96 ? 82   GLN A CG    1 
ATOM   645  C CD    . GLN A 1 82  ? -13.401 35.164 89.689  1.00 13.94 ? 82   GLN A CD    1 
ATOM   646  O OE1   . GLN A 1 82  ? -12.639 35.109 88.724  1.00 14.81 ? 82   GLN A OE1   1 
ATOM   647  N NE2   . GLN A 1 82  ? -13.709 34.099 90.418  1.00 13.09 ? 82   GLN A NE2   1 
ATOM   648  N N     . ALA A 1 83  ? -10.540 39.075 88.922  1.00 14.94 ? 83   ALA A N     1 
ATOM   649  C CA    . ALA A 1 83  ? -9.322  39.855 89.125  1.00 15.08 ? 83   ALA A CA    1 
ATOM   650  C C     . ALA A 1 83  ? -9.100  41.007 88.147  1.00 14.83 ? 83   ALA A C     1 
ATOM   651  O O     . ALA A 1 83  ? -8.148  41.768 88.304  1.00 15.28 ? 83   ALA A O     1 
ATOM   652  C CB    . ALA A 1 83  ? -8.110  38.917 89.091  1.00 14.61 ? 83   ALA A CB    1 
ATOM   653  N N     . PHE A 1 84  ? -9.967  41.142 87.148  1.00 14.90 ? 84   PHE A N     1 
ATOM   654  C CA    . PHE A 1 84  ? -9.812  42.196 86.152  1.00 14.79 ? 84   PHE A CA    1 
ATOM   655  C C     . PHE A 1 84  ? -11.063 43.033 85.970  1.00 14.71 ? 84   PHE A C     1 
ATOM   656  O O     . PHE A 1 84  ? -11.022 44.084 85.335  1.00 15.33 ? 84   PHE A O     1 
ATOM   657  C CB    . PHE A 1 84  ? -9.435  41.591 84.794  1.00 14.80 ? 84   PHE A CB    1 
ATOM   658  C CG    . PHE A 1 84  ? -8.283  40.641 84.861  1.00 15.58 ? 84   PHE A CG    1 
ATOM   659  C CD1   . PHE A 1 84  ? -8.496  39.270 84.820  1.00 15.84 ? 84   PHE A CD1   1 
ATOM   660  C CD2   . PHE A 1 84  ? -6.984  41.116 85.010  1.00 15.50 ? 84   PHE A CD2   1 
ATOM   661  C CE1   . PHE A 1 84  ? -7.432  38.382 84.930  1.00 16.04 ? 84   PHE A CE1   1 
ATOM   662  C CE2   . PHE A 1 84  ? -5.915  40.238 85.121  1.00 16.06 ? 84   PHE A CE2   1 
ATOM   663  C CZ    . PHE A 1 84  ? -6.138  38.867 85.082  1.00 16.02 ? 84   PHE A CZ    1 
ATOM   664  N N     . SER A 1 85  ? -12.175 42.557 86.515  1.00 14.24 ? 85   SER A N     1 
ATOM   665  C CA    . SER A 1 85  ? -13.448 43.251 86.383  1.00 13.58 ? 85   SER A CA    1 
ATOM   666  C C     . SER A 1 85  ? -13.513 44.605 87.069  1.00 14.12 ? 85   SER A C     1 
ATOM   667  O O     . SER A 1 85  ? -12.953 44.810 88.143  1.00 13.93 ? 85   SER A O     1 
ATOM   668  C CB    . SER A 1 85  ? -14.586 42.384 86.919  1.00 12.78 ? 85   SER A CB    1 
ATOM   669  O OG    . SER A 1 85  ? -15.796 43.122 86.919  1.00 11.76 ? 85   SER A OG    1 
ATOM   670  N N     . ILE A 1 86  ? -14.232 45.524 86.446  1.00 14.36 ? 86   ILE A N     1 
ATOM   671  C CA    . ILE A 1 86  ? -14.397 46.856 86.997  1.00 16.19 ? 86   ILE A CA    1 
ATOM   672  C C     . ILE A 1 86  ? -15.153 46.773 88.333  1.00 16.56 ? 86   ILE A C     1 
ATOM   673  O O     . ILE A 1 86  ? -15.101 47.696 89.156  1.00 17.08 ? 86   ILE A O     1 
ATOM   674  C CB    . ILE A 1 86  ? -15.190 47.741 86.016  1.00 16.85 ? 86   ILE A CB    1 
ATOM   675  C CG1   . ILE A 1 86  ? -15.304 49.162 86.562  1.00 17.56 ? 86   ILE A CG1   1 
ATOM   676  C CG2   . ILE A 1 86  ? -16.576 47.139 85.788  1.00 17.13 ? 86   ILE A CG2   1 
ATOM   677  C CD1   . ILE A 1 86  ? -16.034 50.098 85.637  1.00 18.46 ? 86   ILE A CD1   1 
ATOM   678  N N     . SER A 1 87  ? -15.838 45.652 88.549  1.00 16.12 ? 87   SER A N     1 
ATOM   679  C CA    . SER A 1 87  ? -16.631 45.443 89.758  1.00 15.32 ? 87   SER A CA    1 
ATOM   680  C C     . SER A 1 87  ? -15.855 44.880 90.946  1.00 14.99 ? 87   SER A C     1 
ATOM   681  O O     . SER A 1 87  ? -16.353 44.881 92.068  1.00 15.10 ? 87   SER A O     1 
ATOM   682  C CB    . SER A 1 87  ? -17.799 44.513 89.438  1.00 14.69 ? 87   SER A CB    1 
ATOM   683  O OG    . SER A 1 87  ? -18.736 44.497 90.490  1.00 15.37 ? 87   SER A OG    1 
ATOM   684  N N     . GLY A 1 88  ? -14.640 44.405 90.693  1.00 15.62 ? 88   GLY A N     1 
ATOM   685  C CA    . GLY A 1 88  ? -13.828 43.821 91.743  1.00 16.24 ? 88   GLY A CA    1 
ATOM   686  C C     . GLY A 1 88  ? -12.695 44.688 92.251  1.00 17.27 ? 88   GLY A C     1 
ATOM   687  O O     . GLY A 1 88  ? -12.720 45.907 92.093  1.00 16.94 ? 88   GLY A O     1 
ATOM   688  N N     . LYS A 1 89  ? -11.697 44.046 92.857  1.00 17.97 ? 89   LYS A N     1 
ATOM   689  C CA    . LYS A 1 89  ? -10.546 44.739 93.426  1.00 19.14 ? 89   LYS A CA    1 
ATOM   690  C C     . LYS A 1 89  ? -9.390  44.955 92.461  1.00 19.26 ? 89   LYS A C     1 
ATOM   691  O O     . LYS A 1 89  ? -8.392  45.579 92.811  1.00 19.17 ? 89   LYS A O     1 
ATOM   692  C CB    . LYS A 1 89  ? -10.056 43.982 94.654  1.00 20.83 ? 89   LYS A CB    1 
ATOM   693  C CG    . LYS A 1 89  ? -11.062 43.997 95.794  1.00 22.50 ? 89   LYS A CG    1 
ATOM   694  C CD    . LYS A 1 89  ? -10.475 43.398 97.056  1.00 23.83 ? 89   LYS A CD    1 
ATOM   695  C CE    . LYS A 1 89  ? -11.267 43.876 98.264  1.00 24.87 ? 89   LYS A CE    1 
ATOM   696  N NZ    . LYS A 1 89  ? -10.635 43.462 99.550  1.00 26.46 ? 89   LYS A NZ    1 
ATOM   697  N N     . GLN A 1 90  ? -9.539  44.437 91.248  1.00 19.24 ? 90   GLN A N     1 
ATOM   698  C CA    . GLN A 1 90  ? -8.544  44.566 90.187  1.00 19.36 ? 90   GLN A CA    1 
ATOM   699  C C     . GLN A 1 90  ? -7.111  44.182 90.530  1.00 19.75 ? 90   GLN A C     1 
ATOM   700  O O     . GLN A 1 90  ? -6.172  44.829 90.064  1.00 19.15 ? 90   GLN A O     1 
ATOM   701  C CB    . GLN A 1 90  ? -8.549  45.990 89.635  1.00 19.54 ? 90   GLN A CB    1 
ATOM   702  C CG    . GLN A 1 90  ? -9.836  46.398 88.949  1.00 20.62 ? 90   GLN A CG    1 
ATOM   703  C CD    . GLN A 1 90  ? -9.705  47.720 88.211  1.00 21.63 ? 90   GLN A CD    1 
ATOM   704  O OE1   . GLN A 1 90  ? -9.080  47.796 87.143  1.00 22.31 ? 90   GLN A OE1   1 
ATOM   705  N NE2   . GLN A 1 90  ? -10.284 48.774 88.781  1.00 22.04 ? 90   GLN A NE2   1 
ATOM   706  N N     . LYS A 1 91  ? -6.923  43.128 91.319  1.00 20.20 ? 91   LYS A N     1 
ATOM   707  C CA    . LYS A 1 91  ? -5.566  42.721 91.661  1.00 21.41 ? 91   LYS A CA    1 
ATOM   708  C C     . LYS A 1 91  ? -4.863  42.069 90.474  1.00 21.34 ? 91   LYS A C     1 
ATOM   709  O O     . LYS A 1 91  ? -3.671  41.785 90.535  1.00 21.84 ? 91   LYS A O     1 
ATOM   710  C CB    . LYS A 1 91  ? -5.570  41.789 92.873  1.00 23.02 ? 91   LYS A CB    1 
ATOM   711  C CG    . LYS A 1 91  ? -6.070  42.482 94.127  1.00 24.79 ? 91   LYS A CG    1 
ATOM   712  C CD    . LYS A 1 91  ? -5.867  41.636 95.355  1.00 27.27 ? 91   LYS A CD    1 
ATOM   713  C CE    . LYS A 1 91  ? -6.286  42.394 96.610  1.00 29.27 ? 91   LYS A CE    1 
ATOM   714  N NZ    . LYS A 1 91  ? -5.880  41.688 97.859  1.00 30.74 ? 91   LYS A NZ    1 
ATOM   715  N N     . GLY A 1 92  ? -5.603  41.846 89.390  1.00 20.58 ? 92   GLY A N     1 
ATOM   716  C CA    . GLY A 1 92  ? -5.023  41.258 88.194  1.00 19.56 ? 92   GLY A CA    1 
ATOM   717  C C     . GLY A 1 92  ? -4.181  40.012 88.397  1.00 19.39 ? 92   GLY A C     1 
ATOM   718  O O     . GLY A 1 92  ? -4.602  39.068 89.066  1.00 19.01 ? 92   GLY A O     1 
ATOM   719  N N     . PHE A 1 93  ? -2.984  40.002 87.816  1.00 19.04 ? 93   PHE A N     1 
ATOM   720  C CA    . PHE A 1 93  ? -2.102  38.847 87.934  1.00 19.97 ? 93   PHE A CA    1 
ATOM   721  C C     . PHE A 1 93  ? -1.657  38.573 89.367  1.00 21.01 ? 93   PHE A C     1 
ATOM   722  O O     . PHE A 1 93  ? -1.132  37.501 89.654  1.00 20.94 ? 93   PHE A O     1 
ATOM   723  C CB    . PHE A 1 93  ? -0.879  39.017 87.032  1.00 19.16 ? 93   PHE A CB    1 
ATOM   724  C CG    . PHE A 1 93  ? -1.213  39.117 85.571  1.00 18.99 ? 93   PHE A CG    1 
ATOM   725  C CD1   . PHE A 1 93  ? -2.051  38.183 84.969  1.00 19.16 ? 93   PHE A CD1   1 
ATOM   726  C CD2   . PHE A 1 93  ? -0.681  40.136 84.791  1.00 18.83 ? 93   PHE A CD2   1 
ATOM   727  C CE1   . PHE A 1 93  ? -2.357  38.265 83.607  1.00 18.74 ? 93   PHE A CE1   1 
ATOM   728  C CE2   . PHE A 1 93  ? -0.979  40.225 83.429  1.00 18.72 ? 93   PHE A CE2   1 
ATOM   729  C CZ    . PHE A 1 93  ? -1.820  39.286 82.838  1.00 18.67 ? 93   PHE A CZ    1 
ATOM   730  N N     . GLU A 1 94  ? -1.865  39.541 90.259  1.00 22.31 ? 94   GLU A N     1 
ATOM   731  C CA    . GLU A 1 94  ? -1.512  39.397 91.675  1.00 24.05 ? 94   GLU A CA    1 
ATOM   732  C C     . GLU A 1 94  ? -2.525  38.496 92.369  1.00 23.45 ? 94   GLU A C     1 
ATOM   733  O O     . GLU A 1 94  ? -2.289  38.007 93.469  1.00 23.40 ? 94   GLU A O     1 
ATOM   734  C CB    . GLU A 1 94  ? -1.550  40.749 92.382  1.00 26.60 ? 94   GLU A CB    1 
ATOM   735  C CG    . GLU A 1 94  ? -0.529  41.746 91.916  1.00 30.28 ? 94   GLU A CG    1 
ATOM   736  C CD    . GLU A 1 94  ? 0.852   41.372 92.371  1.00 32.28 ? 94   GLU A CD    1 
ATOM   737  O OE1   . GLU A 1 94  ? 1.426   40.425 91.786  1.00 33.27 ? 94   GLU A OE1   1 
ATOM   738  O OE2   . GLU A 1 94  ? 1.350   42.015 93.324  1.00 33.71 ? 94   GLU A OE2   1 
ATOM   739  N N     . ASP A 1 95  ? -3.666  38.313 91.719  1.00 22.84 ? 95   ASP A N     1 
ATOM   740  C CA    . ASP A 1 95  ? -4.754  37.501 92.243  1.00 21.93 ? 95   ASP A CA    1 
ATOM   741  C C     . ASP A 1 95  ? -4.531  36.032 91.887  1.00 21.73 ? 95   ASP A C     1 
ATOM   742  O O     . ASP A 1 95  ? -4.129  35.719 90.767  1.00 20.84 ? 95   ASP A O     1 
ATOM   743  C CB    . ASP A 1 95  ? -6.068  37.996 91.635  1.00 21.14 ? 95   ASP A CB    1 
ATOM   744  C CG    . ASP A 1 95  ? -7.282  37.503 92.379  1.00 20.73 ? 95   ASP A CG    1 
ATOM   745  O OD1   . ASP A 1 95  ? -7.469  36.275 92.490  1.00 21.01 ? 95   ASP A OD1   1 
ATOM   746  O OD2   . ASP A 1 95  ? -8.056  38.355 92.852  1.00 20.23 ? 95   ASP A OD2   1 
ATOM   747  N N     . SER A 1 96  ? -4.789  35.138 92.841  1.00 22.34 ? 96   SER A N     1 
ATOM   748  C CA    . SER A 1 96  ? -4.629  33.701 92.613  1.00 22.95 ? 96   SER A CA    1 
ATOM   749  C C     . SER A 1 96  ? -5.565  33.227 91.500  1.00 22.38 ? 96   SER A C     1 
ATOM   750  O O     . SER A 1 96  ? -5.346  32.181 90.882  1.00 23.76 ? 96   SER A O     1 
ATOM   751  C CB    . SER A 1 96  ? -4.916  32.919 93.902  1.00 23.44 ? 96   SER A CB    1 
ATOM   752  O OG    . SER A 1 96  ? -6.221  33.176 94.397  1.00 24.88 ? 96   SER A OG    1 
ATOM   753  N N     . ARG A 1 97  ? -6.608  34.011 91.250  1.00 20.71 ? 97   ARG A N     1 
ATOM   754  C CA    . ARG A 1 97  ? -7.579  33.698 90.212  1.00 18.89 ? 97   ARG A CA    1 
ATOM   755  C C     . ARG A 1 97  ? -7.238  34.482 88.948  1.00 18.41 ? 97   ARG A C     1 
ATOM   756  O O     . ARG A 1 97  ? -7.917  34.353 87.932  1.00 17.44 ? 97   ARG A O     1 
ATOM   757  C CB    . ARG A 1 97  ? -8.991  34.083 90.676  1.00 17.82 ? 97   ARG A CB    1 
ATOM   758  C CG    . ARG A 1 97  ? -9.453  33.406 91.959  1.00 16.95 ? 97   ARG A CG    1 
ATOM   759  C CD    . ARG A 1 97  ? -10.649 34.144 92.538  1.00 16.12 ? 97   ARG A CD    1 
ATOM   760  N NE    . ARG A 1 97  ? -10.313 35.541 92.810  1.00 15.41 ? 97   ARG A NE    1 
ATOM   761  C CZ    . ARG A 1 97  ? -11.192 36.483 93.133  1.00 14.57 ? 97   ARG A CZ    1 
ATOM   762  N NH1   . ARG A 1 97  ? -12.479 36.191 93.230  1.00 13.87 ? 97   ARG A NH1   1 
ATOM   763  N NH2   . ARG A 1 97  ? -10.782 37.726 93.346  1.00 13.24 ? 97   ARG A NH2   1 
ATOM   764  N N     . GLY A 1 98  ? -6.180  35.289 89.006  1.00 18.05 ? 98   GLY A N     1 
ATOM   765  C CA    . GLY A 1 98  ? -5.821  36.088 87.847  1.00 17.57 ? 98   GLY A CA    1 
ATOM   766  C C     . GLY A 1 98  ? -4.644  35.616 87.024  1.00 18.13 ? 98   GLY A C     1 
ATOM   767  O O     . GLY A 1 98  ? -4.207  36.330 86.125  1.00 19.35 ? 98   GLY A O     1 
ATOM   768  N N     . THR A 1 99  ? -4.135  34.420 87.309  1.00 17.98 ? 99   THR A N     1 
ATOM   769  C CA    . THR A 1 99  ? -2.985  33.892 86.581  1.00 17.82 ? 99   THR A CA    1 
ATOM   770  C C     . THR A 1 99  ? -3.319  32.723 85.664  1.00 17.75 ? 99   THR A C     1 
ATOM   771  O O     . THR A 1 99  ? -2.413  32.045 85.174  1.00 18.21 ? 99   THR A O     1 
ATOM   772  C CB    . THR A 1 99  ? -1.892  33.403 87.547  1.00 18.40 ? 99   THR A CB    1 
ATOM   773  O OG1   . THR A 1 99  ? -2.414  32.347 88.361  1.00 19.36 ? 99   THR A OG1   1 
ATOM   774  C CG2   . THR A 1 99  ? -1.419  34.533 88.442  1.00 18.80 ? 99   THR A CG2   1 
ATOM   775  N N     . LEU A 1 100 ? -4.604  32.479 85.430  1.00 16.27 ? 100  LEU A N     1 
ATOM   776  C CA    . LEU A 1 100 ? -5.000  31.361 84.585  1.00 15.47 ? 100  LEU A CA    1 
ATOM   777  C C     . LEU A 1 100 ? -4.585  31.537 83.133  1.00 14.69 ? 100  LEU A C     1 
ATOM   778  O O     . LEU A 1 100 ? -4.416  30.557 82.411  1.00 14.76 ? 100  LEU A O     1 
ATOM   779  C CB    . LEU A 1 100 ? -6.513  31.121 84.677  1.00 14.92 ? 100  LEU A CB    1 
ATOM   780  C CG    . LEU A 1 100 ? -7.061  30.455 85.945  1.00 15.12 ? 100  LEU A CG    1 
ATOM   781  C CD1   . LEU A 1 100 ? -6.322  29.146 86.213  1.00 14.62 ? 100  LEU A CD1   1 
ATOM   782  C CD2   . LEU A 1 100 ? -6.912  31.396 87.125  1.00 14.98 ? 100  LEU A CD2   1 
ATOM   783  N N     . PHE A 1 101 ? -4.418  32.776 82.692  1.00 14.67 ? 101  PHE A N     1 
ATOM   784  C CA    . PHE A 1 101 ? -4.006  32.990 81.314  1.00 14.78 ? 101  PHE A CA    1 
ATOM   785  C C     . PHE A 1 101 ? -2.675  32.292 81.023  1.00 15.32 ? 101  PHE A C     1 
ATOM   786  O O     . PHE A 1 101 ? -2.428  31.835 79.902  1.00 14.74 ? 101  PHE A O     1 
ATOM   787  C CB    . PHE A 1 101 ? -3.837  34.475 80.999  1.00 13.68 ? 101  PHE A CB    1 
ATOM   788  C CG    . PHE A 1 101 ? -3.104  34.718 79.712  1.00 13.28 ? 101  PHE A CG    1 
ATOM   789  C CD1   . PHE A 1 101 ? -3.696  34.405 78.495  1.00 13.73 ? 101  PHE A CD1   1 
ATOM   790  C CD2   . PHE A 1 101 ? -1.786  35.152 79.720  1.00 13.18 ? 101  PHE A CD2   1 
ATOM   791  C CE1   . PHE A 1 101 ? -2.980  34.511 77.296  1.00 13.70 ? 101  PHE A CE1   1 
ATOM   792  C CE2   . PHE A 1 101 ? -1.062  35.262 78.530  1.00 13.86 ? 101  PHE A CE2   1 
ATOM   793  C CZ    . PHE A 1 101 ? -1.664  34.936 77.314  1.00 13.64 ? 101  PHE A CZ    1 
ATOM   794  N N     . PHE A 1 102 ? -1.810  32.225 82.028  1.00 14.89 ? 102  PHE A N     1 
ATOM   795  C CA    . PHE A 1 102 ? -0.508  31.608 81.839  1.00 15.65 ? 102  PHE A CA    1 
ATOM   796  C C     . PHE A 1 102 ? -0.618  30.102 81.702  1.00 16.43 ? 102  PHE A C     1 
ATOM   797  O O     . PHE A 1 102 ? 0.266   29.462 81.135  1.00 17.28 ? 102  PHE A O     1 
ATOM   798  C CB    . PHE A 1 102 ? 0.426   32.034 82.972  1.00 15.00 ? 102  PHE A CB    1 
ATOM   799  C CG    . PHE A 1 102 ? 0.575   33.531 83.074  1.00 15.08 ? 102  PHE A CG    1 
ATOM   800  C CD1   . PHE A 1 102 ? 1.160   34.255 82.038  1.00 14.72 ? 102  PHE A CD1   1 
ATOM   801  C CD2   . PHE A 1 102 ? 0.037   34.229 84.152  1.00 14.64 ? 102  PHE A CD2   1 
ATOM   802  C CE1   . PHE A 1 102 ? 1.196   35.646 82.071  1.00 14.76 ? 102  PHE A CE1   1 
ATOM   803  C CE2   . PHE A 1 102 ? 0.072   35.619 84.189  1.00 14.47 ? 102  PHE A CE2   1 
ATOM   804  C CZ    . PHE A 1 102 ? 0.647   36.327 83.149  1.00 14.11 ? 102  PHE A CZ    1 
ATOM   805  N N     . ASP A 1 103 ? -1.718  29.536 82.195  1.00 17.02 ? 103  ASP A N     1 
ATOM   806  C CA    . ASP A 1 103 ? -1.953  28.103 82.052  1.00 16.28 ? 103  ASP A CA    1 
ATOM   807  C C     . ASP A 1 103 ? -2.350  27.872 80.603  1.00 15.56 ? 103  ASP A C     1 
ATOM   808  O O     . ASP A 1 103 ? -2.030  26.839 80.017  1.00 16.21 ? 103  ASP A O     1 
ATOM   809  C CB    . ASP A 1 103 ? -3.079  27.658 82.966  1.00 16.66 ? 103  ASP A CB    1 
ATOM   810  C CG    . ASP A 1 103 ? -2.659  27.622 84.401  1.00 17.22 ? 103  ASP A CG    1 
ATOM   811  O OD1   . ASP A 1 103 ? -2.053  26.612 84.812  1.00 17.10 ? 103  ASP A OD1   1 
ATOM   812  O OD2   . ASP A 1 103 ? -2.921  28.613 85.112  1.00 17.42 ? 103  ASP A OD2   1 
ATOM   813  N N     . ILE A 1 104 ? -3.058  28.848 80.038  1.00 14.51 ? 104  ILE A N     1 
ATOM   814  C CA    . ILE A 1 104 ? -3.484  28.795 78.648  1.00 13.57 ? 104  ILE A CA    1 
ATOM   815  C C     . ILE A 1 104 ? -2.232  28.823 77.774  1.00 13.71 ? 104  ILE A C     1 
ATOM   816  O O     . ILE A 1 104 ? -2.093  28.030 76.842  1.00 13.67 ? 104  ILE A O     1 
ATOM   817  C CB    . ILE A 1 104 ? -4.372  30.016 78.283  1.00 13.45 ? 104  ILE A CB    1 
ATOM   818  C CG1   . ILE A 1 104 ? -5.746  29.882 78.941  1.00 12.30 ? 104  ILE A CG1   1 
ATOM   819  C CG2   . ILE A 1 104 ? -4.506  30.137 76.758  1.00 12.67 ? 104  ILE A CG2   1 
ATOM   820  C CD1   . ILE A 1 104 ? -6.634  31.081 78.715  1.00 11.98 ? 104  ILE A CD1   1 
ATOM   821  N N     . ALA A 1 105 ? -1.319  29.738 78.091  1.00 13.84 ? 105  ALA A N     1 
ATOM   822  C CA    . ALA A 1 105 ? -0.078  29.877 77.338  1.00 14.48 ? 105  ALA A CA    1 
ATOM   823  C C     . ALA A 1 105 ? 0.709   28.575 77.368  1.00 14.70 ? 105  ALA A C     1 
ATOM   824  O O     . ALA A 1 105 ? 1.281   28.166 76.366  1.00 15.18 ? 105  ALA A O     1 
ATOM   825  C CB    . ALA A 1 105 ? 0.764   31.016 77.917  1.00 14.41 ? 105  ALA A CB    1 
ATOM   826  N N     . ARG A 1 106 ? 0.731   27.938 78.531  1.00 15.33 ? 106  ARG A N     1 
ATOM   827  C CA    . ARG A 1 106 ? 1.422   26.672 78.730  1.00 16.27 ? 106  ARG A CA    1 
ATOM   828  C C     . ARG A 1 106 ? 0.854   25.595 77.808  1.00 17.08 ? 106  ARG A C     1 
ATOM   829  O O     . ARG A 1 106 ? 1.595   24.811 77.219  1.00 17.56 ? 106  ARG A O     1 
ATOM   830  C CB    . ARG A 1 106 ? 1.281   26.251 80.197  1.00 16.51 ? 106  ARG A CB    1 
ATOM   831  C CG    . ARG A 1 106 ? 1.701   24.822 80.513  1.00 17.20 ? 106  ARG A CG    1 
ATOM   832  C CD    . ARG A 1 106 ? 1.799   24.598 82.026  1.00 16.55 ? 106  ARG A CD    1 
ATOM   833  N NE    . ARG A 1 106 ? 0.539   24.784 82.752  1.00 16.83 ? 106  ARG A NE    1 
ATOM   834  C CZ    . ARG A 1 106 ? -0.434  23.879 82.831  1.00 16.49 ? 106  ARG A CZ    1 
ATOM   835  N NH1   . ARG A 1 106 ? -0.309  22.707 82.222  1.00 16.50 ? 106  ARG A NH1   1 
ATOM   836  N NH2   . ARG A 1 106 ? -1.526  24.132 83.545  1.00 16.33 ? 106  ARG A NH2   1 
ATOM   837  N N     . ILE A 1 107 ? -0.467  25.565 77.680  1.00 17.32 ? 107  ILE A N     1 
ATOM   838  C CA    . ILE A 1 107 ? -1.126  24.591 76.828  1.00 17.06 ? 107  ILE A CA    1 
ATOM   839  C C     . ILE A 1 107 ? -0.914  24.927 75.359  1.00 17.63 ? 107  ILE A C     1 
ATOM   840  O O     . ILE A 1 107 ? -0.750  24.030 74.536  1.00 18.30 ? 107  ILE A O     1 
ATOM   841  C CB    . ILE A 1 107 ? -2.637  24.534 77.136  1.00 16.50 ? 107  ILE A CB    1 
ATOM   842  C CG1   . ILE A 1 107 ? -2.838  24.075 78.587  1.00 16.32 ? 107  ILE A CG1   1 
ATOM   843  C CG2   . ILE A 1 107 ? -3.341  23.603 76.153  1.00 15.78 ? 107  ILE A CG2   1 
ATOM   844  C CD1   . ILE A 1 107 ? -4.267  24.190 79.087  1.00 16.33 ? 107  ILE A CD1   1 
ATOM   845  N N     . VAL A 1 108 ? -0.916  26.216 75.029  1.00 18.69 ? 108  VAL A N     1 
ATOM   846  C CA    . VAL A 1 108 ? -0.708  26.644 73.645  1.00 19.48 ? 108  VAL A CA    1 
ATOM   847  C C     . VAL A 1 108 ? 0.715   26.300 73.207  1.00 20.15 ? 108  VAL A C     1 
ATOM   848  O O     . VAL A 1 108 ? 0.940   25.759 72.125  1.00 19.10 ? 108  VAL A O     1 
ATOM   849  C CB    . VAL A 1 108 ? -0.931  28.173 73.476  1.00 19.09 ? 108  VAL A CB    1 
ATOM   850  C CG1   . VAL A 1 108 ? -0.536  28.604 72.068  1.00 18.71 ? 108  VAL A CG1   1 
ATOM   851  C CG2   . VAL A 1 108 ? -2.397  28.521 73.723  1.00 19.06 ? 108  VAL A CG2   1 
ATOM   852  N N     . ARG A 1 109 ? 1.667   26.618 74.072  1.00 21.73 ? 109  ARG A N     1 
ATOM   853  C CA    . ARG A 1 109 ? 3.080   26.362 73.829  1.00 23.73 ? 109  ARG A CA    1 
ATOM   854  C C     . ARG A 1 109 ? 3.302   24.883 73.490  1.00 23.51 ? 109  ARG A C     1 
ATOM   855  O O     . ARG A 1 109 ? 4.151   24.545 72.665  1.00 23.19 ? 109  ARG A O     1 
ATOM   856  C CB    . ARG A 1 109 ? 3.859   26.758 75.087  1.00 25.38 ? 109  ARG A CB    1 
ATOM   857  C CG    . ARG A 1 109 ? 5.370   26.777 74.992  1.00 28.33 ? 109  ARG A CG    1 
ATOM   858  C CD    . ARG A 1 109 ? 5.935   27.499 76.230  1.00 31.30 ? 109  ARG A CD    1 
ATOM   859  N NE    . ARG A 1 109 ? 5.461   28.890 76.329  1.00 34.09 ? 109  ARG A NE    1 
ATOM   860  C CZ    . ARG A 1 109 ? 4.859   29.436 77.393  1.00 34.93 ? 109  ARG A CZ    1 
ATOM   861  N NH1   . ARG A 1 109 ? 4.635   28.726 78.496  1.00 34.45 ? 109  ARG A NH1   1 
ATOM   862  N NH2   . ARG A 1 109 ? 4.468   30.708 77.350  1.00 35.51 ? 109  ARG A NH2   1 
ATOM   863  N N     . GLU A 1 110 ? 2.516   24.013 74.114  1.00 23.03 ? 110  GLU A N     1 
ATOM   864  C CA    . GLU A 1 110 ? 2.628   22.572 73.910  1.00 23.14 ? 110  GLU A CA    1 
ATOM   865  C C     . GLU A 1 110 ? 1.799   21.991 72.765  1.00 22.88 ? 110  GLU A C     1 
ATOM   866  O O     . GLU A 1 110 ? 2.305   21.196 71.970  1.00 23.38 ? 110  GLU A O     1 
ATOM   867  C CB    . GLU A 1 110 ? 2.259   21.846 75.203  1.00 24.09 ? 110  GLU A CB    1 
ATOM   868  C CG    . GLU A 1 110 ? 2.272   20.334 75.106  1.00 25.13 ? 110  GLU A CG    1 
ATOM   869  C CD    . GLU A 1 110 ? 3.648   19.788 74.801  1.00 25.72 ? 110  GLU A CD    1 
ATOM   870  O OE1   . GLU A 1 110 ? 4.599   20.138 75.528  1.00 26.03 ? 110  GLU A OE1   1 
ATOM   871  O OE2   . GLU A 1 110 ? 3.777   19.007 73.839  1.00 26.41 ? 110  GLU A OE2   1 
ATOM   872  N N     . LYS A 1 111 ? 0.530   22.380 72.676  1.00 21.73 ? 111  LYS A N     1 
ATOM   873  C CA    . LYS A 1 111 ? -0.348  21.849 71.640  1.00 20.37 ? 111  LYS A CA    1 
ATOM   874  C C     . LYS A 1 111 ? -0.383  22.643 70.337  1.00 20.15 ? 111  LYS A C     1 
ATOM   875  O O     . LYS A 1 111 ? -0.789  22.124 69.297  1.00 20.01 ? 111  LYS A O     1 
ATOM   876  C CB    . LYS A 1 111 ? -1.756  21.712 72.201  1.00 19.86 ? 111  LYS A CB    1 
ATOM   877  C CG    . LYS A 1 111 ? -1.810  20.907 73.489  1.00 19.41 ? 111  LYS A CG    1 
ATOM   878  C CD    . LYS A 1 111 ? -1.255  19.500 73.302  1.00 19.47 ? 111  LYS A CD    1 
ATOM   879  C CE    . LYS A 1 111 ? -2.001  18.749 72.211  1.00 20.46 ? 111  LYS A CE    1 
ATOM   880  N NZ    . LYS A 1 111 ? -1.560  17.329 72.098  1.00 20.74 ? 111  LYS A NZ    1 
ATOM   881  N N     . LYS A 1 112 ? 0.038   23.897 70.396  1.00 19.66 ? 112  LYS A N     1 
ATOM   882  C CA    . LYS A 1 112 ? 0.065   24.752 69.220  1.00 20.47 ? 112  LYS A CA    1 
ATOM   883  C C     . LYS A 1 112 ? -1.134  24.618 68.275  1.00 19.69 ? 112  LYS A C     1 
ATOM   884  O O     . LYS A 1 112 ? -0.995  24.189 67.125  1.00 18.63 ? 112  LYS A O     1 
ATOM   885  C CB    . LYS A 1 112 ? 1.368   24.523 68.441  1.00 22.24 ? 112  LYS A CB    1 
ATOM   886  C CG    . LYS A 1 112 ? 2.594   25.194 69.065  1.00 24.26 ? 112  LYS A CG    1 
ATOM   887  C CD    . LYS A 1 112 ? 2.416   26.715 69.112  1.00 25.86 ? 112  LYS A CD    1 
ATOM   888  C CE    . LYS A 1 112 ? 3.626   27.429 69.706  1.00 26.87 ? 112  LYS A CE    1 
ATOM   889  N NZ    . LYS A 1 112 ? 4.810   27.330 68.808  1.00 27.67 ? 112  LYS A NZ    1 
ATOM   890  N N     . PRO A 1 113 ? -2.337  24.980 68.752  1.00 18.59 ? 113  PRO A N     1 
ATOM   891  C CA    . PRO A 1 113 ? -3.520  24.884 67.892  1.00 17.60 ? 113  PRO A CA    1 
ATOM   892  C C     . PRO A 1 113 ? -3.449  25.956 66.801  1.00 16.74 ? 113  PRO A C     1 
ATOM   893  O O     . PRO A 1 113 ? -2.611  26.851 66.859  1.00 15.62 ? 113  PRO A O     1 
ATOM   894  C CB    . PRO A 1 113 ? -4.671  25.122 68.867  1.00 17.44 ? 113  PRO A CB    1 
ATOM   895  C CG    . PRO A 1 113 ? -4.068  26.072 69.857  1.00 17.42 ? 113  PRO A CG    1 
ATOM   896  C CD    . PRO A 1 113 ? -2.705  25.449 70.099  1.00 17.76 ? 113  PRO A CD    1 
ATOM   897  N N     . LYS A 1 114 ? -4.319  25.856 65.804  1.00 16.70 ? 114  LYS A N     1 
ATOM   898  C CA    . LYS A 1 114 ? -4.347  26.840 64.730  1.00 16.74 ? 114  LYS A CA    1 
ATOM   899  C C     . LYS A 1 114 ? -4.872  28.172 65.266  1.00 16.03 ? 114  LYS A C     1 
ATOM   900  O O     . LYS A 1 114 ? -4.386  29.245 64.894  1.00 15.07 ? 114  LYS A O     1 
ATOM   901  C CB    . LYS A 1 114 ? -5.277  26.385 63.601  1.00 17.81 ? 114  LYS A CB    1 
ATOM   902  C CG    . LYS A 1 114 ? -4.850  25.154 62.818  1.00 18.63 ? 114  LYS A CG    1 
ATOM   903  C CD    . LYS A 1 114 ? -5.795  24.971 61.624  1.00 19.68 ? 114  LYS A CD    1 
ATOM   904  C CE    . LYS A 1 114 ? -5.314  23.910 60.654  1.00 20.16 ? 114  LYS A CE    1 
ATOM   905  N NZ    . LYS A 1 114 ? -5.328  22.575 61.294  1.00 21.79 ? 114  LYS A NZ    1 
ATOM   906  N N     . VAL A 1 115 ? -5.870  28.091 66.146  1.00 15.43 ? 115  VAL A N     1 
ATOM   907  C CA    . VAL A 1 115 ? -6.501  29.290 66.701  1.00 14.33 ? 115  VAL A CA    1 
ATOM   908  C C     . VAL A 1 115 ? -6.685  29.265 68.219  1.00 14.06 ? 115  VAL A C     1 
ATOM   909  O O     . VAL A 1 115 ? -6.939  28.219 68.814  1.00 13.99 ? 115  VAL A O     1 
ATOM   910  C CB    . VAL A 1 115 ? -7.892  29.519 66.052  1.00 13.07 ? 115  VAL A CB    1 
ATOM   911  C CG1   . VAL A 1 115 ? -8.466  30.851 66.484  1.00 12.23 ? 115  VAL A CG1   1 
ATOM   912  C CG2   . VAL A 1 115 ? -7.778  29.453 64.534  1.00 12.63 ? 115  VAL A CG2   1 
ATOM   913  N N     . VAL A 1 116 ? -6.516  30.428 68.840  1.00 14.00 ? 116  VAL A N     1 
ATOM   914  C CA    . VAL A 1 116 ? -6.725  30.572 70.275  1.00 13.99 ? 116  VAL A CA    1 
ATOM   915  C C     . VAL A 1 116 ? -7.794  31.658 70.345  1.00 14.74 ? 116  VAL A C     1 
ATOM   916  O O     . VAL A 1 116 ? -7.601  32.777 69.850  1.00 15.01 ? 116  VAL A O     1 
ATOM   917  C CB    . VAL A 1 116 ? -5.444  31.006 71.030  1.00 13.07 ? 116  VAL A CB    1 
ATOM   918  C CG1   . VAL A 1 116 ? -5.750  31.144 72.531  1.00 12.49 ? 116  VAL A CG1   1 
ATOM   919  C CG2   . VAL A 1 116 ? -4.341  29.969 70.823  1.00 11.86 ? 116  VAL A CG2   1 
ATOM   920  N N     . PHE A 1 117 ? -8.932  31.295 70.932  1.00 14.29 ? 117  PHE A N     1 
ATOM   921  C CA    . PHE A 1 117 ? -10.097 32.165 71.049  1.00 13.77 ? 117  PHE A CA    1 
ATOM   922  C C     . PHE A 1 117 ? -10.391 32.386 72.535  1.00 14.27 ? 117  PHE A C     1 
ATOM   923  O O     . PHE A 1 117 ? -10.894 31.496 73.216  1.00 14.10 ? 117  PHE A O     1 
ATOM   924  C CB    . PHE A 1 117 ? -11.261 31.461 70.336  1.00 13.64 ? 117  PHE A CB    1 
ATOM   925  C CG    . PHE A 1 117 ? -12.535 32.262 70.247  1.00 14.05 ? 117  PHE A CG    1 
ATOM   926  C CD1   . PHE A 1 117 ? -12.595 33.591 70.662  1.00 13.65 ? 117  PHE A CD1   1 
ATOM   927  C CD2   . PHE A 1 117 ? -13.689 31.667 69.729  1.00 13.85 ? 117  PHE A CD2   1 
ATOM   928  C CE1   . PHE A 1 117 ? -13.788 34.315 70.562  1.00 13.74 ? 117  PHE A CE1   1 
ATOM   929  C CE2   . PHE A 1 117 ? -14.890 32.383 69.624  1.00 13.78 ? 117  PHE A CE2   1 
ATOM   930  C CZ    . PHE A 1 117 ? -14.937 33.706 70.041  1.00 13.78 ? 117  PHE A CZ    1 
ATOM   931  N N     . MET A 1 118 ? -10.071 33.579 73.031  1.00 14.68 ? 118  MET A N     1 
ATOM   932  C CA    . MET A 1 118 ? -10.272 33.909 74.441  1.00 13.91 ? 118  MET A CA    1 
ATOM   933  C C     . MET A 1 118 ? -11.280 35.020 74.652  1.00 13.96 ? 118  MET A C     1 
ATOM   934  O O     . MET A 1 118 ? -11.585 35.779 73.739  1.00 14.94 ? 118  MET A O     1 
ATOM   935  C CB    . MET A 1 118 ? -8.944  34.310 75.085  1.00 13.67 ? 118  MET A CB    1 
ATOM   936  C CG    . MET A 1 118 ? -7.895  33.199 75.105  1.00 13.99 ? 118  MET A CG    1 
ATOM   937  S SD    . MET A 1 118 ? -6.332  33.730 75.836  1.00 13.65 ? 118  MET A SD    1 
ATOM   938  C CE    . MET A 1 118 ? -5.630  34.637 74.471  1.00 13.25 ? 118  MET A CE    1 
ATOM   939  N N     . GLU A 1 119 ? -11.782 35.116 75.877  1.00 13.42 ? 119  GLU A N     1 
ATOM   940  C CA    . GLU A 1 119 ? -12.776 36.118 76.237  1.00 13.09 ? 119  GLU A CA    1 
ATOM   941  C C     . GLU A 1 119 ? -12.564 36.555 77.675  1.00 12.58 ? 119  GLU A C     1 
ATOM   942  O O     . GLU A 1 119 ? -12.165 35.756 78.515  1.00 12.41 ? 119  GLU A O     1 
ATOM   943  C CB    . GLU A 1 119 ? -14.183 35.508 76.068  1.00 13.28 ? 119  GLU A CB    1 
ATOM   944  C CG    . GLU A 1 119 ? -15.380 36.306 76.606  1.00 13.14 ? 119  GLU A CG    1 
ATOM   945  C CD    . GLU A 1 119 ? -15.653 36.083 78.090  1.00 13.67 ? 119  GLU A CD    1 
ATOM   946  O OE1   . GLU A 1 119 ? -15.236 35.048 78.648  1.00 13.88 ? 119  GLU A OE1   1 
ATOM   947  O OE2   . GLU A 1 119 ? -16.309 36.944 78.701  1.00 13.58 ? 119  GLU A OE2   1 
ATOM   948  N N     . ASN A 1 120 ? -12.791 37.835 77.942  1.00 13.02 ? 120  ASN A N     1 
ATOM   949  C CA    . ASN A 1 120 ? -12.703 38.360 79.299  1.00 13.85 ? 120  ASN A CA    1 
ATOM   950  C C     . ASN A 1 120 ? -13.502 39.657 79.349  1.00 14.06 ? 120  ASN A C     1 
ATOM   951  O O     . ASN A 1 120 ? -13.962 40.141 78.309  1.00 12.89 ? 120  ASN A O     1 
ATOM   952  C CB    . ASN A 1 120 ? -11.250 38.579 79.742  1.00 13.91 ? 120  ASN A CB    1 
ATOM   953  C CG    . ASN A 1 120 ? -11.052 38.276 81.231  1.00 14.88 ? 120  ASN A CG    1 
ATOM   954  O OD1   . ASN A 1 120 ? -11.556 38.993 82.092  1.00 15.54 ? 120  ASN A OD1   1 
ATOM   955  N ND2   . ASN A 1 120 ? -10.339 37.195 81.532  1.00 14.80 ? 120  ASN A ND2   1 
ATOM   956  N N     . VAL A 1 121 ? -13.689 40.204 80.547  1.00 14.04 ? 121  VAL A N     1 
ATOM   957  C CA    . VAL A 1 121 ? -14.476 41.424 80.704  1.00 14.71 ? 121  VAL A CA    1 
ATOM   958  C C     . VAL A 1 121 ? -13.821 42.664 80.093  1.00 15.55 ? 121  VAL A C     1 
ATOM   959  O O     . VAL A 1 121 ? -12.603 42.717 79.914  1.00 15.42 ? 121  VAL A O     1 
ATOM   960  C CB    . VAL A 1 121 ? -14.824 41.667 82.201  1.00 13.97 ? 121  VAL A CB    1 
ATOM   961  C CG1   . VAL A 1 121 ? -15.646 40.498 82.721  1.00 14.76 ? 121  VAL A CG1   1 
ATOM   962  C CG2   . VAL A 1 121 ? -13.562 41.815 83.032  1.00 13.78 ? 121  VAL A CG2   1 
ATOM   963  N N     . LYS A 1 122 ? -14.648 43.653 79.762  1.00 16.45 ? 122  LYS A N     1 
ATOM   964  C CA    . LYS A 1 122 ? -14.190 44.900 79.145  1.00 17.56 ? 122  LYS A CA    1 
ATOM   965  C C     . LYS A 1 122 ? -12.978 45.552 79.818  1.00 17.52 ? 122  LYS A C     1 
ATOM   966  O O     . LYS A 1 122 ? -12.039 45.968 79.131  1.00 17.81 ? 122  LYS A O     1 
ATOM   967  C CB    . LYS A 1 122 ? -15.345 45.908 79.104  1.00 17.85 ? 122  LYS A CB    1 
ATOM   968  C CG    . LYS A 1 122 ? -14.990 47.261 78.495  1.00 19.24 ? 122  LYS A CG    1 
ATOM   969  C CD    . LYS A 1 122 ? -16.136 48.254 78.674  1.00 20.15 ? 122  LYS A CD    1 
ATOM   970  C CE    . LYS A 1 122 ? -15.886 49.550 77.921  1.00 20.84 ? 122  LYS A CE    1 
ATOM   971  N NZ    . LYS A 1 122 ? -17.047 50.479 78.028  1.00 21.65 ? 122  LYS A NZ    1 
ATOM   972  N N     . ASN A 1 123 ? -13.005 45.641 81.148  1.00 16.61 ? 123  ASN A N     1 
ATOM   973  C CA    . ASN A 1 123 ? -11.923 46.259 81.916  1.00 16.75 ? 123  ASN A CA    1 
ATOM   974  C C     . ASN A 1 123 ? -10.587 45.555 81.730  1.00 16.49 ? 123  ASN A C     1 
ATOM   975  O O     . ASN A 1 123 ? -9.541  46.112 82.046  1.00 16.90 ? 123  ASN A O     1 
ATOM   976  C CB    . ASN A 1 123 ? -12.265 46.285 83.409  1.00 16.18 ? 123  ASN A CB    1 
ATOM   977  C CG    . ASN A 1 123 ? -11.397 47.243 84.195  1.00 16.65 ? 123  ASN A CG    1 
ATOM   978  O OD1   . ASN A 1 123 ? -11.387 48.439 83.922  1.00 17.20 ? 123  ASN A OD1   1 
ATOM   979  N ND2   . ASN A 1 123 ? -10.670 46.725 85.182  1.00 15.44 ? 123  ASN A ND2   1 
ATOM   980  N N     . PHE A 1 124 ? -10.621 44.322 81.244  1.00 16.58 ? 124  PHE A N     1 
ATOM   981  C CA    . PHE A 1 124 ? -9.387  43.583 81.011  1.00 16.68 ? 124  PHE A CA    1 
ATOM   982  C C     . PHE A 1 124 ? -8.553  44.359 79.984  1.00 17.11 ? 124  PHE A C     1 
ATOM   983  O O     . PHE A 1 124 ? -7.324  44.377 80.051  1.00 16.75 ? 124  PHE A O     1 
ATOM   984  C CB    . PHE A 1 124 ? -9.711  42.173 80.481  1.00 15.67 ? 124  PHE A CB    1 
ATOM   985  C CG    . PHE A 1 124 ? -8.507  41.270 80.352  1.00 14.78 ? 124  PHE A CG    1 
ATOM   986  C CD1   . PHE A 1 124 ? -7.707  41.307 79.213  1.00 14.32 ? 124  PHE A CD1   1 
ATOM   987  C CD2   . PHE A 1 124 ? -8.163  40.400 81.383  1.00 14.37 ? 124  PHE A CD2   1 
ATOM   988  C CE1   . PHE A 1 124 ? -6.577  40.489 79.105  1.00 14.37 ? 124  PHE A CE1   1 
ATOM   989  C CE2   . PHE A 1 124 ? -7.036  39.579 81.289  1.00 14.42 ? 124  PHE A CE2   1 
ATOM   990  C CZ    . PHE A 1 124 ? -6.241  39.622 80.147  1.00 14.07 ? 124  PHE A CZ    1 
ATOM   991  N N     . ALA A 1 125 ? -9.235  45.017 79.048  1.00 17.66 ? 125  ALA A N     1 
ATOM   992  C CA    . ALA A 1 125 ? -8.570  45.774 77.994  1.00 18.13 ? 125  ALA A CA    1 
ATOM   993  C C     . ALA A 1 125 ? -7.793  47.007 78.469  1.00 18.72 ? 125  ALA A C     1 
ATOM   994  O O     . ALA A 1 125 ? -6.842  47.429 77.813  1.00 19.47 ? 125  ALA A O     1 
ATOM   995  C CB    . ALA A 1 125 ? -9.586  46.181 76.939  1.00 17.99 ? 125  ALA A CB    1 
ATOM   996  N N     . SER A 1 126 ? -8.182  47.588 79.599  1.00 18.51 ? 126  SER A N     1 
ATOM   997  C CA    . SER A 1 126 ? -7.483  48.763 80.090  1.00 18.25 ? 126  SER A CA    1 
ATOM   998  C C     . SER A 1 126 ? -6.847  48.581 81.466  1.00 18.02 ? 126  SER A C     1 
ATOM   999  O O     . SER A 1 126 ? -6.136  49.459 81.947  1.00 18.87 ? 126  SER A O     1 
ATOM   1000 C CB    . SER A 1 126 ? -8.431  49.963 80.097  1.00 19.20 ? 126  SER A CB    1 
ATOM   1001 O OG    . SER A 1 126 ? -9.592  49.696 80.852  1.00 20.06 ? 126  SER A OG    1 
ATOM   1002 N N     . HIS A 1 127 ? -7.087  47.433 82.086  1.00 17.03 ? 127  HIS A N     1 
ATOM   1003 C CA    . HIS A 1 127 ? -6.538  47.124 83.402  1.00 16.45 ? 127  HIS A CA    1 
ATOM   1004 C C     . HIS A 1 127 ? -5.025  47.352 83.487  1.00 16.96 ? 127  HIS A C     1 
ATOM   1005 O O     . HIS A 1 127 ? -4.280  46.993 82.576  1.00 17.15 ? 127  HIS A O     1 
ATOM   1006 C CB    . HIS A 1 127 ? -6.875  45.667 83.764  1.00 15.79 ? 127  HIS A CB    1 
ATOM   1007 C CG    . HIS A 1 127 ? -6.321  45.220 85.084  1.00 15.83 ? 127  HIS A CG    1 
ATOM   1008 N ND1   . HIS A 1 127 ? -5.155  44.494 85.196  1.00 16.19 ? 127  HIS A ND1   1 
ATOM   1009 C CD2   . HIS A 1 127 ? -6.767  45.411 86.348  1.00 15.44 ? 127  HIS A CD2   1 
ATOM   1010 C CE1   . HIS A 1 127 ? -4.907  44.255 86.472  1.00 16.32 ? 127  HIS A CE1   1 
ATOM   1011 N NE2   . HIS A 1 127 ? -5.871  44.801 87.192  1.00 16.10 ? 127  HIS A NE2   1 
ATOM   1012 N N     . ASP A 1 128 ? -4.580  47.958 84.586  1.00 17.19 ? 128  ASP A N     1 
ATOM   1013 C CA    . ASP A 1 128 ? -3.163  48.216 84.812  1.00 18.36 ? 128  ASP A CA    1 
ATOM   1014 C C     . ASP A 1 128 ? -2.572  48.987 83.634  1.00 19.55 ? 128  ASP A C     1 
ATOM   1015 O O     . ASP A 1 128 ? -1.571  48.580 83.042  1.00 19.18 ? 128  ASP A O     1 
ATOM   1016 C CB    . ASP A 1 128 ? -2.426  46.881 85.034  1.00 18.57 ? 128  ASP A CB    1 
ATOM   1017 C CG    . ASP A 1 128 ? -0.947  47.059 85.378  1.00 18.92 ? 128  ASP A CG    1 
ATOM   1018 O OD1   . ASP A 1 128 ? -0.585  48.086 85.969  1.00 19.41 ? 128  ASP A OD1   1 
ATOM   1019 O OD2   . ASP A 1 128 ? -0.134  46.166 85.072  1.00 18.57 ? 128  ASP A OD2   1 
ATOM   1020 N N     . ASN A 1 129 ? -3.219  50.102 83.299  1.00 20.75 ? 129  ASN A N     1 
ATOM   1021 C CA    . ASN A 1 129 ? -2.793  50.971 82.205  1.00 21.86 ? 129  ASN A CA    1 
ATOM   1022 C C     . ASN A 1 129 ? -2.490  50.232 80.915  1.00 21.34 ? 129  ASN A C     1 
ATOM   1023 O O     . ASN A 1 129 ? -1.496  50.518 80.251  1.00 21.41 ? 129  ASN A O     1 
ATOM   1024 C CB    . ASN A 1 129 ? -1.561  51.782 82.622  1.00 23.46 ? 129  ASN A CB    1 
ATOM   1025 C CG    . ASN A 1 129 ? -1.844  52.695 83.790  1.00 25.09 ? 129  ASN A CG    1 
ATOM   1026 O OD1   . ASN A 1 129 ? -2.742  53.540 83.726  1.00 26.40 ? 129  ASN A OD1   1 
ATOM   1027 N ND2   . ASN A 1 129 ? -1.086  52.531 84.870  1.00 25.30 ? 129  ASN A ND2   1 
ATOM   1028 N N     . GLY A 1 130 ? -3.345  49.279 80.563  1.00 21.15 ? 130  GLY A N     1 
ATOM   1029 C CA    . GLY A 1 130 ? -3.146  48.535 79.334  1.00 20.23 ? 130  GLY A CA    1 
ATOM   1030 C C     . GLY A 1 130 ? -2.044  47.496 79.392  1.00 19.74 ? 130  GLY A C     1 
ATOM   1031 O O     . GLY A 1 130 ? -1.848  46.750 78.440  1.00 19.47 ? 130  GLY A O     1 
ATOM   1032 N N     . ASN A 1 131 ? -1.326  47.428 80.506  1.00 19.12 ? 131  ASN A N     1 
ATOM   1033 C CA    . ASN A 1 131 ? -0.241  46.461 80.639  1.00 19.38 ? 131  ASN A CA    1 
ATOM   1034 C C     . ASN A 1 131 ? -0.718  45.017 80.614  1.00 18.97 ? 131  ASN A C     1 
ATOM   1035 O O     . ASN A 1 131 ? -0.033  44.136 80.085  1.00 19.19 ? 131  ASN A O     1 
ATOM   1036 C CB    . ASN A 1 131 ? 0.550   46.730 81.921  1.00 20.33 ? 131  ASN A CB    1 
ATOM   1037 C CG    . ASN A 1 131 ? 1.437   47.950 81.798  1.00 21.13 ? 131  ASN A CG    1 
ATOM   1038 O OD1   . ASN A 1 131 ? 2.347   47.977 80.968  1.00 22.27 ? 131  ASN A OD1   1 
ATOM   1039 N ND2   . ASN A 1 131 ? 1.170   48.971 82.607  1.00 21.15 ? 131  ASN A ND2   1 
ATOM   1040 N N     . THR A 1 132 ? -1.895  44.779 81.177  1.00 18.23 ? 132  THR A N     1 
ATOM   1041 C CA    . THR A 1 132 ? -2.458  43.441 81.215  1.00 17.92 ? 132  THR A CA    1 
ATOM   1042 C C     . THR A 1 132 ? -2.760  42.908 79.817  1.00 17.80 ? 132  THR A C     1 
ATOM   1043 O O     . THR A 1 132 ? -2.411  41.768 79.495  1.00 17.70 ? 132  THR A O     1 
ATOM   1044 C CB    . THR A 1 132 ? -3.726  43.419 82.077  1.00 17.94 ? 132  THR A CB    1 
ATOM   1045 O OG1   . THR A 1 132 ? -3.382  43.803 83.413  1.00 17.83 ? 132  THR A OG1   1 
ATOM   1046 C CG2   . THR A 1 132 ? -4.334  42.022 82.104  1.00 17.97 ? 132  THR A CG2   1 
ATOM   1047 N N     . LEU A 1 133 ? -3.396  43.722 78.980  1.00 17.24 ? 133  LEU A N     1 
ATOM   1048 C CA    . LEU A 1 133 ? -3.700  43.281 77.629  1.00 17.29 ? 133  LEU A CA    1 
ATOM   1049 C C     . LEU A 1 133 ? -2.391  43.091 76.872  1.00 17.72 ? 133  LEU A C     1 
ATOM   1050 O O     . LEU A 1 133 ? -2.213  42.100 76.160  1.00 17.51 ? 133  LEU A O     1 
ATOM   1051 C CB    . LEU A 1 133 ? -4.583  44.301 76.906  1.00 16.86 ? 133  LEU A CB    1 
ATOM   1052 C CG    . LEU A 1 133 ? -4.978  43.945 75.465  1.00 16.94 ? 133  LEU A CG    1 
ATOM   1053 C CD1   . LEU A 1 133 ? -5.714  42.616 75.429  1.00 16.91 ? 133  LEU A CD1   1 
ATOM   1054 C CD2   . LEU A 1 133 ? -5.861  45.040 74.894  1.00 17.12 ? 133  LEU A CD2   1 
ATOM   1055 N N     . GLU A 1 134 ? -1.468  44.034 77.042  1.00 17.78 ? 134  GLU A N     1 
ATOM   1056 C CA    . GLU A 1 134 ? -0.167  43.976 76.372  1.00 19.16 ? 134  GLU A CA    1 
ATOM   1057 C C     . GLU A 1 134 ? 0.589   42.672 76.691  1.00 18.55 ? 134  GLU A C     1 
ATOM   1058 O O     . GLU A 1 134 ? 1.224   42.086 75.814  1.00 18.36 ? 134  GLU A O     1 
ATOM   1059 C CB    . GLU A 1 134 ? 0.672   45.196 76.775  1.00 20.82 ? 134  GLU A CB    1 
ATOM   1060 C CG    . GLU A 1 134 ? 1.998   45.348 76.045  1.00 24.11 ? 134  GLU A CG    1 
ATOM   1061 C CD    . GLU A 1 134 ? 1.853   45.728 74.568  1.00 26.52 ? 134  GLU A CD    1 
ATOM   1062 O OE1   . GLU A 1 134 ? 2.896   45.959 73.922  1.00 28.18 ? 134  GLU A OE1   1 
ATOM   1063 O OE2   . GLU A 1 134 ? 0.716   45.800 74.044  1.00 27.94 ? 134  GLU A OE2   1 
ATOM   1064 N N     . VAL A 1 135 ? 0.515   42.226 77.943  1.00 17.48 ? 135  VAL A N     1 
ATOM   1065 C CA    . VAL A 1 135 ? 1.170   40.993 78.360  1.00 17.27 ? 135  VAL A CA    1 
ATOM   1066 C C     . VAL A 1 135 ? 0.589   39.799 77.600  1.00 17.03 ? 135  VAL A C     1 
ATOM   1067 O O     . VAL A 1 135 ? 1.326   38.918 77.145  1.00 17.09 ? 135  VAL A O     1 
ATOM   1068 C CB    . VAL A 1 135 ? 1.013   40.762 79.884  1.00 16.60 ? 135  VAL A CB    1 
ATOM   1069 C CG1   . VAL A 1 135 ? 1.305   39.311 80.232  1.00 17.45 ? 135  VAL A CG1   1 
ATOM   1070 C CG2   . VAL A 1 135 ? 1.968   41.658 80.633  1.00 16.49 ? 135  VAL A CG2   1 
ATOM   1071 N N     . VAL A 1 136 ? -0.735  39.767 77.472  1.00 16.63 ? 136  VAL A N     1 
ATOM   1072 C CA    . VAL A 1 136 ? -1.387  38.687 76.740  1.00 16.00 ? 136  VAL A CA    1 
ATOM   1073 C C     . VAL A 1 136 ? -0.950  38.739 75.277  1.00 15.59 ? 136  VAL A C     1 
ATOM   1074 O O     . VAL A 1 136 ? -0.570  37.723 74.700  1.00 15.05 ? 136  VAL A O     1 
ATOM   1075 C CB    . VAL A 1 136 ? -2.925  38.794 76.812  1.00 15.64 ? 136  VAL A CB    1 
ATOM   1076 C CG1   . VAL A 1 136 ? -3.558  37.739 75.919  1.00 15.42 ? 136  VAL A CG1   1 
ATOM   1077 C CG2   . VAL A 1 136 ? -3.388  38.605 78.253  1.00 14.67 ? 136  VAL A CG2   1 
ATOM   1078 N N     . LYS A 1 137 ? -0.992  39.930 74.690  1.00 16.01 ? 137  LYS A N     1 
ATOM   1079 C CA    . LYS A 1 137 ? -0.591  40.117 73.299  1.00 16.80 ? 137  LYS A CA    1 
ATOM   1080 C C     . LYS A 1 137 ? 0.827   39.621 73.049  1.00 16.71 ? 137  LYS A C     1 
ATOM   1081 O O     . LYS A 1 137 ? 1.071   38.805 72.159  1.00 17.23 ? 137  LYS A O     1 
ATOM   1082 C CB    . LYS A 1 137 ? -0.666  41.596 72.911  1.00 17.01 ? 137  LYS A CB    1 
ATOM   1083 C CG    . LYS A 1 137 ? -0.214  41.858 71.488  1.00 18.13 ? 137  LYS A CG    1 
ATOM   1084 C CD    . LYS A 1 137 ? -0.218  43.329 71.161  1.00 19.65 ? 137  LYS A CD    1 
ATOM   1085 C CE    . LYS A 1 137 ? 0.194   43.561 69.712  1.00 20.64 ? 137  LYS A CE    1 
ATOM   1086 N NZ    . LYS A 1 137 ? 1.590   43.107 69.451  1.00 21.72 ? 137  LYS A NZ    1 
ATOM   1087 N N     . ASN A 1 138 ? 1.765   40.124 73.839  1.00 16.86 ? 138  ASN A N     1 
ATOM   1088 C CA    . ASN A 1 138 ? 3.153   39.732 73.684  1.00 16.77 ? 138  ASN A CA    1 
ATOM   1089 C C     . ASN A 1 138 ? 3.374   38.254 73.919  1.00 16.13 ? 138  ASN A C     1 
ATOM   1090 O O     . ASN A 1 138 ? 4.171   37.631 73.222  1.00 16.14 ? 138  ASN A O     1 
ATOM   1091 C CB    . ASN A 1 138 ? 4.037   40.557 74.614  1.00 17.46 ? 138  ASN A CB    1 
ATOM   1092 C CG    . ASN A 1 138 ? 4.098   42.000 74.197  1.00 17.92 ? 138  ASN A CG    1 
ATOM   1093 O OD1   . ASN A 1 138 ? 3.819   42.321 73.039  1.00 18.69 ? 138  ASN A OD1   1 
ATOM   1094 N ND2   . ASN A 1 138 ? 4.470   42.880 75.120  1.00 17.22 ? 138  ASN A ND2   1 
ATOM   1095 N N     . THR A 1 139 ? 2.673   37.691 74.896  1.00 15.31 ? 139  THR A N     1 
ATOM   1096 C CA    . THR A 1 139 ? 2.808   36.273 75.183  1.00 15.25 ? 139  THR A CA    1 
ATOM   1097 C C     . THR A 1 139 ? 2.400   35.474 73.939  1.00 16.04 ? 139  THR A C     1 
ATOM   1098 O O     . THR A 1 139 ? 3.120   34.566 73.510  1.00 15.35 ? 139  THR A O     1 
ATOM   1099 C CB    . THR A 1 139 ? 1.919   35.857 76.384  1.00 15.14 ? 139  THR A CB    1 
ATOM   1100 O OG1   . THR A 1 139 ? 2.347   36.548 77.565  1.00 14.23 ? 139  THR A OG1   1 
ATOM   1101 C CG2   . THR A 1 139 ? 2.004   34.359 76.624  1.00 14.66 ? 139  THR A CG2   1 
ATOM   1102 N N     . MET A 1 140 ? 1.252   35.820 73.358  1.00 16.52 ? 140  MET A N     1 
ATOM   1103 C CA    . MET A 1 140 ? 0.768   35.124 72.167  1.00 17.22 ? 140  MET A CA    1 
ATOM   1104 C C     . MET A 1 140 ? 1.735   35.319 71.002  1.00 17.90 ? 140  MET A C     1 
ATOM   1105 O O     . MET A 1 140 ? 2.015   34.378 70.265  1.00 17.79 ? 140  MET A O     1 
ATOM   1106 C CB    . MET A 1 140 ? -0.634  35.612 71.782  1.00 17.10 ? 140  MET A CB    1 
ATOM   1107 C CG    . MET A 1 140 ? -1.705  35.320 72.839  1.00 16.84 ? 140  MET A CG    1 
ATOM   1108 S SD    . MET A 1 140 ? -1.654  33.619 73.481  1.00 18.45 ? 140  MET A SD    1 
ATOM   1109 C CE    . MET A 1 140 ? -1.949  32.695 71.998  1.00 16.01 ? 140  MET A CE    1 
ATOM   1110 N N     . ASN A 1 141 ? 2.247   36.537 70.843  1.00 19.26 ? 141  ASN A N     1 
ATOM   1111 C CA    . ASN A 1 141 ? 3.207   36.823 69.781  1.00 20.60 ? 141  ASN A CA    1 
ATOM   1112 C C     . ASN A 1 141 ? 4.452   35.945 69.974  1.00 21.79 ? 141  ASN A C     1 
ATOM   1113 O O     . ASN A 1 141 ? 4.950   35.339 69.025  1.00 22.01 ? 141  ASN A O     1 
ATOM   1114 C CB    . ASN A 1 141 ? 3.598   38.302 69.811  1.00 20.76 ? 141  ASN A CB    1 
ATOM   1115 C CG    . ASN A 1 141 ? 2.515   39.208 69.257  1.00 21.00 ? 141  ASN A CG    1 
ATOM   1116 O OD1   . ASN A 1 141 ? 2.533   40.419 69.484  1.00 21.18 ? 141  ASN A OD1   1 
ATOM   1117 N ND2   . ASN A 1 141 ? 1.574   38.632 68.512  1.00 20.90 ? 141  ASN A ND2   1 
ATOM   1118 N N     . GLU A 1 142 ? 4.947   35.881 71.207  1.00 22.85 ? 142  GLU A N     1 
ATOM   1119 C CA    . GLU A 1 142 ? 6.114   35.065 71.521  1.00 24.32 ? 142  GLU A CA    1 
ATOM   1120 C C     . GLU A 1 142 ? 5.850   33.634 71.086  1.00 23.74 ? 142  GLU A C     1 
ATOM   1121 O O     . GLU A 1 142 ? 6.736   32.953 70.578  1.00 23.56 ? 142  GLU A O     1 
ATOM   1122 C CB    . GLU A 1 142 ? 6.391   35.056 73.027  1.00 26.69 ? 142  GLU A CB    1 
ATOM   1123 C CG    . GLU A 1 142 ? 7.149   36.248 73.589  1.00 30.13 ? 142  GLU A CG    1 
ATOM   1124 C CD    . GLU A 1 142 ? 7.149   36.258 75.127  1.00 32.45 ? 142  GLU A CD    1 
ATOM   1125 O OE1   . GLU A 1 142 ? 7.369   35.188 75.739  1.00 33.29 ? 142  GLU A OE1   1 
ATOM   1126 O OE2   . GLU A 1 142 ? 6.930   37.334 75.728  1.00 33.91 ? 142  GLU A OE2   1 
ATOM   1127 N N     . LEU A 1 143 ? 4.623   33.180 71.312  1.00 23.22 ? 143  LEU A N     1 
ATOM   1128 C CA    . LEU A 1 143 ? 4.224   31.823 70.965  1.00 21.98 ? 143  LEU A CA    1 
ATOM   1129 C C     . LEU A 1 143 ? 4.036   31.658 69.467  1.00 21.50 ? 143  LEU A C     1 
ATOM   1130 O O     . LEU A 1 143 ? 3.643   30.589 69.009  1.00 21.50 ? 143  LEU A O     1 
ATOM   1131 C CB    . LEU A 1 143 ? 2.930   31.453 71.698  1.00 21.97 ? 143  LEU A CB    1 
ATOM   1132 C CG    . LEU A 1 143 ? 3.041   31.301 73.217  1.00 21.98 ? 143  LEU A CG    1 
ATOM   1133 C CD1   . LEU A 1 143 ? 1.661   31.219 73.837  1.00 21.52 ? 143  LEU A CD1   1 
ATOM   1134 C CD2   . LEU A 1 143 ? 3.856   30.054 73.541  1.00 22.53 ? 143  LEU A CD2   1 
ATOM   1135 N N     . ASP A 1 144 ? 4.314   32.724 68.719  1.00 21.38 ? 144  ASP A N     1 
ATOM   1136 C CA    . ASP A 1 144 ? 4.206   32.733 67.260  1.00 21.43 ? 144  ASP A CA    1 
ATOM   1137 C C     . ASP A 1 144 ? 2.763   32.826 66.747  1.00 20.26 ? 144  ASP A C     1 
ATOM   1138 O O     . ASP A 1 144 ? 2.388   32.176 65.766  1.00 19.34 ? 144  ASP A O     1 
ATOM   1139 C CB    . ASP A 1 144 ? 4.906   31.495 66.679  1.00 23.12 ? 144  ASP A CB    1 
ATOM   1140 C CG    . ASP A 1 144 ? 5.256   31.658 65.212  1.00 24.38 ? 144  ASP A CG    1 
ATOM   1141 O OD1   . ASP A 1 144 ? 5.751   32.741 64.842  1.00 25.45 ? 144  ASP A OD1   1 
ATOM   1142 O OD2   . ASP A 1 144 ? 5.050   30.707 64.429  1.00 25.70 ? 144  ASP A OD2   1 
ATOM   1143 N N     . TYR A 1 145 ? 1.963   33.649 67.419  1.00 19.28 ? 145  TYR A N     1 
ATOM   1144 C CA    . TYR A 1 145 ? 0.569   33.860 67.044  1.00 18.89 ? 145  TYR A CA    1 
ATOM   1145 C C     . TYR A 1 145 ? 0.292   35.327 66.765  1.00 18.28 ? 145  TYR A C     1 
ATOM   1146 O O     . TYR A 1 145 ? 0.927   36.202 67.337  1.00 18.57 ? 145  TYR A O     1 
ATOM   1147 C CB    . TYR A 1 145 ? -0.383  33.423 68.167  1.00 18.46 ? 145  TYR A CB    1 
ATOM   1148 C CG    . TYR A 1 145 ? -0.517  31.933 68.336  1.00 18.48 ? 145  TYR A CG    1 
ATOM   1149 C CD1   . TYR A 1 145 ? 0.470   31.195 68.989  1.00 18.17 ? 145  TYR A CD1   1 
ATOM   1150 C CD2   . TYR A 1 145 ? -1.611  31.249 67.793  1.00 18.40 ? 145  TYR A CD2   1 
ATOM   1151 C CE1   . TYR A 1 145 ? 0.377   29.806 69.092  1.00 18.28 ? 145  TYR A CE1   1 
ATOM   1152 C CE2   . TYR A 1 145 ? -1.713  29.861 67.889  1.00 18.10 ? 145  TYR A CE2   1 
ATOM   1153 C CZ    . TYR A 1 145 ? -0.710  29.148 68.538  1.00 17.95 ? 145  TYR A CZ    1 
ATOM   1154 O OH    . TYR A 1 145 ? -0.781  27.780 68.606  1.00 17.54 ? 145  TYR A OH    1 
ATOM   1155 N N     . SER A 1 146 ? -0.659  35.589 65.879  1.00 17.85 ? 146  SER A N     1 
ATOM   1156 C CA    . SER A 1 146 ? -1.062  36.959 65.601  1.00 17.82 ? 146  SER A CA    1 
ATOM   1157 C C     . SER A 1 146 ? -2.019  37.272 66.753  1.00 17.90 ? 146  SER A C     1 
ATOM   1158 O O     . SER A 1 146 ? -2.473  36.358 67.451  1.00 18.32 ? 146  SER A O     1 
ATOM   1159 C CB    . SER A 1 146 ? -1.819  37.044 64.284  1.00 17.00 ? 146  SER A CB    1 
ATOM   1160 O OG    . SER A 1 146 ? -3.036  36.338 64.381  1.00 17.06 ? 146  SER A OG    1 
ATOM   1161 N N     . PHE A 1 147 ? -2.327  38.544 66.966  1.00 17.40 ? 147  PHE A N     1 
ATOM   1162 C CA    . PHE A 1 147 ? -3.227  38.904 68.054  1.00 17.01 ? 147  PHE A CA    1 
ATOM   1163 C C     . PHE A 1 147 ? -4.273  39.934 67.612  1.00 16.52 ? 147  PHE A C     1 
ATOM   1164 O O     . PHE A 1 147 ? -3.930  41.054 67.241  1.00 17.48 ? 147  PHE A O     1 
ATOM   1165 C CB    . PHE A 1 147 ? -2.414  39.445 69.237  1.00 16.38 ? 147  PHE A CB    1 
ATOM   1166 C CG    . PHE A 1 147 ? -3.217  39.632 70.496  1.00 16.11 ? 147  PHE A CG    1 
ATOM   1167 C CD1   . PHE A 1 147 ? -3.650  38.535 71.230  1.00 16.09 ? 147  PHE A CD1   1 
ATOM   1168 C CD2   . PHE A 1 147 ? -3.545  40.909 70.946  1.00 16.38 ? 147  PHE A CD2   1 
ATOM   1169 C CE1   . PHE A 1 147 ? -4.396  38.703 72.395  1.00 15.85 ? 147  PHE A CE1   1 
ATOM   1170 C CE2   . PHE A 1 147 ? -4.292  41.093 72.111  1.00 16.22 ? 147  PHE A CE2   1 
ATOM   1171 C CZ    . PHE A 1 147 ? -4.717  39.988 72.836  1.00 16.26 ? 147  PHE A CZ    1 
ATOM   1172 N N     . HIS A 1 148 ? -5.545  39.531 67.633  1.00 16.36 ? 148  HIS A N     1 
ATOM   1173 C CA    . HIS A 1 148 ? -6.667  40.399 67.273  1.00 15.84 ? 148  HIS A CA    1 
ATOM   1174 C C     . HIS A 1 148 ? -7.549  40.527 68.507  1.00 15.55 ? 148  HIS A C     1 
ATOM   1175 O O     . HIS A 1 148 ? -8.105  39.534 68.979  1.00 15.42 ? 148  HIS A O     1 
ATOM   1176 C CB    . HIS A 1 148 ? -7.477  39.786 66.134  1.00 16.22 ? 148  HIS A CB    1 
ATOM   1177 C CG    . HIS A 1 148 ? -6.675  39.548 64.895  1.00 17.46 ? 148  HIS A CG    1 
ATOM   1178 N ND1   . HIS A 1 148 ? -6.370  40.552 64.003  1.00 17.67 ? 148  HIS A ND1   1 
ATOM   1179 C CD2   . HIS A 1 148 ? -6.076  38.429 64.422  1.00 17.67 ? 148  HIS A CD2   1 
ATOM   1180 C CE1   . HIS A 1 148 ? -5.617  40.063 63.034  1.00 18.29 ? 148  HIS A CE1   1 
ATOM   1181 N NE2   . HIS A 1 148 ? -5.423  38.778 63.264  1.00 18.16 ? 148  HIS A NE2   1 
ATOM   1182 N N     . ALA A 1 149 ? -7.674  41.744 69.028  1.00 14.78 ? 149  ALA A N     1 
ATOM   1183 C CA    . ALA A 1 149 ? -8.480  41.979 70.222  1.00 14.85 ? 149  ALA A CA    1 
ATOM   1184 C C     . ALA A 1 149 ? -9.428  43.165 70.048  1.00 14.78 ? 149  ALA A C     1 
ATOM   1185 O O     . ALA A 1 149 ? -9.026  44.227 69.591  1.00 14.40 ? 149  ALA A O     1 
ATOM   1186 C CB    . ALA A 1 149 ? -7.562  42.215 71.426  1.00 13.90 ? 149  ALA A CB    1 
ATOM   1187 N N     . LYS A 1 150 ? -10.687 42.982 70.427  1.00 14.18 ? 150  LYS A N     1 
ATOM   1188 C CA    . LYS A 1 150 ? -11.668 44.048 70.302  1.00 13.96 ? 150  LYS A CA    1 
ATOM   1189 C C     . LYS A 1 150 ? -12.798 43.860 71.299  1.00 14.15 ? 150  LYS A C     1 
ATOM   1190 O O     . LYS A 1 150 ? -13.213 42.737 71.572  1.00 13.69 ? 150  LYS A O     1 
ATOM   1191 C CB    . LYS A 1 150 ? -12.245 44.058 68.893  1.00 13.79 ? 150  LYS A CB    1 
ATOM   1192 C CG    . LYS A 1 150 ? -13.132 45.245 68.588  1.00 14.36 ? 150  LYS A CG    1 
ATOM   1193 C CD    . LYS A 1 150 ? -13.717 45.096 67.205  1.00 14.81 ? 150  LYS A CD    1 
ATOM   1194 C CE    . LYS A 1 150 ? -13.529 46.341 66.387  1.00 16.28 ? 150  LYS A CE    1 
ATOM   1195 N NZ    . LYS A 1 150 ? -14.105 47.518 67.066  1.00 17.27 ? 150  LYS A NZ    1 
ATOM   1196 N N     . VAL A 1 151 ? -13.288 44.964 71.850  1.00 14.18 ? 151  VAL A N     1 
ATOM   1197 C CA    . VAL A 1 151 ? -14.391 44.903 72.793  1.00 14.21 ? 151  VAL A CA    1 
ATOM   1198 C C     . VAL A 1 151 ? -15.676 44.943 71.985  1.00 14.37 ? 151  VAL A C     1 
ATOM   1199 O O     . VAL A 1 151 ? -15.880 45.854 71.186  1.00 14.57 ? 151  VAL A O     1 
ATOM   1200 C CB    . VAL A 1 151 ? -14.368 46.098 73.781  1.00 13.65 ? 151  VAL A CB    1 
ATOM   1201 C CG1   . VAL A 1 151 ? -15.643 46.117 74.624  1.00 12.78 ? 151  VAL A CG1   1 
ATOM   1202 C CG2   . VAL A 1 151 ? -13.151 45.994 74.686  1.00 13.05 ? 151  VAL A CG2   1 
ATOM   1203 N N     . LEU A 1 152 ? -16.532 43.942 72.168  1.00 14.23 ? 152  LEU A N     1 
ATOM   1204 C CA    . LEU A 1 152 ? -17.800 43.902 71.449  1.00 14.38 ? 152  LEU A CA    1 
ATOM   1205 C C     . LEU A 1 152 ? -18.952 43.958 72.449  1.00 14.84 ? 152  LEU A C     1 
ATOM   1206 O O     . LEU A 1 152 ? -18.916 43.298 73.494  1.00 14.11 ? 152  LEU A O     1 
ATOM   1207 C CB    . LEU A 1 152 ? -17.907 42.630 70.598  1.00 14.58 ? 152  LEU A CB    1 
ATOM   1208 C CG    . LEU A 1 152 ? -16.840 42.356 69.530  1.00 14.76 ? 152  LEU A CG    1 
ATOM   1209 C CD1   . LEU A 1 152 ? -17.313 41.213 68.652  1.00 15.02 ? 152  LEU A CD1   1 
ATOM   1210 C CD2   . LEU A 1 152 ? -16.602 43.577 68.685  1.00 14.34 ? 152  LEU A CD2   1 
ATOM   1211 N N     . ASN A 1 153 ? -19.961 44.767 72.135  1.00 15.28 ? 153  ASN A N     1 
ATOM   1212 C CA    . ASN A 1 153 ? -21.131 44.911 72.991  1.00 16.35 ? 153  ASN A CA    1 
ATOM   1213 C C     . ASN A 1 153 ? -22.212 44.026 72.379  1.00 16.02 ? 153  ASN A C     1 
ATOM   1214 O O     . ASN A 1 153 ? -22.514 44.143 71.188  1.00 15.79 ? 153  ASN A O     1 
ATOM   1215 C CB    . ASN A 1 153 ? -21.576 46.380 73.035  1.00 18.54 ? 153  ASN A CB    1 
ATOM   1216 C CG    . ASN A 1 153 ? -22.590 46.656 74.143  1.00 21.63 ? 153  ASN A CG    1 
ATOM   1217 O OD1   . ASN A 1 153 ? -22.739 47.795 74.603  1.00 23.16 ? 153  ASN A OD1   1 
ATOM   1218 N ND2   . ASN A 1 153 ? -23.297 45.613 74.575  1.00 22.28 ? 153  ASN A ND2   1 
ATOM   1219 N N     . ALA A 1 154 ? -22.774 43.124 73.189  1.00 14.59 ? 154  ALA A N     1 
ATOM   1220 C CA    . ALA A 1 154 ? -23.795 42.188 72.719  1.00 13.00 ? 154  ALA A CA    1 
ATOM   1221 C C     . ALA A 1 154 ? -25.018 42.834 72.067  1.00 12.57 ? 154  ALA A C     1 
ATOM   1222 O O     . ALA A 1 154 ? -25.664 42.218 71.221  1.00 11.70 ? 154  ALA A O     1 
ATOM   1223 C CB    . ALA A 1 154 ? -24.235 41.276 73.870  1.00 12.43 ? 154  ALA A CB    1 
ATOM   1224 N N     . LEU A 1 155 ? -25.337 44.066 72.453  1.00 12.66 ? 155  LEU A N     1 
ATOM   1225 C CA    . LEU A 1 155 ? -26.491 44.760 71.889  1.00 13.18 ? 155  LEU A CA    1 
ATOM   1226 C C     . LEU A 1 155 ? -26.344 45.035 70.390  1.00 13.18 ? 155  LEU A C     1 
ATOM   1227 O O     . LEU A 1 155 ? -27.318 45.361 69.724  1.00 13.59 ? 155  LEU A O     1 
ATOM   1228 C CB    . LEU A 1 155 ? -26.739 46.076 72.639  1.00 13.13 ? 155  LEU A CB    1 
ATOM   1229 C CG    . LEU A 1 155 ? -25.651 47.154 72.617  1.00 13.17 ? 155  LEU A CG    1 
ATOM   1230 C CD1   . LEU A 1 155 ? -25.670 47.896 71.305  1.00 13.82 ? 155  LEU A CD1   1 
ATOM   1231 C CD2   . LEU A 1 155 ? -25.890 48.127 73.745  1.00 13.83 ? 155  LEU A CD2   1 
ATOM   1232 N N     . ASP A 1 156 ? -25.130 44.897 69.864  1.00 13.49 ? 156  ASP A N     1 
ATOM   1233 C CA    . ASP A 1 156 ? -24.884 45.131 68.445  1.00 13.57 ? 156  ASP A CA    1 
ATOM   1234 C C     . ASP A 1 156 ? -25.036 43.854 67.644  1.00 13.33 ? 156  ASP A C     1 
ATOM   1235 O O     . ASP A 1 156 ? -24.955 43.880 66.414  1.00 14.04 ? 156  ASP A O     1 
ATOM   1236 C CB    . ASP A 1 156 ? -23.469 45.661 68.209  1.00 14.85 ? 156  ASP A CB    1 
ATOM   1237 C CG    . ASP A 1 156 ? -23.290 47.086 68.662  1.00 16.00 ? 156  ASP A CG    1 
ATOM   1238 O OD1   . ASP A 1 156 ? -24.129 47.945 68.313  1.00 17.01 ? 156  ASP A OD1   1 
ATOM   1239 O OD2   . ASP A 1 156 ? -22.296 47.354 69.361  1.00 17.22 ? 156  ASP A OD2   1 
ATOM   1240 N N     . TYR A 1 157 ? -25.250 42.736 68.331  1.00 12.73 ? 157  TYR A N     1 
ATOM   1241 C CA    . TYR A 1 157 ? -25.371 41.458 67.649  1.00 12.94 ? 157  TYR A CA    1 
ATOM   1242 C C     . TYR A 1 157 ? -26.649 40.667 67.915  1.00 12.72 ? 157  TYR A C     1 
ATOM   1243 O O     . TYR A 1 157 ? -26.631 39.445 68.046  1.00 12.57 ? 157  TYR A O     1 
ATOM   1244 C CB    . TYR A 1 157 ? -24.120 40.620 67.936  1.00 12.66 ? 157  TYR A CB    1 
ATOM   1245 C CG    . TYR A 1 157 ? -22.860 41.377 67.570  1.00 13.47 ? 157  TYR A CG    1 
ATOM   1246 C CD1   . TYR A 1 157 ? -22.192 42.168 68.518  1.00 13.07 ? 157  TYR A CD1   1 
ATOM   1247 C CD2   . TYR A 1 157 ? -22.390 41.391 66.251  1.00 13.04 ? 157  TYR A CD2   1 
ATOM   1248 C CE1   . TYR A 1 157 ? -21.099 42.956 68.160  1.00 12.98 ? 157  TYR A CE1   1 
ATOM   1249 C CE2   . TYR A 1 157 ? -21.296 42.178 65.882  1.00 12.99 ? 157  TYR A CE2   1 
ATOM   1250 C CZ    . TYR A 1 157 ? -20.659 42.956 66.842  1.00 13.57 ? 157  TYR A CZ    1 
ATOM   1251 O OH    . TYR A 1 157 ? -19.582 43.731 66.484  1.00 13.33 ? 157  TYR A OH    1 
ATOM   1252 N N     . GLY A 1 158 ? -27.762 41.389 67.979  1.00 13.21 ? 158  GLY A N     1 
ATOM   1253 C CA    . GLY A 1 158 ? -29.057 40.765 68.163  1.00 14.66 ? 158  GLY A CA    1 
ATOM   1254 C C     . GLY A 1 158 ? -29.492 40.288 69.534  1.00 14.95 ? 158  GLY A C     1 
ATOM   1255 O O     . GLY A 1 158 ? -30.548 39.667 69.644  1.00 15.90 ? 158  GLY A O     1 
ATOM   1256 N N     . ILE A 1 159 ? -28.708 40.558 70.572  1.00 15.12 ? 159  ILE A N     1 
ATOM   1257 C CA    . ILE A 1 159 ? -29.076 40.126 71.922  1.00 14.01 ? 159  ILE A CA    1 
ATOM   1258 C C     . ILE A 1 159 ? -29.237 41.351 72.810  1.00 14.53 ? 159  ILE A C     1 
ATOM   1259 O O     . ILE A 1 159 ? -28.331 42.178 72.905  1.00 14.88 ? 159  ILE A O     1 
ATOM   1260 C CB    . ILE A 1 159 ? -27.998 39.187 72.531  1.00 13.84 ? 159  ILE A CB    1 
ATOM   1261 C CG1   . ILE A 1 159 ? -27.979 37.858 71.774  1.00 12.88 ? 159  ILE A CG1   1 
ATOM   1262 C CG2   . ILE A 1 159 ? -28.279 38.937 74.024  1.00 13.21 ? 159  ILE A CG2   1 
ATOM   1263 C CD1   . ILE A 1 159 ? -29.273 37.061 71.888  1.00 13.07 ? 159  ILE A CD1   1 
ATOM   1264 N N     . PRO A 1 160 ? -30.404 41.492 73.461  1.00 14.72 ? 160  PRO A N     1 
ATOM   1265 C CA    . PRO A 1 160 ? -30.636 42.647 74.337  1.00 15.00 ? 160  PRO A CA    1 
ATOM   1266 C C     . PRO A 1 160 ? -29.860 42.562 75.652  1.00 16.30 ? 160  PRO A C     1 
ATOM   1267 O O     . PRO A 1 160 ? -30.432 42.319 76.715  1.00 14.96 ? 160  PRO A O     1 
ATOM   1268 C CB    . PRO A 1 160 ? -32.146 42.631 74.529  1.00 14.90 ? 160  PRO A CB    1 
ATOM   1269 C CG    . PRO A 1 160 ? -32.482 41.166 74.439  1.00 14.32 ? 160  PRO A CG    1 
ATOM   1270 C CD    . PRO A 1 160 ? -31.630 40.689 73.299  1.00 14.24 ? 160  PRO A CD    1 
ATOM   1271 N N     . GLN A 1 161 ? -28.548 42.769 75.556  1.00 18.34 ? 161  GLN A N     1 
ATOM   1272 C CA    . GLN A 1 161 ? -27.647 42.712 76.707  1.00 20.99 ? 161  GLN A CA    1 
ATOM   1273 C C     . GLN A 1 161 ? -26.577 43.795 76.617  1.00 21.47 ? 161  GLN A C     1 
ATOM   1274 O O     . GLN A 1 161 ? -26.017 44.030 75.547  1.00 21.18 ? 161  GLN A O     1 
ATOM   1275 C CB    . GLN A 1 161 ? -26.953 41.345 76.759  1.00 21.79 ? 161  GLN A CB    1 
ATOM   1276 C CG    . GLN A 1 161 ? -27.393 40.458 77.904  1.00 24.72 ? 161  GLN A CG    1 
ATOM   1277 C CD    . GLN A 1 161 ? -26.498 40.575 79.110  1.00 25.87 ? 161  GLN A CD    1 
ATOM   1278 O OE1   . GLN A 1 161 ? -26.103 41.670 79.496  1.00 26.51 ? 161  GLN A OE1   1 
ATOM   1279 N NE2   . GLN A 1 161 ? -26.175 39.441 79.719  1.00 27.52 ? 161  GLN A NE2   1 
ATOM   1280 N N     . LYS A 1 162 ? -26.295 44.448 77.740  1.00 22.49 ? 162  LYS A N     1 
ATOM   1281 C CA    . LYS A 1 162 ? -25.268 45.479 77.776  1.00 24.13 ? 162  LYS A CA    1 
ATOM   1282 C C     . LYS A 1 162 ? -23.895 44.810 77.855  1.00 24.17 ? 162  LYS A C     1 
ATOM   1283 O O     . LYS A 1 162 ? -22.861 45.475 77.864  1.00 26.25 ? 162  LYS A O     1 
ATOM   1284 C CB    . LYS A 1 162 ? -25.456 46.382 78.992  1.00 26.01 ? 162  LYS A CB    1 
ATOM   1285 C CG    . LYS A 1 162 ? -24.378 47.442 79.105  1.00 28.26 ? 162  LYS A CG    1 
ATOM   1286 C CD    . LYS A 1 162 ? -24.421 48.167 80.432  1.00 30.18 ? 162  LYS A CD    1 
ATOM   1287 C CE    . LYS A 1 162 ? -23.208 49.071 80.560  1.00 31.42 ? 162  LYS A CE    1 
ATOM   1288 N NZ    . LYS A 1 162 ? -23.046 49.954 79.358  1.00 32.17 ? 162  LYS A NZ    1 
ATOM   1289 N N     . ASN A 1 163 ? -23.901 43.485 77.924  1.00 22.82 ? 163  ASN A N     1 
ATOM   1290 C CA    . ASN A 1 163 ? -22.688 42.677 78.003  1.00 20.83 ? 163  ASN A CA    1 
ATOM   1291 C C     . ASN A 1 163 ? -21.570 43.190 77.078  1.00 19.89 ? 163  ASN A C     1 
ATOM   1292 O O     . ASN A 1 163 ? -21.667 43.103 75.853  1.00 19.39 ? 163  ASN A O     1 
ATOM   1293 C CB    . ASN A 1 163 ? -23.070 41.223 77.680  1.00 20.41 ? 163  ASN A CB    1 
ATOM   1294 C CG    . ASN A 1 163 ? -21.901 40.265 77.740  1.00 20.17 ? 163  ASN A CG    1 
ATOM   1295 O OD1   . ASN A 1 163 ? -21.121 40.167 76.797  1.00 20.12 ? 163  ASN A OD1   1 
ATOM   1296 N ND2   . ASN A 1 163 ? -21.783 39.540 78.848  1.00 19.81 ? 163  ASN A ND2   1 
ATOM   1297 N N     . GLU A 1 164 ? -20.523 43.746 77.686  1.00 18.86 ? 164  GLU A N     1 
ATOM   1298 C CA    . GLU A 1 164 ? -19.364 44.268 76.962  1.00 18.24 ? 164  GLU A CA    1 
ATOM   1299 C C     . GLU A 1 164 ? -18.147 43.429 77.324  1.00 17.14 ? 164  GLU A C     1 
ATOM   1300 O O     . GLU A 1 164 ? -17.763 43.354 78.489  1.00 16.32 ? 164  GLU A O     1 
ATOM   1301 C CB    . GLU A 1 164 ? -19.120 45.730 77.333  1.00 18.81 ? 164  GLU A CB    1 
ATOM   1302 C CG    . GLU A 1 164 ? -20.158 46.667 76.758  1.00 20.30 ? 164  GLU A CG    1 
ATOM   1303 C CD    . GLU A 1 164 ? -20.167 48.032 77.423  1.00 21.16 ? 164  GLU A CD    1 
ATOM   1304 O OE1   . GLU A 1 164 ? -20.995 48.882 77.029  1.00 22.89 ? 164  GLU A OE1   1 
ATOM   1305 O OE2   . GLU A 1 164 ? -19.360 48.255 78.345  1.00 21.27 ? 164  GLU A OE2   1 
ATOM   1306 N N     . ARG A 1 165 ? -17.535 42.809 76.322  1.00 15.61 ? 165  ARG A N     1 
ATOM   1307 C CA    . ARG A 1 165 ? -16.397 41.941 76.566  1.00 14.55 ? 165  ARG A CA    1 
ATOM   1308 C C     . ARG A 1 165 ? -15.278 42.117 75.553  1.00 14.29 ? 165  ARG A C     1 
ATOM   1309 O O     . ARG A 1 165 ? -15.504 42.558 74.429  1.00 14.08 ? 165  ARG A O     1 
ATOM   1310 C CB    . ARG A 1 165 ? -16.867 40.484 76.536  1.00 14.45 ? 165  ARG A CB    1 
ATOM   1311 C CG    . ARG A 1 165 ? -17.937 40.129 77.571  1.00 14.70 ? 165  ARG A CG    1 
ATOM   1312 C CD    . ARG A 1 165 ? -17.343 40.063 78.967  1.00 15.18 ? 165  ARG A CD    1 
ATOM   1313 N NE    . ARG A 1 165 ? -18.318 39.722 80.003  1.00 15.78 ? 165  ARG A NE    1 
ATOM   1314 C CZ    . ARG A 1 165 ? -18.937 40.604 80.783  1.00 15.97 ? 165  ARG A CZ    1 
ATOM   1315 N NH1   . ARG A 1 165 ? -18.700 41.902 80.653  1.00 16.46 ? 165  ARG A NH1   1 
ATOM   1316 N NH2   . ARG A 1 165 ? -19.771 40.182 81.725  1.00 16.08 ? 165  ARG A NH2   1 
ATOM   1317 N N     . ILE A 1 166 ? -14.064 41.771 75.962  1.00 14.06 ? 166  ILE A N     1 
ATOM   1318 C CA    . ILE A 1 166 ? -12.923 41.851 75.068  1.00 14.59 ? 166  ILE A CA    1 
ATOM   1319 C C     . ILE A 1 166 ? -12.748 40.446 74.499  1.00 14.63 ? 166  ILE A C     1 
ATOM   1320 O O     . ILE A 1 166 ? -12.703 39.459 75.242  1.00 13.91 ? 166  ILE A O     1 
ATOM   1321 C CB    . ILE A 1 166 ? -11.622 42.285 75.813  1.00 15.62 ? 166  ILE A CB    1 
ATOM   1322 C CG1   . ILE A 1 166 ? -10.447 42.345 74.839  1.00 15.02 ? 166  ILE A CG1   1 
ATOM   1323 C CG2   . ILE A 1 166 ? -11.286 41.300 76.928  1.00 15.29 ? 166  ILE A CG2   1 
ATOM   1324 C CD1   . ILE A 1 166 ? -10.638 43.322 73.742  1.00 16.05 ? 166  ILE A CD1   1 
ATOM   1325 N N     . TYR A 1 167 ? -12.689 40.359 73.178  1.00 13.43 ? 167  TYR A N     1 
ATOM   1326 C CA    . TYR A 1 167 ? -12.513 39.083 72.502  1.00 14.04 ? 167  TYR A CA    1 
ATOM   1327 C C     . TYR A 1 167 ? -11.134 39.063 71.856  1.00 14.18 ? 167  TYR A C     1 
ATOM   1328 O O     . TYR A 1 167 ? -10.740 40.008 71.174  1.00 14.85 ? 167  TYR A O     1 
ATOM   1329 C CB    . TYR A 1 167 ? -13.605 38.907 71.451  1.00 13.24 ? 167  TYR A CB    1 
ATOM   1330 C CG    . TYR A 1 167 ? -14.980 38.847 72.061  1.00 12.99 ? 167  TYR A CG    1 
ATOM   1331 C CD1   . TYR A 1 167 ? -15.493 37.639 72.532  1.00 12.83 ? 167  TYR A CD1   1 
ATOM   1332 C CD2   . TYR A 1 167 ? -15.755 40.001 72.209  1.00 12.49 ? 167  TYR A CD2   1 
ATOM   1333 C CE1   . TYR A 1 167 ? -16.739 37.575 73.135  1.00 12.19 ? 167  TYR A CE1   1 
ATOM   1334 C CE2   . TYR A 1 167 ? -17.009 39.948 72.810  1.00 11.99 ? 167  TYR A CE2   1 
ATOM   1335 C CZ    . TYR A 1 167 ? -17.489 38.723 73.272  1.00 12.44 ? 167  TYR A CZ    1 
ATOM   1336 O OH    . TYR A 1 167 ? -18.709 38.631 73.878  1.00 11.75 ? 167  TYR A OH    1 
ATOM   1337 N N     . MET A 1 168 ? -10.400 37.982 72.075  1.00 14.08 ? 168  MET A N     1 
ATOM   1338 C CA    . MET A 1 168 ? -9.058  37.877 71.534  1.00 14.61 ? 168  MET A CA    1 
ATOM   1339 C C     . MET A 1 168 ? -8.930  36.642 70.665  1.00 14.88 ? 168  MET A C     1 
ATOM   1340 O O     . MET A 1 168 ? -9.077  35.518 71.139  1.00 14.81 ? 168  MET A O     1 
ATOM   1341 C CB    . MET A 1 168 ? -8.062  37.850 72.691  1.00 14.54 ? 168  MET A CB    1 
ATOM   1342 C CG    . MET A 1 168 ? -8.214  39.072 73.609  1.00 14.90 ? 168  MET A CG    1 
ATOM   1343 S SD    . MET A 1 168 ? -7.421  38.959 75.234  1.00 15.49 ? 168  MET A SD    1 
ATOM   1344 C CE    . MET A 1 168 ? -8.676  38.095 76.157  1.00 14.29 ? 168  MET A CE    1 
ATOM   1345 N N     . ILE A 1 169 ? -8.680  36.869 69.378  1.00 15.56 ? 169  ILE A N     1 
ATOM   1346 C CA    . ILE A 1 169 ? -8.531  35.792 68.405  1.00 16.27 ? 169  ILE A CA    1 
ATOM   1347 C C     . ILE A 1 169 ? -7.074  35.767 67.971  1.00 16.06 ? 169  ILE A C     1 
ATOM   1348 O O     . ILE A 1 169 ? -6.556  36.768 67.477  1.00 16.15 ? 169  ILE A O     1 
ATOM   1349 C CB    . ILE A 1 169 ? -9.400  36.033 67.147  1.00 16.38 ? 169  ILE A CB    1 
ATOM   1350 C CG1   . ILE A 1 169 ? -10.785 36.560 67.542  1.00 16.88 ? 169  ILE A CG1   1 
ATOM   1351 C CG2   . ILE A 1 169 ? -9.490  34.752 66.329  1.00 16.98 ? 169  ILE A CG2   1 
ATOM   1352 C CD1   . ILE A 1 169 ? -11.488 35.759 68.575  1.00 16.84 ? 169  ILE A CD1   1 
ATOM   1353 N N     . CYS A 1 170 ? -6.421  34.623 68.145  1.00 16.47 ? 170  CYS A N     1 
ATOM   1354 C CA    . CYS A 1 170 ? -5.011  34.490 67.786  1.00 16.77 ? 170  CYS A CA    1 
ATOM   1355 C C     . CYS A 1 170 ? -4.802  33.390 66.745  1.00 15.96 ? 170  CYS A C     1 
ATOM   1356 O O     . CYS A 1 170 ? -5.263  32.269 66.927  1.00 15.84 ? 170  CYS A O     1 
ATOM   1357 C CB    . CYS A 1 170 ? -4.203  34.179 69.045  1.00 16.87 ? 170  CYS A CB    1 
ATOM   1358 S SG    . CYS A 1 170 ? -4.712  35.163 70.479  1.00 17.19 ? 170  CYS A SG    1 
ATOM   1359 N N     . PHE A 1 171 ? -4.105  33.719 65.659  1.00 15.59 ? 171  PHE A N     1 
ATOM   1360 C CA    . PHE A 1 171 ? -3.834  32.765 64.585  1.00 15.53 ? 171  PHE A CA    1 
ATOM   1361 C C     . PHE A 1 171 ? -2.350  32.414 64.547  1.00 16.09 ? 171  PHE A C     1 
ATOM   1362 O O     . PHE A 1 171 ? -1.487  33.297 64.595  1.00 15.75 ? 171  PHE A O     1 
ATOM   1363 C CB    . PHE A 1 171 ? -4.242  33.354 63.224  1.00 14.88 ? 171  PHE A CB    1 
ATOM   1364 C CG    . PHE A 1 171 ? -5.730  33.490 63.031  1.00 14.57 ? 171  PHE A CG    1 
ATOM   1365 C CD1   . PHE A 1 171 ? -6.505  32.388 62.670  1.00 14.21 ? 171  PHE A CD1   1 
ATOM   1366 C CD2   . PHE A 1 171 ? -6.362  34.716 63.229  1.00 13.51 ? 171  PHE A CD2   1 
ATOM   1367 C CE1   . PHE A 1 171 ? -7.891  32.503 62.512  1.00 13.54 ? 171  PHE A CE1   1 
ATOM   1368 C CE2   . PHE A 1 171 ? -7.743  34.841 63.075  1.00 13.82 ? 171  PHE A CE2   1 
ATOM   1369 C CZ    . PHE A 1 171 ? -8.509  33.728 62.715  1.00 13.30 ? 171  PHE A CZ    1 
ATOM   1370 N N     . ARG A 1 172 ? -2.050  31.125 64.465  1.00 16.65 ? 172  ARG A N     1 
ATOM   1371 C CA    . ARG A 1 172 ? -0.665  30.692 64.401  1.00 17.60 ? 172  ARG A CA    1 
ATOM   1372 C C     . ARG A 1 172 ? -0.097  31.339 63.139  1.00 18.63 ? 172  ARG A C     1 
ATOM   1373 O O     . ARG A 1 172 ? -0.695  31.257 62.060  1.00 17.96 ? 172  ARG A O     1 
ATOM   1374 C CB    . ARG A 1 172 ? -0.604  29.176 64.320  1.00 17.46 ? 172  ARG A CB    1 
ATOM   1375 C CG    . ARG A 1 172 ? 0.585   28.570 65.030  1.00 17.48 ? 172  ARG A CG    1 
ATOM   1376 C CD    . ARG A 1 172 ? 0.450   27.078 64.990  1.00 17.63 ? 172  ARG A CD    1 
ATOM   1377 N NE    . ARG A 1 172 ? 0.229   26.630 63.620  1.00 17.35 ? 172  ARG A NE    1 
ATOM   1378 C CZ    . ARG A 1 172 ? -0.422  25.520 63.297  1.00 17.11 ? 172  ARG A CZ    1 
ATOM   1379 N NH1   . ARG A 1 172 ? -0.921  24.742 64.247  1.00 17.55 ? 172  ARG A NH1   1 
ATOM   1380 N NH2   . ARG A 1 172 ? -0.575  25.189 62.025  1.00 17.45 ? 172  ARG A NH2   1 
ATOM   1381 N N     . ASN A 1 173 ? 1.051   31.992 63.281  1.00 19.39 ? 173  ASN A N     1 
ATOM   1382 C CA    . ASN A 1 173 ? 1.659   32.717 62.173  1.00 19.80 ? 173  ASN A CA    1 
ATOM   1383 C C     . ASN A 1 173 ? 1.852   31.981 60.861  1.00 19.76 ? 173  ASN A C     1 
ATOM   1384 O O     . ASN A 1 173 ? 1.683   32.575 59.799  1.00 20.53 ? 173  ASN A O     1 
ATOM   1385 C CB    . ASN A 1 173 ? 2.986   33.336 62.613  1.00 20.10 ? 173  ASN A CB    1 
ATOM   1386 C CG    . ASN A 1 173 ? 2.799   34.441 63.636  1.00 20.57 ? 173  ASN A CG    1 
ATOM   1387 O OD1   . ASN A 1 173 ? 1.856   35.233 63.541  1.00 21.15 ? 173  ASN A OD1   1 
ATOM   1388 N ND2   . ASN A 1 173 ? 3.702   34.511 64.614  1.00 19.70 ? 173  ASN A ND2   1 
ATOM   1389 N N     . ASP A 1 174 ? 2.197   30.701 60.911  1.00 19.90 ? 174  ASP A N     1 
ATOM   1390 C CA    . ASP A 1 174 ? 2.406   29.967 59.670  1.00 20.81 ? 174  ASP A CA    1 
ATOM   1391 C C     . ASP A 1 174 ? 1.154   29.863 58.803  1.00 21.71 ? 174  ASP A C     1 
ATOM   1392 O O     . ASP A 1 174 ? 1.244   29.540 57.616  1.00 20.97 ? 174  ASP A O     1 
ATOM   1393 C CB    . ASP A 1 174 ? 2.952   28.566 59.954  1.00 21.36 ? 174  ASP A CB    1 
ATOM   1394 C CG    . ASP A 1 174 ? 2.083   27.778 60.905  1.00 21.77 ? 174  ASP A CG    1 
ATOM   1395 O OD1   . ASP A 1 174 ? 2.052   28.116 62.106  1.00 22.90 ? 174  ASP A OD1   1 
ATOM   1396 O OD2   . ASP A 1 174 ? 1.432   26.819 60.453  1.00 21.39 ? 174  ASP A OD2   1 
ATOM   1397 N N     . LEU A 1 175 ? -0.009  30.144 59.390  1.00 21.60 ? 175  LEU A N     1 
ATOM   1398 C CA    . LEU A 1 175 ? -1.269  30.076 58.659  1.00 21.61 ? 175  LEU A CA    1 
ATOM   1399 C C     . LEU A 1 175 ? -1.450  31.323 57.812  1.00 22.28 ? 175  LEU A C     1 
ATOM   1400 O O     . LEU A 1 175 ? -2.298  31.366 56.921  1.00 22.32 ? 175  LEU A O     1 
ATOM   1401 C CB    . LEU A 1 175 ? -2.440  29.933 59.628  1.00 20.95 ? 175  LEU A CB    1 
ATOM   1402 C CG    . LEU A 1 175 ? -2.496  28.597 60.366  1.00 20.92 ? 175  LEU A CG    1 
ATOM   1403 C CD1   . LEU A 1 175 ? -3.648  28.606 61.365  1.00 20.80 ? 175  LEU A CD1   1 
ATOM   1404 C CD2   . LEU A 1 175 ? -2.656  27.466 59.353  1.00 20.51 ? 175  LEU A CD2   1 
ATOM   1405 N N     . ASN A 1 176 ? -0.642  32.335 58.105  1.00 22.99 ? 176  ASN A N     1 
ATOM   1406 C CA    . ASN A 1 176 ? -0.675  33.597 57.380  1.00 24.18 ? 176  ASN A CA    1 
ATOM   1407 C C     . ASN A 1 176 ? -2.098  34.108 57.159  1.00 24.01 ? 176  ASN A C     1 
ATOM   1408 O O     . ASN A 1 176 ? -2.499  34.398 56.031  1.00 23.33 ? 176  ASN A O     1 
ATOM   1409 C CB    . ASN A 1 176 ? 0.049   33.436 56.037  1.00 25.65 ? 176  ASN A CB    1 
ATOM   1410 C CG    . ASN A 1 176 ? 0.353   34.768 55.374  1.00 27.10 ? 176  ASN A CG    1 
ATOM   1411 O OD1   . ASN A 1 176 ? 0.742   35.735 56.040  1.00 27.93 ? 176  ASN A OD1   1 
ATOM   1412 N ND2   . ASN A 1 176 ? 0.190   34.823 54.054  1.00 28.10 ? 176  ASN A ND2   1 
ATOM   1413 N N     . ILE A 1 177 ? -2.856  34.215 58.247  1.00 23.89 ? 177  ILE A N     1 
ATOM   1414 C CA    . ILE A 1 177 ? -4.228  34.700 58.179  1.00 23.57 ? 177  ILE A CA    1 
ATOM   1415 C C     . ILE A 1 177 ? -4.193  36.224 58.193  1.00 24.19 ? 177  ILE A C     1 
ATOM   1416 O O     . ILE A 1 177 ? -3.725  36.835 59.152  1.00 23.59 ? 177  ILE A O     1 
ATOM   1417 C CB    . ILE A 1 177 ? -5.064  34.211 59.382  1.00 23.09 ? 177  ILE A CB    1 
ATOM   1418 C CG1   . ILE A 1 177 ? -5.067  32.676 59.438  1.00 23.06 ? 177  ILE A CG1   1 
ATOM   1419 C CG2   . ILE A 1 177 ? -6.476  34.766 59.285  1.00 22.60 ? 177  ILE A CG2   1 
ATOM   1420 C CD1   . ILE A 1 177 ? -5.639  31.989 58.196  1.00 22.93 ? 177  ILE A CD1   1 
ATOM   1421 N N     . GLN A 1 178 ? -4.695  36.838 57.129  1.00 24.65 ? 178  GLN A N     1 
ATOM   1422 C CA    . GLN A 1 178 ? -4.688  38.289 57.032  1.00 24.81 ? 178  GLN A CA    1 
ATOM   1423 C C     . GLN A 1 178 ? -6.065  38.896 56.837  1.00 23.25 ? 178  GLN A C     1 
ATOM   1424 O O     . GLN A 1 178 ? -6.187  40.115 56.712  1.00 23.22 ? 178  GLN A O     1 
ATOM   1425 C CB    . GLN A 1 178 ? -3.807  38.724 55.866  1.00 27.19 ? 178  GLN A CB    1 
ATOM   1426 C CG    . GLN A 1 178 ? -2.355  38.328 55.989  1.00 30.50 ? 178  GLN A CG    1 
ATOM   1427 C CD    . GLN A 1 178 ? -1.588  38.638 54.723  1.00 32.73 ? 178  GLN A CD    1 
ATOM   1428 O OE1   . GLN A 1 178 ? -1.758  37.970 53.695  1.00 34.20 ? 178  GLN A OE1   1 
ATOM   1429 N NE2   . GLN A 1 178 ? -0.753  39.671 54.778  1.00 34.09 ? 178  GLN A NE2   1 
ATOM   1430 N N     . ASN A 1 179 ? -7.103  38.066 56.808  1.00 20.50 ? 179  ASN A N     1 
ATOM   1431 C CA    . ASN A 1 179 ? -8.440  38.595 56.584  1.00 18.90 ? 179  ASN A CA    1 
ATOM   1432 C C     . ASN A 1 179 ? -9.425  38.401 57.731  1.00 18.39 ? 179  ASN A C     1 
ATOM   1433 O O     . ASN A 1 179 ? -10.641 38.441 57.524  1.00 17.93 ? 179  ASN A O     1 
ATOM   1434 C CB    . ASN A 1 179 ? -9.026  37.994 55.307  1.00 17.90 ? 179  ASN A CB    1 
ATOM   1435 C CG    . ASN A 1 179 ? -9.054  36.488 55.342  1.00 17.57 ? 179  ASN A CG    1 
ATOM   1436 O OD1   . ASN A 1 179 ? -8.808  35.877 56.387  1.00 17.18 ? 179  ASN A OD1   1 
ATOM   1437 N ND2   . ASN A 1 179 ? -9.359  35.872 54.203  1.00 17.06 ? 179  ASN A ND2   1 
ATOM   1438 N N     . PHE A 1 180 ? -8.926  38.190 58.942  1.00 18.06 ? 180  PHE A N     1 
ATOM   1439 C CA    . PHE A 1 180 ? -9.860  38.022 60.039  1.00 17.98 ? 180  PHE A CA    1 
ATOM   1440 C C     . PHE A 1 180 ? -10.488 39.357 60.380  1.00 17.93 ? 180  PHE A C     1 
ATOM   1441 O O     . PHE A 1 180 ? -9.800  40.380 60.462  1.00 17.59 ? 180  PHE A O     1 
ATOM   1442 C CB    . PHE A 1 180 ? -9.202  37.480 61.308  1.00 17.03 ? 180  PHE A CB    1 
ATOM   1443 C CG    . PHE A 1 180 ? -10.152 37.411 62.473  1.00 16.44 ? 180  PHE A CG    1 
ATOM   1444 C CD1   . PHE A 1 180 ? -11.129 36.425 62.525  1.00 16.03 ? 180  PHE A CD1   1 
ATOM   1445 C CD2   . PHE A 1 180 ? -10.134 38.391 63.464  1.00 16.39 ? 180  PHE A CD2   1 
ATOM   1446 C CE1   . PHE A 1 180 ? -12.075 36.411 63.535  1.00 16.22 ? 180  PHE A CE1   1 
ATOM   1447 C CE2   . PHE A 1 180 ? -11.076 38.392 64.481  1.00 16.45 ? 180  PHE A CE2   1 
ATOM   1448 C CZ    . PHE A 1 180 ? -12.053 37.397 64.517  1.00 16.60 ? 180  PHE A CZ    1 
ATOM   1449 N N     . GLN A 1 181 ? -11.800 39.345 60.573  1.00 17.97 ? 181  GLN A N     1 
ATOM   1450 C CA    . GLN A 1 181 ? -12.497 40.556 60.947  1.00 18.15 ? 181  GLN A CA    1 
ATOM   1451 C C     . GLN A 1 181 ? -13.556 40.257 61.986  1.00 18.14 ? 181  GLN A C     1 
ATOM   1452 O O     . GLN A 1 181 ? -14.214 39.211 61.944  1.00 18.00 ? 181  GLN A O     1 
ATOM   1453 C CB    . GLN A 1 181 ? -13.131 41.231 59.731  1.00 18.92 ? 181  GLN A CB    1 
ATOM   1454 C CG    . GLN A 1 181 ? -14.281 40.495 59.088  1.00 19.92 ? 181  GLN A CG    1 
ATOM   1455 C CD    . GLN A 1 181 ? -14.866 41.281 57.918  1.00 20.94 ? 181  GLN A CD    1 
ATOM   1456 O OE1   . GLN A 1 181 ? -14.158 41.614 56.963  1.00 20.70 ? 181  GLN A OE1   1 
ATOM   1457 N NE2   . GLN A 1 181 ? -16.159 41.586 57.993  1.00 20.86 ? 181  GLN A NE2   1 
ATOM   1458 N N     . PHE A 1 182 ? -13.688 41.168 62.942  1.00 17.46 ? 182  PHE A N     1 
ATOM   1459 C CA    . PHE A 1 182 ? -14.685 41.034 63.986  1.00 17.14 ? 182  PHE A CA    1 
ATOM   1460 C C     . PHE A 1 182 ? -16.031 41.292 63.323  1.00 17.19 ? 182  PHE A C     1 
ATOM   1461 O O     . PHE A 1 182 ? -16.115 42.040 62.346  1.00 16.55 ? 182  PHE A O     1 
ATOM   1462 C CB    . PHE A 1 182 ? -14.415 42.053 65.093  1.00 16.34 ? 182  PHE A CB    1 
ATOM   1463 C CG    . PHE A 1 182 ? -13.319 41.640 66.028  1.00 15.94 ? 182  PHE A CG    1 
ATOM   1464 C CD1   . PHE A 1 182 ? -13.589 40.783 67.094  1.00 15.13 ? 182  PHE A CD1   1 
ATOM   1465 C CD2   . PHE A 1 182 ? -12.006 42.055 65.808  1.00 14.73 ? 182  PHE A CD2   1 
ATOM   1466 C CE1   . PHE A 1 182 ? -12.565 40.341 67.924  1.00 14.70 ? 182  PHE A CE1   1 
ATOM   1467 C CE2   . PHE A 1 182 ? -10.977 41.619 66.633  1.00 14.14 ? 182  PHE A CE2   1 
ATOM   1468 C CZ    . PHE A 1 182 ? -11.255 40.759 67.693  1.00 14.44 ? 182  PHE A CZ    1 
ATOM   1469 N N     . PRO A 1 183 ? -17.101 40.666 63.832  1.00 17.65 ? 183  PRO A N     1 
ATOM   1470 C CA    . PRO A 1 183 ? -18.426 40.868 63.240  1.00 17.79 ? 183  PRO A CA    1 
ATOM   1471 C C     . PRO A 1 183 ? -18.817 42.341 63.240  1.00 18.28 ? 183  PRO A C     1 
ATOM   1472 O O     . PRO A 1 183 ? -18.539 43.066 64.195  1.00 17.57 ? 183  PRO A O     1 
ATOM   1473 C CB    . PRO A 1 183 ? -19.339 40.038 64.140  1.00 17.80 ? 183  PRO A CB    1 
ATOM   1474 C CG    . PRO A 1 183 ? -18.431 38.969 64.652  1.00 18.20 ? 183  PRO A CG    1 
ATOM   1475 C CD    . PRO A 1 183 ? -17.168 39.723 64.961  1.00 17.49 ? 183  PRO A CD    1 
ATOM   1476 N N     . LYS A 1 184 ? -19.450 42.786 62.162  1.00 18.73 ? 184  LYS A N     1 
ATOM   1477 C CA    . LYS A 1 184 ? -19.887 44.172 62.088  1.00 20.41 ? 184  LYS A CA    1 
ATOM   1478 C C     . LYS A 1 184 ? -21.242 44.269 62.794  1.00 19.57 ? 184  LYS A C     1 
ATOM   1479 O O     . LYS A 1 184 ? -22.087 43.388 62.661  1.00 19.08 ? 184  LYS A O     1 
ATOM   1480 C CB    . LYS A 1 184 ? -20.004 44.614 60.626  1.00 22.42 ? 184  LYS A CB    1 
ATOM   1481 C CG    . LYS A 1 184 ? -18.700 44.472 59.856  1.00 25.41 ? 184  LYS A CG    1 
ATOM   1482 C CD    . LYS A 1 184 ? -17.567 45.242 60.542  1.00 27.97 ? 184  LYS A CD    1 
ATOM   1483 C CE    . LYS A 1 184 ? -16.198 44.818 60.019  1.00 28.89 ? 184  LYS A CE    1 
ATOM   1484 N NZ    . LYS A 1 184 ? -16.101 44.977 58.547  1.00 29.15 ? 184  LYS A NZ    1 
ATOM   1485 N N     . PRO A 1 185 ? -21.456 45.336 63.573  1.00 18.39 ? 185  PRO A N     1 
ATOM   1486 C CA    . PRO A 1 185 ? -22.718 45.519 64.295  1.00 18.08 ? 185  PRO A CA    1 
ATOM   1487 C C     . PRO A 1 185 ? -23.946 45.631 63.395  1.00 17.62 ? 185  PRO A C     1 
ATOM   1488 O O     . PRO A 1 185 ? -23.856 46.063 62.245  1.00 16.55 ? 185  PRO A O     1 
ATOM   1489 C CB    . PRO A 1 185 ? -22.487 46.812 65.074  1.00 17.98 ? 185  PRO A CB    1 
ATOM   1490 C CG    . PRO A 1 185 ? -21.023 46.845 65.261  1.00 18.34 ? 185  PRO A CG    1 
ATOM   1491 C CD    . PRO A 1 185 ? -20.491 46.385 63.935  1.00 18.41 ? 185  PRO A CD    1 
ATOM   1492 N N     . PHE A 1 186 ? -25.091 45.226 63.925  1.00 16.95 ? 186  PHE A N     1 
ATOM   1493 C CA    . PHE A 1 186 ? -26.332 45.342 63.189  1.00 17.26 ? 186  PHE A CA    1 
ATOM   1494 C C     . PHE A 1 186 ? -27.433 45.769 64.152  1.00 18.27 ? 186  PHE A C     1 
ATOM   1495 O O     . PHE A 1 186 ? -27.280 45.667 65.371  1.00 17.92 ? 186  PHE A O     1 
ATOM   1496 C CB    . PHE A 1 186 ? -26.670 44.044 62.445  1.00 17.07 ? 186  PHE A CB    1 
ATOM   1497 C CG    . PHE A 1 186 ? -26.790 42.831 63.321  1.00 17.27 ? 186  PHE A CG    1 
ATOM   1498 C CD1   . PHE A 1 186 ? -27.951 42.594 64.058  1.00 16.87 ? 186  PHE A CD1   1 
ATOM   1499 C CD2   . PHE A 1 186 ? -25.759 41.891 63.363  1.00 17.02 ? 186  PHE A CD2   1 
ATOM   1500 C CE1   . PHE A 1 186 ? -28.088 41.434 64.815  1.00 16.46 ? 186  PHE A CE1   1 
ATOM   1501 C CE2   . PHE A 1 186 ? -25.886 40.727 64.120  1.00 16.82 ? 186  PHE A CE2   1 
ATOM   1502 C CZ    . PHE A 1 186 ? -27.055 40.498 64.845  1.00 16.59 ? 186  PHE A CZ    1 
ATOM   1503 N N     . GLU A 1 187 ? -28.527 46.277 63.598  1.00 19.03 ? 187  GLU A N     1 
ATOM   1504 C CA    . GLU A 1 187 ? -29.643 46.780 64.391  1.00 20.38 ? 187  GLU A CA    1 
ATOM   1505 C C     . GLU A 1 187 ? -30.302 45.773 65.324  1.00 18.87 ? 187  GLU A C     1 
ATOM   1506 O O     . GLU A 1 187 ? -30.619 44.658 64.921  1.00 18.64 ? 187  GLU A O     1 
ATOM   1507 C CB    . GLU A 1 187 ? -30.707 47.366 63.468  1.00 22.15 ? 187  GLU A CB    1 
ATOM   1508 C CG    . GLU A 1 187 ? -31.752 48.162 64.206  1.00 26.19 ? 187  GLU A CG    1 
ATOM   1509 C CD    . GLU A 1 187 ? -32.957 48.469 63.353  1.00 28.75 ? 187  GLU A CD    1 
ATOM   1510 O OE1   . GLU A 1 187 ? -33.865 49.177 63.848  1.00 30.67 ? 187  GLU A OE1   1 
ATOM   1511 O OE2   . GLU A 1 187 ? -33.000 47.995 62.194  1.00 29.87 ? 187  GLU A OE2   1 
ATOM   1512 N N     . LEU A 1 188 ? -30.516 46.184 66.570  1.00 17.99 ? 188  LEU A N     1 
ATOM   1513 C CA    . LEU A 1 188 ? -31.152 45.327 67.564  1.00 17.04 ? 188  LEU A CA    1 
ATOM   1514 C C     . LEU A 1 188 ? -32.659 45.399 67.377  1.00 18.38 ? 188  LEU A C     1 
ATOM   1515 O O     . LEU A 1 188 ? -33.239 46.484 67.377  1.00 17.40 ? 188  LEU A O     1 
ATOM   1516 C CB    . LEU A 1 188 ? -30.794 45.777 68.984  1.00 15.45 ? 188  LEU A CB    1 
ATOM   1517 C CG    . LEU A 1 188 ? -31.397 44.912 70.095  1.00 14.42 ? 188  LEU A CG    1 
ATOM   1518 C CD1   . LEU A 1 188 ? -30.915 43.484 69.930  1.00 13.54 ? 188  LEU A CD1   1 
ATOM   1519 C CD2   . LEU A 1 188 ? -31.012 45.457 71.460  1.00 13.27 ? 188  LEU A CD2   1 
ATOM   1520 N N     . ASN A 1 189 ? -33.289 44.239 67.220  1.00 19.35 ? 189  ASN A N     1 
ATOM   1521 C CA    . ASN A 1 189 ? -34.728 44.175 67.023  1.00 21.12 ? 189  ASN A CA    1 
ATOM   1522 C C     . ASN A 1 189 ? -35.399 43.369 68.128  1.00 20.08 ? 189  ASN A C     1 
ATOM   1523 O O     . ASN A 1 189 ? -36.601 43.122 68.075  1.00 19.94 ? 189  ASN A O     1 
ATOM   1524 C CB    . ASN A 1 189 ? -35.049 43.543 65.662  1.00 24.26 ? 189  ASN A CB    1 
ATOM   1525 C CG    . ASN A 1 189 ? -34.303 42.230 65.435  1.00 27.65 ? 189  ASN A CG    1 
ATOM   1526 O OD1   . ASN A 1 189 ? -34.041 41.473 66.380  1.00 29.56 ? 189  ASN A OD1   1 
ATOM   1527 N ND2   . ASN A 1 189 ? -33.966 41.947 64.176  1.00 29.22 ? 189  ASN A ND2   1 
ATOM   1528 N N     . THR A 1 190 ? -34.616 42.956 69.122  1.00 18.67 ? 190  THR A N     1 
ATOM   1529 C CA    . THR A 1 190 ? -35.137 42.179 70.248  1.00 17.13 ? 190  THR A CA    1 
ATOM   1530 C C     . THR A 1 190 ? -34.790 42.888 71.548  1.00 15.99 ? 190  THR A C     1 
ATOM   1531 O O     . THR A 1 190 ? -33.687 43.406 71.702  1.00 15.52 ? 190  THR A O     1 
ATOM   1532 C CB    . THR A 1 190 ? -34.528 40.766 70.280  1.00 17.21 ? 190  THR A CB    1 
ATOM   1533 O OG1   . THR A 1 190 ? -34.932 40.054 69.109  1.00 18.29 ? 190  THR A OG1   1 
ATOM   1534 C CG2   . THR A 1 190 ? -34.983 40.003 71.521  1.00 17.01 ? 190  THR A CG2   1 
ATOM   1535 N N     . PHE A 1 191 ? -35.734 42.910 72.483  1.00 15.24 ? 191  PHE A N     1 
ATOM   1536 C CA    . PHE A 1 191 ? -35.517 43.577 73.763  1.00 14.15 ? 191  PHE A CA    1 
ATOM   1537 C C     . PHE A 1 191 ? -35.898 42.662 74.917  1.00 13.46 ? 191  PHE A C     1 
ATOM   1538 O O     . PHE A 1 191 ? -36.456 41.585 74.698  1.00 13.95 ? 191  PHE A O     1 
ATOM   1539 C CB    . PHE A 1 191 ? -36.299 44.898 73.789  1.00 14.14 ? 191  PHE A CB    1 
ATOM   1540 C CG    . PHE A 1 191 ? -35.929 45.816 72.659  1.00 14.36 ? 191  PHE A CG    1 
ATOM   1541 C CD1   . PHE A 1 191 ? -36.497 45.654 71.397  1.00 14.77 ? 191  PHE A CD1   1 
ATOM   1542 C CD2   . PHE A 1 191 ? -34.911 46.757 72.819  1.00 14.83 ? 191  PHE A CD2   1 
ATOM   1543 C CE1   . PHE A 1 191 ? -36.053 46.405 70.299  1.00 14.93 ? 191  PHE A CE1   1 
ATOM   1544 C CE2   . PHE A 1 191 ? -34.455 47.516 71.737  1.00 14.78 ? 191  PHE A CE2   1 
ATOM   1545 C CZ    . PHE A 1 191 ? -35.024 47.338 70.473  1.00 15.36 ? 191  PHE A CZ    1 
ATOM   1546 N N     . VAL A 1 192 ? -35.591 43.072 76.143  1.00 12.91 ? 192  VAL A N     1 
ATOM   1547 C CA    . VAL A 1 192 ? -35.881 42.224 77.296  1.00 12.44 ? 192  VAL A CA    1 
ATOM   1548 C C     . VAL A 1 192 ? -37.317 41.711 77.319  1.00 12.81 ? 192  VAL A C     1 
ATOM   1549 O O     . VAL A 1 192 ? -37.550 40.537 77.572  1.00 11.75 ? 192  VAL A O     1 
ATOM   1550 C CB    . VAL A 1 192 ? -35.584 42.953 78.633  1.00 12.08 ? 192  VAL A CB    1 
ATOM   1551 C CG1   . VAL A 1 192 ? -35.884 42.027 79.807  1.00 11.14 ? 192  VAL A CG1   1 
ATOM   1552 C CG2   . VAL A 1 192 ? -34.128 43.391 78.678  1.00 12.03 ? 192  VAL A CG2   1 
ATOM   1553 N N     . LYS A 1 193 ? -38.275 42.593 77.045  1.00 13.62 ? 193  LYS A N     1 
ATOM   1554 C CA    . LYS A 1 193 ? -39.687 42.225 77.049  1.00 14.50 ? 193  LYS A CA    1 
ATOM   1555 C C     . LYS A 1 193 ? -39.977 41.027 76.153  1.00 15.01 ? 193  LYS A C     1 
ATOM   1556 O O     . LYS A 1 193 ? -40.885 40.248 76.427  1.00 15.81 ? 193  LYS A O     1 
ATOM   1557 C CB    . LYS A 1 193 ? -40.545 43.401 76.576  1.00 15.42 ? 193  LYS A CB    1 
ATOM   1558 C CG    . LYS A 1 193 ? -40.481 43.622 75.068  1.00 17.04 ? 193  LYS A CG    1 
ATOM   1559 C CD    . LYS A 1 193 ? -41.424 44.710 74.618  1.00 18.59 ? 193  LYS A CD    1 
ATOM   1560 C CE    . LYS A 1 193 ? -41.257 45.001 73.139  1.00 18.89 ? 193  LYS A CE    1 
ATOM   1561 N NZ    . LYS A 1 193 ? -41.623 43.842 72.280  1.00 19.92 ? 193  LYS A NZ    1 
ATOM   1562 N N     . ASP A 1 194 ? -39.210 40.882 75.079  1.00 15.02 ? 194  ASP A N     1 
ATOM   1563 C CA    . ASP A 1 194 ? -39.417 39.789 74.138  1.00 14.83 ? 194  ASP A CA    1 
ATOM   1564 C C     . ASP A 1 194 ? -38.924 38.415 74.604  1.00 14.70 ? 194  ASP A C     1 
ATOM   1565 O O     . ASP A 1 194 ? -39.281 37.396 74.019  1.00 14.52 ? 194  ASP A O     1 
ATOM   1566 C CB    . ASP A 1 194 ? -38.748 40.139 72.813  1.00 15.87 ? 194  ASP A CB    1 
ATOM   1567 C CG    . ASP A 1 194 ? -39.300 41.404 72.206  1.00 17.16 ? 194  ASP A CG    1 
ATOM   1568 O OD1   . ASP A 1 194 ? -40.532 41.501 72.048  1.00 17.82 ? 194  ASP A OD1   1 
ATOM   1569 O OD2   . ASP A 1 194 ? -38.508 42.308 71.882  1.00 18.19 ? 194  ASP A OD2   1 
ATOM   1570 N N     . LEU A 1 195 ? -38.113 38.388 75.657  1.00 14.45 ? 195  LEU A N     1 
ATOM   1571 C CA    . LEU A 1 195 ? -37.554 37.136 76.154  1.00 14.18 ? 195  LEU A CA    1 
ATOM   1572 C C     . LEU A 1 195 ? -38.112 36.729 77.509  1.00 14.23 ? 195  LEU A C     1 
ATOM   1573 O O     . LEU A 1 195 ? -37.751 35.684 78.036  1.00 14.65 ? 195  LEU A O     1 
ATOM   1574 C CB    . LEU A 1 195 ? -36.025 37.251 76.247  1.00 14.32 ? 195  LEU A CB    1 
ATOM   1575 C CG    . LEU A 1 195 ? -35.274 37.754 75.001  1.00 15.22 ? 195  LEU A CG    1 
ATOM   1576 C CD1   . LEU A 1 195 ? -33.808 37.935 75.338  1.00 14.62 ? 195  LEU A CD1   1 
ATOM   1577 C CD2   . LEU A 1 195 ? -35.431 36.763 73.841  1.00 15.30 ? 195  LEU A CD2   1 
ATOM   1578 N N     . LEU A 1 196 ? -38.989 37.550 78.072  1.00 14.35 ? 196  LEU A N     1 
ATOM   1579 C CA    . LEU A 1 196 ? -39.571 37.252 79.373  1.00 14.27 ? 196  LEU A CA    1 
ATOM   1580 C C     . LEU A 1 196 ? -40.524 36.062 79.355  1.00 14.65 ? 196  LEU A C     1 
ATOM   1581 O O     . LEU A 1 196 ? -41.154 35.760 78.339  1.00 14.50 ? 196  LEU A O     1 
ATOM   1582 C CB    . LEU A 1 196 ? -40.305 38.478 79.915  1.00 13.97 ? 196  LEU A CB    1 
ATOM   1583 C CG    . LEU A 1 196 ? -39.458 39.719 80.195  1.00 14.54 ? 196  LEU A CG    1 
ATOM   1584 C CD1   . LEU A 1 196 ? -40.365 40.830 80.694  1.00 14.83 ? 196  LEU A CD1   1 
ATOM   1585 C CD2   . LEU A 1 196 ? -38.387 39.411 81.224  1.00 14.45 ? 196  LEU A CD2   1 
ATOM   1586 N N     . LEU A 1 197 ? -40.608 35.381 80.493  1.00 14.88 ? 197  LEU A N     1 
ATOM   1587 C CA    . LEU A 1 197 ? -41.493 34.235 80.651  1.00 14.57 ? 197  LEU A CA    1 
ATOM   1588 C C     . LEU A 1 197 ? -42.856 34.765 81.056  1.00 14.82 ? 197  LEU A C     1 
ATOM   1589 O O     . LEU A 1 197 ? -42.987 35.928 81.441  1.00 14.95 ? 197  LEU A O     1 
ATOM   1590 C CB    . LEU A 1 197 ? -40.995 33.315 81.767  1.00 14.23 ? 197  LEU A CB    1 
ATOM   1591 C CG    . LEU A 1 197 ? -39.761 32.444 81.550  1.00 14.28 ? 197  LEU A CG    1 
ATOM   1592 C CD1   . LEU A 1 197 ? -39.349 31.832 82.877  1.00 14.34 ? 197  LEU A CD1   1 
ATOM   1593 C CD2   . LEU A 1 197 ? -40.059 31.366 80.547  1.00 13.45 ? 197  LEU A CD2   1 
ATOM   1594 N N     . PRO A 1 198 ? -43.897 33.923 80.960  1.00 14.94 ? 198  PRO A N     1 
ATOM   1595 C CA    . PRO A 1 198 ? -45.232 34.379 81.353  1.00 14.58 ? 198  PRO A CA    1 
ATOM   1596 C C     . PRO A 1 198 ? -45.193 34.691 82.853  1.00 14.54 ? 198  PRO A C     1 
ATOM   1597 O O     . PRO A 1 198 ? -44.397 34.115 83.587  1.00 13.88 ? 198  PRO A O     1 
ATOM   1598 C CB    . PRO A 1 198 ? -46.112 33.177 81.025  1.00 14.70 ? 198  PRO A CB    1 
ATOM   1599 C CG    . PRO A 1 198 ? -45.417 32.577 79.825  1.00 14.59 ? 198  PRO A CG    1 
ATOM   1600 C CD    . PRO A 1 198 ? -43.967 32.626 80.262  1.00 14.81 ? 198  PRO A CD    1 
ATOM   1601 N N     . ASP A 1 199 ? -46.040 35.609 83.298  1.00 15.46 ? 199  ASP A N     1 
ATOM   1602 C CA    . ASP A 1 199 ? -46.084 36.010 84.700  1.00 16.04 ? 199  ASP A CA    1 
ATOM   1603 C C     . ASP A 1 199 ? -46.308 34.852 85.673  1.00 16.83 ? 199  ASP A C     1 
ATOM   1604 O O     . ASP A 1 199 ? -45.755 34.842 86.777  1.00 16.14 ? 199  ASP A O     1 
ATOM   1605 C CB    . ASP A 1 199 ? -47.183 37.061 84.916  1.00 16.49 ? 199  ASP A CB    1 
ATOM   1606 C CG    . ASP A 1 199 ? -46.760 38.457 84.497  1.00 17.18 ? 199  ASP A CG    1 
ATOM   1607 O OD1   . ASP A 1 199 ? -45.599 38.629 84.079  1.00 18.22 ? 199  ASP A OD1   1 
ATOM   1608 O OD2   . ASP A 1 199 ? -47.586 39.388 84.590  1.00 16.33 ? 199  ASP A OD2   1 
ATOM   1609 N N     . SER A 1 200 ? -47.121 33.881 85.269  1.00 17.35 ? 200  SER A N     1 
ATOM   1610 C CA    . SER A 1 200 ? -47.429 32.744 86.131  1.00 18.77 ? 200  SER A CA    1 
ATOM   1611 C C     . SER A 1 200 ? -46.212 31.939 86.547  1.00 19.25 ? 200  SER A C     1 
ATOM   1612 O O     . SER A 1 200 ? -46.216 31.297 87.595  1.00 20.42 ? 200  SER A O     1 
ATOM   1613 C CB    . SER A 1 200 ? -48.435 31.812 85.445  1.00 18.93 ? 200  SER A CB    1 
ATOM   1614 O OG    . SER A 1 200 ? -47.932 31.312 84.218  1.00 20.13 ? 200  SER A OG    1 
ATOM   1615 N N     . GLU A 1 201 ? -45.165 31.982 85.732  1.00 19.76 ? 201  GLU A N     1 
ATOM   1616 C CA    . GLU A 1 201 ? -43.945 31.225 86.001  1.00 19.47 ? 201  GLU A CA    1 
ATOM   1617 C C     . GLU A 1 201 ? -42.879 31.981 86.787  1.00 18.33 ? 201  GLU A C     1 
ATOM   1618 O O     . GLU A 1 201 ? -41.841 31.415 87.143  1.00 18.22 ? 201  GLU A O     1 
ATOM   1619 C CB    . GLU A 1 201 ? -43.358 30.748 84.673  1.00 20.49 ? 201  GLU A CB    1 
ATOM   1620 C CG    . GLU A 1 201 ? -44.266 29.788 83.937  1.00 22.37 ? 201  GLU A CG    1 
ATOM   1621 C CD    . GLU A 1 201 ? -43.763 29.468 82.557  1.00 23.87 ? 201  GLU A CD    1 
ATOM   1622 O OE1   . GLU A 1 201 ? -42.537 29.323 82.382  1.00 24.91 ? 201  GLU A OE1   1 
ATOM   1623 O OE2   . GLU A 1 201 ? -44.596 29.349 81.639  1.00 25.24 ? 201  GLU A OE2   1 
ATOM   1624 N N     . VAL A 1 202 ? -43.137 33.252 87.070  1.00 17.75 ? 202  VAL A N     1 
ATOM   1625 C CA    . VAL A 1 202 ? -42.163 34.071 87.781  1.00 17.84 ? 202  VAL A CA    1 
ATOM   1626 C C     . VAL A 1 202 ? -42.737 34.850 88.959  1.00 18.48 ? 202  VAL A C     1 
ATOM   1627 O O     . VAL A 1 202 ? -42.083 35.755 89.476  1.00 16.86 ? 202  VAL A O     1 
ATOM   1628 C CB    . VAL A 1 202 ? -41.493 35.073 86.814  1.00 17.87 ? 202  VAL A CB    1 
ATOM   1629 C CG1   . VAL A 1 202 ? -40.674 34.326 85.761  1.00 17.51 ? 202  VAL A CG1   1 
ATOM   1630 C CG2   . VAL A 1 202 ? -42.558 35.908 86.129  1.00 17.63 ? 202  VAL A CG2   1 
ATOM   1631 N N     . GLU A 1 203 ? -43.946 34.492 89.386  1.00 19.44 ? 203  GLU A N     1 
ATOM   1632 C CA    . GLU A 1 203 ? -44.600 35.173 90.502  1.00 21.61 ? 203  GLU A CA    1 
ATOM   1633 C C     . GLU A 1 203 ? -43.722 35.168 91.744  1.00 20.43 ? 203  GLU A C     1 
ATOM   1634 O O     . GLU A 1 203 ? -43.740 36.122 92.521  1.00 21.08 ? 203  GLU A O     1 
ATOM   1635 C CB    . GLU A 1 203 ? -45.930 34.495 90.870  1.00 24.09 ? 203  GLU A CB    1 
ATOM   1636 C CG    . GLU A 1 203 ? -46.882 34.249 89.725  1.00 27.60 ? 203  GLU A CG    1 
ATOM   1637 C CD    . GLU A 1 203 ? -48.036 33.332 90.120  1.00 29.46 ? 203  GLU A CD    1 
ATOM   1638 O OE1   . GLU A 1 203 ? -47.793 32.338 90.839  1.00 30.65 ? 203  GLU A OE1   1 
ATOM   1639 O OE2   . GLU A 1 203 ? -49.182 33.591 89.700  1.00 30.75 ? 203  GLU A OE2   1 
ATOM   1640 N N     . HIS A 1 204 ? -42.967 34.085 91.930  1.00 19.06 ? 204  HIS A N     1 
ATOM   1641 C CA    . HIS A 1 204 ? -42.100 33.938 93.095  1.00 17.69 ? 204  HIS A CA    1 
ATOM   1642 C C     . HIS A 1 204 ? -40.926 34.896 93.107  1.00 17.32 ? 204  HIS A C     1 
ATOM   1643 O O     . HIS A 1 204 ? -40.283 35.079 94.134  1.00 17.79 ? 204  HIS A O     1 
ATOM   1644 C CB    . HIS A 1 204 ? -41.580 32.501 93.194  1.00 18.02 ? 204  HIS A CB    1 
ATOM   1645 C CG    . HIS A 1 204 ? -40.844 32.029 91.974  1.00 17.50 ? 204  HIS A CG    1 
ATOM   1646 N ND1   . HIS A 1 204 ? -41.452 31.874 90.747  1.00 17.04 ? 204  HIS A ND1   1 
ATOM   1647 C CD2   . HIS A 1 204 ? -39.555 31.647 91.804  1.00 17.35 ? 204  HIS A CD2   1 
ATOM   1648 C CE1   . HIS A 1 204 ? -40.572 31.414 89.876  1.00 17.36 ? 204  HIS A CE1   1 
ATOM   1649 N NE2   . HIS A 1 204 ? -39.413 31.268 90.492  1.00 17.13 ? 204  HIS A NE2   1 
ATOM   1650 N N     . LEU A 1 205 ? -40.647 35.510 91.967  1.00 16.98 ? 205  LEU A N     1 
ATOM   1651 C CA    . LEU A 1 205 ? -39.539 36.449 91.859  1.00 16.98 ? 205  LEU A CA    1 
ATOM   1652 C C     . LEU A 1 205 ? -40.000 37.881 92.093  1.00 18.22 ? 205  LEU A C     1 
ATOM   1653 O O     . LEU A 1 205 ? -39.194 38.796 92.126  1.00 18.73 ? 205  LEU A O     1 
ATOM   1654 C CB    . LEU A 1 205 ? -38.889 36.333 90.477  1.00 15.29 ? 205  LEU A CB    1 
ATOM   1655 C CG    . LEU A 1 205 ? -38.349 34.946 90.118  1.00 14.34 ? 205  LEU A CG    1 
ATOM   1656 C CD1   . LEU A 1 205 ? -37.894 34.930 88.673  1.00 14.49 ? 205  LEU A CD1   1 
ATOM   1657 C CD2   . LEU A 1 205 ? -37.210 34.583 91.043  1.00 14.02 ? 205  LEU A CD2   1 
ATOM   1658 N N     . VAL A 1 206 ? -41.302 38.076 92.248  1.00 20.01 ? 206  VAL A N     1 
ATOM   1659 C CA    . VAL A 1 206 ? -41.843 39.407 92.479  1.00 21.60 ? 206  VAL A CA    1 
ATOM   1660 C C     . VAL A 1 206 ? -41.598 39.859 93.913  1.00 23.26 ? 206  VAL A C     1 
ATOM   1661 O O     . VAL A 1 206 ? -41.948 39.170 94.859  1.00 23.96 ? 206  VAL A O     1 
ATOM   1662 C CB    . VAL A 1 206 ? -43.361 39.444 92.212  1.00 21.63 ? 206  VAL A CB    1 
ATOM   1663 C CG1   . VAL A 1 206 ? -43.918 40.806 92.585  1.00 21.80 ? 206  VAL A CG1   1 
ATOM   1664 C CG2   . VAL A 1 206 ? -43.639 39.137 90.752  1.00 21.38 ? 206  VAL A CG2   1 
ATOM   1665 N N     . ILE A 1 207 ? -40.976 41.013 94.084  1.00 24.72 ? 207  ILE A N     1 
ATOM   1666 C CA    . ILE A 1 207 ? -40.749 41.507 95.426  1.00 26.97 ? 207  ILE A CA    1 
ATOM   1667 C C     . ILE A 1 207 ? -41.309 42.913 95.505  1.00 27.98 ? 207  ILE A C     1 
ATOM   1668 O O     . ILE A 1 207 ? -41.161 43.708 94.570  1.00 27.62 ? 207  ILE A O     1 
ATOM   1669 C CB    . ILE A 1 207 ? -39.251 41.518 95.797  1.00 27.67 ? 207  ILE A CB    1 
ATOM   1670 C CG1   . ILE A 1 207 ? -38.479 42.432 94.860  1.00 27.62 ? 207  ILE A CG1   1 
ATOM   1671 C CG2   . ILE A 1 207 ? -38.679 40.106 95.712  1.00 28.35 ? 207  ILE A CG2   1 
ATOM   1672 C CD1   . ILE A 1 207 ? -37.006 42.451 95.165  1.00 28.79 ? 207  ILE A CD1   1 
ATOM   1673 N N     . ASP A 1 208 ? -41.985 43.202 96.611  1.00 28.93 ? 208  ASP A N     1 
ATOM   1674 C CA    . ASP A 1 208 ? -42.568 44.514 96.818  1.00 30.08 ? 208  ASP A CA    1 
ATOM   1675 C C     . ASP A 1 208 ? -41.841 45.213 97.958  1.00 29.90 ? 208  ASP A C     1 
ATOM   1676 O O     . ASP A 1 208 ? -42.193 45.051 99.126  1.00 29.92 ? 208  ASP A O     1 
ATOM   1677 C CB    . ASP A 1 208 ? -44.049 44.392 97.165  1.00 32.00 ? 208  ASP A CB    1 
ATOM   1678 C CG    . ASP A 1 208 ? -44.755 45.731 97.163  1.00 33.62 ? 208  ASP A CG    1 
ATOM   1679 O OD1   . ASP A 1 208 ? -44.128 46.741 97.549  1.00 34.56 ? 208  ASP A OD1   1 
ATOM   1680 O OD2   . ASP A 1 208 ? -45.943 45.774 96.783  1.00 34.96 ? 208  ASP A OD2   1 
ATOM   1681 N N     . ARG A 1 209 ? -40.817 45.984 97.628  1.00 29.31 ? 209  ARG A N     1 
ATOM   1682 C CA    . ARG A 1 209 ? -40.094 46.688 98.665  1.00 29.68 ? 209  ARG A CA    1 
ATOM   1683 C C     . ARG A 1 209 ? -40.642 48.082 98.872  1.00 29.79 ? 209  ARG A C     1 
ATOM   1684 O O     . ARG A 1 209 ? -40.776 48.864 97.930  1.00 29.10 ? 209  ARG A O     1 
ATOM   1685 C CB    . ARG A 1 209 ? -38.599 46.712 98.353  1.00 29.43 ? 209  ARG A CB    1 
ATOM   1686 C CG    . ARG A 1 209 ? -37.961 45.421 98.792  1.00 29.29 ? 209  ARG A CG    1 
ATOM   1687 C CD    . ARG A 1 209 ? -36.488 45.401 98.603  1.00 29.51 ? 209  ARG A CD    1 
ATOM   1688 N NE    . ARG A 1 209 ? -35.793 46.446 99.336  1.00 28.92 ? 209  ARG A NE    1 
ATOM   1689 C CZ    . ARG A 1 209 ? -34.584 46.274 99.858  1.00 29.06 ? 209  ARG A CZ    1 
ATOM   1690 N NH1   . ARG A 1 209 ? -33.982 45.102 99.728  1.00 29.11 ? 209  ARG A NH1   1 
ATOM   1691 N NH2   . ARG A 1 209 ? -33.960 47.270 100.469 1.00 28.75 ? 209  ARG A NH2   1 
ATOM   1692 N N     . LYS A 1 210 ? -40.978 48.376 100.121 1.00 30.22 ? 210  LYS A N     1 
ATOM   1693 C CA    . LYS A 1 210 ? -41.537 49.665 100.466 1.00 31.03 ? 210  LYS A CA    1 
ATOM   1694 C C     . LYS A 1 210 ? -40.515 50.787 100.397 1.00 30.29 ? 210  LYS A C     1 
ATOM   1695 O O     . LYS A 1 210 ? -40.847 51.950 100.595 1.00 30.28 ? 210  LYS A O     1 
ATOM   1696 C CB    . LYS A 1 210 ? -42.204 49.565 101.838 1.00 32.63 ? 210  LYS A CB    1 
ATOM   1697 C CG    . LYS A 1 210 ? -43.360 48.564 101.783 1.00 34.72 ? 210  LYS A CG    1 
ATOM   1698 C CD    . LYS A 1 210 ? -44.084 48.349 103.096 1.00 36.62 ? 210  LYS A CD    1 
ATOM   1699 C CE    . LYS A 1 210 ? -45.178 47.286 102.910 1.00 37.70 ? 210  LYS A CE    1 
ATOM   1700 N NZ    . LYS A 1 210 ? -45.914 46.955 104.173 1.00 38.49 ? 210  LYS A NZ    1 
ATOM   1701 N N     . ASP A 1 211 ? -39.269 50.440 100.092 1.00 29.67 ? 211  ASP A N     1 
ATOM   1702 C CA    . ASP A 1 211 ? -38.227 51.450 99.963  1.00 29.41 ? 211  ASP A CA    1 
ATOM   1703 C C     . ASP A 1 211 ? -37.916 51.650 98.478  1.00 29.49 ? 211  ASP A C     1 
ATOM   1704 O O     . ASP A 1 211 ? -36.872 52.186 98.110  1.00 29.33 ? 211  ASP A O     1 
ATOM   1705 C CB    . ASP A 1 211 ? -36.974 51.040 100.735 1.00 28.90 ? 211  ASP A CB    1 
ATOM   1706 C CG    . ASP A 1 211 ? -36.290 49.846 100.139 1.00 29.34 ? 211  ASP A CG    1 
ATOM   1707 O OD1   . ASP A 1 211 ? -36.983 48.865 99.799  1.00 30.03 ? 211  ASP A OD1   1 
ATOM   1708 O OD2   . ASP A 1 211 ? -35.054 49.884 100.022 1.00 29.28 ? 211  ASP A OD2   1 
ATOM   1709 N N     . LEU A 1 212 ? -38.843 51.203 97.633  1.00 29.69 ? 212  LEU A N     1 
ATOM   1710 C CA    . LEU A 1 212 ? -38.719 51.350 96.185  1.00 29.83 ? 212  LEU A CA    1 
ATOM   1711 C C     . LEU A 1 212 ? -38.924 52.808 95.821  1.00 29.97 ? 212  LEU A C     1 
ATOM   1712 O O     . LEU A 1 212 ? -39.872 53.445 96.281  1.00 29.71 ? 212  LEU A O     1 
ATOM   1713 C CB    . LEU A 1 212 ? -39.780 50.520 95.452  1.00 29.89 ? 212  LEU A CB    1 
ATOM   1714 C CG    . LEU A 1 212 ? -39.978 50.876 93.969  1.00 30.00 ? 212  LEU A CG    1 
ATOM   1715 C CD1   . LEU A 1 212 ? -38.699 50.607 93.186  1.00 30.12 ? 212  LEU A CD1   1 
ATOM   1716 C CD2   . LEU A 1 212 ? -41.128 50.066 93.396  1.00 29.99 ? 212  LEU A CD2   1 
ATOM   1717 N N     . VAL A 1 213 ? -38.033 53.334 94.993  1.00 30.25 ? 213  VAL A N     1 
ATOM   1718 C CA    . VAL A 1 213 ? -38.133 54.716 94.560  1.00 30.15 ? 213  VAL A CA    1 
ATOM   1719 C C     . VAL A 1 213 ? -38.017 54.787 93.043  1.00 30.26 ? 213  VAL A C     1 
ATOM   1720 O O     . VAL A 1 213 ? -36.933 54.615 92.488  1.00 29.84 ? 213  VAL A O     1 
ATOM   1721 C CB    . VAL A 1 213 ? -37.024 55.580 95.192  1.00 30.37 ? 213  VAL A CB    1 
ATOM   1722 C CG1   . VAL A 1 213 ? -37.115 57.016 94.668  1.00 30.38 ? 213  VAL A CG1   1 
ATOM   1723 C CG2   . VAL A 1 213 ? -37.148 55.547 96.709  1.00 29.66 ? 213  VAL A CG2   1 
ATOM   1724 N N     . MET A 1 214 ? -39.142 55.018 92.375  1.00 30.47 ? 214  MET A N     1 
ATOM   1725 C CA    . MET A 1 214 ? -39.138 55.123 90.923  1.00 30.95 ? 214  MET A CA    1 
ATOM   1726 C C     . MET A 1 214 ? -38.576 56.486 90.559  1.00 30.56 ? 214  MET A C     1 
ATOM   1727 O O     . MET A 1 214 ? -39.142 57.511 90.922  1.00 31.34 ? 214  MET A O     1 
ATOM   1728 C CB    . MET A 1 214 ? -40.553 54.966 90.372  1.00 31.41 ? 214  MET A CB    1 
ATOM   1729 C CG    . MET A 1 214 ? -41.126 53.569 90.546  1.00 31.79 ? 214  MET A CG    1 
ATOM   1730 S SD    . MET A 1 214 ? -40.106 52.299 89.769  1.00 32.83 ? 214  MET A SD    1 
ATOM   1731 C CE    . MET A 1 214 ? -40.550 52.501 88.078  1.00 31.99 ? 214  MET A CE    1 
ATOM   1732 N N     . THR A 1 215 ? -37.454 56.493 89.850  1.00 30.02 ? 215  THR A N     1 
ATOM   1733 C CA    . THR A 1 215 ? -36.807 57.738 89.470  1.00 29.27 ? 215  THR A CA    1 
ATOM   1734 C C     . THR A 1 215 ? -37.183 58.224 88.079  1.00 29.58 ? 215  THR A C     1 
ATOM   1735 O O     . THR A 1 215 ? -37.256 59.428 87.840  1.00 30.23 ? 215  THR A O     1 
ATOM   1736 C CB    . THR A 1 215 ? -35.275 57.605 89.561  1.00 28.78 ? 215  THR A CB    1 
ATOM   1737 O OG1   . THR A 1 215 ? -34.830 56.538 88.717  1.00 28.19 ? 215  THR A OG1   1 
ATOM   1738 C CG2   . THR A 1 215 ? -34.861 57.314 90.996  1.00 28.81 ? 215  THR A CG2   1 
ATOM   1739 N N     . ASN A 1 216 ? -37.426 57.291 87.164  1.00 29.30 ? 216  ASN A N     1 
ATOM   1740 C CA    . ASN A 1 216 ? -37.791 57.644 85.801  1.00 28.71 ? 216  ASN A CA    1 
ATOM   1741 C C     . ASN A 1 216 ? -39.051 56.926 85.365  1.00 28.48 ? 216  ASN A C     1 
ATOM   1742 O O     . ASN A 1 216 ? -39.360 55.841 85.851  1.00 28.87 ? 216  ASN A O     1 
ATOM   1743 C CB    . ASN A 1 216 ? -36.662 57.298 84.837  1.00 29.10 ? 216  ASN A CB    1 
ATOM   1744 C CG    . ASN A 1 216 ? -35.375 57.998 85.184  1.00 29.87 ? 216  ASN A CG    1 
ATOM   1745 O OD1   . ASN A 1 216 ? -34.688 57.631 86.139  1.00 30.76 ? 216  ASN A OD1   1 
ATOM   1746 N ND2   . ASN A 1 216 ? -35.041 59.023 84.413  1.00 30.37 ? 216  ASN A ND2   1 
ATOM   1747 N N     . GLN A 1 217 ? -39.767 57.537 84.430  1.00 28.03 ? 217  GLN A N     1 
ATOM   1748 C CA    . GLN A 1 217 ? -41.006 56.974 83.922  1.00 27.66 ? 217  GLN A CA    1 
ATOM   1749 C C     . GLN A 1 217 ? -40.752 55.891 82.885  1.00 25.88 ? 217  GLN A C     1 
ATOM   1750 O O     . GLN A 1 217 ? -39.817 55.987 82.090  1.00 26.02 ? 217  GLN A O     1 
ATOM   1751 C CB    . GLN A 1 217 ? -41.871 58.082 83.308  1.00 29.66 ? 217  GLN A CB    1 
ATOM   1752 C CG    . GLN A 1 217 ? -43.144 57.569 82.648  1.00 32.35 ? 217  GLN A CG    1 
ATOM   1753 C CD    . GLN A 1 217 ? -43.963 58.675 81.999  1.00 34.01 ? 217  GLN A CD    1 
ATOM   1754 O OE1   . GLN A 1 217 ? -43.426 59.521 81.271  1.00 35.04 ? 217  GLN A OE1   1 
ATOM   1755 N NE2   . GLN A 1 217 ? -45.274 58.666 82.248  1.00 34.39 ? 217  GLN A NE2   1 
ATOM   1756 N N     . GLU A 1 218 ? -41.596 54.864 82.904  1.00 23.59 ? 218  GLU A N     1 
ATOM   1757 C CA    . GLU A 1 218 ? -41.499 53.759 81.960  1.00 22.17 ? 218  GLU A CA    1 
ATOM   1758 C C     . GLU A 1 218 ? -41.538 54.298 80.532  1.00 22.44 ? 218  GLU A C     1 
ATOM   1759 O O     . GLU A 1 218 ? -42.183 55.308 80.253  1.00 22.45 ? 218  GLU A O     1 
ATOM   1760 C CB    . GLU A 1 218 ? -42.658 52.774 82.185  1.00 20.18 ? 218  GLU A CB    1 
ATOM   1761 C CG    . GLU A 1 218 ? -42.835 51.716 81.100  1.00 18.77 ? 218  GLU A CG    1 
ATOM   1762 C CD    . GLU A 1 218 ? -41.682 50.730 81.028  1.00 18.04 ? 218  GLU A CD    1 
ATOM   1763 O OE1   . GLU A 1 218 ? -40.536 51.163 80.798  1.00 18.00 ? 218  GLU A OE1   1 
ATOM   1764 O OE2   . GLU A 1 218 ? -41.920 49.516 81.200  1.00 17.57 ? 218  GLU A OE2   1 
ATOM   1765 N N     . ILE A 1 219 ? -40.832 53.625 79.633  1.00 22.80 ? 219  ILE A N     1 
ATOM   1766 C CA    . ILE A 1 219 ? -40.794 54.023 78.237  1.00 22.70 ? 219  ILE A CA    1 
ATOM   1767 C C     . ILE A 1 219 ? -41.687 53.086 77.431  1.00 23.44 ? 219  ILE A C     1 
ATOM   1768 O O     . ILE A 1 219 ? -41.798 51.901 77.738  1.00 23.62 ? 219  ILE A O     1 
ATOM   1769 C CB    . ILE A 1 219 ? -39.356 53.967 77.685  1.00 22.01 ? 219  ILE A CB    1 
ATOM   1770 C CG1   . ILE A 1 219 ? -38.685 52.646 78.090  1.00 21.84 ? 219  ILE A CG1   1 
ATOM   1771 C CG2   . ILE A 1 219 ? -38.576 55.159 78.193  1.00 22.14 ? 219  ILE A CG2   1 
ATOM   1772 C CD1   . ILE A 1 219 ? -37.421 52.309 77.316  1.00 21.37 ? 219  ILE A CD1   1 
ATOM   1773 N N     . GLU A 1 220 ? -42.333 53.621 76.404  1.00 25.18 ? 220  GLU A N     1 
ATOM   1774 C CA    . GLU A 1 220 ? -43.216 52.810 75.576  1.00 27.20 ? 220  GLU A CA    1 
ATOM   1775 C C     . GLU A 1 220 ? -42.509 52.340 74.309  1.00 27.15 ? 220  GLU A C     1 
ATOM   1776 O O     . GLU A 1 220 ? -42.911 51.349 73.697  1.00 27.70 ? 220  GLU A O     1 
ATOM   1777 C CB    . GLU A 1 220 ? -44.478 53.600 75.219  1.00 28.68 ? 220  GLU A CB    1 
ATOM   1778 C CG    . GLU A 1 220 ? -45.314 54.008 76.432  1.00 29.67 ? 220  GLU A CG    1 
ATOM   1779 C CD    . GLU A 1 220 ? -45.829 52.816 77.222  1.00 30.44 ? 220  GLU A CD    1 
ATOM   1780 O OE1   . GLU A 1 220 ? -45.542 52.741 78.440  1.00 30.70 ? 220  GLU A OE1   1 
ATOM   1781 O OE2   . GLU A 1 220 ? -46.525 51.959 76.625  1.00 30.73 ? 220  GLU A OE2   1 
ATOM   1782 N N     . GLN A 1 221 ? -41.454 53.053 73.923  1.00 26.95 ? 221  GLN A N     1 
ATOM   1783 C CA    . GLN A 1 221 ? -40.685 52.689 72.745  1.00 26.51 ? 221  GLN A CA    1 
ATOM   1784 C C     . GLN A 1 221 ? -39.397 51.976 73.128  1.00 24.74 ? 221  GLN A C     1 
ATOM   1785 O O     . GLN A 1 221 ? -38.656 52.434 73.990  1.00 23.94 ? 221  GLN A O     1 
ATOM   1786 C CB    . GLN A 1 221 ? -40.358 53.923 71.913  1.00 28.73 ? 221  GLN A CB    1 
ATOM   1787 C CG    . GLN A 1 221 ? -41.551 54.459 71.142  1.00 32.71 ? 221  GLN A CG    1 
ATOM   1788 C CD    . GLN A 1 221 ? -41.145 55.170 69.861  1.00 34.50 ? 221  GLN A CD    1 
ATOM   1789 O OE1   . GLN A 1 221 ? -40.525 54.570 68.973  1.00 35.68 ? 221  GLN A OE1   1 
ATOM   1790 N NE2   . GLN A 1 221 ? -41.492 56.452 69.755  1.00 35.42 ? 221  GLN A NE2   1 
ATOM   1791 N N     . THR A 1 222 ? -39.143 50.843 72.484  1.00 22.94 ? 222  THR A N     1 
ATOM   1792 C CA    . THR A 1 222 ? -37.942 50.069 72.750  1.00 20.98 ? 222  THR A CA    1 
ATOM   1793 C C     . THR A 1 222 ? -36.714 50.866 72.343  1.00 20.31 ? 222  THR A C     1 
ATOM   1794 O O     . THR A 1 222 ? -36.744 51.639 71.387  1.00 20.38 ? 222  THR A O     1 
ATOM   1795 C CB    . THR A 1 222 ? -37.952 48.749 71.975  1.00 20.55 ? 222  THR A CB    1 
ATOM   1796 O OG1   . THR A 1 222 ? -38.168 49.017 70.585  1.00 20.65 ? 222  THR A OG1   1 
ATOM   1797 C CG2   . THR A 1 222 ? -39.047 47.831 72.496  1.00 20.41 ? 222  THR A CG2   1 
ATOM   1798 N N     . THR A 1 223 ? -35.629 50.668 73.077  1.00 19.64 ? 223  THR A N     1 
ATOM   1799 C CA    . THR A 1 223 ? -34.388 51.369 72.817  1.00 18.44 ? 223  THR A CA    1 
ATOM   1800 C C     . THR A 1 223 ? -33.233 50.411 73.106  1.00 18.60 ? 223  THR A C     1 
ATOM   1801 O O     . THR A 1 223 ? -33.282 49.641 74.064  1.00 18.51 ? 223  THR A O     1 
ATOM   1802 C CB    . THR A 1 223 ? -34.290 52.628 73.713  1.00 18.11 ? 223  THR A CB    1 
ATOM   1803 O OG1   . THR A 1 223 ? -33.028 53.274 73.511  1.00 18.16 ? 223  THR A OG1   1 
ATOM   1804 C CG2   . THR A 1 223 ? -34.438 52.255 75.173  1.00 17.36 ? 223  THR A CG2   1 
ATOM   1805 N N     . PRO A 1 224 ? -32.182 50.437 72.270  1.00 18.92 ? 224  PRO A N     1 
ATOM   1806 C CA    . PRO A 1 224 ? -31.029 49.556 72.462  1.00 18.76 ? 224  PRO A CA    1 
ATOM   1807 C C     . PRO A 1 224 ? -30.071 50.021 73.556  1.00 18.67 ? 224  PRO A C     1 
ATOM   1808 O O     . PRO A 1 224 ? -28.870 50.156 73.321  1.00 18.86 ? 224  PRO A O     1 
ATOM   1809 C CB    . PRO A 1 224 ? -30.373 49.558 71.087  1.00 18.97 ? 224  PRO A CB    1 
ATOM   1810 C CG    . PRO A 1 224 ? -30.576 50.981 70.659  1.00 18.63 ? 224  PRO A CG    1 
ATOM   1811 C CD    . PRO A 1 224 ? -32.029 51.235 71.037  1.00 18.37 ? 224  PRO A CD    1 
ATOM   1812 N N     . LYS A 1 225 ? -30.598 50.268 74.748  1.00 18.47 ? 225  LYS A N     1 
ATOM   1813 C CA    . LYS A 1 225 ? -29.757 50.687 75.859  1.00 18.43 ? 225  LYS A CA    1 
ATOM   1814 C C     . LYS A 1 225 ? -30.417 50.336 77.181  1.00 17.23 ? 225  LYS A C     1 
ATOM   1815 O O     . LYS A 1 225 ? -31.585 49.960 77.217  1.00 16.90 ? 225  LYS A O     1 
ATOM   1816 C CB    . LYS A 1 225 ? -29.480 52.191 75.775  1.00 20.00 ? 225  LYS A CB    1 
ATOM   1817 C CG    . LYS A 1 225 ? -30.674 53.082 76.032  1.00 21.70 ? 225  LYS A CG    1 
ATOM   1818 C CD    . LYS A 1 225 ? -30.357 54.516 75.623  1.00 23.45 ? 225  LYS A CD    1 
ATOM   1819 C CE    . LYS A 1 225 ? -31.212 55.521 76.382  1.00 24.55 ? 225  LYS A CE    1 
ATOM   1820 N NZ    . LYS A 1 225 ? -30.848 55.544 77.836  1.00 26.29 ? 225  LYS A NZ    1 
ATOM   1821 N N     . THR A 1 226 ? -29.661 50.418 78.268  1.00 16.61 ? 226  THR A N     1 
ATOM   1822 C CA    . THR A 1 226 ? -30.231 50.125 79.573  1.00 16.19 ? 226  THR A CA    1 
ATOM   1823 C C     . THR A 1 226 ? -30.992 51.368 79.999  1.00 15.75 ? 226  THR A C     1 
ATOM   1824 O O     . THR A 1 226 ? -30.510 52.488 79.857  1.00 15.75 ? 226  THR A O     1 
ATOM   1825 C CB    . THR A 1 226 ? -29.149 49.791 80.630  1.00 15.92 ? 226  THR A CB    1 
ATOM   1826 O OG1   . THR A 1 226 ? -28.216 50.874 80.738  1.00 17.12 ? 226  THR A OG1   1 
ATOM   1827 C CG2   . THR A 1 226 ? -28.407 48.515 80.246  1.00 15.39 ? 226  THR A CG2   1 
ATOM   1828 N N     . VAL A 1 227 ? -32.197 51.166 80.502  1.00 15.84 ? 227  VAL A N     1 
ATOM   1829 C CA    . VAL A 1 227 ? -33.032 52.274 80.932  1.00 16.04 ? 227  VAL A CA    1 
ATOM   1830 C C     . VAL A 1 227 ? -33.378 52.081 82.403  1.00 16.24 ? 227  VAL A C     1 
ATOM   1831 O O     . VAL A 1 227 ? -34.213 51.245 82.734  1.00 16.62 ? 227  VAL A O     1 
ATOM   1832 C CB    . VAL A 1 227 ? -34.340 52.315 80.107  1.00 14.99 ? 227  VAL A CB    1 
ATOM   1833 C CG1   . VAL A 1 227 ? -35.202 53.463 80.563  1.00 14.94 ? 227  VAL A CG1   1 
ATOM   1834 C CG2   . VAL A 1 227 ? -34.023 52.443 78.618  1.00 15.09 ? 227  VAL A CG2   1 
ATOM   1835 N N     . ARG A 1 228 ? -32.738 52.828 83.292  1.00 16.83 ? 228  ARG A N     1 
ATOM   1836 C CA    . ARG A 1 228 ? -33.062 52.671 84.704  1.00 18.04 ? 228  ARG A CA    1 
ATOM   1837 C C     . ARG A 1 228 ? -34.374 53.368 85.045  1.00 17.63 ? 228  ARG A C     1 
ATOM   1838 O O     . ARG A 1 228 ? -34.609 54.499 84.634  1.00 17.57 ? 228  ARG A O     1 
ATOM   1839 C CB    . ARG A 1 228 ? -31.971 53.222 85.610  1.00 19.11 ? 228  ARG A CB    1 
ATOM   1840 C CG    . ARG A 1 228 ? -32.267 52.858 87.056  1.00 20.33 ? 228  ARG A CG    1 
ATOM   1841 C CD    . ARG A 1 228 ? -31.399 53.574 88.034  1.00 21.40 ? 228  ARG A CD    1 
ATOM   1842 N NE    . ARG A 1 228 ? -30.012 53.146 87.970  1.00 21.91 ? 228  ARG A NE    1 
ATOM   1843 C CZ    . ARG A 1 228 ? -29.114 53.491 88.882  1.00 22.71 ? 228  ARG A CZ    1 
ATOM   1844 N NH1   . ARG A 1 228 ? -29.490 54.254 89.899  1.00 23.29 ? 228  ARG A NH1   1 
ATOM   1845 N NH2   . ARG A 1 228 ? -27.856 53.092 88.779  1.00 21.70 ? 228  ARG A NH2   1 
ATOM   1846 N N     . LEU A 1 229 ? -35.220 52.684 85.808  1.00 17.37 ? 229  LEU A N     1 
ATOM   1847 C CA    . LEU A 1 229 ? -36.516 53.225 86.190  1.00 16.94 ? 229  LEU A CA    1 
ATOM   1848 C C     . LEU A 1 229 ? -36.604 53.570 87.668  1.00 17.18 ? 229  LEU A C     1 
ATOM   1849 O O     . LEU A 1 229 ? -37.398 54.423 88.060  1.00 17.09 ? 229  LEU A O     1 
ATOM   1850 C CB    . LEU A 1 229 ? -37.625 52.229 85.834  1.00 16.09 ? 229  LEU A CB    1 
ATOM   1851 C CG    . LEU A 1 229 ? -37.806 51.926 84.343  1.00 15.45 ? 229  LEU A CG    1 
ATOM   1852 C CD1   . LEU A 1 229 ? -38.972 50.963 84.157  1.00 15.18 ? 229  LEU A CD1   1 
ATOM   1853 C CD2   . LEU A 1 229 ? -38.053 53.223 83.577  1.00 14.51 ? 229  LEU A CD2   1 
ATOM   1854 N N     . GLY A 1 230 ? -35.793 52.908 88.486  1.00 17.02 ? 230  GLY A N     1 
ATOM   1855 C CA    . GLY A 1 230 ? -35.820 53.171 89.914  1.00 17.34 ? 230  GLY A CA    1 
ATOM   1856 C C     . GLY A 1 230 ? -34.804 52.373 90.706  1.00 17.45 ? 230  GLY A C     1 
ATOM   1857 O O     . GLY A 1 230 ? -33.991 51.646 90.138  1.00 16.73 ? 230  GLY A O     1 
ATOM   1858 N N     . ILE A 1 231 ? -34.849 52.515 92.026  1.00 17.86 ? 231  ILE A N     1 
ATOM   1859 C CA    . ILE A 1 231 ? -33.930 51.804 92.905  1.00 19.04 ? 231  ILE A CA    1 
ATOM   1860 C C     . ILE A 1 231 ? -34.600 51.436 94.228  1.00 19.71 ? 231  ILE A C     1 
ATOM   1861 O O     . ILE A 1 231 ? -35.663 51.958 94.566  1.00 20.00 ? 231  ILE A O     1 
ATOM   1862 C CB    . ILE A 1 231 ? -32.693 52.666 93.268  1.00 19.11 ? 231  ILE A CB    1 
ATOM   1863 C CG1   . ILE A 1 231 ? -33.148 53.901 94.049  1.00 19.53 ? 231  ILE A CG1   1 
ATOM   1864 C CG2   . ILE A 1 231 ? -31.926 53.074 92.013  1.00 19.29 ? 231  ILE A CG2   1 
ATOM   1865 C CD1   . ILE A 1 231 ? -32.023 54.669 94.706  1.00 19.60 ? 231  ILE A CD1   1 
ATOM   1866 N N     . VAL A 1 232 ? -33.968 50.520 94.959  1.00 20.22 ? 232  VAL A N     1 
ATOM   1867 C CA    . VAL A 1 232 ? -34.422 50.111 96.283  1.00 20.30 ? 232  VAL A CA    1 
ATOM   1868 C C     . VAL A 1 232 ? -33.173 50.303 97.126  1.00 20.18 ? 232  VAL A C     1 
ATOM   1869 O O     . VAL A 1 232 ? -32.071 50.375 96.585  1.00 19.89 ? 232  VAL A O     1 
ATOM   1870 C CB    . VAL A 1 232 ? -34.863 48.622 96.352  1.00 20.59 ? 232  VAL A CB    1 
ATOM   1871 C CG1   . VAL A 1 232 ? -36.097 48.409 95.502  1.00 21.13 ? 232  VAL A CG1   1 
ATOM   1872 C CG2   . VAL A 1 232 ? -33.735 47.706 95.910  1.00 20.58 ? 232  VAL A CG2   1 
ATOM   1873 N N     . GLY A 1 233 ? -33.329 50.402 98.438  1.00 20.34 ? 233  GLY A N     1 
ATOM   1874 C CA    . GLY A 1 233 ? -32.166 50.592 99.284  1.00 20.60 ? 233  GLY A CA    1 
ATOM   1875 C C     . GLY A 1 233 ? -31.384 51.808 98.830  1.00 21.10 ? 233  GLY A C     1 
ATOM   1876 O O     . GLY A 1 233 ? -31.968 52.853 98.551  1.00 21.95 ? 233  GLY A O     1 
ATOM   1877 N N     . LYS A 1 234 ? -30.066 51.673 98.731  1.00 21.38 ? 234  LYS A N     1 
ATOM   1878 C CA    . LYS A 1 234 ? -29.214 52.783 98.312  1.00 20.88 ? 234  LYS A CA    1 
ATOM   1879 C C     . LYS A 1 234 ? -28.916 52.814 96.814  1.00 20.19 ? 234  LYS A C     1 
ATOM   1880 O O     . LYS A 1 234 ? -28.141 53.651 96.354  1.00 20.69 ? 234  LYS A O     1 
ATOM   1881 C CB    . LYS A 1 234 ? -27.889 52.738 99.068  1.00 21.26 ? 234  LYS A CB    1 
ATOM   1882 C CG    . LYS A 1 234 ? -28.017 52.740 100.576 1.00 22.70 ? 234  LYS A CG    1 
ATOM   1883 C CD    . LYS A 1 234 ? -26.640 52.792 101.198 1.00 23.69 ? 234  LYS A CD    1 
ATOM   1884 C CE    . LYS A 1 234 ? -26.701 52.877 102.700 1.00 24.42 ? 234  LYS A CE    1 
ATOM   1885 N NZ    . LYS A 1 234 ? -25.323 53.041 103.240 1.00 25.83 ? 234  LYS A NZ    1 
ATOM   1886 N N     . GLY A 1 235 ? -29.507 51.900 96.055  1.00 18.74 ? 235  GLY A N     1 
ATOM   1887 C CA    . GLY A 1 235 ? -29.261 51.887 94.625  1.00 17.04 ? 235  GLY A CA    1 
ATOM   1888 C C     . GLY A 1 235 ? -27.934 51.272 94.211  1.00 16.07 ? 235  GLY A C     1 
ATOM   1889 O O     . GLY A 1 235 ? -27.402 51.596 93.154  1.00 16.36 ? 235  GLY A O     1 
ATOM   1890 N N     . GLY A 1 236 ? -27.395 50.386 95.040  1.00 15.12 ? 236  GLY A N     1 
ATOM   1891 C CA    . GLY A 1 236 ? -26.138 49.743 94.709  1.00 14.34 ? 236  GLY A CA    1 
ATOM   1892 C C     . GLY A 1 236 ? -26.389 48.632 93.710  1.00 13.55 ? 236  GLY A C     1 
ATOM   1893 O O     . GLY A 1 236 ? -27.455 48.571 93.110  1.00 13.88 ? 236  GLY A O     1 
ATOM   1894 N N     . GLN A 1 237 ? -25.416 47.753 93.517  1.00 12.78 ? 237  GLN A N     1 
ATOM   1895 C CA    . GLN A 1 237 ? -25.593 46.654 92.581  1.00 12.37 ? 237  GLN A CA    1 
ATOM   1896 C C     . GLN A 1 237 ? -26.700 45.740 93.071  1.00 12.80 ? 237  GLN A C     1 
ATOM   1897 O O     . GLN A 1 237 ? -26.756 45.385 94.254  1.00 13.40 ? 237  GLN A O     1 
ATOM   1898 C CB    . GLN A 1 237 ? -24.283 45.886 92.425  1.00 12.16 ? 237  GLN A CB    1 
ATOM   1899 C CG    . GLN A 1 237 ? -23.291 46.611 91.530  1.00 12.02 ? 237  GLN A CG    1 
ATOM   1900 C CD    . GLN A 1 237 ? -21.917 45.976 91.524  1.00 12.95 ? 237  GLN A CD    1 
ATOM   1901 O OE1   . GLN A 1 237 ? -21.152 46.112 92.483  1.00 13.42 ? 237  GLN A OE1   1 
ATOM   1902 N NE2   . GLN A 1 237 ? -21.594 45.275 90.444  1.00 11.76 ? 237  GLN A NE2   1 
ATOM   1903 N N     . GLY A 1 238 ? -27.598 45.369 92.167  1.00 12.78 ? 238  GLY A N     1 
ATOM   1904 C CA    . GLY A 1 238 ? -28.706 44.513 92.554  1.00 11.87 ? 238  GLY A CA    1 
ATOM   1905 C C     . GLY A 1 238 ? -29.824 45.291 93.223  1.00 11.57 ? 238  GLY A C     1 
ATOM   1906 O O     . GLY A 1 238 ? -30.767 44.707 93.747  1.00 11.67 ? 238  GLY A O     1 
ATOM   1907 N N     . GLU A 1 239 ? -29.724 46.615 93.215  1.00 11.96 ? 239  GLU A N     1 
ATOM   1908 C CA    . GLU A 1 239 ? -30.758 47.455 93.819  1.00 12.75 ? 239  GLU A CA    1 
ATOM   1909 C C     . GLU A 1 239 ? -31.267 48.491 92.816  1.00 12.52 ? 239  GLU A C     1 
ATOM   1910 O O     . GLU A 1 239 ? -31.790 49.543 93.197  1.00 13.25 ? 239  GLU A O     1 
ATOM   1911 C CB    . GLU A 1 239 ? -30.204 48.162 95.056  1.00 13.04 ? 239  GLU A CB    1 
ATOM   1912 C CG    . GLU A 1 239 ? -29.525 47.231 96.034  1.00 13.74 ? 239  GLU A CG    1 
ATOM   1913 C CD    . GLU A 1 239 ? -29.202 47.913 97.336  1.00 14.86 ? 239  GLU A CD    1 
ATOM   1914 O OE1   . GLU A 1 239 ? -28.590 49.002 97.299  1.00 15.19 ? 239  GLU A OE1   1 
ATOM   1915 O OE2   . GLU A 1 239 ? -29.558 47.354 98.395  1.00 15.68 ? 239  GLU A OE2   1 
ATOM   1916 N N     . ARG A 1 240 ? -31.118 48.172 91.536  1.00 11.54 ? 240  ARG A N     1 
ATOM   1917 C CA    . ARG A 1 240 ? -31.532 49.047 90.449  1.00 11.34 ? 240  ARG A CA    1 
ATOM   1918 C C     . ARG A 1 240 ? -32.577 48.339 89.593  1.00 11.46 ? 240  ARG A C     1 
ATOM   1919 O O     . ARG A 1 240 ? -32.404 47.173 89.241  1.00 11.65 ? 240  ARG A O     1 
ATOM   1920 C CB    . ARG A 1 240 ? -30.314 49.409 89.599  1.00 10.53 ? 240  ARG A CB    1 
ATOM   1921 C CG    . ARG A 1 240 ? -29.206 50.075 90.392  1.00 10.31 ? 240  ARG A CG    1 
ATOM   1922 C CD    . ARG A 1 240 ? -27.831 49.707 89.851  1.00 10.23 ? 240  ARG A CD    1 
ATOM   1923 N NE    . ARG A 1 240 ? -26.758 50.261 90.680  1.00 10.10 ? 240  ARG A NE    1 
ATOM   1924 C CZ    . ARG A 1 240 ? -25.463 50.027 90.490  1.00 9.91  ? 240  ARG A CZ    1 
ATOM   1925 N NH1   . ARG A 1 240 ? -25.062 49.248 89.492  1.00 10.03 ? 240  ARG A NH1   1 
ATOM   1926 N NH2   . ARG A 1 240 ? -24.568 50.567 91.304  1.00 9.90  ? 240  ARG A NH2   1 
ATOM   1927 N N     . ILE A 1 241 ? -33.661 49.045 89.273  1.00 11.81 ? 241  ILE A N     1 
ATOM   1928 C CA    . ILE A 1 241 ? -34.747 48.494 88.464  1.00 12.13 ? 241  ILE A CA    1 
ATOM   1929 C C     . ILE A 1 241 ? -34.726 49.087 87.056  1.00 12.51 ? 241  ILE A C     1 
ATOM   1930 O O     . ILE A 1 241 ? -34.702 50.303 86.886  1.00 14.88 ? 241  ILE A O     1 
ATOM   1931 C CB    . ILE A 1 241 ? -36.149 48.770 89.103  1.00 11.61 ? 241  ILE A CB    1 
ATOM   1932 C CG1   . ILE A 1 241 ? -36.305 48.014 90.430  1.00 11.68 ? 241  ILE A CG1   1 
ATOM   1933 C CG2   . ILE A 1 241 ? -37.251 48.298 88.165  1.00 10.40 ? 241  ILE A CG2   1 
ATOM   1934 C CD1   . ILE A 1 241 ? -35.660 48.669 91.611  1.00 12.72 ? 241  ILE A CD1   1 
ATOM   1935 N N     . TYR A 1 242 ? -34.760 48.224 86.047  1.00 13.10 ? 242  TYR A N     1 
ATOM   1936 C CA    . TYR A 1 242 ? -34.711 48.675 84.662  1.00 13.04 ? 242  TYR A CA    1 
ATOM   1937 C C     . TYR A 1 242 ? -35.952 48.393 83.830  1.00 13.44 ? 242  TYR A C     1 
ATOM   1938 O O     . TYR A 1 242 ? -36.814 47.605 84.205  1.00 13.99 ? 242  TYR A O     1 
ATOM   1939 C CB    . TYR A 1 242 ? -33.505 48.052 83.963  1.00 12.51 ? 242  TYR A CB    1 
ATOM   1940 C CG    . TYR A 1 242 ? -32.201 48.380 84.636  1.00 12.34 ? 242  TYR A CG    1 
ATOM   1941 C CD1   . TYR A 1 242 ? -31.773 47.668 85.755  1.00 12.05 ? 242  TYR A CD1   1 
ATOM   1942 C CD2   . TYR A 1 242 ? -31.419 49.437 84.188  1.00 12.05 ? 242  TYR A CD2   1 
ATOM   1943 C CE1   . TYR A 1 242 ? -30.598 48.003 86.415  1.00 12.04 ? 242  TYR A CE1   1 
ATOM   1944 C CE2   . TYR A 1 242 ? -30.242 49.783 84.842  1.00 12.51 ? 242  TYR A CE2   1 
ATOM   1945 C CZ    . TYR A 1 242 ? -29.840 49.063 85.953  1.00 12.46 ? 242  TYR A CZ    1 
ATOM   1946 O OH    . TYR A 1 242 ? -28.680 49.412 86.603  1.00 12.45 ? 242  TYR A OH    1 
ATOM   1947 N N     . SER A 1 243 ? -36.026 49.052 82.684  1.00 13.74 ? 243  SER A N     1 
ATOM   1948 C CA    . SER A 1 243 ? -37.141 48.862 81.779  1.00 13.90 ? 243  SER A CA    1 
ATOM   1949 C C     . SER A 1 243 ? -36.883 47.667 80.869  1.00 14.04 ? 243  SER A C     1 
ATOM   1950 O O     . SER A 1 243 ? -35.774 47.489 80.364  1.00 13.33 ? 243  SER A O     1 
ATOM   1951 C CB    . SER A 1 243 ? -37.347 50.111 80.921  1.00 14.23 ? 243  SER A CB    1 
ATOM   1952 O OG    . SER A 1 243 ? -38.318 49.875 79.917  1.00 14.30 ? 243  SER A OG    1 
ATOM   1953 N N     . THR A 1 244 ? -37.916 46.853 80.670  1.00 14.14 ? 244  THR A N     1 
ATOM   1954 C CA    . THR A 1 244 ? -37.846 45.688 79.803  1.00 14.45 ? 244  THR A CA    1 
ATOM   1955 C C     . THR A 1 244 ? -37.964 46.145 78.349  1.00 15.18 ? 244  THR A C     1 
ATOM   1956 O O     . THR A 1 244 ? -37.876 45.331 77.432  1.00 14.66 ? 244  THR A O     1 
ATOM   1957 C CB    . THR A 1 244 ? -38.974 44.661 80.118  1.00 14.46 ? 244  THR A CB    1 
ATOM   1958 O OG1   . THR A 1 244 ? -40.252 45.235 79.828  1.00 14.54 ? 244  THR A OG1   1 
ATOM   1959 C CG2   . THR A 1 244 ? -38.940 44.261 81.590  1.00 14.10 ? 244  THR A CG2   1 
ATOM   1960 N N     . ARG A 1 245 ? -38.165 47.449 78.144  1.00 15.72 ? 245  ARG A N     1 
ATOM   1961 C CA    . ARG A 1 245 ? -38.258 48.012 76.794  1.00 17.35 ? 245  ARG A CA    1 
ATOM   1962 C C     . ARG A 1 245 ? -36.842 48.330 76.313  1.00 16.48 ? 245  ARG A C     1 
ATOM   1963 O O     . ARG A 1 245 ? -36.622 48.621 75.135  1.00 15.79 ? 245  ARG A O     1 
ATOM   1964 C CB    . ARG A 1 245 ? -39.075 49.301 76.785  1.00 19.62 ? 245  ARG A CB    1 
ATOM   1965 C CG    . ARG A 1 245 ? -40.503 49.162 77.231  1.00 23.04 ? 245  ARG A CG    1 
ATOM   1966 C CD    . ARG A 1 245 ? -41.327 48.386 76.234  1.00 25.70 ? 245  ARG A CD    1 
ATOM   1967 N NE    . ARG A 1 245 ? -42.752 48.642 76.436  1.00 28.95 ? 245  ARG A NE    1 
ATOM   1968 C CZ    . ARG A 1 245 ? -43.406 48.401 77.570  1.00 29.43 ? 245  ARG A CZ    1 
ATOM   1969 N NH1   . ARG A 1 245 ? -42.767 47.893 78.609  1.00 30.58 ? 245  ARG A NH1   1 
ATOM   1970 N NH2   . ARG A 1 245 ? -44.697 48.674 77.666  1.00 29.87 ? 245  ARG A NH2   1 
ATOM   1971 N N     . GLY A 1 246 ? -35.893 48.292 77.246  1.00 15.18 ? 246  GLY A N     1 
ATOM   1972 C CA    . GLY A 1 246 ? -34.503 48.542 76.909  1.00 14.03 ? 246  GLY A CA    1 
ATOM   1973 C C     . GLY A 1 246 ? -33.784 47.204 76.853  1.00 12.66 ? 246  GLY A C     1 
ATOM   1974 O O     . GLY A 1 246 ? -34.390 46.187 76.511  1.00 12.40 ? 246  GLY A O     1 
ATOM   1975 N N     . ILE A 1 247 ? -32.500 47.187 77.188  1.00 12.45 ? 247  ILE A N     1 
ATOM   1976 C CA    . ILE A 1 247 ? -31.754 45.937 77.174  1.00 11.44 ? 247  ILE A CA    1 
ATOM   1977 C C     . ILE A 1 247 ? -31.410 45.524 78.598  1.00 11.53 ? 247  ILE A C     1 
ATOM   1978 O O     . ILE A 1 247 ? -31.537 46.315 79.536  1.00 11.35 ? 247  ILE A O     1 
ATOM   1979 C CB    . ILE A 1 247 ? -30.462 46.051 76.322  1.00 11.72 ? 247  ILE A CB    1 
ATOM   1980 C CG1   . ILE A 1 247 ? -29.508 47.076 76.934  1.00 11.62 ? 247  ILE A CG1   1 
ATOM   1981 C CG2   . ILE A 1 247 ? -30.821 46.437 74.882  1.00 11.19 ? 247  ILE A CG2   1 
ATOM   1982 C CD1   . ILE A 1 247 ? -28.226 47.241 76.164  1.00 10.94 ? 247  ILE A CD1   1 
ATOM   1983 N N     . ALA A 1 248 ? -30.982 44.279 78.762  1.00 11.00 ? 248  ALA A N     1 
ATOM   1984 C CA    . ALA A 1 248 ? -30.647 43.764 80.080  1.00 11.86 ? 248  ALA A CA    1 
ATOM   1985 C C     . ALA A 1 248 ? -29.261 44.204 80.528  1.00 12.69 ? 248  ALA A C     1 
ATOM   1986 O O     . ALA A 1 248 ? -28.347 44.332 79.709  1.00 13.95 ? 248  ALA A O     1 
ATOM   1987 C CB    . ALA A 1 248 ? -30.726 42.238 80.073  1.00 10.86 ? 248  ALA A CB    1 
ATOM   1988 N N     . ILE A 1 249 ? -29.106 44.452 81.827  1.00 12.16 ? 249  ILE A N     1 
ATOM   1989 C CA    . ILE A 1 249 ? -27.803 44.824 82.355  1.00 11.46 ? 249  ILE A CA    1 
ATOM   1990 C C     . ILE A 1 249 ? -26.959 43.553 82.399  1.00 11.31 ? 249  ILE A C     1 
ATOM   1991 O O     . ILE A 1 249 ? -27.485 42.442 82.411  1.00 11.71 ? 249  ILE A O     1 
ATOM   1992 C CB    . ILE A 1 249 ? -27.874 45.404 83.798  1.00 11.71 ? 249  ILE A CB    1 
ATOM   1993 C CG1   . ILE A 1 249 ? -28.561 44.414 84.743  1.00 10.83 ? 249  ILE A CG1   1 
ATOM   1994 C CG2   . ILE A 1 249 ? -28.565 46.759 83.783  1.00 11.38 ? 249  ILE A CG2   1 
ATOM   1995 C CD1   . ILE A 1 249 ? -28.315 44.723 86.203  1.00 10.93 ? 249  ILE A CD1   1 
ATOM   1996 N N     . THR A 1 250 ? -25.649 43.718 82.424  1.00 11.01 ? 250  THR A N     1 
ATOM   1997 C CA    . THR A 1 250 ? -24.744 42.582 82.471  1.00 10.76 ? 250  THR A CA    1 
ATOM   1998 C C     . THR A 1 250 ? -25.064 41.677 83.675  1.00 11.22 ? 250  THR A C     1 
ATOM   1999 O O     . THR A 1 250 ? -25.305 42.160 84.793  1.00 9.24  ? 250  THR A O     1 
ATOM   2000 C CB    . THR A 1 250 ? -23.284 43.095 82.566  1.00 10.71 ? 250  THR A CB    1 
ATOM   2001 O OG1   . THR A 1 250 ? -23.087 44.123 81.592  1.00 10.90 ? 250  THR A OG1   1 
ATOM   2002 C CG2   . THR A 1 250 ? -22.293 41.988 82.301  1.00 10.94 ? 250  THR A CG2   1 
ATOM   2003 N N     . LEU A 1 251 ? -25.086 40.367 83.437  1.00 10.21 ? 251  LEU A N     1 
ATOM   2004 C CA    . LEU A 1 251 ? -25.345 39.406 84.498  1.00 11.22 ? 251  LEU A CA    1 
ATOM   2005 C C     . LEU A 1 251 ? -24.042 39.239 85.291  1.00 11.66 ? 251  LEU A C     1 
ATOM   2006 O O     . LEU A 1 251 ? -22.960 39.532 84.770  1.00 11.55 ? 251  LEU A O     1 
ATOM   2007 C CB    . LEU A 1 251 ? -25.766 38.059 83.902  1.00 10.95 ? 251  LEU A CB    1 
ATOM   2008 C CG    . LEU A 1 251 ? -27.040 38.024 83.047  1.00 11.79 ? 251  LEU A CG    1 
ATOM   2009 C CD1   . LEU A 1 251 ? -27.327 36.585 82.649  1.00 10.76 ? 251  LEU A CD1   1 
ATOM   2010 C CD2   . LEU A 1 251 ? -28.229 38.599 83.817  1.00 11.61 ? 251  LEU A CD2   1 
ATOM   2011 N N     . SER A 1 252 ? -24.136 38.789 86.542  1.00 11.54 ? 252  SER A N     1 
ATOM   2012 C CA    . SER A 1 252 ? -22.934 38.595 87.352  1.00 11.32 ? 252  SER A CA    1 
ATOM   2013 C C     . SER A 1 252 ? -22.942 37.280 88.133  1.00 11.24 ? 252  SER A C     1 
ATOM   2014 O O     . SER A 1 252 ? -23.997 36.779 88.528  1.00 11.41 ? 252  SER A O     1 
ATOM   2015 C CB    . SER A 1 252 ? -22.716 39.792 88.296  1.00 10.77 ? 252  SER A CB    1 
ATOM   2016 O OG    . SER A 1 252 ? -23.835 40.023 89.131  1.00 12.10 ? 252  SER A OG    1 
ATOM   2017 N N     . ALA A 1 253 ? -21.746 36.733 88.346  1.00 10.80 ? 253  ALA A N     1 
ATOM   2018 C CA    . ALA A 1 253 ? -21.558 35.463 89.038  1.00 10.65 ? 253  ALA A CA    1 
ATOM   2019 C C     . ALA A 1 253 ? -21.613 35.515 90.555  1.00 11.12 ? 253  ALA A C     1 
ATOM   2020 O O     . ALA A 1 253 ? -22.111 34.590 91.184  1.00 10.59 ? 253  ALA A O     1 
ATOM   2021 C CB    . ALA A 1 253 ? -20.247 34.841 88.604  1.00 10.69 ? 253  ALA A CB    1 
ATOM   2022 N N     . TYR A 1 254 ? -21.106 36.594 91.140  1.00 11.86 ? 254  TYR A N     1 
ATOM   2023 C CA    . TYR A 1 254 ? -21.094 36.751 92.593  1.00 12.48 ? 254  TYR A CA    1 
ATOM   2024 C C     . TYR A 1 254 ? -21.867 37.995 93.040  1.00 13.10 ? 254  TYR A C     1 
ATOM   2025 O O     . TYR A 1 254 ? -21.714 38.452 94.177  1.00 14.05 ? 254  TYR A O     1 
ATOM   2026 C CB    . TYR A 1 254 ? -19.648 36.849 93.090  1.00 12.23 ? 254  TYR A CB    1 
ATOM   2027 C CG    . TYR A 1 254 ? -18.795 35.653 92.724  1.00 12.26 ? 254  TYR A CG    1 
ATOM   2028 C CD1   . TYR A 1 254 ? -18.762 34.521 93.536  1.00 12.40 ? 254  TYR A CD1   1 
ATOM   2029 C CD2   . TYR A 1 254 ? -18.050 35.639 91.544  1.00 12.32 ? 254  TYR A CD2   1 
ATOM   2030 C CE1   . TYR A 1 254 ? -18.008 33.402 93.186  1.00 12.52 ? 254  TYR A CE1   1 
ATOM   2031 C CE2   . TYR A 1 254 ? -17.297 34.522 91.182  1.00 12.78 ? 254  TYR A CE2   1 
ATOM   2032 C CZ    . TYR A 1 254 ? -17.283 33.408 92.010  1.00 12.85 ? 254  TYR A CZ    1 
ATOM   2033 O OH    . TYR A 1 254 ? -16.554 32.298 91.655  1.00 13.45 ? 254  TYR A OH    1 
ATOM   2034 N N     . GLY A 1 255 ? -22.703 38.528 92.154  1.00 12.41 ? 255  GLY A N     1 
ATOM   2035 C CA    . GLY A 1 255 ? -23.464 39.726 92.474  1.00 13.08 ? 255  GLY A CA    1 
ATOM   2036 C C     . GLY A 1 255 ? -24.373 39.659 93.689  1.00 13.16 ? 255  GLY A C     1 
ATOM   2037 O O     . GLY A 1 255 ? -24.884 38.593 94.043  1.00 13.95 ? 255  GLY A O     1 
ATOM   2038 N N     . GLY A 1 256 ? -24.572 40.812 94.326  1.00 12.74 ? 256  GLY A N     1 
ATOM   2039 C CA    . GLY A 1 256 ? -25.422 40.894 95.496  1.00 12.47 ? 256  GLY A CA    1 
ATOM   2040 C C     . GLY A 1 256 ? -26.618 41.803 95.294  1.00 13.07 ? 256  GLY A C     1 
ATOM   2041 O O     . GLY A 1 256 ? -26.970 42.149 94.161  1.00 13.14 ? 256  GLY A O     1 
ATOM   2042 N N     . GLY A 1 257 ? -27.245 42.205 96.391  1.00 12.66 ? 257  GLY A N     1 
ATOM   2043 C CA    . GLY A 1 257 ? -28.416 43.055 96.296  1.00 13.16 ? 257  GLY A CA    1 
ATOM   2044 C C     . GLY A 1 257 ? -29.664 42.194 96.203  1.00 13.29 ? 257  GLY A C     1 
ATOM   2045 O O     . GLY A 1 257 ? -29.572 41.000 95.921  1.00 13.57 ? 257  GLY A O     1 
ATOM   2046 N N     . ILE A 1 258 ? -30.831 42.791 96.418  1.00 13.51 ? 258  ILE A N     1 
ATOM   2047 C CA    . ILE A 1 258 ? -32.087 42.050 96.368  1.00 14.54 ? 258  ILE A CA    1 
ATOM   2048 C C     . ILE A 1 258 ? -32.400 41.477 94.970  1.00 15.13 ? 258  ILE A C     1 
ATOM   2049 O O     . ILE A 1 258 ? -33.116 40.481 94.845  1.00 15.01 ? 258  ILE A O     1 
ATOM   2050 C CB    . ILE A 1 258 ? -33.265 42.933 96.888  1.00 15.33 ? 258  ILE A CB    1 
ATOM   2051 C CG1   . ILE A 1 258 ? -34.481 42.050 97.179  1.00 15.48 ? 258  ILE A CG1   1 
ATOM   2052 C CG2   . ILE A 1 258 ? -33.606 44.037 95.890  1.00 15.39 ? 258  ILE A CG2   1 
ATOM   2053 C CD1   . ILE A 1 258 ? -34.232 41.013 98.265  1.00 15.27 ? 258  ILE A CD1   1 
ATOM   2054 N N     . PHE A 1 259 ? -31.855 42.099 93.926  1.00 14.83 ? 259  PHE A N     1 
ATOM   2055 C CA    . PHE A 1 259 ? -32.050 41.627 92.552  1.00 14.72 ? 259  PHE A CA    1 
ATOM   2056 C C     . PHE A 1 259 ? -30.710 41.061 92.083  1.00 14.62 ? 259  PHE A C     1 
ATOM   2057 O O     . PHE A 1 259 ? -30.275 41.282 90.947  1.00 14.48 ? 259  PHE A O     1 
ATOM   2058 C CB    . PHE A 1 259 ? -32.459 42.779 91.630  1.00 15.39 ? 259  PHE A CB    1 
ATOM   2059 C CG    . PHE A 1 259 ? -33.738 43.457 92.029  1.00 15.56 ? 259  PHE A CG    1 
ATOM   2060 C CD1   . PHE A 1 259 ? -34.946 42.771 91.990  1.00 15.33 ? 259  PHE A CD1   1 
ATOM   2061 C CD2   . PHE A 1 259 ? -33.734 44.784 92.441  1.00 15.75 ? 259  PHE A CD2   1 
ATOM   2062 C CE1   . PHE A 1 259 ? -36.132 43.394 92.355  1.00 15.09 ? 259  PHE A CE1   1 
ATOM   2063 C CE2   . PHE A 1 259 ? -34.920 45.421 92.812  1.00 16.23 ? 259  PHE A CE2   1 
ATOM   2064 C CZ    . PHE A 1 259 ? -36.120 44.720 92.768  1.00 15.41 ? 259  PHE A CZ    1 
ATOM   2065 N N     . ALA A 1 260 ? -30.070 40.322 92.982  1.00 13.69 ? 260  ALA A N     1 
ATOM   2066 C CA    . ALA A 1 260 ? -28.770 39.721 92.742  1.00 13.44 ? 260  ALA A CA    1 
ATOM   2067 C C     . ALA A 1 260 ? -28.553 39.029 91.408  1.00 13.68 ? 260  ALA A C     1 
ATOM   2068 O O     . ALA A 1 260 ? -29.397 38.274 90.928  1.00 14.66 ? 260  ALA A O     1 
ATOM   2069 C CB    . ALA A 1 260 ? -28.449 38.740 93.865  1.00 13.22 ? 260  ALA A CB    1 
ATOM   2070 N N     . LYS A 1 261 ? -27.391 39.305 90.829  1.00 13.56 ? 261  LYS A N     1 
ATOM   2071 C CA    . LYS A 1 261 ? -26.934 38.693 89.590  1.00 12.74 ? 261  LYS A CA    1 
ATOM   2072 C C     . LYS A 1 261 ? -27.712 38.920 88.302  1.00 12.50 ? 261  LYS A C     1 
ATOM   2073 O O     . LYS A 1 261 ? -27.261 38.489 87.245  1.00 12.43 ? 261  LYS A O     1 
ATOM   2074 C CB    . LYS A 1 261 ? -26.775 37.193 89.829  1.00 13.29 ? 261  LYS A CB    1 
ATOM   2075 C CG    . LYS A 1 261 ? -25.903 36.880 91.046  1.00 13.43 ? 261  LYS A CG    1 
ATOM   2076 C CD    . LYS A 1 261 ? -25.846 35.393 91.348  1.00 13.46 ? 261  LYS A CD    1 
ATOM   2077 C CE    . LYS A 1 261 ? -25.011 35.131 92.596  1.00 13.38 ? 261  LYS A CE    1 
ATOM   2078 N NZ    . LYS A 1 261 ? -25.540 35.907 93.751  1.00 13.50 ? 261  LYS A NZ    1 
ATOM   2079 N N     . THR A 1 262 ? -28.867 39.574 88.372  1.00 11.41 ? 262  THR A N     1 
ATOM   2080 C CA    . THR A 1 262 ? -29.653 39.814 87.164  1.00 11.05 ? 262  THR A CA    1 
ATOM   2081 C C     . THR A 1 262 ? -30.147 41.250 87.074  1.00 10.68 ? 262  THR A C     1 
ATOM   2082 O O     . THR A 1 262 ? -30.377 41.761 85.983  1.00 10.98 ? 262  THR A O     1 
ATOM   2083 C CB    . THR A 1 262 ? -30.925 38.902 87.072  1.00 10.75 ? 262  THR A CB    1 
ATOM   2084 O OG1   . THR A 1 262 ? -31.949 39.425 87.925  1.00 10.77 ? 262  THR A OG1   1 
ATOM   2085 C CG2   . THR A 1 262 ? -30.622 37.480 87.489  1.00 9.50  ? 262  THR A CG2   1 
ATOM   2086 N N     . GLY A 1 263 ? -30.313 41.895 88.222  1.00 10.86 ? 263  GLY A N     1 
ATOM   2087 C CA    . GLY A 1 263 ? -30.835 43.248 88.231  1.00 10.57 ? 263  GLY A CA    1 
ATOM   2088 C C     . GLY A 1 263 ? -32.350 43.147 88.301  1.00 11.26 ? 263  GLY A C     1 
ATOM   2089 O O     . GLY A 1 263 ? -32.910 42.080 88.037  1.00 10.22 ? 263  GLY A O     1 
ATOM   2090 N N     . GLY A 1 264 ? -33.014 44.241 88.661  1.00 11.10 ? 264  GLY A N     1 
ATOM   2091 C CA    . GLY A 1 264 ? -34.463 44.233 88.756  1.00 11.96 ? 264  GLY A CA    1 
ATOM   2092 C C     . GLY A 1 264 ? -35.128 44.831 87.532  1.00 12.33 ? 264  GLY A C     1 
ATOM   2093 O O     . GLY A 1 264 ? -34.548 45.682 86.856  1.00 12.32 ? 264  GLY A O     1 
ATOM   2094 N N     . TYR A 1 265 ? -36.343 44.381 87.233  1.00 12.37 ? 265  TYR A N     1 
ATOM   2095 C CA    . TYR A 1 265 ? -37.074 44.886 86.074  1.00 12.53 ? 265  TYR A CA    1 
ATOM   2096 C C     . TYR A 1 265 ? -38.540 45.150 86.374  1.00 12.83 ? 265  TYR A C     1 
ATOM   2097 O O     . TYR A 1 265 ? -39.153 44.453 87.175  1.00 13.65 ? 265  TYR A O     1 
ATOM   2098 C CB    . TYR A 1 265 ? -36.990 43.896 84.903  1.00 11.69 ? 265  TYR A CB    1 
ATOM   2099 C CG    . TYR A 1 265 ? -35.600 43.725 84.360  1.00 11.04 ? 265  TYR A CG    1 
ATOM   2100 C CD1   . TYR A 1 265 ? -34.686 42.874 84.984  1.00 10.68 ? 265  TYR A CD1   1 
ATOM   2101 C CD2   . TYR A 1 265 ? -35.168 44.476 83.274  1.00 10.10 ? 265  TYR A CD2   1 
ATOM   2102 C CE1   . TYR A 1 265 ? -33.369 42.785 84.539  1.00 10.51 ? 265  TYR A CE1   1 
ATOM   2103 C CE2   . TYR A 1 265 ? -33.858 44.395 82.823  1.00 10.56 ? 265  TYR A CE2   1 
ATOM   2104 C CZ    . TYR A 1 265 ? -32.967 43.552 83.463  1.00 10.41 ? 265  TYR A CZ    1 
ATOM   2105 O OH    . TYR A 1 265 ? -31.668 43.518 83.047  1.00 11.41 ? 265  TYR A OH    1 
ATOM   2106 N N     . LEU A 1 266 ? -39.097 46.162 85.721  1.00 13.43 ? 266  LEU A N     1 
ATOM   2107 C CA    . LEU A 1 266 ? -40.504 46.488 85.882  1.00 13.63 ? 266  LEU A CA    1 
ATOM   2108 C C     . LEU A 1 266 ? -41.278 45.613 84.897  1.00 13.38 ? 266  LEU A C     1 
ATOM   2109 O O     . LEU A 1 266 ? -41.145 45.759 83.685  1.00 13.40 ? 266  LEU A O     1 
ATOM   2110 C CB    . LEU A 1 266 ? -40.746 47.971 85.570  1.00 14.66 ? 266  LEU A CB    1 
ATOM   2111 C CG    . LEU A 1 266 ? -42.204 48.442 85.572  1.00 14.97 ? 266  LEU A CG    1 
ATOM   2112 C CD1   . LEU A 1 266 ? -42.856 48.112 86.906  1.00 15.55 ? 266  LEU A CD1   1 
ATOM   2113 C CD2   . LEU A 1 266 ? -42.252 49.939 85.306  1.00 15.42 ? 266  LEU A CD2   1 
ATOM   2114 N N     . VAL A 1 267 ? -42.070 44.688 85.420  1.00 13.78 ? 267  VAL A N     1 
ATOM   2115 C CA    . VAL A 1 267 ? -42.853 43.796 84.572  1.00 14.04 ? 267  VAL A CA    1 
ATOM   2116 C C     . VAL A 1 267 ? -44.314 43.881 84.992  1.00 15.27 ? 267  VAL A C     1 
ATOM   2117 O O     . VAL A 1 267 ? -44.669 43.503 86.110  1.00 16.29 ? 267  VAL A O     1 
ATOM   2118 C CB    . VAL A 1 267 ? -42.357 42.324 84.696  1.00 13.29 ? 267  VAL A CB    1 
ATOM   2119 C CG1   . VAL A 1 267 ? -43.092 41.433 83.699  1.00 12.34 ? 267  VAL A CG1   1 
ATOM   2120 C CG2   . VAL A 1 267 ? -40.842 42.256 84.464  1.00 12.09 ? 267  VAL A CG2   1 
ATOM   2121 N N     . ASN A 1 268 ? -45.153 44.390 84.097  1.00 16.33 ? 268  ASN A N     1 
ATOM   2122 C CA    . ASN A 1 268 ? -46.584 44.546 84.356  1.00 18.03 ? 268  ASN A CA    1 
ATOM   2123 C C     . ASN A 1 268 ? -46.926 45.137 85.728  1.00 18.66 ? 268  ASN A C     1 
ATOM   2124 O O     . ASN A 1 268 ? -47.730 44.573 86.474  1.00 19.17 ? 268  ASN A O     1 
ATOM   2125 C CB    . ASN A 1 268 ? -47.302 43.208 84.189  1.00 19.28 ? 268  ASN A CB    1 
ATOM   2126 C CG    . ASN A 1 268 ? -47.210 42.675 82.780  1.00 19.94 ? 268  ASN A CG    1 
ATOM   2127 O OD1   . ASN A 1 268 ? -47.403 43.410 81.822  1.00 20.64 ? 268  ASN A OD1   1 
ATOM   2128 N ND2   . ASN A 1 268 ? -46.922 41.387 82.647  1.00 20.78 ? 268  ASN A ND2   1 
ATOM   2129 N N     . GLY A 1 269 ? -46.311 46.270 86.057  1.00 18.21 ? 269  GLY A N     1 
ATOM   2130 C CA    . GLY A 1 269 ? -46.585 46.925 87.321  1.00 18.25 ? 269  GLY A CA    1 
ATOM   2131 C C     . GLY A 1 269 ? -45.827 46.399 88.521  1.00 18.64 ? 269  GLY A C     1 
ATOM   2132 O O     . GLY A 1 269 ? -45.845 47.025 89.581  1.00 17.88 ? 269  GLY A O     1 
ATOM   2133 N N     . LYS A 1 270 ? -45.150 45.265 88.356  1.00 18.94 ? 270  LYS A N     1 
ATOM   2134 C CA    . LYS A 1 270 ? -44.391 44.653 89.444  1.00 19.64 ? 270  LYS A CA    1 
ATOM   2135 C C     . LYS A 1 270 ? -42.888 44.712 89.209  1.00 18.87 ? 270  LYS A C     1 
ATOM   2136 O O     . LYS A 1 270 ? -42.425 44.813 88.072  1.00 19.13 ? 270  LYS A O     1 
ATOM   2137 C CB    . LYS A 1 270 ? -44.796 43.191 89.599  1.00 21.85 ? 270  LYS A CB    1 
ATOM   2138 C CG    . LYS A 1 270 ? -46.279 42.969 89.829  1.00 24.86 ? 270  LYS A CG    1 
ATOM   2139 C CD    . LYS A 1 270 ? -46.636 41.501 89.616  1.00 27.00 ? 270  LYS A CD    1 
ATOM   2140 C CE    . LYS A 1 270 ? -48.057 41.190 90.077  1.00 28.84 ? 270  LYS A CE    1 
ATOM   2141 N NZ    . LYS A 1 270 ? -48.236 41.444 91.547  1.00 30.09 ? 270  LYS A NZ    1 
ATOM   2142 N N     . THR A 1 271 ? -42.125 44.635 90.292  1.00 17.98 ? 271  THR A N     1 
ATOM   2143 C CA    . THR A 1 271 ? -40.670 44.654 90.192  1.00 17.03 ? 271  THR A CA    1 
ATOM   2144 C C     . THR A 1 271 ? -40.129 43.282 90.577  1.00 16.33 ? 271  THR A C     1 
ATOM   2145 O O     . THR A 1 271 ? -40.487 42.746 91.625  1.00 16.05 ? 271  THR A O     1 
ATOM   2146 C CB    . THR A 1 271 ? -40.061 45.701 91.130  1.00 17.40 ? 271  THR A CB    1 
ATOM   2147 O OG1   . THR A 1 271 ? -40.392 45.375 92.486  1.00 18.27 ? 271  THR A OG1   1 
ATOM   2148 C CG2   . THR A 1 271 ? -40.591 47.095 90.788  1.00 17.14 ? 271  THR A CG2   1 
ATOM   2149 N N     . ARG A 1 272 ? -39.276 42.708 89.732  1.00 14.68 ? 272  ARG A N     1 
ATOM   2150 C CA    . ARG A 1 272 ? -38.710 41.391 90.024  1.00 13.91 ? 272  ARG A CA    1 
ATOM   2151 C C     . ARG A 1 272 ? -37.381 41.173 89.317  1.00 13.19 ? 272  ARG A C     1 
ATOM   2152 O O     . ARG A 1 272 ? -37.043 41.880 88.370  1.00 12.67 ? 272  ARG A O     1 
ATOM   2153 C CB    . ARG A 1 272 ? -39.683 40.274 89.605  1.00 13.52 ? 272  ARG A CB    1 
ATOM   2154 C CG    . ARG A 1 272 ? -39.852 40.103 88.088  1.00 13.68 ? 272  ARG A CG    1 
ATOM   2155 C CD    . ARG A 1 272 ? -40.687 38.871 87.753  1.00 13.12 ? 272  ARG A CD    1 
ATOM   2156 N NE    . ARG A 1 272 ? -40.957 38.721 86.319  1.00 13.73 ? 272  ARG A NE    1 
ATOM   2157 C CZ    . ARG A 1 272 ? -40.076 38.303 85.411  1.00 13.58 ? 272  ARG A CZ    1 
ATOM   2158 N NH1   . ARG A 1 272 ? -38.837 37.987 85.768  1.00 13.24 ? 272  ARG A NH1   1 
ATOM   2159 N NH2   . ARG A 1 272 ? -40.442 38.179 84.141  1.00 13.20 ? 272  ARG A NH2   1 
ATOM   2160 N N     . LYS A 1 273 ? -36.616 40.198 89.792  1.00 12.74 ? 273  LYS A N     1 
ATOM   2161 C CA    . LYS A 1 273 ? -35.357 39.891 89.145  1.00 12.31 ? 273  LYS A CA    1 
ATOM   2162 C C     . LYS A 1 273 ? -35.681 38.874 88.053  1.00 12.35 ? 273  LYS A C     1 
ATOM   2163 O O     . LYS A 1 273 ? -36.839 38.464 87.896  1.00 12.14 ? 273  LYS A O     1 
ATOM   2164 C CB    . LYS A 1 273 ? -34.350 39.325 90.153  1.00 12.29 ? 273  LYS A CB    1 
ATOM   2165 C CG    . LYS A 1 273 ? -34.715 37.997 90.774  1.00 12.65 ? 273  LYS A CG    1 
ATOM   2166 C CD    . LYS A 1 273 ? -33.624 37.579 91.739  1.00 13.40 ? 273  LYS A CD    1 
ATOM   2167 C CE    . LYS A 1 273 ? -33.896 36.218 92.344  1.00 14.47 ? 273  LYS A CE    1 
ATOM   2168 N NZ    . LYS A 1 273 ? -32.787 35.812 93.261  1.00 14.56 ? 273  LYS A NZ    1 
ATOM   2169 N N     . LEU A 1 274 ? -34.674 38.466 87.293  1.00 11.92 ? 274  LEU A N     1 
ATOM   2170 C CA    . LEU A 1 274 ? -34.904 37.509 86.228  1.00 11.43 ? 274  LEU A CA    1 
ATOM   2171 C C     . LEU A 1 274 ? -34.897 36.062 86.710  1.00 11.87 ? 274  LEU A C     1 
ATOM   2172 O O     . LEU A 1 274 ? -34.327 35.731 87.748  1.00 11.76 ? 274  LEU A O     1 
ATOM   2173 C CB    . LEU A 1 274 ? -33.862 37.702 85.117  1.00 10.93 ? 274  LEU A CB    1 
ATOM   2174 C CG    . LEU A 1 274 ? -33.863 39.071 84.418  1.00 10.89 ? 274  LEU A CG    1 
ATOM   2175 C CD1   . LEU A 1 274 ? -32.746 39.131 83.377  1.00 10.24 ? 274  LEU A CD1   1 
ATOM   2176 C CD2   . LEU A 1 274 ? -35.203 39.307 83.757  1.00 10.98 ? 274  LEU A CD2   1 
ATOM   2177 N N     . HIS A 1 275 ? -35.557 35.214 85.933  1.00 12.07 ? 275  HIS A N     1 
ATOM   2178 C CA    . HIS A 1 275 ? -35.657 33.784 86.187  1.00 12.12 ? 275  HIS A CA    1 
ATOM   2179 C C     . HIS A 1 275 ? -34.446 33.190 85.471  1.00 11.77 ? 275  HIS A C     1 
ATOM   2180 O O     . HIS A 1 275 ? -34.000 33.743 84.463  1.00 12.13 ? 275  HIS A O     1 
ATOM   2181 C CB    . HIS A 1 275 ? -36.970 33.287 85.571  1.00 12.23 ? 275  HIS A CB    1 
ATOM   2182 C CG    . HIS A 1 275 ? -37.210 31.818 85.711  1.00 12.04 ? 275  HIS A CG    1 
ATOM   2183 N ND1   . HIS A 1 275 ? -36.554 30.878 84.946  1.00 12.47 ? 275  HIS A ND1   1 
ATOM   2184 C CD2   . HIS A 1 275 ? -38.075 31.131 86.493  1.00 11.44 ? 275  HIS A CD2   1 
ATOM   2185 C CE1   . HIS A 1 275 ? -37.007 29.675 85.248  1.00 12.22 ? 275  HIS A CE1   1 
ATOM   2186 N NE2   . HIS A 1 275 ? -37.930 29.801 86.184  1.00 12.09 ? 275  HIS A NE2   1 
ATOM   2187 N N     . PRO A 1 276 ? -33.880 32.077 85.987  1.00 11.69 ? 276  PRO A N     1 
ATOM   2188 C CA    . PRO A 1 276 ? -32.714 31.462 85.339  1.00 10.03 ? 276  PRO A CA    1 
ATOM   2189 C C     . PRO A 1 276 ? -32.906 31.226 83.832  1.00 10.87 ? 276  PRO A C     1 
ATOM   2190 O O     . PRO A 1 276 ? -31.954 31.306 83.055  1.00 10.57 ? 276  PRO A O     1 
ATOM   2191 C CB    . PRO A 1 276 ? -32.544 30.165 86.113  1.00 10.51 ? 276  PRO A CB    1 
ATOM   2192 C CG    . PRO A 1 276 ? -32.968 30.559 87.497  1.00 10.14 ? 276  PRO A CG    1 
ATOM   2193 C CD    . PRO A 1 276 ? -34.229 31.353 87.224  1.00 10.75 ? 276  PRO A CD    1 
ATOM   2194 N N     . ARG A 1 277 ? -34.137 30.936 83.422  1.00 11.03 ? 277  ARG A N     1 
ATOM   2195 C CA    . ARG A 1 277 ? -34.431 30.710 82.011  1.00 11.13 ? 277  ARG A CA    1 
ATOM   2196 C C     . ARG A 1 277 ? -34.326 32.028 81.257  1.00 10.68 ? 277  ARG A C     1 
ATOM   2197 O O     . ARG A 1 277 ? -33.938 32.065 80.089  1.00 9.96  ? 277  ARG A O     1 
ATOM   2198 C CB    . ARG A 1 277 ? -35.846 30.166 81.845  1.00 12.48 ? 277  ARG A CB    1 
ATOM   2199 C CG    . ARG A 1 277 ? -36.204 29.793 80.420  1.00 13.34 ? 277  ARG A CG    1 
ATOM   2200 C CD    . ARG A 1 277 ? -35.801 28.358 80.177  1.00 14.49 ? 277  ARG A CD    1 
ATOM   2201 N NE    . ARG A 1 277 ? -34.561 28.251 79.439  1.00 14.71 ? 277  ARG A NE    1 
ATOM   2202 C CZ    . ARG A 1 277 ? -33.792 27.170 79.417  1.00 13.97 ? 277  ARG A CZ    1 
ATOM   2203 N NH1   . ARG A 1 277 ? -34.117 26.082 80.103  1.00 13.49 ? 277  ARG A NH1   1 
ATOM   2204 N NH2   . ARG A 1 277 ? -32.692 27.184 78.692  1.00 14.51 ? 277  ARG A NH2   1 
ATOM   2205 N N     . GLU A 1 278 ? -34.700 33.116 81.917  1.00 10.98 ? 278  GLU A N     1 
ATOM   2206 C CA    . GLU A 1 278 ? -34.612 34.424 81.280  1.00 11.16 ? 278  GLU A CA    1 
ATOM   2207 C C     . GLU A 1 278 ? -33.149 34.844 81.189  1.00 10.76 ? 278  GLU A C     1 
ATOM   2208 O O     . GLU A 1 278 ? -32.758 35.518 80.240  1.00 10.79 ? 278  GLU A O     1 
ATOM   2209 C CB    . GLU A 1 278 ? -35.448 35.446 82.054  1.00 12.06 ? 278  GLU A CB    1 
ATOM   2210 C CG    . GLU A 1 278 ? -36.934 35.071 82.057  1.00 12.33 ? 278  GLU A CG    1 
ATOM   2211 C CD    . GLU A 1 278 ? -37.787 35.957 82.934  1.00 12.51 ? 278  GLU A CD    1 
ATOM   2212 O OE1   . GLU A 1 278 ? -37.331 36.304 84.041  1.00 13.16 ? 278  GLU A OE1   1 
ATOM   2213 O OE2   . GLU A 1 278 ? -38.924 36.287 82.531  1.00 12.62 ? 278  GLU A OE2   1 
ATOM   2214 N N     . CYS A 1 279 ? -32.336 34.435 82.163  1.00 10.40 ? 279  CYS A N     1 
ATOM   2215 C CA    . CYS A 1 279 ? -30.906 34.741 82.130  1.00 10.28 ? 279  CYS A CA    1 
ATOM   2216 C C     . CYS A 1 279 ? -30.309 33.991 80.950  1.00 10.47 ? 279  CYS A C     1 
ATOM   2217 O O     . CYS A 1 279 ? -29.489 34.519 80.213  1.00 11.16 ? 279  CYS A O     1 
ATOM   2218 C CB    . CYS A 1 279 ? -30.215 34.274 83.403  1.00 9.77  ? 279  CYS A CB    1 
ATOM   2219 S SG    . CYS A 1 279 ? -30.682 35.183 84.849  1.00 10.86 ? 279  CYS A SG    1 
ATOM   2220 N N     . ALA A 1 280 ? -30.728 32.743 80.784  1.00 11.29 ? 280  ALA A N     1 
ATOM   2221 C CA    . ALA A 1 280 ? -30.251 31.916 79.683  1.00 11.39 ? 280  ALA A CA    1 
ATOM   2222 C C     . ALA A 1 280 ? -30.570 32.608 78.367  1.00 11.36 ? 280  ALA A C     1 
ATOM   2223 O O     . ALA A 1 280 ? -29.713 32.730 77.497  1.00 11.92 ? 280  ALA A O     1 
ATOM   2224 C CB    . ALA A 1 280 ? -30.924 30.538 79.726  1.00 10.69 ? 280  ALA A CB    1 
ATOM   2225 N N     . ARG A 1 281 ? -31.808 33.071 78.229  1.00 11.66 ? 281  ARG A N     1 
ATOM   2226 C CA    . ARG A 1 281 ? -32.228 33.739 77.003  1.00 11.38 ? 281  ARG A CA    1 
ATOM   2227 C C     . ARG A 1 281 ? -31.483 35.044 76.732  1.00 11.23 ? 281  ARG A C     1 
ATOM   2228 O O     . ARG A 1 281 ? -31.084 35.288 75.594  1.00 11.69 ? 281  ARG A O     1 
ATOM   2229 C CB    . ARG A 1 281 ? -33.744 33.983 77.018  1.00 10.89 ? 281  ARG A CB    1 
ATOM   2230 C CG    . ARG A 1 281 ? -34.575 32.721 76.817  1.00 10.83 ? 281  ARG A CG    1 
ATOM   2231 C CD    . ARG A 1 281 ? -36.046 33.021 76.986  1.00 11.39 ? 281  ARG A CD    1 
ATOM   2232 N NE    . ARG A 1 281 ? -36.906 31.843 76.866  1.00 11.41 ? 281  ARG A NE    1 
ATOM   2233 C CZ    . ARG A 1 281 ? -38.204 31.845 77.166  1.00 11.83 ? 281  ARG A CZ    1 
ATOM   2234 N NH1   . ARG A 1 281 ? -38.782 32.954 77.603  1.00 11.56 ? 281  ARG A NH1   1 
ATOM   2235 N NH2   . ARG A 1 281 ? -38.934 30.748 77.024  1.00 12.15 ? 281  ARG A NH2   1 
ATOM   2236 N N     . VAL A 1 282 ? -31.281 35.884 77.746  1.00 11.17 ? 282  VAL A N     1 
ATOM   2237 C CA    . VAL A 1 282 ? -30.558 37.134 77.499  1.00 11.87 ? 282  VAL A CA    1 
ATOM   2238 C C     . VAL A 1 282 ? -29.084 36.870 77.209  1.00 11.72 ? 282  VAL A C     1 
ATOM   2239 O O     . VAL A 1 282 ? -28.361 37.774 76.796  1.00 11.98 ? 282  VAL A O     1 
ATOM   2240 C CB    . VAL A 1 282 ? -30.684 38.160 78.667  1.00 11.93 ? 282  VAL A CB    1 
ATOM   2241 C CG1   . VAL A 1 282 ? -32.144 38.428 78.961  1.00 11.96 ? 282  VAL A CG1   1 
ATOM   2242 C CG2   . VAL A 1 282 ? -29.956 37.671 79.896  1.00 12.14 ? 282  VAL A CG2   1 
ATOM   2243 N N     . MET A 1 283 ? -28.643 35.631 77.419  1.00 12.33 ? 283  MET A N     1 
ATOM   2244 C CA    . MET A 1 283 ? -27.261 35.248 77.130  1.00 12.99 ? 283  MET A CA    1 
ATOM   2245 C C     . MET A 1 283 ? -27.172 34.465 75.808  1.00 12.79 ? 283  MET A C     1 
ATOM   2246 O O     . MET A 1 283 ? -26.112 33.961 75.447  1.00 12.99 ? 283  MET A O     1 
ATOM   2247 C CB    . MET A 1 283 ? -26.674 34.411 78.272  1.00 13.65 ? 283  MET A CB    1 
ATOM   2248 C CG    . MET A 1 283 ? -26.401 35.212 79.545  1.00 15.00 ? 283  MET A CG    1 
ATOM   2249 S SD    . MET A 1 283 ? -25.295 36.620 79.260  1.00 17.99 ? 283  MET A SD    1 
ATOM   2250 C CE    . MET A 1 283 ? -23.748 35.868 79.455  1.00 14.86 ? 283  MET A CE    1 
ATOM   2251 N N     . GLY A 1 284 ? -28.296 34.359 75.102  1.00 12.14 ? 284  GLY A N     1 
ATOM   2252 C CA    . GLY A 1 284 ? -28.314 33.672 73.822  1.00 10.69 ? 284  GLY A CA    1 
ATOM   2253 C C     . GLY A 1 284 ? -28.463 32.165 73.862  1.00 10.99 ? 284  GLY A C     1 
ATOM   2254 O O     . GLY A 1 284 ? -28.361 31.507 72.825  1.00 10.77 ? 284  GLY A O     1 
ATOM   2255 N N     . TYR A 1 285 ? -28.694 31.607 75.047  1.00 11.03 ? 285  TYR A N     1 
ATOM   2256 C CA    . TYR A 1 285 ? -28.859 30.162 75.183  1.00 11.33 ? 285  TYR A CA    1 
ATOM   2257 C C     . TYR A 1 285 ? -30.213 29.701 74.663  1.00 11.37 ? 285  TYR A C     1 
ATOM   2258 O O     . TYR A 1 285 ? -31.226 30.374 74.860  1.00 11.55 ? 285  TYR A O     1 
ATOM   2259 C CB    . TYR A 1 285 ? -28.722 29.727 76.646  1.00 10.81 ? 285  TYR A CB    1 
ATOM   2260 C CG    . TYR A 1 285 ? -27.297 29.671 77.130  1.00 10.94 ? 285  TYR A CG    1 
ATOM   2261 C CD1   . TYR A 1 285 ? -26.580 30.838 77.407  1.00 10.57 ? 285  TYR A CD1   1 
ATOM   2262 C CD2   . TYR A 1 285 ? -26.640 28.449 77.252  1.00 11.33 ? 285  TYR A CD2   1 
ATOM   2263 C CE1   . TYR A 1 285 ? -25.241 30.784 77.785  1.00 11.22 ? 285  TYR A CE1   1 
ATOM   2264 C CE2   . TYR A 1 285 ? -25.304 28.383 77.628  1.00 10.99 ? 285  TYR A CE2   1 
ATOM   2265 C CZ    . TYR A 1 285 ? -24.611 29.549 77.888  1.00 11.19 ? 285  TYR A CZ    1 
ATOM   2266 O OH    . TYR A 1 285 ? -23.281 29.466 78.214  1.00 11.65 ? 285  TYR A OH    1 
ATOM   2267 N N     . PRO A 1 286 ? -30.247 28.543 73.990  1.00 11.04 ? 286  PRO A N     1 
ATOM   2268 C CA    . PRO A 1 286 ? -31.499 28.012 73.455  1.00 11.46 ? 286  PRO A CA    1 
ATOM   2269 C C     . PRO A 1 286 ? -32.343 27.473 74.600  1.00 12.39 ? 286  PRO A C     1 
ATOM   2270 O O     . PRO A 1 286 ? -31.809 27.095 75.643  1.00 12.34 ? 286  PRO A O     1 
ATOM   2271 C CB    . PRO A 1 286 ? -31.028 26.909 72.516  1.00 11.11 ? 286  PRO A CB    1 
ATOM   2272 C CG    . PRO A 1 286 ? -29.812 26.387 73.219  1.00 11.33 ? 286  PRO A CG    1 
ATOM   2273 C CD    . PRO A 1 286 ? -29.114 27.662 73.647  1.00 11.42 ? 286  PRO A CD    1 
ATOM   2274 N N     . ASP A 1 287 ? -33.657 27.444 74.421  1.00 12.82 ? 287  ASP A N     1 
ATOM   2275 C CA    . ASP A 1 287 ? -34.524 26.939 75.471  1.00 13.97 ? 287  ASP A CA    1 
ATOM   2276 C C     . ASP A 1 287 ? -34.284 25.458 75.702  1.00 14.35 ? 287  ASP A C     1 
ATOM   2277 O O     . ASP A 1 287 ? -34.705 24.906 76.722  1.00 14.40 ? 287  ASP A O     1 
ATOM   2278 C CB    . ASP A 1 287 ? -35.984 27.175 75.121  1.00 14.75 ? 287  ASP A CB    1 
ATOM   2279 C CG    . ASP A 1 287 ? -36.356 28.631 75.181  1.00 15.96 ? 287  ASP A CG    1 
ATOM   2280 O OD1   . ASP A 1 287 ? -35.610 29.402 75.819  1.00 16.53 ? 287  ASP A OD1   1 
ATOM   2281 O OD2   . ASP A 1 287 ? -37.398 29.004 74.606  1.00 17.24 ? 287  ASP A OD2   1 
ATOM   2282 N N     . SER A 1 288 ? -33.606 24.812 74.756  1.00 14.22 ? 288  SER A N     1 
ATOM   2283 C CA    . SER A 1 288 ? -33.314 23.393 74.898  1.00 14.29 ? 288  SER A CA    1 
ATOM   2284 C C     . SER A 1 288 ? -32.203 23.171 75.920  1.00 14.16 ? 288  SER A C     1 
ATOM   2285 O O     . SER A 1 288 ? -32.060 22.075 76.454  1.00 15.52 ? 288  SER A O     1 
ATOM   2286 C CB    . SER A 1 288 ? -32.930 22.784 73.548  1.00 14.12 ? 288  SER A CB    1 
ATOM   2287 O OG    . SER A 1 288 ? -31.858 23.483 72.949  1.00 14.56 ? 288  SER A OG    1 
ATOM   2288 N N     . TYR A 1 289 ? -31.425 24.208 76.214  1.00 13.30 ? 289  TYR A N     1 
ATOM   2289 C CA    . TYR A 1 289 ? -30.350 24.065 77.191  1.00 13.08 ? 289  TYR A CA    1 
ATOM   2290 C C     . TYR A 1 289 ? -30.924 23.856 78.599  1.00 13.41 ? 289  TYR A C     1 
ATOM   2291 O O     . TYR A 1 289 ? -31.771 24.622 79.057  1.00 13.40 ? 289  TYR A O     1 
ATOM   2292 C CB    . TYR A 1 289 ? -29.429 25.291 77.164  1.00 12.35 ? 289  TYR A CB    1 
ATOM   2293 C CG    . TYR A 1 289 ? -28.172 25.102 77.985  1.00 12.94 ? 289  TYR A CG    1 
ATOM   2294 C CD1   . TYR A 1 289 ? -28.193 25.245 79.372  1.00 12.64 ? 289  TYR A CD1   1 
ATOM   2295 C CD2   . TYR A 1 289 ? -26.971 24.722 77.377  1.00 12.76 ? 289  TYR A CD2   1 
ATOM   2296 C CE1   . TYR A 1 289 ? -27.056 25.011 80.137  1.00 13.33 ? 289  TYR A CE1   1 
ATOM   2297 C CE2   . TYR A 1 289 ? -25.824 24.482 78.136  1.00 12.89 ? 289  TYR A CE2   1 
ATOM   2298 C CZ    . TYR A 1 289 ? -25.879 24.627 79.514  1.00 13.25 ? 289  TYR A CZ    1 
ATOM   2299 O OH    . TYR A 1 289 ? -24.767 24.361 80.276  1.00 14.00 ? 289  TYR A OH    1 
ATOM   2300 N N     . LYS A 1 290 ? -30.455 22.813 79.280  1.00 13.12 ? 290  LYS A N     1 
ATOM   2301 C CA    . LYS A 1 290 ? -30.934 22.479 80.620  1.00 13.75 ? 290  LYS A CA    1 
ATOM   2302 C C     . LYS A 1 290 ? -30.185 23.244 81.718  1.00 14.22 ? 290  LYS A C     1 
ATOM   2303 O O     . LYS A 1 290 ? -28.970 23.114 81.863  1.00 15.45 ? 290  LYS A O     1 
ATOM   2304 C CB    . LYS A 1 290 ? -30.794 20.971 80.818  1.00 14.08 ? 290  LYS A CB    1 
ATOM   2305 C CG    . LYS A 1 290 ? -31.201 20.216 79.557  1.00 15.98 ? 290  LYS A CG    1 
ATOM   2306 C CD    . LYS A 1 290 ? -30.753 18.768 79.560  1.00 17.62 ? 290  LYS A CD    1 
ATOM   2307 C CE    . LYS A 1 290 ? -31.731 17.902 80.304  1.00 18.62 ? 290  LYS A CE    1 
ATOM   2308 N NZ    . LYS A 1 290 ? -33.057 17.983 79.646  1.00 19.41 ? 290  LYS A NZ    1 
ATOM   2309 N N     . VAL A 1 291 ? -30.909 24.053 82.484  1.00 13.94 ? 291  VAL A N     1 
ATOM   2310 C CA    . VAL A 1 291 ? -30.286 24.829 83.550  1.00 13.74 ? 291  VAL A CA    1 
ATOM   2311 C C     . VAL A 1 291 ? -30.044 23.948 84.767  1.00 13.11 ? 291  VAL A C     1 
ATOM   2312 O O     . VAL A 1 291 ? -30.694 22.923 84.947  1.00 13.71 ? 291  VAL A O     1 
ATOM   2313 C CB    . VAL A 1 291 ? -31.165 26.048 83.958  1.00 13.55 ? 291  VAL A CB    1 
ATOM   2314 C CG1   . VAL A 1 291 ? -31.538 26.856 82.724  1.00 13.09 ? 291  VAL A CG1   1 
ATOM   2315 C CG2   . VAL A 1 291 ? -32.412 25.584 84.669  1.00 14.93 ? 291  VAL A CG2   1 
ATOM   2316 N N     . HIS A 1 292 ? -29.102 24.349 85.602  1.00 12.68 ? 292  HIS A N     1 
ATOM   2317 C CA    . HIS A 1 292 ? -28.787 23.580 86.789  1.00 12.31 ? 292  HIS A CA    1 
ATOM   2318 C C     . HIS A 1 292 ? -29.962 23.618 87.770  1.00 12.78 ? 292  HIS A C     1 
ATOM   2319 O O     . HIS A 1 292 ? -30.625 24.643 87.913  1.00 12.87 ? 292  HIS A O     1 
ATOM   2320 C CB    . HIS A 1 292 ? -27.527 24.148 87.436  1.00 11.35 ? 292  HIS A CB    1 
ATOM   2321 C CG    . HIS A 1 292 ? -26.937 23.261 88.485  1.00 10.87 ? 292  HIS A CG    1 
ATOM   2322 N ND1   . HIS A 1 292 ? -27.367 23.264 89.795  1.00 10.91 ? 292  HIS A ND1   1 
ATOM   2323 C CD2   . HIS A 1 292 ? -25.957 22.332 88.413  1.00 10.83 ? 292  HIS A CD2   1 
ATOM   2324 C CE1   . HIS A 1 292 ? -26.676 22.376 90.486  1.00 11.21 ? 292  HIS A CE1   1 
ATOM   2325 N NE2   . HIS A 1 292 ? -25.813 21.796 89.669  1.00 11.07 ? 292  HIS A NE2   1 
ATOM   2326 N N     . PRO A 1 293 ? -30.251 22.486 88.437  1.00 13.51 ? 293  PRO A N     1 
ATOM   2327 C CA    . PRO A 1 293 ? -31.351 22.403 89.405  1.00 13.85 ? 293  PRO A CA    1 
ATOM   2328 C C     . PRO A 1 293 ? -31.290 23.430 90.546  1.00 14.13 ? 293  PRO A C     1 
ATOM   2329 O O     . PRO A 1 293 ? -32.317 23.764 91.130  1.00 15.08 ? 293  PRO A O     1 
ATOM   2330 C CB    . PRO A 1 293 ? -31.284 20.949 89.893  1.00 14.23 ? 293  PRO A CB    1 
ATOM   2331 C CG    . PRO A 1 293 ? -29.885 20.506 89.553  1.00 13.87 ? 293  PRO A CG    1 
ATOM   2332 C CD    . PRO A 1 293 ? -29.643 21.160 88.229  1.00 13.32 ? 293  PRO A CD    1 
ATOM   2333 N N     . SER A 1 294 ? -30.099 23.925 90.871  1.00 13.61 ? 294  SER A N     1 
ATOM   2334 C CA    . SER A 1 294 ? -29.972 24.943 91.911  1.00 13.34 ? 294  SER A CA    1 
ATOM   2335 C C     . SER A 1 294 ? -30.078 26.304 91.235  1.00 13.49 ? 294  SER A C     1 
ATOM   2336 O O     . SER A 1 294 ? -29.233 26.656 90.413  1.00 14.29 ? 294  SER A O     1 
ATOM   2337 C CB    . SER A 1 294 ? -28.622 24.836 92.614  1.00 13.73 ? 294  SER A CB    1 
ATOM   2338 O OG    . SER A 1 294 ? -28.392 25.978 93.421  1.00 13.30 ? 294  SER A OG    1 
ATOM   2339 N N     . THR A 1 295 ? -31.113 27.072 91.560  1.00 13.19 ? 295  THR A N     1 
ATOM   2340 C CA    . THR A 1 295 ? -31.276 28.377 90.935  1.00 13.38 ? 295  THR A CA    1 
ATOM   2341 C C     . THR A 1 295 ? -30.101 29.279 91.277  1.00 12.94 ? 295  THR A C     1 
ATOM   2342 O O     . THR A 1 295 ? -29.663 30.076 90.451  1.00 12.20 ? 295  THR A O     1 
ATOM   2343 C CB    . THR A 1 295 ? -32.574 29.064 91.371  1.00 13.68 ? 295  THR A CB    1 
ATOM   2344 O OG1   . THR A 1 295 ? -32.536 29.296 92.782  1.00 14.97 ? 295  THR A OG1   1 
ATOM   2345 C CG2   . THR A 1 295 ? -33.777 28.199 91.029  1.00 14.33 ? 295  THR A CG2   1 
ATOM   2346 N N     . SER A 1 296 ? -29.593 29.147 92.499  1.00 13.21 ? 296  SER A N     1 
ATOM   2347 C CA    . SER A 1 296 ? -28.455 29.940 92.943  1.00 12.81 ? 296  SER A CA    1 
ATOM   2348 C C     . SER A 1 296 ? -27.235 29.633 92.082  1.00 12.36 ? 296  SER A C     1 
ATOM   2349 O O     . SER A 1 296 ? -26.527 30.542 91.664  1.00 12.00 ? 296  SER A O     1 
ATOM   2350 C CB    . SER A 1 296 ? -28.144 29.646 94.408  1.00 14.12 ? 296  SER A CB    1 
ATOM   2351 O OG    . SER A 1 296 ? -26.986 30.344 94.819  1.00 15.20 ? 296  SER A OG    1 
ATOM   2352 N N     . GLN A 1 297 ? -26.995 28.354 91.804  1.00 11.81 ? 297  GLN A N     1 
ATOM   2353 C CA    . GLN A 1 297 ? -25.861 27.979 90.967  1.00 11.82 ? 297  GLN A CA    1 
ATOM   2354 C C     . GLN A 1 297 ? -26.116 28.374 89.511  1.00 11.34 ? 297  GLN A C     1 
ATOM   2355 O O     . GLN A 1 297 ? -25.195 28.770 88.804  1.00 11.91 ? 297  GLN A O     1 
ATOM   2356 C CB    . GLN A 1 297 ? -25.578 26.473 91.074  1.00 12.06 ? 297  GLN A CB    1 
ATOM   2357 C CG    . GLN A 1 297 ? -24.970 26.042 92.412  1.00 11.85 ? 297  GLN A CG    1 
ATOM   2358 C CD    . GLN A 1 297 ? -23.670 26.780 92.739  1.00 12.62 ? 297  GLN A CD    1 
ATOM   2359 O OE1   . GLN A 1 297 ? -22.731 26.793 91.944  1.00 12.75 ? 297  GLN A OE1   1 
ATOM   2360 N NE2   . GLN A 1 297 ? -23.616 27.391 93.914  1.00 12.08 ? 297  GLN A NE2   1 
ATOM   2361 N N     . ALA A 1 298 ? -27.363 28.285 89.064  1.00 9.90  ? 298  ALA A N     1 
ATOM   2362 C CA    . ALA A 1 298 ? -27.691 28.664 87.693  1.00 9.86  ? 298  ALA A CA    1 
ATOM   2363 C C     . ALA A 1 298 ? -27.452 30.166 87.471  1.00 9.86  ? 298  ALA A C     1 
ATOM   2364 O O     . ALA A 1 298 ? -26.952 30.570 86.419  1.00 9.61  ? 298  ALA A O     1 
ATOM   2365 C CB    . ALA A 1 298 ? -29.143 28.306 87.376  1.00 9.48  ? 298  ALA A CB    1 
ATOM   2366 N N     . TYR A 1 299 ? -27.819 30.991 88.450  1.00 9.69  ? 299  TYR A N     1 
ATOM   2367 C CA    . TYR A 1 299 ? -27.616 32.439 88.343  1.00 10.01 ? 299  TYR A CA    1 
ATOM   2368 C C     . TYR A 1 299 ? -26.115 32.734 88.255  1.00 10.79 ? 299  TYR A C     1 
ATOM   2369 O O     . TYR A 1 299 ? -25.674 33.576 87.460  1.00 10.29 ? 299  TYR A O     1 
ATOM   2370 C CB    . TYR A 1 299 ? -28.205 33.175 89.558  1.00 9.89  ? 299  TYR A CB    1 
ATOM   2371 C CG    . TYR A 1 299 ? -29.713 33.370 89.537  1.00 10.02 ? 299  TYR A CG    1 
ATOM   2372 C CD1   . TYR A 1 299 ? -30.346 33.970 88.442  1.00 9.68  ? 299  TYR A CD1   1 
ATOM   2373 C CD2   . TYR A 1 299 ? -30.504 32.992 90.631  1.00 9.88  ? 299  TYR A CD2   1 
ATOM   2374 C CE1   . TYR A 1 299 ? -31.725 34.192 88.433  1.00 9.00  ? 299  TYR A CE1   1 
ATOM   2375 C CE2   . TYR A 1 299 ? -31.887 33.211 90.633  1.00 9.86  ? 299  TYR A CE2   1 
ATOM   2376 C CZ    . TYR A 1 299 ? -32.487 33.813 89.529  1.00 9.49  ? 299  TYR A CZ    1 
ATOM   2377 O OH    . TYR A 1 299 ? -33.843 34.047 89.520  1.00 9.21  ? 299  TYR A OH    1 
ATOM   2378 N N     . LYS A 1 300 ? -25.338 32.035 89.076  1.00 10.25 ? 300  LYS A N     1 
ATOM   2379 C CA    . LYS A 1 300 ? -23.895 32.198 89.087  1.00 10.78 ? 300  LYS A CA    1 
ATOM   2380 C C     . LYS A 1 300 ? -23.296 31.807 87.737  1.00 11.01 ? 300  LYS A C     1 
ATOM   2381 O O     . LYS A 1 300 ? -22.474 32.530 87.178  1.00 11.36 ? 300  LYS A O     1 
ATOM   2382 C CB    . LYS A 1 300 ? -23.282 31.330 90.187  1.00 10.96 ? 300  LYS A CB    1 
ATOM   2383 C CG    . LYS A 1 300 ? -21.762 31.288 90.180  1.00 11.21 ? 300  LYS A CG    1 
ATOM   2384 C CD    . LYS A 1 300 ? -21.245 30.501 91.360  1.00 10.98 ? 300  LYS A CD    1 
ATOM   2385 C CE    . LYS A 1 300 ? -19.730 30.481 91.401  1.00 10.96 ? 300  LYS A CE    1 
ATOM   2386 N NZ    . LYS A 1 300 ? -19.256 29.876 92.673  1.00 11.21 ? 300  LYS A NZ    1 
ATOM   2387 N N     . GLN A 1 301 ? -23.716 30.659 87.221  1.00 10.78 ? 301  GLN A N     1 
ATOM   2388 C CA    . GLN A 1 301 ? -23.218 30.151 85.948  1.00 10.71 ? 301  GLN A CA    1 
ATOM   2389 C C     . GLN A 1 301 ? -23.517 31.075 84.771  1.00 10.69 ? 301  GLN A C     1 
ATOM   2390 O O     . GLN A 1 301 ? -22.627 31.374 83.972  1.00 10.77 ? 301  GLN A O     1 
ATOM   2391 C CB    . GLN A 1 301 ? -23.783 28.747 85.710  1.00 10.56 ? 301  GLN A CB    1 
ATOM   2392 C CG    . GLN A 1 301 ? -23.515 27.825 86.897  1.00 11.87 ? 301  GLN A CG    1 
ATOM   2393 C CD    . GLN A 1 301 ? -24.156 26.462 86.769  1.00 11.45 ? 301  GLN A CD    1 
ATOM   2394 O OE1   . GLN A 1 301 ? -25.101 26.283 86.013  1.00 12.02 ? 301  GLN A OE1   1 
ATOM   2395 N NE2   . GLN A 1 301 ? -23.650 25.492 87.527  1.00 11.95 ? 301  GLN A NE2   1 
ATOM   2396 N N     . PHE A 1 302 ? -24.758 31.537 84.651  1.00 10.12 ? 302  PHE A N     1 
ATOM   2397 C CA    . PHE A 1 302 ? -25.080 32.436 83.556  1.00 9.94  ? 302  PHE A CA    1 
ATOM   2398 C C     . PHE A 1 302 ? -24.391 33.779 83.767  1.00 9.80  ? 302  PHE A C     1 
ATOM   2399 O O     . PHE A 1 302 ? -24.070 34.477 82.807  1.00 9.86  ? 302  PHE A O     1 
ATOM   2400 C CB    . PHE A 1 302 ? -26.591 32.595 83.421  1.00 9.92  ? 302  PHE A CB    1 
ATOM   2401 C CG    . PHE A 1 302 ? -27.258 31.400 82.797  1.00 10.48 ? 302  PHE A CG    1 
ATOM   2402 C CD1   . PHE A 1 302 ? -26.964 31.033 81.487  1.00 9.96  ? 302  PHE A CD1   1 
ATOM   2403 C CD2   . PHE A 1 302 ? -28.149 30.616 83.531  1.00 10.80 ? 302  PHE A CD2   1 
ATOM   2404 C CE1   . PHE A 1 302 ? -27.539 29.902 80.915  1.00 10.18 ? 302  PHE A CE1   1 
ATOM   2405 C CE2   . PHE A 1 302 ? -28.731 29.480 82.967  1.00 10.04 ? 302  PHE A CE2   1 
ATOM   2406 C CZ    . PHE A 1 302 ? -28.426 29.123 81.658  1.00 10.26 ? 302  PHE A CZ    1 
ATOM   2407 N N     . GLY A 1 303 ? -24.130 34.121 85.025  1.00 9.52  ? 303  GLY A N     1 
ATOM   2408 C CA    . GLY A 1 303 ? -23.454 35.368 85.318  1.00 9.51  ? 303  GLY A CA    1 
ATOM   2409 C C     . GLY A 1 303 ? -22.014 35.335 84.842  1.00 10.52 ? 303  GLY A C     1 
ATOM   2410 O O     . GLY A 1 303 ? -21.442 36.370 84.519  1.00 10.69 ? 303  GLY A O     1 
ATOM   2411 N N     . ASN A 1 304 ? -21.433 34.140 84.792  1.00 10.41 ? 304  ASN A N     1 
ATOM   2412 C CA    . ASN A 1 304 ? -20.050 33.941 84.352  1.00 10.68 ? 304  ASN A CA    1 
ATOM   2413 C C     . ASN A 1 304 ? -19.973 33.711 82.856  1.00 11.32 ? 304  ASN A C     1 
ATOM   2414 O O     . ASN A 1 304 ? -18.913 33.854 82.260  1.00 10.95 ? 304  ASN A O     1 
ATOM   2415 C CB    . ASN A 1 304 ? -19.439 32.690 85.007  1.00 10.56 ? 304  ASN A CB    1 
ATOM   2416 C CG    . ASN A 1 304 ? -18.651 32.997 86.257  1.00 11.13 ? 304  ASN A CG    1 
ATOM   2417 O OD1   . ASN A 1 304 ? -18.157 34.104 86.437  1.00 11.33 ? 304  ASN A OD1   1 
ATOM   2418 N ND2   . ASN A 1 304 ? -18.501 31.997 87.119  1.00 10.50 ? 304  ASN A ND2   1 
ATOM   2419 N N     . SER A 1 305 ? -21.103 33.355 82.261  1.00 12.47 ? 305  SER A N     1 
ATOM   2420 C CA    . SER A 1 305 ? -21.151 32.992 80.857  1.00 13.59 ? 305  SER A CA    1 
ATOM   2421 C C     . SER A 1 305 ? -20.940 34.046 79.789  1.00 14.05 ? 305  SER A C     1 
ATOM   2422 O O     . SER A 1 305 ? -20.790 35.240 80.067  1.00 13.86 ? 305  SER A O     1 
ATOM   2423 C CB    . SER A 1 305 ? -22.457 32.251 80.567  1.00 14.61 ? 305  SER A CB    1 
ATOM   2424 O OG    . SER A 1 305 ? -22.255 31.268 79.567  1.00 17.31 ? 305  SER A OG    1 
ATOM   2425 N N     . VAL A 1 306 ? -20.931 33.554 78.553  1.00 13.69 ? 306  VAL A N     1 
ATOM   2426 C CA    . VAL A 1 306 ? -20.743 34.354 77.352  1.00 14.27 ? 306  VAL A CA    1 
ATOM   2427 C C     . VAL A 1 306 ? -22.069 34.458 76.611  1.00 14.00 ? 306  VAL A C     1 
ATOM   2428 O O     . VAL A 1 306 ? -22.988 33.680 76.861  1.00 15.03 ? 306  VAL A O     1 
ATOM   2429 C CB    . VAL A 1 306 ? -19.728 33.673 76.399  1.00 14.67 ? 306  VAL A CB    1 
ATOM   2430 C CG1   . VAL A 1 306 ? -18.320 33.802 76.934  1.00 14.28 ? 306  VAL A CG1   1 
ATOM   2431 C CG2   . VAL A 1 306 ? -20.091 32.192 76.243  1.00 14.88 ? 306  VAL A CG2   1 
ATOM   2432 N N     . VAL A 1 307 ? -22.165 35.425 75.705  1.00 13.19 ? 307  VAL A N     1 
ATOM   2433 C CA    . VAL A 1 307 ? -23.367 35.600 74.899  1.00 12.68 ? 307  VAL A CA    1 
ATOM   2434 C C     . VAL A 1 307 ? -23.098 34.739 73.667  1.00 12.32 ? 307  VAL A C     1 
ATOM   2435 O O     . VAL A 1 307 ? -22.228 35.060 72.865  1.00 11.65 ? 307  VAL A O     1 
ATOM   2436 C CB    . VAL A 1 307 ? -23.569 37.088 74.490  1.00 12.68 ? 307  VAL A CB    1 
ATOM   2437 C CG1   . VAL A 1 307 ? -24.783 37.223 73.586  1.00 12.40 ? 307  VAL A CG1   1 
ATOM   2438 C CG2   . VAL A 1 307 ? -23.756 37.955 75.736  1.00 11.88 ? 307  VAL A CG2   1 
ATOM   2439 N N     . ILE A 1 308 ? -23.834 33.636 73.543  1.00 12.77 ? 308  ILE A N     1 
ATOM   2440 C CA    . ILE A 1 308 ? -23.657 32.687 72.444  1.00 12.92 ? 308  ILE A CA    1 
ATOM   2441 C C     . ILE A 1 308 ? -23.613 33.301 71.050  1.00 13.32 ? 308  ILE A C     1 
ATOM   2442 O O     . ILE A 1 308 ? -22.691 33.027 70.279  1.00 14.37 ? 308  ILE A O     1 
ATOM   2443 C CB    . ILE A 1 308 ? -24.766 31.604 72.447  1.00 12.49 ? 308  ILE A CB    1 
ATOM   2444 C CG1   . ILE A 1 308 ? -24.949 31.038 73.856  1.00 12.09 ? 308  ILE A CG1   1 
ATOM   2445 C CG2   . ILE A 1 308 ? -24.391 30.477 71.492  1.00 11.95 ? 308  ILE A CG2   1 
ATOM   2446 C CD1   . ILE A 1 308 ? -23.688 30.466 74.461  1.00 11.61 ? 308  ILE A CD1   1 
ATOM   2447 N N     . ASN A 1 309 ? -24.604 34.126 70.727  1.00 12.95 ? 309  ASN A N     1 
ATOM   2448 C CA    . ASN A 1 309 ? -24.674 34.745 69.416  1.00 13.25 ? 309  ASN A CA    1 
ATOM   2449 C C     . ASN A 1 309 ? -23.392 35.474 69.033  1.00 13.74 ? 309  ASN A C     1 
ATOM   2450 O O     . ASN A 1 309 ? -22.944 35.385 67.889  1.00 14.17 ? 309  ASN A O     1 
ATOM   2451 C CB    . ASN A 1 309 ? -25.848 35.716 69.355  1.00 13.43 ? 309  ASN A CB    1 
ATOM   2452 C CG    . ASN A 1 309 ? -27.163 35.045 69.647  1.00 13.89 ? 309  ASN A CG    1 
ATOM   2453 O OD1   . ASN A 1 309 ? -27.309 34.373 70.663  1.00 14.93 ? 309  ASN A OD1   1 
ATOM   2454 N ND2   . ASN A 1 309 ? -28.133 35.224 68.760  1.00 13.90 ? 309  ASN A ND2   1 
ATOM   2455 N N     . VAL A 1 310 ? -22.802 36.201 69.977  1.00 13.20 ? 310  VAL A N     1 
ATOM   2456 C CA    . VAL A 1 310 ? -21.581 36.933 69.677  1.00 13.06 ? 310  VAL A CA    1 
ATOM   2457 C C     . VAL A 1 310 ? -20.457 35.953 69.335  1.00 12.88 ? 310  VAL A C     1 
ATOM   2458 O O     . VAL A 1 310 ? -19.728 36.158 68.364  1.00 12.85 ? 310  VAL A O     1 
ATOM   2459 C CB    . VAL A 1 310 ? -21.160 37.849 70.858  1.00 13.08 ? 310  VAL A CB    1 
ATOM   2460 C CG1   . VAL A 1 310 ? -19.881 38.596 70.501  1.00 12.71 ? 310  VAL A CG1   1 
ATOM   2461 C CG2   . VAL A 1 310 ? -22.277 38.852 71.172  1.00 12.37 ? 310  VAL A CG2   1 
ATOM   2462 N N     . LEU A 1 311 ? -20.329 34.883 70.118  1.00 12.95 ? 311  LEU A N     1 
ATOM   2463 C CA    . LEU A 1 311 ? -19.303 33.879 69.861  1.00 13.28 ? 311  LEU A CA    1 
ATOM   2464 C C     . LEU A 1 311 ? -19.569 33.177 68.528  1.00 13.12 ? 311  LEU A C     1 
ATOM   2465 O O     . LEU A 1 311 ? -18.640 32.761 67.847  1.00 12.89 ? 311  LEU A O     1 
ATOM   2466 C CB    . LEU A 1 311 ? -19.264 32.835 70.977  1.00 13.50 ? 311  LEU A CB    1 
ATOM   2467 C CG    . LEU A 1 311 ? -18.968 33.304 72.398  1.00 14.00 ? 311  LEU A CG    1 
ATOM   2468 C CD1   . LEU A 1 311 ? -18.707 32.081 73.260  1.00 13.31 ? 311  LEU A CD1   1 
ATOM   2469 C CD2   . LEU A 1 311 ? -17.764 34.224 72.412  1.00 14.54 ? 311  LEU A CD2   1 
ATOM   2470 N N     . GLN A 1 312 ? -20.840 33.040 68.164  1.00 12.98 ? 312  GLN A N     1 
ATOM   2471 C CA    . GLN A 1 312 ? -21.199 32.410 66.901  1.00 13.10 ? 312  GLN A CA    1 
ATOM   2472 C C     . GLN A 1 312 ? -20.679 33.208 65.713  1.00 12.87 ? 312  GLN A C     1 
ATOM   2473 O O     . GLN A 1 312 ? -20.082 32.644 64.803  1.00 12.95 ? 312  GLN A O     1 
ATOM   2474 C CB    . GLN A 1 312 ? -22.715 32.271 66.776  1.00 13.22 ? 312  GLN A CB    1 
ATOM   2475 C CG    . GLN A 1 312 ? -23.317 31.170 67.614  1.00 13.15 ? 312  GLN A CG    1 
ATOM   2476 C CD    . GLN A 1 312 ? -24.782 30.990 67.322  1.00 14.31 ? 312  GLN A CD    1 
ATOM   2477 O OE1   . GLN A 1 312 ? -25.600 31.843 67.666  1.00 13.71 ? 312  GLN A OE1   1 
ATOM   2478 N NE2   . GLN A 1 312 ? -25.126 29.883 66.667  1.00 14.15 ? 312  GLN A NE2   1 
ATOM   2479 N N     . TYR A 1 313 ? -20.913 34.518 65.718  1.00 12.91 ? 313  TYR A N     1 
ATOM   2480 C CA    . TYR A 1 313 ? -20.458 35.371 64.622  1.00 13.07 ? 313  TYR A CA    1 
ATOM   2481 C C     . TYR A 1 313 ? -18.937 35.392 64.536  1.00 13.49 ? 313  TYR A C     1 
ATOM   2482 O O     . TYR A 1 313 ? -18.369 35.430 63.442  1.00 13.73 ? 313  TYR A O     1 
ATOM   2483 C CB    . TYR A 1 313 ? -20.979 36.793 64.798  1.00 12.77 ? 313  TYR A CB    1 
ATOM   2484 C CG    . TYR A 1 313 ? -22.479 36.899 64.747  1.00 13.29 ? 313  TYR A CG    1 
ATOM   2485 C CD1   . TYR A 1 313 ? -23.192 36.431 63.643  1.00 12.80 ? 313  TYR A CD1   1 
ATOM   2486 C CD2   . TYR A 1 313 ? -23.193 37.481 65.796  1.00 12.84 ? 313  TYR A CD2   1 
ATOM   2487 C CE1   . TYR A 1 313 ? -24.577 36.542 63.584  1.00 12.72 ? 313  TYR A CE1   1 
ATOM   2488 C CE2   . TYR A 1 313 ? -24.581 37.597 65.745  1.00 12.69 ? 313  TYR A CE2   1 
ATOM   2489 C CZ    . TYR A 1 313 ? -25.267 37.126 64.634  1.00 12.65 ? 313  TYR A CZ    1 
ATOM   2490 O OH    . TYR A 1 313 ? -26.635 37.258 64.564  1.00 12.37 ? 313  TYR A OH    1 
ATOM   2491 N N     . ILE A 1 314 ? -18.279 35.381 65.691  1.00 12.36 ? 314  ILE A N     1 
ATOM   2492 C CA    . ILE A 1 314 ? -16.825 35.376 65.729  1.00 12.71 ? 314  ILE A CA    1 
ATOM   2493 C C     . ILE A 1 314 ? -16.319 34.046 65.198  1.00 13.09 ? 314  ILE A C     1 
ATOM   2494 O O     . ILE A 1 314 ? -15.420 34.005 64.366  1.00 14.15 ? 314  ILE A O     1 
ATOM   2495 C CB    . ILE A 1 314 ? -16.288 35.562 67.169  1.00 11.93 ? 314  ILE A CB    1 
ATOM   2496 C CG1   . ILE A 1 314 ? -16.651 36.960 67.679  1.00 11.62 ? 314  ILE A CG1   1 
ATOM   2497 C CG2   . ILE A 1 314 ? -14.770 35.355 67.189  1.00 11.68 ? 314  ILE A CG2   1 
ATOM   2498 C CD1   . ILE A 1 314 ? -16.223 37.237 69.124  1.00 11.04 ? 314  ILE A CD1   1 
ATOM   2499 N N     . ALA A 1 315 ? -16.903 32.958 65.687  1.00 13.68 ? 315  ALA A N     1 
ATOM   2500 C CA    . ALA A 1 315 ? -16.504 31.622 65.263  1.00 14.31 ? 315  ALA A CA    1 
ATOM   2501 C C     . ALA A 1 315 ? -16.679 31.454 63.752  1.00 14.68 ? 315  ALA A C     1 
ATOM   2502 O O     . ALA A 1 315 ? -15.855 30.828 63.081  1.00 15.19 ? 315  ALA A O     1 
ATOM   2503 C CB    . ALA A 1 315 ? -17.324 30.568 66.015  1.00 13.59 ? 315  ALA A CB    1 
ATOM   2504 N N     . TYR A 1 316 ? -17.755 32.020 63.224  1.00 15.00 ? 316  TYR A N     1 
ATOM   2505 C CA    . TYR A 1 316 ? -18.039 31.930 61.806  1.00 15.27 ? 316  TYR A CA    1 
ATOM   2506 C C     . TYR A 1 316 ? -16.955 32.659 61.028  1.00 15.27 ? 316  TYR A C     1 
ATOM   2507 O O     . TYR A 1 316 ? -16.517 32.200 59.973  1.00 15.28 ? 316  TYR A O     1 
ATOM   2508 C CB    . TYR A 1 316 ? -19.397 32.554 61.497  1.00 15.65 ? 316  TYR A CB    1 
ATOM   2509 C CG    . TYR A 1 316 ? -19.818 32.377 60.059  1.00 16.18 ? 316  TYR A CG    1 
ATOM   2510 C CD1   . TYR A 1 316 ? -20.613 31.302 59.678  1.00 16.31 ? 316  TYR A CD1   1 
ATOM   2511 C CD2   . TYR A 1 316 ? -19.395 33.276 59.069  1.00 16.17 ? 316  TYR A CD2   1 
ATOM   2512 C CE1   . TYR A 1 316 ? -20.980 31.120 58.351  1.00 17.66 ? 316  TYR A CE1   1 
ATOM   2513 C CE2   . TYR A 1 316 ? -19.755 33.103 57.744  1.00 16.77 ? 316  TYR A CE2   1 
ATOM   2514 C CZ    . TYR A 1 316 ? -20.547 32.020 57.392  1.00 17.53 ? 316  TYR A CZ    1 
ATOM   2515 O OH    . TYR A 1 316 ? -20.903 31.821 56.078  1.00 19.82 ? 316  TYR A OH    1 
ATOM   2516 N N     . ASN A 1 317 ? -16.531 33.803 61.555  1.00 14.62 ? 317  ASN A N     1 
ATOM   2517 C CA    . ASN A 1 317 ? -15.495 34.604 60.922  1.00 14.73 ? 317  ASN A CA    1 
ATOM   2518 C C     . ASN A 1 317 ? -14.122 33.952 61.030  1.00 14.27 ? 317  ASN A C     1 
ATOM   2519 O O     . ASN A 1 317 ? -13.282 34.116 60.148  1.00 15.00 ? 317  ASN A O     1 
ATOM   2520 C CB    . ASN A 1 317 ? -15.493 36.012 61.519  1.00 14.37 ? 317  ASN A CB    1 
ATOM   2521 C CG    . ASN A 1 317 ? -16.632 36.860 60.986  1.00 14.98 ? 317  ASN A CG    1 
ATOM   2522 O OD1   . ASN A 1 317 ? -17.603 36.336 60.434  1.00 14.60 ? 317  ASN A OD1   1 
ATOM   2523 N ND2   . ASN A 1 317 ? -16.524 38.174 61.148  1.00 14.06 ? 317  ASN A ND2   1 
ATOM   2524 N N     . ILE A 1 318 ? -13.894 33.202 62.104  1.00 13.82 ? 318  ILE A N     1 
ATOM   2525 C CA    . ILE A 1 318 ? -12.625 32.505 62.263  1.00 12.92 ? 318  ILE A CA    1 
ATOM   2526 C C     . ILE A 1 318 ? -12.570 31.439 61.167  1.00 13.14 ? 318  ILE A C     1 
ATOM   2527 O O     . ILE A 1 318 ? -11.561 31.286 60.479  1.00 12.98 ? 318  ILE A O     1 
ATOM   2528 C CB    . ILE A 1 318 ? -12.516 31.826 63.661  1.00 12.19 ? 318  ILE A CB    1 
ATOM   2529 C CG1   . ILE A 1 318 ? -12.291 32.890 64.738  1.00 10.75 ? 318  ILE A CG1   1 
ATOM   2530 C CG2   . ILE A 1 318 ? -11.388 30.792 63.658  1.00 11.29 ? 318  ILE A CG2   1 
ATOM   2531 C CD1   . ILE A 1 318 ? -12.301 32.357 66.146  1.00 10.52 ? 318  ILE A CD1   1 
ATOM   2532 N N     . GLY A 1 319 ? -13.670 30.711 61.011  1.00 13.47 ? 319  GLY A N     1 
ATOM   2533 C CA    . GLY A 1 319 ? -13.742 29.677 59.995  1.00 13.74 ? 319  GLY A CA    1 
ATOM   2534 C C     . GLY A 1 319 ? -13.622 30.256 58.596  1.00 14.34 ? 319  GLY A C     1 
ATOM   2535 O O     . GLY A 1 319 ? -12.952 29.680 57.736  1.00 14.41 ? 319  GLY A O     1 
ATOM   2536 N N     . SER A 1 320 ? -14.274 31.393 58.367  1.00 13.96 ? 320  SER A N     1 
ATOM   2537 C CA    . SER A 1 320 ? -14.225 32.060 57.074  1.00 15.76 ? 320  SER A CA    1 
ATOM   2538 C C     . SER A 1 320 ? -12.777 32.342 56.690  1.00 17.02 ? 320  SER A C     1 
ATOM   2539 O O     . SER A 1 320 ? -12.386 32.152 55.536  1.00 17.90 ? 320  SER A O     1 
ATOM   2540 C CB    . SER A 1 320 ? -15.006 33.377 57.120  1.00 15.67 ? 320  SER A CB    1 
ATOM   2541 O OG    . SER A 1 320 ? -16.400 33.148 57.248  1.00 17.16 ? 320  SER A OG    1 
ATOM   2542 N N     . SER A 1 321 ? -11.984 32.801 57.660  1.00 17.06 ? 321  SER A N     1 
ATOM   2543 C CA    . SER A 1 321 ? -10.577 33.098 57.417  1.00 17.24 ? 321  SER A CA    1 
ATOM   2544 C C     . SER A 1 321 ? -9.730  31.846 57.214  1.00 17.31 ? 321  SER A C     1 
ATOM   2545 O O     . SER A 1 321 ? -8.869  31.817 56.341  1.00 18.42 ? 321  SER A O     1 
ATOM   2546 C CB    . SER A 1 321 ? -9.994  33.932 58.557  1.00 16.96 ? 321  SER A CB    1 
ATOM   2547 O OG    . SER A 1 321 ? -10.398 35.280 58.437  1.00 17.50 ? 321  SER A OG    1 
ATOM   2548 N N     . LEU A 1 322 ? -9.965  30.811 58.010  1.00 16.67 ? 322  LEU A N     1 
ATOM   2549 C CA    . LEU A 1 322 ? -9.199  29.582 57.860  1.00 16.61 ? 322  LEU A CA    1 
ATOM   2550 C C     . LEU A 1 322 ? -9.490  28.898 56.519  1.00 17.29 ? 322  LEU A C     1 
ATOM   2551 O O     . LEU A 1 322 ? -8.648  28.183 55.979  1.00 17.29 ? 322  LEU A O     1 
ATOM   2552 C CB    . LEU A 1 322 ? -9.523  28.614 58.997  1.00 15.80 ? 322  LEU A CB    1 
ATOM   2553 C CG    . LEU A 1 322 ? -9.189  29.053 60.422  1.00 15.76 ? 322  LEU A CG    1 
ATOM   2554 C CD1   . LEU A 1 322 ? -9.747  28.029 61.407  1.00 15.41 ? 322  LEU A CD1   1 
ATOM   2555 C CD2   . LEU A 1 322 ? -7.683  29.200 60.585  1.00 16.15 ? 322  LEU A CD2   1 
ATOM   2556 N N     . ASN A 1 323 ? -10.681 29.119 55.976  1.00 17.71 ? 323  ASN A N     1 
ATOM   2557 C CA    . ASN A 1 323 ? -11.051 28.475 54.726  1.00 18.17 ? 323  ASN A CA    1 
ATOM   2558 C C     . ASN A 1 323 ? -10.638 29.215 53.460  1.00 18.77 ? 323  ASN A C     1 
ATOM   2559 O O     . ASN A 1 323 ? -10.678 28.641 52.371  1.00 19.19 ? 323  ASN A O     1 
ATOM   2560 C CB    . ASN A 1 323 ? -12.556 28.212 54.691  1.00 18.21 ? 323  ASN A CB    1 
ATOM   2561 C CG    . ASN A 1 323 ? -13.006 27.281 55.795  1.00 18.87 ? 323  ASN A CG    1 
ATOM   2562 O OD1   . ASN A 1 323 ? -12.298 26.346 56.160  1.00 19.02 ? 323  ASN A OD1   1 
ATOM   2563 N ND2   . ASN A 1 323 ? -14.196 27.524 56.325  1.00 19.44 ? 323  ASN A ND2   1 
ATOM   2564 N N     . PHE A 1 324 ? -10.252 30.481 53.588  1.00 18.54 ? 324  PHE A N     1 
ATOM   2565 C CA    . PHE A 1 324 ? -9.828  31.241 52.419  1.00 18.35 ? 324  PHE A CA    1 
ATOM   2566 C C     . PHE A 1 324 ? -8.378  30.860 52.124  1.00 18.91 ? 324  PHE A C     1 
ATOM   2567 O O     . PHE A 1 324 ? -7.445  31.436 52.689  1.00 19.30 ? 324  PHE A O     1 
ATOM   2568 C CB    . PHE A 1 324 ? -9.943  32.744 52.680  1.00 17.02 ? 324  PHE A CB    1 
ATOM   2569 C CG    . PHE A 1 324 ? -9.723  33.583 51.460  1.00 16.40 ? 324  PHE A CG    1 
ATOM   2570 C CD1   . PHE A 1 324 ? -10.610 33.522 50.394  1.00 16.31 ? 324  PHE A CD1   1 
ATOM   2571 C CD2   . PHE A 1 324 ? -8.605  34.403 51.355  1.00 16.74 ? 324  PHE A CD2   1 
ATOM   2572 C CE1   . PHE A 1 324 ? -10.386 34.263 49.232  1.00 16.78 ? 324  PHE A CE1   1 
ATOM   2573 C CE2   . PHE A 1 324 ? -8.369  35.149 50.196  1.00 16.58 ? 324  PHE A CE2   1 
ATOM   2574 C CZ    . PHE A 1 324 ? -9.261  35.077 49.131  1.00 16.56 ? 324  PHE A CZ    1 
ATOM   2575 N N     . LYS A 1 325 ? -8.203  29.873 51.248  1.00 19.21 ? 325  LYS A N     1 
ATOM   2576 C CA    . LYS A 1 325 ? -6.879  29.380 50.877  1.00 19.79 ? 325  LYS A CA    1 
ATOM   2577 C C     . LYS A 1 325 ? -6.723  29.367 49.359  1.00 19.20 ? 325  LYS A C     1 
ATOM   2578 O O     . LYS A 1 325 ? -6.573  28.304 48.757  1.00 19.86 ? 325  LYS A O     1 
ATOM   2579 C CB    . LYS A 1 325 ? -6.684  27.954 51.397  1.00 20.86 ? 325  LYS A CB    1 
ATOM   2580 C CG    . LYS A 1 325 ? -6.916  27.763 52.888  1.00 22.58 ? 325  LYS A CG    1 
ATOM   2581 C CD    . LYS A 1 325 ? -7.056  26.273 53.201  1.00 24.43 ? 325  LYS A CD    1 
ATOM   2582 C CE    . LYS A 1 325 ? -7.386  26.007 54.662  1.00 25.56 ? 325  LYS A CE    1 
ATOM   2583 N NZ    . LYS A 1 325 ? -7.588  24.550 54.936  1.00 26.37 ? 325  LYS A NZ    1 
ATOM   2584 N N     . PRO A 1 326 ? -6.754  30.546 48.719  1.00 18.66 ? 326  PRO A N     1 
ATOM   2585 C CA    . PRO A 1 326 ? -6.610  30.582 47.261  1.00 17.93 ? 326  PRO A CA    1 
ATOM   2586 C C     . PRO A 1 326 ? -5.225  30.176 46.788  1.00 18.26 ? 326  PRO A C     1 
ATOM   2587 O O     . PRO A 1 326 ? -4.259  30.209 47.552  1.00 17.96 ? 326  PRO A O     1 
ATOM   2588 C CB    . PRO A 1 326 ? -6.922  32.036 46.921  1.00 17.06 ? 326  PRO A CB    1 
ATOM   2589 C CG    . PRO A 1 326 ? -6.406  32.769 48.120  1.00 16.80 ? 326  PRO A CG    1 
ATOM   2590 C CD    . PRO A 1 326 ? -6.920  31.909 49.259  1.00 17.33 ? 326  PRO A CD    1 
ATOM   2591 N N     . TYR A 1 327 ? -5.144  29.786 45.519  1.00 18.86 ? 327  TYR A N     1 
ATOM   2592 C CA    . TYR A 1 327 ? -3.881  29.402 44.902  1.00 18.01 ? 327  TYR A CA    1 
ATOM   2593 C C     . TYR A 1 327 ? -3.093  30.666 44.569  1.00 17.67 ? 327  TYR A C     1 
ATOM   2594 O O     . TYR A 1 327 ? -1.869  30.547 44.347  1.00 18.26 ? 327  TYR A O     1 
ATOM   2595 C CB    . TYR A 1 327 ? -4.134  28.613 43.619  1.00 18.24 ? 327  TYR A CB    1 
ATOM   2596 C CG    . TYR A 1 327 ? -4.539  27.175 43.830  1.00 18.21 ? 327  TYR A CG    1 
ATOM   2597 C CD1   . TYR A 1 327 ? -3.583  26.190 44.080  1.00 17.88 ? 327  TYR A CD1   1 
ATOM   2598 C CD2   . TYR A 1 327 ? -5.875  26.791 43.752  1.00 18.20 ? 327  TYR A CD2   1 
ATOM   2599 C CE1   . TYR A 1 327 ? -3.949  24.855 44.239  1.00 17.95 ? 327  TYR A CE1   1 
ATOM   2600 C CE2   . TYR A 1 327 ? -6.250  25.458 43.914  1.00 18.59 ? 327  TYR A CE2   1 
ATOM   2601 C CZ    . TYR A 1 327 ? -5.282  24.499 44.153  1.00 17.96 ? 327  TYR A CZ    1 
ATOM   2602 O OH    . TYR A 1 327 ? -5.653  23.184 44.282  1.00 18.63 ? 327  TYR A OH    1 
ATOM   2603 O OXT   . TYR A 1 327 ? -3.709  31.755 44.511  1.00 16.24 ? 327  TYR A OXT   1 
ATOM   2604 O "O5'" . DT  B 2 1   ? -16.561 28.619 92.783  1.00 46.37 ? 401  DT  C "O5'" 1 
ATOM   2605 C "C5'" . DT  B 2 1   ? -16.652 28.235 94.182  1.00 46.63 ? 401  DT  C "C5'" 1 
ATOM   2606 C "C4'" . DT  B 2 1   ? -17.644 27.131 94.489  1.00 45.81 ? 401  DT  C "C4'" 1 
ATOM   2607 O "O4'" . DT  B 2 1   ? -17.100 25.846 94.080  1.00 46.35 ? 401  DT  C "O4'" 1 
ATOM   2608 C "C3'" . DT  B 2 1   ? -18.004 26.981 95.973  1.00 44.94 ? 401  DT  C "C3'" 1 
ATOM   2609 O "O3'" . DT  B 2 1   ? -19.400 26.705 96.164  1.00 42.21 ? 401  DT  C "O3'" 1 
ATOM   2610 C "C2'" . DT  B 2 1   ? -17.207 25.770 96.413  1.00 45.78 ? 401  DT  C "C2'" 1 
ATOM   2611 C "C1'" . DT  B 2 1   ? -17.193 24.921 95.154  1.00 46.10 ? 401  DT  C "C1'" 1 
ATOM   2612 N N1    . DT  B 2 1   ? -16.037 23.999 95.086  1.00 46.59 ? 401  DT  C N1    1 
ATOM   2613 C C2    . DT  B 2 1   ? -16.023 22.997 94.131  1.00 46.39 ? 401  DT  C C2    1 
ATOM   2614 O O2    . DT  B 2 1   ? -16.888 22.860 93.284  1.00 45.44 ? 401  DT  C O2    1 
ATOM   2615 N N3    . DT  B 2 1   ? -14.938 22.157 94.208  1.00 46.89 ? 401  DT  C N3    1 
ATOM   2616 C C4    . DT  B 2 1   ? -13.887 22.223 95.110  1.00 47.21 ? 401  DT  C C4    1 
ATOM   2617 O O4    . DT  B 2 1   ? -12.995 21.381 95.075  1.00 47.76 ? 401  DT  C O4    1 
ATOM   2618 C C5    . DT  B 2 1   ? -13.948 23.318 96.052  1.00 47.19 ? 401  DT  C C5    1 
ATOM   2619 C C7    . DT  B 2 1   ? -12.839 23.486 97.045  1.00 47.20 ? 401  DT  C C7    1 
ATOM   2620 C C6    . DT  B 2 1   ? -15.003 24.138 95.992  1.00 46.82 ? 401  DT  C C6    1 
ATOM   2621 P P     . DG  B 2 2   ? -20.045 26.896 97.627  1.00 39.84 ? 402  DG  C P     1 
ATOM   2622 O OP1   . DG  B 2 2   ? -19.933 28.345 97.958  1.00 39.31 ? 402  DG  C OP1   1 
ATOM   2623 O OP2   . DG  B 2 2   ? -19.456 25.880 98.542  1.00 39.43 ? 402  DG  C OP2   1 
ATOM   2624 O "O5'" . DG  B 2 2   ? -21.589 26.564 97.442  1.00 36.48 ? 402  DG  C "O5'" 1 
ATOM   2625 C "C5'" . DG  B 2 2   ? -22.066 25.228 97.494  1.00 31.04 ? 402  DG  C "C5'" 1 
ATOM   2626 C "C4'" . DG  B 2 2   ? -23.433 25.210 98.130  1.00 27.35 ? 402  DG  C "C4'" 1 
ATOM   2627 O "O4'" . DG  B 2 2   ? -23.291 25.339 99.563  1.00 26.16 ? 402  DG  C "O4'" 1 
ATOM   2628 C "C3'" . DG  B 2 2   ? -24.309 26.377 97.679  1.00 25.47 ? 402  DG  C "C3'" 1 
ATOM   2629 O "O3'" . DG  B 2 2   ? -25.651 25.960 97.460  1.00 23.56 ? 402  DG  C "O3'" 1 
ATOM   2630 C "C2'" . DG  B 2 2   ? -24.236 27.357 98.834  1.00 24.92 ? 402  DG  C "C2'" 1 
ATOM   2631 C "C1'" . DG  B 2 2   ? -24.017 26.461 100.040 1.00 24.84 ? 402  DG  C "C1'" 1 
ATOM   2632 N N9    . DG  B 2 2   ? -23.201 27.103 101.064 1.00 23.97 ? 402  DG  C N9    1 
ATOM   2633 C C8    . DG  B 2 2   ? -21.834 27.066 101.150 1.00 23.76 ? 402  DG  C C8    1 
ATOM   2634 N N7    . DG  B 2 2   ? -21.362 27.790 102.128 1.00 23.96 ? 402  DG  C N7    1 
ATOM   2635 C C5    . DG  B 2 2   ? -22.488 28.326 102.739 1.00 23.38 ? 402  DG  C C5    1 
ATOM   2636 C C6    . DG  B 2 2   ? -22.599 29.204 103.848 1.00 22.84 ? 402  DG  C C6    1 
ATOM   2637 O O6    . DG  B 2 2   ? -21.691 29.710 104.521 1.00 22.53 ? 402  DG  C O6    1 
ATOM   2638 N N1    . DG  B 2 2   ? -23.930 29.490 104.143 1.00 22.21 ? 402  DG  C N1    1 
ATOM   2639 C C2    . DG  B 2 2   ? -25.014 29.001 103.456 1.00 21.98 ? 402  DG  C C2    1 
ATOM   2640 N N2    . DG  B 2 2   ? -26.224 29.391 103.900 1.00 21.73 ? 402  DG  C N2    1 
ATOM   2641 N N3    . DG  B 2 2   ? -24.923 28.189 102.412 1.00 22.62 ? 402  DG  C N3    1 
ATOM   2642 C C4    . DG  B 2 2   ? -23.637 27.896 102.110 1.00 23.36 ? 402  DG  C C4    1 
ATOM   2643 P P     . DG  B 2 3   ? -26.586 26.808 96.472  1.00 21.95 ? 403  DG  C P     1 
ATOM   2644 O OP1   . DG  B 2 3   ? -27.600 25.882 95.909  1.00 21.36 ? 403  DG  C OP1   1 
ATOM   2645 O OP2   . DG  B 2 3   ? -25.719 27.591 95.561  1.00 22.35 ? 403  DG  C OP2   1 
ATOM   2646 O "O5'" . DG  B 2 3   ? -27.301 27.847 97.436  1.00 21.21 ? 403  DG  C "O5'" 1 
ATOM   2647 C "C5'" . DG  B 2 3   ? -28.261 27.408 98.391  1.00 20.41 ? 403  DG  C "C5'" 1 
ATOM   2648 C "C4'" . DG  B 2 3   ? -28.883 28.597 99.081  1.00 19.36 ? 403  DG  C "C4'" 1 
ATOM   2649 O "O4'" . DG  B 2 3   ? -27.947 29.172 100.023 1.00 18.89 ? 403  DG  C "O4'" 1 
ATOM   2650 C "C3'" . DG  B 2 3   ? -29.294 29.734 98.146  1.00 19.08 ? 403  DG  C "C3'" 1 
ATOM   2651 O "O3'" . DG  B 2 3   ? -30.549 30.246 98.592  1.00 19.80 ? 403  DG  C "O3'" 1 
ATOM   2652 C "C2'" . DG  B 2 3   ? -28.174 30.751 98.313  1.00 18.17 ? 403  DG  C "C2'" 1 
ATOM   2653 C "C1'" . DG  B 2 3   ? -27.783 30.555 99.766  1.00 17.69 ? 403  DG  C "C1'" 1 
ATOM   2654 N N9    . DG  B 2 3   ? -26.407 30.900 100.107 1.00 16.60 ? 403  DG  C N9    1 
ATOM   2655 C C8    . DG  B 2 3   ? -25.272 30.553 99.419  1.00 16.63 ? 403  DG  C C8    1 
ATOM   2656 N N7    . DG  B 2 3   ? -24.177 30.970 99.995  1.00 16.79 ? 403  DG  C N7    1 
ATOM   2657 C C5    . DG  B 2 3   ? -24.616 31.640 101.130 1.00 16.32 ? 403  DG  C C5    1 
ATOM   2658 C C6    . DG  B 2 3   ? -23.882 32.299 102.155 1.00 16.38 ? 403  DG  C C6    1 
ATOM   2659 O O6    . DG  B 2 3   ? -22.652 32.411 102.279 1.00 16.19 ? 403  DG  C O6    1 
ATOM   2660 N N1    . DG  B 2 3   ? -24.727 32.861 103.108 1.00 16.32 ? 403  DG  C N1    1 
ATOM   2661 C C2    . DG  B 2 3   ? -26.096 32.797 103.083 1.00 16.13 ? 403  DG  C C2    1 
ATOM   2662 N N2    . DG  B 2 3   ? -26.725 33.418 104.082 1.00 16.24 ? 403  DG  C N2    1 
ATOM   2663 N N3    . DG  B 2 3   ? -26.792 32.173 102.145 1.00 16.07 ? 403  DG  C N3    1 
ATOM   2664 C C4    . DG  B 2 3   ? -25.992 31.621 101.205 1.00 16.35 ? 403  DG  C C4    1 
ATOM   2665 P P     . DA  B 2 4   ? -31.272 31.421 97.779  1.00 20.68 ? 404  DA  C P     1 
ATOM   2666 O OP1   . DA  B 2 4   ? -32.726 31.215 97.972  1.00 20.50 ? 404  DA  C OP1   1 
ATOM   2667 O OP2   . DA  B 2 4   ? -30.719 31.504 96.399  1.00 21.52 ? 404  DA  C OP2   1 
ATOM   2668 O "O5'" . DA  B 2 4   ? -30.855 32.716 98.604  1.00 21.05 ? 404  DA  C "O5'" 1 
ATOM   2669 C "C5'" . DA  B 2 4   ? -31.215 32.825 99.978  1.00 20.65 ? 404  DA  C "C5'" 1 
ATOM   2670 C "C4'" . DA  B 2 4   ? -30.784 34.158 100.544 1.00 20.69 ? 404  DA  C "C4'" 1 
ATOM   2671 O "O4'" . DA  B 2 4   ? -29.371 34.158 100.856 1.00 20.28 ? 404  DA  C "O4'" 1 
ATOM   2672 C "C3'" . DA  B 2 4   ? -31.032 35.365 99.639  1.00 20.97 ? 404  DA  C "C3'" 1 
ATOM   2673 O "O3'" . DA  B 2 4   ? -31.728 36.377 100.359 1.00 21.80 ? 404  DA  C "O3'" 1 
ATOM   2674 C "C2'" . DA  B 2 4   ? -29.636 35.836 99.267  1.00 20.29 ? 404  DA  C "C2'" 1 
ATOM   2675 C "C1'" . DA  B 2 4   ? -28.799 35.383 100.450 1.00 19.34 ? 404  DA  C "C1'" 1 
ATOM   2676 N N9    . DA  B 2 4   ? -27.388 35.144 100.136 1.00 18.08 ? 404  DA  C N9    1 
ATOM   2677 C C8    . DA  B 2 4   ? -26.866 34.484 99.047  1.00 17.41 ? 404  DA  C C8    1 
ATOM   2678 N N7    . DA  B 2 4   ? -25.554 34.464 99.016  1.00 17.10 ? 404  DA  C N7    1 
ATOM   2679 C C5    . DA  B 2 4   ? -25.184 35.149 100.169 1.00 16.76 ? 404  DA  C C5    1 
ATOM   2680 C C6    . DA  B 2 4   ? -23.926 35.476 100.719 1.00 16.26 ? 404  DA  C C6    1 
ATOM   2681 N N6    . DA  B 2 4   ? -22.760 35.140 100.160 1.00 15.13 ? 404  DA  C N6    1 
ATOM   2682 N N1    . DA  B 2 4   ? -23.909 36.168 101.880 1.00 16.18 ? 404  DA  C N1    1 
ATOM   2683 C C2    . DA  B 2 4   ? -25.075 36.499 102.447 1.00 16.10 ? 404  DA  C C2    1 
ATOM   2684 N N3    . DA  B 2 4   ? -26.315 36.249 102.032 1.00 16.97 ? 404  DA  C N3    1 
ATOM   2685 C C4    . DA  B 2 4   ? -26.302 35.565 100.873 1.00 17.22 ? 404  DA  C C4    1 
ATOM   2686 P P     . DT  B 2 5   ? -32.502 37.529 99.557  1.00 22.03 ? 405  DT  C P     1 
ATOM   2687 O OP1   . DT  B 2 5   ? -33.856 37.669 100.146 1.00 22.83 ? 405  DT  C OP1   1 
ATOM   2688 O OP2   . DT  B 2 5   ? -32.359 37.295 98.103  1.00 21.78 ? 405  DT  C OP2   1 
ATOM   2689 O "O5'" . DT  B 2 5   ? -31.690 38.825 99.975  1.00 22.62 ? 405  DT  C "O5'" 1 
ATOM   2690 C "C5'" . DT  B 2 5   ? -31.562 39.172 101.350 1.00 22.61 ? 405  DT  C "C5'" 1 
ATOM   2691 C "C4'" . DT  B 2 5   ? -30.459 40.186 101.531 1.00 22.75 ? 405  DT  C "C4'" 1 
ATOM   2692 O "O4'" . DT  B 2 5   ? -29.148 39.582 101.385 1.00 22.57 ? 405  DT  C "O4'" 1 
ATOM   2693 C "C3'" . DT  B 2 5   ? -30.491 41.349 100.536 1.00 23.33 ? 405  DT  C "C3'" 1 
ATOM   2694 O "O3'" . DT  B 2 5   ? -30.002 42.504 101.207 1.00 24.57 ? 405  DT  C "O3'" 1 
ATOM   2695 C "C2'" . DT  B 2 5   ? -29.414 40.961 99.541  1.00 22.55 ? 405  DT  C "C2'" 1 
ATOM   2696 C "C1'" . DT  B 2 5   ? -28.400 40.418 100.521 1.00 22.14 ? 405  DT  C "C1'" 1 
ATOM   2697 N N1    . DT  B 2 5   ? -27.243 39.673 99.994  1.00 21.26 ? 405  DT  C N1    1 
ATOM   2698 C C2    . DT  B 2 5   ? -26.080 39.759 100.726 1.00 21.23 ? 405  DT  C C2    1 
ATOM   2699 O O2    . DT  B 2 5   ? -25.999 40.383 101.774 1.00 21.43 ? 405  DT  C O2    1 
ATOM   2700 N N3    . DT  B 2 5   ? -25.014 39.094 100.188 1.00 20.69 ? 405  DT  C N3    1 
ATOM   2701 C C4    . DT  B 2 5   ? -24.991 38.371 99.014  1.00 20.66 ? 405  DT  C C4    1 
ATOM   2702 O O4    . DT  B 2 5   ? -23.943 37.845 98.645  1.00 21.13 ? 405  DT  C O4    1 
ATOM   2703 C C5    . DT  B 2 5   ? -26.253 38.306 98.301  1.00 20.43 ? 405  DT  C C5    1 
ATOM   2704 C C7    . DT  B 2 5   ? -26.331 37.531 97.021  1.00 21.09 ? 405  DT  C C7    1 
ATOM   2705 C C6    . DT  B 2 5   ? -27.303 38.949 98.824  1.00 20.69 ? 405  DT  C C6    1 
ATOM   2706 P P     . DG  B 2 6   ? -31.010 43.650 101.677 1.00 24.80 ? 406  DG  C P     1 
ATOM   2707 O OP1   . DG  B 2 6   ? -31.814 43.100 102.800 1.00 25.92 ? 406  DG  C OP1   1 
ATOM   2708 O OP2   . DG  B 2 6   ? -31.697 44.205 100.484 1.00 24.87 ? 406  DG  C OP2   1 
ATOM   2709 O "O5'" . DG  B 2 6   ? -30.013 44.740 102.260 1.00 23.46 ? 406  DG  C "O5'" 1 
ATOM   2710 C "C5'" . DG  B 2 6   ? -29.362 44.522 103.502 1.00 23.03 ? 406  DG  C "C5'" 1 
ATOM   2711 C "C4'" . DG  B 2 6   ? -27.986 45.145 103.490 1.00 22.57 ? 406  DG  C "C4'" 1 
ATOM   2712 O "O4'" . DG  B 2 6   ? -27.024 44.271 102.856 1.00 21.73 ? 406  DG  C "O4'" 1 
ATOM   2713 C "C3'" . DG  B 2 6   ? -27.889 46.488 102.770 1.00 22.80 ? 406  DG  C "C3'" 1 
ATOM   2714 O "O3'" . DG  B 2 6   ? -27.075 47.357 103.561 1.00 24.42 ? 406  DG  C "O3'" 1 
ATOM   2715 C "C2'" . DG  B 2 6   ? -27.222 46.127 101.453 1.00 21.37 ? 406  DG  C "C2'" 1 
ATOM   2716 C "C1'" . DG  B 2 6   ? -26.313 44.979 101.858 1.00 20.42 ? 406  DG  C "C1'" 1 
ATOM   2717 N N9    . DG  B 2 6   ? -26.001 44.037 100.788 1.00 18.73 ? 406  DG  C N9    1 
ATOM   2718 C C8    . DG  B 2 6   ? -26.889 43.456 99.917  1.00 18.17 ? 406  DG  C C8    1 
ATOM   2719 N N7    . DG  B 2 6   ? -26.317 42.650 99.066  1.00 17.37 ? 406  DG  C N7    1 
ATOM   2720 C C5    . DG  B 2 6   ? -24.970 42.702 99.395  1.00 17.30 ? 406  DG  C C5    1 
ATOM   2721 C C6    . DG  B 2 6   ? -23.859 42.034 98.824  1.00 16.65 ? 406  DG  C C6    1 
ATOM   2722 O O6    . DG  B 2 6   ? -23.842 41.236 97.891  1.00 17.33 ? 406  DG  C O6    1 
ATOM   2723 N N1    . DG  B 2 6   ? -22.672 42.375 99.457  1.00 16.92 ? 406  DG  C N1    1 
ATOM   2724 C C2    . DG  B 2 6   ? -22.564 43.247 100.509 1.00 17.31 ? 406  DG  C C2    1 
ATOM   2725 N N2    . DG  B 2 6   ? -21.324 43.454 100.974 1.00 17.51 ? 406  DG  C N2    1 
ATOM   2726 N N3    . DG  B 2 6   ? -23.594 43.871 101.060 1.00 17.50 ? 406  DG  C N3    1 
ATOM   2727 C C4    . DG  B 2 6   ? -24.759 43.555 100.455 1.00 17.60 ? 406  DG  C C4    1 
HETATM 2728 N N1    . 5CM B 2 7   ? -22.969 46.570 98.999  1.00 21.34 ? 407  5CM C N1    1 
HETATM 2729 C C2    . 5CM B 2 7   ? -22.122 45.799 98.231  1.00 19.92 ? 407  5CM C C2    1 
HETATM 2730 N N3    . 5CM B 2 7   ? -22.721 45.191 97.155  1.00 18.09 ? 407  5CM C N3    1 
HETATM 2731 C C4    . 5CM B 2 7   ? -24.042 45.286 96.784  1.00 17.72 ? 407  5CM C C4    1 
HETATM 2732 C C5    . 5CM B 2 7   ? -24.878 46.115 97.619  1.00 18.25 ? 407  5CM C C5    1 
HETATM 2733 C C5A   . 5CM B 2 7   ? -26.325 46.273 97.275  1.00 17.07 ? 407  5CM C C5A   1 
HETATM 2734 C C6    . 5CM B 2 7   ? -24.305 46.711 98.675  1.00 19.43 ? 407  5CM C C6    1 
HETATM 2735 O O2    . 5CM B 2 7   ? -20.933 45.663 98.478  1.00 19.50 ? 407  5CM C O2    1 
HETATM 2736 N N4    . 5CM B 2 7   ? -24.486 44.634 95.712  1.00 16.87 ? 407  5CM C N4    1 
HETATM 2737 C "C1'" . 5CM B 2 7   ? -22.406 47.237 100.188 1.00 23.96 ? 407  5CM C "C1'" 1 
HETATM 2738 C "C2'" . 5CM B 2 7   ? -22.707 48.721 100.293 1.00 26.49 ? 407  5CM C "C2'" 1 
HETATM 2739 C "C3'" . 5CM B 2 7   ? -22.654 48.968 101.793 1.00 27.88 ? 407  5CM C "C3'" 1 
HETATM 2740 C "C4'" . 5CM B 2 7   ? -23.026 47.622 102.403 1.00 26.94 ? 407  5CM C "C4'" 1 
HETATM 2741 O "O4'" . 5CM B 2 7   ? -23.012 46.660 101.326 1.00 25.43 ? 407  5CM C "O4'" 1 
HETATM 2742 O "O3'" . 5CM B 2 7   ? -21.345 49.323 102.203 1.00 31.28 ? 407  5CM C "O3'" 1 
HETATM 2743 C "C5'" . 5CM B 2 7   ? -24.364 47.647 103.091 1.00 26.81 ? 407  5CM C "C5'" 1 
HETATM 2744 O "O5'" . 5CM B 2 7   ? -25.229 48.558 102.430 1.00 26.19 ? 407  5CM C "O5'" 1 
HETATM 2745 P P     . 5CM B 2 7   ? -26.676 48.813 103.016 1.00 24.60 ? 407  5CM C P     1 
HETATM 2746 O OP1   . 5CM B 2 7   ? -26.538 49.698 104.192 1.00 25.84 ? 407  5CM C OP1   1 
HETATM 2747 O OP2   . 5CM B 2 7   ? -27.566 49.204 101.906 1.00 25.76 ? 407  5CM C OP2   1 
ATOM   2748 P P     . DG  B 2 8   ? -20.986 50.866 102.441 1.00 33.64 ? 408  DG  C P     1 
ATOM   2749 O OP1   . DG  B 2 8   ? -20.737 51.053 103.896 1.00 33.83 ? 408  DG  C OP1   1 
ATOM   2750 O OP2   . DG  B 2 8   ? -22.002 51.708 101.746 1.00 32.44 ? 408  DG  C OP2   1 
ATOM   2751 O "O5'" . DG  B 2 8   ? -19.599 50.996 101.684 1.00 33.72 ? 408  DG  C "O5'" 1 
ATOM   2752 C "C5'" . DG  B 2 8   ? -18.658 49.926 101.727 1.00 33.96 ? 408  DG  C "C5'" 1 
ATOM   2753 C "C4'" . DG  B 2 8   ? -17.802 49.959 100.486 1.00 34.07 ? 408  DG  C "C4'" 1 
ATOM   2754 O "O4'" . DG  B 2 8   ? -18.475 49.353 99.356  1.00 33.31 ? 408  DG  C "O4'" 1 
ATOM   2755 C "C3'" . DG  B 2 8   ? -17.481 51.386 100.067 1.00 34.64 ? 408  DG  C "C3'" 1 
ATOM   2756 O "O3'" . DG  B 2 8   ? -16.158 51.418 99.569  1.00 36.63 ? 408  DG  C "O3'" 1 
ATOM   2757 C "C2'" . DG  B 2 8   ? -18.479 51.663 98.957  1.00 33.28 ? 408  DG  C "C2'" 1 
ATOM   2758 C "C1'" . DG  B 2 8   ? -18.609 50.300 98.305  1.00 32.01 ? 408  DG  C "C1'" 1 
ATOM   2759 N N9    . DG  B 2 8   ? -19.893 50.058 97.657  1.00 30.09 ? 408  DG  C N9    1 
ATOM   2760 C C8    . DG  B 2 8   ? -21.113 50.588 98.000  1.00 29.72 ? 408  DG  C C8    1 
ATOM   2761 N N7    . DG  B 2 8   ? -22.091 50.146 97.258  1.00 29.02 ? 408  DG  C N7    1 
ATOM   2762 C C5    . DG  B 2 8   ? -21.477 49.278 96.365  1.00 27.91 ? 408  DG  C C5    1 
ATOM   2763 C C6    . DG  B 2 8   ? -22.029 48.488 95.324  1.00 26.75 ? 408  DG  C C6    1 
ATOM   2764 O O6    . DG  B 2 8   ? -23.214 48.388 94.976  1.00 25.73 ? 408  DG  C O6    1 
ATOM   2765 N N1    . DG  B 2 8   ? -21.046 47.765 94.660  1.00 25.54 ? 408  DG  C N1    1 
ATOM   2766 C C2    . DG  B 2 8   ? -19.707 47.795 94.957  1.00 25.92 ? 408  DG  C C2    1 
ATOM   2767 N N2    . DG  B 2 8   ? -18.914 47.038 94.189  1.00 24.82 ? 408  DG  C N2    1 
ATOM   2768 N N3    . DG  B 2 8   ? -19.183 48.516 95.930  1.00 26.67 ? 408  DG  C N3    1 
ATOM   2769 C C4    . DG  B 2 8   ? -20.119 49.227 96.589  1.00 28.19 ? 408  DG  C C4    1 
ATOM   2770 P P     . DC  B 2 9   ? -15.212 52.669 99.895  1.00 37.78 ? 409  DC  C P     1 
ATOM   2771 O OP1   . DC  B 2 9   ? -14.618 52.441 101.238 1.00 37.73 ? 409  DC  C OP1   1 
ATOM   2772 O OP2   . DC  B 2 9   ? -15.964 53.930 99.618  1.00 36.98 ? 409  DC  C OP2   1 
ATOM   2773 O "O5'" . DC  B 2 9   ? -14.087 52.476 98.795  1.00 36.33 ? 409  DC  C "O5'" 1 
ATOM   2774 C "C5'" . DC  B 2 9   ? -13.836 51.178 98.269  1.00 34.72 ? 409  DC  C "C5'" 1 
ATOM   2775 C "C4'" . DC  B 2 9   ? -13.958 51.198 96.765  1.00 33.36 ? 409  DC  C "C4'" 1 
ATOM   2776 O "O4'" . DC  B 2 9   ? -15.281 50.851 96.269  1.00 32.18 ? 409  DC  C "O4'" 1 
ATOM   2777 C "C3'" . DC  B 2 9   ? -13.608 52.549 96.141  1.00 33.05 ? 409  DC  C "C3'" 1 
ATOM   2778 O "O3'" . DC  B 2 9   ? -12.714 52.320 95.067  1.00 34.21 ? 409  DC  C "O3'" 1 
ATOM   2779 C "C2'" . DC  B 2 9   ? -14.935 53.021 95.572  1.00 31.81 ? 409  DC  C "C2'" 1 
ATOM   2780 C "C1'" . DC  B 2 9   ? -15.539 51.696 95.165  1.00 30.28 ? 409  DC  C "C1'" 1 
ATOM   2781 N N1    . DC  B 2 9   ? -16.983 51.698 94.867  1.00 27.83 ? 409  DC  C N1    1 
ATOM   2782 C C2    . DC  B 2 9   ? -17.444 50.944 93.768  1.00 26.45 ? 409  DC  C C2    1 
ATOM   2783 O O2    . DC  B 2 9   ? -16.638 50.247 93.133  1.00 25.09 ? 409  DC  C O2    1 
ATOM   2784 N N3    . DC  B 2 9   ? -18.752 50.993 93.431  1.00 25.00 ? 409  DC  C N3    1 
ATOM   2785 C C4    . DC  B 2 9   ? -19.597 51.737 94.144  1.00 25.09 ? 409  DC  C C4    1 
ATOM   2786 N N4    . DC  B 2 9   ? -20.874 51.772 93.754  1.00 23.08 ? 409  DC  C N4    1 
ATOM   2787 C C5    . DC  B 2 9   ? -19.167 52.485 95.287  1.00 25.70 ? 409  DC  C C5    1 
ATOM   2788 C C6    . DC  B 2 9   ? -17.863 52.435 95.610  1.00 26.74 ? 409  DC  C C6    1 
ATOM   2789 P P     . DT  B 2 10  ? -11.791 53.509 94.528  1.00 34.36 ? 410  DT  C P     1 
ATOM   2790 O OP1   . DT  B 2 10  ? -10.546 53.477 95.336  1.00 34.45 ? 410  DT  C OP1   1 
ATOM   2791 O OP2   . DT  B 2 10  ? -12.588 54.764 94.442  1.00 34.54 ? 410  DT  C OP2   1 
ATOM   2792 O "O5'" . DT  B 2 10  ? -11.462 53.008 93.059  1.00 33.27 ? 410  DT  C "O5'" 1 
ATOM   2793 C "C5'" . DT  B 2 10  ? -11.241 51.623 92.821  1.00 31.61 ? 410  DT  C "C5'" 1 
ATOM   2794 C "C4'" . DT  B 2 10  ? -11.632 51.272 91.409  1.00 30.33 ? 410  DT  C "C4'" 1 
ATOM   2795 O "O4'" . DT  B 2 10  ? -13.071 51.206 91.274  1.00 29.38 ? 410  DT  C "O4'" 1 
ATOM   2796 C "C3'" . DT  B 2 10  ? -11.152 52.295 90.388  1.00 30.18 ? 410  DT  C "C3'" 1 
ATOM   2797 O "O3'" . DT  B 2 10  ? -10.668 51.619 89.238  1.00 30.78 ? 410  DT  C "O3'" 1 
ATOM   2798 C "C2'" . DT  B 2 10  ? -12.402 53.094 90.063  1.00 29.70 ? 410  DT  C "C2'" 1 
ATOM   2799 C "C1'" . DT  B 2 10  ? -13.509 52.074 90.245  1.00 28.64 ? 410  DT  C "C1'" 1 
ATOM   2800 N N1    . DT  B 2 10  ? -14.792 52.655 90.674  1.00 27.65 ? 410  DT  C N1    1 
ATOM   2801 C C2    . DT  B 2 10  ? -15.922 52.304 89.978  1.00 26.87 ? 410  DT  C C2    1 
ATOM   2802 O O2    . DT  B 2 10  ? -15.905 51.558 89.019  1.00 26.95 ? 410  DT  C O2    1 
ATOM   2803 N N3    . DT  B 2 10  ? -17.079 52.865 90.448  1.00 26.39 ? 410  DT  C N3    1 
ATOM   2804 C C4    . DT  B 2 10  ? -17.215 53.728 91.518  1.00 26.15 ? 410  DT  C C4    1 
ATOM   2805 O O4    . DT  B 2 10  ? -18.326 54.143 91.829  1.00 25.56 ? 410  DT  C O4    1 
ATOM   2806 C C5    . DT  B 2 10  ? -15.988 54.068 92.197  1.00 26.34 ? 410  DT  C C5    1 
ATOM   2807 C C7    . DT  B 2 10  ? -16.040 55.011 93.360  1.00 25.71 ? 410  DT  C C7    1 
ATOM   2808 C C6    . DT  B 2 10  ? -14.851 53.520 91.748  1.00 26.81 ? 410  DT  C C6    1 
ATOM   2809 P P     . DG  B 2 11  ? -9.825  52.425 88.147  1.00 29.69 ? 411  DG  C P     1 
ATOM   2810 O OP1   . DG  B 2 11  ? -8.608  51.636 87.836  1.00 30.59 ? 411  DG  C OP1   1 
ATOM   2811 O OP2   . DG  B 2 11  ? -9.699  53.824 88.603  1.00 31.26 ? 411  DG  C OP2   1 
ATOM   2812 O "O5'" . DG  B 2 11  ? -10.791 52.402 86.894  1.00 29.38 ? 411  DG  C "O5'" 1 
ATOM   2813 C "C5'" . DG  B 2 11  ? -11.353 51.176 86.467  1.00 28.95 ? 411  DG  C "C5'" 1 
ATOM   2814 C "C4'" . DG  B 2 11  ? -12.396 51.436 85.414  1.00 29.02 ? 411  DG  C "C4'" 1 
ATOM   2815 O "O4'" . DG  B 2 11  ? -13.588 51.979 86.024  1.00 28.57 ? 411  DG  C "O4'" 1 
ATOM   2816 C "C3'" . DG  B 2 11  ? -11.955 52.445 84.360  1.00 29.26 ? 411  DG  C "C3'" 1 
ATOM   2817 O "O3'" . DG  B 2 11  ? -12.384 51.974 83.091  1.00 30.24 ? 411  DG  C "O3'" 1 
ATOM   2818 C "C2'" . DG  B 2 11  ? -12.675 53.724 84.763  1.00 28.84 ? 411  DG  C "C2'" 1 
ATOM   2819 C "C1'" . DG  B 2 11  ? -13.952 53.194 85.390  1.00 28.26 ? 411  DG  C "C1'" 1 
ATOM   2820 N N9    . DG  B 2 11  ? -14.571 54.037 86.408  1.00 27.30 ? 411  DG  C N9    1 
ATOM   2821 C C8    . DG  B 2 11  ? -13.942 54.716 87.422  1.00 27.09 ? 411  DG  C C8    1 
ATOM   2822 N N7    . DG  B 2 11  ? -14.774 55.308 88.236  1.00 26.72 ? 411  DG  C N7    1 
ATOM   2823 C C5    . DG  B 2 11  ? -16.028 55.015 87.718  1.00 26.49 ? 411  DG  C C5    1 
ATOM   2824 C C6    . DG  B 2 11  ? -17.325 55.366 88.188  1.00 26.40 ? 411  DG  C C6    1 
ATOM   2825 O O6    . DG  B 2 11  ? -17.632 56.010 89.205  1.00 26.51 ? 411  DG  C O6    1 
ATOM   2826 N N1    . DG  B 2 11  ? -18.322 54.880 87.348  1.00 25.55 ? 411  DG  C N1    1 
ATOM   2827 C C2    . DG  B 2 11  ? -18.105 54.143 86.209  1.00 26.39 ? 411  DG  C C2    1 
ATOM   2828 N N2    . DG  B 2 11  ? -19.201 53.785 85.517  1.00 25.89 ? 411  DG  C N2    1 
ATOM   2829 N N3    . DG  B 2 11  ? -16.902 53.788 85.773  1.00 26.43 ? 411  DG  C N3    1 
ATOM   2830 C C4    . DG  B 2 11  ? -15.918 54.257 86.572  1.00 26.85 ? 411  DG  C C4    1 
ATOM   2831 P P     . DA  B 2 12  ? -11.800 52.635 81.758  1.00 30.67 ? 412  DA  C P     1 
ATOM   2832 O OP1   . DA  B 2 12  ? -11.576 51.547 80.770  1.00 30.59 ? 412  DA  C OP1   1 
ATOM   2833 O OP2   . DA  B 2 12  ? -10.678 53.523 82.146  1.00 30.31 ? 412  DA  C OP2   1 
ATOM   2834 O "O5'" . DA  B 2 12  ? -13.033 53.497 81.254  1.00 30.41 ? 412  DA  C "O5'" 1 
ATOM   2835 C "C5'" . DA  B 2 12  ? -14.255 52.854 80.901  1.00 30.21 ? 412  DA  C "C5'" 1 
ATOM   2836 C "C4'" . DA  B 2 12  ? -15.312 53.885 80.597  1.00 30.58 ? 412  DA  C "C4'" 1 
ATOM   2837 O "O4'" . DA  B 2 12  ? -15.873 54.398 81.831  1.00 30.04 ? 412  DA  C "O4'" 1 
ATOM   2838 C "C3'" . DA  B 2 12  ? -14.777 55.098 79.833  1.00 30.87 ? 412  DA  C "C3'" 1 
ATOM   2839 O "O3'" . DA  B 2 12  ? -15.677 55.480 78.794  1.00 32.43 ? 412  DA  C "O3'" 1 
ATOM   2840 C "C2'" . DA  B 2 12  ? -14.723 56.187 80.889  1.00 30.18 ? 412  DA  C "C2'" 1 
ATOM   2841 C "C1'" . DA  B 2 12  ? -15.911 55.810 81.746  1.00 29.26 ? 412  DA  C "C1'" 1 
ATOM   2842 N N9    . DA  B 2 12  ? -15.909 56.357 83.099  1.00 27.47 ? 412  DA  C N9    1 
ATOM   2843 C C8    . DA  B 2 12  ? -14.844 56.609 83.923  1.00 27.19 ? 412  DA  C C8    1 
ATOM   2844 N N7    . DA  B 2 12  ? -15.180 57.144 85.073  1.00 26.47 ? 412  DA  C N7    1 
ATOM   2845 C C5    . DA  B 2 12  ? -16.561 57.244 85.000  1.00 26.21 ? 412  DA  C C5    1 
ATOM   2846 C C6    . DA  B 2 12  ? -17.520 57.745 85.894  1.00 25.75 ? 412  DA  C C6    1 
ATOM   2847 N N6    . DA  B 2 12  ? -17.219 58.275 87.081  1.00 25.56 ? 412  DA  C N6    1 
ATOM   2848 N N1    . DA  B 2 12  ? -18.818 57.690 85.517  1.00 25.70 ? 412  DA  C N1    1 
ATOM   2849 C C2    . DA  B 2 12  ? -19.116 57.176 84.315  1.00 25.53 ? 412  DA  C C2    1 
ATOM   2850 N N3    . DA  B 2 12  ? -18.303 56.687 83.385  1.00 25.84 ? 412  DA  C N3    1 
ATOM   2851 C C4    . DA  B 2 12  ? -17.024 56.751 83.795  1.00 26.55 ? 412  DA  C C4    1 
ATOM   2852 P P     . DC  B 2 13  ? -15.215 56.581 77.715  1.00 33.09 ? 413  DC  C P     1 
ATOM   2853 O OP1   . DC  B 2 13  ? -16.187 56.560 76.593  1.00 33.60 ? 413  DC  C OP1   1 
ATOM   2854 O OP2   . DC  B 2 13  ? -13.771 56.366 77.444  1.00 33.63 ? 413  DC  C OP2   1 
ATOM   2855 O "O5'" . DC  B 2 13  ? -15.359 57.963 78.494  1.00 32.69 ? 413  DC  C "O5'" 1 
ATOM   2856 C "C5'" . DC  B 2 13  ? -16.365 58.905 78.133  1.00 31.40 ? 413  DC  C "C5'" 1 
ATOM   2857 C "C4'" . DC  B 2 13  ? -17.684 58.521 78.763  1.00 30.71 ? 413  DC  C "C4'" 1 
ATOM   2858 O "O4'" . DC  B 2 13  ? -17.492 58.291 80.178  1.00 29.85 ? 413  DC  C "O4'" 1 
ATOM   2859 C "C3'" . DC  B 2 13  ? -18.775 59.586 78.657  1.00 30.51 ? 413  DC  C "C3'" 1 
ATOM   2860 O "O3'" . DC  B 2 13  ? -20.051 58.953 78.702  1.00 30.76 ? 413  DC  C "O3'" 1 
ATOM   2861 C "C2'" . DC  B 2 13  ? -18.635 60.335 79.968  1.00 30.05 ? 413  DC  C "C2'" 1 
ATOM   2862 C "C1'" . DC  B 2 13  ? -18.267 59.215 80.928  1.00 29.58 ? 413  DC  C "C1'" 1 
ATOM   2863 N N1    . DC  B 2 13  ? -17.465 59.643 82.083  1.00 28.93 ? 413  DC  C N1    1 
ATOM   2864 C C2    . DC  B 2 13  ? -18.117 60.227 83.177  1.00 28.89 ? 413  DC  C C2    1 
ATOM   2865 O O2    . DC  B 2 13  ? -19.356 60.375 83.135  1.00 28.72 ? 413  DC  C O2    1 
ATOM   2866 N N3    . DC  B 2 13  ? -17.385 60.616 84.250  1.00 28.49 ? 413  DC  C N3    1 
ATOM   2867 C C4    . DC  B 2 13  ? -16.061 60.443 84.252  1.00 28.13 ? 413  DC  C C4    1 
ATOM   2868 N N4    . DC  B 2 13  ? -15.383 60.838 85.331  1.00 27.95 ? 413  DC  C N4    1 
ATOM   2869 C C5    . DC  B 2 13  ? -15.374 59.858 83.149  1.00 27.91 ? 413  DC  C C5    1 
ATOM   2870 C C6    . DC  B 2 13  ? -16.108 59.476 82.097  1.00 28.48 ? 413  DC  C C6    1 
ATOM   2871 O OP3   . DG  C 3 1   ? -20.151 64.723 93.294  1.00 58.43 ? 422  DG  D OP3   1 
ATOM   2872 P P     . DG  C 3 1   ? -21.320 65.691 93.168  1.00 58.69 ? 422  DG  D P     1 
ATOM   2873 O OP1   . DG  C 3 1   ? -21.174 66.899 94.088  1.00 58.53 ? 422  DG  D OP1   1 
ATOM   2874 O OP2   . DG  C 3 1   ? -22.671 64.999 93.313  1.00 58.44 ? 422  DG  D OP2   1 
ATOM   2875 O "O5'" . DG  C 3 1   ? -21.273 66.273 91.641  1.00 56.86 ? 422  DG  D "O5'" 1 
ATOM   2876 C "C5'" . DG  C 3 1   ? -22.322 67.128 91.132  1.00 53.95 ? 422  DG  D "C5'" 1 
ATOM   2877 C "C4'" . DG  C 3 1   ? -23.046 66.444 89.994  1.00 51.84 ? 422  DG  D "C4'" 1 
ATOM   2878 O "O4'" . DG  C 3 1   ? -22.078 66.093 88.970  1.00 50.61 ? 422  DG  D "O4'" 1 
ATOM   2879 C "C3'" . DG  C 3 1   ? -23.729 65.132 90.398  1.00 51.00 ? 422  DG  D "C3'" 1 
ATOM   2880 O "O3'" . DG  C 3 1   ? -24.967 64.924 89.708  1.00 50.37 ? 422  DG  D "O3'" 1 
ATOM   2881 C "C2'" . DG  C 3 1   ? -22.749 64.074 89.945  1.00 50.14 ? 422  DG  D "C2'" 1 
ATOM   2882 C "C1'" . DG  C 3 1   ? -22.150 64.701 88.704  1.00 49.21 ? 422  DG  D "C1'" 1 
ATOM   2883 N N9    . DG  C 3 1   ? -20.804 64.193 88.482  1.00 47.59 ? 422  DG  D N9    1 
ATOM   2884 C C8    . DG  C 3 1   ? -19.752 64.225 89.368  1.00 47.03 ? 422  DG  D C8    1 
ATOM   2885 N N7    . DG  C 3 1   ? -18.706 63.571 88.941  1.00 46.38 ? 422  DG  D N7    1 
ATOM   2886 C C5    . DG  C 3 1   ? -19.081 63.107 87.687  1.00 45.58 ? 422  DG  D C5    1 
ATOM   2887 C C6    . DG  C 3 1   ? -18.372 62.314 86.754  1.00 44.73 ? 422  DG  D C6    1 
ATOM   2888 O O6    . DG  C 3 1   ? -17.236 61.834 86.858  1.00 44.25 ? 422  DG  D O6    1 
ATOM   2889 N N1    . DG  C 3 1   ? -19.124 62.082 85.607  1.00 44.14 ? 422  DG  D N1    1 
ATOM   2890 C C2    . DG  C 3 1   ? -20.396 62.547 85.388  1.00 44.09 ? 422  DG  D C2    1 
ATOM   2891 N N2    . DG  C 3 1   ? -20.952 62.227 84.214  1.00 43.79 ? 422  DG  D N2    1 
ATOM   2892 N N3    . DG  C 3 1   ? -21.073 63.276 86.256  1.00 44.84 ? 422  DG  D N3    1 
ATOM   2893 C C4    . DG  C 3 1   ? -20.361 63.514 87.376  1.00 46.06 ? 422  DG  D C4    1 
ATOM   2894 P P     . DT  C 3 2   ? -25.712 63.494 89.830  1.00 49.43 ? 423  DT  D P     1 
ATOM   2895 O OP1   . DT  C 3 2   ? -27.172 63.731 89.671  1.00 49.72 ? 423  DT  D OP1   1 
ATOM   2896 O OP2   . DT  C 3 2   ? -25.208 62.780 91.038  1.00 48.92 ? 423  DT  D OP2   1 
ATOM   2897 O "O5'" . DT  C 3 2   ? -25.218 62.689 88.549  1.00 47.22 ? 423  DT  D "O5'" 1 
ATOM   2898 C "C5'" . DT  C 3 2   ? -25.682 63.034 87.247  1.00 43.68 ? 423  DT  D "C5'" 1 
ATOM   2899 C "C4'" . DT  C 3 2   ? -25.681 61.811 86.363  1.00 41.11 ? 423  DT  D "C4'" 1 
ATOM   2900 O "O4'" . DT  C 3 2   ? -24.312 61.437 86.065  1.00 39.64 ? 423  DT  D "O4'" 1 
ATOM   2901 C "C3'" . DT  C 3 2   ? -26.324 60.598 87.036  1.00 40.11 ? 423  DT  D "C3'" 1 
ATOM   2902 O "O3'" . DT  C 3 2   ? -27.145 59.869 86.124  1.00 40.13 ? 423  DT  D "O3'" 1 
ATOM   2903 C "C2'" . DT  C 3 2   ? -25.143 59.761 87.485  1.00 38.98 ? 423  DT  D "C2'" 1 
ATOM   2904 C "C1'" . DT  C 3 2   ? -24.071 60.095 86.462  1.00 37.96 ? 423  DT  D "C1'" 1 
ATOM   2905 N N1    . DT  C 3 2   ? -22.712 60.017 87.034  1.00 35.98 ? 423  DT  D N1    1 
ATOM   2906 C C2    . DT  C 3 2   ? -21.730 59.357 86.329  1.00 34.34 ? 423  DT  D C2    1 
ATOM   2907 O O2    . DT  C 3 2   ? -21.899 58.904 85.210  1.00 33.42 ? 423  DT  D O2    1 
ATOM   2908 N N3    . DT  C 3 2   ? -20.530 59.251 86.988  1.00 33.66 ? 423  DT  D N3    1 
ATOM   2909 C C4    . DT  C 3 2   ? -20.218 59.743 88.245  1.00 33.60 ? 423  DT  D C4    1 
ATOM   2910 O O4    . DT  C 3 2   ? -19.108 59.546 88.723  1.00 33.04 ? 423  DT  D O4    1 
ATOM   2911 C C5    . DT  C 3 2   ? -21.277 60.465 88.904  1.00 34.06 ? 423  DT  D C5    1 
ATOM   2912 C C7    . DT  C 3 2   ? -21.018 61.058 90.252  1.00 33.71 ? 423  DT  D C7    1 
ATOM   2913 C C6    . DT  C 3 2   ? -22.455 60.569 88.274  1.00 34.96 ? 423  DT  D C6    1 
ATOM   2914 P P     . DC  C 3 3   ? -28.107 58.702 86.681  1.00 39.83 ? 424  DC  D P     1 
ATOM   2915 O OP1   . DC  C 3 3   ? -29.322 58.712 85.825  1.00 39.80 ? 424  DC  D OP1   1 
ATOM   2916 O OP2   . DC  C 3 3   ? -28.244 58.794 88.163  1.00 39.28 ? 424  DC  D OP2   1 
ATOM   2917 O "O5'" . DC  C 3 3   ? -27.279 57.379 86.376  1.00 38.10 ? 424  DC  D "O5'" 1 
ATOM   2918 C "C5'" . DC  C 3 3   ? -26.822 57.099 85.059  1.00 34.98 ? 424  DC  D "C5'" 1 
ATOM   2919 C "C4'" . DC  C 3 3   ? -25.939 55.877 85.081  1.00 32.90 ? 424  DC  D "C4'" 1 
ATOM   2920 O "O4'" . DC  C 3 3   ? -24.621 56.201 85.595  1.00 32.17 ? 424  DC  D "O4'" 1 
ATOM   2921 C "C3'" . DC  C 3 3   ? -26.483 54.769 85.986  1.00 31.69 ? 424  DC  D "C3'" 1 
ATOM   2922 O "O3'" . DC  C 3 3   ? -26.213 53.513 85.382  1.00 30.78 ? 424  DC  D "O3'" 1 
ATOM   2923 C "C2'" . DC  C 3 3   ? -25.613 54.884 87.223  1.00 31.23 ? 424  DC  D "C2'" 1 
ATOM   2924 C "C1'" . DC  C 3 3   ? -24.294 55.236 86.573  1.00 31.17 ? 424  DC  D "C1'" 1 
ATOM   2925 N N1    . DC  C 3 3   ? -23.250 55.775 87.456  1.00 30.41 ? 424  DC  D N1    1 
ATOM   2926 C C2    . DC  C 3 3   ? -21.916 55.473 87.164  1.00 29.86 ? 424  DC  D C2    1 
ATOM   2927 O O2    . DC  C 3 3   ? -21.660 54.836 86.132  1.00 29.51 ? 424  DC  D O2    1 
ATOM   2928 N N3    . DC  C 3 3   ? -20.943 55.884 88.007  1.00 29.44 ? 424  DC  D N3    1 
ATOM   2929 C C4    . DC  C 3 3   ? -21.259 56.583 89.097  1.00 29.64 ? 424  DC  D C4    1 
ATOM   2930 N N4    . DC  C 3 3   ? -20.268 56.942 89.916  1.00 29.64 ? 424  DC  D N4    1 
ATOM   2931 C C5    . DC  C 3 3   ? -22.607 56.941 89.400  1.00 30.04 ? 424  DC  D C5    1 
ATOM   2932 C C6    . DC  C 3 3   ? -23.563 56.523 88.557  1.00 30.38 ? 424  DC  D C6    1 
ATOM   2933 P P     . DA  C 3 4   ? -27.399 52.461 85.135  1.00 28.52 ? 425  DA  D P     1 
ATOM   2934 O OP1   . DA  C 3 4   ? -28.294 53.017 84.082  1.00 29.10 ? 425  DA  D OP1   1 
ATOM   2935 O OP2   . DA  C 3 4   ? -27.967 52.031 86.434  1.00 27.94 ? 425  DA  D OP2   1 
ATOM   2936 O "O5'" . DA  C 3 4   ? -26.595 51.248 84.496  1.00 27.08 ? 425  DA  D "O5'" 1 
ATOM   2937 C "C5'" . DA  C 3 4   ? -25.668 51.483 83.434  1.00 24.21 ? 425  DA  D "C5'" 1 
ATOM   2938 C "C4'" . DA  C 3 4   ? -24.381 50.738 83.693  1.00 22.24 ? 425  DA  D "C4'" 1 
ATOM   2939 O "O4'" . DA  C 3 4   ? -23.512 51.481 84.589  1.00 21.73 ? 425  DA  D "O4'" 1 
ATOM   2940 C "C3'" . DA  C 3 4   ? -24.599 49.371 84.342  1.00 21.00 ? 425  DA  D "C3'" 1 
ATOM   2941 O "O3'" . DA  C 3 4   ? -23.797 48.374 83.724  1.00 19.17 ? 425  DA  D "O3'" 1 
ATOM   2942 C "C2'" . DA  C 3 4   ? -24.135 49.578 85.769  1.00 21.29 ? 425  DA  D "C2'" 1 
ATOM   2943 C "C1'" . DA  C 3 4   ? -23.035 50.607 85.596  1.00 21.10 ? 425  DA  D "C1'" 1 
ATOM   2944 N N9    . DA  C 3 4   ? -22.793 51.379 86.815  1.00 20.40 ? 425  DA  D N9    1 
ATOM   2945 C C8    . DA  C 3 4   ? -23.723 52.009 87.604  1.00 19.93 ? 425  DA  D C8    1 
ATOM   2946 N N7    . DA  C 3 4   ? -23.218 52.549 88.687  1.00 19.54 ? 425  DA  D N7    1 
ATOM   2947 C C5    . DA  C 3 4   ? -21.862 52.273 88.596  1.00 19.47 ? 425  DA  D C5    1 
ATOM   2948 C C6    . DA  C 3 4   ? -20.784 52.566 89.444  1.00 19.52 ? 425  DA  D C6    1 
ATOM   2949 N N6    . DA  C 3 4   ? -20.912 53.227 90.600  1.00 20.03 ? 425  DA  D N6    1 
ATOM   2950 N N1    . DA  C 3 4   ? -19.555 52.152 89.065  1.00 19.39 ? 425  DA  D N1    1 
ATOM   2951 C C2    . DA  C 3 4   ? -19.433 51.492 87.907  1.00 19.38 ? 425  DA  D C2    1 
ATOM   2952 N N3    . DA  C 3 4   ? -20.373 51.154 87.025  1.00 19.48 ? 425  DA  D N3    1 
ATOM   2953 C C4    . DA  C 3 4   ? -21.581 51.575 87.436  1.00 19.60 ? 425  DA  D C4    1 
ATOM   2954 P P     . DG  C 3 5   ? -23.999 46.835 84.131  1.00 17.02 ? 426  DG  D P     1 
ATOM   2955 O OP1   . DG  C 3 5   ? -24.360 46.069 82.913  1.00 16.85 ? 426  DG  D OP1   1 
ATOM   2956 O OP2   . DG  C 3 5   ? -24.882 46.789 85.322  1.00 16.49 ? 426  DG  D OP2   1 
ATOM   2957 O "O5'" . DG  C 3 5   ? -22.553 46.383 84.620  1.00 16.97 ? 426  DG  D "O5'" 1 
ATOM   2958 C "C5'" . DG  C 3 5   ? -21.409 46.492 83.774  1.00 14.89 ? 426  DG  D "C5'" 1 
ATOM   2959 C "C4'" . DG  C 3 5   ? -20.167 46.145 84.561  1.00 13.61 ? 426  DG  D "C4'" 1 
ATOM   2960 O "O4'" . DG  C 3 5   ? -20.008 47.117 85.620  1.00 13.32 ? 426  DG  D "O4'" 1 
ATOM   2961 C "C3'" . DG  C 3 5   ? -20.237 44.784 85.255  1.00 13.28 ? 426  DG  D "C3'" 1 
ATOM   2962 O "O3'" . DG  C 3 5   ? -18.926 44.227 85.364  1.00 13.38 ? 426  DG  D "O3'" 1 
ATOM   2963 C "C2'" . DG  C 3 5   ? -20.744 45.140 86.641  1.00 13.15 ? 426  DG  D "C2'" 1 
ATOM   2964 C "C1'" . DG  C 3 5   ? -20.058 46.472 86.881  1.00 13.13 ? 426  DG  D "C1'" 1 
ATOM   2965 N N9    . DG  C 3 5   ? -20.752 47.351 87.818  1.00 12.86 ? 426  DG  D N9    1 
ATOM   2966 C C8    . DG  C 3 5   ? -22.095 47.645 87.857  1.00 12.19 ? 426  DG  D C8    1 
ATOM   2967 N N7    . DG  C 3 5   ? -22.419 48.431 88.848  1.00 12.66 ? 426  DG  D N7    1 
ATOM   2968 C C5    . DG  C 3 5   ? -21.217 48.677 89.497  1.00 12.55 ? 426  DG  D C5    1 
ATOM   2969 C C6    . DG  C 3 5   ? -20.935 49.452 90.651  1.00 12.56 ? 426  DG  D C6    1 
ATOM   2970 O O6    . DG  C 3 5   ? -21.719 50.101 91.353  1.00 12.93 ? 426  DG  D O6    1 
ATOM   2971 N N1    . DG  C 3 5   ? -19.579 49.428 90.963  1.00 11.94 ? 426  DG  D N1    1 
ATOM   2972 C C2    . DG  C 3 5   ? -18.615 48.753 90.253  1.00 12.39 ? 426  DG  D C2    1 
ATOM   2973 N N2    . DG  C 3 5   ? -17.355 48.853 90.699  1.00 11.78 ? 426  DG  D N2    1 
ATOM   2974 N N3    . DG  C 3 5   ? -18.866 48.030 89.179  1.00 12.71 ? 426  DG  D N3    1 
ATOM   2975 C C4    . DG  C 3 5   ? -20.177 48.032 88.862  1.00 12.78 ? 426  DG  D C4    1 
ATOM   2976 P P     . DC  C 3 6   ? -18.343 43.307 84.188  1.00 13.00 ? 427  DC  D P     1 
ATOM   2977 O OP1   . DC  C 3 6   ? -16.878 43.223 84.389  1.00 14.07 ? 427  DC  D OP1   1 
ATOM   2978 O OP2   . DC  C 3 6   ? -18.877 43.800 82.892  1.00 14.16 ? 427  DC  D OP2   1 
ATOM   2979 O "O5'" . DC  C 3 6   ? -18.945 41.860 84.472  1.00 14.77 ? 427  DC  D "O5'" 1 
ATOM   2980 C "C5'" . DC  C 3 6   ? -18.163 40.886 85.160  1.00 15.58 ? 427  DC  D "C5'" 1 
ATOM   2981 C "C4'" . DC  C 3 6   ? -18.951 39.615 85.364  1.00 15.79 ? 427  DC  D "C4'" 1 
ATOM   2982 O "O4'" . DC  C 3 6   ? -18.774 38.778 84.187  1.00 16.07 ? 427  DC  D "O4'" 1 
ATOM   2983 C "C3'" . DC  C 3 6   ? -18.416 38.799 86.538  1.00 15.82 ? 427  DC  D "C3'" 1 
ATOM   2984 O "O3'" . DC  C 3 6   ? -19.309 38.743 87.640  1.00 15.61 ? 427  DC  D "O3'" 1 
ATOM   2985 C "C2'" . DC  C 3 6   ? -18.147 37.408 85.989  1.00 16.57 ? 427  DC  D "C2'" 1 
ATOM   2986 C "C1'" . DC  C 3 6   ? -18.633 37.409 84.547  1.00 16.29 ? 427  DC  D "C1'" 1 
ATOM   2987 N N1    . DC  C 3 6   ? -17.613 36.794 83.661  1.00 16.19 ? 427  DC  D N1    1 
ATOM   2988 C C2    . DC  C 3 6   ? -17.660 37.008 82.273  1.00 16.12 ? 427  DC  D C2    1 
ATOM   2989 O O2    . DC  C 3 6   ? -18.617 37.619 81.790  1.00 15.96 ? 427  DC  D O2    1 
ATOM   2990 N N3    . DC  C 3 6   ? -16.654 36.514 81.495  1.00 16.37 ? 427  DC  D N3    1 
ATOM   2991 C C4    . DC  C 3 6   ? -15.658 35.809 82.051  1.00 16.07 ? 427  DC  D C4    1 
ATOM   2992 N N4    . DC  C 3 6   ? -14.674 35.361 81.260  1.00 15.78 ? 427  DC  D N4    1 
ATOM   2993 C C5    . DC  C 3 6   ? -15.621 35.532 83.448  1.00 16.72 ? 427  DC  D C5    1 
ATOM   2994 C C6    . DC  C 3 6   ? -16.609 36.034 84.204  1.00 16.44 ? 427  DC  D C6    1 
ATOM   2995 P P     . DG  C 3 7   ? -18.700 38.733 89.127  1.00 15.05 ? 428  DG  D P     1 
ATOM   2996 O OP1   . DG  C 3 7   ? -17.602 37.722 89.140  1.00 15.01 ? 428  DG  D OP1   1 
ATOM   2997 O OP2   . DG  C 3 7   ? -19.833 38.604 90.078  1.00 15.32 ? 428  DG  D OP2   1 
ATOM   2998 O "O5'" . DG  C 3 7   ? -18.060 40.184 89.333  1.00 14.59 ? 428  DG  D "O5'" 1 
ATOM   2999 C "C5'" . DG  C 3 7   ? -16.646 40.409 89.225  1.00 14.54 ? 428  DG  D "C5'" 1 
ATOM   3000 C "C4'" . DG  C 3 7   ? -16.071 40.890 90.543  1.00 14.57 ? 428  DG  D "C4'" 1 
ATOM   3001 O "O4'" . DG  C 3 7   ? -16.929 41.923 91.090  1.00 13.86 ? 428  DG  D "O4'" 1 
ATOM   3002 C "C3'" . DG  C 3 7   ? -15.921 39.841 91.651  1.00 15.16 ? 428  DG  D "C3'" 1 
ATOM   3003 O "O3'" . DG  C 3 7   ? -14.706 40.090 92.376  1.00 16.78 ? 428  DG  D "O3'" 1 
ATOM   3004 C "C2'" . DG  C 3 7   ? -17.132 40.076 92.531  1.00 14.65 ? 428  DG  D "C2'" 1 
ATOM   3005 C "C1'" . DG  C 3 7   ? -17.377 41.570 92.395  1.00 13.87 ? 428  DG  D "C1'" 1 
ATOM   3006 N N9    . DG  C 3 7   ? -18.796 41.902 92.499  1.00 12.66 ? 428  DG  D N9    1 
ATOM   3007 C C8    . DG  C 3 7   ? -19.784 41.544 91.618  1.00 13.02 ? 428  DG  D C8    1 
ATOM   3008 N N7    . DG  C 3 7   ? -20.976 41.908 92.008  1.00 13.18 ? 428  DG  D N7    1 
ATOM   3009 C C5    . DG  C 3 7   ? -20.763 42.560 93.215  1.00 12.14 ? 428  DG  D C5    1 
ATOM   3010 C C6    . DG  C 3 7   ? -21.689 43.143 94.120  1.00 12.27 ? 428  DG  D C6    1 
ATOM   3011 O O6    . DG  C 3 7   ? -22.921 43.181 94.043  1.00 12.04 ? 428  DG  D O6    1 
ATOM   3012 N N1    . DG  C 3 7   ? -21.047 43.709 95.218  1.00 12.26 ? 428  DG  D N1    1 
ATOM   3013 C C2    . DG  C 3 7   ? -19.694 43.705 95.424  1.00 12.55 ? 428  DG  D C2    1 
ATOM   3014 N N2    . DG  C 3 7   ? -19.265 44.319 96.540  1.00 12.23 ? 428  DG  D N2    1 
ATOM   3015 N N3    . DG  C 3 7   ? -18.821 43.145 94.598  1.00 12.20 ? 428  DG  D N3    1 
ATOM   3016 C C4    . DG  C 3 7   ? -19.422 42.594 93.522  1.00 12.70 ? 428  DG  D C4    1 
ATOM   3017 P P     . DC  C 3 8   ? -14.398 39.309 93.755  1.00 18.27 ? 429  DC  D P     1 
ATOM   3018 O OP1   . DC  C 3 8   ? -12.925 39.353 93.956  1.00 19.17 ? 429  DC  D OP1   1 
ATOM   3019 O OP2   . DC  C 3 8   ? -15.095 37.998 93.762  1.00 18.40 ? 429  DC  D OP2   1 
ATOM   3020 O "O5'" . DC  C 3 8   ? -15.043 40.237 94.874  1.00 18.97 ? 429  DC  D "O5'" 1 
ATOM   3021 C "C5'" . DC  C 3 8   ? -14.513 41.538 95.119  1.00 20.52 ? 429  DC  D "C5'" 1 
ATOM   3022 C "C4'" . DC  C 3 8   ? -14.693 41.912 96.570  1.00 21.44 ? 429  DC  D "C4'" 1 
ATOM   3023 O "O4'" . DC  C 3 8   ? -16.068 42.282 96.816  1.00 21.29 ? 429  DC  D "O4'" 1 
ATOM   3024 C "C3'" . DC  C 3 8   ? -14.368 40.785 97.546  1.00 22.78 ? 429  DC  D "C3'" 1 
ATOM   3025 O "O3'" . DC  C 3 8   ? -13.647 41.297 98.655  1.00 26.07 ? 429  DC  D "O3'" 1 
ATOM   3026 C "C2'" . DC  C 3 8   ? -15.727 40.276 97.993  1.00 21.82 ? 429  DC  D "C2'" 1 
ATOM   3027 C "C1'" . DC  C 3 8   ? -16.622 41.498 97.866  1.00 20.74 ? 429  DC  D "C1'" 1 
ATOM   3028 N N1    . DC  C 3 8   ? -18.005 41.161 97.482  1.00 19.40 ? 429  DC  D N1    1 
ATOM   3029 C C2    . DC  C 3 8   ? -19.067 41.607 98.285  1.00 18.38 ? 429  DC  D C2    1 
ATOM   3030 O O2    . DC  C 3 8   ? -18.815 42.269 99.304  1.00 17.40 ? 429  DC  D O2    1 
ATOM   3031 N N3    . DC  C 3 8   ? -20.340 41.300 97.926  1.00 17.93 ? 429  DC  D N3    1 
ATOM   3032 C C4    . DC  C 3 8   ? -20.568 40.577 96.824  1.00 17.57 ? 429  DC  D C4    1 
ATOM   3033 N N4    . DC  C 3 8   ? -21.836 40.294 96.508  1.00 16.95 ? 429  DC  D N4    1 
ATOM   3034 C C5    . DC  C 3 8   ? -19.504 40.109 95.994  1.00 17.65 ? 429  DC  D C5    1 
ATOM   3035 C C6    . DC  C 3 8   ? -18.254 40.421 96.357  1.00 18.15 ? 429  DC  D C6    1 
ATOM   3036 P P     . DA  C 3 9   ? -13.020 40.283 99.727  1.00 28.76 ? 430  DA  D P     1 
ATOM   3037 O OP1   . DA  C 3 9   ? -11.649 40.788 99.999  1.00 29.39 ? 430  DA  D OP1   1 
ATOM   3038 O OP2   . DA  C 3 9   ? -13.211 38.876 99.285  1.00 28.35 ? 430  DA  D OP2   1 
ATOM   3039 O "O5'" . DA  C 3 9   ? -13.925 40.527 101.011 1.00 28.47 ? 430  DA  D "O5'" 1 
ATOM   3040 C "C5'" . DA  C 3 9   ? -14.076 41.835 101.543 1.00 29.48 ? 430  DA  D "C5'" 1 
ATOM   3041 C "C4'" . DA  C 3 9   ? -15.050 41.810 102.693 1.00 30.50 ? 430  DA  D "C4'" 1 
ATOM   3042 O "O4'" . DA  C 3 9   ? -16.382 41.590 102.179 1.00 30.09 ? 430  DA  D "O4'" 1 
ATOM   3043 C "C3'" . DA  C 3 9   ? -14.789 40.688 103.696 1.00 31.31 ? 430  DA  D "C3'" 1 
ATOM   3044 O "O3'" . DA  C 3 9   ? -15.036 41.148 105.024 1.00 33.29 ? 430  DA  D "O3'" 1 
ATOM   3045 C "C2'" . DA  C 3 9   ? -15.793 39.621 103.307 1.00 30.68 ? 430  DA  D "C2'" 1 
ATOM   3046 C "C1'" . DA  C 3 9   ? -16.953 40.441 102.778 1.00 30.10 ? 430  DA  D "C1'" 1 
ATOM   3047 N N9    . DA  C 3 9   ? -17.724 39.751 101.752 1.00 29.45 ? 430  DA  D N9    1 
ATOM   3048 C C8    . DA  C 3 9   ? -17.259 38.927 100.756 1.00 29.60 ? 430  DA  D C8    1 
ATOM   3049 N N7    . DA  C 3 9   ? -18.203 38.440 99.990  1.00 29.33 ? 430  DA  D N7    1 
ATOM   3050 C C5    . DA  C 3 9   ? -19.366 38.980 100.517 1.00 29.15 ? 430  DA  D C5    1 
ATOM   3051 C C6    . DA  C 3 9   ? -20.703 38.842 100.159 1.00 29.04 ? 430  DA  D C6    1 
ATOM   3052 N N6    . DA  C 3 9   ? -21.112 38.087 99.140  1.00 28.72 ? 430  DA  D N6    1 
ATOM   3053 N N1    . DA  C 3 9   ? -21.624 39.511 100.891 1.00 30.15 ? 430  DA  D N1    1 
ATOM   3054 C C2    . DA  C 3 9   ? -21.203 40.270 101.915 1.00 30.05 ? 430  DA  D C2    1 
ATOM   3055 N N3    . DA  C 3 9   ? -19.963 40.480 102.349 1.00 29.20 ? 430  DA  D N3    1 
ATOM   3056 C C4    . DA  C 3 9   ? -19.084 39.795 101.599 1.00 29.22 ? 430  DA  D C4    1 
ATOM   3057 P P     . DT  C 3 10  ? -15.119 40.090 106.226 1.00 34.72 ? 431  DT  D P     1 
ATOM   3058 O OP1   . DT  C 3 10  ? -14.616 40.762 107.452 1.00 35.29 ? 431  DT  D OP1   1 
ATOM   3059 O OP2   . DT  C 3 10  ? -14.502 38.809 105.774 1.00 34.51 ? 431  DT  D OP2   1 
ATOM   3060 O "O5'" . DT  C 3 10  ? -16.684 39.870 106.399 1.00 33.73 ? 431  DT  D "O5'" 1 
ATOM   3061 C "C5'" . DT  C 3 10  ? -17.538 40.988 106.614 1.00 31.98 ? 431  DT  D "C5'" 1 
ATOM   3062 C "C4'" . DT  C 3 10  ? -18.927 40.523 106.972 1.00 30.35 ? 431  DT  D "C4'" 1 
ATOM   3063 O "O4'" . DT  C 3 10  ? -19.585 40.029 105.781 1.00 29.48 ? 431  DT  D "O4'" 1 
ATOM   3064 C "C3'" . DT  C 3 10  ? -18.968 39.388 107.998 1.00 29.70 ? 431  DT  D "C3'" 1 
ATOM   3065 O "O3'" . DT  C 3 10  ? -19.947 39.651 108.999 1.00 30.08 ? 431  DT  D "O3'" 1 
ATOM   3066 C "C2'" . DT  C 3 10  ? -19.377 38.177 107.184 1.00 29.12 ? 431  DT  D "C2'" 1 
ATOM   3067 C "C1'" . DT  C 3 10  ? -20.199 38.787 106.062 1.00 28.07 ? 431  DT  D "C1'" 1 
ATOM   3068 N N1    . DT  C 3 10  ? -20.184 37.976 104.832 1.00 25.44 ? 431  DT  D N1    1 
ATOM   3069 C C2    . DT  C 3 10  ? -21.369 37.770 104.162 1.00 24.15 ? 431  DT  D C2    1 
ATOM   3070 O O2    . DT  C 3 10  ? -22.416 38.296 104.487 1.00 23.45 ? 431  DT  D O2    1 
ATOM   3071 N N3    . DT  C 3 10  ? -21.278 36.923 103.086 1.00 23.44 ? 431  DT  D N3    1 
ATOM   3072 C C4    . DT  C 3 10  ? -20.141 36.299 102.611 1.00 23.30 ? 431  DT  D C4    1 
ATOM   3073 O O4    . DT  C 3 10  ? -20.215 35.542 101.648 1.00 23.14 ? 431  DT  D O4    1 
ATOM   3074 C C5    . DT  C 3 10  ? -18.923 36.605 103.332 1.00 23.79 ? 431  DT  D C5    1 
ATOM   3075 C C7    . DT  C 3 10  ? -17.630 36.013 102.864 1.00 23.40 ? 431  DT  D C7    1 
ATOM   3076 C C6    . DT  C 3 10  ? -19.008 37.416 104.392 1.00 24.47 ? 431  DT  D C6    1 
ATOM   3077 P P     . DC  C 3 11  ? -20.166 38.601 110.197 1.00 29.87 ? 432  DC  D P     1 
ATOM   3078 O OP1   . DC  C 3 11  ? -20.123 39.328 111.494 1.00 30.23 ? 432  DC  D OP1   1 
ATOM   3079 O OP2   . DC  C 3 11  ? -19.272 37.439 109.974 1.00 29.51 ? 432  DC  D OP2   1 
ATOM   3080 O "O5'" . DC  C 3 11  ? -21.660 38.123 109.960 1.00 28.54 ? 432  DC  D "O5'" 1 
ATOM   3081 C "C5'" . DC  C 3 11  ? -22.693 39.069 109.697 1.00 27.11 ? 432  DC  D "C5'" 1 
ATOM   3082 C "C4'" . DC  C 3 11  ? -23.979 38.336 109.422 1.00 26.03 ? 432  DC  D "C4'" 1 
ATOM   3083 O "O4'" . DC  C 3 11  ? -23.987 37.948 108.021 1.00 25.48 ? 432  DC  D "O4'" 1 
ATOM   3084 C "C3'" . DC  C 3 11  ? -24.005 37.041 110.230 1.00 25.48 ? 432  DC  D "C3'" 1 
ATOM   3085 O "O3'" . DC  C 3 11  ? -25.098 36.854 111.104 1.00 25.08 ? 432  DC  D "O3'" 1 
ATOM   3086 C "C2'" . DC  C 3 11  ? -24.025 35.930 109.206 1.00 25.60 ? 432  DC  D "C2'" 1 
ATOM   3087 C "C1'" . DC  C 3 11  ? -24.365 36.589 107.889 1.00 24.47 ? 432  DC  D "C1'" 1 
ATOM   3088 N N1    . DC  C 3 11  ? -23.514 35.960 106.874 1.00 23.04 ? 432  DC  D N1    1 
ATOM   3089 C C2    . DC  C 3 11  ? -24.110 35.263 105.821 1.00 22.52 ? 432  DC  D C2    1 
ATOM   3090 O O2    . DC  C 3 11  ? -25.342 35.331 105.674 1.00 22.26 ? 432  DC  D O2    1 
ATOM   3091 N N3    . DC  C 3 11  ? -23.329 34.536 104.990 1.00 21.86 ? 432  DC  D N3    1 
ATOM   3092 C C4    . DC  C 3 11  ? -22.008 34.514 105.167 1.00 21.17 ? 432  DC  D C4    1 
ATOM   3093 N N4    . DC  C 3 11  ? -21.287 33.742 104.362 1.00 20.94 ? 432  DC  D N4    1 
ATOM   3094 C C5    . DC  C 3 11  ? -21.372 35.274 106.186 1.00 21.83 ? 432  DC  D C5    1 
ATOM   3095 C C6    . DC  C 3 11  ? -22.155 35.987 107.001 1.00 21.85 ? 432  DC  D C6    1 
ATOM   3096 P P     . DC  C 3 12  ? -25.001 35.671 112.184 1.00 24.47 ? 433  DC  D P     1 
ATOM   3097 O OP1   . DC  C 3 12  ? -25.663 36.120 113.429 1.00 24.70 ? 433  DC  D OP1   1 
ATOM   3098 O OP2   . DC  C 3 12  ? -23.583 35.240 112.222 1.00 24.11 ? 433  DC  D OP2   1 
ATOM   3099 O "O5'" . DC  C 3 12  ? -25.834 34.484 111.520 1.00 23.96 ? 433  DC  D "O5'" 1 
ATOM   3100 C "C5'" . DC  C 3 12  ? -27.216 34.658 111.214 1.00 23.12 ? 433  DC  D "C5'" 1 
ATOM   3101 C "C4'" . DC  C 3 12  ? -27.731 33.493 110.403 1.00 22.44 ? 433  DC  D "C4'" 1 
ATOM   3102 O "O4'" . DC  C 3 12  ? -27.043 33.487 109.134 1.00 21.56 ? 433  DC  D "O4'" 1 
ATOM   3103 C "C3'" . DC  C 3 12  ? -27.501 32.119 111.036 1.00 22.62 ? 433  DC  D "C3'" 1 
ATOM   3104 O "O3'" . DC  C 3 12  ? -28.631 31.402 111.530 1.00 24.98 ? 433  DC  D "O3'" 1 
ATOM   3105 C "C2'" . DC  C 3 12  ? -26.695 31.341 110.018 1.00 22.42 ? 433  DC  D "C2'" 1 
ATOM   3106 C "C1'" . DC  C 3 12  ? -26.760 32.157 108.741 1.00 21.46 ? 433  DC  D "C1'" 1 
ATOM   3107 N N1    . DC  C 3 12  ? -25.438 32.145 108.110 1.00 20.38 ? 433  DC  D N1    1 
ATOM   3108 C C2    . DC  C 3 12  ? -25.274 31.485 106.897 1.00 19.92 ? 433  DC  D C2    1 
ATOM   3109 O O2    . DC  C 3 12  ? -26.270 31.036 106.323 1.00 19.63 ? 433  DC  D O2    1 
ATOM   3110 N N3    . DC  C 3 12  ? -24.036 31.357 106.379 1.00 20.24 ? 433  DC  D N3    1 
ATOM   3111 C C4    . DC  C 3 12  ? -22.987 31.887 107.019 1.00 20.43 ? 433  DC  D C4    1 
ATOM   3112 N N4    . DC  C 3 12  ? -21.773 31.709 106.488 1.00 20.45 ? 433  DC  D N4    1 
ATOM   3113 C C5    . DC  C 3 12  ? -23.136 32.615 108.233 1.00 19.67 ? 433  DC  D C5    1 
ATOM   3114 C C6    . DC  C 3 12  ? -24.368 32.724 108.734 1.00 19.91 ? 433  DC  D C6    1 
HETATM 3115 N N     . SAH D 4 .   ? -17.411 30.708 79.076  1.00 12.55 ? 1328 SAH A N     1 
HETATM 3116 C CA    . SAH D 4 .   ? -17.780 29.850 80.218  1.00 12.58 ? 1328 SAH A CA    1 
HETATM 3117 C CB    . SAH D 4 .   ? -17.664 30.453 81.619  1.00 11.64 ? 1328 SAH A CB    1 
HETATM 3118 C CG    . SAH D 4 .   ? -16.279 31.000 81.917  1.00 11.18 ? 1328 SAH A CG    1 
HETATM 3119 S SD    . SAH D 4 .   ? -16.109 31.725 83.578  1.00 12.69 ? 1328 SAH A SD    1 
HETATM 3120 C C     . SAH D 4 .   ? -19.203 29.412 79.856  1.00 12.45 ? 1328 SAH A C     1 
HETATM 3121 O O     . SAH D 4 .   ? -19.767 29.787 78.768  1.00 13.37 ? 1328 SAH A O     1 
HETATM 3122 O OXT   . SAH D 4 .   ? -20.135 29.591 80.745  1.00 12.95 ? 1328 SAH A OXT   1 
HETATM 3123 C "C5'" . SAH D 4 .   ? -14.595 30.899 84.121  1.00 12.59 ? 1328 SAH A "C5'" 1 
HETATM 3124 C "C4'" . SAH D 4 .   ? -14.729 29.447 84.564  1.00 13.30 ? 1328 SAH A "C4'" 1 
HETATM 3125 O "O4'" . SAH D 4 .   ? -13.468 28.973 84.944  1.00 13.50 ? 1328 SAH A "O4'" 1 
HETATM 3126 C "C3'" . SAH D 4 .   ? -15.582 29.233 85.795  1.00 13.28 ? 1328 SAH A "C3'" 1 
HETATM 3127 O "O3'" . SAH D 4 .   ? -16.707 28.361 85.521  1.00 12.80 ? 1328 SAH A "O3'" 1 
HETATM 3128 C "C2'" . SAH D 4 .   ? -14.613 28.624 86.814  1.00 12.93 ? 1328 SAH A "C2'" 1 
HETATM 3129 O "O2'" . SAH D 4 .   ? -15.241 27.671 87.711  1.00 13.12 ? 1328 SAH A "O2'" 1 
HETATM 3130 C "C1'" . SAH D 4 .   ? -13.610 27.969 85.939  1.00 13.30 ? 1328 SAH A "C1'" 1 
HETATM 3131 N N9    . SAH D 4 .   ? -12.318 27.856 86.537  1.00 14.18 ? 1328 SAH A N9    1 
HETATM 3132 C C8    . SAH D 4 .   ? -11.682 28.796 87.325  1.00 14.05 ? 1328 SAH A C8    1 
HETATM 3133 N N7    . SAH D 4 .   ? -10.514 28.414 87.721  1.00 14.02 ? 1328 SAH A N7    1 
HETATM 3134 C C5    . SAH D 4 .   ? -10.346 27.153 87.179  1.00 13.94 ? 1328 SAH A C5    1 
HETATM 3135 C C6    . SAH D 4 .   ? -9.290  26.201 87.239  1.00 13.93 ? 1328 SAH A C6    1 
HETATM 3136 N N6    . SAH D 4 .   ? -8.157  26.381 87.903  1.00 13.75 ? 1328 SAH A N6    1 
HETATM 3137 N N1    . SAH D 4 .   ? -9.458  25.020 86.566  1.00 14.16 ? 1328 SAH A N1    1 
HETATM 3138 C C2    . SAH D 4 .   ? -10.588 24.775 85.872  1.00 14.12 ? 1328 SAH A C2    1 
HETATM 3139 N N3    . SAH D 4 .   ? -11.642 25.583 85.743  1.00 13.64 ? 1328 SAH A N3    1 
HETATM 3140 C C4    . SAH D 4 .   ? -11.442 26.777 86.438  1.00 13.75 ? 1328 SAH A C4    1 
HETATM 3141 S S     . SO4 E 5 .   ? -48.533 37.082 80.569  1.00 54.71 ? 1329 SO4 A S     1 
HETATM 3142 O O1    . SO4 E 5 .   ? -47.413 37.410 81.694  1.00 54.55 ? 1329 SO4 A O1    1 
HETATM 3143 O O2    . SO4 E 5 .   ? -49.020 38.386 80.143  1.00 54.76 ? 1329 SO4 A O2    1 
HETATM 3144 O O3    . SO4 E 5 .   ? -47.995 36.384 79.602  1.00 54.52 ? 1329 SO4 A O3    1 
HETATM 3145 O O4    . SO4 E 5 .   ? -49.571 36.418 81.320  1.00 54.99 ? 1329 SO4 A O4    1 
HETATM 3146 S S     . SO4 F 5 .   ? -34.952 26.779 71.230  1.00 43.78 ? 1330 SO4 A S     1 
HETATM 3147 O O1    . SO4 F 5 .   ? -34.094 26.630 69.859  1.00 44.03 ? 1330 SO4 A O1    1 
HETATM 3148 O O2    . SO4 F 5 .   ? -34.516 28.032 71.822  1.00 43.35 ? 1330 SO4 A O2    1 
HETATM 3149 O O3    . SO4 F 5 .   ? -36.230 26.772 70.961  1.00 44.07 ? 1330 SO4 A O3    1 
HETATM 3150 O O4    . SO4 F 5 .   ? -34.469 25.671 72.019  1.00 43.04 ? 1330 SO4 A O4    1 
HETATM 3151 S S     . SO4 G 5 .   ? -34.033 16.367 76.637  1.00 57.38 ? 1331 SO4 A S     1 
HETATM 3152 O O1    . SO4 G 5 .   ? -32.885 17.421 77.095  1.00 57.42 ? 1331 SO4 A O1    1 
HETATM 3153 O O2    . SO4 G 5 .   ? -35.268 16.893 77.187  1.00 57.24 ? 1331 SO4 A O2    1 
HETATM 3154 O O3    . SO4 G 5 .   ? -34.049 16.260 75.336  1.00 57.02 ? 1331 SO4 A O3    1 
HETATM 3155 O O4    . SO4 G 5 .   ? -33.675 15.176 77.353  1.00 57.75 ? 1331 SO4 A O4    1 
HETATM 3156 S S     . SO4 H 5 .   ? -1.936  21.922 62.057  1.00 61.37 ? 1332 SO4 A S     1 
HETATM 3157 O O1    . SO4 H 5 .   ? -0.493  21.532 61.434  1.00 61.49 ? 1332 SO4 A O1    1 
HETATM 3158 O O2    . SO4 H 5 .   ? -1.699  22.120 63.471  1.00 61.46 ? 1332 SO4 A O2    1 
HETATM 3159 O O3    . SO4 H 5 .   ? -2.409  22.986 61.466  1.00 61.63 ? 1332 SO4 A O3    1 
HETATM 3160 O O4    . SO4 H 5 .   ? -2.693  20.713 61.871  1.00 61.64 ? 1332 SO4 A O4    1 
HETATM 3161 S S     . SO4 I 5 .   ? -41.153 56.911 75.062  1.00 63.36 ? 1333 SO4 A S     1 
HETATM 3162 O O1    . SO4 I 5 .   ? -40.293 57.691 76.198  1.00 63.27 ? 1333 SO4 A O1    1 
HETATM 3163 O O2    . SO4 I 5 .   ? -41.533 57.936 74.108  1.00 63.80 ? 1333 SO4 A O2    1 
HETATM 3164 O O3    . SO4 I 5 .   ? -40.430 55.963 74.527  1.00 63.74 ? 1333 SO4 A O3    1 
HETATM 3165 O O4    . SO4 I 5 .   ? -42.326 56.477 75.781  1.00 63.18 ? 1333 SO4 A O4    1 
HETATM 3166 S S     . SO4 J 5 .   ? -38.518 60.754 83.005  1.00 76.15 ? 1334 SO4 A S     1 
HETATM 3167 O O1    . SO4 J 5 .   ? -38.061 62.297 83.233  1.00 76.11 ? 1334 SO4 A O1    1 
HETATM 3168 O O2    . SO4 J 5 .   ? -39.015 60.708 81.640  1.00 76.05 ? 1334 SO4 A O2    1 
HETATM 3169 O O3    . SO4 J 5 .   ? -37.506 59.954 83.207  1.00 75.91 ? 1334 SO4 A O3    1 
HETATM 3170 O O4    . SO4 J 5 .   ? -39.626 60.608 83.921  1.00 75.81 ? 1334 SO4 A O4    1 
HETATM 3171 C C1    . GOL K 6 .   ? -18.607 47.521 67.560  1.00 32.65 ? 1335 GOL A C1    1 
HETATM 3172 O O1    . GOL K 6 .   ? -17.830 46.572 66.808  1.00 33.64 ? 1335 GOL A O1    1 
HETATM 3173 C C2    . GOL K 6 .   ? -18.063 47.567 68.985  1.00 32.03 ? 1335 GOL A C2    1 
HETATM 3174 O O2    . GOL K 6 .   ? -17.427 48.825 69.146  1.00 32.58 ? 1335 GOL A O2    1 
HETATM 3175 C C3    . GOL K 6 .   ? -19.122 47.367 69.991  1.00 31.20 ? 1335 GOL A C3    1 
HETATM 3176 O O3    . GOL K 6 .   ? -19.894 46.146 69.633  1.00 29.38 ? 1335 GOL A O3    1 
HETATM 3177 C C1    . GOL L 6 .   ? -24.517 30.962 57.487  1.00 44.28 ? 1336 GOL A C1    1 
HETATM 3178 O O1    . GOL L 6 .   ? -24.889 30.043 56.448  1.00 43.93 ? 1336 GOL A O1    1 
HETATM 3179 C C2    . GOL L 6 .   ? -25.705 31.891 57.751  1.00 44.87 ? 1336 GOL A C2    1 
HETATM 3180 O O2    . GOL L 6 .   ? -26.381 32.145 56.518  1.00 45.01 ? 1336 GOL A O2    1 
HETATM 3181 C C3    . GOL L 6 .   ? -26.602 31.337 58.768  1.00 44.97 ? 1336 GOL A C3    1 
HETATM 3182 O O3    . GOL L 6 .   ? -27.384 30.242 58.144  1.00 45.73 ? 1336 GOL A O3    1 
HETATM 3183 C C1    . GOL M 6 .   ? -5.453  24.436 49.414  1.00 34.83 ? 1337 GOL A C1    1 
HETATM 3184 O O1    . GOL M 6 .   ? -6.276  23.537 48.646  1.00 34.79 ? 1337 GOL A O1    1 
HETATM 3185 C C2    . GOL M 6 .   ? -4.691  25.325 48.438  1.00 34.61 ? 1337 GOL A C2    1 
HETATM 3186 O O2    . GOL M 6 .   ? -5.614  25.783 47.468  1.00 34.52 ? 1337 GOL A O2    1 
HETATM 3187 C C3    . GOL M 6 .   ? -4.044  26.437 49.136  1.00 34.64 ? 1337 GOL A C3    1 
HETATM 3188 O O3    . GOL M 6 .   ? -3.113  27.084 48.184  1.00 34.48 ? 1337 GOL A O3    1 
HETATM 3189 C C1    . GOL N 6 .   ? -30.438 34.546 95.187  1.00 32.33 ? 1338 GOL A C1    1 
HETATM 3190 O O1    . GOL N 6 .   ? -30.359 35.945 95.556  1.00 32.15 ? 1338 GOL A O1    1 
HETATM 3191 C C2    . GOL N 6 .   ? -29.050 34.053 94.725  1.00 31.99 ? 1338 GOL A C2    1 
HETATM 3192 O O2    . GOL N 6 .   ? -28.637 34.830 93.606  1.00 31.02 ? 1338 GOL A O2    1 
HETATM 3193 C C3    . GOL N 6 .   ? -28.074 34.116 95.818  1.00 32.13 ? 1338 GOL A C3    1 
HETATM 3194 O O3    . GOL N 6 .   ? -27.057 33.061 95.600  1.00 32.23 ? 1338 GOL A O3    1 
HETATM 3195 C C1    . GOL O 6 .   ? -49.392 35.761 87.420  1.00 45.01 ? 1339 GOL A C1    1 
HETATM 3196 O O1    . GOL O 6 .   ? -49.295 36.279 88.758  1.00 45.04 ? 1339 GOL A O1    1 
HETATM 3197 C C2    . GOL O 6 .   ? -50.874 35.586 87.076  1.00 45.40 ? 1339 GOL A C2    1 
HETATM 3198 O O2    . GOL O 6 .   ? -50.999 35.508 85.660  1.00 45.42 ? 1339 GOL A O2    1 
HETATM 3199 C C3    . GOL O 6 .   ? -51.486 34.430 87.778  1.00 45.67 ? 1339 GOL A C3    1 
HETATM 3200 O O3    . GOL O 6 .   ? -50.909 33.160 87.255  1.00 46.04 ? 1339 GOL A O3    1 
HETATM 3201 O O     . HOH P 7 .   ? -30.881 34.295 69.791  1.00 20.67 ? 2001 HOH A O     1 
HETATM 3202 O O     . HOH P 7 .   ? -31.789 30.499 70.842  1.00 20.48 ? 2002 HOH A O     1 
HETATM 3203 O O     . HOH P 7 .   ? -32.394 34.239 66.943  1.00 30.33 ? 2003 HOH A O     1 
HETATM 3204 O O     . HOH P 7 .   ? -32.601 35.316 70.962  1.00 19.54 ? 2004 HOH A O     1 
HETATM 3205 O O     . HOH P 7 .   ? -31.734 31.946 63.453  1.00 22.63 ? 2005 HOH A O     1 
HETATM 3206 O O     . HOH P 7 .   ? -26.859 25.948 63.543  1.00 23.63 ? 2006 HOH A O     1 
HETATM 3207 O O     . HOH P 7 .   ? -21.993 23.550 55.670  1.00 24.25 ? 2007 HOH A O     1 
HETATM 3208 O O     . HOH P 7 .   ? -25.759 20.927 72.046  1.00 29.45 ? 2008 HOH A O     1 
HETATM 3209 O O     . HOH P 7 .   ? -15.998 18.702 62.786  1.00 30.59 ? 2009 HOH A O     1 
HETATM 3210 O O     . HOH P 7 .   ? -8.861  13.045 70.612  1.00 29.28 ? 2010 HOH A O     1 
HETATM 3211 O O     . HOH P 7 .   ? -12.466 30.792 92.469  1.00 35.38 ? 2011 HOH A O     1 
HETATM 3212 O O     . HOH P 7 .   ? -19.887 28.651 88.254  1.00 8.36  ? 2012 HOH A O     1 
HETATM 3213 O O     . HOH P 7 .   ? -14.043 27.710 76.587  1.00 5.84  ? 2013 HOH A O     1 
HETATM 3214 O O     . HOH P 7 .   ? -20.140 15.546 88.251  1.00 28.18 ? 2014 HOH A O     1 
HETATM 3215 O O     . HOH P 7 .   ? -10.217 25.381 82.419  1.00 16.56 ? 2015 HOH A O     1 
HETATM 3216 O O     . HOH P 7 .   ? -17.763 27.394 76.943  1.00 11.44 ? 2016 HOH A O     1 
HETATM 3217 O O     . HOH P 7 .   ? -24.676 24.113 69.140  1.00 17.36 ? 2017 HOH A O     1 
HETATM 3218 O O     . HOH P 7 .   ? -18.410 18.180 69.547  1.00 17.67 ? 2018 HOH A O     1 
HETATM 3219 O O     . HOH P 7 .   ? -24.101 22.132 70.313  1.00 24.49 ? 2019 HOH A O     1 
HETATM 3220 O O     . HOH P 7 .   ? -23.347 18.781 71.684  1.00 22.64 ? 2020 HOH A O     1 
HETATM 3221 O O     . HOH P 7 .   ? -23.906 22.294 63.722  1.00 27.07 ? 2021 HOH A O     1 
HETATM 3222 O O     . HOH P 7 .   ? -20.452 20.037 65.622  1.00 25.59 ? 2022 HOH A O     1 
HETATM 3223 O O     . HOH P 7 .   ? -14.014 17.292 63.768  1.00 27.97 ? 2023 HOH A O     1 
HETATM 3224 O O     . HOH P 7 .   ? -18.034 15.976 70.993  1.00 32.21 ? 2024 HOH A O     1 
HETATM 3225 O O     . HOH P 7 .   ? -10.983 13.359 72.698  1.00 27.43 ? 2025 HOH A O     1 
HETATM 3226 O O     . HOH P 7 .   ? -10.039 30.146 93.753  1.00 34.08 ? 2026 HOH A O     1 
HETATM 3227 O O     . HOH P 7 .   ? -12.841 16.183 78.857  1.00 21.03 ? 2027 HOH A O     1 
HETATM 3228 O O     . HOH P 7 .   ? -13.588 29.148 90.615  1.00 18.36 ? 2028 HOH A O     1 
HETATM 3229 O O     . HOH P 7 .   ? -15.172 19.507 91.633  1.00 34.35 ? 2029 HOH A O     1 
HETATM 3230 O O     . HOH P 7 .   ? -21.402 26.708 89.426  1.00 12.67 ? 2030 HOH A O     1 
HETATM 3231 O O     . HOH P 7 .   ? -19.411 17.420 89.505  1.00 33.19 ? 2031 HOH A O     1 
HETATM 3232 O O     . HOH P 7 .   ? -12.776 17.252 89.466  1.00 25.58 ? 2032 HOH A O     1 
HETATM 3233 O O     . HOH P 7 .   ? 1.826   42.656 84.155  1.00 24.73 ? 2033 HOH A O     1 
HETATM 3234 O O     . HOH P 7 .   ? -28.267 20.882 75.748  1.00 19.75 ? 2034 HOH A O     1 
HETATM 3235 O O     . HOH P 7 .   ? -26.690 20.644 74.462  1.00 32.63 ? 2035 HOH A O     1 
HETATM 3236 O O     . HOH P 7 .   ? -15.915 49.690 73.223  1.00 34.81 ? 2036 HOH A O     1 
HETATM 3237 O O     . HOH P 7 .   ? -9.464  46.883 72.799  1.00 26.55 ? 2037 HOH A O     1 
HETATM 3238 O O     . HOH P 7 .   ? -14.027 15.421 86.149  1.00 29.76 ? 2038 HOH A O     1 
HETATM 3239 O O     . HOH P 7 .   ? -6.273  15.428 80.102  1.00 30.65 ? 2039 HOH A O     1 
HETATM 3240 O O     . HOH P 7 .   ? -10.512 15.926 87.098  1.00 21.38 ? 2040 HOH A O     1 
HETATM 3241 O O     . HOH P 7 .   ? -10.710 20.523 90.224  1.00 24.08 ? 2041 HOH A O     1 
HETATM 3242 O O     . HOH P 7 .   ? -5.594  25.677 91.554  1.00 20.23 ? 2042 HOH A O     1 
HETATM 3243 O O     . HOH P 7 .   ? -2.598  26.763 91.415  1.00 36.48 ? 2043 HOH A O     1 
HETATM 3244 O O     . HOH P 7 .   ? -2.670  15.548 84.089  1.00 27.63 ? 2044 HOH A O     1 
HETATM 3245 O O     . HOH P 7 .   ? 5.473   14.795 80.976  1.00 31.63 ? 2045 HOH A O     1 
HETATM 3246 O O     . HOH P 7 .   ? -1.935  14.356 73.558  1.00 29.64 ? 2046 HOH A O     1 
HETATM 3247 O O     . HOH P 7 .   ? -4.546  13.721 70.610  1.00 27.49 ? 2047 HOH A O     1 
HETATM 3248 O O     . HOH P 7 .   ? -8.730  18.803 62.113  1.00 28.64 ? 2048 HOH A O     1 
HETATM 3249 O O     . HOH P 7 .   ? -43.715 47.230 93.231  1.00 32.96 ? 2049 HOH A O     1 
HETATM 3250 O O     . HOH P 7 .   ? -14.729 34.346 86.436  1.00 14.64 ? 2050 HOH A O     1 
HETATM 3251 O O     . HOH P 7 .   ? -14.157 32.134 87.623  1.00 10.62 ? 2051 HOH A O     1 
HETATM 3252 O O     . HOH P 7 .   ? -12.132 31.525 89.665  1.00 21.77 ? 2052 HOH A O     1 
HETATM 3253 O O     . HOH P 7 .   ? -10.203 36.128 88.200  1.00 14.59 ? 2053 HOH A O     1 
HETATM 3254 O O     . HOH P 7 .   ? -11.500 41.312 92.461  1.00 14.42 ? 2054 HOH A O     1 
HETATM 3255 O O     . HOH P 7 .   ? -11.418 43.447 89.428  1.00 14.31 ? 2055 HOH A O     1 
HETATM 3256 O O     . HOH P 7 .   ? -6.338  48.874 86.853  1.00 30.67 ? 2056 HOH A O     1 
HETATM 3257 O O     . HOH P 7 .   ? -4.284  39.373 96.281  1.00 38.13 ? 2057 HOH A O     1 
HETATM 3258 O O     . HOH P 7 .   ? -1.830  42.838 87.184  1.00 20.46 ? 2058 HOH A O     1 
HETATM 3259 O O     . HOH P 7 .   ? -8.534  40.988 92.376  1.00 20.56 ? 2059 HOH A O     1 
HETATM 3260 O O     . HOH P 7 .   ? -7.508  30.190 91.492  1.00 28.04 ? 2060 HOH A O     1 
HETATM 3261 O O     . HOH P 7 .   ? -4.504  29.692 89.500  1.00 24.92 ? 2061 HOH A O     1 
HETATM 3262 O O     . HOH P 7 .   ? -8.025  34.784 85.283  1.00 13.58 ? 2062 HOH A O     1 
HETATM 3263 O O     . HOH P 7 .   ? -35.689 32.103 93.772  1.00 31.14 ? 2063 HOH A O     1 
HETATM 3264 O O     . HOH P 7 .   ? -5.351  35.343 83.709  1.00 14.20 ? 2064 HOH A O     1 
HETATM 3265 O O     . HOH P 7 .   ? -34.466 27.537 86.839  1.00 16.41 ? 2065 HOH A O     1 
HETATM 3266 O O     . HOH P 7 .   ? 2.878   29.898 80.829  1.00 27.60 ? 2066 HOH A O     1 
HETATM 3267 O O     . HOH P 7 .   ? -35.121 31.885 73.052  1.00 28.45 ? 2067 HOH A O     1 
HETATM 3268 O O     . HOH P 7 .   ? -2.431  29.605 87.580  1.00 19.89 ? 2068 HOH A O     1 
HETATM 3269 O O     . HOH P 7 .   ? -0.206  26.765 86.747  1.00 29.51 ? 2069 HOH A O     1 
HETATM 3270 O O     . HOH P 7 .   ? -28.282 22.863 71.352  1.00 39.51 ? 2070 HOH A O     1 
HETATM 3271 O O     . HOH P 7 .   ? 1.171   27.257 84.158  1.00 21.03 ? 2071 HOH A O     1 
HETATM 3272 O O     . HOH P 7 .   ? 4.137   23.962 77.707  1.00 17.82 ? 2072 HOH A O     1 
HETATM 3273 O O     . HOH P 7 .   ? -18.567 32.080 96.646  1.00 35.18 ? 2073 HOH A O     1 
HETATM 3274 O O     . HOH P 7 .   ? -2.854  20.102 68.909  1.00 23.69 ? 2074 HOH A O     1 
HETATM 3275 O O     . HOH P 7 .   ? 0.908   17.812 70.546  1.00 32.20 ? 2075 HOH A O     1 
HETATM 3276 O O     . HOH P 7 .   ? -30.714 37.891 66.149  1.00 32.56 ? 2076 HOH A O     1 
HETATM 3277 O O     . HOH P 7 .   ? -0.603  21.700 66.141  1.00 32.15 ? 2077 HOH A O     1 
HETATM 3278 O O     . HOH P 7 .   ? -5.734  26.022 58.292  1.00 30.55 ? 2078 HOH A O     1 
HETATM 3279 O O     . HOH P 7 .   ? -13.192 49.102 81.850  1.00 23.46 ? 2079 HOH A O     1 
HETATM 3280 O O     . HOH P 7 .   ? -14.662 45.015 83.489  1.00 16.16 ? 2080 HOH A O     1 
HETATM 3281 O O     . HOH P 7 .   ? -9.129  49.896 83.904  1.00 23.89 ? 2081 HOH A O     1 
HETATM 3282 O O     . HOH P 7 .   ? -15.802 47.267 82.247  1.00 24.66 ? 2082 HOH A O     1 
HETATM 3283 O O     . HOH P 7 .   ? -5.225  48.649 75.949  1.00 26.37 ? 2083 HOH A O     1 
HETATM 3284 O O     . HOH P 7 .   ? -4.798  46.071 79.990  1.00 17.47 ? 2084 HOH A O     1 
HETATM 3285 O O     . HOH P 7 .   ? 0.599   50.293 85.157  1.00 27.35 ? 2085 HOH A O     1 
HETATM 3286 O O     . HOH P 7 .   ? -1.814  49.160 87.703  1.00 36.56 ? 2086 HOH A O     1 
HETATM 3287 O O     . HOH P 7 .   ? -0.942  43.819 84.735  1.00 21.10 ? 2087 HOH A O     1 
HETATM 3288 O O     . HOH P 7 .   ? -5.506  51.466 84.872  1.00 27.89 ? 2088 HOH A O     1 
HETATM 3289 O O     . HOH P 7 .   ? -2.538  47.425 76.281  1.00 20.90 ? 2089 HOH A O     1 
HETATM 3290 O O     . HOH P 7 .   ? 3.237   44.636 71.832  1.00 26.67 ? 2090 HOH A O     1 
HETATM 3291 O O     . HOH P 7 .   ? 8.056   34.054 67.383  1.00 36.71 ? 2091 HOH A O     1 
HETATM 3292 O O     . HOH P 7 .   ? 3.127   37.091 66.156  1.00 32.28 ? 2092 HOH A O     1 
HETATM 3293 O O     . HOH P 7 .   ? -3.528  42.361 64.225  1.00 35.21 ? 2093 HOH A O     1 
HETATM 3294 O O     . HOH P 7 .   ? -2.002  42.765 67.666  1.00 39.28 ? 2094 HOH A O     1 
HETATM 3295 O O     . HOH P 7 .   ? 0.103   40.710 66.273  1.00 26.45 ? 2095 HOH A O     1 
HETATM 3296 O O     . HOH P 7 .   ? -8.285  42.875 63.951  1.00 30.41 ? 2096 HOH A O     1 
HETATM 3297 O O     . HOH P 7 .   ? -6.244  43.968 67.583  1.00 35.82 ? 2097 HOH A O     1 
HETATM 3298 O O     . HOH P 7 .   ? -14.993 47.976 70.219  1.00 32.96 ? 2098 HOH A O     1 
HETATM 3299 O O     . HOH P 7 .   ? -11.995 47.389 71.498  1.00 17.91 ? 2099 HOH A O     1 
HETATM 3300 O O     . HOH P 7 .   ? -24.109 50.120 76.245  1.00 36.28 ? 2100 HOH A O     1 
HETATM 3301 O O     . HOH P 7 .   ? -28.073 48.563 68.323  1.00 27.49 ? 2101 HOH A O     1 
HETATM 3302 O O     . HOH P 7 .   ? -22.426 49.729 70.972  1.00 27.14 ? 2102 HOH A O     1 
HETATM 3303 O O     . HOH P 7 .   ? -25.999 47.972 66.377  1.00 17.59 ? 2103 HOH A O     1 
HETATM 3304 O O     . HOH P 7 .   ? -32.582 37.529 69.593  1.00 34.75 ? 2104 HOH A O     1 
HETATM 3305 O O     . HOH P 7 .   ? -21.322 51.288 81.478  1.00 28.08 ? 2105 HOH A O     1 
HETATM 3306 O O     . HOH P 7 .   ? -25.459 51.242 79.926  1.00 28.35 ? 2106 HOH A O     1 
HETATM 3307 O O     . HOH P 7 .   ? -19.750 46.922 80.813  1.00 28.97 ? 2107 HOH A O     1 
HETATM 3308 O O     . HOH P 7 .   ? -19.760 37.134 75.554  1.00 17.74 ? 2108 HOH A O     1 
HETATM 3309 O O     . HOH P 7 .   ? -20.147 40.664 74.237  1.00 11.69 ? 2109 HOH A O     1 
HETATM 3310 O O     . HOH P 7 .   ? 3.744   28.584 56.591  1.00 35.06 ? 2110 HOH A O     1 
HETATM 3311 O O     . HOH P 7 .   ? -4.024  29.632 55.478  1.00 20.79 ? 2111 HOH A O     1 
HETATM 3312 O O     . HOH P 7 .   ? -5.994  38.779 59.953  1.00 16.50 ? 2112 HOH A O     1 
HETATM 3313 O O     . HOH P 7 .   ? -1.774  33.790 60.884  1.00 13.42 ? 2113 HOH A O     1 
HETATM 3314 O O     . HOH P 7 .   ? -3.729  37.139 61.739  1.00 20.25 ? 2114 HOH A O     1 
HETATM 3315 O O     . HOH P 7 .   ? -5.940  35.471 54.849  1.00 19.32 ? 2115 HOH A O     1 
HETATM 3316 O O     . HOH P 7 .   ? -9.840  37.799 52.151  0.30 6.25  ? 2116 HOH A O     1 
HETATM 3317 O O     . HOH P 7 .   ? -12.946 37.063 58.963  1.00 13.31 ? 2117 HOH A O     1 
HETATM 3318 O O     . HOH P 7 .   ? -11.964 43.797 62.621  1.00 18.49 ? 2118 HOH A O     1 
HETATM 3319 O O     . HOH P 7 .   ? -16.560 44.923 64.892  1.00 23.40 ? 2119 HOH A O     1 
HETATM 3320 O O     . HOH P 7 .   ? -28.166 44.134 67.380  1.00 18.60 ? 2120 HOH A O     1 
HETATM 3321 O O     . HOH P 7 .   ? -31.085 43.804 62.317  1.00 25.86 ? 2121 HOH A O     1 
HETATM 3322 O O     . HOH P 7 .   ? -28.382 46.835 60.718  1.00 25.09 ? 2122 HOH A O     1 
HETATM 3323 O O     . HOH P 7 .   ? -32.598 49.002 68.208  1.00 27.65 ? 2123 HOH A O     1 
HETATM 3324 O O     . HOH P 7 .   ? -30.093 48.762 67.317  1.00 23.69 ? 2124 HOH A O     1 
HETATM 3325 O O     . HOH P 7 .   ? -31.483 42.174 66.181  1.00 20.56 ? 2125 HOH A O     1 
HETATM 3326 O O     . HOH P 7 .   ? -44.185 43.289 72.981  1.00 37.54 ? 2126 HOH A O     1 
HETATM 3327 O O     . HOH P 7 .   ? -41.914 37.751 76.248  1.00 26.89 ? 2127 HOH A O     1 
HETATM 3328 O O     . HOH P 7 .   ? -38.954 43.720 69.626  1.00 25.80 ? 2128 HOH A O     1 
HETATM 3329 O O     . HOH P 7 .   ? -40.525 35.437 75.529  1.00 37.56 ? 2129 HOH A O     1 
HETATM 3330 O O     . HOH P 7 .   ? -38.338 34.225 74.048  1.00 27.86 ? 2130 HOH A O     1 
HETATM 3331 O O     . HOH P 7 .   ? -47.650 40.195 87.076  1.00 32.88 ? 2131 HOH A O     1 
HETATM 3332 O O     . HOH P 7 .   ? -45.192 37.277 88.046  1.00 14.29 ? 2132 HOH A O     1 
HETATM 3333 O O     . HOH P 7 .   ? -43.277 38.256 82.973  1.00 9.91  ? 2133 HOH A O     1 
HETATM 3334 O O     . HOH P 7 .   ? -44.364 31.319 90.017  1.00 22.87 ? 2134 HOH A O     1 
HETATM 3335 O O     . HOH P 7 .   ? -40.651 28.318 83.984  1.00 20.20 ? 2135 HOH A O     1 
HETATM 3336 O O     . HOH P 7 .   ? -36.832 30.662 89.834  1.00 19.79 ? 2136 HOH A O     1 
HETATM 3337 O O     . HOH P 7 .   ? -36.961 39.534 92.730  1.00 31.84 ? 2137 HOH A O     1 
HETATM 3338 O O     . HOH P 7 .   ? -43.099 37.089 95.387  1.00 30.56 ? 2138 HOH A O     1 
HETATM 3339 O O     . HOH P 7 .   ? -42.319 41.307 98.858  1.00 32.37 ? 2139 HOH A O     1 
HETATM 3340 O O     . HOH P 7 .   ? -40.830 46.863 94.982  1.00 19.91 ? 2140 HOH A O     1 
HETATM 3341 O O     . HOH P 7 .   ? -33.834 51.484 102.003 1.00 34.67 ? 2141 HOH A O     1 
HETATM 3342 O O     . HOH P 7 .   ? -34.606 53.507 98.324  1.00 27.49 ? 2142 HOH A O     1 
HETATM 3343 O O     . HOH P 7 .   ? -37.489 54.640 74.285  1.00 18.97 ? 2143 HOH A O     1 
HETATM 3344 O O     . HOH P 7 .   ? -39.591 46.734 69.162  1.00 29.56 ? 2144 HOH A O     1 
HETATM 3345 O O     . HOH P 7 .   ? -26.766 51.209 72.092  1.00 35.42 ? 2145 HOH A O     1 
HETATM 3346 O O     . HOH P 7 .   ? -28.565 54.097 79.502  1.00 37.31 ? 2146 HOH A O     1 
HETATM 3347 O O     . HOH P 7 .   ? -26.546 51.468 77.955  1.00 27.30 ? 2147 HOH A O     1 
HETATM 3348 O O     . HOH P 7 .   ? -27.770 53.888 91.783  1.00 31.94 ? 2148 HOH A O     1 
HETATM 3349 O O     . HOH P 7 .   ? -31.087 54.938 82.371  1.00 27.86 ? 2149 HOH A O     1 
HETATM 3350 O O     . HOH P 7 .   ? -23.876 44.552 88.945  1.00 17.72 ? 2150 HOH A O     1 
HETATM 3351 O O     . HOH P 7 .   ? -26.687 43.501 89.341  1.00 14.36 ? 2151 HOH A O     1 
HETATM 3352 O O     . HOH P 7 .   ? -27.559 45.771 89.280  1.00 11.80 ? 2152 HOH A O     1 
HETATM 3353 O O     . HOH P 7 .   ? -26.780 49.398 99.202  1.00 22.79 ? 2153 HOH A O     1 
HETATM 3354 O O     . HOH P 7 .   ? -30.093 45.765 89.972  1.00 18.60 ? 2154 HOH A O     1 
HETATM 3355 O O     . HOH P 7 .   ? -24.126 52.439 93.445  1.00 25.53 ? 2155 HOH A O     1 
HETATM 3356 O O     . HOH P 7 .   ? -26.816 47.642 86.990  1.00 15.10 ? 2156 HOH A O     1 
HETATM 3357 O O     . HOH P 7 .   ? -33.345 48.550 80.133  1.00 13.61 ? 2157 HOH A O     1 
HETATM 3358 O O     . HOH P 7 .   ? -40.261 47.221 81.449  1.00 16.30 ? 2158 HOH A O     1 
HETATM 3359 O O     . HOH P 7 .   ? -25.739 41.489 87.541  1.00 15.19 ? 2159 HOH A O     1 
HETATM 3360 O O     . HOH P 7 .   ? -23.552 39.350 81.408  1.00 23.73 ? 2160 HOH A O     1 
HETATM 3361 O O     . HOH P 7 .   ? -22.132 33.011 93.504  1.00 13.33 ? 2161 HOH A O     1 
HETATM 3362 O O     . HOH P 7 .   ? -14.131 33.343 93.633  1.00 32.40 ? 2162 HOH A O     1 
HETATM 3363 O O     . HOH P 7 .   ? -16.528 31.525 89.028  1.00 14.09 ? 2163 HOH A O     1 
HETATM 3364 O O     . HOH P 7 .   ? -26.154 41.753 91.644  1.00 11.11 ? 2164 HOH A O     1 
HETATM 3365 O O     . HOH P 7 .   ? -30.093 44.510 98.338  1.00 18.71 ? 2165 HOH A O     1 
HETATM 3366 O O     . HOH P 7 .   ? -30.410 35.963 91.688  1.00 20.97 ? 2166 HOH A O     1 
HETATM 3367 O O     . HOH P 7 .   ? -23.814 35.063 95.417  1.00 31.34 ? 2167 HOH A O     1 
HETATM 3368 O O     . HOH P 7 .   ? -30.067 41.642 83.286  1.00 16.01 ? 2168 HOH A O     1 
HETATM 3369 O O     . HOH P 7 .   ? -43.715 48.496 90.982  1.00 37.89 ? 2169 HOH A O     1 
HETATM 3370 O O     . HOH P 7 .   ? -45.440 48.069 84.393  1.00 25.85 ? 2170 HOH A O     1 
HETATM 3371 O O     . HOH P 7 .   ? -43.392 44.625 92.898  1.00 17.39 ? 2171 HOH A O     1 
HETATM 3372 O O     . HOH P 7 .   ? -43.784 39.288 86.231  1.00 17.35 ? 2172 HOH A O     1 
HETATM 3373 O O     . HOH P 7 .   ? -33.728 33.284 94.114  1.00 23.15 ? 2173 HOH A O     1 
HETATM 3374 O O     . HOH P 7 .   ? -36.475 28.082 88.732  1.00 25.22 ? 2174 HOH A O     1 
HETATM 3375 O O     . HOH P 7 .   ? -41.957 31.425 77.104  1.00 20.47 ? 2175 HOH A O     1 
HETATM 3376 O O     . HOH P 7 .   ? -31.797 34.307 73.051  1.00 16.72 ? 2176 HOH A O     1 
HETATM 3377 O O     . HOH P 7 .   ? -38.224 27.587 78.040  1.00 21.16 ? 2177 HOH A O     1 
HETATM 3378 O O     . HOH P 7 .   ? -32.643 32.032 73.358  1.00 21.83 ? 2178 HOH A O     1 
HETATM 3379 O O     . HOH P 7 .   ? -33.098 29.707 77.060  1.00 12.76 ? 2179 HOH A O     1 
HETATM 3380 O O     . HOH P 7 .   ? -29.426 22.866 74.047  1.00 25.78 ? 2180 HOH A O     1 
HETATM 3381 O O     . HOH P 7 .   ? -32.593 24.081 70.156  1.00 28.55 ? 2181 HOH A O     1 
HETATM 3382 O O     . HOH P 7 .   ? -33.767 23.314 82.398  1.00 16.51 ? 2182 HOH A O     1 
HETATM 3383 O O     . HOH P 7 .   ? -32.793 26.123 88.361  1.00 22.57 ? 2183 HOH A O     1 
HETATM 3384 O O     . HOH P 7 .   ? -32.626 25.993 93.925  1.00 25.64 ? 2184 HOH A O     1 
HETATM 3385 O O     . HOH P 7 .   ? -24.774 31.507 93.443  1.00 22.23 ? 2185 HOH A O     1 
HETATM 3386 O O     . HOH P 7 .   ? -30.848 27.997 95.068  1.00 17.01 ? 2186 HOH A O     1 
HETATM 3387 O O     . HOH P 7 .   ? -20.204 27.299 92.778  1.00 13.44 ? 2187 HOH A O     1 
HETATM 3388 O O     . HOH P 7 .   ? -27.358 35.557 86.349  1.00 13.75 ? 2188 HOH A O     1 
HETATM 3389 O O     . HOH P 7 .   ? -34.926 31.885 91.223  1.00 22.62 ? 2189 HOH A O     1 
HETATM 3390 O O     . HOH P 7 .   ? -20.552 31.673 94.782  1.00 18.13 ? 2190 HOH A O     1 
HETATM 3391 O O     . HOH P 7 .   ? -27.442 26.828 84.844  1.00 12.06 ? 2191 HOH A O     1 
HETATM 3392 O O     . HOH P 7 .   ? -20.827 29.602 83.667  1.00 13.61 ? 2192 HOH A O     1 
HETATM 3393 O O     . HOH P 7 .   ? -17.418 33.299 80.083  1.00 13.98 ? 2193 HOH A O     1 
HETATM 3394 O O     . HOH P 7 .   ? -19.236 37.045 78.522  1.00 20.86 ? 2194 HOH A O     1 
HETATM 3395 O O     . HOH P 7 .   ? -28.007 37.248 66.927  1.00 15.11 ? 2195 HOH A O     1 
HETATM 3396 O O     . HOH P 7 .   ? -28.024 36.730 62.085  1.00 21.09 ? 2196 HOH A O     1 
HETATM 3397 O O     . HOH P 7 .   ? -17.675 33.013 54.813  1.00 14.49 ? 2197 HOH A O     1 
HETATM 3398 O O     . HOH P 7 .   ? -7.656  33.371 54.792  1.00 20.47 ? 2198 HOH A O     1 
HETATM 3399 O O     . HOH P 7 .   ? -6.352  28.065 57.141  1.00 26.12 ? 2199 HOH A O     1 
HETATM 3400 O O     . HOH P 7 .   ? -11.446 26.264 51.750  1.00 26.85 ? 2200 HOH A O     1 
HETATM 3401 O O     . HOH P 7 .   ? -11.072 24.766 58.074  1.00 31.47 ? 2201 HOH A O     1 
HETATM 3402 O O     . HOH P 7 .   ? -3.800  30.490 50.119  1.00 28.85 ? 2202 HOH A O     1 
HETATM 3403 O O     . HOH P 7 .   ? -3.683  21.466 44.251  1.00 19.23 ? 2203 HOH A O     1 
HETATM 3404 O O     . HOH P 7 .   ? -17.318 28.824 88.853  1.00 17.50 ? 2204 HOH A O     1 
HETATM 3405 O O     . HOH P 7 .   ? -9.545  30.619 89.146  1.00 17.44 ? 2205 HOH A O     1 
HETATM 3406 O O     . HOH P 7 .   ? -19.253 29.131 85.928  1.00 11.78 ? 2206 HOH A O     1 
HETATM 3407 O O     . HOH P 7 .   ? -15.095 29.413 78.531  1.00 10.32 ? 2207 HOH A O     1 
HETATM 3408 O O     . HOH P 7 .   ? -6.922  28.038 89.907  1.00 27.08 ? 2208 HOH A O     1 
HETATM 3409 O O     . HOH P 7 .   ? -50.774 37.273 78.197  1.00 16.73 ? 2209 HOH A O     1 
HETATM 3410 O O     . HOH P 7 .   ? -36.436 23.427 72.876  1.00 27.06 ? 2210 HOH A O     1 
HETATM 3411 O O     . HOH P 7 .   ? -4.284  22.490 64.725  1.00 29.42 ? 2211 HOH A O     1 
HETATM 3412 O O     . HOH P 7 .   ? -41.238 58.080 78.877  1.00 32.22 ? 2212 HOH A O     1 
HETATM 3413 O O     . HOH P 7 .   ? -37.606 58.112 80.984  1.00 39.88 ? 2213 HOH A O     1 
HETATM 3414 O O     . HOH P 7 .   ? -47.148 38.054 89.456  1.00 27.86 ? 2214 HOH A O     1 
HETATM 3415 O O     . HOH P 7 .   ? -52.101 38.093 84.665  1.00 23.34 ? 2215 HOH A O     1 
HETATM 3416 O O     . HOH Q 7 .   ? -21.595 29.132 95.612  1.00 22.76 ? 2001 HOH C O     1 
HETATM 3417 O O     . HOH Q 7 .   ? -29.710 31.652 103.058 1.00 19.44 ? 2002 HOH C O     1 
HETATM 3418 O O     . HOH Q 7 .   ? -24.222 30.192 96.335  1.00 22.65 ? 2003 HOH C O     1 
HETATM 3419 O O     . HOH Q 7 .   ? -31.311 31.386 93.928  1.00 15.30 ? 2004 HOH C O     1 
HETATM 3420 O O     . HOH Q 7 .   ? -30.399 38.460 97.025  1.00 16.67 ? 2005 HOH C O     1 
HETATM 3421 O O     . HOH Q 7 .   ? -23.196 44.577 103.714 1.00 26.52 ? 2006 HOH C O     1 
HETATM 3422 O O     . HOH Q 7 .   ? -29.703 49.186 100.627 1.00 23.17 ? 2007 HOH C O     1 
HETATM 3423 O O     . HOH Q 7 .   ? -19.486 55.876 93.241  1.00 33.21 ? 2008 HOH C O     1 
HETATM 3424 O O     . HOH Q 7 .   ? -19.437 55.125 81.421  1.00 32.25 ? 2009 HOH C O     1 
HETATM 3425 O O     . HOH R 7 .   ? -24.412 54.665 81.548  1.00 31.67 ? 2001 HOH D O     1 
HETATM 3426 O O     . HOH R 7 .   ? -22.343 54.444 83.626  1.00 33.33 ? 2002 HOH D O     1 
HETATM 3427 O O     . HOH R 7 .   ? -25.056 53.715 90.202  1.00 36.52 ? 2003 HOH D O     1 
HETATM 3428 O O     . HOH R 7 .   ? -24.034 44.278 86.304  1.00 13.93 ? 2004 HOH D O     1 
HETATM 3429 O O     . HOH R 7 .   ? -20.306 44.421 80.626  1.00 20.38 ? 2005 HOH D O     1 
HETATM 3430 O O     . HOH R 7 .   ? -21.524 37.562 81.766  1.00 22.21 ? 2006 HOH D O     1 
HETATM 3431 O O     . HOH R 7 .   ? -23.209 42.387 90.712  1.00 13.58 ? 2007 HOH D O     1 
HETATM 3432 O O     . HOH R 7 .   ? -16.432 35.435 88.199  1.00 13.68 ? 2008 HOH D O     1 
HETATM 3433 O O     . HOH R 7 .   ? -16.227 44.130 94.823  1.00 23.79 ? 2009 HOH D O     1 
HETATM 3434 O O     . HOH R 7 .   ? -26.078 35.230 115.862 1.00 12.50 ? 2010 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  CYS 35  35  35  CYS CYS A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 HIS 127 127 127 HIS HIS A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 HIS 148 148 148 HIS HIS A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 TYR 157 157 157 TYR TYR A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 MET 168 168 168 MET MET A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 CYS 170 170 170 CYS CYS A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 ASP 199 199 199 ASP ASP A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 HIS 204 204 204 HIS HIS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 MET 214 214 214 MET MET A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 GLN 217 217 217 GLN GLN A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 TYR 242 242 242 TYR TYR A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 PHE 259 259 259 PHE PHE A . n 
A 1 260 ALA 260 260 260 ALA ALA A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 CYS 279 279 279 CYS CYS A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 ARG 281 281 281 ARG ARG A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 MET 283 283 283 MET MET A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 TYR 285 285 285 TYR TYR A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 SER 288 288 288 SER SER A . n 
A 1 289 TYR 289 289 289 TYR TYR A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 HIS 292 292 292 HIS HIS A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 SER 294 294 294 SER SER A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 TYR 299 299 299 TYR TYR A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 GLN 301 301 301 GLN GLN A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 TYR 313 313 313 TYR TYR A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 TYR 316 316 316 TYR TYR A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 SER 320 320 320 SER SER A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 ASN 323 323 323 ASN ASN A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 PRO 326 326 326 PRO PRO A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
B 2 1   DT  1   401 401 DT  DT  C . n 
B 2 2   DG  2   402 402 DG  DG  C . n 
B 2 3   DG  3   403 403 DG  DG  C . n 
B 2 4   DA  4   404 404 DA  DA  C . n 
B 2 5   DT  5   405 405 DT  DT  C . n 
B 2 6   DG  6   406 406 DG  DG  C . n 
B 2 7   5CM 7   407 407 5CM 5CM C . n 
B 2 8   DG  8   408 408 DG  DG  C . n 
B 2 9   DC  9   409 409 DC  DC  C . n 
B 2 10  DT  10  410 410 DT  DT  C . n 
B 2 11  DG  11  411 411 DG  DG  C . n 
B 2 12  DA  12  412 412 DA  DA  C . n 
B 2 13  DC  13  413 413 DC  DC  C . n 
C 3 1   DG  1   422 422 DG  DG  D . n 
C 3 2   DT  2   423 423 DT  DT  D . n 
C 3 3   DC  3   424 424 DC  DC  D . n 
C 3 4   DA  4   425 425 DA  DA  D . n 
C 3 5   DG  5   426 426 DG  DG  D . n 
C 3 6   DC  6   427 427 DC  DC  D . n 
C 3 7   DG  7   428 428 DG  DG  D . n 
C 3 8   DC  8   429 429 DC  DC  D . n 
C 3 9   DA  9   430 430 DA  DA  D . n 
C 3 10  DT  10  431 431 DT  DT  D . n 
C 3 11  DC  11  432 432 DC  DC  D . n 
C 3 12  DC  12  433 433 DC  DC  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SAH 1   1328 1328 SAH SAH A . 
E 5 SO4 1   1329 1329 SO4 SO4 A . 
F 5 SO4 1   1330 1330 SO4 SO4 A . 
G 5 SO4 1   1331 1331 SO4 SO4 A . 
H 5 SO4 1   1332 1332 SO4 SO4 A . 
I 5 SO4 1   1333 1333 SO4 SO4 A . 
J 5 SO4 1   1334 1334 SO4 SO4 A . 
K 6 GOL 1   1335 1335 GOL GOL A . 
L 6 GOL 1   1336 1336 GOL GOL A . 
M 6 GOL 1   1337 1337 GOL GOL A . 
N 6 GOL 1   1338 1338 GOL GOL A . 
O 6 GOL 1   1339 1339 GOL GOL A . 
P 7 HOH 1   2001 2001 HOH HOH A . 
P 7 HOH 2   2002 2002 HOH HOH A . 
P 7 HOH 3   2003 2003 HOH HOH A . 
P 7 HOH 4   2004 2004 HOH HOH A . 
P 7 HOH 5   2005 2005 HOH HOH A . 
P 7 HOH 6   2006 2006 HOH HOH A . 
P 7 HOH 7   2007 2007 HOH HOH A . 
P 7 HOH 8   2008 2008 HOH HOH A . 
P 7 HOH 9   2009 2009 HOH HOH A . 
P 7 HOH 10  2010 2010 HOH HOH A . 
P 7 HOH 11  2011 2011 HOH HOH A . 
P 7 HOH 12  2012 2012 HOH HOH A . 
P 7 HOH 13  2013 2013 HOH HOH A . 
P 7 HOH 14  2014 2014 HOH HOH A . 
P 7 HOH 15  2015 2015 HOH HOH A . 
P 7 HOH 16  2016 2016 HOH HOH A . 
P 7 HOH 17  2017 2017 HOH HOH A . 
P 7 HOH 18  2018 2018 HOH HOH A . 
P 7 HOH 19  2019 2019 HOH HOH A . 
P 7 HOH 20  2020 2020 HOH HOH A . 
P 7 HOH 21  2021 2021 HOH HOH A . 
P 7 HOH 22  2022 2022 HOH HOH A . 
P 7 HOH 23  2023 2023 HOH HOH A . 
P 7 HOH 24  2024 2024 HOH HOH A . 
P 7 HOH 25  2025 2025 HOH HOH A . 
P 7 HOH 26  2026 2026 HOH HOH A . 
P 7 HOH 27  2027 2027 HOH HOH A . 
P 7 HOH 28  2028 2028 HOH HOH A . 
P 7 HOH 29  2029 2029 HOH HOH A . 
P 7 HOH 30  2030 2030 HOH HOH A . 
P 7 HOH 31  2031 2031 HOH HOH A . 
P 7 HOH 32  2032 2032 HOH HOH A . 
P 7 HOH 33  2033 2033 HOH HOH A . 
P 7 HOH 34  2034 2034 HOH HOH A . 
P 7 HOH 35  2035 2035 HOH HOH A . 
P 7 HOH 36  2036 2036 HOH HOH A . 
P 7 HOH 37  2037 2037 HOH HOH A . 
P 7 HOH 38  2038 2038 HOH HOH A . 
P 7 HOH 39  2039 2039 HOH HOH A . 
P 7 HOH 40  2040 2040 HOH HOH A . 
P 7 HOH 41  2041 2041 HOH HOH A . 
P 7 HOH 42  2042 2042 HOH HOH A . 
P 7 HOH 43  2043 2043 HOH HOH A . 
P 7 HOH 44  2044 2044 HOH HOH A . 
P 7 HOH 45  2045 2045 HOH HOH A . 
P 7 HOH 46  2046 2046 HOH HOH A . 
P 7 HOH 47  2047 2047 HOH HOH A . 
P 7 HOH 48  2048 2048 HOH HOH A . 
P 7 HOH 49  2049 2049 HOH HOH A . 
P 7 HOH 50  2050 2050 HOH HOH A . 
P 7 HOH 51  2051 2051 HOH HOH A . 
P 7 HOH 52  2052 2052 HOH HOH A . 
P 7 HOH 53  2053 2053 HOH HOH A . 
P 7 HOH 54  2054 2054 HOH HOH A . 
P 7 HOH 55  2055 2055 HOH HOH A . 
P 7 HOH 56  2056 2056 HOH HOH A . 
P 7 HOH 57  2057 2057 HOH HOH A . 
P 7 HOH 58  2058 2058 HOH HOH A . 
P 7 HOH 59  2059 2059 HOH HOH A . 
P 7 HOH 60  2060 2060 HOH HOH A . 
P 7 HOH 61  2061 2061 HOH HOH A . 
P 7 HOH 62  2062 2062 HOH HOH A . 
P 7 HOH 63  2063 2063 HOH HOH A . 
P 7 HOH 64  2064 2064 HOH HOH A . 
P 7 HOH 65  2065 2065 HOH HOH A . 
P 7 HOH 66  2066 2066 HOH HOH A . 
P 7 HOH 67  2067 2067 HOH HOH A . 
P 7 HOH 68  2068 2068 HOH HOH A . 
P 7 HOH 69  2069 2069 HOH HOH A . 
P 7 HOH 70  2070 2070 HOH HOH A . 
P 7 HOH 71  2071 2071 HOH HOH A . 
P 7 HOH 72  2072 2072 HOH HOH A . 
P 7 HOH 73  2073 2073 HOH HOH A . 
P 7 HOH 74  2074 2074 HOH HOH A . 
P 7 HOH 75  2075 2075 HOH HOH A . 
P 7 HOH 76  2076 2076 HOH HOH A . 
P 7 HOH 77  2077 2077 HOH HOH A . 
P 7 HOH 78  2078 2078 HOH HOH A . 
P 7 HOH 79  2079 2079 HOH HOH A . 
P 7 HOH 80  2080 2080 HOH HOH A . 
P 7 HOH 81  2081 2081 HOH HOH A . 
P 7 HOH 82  2082 2082 HOH HOH A . 
P 7 HOH 83  2083 2083 HOH HOH A . 
P 7 HOH 84  2084 2084 HOH HOH A . 
P 7 HOH 85  2085 2085 HOH HOH A . 
P 7 HOH 86  2086 2086 HOH HOH A . 
P 7 HOH 87  2087 2087 HOH HOH A . 
P 7 HOH 88  2088 2088 HOH HOH A . 
P 7 HOH 89  2089 2089 HOH HOH A . 
P 7 HOH 90  2090 2090 HOH HOH A . 
P 7 HOH 91  2091 2091 HOH HOH A . 
P 7 HOH 92  2092 2092 HOH HOH A . 
P 7 HOH 93  2093 2093 HOH HOH A . 
P 7 HOH 94  2094 2094 HOH HOH A . 
P 7 HOH 95  2095 2095 HOH HOH A . 
P 7 HOH 96  2096 2096 HOH HOH A . 
P 7 HOH 97  2097 2097 HOH HOH A . 
P 7 HOH 98  2098 2098 HOH HOH A . 
P 7 HOH 99  2099 2099 HOH HOH A . 
P 7 HOH 100 2100 2100 HOH HOH A . 
P 7 HOH 101 2101 2101 HOH HOH A . 
P 7 HOH 102 2102 2102 HOH HOH A . 
P 7 HOH 103 2103 2103 HOH HOH A . 
P 7 HOH 104 2104 2104 HOH HOH A . 
P 7 HOH 105 2105 2105 HOH HOH A . 
P 7 HOH 106 2106 2106 HOH HOH A . 
P 7 HOH 107 2107 2107 HOH HOH A . 
P 7 HOH 108 2108 2108 HOH HOH A . 
P 7 HOH 109 2109 2109 HOH HOH A . 
P 7 HOH 110 2110 2110 HOH HOH A . 
P 7 HOH 111 2111 2111 HOH HOH A . 
P 7 HOH 112 2112 2112 HOH HOH A . 
P 7 HOH 113 2113 2113 HOH HOH A . 
P 7 HOH 114 2114 2114 HOH HOH A . 
P 7 HOH 115 2115 2115 HOH HOH A . 
P 7 HOH 116 2116 2116 HOH HOH A . 
P 7 HOH 117 2117 2117 HOH HOH A . 
P 7 HOH 118 2118 2118 HOH HOH A . 
P 7 HOH 119 2119 2119 HOH HOH A . 
P 7 HOH 120 2120 2120 HOH HOH A . 
P 7 HOH 121 2121 2121 HOH HOH A . 
P 7 HOH 122 2122 2122 HOH HOH A . 
P 7 HOH 123 2123 2123 HOH HOH A . 
P 7 HOH 124 2124 2124 HOH HOH A . 
P 7 HOH 125 2125 2125 HOH HOH A . 
P 7 HOH 126 2126 2126 HOH HOH A . 
P 7 HOH 127 2127 2127 HOH HOH A . 
P 7 HOH 128 2128 2128 HOH HOH A . 
P 7 HOH 129 2129 2129 HOH HOH A . 
P 7 HOH 130 2130 2130 HOH HOH A . 
P 7 HOH 131 2131 2131 HOH HOH A . 
P 7 HOH 132 2132 2132 HOH HOH A . 
P 7 HOH 133 2133 2133 HOH HOH A . 
P 7 HOH 134 2134 2134 HOH HOH A . 
P 7 HOH 135 2135 2135 HOH HOH A . 
P 7 HOH 136 2136 2136 HOH HOH A . 
P 7 HOH 137 2137 2137 HOH HOH A . 
P 7 HOH 138 2138 2138 HOH HOH A . 
P 7 HOH 139 2139 2139 HOH HOH A . 
P 7 HOH 140 2140 2140 HOH HOH A . 
P 7 HOH 141 2141 2141 HOH HOH A . 
P 7 HOH 142 2142 2142 HOH HOH A . 
P 7 HOH 143 2143 2143 HOH HOH A . 
P 7 HOH 144 2144 2144 HOH HOH A . 
P 7 HOH 145 2145 2145 HOH HOH A . 
P 7 HOH 146 2146 2146 HOH HOH A . 
P 7 HOH 147 2147 2147 HOH HOH A . 
P 7 HOH 148 2148 2148 HOH HOH A . 
P 7 HOH 149 2149 2149 HOH HOH A . 
P 7 HOH 150 2150 2150 HOH HOH A . 
P 7 HOH 151 2151 2151 HOH HOH A . 
P 7 HOH 152 2152 2152 HOH HOH A . 
P 7 HOH 153 2153 2153 HOH HOH A . 
P 7 HOH 154 2154 2154 HOH HOH A . 
P 7 HOH 155 2155 2155 HOH HOH A . 
P 7 HOH 156 2156 2156 HOH HOH A . 
P 7 HOH 157 2157 2157 HOH HOH A . 
P 7 HOH 158 2158 2158 HOH HOH A . 
P 7 HOH 159 2159 2159 HOH HOH A . 
P 7 HOH 160 2160 2160 HOH HOH A . 
P 7 HOH 161 2161 2161 HOH HOH A . 
P 7 HOH 162 2162 2162 HOH HOH A . 
P 7 HOH 163 2163 2163 HOH HOH A . 
P 7 HOH 164 2164 2164 HOH HOH A . 
P 7 HOH 165 2165 2165 HOH HOH A . 
P 7 HOH 166 2166 2166 HOH HOH A . 
P 7 HOH 167 2167 2167 HOH HOH A . 
P 7 HOH 168 2168 2168 HOH HOH A . 
P 7 HOH 169 2169 2169 HOH HOH A . 
P 7 HOH 170 2170 2170 HOH HOH A . 
P 7 HOH 171 2171 2171 HOH HOH A . 
P 7 HOH 172 2172 2172 HOH HOH A . 
P 7 HOH 173 2173 2173 HOH HOH A . 
P 7 HOH 174 2174 2174 HOH HOH A . 
P 7 HOH 175 2175 2175 HOH HOH A . 
P 7 HOH 176 2176 2176 HOH HOH A . 
P 7 HOH 177 2177 2177 HOH HOH A . 
P 7 HOH 178 2178 2178 HOH HOH A . 
P 7 HOH 179 2179 2179 HOH HOH A . 
P 7 HOH 180 2180 2180 HOH HOH A . 
P 7 HOH 181 2181 2181 HOH HOH A . 
P 7 HOH 182 2182 2182 HOH HOH A . 
P 7 HOH 183 2183 2183 HOH HOH A . 
P 7 HOH 184 2184 2184 HOH HOH A . 
P 7 HOH 185 2185 2185 HOH HOH A . 
P 7 HOH 186 2186 2186 HOH HOH A . 
P 7 HOH 187 2187 2187 HOH HOH A . 
P 7 HOH 188 2188 2188 HOH HOH A . 
P 7 HOH 189 2189 2189 HOH HOH A . 
P 7 HOH 190 2190 2190 HOH HOH A . 
P 7 HOH 191 2191 2191 HOH HOH A . 
P 7 HOH 192 2192 2192 HOH HOH A . 
P 7 HOH 193 2193 2193 HOH HOH A . 
P 7 HOH 194 2194 2194 HOH HOH A . 
P 7 HOH 195 2195 2195 HOH HOH A . 
P 7 HOH 196 2196 2196 HOH HOH A . 
P 7 HOH 197 2197 2197 HOH HOH A . 
P 7 HOH 198 2198 2198 HOH HOH A . 
P 7 HOH 199 2199 2199 HOH HOH A . 
P 7 HOH 200 2200 2200 HOH HOH A . 
P 7 HOH 201 2201 2201 HOH HOH A . 
P 7 HOH 202 2202 2202 HOH HOH A . 
P 7 HOH 203 2203 2203 HOH HOH A . 
P 7 HOH 204 2204 2204 HOH HOH A . 
P 7 HOH 205 2205 2205 HOH HOH A . 
P 7 HOH 206 2206 2206 HOH HOH A . 
P 7 HOH 207 2207 2207 HOH HOH A . 
P 7 HOH 208 2208 2208 HOH HOH A . 
P 7 HOH 209 2209 2209 HOH HOH A . 
P 7 HOH 210 2210 2210 HOH HOH A . 
P 7 HOH 211 2211 2211 HOH HOH A . 
P 7 HOH 212 2212 2212 HOH HOH A . 
P 7 HOH 213 2213 2213 HOH HOH A . 
P 7 HOH 214 2214 2214 HOH HOH A . 
P 7 HOH 215 2215 2215 HOH HOH A . 
Q 7 HOH 1   2001 2001 HOH HOH C . 
Q 7 HOH 2   2002 2002 HOH HOH C . 
Q 7 HOH 3   2003 2003 HOH HOH C . 
Q 7 HOH 4   2004 2004 HOH HOH C . 
Q 7 HOH 5   2005 2005 HOH HOH C . 
Q 7 HOH 6   2006 2006 HOH HOH C . 
Q 7 HOH 7   2007 2007 HOH HOH C . 
Q 7 HOH 8   2008 2008 HOH HOH C . 
Q 7 HOH 9   2009 2009 HOH HOH C . 
R 7 HOH 1   2001 2001 HOH HOH D . 
R 7 HOH 2   2002 2002 HOH HOH D . 
R 7 HOH 3   2003 2003 HOH HOH D . 
R 7 HOH 4   2004 2004 HOH HOH D . 
R 7 HOH 5   2005 2005 HOH HOH D . 
R 7 HOH 6   2006 2006 HOH HOH D . 
R 7 HOH 7   2007 2007 HOH HOH D . 
R 7 HOH 8   2008 2008 HOH HOH D . 
R 7 HOH 9   2009 2009 HOH HOH D . 
R 7 HOH 10  2010 2010 HOH HOH D . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    5CM 
_pdbx_struct_mod_residue.label_seq_id     7 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     5CM 
_pdbx_struct_mod_residue.auth_seq_id      407 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7290  ? 
1 MORE         -74.3 ? 
1 'SSA (A^2)'  16030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2116 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   P 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-27 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-24 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Source and taxonomy'       
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen      
2 4 'Structure model' pdbx_entity_src_syn 
3 5 'Structure model' diffrn_source       
4 5 'Structure model' struct_conn         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 
2 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'          
3 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2UYC 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, ARG 163 TO ASN' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'MUTATION R163N' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2034 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2035 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.05 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             422 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             422 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.523 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.084 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 37  ? ? -173.06 143.50 
2 1 ASP A 60  ? ? -1.99   101.74 
3 1 ALA A 77  ? ? -160.68 104.00 
4 1 ASP A 144 ? ? 76.25   40.07  
5 1 ASN A 163 ? ? -40.96  109.59 
6 1 PHE A 259 ? ? -109.62 42.35  
7 1 LYS A 261 ? ? 63.13   -6.28  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG D 422 ? ? 0.050 'SIDE CHAIN' 
2 1 DC D 432 ? ? 0.071 'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2UYC 'double helix'        
2UYC 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG  2  1_555 C DC 12 1_555 -0.394 -0.215 -0.493 -9.302 7.579   -3.943  1  C_DG402:DC433_D  C 402 ? D 433 ? 19 1 
1 B DG  3  1_555 C DC 11 1_555 -0.268 -0.193 -0.190 3.560  -7.987  -0.948  2  C_DG403:DC432_D  C 403 ? D 432 ? 19 1 
1 B DA  4  1_555 C DT 10 1_555 -0.076 -0.005 -0.166 -3.937 -11.021 -2.451  3  C_DA404:DT431_D  C 404 ? D 431 ? 20 1 
1 B DT  5  1_555 C DA 9  1_555 -0.550 0.403  -0.667 10.716 -3.882  -17.649 4  C_DT405:DA430_D  C 405 ? D 430 ? 20 1 
1 B DG  6  1_555 C DC 8  1_555 -0.106 -0.113 0.043  12.408 1.631   -9.895  5  C_DG406:DC429_D  C 406 ? D 429 ? 19 1 
1 B 5CM 7  1_555 C DG 7  1_555 -0.015 -0.126 -0.161 8.572  -3.767  -4.048  6  C_5CM407:DG428_D C 407 ? D 428 ? 19 1 
1 B DC  9  1_555 C DG 5  1_555 0.229  0.010  -0.062 0.199  -2.200  0.508   7  C_DC409:DG426_D  C 409 ? D 426 ? 19 1 
1 B DT  10 1_555 C DA 4  1_555 -0.102 -0.039 0.136  4.311  -7.585  -0.947  8  C_DT410:DA425_D  C 410 ? D 425 ? 20 1 
1 B DG  11 1_555 C DC 3  1_555 -0.336 -0.183 -0.242 2.608  -1.821  0.408   9  C_DG411:DC424_D  C 411 ? D 424 ? 19 1 
1 B DA  12 1_555 C DT 2  1_555 -0.233 -0.284 -0.205 11.738 -5.309  0.124   10 C_DA412:DT423_D  C 412 ? D 423 ? 20 1 
1 B DC  13 1_555 C DG 1  1_555 0.828  -0.628 -0.290 6.482  -13.122 -1.262  11 C_DC413:DG422_D  C 413 ? D 422 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG  2  1_555 C DC 12 1_555 B DG  3  1_555 C DC 11 1_555 -0.451 -0.549 3.204 -0.451 3.721  34.189 -1.493 0.695  3.134 6.306   
0.765  34.388 1  CC_DG402DG403:DC432DC433_DD  C 402 ? D 433 ? C 403 ? D 432 ? 
1 B DG  3  1_555 C DC 11 1_555 B DA  4  1_555 C DT 10 1_555 0.249  -0.597 3.432 3.048  2.758  35.246 -1.403 0.059  3.386 4.536   
-5.013 35.477 2  CC_DG403DA404:DT431DC432_DD  C 403 ? D 432 ? C 404 ? D 431 ? 
1 B DA  4  1_555 C DT 10 1_555 B DT  5  1_555 C DA 9  1_555 -0.652 -0.557 3.006 3.887  3.095  25.427 -2.010 2.417  2.790 6.946   
-8.725 25.900 3  CC_DA404DT405:DA430DT431_DD  C 404 ? D 431 ? C 405 ? D 430 ? 
1 B DT  5  1_555 C DA 9  1_555 B DG  6  1_555 C DC 8  1_555 -0.015 0.352  3.287 -7.460 2.418  39.991 0.235  -0.811 3.253 3.496   
10.782 40.721 4  CC_DT405DG406:DC429DA430_DD  C 405 ? D 430 ? C 406 ? D 429 ? 
1 B DG  6  1_555 C DC 8  1_555 B 5CM 7  1_555 C DG 7  1_555 1.033  -1.257 3.661 2.125  -7.512 34.390 -0.770 -1.337 3.896 -12.506 
-3.538 35.239 5  CC_DG4065CM407:DG428DC429_DD C 406 ? D 429 ? C 407 ? D 428 ? 
1 B 5CM 7  1_555 C DG 7  1_555 B DC  9  1_555 C DG 5  1_555 -0.749 0.451  7.415 3.918  -0.299 53.733 0.540  1.376  7.345 -0.330  
-4.329 53.866 6  CC_5CM407DC409:DG426DG428_DD C 407 ? D 428 ? C 409 ? D 426 ? 
1 B DC  9  1_555 C DG 5  1_555 B DT  10 1_555 C DA 4  1_555 -0.228 0.020  3.297 -0.722 2.875  37.461 -0.347 0.260  3.293 4.468   
1.122  37.574 7  CC_DC409DT410:DA425DG426_DD  C 409 ? D 426 ? C 410 ? D 425 ? 
1 B DT  10 1_555 C DA 4  1_555 B DG  11 1_555 C DC 3  1_555 0.188  0.346  3.416 3.562  1.797  36.270 0.292  0.217  3.431 2.876   
-5.701 36.482 8  CC_DT410DG411:DC424DA425_DD  C 410 ? D 425 ? C 411 ? D 424 ? 
1 B DG  11 1_555 C DC 3  1_555 B DA  12 1_555 C DT 2  1_555 -0.435 -0.243 3.101 -3.885 9.659  25.881 -2.690 0.025  2.862 20.538  
8.261  27.864 9  CC_DG411DA412:DT423DC424_DD  C 411 ? D 424 ? C 412 ? D 423 ? 
1 B DA  12 1_555 C DT 2  1_555 B DC  13 1_555 C DG 1  1_555 0.581  -0.979 3.418 -1.820 2.167  36.092 -1.890 -1.199 3.323 3.490   
2.932  36.199 10 CC_DA412DC413:DG422DT423_DD  C 412 ? D 423 ? C 413 ? D 422 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 S-ADENOSYL-L-HOMOCYSTEINE SAH 
5 'SULFATE ION'             SO4 
6 GLYCEROL                  GOL 
7 water                     HOH 
#