data_2UZC
# 
_entry.id   2UZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2UZC         
PDBE  EBI-32377    
WWPDB D_1290032377 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2UYY 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'STRUCTURE OF THE CYTOKINE-LIKE NUCLEAR FACTOR N-PAC' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2UZC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bunkoczi, G.'      1  ? 
'Elkins, J.'        2  ? 
'Salah, E.'         3  ? 
'Burgess-Brown, N.' 4  ? 
'Papagrigoriou, E.' 5  ? 
'Pike, A.C.W.'      6  ? 
'Turnbull, A.'      7  ? 
'Gileadi, O.'       8  ? 
'von Delft, F.'     9  ? 
'Arrowsmith, C.H.'  10 ? 
'Edwards, A.'       11 ? 
'Sundstrom, M.'     12 ? 
'Weigelt, J.'       13 ? 
'Doyle, D.'         14 ? 
# 
_citation.id                        primary 
_citation.title                     
'Unusual binding interactions in PDZ domain crystal structures help explain binding mechanisms.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            19 
_citation.page_first                731 
_citation.page_last                 741 
_citation.year                      2010 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20120020 
_citation.pdbx_database_id_DOI      10.1002/pro.349 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Elkins, J.M.' 1 
primary 'Gileadi, C.'  2 
primary 'Shrestha, L.' 3 
primary 'Phillips, C.' 4 
primary 'Wang, J.'     5 
primary 'Muniz, J.R.'  6 
primary 'Doyle, D.A.'  7 
# 
_cell.entry_id           2UZC 
_cell.length_a           61.250 
_cell.length_b           36.474 
_cell.length_c           88.706 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.15 
_cell.angle_gamma        90.00 
_cell.Z_PDB              10 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2UZC 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PDZ AND LIM DOMAIN 5' 9317.584 5   ? ? 'RESIDUES 1-83' ? 
2 non-polymer syn 'CHLORIDE ION'         35.453   6   ? ? ?               ? 
3 non-polymer syn 1,2-ETHANEDIOL         62.068   2   ? ? ?               ? 
4 water       nat water                  18.015   460 ? ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN PDLIM5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNM
TLQRESDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNM
TLQRESDL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  SER n 
1 4  ASN n 
1 5  TYR n 
1 6  SER n 
1 7  VAL n 
1 8  SER n 
1 9  LEU n 
1 10 VAL n 
1 11 GLY n 
1 12 PRO n 
1 13 ALA n 
1 14 PRO n 
1 15 TRP n 
1 16 GLY n 
1 17 PHE n 
1 18 ARG n 
1 19 LEU n 
1 20 GLN n 
1 21 GLY n 
1 22 GLY n 
1 23 LYS n 
1 24 ASP n 
1 25 PHE n 
1 26 ASN n 
1 27 MET n 
1 28 PRO n 
1 29 LEU n 
1 30 THR n 
1 31 ILE n 
1 32 SER n 
1 33 SER n 
1 34 LEU n 
1 35 LYS n 
1 36 ASP n 
1 37 GLY n 
1 38 GLY n 
1 39 LYS n 
1 40 ALA n 
1 41 ALA n 
1 42 GLN n 
1 43 ALA n 
1 44 ASN n 
1 45 VAL n 
1 46 ARG n 
1 47 ILE n 
1 48 GLY n 
1 49 ASP n 
1 50 VAL n 
1 51 VAL n 
1 52 LEU n 
1 53 SER n 
1 54 ILE n 
1 55 ASP n 
1 56 GLY n 
1 57 ILE n 
1 58 ASN n 
1 59 ALA n 
1 60 GLN n 
1 61 GLY n 
1 62 MET n 
1 63 THR n 
1 64 HIS n 
1 65 LEU n 
1 66 GLU n 
1 67 ALA n 
1 68 GLN n 
1 69 ASN n 
1 70 LYS n 
1 71 ILE n 
1 72 LYS n 
1 73 GLY n 
1 74 CYS n 
1 75 THR n 
1 76 GLY n 
1 77 SER n 
1 78 LEU n 
1 79 ASN n 
1 80 MET n 
1 81 THR n 
1 82 LEU n 
1 83 GLN n 
1 84 ARG n 
1 85 GLU n 
1 86 SER n 
1 87 ASP n 
1 88 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              R3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2UZC         1 ? ? 2UZC   ? 
2 UNP Q8WVK0_HUMAN 1 ? ? Q8WVK0 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2UZC A 1  ? 1  ? 2UZC   0  ? 0  ? 0  0  
2  2 2UZC A 2  ? 84 ? Q8WVK0 1  ? 83 ? 1  83 
3  1 2UZC A 85 ? 88 ? 2UZC   84 ? 87 ? 84 87 
4  1 2UZC B 1  ? 1  ? 2UZC   0  ? 0  ? 0  0  
5  2 2UZC B 2  ? 84 ? Q8WVK0 1  ? 83 ? 1  83 
6  1 2UZC B 85 ? 88 ? 2UZC   84 ? 87 ? 84 87 
7  1 2UZC C 1  ? 1  ? 2UZC   0  ? 0  ? 0  0  
8  2 2UZC C 2  ? 84 ? Q8WVK0 1  ? 83 ? 1  83 
9  1 2UZC C 85 ? 88 ? 2UZC   84 ? 87 ? 84 87 
10 1 2UZC D 1  ? 1  ? 2UZC   0  ? 0  ? 0  0  
11 2 2UZC D 2  ? 84 ? Q8WVK0 1  ? 83 ? 1  83 
12 1 2UZC D 85 ? 88 ? 2UZC   84 ? 87 ? 84 87 
13 1 2UZC E 1  ? 1  ? 2UZC   0  ? 0  ? 0  0  
14 2 2UZC E 2  ? 84 ? Q8WVK0 1  ? 83 ? 1  83 
15 1 2UZC E 85 ? 88 ? 2UZC   84 ? 87 ? 84 87 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2UZC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350 0.20 M KSCN' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-03-03 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9537 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.9537 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2UZC 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.400 
_reflns.d_resolution_high            1.500 
_reflns.number_obs                   49917 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         79.7 
_reflns.pdbx_Rmerge_I_obs            0.04000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.690 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.60 
_reflns_shell.percent_possible_all   37.0 
_reflns_shell.Rmerge_I_obs           0.38000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.980 
_reflns_shell.pdbx_redundancy        0.83 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2UZC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     47380 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    79.8 
_refine.ls_R_factor_obs                          0.166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.163 
_refine.ls_R_factor_R_free                       0.215 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2527 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.970 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               16.84 
_refine.aniso_B[1][1]                            -0.97000 
_refine.aniso_B[2][2]                            0.72000 
_refine.aniso_B[3][3]                            0.07000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.56000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PKT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.092 
_refine.pdbx_overall_ESU_R_Free                  0.100 
_refine.overall_SU_ML                            0.062 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.312 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3188 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             460 
_refine_hist.number_atoms_total               3662 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 3346 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2235 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.480  1.964  ? 4523 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.930  3.000  ? 5519 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.810  5.000  ? 437  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.926 25.786 ? 140  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.659 15.000 ? 591  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.015 15.000 ? 17   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.084  0.200  ? 526  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 3754 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 594  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.204  0.200  ? 627  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.194  0.200  ? 2313 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.168  0.200  ? 1572 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.086  0.200  ? 1874 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.171  0.200  ? 310  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.186  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.254  0.200  ? 91   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.206  0.200  ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.169  3.000  ? 2257 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.200  5.000  ? 3499 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.178  8.000  ? 1236 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.097  11.000 ? 1023 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.54 
_refine_ls_shell.number_reflns_R_work             1339 
_refine_ls_shell.R_factor_R_work                  0.2510 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3400 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.717310 -0.645400 -0.262540 0.598100  -0.763650 0.243140  -0.357410 0.017380  0.933780  20.21770  -15.04690 22.95777 
2 given ? -0.194370 0.980720  0.020220  0.972180  0.189850  0.137170  0.130680  0.046320  -0.990340 -13.56198 -36.80161 32.61575 
3 given ? 0.349880  0.922980  -0.160260 -0.910940 0.295300  -0.288090 -0.218570 0.246780  0.944100  6.85790   12.03168  39.62221 
4 given ? 0.679220  -0.658640 0.323810  -0.681850 -0.729530 -0.053650 0.271570  -0.184350 -0.944600 -31.24924 -15.49909 12.26183 
# 
_struct.entry_id                  2UZC 
_struct.title                     'Structure of human PDLIM5 in complex with the C-terminal peptide of human alpha-actinin-1' 
_struct.pdbx_descriptor           'PDZ AND LIM DOMAIN 5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2UZC 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'METAL-BINDING, ENIGMA HOMOLOG, PHOSPHORYLATION, SIGNALING PROTEIN, LIM DOMAIN, PDZ DOMAIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 2 ? 
M N N 2 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 23 ? ASN A 26 ? LYS A 22 ASN A 25 5 ? 4  
HELX_P HELX_P2  2  GLY A 38 ? ALA A 43 ? GLY A 37 ALA A 42 1 ? 6  
HELX_P HELX_P3  3  THR A 63 ? GLY A 73 ? THR A 62 GLY A 72 1 ? 11 
HELX_P HELX_P4  4  LYS B 23 ? ASN B 26 ? LYS B 22 ASN B 25 5 ? 4  
HELX_P HELX_P5  5  GLY B 38 ? ALA B 43 ? GLY B 37 ALA B 42 1 ? 6  
HELX_P HELX_P6  6  THR B 63 ? CYS B 74 ? THR B 62 CYS B 73 1 ? 12 
HELX_P HELX_P7  7  GLY C 38 ? ALA C 43 ? GLY C 37 ALA C 42 1 ? 6  
HELX_P HELX_P8  8  THR C 63 ? GLY C 73 ? THR C 62 GLY C 72 1 ? 11 
HELX_P HELX_P9  9  LYS D 23 ? ASN D 26 ? LYS D 22 ASN D 25 5 ? 4  
HELX_P HELX_P10 10 GLY D 38 ? ALA D 43 ? GLY D 37 ALA D 42 1 ? 6  
HELX_P HELX_P11 11 THR D 63 ? CYS D 74 ? THR D 62 CYS D 73 1 ? 12 
HELX_P HELX_P12 12 GLY E 38 ? ALA E 43 ? GLY E 37 ALA E 42 1 ? 6  
HELX_P HELX_P13 13 THR E 63 ? GLY E 73 ? THR E 62 GLY E 72 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 11 A . ? GLY 10 A PRO 12 A ? PRO 11 A 1 5.84  
2  ALA 13 A . ? ALA 12 A PRO 14 A ? PRO 13 A 1 1.58  
3  GLY 11 B . ? GLY 10 B PRO 12 B ? PRO 11 B 1 2.71  
4  ALA 13 B . ? ALA 12 B PRO 14 B ? PRO 13 B 1 0.45  
5  GLY 11 C . ? GLY 10 C PRO 12 C ? PRO 11 C 1 -0.23 
6  ALA 13 C . ? ALA 12 C PRO 14 C ? PRO 13 C 1 6.68  
7  GLY 11 D . ? GLY 10 D PRO 12 D ? PRO 11 D 1 3.55  
8  ALA 13 D . ? ALA 12 D PRO 14 D ? PRO 13 D 1 6.67  
9  GLY 11 E . ? GLY 10 E PRO 12 E ? PRO 11 E 1 8.49  
10 ALA 13 E . ? ALA 12 E PRO 14 E ? PRO 13 E 1 4.42  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
BA ? 4 ? 
BB ? 2 ? 
CA ? 4 ? 
CB ? 2 ? 
DA ? 4 ? 
DB ? 2 ? 
EA ? 4 ? 
EB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ASN A 4  ? VAL A 10 ? ASN A 3  VAL A 9  
AA 2 SER A 77 ? GLN A 83 ? SER A 76 GLN A 82 
AA 3 VAL A 50 ? ILE A 54 ? VAL A 49 ILE A 53 
AA 4 ILE A 57 ? ASN A 58 ? ILE A 56 ASN A 57 
AB 1 PHE A 17 ? GLY A 22 ? PHE A 16 GLY A 21 
AB 2 MET A 27 ? LEU A 34 ? MET A 26 LEU A 33 
BA 1 ASN B 4  ? VAL B 10 ? ASN B 3  VAL B 9  
BA 2 SER B 77 ? GLN B 83 ? SER B 76 GLN B 82 
BA 3 VAL B 50 ? ILE B 54 ? VAL B 49 ILE B 53 
BA 4 ILE B 57 ? ASN B 58 ? ILE B 56 ASN B 57 
BB 1 PHE B 17 ? GLY B 22 ? PHE B 16 GLY B 21 
BB 2 MET B 27 ? LEU B 34 ? MET B 26 LEU B 33 
CA 1 ASN C 4  ? LEU C 9  ? ASN C 3  LEU C 8  
CA 2 LEU C 78 ? GLN C 83 ? LEU C 77 GLN C 82 
CA 3 VAL C 50 ? ILE C 54 ? VAL C 49 ILE C 53 
CA 4 ILE C 57 ? ASN C 58 ? ILE C 56 ASN C 57 
CB 1 PHE C 17 ? GLN C 20 ? PHE C 16 GLN C 19 
CB 2 THR C 30 ? LEU C 34 ? THR C 29 LEU C 33 
DA 1 TYR D 5  ? VAL D 10 ? TYR D 4  VAL D 9  
DA 2 SER D 77 ? GLN D 83 ? SER D 76 GLN D 82 
DA 3 VAL D 50 ? ILE D 54 ? VAL D 49 ILE D 53 
DA 4 ILE D 57 ? ASN D 58 ? ILE D 56 ASN D 57 
DB 1 PHE D 17 ? GLY D 22 ? PHE D 16 GLY D 21 
DB 2 MET D 27 ? LEU D 34 ? MET D 26 LEU D 33 
EA 1 ASN E 4  ? VAL E 10 ? ASN E 3  VAL E 9  
EA 2 SER E 77 ? GLN E 83 ? SER E 76 GLN E 82 
EA 3 VAL E 50 ? ILE E 54 ? VAL E 49 ILE E 53 
EA 4 ILE E 57 ? ASN E 58 ? ILE E 56 ASN E 57 
EB 1 PHE E 17 ? GLN E 20 ? PHE E 16 GLN E 19 
EB 2 THR E 30 ? LEU E 34 ? THR E 29 LEU E 33 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 9  ? N LEU A 8  O LEU A 78 ? O LEU A 77 
AA 2 3 N GLN A 83 ? N GLN A 82 O VAL A 50 ? O VAL A 49 
AA 3 4 N ILE A 54 ? N ILE A 53 O ILE A 57 ? O ILE A 56 
AB 1 2 N GLY A 22 ? N GLY A 21 O MET A 27 ? O MET A 26 
BA 1 2 N LEU B 9  ? N LEU B 8  O LEU B 78 ? O LEU B 77 
BA 2 3 N GLN B 83 ? N GLN B 82 O VAL B 50 ? O VAL B 49 
BA 3 4 N ILE B 54 ? N ILE B 53 O ILE B 57 ? O ILE B 56 
BB 1 2 N GLY B 22 ? N GLY B 21 O MET B 27 ? O MET B 26 
CA 1 2 N LEU C 9  ? N LEU C 8  O LEU C 78 ? O LEU C 77 
CA 2 3 N GLN C 83 ? N GLN C 82 O VAL C 50 ? O VAL C 49 
CA 3 4 N ILE C 54 ? N ILE C 53 O ILE C 57 ? O ILE C 56 
CB 1 2 N GLN C 20 ? N GLN C 19 O THR C 30 ? O THR C 29 
DA 1 2 N LEU D 9  ? N LEU D 8  O LEU D 78 ? O LEU D 77 
DA 2 3 N GLN D 83 ? N GLN D 82 O VAL D 50 ? O VAL D 49 
DA 3 4 N ILE D 54 ? N ILE D 53 O ILE D 57 ? O ILE D 56 
DB 1 2 N GLY D 22 ? N GLY D 21 O MET D 27 ? O MET D 26 
EA 1 2 N LEU E 9  ? N LEU E 8  O LEU E 78 ? O LEU E 77 
EA 2 3 N GLN E 83 ? N GLN E 82 O VAL E 50 ? O VAL E 49 
EA 3 4 N ILE E 54 ? N ILE E 53 O ILE E 57 ? O ILE E 56 
EB 1 2 N GLN E 20 ? N GLN E 19 O THR E 30 ? O THR E 29 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 1088'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL C 1088'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL D 1088'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 1089'  
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL E 1088'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL E 1089'  
AC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO B 1089' 
AC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO D 1090' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ARG B 18 ? ARG B 17   . ? 1_555 ? 
2  AC1 3 SER B 32 ? SER B 31   . ? 1_555 ? 
3  AC1 3 HOH O .  ? HOH B 2019 . ? 1_555 ? 
4  AC2 4 ARG C 18 ? ARG C 17   . ? 1_555 ? 
5  AC2 4 GLN C 20 ? GLN C 19   . ? 1_555 ? 
6  AC2 4 SER C 32 ? SER C 31   . ? 1_555 ? 
7  AC2 4 HOH P .  ? HOH C 2045 . ? 1_555 ? 
8  AC3 6 SER D 53 ? SER D 52   . ? 1_555 ? 
9  AC3 6 ASP D 55 ? ASP D 54   . ? 1_555 ? 
10 AC3 6 GLY D 56 ? GLY D 55   . ? 1_555 ? 
11 AC3 6 ASN D 79 ? ASN D 78   . ? 1_555 ? 
12 AC3 6 MET D 80 ? MET D 79   . ? 1_555 ? 
13 AC3 6 HOH Q .  ? HOH D 2086 . ? 1_555 ? 
14 AC4 4 LEU D 9  ? LEU D 8    . ? 1_555 ? 
15 AC4 4 VAL D 10 ? VAL D 9    . ? 1_555 ? 
16 AC4 4 HOH Q .  ? HOH D 2046 . ? 1_555 ? 
17 AC4 4 HOH Q .  ? HOH D 2047 . ? 1_555 ? 
18 AC5 3 ARG E 18 ? ARG E 17   . ? 1_555 ? 
19 AC5 3 GLN E 20 ? GLN E 19   . ? 1_555 ? 
20 AC5 3 SER E 32 ? SER E 31   . ? 1_555 ? 
21 AC6 4 SER E 53 ? SER E 52   . ? 1_555 ? 
22 AC6 4 GLY E 56 ? GLY E 55   . ? 1_555 ? 
23 AC6 4 ASN E 79 ? ASN E 78   . ? 1_555 ? 
24 AC6 4 THR E 81 ? THR E 80   . ? 1_555 ? 
25 AC7 8 ASP A 87 ? ASP A 86   . ? 1_555 ? 
26 AC7 8 HOH N .  ? HOH A 2077 . ? 1_555 ? 
27 AC7 8 GLY B 16 ? GLY B 15   . ? 1_555 ? 
28 AC7 8 PHE B 17 ? PHE B 16   . ? 1_555 ? 
29 AC7 8 ARG B 18 ? ARG B 17   . ? 1_555 ? 
30 AC7 8 SER B 33 ? SER B 32   . ? 1_555 ? 
31 AC7 8 LEU B 34 ? LEU B 33   . ? 1_555 ? 
32 AC7 8 LYS B 35 ? LYS B 34   . ? 1_555 ? 
33 AC8 7 ASP B 87 ? ASP B 86   . ? 1_555 ? 
34 AC8 7 PHE D 17 ? PHE D 16   . ? 1_555 ? 
35 AC8 7 ARG D 18 ? ARG D 17   . ? 1_555 ? 
36 AC8 7 SER D 33 ? SER D 32   . ? 1_555 ? 
37 AC8 7 LYS D 35 ? LYS D 34   . ? 1_555 ? 
38 AC8 7 HOH Q .  ? HOH D 2104 . ? 1_555 ? 
39 AC8 7 HOH Q .  ? HOH D 2105 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2UZC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2UZC 
_atom_sites.fract_transf_matrix[1][1]   0.016327 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002630 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027417 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011418 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 2  ? -6.084  -1.873  6.526   1.00 48.99 ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 2  ? -4.654  -1.740  6.981   1.00 48.27 ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 2  ? -4.250  -0.268  7.269   1.00 44.10 ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 2  ? -5.017  0.656   6.990   1.00 47.41 ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 2  ? -3.710  -2.381  5.947   1.00 49.50 ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 2  ? -4.026  -3.861  5.637   1.00 43.63 ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 2  ? -2.777  -4.674  4.593   1.00 45.31 ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 2  ? -1.360  -4.649  5.708   1.00 36.40 ? 1    MET A CE  1 
ATOM   9    N  N   . SER A 1 3  ? -3.053  -0.064  7.827   1.00 34.88 ? 2    SER A N   1 
ATOM   10   C  CA  . SER A 1 3  ? -2.591  1.270   8.258   1.00 31.14 ? 2    SER A CA  1 
ATOM   11   C  C   . SER A 1 3  ? -1.513  1.887   7.342   1.00 27.64 ? 2    SER A C   1 
ATOM   12   O  O   . SER A 1 3  ? -0.381  1.414   7.227   1.00 28.44 ? 2    SER A O   1 
ATOM   13   C  CB  . SER A 1 3  ? -2.095  1.235   9.711   1.00 38.90 ? 2    SER A CB  1 
ATOM   14   O  OG  . SER A 1 3  ? -1.600  2.500   10.117  1.00 40.56 ? 2    SER A OG  1 
ATOM   15   N  N   . ASN A 1 4  ? -1.887  2.980   6.708   1.00 24.51 ? 3    ASN A N   1 
ATOM   16   C  CA  . ASN A 1 4  ? -1.038  3.651   5.750   1.00 24.92 ? 3    ASN A CA  1 
ATOM   17   C  C   . ASN A 1 4  ? -0.407  4.869   6.413   1.00 24.05 ? 3    ASN A C   1 
ATOM   18   O  O   . ASN A 1 4  ? -0.897  5.346   7.440   1.00 27.98 ? 3    ASN A O   1 
ATOM   19   C  CB  . ASN A 1 4  ? -1.851  4.094   4.538   1.00 24.15 ? 3    ASN A CB  1 
ATOM   20   C  CG  . ASN A 1 4  ? -2.402  2.920   3.721   1.00 28.35 ? 3    ASN A CG  1 
ATOM   21   O  OD1 . ASN A 1 4  ? -2.143  1.746   4.010   1.00 34.21 ? 3    ASN A OD1 1 
ATOM   22   N  ND2 . ASN A 1 4  ? -3.133  3.243   2.666   1.00 37.76 ? 3    ASN A ND2 1 
ATOM   23   N  N   . TYR A 1 5  ? 0.674   5.361   5.823   1.00 26.01 ? 4    TYR A N   1 
ATOM   24   C  CA  . TYR A 1 5  ? 1.270   6.622   6.231   1.00 16.49 ? 4    TYR A CA  1 
ATOM   25   C  C   . TYR A 1 5  ? 2.082   7.213   5.096   1.00 22.88 ? 4    TYR A C   1 
ATOM   26   O  O   . TYR A 1 5  ? 2.485   6.497   4.179   1.00 20.68 ? 4    TYR A O   1 
ATOM   27   C  CB  . TYR A 1 5  ? 2.148   6.416   7.473   1.00 21.64 ? 4    TYR A CB  1 
ATOM   28   C  CG  . TYR A 1 5  ? 3.439   5.637   7.230   1.00 20.32 ? 4    TYR A CG  1 
ATOM   29   C  CD1 . TYR A 1 5  ? 3.439   4.255   7.166   1.00 20.86 ? 4    TYR A CD1 1 
ATOM   30   C  CD2 . TYR A 1 5  ? 4.647   6.302   7.069   1.00 19.10 ? 4    TYR A CD2 1 
ATOM   31   C  CE1 . TYR A 1 5  ? 4.606   3.542   6.948   1.00 19.14 ? 4    TYR A CE1 1 
ATOM   32   C  CE2 . TYR A 1 5  ? 5.843   5.600   6.860   1.00 25.25 ? 4    TYR A CE2 1 
ATOM   33   C  CZ  . TYR A 1 5  ? 5.819   4.226   6.789   1.00 17.36 ? 4    TYR A CZ  1 
ATOM   34   O  OH  . TYR A 1 5  ? 6.992   3.510   6.562   1.00 22.67 ? 4    TYR A OH  1 
ATOM   35   N  N   . SER A 1 6  ? 2.312   8.518   5.161   1.00 22.51 ? 5    SER A N   1 
ATOM   36   C  CA  . SER A 1 6  ? 2.997   9.241   4.105   1.00 21.37 ? 5    SER A CA  1 
ATOM   37   C  C   . SER A 1 6  ? 4.238   9.933   4.635   1.00 25.28 ? 5    SER A C   1 
ATOM   38   O  O   . SER A 1 6  ? 4.240   10.417  5.766   1.00 23.13 ? 5    SER A O   1 
ATOM   39   C  CB  . SER A 1 6  ? 2.067   10.298  3.485   1.00 26.74 ? 5    SER A CB  1 
ATOM   40   O  OG  . SER A 1 6  ? 1.044   9.685   2.717   1.00 43.91 ? 5    SER A OG  1 
ATOM   41   N  N   . VAL A 1 7  ? 5.278   9.989   3.812   1.00 21.74 ? 6    VAL A N   1 
ATOM   42   C  CA  . VAL A 1 7  ? 6.505   10.705  4.142   1.00 22.51 ? 6    VAL A CA  1 
ATOM   43   C  C   . VAL A 1 7  ? 6.864   11.626  3.003   1.00 22.59 ? 6    VAL A C   1 
ATOM   44   O  O   . VAL A 1 7  ? 6.587   11.351  1.838   1.00 23.59 ? 6    VAL A O   1 
ATOM   45   C  CB  . VAL A 1 7  ? 7.708   9.762   4.416   1.00 25.79 ? 6    VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 7  ? 7.430   8.860   5.634   1.00 26.03 ? 6    VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 7  ? 8.078   8.957   3.151   1.00 25.61 ? 6    VAL A CG2 1 
ATOM   48   N  N   . SER A 1 8  ? 7.467   12.755  3.349   1.00 20.74 ? 7    SER A N   1 
ATOM   49   C  CA  . SER A 1 8  ? 7.963   13.684  2.352   1.00 22.45 ? 7    SER A CA  1 
ATOM   50   C  C   . SER A 1 8  ? 9.392   14.033  2.742   1.00 25.06 ? 7    SER A C   1 
ATOM   51   O  O   . SER A 1 8  ? 9.603   14.899  3.578   1.00 30.65 ? 7    SER A O   1 
ATOM   52   C  CB  . SER A 1 8  ? 7.090   14.940  2.279   1.00 22.94 ? 7    SER A CB  1 
ATOM   53   O  OG  . SER A 1 8  ? 7.511   15.755  1.198   1.00 32.31 ? 7    SER A OG  1 
ATOM   54   N  N   . LEU A 1 9  ? 10.365  13.336  2.155   1.00 26.22 ? 8    LEU A N   1 
ATOM   55   C  CA  . LEU A 1 9  ? 11.754  13.469  2.588   1.00 26.34 ? 8    LEU A CA  1 
ATOM   56   C  C   . LEU A 1 9  ? 12.357  14.640  1.862   1.00 26.61 ? 8    LEU A C   1 
ATOM   57   O  O   . LEU A 1 9  ? 12.230  14.746  0.642   1.00 24.42 ? 8    LEU A O   1 
ATOM   58   C  CB  . LEU A 1 9  ? 12.573  12.218  2.270   1.00 26.22 ? 8    LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 9  ? 12.001  10.904  2.782   1.00 22.69 ? 8    LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 9  ? 12.934  9.772   2.397   1.00 26.80 ? 8    LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 9  ? 11.750  10.947  4.310   1.00 23.33 ? 8    LEU A CD2 1 
ATOM   62   N  N   . VAL A 1 10 ? 13.038  15.501  2.609   1.00 31.70 ? 9    VAL A N   1 
ATOM   63   C  CA  . VAL A 1 10 ? 13.629  16.708  2.053   1.00 31.66 ? 9    VAL A CA  1 
ATOM   64   C  C   . VAL A 1 10 ? 14.992  16.380  1.475   1.00 27.13 ? 9    VAL A C   1 
ATOM   65   O  O   . VAL A 1 10 ? 15.900  15.945  2.191   1.00 30.37 ? 9    VAL A O   1 
ATOM   66   C  CB  . VAL A 1 10 ? 13.775  17.800  3.124   1.00 31.86 ? 9    VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 10 ? 14.539  19.002  2.571   1.00 30.42 ? 9    VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 10 ? 12.398  18.212  3.626   1.00 27.88 ? 9    VAL A CG2 1 
ATOM   69   N  N   . GLY A 1 11 ? 15.135  16.586  0.174   1.00 30.00 ? 10   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 11 ? 16.395  16.315  -0.494  1.00 27.87 ? 10   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 11 ? 17.557  17.132  0.066   1.00 30.50 ? 10   GLY A C   1 
ATOM   72   O  O   . GLY A 1 11 ? 17.358  18.018  0.917   1.00 35.10 ? 10   GLY A O   1 
ATOM   73   N  N   . PRO A 1 12 ? 18.784  16.851  -0.414  1.00 27.20 ? 11   PRO A N   1 
ATOM   74   C  CA  . PRO A 1 12 ? 19.073  15.920  -1.505  1.00 28.58 ? 11   PRO A CA  1 
ATOM   75   C  C   . PRO A 1 12 ? 19.202  14.442  -1.056  1.00 25.15 ? 11   PRO A C   1 
ATOM   76   O  O   . PRO A 1 12 ? 19.244  14.152  0.143   1.00 27.04 ? 11   PRO A O   1 
ATOM   77   C  CB  . PRO A 1 12 ? 20.415  16.450  -2.026  1.00 26.05 ? 11   PRO A CB  1 
ATOM   78   C  CG  . PRO A 1 12 ? 21.107  16.879  -0.788  1.00 29.70 ? 11   PRO A CG  1 
ATOM   79   C  CD  . PRO A 1 12 ? 20.025  17.443  0.122   1.00 28.21 ? 11   PRO A CD  1 
ATOM   80   N  N   . ALA A 1 13 ? 19.265  13.522  -2.017  1.00 23.37 ? 12   ALA A N   1 
ATOM   81   C  CA  . ALA A 1 13 ? 19.611  12.127  -1.734  1.00 31.66 ? 12   ALA A CA  1 
ATOM   82   C  C   . ALA A 1 13 ? 21.089  12.076  -1.301  1.00 29.86 ? 12   ALA A C   1 
ATOM   83   O  O   . ALA A 1 13 ? 21.809  13.071  -1.483  1.00 28.18 ? 12   ALA A O   1 
ATOM   84   C  CB  . ALA A 1 13 ? 19.358  11.247  -2.963  1.00 27.44 ? 12   ALA A CB  1 
ATOM   85   N  N   . PRO A 1 14 ? 21.557  10.942  -0.735  1.00 31.35 ? 13   PRO A N   1 
ATOM   86   C  CA  . PRO A 1 14 ? 20.855  9.680   -0.482  1.00 30.25 ? 13   PRO A CA  1 
ATOM   87   C  C   . PRO A 1 14 ? 19.659  9.802   0.453   1.00 29.22 ? 13   PRO A C   1 
ATOM   88   O  O   . PRO A 1 14 ? 19.624  10.667  1.337   1.00 27.59 ? 13   PRO A O   1 
ATOM   89   C  CB  . PRO A 1 14 ? 21.929  8.788   0.168   1.00 31.63 ? 13   PRO A CB  1 
ATOM   90   C  CG  . PRO A 1 14 ? 23.212  9.394   -0.188  1.00 36.50 ? 13   PRO A CG  1 
ATOM   91   C  CD  . PRO A 1 14 ? 22.957  10.863  -0.286  1.00 33.05 ? 13   PRO A CD  1 
ATOM   92   N  N   . TRP A 1 15 ? 18.679  8.928   0.225   1.00 24.15 ? 14   TRP A N   1 
ATOM   93   C  CA  . TRP A 1 15 ? 17.491  8.875   1.049   1.00 22.11 ? 14   TRP A CA  1 
ATOM   94   C  C   . TRP A 1 15 ? 17.706  7.922   2.209   1.00 21.30 ? 14   TRP A C   1 
ATOM   95   O  O   . TRP A 1 15 ? 16.972  7.985   3.195   1.00 21.77 ? 14   TRP A O   1 
ATOM   96   C  CB  . TRP A 1 15 ? 16.271  8.480   0.221   1.00 23.08 ? 14   TRP A CB  1 
ATOM   97   C  CG  . TRP A 1 15 ? 16.016  9.388   -0.959  1.00 19.87 ? 14   TRP A CG  1 
ATOM   98   C  CD1 . TRP A 1 15 ? 16.034  9.029   -2.270  1.00 27.50 ? 14   TRP A CD1 1 
ATOM   99   C  CD2 . TRP A 1 15 ? 15.687  10.790  -0.928  1.00 27.32 ? 14   TRP A CD2 1 
ATOM   100  N  NE1 . TRP A 1 15 ? 15.730  10.113  -3.062  1.00 24.18 ? 14   TRP A NE1 1 
ATOM   101  C  CE2 . TRP A 1 15 ? 15.512  11.205  -2.264  1.00 27.53 ? 14   TRP A CE2 1 
ATOM   102  C  CE3 . TRP A 1 15 ? 15.505  11.725  0.099   1.00 27.65 ? 14   TRP A CE3 1 
ATOM   103  C  CZ2 . TRP A 1 15 ? 15.178  12.532  -2.607  1.00 22.15 ? 14   TRP A CZ2 1 
ATOM   104  C  CZ3 . TRP A 1 15 ? 15.169  13.027  -0.238  1.00 31.02 ? 14   TRP A CZ3 1 
ATOM   105  C  CH2 . TRP A 1 15 ? 15.005  13.416  -1.588  1.00 29.12 ? 14   TRP A CH2 1 
ATOM   106  N  N   . GLY A 1 16 ? 18.684  7.022   2.089   1.00 20.79 ? 15   GLY A N   1 
ATOM   107  C  CA  . GLY A 1 16 ? 19.046  6.117   3.190   1.00 17.38 ? 15   GLY A CA  1 
ATOM   108  C  C   . GLY A 1 16 ? 18.173  4.888   3.348   1.00 16.41 ? 15   GLY A C   1 
ATOM   109  O  O   . GLY A 1 16 ? 17.776  4.549   4.451   1.00 22.72 ? 15   GLY A O   1 
ATOM   110  N  N   . PHE A 1 17 ? 17.846  4.243   2.239   1.00 17.52 ? 16   PHE A N   1 
ATOM   111  C  CA  . PHE A 1 17 ? 17.115  2.955   2.269   1.00 16.30 ? 16   PHE A CA  1 
ATOM   112  C  C   . PHE A 1 17 ? 17.377  2.101   1.046   1.00 19.82 ? 16   PHE A C   1 
ATOM   113  O  O   . PHE A 1 17 ? 17.972  2.578   0.053   1.00 21.96 ? 16   PHE A O   1 
ATOM   114  C  CB  . PHE A 1 17 ? 15.604  3.188   2.491   1.00 22.11 ? 16   PHE A CB  1 
ATOM   115  C  CG  . PHE A 1 17 ? 14.850  3.770   1.311   1.00 17.19 ? 16   PHE A CG  1 
ATOM   116  C  CD1 . PHE A 1 17 ? 14.127  2.922   0.441   1.00 18.91 ? 16   PHE A CD1 1 
ATOM   117  C  CD2 . PHE A 1 17 ? 14.784  5.164   1.100   1.00 17.64 ? 16   PHE A CD2 1 
ATOM   118  C  CE1 . PHE A 1 17 ? 13.381  3.475   -0.624  1.00 22.03 ? 16   PHE A CE1 1 
ATOM   119  C  CE2 . PHE A 1 17 ? 14.062  5.703   0.037   1.00 20.77 ? 16   PHE A CE2 1 
ATOM   120  C  CZ  . PHE A 1 17 ? 13.365  4.868   -0.818  1.00 19.18 ? 16   PHE A CZ  1 
ATOM   121  N  N   . ARG A 1 18 ? 16.996  0.829   1.175   1.00 20.14 ? 17   ARG A N   1 
ATOM   122  C  CA  . ARG A 1 18 ? 17.034  -0.133  0.091   1.00 19.45 ? 17   ARG A CA  1 
ATOM   123  C  C   . ARG A 1 18 ? 15.637  -0.746  -0.022  1.00 19.32 ? 17   ARG A C   1 
ATOM   124  O  O   . ARG A 1 18 ? 14.857  -0.713  0.950   1.00 21.19 ? 17   ARG A O   1 
ATOM   125  C  CB  . ARG A 1 18 ? 18.076  -1.226  0.317   1.00 23.92 ? 17   ARG A CB  1 
ATOM   126  C  CG  . ARG A 1 18 ? 19.503  -0.698  0.450   1.00 27.51 ? 17   ARG A CG  1 
ATOM   127  C  CD  . ARG A 1 18 ? 20.477  -1.833  0.654   1.00 28.52 ? 17   ARG A CD  1 
ATOM   128  N  NE  . ARG A 1 18 ? 20.356  -2.718  -0.472  1.00 27.97 ? 17   ARG A NE  1 
ATOM   129  C  CZ  . ARG A 1 18 ? 20.920  -2.528  -1.661  1.00 43.67 ? 17   ARG A CZ  1 
ATOM   130  N  NH1 . ARG A 1 18 ? 21.696  -1.488  -1.901  1.00 39.06 ? 17   ARG A NH1 1 
ATOM   131  N  NH2 . ARG A 1 18 ? 20.703  -3.405  -2.622  1.00 47.79 ? 17   ARG A NH2 1 
ATOM   132  N  N   . LEU A 1 19 ? 15.320  -1.272  -1.206  1.00 18.02 ? 18   LEU A N   1 
ATOM   133  C  CA  . LEU A 1 19 ? 14.069  -1.951  -1.482  1.00 19.33 ? 18   LEU A CA  1 
ATOM   134  C  C   . LEU A 1 19 ? 14.335  -3.407  -1.823  1.00 17.23 ? 18   LEU A C   1 
ATOM   135  O  O   . LEU A 1 19 ? 15.402  -3.735  -2.392  1.00 17.90 ? 18   LEU A O   1 
ATOM   136  C  CB  . LEU A 1 19 ? 13.354  -1.346  -2.698  1.00 16.26 ? 18   LEU A CB  1 
ATOM   137  C  CG  . LEU A 1 19 ? 12.761  0.050   -2.509  1.00 17.50 ? 18   LEU A CG  1 
ATOM   138  C  CD1 . LEU A 1 19 ? 12.282  0.626   -3.844  1.00 24.10 ? 18   LEU A CD1 1 
ATOM   139  C  CD2 . LEU A 1 19 ? 11.668  0.076   -1.428  1.00 25.50 ? 18   LEU A CD2 1 
ATOM   140  N  N   . GLN A 1 20 ? 13.367  -4.276  -1.505  1.00 21.87 ? 19   GLN A N   1 
ATOM   141  C  CA  . GLN A 1 20 ? 13.269  -5.577  -2.111  1.00 21.07 ? 19   GLN A CA  1 
ATOM   142  C  C   . GLN A 1 20 ? 11.881  -5.684  -2.753  1.00 22.78 ? 19   GLN A C   1 
ATOM   143  O  O   . GLN A 1 20 ? 10.978  -4.881  -2.443  1.00 22.76 ? 19   GLN A O   1 
ATOM   144  C  CB  . GLN A 1 20 ? 13.497  -6.690  -1.089  1.00 23.01 ? 19   GLN A CB  1 
ATOM   145  C  CG  . GLN A 1 20 ? 14.928  -6.832  -0.687  1.00 22.67 ? 19   GLN A CG  1 
ATOM   146  C  CD  . GLN A 1 20 ? 15.225  -8.063  0.193   1.00 25.96 ? 19   GLN A CD  1 
ATOM   147  O  OE1 . GLN A 1 20 ? 14.395  -8.971  0.347   1.00 34.31 ? 19   GLN A OE1 1 
ATOM   148  N  NE2 . GLN A 1 20 ? 16.443  -8.111  0.728   1.00 32.05 ? 19   GLN A NE2 1 
ATOM   149  N  N   . GLY A 1 21 ? 11.715  -6.655  -3.641  1.00 19.90 ? 20   GLY A N   1 
ATOM   150  C  CA  . GLY A 1 21 ? 10.418  -6.927  -4.220  1.00 19.42 ? 20   GLY A CA  1 
ATOM   151  C  C   . GLY A 1 21 ? 10.108  -6.150  -5.475  1.00 17.26 ? 20   GLY A C   1 
ATOM   152  O  O   . GLY A 1 21 ? 10.980  -5.529  -6.074  1.00 20.37 ? 20   GLY A O   1 
ATOM   153  N  N   . GLY A 1 22 ? 8.843   -6.190  -5.872  1.00 19.96 ? 21   GLY A N   1 
ATOM   154  C  CA  . GLY A 1 22 ? 8.371   -5.622  -7.117  1.00 21.63 ? 21   GLY A CA  1 
ATOM   155  C  C   . GLY A 1 22 ? 7.661   -6.660  -7.963  1.00 22.98 ? 21   GLY A C   1 
ATOM   156  O  O   . GLY A 1 22 ? 7.619   -7.832  -7.596  1.00 26.11 ? 21   GLY A O   1 
ATOM   157  N  N   . LYS A 1 23 ? 7.119   -6.235  -9.099  1.00 28.05 ? 22   LYS A N   1 
ATOM   158  C  CA  . LYS A 1 23 ? 6.396   -7.155  -10.012 1.00 29.76 ? 22   LYS A CA  1 
ATOM   159  C  C   . LYS A 1 23 ? 7.217   -8.393  -10.392 1.00 34.17 ? 22   LYS A C   1 
ATOM   160  O  O   . LYS A 1 23 ? 6.710   -9.527  -10.356 1.00 35.12 ? 22   LYS A O   1 
ATOM   161  C  CB  . LYS A 1 23 ? 5.926   -6.438  -11.284 1.00 35.33 ? 22   LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 23 ? 4.411   -6.265  -11.382 1.00 48.98 ? 22   LYS A CG  1 
ATOM   163  N  N   . ASP A 1 24 ? 8.474   -8.174  -10.755 1.00 29.86 ? 23   ASP A N   1 
ATOM   164  C  CA  . ASP A 1 24 ? 9.359   -9.247  -11.221 1.00 30.06 ? 23   ASP A CA  1 
ATOM   165  C  C   . ASP A 1 24 ? 9.732   -10.283 -10.137 1.00 24.59 ? 23   ASP A C   1 
ATOM   166  O  O   . ASP A 1 24 ? 10.356  -11.304 -10.441 1.00 30.06 ? 23   ASP A O   1 
ATOM   167  C  CB  . ASP A 1 24 ? 10.634  -8.660  -11.898 1.00 33.37 ? 23   ASP A CB  1 
ATOM   168  C  CG  . ASP A 1 24 ? 11.294  -7.484  -11.103 1.00 40.27 ? 23   ASP A CG  1 
ATOM   169  O  OD1 . ASP A 1 24 ? 10.584  -6.656  -10.472 1.00 22.51 ? 23   ASP A OD1 1 
ATOM   170  O  OD2 . ASP A 1 24 ? 12.545  -7.385  -11.130 1.00 32.79 ? 23   ASP A OD2 1 
ATOM   171  N  N   . PHE A 1 25 ? 9.403   -9.982  -8.880  1.00 27.93 ? 24   PHE A N   1 
ATOM   172  C  CA  . PHE A 1 25 ? 9.629   -10.899 -7.755  1.00 25.80 ? 24   PHE A CA  1 
ATOM   173  C  C   . PHE A 1 25 ? 8.329   -11.411 -7.182  1.00 30.46 ? 24   PHE A C   1 
ATOM   174  O  O   . PHE A 1 25 ? 8.335   -12.142 -6.194  1.00 31.27 ? 24   PHE A O   1 
ATOM   175  C  CB  . PHE A 1 25 ? 10.438  -10.230 -6.630  1.00 26.51 ? 24   PHE A CB  1 
ATOM   176  C  CG  . PHE A 1 25 ? 11.808  -9.900  -7.041  1.00 30.14 ? 24   PHE A CG  1 
ATOM   177  C  CD1 . PHE A 1 25 ? 12.815  -10.842 -6.952  1.00 26.73 ? 24   PHE A CD1 1 
ATOM   178  C  CD2 . PHE A 1 25 ? 12.087  -8.658  -7.612  1.00 30.55 ? 24   PHE A CD2 1 
ATOM   179  C  CE1 . PHE A 1 25 ? 14.113  -10.531 -7.389  1.00 36.62 ? 24   PHE A CE1 1 
ATOM   180  C  CE2 . PHE A 1 25 ? 13.364  -8.354  -8.058  1.00 30.71 ? 24   PHE A CE2 1 
ATOM   181  C  CZ  . PHE A 1 25 ? 14.377  -9.290  -7.944  1.00 35.55 ? 24   PHE A CZ  1 
ATOM   182  N  N   . ASN A 1 26 ? 7.213   -10.983 -7.755  1.00 29.68 ? 25   ASN A N   1 
ATOM   183  C  CA  . ASN A 1 26 ? 5.944   -11.470 -7.312  1.00 33.95 ? 25   ASN A CA  1 
ATOM   184  C  C   . ASN A 1 26 ? 5.821   -11.247 -5.804  1.00 36.56 ? 25   ASN A C   1 
ATOM   185  O  O   . ASN A 1 26 ? 5.329   -12.084 -5.067  1.00 32.84 ? 25   ASN A O   1 
ATOM   186  C  CB  . ASN A 1 26 ? 5.851   -12.944 -7.703  1.00 34.41 ? 25   ASN A CB  1 
ATOM   187  C  CG  . ASN A 1 26 ? 4.521   -13.508 -7.460  1.00 34.93 ? 25   ASN A CG  1 
ATOM   188  O  OD1 . ASN A 1 26 ? 3.520   -12.986 -7.946  1.00 39.33 ? 25   ASN A OD1 1 
ATOM   189  N  ND2 . ASN A 1 26 ? 4.480   -14.584 -6.690  1.00 30.51 ? 25   ASN A ND2 1 
ATOM   190  N  N   . MET A 1 27 ? 6.310   -10.100 -5.350  1.00 31.73 ? 26   MET A N   1 
ATOM   191  C  CA  . MET A 1 27 ? 6.132   -9.700  -3.969  1.00 34.10 ? 26   MET A CA  1 
ATOM   192  C  C   . MET A 1 27 ? 6.048   -8.168  -3.939  1.00 27.82 ? 26   MET A C   1 
ATOM   193  O  O   . MET A 1 27 ? 6.529   -7.509  -4.866  1.00 27.16 ? 26   MET A O   1 
ATOM   194  C  CB  . MET A 1 27 ? 7.286   -10.215 -3.103  1.00 32.31 ? 26   MET A CB  1 
ATOM   195  C  CG  . MET A 1 27 ? 8.203   -9.138  -2.528  1.00 41.73 ? 26   MET A CG  1 
ATOM   196  S  SD  . MET A 1 27 ? 9.781   -9.780  -1.920  1.00 48.26 ? 26   MET A SD  1 
ATOM   197  C  CE  . MET A 1 27 ? 10.266  -8.564  -0.642  1.00 33.15 ? 26   MET A CE  1 
ATOM   198  N  N   . PRO A 1 28 ? 5.426   -7.600  -2.901  1.00 27.80 ? 27   PRO A N   1 
ATOM   199  C  CA  . PRO A 1 28 ? 5.335   -6.155  -2.890  1.00 21.61 ? 27   PRO A CA  1 
ATOM   200  C  C   . PRO A 1 28 ? 6.688   -5.462  -2.756  1.00 24.40 ? 27   PRO A C   1 
ATOM   201  O  O   . PRO A 1 28 ? 7.640   -6.050  -2.239  1.00 21.65 ? 27   PRO A O   1 
ATOM   202  C  CB  . PRO A 1 28 ? 4.493   -5.839  -1.646  1.00 21.50 ? 27   PRO A CB  1 
ATOM   203  C  CG  . PRO A 1 28 ? 4.368   -7.073  -0.893  1.00 33.43 ? 27   PRO A CG  1 
ATOM   204  C  CD  . PRO A 1 28 ? 4.756   -8.221  -1.745  1.00 27.63 ? 27   PRO A CD  1 
ATOM   205  N  N   . LEU A 1 29 ? 6.744   -4.200  -3.174  1.00 18.12 ? 28   LEU A N   1 
ATOM   206  C  CA  . LEU A 1 29 ? 7.909   -3.352  -2.899  1.00 19.48 ? 28   LEU A CA  1 
ATOM   207  C  C   . LEU A 1 29 ? 7.953   -3.060  -1.434  1.00 21.99 ? 28   LEU A C   1 
ATOM   208  O  O   . LEU A 1 29 ? 7.018   -2.457  -0.895  1.00 22.04 ? 28   LEU A O   1 
ATOM   209  C  CB  . LEU A 1 29 ? 7.846   -2.016  -3.622  1.00 25.11 ? 28   LEU A CB  1 
ATOM   210  C  CG  . LEU A 1 29 ? 8.038   -2.021  -5.114  1.00 33.54 ? 28   LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1 29 ? 7.652   -0.626  -5.615  1.00 23.96 ? 28   LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1 29 ? 9.487   -2.443  -5.496  1.00 21.64 ? 28   LEU A CD2 1 
ATOM   213  N  N   . THR A 1 30 ? 9.068   -3.449  -0.833  1.00 20.06 ? 29   THR A N   1 
ATOM   214  C  CA  . THR A 1 30 ? 9.229   -3.469  0.615   1.00 17.51 ? 29   THR A CA  1 
ATOM   215  C  C   . THR A 1 30 ? 10.516  -2.760  0.976   1.00 19.13 ? 29   THR A C   1 
ATOM   216  O  O   . THR A 1 30 ? 11.538  -3.025  0.370   1.00 21.39 ? 29   THR A O   1 
ATOM   217  C  CB  . THR A 1 30 ? 9.312   -4.934  1.085   1.00 23.46 ? 29   THR A CB  1 
ATOM   218  O  OG1 . THR A 1 30 ? 8.190   -5.689  0.572   1.00 26.81 ? 29   THR A OG1 1 
ATOM   219  C  CG2 . THR A 1 30 ? 9.309   -5.042  2.637   1.00 20.31 ? 29   THR A CG2 1 
ATOM   220  N  N   . ILE A 1 31 ? 10.487  -1.925  2.016   1.00 19.56 ? 30   ILE A N   1 
ATOM   221  C  CA  . ILE A 1 31 ? 11.715  -1.364  2.594   1.00 19.42 ? 30   ILE A CA  1 
ATOM   222  C  C   . ILE A 1 31 ? 12.526  -2.519  3.221   1.00 20.78 ? 30   ILE A C   1 
ATOM   223  O  O   . ILE A 1 31 ? 12.052  -3.202  4.113   1.00 19.63 ? 30   ILE A O   1 
ATOM   224  C  CB  . ILE A 1 31 ? 11.405  -0.312  3.715   1.00 20.26 ? 30   ILE A CB  1 
ATOM   225  C  CG1 . ILE A 1 31 ? 10.406  0.744   3.257   1.00 19.58 ? 30   ILE A CG1 1 
ATOM   226  C  CG2 . ILE A 1 31 ? 12.718  0.266   4.288   1.00 17.54 ? 30   ILE A CG2 1 
ATOM   227  C  CD1 . ILE A 1 31 ? 10.881  1.639   2.140   1.00 17.89 ? 30   ILE A CD1 1 
ATOM   228  N  N   . SER A 1 32 ? 13.710  -2.783  2.706   1.00 23.14 ? 31   SER A N   1 
ATOM   229  C  CA  . SER A 1 32 ? 14.523  -3.915  3.170   1.00 17.45 ? 31   SER A CA  1 
ATOM   230  C  C   . SER A 1 32 ? 15.737  -3.554  4.018   1.00 20.89 ? 31   SER A C   1 
ATOM   231  O  O   . SER A 1 32 ? 16.338  -4.439  4.654   1.00 21.98 ? 31   SER A O   1 
ATOM   232  C  CB  . SER A 1 32 ? 15.025  -4.712  1.975   1.00 21.74 ? 31   SER A CB  1 
ATOM   233  O  OG  . SER A 1 32 ? 15.675  -3.838  1.071   1.00 21.81 ? 31   SER A OG  1 
ATOM   234  N  N   . SER A 1 33 ? 16.105  -2.280  3.993   1.00 22.94 ? 32   SER A N   1 
ATOM   235  C  CA  . SER A 1 33 ? 17.278  -1.800  4.681   1.00 25.95 ? 32   SER A CA  1 
ATOM   236  C  C   . SER A 1 33 ? 17.087  -0.317  4.939   1.00 21.71 ? 32   SER A C   1 
ATOM   237  O  O   . SER A 1 33 ? 16.402  0.359   4.174   1.00 22.57 ? 32   SER A O   1 
ATOM   238  C  CB  . SER A 1 33 ? 18.539  -2.035  3.832   1.00 27.13 ? 32   SER A CB  1 
ATOM   239  O  OG  . SER A 1 33 ? 19.724  -1.784  4.576   1.00 31.79 ? 32   SER A OG  1 
ATOM   240  N  N   . LEU A 1 34 ? 17.683  0.163   6.028   1.00 20.98 ? 33   LEU A N   1 
ATOM   241  C  CA  . LEU A 1 34 ? 17.655  1.568   6.407   1.00 23.04 ? 33   LEU A CA  1 
ATOM   242  C  C   . LEU A 1 34 ? 19.039  1.957   6.940   1.00 26.13 ? 33   LEU A C   1 
ATOM   243  O  O   . LEU A 1 34 ? 19.627  1.224   7.738   1.00 32.06 ? 33   LEU A O   1 
ATOM   244  C  CB  . LEU A 1 34 ? 16.618  1.826   7.504   1.00 18.89 ? 33   LEU A CB  1 
ATOM   245  C  CG  . LEU A 1 34 ? 15.122  1.828   7.186   1.00 19.25 ? 33   LEU A CG  1 
ATOM   246  C  CD1 . LEU A 1 34 ? 14.311  1.779   8.482   1.00 24.83 ? 33   LEU A CD1 1 
ATOM   247  C  CD2 . LEU A 1 34 ? 14.742  2.985   6.293   1.00 21.13 ? 33   LEU A CD2 1 
ATOM   248  N  N   . LYS A 1 35 ? 19.566  3.087   6.477   1.00 20.88 ? 34   LYS A N   1 
ATOM   249  C  CA  . LYS A 1 35 ? 20.754  3.662   7.074   1.00 26.53 ? 34   LYS A CA  1 
ATOM   250  C  C   . LYS A 1 35 ? 20.354  4.315   8.377   1.00 24.17 ? 34   LYS A C   1 
ATOM   251  O  O   . LYS A 1 35 ? 19.418  5.121   8.426   1.00 23.80 ? 34   LYS A O   1 
ATOM   252  C  CB  . LYS A 1 35 ? 21.404  4.704   6.142   1.00 24.14 ? 34   LYS A CB  1 
ATOM   253  C  CG  . LYS A 1 35 ? 22.844  5.010   6.496   1.00 34.94 ? 34   LYS A CG  1 
ATOM   254  N  N   . ASP A 1 36 ? 21.066  3.959   9.442   1.00 22.86 ? 35   ASP A N   1 
ATOM   255  C  CA  . ASP A 1 36 ? 20.863  4.568   10.739  1.00 27.79 ? 35   ASP A CA  1 
ATOM   256  C  C   . ASP A 1 36 ? 21.127  6.058   10.611  1.00 28.01 ? 35   ASP A C   1 
ATOM   257  O  O   . ASP A 1 36 ? 22.166  6.475   10.078  1.00 28.36 ? 35   ASP A O   1 
ATOM   258  C  CB  A ASP A 1 36 ? 21.791  3.959   11.802  0.60 30.89 ? 35   ASP A CB  1 
ATOM   259  C  CB  B ASP A 1 36 ? 21.801  3.915   11.764  0.40 30.05 ? 35   ASP A CB  1 
ATOM   260  C  CG  A ASP A 1 36 ? 21.097  2.936   12.682  0.60 34.77 ? 35   ASP A CG  1 
ATOM   261  C  CG  B ASP A 1 36 ? 21.418  4.218   13.196  0.40 26.37 ? 35   ASP A CG  1 
ATOM   262  O  OD1 A ASP A 1 36 ? 19.863  2.762   12.575  0.60 32.66 ? 35   ASP A OD1 1 
ATOM   263  O  OD1 B ASP A 1 36 ? 20.234  4.513   13.460  0.40 48.35 ? 35   ASP A OD1 1 
ATOM   264  O  OD2 A ASP A 1 36 ? 21.799  2.317   13.507  0.60 28.11 ? 35   ASP A OD2 1 
ATOM   265  O  OD2 B ASP A 1 36 ? 22.308  4.141   14.063  0.40 37.15 ? 35   ASP A OD2 1 
ATOM   266  N  N   . GLY A 1 37 ? 20.162  6.861   11.047  1.00 27.29 ? 36   GLY A N   1 
ATOM   267  C  CA  . GLY A 1 37 ? 20.291  8.311   10.972  1.00 24.97 ? 36   GLY A CA  1 
ATOM   268  C  C   . GLY A 1 37 ? 20.141  8.894   9.587   1.00 30.66 ? 36   GLY A C   1 
ATOM   269  O  O   . GLY A 1 37 ? 20.375  10.090  9.383   1.00 26.92 ? 36   GLY A O   1 
ATOM   270  N  N   . GLY A 1 38 ? 19.740  8.062   8.622   1.00 25.27 ? 37   GLY A N   1 
ATOM   271  C  CA  . GLY A 1 38 ? 19.458  8.542   7.275   1.00 26.42 ? 37   GLY A CA  1 
ATOM   272  C  C   . GLY A 1 38 ? 18.064  9.132   7.270   1.00 24.45 ? 37   GLY A C   1 
ATOM   273  O  O   . GLY A 1 38 ? 17.330  8.991   8.248   1.00 23.38 ? 37   GLY A O   1 
ATOM   274  N  N   . LYS A 1 39 ? 17.693  9.751   6.156   1.00 25.25 ? 38   LYS A N   1 
ATOM   275  C  CA  . LYS A 1 39 ? 16.417  10.474  6.030   1.00 25.34 ? 38   LYS A CA  1 
ATOM   276  C  C   . LYS A 1 39 ? 15.160  9.599   6.152   1.00 29.40 ? 38   LYS A C   1 
ATOM   277  O  O   . LYS A 1 39 ? 14.187  9.975   6.829   1.00 19.53 ? 38   LYS A O   1 
ATOM   278  C  CB  . LYS A 1 39 ? 16.410  11.242  4.711   1.00 22.89 ? 38   LYS A CB  1 
ATOM   279  C  CG  . LYS A 1 39 ? 17.395  12.428  4.755   1.00 22.93 ? 38   LYS A CG  1 
ATOM   280  C  CD  . LYS A 1 39 ? 17.516  13.172  3.450   1.00 26.33 ? 38   LYS A CD  1 
ATOM   281  C  CE  . LYS A 1 39 ? 18.262  14.494  3.663   1.00 36.86 ? 38   LYS A CE  1 
ATOM   282  N  NZ  . LYS A 1 39 ? 18.348  15.296  2.423   1.00 40.22 ? 38   LYS A NZ  1 
ATOM   283  N  N   . ALA A 1 40 ? 15.174  8.430   5.520   1.00 25.21 ? 39   ALA A N   1 
ATOM   284  C  CA  . ALA A 1 40 ? 14.051  7.510   5.659   1.00 24.37 ? 39   ALA A CA  1 
ATOM   285  C  C   . ALA A 1 40 ? 13.848  7.062   7.126   1.00 23.33 ? 39   ALA A C   1 
ATOM   286  O  O   . ALA A 1 40 ? 12.738  7.178   7.663   1.00 18.93 ? 39   ALA A O   1 
ATOM   287  C  CB  . ALA A 1 40 ? 14.223  6.316   4.714   1.00 17.57 ? 39   ALA A CB  1 
ATOM   288  N  N   . ALA A 1 41 ? 14.913  6.589   7.783   1.00 23.11 ? 40   ALA A N   1 
ATOM   289  C  CA  . ALA A 1 41 ? 14.854  6.202   9.208   1.00 21.29 ? 40   ALA A CA  1 
ATOM   290  C  C   . ALA A 1 41 ? 14.315  7.343   10.105  1.00 24.15 ? 40   ALA A C   1 
ATOM   291  O  O   . ALA A 1 41 ? 13.444  7.120   10.966  1.00 23.29 ? 40   ALA A O   1 
ATOM   292  C  CB  . ALA A 1 41 ? 16.244  5.775   9.708   1.00 18.98 ? 40   ALA A CB  1 
ATOM   293  N  N   . GLN A 1 42 ? 14.838  8.545   9.882   1.00 26.01 ? 41   GLN A N   1 
ATOM   294  C  CA  . GLN A 1 42 ? 14.457  9.733   10.669  1.00 22.08 ? 41   GLN A CA  1 
ATOM   295  C  C   . GLN A 1 42 ? 12.999  10.132  10.425  1.00 25.05 ? 41   GLN A C   1 
ATOM   296  O  O   . GLN A 1 42 ? 12.369  10.735  11.302  1.00 22.22 ? 41   GLN A O   1 
ATOM   297  C  CB  A GLN A 1 42 ? 15.367  10.909  10.327  0.50 24.38 ? 41   GLN A CB  1 
ATOM   298  C  CB  B GLN A 1 42 ? 15.411  10.885  10.378  0.50 24.95 ? 41   GLN A CB  1 
ATOM   299  C  CG  A GLN A 1 42 ? 16.782  10.785  10.859  0.50 28.86 ? 41   GLN A CG  1 
ATOM   300  C  CG  B GLN A 1 42 ? 16.874  10.577  10.708  0.50 27.27 ? 41   GLN A CG  1 
ATOM   301  C  CD  A GLN A 1 42 ? 17.665  11.959  10.453  0.50 18.18 ? 41   GLN A CD  1 
ATOM   302  C  CD  B GLN A 1 42 ? 17.139  10.396  12.186  0.50 34.32 ? 41   GLN A CD  1 
ATOM   303  O  OE1 A GLN A 1 42 ? 17.626  12.427  9.315   0.50 24.70 ? 41   GLN A OE1 1 
ATOM   304  O  OE1 B GLN A 1 42 ? 16.529  9.557   12.847  0.50 34.02 ? 41   GLN A OE1 1 
ATOM   305  N  NE2 A GLN A 1 42 ? 18.486  12.408  11.369  0.50 16.96 ? 41   GLN A NE2 1 
ATOM   306  N  NE2 B GLN A 1 42 ? 18.076  11.172  12.710  0.50 27.20 ? 41   GLN A NE2 1 
ATOM   307  N  N   . ALA A 1 43 ? 12.470  9.761   9.258   1.00 24.81 ? 42   ALA A N   1 
ATOM   308  C  CA  . ALA A 1 43 ? 11.061  9.961   8.907   1.00 20.93 ? 42   ALA A CA  1 
ATOM   309  C  C   . ALA A 1 43 ? 10.165  8.853   9.479   1.00 21.00 ? 42   ALA A C   1 
ATOM   310  O  O   . ALA A 1 43 ? 8.958   8.846   9.225   1.00 24.68 ? 42   ALA A O   1 
ATOM   311  C  CB  . ALA A 1 43 ? 10.903  10.011  7.416   1.00 27.14 ? 42   ALA A CB  1 
ATOM   312  N  N   . ASN A 1 44 ? 10.740  7.939   10.253  1.00 22.67 ? 43   ASN A N   1 
ATOM   313  C  CA  . ASN A 1 44 ? 10.007  6.822   10.843  1.00 27.32 ? 43   ASN A CA  1 
ATOM   314  C  C   . ASN A 1 44 ? 9.508   5.794   9.824   1.00 20.44 ? 43   ASN A C   1 
ATOM   315  O  O   . ASN A 1 44 ? 8.517   5.110   10.063  1.00 21.21 ? 43   ASN A O   1 
ATOM   316  C  CB  . ASN A 1 44 ? 8.839   7.332   11.694  1.00 30.32 ? 43   ASN A CB  1 
ATOM   317  C  CG  . ASN A 1 44 ? 8.521   6.417   12.877  1.00 46.18 ? 43   ASN A CG  1 
ATOM   318  O  OD1 . ASN A 1 44 ? 9.366   5.640   13.337  1.00 57.78 ? 43   ASN A OD1 1 
ATOM   319  N  ND2 . ASN A 1 44 ? 7.292   6.518   13.382  1.00 55.79 ? 43   ASN A ND2 1 
ATOM   320  N  N   . VAL A 1 45 ? 10.188  5.711   8.680   1.00 24.79 ? 44   VAL A N   1 
ATOM   321  C  CA  . VAL A 1 45 ? 10.031  4.563   7.792   1.00 21.36 ? 44   VAL A CA  1 
ATOM   322  C  C   . VAL A 1 45 ? 10.658  3.342   8.496   1.00 21.61 ? 44   VAL A C   1 
ATOM   323  O  O   . VAL A 1 45 ? 11.697  3.455   9.150   1.00 20.93 ? 44   VAL A O   1 
ATOM   324  C  CB  . VAL A 1 45 ? 10.736  4.795   6.422   1.00 19.66 ? 44   VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 45 ? 10.626  3.529   5.529   1.00 17.80 ? 44   VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 45 ? 10.165  6.024   5.682   1.00 24.70 ? 44   VAL A CG2 1 
ATOM   327  N  N   . ARG A 1 46 ? 10.012  2.184   8.390   1.00 20.83 ? 45   ARG A N   1 
ATOM   328  C  CA  . ARG A 1 46 ? 10.503  1.005   9.062   1.00 21.42 ? 45   ARG A CA  1 
ATOM   329  C  C   . ARG A 1 46 ? 10.695  -0.111  8.050   1.00 21.61 ? 45   ARG A C   1 
ATOM   330  O  O   . ARG A 1 46 ? 9.929   -0.248  7.103   1.00 19.32 ? 45   ARG A O   1 
ATOM   331  C  CB  . ARG A 1 46 ? 9.556   0.563   10.169  1.00 21.26 ? 45   ARG A CB  1 
ATOM   332  C  CG  . ARG A 1 46 ? 9.439   1.620   11.254  1.00 25.71 ? 45   ARG A CG  1 
ATOM   333  C  CD  A ARG A 1 46 ? 8.739   1.177   12.557  0.50 25.51 ? 45   ARG A CD  1 
ATOM   334  C  CD  B ARG A 1 46 ? 8.766   1.077   12.495  0.50 22.01 ? 45   ARG A CD  1 
ATOM   335  N  NE  A ARG A 1 46 ? 7.429   0.547   12.370  0.50 31.79 ? 45   ARG A NE  1 
ATOM   336  N  NE  B ARG A 1 46 ? 8.759   2.070   13.570  0.50 14.59 ? 45   ARG A NE  1 
ATOM   337  C  CZ  A ARG A 1 46 ? 6.281   0.913   12.954  0.50 33.52 ? 45   ARG A CZ  1 
ATOM   338  C  CZ  B ARG A 1 46 ? 7.727   2.853   13.869  0.50 16.27 ? 45   ARG A CZ  1 
ATOM   339  N  NH1 A ARG A 1 46 ? 6.218   1.939   13.824  0.50 20.71 ? 45   ARG A NH1 1 
ATOM   340  N  NH1 B ARG A 1 46 ? 6.576   2.781   13.207  0.50 36.00 ? 45   ARG A NH1 1 
ATOM   341  N  NH2 A ARG A 1 46 ? 5.168   0.217   12.678  0.50 15.56 ? 45   ARG A NH2 1 
ATOM   342  N  NH2 B ARG A 1 46 ? 7.846   3.724   14.858  0.50 18.62 ? 45   ARG A NH2 1 
ATOM   343  N  N   . ILE A 1 47 ? 11.733  -0.901  8.265   1.00 20.28 ? 46   ILE A N   1 
ATOM   344  C  CA  . ILE A 1 47 ? 11.937  -2.122  7.487   1.00 20.52 ? 46   ILE A CA  1 
ATOM   345  C  C   . ILE A 1 47 ? 10.706  -3.013  7.540   1.00 21.75 ? 46   ILE A C   1 
ATOM   346  O  O   . ILE A 1 47 ? 10.130  -3.284  8.629   1.00 19.68 ? 46   ILE A O   1 
ATOM   347  C  CB  . ILE A 1 47 ? 13.214  -2.891  7.957   1.00 20.21 ? 46   ILE A CB  1 
ATOM   348  C  CG1 . ILE A 1 47 ? 14.480  -2.068  7.689   1.00 26.67 ? 46   ILE A CG1 1 
ATOM   349  C  CG2 . ILE A 1 47 ? 13.313  -4.258  7.286   1.00 16.18 ? 46   ILE A CG2 1 
ATOM   350  C  CD1 . ILE A 1 47 ? 15.709  -2.592  8.422   1.00 20.64 ? 46   ILE A CD1 1 
ATOM   351  N  N   . GLY A 1 48 ? 10.317  -3.492  6.360   1.00 17.31 ? 47   GLY A N   1 
ATOM   352  C  CA  . GLY A 1 48 ? 9.137   -4.323  6.173   1.00 17.60 ? 47   GLY A CA  1 
ATOM   353  C  C   . GLY A 1 48 ? 7.941   -3.577  5.642   1.00 19.88 ? 47   GLY A C   1 
ATOM   354  O  O   . GLY A 1 48 ? 7.026   -4.209  5.119   1.00 22.14 ? 47   GLY A O   1 
ATOM   355  N  N   . ASP A 1 49 ? 7.913   -2.253  5.787   1.00 16.79 ? 48   ASP A N   1 
ATOM   356  C  CA  . ASP A 1 49 ? 6.784   -1.491  5.340   1.00 20.39 ? 48   ASP A CA  1 
ATOM   357  C  C   . ASP A 1 49 ? 6.756   -1.571  3.817   1.00 19.46 ? 48   ASP A C   1 
ATOM   358  O  O   . ASP A 1 49 ? 7.809   -1.684  3.172   1.00 17.84 ? 48   ASP A O   1 
ATOM   359  C  CB  . ASP A 1 49 ? 6.847   -0.038  5.822   1.00 17.11 ? 48   ASP A CB  1 
ATOM   360  C  CG  . ASP A 1 49 ? 6.683   0.088   7.297   1.00 20.97 ? 48   ASP A CG  1 
ATOM   361  O  OD1 . ASP A 1 49 ? 6.196   -0.858  7.956   1.00 21.31 ? 48   ASP A OD1 1 
ATOM   362  O  OD2 . ASP A 1 49 ? 6.986   1.169   7.784   1.00 23.37 ? 48   ASP A OD2 1 
ATOM   363  N  N   . VAL A 1 50 ? 5.550   -1.512  3.264   1.00 20.82 ? 49   VAL A N   1 
ATOM   364  C  CA  . VAL A 1 50 ? 5.313   -1.696  1.834   1.00 19.25 ? 49   VAL A CA  1 
ATOM   365  C  C   . VAL A 1 50 ? 5.066   -0.360  1.181   1.00 19.00 ? 49   VAL A C   1 
ATOM   366  O  O   . VAL A 1 50 ? 4.299   0.453   1.706   1.00 21.71 ? 49   VAL A O   1 
ATOM   367  C  CB  . VAL A 1 50 ? 4.152   -2.733  1.578   1.00 20.58 ? 49   VAL A CB  1 
ATOM   368  C  CG1 . VAL A 1 50 ? 3.582   -2.664  0.148   1.00 23.53 ? 49   VAL A CG1 1 
ATOM   369  C  CG2 . VAL A 1 50 ? 4.666   -4.145  1.901   1.00 23.04 ? 49   VAL A CG2 1 
ATOM   370  N  N   . VAL A 1 51 ? 5.748   -0.133  0.064   1.00 19.44 ? 50   VAL A N   1 
ATOM   371  C  CA  . VAL A 1 51 ? 5.589   1.100   -0.684  1.00 20.90 ? 50   VAL A CA  1 
ATOM   372  C  C   . VAL A 1 51 ? 4.358   0.992   -1.582  1.00 22.53 ? 50   VAL A C   1 
ATOM   373  O  O   . VAL A 1 51 ? 4.299   0.135   -2.479  1.00 21.45 ? 50   VAL A O   1 
ATOM   374  C  CB  . VAL A 1 51 ? 6.866   1.393   -1.518  1.00 19.61 ? 50   VAL A CB  1 
ATOM   375  C  CG1 . VAL A 1 51 ? 6.679   2.645   -2.352  1.00 18.87 ? 50   VAL A CG1 1 
ATOM   376  C  CG2 . VAL A 1 51 ? 8.054   1.563   -0.609  1.00 20.33 ? 50   VAL A CG2 1 
ATOM   377  N  N   . LEU A 1 52 ? 3.400   1.880   -1.365  1.00 18.83 ? 51   LEU A N   1 
ATOM   378  C  CA  . LEU A 1 52 ? 2.159   1.909   -2.138  1.00 19.04 ? 51   LEU A CA  1 
ATOM   379  C  C   . LEU A 1 52 ? 2.207   2.873   -3.305  1.00 16.68 ? 51   LEU A C   1 
ATOM   380  O  O   . LEU A 1 52 ? 1.660   2.590   -4.354  1.00 17.57 ? 51   LEU A O   1 
ATOM   381  C  CB  . LEU A 1 52 ? 0.992   2.273   -1.225  1.00 18.47 ? 51   LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 52 ? 0.731   1.292   -0.075  1.00 18.50 ? 51   LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 52 ? -0.457  1.797   0.733   1.00 26.23 ? 51   LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 52 ? 0.510   -0.152  -0.587  1.00 24.01 ? 51   LEU A CD2 1 
ATOM   385  N  N   . SER A 1 53 ? 2.834   4.026   -3.095  1.00 16.68 ? 52   SER A N   1 
ATOM   386  C  CA  . SER A 1 53 ? 2.950   4.998   -4.167  1.00 21.09 ? 52   SER A CA  1 
ATOM   387  C  C   . SER A 1 53 ? 4.213   5.801   -3.984  1.00 19.90 ? 52   SER A C   1 
ATOM   388  O  O   . SER A 1 53 ? 4.737   5.934   -2.875  1.00 18.65 ? 52   SER A O   1 
ATOM   389  C  CB  . SER A 1 53 ? 1.734   5.920   -4.261  1.00 23.11 ? 52   SER A CB  1 
ATOM   390  O  OG  . SER A 1 53 ? 1.580   6.621   -3.066  1.00 20.61 ? 52   SER A OG  1 
ATOM   391  N  N   . ILE A 1 54 ? 4.713   6.285   -5.114  1.00 17.85 ? 53   ILE A N   1 
ATOM   392  C  CA  . ILE A 1 54 ? 5.879   7.131   -5.157  1.00 17.97 ? 53   ILE A CA  1 
ATOM   393  C  C   . ILE A 1 54 ? 5.490   8.361   -5.985  1.00 23.09 ? 53   ILE A C   1 
ATOM   394  O  O   . ILE A 1 54 ? 5.095   8.235   -7.146  1.00 18.73 ? 53   ILE A O   1 
ATOM   395  C  CB  . ILE A 1 54 ? 7.079   6.402   -5.791  1.00 18.17 ? 53   ILE A CB  1 
ATOM   396  C  CG1 . ILE A 1 54 ? 7.411   5.087   -5.055  1.00 21.11 ? 53   ILE A CG1 1 
ATOM   397  C  CG2 . ILE A 1 54 ? 8.279   7.367   -5.861  1.00 15.13 ? 53   ILE A CG2 1 
ATOM   398  C  CD1 . ILE A 1 54 ? 8.190   4.077   -5.967  1.00 19.55 ? 53   ILE A CD1 1 
ATOM   399  N  N   . ASP A 1 55 ? 5.571   9.541   -5.363  1.00 23.76 ? 54   ASP A N   1 
ATOM   400  C  CA  . ASP A 1 55 ? 5.125   10.795  -5.964  1.00 25.32 ? 54   ASP A CA  1 
ATOM   401  C  C   . ASP A 1 55 ? 3.812   10.707  -6.728  1.00 22.08 ? 54   ASP A C   1 
ATOM   402  O  O   . ASP A 1 55 ? 3.721   11.197  -7.865  1.00 17.82 ? 54   ASP A O   1 
ATOM   403  C  CB  . ASP A 1 55 ? 6.234   11.365  -6.838  1.00 25.63 ? 54   ASP A CB  1 
ATOM   404  C  CG  . ASP A 1 55 ? 7.340   12.006  -6.011  1.00 39.08 ? 54   ASP A CG  1 
ATOM   405  O  OD1 . ASP A 1 55 ? 7.134   12.324  -4.818  1.00 29.38 ? 54   ASP A OD1 1 
ATOM   406  O  OD2 . ASP A 1 55 ? 8.426   12.203  -6.554  1.00 26.29 ? 54   ASP A OD2 1 
ATOM   407  N  N   . GLY A 1 56 ? 2.810   10.112  -6.084  1.00 22.84 ? 55   GLY A N   1 
ATOM   408  C  CA  . GLY A 1 56 ? 1.438   10.057  -6.608  1.00 24.79 ? 55   GLY A CA  1 
ATOM   409  C  C   . GLY A 1 56 ? 1.104   8.800   -7.394  1.00 23.47 ? 55   GLY A C   1 
ATOM   410  O  O   . GLY A 1 56 ? -0.074  8.474   -7.584  1.00 30.02 ? 55   GLY A O   1 
ATOM   411  N  N   . ILE A 1 57 ? 2.135   8.067   -7.806  1.00 18.07 ? 56   ILE A N   1 
ATOM   412  C  CA  . ILE A 1 57 ? 1.974   6.979   -8.764  1.00 20.37 ? 56   ILE A CA  1 
ATOM   413  C  C   . ILE A 1 57 ? 1.906   5.650   -8.040  1.00 21.69 ? 56   ILE A C   1 
ATOM   414  O  O   . ILE A 1 57 ? 2.758   5.346   -7.225  1.00 20.98 ? 56   ILE A O   1 
ATOM   415  C  CB  . ILE A 1 57 ? 3.141   6.929   -9.742  1.00 17.17 ? 56   ILE A CB  1 
ATOM   416  C  CG1 . ILE A 1 57 ? 3.399   8.288   -10.422 1.00 19.22 ? 56   ILE A CG1 1 
ATOM   417  C  CG2 . ILE A 1 57 ? 2.917   5.823   -10.808 1.00 17.32 ? 56   ILE A CG2 1 
ATOM   418  C  CD1 . ILE A 1 57 ? 2.195   8.857   -11.178 1.00 19.01 ? 56   ILE A CD1 1 
ATOM   419  N  N   . ASN A 1 58 ? 0.892   4.854   -8.366  1.00 18.03 ? 57   ASN A N   1 
ATOM   420  C  CA  . ASN A 1 58 ? 0.758   3.496   -7.810  1.00 18.82 ? 57   ASN A CA  1 
ATOM   421  C  C   . ASN A 1 58 ? 2.018   2.695   -8.151  1.00 13.95 ? 57   ASN A C   1 
ATOM   422  O  O   . ASN A 1 58 ? 2.361   2.520   -9.319  1.00 20.10 ? 57   ASN A O   1 
ATOM   423  C  CB  . ASN A 1 58 ? -0.476  2.799   -8.387  1.00 17.35 ? 57   ASN A CB  1 
ATOM   424  C  CG  . ASN A 1 58 ? -0.852  1.539   -7.627  1.00 28.33 ? 57   ASN A CG  1 
ATOM   425  O  OD1 . ASN A 1 58 ? -0.039  0.954   -6.907  1.00 27.50 ? 57   ASN A OD1 1 
ATOM   426  N  ND2 . ASN A 1 58 ? -2.101  1.130   -7.767  1.00 24.88 ? 57   ASN A ND2 1 
ATOM   427  N  N   . ALA A 1 59 ? 2.716   2.261   -7.090  1.00 18.80 ? 58   ALA A N   1 
ATOM   428  C  CA  . ALA A 1 59 ? 3.966   1.511   -7.211  1.00 17.04 ? 58   ALA A CA  1 
ATOM   429  C  C   . ALA A 1 59 ? 3.760   0.017   -7.154  1.00 20.03 ? 58   ALA A C   1 
ATOM   430  O  O   . ALA A 1 59 ? 4.724   -0.714  -7.357  1.00 24.94 ? 58   ALA A O   1 
ATOM   431  C  CB  . ALA A 1 59 ? 4.930   1.924   -6.107  1.00 18.21 ? 58   ALA A CB  1 
ATOM   432  N  N   . GLN A 1 60 ? 2.523   -0.433  -6.882  1.00 18.86 ? 59   GLN A N   1 
ATOM   433  C  CA  . GLN A 1 60 ? 2.253   -1.838  -6.530  1.00 28.37 ? 59   GLN A CA  1 
ATOM   434  C  C   . GLN A 1 60 ? 2.343   -2.838  -7.686  1.00 28.20 ? 59   GLN A C   1 
ATOM   435  O  O   . GLN A 1 60 ? 2.258   -4.059  -7.484  1.00 34.33 ? 59   GLN A O   1 
ATOM   436  C  CB  . GLN A 1 60 ? 0.892   -1.983  -5.852  1.00 26.65 ? 59   GLN A CB  1 
ATOM   437  C  CG  . GLN A 1 60 ? 0.776   -1.273  -4.515  1.00 30.93 ? 59   GLN A CG  1 
ATOM   438  C  CD  . GLN A 1 60 ? -0.546  -1.581  -3.796  1.00 38.48 ? 59   GLN A CD  1 
ATOM   439  O  OE1 . GLN A 1 60 ? -0.680  -2.616  -3.141  1.00 37.65 ? 59   GLN A OE1 1 
ATOM   440  N  NE2 . GLN A 1 60 ? -1.522  -0.676  -3.917  1.00 40.02 ? 59   GLN A NE2 1 
ATOM   441  N  N   . GLY A 1 61 ? 2.515   -2.322  -8.873  1.00 21.74 ? 60   GLY A N   1 
ATOM   442  C  CA  . GLY A 1 61 ? 2.811   -3.144  -10.044 1.00 30.21 ? 60   GLY A CA  1 
ATOM   443  C  C   . GLY A 1 61 ? 4.142   -2.849  -10.714 1.00 31.05 ? 60   GLY A C   1 
ATOM   444  O  O   . GLY A 1 61 ? 4.497   -3.538  -11.691 1.00 30.49 ? 60   GLY A O   1 
ATOM   445  N  N   . MET A 1 62 ? 4.867   -1.829  -10.232 1.00 24.49 ? 61   MET A N   1 
ATOM   446  C  CA  . MET A 1 62 ? 6.164   -1.466  -10.823 1.00 22.93 ? 61   MET A CA  1 
ATOM   447  C  C   . MET A 1 62 ? 7.108   -2.628  -10.679 1.00 25.29 ? 61   MET A C   1 
ATOM   448  O  O   . MET A 1 62 ? 7.127   -3.299  -9.654  1.00 22.19 ? 61   MET A O   1 
ATOM   449  C  CB  . MET A 1 62 ? 6.806   -0.232  -10.157 1.00 23.24 ? 61   MET A CB  1 
ATOM   450  C  CG  . MET A 1 62 ? 6.149   1.101   -10.451 1.00 23.25 ? 61   MET A CG  1 
ATOM   451  S  SD  . MET A 1 62 ? 6.896   2.486   -9.576  1.00 24.78 ? 61   MET A SD  1 
ATOM   452  C  CE  . MET A 1 62 ? 5.848   3.854   -10.057 1.00 33.96 ? 61   MET A CE  1 
ATOM   453  N  N   . THR A 1 63 ? 7.949   -2.832  -11.692 1.00 23.80 ? 62   THR A N   1 
ATOM   454  C  CA  . THR A 1 63 ? 9.136   -3.645  -11.499 1.00 22.92 ? 62   THR A CA  1 
ATOM   455  C  C   . THR A 1 63 ? 10.056  -2.957  -10.450 1.00 19.81 ? 62   THR A C   1 
ATOM   456  O  O   . THR A 1 63 ? 9.927   -1.780  -10.168 1.00 16.94 ? 62   THR A O   1 
ATOM   457  C  CB  . THR A 1 63 ? 9.903   -3.826  -12.797 1.00 21.74 ? 62   THR A CB  1 
ATOM   458  O  OG1 . THR A 1 63 ? 10.466  -2.570  -13.205 1.00 19.23 ? 62   THR A OG1 1 
ATOM   459  C  CG2 . THR A 1 63 ? 8.986   -4.372  -13.895 1.00 22.53 ? 62   THR A CG2 1 
ATOM   460  N  N   . HIS A 1 64 ? 10.953  -3.738  -9.869  1.00 19.46 ? 63   HIS A N   1 
ATOM   461  C  CA  . HIS A 1 64 ? 11.970  -3.211  -8.956  1.00 18.87 ? 63   HIS A CA  1 
ATOM   462  C  C   . HIS A 1 64 ? 12.757  -2.029  -9.577  1.00 15.70 ? 63   HIS A C   1 
ATOM   463  O  O   . HIS A 1 64 ? 12.905  -0.970  -8.961  1.00 19.29 ? 63   HIS A O   1 
ATOM   464  C  CB  . HIS A 1 64 ? 12.924  -4.342  -8.593  1.00 18.61 ? 63   HIS A CB  1 
ATOM   465  C  CG  . HIS A 1 64 ? 13.787  -4.037  -7.422  1.00 21.32 ? 63   HIS A CG  1 
ATOM   466  N  ND1 . HIS A 1 64 ? 13.487  -4.488  -6.157  1.00 22.61 ? 63   HIS A ND1 1 
ATOM   467  C  CD2 . HIS A 1 64 ? 14.938  -3.333  -7.316  1.00 24.54 ? 63   HIS A CD2 1 
ATOM   468  C  CE1 . HIS A 1 64 ? 14.419  -4.070  -5.320  1.00 29.41 ? 63   HIS A CE1 1 
ATOM   469  N  NE2 . HIS A 1 64 ? 15.310  -3.364  -5.995  1.00 18.90 ? 63   HIS A NE2 1 
ATOM   470  N  N   . LEU A 1 65 ? 13.224  -2.196  -10.814 1.00 17.02 ? 64   LEU A N   1 
ATOM   471  C  CA  . LEU A 1 65 ? 13.979  -1.139  -11.483 1.00 19.51 ? 64   LEU A CA  1 
ATOM   472  C  C   . LEU A 1 65 ? 13.132  0.116   -11.760 1.00 15.55 ? 64   LEU A C   1 
ATOM   473  O  O   . LEU A 1 65 ? 13.628  1.245   -11.633 1.00 19.06 ? 64   LEU A O   1 
ATOM   474  C  CB  . LEU A 1 65 ? 14.626  -1.664  -12.777 1.00 23.10 ? 64   LEU A CB  1 
ATOM   475  C  CG  . LEU A 1 65 ? 15.502  -0.636  -13.510 1.00 19.30 ? 64   LEU A CG  1 
ATOM   476  C  CD1 . LEU A 1 65 ? 16.694  -0.243  -12.652 1.00 18.57 ? 64   LEU A CD1 1 
ATOM   477  C  CD2 . LEU A 1 65 ? 15.925  -1.118  -14.881 1.00 20.77 ? 64   LEU A CD2 1 
ATOM   478  N  N   . GLU A 1 66 ? 11.876  -0.085  -12.182 1.00 19.13 ? 65   GLU A N   1 
ATOM   479  C  CA  . GLU A 1 66 ? 10.935  1.038   -12.331 1.00 23.79 ? 65   GLU A CA  1 
ATOM   480  C  C   . GLU A 1 66 ? 10.799  1.842   -11.043 1.00 22.84 ? 65   GLU A C   1 
ATOM   481  O  O   . GLU A 1 66 ? 10.900  3.056   -11.085 1.00 18.49 ? 65   GLU A O   1 
ATOM   482  C  CB  . GLU A 1 66 ? 9.570   0.559   -12.824 1.00 24.01 ? 65   GLU A CB  1 
ATOM   483  C  CG  . GLU A 1 66 ? 9.577   0.291   -14.327 1.00 20.51 ? 65   GLU A CG  1 
ATOM   484  C  CD  . GLU A 1 66 ? 8.377   -0.510  -14.823 1.00 22.54 ? 65   GLU A CD  1 
ATOM   485  O  OE1 . GLU A 1 66 ? 7.581   -1.059  -14.010 1.00 20.35 ? 65   GLU A OE1 1 
ATOM   486  O  OE2 . GLU A 1 66 ? 8.260   -0.613  -16.070 1.00 24.28 ? 65   GLU A OE2 1 
ATOM   487  N  N   . ALA A 1 67 ? 10.627  1.168   -9.912  1.00 20.88 ? 66   ALA A N   1 
ATOM   488  C  CA  . ALA A 1 67 ? 10.487  1.850   -8.617  1.00 20.04 ? 66   ALA A CA  1 
ATOM   489  C  C   . ALA A 1 67 ? 11.775  2.609   -8.257  1.00 19.75 ? 66   ALA A C   1 
ATOM   490  O  O   . ALA A 1 67 ? 11.738  3.787   -7.911  1.00 19.09 ? 66   ALA A O   1 
ATOM   491  C  CB  . ALA A 1 67 ? 10.074  0.868   -7.509  1.00 19.26 ? 66   ALA A CB  1 
ATOM   492  N  N   . GLN A 1 68 ? 12.924  1.942   -8.375  1.00 20.72 ? 67   GLN A N   1 
ATOM   493  C  CA  . GLN A 1 68 ? 14.221  2.607   -8.143  1.00 19.62 ? 67   GLN A CA  1 
ATOM   494  C  C   . GLN A 1 68 ? 14.436  3.821   -9.013  1.00 17.93 ? 67   GLN A C   1 
ATOM   495  O  O   . GLN A 1 68 ? 14.836  4.877   -8.508  1.00 22.12 ? 67   GLN A O   1 
ATOM   496  C  CB  . GLN A 1 68 ? 15.346  1.657   -8.424  1.00 22.24 ? 67   GLN A CB  1 
ATOM   497  C  CG  . GLN A 1 68 ? 15.477  0.578   -7.426  1.00 23.05 ? 67   GLN A CG  1 
ATOM   498  C  CD  . GLN A 1 68 ? 16.716  -0.189  -7.677  1.00 38.39 ? 67   GLN A CD  1 
ATOM   499  O  OE1 . GLN A 1 68 ? 17.078  -0.422  -8.840  1.00 38.19 ? 67   GLN A OE1 1 
ATOM   500  N  NE2 . GLN A 1 68 ? 17.393  -0.600  -6.601  1.00 30.01 ? 67   GLN A NE2 1 
ATOM   501  N  N   . ASN A 1 69 ? 14.143  3.685   -10.302 1.00 20.62 ? 68   ASN A N   1 
ATOM   502  C  CA  . ASN A 1 69 ? 14.242  4.804   -11.239 1.00 24.95 ? 68   ASN A CA  1 
ATOM   503  C  C   . ASN A 1 69 ? 13.296  5.940   -10.870 1.00 23.53 ? 68   ASN A C   1 
ATOM   504  O  O   . ASN A 1 69 ? 13.686  7.096   -10.935 1.00 25.55 ? 68   ASN A O   1 
ATOM   505  C  CB  . ASN A 1 69 ? 13.982  4.349   -12.684 1.00 25.31 ? 68   ASN A CB  1 
ATOM   506  C  CG  . ASN A 1 69 ? 15.169  3.605   -13.305 1.00 33.09 ? 68   ASN A CG  1 
ATOM   507  O  OD1 . ASN A 1 69 ? 16.273  3.588   -12.763 1.00 34.34 ? 68   ASN A OD1 1 
ATOM   508  N  ND2 . ASN A 1 69 ? 14.929  2.982   -14.446 1.00 24.53 ? 68   ASN A ND2 1 
ATOM   509  N  N   . LYS A 1 70 ? 12.070  5.618   -10.467 1.00 21.64 ? 69   LYS A N   1 
ATOM   510  C  CA  . LYS A 1 70 ? 11.142  6.657   -10.004 1.00 22.27 ? 69   LYS A CA  1 
ATOM   511  C  C   . LYS A 1 70 ? 11.730  7.387   -8.794  1.00 20.73 ? 69   LYS A C   1 
ATOM   512  O  O   . LYS A 1 70 ? 11.736  8.638   -8.769  1.00 24.64 ? 69   LYS A O   1 
ATOM   513  C  CB  . LYS A 1 70 ? 9.761   6.099   -9.715  1.00 18.78 ? 69   LYS A CB  1 
ATOM   514  C  CG  . LYS A 1 70 ? 8.695   7.159   -9.401  1.00 21.82 ? 69   LYS A CG  1 
ATOM   515  C  CD  . LYS A 1 70 ? 8.061   7.683   -10.654 1.00 32.19 ? 69   LYS A CD  1 
ATOM   516  C  CE  . LYS A 1 70 ? 7.081   8.814   -10.358 1.00 37.22 ? 69   LYS A CE  1 
ATOM   517  N  NZ  . LYS A 1 70 ? 6.637   9.395   -11.639 1.00 38.00 ? 69   LYS A NZ  1 
ATOM   518  N  N   . ILE A 1 71 ? 12.272  6.627   -7.842  1.00 21.95 ? 70   ILE A N   1 
ATOM   519  C  CA  . ILE A 1 71 ? 12.870  7.196   -6.645  1.00 22.87 ? 70   ILE A CA  1 
ATOM   520  C  C   . ILE A 1 71 ? 14.098  8.044   -6.958  1.00 26.94 ? 70   ILE A C   1 
ATOM   521  O  O   . ILE A 1 71 ? 14.283  9.099   -6.361  1.00 24.42 ? 70   ILE A O   1 
ATOM   522  C  CB  . ILE A 1 71 ? 13.191  6.106   -5.611  1.00 17.30 ? 70   ILE A CB  1 
ATOM   523  C  CG1 . ILE A 1 71 ? 11.878  5.596   -5.003  1.00 22.85 ? 70   ILE A CG1 1 
ATOM   524  C  CG2 . ILE A 1 71 ? 14.115  6.630   -4.491  1.00 20.72 ? 70   ILE A CG2 1 
ATOM   525  C  CD1 . ILE A 1 71 ? 11.963  4.270   -4.413  1.00 21.40 ? 70   ILE A CD1 1 
ATOM   526  N  N   . LYS A 1 72 ? 14.923  7.611   -7.899  1.00 27.55 ? 71   LYS A N   1 
ATOM   527  C  CA  . LYS A 1 72 ? 16.118  8.376   -8.283  1.00 29.53 ? 71   LYS A CA  1 
ATOM   528  C  C   . LYS A 1 72 ? 15.822  9.592   -9.130  1.00 32.26 ? 71   LYS A C   1 
ATOM   529  O  O   . LYS A 1 72 ? 16.654  10.499  -9.211  1.00 27.70 ? 71   LYS A O   1 
ATOM   530  C  CB  . LYS A 1 72 ? 17.100  7.500   -9.048  1.00 31.39 ? 71   LYS A CB  1 
ATOM   531  C  CG  . LYS A 1 72 ? 17.839  6.557   -8.173  1.00 26.06 ? 71   LYS A CG  1 
ATOM   532  C  CD  . LYS A 1 72 ? 18.399  5.407   -8.992  1.00 29.34 ? 71   LYS A CD  1 
ATOM   533  C  CE  . LYS A 1 72 ? 19.260  4.492   -8.157  1.00 47.28 ? 71   LYS A CE  1 
ATOM   534  N  NZ  . LYS A 1 72 ? 19.356  3.151   -8.795  1.00 51.74 ? 71   LYS A NZ  1 
ATOM   535  N  N   . GLY A 1 73 ? 14.654  9.607   -9.766  1.00 32.96 ? 72   GLY A N   1 
ATOM   536  C  CA  . GLY A 1 73 ? 14.210  10.757  -10.548 1.00 37.18 ? 72   GLY A CA  1 
ATOM   537  C  C   . GLY A 1 73 ? 13.663  11.873  -9.671  1.00 38.29 ? 72   GLY A C   1 
ATOM   538  O  O   . GLY A 1 73 ? 13.446  12.983  -10.142 1.00 38.34 ? 72   GLY A O   1 
ATOM   539  N  N   . CYS A 1 74 ? 13.428  11.570  -8.395  1.00 39.09 ? 73   CYS A N   1 
ATOM   540  C  CA  . CYS A 1 74 ? 12.926  12.565  -7.444  1.00 43.81 ? 73   CYS A CA  1 
ATOM   541  C  C   . CYS A 1 74 ? 14.017  13.526  -7.047  1.00 42.69 ? 73   CYS A C   1 
ATOM   542  O  O   . CYS A 1 74 ? 14.979  13.133  -6.384  1.00 35.52 ? 73   CYS A O   1 
ATOM   543  C  CB  . CYS A 1 74 ? 12.375  11.910  -6.177  1.00 35.66 ? 73   CYS A CB  1 
ATOM   544  S  SG  . CYS A 1 74 ? 10.831  11.071  -6.476  1.00 50.57 ? 73   CYS A SG  1 
ATOM   545  N  N   . THR A 1 75 ? 13.851  14.777  -7.467  1.00 46.01 ? 74   THR A N   1 
ATOM   546  C  CA  . THR A 1 75 ? 14.648  15.891  -6.971  1.00 47.89 ? 74   THR A CA  1 
ATOM   547  C  C   . THR A 1 75 ? 13.838  16.620  -5.905  1.00 45.93 ? 74   THR A C   1 
ATOM   548  O  O   . THR A 1 75 ? 12.603  16.513  -5.859  1.00 40.11 ? 74   THR A O   1 
ATOM   549  C  CB  . THR A 1 75 ? 15.016  16.868  -8.102  1.00 45.75 ? 74   THR A CB  1 
ATOM   550  N  N   . GLY A 1 76 ? 14.536  17.336  -5.030  1.00 43.71 ? 75   GLY A N   1 
ATOM   551  C  CA  . GLY A 1 76 ? 13.882  18.222  -4.074  1.00 43.80 ? 75   GLY A CA  1 
ATOM   552  C  C   . GLY A 1 76 ? 13.252  17.516  -2.893  1.00 41.57 ? 75   GLY A C   1 
ATOM   553  O  O   . GLY A 1 76 ? 13.724  17.658  -1.764  1.00 42.69 ? 75   GLY A O   1 
ATOM   554  N  N   . SER A 1 77 ? 12.165  16.785  -3.147  1.00 37.05 ? 76   SER A N   1 
ATOM   555  C  CA  . SER A 1 77 ? 11.527  15.979  -2.113  1.00 33.24 ? 76   SER A CA  1 
ATOM   556  C  C   . SER A 1 77 ? 11.151  14.576  -2.628  1.00 35.58 ? 76   SER A C   1 
ATOM   557  O  O   . SER A 1 77 ? 10.717  14.412  -3.772  1.00 36.74 ? 76   SER A O   1 
ATOM   558  C  CB  . SER A 1 77 ? 10.279  16.692  -1.585  1.00 26.16 ? 76   SER A CB  1 
ATOM   559  O  OG  . SER A 1 77 ? 9.932   16.229  -0.293  1.00 42.66 ? 76   SER A OG  1 
ATOM   560  N  N   . LEU A 1 78 ? 11.330  13.564  -1.784  1.00 30.64 ? 77   LEU A N   1 
ATOM   561  C  CA  . LEU A 1 78 ? 10.786  12.242  -2.074  1.00 25.69 ? 77   LEU A CA  1 
ATOM   562  C  C   . LEU A 1 78 ? 9.484   12.083  -1.306  1.00 19.69 ? 77   LEU A C   1 
ATOM   563  O  O   . LEU A 1 78 ? 9.501   11.943  -0.097  1.00 24.63 ? 77   LEU A O   1 
ATOM   564  C  CB  . LEU A 1 78 ? 11.778  11.120  -1.696  1.00 27.56 ? 77   LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 78 ? 11.348  9.665   -1.944  1.00 23.22 ? 77   LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 78 ? 10.874  9.430   -3.355  1.00 23.38 ? 77   LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 78 ? 12.484  8.709   -1.617  1.00 25.93 ? 77   LEU A CD2 1 
ATOM   568  N  N   . ASN A 1 79 ? 8.361   12.051  -2.021  1.00 26.01 ? 78   ASN A N   1 
ATOM   569  C  CA  . ASN A 1 79 ? 7.081   11.659  -1.437  1.00 23.57 ? 78   ASN A CA  1 
ATOM   570  C  C   . ASN A 1 79 ? 6.769   10.172  -1.691  1.00 23.60 ? 78   ASN A C   1 
ATOM   571  O  O   . ASN A 1 79 ? 6.815   9.664   -2.840  1.00 22.83 ? 78   ASN A O   1 
ATOM   572  C  CB  . ASN A 1 79 ? 5.944   12.521  -1.988  1.00 23.49 ? 78   ASN A CB  1 
ATOM   573  C  CG  . ASN A 1 79 ? 6.227   13.998  -1.862  1.00 23.89 ? 78   ASN A CG  1 
ATOM   574  O  OD1 . ASN A 1 79 ? 6.197   14.563  -0.766  1.00 26.27 ? 78   ASN A OD1 1 
ATOM   575  N  ND2 . ASN A 1 79 ? 6.491   14.642  -2.989  1.00 26.70 ? 78   ASN A ND2 1 
ATOM   576  N  N   . MET A 1 80 ? 6.438   9.474   -0.606  1.00 24.39 ? 79   MET A N   1 
ATOM   577  C  CA  . MET A 1 80 ? 5.950   8.111   -0.724  1.00 21.25 ? 79   MET A CA  1 
ATOM   578  C  C   . MET A 1 80 ? 4.822   7.874   0.236   1.00 23.83 ? 79   MET A C   1 
ATOM   579  O  O   . MET A 1 80 ? 4.776   8.443   1.330   1.00 21.22 ? 79   MET A O   1 
ATOM   580  C  CB  . MET A 1 80 ? 7.057   7.094   -0.434  1.00 20.99 ? 79   MET A CB  1 
ATOM   581  C  CG  . MET A 1 80 ? 8.253   7.184   -1.328  1.00 22.87 ? 79   MET A CG  1 
ATOM   582  S  SD  . MET A 1 80 ? 9.405   5.830   -0.983  1.00 25.28 ? 79   MET A SD  1 
ATOM   583  C  CE  . MET A 1 80 ? 10.069  6.355   0.590   1.00 24.57 ? 79   MET A CE  1 
ATOM   584  N  N   . THR A 1 81 ? 3.917   6.997   -0.163  1.00 19.96 ? 80   THR A N   1 
ATOM   585  C  CA  . THR A 1 81 ? 2.916   6.491   0.774   1.00 21.16 ? 80   THR A CA  1 
ATOM   586  C  C   . THR A 1 81 ? 3.211   5.021   0.976   1.00 21.33 ? 80   THR A C   1 
ATOM   587  O  O   . THR A 1 81 ? 3.527   4.310   0.003   1.00 17.34 ? 80   THR A O   1 
ATOM   588  C  CB  . THR A 1 81 ? 1.470   6.727   0.275   1.00 20.83 ? 80   THR A CB  1 
ATOM   589  O  OG1 . THR A 1 81 ? 1.251   8.142   0.170   1.00 20.12 ? 80   THR A OG1 1 
ATOM   590  C  CG2 . THR A 1 81 ? 0.462   6.105   1.203   1.00 28.62 ? 80   THR A CG2 1 
ATOM   591  N  N   . LEU A 1 82 ? 3.159   4.597   2.229   1.00 20.88 ? 81   LEU A N   1 
ATOM   592  C  CA  . LEU A 1 82 ? 3.492   3.252   2.626   1.00 21.19 ? 81   LEU A CA  1 
ATOM   593  C  C   . LEU A 1 82 ? 2.408   2.652   3.504   1.00 26.45 ? 81   LEU A C   1 
ATOM   594  O  O   . LEU A 1 82 ? 1.590   3.363   4.093   1.00 21.17 ? 81   LEU A O   1 
ATOM   595  C  CB  . LEU A 1 82 ? 4.833   3.223   3.362   1.00 20.77 ? 81   LEU A CB  1 
ATOM   596  C  CG  . LEU A 1 82 ? 6.079   3.710   2.624   1.00 20.98 ? 81   LEU A CG  1 
ATOM   597  C  CD1 . LEU A 1 82 ? 6.356   5.177   2.899   1.00 25.65 ? 81   LEU A CD1 1 
ATOM   598  C  CD2 . LEU A 1 82 ? 7.318   2.862   2.951   1.00 25.02 ? 81   LEU A CD2 1 
ATOM   599  N  N   . GLN A 1 83 ? 2.449   1.326   3.585   1.00 19.72 ? 82   GLN A N   1 
ATOM   600  C  CA  . GLN A 1 83 ? 1.539   0.493   4.364   1.00 22.39 ? 82   GLN A CA  1 
ATOM   601  C  C   . GLN A 1 83 ? 2.377   -0.130  5.478   1.00 20.78 ? 82   GLN A C   1 
ATOM   602  O  O   . GLN A 1 83 ? 3.430   -0.696  5.238   1.00 22.11 ? 82   GLN A O   1 
ATOM   603  C  CB  . GLN A 1 83 ? 0.962   -0.540  3.413   1.00 25.94 ? 82   GLN A CB  1 
ATOM   604  C  CG  . GLN A 1 83 ? -0.198  -1.347  3.902   1.00 37.30 ? 82   GLN A CG  1 
ATOM   605  C  CD  . GLN A 1 83 ? -0.703  -2.255  2.800   1.00 32.09 ? 82   GLN A CD  1 
ATOM   606  O  OE1 . GLN A 1 83 ? -1.741  -1.993  2.195   1.00 46.80 ? 82   GLN A OE1 1 
ATOM   607  N  NE2 . GLN A 1 83 ? 0.060   -3.299  2.495   1.00 34.00 ? 82   GLN A NE2 1 
ATOM   608  N  N   . ARG A 1 84 ? 1.936   0.021   6.722   1.00 23.47 ? 83   ARG A N   1 
ATOM   609  C  CA  . ARG A 1 84 ? 2.705   -0.501  7.844   1.00 24.98 ? 83   ARG A CA  1 
ATOM   610  C  C   . ARG A 1 84 ? 2.616   -2.006  7.766   1.00 29.93 ? 83   ARG A C   1 
ATOM   611  O  O   . ARG A 1 84 ? 1.515   -2.537  7.661   1.00 24.91 ? 83   ARG A O   1 
ATOM   612  C  CB  . ARG A 1 84 ? 2.143   -0.034  9.192   1.00 26.02 ? 83   ARG A CB  1 
ATOM   613  C  CG  . ARG A 1 84 ? 2.444   1.392   9.506   1.00 25.62 ? 83   ARG A CG  1 
ATOM   614  C  CD  . ARG A 1 84 ? 3.910   1.600   9.777   1.00 20.52 ? 83   ARG A CD  1 
ATOM   615  N  NE  . ARG A 1 84 ? 4.150   2.931   10.324  1.00 26.88 ? 83   ARG A NE  1 
ATOM   616  C  CZ  . ARG A 1 84 ? 5.328   3.547   10.378  1.00 24.34 ? 83   ARG A CZ  1 
ATOM   617  N  NH1 . ARG A 1 84 ? 6.452   2.962   9.974   1.00 27.07 ? 83   ARG A NH1 1 
ATOM   618  N  NH2 . ARG A 1 84 ? 5.377   4.778   10.887  1.00 26.31 ? 83   ARG A NH2 1 
ATOM   619  N  N   . GLU A 1 85 ? 3.769   -2.684  7.729   1.00 22.34 ? 84   GLU A N   1 
ATOM   620  C  CA  . GLU A 1 85 ? 3.816   -4.127  7.844   1.00 24.23 ? 84   GLU A CA  1 
ATOM   621  C  C   . GLU A 1 85 ? 4.926   -4.560  8.791   1.00 24.55 ? 84   GLU A C   1 
ATOM   622  O  O   . GLU A 1 85 ? 5.328   -5.704  8.825   1.00 27.18 ? 84   GLU A O   1 
ATOM   623  C  CB  . GLU A 1 85 ? 3.883   -4.776  6.458   1.00 25.46 ? 84   GLU A CB  1 
ATOM   624  C  CG  . GLU A 1 85 ? 2.541   -4.581  5.702   1.00 26.76 ? 84   GLU A CG  1 
ATOM   625  C  CD  . GLU A 1 85 ? 2.374   -5.471  4.500   1.00 31.03 ? 84   GLU A CD  1 
ATOM   626  O  OE1 . GLU A 1 85 ? 2.721   -6.669  4.587   1.00 53.81 ? 84   GLU A OE1 1 
ATOM   627  O  OE2 . GLU A 1 85 ? 1.879   -4.971  3.462   1.00 44.59 ? 84   GLU A OE2 1 
ATOM   628  N  N   . SER A 1 86 ? 5.312   -3.632  9.653   1.00 19.96 ? 85   SER A N   1 
ATOM   629  C  CA  . SER A 1 86 ? 6.354   -3.826  10.655  1.00 21.64 ? 85   SER A CA  1 
ATOM   630  C  C   . SER A 1 86 ? 5.822   -4.103  12.073  1.00 18.49 ? 85   SER A C   1 
ATOM   631  O  O   . SER A 1 86 ? 6.608   -4.434  12.967  1.00 15.95 ? 85   SER A O   1 
ATOM   632  C  CB  . SER A 1 86 ? 7.259   -2.605  10.636  1.00 21.43 ? 85   SER A CB  1 
ATOM   633  O  OG  . SER A 1 86 ? 6.485   -1.408  10.635  1.00 21.18 ? 85   SER A OG  1 
ATOM   634  N  N   . ASP A 1 87 ? 4.506   -3.973  12.311  1.00 21.13 ? 86   ASP A N   1 
ATOM   635  C  CA  . ASP A 1 87 ? 3.913   -4.372  13.583  1.00 20.03 ? 86   ASP A CA  1 
ATOM   636  C  C   . ASP A 1 87 ? 3.588   -5.848  13.482  1.00 23.66 ? 86   ASP A C   1 
ATOM   637  O  O   . ASP A 1 87 ? 2.727   -6.275  12.686  1.00 24.87 ? 86   ASP A O   1 
ATOM   638  C  CB  . ASP A 1 87 ? 2.659   -3.574  13.919  1.00 24.79 ? 86   ASP A CB  1 
ATOM   639  C  CG  . ASP A 1 87 ? 2.980   -2.159  14.264  1.00 21.93 ? 86   ASP A CG  1 
ATOM   640  O  OD1 . ASP A 1 87 ? 3.484   -1.933  15.373  1.00 27.59 ? 86   ASP A OD1 1 
ATOM   641  O  OD2 . ASP A 1 87 ? 2.718   -1.289  13.425  1.00 25.87 ? 86   ASP A OD2 1 
ATOM   642  N  N   . LEU A 1 88 ? 4.333   -6.626  14.238  1.00 16.30 ? 87   LEU A N   1 
ATOM   643  C  CA  . LEU A 1 88 ? 4.276   -8.078  14.113  1.00 15.24 ? 87   LEU A CA  1 
ATOM   644  C  C   . LEU A 1 88 ? 3.160   -8.695  14.965  1.00 19.70 ? 87   LEU A C   1 
ATOM   645  O  O   . LEU A 1 88 ? 2.703   -8.148  15.988  1.00 17.20 ? 87   LEU A O   1 
ATOM   646  C  CB  . LEU A 1 88 ? 5.649   -8.693  14.404  1.00 17.19 ? 87   LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 88 ? 6.840   -8.072  13.701  1.00 18.12 ? 87   LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 88 ? 8.105   -8.795  14.028  1.00 20.06 ? 87   LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 88 ? 6.623   -7.988  12.165  1.00 16.54 ? 87   LEU A CD2 1 
ATOM   650  O  OXT . LEU A 1 88 ? 2.652   -9.782  14.631  1.00 18.64 ? 87   LEU A OXT 1 
ATOM   651  N  N   . SER B 1 3  ? 18.438  -16.020 33.121  1.00 53.14 ? 2    SER B N   1 
ATOM   652  C  CA  . SER B 1 3  ? 17.831  -14.846 32.425  1.00 47.87 ? 2    SER B CA  1 
ATOM   653  C  C   . SER B 1 3  ? 17.574  -15.114 30.918  1.00 42.18 ? 2    SER B C   1 
ATOM   654  O  O   . SER B 1 3  ? 17.558  -14.183 30.109  1.00 40.89 ? 2    SER B O   1 
ATOM   655  C  CB  . SER B 1 3  ? 18.719  -13.611 32.623  1.00 46.05 ? 2    SER B CB  1 
ATOM   656  O  OG  . SER B 1 3  ? 19.969  -13.766 31.983  1.00 45.36 ? 2    SER B OG  1 
ATOM   657  N  N   . ASN B 1 4  ? 17.403  -16.386 30.555  1.00 24.53 ? 3    ASN B N   1 
ATOM   658  C  CA  . ASN B 1 4  ? 17.012  -16.762 29.187  1.00 23.07 ? 3    ASN B CA  1 
ATOM   659  C  C   . ASN B 1 4  ? 15.688  -17.454 29.337  1.00 19.19 ? 3    ASN B C   1 
ATOM   660  O  O   . ASN B 1 4  ? 15.449  -18.106 30.359  1.00 22.87 ? 3    ASN B O   1 
ATOM   661  C  CB  . ASN B 1 4  ? 17.999  -17.731 28.552  1.00 20.44 ? 3    ASN B CB  1 
ATOM   662  C  CG  . ASN B 1 4  ? 19.144  -17.050 27.823  1.00 30.53 ? 3    ASN B CG  1 
ATOM   663  O  OD1 . ASN B 1 4  ? 19.442  -15.872 28.027  1.00 27.27 ? 3    ASN B OD1 1 
ATOM   664  N  ND2 . ASN B 1 4  ? 19.803  -17.814 26.957  1.00 36.78 ? 3    ASN B ND2 1 
ATOM   665  N  N   . TYR B 1 5  ? 14.838  -17.351 28.315  1.00 13.17 ? 4    TYR B N   1 
ATOM   666  C  CA  . TYR B 1 5  ? 13.488  -17.877 28.407  1.00 12.80 ? 4    TYR B CA  1 
ATOM   667  C  C   . TYR B 1 5  ? 12.916  -18.136 27.029  1.00 16.81 ? 4    TYR B C   1 
ATOM   668  O  O   . TYR B 1 5  ? 13.434  -17.609 26.023  1.00 18.42 ? 4    TYR B O   1 
ATOM   669  C  CB  . TYR B 1 5  ? 12.617  -16.921 29.224  1.00 18.15 ? 4    TYR B CB  1 
ATOM   670  C  CG  . TYR B 1 5  ? 12.281  -15.610 28.518  1.00 17.54 ? 4    TYR B CG  1 
ATOM   671  C  CD1 . TYR B 1 5  ? 13.207  -14.559 28.438  1.00 20.68 ? 4    TYR B CD1 1 
ATOM   672  C  CD2 . TYR B 1 5  ? 11.043  -15.442 27.917  1.00 20.81 ? 4    TYR B CD2 1 
ATOM   673  C  CE1 . TYR B 1 5  ? 12.881  -13.358 27.800  1.00 23.97 ? 4    TYR B CE1 1 
ATOM   674  C  CE2 . TYR B 1 5  ? 10.716  -14.245 27.286  1.00 14.03 ? 4    TYR B CE2 1 
ATOM   675  C  CZ  . TYR B 1 5  ? 11.623  -13.213 27.211  1.00 19.42 ? 4    TYR B CZ  1 
ATOM   676  O  OH  . TYR B 1 5  ? 11.265  -12.038 26.571  1.00 18.69 ? 4    TYR B OH  1 
ATOM   677  N  N   . SER B 1 6  ? 11.862  -18.936 26.983  1.00 17.43 ? 5    SER B N   1 
ATOM   678  C  CA  . SER B 1 6  ? 11.171  -19.256 25.747  1.00 21.13 ? 5    SER B CA  1 
ATOM   679  C  C   . SER B 1 6  ? 9.694   -18.879 25.850  1.00 19.67 ? 5    SER B C   1 
ATOM   680  O  O   . SER B 1 6  ? 9.119   -18.880 26.931  1.00 21.21 ? 5    SER B O   1 
ATOM   681  C  CB  A SER B 1 6  ? 11.252  -20.750 25.462  0.60 23.42 ? 5    SER B CB  1 
ATOM   682  C  CB  B SER B 1 6  ? 11.354  -20.733 25.422  0.40 23.16 ? 5    SER B CB  1 
ATOM   683  O  OG  A SER B 1 6  ? 10.375  -21.452 26.321  0.60 22.53 ? 5    SER B OG  1 
ATOM   684  O  OG  B SER B 1 6  ? 12.739  -21.015 25.275  0.40 14.33 ? 5    SER B OG  1 
ATOM   685  N  N   . VAL B 1 7  ? 9.107   -18.530 24.700  1.00 22.60 ? 6    VAL B N   1 
ATOM   686  C  CA  . VAL B 1 7  ? 7.669   -18.299 24.586  1.00 19.21 ? 6    VAL B CA  1 
ATOM   687  C  C   . VAL B 1 7  ? 7.112   -19.097 23.432  1.00 18.33 ? 6    VAL B C   1 
ATOM   688  O  O   . VAL B 1 7  ? 7.830   -19.481 22.507  1.00 17.76 ? 6    VAL B O   1 
ATOM   689  C  CB  . VAL B 1 7  ? 7.300   -16.790 24.325  1.00 21.34 ? 6    VAL B CB  1 
ATOM   690  C  CG1 . VAL B 1 7  ? 7.858   -15.907 25.413  1.00 20.19 ? 6    VAL B CG1 1 
ATOM   691  C  CG2 . VAL B 1 7  ? 7.764   -16.333 22.939  1.00 24.62 ? 6    VAL B CG2 1 
ATOM   692  N  N   . SER B 1 8  ? 5.810   -19.360 23.514  1.00 17.46 ? 7    SER B N   1 
ATOM   693  C  CA  . SER B 1 8  ? 5.049   -20.067 22.489  1.00 20.19 ? 7    SER B CA  1 
ATOM   694  C  C   . SER B 1 8  ? 3.699   -19.367 22.431  1.00 19.27 ? 7    SER B C   1 
ATOM   695  O  O   . SER B 1 8  ? 2.810   -19.607 23.254  1.00 22.74 ? 7    SER B O   1 
ATOM   696  C  CB  . SER B 1 8  ? 4.904   -21.555 22.840  1.00 24.10 ? 7    SER B CB  1 
ATOM   697  O  OG  . SER B 1 8  ? 4.275   -22.271 21.792  1.00 24.02 ? 7    SER B OG  1 
ATOM   698  N  N   . LEU B 1 9  ? 3.576   -18.439 21.485  1.00 18.20 ? 8    LEU B N   1 
ATOM   699  C  CA  . LEU B 1 9  ? 2.393   -17.596 21.395  1.00 16.76 ? 8    LEU B CA  1 
ATOM   700  C  C   . LEU B 1 9  ? 1.387   -18.322 20.509  1.00 18.37 ? 8    LEU B C   1 
ATOM   701  O  O   . LEU B 1 9  ? 1.720   -18.731 19.416  1.00 21.06 ? 8    LEU B O   1 
ATOM   702  C  CB  . LEU B 1 9  ? 2.725   -16.209 20.815  1.00 15.78 ? 8    LEU B CB  1 
ATOM   703  C  CG  . LEU B 1 9  ? 3.892   -15.451 21.457  1.00 17.32 ? 8    LEU B CG  1 
ATOM   704  C  CD1 . LEU B 1 9  ? 4.114   -14.131 20.689  1.00 17.17 ? 8    LEU B CD1 1 
ATOM   705  C  CD2 . LEU B 1 9  ? 3.689   -15.232 22.955  1.00 22.39 ? 8    LEU B CD2 1 
ATOM   706  N  N   . VAL B 1 10 ? 0.168   -18.505 20.990  1.00 17.86 ? 9    VAL B N   1 
ATOM   707  C  CA  . VAL B 1 10 ? -0.831  -19.195 20.211  1.00 17.00 ? 9    VAL B CA  1 
ATOM   708  C  C   . VAL B 1 10 ? -1.305  -18.258 19.101  1.00 14.98 ? 9    VAL B C   1 
ATOM   709  O  O   . VAL B 1 10 ? -1.656  -17.134 19.365  1.00 19.61 ? 9    VAL B O   1 
ATOM   710  C  CB  . VAL B 1 10 ? -2.037  -19.566 21.100  1.00 20.25 ? 9    VAL B CB  1 
ATOM   711  C  CG1 . VAL B 1 10 ? -3.092  -20.295 20.293  1.00 24.88 ? 9    VAL B CG1 1 
ATOM   712  C  CG2 . VAL B 1 10 ? -1.556  -20.358 22.318  1.00 22.76 ? 9    VAL B CG2 1 
ATOM   713  N  N   . GLY B 1 11 ? -1.375  -18.764 17.878  1.00 16.05 ? 10   GLY B N   1 
ATOM   714  C  CA  . GLY B 1 11 ? -1.785  -17.958 16.735  1.00 20.56 ? 10   GLY B CA  1 
ATOM   715  C  C   . GLY B 1 11 ? -3.288  -17.772 16.680  1.00 20.28 ? 10   GLY B C   1 
ATOM   716  O  O   . GLY B 1 11 ? -4.009  -18.351 17.456  1.00 18.68 ? 10   GLY B O   1 
ATOM   717  N  N   . PRO B 1 12 ? -3.770  -16.959 15.744  1.00 20.58 ? 11   PRO B N   1 
ATOM   718  C  CA  . PRO B 1 12 ? -2.898  -16.321 14.774  1.00 17.70 ? 11   PRO B CA  1 
ATOM   719  C  C   . PRO B 1 12 ? -2.397  -14.959 15.242  1.00 18.70 ? 11   PRO B C   1 
ATOM   720  O  O   . PRO B 1 12 ? -2.737  -14.489 16.335  1.00 20.70 ? 11   PRO B O   1 
ATOM   721  C  CB  . PRO B 1 12 ? -3.828  -16.155 13.578  1.00 19.34 ? 11   PRO B CB  1 
ATOM   722  C  CG  . PRO B 1 12 ? -5.120  -15.841 14.211  1.00 19.43 ? 11   PRO B CG  1 
ATOM   723  C  CD  . PRO B 1 12 ? -5.169  -16.581 15.529  1.00 25.78 ? 11   PRO B CD  1 
ATOM   724  N  N   . ALA B 1 13 ? -1.573  -14.347 14.398  1.00 20.72 ? 12   ALA B N   1 
ATOM   725  C  CA  . ALA B 1 13 ? -1.085  -12.982 14.602  1.00 18.54 ? 12   ALA B CA  1 
ATOM   726  C  C   . ALA B 1 13 ? -2.265  -12.008 14.490  1.00 18.03 ? 12   ALA B C   1 
ATOM   727  O  O   . ALA B 1 13 ? -3.342  -12.413 14.053  1.00 20.57 ? 12   ALA B O   1 
ATOM   728  C  CB  . ALA B 1 13 ? 0.008   -12.642 13.582  1.00 17.82 ? 12   ALA B CB  1 
ATOM   729  N  N   . PRO B 1 14 ? -2.071  -10.728 14.856  1.00 20.28 ? 13   PRO B N   1 
ATOM   730  C  CA  . PRO B 1 14 ? -0.851  -10.091 15.359  1.00 19.86 ? 13   PRO B CA  1 
ATOM   731  C  C   . PRO B 1 14 ? -0.285  -10.699 16.637  1.00 18.49 ? 13   PRO B C   1 
ATOM   732  O  O   . PRO B 1 14 ? -1.043  -11.027 17.580  1.00 18.49 ? 13   PRO B O   1 
ATOM   733  C  CB  . PRO B 1 14 ? -1.276  -8.644  15.637  1.00 23.80 ? 13   PRO B CB  1 
ATOM   734  C  CG  . PRO B 1 14 ? -2.526  -8.441  14.920  1.00 27.62 ? 13   PRO B CG  1 
ATOM   735  C  CD  . PRO B 1 14 ? -3.180  -9.767  14.723  1.00 19.82 ? 13   PRO B CD  1 
ATOM   736  N  N   . TRP B 1 15 ? 1.038   -10.820 16.642  1.00 17.03 ? 14   TRP B N   1 
ATOM   737  C  CA  . TRP B 1 15 ? 1.801   -11.250 17.815  1.00 15.35 ? 14   TRP B CA  1 
ATOM   738  C  C   . TRP B 1 15 ? 1.958   -10.156 18.889  1.00 16.81 ? 14   TRP B C   1 
ATOM   739  O  O   . TRP B 1 15 ? 2.129   -10.509 20.081  1.00 16.78 ? 14   TRP B O   1 
ATOM   740  C  CB  . TRP B 1 15 ? 3.163   -11.815 17.374  1.00 18.56 ? 14   TRP B CB  1 
ATOM   741  C  CG  . TRP B 1 15 ? 3.088   -12.891 16.306  1.00 19.96 ? 14   TRP B CG  1 
ATOM   742  C  CD1 . TRP B 1 15 ? 3.631   -12.848 15.055  1.00 18.55 ? 14   TRP B CD1 1 
ATOM   743  C  CD2 . TRP B 1 15 ? 2.456   -14.173 16.418  1.00 15.70 ? 14   TRP B CD2 1 
ATOM   744  N  NE1 . TRP B 1 15 ? 3.394   -14.033 14.388  1.00 19.29 ? 14   TRP B NE1 1 
ATOM   745  C  CE2 . TRP B 1 15 ? 2.664   -14.855 15.193  1.00 17.96 ? 14   TRP B CE2 1 
ATOM   746  C  CE3 . TRP B 1 15 ? 1.723   -14.821 17.431  1.00 14.17 ? 14   TRP B CE3 1 
ATOM   747  C  CZ2 . TRP B 1 15 ? 2.150   -16.143 14.948  1.00 21.10 ? 14   TRP B CZ2 1 
ATOM   748  C  CZ3 . TRP B 1 15 ? 1.224   -16.093 17.181  1.00 20.00 ? 14   TRP B CZ3 1 
ATOM   749  C  CH2 . TRP B 1 15 ? 1.468   -16.744 15.960  1.00 18.17 ? 14   TRP B CH2 1 
ATOM   750  N  N   . GLY B 1 16 ? 1.923   -8.871  18.502  1.00 16.52 ? 15   GLY B N   1 
ATOM   751  C  CA  . GLY B 1 16 ? 1.959   -7.798  19.481  1.00 17.00 ? 15   GLY B CA  1 
ATOM   752  C  C   . GLY B 1 16 ? 3.335   -7.241  19.795  1.00 15.97 ? 15   GLY B C   1 
ATOM   753  O  O   . GLY B 1 16 ? 3.543   -6.800  20.910  1.00 18.01 ? 15   GLY B O   1 
ATOM   754  N  N   . PHE B 1 17 ? 4.257   -7.178  18.842  1.00 15.60 ? 16   PHE B N   1 
ATOM   755  C  CA  . PHE B 1 17 ? 5.531   -6.551  19.104  1.00 13.69 ? 16   PHE B CA  1 
ATOM   756  C  C   . PHE B 1 17 ? 6.192   -6.022  17.859  1.00 16.02 ? 16   PHE B C   1 
ATOM   757  O  O   . PHE B 1 17 ? 5.812   -6.388  16.753  1.00 16.06 ? 16   PHE B O   1 
ATOM   758  C  CB  . PHE B 1 17 ? 6.443   -7.511  19.890  1.00 16.17 ? 16   PHE B CB  1 
ATOM   759  C  CG  . PHE B 1 17 ? 6.887   -8.716  19.105  1.00 14.47 ? 16   PHE B CG  1 
ATOM   760  C  CD1 . PHE B 1 17 ? 8.120   -8.727  18.488  1.00 13.95 ? 16   PHE B CD1 1 
ATOM   761  C  CD2 . PHE B 1 17 ? 6.106   -9.848  18.985  1.00 16.66 ? 16   PHE B CD2 1 
ATOM   762  C  CE1 . PHE B 1 17 ? 8.574   -9.868  17.801  1.00 15.27 ? 16   PHE B CE1 1 
ATOM   763  C  CE2 . PHE B 1 17 ? 6.546   -10.977 18.221  1.00 15.14 ? 16   PHE B CE2 1 
ATOM   764  C  CZ  . PHE B 1 17 ? 7.759   -10.978 17.636  1.00 15.41 ? 16   PHE B CZ  1 
ATOM   765  N  N   . ARG B 1 18 ? 7.193   -5.180  18.063  1.00 13.11 ? 17   ARG B N   1 
ATOM   766  C  CA  . ARG B 1 18 ? 8.136   -4.810  17.002  1.00 14.92 ? 17   ARG B CA  1 
ATOM   767  C  C   . ARG B 1 18 ? 9.565   -5.130  17.447  1.00 15.16 ? 17   ARG B C   1 
ATOM   768  O  O   . ARG B 1 18 ? 9.846   -5.302  18.654  1.00 16.68 ? 17   ARG B O   1 
ATOM   769  C  CB  . ARG B 1 18 ? 8.034   -3.336  16.592  1.00 15.62 ? 17   ARG B CB  1 
ATOM   770  C  CG  . ARG B 1 18 ? 6.681   -2.927  15.991  1.00 20.26 ? 17   ARG B CG  1 
ATOM   771  C  CD  . ARG B 1 18 ? 6.750   -1.575  15.314  1.00 21.82 ? 17   ARG B CD  1 
ATOM   772  N  NE  . ARG B 1 18 ? 7.139   -0.502  16.195  1.00 26.53 ? 17   ARG B NE  1 
ATOM   773  C  CZ  . ARG B 1 18 ? 6.275   0.309   16.798  1.00 26.10 ? 17   ARG B CZ  1 
ATOM   774  N  NH1 . ARG B 1 18 ? 4.971   0.163   16.619  1.00 23.61 ? 17   ARG B NH1 1 
ATOM   775  N  NH2 . ARG B 1 18 ? 6.719   1.293   17.572  1.00 32.40 ? 17   ARG B NH2 1 
ATOM   776  N  N   . LEU B 1 19 ? 10.429  -5.221  16.441  1.00 17.37 ? 18   LEU B N   1 
ATOM   777  C  CA  . LEU B 1 19 ? 11.865  -5.387  16.598  1.00 16.72 ? 18   LEU B CA  1 
ATOM   778  C  C   . LEU B 1 19 ? 12.691  -4.160  16.184  1.00 14.70 ? 18   LEU B C   1 
ATOM   779  O  O   . LEU B 1 19 ? 12.316  -3.394  15.297  1.00 16.20 ? 18   LEU B O   1 
ATOM   780  C  CB  . LEU B 1 19 ? 12.329  -6.563  15.741  1.00 19.46 ? 18   LEU B CB  1 
ATOM   781  C  CG  . LEU B 1 19 ? 11.790  -7.900  16.203  1.00 17.48 ? 18   LEU B CG  1 
ATOM   782  C  CD1 . LEU B 1 19 ? 12.090  -8.958  15.142  1.00 22.81 ? 18   LEU B CD1 1 
ATOM   783  C  CD2 . LEU B 1 19 ? 12.257  -8.320  17.626  1.00 22.88 ? 18   LEU B CD2 1 
ATOM   784  N  N   . GLN B 1 20 ? 13.886  -4.074  16.778  1.00 14.72 ? 19   GLN B N   1 
ATOM   785  C  CA  . GLN B 1 20 ? 14.988  -3.263  16.240  1.00 12.42 ? 19   GLN B CA  1 
ATOM   786  C  C   . GLN B 1 20 ? 16.236  -4.134  16.125  1.00 14.24 ? 19   GLN B C   1 
ATOM   787  O  O   . GLN B 1 20 ? 16.294  -5.182  16.712  1.00 15.71 ? 19   GLN B O   1 
ATOM   788  C  CB  A GLN B 1 20 ? 15.251  -2.034  17.120  0.50 19.38 ? 19   GLN B CB  1 
ATOM   789  C  CB  B GLN B 1 20 ? 15.274  -2.057  17.145  0.50 20.13 ? 19   GLN B CB  1 
ATOM   790  C  CG  A GLN B 1 20 ? 15.785  -2.401  18.489  0.50 15.17 ? 19   GLN B CG  1 
ATOM   791  C  CG  B GLN B 1 20 ? 14.291  -0.913  17.012  0.50 22.77 ? 19   GLN B CG  1 
ATOM   792  C  CD  A GLN B 1 20 ? 16.167  -1.211  19.358  0.50 25.30 ? 19   GLN B CD  1 
ATOM   793  C  CD  B GLN B 1 20 ? 14.625  0.268   17.905  0.50 20.22 ? 19   GLN B CD  1 
ATOM   794  O  OE1 A GLN B 1 20 ? 17.081  -1.298  20.177  0.50 31.80 ? 19   GLN B OE1 1 
ATOM   795  O  OE1 B GLN B 1 20 ? 15.598  0.238   18.660  0.50 39.55 ? 19   GLN B OE1 1 
ATOM   796  N  NE2 A GLN B 1 20 ? 15.465  -0.121  19.200  0.50 16.05 ? 19   GLN B NE2 1 
ATOM   797  N  NE2 B GLN B 1 20 ? 13.823  1.324   17.809  0.50 23.16 ? 19   GLN B NE2 1 
ATOM   798  N  N   . GLY B 1 21 ? 17.227  -3.695  15.359  1.00 17.04 ? 20   GLY B N   1 
ATOM   799  C  CA  . GLY B 1 21 ? 18.453  -4.463  15.244  1.00 18.12 ? 20   GLY B CA  1 
ATOM   800  C  C   . GLY B 1 21 ? 18.489  -5.466  14.110  1.00 20.51 ? 20   GLY B C   1 
ATOM   801  O  O   . GLY B 1 21 ? 17.679  -5.445  13.194  1.00 21.48 ? 20   GLY B O   1 
ATOM   802  N  N   . GLY B 1 22 ? 19.451  -6.362  14.209  1.00 20.34 ? 21   GLY B N   1 
ATOM   803  C  CA  . GLY B 1 22 ? 19.646  -7.380  13.229  1.00 18.56 ? 21   GLY B CA  1 
ATOM   804  C  C   . GLY B 1 22 ? 21.057  -7.298  12.735  1.00 22.52 ? 21   GLY B C   1 
ATOM   805  O  O   . GLY B 1 22 ? 21.786  -6.334  13.015  1.00 22.49 ? 21   GLY B O   1 
ATOM   806  N  N   . LYS B 1 23 ? 21.430  -8.304  11.975  1.00 19.44 ? 22   LYS B N   1 
ATOM   807  C  CA  . LYS B 1 23 ? 22.806  -8.453  11.572  1.00 22.03 ? 22   LYS B CA  1 
ATOM   808  C  C   . LYS B 1 23 ? 23.313  -7.262  10.725  1.00 21.87 ? 22   LYS B C   1 
ATOM   809  O  O   . LYS B 1 23 ? 24.493  -6.809  10.849  1.00 22.39 ? 22   LYS B O   1 
ATOM   810  C  CB  . LYS B 1 23 ? 22.985  -9.790  10.853  1.00 21.26 ? 22   LYS B CB  1 
ATOM   811  C  CG  . LYS B 1 23 ? 24.439  -10.200 10.703  1.00 26.94 ? 22   LYS B CG  1 
ATOM   812  C  CD  . LYS B 1 23 ? 25.206  -10.091 12.041  1.00 27.95 ? 22   LYS B CD  1 
ATOM   813  C  CE  . LYS B 1 23 ? 26.633  -10.602 11.924  1.00 45.30 ? 22   LYS B CE  1 
ATOM   814  N  NZ  . LYS B 1 23 ? 27.419  -10.340 13.169  1.00 34.01 ? 22   LYS B NZ  1 
ATOM   815  N  N   . ASP B 1 24 ? 22.419  -6.735  9.884   1.00 19.09 ? 23   ASP B N   1 
ATOM   816  C  CA  . ASP B 1 24 ? 22.744  -5.574  9.035   1.00 21.73 ? 23   ASP B CA  1 
ATOM   817  C  C   . ASP B 1 24 ? 23.053  -4.281  9.820   1.00 22.19 ? 23   ASP B C   1 
ATOM   818  O  O   . ASP B 1 24 ? 23.645  -3.332  9.286   1.00 24.31 ? 23   ASP B O   1 
ATOM   819  C  CB  . ASP B 1 24 ? 21.666  -5.342  7.925   1.00 19.73 ? 23   ASP B CB  1 
ATOM   820  C  CG  . ASP B 1 24 ? 20.190  -5.499  8.402   1.00 26.88 ? 23   ASP B CG  1 
ATOM   821  O  OD1 . ASP B 1 24 ? 19.862  -6.224  9.387   1.00 20.10 ? 23   ASP B OD1 1 
ATOM   822  O  OD2 . ASP B 1 24 ? 19.335  -4.869  7.727   1.00 26.90 ? 23   ASP B OD2 1 
ATOM   823  N  N   . PHE B 1 25 ? 22.660  -4.254  11.083  1.00 23.81 ? 24   PHE B N   1 
ATOM   824  C  CA  . PHE B 1 25 ? 22.909  -3.134  11.966  1.00 26.53 ? 24   PHE B CA  1 
ATOM   825  C  C   . PHE B 1 25 ? 24.050  -3.391  12.949  1.00 28.11 ? 24   PHE B C   1 
ATOM   826  O  O   . PHE B 1 25 ? 24.412  -2.506  13.726  1.00 28.88 ? 24   PHE B O   1 
ATOM   827  C  CB  . PHE B 1 25 ? 21.643  -2.852  12.745  1.00 27.21 ? 24   PHE B CB  1 
ATOM   828  C  CG  . PHE B 1 25 ? 20.532  -2.356  11.893  1.00 28.80 ? 24   PHE B CG  1 
ATOM   829  C  CD1 . PHE B 1 25 ? 20.442  -1.010  11.582  1.00 36.28 ? 24   PHE B CD1 1 
ATOM   830  C  CD2 . PHE B 1 25 ? 19.587  -3.231  11.382  1.00 30.52 ? 24   PHE B CD2 1 
ATOM   831  C  CE1 . PHE B 1 25 ? 19.419  -0.538  10.782  1.00 44.41 ? 24   PHE B CE1 1 
ATOM   832  C  CE2 . PHE B 1 25 ? 18.561  -2.772  10.576  1.00 37.96 ? 24   PHE B CE2 1 
ATOM   833  C  CZ  . PHE B 1 25 ? 18.470  -1.423  10.279  1.00 40.92 ? 24   PHE B CZ  1 
ATOM   834  N  N   . ASN B 1 26 ? 24.618  -4.591  12.912  1.00 21.06 ? 25   ASN B N   1 
ATOM   835  C  CA  . ASN B 1 26 ? 25.512  -5.056  13.974  1.00 21.71 ? 25   ASN B CA  1 
ATOM   836  C  C   . ASN B 1 26 ? 24.900  -4.894  15.367  1.00 27.41 ? 25   ASN B C   1 
ATOM   837  O  O   . ASN B 1 26 ? 25.576  -4.456  16.317  1.00 27.10 ? 25   ASN B O   1 
ATOM   838  C  CB  . ASN B 1 26 ? 26.874  -4.340  13.933  1.00 21.70 ? 25   ASN B CB  1 
ATOM   839  C  CG  . ASN B 1 26 ? 27.850  -4.930  14.927  1.00 21.94 ? 25   ASN B CG  1 
ATOM   840  O  OD1 . ASN B 1 26 ? 28.056  -6.151  14.953  1.00 29.80 ? 25   ASN B OD1 1 
ATOM   841  N  ND2 . ASN B 1 26 ? 28.447  -4.080  15.758  1.00 27.00 ? 25   ASN B ND2 1 
ATOM   842  N  N   . MET B 1 27 ? 23.619  -5.233  15.492  1.00 20.82 ? 26   MET B N   1 
ATOM   843  C  CA  . MET B 1 27 ? 22.963  -5.152  16.783  1.00 21.60 ? 26   MET B CA  1 
ATOM   844  C  C   . MET B 1 27 ? 22.178  -6.426  16.973  1.00 25.61 ? 26   MET B C   1 
ATOM   845  O  O   . MET B 1 27 ? 21.673  -6.978  15.997  1.00 21.80 ? 26   MET B O   1 
ATOM   846  C  CB  A MET B 1 27 ? 22.030  -3.945  16.825  0.50 22.80 ? 26   MET B CB  1 
ATOM   847  C  CB  B MET B 1 27 ? 22.000  -3.956  16.857  0.50 23.75 ? 26   MET B CB  1 
ATOM   848  C  CG  A MET B 1 27 ? 22.740  -2.605  16.925  0.50 17.91 ? 26   MET B CG  1 
ATOM   849  C  CG  B MET B 1 27 ? 22.481  -2.685  16.178  0.50 29.96 ? 26   MET B CG  1 
ATOM   850  S  SD  A MET B 1 27 ? 23.592  -2.459  18.488  0.50 31.11 ? 26   MET B SD  1 
ATOM   851  S  SD  B MET B 1 27 ? 21.392  -1.260  16.402  0.50 39.32 ? 26   MET B SD  1 
ATOM   852  C  CE  A MET B 1 27 ? 22.983  -0.867  19.052  0.50 35.73 ? 26   MET B CE  1 
ATOM   853  C  CE  B MET B 1 27 ? 19.943  -1.635  15.430  0.50 28.35 ? 26   MET B CE  1 
ATOM   854  N  N   . PRO B 1 28 ? 22.044  -6.888  18.223  1.00 26.85 ? 27   PRO B N   1 
ATOM   855  C  CA  . PRO B 1 28 ? 21.107  -7.973  18.433  1.00 24.12 ? 27   PRO B CA  1 
ATOM   856  C  C   . PRO B 1 28 ? 19.708  -7.549  18.026  1.00 23.58 ? 27   PRO B C   1 
ATOM   857  O  O   . PRO B 1 28 ? 19.384  -6.354  18.044  1.00 21.61 ? 27   PRO B O   1 
ATOM   858  C  CB  . PRO B 1 28 ? 21.158  -8.199  19.944  1.00 24.89 ? 27   PRO B CB  1 
ATOM   859  C  CG  . PRO B 1 28 ? 21.693  -7.001  20.501  1.00 33.96 ? 27   PRO B CG  1 
ATOM   860  C  CD  . PRO B 1 28 ? 22.667  -6.484  19.489  1.00 30.69 ? 27   PRO B CD  1 
ATOM   861  N  N   . LEU B 1 29 ? 18.892  -8.537  17.680  1.00 19.77 ? 28   LEU B N   1 
ATOM   862  C  CA  . LEU B 1 29 ? 17.475  -8.300  17.437  1.00 16.48 ? 28   LEU B CA  1 
ATOM   863  C  C   . LEU B 1 29 ? 16.850  -8.107  18.787  1.00 19.29 ? 28   LEU B C   1 
ATOM   864  O  O   . LEU B 1 29 ? 16.932  -8.995  19.627  1.00 20.58 ? 28   LEU B O   1 
ATOM   865  C  CB  . LEU B 1 29 ? 16.790  -9.496  16.745  1.00 22.67 ? 28   LEU B CB  1 
ATOM   866  C  CG  . LEU B 1 29 ? 17.117  -9.704  15.275  1.00 27.86 ? 28   LEU B CG  1 
ATOM   867  C  CD1 . LEU B 1 29 ? 16.634  -11.074 14.869  1.00 32.31 ? 28   LEU B CD1 1 
ATOM   868  C  CD2 . LEU B 1 29 ? 16.491  -8.595  14.452  1.00 19.04 ? 28   LEU B CD2 1 
ATOM   869  N  N   . THR B 1 30 ? 16.221  -6.963  19.012  1.00 16.59 ? 29   THR B N   1 
ATOM   870  C  CA  . THR B 1 30 ? 15.574  -6.696  20.275  1.00 16.96 ? 29   THR B CA  1 
ATOM   871  C  C   . THR B 1 30 ? 14.127  -6.260  20.161  1.00 18.31 ? 29   THR B C   1 
ATOM   872  O  O   . THR B 1 30 ? 13.740  -5.633  19.199  1.00 17.51 ? 29   THR B O   1 
ATOM   873  C  CB  . THR B 1 30 ? 16.339  -5.610  21.067  1.00 19.87 ? 29   THR B CB  1 
ATOM   874  O  OG1 . THR B 1 30 ? 16.465  -4.407  20.292  1.00 22.76 ? 29   THR B OG1 1 
ATOM   875  C  CG2 . THR B 1 30 ? 17.728  -6.121  21.448  1.00 20.40 ? 29   THR B CG2 1 
ATOM   876  N  N   . ILE B 1 31 ? 13.356  -6.598  21.184  1.00 16.19 ? 30   ILE B N   1 
ATOM   877  C  CA  . ILE B 1 31 ? 11.966  -6.151  21.310  1.00 18.83 ? 30   ILE B CA  1 
ATOM   878  C  C   . ILE B 1 31 ? 11.929  -4.644  21.577  1.00 16.95 ? 30   ILE B C   1 
ATOM   879  O  O   . ILE B 1 31 ? 12.434  -4.149  22.629  1.00 16.81 ? 30   ILE B O   1 
ATOM   880  C  CB  . ILE B 1 31 ? 11.213  -6.863  22.460  1.00 17.14 ? 30   ILE B CB  1 
ATOM   881  C  CG1 . ILE B 1 31 ? 11.308  -8.372  22.318  1.00 17.70 ? 30   ILE B CG1 1 
ATOM   882  C  CG2 . ILE B 1 31 ? 9.760   -6.377  22.539  1.00 18.53 ? 30   ILE B CG2 1 
ATOM   883  C  CD1 . ILE B 1 31 ? 10.592  -8.957  21.082  1.00 21.57 ? 30   ILE B CD1 1 
ATOM   884  N  N   . SER B 1 32 ? 11.388  -3.910  20.621  1.00 15.62 ? 31   SER B N   1 
ATOM   885  C  CA  . SER B 1 32 ? 11.383  -2.451  20.656  1.00 14.36 ? 31   SER B CA  1 
ATOM   886  C  C   . SER B 1 32 ? 10.052  -1.806  21.018  1.00 19.48 ? 31   SER B C   1 
ATOM   887  O  O   . SER B 1 32 ? 10.010  -0.608  21.369  1.00 19.99 ? 31   SER B O   1 
ATOM   888  C  CB  . SER B 1 32 ? 11.894  -1.897  19.331  1.00 17.06 ? 31   SER B CB  1 
ATOM   889  O  OG  . SER B 1 32 ? 11.068  -2.332  18.267  1.00 19.06 ? 31   SER B OG  1 
ATOM   890  N  N   . SER B 1 33 ? 8.977   -2.582  20.946  1.00 15.70 ? 32   SER B N   1 
ATOM   891  C  CA  . SER B 1 33 ? 7.656   -2.098  21.171  1.00 15.94 ? 32   SER B CA  1 
ATOM   892  C  C   . SER B 1 33 ? 6.819   -3.312  21.472  1.00 19.09 ? 32   SER B C   1 
ATOM   893  O  O   . SER B 1 33 ? 7.130   -4.417  20.977  1.00 18.47 ? 32   SER B O   1 
ATOM   894  C  CB  . SER B 1 33 ? 7.143   -1.387  19.925  1.00 22.93 ? 32   SER B CB  1 
ATOM   895  O  OG  . SER B 1 33 ? 5.908   -0.781  20.168  1.00 23.69 ? 32   SER B OG  1 
ATOM   896  N  N   . LEU B 1 34 ? 5.804   -3.102  22.318  1.00 17.14 ? 33   LEU B N   1 
ATOM   897  C  CA  . LEU B 1 34 ? 4.833   -4.123  22.712  1.00 14.70 ? 33   LEU B CA  1 
ATOM   898  C  C   . LEU B 1 34 ? 3.443   -3.533  22.644  1.00 19.20 ? 33   LEU B C   1 
ATOM   899  O  O   . LEU B 1 34 ? 3.216   -2.388  23.062  1.00 20.43 ? 33   LEU B O   1 
ATOM   900  C  CB  . LEU B 1 34 ? 5.057   -4.664  24.109  1.00 20.57 ? 33   LEU B CB  1 
ATOM   901  C  CG  . LEU B 1 34 ? 6.191   -5.596  24.390  1.00 16.70 ? 33   LEU B CG  1 
ATOM   902  C  CD1 . LEU B 1 34 ? 6.321   -5.715  25.902  1.00 22.18 ? 33   LEU B CD1 1 
ATOM   903  C  CD2 . LEU B 1 34 ? 5.923   -6.960  23.735  1.00 17.44 ? 33   LEU B CD2 1 
ATOM   904  N  N   . LYS B 1 35 ? 2.502   -4.309  22.111  1.00 19.28 ? 34   LYS B N   1 
ATOM   905  C  CA  . LYS B 1 35 ? 1.099   -3.935  22.145  1.00 20.13 ? 34   LYS B CA  1 
ATOM   906  C  C   . LYS B 1 35 ? 0.587   -4.228  23.525  1.00 23.93 ? 34   LYS B C   1 
ATOM   907  O  O   . LYS B 1 35 ? 0.696   -5.332  24.000  1.00 20.18 ? 34   LYS B O   1 
ATOM   908  C  CB  A LYS B 1 35 ? 0.284   -4.731  21.139  0.50 22.82 ? 34   LYS B CB  1 
ATOM   909  C  CB  B LYS B 1 35 ? 0.279   -4.710  21.127  0.50 23.15 ? 34   LYS B CB  1 
ATOM   910  C  CG  A LYS B 1 35 ? -1.198  -4.381  21.149  0.50 21.66 ? 34   LYS B CG  1 
ATOM   911  C  CG  B LYS B 1 35 ? 0.092   -3.962  19.829  0.50 23.29 ? 34   LYS B CG  1 
ATOM   912  N  N   . ASP B 1 36 ? -0.007  -3.241  24.160  1.00 28.37 ? 35   ASP B N   1 
ATOM   913  C  CA  . ASP B 1 36 ? -0.552  -3.432  25.502  1.00 30.15 ? 35   ASP B CA  1 
ATOM   914  C  C   . ASP B 1 36 ? -1.666  -4.494  25.419  1.00 28.20 ? 35   ASP B C   1 
ATOM   915  O  O   . ASP B 1 36 ? -2.561  -4.373  24.609  1.00 27.23 ? 35   ASP B O   1 
ATOM   916  C  CB  . ASP B 1 36 ? -1.092  -2.093  26.034  1.00 30.54 ? 35   ASP B CB  1 
ATOM   917  C  CG  . ASP B 1 36 ? -1.476  -2.158  27.490  1.00 39.76 ? 35   ASP B CG  1 
ATOM   918  O  OD1 . ASP B 1 36 ? -0.915  -3.008  28.223  1.00 37.46 ? 35   ASP B OD1 1 
ATOM   919  O  OD2 . ASP B 1 36 ? -2.329  -1.337  27.897  1.00 55.35 ? 35   ASP B OD2 1 
ATOM   920  N  N   . GLY B 1 37 ? -1.574  -5.551  26.214  1.00 27.68 ? 36   GLY B N   1 
ATOM   921  C  CA  . GLY B 1 37 ? -2.574  -6.614  26.162  1.00 26.40 ? 36   GLY B CA  1 
ATOM   922  C  C   . GLY B 1 37 ? -2.420  -7.605  25.016  1.00 22.44 ? 36   GLY B C   1 
ATOM   923  O  O   . GLY B 1 37 ? -3.256  -8.510  24.861  1.00 26.31 ? 36   GLY B O   1 
ATOM   924  N  N   . GLY B 1 38 ? -1.348  -7.459  24.229  1.00 24.07 ? 37   GLY B N   1 
ATOM   925  C  CA  . GLY B 1 38 ? -1.098  -8.341  23.099  1.00 20.98 ? 37   GLY B CA  1 
ATOM   926  C  C   . GLY B 1 38 ? -0.496  -9.670  23.536  1.00 20.08 ? 37   GLY B C   1 
ATOM   927  O  O   . GLY B 1 38 ? -0.210  -9.875  24.722  1.00 19.89 ? 37   GLY B O   1 
ATOM   928  N  N   . LYS B 1 39 ? -0.300  -10.562 22.565  1.00 16.87 ? 38   LYS B N   1 
ATOM   929  C  CA  . LYS B 1 39 ? 0.134   -11.915 22.849  1.00 16.95 ? 38   LYS B CA  1 
ATOM   930  C  C   . LYS B 1 39 ? 1.549   -11.949 23.418  1.00 17.07 ? 38   LYS B C   1 
ATOM   931  O  O   . LYS B 1 39 ? 1.786   -12.647 24.417  1.00 18.29 ? 38   LYS B O   1 
ATOM   932  C  CB  . LYS B 1 39 ? -0.030  -12.812 21.630  1.00 18.01 ? 38   LYS B CB  1 
ATOM   933  C  CG  . LYS B 1 39 ? -1.479  -13.167 21.390  1.00 20.60 ? 38   LYS B CG  1 
ATOM   934  C  CD  . LYS B 1 39 ? -1.673  -13.975 20.147  1.00 17.39 ? 38   LYS B CD  1 
ATOM   935  C  CE  . LYS B 1 39 ? -3.137  -14.353 20.019  1.00 21.87 ? 38   LYS B CE  1 
ATOM   936  N  NZ  . LYS B 1 39 ? -3.395  -15.190 18.845  1.00 20.23 ? 38   LYS B NZ  1 
ATOM   937  N  N   . ALA B 1 40 ? 2.456   -11.165 22.850  1.00 17.16 ? 39   ALA B N   1 
ATOM   938  C  CA  . ALA B 1 40 ? 3.836   -11.109 23.362  1.00 13.54 ? 39   ALA B CA  1 
ATOM   939  C  C   . ALA B 1 40 ? 3.863   -10.584 24.814  1.00 16.91 ? 39   ALA B C   1 
ATOM   940  O  O   . ALA B 1 40 ? 4.501   -11.196 25.674  1.00 16.60 ? 39   ALA B O   1 
ATOM   941  C  CB  . ALA B 1 40 ? 4.730   -10.297 22.447  1.00 15.27 ? 39   ALA B CB  1 
ATOM   942  N  N   . ALA B 1 41 ? 3.160   -9.483  25.071  1.00 15.36 ? 40   ALA B N   1 
ATOM   943  C  CA  . ALA B 1 41 ? 3.039   -8.879  26.426  1.00 15.08 ? 40   ALA B CA  1 
ATOM   944  C  C   . ALA B 1 41 ? 2.485   -9.832  27.453  1.00 18.40 ? 40   ALA B C   1 
ATOM   945  O  O   . ALA B 1 41 ? 2.980   -9.878  28.582  1.00 19.44 ? 40   ALA B O   1 
ATOM   946  C  CB  . ALA B 1 41 ? 2.206   -7.594  26.386  1.00 18.91 ? 40   ALA B CB  1 
ATOM   947  N  N   . GLN B 1 42 ? 1.446   -10.582 27.076  1.00 18.95 ? 41   GLN B N   1 
ATOM   948  C  CA  . GLN B 1 42 ? 0.834   -11.569 27.961  1.00 18.67 ? 41   GLN B CA  1 
ATOM   949  C  C   . GLN B 1 42 ? 1.752   -12.743 28.255  1.00 22.44 ? 41   GLN B C   1 
ATOM   950  O  O   . GLN B 1 42 ? 1.670   -13.344 29.324  1.00 26.16 ? 41   GLN B O   1 
ATOM   951  C  CB  . GLN B 1 42 ? -0.494  -12.064 27.375  1.00 23.56 ? 41   GLN B CB  1 
ATOM   952  C  CG  . GLN B 1 42 ? -1.540  -10.972 27.271  1.00 24.23 ? 41   GLN B CG  1 
ATOM   953  N  N   . ALA B 1 43 ? 2.624   -13.066 27.311  1.00 19.12 ? 42   ALA B N   1 
ATOM   954  C  CA  . ALA B 1 43 ? 3.651   -14.093 27.496  1.00 20.79 ? 42   ALA B CA  1 
ATOM   955  C  C   . ALA B 1 43 ? 4.885   -13.636 28.291  1.00 18.61 ? 42   ALA B C   1 
ATOM   956  O  O   . ALA B 1 43 ? 5.860   -14.414 28.427  1.00 17.89 ? 42   ALA B O   1 
ATOM   957  C  CB  . ALA B 1 43 ? 4.095   -14.634 26.137  1.00 24.35 ? 42   ALA B CB  1 
ATOM   958  N  N   . ASN B 1 44 ? 4.847   -12.405 28.816  1.00 20.47 ? 43   ASN B N   1 
ATOM   959  C  CA  . ASN B 1 44 ? 5.940   -11.811 29.609  1.00 18.84 ? 43   ASN B CA  1 
ATOM   960  C  C   . ASN B 1 44 ? 7.225   -11.545 28.806  1.00 17.86 ? 43   ASN B C   1 
ATOM   961  O  O   . ASN B 1 44 ? 8.318   -11.529 29.350  1.00 18.42 ? 43   ASN B O   1 
ATOM   962  C  CB  . ASN B 1 44 ? 6.219   -12.630 30.868  1.00 20.86 ? 43   ASN B CB  1 
ATOM   963  C  CG  . ASN B 1 44 ? 5.030   -12.653 31.803  1.00 32.87 ? 43   ASN B CG  1 
ATOM   964  O  OD1 . ASN B 1 44 ? 4.367   -11.632 32.002  1.00 39.17 ? 43   ASN B OD1 1 
ATOM   965  N  ND2 . ASN B 1 44 ? 4.742   -13.816 32.365  1.00 55.98 ? 43   ASN B ND2 1 
ATOM   966  N  N   . VAL B 1 45 ? 7.065   -11.299 27.502  1.00 16.15 ? 44   VAL B N   1 
ATOM   967  C  CA  . VAL B 1 45 ? 8.133   -10.681 26.699  1.00 18.02 ? 44   VAL B CA  1 
ATOM   968  C  C   . VAL B 1 45 ? 8.199   -9.222  27.121  1.00 19.58 ? 44   VAL B C   1 
ATOM   969  O  O   . VAL B 1 45 ? 7.170   -8.597  27.322  1.00 17.54 ? 44   VAL B O   1 
ATOM   970  C  CB  . VAL B 1 45 ? 7.871   -10.800 25.160  1.00 12.85 ? 44   VAL B CB  1 
ATOM   971  C  CG1 . VAL B 1 45 ? 9.004   -10.130 24.343  1.00 14.77 ? 44   VAL B CG1 1 
ATOM   972  C  CG2 . VAL B 1 45 ? 7.604   -12.279 24.778  1.00 18.22 ? 44   VAL B CG2 1 
ATOM   973  N  N   . ARG B 1 46 ? 9.410   -8.674  27.177  1.00 17.78 ? 45   ARG B N   1 
ATOM   974  C  CA  . ARG B 1 46 ? 9.637   -7.309  27.663  1.00 15.52 ? 45   ARG B CA  1 
ATOM   975  C  C   . ARG B 1 46 ? 10.478  -6.518  26.675  1.00 17.03 ? 45   ARG B C   1 
ATOM   976  O  O   . ARG B 1 46 ? 11.350  -7.057  26.010  1.00 16.80 ? 45   ARG B O   1 
ATOM   977  C  CB  . ARG B 1 46 ? 10.315  -7.358  29.039  1.00 19.35 ? 45   ARG B CB  1 
ATOM   978  C  CG  . ARG B 1 46 ? 9.395   -7.849  30.160  1.00 16.96 ? 45   ARG B CG  1 
ATOM   979  C  CD  . ARG B 1 46 ? 10.187  -8.269  31.410  1.00 24.71 ? 45   ARG B CD  1 
ATOM   980  N  NE  . ARG B 1 46 ? 9.346   -9.146  32.229  1.00 24.05 ? 45   ARG B NE  1 
ATOM   981  C  CZ  . ARG B 1 46 ? 9.762   -10.127 33.035  1.00 20.92 ? 45   ARG B CZ  1 
ATOM   982  N  NH1 . ARG B 1 46 ? 11.059  -10.397 33.243  1.00 19.53 ? 45   ARG B NH1 1 
ATOM   983  N  NH2 . ARG B 1 46 ? 8.855   -10.822 33.696  1.00 31.23 ? 45   ARG B NH2 1 
ATOM   984  N  N   . ILE B 1 47 ? 10.184  -5.240  26.597  1.00 17.64 ? 46   ILE B N   1 
ATOM   985  C  CA  . ILE B 1 47 ? 10.964  -4.328  25.781  1.00 15.71 ? 46   ILE B CA  1 
ATOM   986  C  C   . ILE B 1 47 ? 12.435  -4.451  26.197  1.00 18.58 ? 46   ILE B C   1 
ATOM   987  O  O   . ILE B 1 47 ? 12.754  -4.521  27.379  1.00 17.31 ? 46   ILE B O   1 
ATOM   988  C  CB  . ILE B 1 47 ? 10.394  -2.892  25.859  1.00 17.73 ? 46   ILE B CB  1 
ATOM   989  C  CG1 . ILE B 1 47 ? 9.064   -2.870  25.076  1.00 21.12 ? 46   ILE B CG1 1 
ATOM   990  C  CG2 . ILE B 1 47 ? 11.391  -1.806  25.311  1.00 15.57 ? 46   ILE B CG2 1 
ATOM   991  C  CD1 . ILE B 1 47 ? 8.220   -1.645  25.232  1.00 28.26 ? 46   ILE B CD1 1 
ATOM   992  N  N   . GLY B 1 48 ? 13.322  -4.499  25.209  1.00 17.53 ? 47   GLY B N   1 
ATOM   993  C  CA  . GLY B 1 48 ? 14.761  -4.599  25.470  1.00 17.82 ? 47   GLY B CA  1 
ATOM   994  C  C   . GLY B 1 48 ? 15.282  -6.018  25.337  1.00 19.35 ? 47   GLY B C   1 
ATOM   995  O  O   . GLY B 1 48 ? 16.466  -6.227  25.022  1.00 21.03 ? 47   GLY B O   1 
ATOM   996  N  N   . ASP B 1 49 ? 14.397  -6.997  25.525  1.00 16.77 ? 48   ASP B N   1 
ATOM   997  C  CA  . ASP B 1 49 ? 14.821  -8.393  25.389  1.00 15.75 ? 48   ASP B CA  1 
ATOM   998  C  C   . ASP B 1 49 ? 15.347  -8.768  23.979  1.00 16.22 ? 48   ASP B C   1 
ATOM   999  O  O   . ASP B 1 49 ? 14.891  -8.275  22.943  1.00 18.24 ? 48   ASP B O   1 
ATOM   1000 C  CB  . ASP B 1 49 ? 13.732  -9.361  25.845  1.00 17.33 ? 48   ASP B CB  1 
ATOM   1001 C  CG  . ASP B 1 49 ? 13.389  -9.243  27.318  1.00 23.49 ? 48   ASP B CG  1 
ATOM   1002 O  OD1 . ASP B 1 49 ? 14.098  -8.565  28.108  1.00 18.88 ? 48   ASP B OD1 1 
ATOM   1003 O  OD2 . ASP B 1 49 ? 12.378  -9.861  27.694  1.00 18.48 ? 48   ASP B OD2 1 
ATOM   1004 N  N   . VAL B 1 50 ? 16.368  -9.598  23.986  1.00 17.52 ? 49   VAL B N   1 
ATOM   1005 C  CA  . VAL B 1 50 ? 17.044  -10.060 22.798  1.00 14.78 ? 49   VAL B CA  1 
ATOM   1006 C  C   . VAL B 1 50 ? 16.435  -11.359 22.283  1.00 16.06 ? 49   VAL B C   1 
ATOM   1007 O  O   . VAL B 1 50 ? 16.269  -12.320 23.028  1.00 18.92 ? 49   VAL B O   1 
ATOM   1008 C  CB  . VAL B 1 50 ? 18.561  -10.251 23.052  1.00 22.81 ? 49   VAL B CB  1 
ATOM   1009 C  CG1 . VAL B 1 50 ? 19.244  -10.895 21.839  1.00 22.88 ? 49   VAL B CG1 1 
ATOM   1010 C  CG2 . VAL B 1 50 ? 19.215  -8.896  23.378  1.00 24.56 ? 49   VAL B CG2 1 
ATOM   1011 N  N   . VAL B 1 51 ? 16.093  -11.382 21.000  1.00 17.56 ? 50   VAL B N   1 
ATOM   1012 C  CA  . VAL B 1 51 ? 15.623  -12.591 20.335  1.00 14.43 ? 50   VAL B CA  1 
ATOM   1013 C  C   . VAL B 1 51 ? 16.777  -13.482 19.934  1.00 18.12 ? 50   VAL B C   1 
ATOM   1014 O  O   . VAL B 1 51 ? 17.585  -13.115 19.085  1.00 19.88 ? 50   VAL B O   1 
ATOM   1015 C  CB  . VAL B 1 51 ? 14.798  -12.276 19.110  1.00 14.91 ? 50   VAL B CB  1 
ATOM   1016 C  CG1 . VAL B 1 51 ? 14.250  -13.598 18.470  1.00 17.23 ? 50   VAL B CG1 1 
ATOM   1017 C  CG2 . VAL B 1 51 ? 13.619  -11.313 19.459  1.00 21.34 ? 50   VAL B CG2 1 
ATOM   1018 N  N   . LEU B 1 52 ? 16.861  -14.648 20.587  1.00 14.54 ? 51   LEU B N   1 
ATOM   1019 C  CA  . LEU B 1 52 ? 17.932  -15.618 20.284  1.00 16.10 ? 51   LEU B CA  1 
ATOM   1020 C  C   . LEU B 1 52 ? 17.592  -16.623 19.166  1.00 19.85 ? 51   LEU B C   1 
ATOM   1021 O  O   . LEU B 1 52 ? 18.444  -16.987 18.343  1.00 20.23 ? 51   LEU B O   1 
ATOM   1022 C  CB  . LEU B 1 52 ? 18.281  -16.409 21.542  1.00 20.07 ? 51   LEU B CB  1 
ATOM   1023 C  CG  . LEU B 1 52 ? 18.817  -15.628 22.712  1.00 17.08 ? 51   LEU B CG  1 
ATOM   1024 C  CD1 . LEU B 1 52 ? 19.115  -16.541 23.885  1.00 22.10 ? 51   LEU B CD1 1 
ATOM   1025 C  CD2 . LEU B 1 52 ? 20.069  -14.860 22.265  1.00 20.56 ? 51   LEU B CD2 1 
ATOM   1026 N  N   . SER B 1 53 ? 16.337  -17.066 19.115  1.00 21.39 ? 52   SER B N   1 
ATOM   1027 C  CA  . SER B 1 53 ? 15.893  -17.922 18.042  1.00 19.66 ? 52   SER B CA  1 
ATOM   1028 C  C   . SER B 1 53 ? 14.411  -17.688 17.782  1.00 18.68 ? 52   SER B C   1 
ATOM   1029 O  O   . SER B 1 53 ? 13.688  -17.214 18.657  1.00 17.63 ? 52   SER B O   1 
ATOM   1030 C  CB  . SER B 1 53 ? 16.116  -19.401 18.384  1.00 16.30 ? 52   SER B CB  1 
ATOM   1031 O  OG  . SER B 1 53 ? 15.472  -19.760 19.591  1.00 21.29 ? 52   SER B OG  1 
ATOM   1032 N  N   . ILE B 1 54 ? 14.001  -18.044 16.571  1.00 17.86 ? 53   ILE B N   1 
ATOM   1033 C  CA  . ILE B 1 54 ? 12.630  -17.962 16.127  1.00 19.64 ? 53   ILE B CA  1 
ATOM   1034 C  C   . ILE B 1 54 ? 12.306  -19.328 15.552  1.00 24.32 ? 53   ILE B C   1 
ATOM   1035 O  O   . ILE B 1 54 ? 12.993  -19.775 14.640  1.00 21.63 ? 53   ILE B O   1 
ATOM   1036 C  CB  . ILE B 1 54 ? 12.431  -16.857 15.051  1.00 23.57 ? 53   ILE B CB  1 
ATOM   1037 C  CG1 . ILE B 1 54 ? 12.902  -15.467 15.557  1.00 18.20 ? 53   ILE B CG1 1 
ATOM   1038 C  CG2 . ILE B 1 54 ? 10.966  -16.850 14.566  1.00 19.53 ? 53   ILE B CG2 1 
ATOM   1039 C  CD1 . ILE B 1 54 ? 13.212  -14.415 14.459  1.00 18.71 ? 53   ILE B CD1 1 
ATOM   1040 N  N   . ASP B 1 55 ? 11.290  -19.993 16.101  1.00 24.89 ? 54   ASP B N   1 
ATOM   1041 C  CA  . ASP B 1 55 ? 10.859  -21.321 15.628  1.00 27.26 ? 54   ASP B CA  1 
ATOM   1042 C  C   . ASP B 1 55 ? 11.979  -22.370 15.673  1.00 31.40 ? 54   ASP B C   1 
ATOM   1043 O  O   . ASP B 1 55 ? 12.119  -23.188 14.761  1.00 33.96 ? 54   ASP B O   1 
ATOM   1044 C  CB  . ASP B 1 55 ? 10.297  -21.196 14.210  1.00 27.93 ? 54   ASP B CB  1 
ATOM   1045 C  CG  . ASP B 1 55 ? 9.335   -22.350 13.835  1.00 40.24 ? 54   ASP B CG  1 
ATOM   1046 O  OD1 . ASP B 1 55 ? 8.799   -23.047 14.741  1.00 33.32 ? 54   ASP B OD1 1 
ATOM   1047 O  OD2 . ASP B 1 55 ? 9.104   -22.531 12.617  1.00 51.68 ? 54   ASP B OD2 1 
ATOM   1048 N  N   . GLY B 1 56 ? 12.769  -22.349 16.739  1.00 30.81 ? 55   GLY B N   1 
ATOM   1049 C  CA  . GLY B 1 56 ? 13.878  -23.287 16.894  1.00 33.71 ? 55   GLY B CA  1 
ATOM   1050 C  C   . GLY B 1 56 ? 15.118  -22.950 16.073  1.00 32.93 ? 55   GLY B C   1 
ATOM   1051 O  O   . GLY B 1 56 ? 16.075  -23.730 16.049  1.00 36.20 ? 55   GLY B O   1 
ATOM   1052 N  N   . ILE B 1 57 ? 15.125  -21.785 15.419  1.00 27.55 ? 56   ILE B N   1 
ATOM   1053 C  CA  . ILE B 1 57 ? 16.197  -21.417 14.491  1.00 25.13 ? 56   ILE B CA  1 
ATOM   1054 C  C   . ILE B 1 57 ? 16.980  -20.198 14.947  1.00 22.60 ? 56   ILE B C   1 
ATOM   1055 O  O   . ILE B 1 57 ? 16.413  -19.140 15.231  1.00 19.06 ? 56   ILE B O   1 
ATOM   1056 C  CB  A ILE B 1 57 ? 15.661  -21.078 13.098  0.60 20.06 ? 56   ILE B CB  1 
ATOM   1057 C  CB  B ILE B 1 57 ? 15.650  -21.175 13.082  0.40 22.97 ? 56   ILE B CB  1 
ATOM   1058 C  CG1 A ILE B 1 57 ? 14.832  -22.225 12.525  0.60 35.43 ? 56   ILE B CG1 1 
ATOM   1059 C  CG1 B ILE B 1 57 ? 14.839  -22.392 12.616  0.40 32.05 ? 56   ILE B CG1 1 
ATOM   1060 C  CG2 A ILE B 1 57 ? 16.821  -20.732 12.157  0.60 25.47 ? 56   ILE B CG2 1 
ATOM   1061 C  CG2 B ILE B 1 57 ? 16.794  -20.872 12.118  0.40 27.43 ? 56   ILE B CG2 1 
ATOM   1062 C  CD1 A ILE B 1 57 ? 14.240  -21.892 11.172  0.60 29.17 ? 56   ILE B CD1 1 
ATOM   1063 C  CD1 B ILE B 1 57 ? 15.482  -23.736 12.937  0.40 22.90 ? 56   ILE B CD1 1 
ATOM   1064 N  N   . ASN B 1 58 ? 18.299  -20.331 14.957  1.00 22.65 ? 57   ASN B N   1 
ATOM   1065 C  CA  . ASN B 1 58 ? 19.177  -19.262 15.433  1.00 16.99 ? 57   ASN B CA  1 
ATOM   1066 C  C   . ASN B 1 58 ? 18.944  -17.948 14.692  1.00 16.34 ? 57   ASN B C   1 
ATOM   1067 O  O   . ASN B 1 58 ? 19.022  -17.895 13.465  1.00 17.50 ? 57   ASN B O   1 
ATOM   1068 C  CB  . ASN B 1 58 ? 20.643  -19.702 15.289  1.00 17.64 ? 57   ASN B CB  1 
ATOM   1069 C  CG  . ASN B 1 58 ? 21.653  -18.742 15.937  1.00 16.05 ? 57   ASN B CG  1 
ATOM   1070 O  OD1 . ASN B 1 58 ? 21.302  -17.731 16.527  1.00 19.65 ? 57   ASN B OD1 1 
ATOM   1071 N  ND2 . ASN B 1 58 ? 22.946  -19.090 15.819  1.00 17.70 ? 57   ASN B ND2 1 
ATOM   1072 N  N   . ALA B 1 59 ? 18.648  -16.899 15.461  1.00 18.45 ? 58   ALA B N   1 
ATOM   1073 C  CA  . ALA B 1 59 ? 18.373  -15.558 14.925  1.00 18.01 ? 58   ALA B CA  1 
ATOM   1074 C  C   . ALA B 1 59 ? 19.646  -14.699 14.691  1.00 19.65 ? 58   ALA B C   1 
ATOM   1075 O  O   . ALA B 1 59 ? 19.564  -13.623 14.104  1.00 19.62 ? 58   ALA B O   1 
ATOM   1076 C  CB  . ALA B 1 59 ? 17.367  -14.818 15.822  1.00 14.54 ? 58   ALA B CB  1 
ATOM   1077 N  N   . GLN B 1 60 ? 20.821  -15.192 15.107  1.00 16.01 ? 59   GLN B N   1 
ATOM   1078 C  CA  . GLN B 1 60 ? 22.050  -14.388 15.146  1.00 16.61 ? 59   GLN B CA  1 
ATOM   1079 C  C   . GLN B 1 60 ? 22.520  -13.794 13.828  1.00 22.64 ? 59   GLN B C   1 
ATOM   1080 O  O   . GLN B 1 60 ? 23.069  -12.696 13.815  1.00 27.16 ? 59   GLN B O   1 
ATOM   1081 C  CB  . GLN B 1 60 ? 23.192  -15.188 15.807  1.00 23.31 ? 59   GLN B CB  1 
ATOM   1082 C  CG  . GLN B 1 60 ? 24.190  -15.844 14.858  1.00 32.14 ? 59   GLN B CG  1 
ATOM   1083 C  CD  . GLN B 1 60 ? 25.301  -16.566 15.619  1.00 14.37 ? 59   GLN B CD  1 
ATOM   1084 O  OE1 . GLN B 1 60 ? 25.013  -17.486 16.374  1.00 24.62 ? 59   GLN B OE1 1 
ATOM   1085 N  NE2 . GLN B 1 60 ? 26.546  -16.080 15.485  1.00 17.36 ? 59   GLN B NE2 1 
ATOM   1086 N  N   . GLY B 1 61 ? 22.326  -14.496 12.729  1.00 23.24 ? 60   GLY B N   1 
ATOM   1087 C  CA  . GLY B 1 61 ? 22.809  -13.980 11.436  1.00 29.39 ? 60   GLY B CA  1 
ATOM   1088 C  C   . GLY B 1 61 ? 21.723  -13.360 10.589  1.00 27.66 ? 60   GLY B C   1 
ATOM   1089 O  O   . GLY B 1 61 ? 21.969  -12.930 9.463   1.00 30.88 ? 60   GLY B O   1 
ATOM   1090 N  N   . MET B 1 62 ? 20.505  -13.327 11.123  1.00 24.57 ? 61   MET B N   1 
ATOM   1091 C  CA  . MET B 1 62 ? 19.392  -12.793 10.373  1.00 23.15 ? 61   MET B CA  1 
ATOM   1092 C  C   . MET B 1 62 ? 19.486  -11.270 10.316  1.00 15.90 ? 61   MET B C   1 
ATOM   1093 O  O   . MET B 1 62 ? 19.729  -10.570 11.319  1.00 19.23 ? 61   MET B O   1 
ATOM   1094 C  CB  . MET B 1 62 ? 18.067  -13.228 11.000  1.00 19.32 ? 61   MET B CB  1 
ATOM   1095 C  CG  . MET B 1 62 ? 17.771  -14.712 10.995  1.00 19.86 ? 61   MET B CG  1 
ATOM   1096 S  SD  . MET B 1 62 ? 16.177  -14.961 11.802  1.00 23.30 ? 61   MET B SD  1 
ATOM   1097 C  CE  . MET B 1 62 ? 15.976  -16.750 11.739  1.00 28.47 ? 61   MET B CE  1 
ATOM   1098 N  N   . THR B 1 63 ? 19.277  -10.761 9.111   1.00 20.64 ? 62   THR B N   1 
ATOM   1099 C  CA  . THR B 1 63 ? 19.007  -9.372  8.947   1.00 18.07 ? 62   THR B CA  1 
ATOM   1100 C  C   . THR B 1 63 ? 17.647  -9.109  9.589   1.00 16.54 ? 62   THR B C   1 
ATOM   1101 O  O   . THR B 1 63 ? 16.825  -10.024 9.871   1.00 18.37 ? 62   THR B O   1 
ATOM   1102 C  CB  . THR B 1 63 ? 18.963  -8.972  7.491   1.00 15.59 ? 62   THR B CB  1 
ATOM   1103 O  OG1 . THR B 1 63 ? 17.850  -9.621  6.847   1.00 17.42 ? 62   THR B OG1 1 
ATOM   1104 C  CG2 . THR B 1 63 ? 20.346  -9.294  6.807   1.00 15.38 ? 62   THR B CG2 1 
ATOM   1105 N  N   . HIS B 1 64 ? 17.393  -7.836  9.785   1.00 18.90 ? 63   HIS B N   1 
ATOM   1106 C  CA  . HIS B 1 64 ? 16.116  -7.403  10.328  1.00 19.43 ? 63   HIS B CA  1 
ATOM   1107 C  C   . HIS B 1 64 ? 14.943  -7.985  9.498   1.00 19.10 ? 63   HIS B C   1 
ATOM   1108 O  O   . HIS B 1 64 ? 14.014  -8.598  10.037  1.00 18.61 ? 63   HIS B O   1 
ATOM   1109 C  CB  . HIS B 1 64 ? 16.061  -5.899  10.293  1.00 19.64 ? 63   HIS B CB  1 
ATOM   1110 C  CG  . HIS B 1 64 ? 14.910  -5.336  11.034  1.00 17.69 ? 63   HIS B CG  1 
ATOM   1111 N  ND1 . HIS B 1 64 ? 15.037  -4.826  12.313  1.00 18.88 ? 63   HIS B ND1 1 
ATOM   1112 C  CD2 . HIS B 1 64 ? 13.606  -5.218  10.699  1.00 23.53 ? 63   HIS B CD2 1 
ATOM   1113 C  CE1 . HIS B 1 64 ? 13.847  -4.413  12.722  1.00 23.27 ? 63   HIS B CE1 1 
ATOM   1114 N  NE2 . HIS B 1 64 ? 12.966  -4.636  11.761  1.00 24.93 ? 63   HIS B NE2 1 
ATOM   1115 N  N   . LEU B 1 65 ? 15.038  -7.840  8.183   1.00 18.04 ? 64   LEU B N   1 
ATOM   1116 C  CA  . LEU B 1 65 ? 13.952  -8.264  7.323   1.00 20.42 ? 64   LEU B CA  1 
ATOM   1117 C  C   . LEU B 1 65 ? 13.772  -9.777  7.347   1.00 15.99 ? 64   LEU B C   1 
ATOM   1118 O  O   . LEU B 1 65 ? 12.648  -10.274 7.419   1.00 18.25 ? 64   LEU B O   1 
ATOM   1119 C  CB  . LEU B 1 65 ? 14.200  -7.789  5.897   1.00 16.88 ? 64   LEU B CB  1 
ATOM   1120 C  CG  . LEU B 1 65 ? 13.044  -8.034  4.920   1.00 16.81 ? 64   LEU B CG  1 
ATOM   1121 C  CD1 . LEU B 1 65 ? 11.744  -7.295  5.313   1.00 19.92 ? 64   LEU B CD1 1 
ATOM   1122 C  CD2 . LEU B 1 65 ? 13.465  -7.740  3.454   1.00 17.25 ? 64   LEU B CD2 1 
ATOM   1123 N  N   . GLU B 1 66 ? 14.873  -10.507 7.330   1.00 15.68 ? 65   GLU B N   1 
ATOM   1124 C  CA  . GLU B 1 66 ? 14.819  -11.980 7.478   1.00 16.83 ? 65   GLU B CA  1 
ATOM   1125 C  C   . GLU B 1 66 ? 14.076  -12.441 8.750   1.00 16.88 ? 65   GLU B C   1 
ATOM   1126 O  O   . GLU B 1 66 ? 13.232  -13.357 8.700   1.00 17.16 ? 65   GLU B O   1 
ATOM   1127 C  CB  . GLU B 1 66 ? 16.235  -12.545 7.460   1.00 20.79 ? 65   GLU B CB  1 
ATOM   1128 C  CG  . GLU B 1 66 ? 16.847  -12.487 6.090   1.00 26.95 ? 65   GLU B CG  1 
ATOM   1129 C  CD  . GLU B 1 66 ? 18.316  -12.881 6.042   1.00 21.55 ? 65   GLU B CD  1 
ATOM   1130 O  OE1 . GLU B 1 66 ? 19.038  -12.846 7.073   1.00 22.46 ? 65   GLU B OE1 1 
ATOM   1131 O  OE2 . GLU B 1 66 ? 18.768  -13.205 4.924   1.00 37.74 ? 65   GLU B OE2 1 
ATOM   1132 N  N   . ALA B 1 67 ? 14.380  -11.792 9.880   1.00 19.37 ? 66   ALA B N   1 
ATOM   1133 C  CA  . ALA B 1 67 ? 13.716  -12.125 11.159  1.00 17.94 ? 66   ALA B CA  1 
ATOM   1134 C  C   . ALA B 1 67 ? 12.225  -11.786 11.092  1.00 15.02 ? 66   ALA B C   1 
ATOM   1135 O  O   . ALA B 1 67 ? 11.387  -12.568 11.517  1.00 16.04 ? 66   ALA B O   1 
ATOM   1136 C  CB  . ALA B 1 67 ? 14.375  -11.368 12.297  1.00 21.70 ? 66   ALA B CB  1 
ATOM   1137 N  N   . GLN B 1 68 ? 11.901  -10.627 10.534  1.00 17.93 ? 67   GLN B N   1 
ATOM   1138 C  CA  . GLN B 1 68 ? 10.513  -10.214 10.417  1.00 15.73 ? 67   GLN B CA  1 
ATOM   1139 C  C   . GLN B 1 68 ? 9.755   -11.228 9.566   1.00 17.61 ? 67   GLN B C   1 
ATOM   1140 O  O   . GLN B 1 68 ? 8.683   -11.686 9.919   1.00 16.97 ? 67   GLN B O   1 
ATOM   1141 C  CB  A GLN B 1 68 ? 10.375  -8.877  9.677   0.50 15.33 ? 67   GLN B CB  1 
ATOM   1142 C  CB  B GLN B 1 68 ? 10.421  -8.835  9.807   0.50 13.57 ? 67   GLN B CB  1 
ATOM   1143 C  CG  A GLN B 1 68 ? 10.703  -7.668  10.459  0.50 23.62 ? 67   GLN B CG  1 
ATOM   1144 C  CG  B GLN B 1 68 ? 9.031   -8.416  9.554   0.50 14.66 ? 67   GLN B CG  1 
ATOM   1145 C  CD  A GLN B 1 68 ? 10.326  -6.398  9.735   0.50 16.32 ? 67   GLN B CD  1 
ATOM   1146 C  CD  B GLN B 1 68 ? 9.002   -7.098  8.854   0.50 18.65 ? 67   GLN B CD  1 
ATOM   1147 O  OE1 A GLN B 1 68 ? 10.334  -6.349  8.489   0.50 20.53 ? 67   GLN B OE1 1 
ATOM   1148 O  OE1 B GLN B 1 68 ? 8.720   -7.028  7.677   0.50 23.03 ? 67   GLN B OE1 1 
ATOM   1149 N  NE2 A GLN B 1 68 ? 10.015  -5.344  10.498  0.50 15.02 ? 67   GLN B NE2 1 
ATOM   1150 N  NE2 B GLN B 1 68 ? 9.364   -6.058  9.570   0.50 16.90 ? 67   GLN B NE2 1 
ATOM   1151 N  N   . ASN B 1 69 ? 10.348  -11.602 8.437   1.00 19.72 ? 68   ASN B N   1 
ATOM   1152 C  CA  . ASN B 1 69 ? 9.706   -12.568 7.552   1.00 21.14 ? 68   ASN B CA  1 
ATOM   1153 C  C   . ASN B 1 69 ? 9.544   -13.967 8.179   1.00 19.88 ? 68   ASN B C   1 
ATOM   1154 O  O   . ASN B 1 69 ? 8.535   -14.655 7.982   1.00 20.66 ? 68   ASN B O   1 
ATOM   1155 C  CB  . ASN B 1 69 ? 10.484  -12.655 6.265   1.00 20.76 ? 68   ASN B CB  1 
ATOM   1156 C  CG  . ASN B 1 69 ? 10.334  -11.411 5.386   1.00 23.43 ? 68   ASN B CG  1 
ATOM   1157 O  OD1 . ASN B 1 69 ? 9.376   -10.653 5.504   1.00 31.41 ? 68   ASN B OD1 1 
ATOM   1158 N  ND2 . ASN B 1 69 ? 11.289  -11.236 4.472   1.00 27.90 ? 68   ASN B ND2 1 
ATOM   1159 N  N   . LYS B 1 70 ? 10.510  -14.381 8.970   1.00 18.50 ? 69   LYS B N   1 
ATOM   1160 C  CA  . LYS B 1 70 ? 10.379  -15.638 9.685   1.00 20.55 ? 69   LYS B CA  1 
ATOM   1161 C  C   . LYS B 1 70 ? 9.237   -15.580 10.700  1.00 16.96 ? 69   LYS B C   1 
ATOM   1162 O  O   . LYS B 1 70 ? 8.437   -16.505 10.821  1.00 19.50 ? 69   LYS B O   1 
ATOM   1163 C  CB  . LYS B 1 70 ? 11.674  -15.948 10.411  1.00 18.28 ? 69   LYS B CB  1 
ATOM   1164 C  CG  . LYS B 1 70 ? 11.709  -17.333 11.040  1.00 25.67 ? 69   LYS B CG  1 
ATOM   1165 C  CD  . LYS B 1 70 ? 11.796  -18.442 10.001  1.00 37.38 ? 69   LYS B CD  1 
ATOM   1166 C  CE  . LYS B 1 70 ? 13.021  -18.312 9.102   1.00 47.06 ? 69   LYS B CE  1 
ATOM   1167 N  N   . ILE B 1 71 ? 9.158   -14.493 11.463  1.00 18.06 ? 70   ILE B N   1 
ATOM   1168 C  CA  . ILE B 1 71 ? 8.062   -14.351 12.404  1.00 20.55 ? 70   ILE B CA  1 
ATOM   1169 C  C   . ILE B 1 71 ? 6.722   -14.343 11.681  1.00 21.21 ? 70   ILE B C   1 
ATOM   1170 O  O   . ILE B 1 71 ? 5.776   -15.025 12.118  1.00 17.91 ? 70   ILE B O   1 
ATOM   1171 C  CB  . ILE B 1 71 ? 8.255   -13.093 13.224  1.00 16.20 ? 70   ILE B CB  1 
ATOM   1172 C  CG1 . ILE B 1 71 ? 9.389   -13.295 14.227  1.00 20.02 ? 70   ILE B CG1 1 
ATOM   1173 C  CG2 . ILE B 1 71 ? 6.968   -12.660 13.979  1.00 11.93 ? 70   ILE B CG2 1 
ATOM   1174 C  CD1 . ILE B 1 71 ? 10.005  -11.994 14.677  1.00 16.03 ? 70   ILE B CD1 1 
ATOM   1175 N  N   . LYS B 1 72 ? 6.628   -13.587 10.586  1.00 21.74 ? 71   LYS B N   1 
ATOM   1176 C  CA  . LYS B 1 72 ? 5.354   -13.480 9.879   1.00 22.18 ? 71   LYS B CA  1 
ATOM   1177 C  C   . LYS B 1 72 ? 4.926   -14.794 9.240   1.00 22.56 ? 71   LYS B C   1 
ATOM   1178 O  O   . LYS B 1 72 ? 3.727   -15.043 9.066   1.00 28.83 ? 71   LYS B O   1 
ATOM   1179 C  CB  . LYS B 1 72 ? 5.433   -12.437 8.796   1.00 24.36 ? 71   LYS B CB  1 
ATOM   1180 C  CG  . LYS B 1 72 ? 5.445   -11.030 9.312   1.00 25.47 ? 71   LYS B CG  1 
ATOM   1181 C  CD  . LYS B 1 72 ? 5.793   -10.124 8.154   1.00 31.54 ? 71   LYS B CD  1 
ATOM   1182 C  CE  . LYS B 1 72 ? 5.532   -8.696  8.458   1.00 34.85 ? 71   LYS B CE  1 
ATOM   1183 N  NZ  . LYS B 1 72 ? 5.774   -7.890  7.249   1.00 36.56 ? 71   LYS B NZ  1 
ATOM   1184 N  N   . GLY B 1 73 ? 5.906   -15.607 8.852   1.00 25.10 ? 72   GLY B N   1 
ATOM   1185 C  CA  . GLY B 1 73 ? 5.620   -16.856 8.185   1.00 26.13 ? 72   GLY B CA  1 
ATOM   1186 C  C   . GLY B 1 73 ? 5.215   -17.985 9.104   1.00 28.43 ? 72   GLY B C   1 
ATOM   1187 O  O   . GLY B 1 73 ? 4.850   -19.059 8.649   1.00 29.60 ? 72   GLY B O   1 
ATOM   1188 N  N   . CYS B 1 74 ? 5.289   -17.766 10.406  1.00 18.80 ? 73   CYS B N   1 
ATOM   1189 C  CA  . CYS B 1 74 ? 4.896   -18.784 11.348  1.00 25.40 ? 73   CYS B CA  1 
ATOM   1190 C  C   A CYS B 1 74 ? 3.383   -19.008 11.281  0.50 29.44 ? 73   CYS B C   1 
ATOM   1191 C  C   B CYS B 1 74 ? 3.396   -19.004 11.297  0.50 30.15 ? 73   CYS B C   1 
ATOM   1192 O  O   A CYS B 1 74 ? 2.615   -18.106 10.894  0.50 23.05 ? 73   CYS B O   1 
ATOM   1193 O  O   B CYS B 1 74 ? 2.629   -18.203 11.848  0.50 24.97 ? 73   CYS B O   1 
ATOM   1194 C  CB  A CYS B 1 74 ? 5.375   -18.511 12.795  0.60 20.81 ? 73   CYS B CB  1 
ATOM   1195 C  CB  B CYS B 1 74 ? 5.304   -18.382 12.741  0.40 25.24 ? 73   CYS B CB  1 
ATOM   1196 S  SG  A CYS B 1 74 ? 7.226   -18.692 13.126  0.60 21.93 ? 73   CYS B SG  1 
ATOM   1197 S  SG  B CYS B 1 74 ? 4.610   -19.435 13.900  0.40 26.27 ? 73   CYS B SG  1 
ATOM   1198 N  N   A THR B 1 75 ? 2.986   -20.233 11.633  0.50 21.88 ? 74   THR B N   1 
ATOM   1199 N  N   B THR B 1 75 ? 3.017   -20.097 10.623  0.50 25.48 ? 74   THR B N   1 
ATOM   1200 C  CA  A THR B 1 75 ? 1.585   -20.625 11.784  0.50 24.78 ? 74   THR B CA  1 
ATOM   1201 C  CA  B THR B 1 75 ? 1.625   -20.485 10.383  0.50 24.73 ? 74   THR B CA  1 
ATOM   1202 C  C   A THR B 1 75 ? 1.438   -21.513 13.023  0.50 24.31 ? 74   THR B C   1 
ATOM   1203 C  C   B THR B 1 75 ? 1.058   -21.325 11.534  0.50 24.17 ? 74   THR B C   1 
ATOM   1204 O  O   A THR B 1 75 ? 2.407   -22.105 13.498  0.50 28.25 ? 74   THR B O   1 
ATOM   1205 O  O   B THR B 1 75 ? -0.016  -21.906 11.424  0.50 27.30 ? 74   THR B O   1 
ATOM   1206 C  CB  A THR B 1 75 ? 1.037   -21.360 10.525  0.50 18.19 ? 74   THR B CB  1 
ATOM   1207 C  CB  B THR B 1 75 ? 1.486   -21.262 9.031   0.50 19.70 ? 74   THR B CB  1 
ATOM   1208 O  OG1 A THR B 1 75 ? 1.736   -22.602 10.291  0.50 17.50 ? 74   THR B OG1 1 
ATOM   1209 O  OG1 B THR B 1 75 ? 2.380   -22.389 8.995   0.50 20.60 ? 74   THR B OG1 1 
ATOM   1210 C  CG2 A THR B 1 75 ? 1.172   -20.476 9.306   0.50 28.54 ? 74   THR B CG2 1 
ATOM   1211 C  CG2 B THR B 1 75 ? 1.788   -20.358 7.851   0.50 22.82 ? 74   THR B CG2 1 
ATOM   1212 N  N   A GLY B 1 76 ? 0.222   -21.604 13.543  0.50 22.78 ? 75   GLY B N   1 
ATOM   1213 N  N   B GLY B 1 76 ? 1.779   -21.367 12.652  0.50 27.37 ? 75   GLY B N   1 
ATOM   1214 C  CA  A GLY B 1 76 ? -0.034  -22.402 14.732  0.50 25.56 ? 75   GLY B CA  1 
ATOM   1215 C  CA  B GLY B 1 76 ? 1.311   -22.056 13.855  0.50 24.23 ? 75   GLY B CA  1 
ATOM   1216 C  C   A GLY B 1 76 ? 0.348   -21.627 15.974  0.50 21.79 ? 75   GLY B C   1 
ATOM   1217 C  C   B GLY B 1 76 ? 1.482   -21.176 15.078  0.50 18.72 ? 75   GLY B C   1 
ATOM   1218 O  O   A GLY B 1 76 ? -0.517  -21.101 16.678  0.50 22.42 ? 75   GLY B O   1 
ATOM   1219 O  O   B GLY B 1 76 ? 1.192   -19.991 15.025  0.50 21.53 ? 75   GLY B O   1 
ATOM   1220 N  N   A SER B 1 77 ? 1.650   -21.559 16.231  0.50 23.31 ? 76   SER B N   1 
ATOM   1221 N  N   B SER B 1 77 ? 1.929   -21.755 16.188  0.50 19.99 ? 76   SER B N   1 
ATOM   1222 C  CA  A SER B 1 77 ? 2.172   -20.767 17.339  0.50 20.90 ? 76   SER B CA  1 
ATOM   1223 C  CA  B SER B 1 77 ? 2.340   -20.939 17.325  0.50 19.07 ? 76   SER B CA  1 
ATOM   1224 C  C   A SER B 1 77 ? 3.598   -20.271 17.076  0.50 19.45 ? 76   SER B C   1 
ATOM   1225 C  C   B SER B 1 77 ? 3.598   -20.180 16.893  0.50 16.26 ? 76   SER B C   1 
ATOM   1226 O  O   A SER B 1 77 ? 4.441   -21.001 16.524  0.50 22.26 ? 76   SER B O   1 
ATOM   1227 O  O   B SER B 1 77 ? 4.320   -20.614 15.972  0.50 18.56 ? 76   SER B O   1 
ATOM   1228 C  CB  A SER B 1 77 ? 2.166   -21.573 18.641  0.50 19.34 ? 76   SER B CB  1 
ATOM   1229 C  CB  B SER B 1 77 ? 2.649   -21.784 18.581  0.50 17.15 ? 76   SER B CB  1 
ATOM   1230 O  OG  A SER B 1 77 ? 0.868   -22.062 18.946  0.50 27.99 ? 76   SER B OG  1 
ATOM   1231 O  OG  B SER B 1 77 ? 1.467   -22.279 19.211  0.50 17.66 ? 76   SER B OG  1 
ATOM   1232 N  N   . LEU B 1 78 ? 3.867   -19.058 17.538  1.00 17.24 ? 77   LEU B N   1 
ATOM   1233 C  CA  . LEU B 1 78 ? 5.160   -18.424 17.373  1.00 17.57 ? 77   LEU B CA  1 
ATOM   1234 C  C   . LEU B 1 78 ? 6.057   -18.816 18.543  1.00 15.68 ? 77   LEU B C   1 
ATOM   1235 O  O   . LEU B 1 78 ? 5.811   -18.404 19.691  1.00 20.14 ? 77   LEU B O   1 
ATOM   1236 C  CB  . LEU B 1 78 ? 5.003   -16.912 17.324  1.00 17.11 ? 77   LEU B CB  1 
ATOM   1237 C  CG  . LEU B 1 78 ? 6.311   -16.159 17.150  1.00 15.66 ? 77   LEU B CG  1 
ATOM   1238 C  CD1 . LEU B 1 78 ? 7.029   -16.464 15.806  1.00 16.04 ? 77   LEU B CD1 1 
ATOM   1239 C  CD2 . LEU B 1 78 ? 6.061   -14.660 17.340  1.00 19.93 ? 77   LEU B CD2 1 
ATOM   1240 N  N   . ASN B 1 79 ? 7.077   -19.604 18.258  1.00 18.44 ? 78   ASN B N   1 
ATOM   1241 C  CA  . ASN B 1 79 ? 8.018   -20.054 19.265  1.00 14.60 ? 78   ASN B CA  1 
ATOM   1242 C  C   . ASN B 1 79 ? 9.252   -19.161 19.129  1.00 15.22 ? 78   ASN B C   1 
ATOM   1243 O  O   . ASN B 1 79 ? 9.777   -19.000 18.049  1.00 18.53 ? 78   ASN B O   1 
ATOM   1244 C  CB  . ASN B 1 79 ? 8.358   -21.517 19.052  1.00 18.14 ? 78   ASN B CB  1 
ATOM   1245 C  CG  . ASN B 1 79 ? 7.126   -22.412 19.199  1.00 20.93 ? 78   ASN B CG  1 
ATOM   1246 O  OD1 . ASN B 1 79 ? 6.398   -22.307 20.176  1.00 30.08 ? 78   ASN B OD1 1 
ATOM   1247 N  ND2 . ASN B 1 79 ? 6.857   -23.232 18.199  1.00 35.43 ? 78   ASN B ND2 1 
ATOM   1248 N  N   . MET B 1 80 ? 9.693   -18.584 20.238  1.00 17.22 ? 79   MET B N   1 
ATOM   1249 C  CA  . MET B 1 80 ? 10.973  -17.847 20.277  1.00 17.79 ? 79   MET B CA  1 
ATOM   1250 C  C   . MET B 1 80 ? 11.690  -18.194 21.555  1.00 17.62 ? 79   MET B C   1 
ATOM   1251 O  O   . MET B 1 80 ? 11.047  -18.514 22.564  1.00 18.84 ? 79   MET B O   1 
ATOM   1252 C  CB  . MET B 1 80 ? 10.765  -16.338 20.187  1.00 17.73 ? 79   MET B CB  1 
ATOM   1253 C  CG  . MET B 1 80 ? 10.121  -15.893 18.909  1.00 17.74 ? 79   MET B CG  1 
ATOM   1254 S  SD  . MET B 1 80 ? 9.964   -14.117 18.773  1.00 21.90 ? 79   MET B SD  1 
ATOM   1255 C  CE  . MET B 1 80 ? 8.877   -13.709 20.091  1.00 22.55 ? 79   MET B CE  1 
ATOM   1256 N  N   . THR B 1 81 ? 13.009  -18.123 21.506  1.00 16.19 ? 80   THR B N   1 
ATOM   1257 C  CA  . THR B 1 81 ? 13.812  -18.024 22.712  1.00 15.09 ? 80   THR B CA  1 
ATOM   1258 C  C   . THR B 1 81 ? 14.476  -16.632 22.744  1.00 15.10 ? 80   THR B C   1 
ATOM   1259 O  O   . THR B 1 81 ? 14.867  -16.077 21.728  1.00 17.40 ? 80   THR B O   1 
ATOM   1260 C  CB  A THR B 1 81 ? 14.809  -19.196 22.843  0.60 16.19 ? 80   THR B CB  1 
ATOM   1261 C  CB  B THR B 1 81 ? 14.845  -19.170 22.767  0.40 15.63 ? 80   THR B CB  1 
ATOM   1262 O  OG1 A THR B 1 81 ? 14.062  -20.413 22.988  0.60 19.65 ? 80   THR B OG1 1 
ATOM   1263 O  OG1 B THR B 1 81 ? 15.923  -18.912 21.860  0.40 19.47 ? 80   THR B OG1 1 
ATOM   1264 C  CG2 A THR B 1 81 ? 15.714  -19.021 24.068  0.60 19.82 ? 80   THR B CG2 1 
ATOM   1265 C  CG2 B THR B 1 81 ? 14.176  -20.483 22.380  0.40 18.57 ? 80   THR B CG2 1 
ATOM   1266 N  N   . LEU B 1 82 ? 14.545  -16.090 23.952  1.00 19.25 ? 81   LEU B N   1 
ATOM   1267 C  CA  . LEU B 1 82 ? 15.017  -14.771 24.198  1.00 19.91 ? 81   LEU B CA  1 
ATOM   1268 C  C   . LEU B 1 82 ? 15.953  -14.728 25.393  1.00 22.94 ? 81   LEU B C   1 
ATOM   1269 O  O   . LEU B 1 82 ? 15.894  -15.592 26.264  1.00 23.15 ? 81   LEU B O   1 
ATOM   1270 C  CB  . LEU B 1 82 ? 13.848  -13.843 24.480  1.00 18.27 ? 81   LEU B CB  1 
ATOM   1271 C  CG  . LEU B 1 82 ? 12.737  -13.684 23.418  1.00 20.79 ? 81   LEU B CG  1 
ATOM   1272 C  CD1 . LEU B 1 82 ? 11.463  -14.471 23.792  1.00 22.65 ? 81   LEU B CD1 1 
ATOM   1273 C  CD2 . LEU B 1 82 ? 12.378  -12.201 23.203  1.00 19.73 ? 81   LEU B CD2 1 
ATOM   1274 N  N   . GLN B 1 83 ? 16.766  -13.687 25.410  1.00 19.71 ? 82   GLN B N   1 
ATOM   1275 C  CA  . GLN B 1 83 ? 17.638  -13.341 26.515  1.00 20.78 ? 82   GLN B CA  1 
ATOM   1276 C  C   . GLN B 1 83 ? 17.084  -12.088 27.152  1.00 17.80 ? 82   GLN B C   1 
ATOM   1277 O  O   . GLN B 1 83 ? 16.840  -11.042 26.497  1.00 19.53 ? 82   GLN B O   1 
ATOM   1278 C  CB  . GLN B 1 83 ? 19.056  -13.092 25.993  1.00 22.19 ? 82   GLN B CB  1 
ATOM   1279 C  CG  . GLN B 1 83 ? 20.086  -12.878 27.063  1.00 34.70 ? 82   GLN B CG  1 
ATOM   1280 C  CD  . GLN B 1 83 ? 21.465  -12.660 26.489  1.00 35.21 ? 82   GLN B CD  1 
ATOM   1281 O  OE1 . GLN B 1 83 ? 21.940  -13.430 25.652  1.00 42.79 ? 82   GLN B OE1 1 
ATOM   1282 N  NE2 . GLN B 1 83 ? 22.127  -11.613 26.951  1.00 36.77 ? 82   GLN B NE2 1 
ATOM   1283 N  N   . ARG B 1 84 ? 16.915  -12.131 28.452  1.00 20.23 ? 83   ARG B N   1 
ATOM   1284 C  CA  . ARG B 1 84 ? 16.522  -10.942 29.146  1.00 18.01 ? 83   ARG B CA  1 
ATOM   1285 C  C   . ARG B 1 84 ? 17.615  -9.866  28.990  1.00 23.31 ? 83   ARG B C   1 
ATOM   1286 O  O   . ARG B 1 84 ? 18.821  -10.151 29.143  1.00 28.25 ? 83   ARG B O   1 
ATOM   1287 C  CB  . ARG B 1 84 ? 16.248  -11.272 30.611  1.00 24.74 ? 83   ARG B CB  1 
ATOM   1288 C  CG  . ARG B 1 84 ? 15.132  -12.233 30.837  1.00 28.98 ? 83   ARG B CG  1 
ATOM   1289 C  CD  . ARG B 1 84 ? 13.807  -11.563 30.552  1.00 31.42 ? 83   ARG B CD  1 
ATOM   1290 N  NE  . ARG B 1 84 ? 12.692  -12.448 30.878  1.00 22.62 ? 83   ARG B NE  1 
ATOM   1291 C  CZ  . ARG B 1 84 ? 11.429  -12.215 30.549  1.00 23.62 ? 83   ARG B CZ  1 
ATOM   1292 N  NH1 . ARG B 1 84 ? 11.072  -11.114 29.873  1.00 21.29 ? 83   ARG B NH1 1 
ATOM   1293 N  NH2 . ARG B 1 84 ? 10.515  -13.114 30.915  1.00 18.80 ? 83   ARG B NH2 1 
ATOM   1294 N  N   . GLU B 1 85 ? 17.189  -8.655  28.641  1.00 14.98 ? 84   GLU B N   1 
ATOM   1295 C  CA  . GLU B 1 85 ? 18.031  -7.460  28.671  1.00 17.32 ? 84   GLU B CA  1 
ATOM   1296 C  C   . GLU B 1 85 ? 17.193  -6.246  29.125  1.00 18.34 ? 84   GLU B C   1 
ATOM   1297 O  O   . GLU B 1 85 ? 17.531  -5.090  28.869  1.00 23.46 ? 84   GLU B O   1 
ATOM   1298 C  CB  . GLU B 1 85 ? 18.688  -7.171  27.310  1.00 18.50 ? 84   GLU B CB  1 
ATOM   1299 C  CG  . GLU B 1 85 ? 19.758  -8.181  26.923  1.00 21.24 ? 84   GLU B CG  1 
ATOM   1300 C  CD  . GLU B 1 85 ? 20.902  -8.251  27.907  1.00 35.26 ? 84   GLU B CD  1 
ATOM   1301 O  OE1 . GLU B 1 85 ? 21.117  -7.263  28.646  1.00 39.70 ? 84   GLU B OE1 1 
ATOM   1302 O  OE2 . GLU B 1 85 ? 21.590  -9.294  27.924  1.00 40.52 ? 84   GLU B OE2 1 
ATOM   1303 N  N   . SER B 1 86 ? 16.114  -6.572  29.799  1.00 17.58 ? 85   SER B N   1 
ATOM   1304 C  CA  . SER B 1 86 ? 15.174  -5.633  30.384  1.00 18.24 ? 85   SER B CA  1 
ATOM   1305 C  C   . SER B 1 86 ? 15.425  -5.505  31.883  1.00 19.11 ? 85   SER B C   1 
ATOM   1306 O  O   . SER B 1 86 ? 14.841  -4.641  32.496  1.00 16.33 ? 85   SER B O   1 
ATOM   1307 C  CB  . SER B 1 86 ? 13.746  -6.082  30.133  1.00 20.13 ? 85   SER B CB  1 
ATOM   1308 O  OG  . SER B 1 86 ? 13.556  -7.419  30.536  1.00 16.03 ? 85   SER B OG  1 
ATOM   1309 N  N   . ASP B 1 87 ? 16.293  -6.332  32.475  1.00 13.41 ? 86   ASP B N   1 
ATOM   1310 C  CA  . ASP B 1 87 ? 16.758  -6.102  33.832  1.00 14.35 ? 86   ASP B CA  1 
ATOM   1311 C  C   . ASP B 1 87 ? 17.808  -5.013  33.820  1.00 24.00 ? 86   ASP B C   1 
ATOM   1312 O  O   . ASP B 1 87 ? 18.852  -5.142  33.178  1.00 22.50 ? 86   ASP B O   1 
ATOM   1313 C  CB  . ASP B 1 87 ? 17.306  -7.371  34.483  1.00 20.85 ? 86   ASP B CB  1 
ATOM   1314 C  CG  . ASP B 1 87 ? 16.236  -8.416  34.696  1.00 23.59 ? 86   ASP B CG  1 
ATOM   1315 O  OD1 . ASP B 1 87 ? 15.302  -8.173  35.473  1.00 23.30 ? 86   ASP B OD1 1 
ATOM   1316 O  OD2 . ASP B 1 87 ? 16.331  -9.498  34.087  1.00 28.92 ? 86   ASP B OD2 1 
ATOM   1317 N  N   . LEU B 1 88 ? 17.543  -3.936  34.535  1.00 14.59 ? 87   LEU B N   1 
ATOM   1318 C  CA  . LEU B 1 88 ? 18.400  -2.784  34.480  1.00 14.96 ? 87   LEU B CA  1 
ATOM   1319 C  C   . LEU B 1 88 ? 19.351  -2.761  35.666  1.00 16.24 ? 87   LEU B C   1 
ATOM   1320 O  O   . LEU B 1 88 ? 19.139  -3.394  36.737  1.00 13.83 ? 87   LEU B O   1 
ATOM   1321 C  CB  . LEU B 1 88 ? 17.566  -1.497  34.403  1.00 16.54 ? 87   LEU B CB  1 
ATOM   1322 C  CG  . LEU B 1 88 ? 16.501  -1.465  33.317  1.00 14.79 ? 87   LEU B CG  1 
ATOM   1323 C  CD1 . LEU B 1 88 ? 15.718  -0.165  33.341  1.00 18.69 ? 87   LEU B CD1 1 
ATOM   1324 C  CD2 . LEU B 1 88 ? 17.139  -1.666  31.940  1.00 17.36 ? 87   LEU B CD2 1 
ATOM   1325 O  OXT . LEU B 1 88 ? 20.424  -2.130  35.587  1.00 18.06 ? 87   LEU B OXT 1 
ATOM   1326 N  N   . SER C 1 1  ? -10.892 -42.464 27.217  1.00 71.67 ? 0    SER C N   1 
ATOM   1327 C  CA  . SER C 1 1  ? -11.315 -41.838 25.932  1.00 66.52 ? 0    SER C CA  1 
ATOM   1328 C  C   . SER C 1 1  ? -10.186 -41.039 25.262  1.00 65.16 ? 0    SER C C   1 
ATOM   1329 O  O   . SER C 1 1  ? -9.447  -40.299 25.928  1.00 62.91 ? 0    SER C O   1 
ATOM   1330 C  CB  . SER C 1 1  ? -12.516 -40.920 26.172  1.00 65.65 ? 0    SER C CB  1 
ATOM   1331 O  OG  . SER C 1 1  ? -12.940 -40.301 24.970  1.00 59.56 ? 0    SER C OG  1 
ATOM   1332 N  N   . MET C 1 2  ? -10.071 -41.193 23.940  1.00 61.59 ? 1    MET C N   1 
ATOM   1333 C  CA  . MET C 1 2  ? -9.269  -40.288 23.108  1.00 58.46 ? 1    MET C CA  1 
ATOM   1334 C  C   . MET C 1 2  ? -9.858  -38.872 23.121  1.00 55.80 ? 1    MET C C   1 
ATOM   1335 O  O   . MET C 1 2  ? -9.176  -37.912 22.762  1.00 59.35 ? 1    MET C O   1 
ATOM   1336 C  CB  . MET C 1 2  ? -9.210  -40.792 21.664  1.00 57.99 ? 1    MET C CB  1 
ATOM   1337 N  N   . SER C 1 3  ? -11.128 -38.757 23.525  1.00 48.15 ? 2    SER C N   1 
ATOM   1338 C  CA  . SER C 1 3  ? -11.792 -37.472 23.694  1.00 42.08 ? 2    SER C CA  1 
ATOM   1339 C  C   . SER C 1 3  ? -11.561 -36.863 25.087  1.00 36.31 ? 2    SER C C   1 
ATOM   1340 O  O   . SER C 1 3  ? -12.412 -36.122 25.574  1.00 31.73 ? 2    SER C O   1 
ATOM   1341 C  CB  . SER C 1 3  ? -13.299 -37.610 23.451  1.00 41.20 ? 2    SER C CB  1 
ATOM   1342 O  OG  . SER C 1 3  ? -13.566 -38.018 22.124  1.00 62.81 ? 2    SER C OG  1 
ATOM   1343 N  N   . ASN C 1 4  ? -10.441 -37.195 25.732  1.00 25.08 ? 3    ASN C N   1 
ATOM   1344 C  CA  . ASN C 1 4  ? -10.008 -36.452 26.910  1.00 20.14 ? 3    ASN C CA  1 
ATOM   1345 C  C   . ASN C 1 4  ? -8.762  -35.637 26.533  1.00 19.46 ? 3    ASN C C   1 
ATOM   1346 O  O   . ASN C 1 4  ? -7.985  -35.984 25.629  1.00 18.74 ? 3    ASN C O   1 
ATOM   1347 C  CB  . ASN C 1 4  ? -9.678  -37.376 28.091  1.00 27.39 ? 3    ASN C CB  1 
ATOM   1348 C  CG  . ASN C 1 4  ? -10.903 -38.096 28.674  1.00 20.42 ? 3    ASN C CG  1 
ATOM   1349 O  OD1 . ASN C 1 4  ? -12.050 -37.827 28.318  1.00 28.79 ? 3    ASN C OD1 1 
ATOM   1350 N  ND2 . ASN C 1 4  ? -10.638 -39.028 29.572  1.00 36.19 ? 3    ASN C ND2 1 
ATOM   1351 N  N   . TYR C 1 5  ? -8.544  -34.543 27.234  1.00 16.21 ? 4    TYR C N   1 
ATOM   1352 C  CA  . TYR C 1 5  ? -7.407  -33.688 26.958  1.00 14.28 ? 4    TYR C CA  1 
ATOM   1353 C  C   . TYR C 1 5  ? -7.040  -32.951 28.235  1.00 15.86 ? 4    TYR C C   1 
ATOM   1354 O  O   . TYR C 1 5  ? -7.799  -32.932 29.214  1.00 16.46 ? 4    TYR C O   1 
ATOM   1355 C  CB  . TYR C 1 5  ? -7.709  -32.677 25.844  1.00 15.82 ? 4    TYR C CB  1 
ATOM   1356 C  CG  . TYR C 1 5  ? -8.720  -31.610 26.196  1.00 14.85 ? 4    TYR C CG  1 
ATOM   1357 C  CD1 . TYR C 1 5  ? -10.072 -31.907 26.200  1.00 13.05 ? 4    TYR C CD1 1 
ATOM   1358 C  CD2 . TYR C 1 5  ? -8.327  -30.301 26.523  1.00 15.86 ? 4    TYR C CD2 1 
ATOM   1359 C  CE1 . TYR C 1 5  ? -11.040 -30.942 26.531  1.00 12.89 ? 4    TYR C CE1 1 
ATOM   1360 C  CE2 . TYR C 1 5  ? -9.265  -29.340 26.859  1.00 15.20 ? 4    TYR C CE2 1 
ATOM   1361 C  CZ  . TYR C 1 5  ? -10.624 -29.655 26.858  1.00 14.78 ? 4    TYR C CZ  1 
ATOM   1362 O  OH  . TYR C 1 5  ? -11.523 -28.644 27.184  1.00 15.28 ? 4    TYR C OH  1 
ATOM   1363 N  N   . SER C 1 6  ? -5.861  -32.364 28.212  1.00 15.88 ? 5    SER C N   1 
ATOM   1364 C  CA  . SER C 1 6  ? -5.335  -31.646 29.358  1.00 13.09 ? 5    SER C CA  1 
ATOM   1365 C  C   . SER C 1 6  ? -4.975  -30.234 28.987  1.00 14.65 ? 5    SER C C   1 
ATOM   1366 O  O   . SER C 1 6  ? -4.683  -29.929 27.821  1.00 16.18 ? 5    SER C O   1 
ATOM   1367 C  CB  . SER C 1 6  ? -4.112  -32.394 29.901  1.00 18.54 ? 5    SER C CB  1 
ATOM   1368 O  OG  . SER C 1 6  ? -4.562  -33.669 30.360  1.00 23.73 ? 5    SER C OG  1 
ATOM   1369 N  N   . VAL C 1 7  ? -4.969  -29.361 29.990  1.00 14.40 ? 6    VAL C N   1 
ATOM   1370 C  CA  . VAL C 1 7  ? -4.471  -28.012 29.795  1.00 13.23 ? 6    VAL C CA  1 
ATOM   1371 C  C   . VAL C 1 7  ? -3.569  -27.643 30.967  1.00 14.69 ? 6    VAL C C   1 
ATOM   1372 O  O   . VAL C 1 7  ? -3.740  -28.151 32.086  1.00 15.99 ? 6    VAL C O   1 
ATOM   1373 C  CB  . VAL C 1 7  ? -5.608  -26.958 29.631  1.00 18.24 ? 6    VAL C CB  1 
ATOM   1374 C  CG1 . VAL C 1 7  ? -6.469  -27.265 28.418  1.00 19.99 ? 6    VAL C CG1 1 
ATOM   1375 C  CG2 . VAL C 1 7  ? -6.406  -26.865 30.924  1.00 17.63 ? 6    VAL C CG2 1 
ATOM   1376 N  N   . SER C 1 8  ? -2.583  -26.787 30.712  1.00 14.07 ? 7    SER C N   1 
ATOM   1377 C  CA  . SER C 1 8  ? -1.724  -26.244 31.748  1.00 18.03 ? 7    SER C CA  1 
ATOM   1378 C  C   . SER C 1 8  ? -1.610  -24.731 31.502  1.00 17.38 ? 7    SER C C   1 
ATOM   1379 O  O   . SER C 1 8  ? -0.905  -24.281 30.581  1.00 19.87 ? 7    SER C O   1 
ATOM   1380 C  CB  . SER C 1 8  ? -0.346  -26.950 31.745  1.00 16.22 ? 7    SER C CB  1 
ATOM   1381 O  OG  . SER C 1 8  ? 0.411   -26.533 32.890  1.00 21.34 ? 7    SER C OG  1 
ATOM   1382 N  N   . LEU C 1 9  ? -2.378  -23.963 32.256  1.00 15.41 ? 8    LEU C N   1 
ATOM   1383 C  CA  . LEU C 1 9  ? -2.514  -22.536 32.033  1.00 14.91 ? 8    LEU C CA  1 
ATOM   1384 C  C   . LEU C 1 9  ? -1.460  -21.833 32.915  1.00 16.16 ? 8    LEU C C   1 
ATOM   1385 O  O   . LEU C 1 9  ? -1.384  -22.110 34.119  1.00 18.14 ? 8    LEU C O   1 
ATOM   1386 C  CB  . LEU C 1 9  ? -3.930  -22.076 32.398  1.00 13.41 ? 8    LEU C CB  1 
ATOM   1387 C  CG  . LEU C 1 9  ? -5.122  -22.808 31.800  1.00 12.02 ? 8    LEU C CG  1 
ATOM   1388 C  CD1 . LEU C 1 9  ? -6.459  -22.190 32.147  1.00 16.96 ? 8    LEU C CD1 1 
ATOM   1389 C  CD2 . LEU C 1 9  ? -4.948  -22.927 30.256  1.00 15.07 ? 8    LEU C CD2 1 
ATOM   1390 N  N   . VAL C 1 10 ? -0.690  -20.926 32.321  1.00 16.57 ? 9    VAL C N   1 
ATOM   1391 C  CA  . VAL C 1 10 ? 0.316   -20.163 33.052  1.00 17.77 ? 9    VAL C CA  1 
ATOM   1392 C  C   . VAL C 1 10 ? -0.371  -19.123 33.930  1.00 20.95 ? 9    VAL C C   1 
ATOM   1393 O  O   . VAL C 1 10 ? -1.248  -18.382 33.449  1.00 22.61 ? 9    VAL C O   1 
ATOM   1394 C  CB  . VAL C 1 10 ? 1.272   -19.445 32.077  1.00 19.48 ? 9    VAL C CB  1 
ATOM   1395 C  CG1 . VAL C 1 10 ? 2.312   -18.651 32.817  1.00 17.59 ? 9    VAL C CG1 1 
ATOM   1396 C  CG2 . VAL C 1 10 ? 1.909   -20.463 31.147  1.00 28.83 ? 9    VAL C CG2 1 
ATOM   1397 N  N   . GLY C 1 11 ? -0.005  -19.080 35.211  1.00 20.51 ? 10   GLY C N   1 
ATOM   1398 C  CA  . GLY C 1 11 ? -0.550  -18.078 36.123  1.00 20.15 ? 10   GLY C CA  1 
ATOM   1399 C  C   . GLY C 1 11 ? -0.091  -16.655 35.868  1.00 20.95 ? 10   GLY C C   1 
ATOM   1400 O  O   . GLY C 1 11 ? 0.788   -16.428 35.040  1.00 22.15 ? 10   GLY C O   1 
ATOM   1401 N  N   . PRO C 1 12 ? -0.671  -15.675 36.605  1.00 20.14 ? 11   PRO C N   1 
ATOM   1402 C  CA  . PRO C 1 12 ? -1.697  -15.915 37.607  1.00 18.88 ? 11   PRO C CA  1 
ATOM   1403 C  C   . PRO C 1 12 ? -3.116  -15.890 37.023  1.00 18.69 ? 11   PRO C C   1 
ATOM   1404 O  O   . PRO C 1 12 ? -3.300  -15.661 35.825  1.00 18.87 ? 11   PRO C O   1 
ATOM   1405 C  CB  . PRO C 1 12 ? -1.530  -14.728 38.541  1.00 20.75 ? 11   PRO C CB  1 
ATOM   1406 C  CG  . PRO C 1 12 ? -1.216  -13.647 37.631  1.00 18.95 ? 11   PRO C CG  1 
ATOM   1407 C  CD  . PRO C 1 12 ? -0.360  -14.238 36.525  1.00 22.42 ? 11   PRO C CD  1 
ATOM   1408 N  N   . ALA C 1 13 ? -4.085  -16.159 37.891  1.00 17.89 ? 12   ALA C N   1 
ATOM   1409 C  CA  . ALA C 1 13 ? -5.487  -15.976 37.588  1.00 18.60 ? 12   ALA C CA  1 
ATOM   1410 C  C   . ALA C 1 13 ? -5.729  -14.489 37.242  1.00 20.63 ? 12   ALA C C   1 
ATOM   1411 O  O   . ALA C 1 13 ? -4.913  -13.626 37.612  1.00 17.12 ? 12   ALA C O   1 
ATOM   1412 C  CB  . ALA C 1 13 ? -6.314  -16.351 38.785  1.00 20.08 ? 12   ALA C CB  1 
ATOM   1413 N  N   . PRO C 1 14 ? -6.827  -14.171 36.521  1.00 19.59 ? 13   PRO C N   1 
ATOM   1414 C  CA  . PRO C 1 14 ? -7.918  -15.047 36.120  1.00 18.77 ? 13   PRO C CA  1 
ATOM   1415 C  C   . PRO C 1 14 ? -7.619  -15.968 34.946  1.00 20.12 ? 13   PRO C C   1 
ATOM   1416 O  O   . PRO C 1 14 ? -6.800  -15.653 34.069  1.00 16.24 ? 13   PRO C O   1 
ATOM   1417 C  CB  . PRO C 1 14 ? -9.046  -14.070 35.753  1.00 22.19 ? 13   PRO C CB  1 
ATOM   1418 C  CG  . PRO C 1 14 ? -8.478  -12.725 35.738  1.00 26.65 ? 13   PRO C CG  1 
ATOM   1419 C  CD  . PRO C 1 14 ? -7.025  -12.801 36.024  1.00 21.31 ? 13   PRO C CD  1 
ATOM   1420 N  N   . TRP C 1 15 ? -8.277  -17.120 34.981  1.00 14.45 ? 14   TRP C N   1 
ATOM   1421 C  CA  . TRP C 1 15 ? -8.108  -18.153 33.989  1.00 15.42 ? 14   TRP C CA  1 
ATOM   1422 C  C   . TRP C 1 15 ? -9.071  -17.970 32.818  1.00 15.16 ? 14   TRP C C   1 
ATOM   1423 O  O   . TRP C 1 15 ? -8.840  -18.533 31.752  1.00 16.12 ? 14   TRP C O   1 
ATOM   1424 C  CB  . TRP C 1 15 ? -8.312  -19.520 34.611  1.00 17.49 ? 14   TRP C CB  1 
ATOM   1425 C  CG  . TRP C 1 15 ? -7.492  -19.694 35.850  1.00 21.94 ? 14   TRP C CG  1 
ATOM   1426 C  CD1 . TRP C 1 15 ? -7.948  -19.783 37.121  1.00 21.82 ? 14   TRP C CD1 1 
ATOM   1427 C  CD2 . TRP C 1 15 ? -6.065  -19.728 35.937  1.00 15.78 ? 14   TRP C CD2 1 
ATOM   1428 N  NE1 . TRP C 1 15 ? -6.912  -19.890 37.993  1.00 20.86 ? 14   TRP C NE1 1 
ATOM   1429 C  CE2 . TRP C 1 15 ? -5.741  -19.884 37.296  1.00 18.20 ? 14   TRP C CE2 1 
ATOM   1430 C  CE3 . TRP C 1 15 ? -5.041  -19.717 34.995  1.00 19.34 ? 14   TRP C CE3 1 
ATOM   1431 C  CZ2 . TRP C 1 15 ? -4.422  -19.989 37.742  1.00 17.89 ? 14   TRP C CZ2 1 
ATOM   1432 C  CZ3 . TRP C 1 15 ? -3.741  -19.805 35.427  1.00 17.89 ? 14   TRP C CZ3 1 
ATOM   1433 C  CH2 . TRP C 1 15 ? -3.444  -19.932 36.798  1.00 19.64 ? 14   TRP C CH2 1 
ATOM   1434 N  N   . GLY C 1 16 ? -10.172 -17.249 33.020  1.00 14.24 ? 15   GLY C N   1 
ATOM   1435 C  CA  . GLY C 1 16 ? -11.069 -16.947 31.932  1.00 13.69 ? 15   GLY C CA  1 
ATOM   1436 C  C   . GLY C 1 16 ? -12.209 -17.911 31.692  1.00 16.60 ? 15   GLY C C   1 
ATOM   1437 O  O   . GLY C 1 16 ? -12.541 -18.202 30.533  1.00 15.61 ? 15   GLY C O   1 
ATOM   1438 N  N   . PHE C 1 17 ? -12.778 -18.465 32.760  1.00 12.64 ? 16   PHE C N   1 
ATOM   1439 C  CA  . PHE C 1 17 ? -13.886 -19.399 32.604  1.00 11.52 ? 16   PHE C CA  1 
ATOM   1440 C  C   . PHE C 1 17 ? -14.758 -19.400 33.832  1.00 12.48 ? 16   PHE C C   1 
ATOM   1441 O  O   . PHE C 1 17 ? -14.353 -18.941 34.887  1.00 13.86 ? 16   PHE C O   1 
ATOM   1442 C  CB  . PHE C 1 17 ? -13.385 -20.795 32.224  1.00 12.66 ? 16   PHE C CB  1 
ATOM   1443 C  CG  . PHE C 1 17 ? -12.665 -21.563 33.347  1.00 12.10 ? 16   PHE C CG  1 
ATOM   1444 C  CD1 . PHE C 1 17 ? -13.358 -22.414 34.190  1.00 12.85 ? 16   PHE C CD1 1 
ATOM   1445 C  CD2 . PHE C 1 17 ? -11.305 -21.381 33.566  1.00 11.68 ? 16   PHE C CD2 1 
ATOM   1446 C  CE1 . PHE C 1 17 ? -12.700 -23.136 35.188  1.00 13.81 ? 16   PHE C CE1 1 
ATOM   1447 C  CE2 . PHE C 1 17 ? -10.623 -22.119 34.572  1.00 11.05 ? 16   PHE C CE2 1 
ATOM   1448 C  CZ  . PHE C 1 17 ? -11.323 -22.970 35.375  1.00 15.38 ? 16   PHE C CZ  1 
ATOM   1449 N  N   . ARG C 1 18 ? -15.970 -19.927 33.652  1.00 13.85 ? 17   ARG C N   1 
ATOM   1450 C  CA  . ARG C 1 18 ? -16.844 -20.313 34.745  1.00 12.83 ? 17   ARG C CA  1 
ATOM   1451 C  C   . ARG C 1 18 ? -17.232 -21.768 34.623  1.00 10.85 ? 17   ARG C C   1 
ATOM   1452 O  O   . ARG C 1 18 ? -17.079 -22.426 33.583  1.00 13.46 ? 17   ARG C O   1 
ATOM   1453 C  CB  . ARG C 1 18 ? -18.123 -19.467 34.744  1.00 16.63 ? 17   ARG C CB  1 
ATOM   1454 C  CG  . ARG C 1 18 ? -17.896 -18.029 34.965  1.00 15.56 ? 17   ARG C CG  1 
ATOM   1455 C  CD  . ARG C 1 18 ? -19.125 -17.360 35.505  1.00 19.62 ? 17   ARG C CD  1 
ATOM   1456 N  NE  . ARG C 1 18 ? -20.207 -17.364 34.547  1.00 19.80 ? 17   ARG C NE  1 
ATOM   1457 C  CZ  . ARG C 1 18 ? -20.482 -16.386 33.695  1.00 22.40 ? 17   ARG C CZ  1 
ATOM   1458 N  NH1 . ARG C 1 18 ? -19.742 -15.272 33.646  1.00 25.21 ? 17   ARG C NH1 1 
ATOM   1459 N  NH2 . ARG C 1 18 ? -21.523 -16.513 32.870  1.00 20.93 ? 17   ARG C NH2 1 
ATOM   1460 N  N   . LEU C 1 19 ? -17.738 -22.264 35.739  1.00 13.86 ? 18   LEU C N   1 
ATOM   1461 C  CA  . LEU C 1 19 ? -18.222 -23.584 35.839  1.00 11.23 ? 18   LEU C CA  1 
ATOM   1462 C  C   . LEU C 1 19 ? -19.721 -23.653 36.204  1.00 11.86 ? 18   LEU C C   1 
ATOM   1463 O  O   . LEU C 1 19 ? -20.215 -22.776 36.958  1.00 13.17 ? 18   LEU C O   1 
ATOM   1464 C  CB  . LEU C 1 19 ? -17.420 -24.346 36.901  1.00 14.61 ? 18   LEU C CB  1 
ATOM   1465 C  CG  . LEU C 1 19 ? -15.936 -24.590 36.672  1.00 15.59 ? 18   LEU C CG  1 
ATOM   1466 C  CD1 . LEU C 1 19 ? -15.271 -25.109 37.926  1.00 20.87 ? 18   LEU C CD1 1 
ATOM   1467 C  CD2 . LEU C 1 19 ? -15.749 -25.576 35.547  1.00 14.81 ? 18   LEU C CD2 1 
ATOM   1468 N  N   . GLN C 1 20 ? -20.419 -24.724 35.767  1.00 12.67 ? 19   GLN C N   1 
ATOM   1469 C  CA  . GLN C 1 20 ? -21.692 -25.144 36.355  1.00 16.62 ? 19   GLN C CA  1 
ATOM   1470 C  C   . GLN C 1 20 ? -21.557 -26.568 36.810  1.00 13.32 ? 19   GLN C C   1 
ATOM   1471 O  O   . GLN C 1 20 ? -20.705 -27.307 36.329  1.00 12.34 ? 19   GLN C O   1 
ATOM   1472 C  CB  . GLN C 1 20 ? -22.859 -25.006 35.368  1.00 19.36 ? 19   GLN C CB  1 
ATOM   1473 C  CG  . GLN C 1 20 ? -23.231 -23.567 35.192  1.00 18.34 ? 19   GLN C CG  1 
ATOM   1474 C  CD  . GLN C 1 20 ? -24.426 -23.355 34.258  1.00 21.26 ? 19   GLN C CD  1 
ATOM   1475 O  OE1 . GLN C 1 20 ? -25.219 -24.257 34.019  1.00 25.22 ? 19   GLN C OE1 1 
ATOM   1476 N  NE2 . GLN C 1 20 ? -24.538 -22.128 33.732  1.00 22.88 ? 19   GLN C NE2 1 
ATOM   1477 N  N   . GLY C 1 21 ? -22.446 -26.987 37.705  1.00 12.97 ? 20   GLY C N   1 
ATOM   1478 C  CA  . GLY C 1 21 ? -22.540 -28.348 38.095  1.00 13.72 ? 20   GLY C CA  1 
ATOM   1479 C  C   . GLY C 1 21 ? -21.574 -28.738 39.179  1.00 14.19 ? 20   GLY C C   1 
ATOM   1480 O  O   . GLY C 1 21 ? -20.956 -27.893 39.804  1.00 16.24 ? 20   GLY C O   1 
ATOM   1481 N  N   . GLY C 1 22 ? -21.419 -30.049 39.347  1.00 13.51 ? 21   GLY C N   1 
ATOM   1482 C  CA  . GLY C 1 22 ? -20.704 -30.626 40.443  1.00 14.23 ? 21   GLY C CA  1 
ATOM   1483 C  C   . GLY C 1 22 ? -21.483 -31.725 41.111  1.00 15.62 ? 21   GLY C C   1 
ATOM   1484 O  O   . GLY C 1 22 ? -22.621 -32.048 40.716  1.00 13.70 ? 21   GLY C O   1 
ATOM   1485 N  N   . LYS C 1 23 ? -20.849 -32.348 42.100  1.00 16.14 ? 22   LYS C N   1 
ATOM   1486 C  CA  . LYS C 1 23 ? -21.430 -33.529 42.772  1.00 18.28 ? 22   LYS C CA  1 
ATOM   1487 C  C   . LYS C 1 23 ? -22.823 -33.199 43.303  1.00 21.21 ? 22   LYS C C   1 
ATOM   1488 O  O   . LYS C 1 23 ? -23.748 -34.032 43.248  1.00 18.82 ? 22   LYS C O   1 
ATOM   1489 C  CB  . LYS C 1 23 ? -20.540 -33.981 43.928  1.00 22.00 ? 22   LYS C CB  1 
ATOM   1490 C  CG  . LYS C 1 23 ? -21.057 -35.202 44.713  1.00 27.14 ? 22   LYS C CG  1 
ATOM   1491 C  CD  . LYS C 1 23 ? -20.521 -35.179 46.142  1.00 24.68 ? 22   LYS C CD  1 
ATOM   1492 N  N   . ASP C 1 24 ? -22.965 -31.965 43.774  1.00 16.26 ? 23   ASP C N   1 
ATOM   1493 C  CA  . ASP C 1 24 ? -24.202 -31.454 44.349  1.00 17.88 ? 23   ASP C CA  1 
ATOM   1494 C  C   . ASP C 1 24 ? -25.334 -31.089 43.339  1.00 12.91 ? 23   ASP C C   1 
ATOM   1495 O  O   . ASP C 1 24 ? -26.405 -30.630 43.748  1.00 17.70 ? 23   ASP C O   1 
ATOM   1496 C  CB  . ASP C 1 24 ? -23.941 -30.314 45.366  1.00 16.47 ? 23   ASP C CB  1 
ATOM   1497 C  CG  . ASP C 1 24 ? -22.963 -29.222 44.893  1.00 15.34 ? 23   ASP C CG  1 
ATOM   1498 O  OD1 . ASP C 1 24 ? -23.013 -28.151 45.556  1.00 19.35 ? 23   ASP C OD1 1 
ATOM   1499 O  OD2 . ASP C 1 24 ? -22.183 -29.436 43.952  1.00 13.67 ? 23   ASP C OD2 1 
ATOM   1500 N  N   . PHE C 1 25 ? -25.097 -31.379 42.057  1.00 18.72 ? 24   PHE C N   1 
ATOM   1501 C  CA  . PHE C 1 25 ? -26.019 -31.117 40.964  1.00 15.20 ? 24   PHE C CA  1 
ATOM   1502 C  C   . PHE C 1 25 ? -26.222 -32.338 40.039  1.00 16.21 ? 24   PHE C C   1 
ATOM   1503 O  O   . PHE C 1 25 ? -25.411 -33.255 40.005  1.00 23.26 ? 24   PHE C O   1 
ATOM   1504 C  CB  . PHE C 1 25 ? -25.490 -29.958 40.154  1.00 16.33 ? 24   PHE C CB  1 
ATOM   1505 C  CG  . PHE C 1 25 ? -25.472 -28.675 40.908  1.00 14.60 ? 24   PHE C CG  1 
ATOM   1506 C  CD1 . PHE C 1 25 ? -24.319 -28.257 41.566  1.00 17.75 ? 24   PHE C CD1 1 
ATOM   1507 C  CD2 . PHE C 1 25 ? -26.615 -27.886 40.979  1.00 20.20 ? 24   PHE C CD2 1 
ATOM   1508 C  CE1 . PHE C 1 25 ? -24.303 -27.086 42.277  1.00 16.58 ? 24   PHE C CE1 1 
ATOM   1509 C  CE2 . PHE C 1 25 ? -26.608 -26.687 41.669  1.00 13.46 ? 24   PHE C CE2 1 
ATOM   1510 C  CZ  . PHE C 1 25 ? -25.454 -26.290 42.341  1.00 18.64 ? 24   PHE C CZ  1 
ATOM   1511 N  N   . ASN C 1 26 ? -27.281 -32.310 39.253  1.00 18.67 ? 25   ASN C N   1 
ATOM   1512 C  CA  . ASN C 1 26 ? -27.510 -33.320 38.199  1.00 24.26 ? 25   ASN C CA  1 
ATOM   1513 C  C   . ASN C 1 26 ? -26.424 -33.186 37.115  1.00 24.94 ? 25   ASN C C   1 
ATOM   1514 O  O   . ASN C 1 26 ? -25.910 -34.195 36.591  1.00 27.54 ? 25   ASN C O   1 
ATOM   1515 C  CB  . ASN C 1 26 ? -28.906 -33.101 37.587  1.00 21.82 ? 25   ASN C CB  1 
ATOM   1516 C  CG  . ASN C 1 26 ? -29.236 -34.093 36.492  1.00 39.95 ? 25   ASN C CG  1 
ATOM   1517 O  OD1 . ASN C 1 26 ? -29.092 -35.304 36.671  1.00 28.39 ? 25   ASN C OD1 1 
ATOM   1518 N  ND2 . ASN C 1 26 ? -29.677 -33.582 35.345  1.00 40.60 ? 25   ASN C ND2 1 
ATOM   1519 N  N   . MET C 1 27 ? -26.094 -31.944 36.786  1.00 26.33 ? 26   MET C N   1 
ATOM   1520 C  CA  . MET C 1 27 ? -25.010 -31.627 35.865  1.00 23.67 ? 26   MET C CA  1 
ATOM   1521 C  C   . MET C 1 27 ? -23.646 -31.882 36.509  1.00 24.89 ? 26   MET C C   1 
ATOM   1522 O  O   . MET C 1 27 ? -23.412 -31.400 37.629  1.00 21.68 ? 26   MET C O   1 
ATOM   1523 C  CB  . MET C 1 27 ? -25.114 -30.149 35.478  1.00 15.04 ? 26   MET C CB  1 
ATOM   1524 C  CG  . MET C 1 27 ? -24.185 -29.768 34.338  1.00 24.02 ? 26   MET C CG  1 
ATOM   1525 S  SD  . MET C 1 27 ? -24.174 -27.998 34.046  1.00 30.20 ? 26   MET C SD  1 
ATOM   1526 C  CE  . MET C 1 27 ? -25.928 -27.603 34.069  1.00 37.63 ? 26   MET C CE  1 
ATOM   1527 N  N   . PRO C 1 28 ? -22.727 -32.618 35.818  1.00 24.18 ? 27   PRO C N   1 
ATOM   1528 C  CA  . PRO C 1 28 ? -21.355 -32.765 36.325  1.00 26.52 ? 27   PRO C CA  1 
ATOM   1529 C  C   . PRO C 1 28 ? -20.614 -31.448 36.169  1.00 17.13 ? 27   PRO C C   1 
ATOM   1530 O  O   . PRO C 1 28 ? -21.114 -30.526 35.556  1.00 18.16 ? 27   PRO C O   1 
ATOM   1531 C  CB  . PRO C 1 28 ? -20.709 -33.781 35.385  1.00 25.35 ? 27   PRO C CB  1 
ATOM   1532 C  CG  . PRO C 1 28 ? -21.398 -33.595 34.134  1.00 28.66 ? 27   PRO C CG  1 
ATOM   1533 C  CD  . PRO C 1 28 ? -22.862 -33.300 34.516  1.00 24.98 ? 27   PRO C CD  1 
ATOM   1534 N  N   . LEU C 1 29 ? -19.374 -31.382 36.647  1.00 18.93 ? 28   LEU C N   1 
ATOM   1535 C  CA  . LEU C 1 29 ? -18.612 -30.148 36.581  1.00 16.29 ? 28   LEU C CA  1 
ATOM   1536 C  C   . LEU C 1 29 ? -18.307 -29.813 35.134  1.00 14.36 ? 28   LEU C C   1 
ATOM   1537 O  O   . LEU C 1 29 ? -17.594 -30.546 34.475  1.00 13.78 ? 28   LEU C O   1 
ATOM   1538 C  CB  A LEU C 1 29 ? -17.385 -30.327 37.464  0.50 14.22 ? 28   LEU C CB  1 
ATOM   1539 C  CB  B LEU C 1 29 ? -17.275 -30.221 37.337  0.50 16.08 ? 28   LEU C CB  1 
ATOM   1540 C  CG  A LEU C 1 29 ? -16.562 -29.126 37.807  0.50 9.67  ? 28   LEU C CG  1 
ATOM   1541 C  CG  B LEU C 1 29 ? -17.181 -30.092 38.841  0.50 16.73 ? 28   LEU C CG  1 
ATOM   1542 C  CD1 A LEU C 1 29 ? -17.339 -28.100 38.639  0.50 16.10 ? 28   LEU C CD1 1 
ATOM   1543 C  CD1 B LEU C 1 29 ? -15.708 -30.321 39.252  0.50 13.92 ? 28   LEU C CD1 1 
ATOM   1544 C  CD2 A LEU C 1 29 ? -15.289 -29.581 38.525  0.50 9.24  ? 28   LEU C CD2 1 
ATOM   1545 C  CD2 B LEU C 1 29 ? -17.696 -28.715 39.262  0.50 12.13 ? 28   LEU C CD2 1 
ATOM   1546 N  N   . THR C 1 30 ? -18.827 -28.681 34.658  1.00 16.43 ? 29   THR C N   1 
ATOM   1547 C  CA  . THR C 1 30 ? -18.900 -28.346 33.241  1.00 11.75 ? 29   THR C CA  1 
ATOM   1548 C  C   . THR C 1 30 ? -18.381 -26.941 33.020  1.00 11.04 ? 29   THR C C   1 
ATOM   1549 O  O   . THR C 1 30 ? -18.766 -26.021 33.756  1.00 13.39 ? 29   THR C O   1 
ATOM   1550 C  CB  . THR C 1 30 ? -20.358 -28.481 32.718  1.00 15.24 ? 29   THR C CB  1 
ATOM   1551 O  OG1 . THR C 1 30 ? -20.838 -29.801 32.967  1.00 16.66 ? 29   THR C OG1 1 
ATOM   1552 C  CG2 . THR C 1 30 ? -20.460 -28.156 31.191  1.00 16.61 ? 29   THR C CG2 1 
ATOM   1553 N  N   . ILE C 1 31 ? -17.589 -26.698 31.968  1.00 11.03 ? 30   ILE C N   1 
ATOM   1554 C  CA  . ILE C 1 31 ? -17.217 -25.345 31.552  1.00 12.77 ? 30   ILE C CA  1 
ATOM   1555 C  C   . ILE C 1 31 ? -18.477 -24.666 31.008  1.00 12.57 ? 30   ILE C C   1 
ATOM   1556 O  O   . ILE C 1 31 ? -19.083 -25.157 30.050  1.00 15.29 ? 30   ILE C O   1 
ATOM   1557 C  CB  . ILE C 1 31 ? -16.147 -25.390 30.479  1.00 14.15 ? 30   ILE C CB  1 
ATOM   1558 C  CG1 . ILE C 1 31 ? -14.857 -26.127 30.951  1.00 12.34 ? 30   ILE C CG1 1 
ATOM   1559 C  CG2 . ILE C 1 31 ? -15.858 -23.980 29.982  1.00 13.88 ? 30   ILE C CG2 1 
ATOM   1560 C  CD1 . ILE C 1 31 ? -14.105 -25.428 32.063  1.00 15.59 ? 30   ILE C CD1 1 
ATOM   1561 N  N   . SER C 1 32 ? -18.910 -23.594 31.661  1.00 13.70 ? 31   SER C N   1 
ATOM   1562 C  CA  . SER C 1 32 ? -20.175 -22.979 31.318  1.00 12.90 ? 31   SER C CA  1 
ATOM   1563 C  C   . SER C 1 32 ? -20.032 -21.627 30.638  1.00 17.44 ? 31   SER C C   1 
ATOM   1564 O  O   . SER C 1 32 ? -20.977 -21.157 30.021  1.00 18.54 ? 31   SER C O   1 
ATOM   1565 C  CB  . SER C 1 32 ? -21.002 -22.788 32.585  1.00 15.10 ? 31   SER C CB  1 
ATOM   1566 O  OG  . SER C 1 32 ? -20.309 -22.003 33.533  1.00 15.23 ? 31   SER C OG  1 
ATOM   1567 N  N   . SER C 1 33 ? -18.858 -21.007 30.758  1.00 15.64 ? 32   SER C N   1 
ATOM   1568 C  CA  . SER C 1 33 ? -18.566 -19.769 30.091  1.00 13.16 ? 32   SER C CA  1 
ATOM   1569 C  C   . SER C 1 33 ? -17.054 -19.659 29.865  1.00 18.22 ? 32   SER C C   1 
ATOM   1570 O  O   . SER C 1 33 ? -16.248 -20.295 30.558  1.00 15.05 ? 32   SER C O   1 
ATOM   1571 C  CB  . SER C 1 33 ? -19.060 -18.605 30.948  1.00 18.70 ? 32   SER C CB  1 
ATOM   1572 O  OG  . SER C 1 33 ? -18.912 -17.380 30.268  1.00 23.73 ? 32   SER C OG  1 
ATOM   1573 N  N   . LEU C 1 34 ? -16.698 -18.844 28.875  1.00 15.04 ? 33   LEU C N   1 
ATOM   1574 C  CA  . LEU C 1 34 ? -15.323 -18.501 28.545  1.00 12.41 ? 33   LEU C CA  1 
ATOM   1575 C  C   . LEU C 1 34 ? -15.200 -17.010 28.241  1.00 18.44 ? 33   LEU C C   1 
ATOM   1576 O  O   . LEU C 1 34 ? -16.021 -16.411 27.549  1.00 20.60 ? 33   LEU C O   1 
ATOM   1577 C  CB  . LEU C 1 34 ? -14.824 -19.292 27.354  1.00 14.66 ? 33   LEU C CB  1 
ATOM   1578 C  CG  . LEU C 1 34 ? -14.590 -20.782 27.443  1.00 16.46 ? 33   LEU C CG  1 
ATOM   1579 C  CD1 . LEU C 1 34 ? -14.453 -21.364 26.016  1.00 18.87 ? 33   LEU C CD1 1 
ATOM   1580 C  CD2 . LEU C 1 34 ? -13.413 -21.105 28.314  1.00 14.79 ? 33   LEU C CD2 1 
ATOM   1581 N  N   . LYS C 1 35 ? -14.135 -16.420 28.744  1.00 13.46 ? 34   LYS C N   1 
ATOM   1582 C  CA  . LYS C 1 35 ? -13.768 -15.064 28.414  1.00 17.40 ? 34   LYS C CA  1 
ATOM   1583 C  C   . LYS C 1 35 ? -13.043 -15.060 27.060  1.00 17.91 ? 34   LYS C C   1 
ATOM   1584 O  O   . LYS C 1 35 ? -12.068 -15.783 26.857  1.00 16.41 ? 34   LYS C O   1 
ATOM   1585 C  CB  . LYS C 1 35 ? -12.886 -14.462 29.512  1.00 23.44 ? 34   LYS C CB  1 
ATOM   1586 C  CG  . LYS C 1 35 ? -13.625 -13.873 30.700  1.00 28.44 ? 34   LYS C CG  1 
ATOM   1587 N  N   . ASP C 1 36 ? -13.551 -14.273 26.115  1.00 18.43 ? 35   ASP C N   1 
ATOM   1588 C  CA  . ASP C 1 36 ? -12.853 -14.009 24.868  1.00 25.50 ? 35   ASP C CA  1 
ATOM   1589 C  C   . ASP C 1 36 ? -11.406 -13.621 25.109  1.00 17.13 ? 35   ASP C C   1 
ATOM   1590 O  O   . ASP C 1 36 ? -11.117 -12.681 25.839  1.00 19.02 ? 35   ASP C O   1 
ATOM   1591 C  CB  . ASP C 1 36 ? -13.537 -12.852 24.133  1.00 30.53 ? 35   ASP C CB  1 
ATOM   1592 C  CG  . ASP C 1 36 ? -14.732 -13.297 23.329  1.00 37.81 ? 35   ASP C CG  1 
ATOM   1593 O  OD1 . ASP C 1 36 ? -15.220 -14.433 23.538  1.00 48.44 ? 35   ASP C OD1 1 
ATOM   1594 O  OD2 . ASP C 1 36 ? -15.178 -12.498 22.473  1.00 55.52 ? 35   ASP C OD2 1 
ATOM   1595 N  N   . GLY C 1 37 ? -10.490 -14.349 24.494  1.00 16.45 ? 36   GLY C N   1 
ATOM   1596 C  CA  . GLY C 1 37 ? -9.089  -14.052 24.601  1.00 13.80 ? 36   GLY C CA  1 
ATOM   1597 C  C   . GLY C 1 37 ? -8.458  -14.441 25.923  1.00 18.38 ? 36   GLY C C   1 
ATOM   1598 O  O   . GLY C 1 37 ? -7.289  -14.175 26.133  1.00 17.94 ? 36   GLY C O   1 
ATOM   1599 N  N   . GLY C 1 38 ? -9.220  -15.089 26.796  1.00 18.31 ? 37   GLY C N   1 
ATOM   1600 C  CA  . GLY C 1 38 ? -8.706  -15.544 28.068  1.00 15.85 ? 37   GLY C CA  1 
ATOM   1601 C  C   . GLY C 1 38 ? -7.868  -16.793 27.966  1.00 15.33 ? 37   GLY C C   1 
ATOM   1602 O  O   . GLY C 1 38 ? -7.796  -17.422 26.913  1.00 14.52 ? 37   GLY C O   1 
ATOM   1603 N  N   . LYS C 1 39 ? -7.226  -17.167 29.069  1.00 14.00 ? 38   LYS C N   1 
ATOM   1604 C  CA  . LYS C 1 39 ? -6.278  -18.283 29.067  1.00 14.32 ? 38   LYS C CA  1 
ATOM   1605 C  C   . LYS C 1 39 ? -6.923  -19.630 28.700  1.00 12.35 ? 38   LYS C C   1 
ATOM   1606 O  O   . LYS C 1 39 ? -6.357  -20.394 27.916  1.00 14.37 ? 38   LYS C O   1 
ATOM   1607 C  CB  . LYS C 1 39 ? -5.538  -18.369 30.408  1.00 11.88 ? 38   LYS C CB  1 
ATOM   1608 C  CG  . LYS C 1 39 ? -4.543  -17.266 30.545  1.00 16.20 ? 38   LYS C CG  1 
ATOM   1609 C  CD  . LYS C 1 39 ? -3.935  -17.149 31.944  1.00 17.61 ? 38   LYS C CD  1 
ATOM   1610 C  CE  . LYS C 1 39 ? -2.868  -16.086 31.940  1.00 21.51 ? 38   LYS C CE  1 
ATOM   1611 N  NZ  . LYS C 1 39 ? -2.276  -15.830 33.283  1.00 24.01 ? 38   LYS C NZ  1 
ATOM   1612 N  N   . ALA C 1 40 ? -8.112  -19.891 29.234  1.00 14.93 ? 39   ALA C N   1 
ATOM   1613 C  CA  . ALA C 1 40 ? -8.801  -21.145 28.984  1.00 13.79 ? 39   ALA C CA  1 
ATOM   1614 C  C   . ALA C 1 40 ? -9.182  -21.258 27.520  1.00 11.46 ? 39   ALA C C   1 
ATOM   1615 O  O   . ALA C 1 40 ? -8.921  -22.268 26.879  1.00 11.46 ? 39   ALA C O   1 
ATOM   1616 C  CB  . ALA C 1 40 ? -10.019 -21.248 29.874  1.00 13.11 ? 39   ALA C CB  1 
ATOM   1617 N  N   . ALA C 1 41 ? -9.722  -20.170 26.980  1.00 11.61 ? 40   ALA C N   1 
ATOM   1618 C  CA  . ALA C 1 41 ? -10.131 -20.140 25.561  1.00 13.76 ? 40   ALA C CA  1 
ATOM   1619 C  C   . ALA C 1 41 ? -8.923  -20.353 24.641  1.00 16.09 ? 40   ALA C C   1 
ATOM   1620 O  O   . ALA C 1 41 ? -9.007  -21.120 23.680  1.00 15.92 ? 40   ALA C O   1 
ATOM   1621 C  CB  . ALA C 1 41 ? -10.832 -18.812 25.208  1.00 16.91 ? 40   ALA C CB  1 
ATOM   1622 N  N   . GLN C 1 42 ? -7.796  -19.702 24.944  1.00 13.96 ? 41   GLN C N   1 
ATOM   1623 C  CA  . GLN C 1 42 ? -6.573  -19.816 24.125  1.00 17.96 ? 41   GLN C CA  1 
ATOM   1624 C  C   . GLN C 1 42 ? -6.020  -21.223 24.175  1.00 18.16 ? 41   GLN C C   1 
ATOM   1625 O  O   . GLN C 1 42 ? -5.337  -21.652 23.235  1.00 19.10 ? 41   GLN C O   1 
ATOM   1626 C  CB  . GLN C 1 42 ? -5.490  -18.839 24.583  1.00 18.14 ? 41   GLN C CB  1 
ATOM   1627 C  CG  . GLN C 1 42 ? -5.716  -17.384 24.213  1.00 26.15 ? 41   GLN C CG  1 
ATOM   1628 C  CD  . GLN C 1 42 ? -4.435  -16.537 24.450  1.00 36.20 ? 41   GLN C CD  1 
ATOM   1629 O  OE1 . GLN C 1 42 ? -3.328  -16.905 24.013  1.00 39.79 ? 41   GLN C OE1 1 
ATOM   1630 N  NE2 . GLN C 1 42 ? -4.589  -15.419 25.142  1.00 48.46 ? 41   GLN C NE2 1 
ATOM   1631 N  N   . ALA C 1 43 ? -6.313  -21.932 25.269  1.00 13.13 ? 42   ALA C N   1 
ATOM   1632 C  CA  . ALA C 1 43 ? -5.906  -23.312 25.480  1.00 13.04 ? 42   ALA C CA  1 
ATOM   1633 C  C   . ALA C 1 43 ? -6.857  -24.312 24.825  1.00 17.44 ? 42   ALA C C   1 
ATOM   1634 O  O   . ALA C 1 43 ? -6.671  -25.530 24.981  1.00 17.91 ? 42   ALA C O   1 
ATOM   1635 C  CB  . ALA C 1 43 ? -5.704  -23.617 26.963  1.00 15.68 ? 42   ALA C CB  1 
ATOM   1636 N  N   . ASN C 1 44 ? -7.877  -23.794 24.126  1.00 15.94 ? 43   ASN C N   1 
ATOM   1637 C  CA  . ASN C 1 44 ? -8.864  -24.595 23.371  1.00 17.13 ? 43   ASN C CA  1 
ATOM   1638 C  C   . ASN C 1 44 ? -9.824  -25.397 24.238  1.00 14.93 ? 43   ASN C C   1 
ATOM   1639 O  O   . ASN C 1 44 ? -10.332 -26.429 23.857  1.00 15.50 ? 43   ASN C O   1 
ATOM   1640 C  CB  . ASN C 1 44 ? -8.180  -25.448 22.308  1.00 18.61 ? 43   ASN C CB  1 
ATOM   1641 C  CG  . ASN C 1 44 ? -7.835  -24.652 21.095  1.00 28.53 ? 43   ASN C CG  1 
ATOM   1642 O  OD1 . ASN C 1 44 ? -8.654  -23.862 20.607  1.00 44.12 ? 43   ASN C OD1 1 
ATOM   1643 N  ND2 . ASN C 1 44 ? -6.633  -24.847 20.589  1.00 41.49 ? 43   ASN C ND2 1 
ATOM   1644 N  N   . VAL C 1 45 ? -10.031 -24.919 25.454  1.00 12.08 ? 44   VAL C N   1 
ATOM   1645 C  CA  . VAL C 1 45 ? -11.117 -25.378 26.287  1.00 13.28 ? 44   VAL C CA  1 
ATOM   1646 C  C   . VAL C 1 45 ? -12.422 -24.876 25.644  1.00 16.17 ? 44   VAL C C   1 
ATOM   1647 O  O   . VAL C 1 45 ? -12.480 -23.734 25.165  1.00 15.77 ? 44   VAL C O   1 
ATOM   1648 C  CB  . VAL C 1 45 ? -10.988 -24.804 27.690  1.00 11.80 ? 44   VAL C CB  1 
ATOM   1649 C  CG1 . VAL C 1 45 ? -12.241 -25.161 28.563  1.00 12.34 ? 44   VAL C CG1 1 
ATOM   1650 C  CG2 . VAL C 1 45 ? -9.684  -25.241 28.380  1.00 12.71 ? 44   VAL C CG2 1 
ATOM   1651 N  N   . ARG C 1 46 ? -13.470 -25.697 25.674  1.00 13.50 ? 45   ARG C N   1 
ATOM   1652 C  CA  . ARG C 1 46 ? -14.732 -25.340 25.025  1.00 14.02 ? 45   ARG C CA  1 
ATOM   1653 C  C   . ARG C 1 46 ? -15.877 -25.464 25.999  1.00 16.18 ? 45   ARG C C   1 
ATOM   1654 O  O   . ARG C 1 46 ? -15.913 -26.379 26.825  1.00 12.51 ? 45   ARG C O   1 
ATOM   1655 C  CB  . ARG C 1 46 ? -14.997 -26.264 23.817  1.00 16.80 ? 45   ARG C CB  1 
ATOM   1656 C  CG  . ARG C 1 46 ? -13.975 -26.069 22.707  1.00 15.61 ? 45   ARG C CG  1 
ATOM   1657 C  CD  . ARG C 1 46 ? -14.141 -26.997 21.530  1.00 16.77 ? 45   ARG C CD  1 
ATOM   1658 N  NE  . ARG C 1 46 ? -12.953 -26.776 20.710  1.00 24.11 ? 45   ARG C NE  1 
ATOM   1659 C  CZ  . ARG C 1 46 ? -12.171 -27.705 20.181  1.00 19.50 ? 45   ARG C CZ  1 
ATOM   1660 N  NH1 . ARG C 1 46 ? -12.462 -28.994 20.233  1.00 22.28 ? 45   ARG C NH1 1 
ATOM   1661 N  NH2 . ARG C 1 46 ? -11.111 -27.313 19.484  1.00 36.94 ? 45   ARG C NH2 1 
ATOM   1662 N  N   . ILE C 1 47 ? -16.854 -24.572 25.881  1.00 13.93 ? 46   ILE C N   1 
ATOM   1663 C  CA  . ILE C 1 47 ? -18.066 -24.659 26.707  1.00 15.43 ? 46   ILE C CA  1 
ATOM   1664 C  C   . ILE C 1 47 ? -18.747 -26.030 26.524  1.00 12.21 ? 46   ILE C C   1 
ATOM   1665 O  O   . ILE C 1 47 ? -18.858 -26.522 25.404  1.00 12.29 ? 46   ILE C O   1 
ATOM   1666 C  CB  . ILE C 1 47 ? -19.048 -23.468 26.403  1.00 13.61 ? 46   ILE C CB  1 
ATOM   1667 C  CG1 . ILE C 1 47 ? -18.415 -22.141 26.825  1.00 14.13 ? 46   ILE C CG1 1 
ATOM   1668 C  CG2 . ILE C 1 47 ? -20.427 -23.735 27.063  1.00 13.65 ? 46   ILE C CG2 1 
ATOM   1669 C  CD1 . ILE C 1 47 ? -19.143 -20.854 26.378  1.00 15.22 ? 46   ILE C CD1 1 
ATOM   1670 N  N   . GLY C 1 48 ? -19.141 -26.667 27.631  1.00 12.05 ? 47   GLY C N   1 
ATOM   1671 C  CA  . GLY C 1 48 ? -19.739 -27.974 27.667  1.00 14.66 ? 47   GLY C CA  1 
ATOM   1672 C  C   . GLY C 1 48 ? -18.778 -29.066 28.064  1.00 13.95 ? 47   GLY C C   1 
ATOM   1673 O  O   . GLY C 1 48 ? -19.192 -30.178 28.450  1.00 13.08 ? 47   GLY C O   1 
ATOM   1674 N  N   . ASP C 1 49 ? -17.481 -28.798 27.946  1.00 11.78 ? 48   ASP C N   1 
ATOM   1675 C  CA  . ASP C 1 49 ? -16.483 -29.798 28.297  1.00 13.51 ? 48   ASP C CA  1 
ATOM   1676 C  C   . ASP C 1 49 ? -16.541 -30.027 29.795  1.00 13.20 ? 48   ASP C C   1 
ATOM   1677 O  O   . ASP C 1 49 ? -16.868 -29.135 30.560  1.00 13.35 ? 48   ASP C O   1 
ATOM   1678 C  CB  . ASP C 1 49 ? -15.084 -29.417 27.857  1.00 12.99 ? 48   ASP C CB  1 
ATOM   1679 C  CG  . ASP C 1 49 ? -14.915 -29.437 26.369  1.00 13.98 ? 48   ASP C CG  1 
ATOM   1680 O  OD1 . ASP C 1 49 ? -15.798 -29.946 25.616  1.00 12.35 ? 48   ASP C OD1 1 
ATOM   1681 O  OD2 . ASP C 1 49 ? -13.854 -28.920 25.962  1.00 14.40 ? 48   ASP C OD2 1 
ATOM   1682 N  N   . VAL C 1 50 ? -16.306 -31.243 30.184  1.00 12.08 ? 49   VAL C N   1 
ATOM   1683 C  CA  . VAL C 1 50 ? -16.463 -31.686 31.561  1.00 11.31 ? 49   VAL C CA  1 
ATOM   1684 C  C   . VAL C 1 50 ? -15.098 -31.779 32.234  1.00 12.35 ? 49   VAL C C   1 
ATOM   1685 O  O   . VAL C 1 50 ? -14.152 -32.329 31.666  1.00 15.08 ? 49   VAL C O   1 
ATOM   1686 C  CB  . VAL C 1 50 ? -17.222 -33.009 31.593  1.00 15.38 ? 49   VAL C CB  1 
ATOM   1687 C  CG1 . VAL C 1 50 ? -17.257 -33.577 32.992  1.00 19.25 ? 49   VAL C CG1 1 
ATOM   1688 C  CG2 . VAL C 1 50 ? -18.621 -32.800 31.070  1.00 19.90 ? 49   VAL C CG2 1 
ATOM   1689 N  N   . VAL C 1 51 ? -14.978 -31.193 33.419  1.00 13.38 ? 50   VAL C N   1 
ATOM   1690 C  CA  . VAL C 1 51 ? -13.720 -31.199 34.186  1.00 12.91 ? 50   VAL C CA  1 
ATOM   1691 C  C   . VAL C 1 51 ? -13.614 -32.550 34.936  1.00 12.49 ? 50   VAL C C   1 
ATOM   1692 O  O   . VAL C 1 51 ? -14.471 -32.888 35.780  1.00 16.76 ? 50   VAL C O   1 
ATOM   1693 C  CB  . VAL C 1 51 ? -13.702 -29.997 35.165  1.00 17.26 ? 50   VAL C CB  1 
ATOM   1694 C  CG1 . VAL C 1 51 ? -12.431 -29.990 36.022  1.00 16.05 ? 50   VAL C CG1 1 
ATOM   1695 C  CG2 . VAL C 1 51 ? -13.842 -28.672 34.419  1.00 16.99 ? 50   VAL C CG2 1 
ATOM   1696 N  N   . LEU C 1 52 ? -12.544 -33.267 34.657  1.00 11.58 ? 51   LEU C N   1 
ATOM   1697 C  CA  . LEU C 1 52 ? -12.261 -34.567 35.279  1.00 15.33 ? 51   LEU C CA  1 
ATOM   1698 C  C   . LEU C 1 52 ? -11.276 -34.444 36.459  1.00 15.17 ? 51   LEU C C   1 
ATOM   1699 O  O   . LEU C 1 52 ? -11.392 -35.230 37.424  1.00 12.82 ? 51   LEU C O   1 
ATOM   1700 C  CB  . LEU C 1 52 ? -11.723 -35.533 34.242  1.00 15.20 ? 51   LEU C CB  1 
ATOM   1701 C  CG  . LEU C 1 52 ? -12.634 -35.886 33.041  1.00 13.90 ? 51   LEU C CG  1 
ATOM   1702 C  CD1 . LEU C 1 52 ? -11.841 -36.842 32.192  1.00 15.42 ? 51   LEU C CD1 1 
ATOM   1703 C  CD2 . LEU C 1 52 ? -13.968 -36.406 33.468  1.00 18.11 ? 51   LEU C CD2 1 
ATOM   1704 N  N   . SER C 1 53 ? -10.330 -33.504 36.371  1.00 12.66 ? 52   SER C N   1 
ATOM   1705 C  CA  . SER C 1 53 ? -9.332  -33.339 37.426  1.00 13.15 ? 52   SER C CA  1 
ATOM   1706 C  C   . SER C 1 53 ? -8.815  -31.929 37.449  1.00 13.30 ? 52   SER C C   1 
ATOM   1707 O  O   . SER C 1 53 ? -8.869  -31.199 36.440  1.00 13.38 ? 52   SER C O   1 
ATOM   1708 C  CB  . SER C 1 53 ? -8.180  -34.335 37.295  1.00 14.03 ? 52   SER C CB  1 
ATOM   1709 O  OG  . SER C 1 53 ? -7.358  -34.076 36.192  1.00 17.38 ? 52   SER C OG  1 
ATOM   1710 N  N   . ILE C 1 54 ? -8.389  -31.505 38.624  1.00 13.72 ? 53   ILE C N   1 
ATOM   1711 C  CA  . ILE C 1 54 ? -7.839  -30.170 38.826  1.00 13.89 ? 53   ILE C CA  1 
ATOM   1712 C  C   . ILE C 1 54 ? -6.562  -30.317 39.665  1.00 14.26 ? 53   ILE C C   1 
ATOM   1713 O  O   . ILE C 1 54 ? -6.615  -30.921 40.755  1.00 15.79 ? 53   ILE C O   1 
ATOM   1714 C  CB  . ILE C 1 54 ? -8.799  -29.221 39.607  1.00 14.36 ? 53   ILE C CB  1 
ATOM   1715 C  CG1 . ILE C 1 54 ? -10.152 -29.063 38.924  1.00 13.93 ? 53   ILE C CG1 1 
ATOM   1716 C  CG2 . ILE C 1 54 ? -8.147  -27.841 39.779  1.00 15.14 ? 53   ILE C CG2 1 
ATOM   1717 C  CD1 . ILE C 1 54 ? -11.262 -28.491 39.754  1.00 14.57 ? 53   ILE C CD1 1 
ATOM   1718 N  N   . ASP C 1 55 ? -5.472  -29.794 39.117  1.00 17.17 ? 54   ASP C N   1 
ATOM   1719 C  CA  . ASP C 1 55 ? -4.117  -29.913 39.667  1.00 19.47 ? 54   ASP C CA  1 
ATOM   1720 C  C   . ASP C 1 55 ? -3.826  -31.348 40.156  1.00 17.48 ? 54   ASP C C   1 
ATOM   1721 O  O   . ASP C 1 55 ? -3.294  -31.595 41.265  1.00 21.93 ? 54   ASP C O   1 
ATOM   1722 C  CB  . ASP C 1 55 ? -3.871  -28.808 40.713  1.00 26.34 ? 54   ASP C CB  1 
ATOM   1723 C  CG  . ASP C 1 55 ? -3.691  -27.351 40.083  1.00 29.58 ? 54   ASP C CG  1 
ATOM   1724 O  OD1 . ASP C 1 55 ? -3.206  -27.170 38.949  1.00 23.02 ? 54   ASP C OD1 1 
ATOM   1725 O  OD2 . ASP C 1 55 ? -3.990  -26.355 40.782  1.00 31.54 ? 54   ASP C OD2 1 
ATOM   1726 N  N   . GLY C 1 56 ? -4.182  -32.318 39.322  1.00 17.70 ? 55   GLY C N   1 
ATOM   1727 C  CA  . GLY C 1 56 ? -3.824  -33.704 39.551  1.00 20.27 ? 55   GLY C CA  1 
ATOM   1728 C  C   . GLY C 1 56 ? -4.746  -34.462 40.473  1.00 15.76 ? 55   GLY C C   1 
ATOM   1729 O  O   . GLY C 1 56 ? -4.515  -35.648 40.707  1.00 18.98 ? 55   GLY C O   1 
ATOM   1730 N  N   . ILE C 1 57 ? -5.814  -33.806 40.923  1.00 15.04 ? 56   ILE C N   1 
ATOM   1731 C  CA  . ILE C 1 57 ? -6.794  -34.385 41.870  1.00 12.76 ? 56   ILE C CA  1 
ATOM   1732 C  C   . ILE C 1 57 ? -8.107  -34.652 41.153  1.00 14.60 ? 56   ILE C C   1 
ATOM   1733 O  O   . ILE C 1 57 ? -8.661  -33.748 40.523  1.00 15.94 ? 56   ILE C O   1 
ATOM   1734 C  CB  . ILE C 1 57 ? -7.061  -33.461 43.111  1.00 14.16 ? 56   ILE C CB  1 
ATOM   1735 C  CG1 . ILE C 1 57 ? -5.755  -33.077 43.824  1.00 19.58 ? 56   ILE C CG1 1 
ATOM   1736 C  CG2 . ILE C 1 57 ? -8.033  -34.118 44.057  1.00 20.51 ? 56   ILE C CG2 1 
ATOM   1737 C  CD1 . ILE C 1 57 ? -4.857  -34.287 44.241  1.00 21.86 ? 56   ILE C CD1 1 
ATOM   1738 N  N   . ASN C 1 58 ? -8.619  -35.888 41.239  1.00 15.41 ? 57   ASN C N   1 
ATOM   1739 C  CA  . ASN C 1 58 ? -9.916  -36.255 40.665  1.00 18.91 ? 57   ASN C CA  1 
ATOM   1740 C  C   . ASN C 1 58 ? -10.965 -35.263 41.139  1.00 18.23 ? 57   ASN C C   1 
ATOM   1741 O  O   . ASN C 1 58 ? -11.150 -35.091 42.336  1.00 17.93 ? 57   ASN C O   1 
ATOM   1742 C  CB  . ASN C 1 58 ? -10.331 -37.666 41.105  1.00 18.09 ? 57   ASN C CB  1 
ATOM   1743 C  CG  . ASN C 1 58 ? -11.607 -38.174 40.423  1.00 20.17 ? 57   ASN C CG  1 
ATOM   1744 O  OD1 . ASN C 1 58 ? -12.187 -37.502 39.575  1.00 22.75 ? 57   ASN C OD1 1 
ATOM   1745 N  ND2 . ASN C 1 58 ? -12.039 -39.378 40.805  1.00 26.26 ? 57   ASN C ND2 1 
ATOM   1746 N  N   . ALA C 1 59 ? -11.639 -34.628 40.174  1.00 16.77 ? 58   ALA C N   1 
ATOM   1747 C  CA  . ALA C 1 59 ? -12.625 -33.567 40.410  1.00 16.94 ? 58   ALA C CA  1 
ATOM   1748 C  C   . ALA C 1 59 ? -14.036 -34.117 40.405  1.00 17.58 ? 58   ALA C C   1 
ATOM   1749 O  O   . ALA C 1 59 ? -14.987 -33.405 40.679  1.00 18.99 ? 58   ALA C O   1 
ATOM   1750 C  CB  . ALA C 1 59 ? -12.516 -32.482 39.337  1.00 19.59 ? 58   ALA C CB  1 
ATOM   1751 N  N   . GLN C 1 60 ? -14.176 -35.373 40.042  1.00 14.90 ? 59   GLN C N   1 
ATOM   1752 C  CA  . GLN C 1 60 ? -15.496 -35.929 39.691  1.00 20.05 ? 59   GLN C CA  1 
ATOM   1753 C  C   . GLN C 1 60 ? -16.368 -36.169 40.891  1.00 17.55 ? 59   GLN C C   1 
ATOM   1754 O  O   . GLN C 1 60 ? -17.569 -36.402 40.719  1.00 23.08 ? 59   GLN C O   1 
ATOM   1755 C  CB  . GLN C 1 60 ? -15.347 -37.245 38.912  1.00 23.10 ? 59   GLN C CB  1 
ATOM   1756 C  CG  . GLN C 1 60 ? -14.621 -37.103 37.598  1.00 21.44 ? 59   GLN C CG  1 
ATOM   1757 C  CD  . GLN C 1 60 ? -14.607 -38.409 36.834  1.00 31.89 ? 59   GLN C CD  1 
ATOM   1758 O  OE1 . GLN C 1 60 ? -15.648 -38.857 36.338  1.00 37.83 ? 59   GLN C OE1 1 
ATOM   1759 N  NE2 . GLN C 1 60 ? -13.450 -39.044 36.767  1.00 36.99 ? 59   GLN C NE2 1 
ATOM   1760 N  N   . GLY C 1 61 ? -15.788 -36.151 42.096  1.00 16.80 ? 60   GLY C N   1 
ATOM   1761 C  CA  . GLY C 1 61 ? -16.574 -36.154 43.325  1.00 18.98 ? 60   GLY C CA  1 
ATOM   1762 C  C   . GLY C 1 61 ? -16.681 -34.836 44.072  1.00 24.16 ? 60   GLY C C   1 
ATOM   1763 O  O   . GLY C 1 61 ? -17.229 -34.801 45.174  1.00 24.16 ? 60   GLY C O   1 
ATOM   1764 N  N   . MET C 1 62 ? -16.197 -33.746 43.484  1.00 16.07 ? 61   MET C N   1 
ATOM   1765 C  CA  . MET C 1 62 ? -16.167 -32.493 44.192  1.00 14.98 ? 61   MET C CA  1 
ATOM   1766 C  C   . MET C 1 62 ? -17.521 -31.803 44.039  1.00 16.77 ? 61   MET C C   1 
ATOM   1767 O  O   . MET C 1 62 ? -18.164 -31.849 42.945  1.00 15.09 ? 61   MET C O   1 
ATOM   1768 C  CB  . MET C 1 62 ? -15.082 -31.561 43.656  1.00 14.38 ? 61   MET C CB  1 
ATOM   1769 C  CG  . MET C 1 62 ? -13.688 -31.975 44.005  1.00 17.43 ? 61   MET C CG  1 
ATOM   1770 S  SD  . MET C 1 62 ? -12.526 -30.848 43.230  1.00 17.60 ? 61   MET C SD  1 
ATOM   1771 C  CE  . MET C 1 62 ? -10.993 -31.701 43.649  1.00 21.49 ? 61   MET C CE  1 
ATOM   1772 N  N   . THR C 1 63 ? -17.926 -31.153 45.122  1.00 12.13 ? 62   THR C N   1 
ATOM   1773 C  CA  . THR C 1 63 ? -19.037 -30.199 45.020  1.00 14.26 ? 62   THR C CA  1 
ATOM   1774 C  C   . THR C 1 63 ? -18.559 -29.032 44.176  1.00 14.84 ? 62   THR C C   1 
ATOM   1775 O  O   . THR C 1 63 ? -17.354 -28.833 43.984  1.00 12.50 ? 62   THR C O   1 
ATOM   1776 C  CB  . THR C 1 63 ? -19.509 -29.652 46.370  1.00 13.68 ? 62   THR C CB  1 
ATOM   1777 O  OG1 . THR C 1 63 ? -18.437 -28.915 46.945  1.00 13.96 ? 62   THR C OG1 1 
ATOM   1778 C  CG2 . THR C 1 63 ? -20.002 -30.805 47.350  1.00 14.64 ? 62   THR C CG2 1 
ATOM   1779 N  N   . HIS C 1 64 ? -19.510 -28.220 43.716  1.00 13.48 ? 63   HIS C N   1 
ATOM   1780 C  CA  . HIS C 1 64 ? -19.192 -27.058 42.931  1.00 11.57 ? 63   HIS C CA  1 
ATOM   1781 C  C   . HIS C 1 64 ? -18.266 -26.123 43.713  1.00 11.46 ? 63   HIS C C   1 
ATOM   1782 O  O   . HIS C 1 64 ? -17.231 -25.688 43.220  1.00 11.89 ? 63   HIS C O   1 
ATOM   1783 C  CB  . HIS C 1 64 ? -20.483 -26.341 42.536  1.00 13.07 ? 63   HIS C CB  1 
ATOM   1784 C  CG  . HIS C 1 64 ? -20.249 -25.166 41.682  1.00 11.69 ? 63   HIS C CG  1 
ATOM   1785 N  ND1 . HIS C 1 64 ? -20.367 -25.197 40.305  1.00 15.95 ? 63   HIS C ND1 1 
ATOM   1786 C  CD2 . HIS C 1 64 ? -19.854 -23.916 42.000  1.00 11.63 ? 63   HIS C CD2 1 
ATOM   1787 C  CE1 . HIS C 1 64 ? -20.053 -24.010 39.824  1.00 16.52 ? 63   HIS C CE1 1 
ATOM   1788 N  NE2 . HIS C 1 64 ? -19.754 -23.207 40.834  1.00 15.18 ? 63   HIS C NE2 1 
ATOM   1789 N  N   . LEU C 1 65 ? -18.613 -25.856 44.971  1.00 12.07 ? 64   LEU C N   1 
ATOM   1790 C  CA  . LEU C 1 65 ? -17.760 -25.013 45.831  1.00 14.42 ? 64   LEU C CA  1 
ATOM   1791 C  C   . LEU C 1 65 ? -16.340 -25.598 46.024  1.00 11.70 ? 64   LEU C C   1 
ATOM   1792 O  O   . LEU C 1 65 ? -15.365 -24.861 45.957  1.00 12.82 ? 64   LEU C O   1 
ATOM   1793 C  CB  . LEU C 1 65 ? -18.421 -24.749 47.181  1.00 15.78 ? 64   LEU C CB  1 
ATOM   1794 C  CG  . LEU C 1 65 ? -17.650 -23.826 48.125  1.00 13.18 ? 64   LEU C CG  1 
ATOM   1795 C  CD1 . LEU C 1 65 ? -17.435 -22.454 47.487  1.00 17.80 ? 64   LEU C CD1 1 
ATOM   1796 C  CD2 . LEU C 1 65 ? -18.372 -23.797 49.418  1.00 17.07 ? 64   LEU C CD2 1 
ATOM   1797 N  N   . GLU C 1 66 ? -16.260 -26.902 46.312  1.00 11.65 ? 65   GLU C N   1 
ATOM   1798 C  CA  . GLU C 1 66 ? -14.955 -27.575 46.407  1.00 8.53  ? 65   GLU C CA  1 
ATOM   1799 C  C   . GLU C 1 66 ? -14.088 -27.337 45.153  1.00 13.48 ? 65   GLU C C   1 
ATOM   1800 O  O   . GLU C 1 66 ? -12.886 -26.983 45.267  1.00 14.70 ? 65   GLU C O   1 
ATOM   1801 C  CB  . GLU C 1 66 ? -15.106 -29.052 46.736  1.00 13.26 ? 65   GLU C CB  1 
ATOM   1802 C  CG  . GLU C 1 66 ? -15.509 -29.317 48.173  1.00 18.84 ? 65   GLU C CG  1 
ATOM   1803 C  CD  . GLU C 1 66 ? -16.103 -30.703 48.390  1.00 16.74 ? 65   GLU C CD  1 
ATOM   1804 O  OE1 . GLU C 1 66 ? -16.288 -31.454 47.397  1.00 18.04 ? 65   GLU C OE1 1 
ATOM   1805 O  OE2 . GLU C 1 66 ? -16.411 -31.006 49.559  1.00 17.73 ? 65   GLU C OE2 1 
ATOM   1806 N  N   . ALA C 1 67 ? -14.675 -27.525 43.978  1.00 10.38 ? 66   ALA C N   1 
ATOM   1807 C  CA  . ALA C 1 67 ? -13.946 -27.312 42.736  1.00 12.74 ? 66   ALA C CA  1 
ATOM   1808 C  C   . ALA C 1 67 ? -13.547 -25.840 42.596  1.00 12.67 ? 66   ALA C C   1 
ATOM   1809 O  O   . ALA C 1 67 ? -12.417 -25.519 42.193  1.00 12.42 ? 66   ALA C O   1 
ATOM   1810 C  CB  . ALA C 1 67 ? -14.823 -27.762 41.579  1.00 12.89 ? 66   ALA C CB  1 
ATOM   1811 N  N   . GLN C 1 68 ? -14.469 -24.935 42.908  1.00 12.98 ? 67   GLN C N   1 
ATOM   1812 C  CA  . GLN C 1 68 ? -14.156 -23.517 42.844  1.00 13.08 ? 67   GLN C CA  1 
ATOM   1813 C  C   . GLN C 1 68 ? -13.023 -23.148 43.781  1.00 12.02 ? 67   GLN C C   1 
ATOM   1814 O  O   . GLN C 1 68 ? -12.081 -22.423 43.386  1.00 14.14 ? 67   GLN C O   1 
ATOM   1815 C  CB  . GLN C 1 68 ? -15.404 -22.723 43.166  1.00 13.39 ? 67   GLN C CB  1 
ATOM   1816 C  CG  . GLN C 1 68 ? -15.190 -21.271 43.035  1.00 14.37 ? 67   GLN C CG  1 
ATOM   1817 C  CD  . GLN C 1 68 ? -16.469 -20.457 43.254  1.00 22.54 ? 67   GLN C CD  1 
ATOM   1818 O  OE1 . GLN C 1 68 ? -17.301 -20.300 42.353  1.00 22.56 ? 67   GLN C OE1 1 
ATOM   1819 N  NE2 . GLN C 1 68 ? -16.584 -19.901 44.435  1.00 20.89 ? 67   GLN C NE2 1 
ATOM   1820 N  N   . ASN C 1 69 ? -13.062 -23.712 44.975  1.00 14.97 ? 68   ASN C N   1 
ATOM   1821 C  CA  . ASN C 1 69 ? -12.018 -23.481 45.986  1.00 16.93 ? 68   ASN C CA  1 
ATOM   1822 C  C   . ASN C 1 69 ? -10.666 -24.000 45.515  1.00 13.43 ? 68   ASN C C   1 
ATOM   1823 O  O   . ASN C 1 69 ? -9.638  -23.350 45.738  1.00 15.13 ? 68   ASN C O   1 
ATOM   1824 C  CB  . ASN C 1 69 ? -12.389 -24.158 47.318  1.00 17.05 ? 68   ASN C CB  1 
ATOM   1825 C  CG  . ASN C 1 69 ? -13.434 -23.384 48.134  1.00 19.45 ? 68   ASN C CG  1 
ATOM   1826 O  OD1 . ASN C 1 69 ? -13.736 -22.211 47.856  1.00 20.58 ? 68   ASN C OD1 1 
ATOM   1827 N  ND2 . ASN C 1 69 ? -13.994 -24.055 49.149  1.00 27.50 ? 68   ASN C ND2 1 
ATOM   1828 N  N   . LYS C 1 70 ? -10.661 -25.179 44.880  1.00 13.24 ? 69   LYS C N   1 
ATOM   1829 C  CA  . LYS C 1 70 ? -9.440  -25.785 44.382  1.00 13.14 ? 69   LYS C CA  1 
ATOM   1830 C  C   . LYS C 1 70 ? -8.799  -24.876 43.303  1.00 12.66 ? 69   LYS C C   1 
ATOM   1831 O  O   . LYS C 1 70 ? -7.570  -24.675 43.258  1.00 14.11 ? 69   LYS C O   1 
ATOM   1832 C  CB  . LYS C 1 70 ? -9.754  -27.166 43.826  1.00 17.03 ? 69   LYS C CB  1 
ATOM   1833 C  CG  . LYS C 1 70 ? -8.552  -27.979 43.318  1.00 20.40 ? 69   LYS C CG  1 
ATOM   1834 C  CD  . LYS C 1 70 ? -7.698  -28.488 44.462  1.00 18.06 ? 69   LYS C CD  1 
ATOM   1835 C  CE  . LYS C 1 70 ? -6.464  -29.196 43.971  1.00 19.46 ? 69   LYS C CE  1 
ATOM   1836 N  NZ  . LYS C 1 70 ? -5.504  -29.398 45.059  1.00 22.84 ? 69   LYS C NZ  1 
ATOM   1837 N  N   . ILE C 1 71 ? -9.627  -24.351 42.404  1.00 12.62 ? 70   ILE C N   1 
ATOM   1838 C  CA  . ILE C 1 71 ? -9.159  -23.440 41.352  1.00 13.72 ? 70   ILE C CA  1 
ATOM   1839 C  C   . ILE C 1 71 ? -8.670  -22.116 41.915  1.00 14.88 ? 70   ILE C C   1 
ATOM   1840 O  O   . ILE C 1 71 ? -7.569  -21.660 41.546  1.00 13.58 ? 70   ILE C O   1 
ATOM   1841 C  CB  . ILE C 1 71 ? -10.228 -23.246 40.282  1.00 12.11 ? 70   ILE C CB  1 
ATOM   1842 C  CG1 . ILE C 1 71 ? -10.417 -24.545 39.521  1.00 11.49 ? 70   ILE C CG1 1 
ATOM   1843 C  CG2 . ILE C 1 71 ? -9.854  -22.140 39.280  1.00 10.92 ? 70   ILE C CG2 1 
ATOM   1844 C  CD1 . ILE C 1 71 ? -11.778 -24.725 38.860  1.00 14.22 ? 70   ILE C CD1 1 
ATOM   1845 N  N   . LYS C 1 72 ? -9.468  -21.508 42.804  1.00 12.01 ? 71   LYS C N   1 
ATOM   1846 C  CA  . LYS C 1 72 ? -9.022  -20.264 43.487  1.00 12.64 ? 71   LYS C CA  1 
ATOM   1847 C  C   . LYS C 1 72 ? -7.748  -20.478 44.341  1.00 12.77 ? 71   LYS C C   1 
ATOM   1848 O  O   . LYS C 1 72 ? -6.973  -19.529 44.560  1.00 13.75 ? 71   LYS C O   1 
ATOM   1849 C  CB  . LYS C 1 72 ? -10.147 -19.686 44.295  1.00 15.79 ? 71   LYS C CB  1 
ATOM   1850 C  CG  . LYS C 1 72 ? -11.265 -19.143 43.442  1.00 13.14 ? 71   LYS C CG  1 
ATOM   1851 C  CD  . LYS C 1 72 ? -12.284 -18.371 44.282  1.00 16.34 ? 71   LYS C CD  1 
ATOM   1852 C  CE  . LYS C 1 72 ? -13.410 -17.733 43.452  1.00 16.53 ? 71   LYS C CE  1 
ATOM   1853 N  NZ  . LYS C 1 72 ? -14.278 -16.921 44.339  1.00 23.88 ? 71   LYS C NZ  1 
ATOM   1854 N  N   . GLY C 1 73 ? -7.492  -21.723 44.762  1.00 14.75 ? 72   GLY C N   1 
ATOM   1855 C  CA  . GLY C 1 73 ? -6.335  -22.073 45.591  1.00 14.74 ? 72   GLY C CA  1 
ATOM   1856 C  C   . GLY C 1 73 ? -5.095  -22.449 44.828  1.00 14.95 ? 72   GLY C C   1 
ATOM   1857 O  O   . GLY C 1 73 ? -4.074  -22.752 45.429  1.00 15.28 ? 72   GLY C O   1 
ATOM   1858 N  N   . CYS C 1 74 ? -5.172  -22.417 43.495  1.00 13.59 ? 73   CYS C N   1 
ATOM   1859 C  CA  . CYS C 1 74 ? -4.060  -22.789 42.639  1.00 16.24 ? 73   CYS C CA  1 
ATOM   1860 C  C   . CYS C 1 74 ? -2.842  -21.930 42.993  1.00 21.03 ? 73   CYS C C   1 
ATOM   1861 O  O   . CYS C 1 74 ? -2.953  -20.723 43.141  1.00 20.71 ? 73   CYS C O   1 
ATOM   1862 C  CB  . CYS C 1 74 ? -4.426  -22.570 41.180  1.00 16.35 ? 73   CYS C CB  1 
ATOM   1863 S  SG  . CYS C 1 74 ? -3.197  -23.140 40.054  1.00 20.10 ? 73   CYS C SG  1 
ATOM   1864 N  N   . THR C 1 75 ? -1.709  -22.604 43.145  1.00 21.57 ? 74   THR C N   1 
ATOM   1865 C  CA  . THR C 1 75 ? -0.454  -21.963 43.523  1.00 33.12 ? 74   THR C CA  1 
ATOM   1866 C  C   . THR C 1 75 ? 0.239   -21.281 42.340  1.00 29.66 ? 74   THR C C   1 
ATOM   1867 O  O   . THR C 1 75 ? 0.702   -20.135 42.452  1.00 35.98 ? 74   THR C O   1 
ATOM   1868 C  CB  . THR C 1 75 ? 0.522   -23.003 44.110  1.00 30.86 ? 74   THR C CB  1 
ATOM   1869 O  OG1 . THR C 1 75 ? -0.157  -23.857 45.040  1.00 36.43 ? 74   THR C OG1 1 
ATOM   1870 C  CG2 . THR C 1 75 ? 1.694   -22.317 44.781  1.00 38.18 ? 74   THR C CG2 1 
ATOM   1871 N  N   . GLY C 1 76 ? 0.326   -22.003 41.229  1.00 18.02 ? 75   GLY C N   1 
ATOM   1872 C  CA  . GLY C 1 76 ? 1.152   -21.642 40.095  1.00 18.78 ? 75   GLY C CA  1 
ATOM   1873 C  C   . GLY C 1 76 ? 0.318   -21.716 38.812  1.00 17.11 ? 75   GLY C C   1 
ATOM   1874 O  O   . GLY C 1 76 ? -0.621  -20.935 38.602  1.00 18.35 ? 75   GLY C O   1 
ATOM   1875 N  N   . SER C 1 77 ? 0.658   -22.680 37.966  1.00 17.11 ? 76   SER C N   1 
ATOM   1876 C  CA  . SER C 1 77 ? -0.113  -22.974 36.764  1.00 12.70 ? 76   SER C CA  1 
ATOM   1877 C  C   . SER C 1 77 ? -1.342  -23.786 37.121  1.00 13.92 ? 76   SER C C   1 
ATOM   1878 O  O   . SER C 1 77 ? -1.301  -24.596 38.058  1.00 17.83 ? 76   SER C O   1 
ATOM   1879 C  CB  . SER C 1 77 ? 0.690   -23.802 35.795  1.00 17.71 ? 76   SER C CB  1 
ATOM   1880 O  OG  . SER C 1 77 ? 1.818   -23.068 35.367  1.00 22.46 ? 76   SER C OG  1 
ATOM   1881 N  N   . LEU C 1 78 ? -2.444  -23.512 36.430  1.00 14.70 ? 77   LEU C N   1 
ATOM   1882 C  CA  . LEU C 1 78 ? -3.655  -24.288 36.597  1.00 11.82 ? 77   LEU C CA  1 
ATOM   1883 C  C   . LEU C 1 78 ? -3.671  -25.447 35.622  1.00 11.86 ? 77   LEU C C   1 
ATOM   1884 O  O   . LEU C 1 78 ? -3.668  -25.286 34.408  1.00 15.03 ? 77   LEU C O   1 
ATOM   1885 C  CB  . LEU C 1 78 ? -4.937  -23.422 36.425  1.00 12.92 ? 77   LEU C CB  1 
ATOM   1886 C  CG  . LEU C 1 78 ? -6.265  -24.150 36.621  1.00 12.92 ? 77   LEU C CG  1 
ATOM   1887 C  CD1 . LEU C 1 78 ? -6.467  -24.597 38.069  1.00 16.86 ? 77   LEU C CD1 1 
ATOM   1888 C  CD2 . LEU C 1 78 ? -7.463  -23.342 36.109  1.00 18.95 ? 77   LEU C CD2 1 
ATOM   1889 N  N   . ASN C 1 79 ? -3.689  -26.634 36.200  1.00 11.51 ? 78   ASN C N   1 
ATOM   1890 C  CA  . ASN C 1 79 ? -3.663  -27.841 35.433  1.00 12.24 ? 78   ASN C CA  1 
ATOM   1891 C  C   . ASN C 1 79 ? -5.009  -28.534 35.571  1.00 14.33 ? 78   ASN C C   1 
ATOM   1892 O  O   . ASN C 1 79 ? -5.510  -28.719 36.672  1.00 15.86 ? 78   ASN C O   1 
ATOM   1893 C  CB  . ASN C 1 79 ? -2.552  -28.750 35.964  1.00 16.27 ? 78   ASN C CB  1 
ATOM   1894 C  CG  . ASN C 1 79 ? -1.200  -28.081 35.920  1.00 22.49 ? 78   ASN C CG  1 
ATOM   1895 O  OD1 . ASN C 1 79 ? -0.780  -27.624 34.880  1.00 22.13 ? 78   ASN C OD1 1 
ATOM   1896 N  ND2 . ASN C 1 79 ? -0.543  -27.982 37.063  1.00 25.19 ? 78   ASN C ND2 1 
ATOM   1897 N  N   . MET C 1 80 ? -5.593  -28.908 34.436  1.00 14.71 ? 79   MET C N   1 
ATOM   1898 C  CA  . MET C 1 80 ? -6.867  -29.654 34.432  1.00 10.00 ? 79   MET C CA  1 
ATOM   1899 C  C   . MET C 1 80 ? -6.849  -30.696 33.349  1.00 13.84 ? 79   MET C C   1 
ATOM   1900 O  O   . MET C 1 80 ? -6.211  -30.519 32.292  1.00 15.28 ? 79   MET C O   1 
ATOM   1901 C  CB  . MET C 1 80 ? -8.047  -28.726 34.183  1.00 13.81 ? 79   MET C CB  1 
ATOM   1902 C  CG  . MET C 1 80 ? -8.227  -27.652 35.241  1.00 15.62 ? 79   MET C CG  1 
ATOM   1903 S  SD  . MET C 1 80 ? -9.793  -26.687 35.055  1.00 18.12 ? 79   MET C SD  1 
ATOM   1904 C  CE  . MET C 1 80 ? -9.513  -25.800 33.545  1.00 17.94 ? 79   MET C CE  1 
ATOM   1905 N  N   . THR C 1 81 ? -7.592  -31.764 33.614  1.00 13.87 ? 80   THR C N   1 
ATOM   1906 C  CA  . THR C 1 81 ? -7.961  -32.692 32.556  1.00 11.91 ? 80   THR C CA  1 
ATOM   1907 C  C   . THR C 1 81 ? -9.465  -32.633 32.383  1.00 12.67 ? 80   THR C C   1 
ATOM   1908 O  O   . THR C 1 81 ? -10.210 -32.473 33.334  1.00 11.85 ? 80   THR C O   1 
ATOM   1909 C  CB  A THR C 1 81 ? -7.532  -34.152 32.843  0.50 16.25 ? 80   THR C CB  1 
ATOM   1910 C  CB  B THR C 1 81 ? -7.375  -34.106 32.792  0.50 17.02 ? 80   THR C CB  1 
ATOM   1911 O  OG1 A THR C 1 81 ? -8.303  -34.706 33.924  0.50 9.10  ? 80   THR C OG1 1 
ATOM   1912 O  OG1 B THR C 1 81 ? -5.942  -34.059 32.613  0.50 15.17 ? 80   THR C OG1 1 
ATOM   1913 C  CG2 A THR C 1 81 ? -6.071  -34.202 33.233  0.50 15.99 ? 80   THR C CG2 1 
ATOM   1914 C  CG2 B THR C 1 81 ? -7.967  -35.129 31.840  0.50 20.24 ? 80   THR C CG2 1 
ATOM   1915 N  N   . LEU C 1 82 ? -9.867  -32.724 31.131  1.00 12.75 ? 81   LEU C N   1 
ATOM   1916 C  CA  . LEU C 1 82 ? -11.252 -32.551 30.715  1.00 11.40 ? 81   LEU C CA  1 
ATOM   1917 C  C   . LEU C 1 82 ? -11.652 -33.601 29.681  1.00 16.88 ? 81   LEU C C   1 
ATOM   1918 O  O   . LEU C 1 82 ? -10.808 -34.191 29.009  1.00 15.61 ? 81   LEU C O   1 
ATOM   1919 C  CB  . LEU C 1 82 ? -11.499 -31.142 30.161  1.00 15.08 ? 81   LEU C CB  1 
ATOM   1920 C  CG  . LEU C 1 82 ? -11.207 -29.910 31.018  1.00 13.72 ? 81   LEU C CG  1 
ATOM   1921 C  CD1 . LEU C 1 82 ? -9.840  -29.418 30.735  1.00 15.25 ? 81   LEU C CD1 1 
ATOM   1922 C  CD2 . LEU C 1 82 ? -12.228 -28.824 30.755  1.00 15.68 ? 81   LEU C CD2 1 
ATOM   1923 N  N   . GLN C 1 83 ? -12.945 -33.855 29.628  1.00 13.51 ? 82   GLN C N   1 
ATOM   1924 C  CA  . GLN C 1 83 ? -13.567 -34.719 28.631  1.00 14.54 ? 82   GLN C CA  1 
ATOM   1925 C  C   . GLN C 1 83 ? -14.281 -33.824 27.643  1.00 15.89 ? 82   GLN C C   1 
ATOM   1926 O  O   . GLN C 1 83 ? -15.080 -32.965 28.015  1.00 15.48 ? 82   GLN C O   1 
ATOM   1927 C  CB  . GLN C 1 83 ? -14.528 -35.635 29.373  1.00 17.24 ? 82   GLN C CB  1 
ATOM   1928 C  CG  . GLN C 1 83 ? -15.298 -36.555 28.549  1.00 23.35 ? 82   GLN C CG  1 
ATOM   1929 C  CD  . GLN C 1 83 ? -16.143 -37.413 29.461  1.00 32.21 ? 82   GLN C CD  1 
ATOM   1930 O  OE1 . GLN C 1 83 ? -15.623 -38.289 30.147  1.00 34.72 ? 82   GLN C OE1 1 
ATOM   1931 N  NE2 . GLN C 1 83 ? -17.435 -37.116 29.530  1.00 32.83 ? 82   GLN C NE2 1 
ATOM   1932 N  N   . ARG C 1 84 ? -14.056 -34.058 26.359  1.00 14.33 ? 83   ARG C N   1 
ATOM   1933 C  CA  . ARG C 1 84 ? -14.745 -33.280 25.340  1.00 14.04 ? 83   ARG C CA  1 
ATOM   1934 C  C   . ARG C 1 84 ? -16.223 -33.615 25.317  1.00 16.65 ? 83   ARG C C   1 
ATOM   1935 O  O   . ARG C 1 84 ? -16.614 -34.793 25.156  1.00 17.65 ? 83   ARG C O   1 
ATOM   1936 C  CB  . ARG C 1 84 ? -14.188 -33.588 23.944  1.00 14.29 ? 83   ARG C CB  1 
ATOM   1937 C  CG  . ARG C 1 84 ? -12.811 -33.064 23.676  1.00 15.24 ? 83   ARG C CG  1 
ATOM   1938 C  CD  . ARG C 1 84 ? -12.801 -31.527 23.542  1.00 19.31 ? 83   ARG C CD  1 
ATOM   1939 N  NE  . ARG C 1 84 ? -11.477 -31.021 23.179  1.00 19.05 ? 83   ARG C NE  1 
ATOM   1940 C  CZ  . ARG C 1 84 ? -11.099 -29.744 23.305  1.00 14.37 ? 83   ARG C CZ  1 
ATOM   1941 N  NH1 . ARG C 1 84 ? -11.934 -28.834 23.791  1.00 15.92 ? 83   ARG C NH1 1 
ATOM   1942 N  NH2 . ARG C 1 84 ? -9.856  -29.394 22.958  1.00 19.33 ? 83   ARG C NH2 1 
ATOM   1943 N  N   . GLU C 1 85 ? -17.054 -32.578 25.398  1.00 13.00 ? 84   GLU C N   1 
ATOM   1944 C  CA  . GLU C 1 85 ? -18.504 -32.773 25.292  1.00 14.15 ? 84   GLU C CA  1 
ATOM   1945 C  C   . GLU C 1 85 ? -19.128 -31.643 24.477  1.00 17.03 ? 84   GLU C C   1 
ATOM   1946 O  O   . GLU C 1 85 ? -20.273 -31.261 24.684  1.00 21.85 ? 84   GLU C O   1 
ATOM   1947 C  CB  . GLU C 1 85 ? -19.183 -32.906 26.671  1.00 16.52 ? 84   GLU C CB  1 
ATOM   1948 C  CG  . GLU C 1 85 ? -18.790 -34.107 27.520  1.00 21.77 ? 84   GLU C CG  1 
ATOM   1949 C  CD  . GLU C 1 85 ? -19.208 -35.454 26.946  1.00 38.34 ? 84   GLU C CD  1 
ATOM   1950 O  OE1 . GLU C 1 85 ? -20.086 -35.502 26.059  1.00 34.80 ? 84   GLU C OE1 1 
ATOM   1951 O  OE2 . GLU C 1 85 ? -18.658 -36.481 27.394  1.00 39.78 ? 84   GLU C OE2 1 
ATOM   1952 N  N   . SER C 1 86 ? -18.334 -31.123 23.561  1.00 16.28 ? 85   SER C N   1 
ATOM   1953 C  CA  . SER C 1 86 ? -18.653 -29.929 22.785  1.00 16.58 ? 85   SER C CA  1 
ATOM   1954 C  C   . SER C 1 86 ? -18.831 -30.219 21.282  1.00 16.04 ? 85   SER C C   1 
ATOM   1955 O  O   . SER C 1 86 ? -19.228 -29.314 20.541  1.00 16.81 ? 85   SER C O   1 
ATOM   1956 C  CB  . SER C 1 86 ? -17.573 -28.841 23.028  1.00 17.75 ? 85   SER C CB  1 
ATOM   1957 O  OG  . SER C 1 86 ? -16.276 -29.399 23.019  1.00 14.90 ? 85   SER C OG  1 
ATOM   1958 N  N   . ASP C 1 87 ? -18.539 -31.452 20.814  1.00 16.48 ? 86   ASP C N   1 
ATOM   1959 C  CA  . ASP C 1 87 ? -18.851 -31.849 19.446  1.00 18.32 ? 86   ASP C CA  1 
ATOM   1960 C  C   . ASP C 1 87 ? -20.290 -32.330 19.419  1.00 18.64 ? 86   ASP C C   1 
ATOM   1961 O  O   . ASP C 1 87 ? -20.664 -33.271 20.121  1.00 21.17 ? 86   ASP C O   1 
ATOM   1962 C  CB  . ASP C 1 87 ? -17.877 -32.924 18.984  1.00 17.43 ? 86   ASP C CB  1 
ATOM   1963 C  CG  . ASP C 1 87 ? -16.480 -32.395 18.853  1.00 19.39 ? 86   ASP C CG  1 
ATOM   1964 O  OD1 . ASP C 1 87 ? -16.241 -31.658 17.871  1.00 22.73 ? 86   ASP C OD1 1 
ATOM   1965 O  OD2 . ASP C 1 87 ? -15.630 -32.669 19.741  1.00 22.29 ? 86   ASP C OD2 1 
ATOM   1966 N  N   . LEU C 1 88 ? -21.122 -31.661 18.642  1.00 15.82 ? 87   LEU C N   1 
ATOM   1967 C  CA  . LEU C 1 88 ? -22.544 -31.933 18.677  1.00 17.59 ? 87   LEU C CA  1 
ATOM   1968 C  C   . LEU C 1 88 ? -22.943 -32.861 17.563  1.00 20.28 ? 87   LEU C C   1 
ATOM   1969 O  O   . LEU C 1 88 ? -23.987 -33.515 17.633  1.00 20.80 ? 87   LEU C O   1 
ATOM   1970 C  CB  . LEU C 1 88 ? -23.333 -30.625 18.603  1.00 13.97 ? 87   LEU C CB  1 
ATOM   1971 C  CG  . LEU C 1 88 ? -22.904 -29.563 19.637  1.00 16.88 ? 87   LEU C CG  1 
ATOM   1972 C  CD1 . LEU C 1 88 ? -23.670 -28.266 19.471  1.00 18.39 ? 87   LEU C CD1 1 
ATOM   1973 C  CD2 . LEU C 1 88 ? -22.945 -30.099 21.100  1.00 20.19 ? 87   LEU C CD2 1 
ATOM   1974 O  OXT . LEU C 1 88 ? -22.220 -32.956 16.571  1.00 15.67 ? 87   LEU C OXT 1 
ATOM   1975 N  N   . SER D 1 1  ? 4.495   15.317  45.750  1.00 47.79 ? 0    SER D N   1 
ATOM   1976 C  CA  . SER D 1 1  ? 4.127   15.039  47.168  1.00 48.77 ? 0    SER D CA  1 
ATOM   1977 C  C   . SER D 1 1  ? 5.331   15.209  48.066  1.00 46.57 ? 0    SER D C   1 
ATOM   1978 O  O   . SER D 1 1  ? 6.473   15.086  47.607  1.00 39.05 ? 0    SER D O   1 
ATOM   1979 C  CB  . SER D 1 1  ? 3.601   13.611  47.338  1.00 48.25 ? 0    SER D CB  1 
ATOM   1980 O  OG  . SER D 1 1  ? 3.005   13.456  48.614  1.00 60.83 ? 0    SER D OG  1 
ATOM   1981 N  N   . MET D 1 2  ? 5.071   15.463  49.355  1.00 46.76 ? 1    MET D N   1 
ATOM   1982 C  CA  . MET D 1 2  ? 6.119   15.488  50.395  1.00 45.25 ? 1    MET D CA  1 
ATOM   1983 C  C   . MET D 1 2  ? 6.950   14.208  50.391  1.00 44.96 ? 1    MET D C   1 
ATOM   1984 O  O   . MET D 1 2  ? 8.156   14.231  50.673  1.00 42.73 ? 1    MET D O   1 
ATOM   1985 C  CB  . MET D 1 2  ? 5.486   15.653  51.780  1.00 46.46 ? 1    MET D CB  1 
ATOM   1986 N  N   . SER D 1 3  ? 6.295   13.094  50.067  1.00 38.57 ? 2    SER D N   1 
ATOM   1987 C  CA  . SER D 1 3  ? 6.955   11.816  50.051  1.00 34.21 ? 2    SER D CA  1 
ATOM   1988 C  C   . SER D 1 3  ? 7.768   11.529  48.766  1.00 28.33 ? 2    SER D C   1 
ATOM   1989 O  O   . SER D 1 3  ? 8.451   10.490  48.728  1.00 29.00 ? 2    SER D O   1 
ATOM   1990 C  CB  . SER D 1 3  ? 5.932   10.714  50.300  1.00 30.31 ? 2    SER D CB  1 
ATOM   1991 O  OG  . SER D 1 3  ? 5.006   10.671  49.239  1.00 38.78 ? 2    SER D OG  1 
ATOM   1992 N  N   . ASN D 1 4  ? 7.735   12.400  47.734  1.00 24.26 ? 3    ASN D N   1 
ATOM   1993 C  CA  . ASN D 1 4  ? 8.647   12.200  46.559  1.00 22.02 ? 3    ASN D CA  1 
ATOM   1994 C  C   . ASN D 1 4  ? 10.068  12.133  47.059  1.00 20.43 ? 3    ASN D C   1 
ATOM   1995 O  O   . ASN D 1 4  ? 10.415  12.792  48.020  1.00 21.91 ? 3    ASN D O   1 
ATOM   1996 C  CB  . ASN D 1 4  ? 8.596   13.326  45.525  1.00 16.28 ? 3    ASN D CB  1 
ATOM   1997 C  CG  . ASN D 1 4  ? 7.343   13.304  44.662  1.00 23.35 ? 3    ASN D CG  1 
ATOM   1998 O  OD1 . ASN D 1 4  ? 6.408   12.519  44.870  1.00 24.19 ? 3    ASN D OD1 1 
ATOM   1999 N  ND2 . ASN D 1 4  ? 7.326   14.191  43.663  1.00 22.83 ? 3    ASN D ND2 1 
ATOM   2000 N  N   . TYR D 1 5  ? 10.925  11.393  46.362  1.00 14.35 ? 4    TYR D N   1 
ATOM   2001 C  CA  . TYR D 1 5  ? 12.248  11.107  46.855  1.00 12.91 ? 4    TYR D CA  1 
ATOM   2002 C  C   . TYR D 1 5  ? 13.215  10.900  45.717  1.00 15.13 ? 4    TYR D C   1 
ATOM   2003 O  O   . TYR D 1 5  ? 12.818  10.585  44.594  1.00 15.17 ? 4    TYR D O   1 
ATOM   2004 C  CB  . TYR D 1 5  ? 12.236  9.887   47.790  1.00 15.88 ? 4    TYR D CB  1 
ATOM   2005 C  CG  . TYR D 1 5  ? 11.976  8.537   47.119  1.00 14.69 ? 4    TYR D CG  1 
ATOM   2006 C  CD1 . TYR D 1 5  ? 10.681  8.160   46.787  1.00 13.41 ? 4    TYR D CD1 1 
ATOM   2007 C  CD2 . TYR D 1 5  ? 13.012  7.667   46.796  1.00 17.85 ? 4    TYR D CD2 1 
ATOM   2008 C  CE1 . TYR D 1 5  ? 10.408  6.951   46.142  1.00 12.23 ? 4    TYR D CE1 1 
ATOM   2009 C  CE2 . TYR D 1 5  ? 12.756  6.450   46.164  1.00 16.61 ? 4    TYR D CE2 1 
ATOM   2010 C  CZ  . TYR D 1 5  ? 11.463  6.104   45.875  1.00 15.90 ? 4    TYR D CZ  1 
ATOM   2011 O  OH  . TYR D 1 5  ? 11.183  4.927   45.229  1.00 14.27 ? 4    TYR D OH  1 
ATOM   2012 N  N   . SER D 1 6  ? 14.490  11.074  46.017  1.00 16.10 ? 5    SER D N   1 
ATOM   2013 C  CA  . SER D 1 6  ? 15.531  10.926  45.022  1.00 17.82 ? 5    SER D CA  1 
ATOM   2014 C  C   . SER D 1 6  ? 16.443  9.802   45.421  1.00 16.92 ? 5    SER D C   1 
ATOM   2015 O  O   . SER D 1 6  ? 16.638  9.535   46.621  1.00 20.14 ? 5    SER D O   1 
ATOM   2016 C  CB  . SER D 1 6  ? 16.311  12.231  44.894  1.00 24.09 ? 5    SER D CB  1 
ATOM   2017 O  OG  . SER D 1 6  ? 15.496  13.248  44.357  1.00 34.10 ? 5    SER D OG  1 
ATOM   2018 N  N   . VAL D 1 7  ? 16.993  9.129   44.421  1.00 14.52 ? 6    VAL D N   1 
ATOM   2019 C  CA  . VAL D 1 7  ? 18.076  8.186   44.646  1.00 20.32 ? 6    VAL D CA  1 
ATOM   2020 C  C   . VAL D 1 7  ? 19.262  8.503   43.766  1.00 13.20 ? 6    VAL D C   1 
ATOM   2021 O  O   . VAL D 1 7  ? 19.122  9.097   42.678  1.00 16.97 ? 6    VAL D O   1 
ATOM   2022 C  CB  . VAL D 1 7  ? 17.663  6.732   44.417  1.00 17.63 ? 6    VAL D CB  1 
ATOM   2023 C  CG1 . VAL D 1 7  ? 16.493  6.349   45.355  1.00 18.21 ? 6    VAL D CG1 1 
ATOM   2024 C  CG2 . VAL D 1 7  ? 17.370  6.466   42.946  1.00 15.51 ? 6    VAL D CG2 1 
ATOM   2025 N  N   . SER D 1 8  ? 20.447  8.165   44.281  1.00 15.04 ? 7    SER D N   1 
ATOM   2026 C  CA  . SER D 1 8  ? 21.688  8.370   43.521  1.00 17.36 ? 7    SER D CA  1 
ATOM   2027 C  C   . SER D 1 8  ? 22.510  7.125   43.713  1.00 19.53 ? 7    SER D C   1 
ATOM   2028 O  O   . SER D 1 8  ? 23.234  7.006   44.707  1.00 20.12 ? 7    SER D O   1 
ATOM   2029 C  CB  . SER D 1 8  ? 22.420  9.637   44.005  1.00 22.51 ? 7    SER D CB  1 
ATOM   2030 O  OG  . SER D 1 8  ? 23.514  9.961   43.137  1.00 27.51 ? 7    SER D OG  1 
ATOM   2031 N  N   . LEU D 1 9  ? 22.406  6.206   42.746  1.00 14.60 ? 8    LEU D N   1 
ATOM   2032 C  CA  . LEU D 1 9  ? 23.051  4.893   42.830  1.00 16.18 ? 8    LEU D CA  1 
ATOM   2033 C  C   . LEU D 1 9  ? 24.469  4.992   42.294  1.00 19.45 ? 8    LEU D C   1 
ATOM   2034 O  O   . LEU D 1 9  ? 24.710  5.659   41.287  1.00 18.89 ? 8    LEU D O   1 
ATOM   2035 C  CB  . LEU D 1 9  ? 22.249  3.819   42.065  1.00 18.21 ? 8    LEU D CB  1 
ATOM   2036 C  CG  . LEU D 1 9  ? 20.741  3.799   42.358  1.00 16.70 ? 8    LEU D CG  1 
ATOM   2037 C  CD1 . LEU D 1 9  ? 20.094  2.720   41.491  1.00 16.70 ? 8    LEU D CD1 1 
ATOM   2038 C  CD2 . LEU D 1 9  ? 20.397  3.574   43.830  1.00 14.85 ? 8    LEU D CD2 1 
ATOM   2039 N  N   . VAL D 1 10 ? 25.372  4.277   42.952  1.00 20.34 ? 9    VAL D N   1 
ATOM   2040 C  CA  . VAL D 1 10 ? 26.786  4.223   42.584  1.00 20.67 ? 9    VAL D CA  1 
ATOM   2041 C  C   . VAL D 1 10 ? 26.982  3.089   41.589  1.00 18.78 ? 9    VAL D C   1 
ATOM   2042 O  O   . VAL D 1 10 ? 26.580  1.953   41.846  1.00 19.25 ? 9    VAL D O   1 
ATOM   2043 C  CB  . VAL D 1 10 ? 27.666  3.988   43.832  1.00 21.47 ? 9    VAL D CB  1 
ATOM   2044 C  CG1 . VAL D 1 10 ? 29.149  3.999   43.460  1.00 29.18 ? 9    VAL D CG1 1 
ATOM   2045 C  CG2 . VAL D 1 10 ? 27.350  5.036   44.919  1.00 27.18 ? 9    VAL D CG2 1 
ATOM   2046 N  N   . GLY D 1 11 ? 27.578  3.390   40.442  1.00 21.39 ? 10   GLY D N   1 
ATOM   2047 C  CA  . GLY D 1 11 ? 27.772  2.381   39.400  1.00 20.76 ? 10   GLY D CA  1 
ATOM   2048 C  C   . GLY D 1 11 ? 28.909  1.419   39.769  1.00 25.96 ? 10   GLY D C   1 
ATOM   2049 O  O   . GLY D 1 11 ? 29.604  1.613   40.790  1.00 25.84 ? 10   GLY D O   1 
ATOM   2050 N  N   . PRO D 1 12 ? 29.120  0.384   38.940  1.00 24.36 ? 11   PRO D N   1 
ATOM   2051 C  CA  . PRO D 1 12 ? 28.422  0.128   37.689  1.00 24.97 ? 11   PRO D CA  1 
ATOM   2052 C  C   . PRO D 1 12 ? 27.096  -0.613  37.892  1.00 18.96 ? 11   PRO D C   1 
ATOM   2053 O  O   . PRO D 1 12 ? 26.857  -1.179  38.960  1.00 22.12 ? 11   PRO D O   1 
ATOM   2054 C  CB  . PRO D 1 12 ? 29.388  -0.801  36.963  1.00 27.28 ? 11   PRO D CB  1 
ATOM   2055 C  CG  . PRO D 1 12 ? 29.962  -1.620  38.071  1.00 22.81 ? 11   PRO D CG  1 
ATOM   2056 C  CD  . PRO D 1 12 ? 30.118  -0.669  39.220  1.00 28.98 ? 11   PRO D CD  1 
ATOM   2057 N  N   . ALA D 1 13 ? 26.271  -0.608  36.852  1.00 22.32 ? 12   ALA D N   1 
ATOM   2058 C  CA  . ALA D 1 13 ? 25.082  -1.441  36.817  1.00 22.77 ? 12   ALA D CA  1 
ATOM   2059 C  C   . ALA D 1 13 ? 25.525  -2.906  36.916  1.00 25.26 ? 12   ALA D C   1 
ATOM   2060 O  O   . ALA D 1 13 ? 26.739  -3.214  36.719  1.00 20.52 ? 12   ALA D O   1 
ATOM   2061 C  CB  . ALA D 1 13 ? 24.314  -1.212  35.527  1.00 23.19 ? 12   ALA D CB  1 
ATOM   2062 N  N   . PRO D 1 14 ? 24.570  -3.826  37.178  1.00 21.78 ? 13   PRO D N   1 
ATOM   2063 C  CA  . PRO D 1 14 ? 23.092  -3.695  37.269  1.00 20.19 ? 13   PRO D CA  1 
ATOM   2064 C  C   . PRO D 1 14 ? 22.614  -2.815  38.378  1.00 16.50 ? 13   PRO D C   1 
ATOM   2065 O  O   . PRO D 1 14 ? 23.132  -2.882  39.503  1.00 17.42 ? 13   PRO D O   1 
ATOM   2066 C  CB  . PRO D 1 14 ? 22.623  -5.142  37.555  1.00 20.00 ? 13   PRO D CB  1 
ATOM   2067 C  CG  . PRO D 1 14 ? 23.732  -6.001  37.209  1.00 26.91 ? 13   PRO D CG  1 
ATOM   2068 C  CD  . PRO D 1 14 ? 24.984  -5.223  37.412  1.00 20.88 ? 13   PRO D CD  1 
ATOM   2069 N  N   . TRP D 1 15 ? 21.623  -1.999  38.078  1.00 13.91 ? 14   TRP D N   1 
ATOM   2070 C  CA  . TRP D 1 15 ? 21.031  -1.103  39.046  1.00 18.52 ? 14   TRP D CA  1 
ATOM   2071 C  C   . TRP D 1 15 ? 20.025  -1.858  39.907  1.00 15.94 ? 14   TRP D C   1 
ATOM   2072 O  O   . TRP D 1 15 ? 19.685  -1.404  40.969  1.00 16.49 ? 14   TRP D O   1 
ATOM   2073 C  CB  . TRP D 1 15 ? 20.349  0.085   38.357  1.00 18.94 ? 14   TRP D CB  1 
ATOM   2074 C  CG  . TRP D 1 15 ? 21.263  0.844   37.440  1.00 14.62 ? 14   TRP D CG  1 
ATOM   2075 C  CD1 . TRP D 1 15 ? 21.151  0.955   36.102  1.00 18.11 ? 14   TRP D CD1 1 
ATOM   2076 C  CD2 . TRP D 1 15 ? 22.463  1.542   37.800  1.00 17.16 ? 14   TRP D CD2 1 
ATOM   2077 N  NE1 . TRP D 1 15 ? 22.185  1.704   35.597  1.00 16.55 ? 14   TRP D NE1 1 
ATOM   2078 C  CE2 . TRP D 1 15 ? 22.999  2.083   36.621  1.00 20.65 ? 14   TRP D CE2 1 
ATOM   2079 C  CE3 . TRP D 1 15 ? 23.107  1.796   39.005  1.00 18.20 ? 14   TRP D CE3 1 
ATOM   2080 C  CZ2 . TRP D 1 15 ? 24.186  2.829   36.612  1.00 18.73 ? 14   TRP D CZ2 1 
ATOM   2081 C  CZ3 . TRP D 1 15 ? 24.275  2.513   38.986  1.00 17.51 ? 14   TRP D CZ3 1 
ATOM   2082 C  CH2 . TRP D 1 15 ? 24.773  3.063   37.804  1.00 17.23 ? 14   TRP D CH2 1 
ATOM   2083 N  N   . GLY D 1 16 ? 19.557  -3.009  39.426  1.00 12.25 ? 15   GLY D N   1 
ATOM   2084 C  CA  . GLY D 1 16 ? 18.667  -3.881  40.216  1.00 13.14 ? 15   GLY D CA  1 
ATOM   2085 C  C   . GLY D 1 16 ? 17.171  -3.597  40.176  1.00 13.49 ? 15   GLY D C   1 
ATOM   2086 O  O   . GLY D 1 16 ? 16.427  -3.809  41.170  1.00 13.43 ? 15   GLY D O   1 
ATOM   2087 N  N   . PHE D 1 17 ? 16.678  -3.138  39.012  1.00 11.46 ? 16   PHE D N   1 
ATOM   2088 C  CA  . PHE D 1 17 ? 15.248  -2.947  38.841  1.00 12.08 ? 16   PHE D CA  1 
ATOM   2089 C  C   . PHE D 1 17 ? 14.782  -3.147  37.400  1.00 10.18 ? 16   PHE D C   1 
ATOM   2090 O  O   . PHE D 1 17 ? 15.598  -3.136  36.488  1.00 12.86 ? 16   PHE D O   1 
ATOM   2091 C  CB  . PHE D 1 17 ? 14.857  -1.580  39.420  1.00 10.89 ? 16   PHE D CB  1 
ATOM   2092 C  CG  . PHE D 1 17 ? 15.302  -0.401  38.592  1.00 9.46  ? 16   PHE D CG  1 
ATOM   2093 C  CD1 . PHE D 1 17 ? 14.447  0.191   37.675  1.00 12.42 ? 16   PHE D CD1 1 
ATOM   2094 C  CD2 . PHE D 1 17 ? 16.582  0.124   38.758  1.00 13.11 ? 16   PHE D CD2 1 
ATOM   2095 C  CE1 . PHE D 1 17 ? 14.851  1.273   36.905  1.00 13.40 ? 16   PHE D CE1 1 
ATOM   2096 C  CE2 . PHE D 1 17 ? 17.000  1.184   37.997  1.00 14.00 ? 16   PHE D CE2 1 
ATOM   2097 C  CZ  . PHE D 1 17 ? 16.116  1.777   37.073  1.00 14.80 ? 16   PHE D CZ  1 
ATOM   2098 N  N   . ARG D 1 18 ? 13.488  -3.304  37.255  1.00 12.79 ? 17   ARG D N   1 
ATOM   2099 C  CA  . ARG D 1 18 ? 12.775  -3.269  35.982  1.00 12.42 ? 17   ARG D CA  1 
ATOM   2100 C  C   . ARG D 1 18 ? 11.663  -2.232  36.037  1.00 11.77 ? 17   ARG D C   1 
ATOM   2101 O  O   . ARG D 1 18 ? 11.101  -1.874  37.085  1.00 11.64 ? 17   ARG D O   1 
ATOM   2102 C  CB  . ARG D 1 18 ? 12.171  -4.629  35.613  1.00 13.69 ? 17   ARG D CB  1 
ATOM   2103 C  CG  . ARG D 1 18 ? 13.182  -5.742  35.367  1.00 16.33 ? 17   ARG D CG  1 
ATOM   2104 C  CD  . ARG D 1 18 ? 12.605  -6.834  34.436  1.00 20.10 ? 17   ARG D CD  1 
ATOM   2105 N  NE  . ARG D 1 18 ? 11.485  -7.505  35.099  1.00 17.96 ? 17   ARG D NE  1 
ATOM   2106 C  CZ  . ARG D 1 18 ? 11.581  -8.599  35.856  1.00 21.43 ? 17   ARG D CZ  1 
ATOM   2107 N  NH1 . ARG D 1 18 ? 12.736  -9.225  36.029  1.00 23.67 ? 17   ARG D NH1 1 
ATOM   2108 N  NH2 . ARG D 1 18 ? 10.487  -9.082  36.432  1.00 23.21 ? 17   ARG D NH2 1 
ATOM   2109 N  N   . LEU D 1 19 ? 11.324  -1.763  34.849  1.00 16.63 ? 18   LEU D N   1 
ATOM   2110 C  CA  . LEU D 1 19 ? 10.237  -0.822  34.664  1.00 14.47 ? 18   LEU D CA  1 
ATOM   2111 C  C   . LEU D 1 19 ? 9.051   -1.467  33.923  1.00 11.94 ? 18   LEU D C   1 
ATOM   2112 O  O   . LEU D 1 19 ? 9.227   -2.357  33.095  1.00 14.42 ? 18   LEU D O   1 
ATOM   2113 C  CB  . LEU D 1 19 ? 10.736  0.357   33.834  1.00 13.89 ? 18   LEU D CB  1 
ATOM   2114 C  CG  . LEU D 1 19 ? 11.806  1.262   34.469  1.00 13.46 ? 18   LEU D CG  1 
ATOM   2115 C  CD1 . LEU D 1 19 ? 12.307  2.263   33.458  1.00 19.45 ? 18   LEU D CD1 1 
ATOM   2116 C  CD2 . LEU D 1 19 ? 11.326  1.994   35.717  1.00 17.09 ? 18   LEU D CD2 1 
ATOM   2117 N  N   . GLN D 1 20 ? 7.859   -0.932  34.142  1.00 13.24 ? 19   GLN D N   1 
ATOM   2118 C  CA  . GLN D 1 20 ? 6.745   -1.121  33.238  1.00 16.79 ? 19   GLN D CA  1 
ATOM   2119 C  C   . GLN D 1 20 ? 6.198   0.243   32.855  1.00 13.36 ? 19   GLN D C   1 
ATOM   2120 O  O   . GLN D 1 20 ? 6.402   1.280   33.539  1.00 13.61 ? 19   GLN D O   1 
ATOM   2121 C  CB  A GLN D 1 20 ? 5.650   -2.027  33.840  0.50 16.74 ? 19   GLN D CB  1 
ATOM   2122 C  CB  B GLN D 1 20 ? 5.638   -1.938  33.901  0.50 17.35 ? 19   GLN D CB  1 
ATOM   2123 C  CG  A GLN D 1 20 ? 4.994   -1.451  35.049  0.50 15.87 ? 19   GLN D CG  1 
ATOM   2124 C  CG  B GLN D 1 20 ? 5.937   -3.391  33.931  0.50 19.77 ? 19   GLN D CG  1 
ATOM   2125 C  CD  A GLN D 1 20 ? 3.858   -2.310  35.591  0.50 15.91 ? 19   GLN D CD  1 
ATOM   2126 C  CD  B GLN D 1 20 ? 4.871   -4.166  34.649  0.50 20.52 ? 19   GLN D CD  1 
ATOM   2127 O  OE1 A GLN D 1 20 ? 3.229   -3.085  34.862  0.50 29.72 ? 19   GLN D OE1 1 
ATOM   2128 O  OE1 B GLN D 1 20 ? 4.034   -3.597  35.351  0.50 21.04 ? 19   GLN D OE1 1 
ATOM   2129 N  NE2 A GLN D 1 20 ? 3.564   -2.135  36.860  0.50 26.14 ? 19   GLN D NE2 1 
ATOM   2130 N  NE2 B GLN D 1 20 ? 4.900   -5.466  34.490  0.50 16.79 ? 19   GLN D NE2 1 
ATOM   2131 N  N   . GLY D 1 21 ? 5.417   0.254   31.791  1.00 14.83 ? 20   GLY D N   1 
ATOM   2132 C  CA  . GLY D 1 21 ? 4.663   1.436   31.452  1.00 15.85 ? 20   GLY D CA  1 
ATOM   2133 C  C   . GLY D 1 21 ? 5.438   2.363   30.551  1.00 18.58 ? 20   GLY D C   1 
ATOM   2134 O  O   . GLY D 1 21 ? 6.327   1.951   29.783  1.00 22.55 ? 20   GLY D O   1 
ATOM   2135 N  N   . GLY D 1 22 ? 5.094   3.632   30.617  1.00 14.11 ? 21   GLY D N   1 
ATOM   2136 C  CA  . GLY D 1 22 ? 5.641   4.603   29.711  1.00 14.47 ? 21   GLY D CA  1 
ATOM   2137 C  C   . GLY D 1 22 ? 4.650   5.179   28.692  1.00 15.39 ? 21   GLY D C   1 
ATOM   2138 O  O   . GLY D 1 22 ? 3.516   4.728   28.560  1.00 14.64 ? 21   GLY D O   1 
ATOM   2139 N  N   . LYS D 1 23 ? 5.109   6.165   27.953  1.00 16.05 ? 22   LYS D N   1 
ATOM   2140 C  CA  . LYS D 1 23 ? 4.241   6.955   27.067  1.00 19.64 ? 22   LYS D CA  1 
ATOM   2141 C  C   . LYS D 1 23 ? 3.588   6.165   25.969  1.00 21.97 ? 22   LYS D C   1 
ATOM   2142 O  O   . LYS D 1 23 ? 2.466   6.463   25.583  1.00 19.90 ? 22   LYS D O   1 
ATOM   2143 C  CB  . LYS D 1 23 ? 5.037   8.113   26.470  1.00 21.66 ? 22   LYS D CB  1 
ATOM   2144 C  CG  . LYS D 1 23 ? 4.291   9.003   25.503  1.00 27.57 ? 22   LYS D CG  1 
ATOM   2145 C  CD  . LYS D 1 23 ? 3.082   9.551   26.181  1.00 28.21 ? 22   LYS D CD  1 
ATOM   2146 N  N   . ASP D 1 24 ? 4.283   5.163   25.448  1.00 19.19 ? 23   ASP D N   1 
ATOM   2147 C  CA  . ASP D 1 24 ? 3.691   4.267   24.459  1.00 17.43 ? 23   ASP D CA  1 
ATOM   2148 C  C   . ASP D 1 24 ? 2.469   3.509   24.964  1.00 18.88 ? 23   ASP D C   1 
ATOM   2149 O  O   . ASP D 1 24 ? 1.630   3.072   24.182  1.00 23.44 ? 23   ASP D O   1 
ATOM   2150 C  CB  . ASP D 1 24 ? 4.718   3.362   23.761  1.00 23.16 ? 23   ASP D CB  1 
ATOM   2151 C  CG  . ASP D 1 24 ? 5.852   2.868   24.665  1.00 31.70 ? 23   ASP D CG  1 
ATOM   2152 O  OD1 . ASP D 1 24 ? 6.084   3.379   25.808  1.00 26.04 ? 23   ASP D OD1 1 
ATOM   2153 O  OD2 . ASP D 1 24 ? 6.531   1.941   24.155  1.00 28.70 ? 23   ASP D OD2 1 
ATOM   2154 N  N   . PHE D 1 25 ? 2.356   3.394   26.273  1.00 19.56 ? 24   PHE D N   1 
ATOM   2155 C  CA  . PHE D 1 25 ? 1.243   2.761   26.928  1.00 16.97 ? 24   PHE D CA  1 
ATOM   2156 C  C   . PHE D 1 25 ? 0.297   3.765   27.585  1.00 16.94 ? 24   PHE D C   1 
ATOM   2157 O  O   . PHE D 1 25 ? -0.707  3.361   28.142  1.00 16.93 ? 24   PHE D O   1 
ATOM   2158 C  CB  . PHE D 1 25 ? 1.800   1.793   27.984  1.00 20.78 ? 24   PHE D CB  1 
ATOM   2159 C  CG  . PHE D 1 25 ? 2.711   0.722   27.400  1.00 22.57 ? 24   PHE D CG  1 
ATOM   2160 C  CD1 . PHE D 1 25 ? 2.177   -0.452  26.916  1.00 34.05 ? 24   PHE D CD1 1 
ATOM   2161 C  CD2 . PHE D 1 25 ? 4.094   0.909   27.334  1.00 25.51 ? 24   PHE D CD2 1 
ATOM   2162 C  CE1 . PHE D 1 25 ? 2.993   -1.446  26.374  1.00 21.85 ? 24   PHE D CE1 1 
ATOM   2163 C  CE2 . PHE D 1 25 ? 4.923   -0.063  26.795  1.00 30.01 ? 24   PHE D CE2 1 
ATOM   2164 C  CZ  . PHE D 1 25 ? 4.371   -1.249  26.317  1.00 31.86 ? 24   PHE D CZ  1 
ATOM   2165 N  N   . ASN D 1 26 ? 0.633   5.051   27.498  1.00 13.82 ? 25   ASN D N   1 
ATOM   2166 C  CA  . ASN D 1 26 ? -0.126  6.120   28.142  1.00 11.27 ? 25   ASN D CA  1 
ATOM   2167 C  C   . ASN D 1 26 ? -0.235  5.865   29.626  1.00 15.73 ? 25   ASN D C   1 
ATOM   2168 O  O   . ASN D 1 26 ? -1.286  6.029   30.213  1.00 15.84 ? 25   ASN D O   1 
ATOM   2169 C  CB  . ASN D 1 26 ? -1.532  6.248   27.526  1.00 15.16 ? 25   ASN D CB  1 
ATOM   2170 C  CG  . ASN D 1 26 ? -1.498  6.588   26.061  1.00 19.37 ? 25   ASN D CG  1 
ATOM   2171 O  OD1 . ASN D 1 26 ? -2.084  5.877   25.233  1.00 28.16 ? 25   ASN D OD1 1 
ATOM   2172 N  ND2 . ASN D 1 26 ? -0.787  7.669   25.720  1.00 18.59 ? 25   ASN D ND2 1 
ATOM   2173 N  N   . MET D 1 27 ? 0.879   5.429   30.186  1.00 13.40 ? 26   MET D N   1 
ATOM   2174 C  CA  . MET D 1 27 ? 0.999   5.106   31.589  1.00 15.33 ? 26   MET D CA  1 
ATOM   2175 C  C   . MET D 1 27 ? 2.264   5.730   32.151  1.00 14.78 ? 26   MET D C   1 
ATOM   2176 O  O   . MET D 1 27 ? 3.269   5.920   31.436  1.00 13.35 ? 26   MET D O   1 
ATOM   2177 C  CB  A MET D 1 27 ? 1.119   3.583   31.799  0.50 16.15 ? 26   MET D CB  1 
ATOM   2178 C  CB  B MET D 1 27 ? 1.065   3.602   31.788  0.50 15.52 ? 26   MET D CB  1 
ATOM   2179 C  CG  A MET D 1 27 ? -0.064  2.755   31.403  0.50 20.49 ? 26   MET D CG  1 
ATOM   2180 C  CG  B MET D 1 27 ? -0.083  2.883   31.222  0.50 21.63 ? 26   MET D CG  1 
ATOM   2181 S  SD  A MET D 1 27 ? -1.512  3.007   32.432  0.50 21.28 ? 26   MET D SD  1 
ATOM   2182 S  SD  B MET D 1 27 ? 0.119   1.164   31.578  0.50 26.49 ? 26   MET D SD  1 
ATOM   2183 C  CE  A MET D 1 27 ? -1.051  2.293   33.990  0.50 14.67 ? 26   MET D CE  1 
ATOM   2184 C  CE  B MET D 1 27 ? -0.584  1.135   33.219  0.50 21.73 ? 26   MET D CE  1 
ATOM   2185 N  N   . PRO D 1 28 ? 2.259   5.992   33.462  1.00 14.84 ? 27   PRO D N   1 
ATOM   2186 C  CA  . PRO D 1 28 ? 3.515   6.353   34.083  1.00 14.77 ? 27   PRO D CA  1 
ATOM   2187 C  C   . PRO D 1 28 ? 4.507   5.177   33.994  1.00 13.15 ? 27   PRO D C   1 
ATOM   2188 O  O   . PRO D 1 28 ? 4.123   4.028   33.795  1.00 15.42 ? 27   PRO D O   1 
ATOM   2189 C  CB  . PRO D 1 28 ? 3.135   6.634   35.550  1.00 15.50 ? 27   PRO D CB  1 
ATOM   2190 C  CG  . PRO D 1 28 ? 1.815   6.068   35.733  1.00 18.30 ? 27   PRO D CG  1 
ATOM   2191 C  CD  . PRO D 1 28 ? 1.150   5.915   34.421  1.00 16.32 ? 27   PRO D CD  1 
ATOM   2192 N  N   . LEU D 1 29 ? 5.779   5.531   34.014  1.00 13.27 ? 28   LEU D N   1 
ATOM   2193 C  CA  . LEU D 1 29 ? 6.837   4.560   34.234  1.00 14.37 ? 28   LEU D CA  1 
ATOM   2194 C  C   . LEU D 1 29 ? 6.831   4.187   35.703  1.00 9.91  ? 28   LEU D C   1 
ATOM   2195 O  O   . LEU D 1 29 ? 6.984   5.048   36.561  1.00 14.26 ? 28   LEU D O   1 
ATOM   2196 C  CB  . LEU D 1 29 ? 8.214   5.152   33.843  1.00 15.81 ? 28   LEU D CB  1 
ATOM   2197 C  CG  . LEU D 1 29 ? 8.468   5.409   32.359  1.00 22.43 ? 28   LEU D CG  1 
ATOM   2198 C  CD1 . LEU D 1 29 ? 9.721   6.281   32.163  1.00 23.55 ? 28   LEU D CD1 1 
ATOM   2199 C  CD2 . LEU D 1 29 ? 8.630   4.092   31.676  1.00 18.17 ? 28   LEU D CD2 1 
ATOM   2200 N  N   . THR D 1 30 ? 6.722   2.909   36.001  1.00 13.16 ? 29   THR D N   1 
ATOM   2201 C  CA  . THR D 1 30 ? 6.716   2.431   37.377  1.00 11.51 ? 29   THR D CA  1 
ATOM   2202 C  C   . THR D 1 30 ? 7.724   1.303   37.576  1.00 14.14 ? 29   THR D C   1 
ATOM   2203 O  O   . THR D 1 30 ? 8.029   0.513   36.675  1.00 14.13 ? 29   THR D O   1 
ATOM   2204 C  CB  . THR D 1 30 ? 5.306   1.899   37.802  1.00 16.26 ? 29   THR D CB  1 
ATOM   2205 O  OG1 . THR D 1 30 ? 4.891   0.925   36.866  1.00 17.81 ? 29   THR D OG1 1 
ATOM   2206 C  CG2 . THR D 1 30 ? 4.264   3.002   37.890  1.00 17.52 ? 29   THR D CG2 1 
ATOM   2207 N  N   . ILE D 1 31 ? 8.235   1.205   38.786  1.00 12.26 ? 30   ILE D N   1 
ATOM   2208 C  CA  . ILE D 1 31 ? 9.129   0.106   39.178  1.00 11.15 ? 30   ILE D CA  1 
ATOM   2209 C  C   . ILE D 1 31 ? 8.324   -1.176  39.257  1.00 12.97 ? 30   ILE D C   1 
ATOM   2210 O  O   . ILE D 1 31 ? 7.378   -1.278  40.055  1.00 13.98 ? 30   ILE D O   1 
ATOM   2211 C  CB  . ILE D 1 31 ? 9.815   0.370   40.549  1.00 11.88 ? 30   ILE D CB  1 
ATOM   2212 C  CG1 . ILE D 1 31 ? 10.582  1.699   40.532  1.00 11.73 ? 30   ILE D CG1 1 
ATOM   2213 C  CG2 . ILE D 1 31 ? 10.670  -0.819  40.896  1.00 15.69 ? 30   ILE D CG2 1 
ATOM   2214 C  CD1 . ILE D 1 31 ? 11.805  1.746   39.597  1.00 15.03 ? 30   ILE D CD1 1 
ATOM   2215 N  N   . SER D 1 32 ? 8.645   -2.156  38.414  1.00 10.85 ? 31   SER D N   1 
ATOM   2216 C  CA  . SER D 1 32 ? 7.890   -3.360  38.377  1.00 13.95 ? 31   SER D CA  1 
ATOM   2217 C  C   . SER D 1 32 ? 8.568   -4.560  39.041  1.00 14.39 ? 31   SER D C   1 
ATOM   2218 O  O   . SER D 1 32 ? 7.904   -5.540  39.322  1.00 15.22 ? 31   SER D O   1 
ATOM   2219 C  CB  . SER D 1 32 ? 7.552   -3.677  36.945  1.00 15.07 ? 31   SER D CB  1 
ATOM   2220 O  OG  . SER D 1 32 ? 8.746   -3.886  36.181  1.00 15.40 ? 31   SER D OG  1 
ATOM   2221 N  N   . SER D 1 33 ? 9.883   -4.500  39.243  1.00 11.44 ? 32   SER D N   1 
ATOM   2222 C  CA  . SER D 1 33 ? 10.633  -5.573  39.859  1.00 13.06 ? 32   SER D CA  1 
ATOM   2223 C  C   . SER D 1 33 ? 11.840  -4.967  40.523  1.00 9.73  ? 32   SER D C   1 
ATOM   2224 O  O   . SER D 1 33 ? 12.325  -3.905  40.064  1.00 12.43 ? 32   SER D O   1 
ATOM   2225 C  CB  . SER D 1 33 ? 11.080  -6.587  38.776  1.00 15.86 ? 32   SER D CB  1 
ATOM   2226 O  OG  . SER D 1 33 ? 11.737  -7.744  39.334  1.00 22.18 ? 32   SER D OG  1 
ATOM   2227 N  N   . LEU D 1 34 ? 12.316  -5.613  41.596  1.00 14.92 ? 33   LEU D N   1 
ATOM   2228 C  CA  . LEU D 1 34 ? 13.562  -5.207  42.274  1.00 12.54 ? 33   LEU D CA  1 
ATOM   2229 C  C   . LEU D 1 34 ? 14.391  -6.434  42.557  1.00 14.21 ? 33   LEU D C   1 
ATOM   2230 O  O   . LEU D 1 34 ? 13.872  -7.426  43.035  1.00 13.24 ? 33   LEU D O   1 
ATOM   2231 C  CB  . LEU D 1 34 ? 13.307  -4.538  43.617  1.00 14.23 ? 33   LEU D CB  1 
ATOM   2232 C  CG  . LEU D 1 34 ? 12.702  -3.161  43.633  1.00 16.92 ? 33   LEU D CG  1 
ATOM   2233 C  CD1 . LEU D 1 34 ? 12.268  -2.837  45.052  1.00 17.63 ? 33   LEU D CD1 1 
ATOM   2234 C  CD2 . LEU D 1 34 ? 13.702  -2.119  43.102  1.00 16.35 ? 33   LEU D CD2 1 
ATOM   2235 N  N   . LYS D 1 35 ? 15.696  -6.320  42.345  1.00 14.01 ? 34   LYS D N   1 
ATOM   2236 C  CA  . LYS D 1 35 ? 16.623  -7.335  42.747  1.00 13.20 ? 34   LYS D CA  1 
ATOM   2237 C  C   . LYS D 1 35 ? 16.796  -7.225  44.252  1.00 12.84 ? 34   LYS D C   1 
ATOM   2238 O  O   . LYS D 1 35 ? 17.016  -6.160  44.808  1.00 17.42 ? 34   LYS D O   1 
ATOM   2239 C  CB  . LYS D 1 35 ? 17.941  -7.108  41.996  1.00 13.91 ? 34   LYS D CB  1 
ATOM   2240 C  CG  . LYS D 1 35 ? 19.025  -8.067  42.334  1.00 17.20 ? 34   LYS D CG  1 
ATOM   2241 C  CD  . LYS D 1 35 ? 20.325  -7.764  41.603  1.00 29.14 ? 34   LYS D CD  1 
ATOM   2242 C  CE  . LYS D 1 35 ? 21.456  -8.618  42.199  1.00 45.43 ? 34   LYS D CE  1 
ATOM   2243 N  NZ  . LYS D 1 35 ? 21.299  -10.110 42.012  1.00 29.21 ? 34   LYS D NZ  1 
ATOM   2244 N  N   . ASP D 1 36 ? 16.685  -8.365  44.907  1.00 13.54 ? 35   ASP D N   1 
ATOM   2245 C  CA  . ASP D 1 36 ? 16.903  -8.481  46.359  1.00 16.51 ? 35   ASP D CA  1 
ATOM   2246 C  C   . ASP D 1 36 ? 18.342  -8.065  46.667  1.00 17.27 ? 35   ASP D C   1 
ATOM   2247 O  O   . ASP D 1 36 ? 19.288  -8.602  46.063  1.00 19.09 ? 35   ASP D O   1 
ATOM   2248 C  CB  . ASP D 1 36 ? 16.665  -9.930  46.794  1.00 21.88 ? 35   ASP D CB  1 
ATOM   2249 C  CG  . ASP D 1 36 ? 16.048  -10.049 48.160  1.00 28.25 ? 35   ASP D CG  1 
ATOM   2250 O  OD1 . ASP D 1 36 ? 16.073  -9.078  48.953  1.00 34.92 ? 35   ASP D OD1 1 
ATOM   2251 O  OD2 . ASP D 1 36 ? 15.537  -11.158 48.419  1.00 35.75 ? 35   ASP D OD2 1 
ATOM   2252 N  N   . GLY D 1 37 ? 18.496  -7.055  47.521  1.00 17.82 ? 36   GLY D N   1 
ATOM   2253 C  CA  . GLY D 1 37 ? 19.810  -6.567  47.908  1.00 18.83 ? 36   GLY D CA  1 
ATOM   2254 C  C   . GLY D 1 37 ? 20.516  -5.753  46.854  1.00 17.92 ? 36   GLY D C   1 
ATOM   2255 O  O   . GLY D 1 37 ? 21.660  -5.320  47.031  1.00 20.41 ? 36   GLY D O   1 
ATOM   2256 N  N   . GLY D 1 38 ? 19.802  -5.505  45.748  1.00 16.31 ? 37   GLY D N   1 
ATOM   2257 C  CA  . GLY D 1 38 ? 20.316  -4.668  44.684  1.00 13.95 ? 37   GLY D CA  1 
ATOM   2258 C  C   . GLY D 1 38 ? 20.390  -3.192  45.028  1.00 13.47 ? 37   GLY D C   1 
ATOM   2259 O  O   . GLY D 1 38 ? 19.899  -2.730  46.070  1.00 13.81 ? 37   GLY D O   1 
ATOM   2260 N  N   . LYS D 1 39 ? 20.968  -2.416  44.132  1.00 13.38 ? 38   LYS D N   1 
ATOM   2261 C  CA  . LYS D 1 39 ? 21.269  -1.038  44.476  1.00 16.07 ? 38   LYS D CA  1 
ATOM   2262 C  C   . LYS D 1 39 ? 19.974  -0.263  44.638  1.00 15.91 ? 38   LYS D C   1 
ATOM   2263 O  O   . LYS D 1 39 ? 19.860  0.539   45.555  1.00 14.52 ? 38   LYS D O   1 
ATOM   2264 C  CB  . LYS D 1 39 ? 22.194  -0.399  43.432  1.00 16.16 ? 38   LYS D CB  1 
ATOM   2265 C  CG  . LYS D 1 39 ? 23.614  -0.934  43.525  1.00 14.27 ? 38   LYS D CG  1 
ATOM   2266 C  CD  . LYS D 1 39 ? 24.395  -0.636  42.284  1.00 19.25 ? 38   LYS D CD  1 
ATOM   2267 C  CE  . LYS D 1 39 ? 25.809  -1.221  42.355  1.00 23.73 ? 38   LYS D CE  1 
ATOM   2268 N  NZ  . LYS D 1 39 ? 26.729  -0.285  42.979  1.00 37.34 ? 38   LYS D NZ  1 
ATOM   2269 N  N   . ALA D 1 40 ? 18.991  -0.491  43.768  1.00 14.35 ? 39   ALA D N   1 
ATOM   2270 C  CA  . ALA D 1 40 ? 17.726  0.251   43.892  1.00 14.40 ? 39   ALA D CA  1 
ATOM   2271 C  C   . ALA D 1 40 ? 17.007  -0.101  45.216  1.00 13.83 ? 39   ALA D C   1 
ATOM   2272 O  O   . ALA D 1 40 ? 16.551  0.797   45.943  1.00 12.91 ? 39   ALA D O   1 
ATOM   2273 C  CB  . ALA D 1 40 ? 16.850  -0.040  42.669  1.00 13.23 ? 39   ALA D CB  1 
ATOM   2274 N  N   . ALA D 1 41 ? 16.951  -1.396  45.541  1.00 15.67 ? 40   ALA D N   1 
ATOM   2275 C  CA  . ALA D 1 41 ? 16.288  -1.847  46.760  1.00 17.11 ? 40   ALA D CA  1 
ATOM   2276 C  C   . ALA D 1 41 ? 16.990  -1.259  47.994  1.00 15.53 ? 40   ALA D C   1 
ATOM   2277 O  O   . ALA D 1 41 ? 16.343  -0.792  48.909  1.00 17.66 ? 40   ALA D O   1 
ATOM   2278 C  CB  . ALA D 1 41 ? 16.257  -3.401  46.812  1.00 16.40 ? 40   ALA D CB  1 
ATOM   2279 N  N   . GLN D 1 42 ? 18.317  -1.243  47.979  1.00 16.53 ? 41   GLN D N   1 
ATOM   2280 C  CA  . GLN D 1 42 ? 19.085  -0.690  49.095  1.00 18.16 ? 41   GLN D CA  1 
ATOM   2281 C  C   . GLN D 1 42 ? 18.925  0.833   49.250  1.00 19.16 ? 41   GLN D C   1 
ATOM   2282 O  O   . GLN D 1 42 ? 19.081  1.373   50.332  1.00 21.92 ? 41   GLN D O   1 
ATOM   2283 C  CB  . GLN D 1 42 ? 20.546  -1.131  48.977  1.00 18.01 ? 41   GLN D CB  1 
ATOM   2284 C  CG  . GLN D 1 42 ? 20.617  -2.659  49.134  1.00 25.47 ? 41   GLN D CG  1 
ATOM   2285 C  CD  . GLN D 1 42 ? 21.945  -3.181  49.618  1.00 46.37 ? 41   GLN D CD  1 
ATOM   2286 O  OE1 . GLN D 1 42 ? 23.005  -2.675  49.247  1.00 48.06 ? 41   GLN D OE1 1 
ATOM   2287 N  NE2 . GLN D 1 42 ? 21.896  -4.228  50.436  1.00 42.38 ? 41   GLN D NE2 1 
ATOM   2288 N  N   . ALA D 1 43 ? 18.563  1.498   48.167  1.00 17.51 ? 42   ALA D N   1 
ATOM   2289 C  CA  . ALA D 1 43 ? 18.281  2.922   48.142  1.00 14.15 ? 42   ALA D CA  1 
ATOM   2290 C  C   . ALA D 1 43 ? 16.804  3.236   48.499  1.00 11.65 ? 42   ALA D C   1 
ATOM   2291 O  O   . ALA D 1 43 ? 16.377  4.396   48.424  1.00 18.05 ? 42   ALA D O   1 
ATOM   2292 C  CB  . ALA D 1 43 ? 18.661  3.511   46.773  1.00 17.69 ? 42   ALA D CB  1 
ATOM   2293 N  N   . ASN D 1 44 ? 16.067  2.189   48.899  1.00 14.72 ? 43   ASN D N   1 
ATOM   2294 C  CA  . ASN D 1 44 ? 14.686  2.245   49.427  1.00 13.28 ? 43   ASN D CA  1 
ATOM   2295 C  C   . ASN D 1 44 ? 13.645  2.563   48.333  1.00 12.27 ? 43   ASN D C   1 
ATOM   2296 O  O   . ASN D 1 44 ? 12.565  3.060   48.592  1.00 15.34 ? 43   ASN D O   1 
ATOM   2297 C  CB  A ASN D 1 44 ? 14.550  3.216   50.620  0.50 16.91 ? 43   ASN D CB  1 
ATOM   2298 C  CB  B ASN D 1 44 ? 14.600  3.233   50.612  0.50 16.95 ? 43   ASN D CB  1 
ATOM   2299 C  CG  A ASN D 1 44 ? 15.403  2.813   51.803  0.50 18.51 ? 43   ASN D CG  1 
ATOM   2300 C  CG  B ASN D 1 44 ? 13.517  2.868   51.623  0.50 20.00 ? 43   ASN D CG  1 
ATOM   2301 O  OD1 A ASN D 1 44 ? 16.148  3.628   52.352  0.50 37.93 ? 43   ASN D OD1 1 
ATOM   2302 O  OD1 B ASN D 1 44 ? 13.180  1.696   51.816  0.50 29.93 ? 43   ASN D OD1 1 
ATOM   2303 N  ND2 A ASN D 1 44 ? 15.324  1.546   52.185  0.50 30.50 ? 43   ASN D ND2 1 
ATOM   2304 N  ND2 B ASN D 1 44 ? 12.978  3.883   52.288  0.50 23.50 ? 43   ASN D ND2 1 
ATOM   2305 N  N   . VAL D 1 45 ? 13.987  2.227   47.087  1.00 10.36 ? 44   VAL D N   1 
ATOM   2306 C  CA  . VAL D 1 45 ? 13.016  2.164   45.983  1.00 10.96 ? 44   VAL D CA  1 
ATOM   2307 C  C   . VAL D 1 45 ? 12.025  0.988   46.261  1.00 11.21 ? 44   VAL D C   1 
ATOM   2308 O  O   . VAL D 1 45 ? 12.418  -0.081  46.774  1.00 13.06 ? 44   VAL D O   1 
ATOM   2309 C  CB  . VAL D 1 45 ? 13.707  1.946   44.622  1.00 11.99 ? 44   VAL D CB  1 
ATOM   2310 C  CG1 . VAL D 1 45 ? 12.689  1.748   43.466  1.00 13.18 ? 44   VAL D CG1 1 
ATOM   2311 C  CG2 . VAL D 1 45 ? 14.742  3.072   44.306  1.00 12.49 ? 44   VAL D CG2 1 
ATOM   2312 N  N   . ARG D 1 46 ? 10.756  1.204   45.926  1.00 11.04 ? 45   ARG D N   1 
ATOM   2313 C  CA  . ARG D 1 46 ? 9.719   0.214   46.138  1.00 13.71 ? 45   ARG D CA  1 
ATOM   2314 C  C   . ARG D 1 46 ? 8.975   -0.086  44.858  1.00 13.82 ? 45   ARG D C   1 
ATOM   2315 O  O   . ARG D 1 46 ? 8.693   0.817   44.048  1.00 13.31 ? 45   ARG D O   1 
ATOM   2316 C  CB  . ARG D 1 46 ? 8.727   0.643   47.231  1.00 13.77 ? 45   ARG D CB  1 
ATOM   2317 C  CG  . ARG D 1 46 ? 9.337   0.638   48.622  1.00 13.60 ? 45   ARG D CG  1 
ATOM   2318 C  CD  . ARG D 1 46 ? 8.470   1.292   49.702  1.00 19.62 ? 45   ARG D CD  1 
ATOM   2319 N  NE  . ARG D 1 46 ? 9.316   1.473   50.892  1.00 24.71 ? 45   ARG D NE  1 
ATOM   2320 C  CZ  . ARG D 1 46 ? 9.222   2.477   51.756  1.00 24.24 ? 45   ARG D CZ  1 
ATOM   2321 N  NH1 . ARG D 1 46 ? 8.297   3.410   51.621  1.00 16.28 ? 45   ARG D NH1 1 
ATOM   2322 N  NH2 . ARG D 1 46 ? 10.060  2.537   52.779  1.00 31.62 ? 45   ARG D NH2 1 
ATOM   2323 N  N   . ILE D 1 47 ? 8.651   -1.347  44.687  1.00 12.49 ? 46   ILE D N   1 
ATOM   2324 C  CA  . ILE D 1 47 ? 7.819   -1.768  43.572  1.00 10.38 ? 46   ILE D CA  1 
ATOM   2325 C  C   . ILE D 1 47 ? 6.499   -0.983  43.620  1.00 11.69 ? 46   ILE D C   1 
ATOM   2326 O  O   . ILE D 1 47 ? 5.852   -0.808  44.680  1.00 11.32 ? 46   ILE D O   1 
ATOM   2327 C  CB  . ILE D 1 47 ? 7.609   -3.297  43.589  1.00 10.06 ? 46   ILE D CB  1 
ATOM   2328 C  CG1 . ILE D 1 47 ? 8.929   -4.023  43.242  1.00 11.83 ? 46   ILE D CG1 1 
ATOM   2329 C  CG2 . ILE D 1 47 ? 6.481   -3.682  42.638  1.00 15.81 ? 46   ILE D CG2 1 
ATOM   2330 C  CD1 . ILE D 1 47 ? 8.915   -5.524  43.501  1.00 11.94 ? 46   ILE D CD1 1 
ATOM   2331 N  N   . GLY D 1 48 ? 6.111   -0.471  42.464  1.00 15.74 ? 47   GLY D N   1 
ATOM   2332 C  CA  . GLY D 1 48 ? 4.909   0.336   42.302  1.00 14.58 ? 47   GLY D CA  1 
ATOM   2333 C  C   . GLY D 1 48 ? 5.192   1.832   42.215  1.00 14.68 ? 47   GLY D C   1 
ATOM   2334 O  O   . GLY D 1 48 ? 4.378   2.592   41.647  1.00 15.23 ? 47   GLY D O   1 
ATOM   2335 N  N   . ASP D 1 49 ? 6.338   2.263   42.727  1.00 14.09 ? 48   ASP D N   1 
ATOM   2336 C  CA  . ASP D 1 49 ? 6.694   3.685   42.697  1.00 11.40 ? 48   ASP D CA  1 
ATOM   2337 C  C   . ASP D 1 49 ? 6.855   4.208   41.247  1.00 11.31 ? 48   ASP D C   1 
ATOM   2338 O  O   . ASP D 1 49 ? 7.289   3.465   40.367  1.00 13.76 ? 48   ASP D O   1 
ATOM   2339 C  CB  . ASP D 1 49 ? 7.939   3.965   43.508  1.00 11.41 ? 48   ASP D CB  1 
ATOM   2340 C  CG  . ASP D 1 49 ? 7.754   3.745   44.987  1.00 12.79 ? 48   ASP D CG  1 
ATOM   2341 O  OD1 . ASP D 1 49 ? 6.596   3.612   45.452  1.00 13.62 ? 48   ASP D OD1 1 
ATOM   2342 O  OD2 . ASP D 1 49 ? 8.794   3.787   45.661  1.00 14.53 ? 48   ASP D OD2 1 
ATOM   2343 N  N   . VAL D 1 50 ? 6.492   5.470   41.005  1.00 11.89 ? 49   VAL D N   1 
ATOM   2344 C  CA  . VAL D 1 50 ? 6.537   6.106   39.712  1.00 13.16 ? 49   VAL D CA  1 
ATOM   2345 C  C   . VAL D 1 50 ? 7.880   6.800   39.515  1.00 12.98 ? 49   VAL D C   1 
ATOM   2346 O  O   . VAL D 1 50 ? 8.325   7.534   40.413  1.00 13.90 ? 49   VAL D O   1 
ATOM   2347 C  CB  . VAL D 1 50 ? 5.406   7.125   39.534  1.00 12.73 ? 49   VAL D CB  1 
ATOM   2348 C  CG1 . VAL D 1 50 ? 5.632   7.954   38.280  1.00 13.83 ? 49   VAL D CG1 1 
ATOM   2349 C  CG2 . VAL D 1 50 ? 4.035   6.442   39.556  1.00 14.45 ? 49   VAL D CG2 1 
ATOM   2350 N  N   . VAL D 1 51 ? 8.499   6.606   38.343  1.00 15.28 ? 50   VAL D N   1 
ATOM   2351 C  CA  . VAL D 1 51 ? 9.723   7.311   37.980  1.00 14.79 ? 50   VAL D CA  1 
ATOM   2352 C  C   . VAL D 1 51 ? 9.359   8.665   37.385  1.00 14.38 ? 50   VAL D C   1 
ATOM   2353 O  O   . VAL D 1 51 ? 8.757   8.739   36.317  1.00 16.21 ? 50   VAL D O   1 
ATOM   2354 C  CB  . VAL D 1 51 ? 10.592  6.557   36.968  1.00 14.72 ? 50   VAL D CB  1 
ATOM   2355 C  CG1 . VAL D 1 51 ? 11.806  7.453   36.504  1.00 14.22 ? 50   VAL D CG1 1 
ATOM   2356 C  CG2 . VAL D 1 51 ? 11.034  5.146   37.525  1.00 13.89 ? 50   VAL D CG2 1 
ATOM   2357 N  N   . LEU D 1 52 ? 9.712   9.698   38.126  1.00 12.15 ? 51   LEU D N   1 
ATOM   2358 C  CA  . LEU D 1 52 ? 9.532   11.078  37.695  1.00 13.64 ? 51   LEU D CA  1 
ATOM   2359 C  C   . LEU D 1 52 ? 10.627  11.656  36.788  1.00 15.41 ? 51   LEU D C   1 
ATOM   2360 O  O   . LEU D 1 52 ? 10.331  12.457  35.883  1.00 18.12 ? 51   LEU D O   1 
ATOM   2361 C  CB  . LEU D 1 52 ? 9.398   11.955  38.922  1.00 13.71 ? 51   LEU D CB  1 
ATOM   2362 C  CG  . LEU D 1 52 ? 8.188   11.674  39.793  1.00 17.38 ? 51   LEU D CG  1 
ATOM   2363 C  CD1 . LEU D 1 52 ? 8.238   12.549  41.059  1.00 16.63 ? 51   LEU D CD1 1 
ATOM   2364 C  CD2 . LEU D 1 52 ? 6.879   11.842  39.041  1.00 21.57 ? 51   LEU D CD2 1 
ATOM   2365 N  N   . SER D 1 53 ? 11.864  11.287  37.055  1.00 13.74 ? 52   SER D N   1 
ATOM   2366 C  CA  . SER D 1 53 ? 12.994  11.819  36.291  1.00 14.87 ? 52   SER D CA  1 
ATOM   2367 C  C   . SER D 1 53 ? 14.152  10.833  36.307  1.00 15.43 ? 52   SER D C   1 
ATOM   2368 O  O   . SER D 1 53 ? 14.271  10.005  37.221  1.00 14.22 ? 52   SER D O   1 
ATOM   2369 C  CB  . SER D 1 53 ? 13.428  13.173  36.828  1.00 14.72 ? 52   SER D CB  1 
ATOM   2370 O  OG  . SER D 1 53 ? 14.121  13.072  38.040  1.00 19.43 ? 52   SER D OG  1 
ATOM   2371 N  N   . ILE D 1 54 ? 14.944  10.873  35.244  1.00 16.13 ? 53   ILE D N   1 
ATOM   2372 C  CA  . ILE D 1 54 ? 16.105  9.993   35.097  1.00 15.85 ? 53   ILE D CA  1 
ATOM   2373 C  C   . ILE D 1 54 ? 17.261  10.901  34.694  1.00 14.29 ? 53   ILE D C   1 
ATOM   2374 O  O   . ILE D 1 54 ? 17.186  11.568  33.673  1.00 18.88 ? 53   ILE D O   1 
ATOM   2375 C  CB  . ILE D 1 54 ? 15.896  8.937   34.006  1.00 15.88 ? 53   ILE D CB  1 
ATOM   2376 C  CG1 . ILE D 1 54 ? 14.770  7.970   34.379  1.00 15.43 ? 53   ILE D CG1 1 
ATOM   2377 C  CG2 . ILE D 1 54 ? 17.172  8.102   33.745  1.00 16.26 ? 53   ILE D CG2 1 
ATOM   2378 C  CD1 . ILE D 1 54 ? 14.309  7.167   33.214  1.00 19.42 ? 53   ILE D CD1 1 
ATOM   2379 N  N   . ASP D 1 55 ? 18.338  10.881  35.465  1.00 17.90 ? 54   ASP D N   1 
ATOM   2380 C  CA  . ASP D 1 55 ? 19.501  11.718  35.158  1.00 25.60 ? 54   ASP D CA  1 
ATOM   2381 C  C   . ASP D 1 55 ? 19.088  13.200  34.937  1.00 21.02 ? 54   ASP D C   1 
ATOM   2382 O  O   . ASP D 1 55 ? 19.568  13.877  34.036  1.00 22.48 ? 54   ASP D O   1 
ATOM   2383 C  CB  . ASP D 1 55 ? 20.224  11.089  33.955  1.00 26.17 ? 54   ASP D CB  1 
ATOM   2384 C  CG  . ASP D 1 55 ? 21.613  11.626  33.740  1.00 45.85 ? 54   ASP D CG  1 
ATOM   2385 O  OD1 . ASP D 1 55 ? 22.249  12.073  34.725  1.00 38.71 ? 54   ASP D OD1 1 
ATOM   2386 O  OD2 . ASP D 1 55 ? 22.055  11.588  32.562  1.00 40.58 ? 54   ASP D OD2 1 
ATOM   2387 N  N   . GLY D 1 56 ? 18.216  13.693  35.798  1.00 20.96 ? 55   GLY D N   1 
ATOM   2388 C  CA  . GLY D 1 56 ? 17.746  15.065  35.749  1.00 25.46 ? 55   GLY D CA  1 
ATOM   2389 C  C   . GLY D 1 56 ? 16.657  15.360  34.734  1.00 29.33 ? 55   GLY D C   1 
ATOM   2390 O  O   . GLY D 1 56 ? 16.061  16.433  34.774  1.00 36.53 ? 55   GLY D O   1 
ATOM   2391 N  N   . ILE D 1 57 ? 16.362  14.417  33.843  1.00 17.72 ? 56   ILE D N   1 
ATOM   2392 C  CA  . ILE D 1 57 ? 15.438  14.679  32.729  1.00 21.79 ? 56   ILE D CA  1 
ATOM   2393 C  C   . ILE D 1 57 ? 14.072  14.109  33.063  1.00 18.42 ? 56   ILE D C   1 
ATOM   2394 O  O   . ILE D 1 57 ? 13.965  12.950  33.433  1.00 16.20 ? 56   ILE D O   1 
ATOM   2395 C  CB  . ILE D 1 57 ? 15.930  14.026  31.445  1.00 24.36 ? 56   ILE D CB  1 
ATOM   2396 C  CG1 . ILE D 1 57 ? 17.319  14.563  31.067  1.00 32.28 ? 56   ILE D CG1 1 
ATOM   2397 C  CG2 . ILE D 1 57 ? 14.946  14.253  30.290  1.00 23.53 ? 56   ILE D CG2 1 
ATOM   2398 C  CD1 . ILE D 1 57 ? 18.115  13.593  30.249  1.00 44.60 ? 56   ILE D CD1 1 
ATOM   2399 N  N   . ASN D 1 58 ? 13.024  14.912  32.932  1.00 16.38 ? 57   ASN D N   1 
ATOM   2400 C  CA  . ASN D 1 58 ? 11.635  14.449  33.154  1.00 16.68 ? 57   ASN D CA  1 
ATOM   2401 C  C   . ASN D 1 58 ? 11.322  13.176  32.371  1.00 19.95 ? 57   ASN D C   1 
ATOM   2402 O  O   . ASN D 1 58 ? 11.485  13.113  31.156  1.00 22.41 ? 57   ASN D O   1 
ATOM   2403 C  CB  . ASN D 1 58 ? 10.684  15.585  32.720  1.00 23.11 ? 57   ASN D CB  1 
ATOM   2404 C  CG  . ASN D 1 58 ? 9.254   15.374  33.160  1.00 20.62 ? 57   ASN D CG  1 
ATOM   2405 O  OD1 . ASN D 1 58 ? 8.855   14.290  33.526  1.00 25.50 ? 57   ASN D OD1 1 
ATOM   2406 N  ND2 . ASN D 1 58 ? 8.478   16.445  33.137  1.00 40.70 ? 57   ASN D ND2 1 
ATOM   2407 N  N   . ALA D 1 59 ? 10.884  12.144  33.078  1.00 17.70 ? 58   ALA D N   1 
ATOM   2408 C  CA  . ALA D 1 59 ? 10.629  10.856  32.471  1.00 20.49 ? 58   ALA D CA  1 
ATOM   2409 C  C   . ALA D 1 59 ? 9.209   10.749  31.954  1.00 26.58 ? 58   ALA D C   1 
ATOM   2410 O  O   . ALA D 1 59 ? 8.900   9.867   31.153  1.00 27.78 ? 58   ALA D O   1 
ATOM   2411 C  CB  . ALA D 1 59 ? 10.898  9.776   33.468  1.00 21.25 ? 58   ALA D CB  1 
ATOM   2412 N  N   . GLN D 1 60 ? 8.353   11.680  32.362  1.00 29.34 ? 59   GLN D N   1 
ATOM   2413 C  CA  . GLN D 1 60 ? 6.917   11.407  32.390  1.00 32.89 ? 59   GLN D CA  1 
ATOM   2414 C  C   . GLN D 1 60 ? 6.236   11.382  30.996  1.00 30.47 ? 59   GLN D C   1 
ATOM   2415 O  O   . GLN D 1 60 ? 5.079   10.928  30.874  1.00 35.18 ? 59   GLN D O   1 
ATOM   2416 C  CB  A GLN D 1 60 ? 6.197   12.342  33.378  0.50 31.66 ? 59   GLN D CB  1 
ATOM   2417 C  CB  B GLN D 1 60 ? 6.241   12.376  33.363  0.50 32.25 ? 59   GLN D CB  1 
ATOM   2418 C  CG  A GLN D 1 60 ? 6.549   12.040  34.865  0.50 32.64 ? 59   GLN D CG  1 
ATOM   2419 C  CG  B GLN D 1 60 ? 6.839   12.278  34.795  0.50 32.62 ? 59   GLN D CG  1 
ATOM   2420 C  CD  A GLN D 1 60 ? 5.710   12.842  35.864  0.50 34.67 ? 59   GLN D CD  1 
ATOM   2421 C  CD  B GLN D 1 60 ? 6.916   13.619  35.502  0.50 40.85 ? 59   GLN D CD  1 
ATOM   2422 O  OE1 A GLN D 1 60 ? 6.008   14.005  36.141  0.50 33.31 ? 59   GLN D OE1 1 
ATOM   2423 O  OE1 B GLN D 1 60 ? 7.976   14.019  35.999  0.50 31.62 ? 59   GLN D OE1 1 
ATOM   2424 N  NE2 A GLN D 1 60 ? 4.673   12.215  36.423  0.50 16.32 ? 59   GLN D NE2 1 
ATOM   2425 N  NE2 B GLN D 1 60 ? 5.796   14.328  35.539  0.50 49.02 ? 59   GLN D NE2 1 
ATOM   2426 N  N   . GLY D 1 61 ? 6.968   11.788  29.953  1.00 25.98 ? 60   GLY D N   1 
ATOM   2427 C  CA  . GLY D 1 61 ? 6.569   11.552  28.571  1.00 27.91 ? 60   GLY D CA  1 
ATOM   2428 C  C   . GLY D 1 61 ? 7.496   10.634  27.765  1.00 27.74 ? 60   GLY D C   1 
ATOM   2429 O  O   . GLY D 1 61 ? 7.366   10.541  26.546  1.00 25.81 ? 60   GLY D O   1 
ATOM   2430 N  N   . MET D 1 62 ? 8.427   9.935   28.425  1.00 27.47 ? 61   MET D N   1 
ATOM   2431 C  CA  . MET D 1 62 ? 9.347   9.000   27.713  1.00 21.97 ? 61   MET D CA  1 
ATOM   2432 C  C   . MET D 1 62 ? 8.618   7.729   27.410  1.00 17.77 ? 61   MET D C   1 
ATOM   2433 O  O   . MET D 1 62 ? 7.782   7.295   28.215  1.00 18.27 ? 61   MET D O   1 
ATOM   2434 C  CB  . MET D 1 62 ? 10.571  8.601   28.552  1.00 18.54 ? 61   MET D CB  1 
ATOM   2435 C  CG  . MET D 1 62 ? 11.624  9.652   28.683  1.00 22.45 ? 61   MET D CG  1 
ATOM   2436 S  SD  . MET D 1 62 ? 12.867  9.079   29.859  1.00 22.37 ? 61   MET D SD  1 
ATOM   2437 C  CE  . MET D 1 62 ? 13.816  10.551  30.221  1.00 27.38 ? 61   MET D CE  1 
ATOM   2438 N  N   . THR D 1 63 ? 8.933   7.151   26.253  1.00 19.14 ? 62   THR D N   1 
ATOM   2439 C  CA  . THR D 1 63 ? 8.543   5.773   25.979  1.00 19.77 ? 62   THR D CA  1 
ATOM   2440 C  C   . THR D 1 63 ? 9.332   4.866   26.885  1.00 22.05 ? 62   THR D C   1 
ATOM   2441 O  O   . THR D 1 63 ? 10.377  5.231   27.432  1.00 17.55 ? 62   THR D O   1 
ATOM   2442 C  CB  . THR D 1 63 ? 8.805   5.332   24.519  1.00 21.42 ? 62   THR D CB  1 
ATOM   2443 O  OG1 . THR D 1 63 ? 10.212  5.323   24.240  1.00 20.43 ? 62   THR D OG1 1 
ATOM   2444 C  CG2 . THR D 1 63 ? 8.073   6.248   23.522  1.00 22.81 ? 62   THR D CG2 1 
ATOM   2445 N  N   . HIS D 1 64 ? 8.853   3.647   27.012  1.00 20.09 ? 63   HIS D N   1 
ATOM   2446 C  CA  . HIS D 1 64 ? 9.553   2.679   27.784  1.00 15.77 ? 63   HIS D CA  1 
ATOM   2447 C  C   . HIS D 1 64 ? 10.998  2.464   27.277  1.00 15.90 ? 63   HIS D C   1 
ATOM   2448 O  O   . HIS D 1 64 ? 11.971  2.453   28.033  1.00 12.66 ? 63   HIS D O   1 
ATOM   2449 C  CB  . HIS D 1 64 ? 8.784   1.383   27.665  1.00 18.98 ? 63   HIS D CB  1 
ATOM   2450 C  CG  . HIS D 1 64 ? 9.232   0.352   28.610  1.00 17.25 ? 63   HIS D CG  1 
ATOM   2451 N  ND1 . HIS D 1 64 ? 8.547   0.074   29.766  1.00 22.13 ? 63   HIS D ND1 1 
ATOM   2452 C  CD2 . HIS D 1 64 ? 10.275  -0.515  28.565  1.00 27.05 ? 63   HIS D CD2 1 
ATOM   2453 C  CE1 . HIS D 1 64 ? 9.145   -0.921  30.391  1.00 27.38 ? 63   HIS D CE1 1 
ATOM   2454 N  NE2 . HIS D 1 64 ? 10.191  -1.299  29.686  1.00 26.84 ? 63   HIS D NE2 1 
ATOM   2455 N  N   . LEU D 1 65 ? 11.116  2.278   25.965  1.00 14.60 ? 64   LEU D N   1 
ATOM   2456 C  CA  . LEU D 1 65 ? 12.438  2.103   25.354  1.00 13.79 ? 64   LEU D CA  1 
ATOM   2457 C  C   . LEU D 1 65 ? 13.374  3.286   25.568  1.00 13.41 ? 64   LEU D C   1 
ATOM   2458 O  O   . LEU D 1 65 ? 14.557  3.096   25.846  1.00 15.00 ? 64   LEU D O   1 
ATOM   2459 C  CB  . LEU D 1 65 ? 12.291  1.820   23.872  1.00 12.25 ? 64   LEU D CB  1 
ATOM   2460 C  CG  . LEU D 1 65 ? 13.572  1.492   23.129  1.00 16.33 ? 64   LEU D CG  1 
ATOM   2461 C  CD1 . LEU D 1 65 ? 14.311  0.311   23.758  1.00 15.73 ? 64   LEU D CD1 1 
ATOM   2462 C  CD2 . LEU D 1 65 ? 13.222  1.263   21.690  1.00 20.92 ? 64   LEU D CD2 1 
ATOM   2463 N  N   . GLU D 1 66 ? 12.820  4.495   25.495  1.00 15.61 ? 65   GLU D N   1 
ATOM   2464 C  CA  . GLU D 1 66 ? 13.620  5.687   25.680  1.00 16.30 ? 65   GLU D CA  1 
ATOM   2465 C  C   . GLU D 1 66 ? 14.196  5.685   27.102  1.00 13.89 ? 65   GLU D C   1 
ATOM   2466 O  O   . GLU D 1 66 ? 15.384  5.979   27.305  1.00 15.50 ? 65   GLU D O   1 
ATOM   2467 C  CB  . GLU D 1 66 ? 12.764  6.924   25.443  1.00 17.54 ? 65   GLU D CB  1 
ATOM   2468 C  CG  . GLU D 1 66 ? 12.614  7.287   23.963  1.00 19.86 ? 65   GLU D CG  1 
ATOM   2469 C  CD  . GLU D 1 66 ? 11.457  8.252   23.680  1.00 22.63 ? 65   GLU D CD  1 
ATOM   2470 O  OE1 . GLU D 1 66 ? 10.674  8.590   24.598  1.00 28.12 ? 65   GLU D OE1 1 
ATOM   2471 O  OE2 . GLU D 1 66 ? 11.326  8.678   22.512  1.00 30.73 ? 65   GLU D OE2 1 
ATOM   2472 N  N   . ALA D 1 67 ? 13.359  5.375   28.103  1.00 14.46 ? 66   ALA D N   1 
ATOM   2473 C  CA  . ALA D 1 67 ? 13.803  5.396   29.489  1.00 15.37 ? 66   ALA D CA  1 
ATOM   2474 C  C   . ALA D 1 67 ? 14.866  4.328   29.701  1.00 16.03 ? 66   ALA D C   1 
ATOM   2475 O  O   . ALA D 1 67 ? 15.887  4.538   30.356  1.00 17.03 ? 66   ALA D O   1 
ATOM   2476 C  CB  . ALA D 1 67 ? 12.614  5.130   30.417  1.00 17.12 ? 66   ALA D CB  1 
ATOM   2477 N  N   . GLN D 1 68 ? 14.609  3.149   29.148  1.00 13.75 ? 67   GLN D N   1 
ATOM   2478 C  CA  . GLN D 1 68 ? 15.535  2.056   29.265  1.00 18.45 ? 67   GLN D CA  1 
ATOM   2479 C  C   . GLN D 1 68 ? 16.907  2.442   28.706  1.00 15.45 ? 67   GLN D C   1 
ATOM   2480 O  O   . GLN D 1 68 ? 17.931  2.181   29.321  1.00 19.32 ? 67   GLN D O   1 
ATOM   2481 C  CB  . GLN D 1 68 ? 14.979  0.868   28.496  1.00 19.31 ? 67   GLN D CB  1 
ATOM   2482 C  CG  . GLN D 1 68 ? 15.413  -0.421  29.015  1.00 29.35 ? 67   GLN D CG  1 
ATOM   2483 C  CD  . GLN D 1 68 ? 14.756  -1.552  28.275  1.00 23.91 ? 67   GLN D CD  1 
ATOM   2484 O  OE1 . GLN D 1 68 ? 15.192  -1.880  27.171  1.00 30.03 ? 67   GLN D OE1 1 
ATOM   2485 N  NE2 . GLN D 1 68 ? 13.734  -2.161  28.883  1.00 18.77 ? 67   GLN D NE2 1 
ATOM   2486 N  N   . ASN D 1 69 ? 16.918  3.067   27.524  1.00 18.80 ? 68   ASN D N   1 
ATOM   2487 C  CA  . ASN D 1 69 ? 18.155  3.463   26.866  1.00 18.41 ? 68   ASN D CA  1 
ATOM   2488 C  C   . ASN D 1 69 ? 18.901  4.543   27.655  1.00 14.90 ? 68   ASN D C   1 
ATOM   2489 O  O   . ASN D 1 69 ? 20.108  4.490   27.760  1.00 17.79 ? 68   ASN D O   1 
ATOM   2490 C  CB  . ASN D 1 69 ? 17.871  3.928   25.449  1.00 17.38 ? 68   ASN D CB  1 
ATOM   2491 C  CG  . ASN D 1 69 ? 17.571  2.777   24.501  1.00 19.54 ? 68   ASN D CG  1 
ATOM   2492 O  OD1 . ASN D 1 69 ? 17.878  1.617   24.789  1.00 26.76 ? 68   ASN D OD1 1 
ATOM   2493 N  ND2 . ASN D 1 69 ? 16.999  3.098   23.366  1.00 23.76 ? 68   ASN D ND2 1 
ATOM   2494 N  N   . LYS D 1 70 ? 18.176  5.500   28.246  1.00 13.67 ? 69   LYS D N   1 
ATOM   2495 C  CA  . LYS D 1 70 ? 18.791  6.500   29.133  1.00 15.72 ? 69   LYS D CA  1 
ATOM   2496 C  C   . LYS D 1 70 ? 19.492  5.817   30.338  1.00 15.38 ? 69   LYS D C   1 
ATOM   2497 O  O   . LYS D 1 70 ? 20.605  6.134   30.677  1.00 18.20 ? 69   LYS D O   1 
ATOM   2498 C  CB  . LYS D 1 70 ? 17.774  7.523   29.588  1.00 17.25 ? 69   LYS D CB  1 
ATOM   2499 C  CG  . LYS D 1 70 ? 18.377  8.661   30.383  1.00 23.07 ? 69   LYS D CG  1 
ATOM   2500 C  CD  . LYS D 1 70 ? 17.529  9.934   30.355  1.00 40.69 ? 69   LYS D CD  1 
ATOM   2501 N  N   . ILE D 1 71 ? 18.817  4.865   30.970  1.00 15.60 ? 70   ILE D N   1 
ATOM   2502 C  CA  . ILE D 1 71 ? 19.337  4.170   32.142  1.00 14.76 ? 70   ILE D CA  1 
ATOM   2503 C  C   . ILE D 1 71 ? 20.519  3.310   31.784  1.00 21.42 ? 70   ILE D C   1 
ATOM   2504 O  O   . ILE D 1 71 ? 21.514  3.315   32.489  1.00 20.99 ? 70   ILE D O   1 
ATOM   2505 C  CB  . ILE D 1 71 ? 18.206  3.336   32.804  1.00 16.85 ? 70   ILE D CB  1 
ATOM   2506 C  CG1 . ILE D 1 71 ? 17.159  4.266   33.475  1.00 14.72 ? 70   ILE D CG1 1 
ATOM   2507 C  CG2 . ILE D 1 71 ? 18.776  2.360   33.812  1.00 16.97 ? 70   ILE D CG2 1 
ATOM   2508 C  CD1 . ILE D 1 71 ? 15.804  3.592   33.809  1.00 15.43 ? 70   ILE D CD1 1 
ATOM   2509 N  N   . LYS D 1 72 ? 20.404  2.591   30.667  1.00 18.18 ? 71   LYS D N   1 
ATOM   2510 C  CA  . LYS D 1 72 ? 21.516  1.796   30.166  1.00 21.17 ? 71   LYS D CA  1 
ATOM   2511 C  C   . LYS D 1 72 ? 22.744  2.602   29.832  1.00 19.49 ? 71   LYS D C   1 
ATOM   2512 O  O   . LYS D 1 72 ? 23.866  2.098   29.950  1.00 25.78 ? 71   LYS D O   1 
ATOM   2513 C  CB  . LYS D 1 72 ? 21.079  0.972   28.955  1.00 17.44 ? 71   LYS D CB  1 
ATOM   2514 C  CG  . LYS D 1 72 ? 20.262  -0.198  29.413  1.00 19.91 ? 71   LYS D CG  1 
ATOM   2515 C  CD  . LYS D 1 72 ? 19.821  -1.085  28.253  1.00 26.94 ? 71   LYS D CD  1 
ATOM   2516 C  CE  . LYS D 1 72 ? 19.103  -2.335  28.767  1.00 23.64 ? 71   LYS D CE  1 
ATOM   2517 N  NZ  . LYS D 1 72 ? 18.761  -3.271  27.647  1.00 25.35 ? 71   LYS D NZ  1 
ATOM   2518 N  N   . GLY D 1 73 ? 22.545  3.830   29.403  1.00 19.48 ? 72   GLY D N   1 
ATOM   2519 C  CA  . GLY D 1 73 ? 23.644  4.708   29.024  1.00 19.95 ? 72   GLY D CA  1 
ATOM   2520 C  C   . GLY D 1 73 ? 24.405  5.324   30.180  1.00 24.35 ? 72   GLY D C   1 
ATOM   2521 O  O   . GLY D 1 73 ? 25.492  5.866   29.995  1.00 25.13 ? 72   GLY D O   1 
ATOM   2522 N  N   . CYS D 1 74 ? 23.849  5.252   31.376  1.00 19.01 ? 73   CYS D N   1 
ATOM   2523 C  CA  . CYS D 1 74 ? 24.522  5.747   32.591  1.00 22.46 ? 73   CYS D CA  1 
ATOM   2524 C  C   . CYS D 1 74 ? 25.588  4.749   32.998  1.00 22.62 ? 73   CYS D C   1 
ATOM   2525 O  O   . CYS D 1 74 ? 25.380  3.548   32.914  1.00 33.38 ? 73   CYS D O   1 
ATOM   2526 C  CB  . CYS D 1 74 ? 23.524  5.903   33.736  1.00 20.36 ? 73   CYS D CB  1 
ATOM   2527 S  SG  . CYS D 1 74 ? 22.353  7.262   33.470  1.00 25.12 ? 73   CYS D SG  1 
ATOM   2528 N  N   . THR D 1 75 ? 26.728  5.234   33.466  1.00 20.70 ? 74   THR D N   1 
ATOM   2529 C  CA  . THR D 1 75 ? 27.846  4.347   33.708  1.00 24.33 ? 74   THR D CA  1 
ATOM   2530 C  C   . THR D 1 75 ? 28.299  4.396   35.189  1.00 19.64 ? 74   THR D C   1 
ATOM   2531 O  O   . THR D 1 75 ? 28.150  3.419   35.917  1.00 23.35 ? 74   THR D O   1 
ATOM   2532 C  CB  . THR D 1 75 ? 29.010  4.664   32.746  1.00 28.87 ? 74   THR D CB  1 
ATOM   2533 O  OG1 . THR D 1 75 ? 29.304  6.065   32.801  1.00 37.65 ? 74   THR D OG1 1 
ATOM   2534 C  CG2 . THR D 1 75 ? 28.622  4.296   31.318  1.00 28.11 ? 74   THR D CG2 1 
ATOM   2535 N  N   . GLY D 1 76 ? 28.807  5.539   35.633  1.00 20.85 ? 75   GLY D N   1 
ATOM   2536 C  CA  . GLY D 1 76 ? 29.339  5.631   36.990  1.00 24.86 ? 75   GLY D CA  1 
ATOM   2537 C  C   . GLY D 1 76 ? 28.299  5.819   38.077  1.00 21.44 ? 75   GLY D C   1 
ATOM   2538 O  O   . GLY D 1 76 ? 28.592  5.617   39.251  1.00 19.02 ? 75   GLY D O   1 
ATOM   2539 N  N   . SER D 1 77 ? 27.091  6.212   37.685  1.00 18.22 ? 76   SER D N   1 
ATOM   2540 C  CA  . SER D 1 77 ? 26.024  6.494   38.629  1.00 14.34 ? 76   SER D CA  1 
ATOM   2541 C  C   . SER D 1 77 ? 24.677  6.573   37.939  1.00 16.59 ? 76   SER D C   1 
ATOM   2542 O  O   . SER D 1 77 ? 24.613  6.749   36.746  1.00 15.14 ? 76   SER D O   1 
ATOM   2543 C  CB  . SER D 1 77 ? 26.281  7.822   39.354  1.00 18.03 ? 76   SER D CB  1 
ATOM   2544 O  OG  . SER D 1 77 ? 26.419  8.898   38.426  1.00 21.29 ? 76   SER D OG  1 
ATOM   2545 N  N   . LEU D 1 78 ? 23.596  6.516   38.719  1.00 18.96 ? 77   LEU D N   1 
ATOM   2546 C  CA  . LEU D 1 78 ? 22.249  6.701   38.177  1.00 15.56 ? 77   LEU D CA  1 
ATOM   2547 C  C   . LEU D 1 78 ? 21.424  7.503   39.170  1.00 14.61 ? 77   LEU D C   1 
ATOM   2548 O  O   . LEU D 1 78 ? 21.213  7.061   40.296  1.00 13.95 ? 77   LEU D O   1 
ATOM   2549 C  CB  . LEU D 1 78 ? 21.559  5.351   37.908  1.00 13.19 ? 77   LEU D CB  1 
ATOM   2550 C  CG  . LEU D 1 78 ? 20.069  5.358   37.457  1.00 16.05 ? 77   LEU D CG  1 
ATOM   2551 C  CD1 . LEU D 1 78 ? 19.876  6.052   36.100  1.00 18.38 ? 77   LEU D CD1 1 
ATOM   2552 C  CD2 . LEU D 1 78 ? 19.494  3.942   37.426  1.00 18.75 ? 77   LEU D CD2 1 
ATOM   2553 N  N   . ASN D 1 79 ? 21.013  8.695   38.757  1.00 14.99 ? 78   ASN D N   1 
ATOM   2554 C  CA  . ASN D 1 79 ? 20.145  9.546   39.562  1.00 13.25 ? 78   ASN D CA  1 
ATOM   2555 C  C   . ASN D 1 79 ? 18.726  9.401   39.038  1.00 12.94 ? 78   ASN D C   1 
ATOM   2556 O  O   . ASN D 1 79 ? 18.497  9.454   37.839  1.00 14.55 ? 78   ASN D O   1 
ATOM   2557 C  CB  . ASN D 1 79 ? 20.575  11.030  39.478  1.00 17.05 ? 78   ASN D CB  1 
ATOM   2558 C  CG  . ASN D 1 79 ? 21.950  11.259  40.066  1.00 18.72 ? 78   ASN D CG  1 
ATOM   2559 O  OD1 . ASN D 1 79 ? 22.298  10.633  41.059  1.00 21.15 ? 78   ASN D OD1 1 
ATOM   2560 N  ND2 . ASN D 1 79 ? 22.754  12.123  39.445  1.00 21.44 ? 78   ASN D ND2 1 
ATOM   2561 N  N   . MET D 1 80 ? 17.775  9.234   39.945  1.00 15.82 ? 79   MET D N   1 
ATOM   2562 C  CA  . MET D 1 80 ? 16.367  9.272   39.593  1.00 16.18 ? 79   MET D CA  1 
ATOM   2563 C  C   . MET D 1 80 ? 15.578  9.982   40.689  1.00 15.29 ? 79   MET D C   1 
ATOM   2564 O  O   . MET D 1 80 ? 16.006  10.042  41.834  1.00 15.42 ? 79   MET D O   1 
ATOM   2565 C  CB  . MET D 1 80 ? 15.818  7.855   39.405  1.00 15.50 ? 79   MET D CB  1 
ATOM   2566 C  CG  . MET D 1 80 ? 16.421  7.067   38.289  1.00 15.19 ? 79   MET D CG  1 
ATOM   2567 S  SD  . MET D 1 80 ? 15.553  5.477   38.061  1.00 18.47 ? 79   MET D SD  1 
ATOM   2568 C  CE  . MET D 1 80 ? 15.988  4.554   39.536  1.00 20.05 ? 79   MET D CE  1 
ATOM   2569 N  N   . THR D 1 81 ? 14.440  10.575  40.342  1.00 12.42 ? 80   THR D N   1 
ATOM   2570 C  CA  . THR D 1 81 ? 13.492  11.006  41.330  1.00 13.06 ? 80   THR D CA  1 
ATOM   2571 C  C   . THR D 1 81 ? 12.201  10.228  41.103  1.00 12.15 ? 80   THR D C   1 
ATOM   2572 O  O   . THR D 1 81 ? 11.839  9.911   39.963  1.00 15.02 ? 80   THR D O   1 
ATOM   2573 C  CB  A THR D 1 81 ? 13.223  12.518  41.297  0.50 15.36 ? 80   THR D CB  1 
ATOM   2574 C  CB  B THR D 1 81 ? 13.268  12.517  41.217  0.50 14.57 ? 80   THR D CB  1 
ATOM   2575 O  OG1 A THR D 1 81 ? 12.564  12.892  40.081  0.50 17.59 ? 80   THR D OG1 1 
ATOM   2576 O  OG1 B THR D 1 81 ? 14.501  13.203  41.501  0.50 17.24 ? 80   THR D OG1 1 
ATOM   2577 C  CG2 A THR D 1 81 ? 14.533  13.302  41.437  0.50 14.75 ? 80   THR D CG2 1 
ATOM   2578 C  CG2 B THR D 1 81 ? 12.205  13.008  42.186  0.50 12.64 ? 80   THR D CG2 1 
ATOM   2579 N  N   . LEU D 1 82 ? 11.550  9.894   42.220  1.00 12.84 ? 81   LEU D N   1 
ATOM   2580 C  CA  . LEU D 1 82 ? 10.394  9.028   42.184  1.00 16.76 ? 81   LEU D CA  1 
ATOM   2581 C  C   . LEU D 1 82 ? 9.271   9.538   43.083  1.00 15.05 ? 81   LEU D C   1 
ATOM   2582 O  O   . LEU D 1 82 ? 9.502   10.265  44.049  1.00 14.40 ? 81   LEU D O   1 
ATOM   2583 C  CB  . LEU D 1 82 ? 10.750  7.607   42.640  1.00 16.24 ? 81   LEU D CB  1 
ATOM   2584 C  CG  . LEU D 1 82 ? 11.795  6.840   41.760  1.00 13.74 ? 81   LEU D CG  1 
ATOM   2585 C  CD1 . LEU D 1 82 ? 13.195  6.979   42.323  1.00 15.96 ? 81   LEU D CD1 1 
ATOM   2586 C  CD2 . LEU D 1 82 ? 11.452  5.350   41.532  1.00 15.88 ? 81   LEU D CD2 1 
ATOM   2587 N  N   . GLN D 1 83 ? 8.072   9.058   42.773  1.00 14.84 ? 82   GLN D N   1 
ATOM   2588 C  CA  . GLN D 1 83 ? 6.846   9.286   43.531  1.00 15.25 ? 82   GLN D CA  1 
ATOM   2589 C  C   . GLN D 1 83 ? 6.365   7.959   44.161  1.00 16.42 ? 82   GLN D C   1 
ATOM   2590 O  O   . GLN D 1 83 ? 6.189   6.940   43.471  1.00 14.12 ? 82   GLN D O   1 
ATOM   2591 C  CB  . GLN D 1 83 ? 5.815   9.917   42.601  1.00 13.56 ? 82   GLN D CB  1 
ATOM   2592 C  CG  . GLN D 1 83 ? 4.452   10.210  43.193  1.00 16.54 ? 82   GLN D CG  1 
ATOM   2593 C  CD  . GLN D 1 83 ? 3.510   10.763  42.139  1.00 19.39 ? 82   GLN D CD  1 
ATOM   2594 O  OE1 . GLN D 1 83 ? 3.853   11.742  41.459  1.00 19.26 ? 82   GLN D OE1 1 
ATOM   2595 N  NE2 . GLN D 1 83 ? 2.335   10.135  41.974  1.00 22.07 ? 82   GLN D NE2 1 
ATOM   2596 N  N   . ARG D 1 84 ? 6.116   7.976   45.463  1.00 14.00 ? 83   ARG D N   1 
ATOM   2597 C  CA  . ARG D 1 84 ? 5.656   6.805   46.201  1.00 13.64 ? 83   ARG D CA  1 
ATOM   2598 C  C   . ARG D 1 84 ? 4.251   6.380   45.741  1.00 14.45 ? 83   ARG D C   1 
ATOM   2599 O  O   . ARG D 1 84 ? 3.302   7.187   45.772  1.00 16.98 ? 83   ARG D O   1 
ATOM   2600 C  CB  . ARG D 1 84 ? 5.639   7.043   47.712  1.00 14.95 ? 83   ARG D CB  1 
ATOM   2601 C  CG  . ARG D 1 84 ? 6.965   7.244   48.355  1.00 13.91 ? 83   ARG D CG  1 
ATOM   2602 C  CD  . ARG D 1 84 ? 7.786   5.978   48.296  1.00 18.02 ? 83   ARG D CD  1 
ATOM   2603 N  NE  . ARG D 1 84 ? 9.021   6.088   49.063  1.00 17.61 ? 83   ARG D NE  1 
ATOM   2604 C  CZ  . ARG D 1 84 ? 10.014  5.193   49.012  1.00 15.87 ? 83   ARG D CZ  1 
ATOM   2605 N  NH1 . ARG D 1 84 ? 9.935   4.127   48.222  1.00 14.15 ? 83   ARG D NH1 1 
ATOM   2606 N  NH2 . ARG D 1 84 ? 11.085  5.383   49.754  1.00 15.37 ? 83   ARG D NH2 1 
ATOM   2607 N  N   . GLU D 1 85 ? 4.135   5.132   45.290  1.00 15.86 ? 84   GLU D N   1 
ATOM   2608 C  CA  . GLU D 1 85 ? 2.833   4.534   44.945  1.00 16.81 ? 84   GLU D CA  1 
ATOM   2609 C  C   . GLU D 1 85 ? 2.735   3.106   45.418  1.00 16.03 ? 84   GLU D C   1 
ATOM   2610 O  O   . GLU D 1 85 ? 2.073   2.225   44.807  1.00 21.75 ? 84   GLU D O   1 
ATOM   2611 C  CB  . GLU D 1 85 ? 2.577   4.643   43.451  1.00 15.89 ? 84   GLU D CB  1 
ATOM   2612 C  CG  . GLU D 1 85 ? 2.499   6.076   42.917  1.00 18.93 ? 84   GLU D CG  1 
ATOM   2613 C  CD  . GLU D 1 85 ? 1.294   6.875   43.463  1.00 31.87 ? 84   GLU D CD  1 
ATOM   2614 O  OE1 . GLU D 1 85 ? 0.317   6.247   43.944  1.00 28.27 ? 84   GLU D OE1 1 
ATOM   2615 O  OE2 . GLU D 1 85 ? 1.327   8.134   43.440  1.00 25.79 ? 84   GLU D OE2 1 
ATOM   2616 N  N   . SER D 1 86 ? 3.380   2.889   46.558  1.00 14.88 ? 85   SER D N   1 
ATOM   2617 C  CA  . SER D 1 86 ? 3.523   1.577   47.184  1.00 15.30 ? 85   SER D CA  1 
ATOM   2618 C  C   . SER D 1 86 ? 2.792   1.464   48.532  1.00 17.27 ? 85   SER D C   1 
ATOM   2619 O  O   . SER D 1 86 ? 2.783   0.389   49.121  1.00 16.46 ? 85   SER D O   1 
ATOM   2620 C  CB  . SER D 1 86 ? 5.016   1.237   47.377  1.00 18.70 ? 85   SER D CB  1 
ATOM   2621 O  OG  . SER D 1 86 ? 5.753   2.413   47.778  1.00 16.72 ? 85   SER D OG  1 
ATOM   2622 N  N   . ASP D 1 87 ? 2.190   2.543   49.031  1.00 14.16 ? 86   ASP D N   1 
ATOM   2623 C  CA  . ASP D 1 87 ? 1.399   2.478   50.238  1.00 17.48 ? 86   ASP D CA  1 
ATOM   2624 C  C   . ASP D 1 87 ? 0.002   2.045   49.803  1.00 21.27 ? 86   ASP D C   1 
ATOM   2625 O  O   . ASP D 1 87 ? -0.619  2.648   48.924  1.00 22.32 ? 86   ASP D O   1 
ATOM   2626 C  CB  . ASP D 1 87 ? 1.403   3.809   50.936  1.00 18.34 ? 86   ASP D CB  1 
ATOM   2627 C  CG  . ASP D 1 87 ? 2.744   4.132   51.525  1.00 20.70 ? 86   ASP D CG  1 
ATOM   2628 O  OD1 . ASP D 1 87 ? 3.101   3.513   52.538  1.00 22.63 ? 86   ASP D OD1 1 
ATOM   2629 O  OD2 . ASP D 1 87 ? 3.434   5.003   50.962  1.00 25.33 ? 86   ASP D OD2 1 
ATOM   2630 N  N   . LEU D 1 88 ? -0.473  0.959   50.395  1.00 14.44 ? 87   LEU D N   1 
ATOM   2631 C  CA  . LEU D 1 88 ? -1.760  0.364   50.029  1.00 14.55 ? 87   LEU D CA  1 
ATOM   2632 C  C   . LEU D 1 88 ? -2.882  0.739   50.993  1.00 14.28 ? 87   LEU D C   1 
ATOM   2633 O  O   . LEU D 1 88 ? -2.649  1.150   52.163  1.00 17.14 ? 87   LEU D O   1 
ATOM   2634 C  CB  . LEU D 1 88 ? -1.619  -1.158  49.900  1.00 14.33 ? 87   LEU D CB  1 
ATOM   2635 C  CG  . LEU D 1 88 ? -0.421  -1.609  49.049  1.00 16.34 ? 87   LEU D CG  1 
ATOM   2636 C  CD1 . LEU D 1 88 ? -0.265  -3.108  49.053  1.00 17.86 ? 87   LEU D CD1 1 
ATOM   2637 C  CD2 . LEU D 1 88 ? -0.532  -1.075  47.607  1.00 20.51 ? 87   LEU D CD2 1 
ATOM   2638 O  OXT . LEU D 1 88 ? -4.048  0.666   50.557  1.00 14.11 ? 87   LEU D OXT 1 
ATOM   2639 N  N   . MET E 1 2  ? -35.067 -13.533 2.133   1.00 57.22 ? 1    MET E N   1 
ATOM   2640 C  CA  . MET E 1 2  ? -34.064 -13.794 3.202   1.00 55.88 ? 1    MET E CA  1 
ATOM   2641 C  C   . MET E 1 2  ? -32.959 -14.704 2.690   1.00 55.06 ? 1    MET E C   1 
ATOM   2642 O  O   . MET E 1 2  ? -33.217 -15.635 1.922   1.00 56.93 ? 1    MET E O   1 
ATOM   2643 C  CB  . MET E 1 2  ? -34.727 -14.451 4.420   1.00 52.48 ? 1    MET E CB  1 
ATOM   2644 N  N   . SER E 1 3  ? -31.731 -14.417 3.124   1.00 52.63 ? 2    SER E N   1 
ATOM   2645 C  CA  . SER E 1 3  ? -30.615 -15.363 3.050   1.00 46.09 ? 2    SER E CA  1 
ATOM   2646 C  C   . SER E 1 3  ? -30.619 -16.233 4.319   1.00 38.07 ? 2    SER E C   1 
ATOM   2647 O  O   . SER E 1 3  ? -29.559 -16.592 4.875   1.00 32.97 ? 2    SER E O   1 
ATOM   2648 C  CB  . SER E 1 3  ? -29.297 -14.607 2.934   1.00 48.25 ? 2    SER E CB  1 
ATOM   2649 O  OG  . SER E 1 3  ? -29.127 -13.732 4.040   1.00 62.01 ? 2    SER E OG  1 
ATOM   2650 N  N   . ASN E 1 4  ? -31.821 -16.539 4.794   1.00 27.93 ? 3    ASN E N   1 
ATOM   2651 C  CA  . ASN E 1 4  ? -32.006 -17.509 5.868   1.00 24.64 ? 3    ASN E CA  1 
ATOM   2652 C  C   . ASN E 1 4  ? -32.443 -18.834 5.270   1.00 22.91 ? 3    ASN E C   1 
ATOM   2653 O  O   . ASN E 1 4  ? -33.037 -18.865 4.195   1.00 25.60 ? 3    ASN E O   1 
ATOM   2654 C  CB  . ASN E 1 4  ? -33.068 -17.027 6.863   1.00 26.05 ? 3    ASN E CB  1 
ATOM   2655 C  CG  . ASN E 1 4  ? -32.658 -15.774 7.609   1.00 30.15 ? 3    ASN E CG  1 
ATOM   2656 O  OD1 . ASN E 1 4  ? -31.572 -15.224 7.412   1.00 34.95 ? 3    ASN E OD1 1 
ATOM   2657 N  ND2 . ASN E 1 4  ? -33.535 -15.318 8.478   1.00 26.36 ? 3    ASN E ND2 1 
ATOM   2658 N  N   . TYR E 1 5  ? -32.180 -19.916 5.986   1.00 19.53 ? 4    TYR E N   1 
ATOM   2659 C  CA  . TYR E 1 5  ? -32.555 -21.257 5.565   1.00 21.31 ? 4    TYR E CA  1 
ATOM   2660 C  C   . TYR E 1 5  ? -32.814 -22.130 6.793   1.00 20.67 ? 4    TYR E C   1 
ATOM   2661 O  O   . TYR E 1 5  ? -32.371 -21.814 7.918   1.00 20.18 ? 4    TYR E O   1 
ATOM   2662 C  CB  . TYR E 1 5  ? -31.473 -21.888 4.695   1.00 20.86 ? 4    TYR E CB  1 
ATOM   2663 C  CG  . TYR E 1 5  ? -30.170 -22.168 5.415   1.00 19.94 ? 4    TYR E CG  1 
ATOM   2664 C  CD1 . TYR E 1 5  ? -29.248 -21.149 5.676   1.00 21.53 ? 4    TYR E CD1 1 
ATOM   2665 C  CD2 . TYR E 1 5  ? -29.848 -23.461 5.820   1.00 20.95 ? 4    TYR E CD2 1 
ATOM   2666 C  CE1 . TYR E 1 5  ? -28.036 -21.419 6.318   1.00 23.08 ? 4    TYR E CE1 1 
ATOM   2667 C  CE2 . TYR E 1 5  ? -28.672 -23.730 6.461   1.00 20.15 ? 4    TYR E CE2 1 
ATOM   2668 C  CZ  . TYR E 1 5  ? -27.763 -22.712 6.723   1.00 24.08 ? 4    TYR E CZ  1 
ATOM   2669 O  OH  . TYR E 1 5  ? -26.586 -23.042 7.364   1.00 21.13 ? 4    TYR E OH  1 
ATOM   2670 N  N   . SER E 1 6  ? -33.540 -23.220 6.561   1.00 21.00 ? 5    SER E N   1 
ATOM   2671 C  CA  . SER E 1 6  ? -33.876 -24.170 7.617   1.00 22.63 ? 5    SER E CA  1 
ATOM   2672 C  C   . SER E 1 6  ? -33.315 -25.521 7.298   1.00 23.06 ? 5    SER E C   1 
ATOM   2673 O  O   . SER E 1 6  ? -33.181 -25.885 6.145   1.00 23.45 ? 5    SER E O   1 
ATOM   2674 C  CB  . SER E 1 6  ? -35.387 -24.289 7.771   1.00 29.45 ? 5    SER E CB  1 
ATOM   2675 O  OG  . SER E 1 6  ? -35.931 -23.058 8.187   1.00 36.39 ? 5    SER E OG  1 
ATOM   2676 N  N   . VAL E 1 7  ? -32.989 -26.272 8.347   1.00 21.77 ? 6    VAL E N   1 
ATOM   2677 C  CA  . VAL E 1 7  ? -32.568 -27.659 8.202   1.00 21.76 ? 6    VAL E CA  1 
ATOM   2678 C  C   . VAL E 1 7  ? -33.338 -28.522 9.179   1.00 18.87 ? 6    VAL E C   1 
ATOM   2679 O  O   . VAL E 1 7  ? -33.767 -28.056 10.250  1.00 19.60 ? 6    VAL E O   1 
ATOM   2680 C  CB  . VAL E 1 7  ? -31.046 -27.859 8.453   1.00 23.26 ? 6    VAL E CB  1 
ATOM   2681 C  CG1 . VAL E 1 7  ? -30.212 -27.076 7.432   1.00 18.22 ? 6    VAL E CG1 1 
ATOM   2682 C  CG2 . VAL E 1 7  ? -30.689 -27.520 9.902   1.00 23.69 ? 6    VAL E CG2 1 
ATOM   2683 N  N   . SER E 1 8  ? -33.508 -29.785 8.805   1.00 21.64 ? 7    SER E N   1 
ATOM   2684 C  CA  . SER E 1 8  ? -34.107 -30.776 9.660   1.00 20.87 ? 7    SER E CA  1 
ATOM   2685 C  C   . SER E 1 8  ? -33.259 -32.022 9.495   1.00 21.64 ? 7    SER E C   1 
ATOM   2686 O  O   . SER E 1 8  ? -33.346 -32.735 8.482   1.00 21.29 ? 7    SER E O   1 
ATOM   2687 C  CB  . SER E 1 8  ? -35.563 -31.019 9.273   1.00 24.10 ? 7    SER E CB  1 
ATOM   2688 O  OG  . SER E 1 8  ? -36.193 -31.830 10.238  1.00 21.78 ? 7    SER E OG  1 
ATOM   2689 N  N   . LEU E 1 9  ? -32.410 -32.251 10.485  1.00 19.83 ? 8    LEU E N   1 
ATOM   2690 C  CA  . LEU E 1 9  ? -31.432 -33.313 10.446  1.00 22.23 ? 8    LEU E CA  1 
ATOM   2691 C  C   . LEU E 1 9  ? -32.044 -34.503 11.144  1.00 18.28 ? 8    LEU E C   1 
ATOM   2692 O  O   . LEU E 1 9  ? -32.442 -34.391 12.312  1.00 22.32 ? 8    LEU E O   1 
ATOM   2693 C  CB  . LEU E 1 9  ? -30.149 -32.886 11.162  1.00 17.75 ? 8    LEU E CB  1 
ATOM   2694 C  CG  . LEU E 1 9  ? -29.549 -31.529 10.754  1.00 22.95 ? 8    LEU E CG  1 
ATOM   2695 C  CD1 . LEU E 1 9  ? -28.230 -31.273 11.472  1.00 23.84 ? 8    LEU E CD1 1 
ATOM   2696 C  CD2 . LEU E 1 9  ? -29.365 -31.389 9.236   1.00 19.14 ? 8    LEU E CD2 1 
ATOM   2697 N  N   . VAL E 1 10 ? -32.143 -35.623 10.447  1.00 20.24 ? 9    VAL E N   1 
ATOM   2698 C  CA  . VAL E 1 10 ? -32.672 -36.846 11.063  1.00 18.49 ? 9    VAL E CA  1 
ATOM   2699 C  C   . VAL E 1 10 ? -31.556 -37.556 11.841  1.00 20.82 ? 9    VAL E C   1 
ATOM   2700 O  O   . VAL E 1 10 ? -30.472 -37.814 11.312  1.00 23.71 ? 9    VAL E O   1 
ATOM   2701 C  CB  . VAL E 1 10 ? -33.303 -37.815 10.052  1.00 18.39 ? 9    VAL E CB  1 
ATOM   2702 C  CG1 . VAL E 1 10 ? -33.846 -39.024 10.788  1.00 19.34 ? 9    VAL E CG1 1 
ATOM   2703 C  CG2 . VAL E 1 10 ? -34.444 -37.142 9.312   1.00 20.80 ? 9    VAL E CG2 1 
ATOM   2704 N  N   . GLY E 1 11 ? -31.842 -37.870 13.103  1.00 22.06 ? 10   GLY E N   1 
ATOM   2705 C  CA  . GLY E 1 11 ? -30.867 -38.480 13.979  1.00 20.24 ? 10   GLY E CA  1 
ATOM   2706 C  C   . GLY E 1 11 ? -30.629 -39.940 13.632  1.00 23.76 ? 10   GLY E C   1 
ATOM   2707 O  O   . GLY E 1 11 ? -31.246 -40.480 12.699  1.00 24.34 ? 10   GLY E O   1 
ATOM   2708 N  N   . PRO E 1 12 ? -29.775 -40.620 14.418  1.00 22.81 ? 11   PRO E N   1 
ATOM   2709 C  CA  . PRO E 1 12 ? -29.170 -40.176 15.675  1.00 19.41 ? 11   PRO E CA  1 
ATOM   2710 C  C   . PRO E 1 12 ? -28.045 -39.172 15.460  1.00 21.05 ? 11   PRO E C   1 
ATOM   2711 O  O   . PRO E 1 12 ? -27.421 -39.138 14.406  1.00 22.10 ? 11   PRO E O   1 
ATOM   2712 C  CB  . PRO E 1 12 ? -28.613 -41.477 16.265  1.00 25.92 ? 11   PRO E CB  1 
ATOM   2713 C  CG  . PRO E 1 12 ? -28.309 -42.310 15.102  1.00 29.06 ? 11   PRO E CG  1 
ATOM   2714 C  CD  . PRO E 1 12 ? -29.363 -41.988 14.064  1.00 21.65 ? 11   PRO E CD  1 
ATOM   2715 N  N   . ALA E 1 13 ? -27.829 -38.340 16.456  1.00 21.89 ? 12   ALA E N   1 
ATOM   2716 C  CA  . ALA E 1 13 ? -26.604 -37.581 16.557  1.00 24.33 ? 12   ALA E CA  1 
ATOM   2717 C  C   . ALA E 1 13 ? -25.435 -38.579 16.666  1.00 25.61 ? 12   ALA E C   1 
ATOM   2718 O  O   . ALA E 1 13 ? -25.649 -39.772 16.852  1.00 22.45 ? 12   ALA E O   1 
ATOM   2719 C  CB  . ALA E 1 13 ? -26.662 -36.659 17.762  1.00 21.02 ? 12   ALA E CB  1 
ATOM   2720 N  N   . PRO E 1 14 ? -24.192 -38.114 16.510  1.00 25.55 ? 13   PRO E N   1 
ATOM   2721 C  CA  . PRO E 1 14 ? -23.719 -36.745 16.326  1.00 20.53 ? 13   PRO E CA  1 
ATOM   2722 C  C   . PRO E 1 14 ? -24.233 -36.042 15.078  1.00 22.99 ? 13   PRO E C   1 
ATOM   2723 O  O   . PRO E 1 14 ? -24.327 -36.612 14.005  1.00 22.19 ? 13   PRO E O   1 
ATOM   2724 C  CB  . PRO E 1 14 ? -22.201 -36.907 16.218  1.00 20.85 ? 13   PRO E CB  1 
ATOM   2725 C  CG  . PRO E 1 14 ? -21.890 -38.223 16.696  1.00 21.05 ? 13   PRO E CG  1 
ATOM   2726 C  CD  . PRO E 1 14 ? -23.077 -39.077 16.488  1.00 24.62 ? 13   PRO E CD  1 
ATOM   2727 N  N   . TRP E 1 15 ? -24.547 -34.779 15.232  1.00 19.17 ? 14   TRP E N   1 
ATOM   2728 C  CA  . TRP E 1 15 ? -24.996 -33.968 14.092  1.00 20.50 ? 14   TRP E CA  1 
ATOM   2729 C  C   . TRP E 1 15 ? -23.839 -33.435 13.216  1.00 20.68 ? 14   TRP E C   1 
ATOM   2730 O  O   . TRP E 1 15 ? -24.046 -33.109 12.047  1.00 19.56 ? 14   TRP E O   1 
ATOM   2731 C  CB  . TRP E 1 15 ? -25.791 -32.788 14.589  1.00 18.42 ? 14   TRP E CB  1 
ATOM   2732 C  CG  . TRP E 1 15 ? -26.873 -33.149 15.527  1.00 18.95 ? 14   TRP E CG  1 
ATOM   2733 C  CD1 . TRP E 1 15 ? -26.973 -32.817 16.851  1.00 19.51 ? 14   TRP E CD1 1 
ATOM   2734 C  CD2 . TRP E 1 15 ? -28.026 -33.908 15.211  1.00 22.17 ? 14   TRP E CD2 1 
ATOM   2735 N  NE1 . TRP E 1 15 ? -28.107 -33.359 17.380  1.00 22.95 ? 14   TRP E NE1 1 
ATOM   2736 C  CE2 . TRP E 1 15 ? -28.783 -34.022 16.390  1.00 24.50 ? 14   TRP E CE2 1 
ATOM   2737 C  CE3 . TRP E 1 15 ? -28.497 -34.502 14.034  1.00 26.57 ? 14   TRP E CE3 1 
ATOM   2738 C  CZ2 . TRP E 1 15 ? -29.995 -34.710 16.430  1.00 21.02 ? 14   TRP E CZ2 1 
ATOM   2739 C  CZ3 . TRP E 1 15 ? -29.689 -35.173 14.067  1.00 25.70 ? 14   TRP E CZ3 1 
ATOM   2740 C  CH2 . TRP E 1 15 ? -30.437 -35.254 15.251  1.00 17.78 ? 14   TRP E CH2 1 
ATOM   2741 N  N   . GLY E 1 16 ? -22.637 -33.315 13.780  1.00 17.34 ? 15   GLY E N   1 
ATOM   2742 C  CA  . GLY E 1 16 ? -21.434 -33.014 13.029  1.00 17.20 ? 15   GLY E CA  1 
ATOM   2743 C  C   . GLY E 1 16 ? -21.066 -31.549 13.017  1.00 16.98 ? 15   GLY E C   1 
ATOM   2744 O  O   . GLY E 1 16 ? -20.610 -31.018 11.994  1.00 17.98 ? 15   GLY E O   1 
ATOM   2745 N  N   . PHE E 1 17 ? -21.264 -30.873 14.138  1.00 18.17 ? 16   PHE E N   1 
ATOM   2746 C  CA  . PHE E 1 17 ? -20.837 -29.487 14.202  1.00 17.28 ? 16   PHE E CA  1 
ATOM   2747 C  C   . PHE E 1 17 ? -20.513 -29.028 15.611  1.00 17.21 ? 16   PHE E C   1 
ATOM   2748 O  O   . PHE E 1 17 ? -20.824 -29.711 16.585  1.00 18.91 ? 16   PHE E O   1 
ATOM   2749 C  CB  . PHE E 1 17 ? -21.856 -28.547 13.554  1.00 15.02 ? 16   PHE E CB  1 
ATOM   2750 C  CG  . PHE E 1 17 ? -23.182 -28.414 14.315  1.00 13.47 ? 16   PHE E CG  1 
ATOM   2751 C  CD1 . PHE E 1 17 ? -23.396 -27.376 15.236  1.00 16.23 ? 16   PHE E CD1 1 
ATOM   2752 C  CD2 . PHE E 1 17 ? -24.201 -29.339 14.141  1.00 18.40 ? 16   PHE E CD2 1 
ATOM   2753 C  CE1 . PHE E 1 17 ? -24.583 -27.272 15.944  1.00 17.00 ? 16   PHE E CE1 1 
ATOM   2754 C  CE2 . PHE E 1 17 ? -25.412 -29.233 14.842  1.00 17.02 ? 16   PHE E CE2 1 
ATOM   2755 C  CZ  . PHE E 1 17 ? -25.597 -28.179 15.733  1.00 15.51 ? 16   PHE E CZ  1 
ATOM   2756 N  N   . ARG E 1 18 ? -19.846 -27.872 15.691  1.00 18.58 ? 17   ARG E N   1 
ATOM   2757 C  CA  . ARG E 1 18 ? -19.699 -27.125 16.934  1.00 16.55 ? 17   ARG E CA  1 
ATOM   2758 C  C   . ARG E 1 18 ? -20.195 -25.707 16.791  1.00 17.53 ? 17   ARG E C   1 
ATOM   2759 O  O   . ARG E 1 18 ? -20.400 -25.206 15.691  1.00 15.79 ? 17   ARG E O   1 
ATOM   2760 C  CB  . ARG E 1 18 ? -18.231 -27.073 17.375  1.00 16.23 ? 17   ARG E CB  1 
ATOM   2761 C  CG  . ARG E 1 18 ? -17.622 -28.415 17.630  1.00 19.31 ? 17   ARG E CG  1 
ATOM   2762 C  CD  . ARG E 1 18 ? -16.463 -28.335 18.576  1.00 21.94 ? 17   ARG E CD  1 
ATOM   2763 N  NE  . ARG E 1 18 ? -15.318 -27.719 17.951  1.00 21.33 ? 17   ARG E NE  1 
ATOM   2764 C  CZ  . ARG E 1 18 ? -14.361 -28.339 17.291  1.00 22.92 ? 17   ARG E CZ  1 
ATOM   2765 N  NH1 . ARG E 1 18 ? -14.384 -29.644 17.125  1.00 23.76 ? 17   ARG E NH1 1 
ATOM   2766 N  NH2 . ARG E 1 18 ? -13.374 -27.618 16.751  1.00 29.05 ? 17   ARG E NH2 1 
ATOM   2767 N  N   . LEU E 1 19 ? -20.396 -25.073 17.942  1.00 18.02 ? 18   LEU E N   1 
ATOM   2768 C  CA  . LEU E 1 19 ? -20.796 -23.680 18.036  1.00 18.93 ? 18   LEU E CA  1 
ATOM   2769 C  C   . LEU E 1 19 ? -19.786 -22.810 18.779  1.00 16.57 ? 18   LEU E C   1 
ATOM   2770 O  O   . LEU E 1 19 ? -19.064 -23.291 19.686  1.00 16.16 ? 18   LEU E O   1 
ATOM   2771 C  CB  . LEU E 1 19 ? -22.108 -23.627 18.778  1.00 17.95 ? 18   LEU E CB  1 
ATOM   2772 C  CG  . LEU E 1 19 ? -23.272 -24.332 18.102  1.00 20.09 ? 18   LEU E CG  1 
ATOM   2773 C  CD1 . LEU E 1 19 ? -24.486 -24.422 19.009  1.00 23.67 ? 18   LEU E CD1 1 
ATOM   2774 C  CD2 . LEU E 1 19 ? -23.625 -23.560 16.796  1.00 21.61 ? 18   LEU E CD2 1 
ATOM   2775 N  N   . GLN E 1 20 ? -19.784 -21.529 18.433  1.00 17.98 ? 19   GLN E N   1 
ATOM   2776 C  CA  . GLN E 1 20 ? -19.163 -20.483 19.245  1.00 19.58 ? 19   GLN E CA  1 
ATOM   2777 C  C   . GLN E 1 20 ? -20.161 -19.356 19.361  1.00 15.64 ? 19   GLN E C   1 
ATOM   2778 O  O   . GLN E 1 20 ? -21.139 -19.279 18.607  1.00 18.56 ? 19   GLN E O   1 
ATOM   2779 C  CB  . GLN E 1 20 ? -17.835 -19.991 18.653  1.00 17.74 ? 19   GLN E CB  1 
ATOM   2780 C  CG  . GLN E 1 20 ? -16.713 -20.926 18.853  1.00 17.53 ? 19   GLN E CG  1 
ATOM   2781 C  CD  . GLN E 1 20 ? -15.409 -20.439 18.250  1.00 24.38 ? 19   GLN E CD  1 
ATOM   2782 O  OE1 . GLN E 1 20 ? -15.124 -19.230 18.228  1.00 24.74 ? 19   GLN E OE1 1 
ATOM   2783 N  NE2 . GLN E 1 20 ? -14.595 -21.378 17.792  1.00 28.65 ? 19   GLN E NE2 1 
ATOM   2784 N  N   . GLY E 1 21 ? -19.937 -18.519 20.362  1.00 15.14 ? 20   GLY E N   1 
ATOM   2785 C  CA  . GLY E 1 21 ? -20.727 -17.332 20.561  1.00 16.99 ? 20   GLY E CA  1 
ATOM   2786 C  C   . GLY E 1 21 ? -22.020 -17.617 21.292  1.00 15.46 ? 20   GLY E C   1 
ATOM   2787 O  O   . GLY E 1 21 ? -22.204 -18.673 21.870  1.00 19.40 ? 20   GLY E O   1 
ATOM   2788 N  N   . GLY E 1 22 ? -22.896 -16.617 21.294  1.00 19.33 ? 21   GLY E N   1 
ATOM   2789 C  CA  . GLY E 1 22 ? -24.172 -16.670 21.991  1.00 17.12 ? 21   GLY E CA  1 
ATOM   2790 C  C   . GLY E 1 22 ? -24.549 -15.354 22.629  1.00 19.07 ? 21   GLY E C   1 
ATOM   2791 O  O   . GLY E 1 22 ? -23.808 -14.372 22.524  1.00 17.84 ? 21   GLY E O   1 
ATOM   2792 N  N   . LYS E 1 23 ? -25.683 -15.333 23.316  1.00 21.06 ? 22   LYS E N   1 
ATOM   2793 C  CA  . LYS E 1 23 ? -26.176 -14.074 23.905  1.00 27.65 ? 22   LYS E CA  1 
ATOM   2794 C  C   . LYS E 1 23 ? -25.174 -13.480 24.922  1.00 29.44 ? 22   LYS E C   1 
ATOM   2795 O  O   . LYS E 1 23 ? -25.095 -12.266 25.098  1.00 31.27 ? 22   LYS E O   1 
ATOM   2796 C  CB  . LYS E 1 23 ? -27.589 -14.248 24.490  1.00 26.48 ? 22   LYS E CB  1 
ATOM   2797 C  CG  . LYS E 1 23 ? -27.699 -14.746 25.918  1.00 32.77 ? 22   LYS E CG  1 
ATOM   2798 C  CD  . LYS E 1 23 ? -29.031 -14.295 26.552  1.00 39.25 ? 22   LYS E CD  1 
ATOM   2799 C  CE  . LYS E 1 23 ? -29.253 -14.836 27.979  1.00 44.18 ? 22   LYS E CE  1 
ATOM   2800 N  NZ  . LYS E 1 23 ? -30.231 -15.994 28.060  1.00 31.05 ? 22   LYS E NZ  1 
ATOM   2801 N  N   . ASP E 1 24 ? -24.399 -14.358 25.552  1.00 28.32 ? 23   ASP E N   1 
ATOM   2802 C  CA  . ASP E 1 24 ? -23.373 -13.970 26.507  1.00 32.57 ? 23   ASP E CA  1 
ATOM   2803 C  C   . ASP E 1 24 ? -22.053 -13.436 25.897  1.00 33.96 ? 23   ASP E C   1 
ATOM   2804 O  O   . ASP E 1 24 ? -21.163 -13.021 26.635  1.00 38.18 ? 23   ASP E O   1 
ATOM   2805 C  CB  . ASP E 1 24 ? -23.114 -15.110 27.535  1.00 34.58 ? 23   ASP E CB  1 
ATOM   2806 C  CG  . ASP E 1 24 ? -22.985 -16.540 26.904  1.00 40.26 ? 23   ASP E CG  1 
ATOM   2807 O  OD1 . ASP E 1 24 ? -23.620 -16.860 25.847  1.00 17.19 ? 23   ASP E OD1 1 
ATOM   2808 O  OD2 . ASP E 1 24 ? -22.260 -17.366 27.558  1.00 31.87 ? 23   ASP E OD2 1 
ATOM   2809 N  N   . PHE E 1 25 ? -21.947 -13.394 24.569  1.00 25.36 ? 24   PHE E N   1 
ATOM   2810 C  CA  . PHE E 1 25 ? -20.719 -13.002 23.886  1.00 20.92 ? 24   PHE E CA  1 
ATOM   2811 C  C   . PHE E 1 25 ? -20.954 -11.971 22.780  1.00 22.64 ? 24   PHE E C   1 
ATOM   2812 O  O   . PHE E 1 25 ? -22.084 -11.786 22.331  1.00 23.84 ? 24   PHE E O   1 
ATOM   2813 C  CB  . PHE E 1 25 ? -20.083 -14.253 23.293  1.00 26.58 ? 24   PHE E CB  1 
ATOM   2814 C  CG  . PHE E 1 25 ? -19.826 -15.308 24.321  1.00 33.20 ? 24   PHE E CG  1 
ATOM   2815 C  CD1 . PHE E 1 25 ? -18.971 -15.054 25.384  1.00 49.99 ? 24   PHE E CD1 1 
ATOM   2816 C  CD2 . PHE E 1 25 ? -20.470 -16.519 24.271  1.00 25.54 ? 24   PHE E CD2 1 
ATOM   2817 C  CE1 . PHE E 1 25 ? -18.750 -16.011 26.360  1.00 51.83 ? 24   PHE E CE1 1 
ATOM   2818 C  CE2 . PHE E 1 25 ? -20.243 -17.497 25.236  1.00 42.39 ? 24   PHE E CE2 1 
ATOM   2819 C  CZ  . PHE E 1 25 ? -19.387 -17.239 26.284  1.00 42.91 ? 24   PHE E CZ  1 
ATOM   2820 N  N   . ASN E 1 26 ? -19.864 -11.347 22.329  1.00 22.41 ? 25   ASN E N   1 
ATOM   2821 C  CA  . ASN E 1 26 ? -19.904 -10.336 21.265  1.00 29.81 ? 25   ASN E CA  1 
ATOM   2822 C  C   . ASN E 1 26 ? -20.270 -10.918 19.904  1.00 28.60 ? 25   ASN E C   1 
ATOM   2823 O  O   . ASN E 1 26 ? -20.865 -10.239 19.076  1.00 31.57 ? 25   ASN E O   1 
ATOM   2824 C  CB  . ASN E 1 26 ? -18.563 -9.586  21.168  1.00 32.17 ? 25   ASN E CB  1 
ATOM   2825 C  CG  . ASN E 1 26 ? -18.562 -8.516  20.079  1.00 47.83 ? 25   ASN E CG  1 
ATOM   2826 O  OD1 . ASN E 1 26 ? -19.444 -7.653  20.030  1.00 50.89 ? 25   ASN E OD1 1 
ATOM   2827 N  ND2 . ASN E 1 26 ? -17.566 -8.573  19.198  1.00 67.52 ? 25   ASN E ND2 1 
ATOM   2828 N  N   . MET E 1 27 ? -19.926 -12.182 19.673  1.00 30.31 ? 26   MET E N   1 
ATOM   2829 C  CA  . MET E 1 27 ? -20.337 -12.881 18.460  1.00 32.22 ? 26   MET E CA  1 
ATOM   2830 C  C   . MET E 1 27 ? -21.622 -13.646 18.785  1.00 28.23 ? 26   MET E C   1 
ATOM   2831 O  O   . MET E 1 27 ? -21.677 -14.324 19.819  1.00 22.78 ? 26   MET E O   1 
ATOM   2832 C  CB  . MET E 1 27 ? -19.228 -13.856 18.040  1.00 32.18 ? 26   MET E CB  1 
ATOM   2833 C  CG  . MET E 1 27 ? -19.471 -14.593 16.725  1.00 33.95 ? 26   MET E CG  1 
ATOM   2834 S  SD  . MET E 1 27 ? -18.266 -15.914 16.424  1.00 38.97 ? 26   MET E SD  1 
ATOM   2835 C  CE  . MET E 1 27 ? -18.533 -16.878 17.877  1.00 25.12 ? 26   MET E CE  1 
ATOM   2836 N  N   . PRO E 1 28 ? -22.653 -13.568 17.908  1.00 25.41 ? 27   PRO E N   1 
ATOM   2837 C  CA  . PRO E 1 28 ? -23.858 -14.371 18.142  1.00 25.53 ? 27   PRO E CA  1 
ATOM   2838 C  C   . PRO E 1 28 ? -23.579 -15.873 17.914  1.00 19.81 ? 27   PRO E C   1 
ATOM   2839 O  O   . PRO E 1 28 ? -22.514 -16.261 17.447  1.00 17.59 ? 27   PRO E O   1 
ATOM   2840 C  CB  . PRO E 1 28 ? -24.823 -13.875 17.059  1.00 22.21 ? 27   PRO E CB  1 
ATOM   2841 C  CG  . PRO E 1 28 ? -23.909 -13.582 15.931  1.00 28.91 ? 27   PRO E CG  1 
ATOM   2842 C  CD  . PRO E 1 28 ? -22.761 -12.853 16.622  1.00 24.78 ? 27   PRO E CD  1 
ATOM   2843 N  N   . LEU E 1 29 ? -24.563 -16.707 18.204  1.00 21.73 ? 28   LEU E N   1 
ATOM   2844 C  CA  . LEU E 1 29 ? -24.414 -18.143 18.074  1.00 19.08 ? 28   LEU E CA  1 
ATOM   2845 C  C   . LEU E 1 29 ? -24.126 -18.551 16.615  1.00 15.33 ? 28   LEU E C   1 
ATOM   2846 O  O   . LEU E 1 29 ? -24.956 -18.363 15.713  1.00 17.81 ? 28   LEU E O   1 
ATOM   2847 C  CB  . LEU E 1 29 ? -25.681 -18.858 18.574  1.00 18.40 ? 28   LEU E CB  1 
ATOM   2848 C  CG  . LEU E 1 29 ? -25.503 -20.311 19.017  1.00 18.97 ? 28   LEU E CG  1 
ATOM   2849 C  CD1 . LEU E 1 29 ? -24.624 -20.382 20.229  1.00 20.47 ? 28   LEU E CD1 1 
ATOM   2850 C  CD2 . LEU E 1 29 ? -26.864 -20.943 19.283  1.00 21.59 ? 28   LEU E CD2 1 
ATOM   2851 N  N   . THR E 1 30 ? -22.964 -19.161 16.393  1.00 19.01 ? 29   THR E N   1 
ATOM   2852 C  CA  . THR E 1 30 ? -22.433 -19.362 15.054  1.00 20.86 ? 29   THR E CA  1 
ATOM   2853 C  C   . THR E 1 30 ? -21.888 -20.784 14.940  1.00 17.28 ? 29   THR E C   1 
ATOM   2854 O  O   . THR E 1 30 ? -21.232 -21.286 15.851  1.00 18.45 ? 29   THR E O   1 
ATOM   2855 C  CB  . THR E 1 30 ? -21.310 -18.314 14.768  1.00 20.10 ? 29   THR E CB  1 
ATOM   2856 O  OG1 . THR E 1 30 ? -21.839 -16.978 14.893  1.00 19.22 ? 29   THR E OG1 1 
ATOM   2857 C  CG2 . THR E 1 30 ? -20.710 -18.480 13.379  1.00 23.02 ? 29   THR E CG2 1 
ATOM   2858 N  N   . ILE E 1 31 ? -22.105 -21.405 13.794  1.00 15.06 ? 30   ILE E N   1 
ATOM   2859 C  CA  . ILE E 1 31 ? -21.481 -22.659 13.478  1.00 16.05 ? 30   ILE E CA  1 
ATOM   2860 C  C   . ILE E 1 31 ? -19.959 -22.416 13.343  1.00 16.34 ? 30   ILE E C   1 
ATOM   2861 O  O   . ILE E 1 31 ? -19.509 -21.621 12.524  1.00 17.66 ? 30   ILE E O   1 
ATOM   2862 C  CB  . ILE E 1 31 ? -22.015 -23.196 12.146  1.00 18.21 ? 30   ILE E CB  1 
ATOM   2863 C  CG1 . ILE E 1 31 ? -23.546 -23.353 12.147  1.00 15.55 ? 30   ILE E CG1 1 
ATOM   2864 C  CG2 . ILE E 1 31 ? -21.265 -24.435 11.792  1.00 15.83 ? 30   ILE E CG2 1 
ATOM   2865 C  CD1 . ILE E 1 31 ? -24.090 -24.421 13.088  1.00 18.31 ? 30   ILE E CD1 1 
ATOM   2866 N  N   . SER E 1 32 ? -19.163 -23.079 14.167  1.00 16.07 ? 31   SER E N   1 
ATOM   2867 C  CA  . SER E 1 32 ? -17.725 -22.777 14.282  1.00 16.01 ? 31   SER E CA  1 
ATOM   2868 C  C   . SER E 1 32 ? -16.860 -23.921 13.763  1.00 18.39 ? 31   SER E C   1 
ATOM   2869 O  O   . SER E 1 32 ? -15.675 -23.733 13.547  1.00 17.86 ? 31   SER E O   1 
ATOM   2870 C  CB  . SER E 1 32 ? -17.357 -22.522 15.736  1.00 17.59 ? 31   SER E CB  1 
ATOM   2871 O  OG  . SER E 1 32 ? -17.715 -23.633 16.516  1.00 17.52 ? 31   SER E OG  1 
ATOM   2872 N  N   . SER E 1 33 ? -17.432 -25.133 13.609  1.00 15.93 ? 32   SER E N   1 
ATOM   2873 C  CA  . SER E 1 33 ? -16.702 -26.299 13.092  1.00 16.95 ? 32   SER E CA  1 
ATOM   2874 C  C   . SER E 1 33 ? -17.754 -27.214 12.489  1.00 17.18 ? 32   SER E C   1 
ATOM   2875 O  O   . SER E 1 33 ? -18.932 -27.220 12.931  1.00 17.34 ? 32   SER E O   1 
ATOM   2876 C  CB  . SER E 1 33 ? -15.979 -27.045 14.234  1.00 21.33 ? 32   SER E CB  1 
ATOM   2877 O  OG  . SER E 1 33 ? -15.241 -28.179 13.770  1.00 26.48 ? 32   SER E OG  1 
ATOM   2878 N  N   . LEU E 1 34 ? -17.308 -27.994 11.506  1.00 16.99 ? 33   LEU E N   1 
ATOM   2879 C  CA  . LEU E 1 34 ? -18.187 -28.845 10.761  1.00 17.38 ? 33   LEU E CA  1 
ATOM   2880 C  C   . LEU E 1 34 ? -17.427 -30.109 10.425  1.00 22.11 ? 33   LEU E C   1 
ATOM   2881 O  O   . LEU E 1 34 ? -16.302 -30.045 9.893   1.00 19.71 ? 33   LEU E O   1 
ATOM   2882 C  CB  . LEU E 1 34 ? -18.633 -28.092 9.487   1.00 21.63 ? 33   LEU E CB  1 
ATOM   2883 C  CG  . LEU E 1 34 ? -19.839 -28.503 8.663   1.00 29.51 ? 33   LEU E CG  1 
ATOM   2884 C  CD1 . LEU E 1 34 ? -21.103 -28.212 9.456   1.00 24.40 ? 33   LEU E CD1 1 
ATOM   2885 C  CD2 . LEU E 1 34 ? -19.802 -27.741 7.320   1.00 20.25 ? 33   LEU E CD2 1 
ATOM   2886 N  N   . LYS E 1 35 ? -18.014 -31.261 10.755  1.00 18.56 ? 34   LYS E N   1 
ATOM   2887 C  CA  . LYS E 1 35 ? -17.449 -32.545 10.339  1.00 18.38 ? 34   LYS E CA  1 
ATOM   2888 C  C   . LYS E 1 35 ? -17.706 -32.873 8.844   1.00 19.00 ? 34   LYS E C   1 
ATOM   2889 O  O   . LYS E 1 35 ? -18.846 -32.825 8.365   1.00 20.62 ? 34   LYS E O   1 
ATOM   2890 C  CB  . LYS E 1 35 ? -17.970 -33.643 11.250  1.00 19.36 ? 34   LYS E CB  1 
ATOM   2891 C  CG  . LYS E 1 35 ? -17.763 -35.047 10.706  1.00 24.78 ? 34   LYS E CG  1 
ATOM   2892 N  N   . ASP E 1 36 ? -16.636 -33.203 8.116   1.00 27.93 ? 35   ASP E N   1 
ATOM   2893 C  CA  . ASP E 1 36 ? -16.762 -33.560 6.700   1.00 28.28 ? 35   ASP E CA  1 
ATOM   2894 C  C   . ASP E 1 36 ? -17.668 -34.788 6.578   1.00 22.98 ? 35   ASP E C   1 
ATOM   2895 O  O   . ASP E 1 36 ? -17.503 -35.763 7.323   1.00 25.99 ? 35   ASP E O   1 
ATOM   2896 C  CB  . ASP E 1 36 ? -15.394 -33.872 6.084   1.00 37.42 ? 35   ASP E CB  1 
ATOM   2897 C  CG  . ASP E 1 36 ? -14.641 -32.631 5.688   1.00 46.29 ? 35   ASP E CG  1 
ATOM   2898 O  OD1 . ASP E 1 36 ? -14.581 -31.696 6.511   1.00 69.44 ? 35   ASP E OD1 1 
ATOM   2899 O  OD2 . ASP E 1 36 ? -14.102 -32.593 4.560   1.00 63.45 ? 35   ASP E OD2 1 
ATOM   2900 N  N   . GLY E 1 37 ? -18.667 -34.705 5.704   1.00 23.14 ? 36   GLY E N   1 
ATOM   2901 C  CA  . GLY E 1 37 ? -19.598 -35.812 5.537   1.00 25.00 ? 36   GLY E CA  1 
ATOM   2902 C  C   . GLY E 1 37 ? -20.615 -36.002 6.656   1.00 26.48 ? 36   GLY E C   1 
ATOM   2903 O  O   . GLY E 1 37 ? -21.426 -36.923 6.582   1.00 25.58 ? 36   GLY E O   1 
ATOM   2904 N  N   . GLY E 1 38 ? -20.607 -35.133 7.684   1.00 19.10 ? 37   GLY E N   1 
ATOM   2905 C  CA  . GLY E 1 38 ? -21.563 -35.255 8.760   1.00 22.47 ? 37   GLY E CA  1 
ATOM   2906 C  C   . GLY E 1 38 ? -22.943 -34.793 8.344   1.00 20.44 ? 37   GLY E C   1 
ATOM   2907 O  O   . GLY E 1 38 ? -23.152 -34.259 7.242   1.00 20.12 ? 37   GLY E O   1 
ATOM   2908 N  N   . LYS E 1 39 ? -23.899 -34.955 9.240   1.00 15.60 ? 38   LYS E N   1 
ATOM   2909 C  CA  . LYS E 1 39 ? -25.288 -34.645 8.899   1.00 20.55 ? 38   LYS E CA  1 
ATOM   2910 C  C   . LYS E 1 39 ? -25.513 -33.155 8.633   1.00 19.16 ? 38   LYS E C   1 
ATOM   2911 O  O   . LYS E 1 39 ? -26.224 -32.812 7.685   1.00 20.47 ? 38   LYS E O   1 
ATOM   2912 C  CB  . LYS E 1 39 ? -26.269 -35.209 9.935   1.00 21.23 ? 38   LYS E CB  1 
ATOM   2913 C  CG  . LYS E 1 39 ? -26.318 -36.719 9.888   1.00 26.02 ? 38   LYS E CG  1 
ATOM   2914 C  CD  . LYS E 1 39 ? -27.122 -37.293 11.000  1.00 27.08 ? 38   LYS E CD  1 
ATOM   2915 C  CE  . LYS E 1 39 ? -27.261 -38.785 10.791  1.00 28.62 ? 38   LYS E CE  1 
ATOM   2916 N  NZ  . LYS E 1 39 ? -28.169 -39.420 11.777  1.00 25.68 ? 38   LYS E NZ  1 
ATOM   2917 N  N   . ALA E 1 40 ? -24.897 -32.279 9.418   1.00 17.41 ? 39   ALA E N   1 
ATOM   2918 C  CA  . ALA E 1 40 ? -25.029 -30.837 9.201   1.00 16.06 ? 39   ALA E CA  1 
ATOM   2919 C  C   . ALA E 1 40 ? -24.399 -30.429 7.856   1.00 18.45 ? 39   ALA E C   1 
ATOM   2920 O  O   . ALA E 1 40 ? -25.053 -29.725 7.052   1.00 18.91 ? 39   ALA E O   1 
ATOM   2921 C  CB  . ALA E 1 40 ? -24.433 -30.038 10.396  1.00 15.53 ? 39   ALA E CB  1 
ATOM   2922 N  N   . ALA E 1 41 ? -23.165 -30.869 7.624   1.00 18.60 ? 40   ALA E N   1 
ATOM   2923 C  CA  . ALA E 1 41 ? -22.477 -30.617 6.347   1.00 16.34 ? 40   ALA E CA  1 
ATOM   2924 C  C   . ALA E 1 41 ? -23.350 -31.076 5.168   1.00 20.20 ? 40   ALA E C   1 
ATOM   2925 O  O   . ALA E 1 41 ? -23.497 -30.361 4.146   1.00 20.70 ? 40   ALA E O   1 
ATOM   2926 C  CB  . ALA E 1 41 ? -21.086 -31.318 6.304   1.00 21.34 ? 40   ALA E CB  1 
ATOM   2927 N  N   . GLN E 1 42 ? -23.943 -32.262 5.273   1.00 16.43 ? 41   GLN E N   1 
ATOM   2928 C  CA  . GLN E 1 42 ? -24.713 -32.776 4.129   1.00 24.15 ? 41   GLN E CA  1 
ATOM   2929 C  C   . GLN E 1 42 ? -26.070 -32.063 3.945   1.00 19.57 ? 41   GLN E C   1 
ATOM   2930 O  O   . GLN E 1 42 ? -26.641 -32.091 2.844   1.00 23.55 ? 41   GLN E O   1 
ATOM   2931 C  CB  A GLN E 1 42 ? -24.805 -34.314 4.156   0.60 26.74 ? 41   GLN E CB  1 
ATOM   2932 C  CB  B GLN E 1 42 ? -24.927 -34.296 4.240   0.40 24.40 ? 41   GLN E CB  1 
ATOM   2933 C  CG  A GLN E 1 42 ? -23.423 -35.025 4.101   0.60 31.58 ? 41   GLN E CG  1 
ATOM   2934 C  CG  B GLN E 1 42 ? -23.675 -35.118 4.000   0.40 16.42 ? 41   GLN E CG  1 
ATOM   2935 C  CD  A GLN E 1 42 ? -22.606 -34.763 2.817   0.60 36.99 ? 41   GLN E CD  1 
ATOM   2936 C  CD  B GLN E 1 42 ? -23.939 -36.624 3.964   0.40 16.53 ? 41   GLN E CD  1 
ATOM   2937 O  OE1 A GLN E 1 42 ? -21.430 -34.394 2.881   0.60 34.91 ? 41   GLN E OE1 1 
ATOM   2938 O  OE1 B GLN E 1 42 ? -24.911 -37.083 3.363   0.40 25.59 ? 41   GLN E OE1 1 
ATOM   2939 N  NE2 A GLN E 1 42 ? -23.218 -34.982 1.663   0.60 21.97 ? 41   GLN E NE2 1 
ATOM   2940 N  NE2 B GLN E 1 42 ? -23.067 -37.391 4.607   0.40 18.82 ? 41   GLN E NE2 1 
ATOM   2941 N  N   . ALA E 1 43 ? -26.537 -31.364 4.980   1.00 17.62 ? 42   ALA E N   1 
ATOM   2942 C  CA  . ALA E 1 43 ? -27.696 -30.486 4.893   1.00 16.01 ? 42   ALA E CA  1 
ATOM   2943 C  C   . ALA E 1 43 ? -27.334 -29.096 4.427   1.00 21.57 ? 42   ALA E C   1 
ATOM   2944 O  O   . ALA E 1 43 ? -28.185 -28.235 4.419   1.00 23.58 ? 42   ALA E O   1 
ATOM   2945 C  CB  . ALA E 1 43 ? -28.366 -30.382 6.230   1.00 18.41 ? 42   ALA E CB  1 
ATOM   2946 N  N   . ASN E 1 44 ? -26.069 -28.895 4.062   1.00 20.44 ? 43   ASN E N   1 
ATOM   2947 C  CA  A ASN E 1 44 ? -25.550 -27.608 3.589   0.50 20.92 ? 43   ASN E CA  1 
ATOM   2948 C  CA  B ASN E 1 44 ? -25.522 -27.610 3.593   0.50 21.53 ? 43   ASN E CA  1 
ATOM   2949 C  C   . ASN E 1 44 ? -25.413 -26.518 4.656   1.00 20.35 ? 43   ASN E C   1 
ATOM   2950 O  O   . ASN E 1 44 ? -25.430 -25.339 4.353   1.00 20.65 ? 43   ASN E O   1 
ATOM   2951 C  CB  A ASN E 1 44 ? -26.372 -27.091 2.397   0.50 23.00 ? 43   ASN E CB  1 
ATOM   2952 C  CB  B ASN E 1 44 ? -26.252 -27.104 2.333   0.50 24.06 ? 43   ASN E CB  1 
ATOM   2953 C  CG  A ASN E 1 44 ? -25.553 -26.223 1.456   0.50 24.22 ? 43   ASN E CG  1 
ATOM   2954 C  CG  B ASN E 1 44 ? -25.688 -27.698 1.054   0.50 28.26 ? 43   ASN E CG  1 
ATOM   2955 O  OD1 A ASN E 1 44 ? -26.094 -25.352 0.769   0.50 29.71 ? 43   ASN E OD1 1 
ATOM   2956 O  OD1 B ASN E 1 44 ? -24.472 -27.776 0.872   0.50 28.37 ? 43   ASN E OD1 1 
ATOM   2957 N  ND2 A ASN E 1 44 ? -24.240 -26.458 1.419   0.50 19.88 ? 43   ASN E ND2 1 
ATOM   2958 N  ND2 B ASN E 1 44 ? -26.572 -28.115 0.159   0.50 39.23 ? 43   ASN E ND2 1 
ATOM   2959 N  N   . VAL E 1 45 ? -25.277 -26.917 5.909   1.00 17.50 ? 44   VAL E N   1 
ATOM   2960 C  CA  . VAL E 1 45 ? -24.889 -25.995 6.954   1.00 16.45 ? 44   VAL E CA  1 
ATOM   2961 C  C   . VAL E 1 45 ? -23.400 -25.702 6.765   1.00 20.26 ? 44   VAL E C   1 
ATOM   2962 O  O   . VAL E 1 45 ? -22.622 -26.608 6.437   1.00 18.16 ? 44   VAL E O   1 
ATOM   2963 C  CB  . VAL E 1 45 ? -25.090 -26.631 8.331   1.00 16.73 ? 44   VAL E CB  1 
ATOM   2964 C  CG1 . VAL E 1 45 ? -24.571 -25.713 9.414   1.00 18.57 ? 44   VAL E CG1 1 
ATOM   2965 C  CG2 . VAL E 1 45 ? -26.558 -26.995 8.550   1.00 16.80 ? 44   VAL E CG2 1 
ATOM   2966 N  N   . ARG E 1 46 ? -22.995 -24.463 6.978   1.00 18.69 ? 45   ARG E N   1 
ATOM   2967 C  CA  . ARG E 1 46 ? -21.604 -24.076 6.772   1.00 22.12 ? 45   ARG E CA  1 
ATOM   2968 C  C   . ARG E 1 46 ? -21.091 -23.245 7.952   1.00 19.63 ? 45   ARG E C   1 
ATOM   2969 O  O   . ARG E 1 46 ? -21.861 -22.513 8.607   1.00 18.15 ? 45   ARG E O   1 
ATOM   2970 C  CB  A ARG E 1 46 ? -21.480 -23.298 5.457   0.50 20.78 ? 45   ARG E CB  1 
ATOM   2971 C  CB  B ARG E 1 46 ? -21.468 -23.293 5.460   0.50 20.93 ? 45   ARG E CB  1 
ATOM   2972 C  CG  A ARG E 1 46 ? -21.747 -24.157 4.216   0.50 19.54 ? 45   ARG E CG  1 
ATOM   2973 C  CG  B ARG E 1 46 ? -21.532 -24.167 4.193   0.50 21.01 ? 45   ARG E CG  1 
ATOM   2974 C  CD  A ARG E 1 46 ? -20.551 -25.066 3.932   0.50 30.24 ? 45   ARG E CD  1 
ATOM   2975 C  CD  B ARG E 1 46 ? -22.621 -23.711 3.249   0.50 30.06 ? 45   ARG E CD  1 
ATOM   2976 N  NE  A ARG E 1 46 ? -20.774 -25.935 2.775   0.50 24.64 ? 45   ARG E NE  1 
ATOM   2977 N  NE  B ARG E 1 46 ? -22.478 -24.213 1.886   0.50 33.32 ? 45   ARG E NE  1 
ATOM   2978 C  CZ  A ARG E 1 46 ? -21.310 -27.152 2.816   0.50 16.27 ? 45   ARG E CZ  1 
ATOM   2979 C  CZ  B ARG E 1 46 ? -23.132 -23.738 0.826   0.50 29.74 ? 45   ARG E CZ  1 
ATOM   2980 N  NH1 A ARG E 1 46 ? -21.697 -27.706 3.958   0.50 12.86 ? 45   ARG E NH1 1 
ATOM   2981 N  NH1 B ARG E 1 46 ? -22.934 -24.291 -0.360  0.50 24.99 ? 45   ARG E NH1 1 
ATOM   2982 N  NH2 A ARG E 1 46 ? -21.460 -27.832 1.682   0.50 34.70 ? 45   ARG E NH2 1 
ATOM   2983 N  NH2 B ARG E 1 46 ? -23.975 -22.714 0.935   0.50 39.18 ? 45   ARG E NH2 1 
ATOM   2984 N  N   . ILE E 1 47 ? -19.786 -23.347 8.188   1.00 17.80 ? 46   ILE E N   1 
ATOM   2985 C  CA  . ILE E 1 47 ? -19.093 -22.535 9.196   1.00 19.40 ? 46   ILE E CA  1 
ATOM   2986 C  C   . ILE E 1 47 ? -19.292 -21.066 8.898   1.00 19.93 ? 46   ILE E C   1 
ATOM   2987 O  O   . ILE E 1 47 ? -19.161 -20.629 7.745   1.00 21.13 ? 46   ILE E O   1 
ATOM   2988 C  CB  . ILE E 1 47 ? -17.585 -22.897 9.248   1.00 17.10 ? 46   ILE E CB  1 
ATOM   2989 C  CG1 . ILE E 1 47 ? -17.415 -24.334 9.693   1.00 15.09 ? 46   ILE E CG1 1 
ATOM   2990 C  CG2 . ILE E 1 47 ? -16.845 -21.955 10.224  1.00 18.75 ? 46   ILE E CG2 1 
ATOM   2991 C  CD1 . ILE E 1 47 ? -15.949 -24.848 9.673   1.00 16.36 ? 46   ILE E CD1 1 
ATOM   2992 N  N   . GLY E 1 48 ? -19.633 -20.312 9.942   1.00 15.83 ? 47   GLY E N   1 
ATOM   2993 C  CA  . GLY E 1 48 ? -19.946 -18.931 9.827   1.00 19.11 ? 47   GLY E CA  1 
ATOM   2994 C  C   . GLY E 1 48 ? -21.419 -18.605 9.750   1.00 20.39 ? 47   GLY E C   1 
ATOM   2995 O  O   . GLY E 1 48 ? -21.777 -17.459 9.968   1.00 18.26 ? 47   GLY E O   1 
ATOM   2996 N  N   . ASP E 1 49 ? -22.270 -19.601 9.491   1.00 17.39 ? 48   ASP E N   1 
ATOM   2997 C  CA  . ASP E 1 49 ? -23.719 -19.376 9.491   1.00 19.10 ? 48   ASP E CA  1 
ATOM   2998 C  C   . ASP E 1 49 ? -24.183 -19.173 10.932  1.00 16.84 ? 48   ASP E C   1 
ATOM   2999 O  O   . ASP E 1 49 ? -23.620 -19.744 11.859  1.00 16.75 ? 48   ASP E O   1 
ATOM   3000 C  CB  . ASP E 1 49 ? -24.491 -20.528 8.854   1.00 17.15 ? 48   ASP E CB  1 
ATOM   3001 C  CG  . ASP E 1 49 ? -24.209 -20.672 7.388   1.00 20.31 ? 48   ASP E CG  1 
ATOM   3002 O  OD1 . ASP E 1 49 ? -23.590 -19.757 6.818   1.00 18.85 ? 48   ASP E OD1 1 
ATOM   3003 O  OD2 . ASP E 1 49 ? -24.613 -21.698 6.830   1.00 19.38 ? 48   ASP E OD2 1 
ATOM   3004 N  N   . VAL E 1 50 ? -25.165 -18.310 11.105  1.00 19.16 ? 49   VAL E N   1 
ATOM   3005 C  CA  . VAL E 1 50 ? -25.622 -17.906 12.419  1.00 16.84 ? 49   VAL E CA  1 
ATOM   3006 C  C   . VAL E 1 50 ? -26.907 -18.695 12.725  1.00 16.30 ? 49   VAL E C   1 
ATOM   3007 O  O   . VAL E 1 50 ? -27.819 -18.734 11.908  1.00 16.80 ? 49   VAL E O   1 
ATOM   3008 C  CB  . VAL E 1 50 ? -25.803 -16.365 12.517  1.00 17.77 ? 49   VAL E CB  1 
ATOM   3009 C  CG1 . VAL E 1 50 ? -26.571 -15.955 13.779  1.00 19.01 ? 49   VAL E CG1 1 
ATOM   3010 C  CG2 . VAL E 1 50 ? -24.419 -15.636 12.446  1.00 17.30 ? 49   VAL E CG2 1 
ATOM   3011 N  N   . VAL E 1 51 ? -26.948 -19.305 13.913  1.00 18.51 ? 50   VAL E N   1 
ATOM   3012 C  CA  . VAL E 1 51 ? -28.106 -20.050 14.392  1.00 15.29 ? 50   VAL E CA  1 
ATOM   3013 C  C   . VAL E 1 51 ? -29.126 -19.053 14.966  1.00 14.73 ? 50   VAL E C   1 
ATOM   3014 O  O   . VAL E 1 51 ? -28.845 -18.324 15.954  1.00 16.69 ? 50   VAL E O   1 
ATOM   3015 C  CB  . VAL E 1 51 ? -27.735 -21.105 15.450  1.00 16.41 ? 50   VAL E CB  1 
ATOM   3016 C  CG1 . VAL E 1 51 ? -28.981 -21.851 15.897  1.00 18.04 ? 50   VAL E CG1 1 
ATOM   3017 C  CG2 . VAL E 1 51 ? -26.680 -22.077 14.872  1.00 15.84 ? 50   VAL E CG2 1 
ATOM   3018 N  N   . LEU E 1 52 ? -30.297 -19.036 14.323  1.00 19.89 ? 51   LEU E N   1 
ATOM   3019 C  CA  . LEU E 1 52 ? -31.404 -18.145 14.662  1.00 17.28 ? 51   LEU E CA  1 
ATOM   3020 C  C   . LEU E 1 52 ? -32.401 -18.810 15.608  1.00 14.87 ? 51   LEU E C   1 
ATOM   3021 O  O   . LEU E 1 52 ? -32.966 -18.129 16.477  1.00 15.25 ? 51   LEU E O   1 
ATOM   3022 C  CB  . LEU E 1 52 ? -32.142 -17.665 13.410  1.00 16.17 ? 51   LEU E CB  1 
ATOM   3023 C  CG  . LEU E 1 52 ? -31.299 -16.846 12.443  1.00 21.33 ? 51   LEU E CG  1 
ATOM   3024 C  CD1 . LEU E 1 52 ? -32.098 -16.545 11.221  1.00 19.41 ? 51   LEU E CD1 1 
ATOM   3025 C  CD2 . LEU E 1 52 ? -30.759 -15.570 13.065  1.00 22.13 ? 51   LEU E CD2 1 
ATOM   3026 N  N   . SER E 1 53 ? -32.661 -20.100 15.370  1.00 18.60 ? 52   SER E N   1 
ATOM   3027 C  CA  . SER E 1 53 ? -33.607 -20.863 16.159  1.00 16.73 ? 52   SER E CA  1 
ATOM   3028 C  C   . SER E 1 53 ? -33.202 -22.334 16.223  1.00 16.51 ? 52   SER E C   1 
ATOM   3029 O  O   . SER E 1 53 ? -32.535 -22.828 15.324  1.00 16.50 ? 52   SER E O   1 
ATOM   3030 C  CB  . SER E 1 53 ? -35.051 -20.739 15.603  1.00 20.47 ? 52   SER E CB  1 
ATOM   3031 O  OG  . SER E 1 53 ? -35.220 -21.359 14.348  1.00 23.55 ? 52   SER E OG  1 
ATOM   3032 N  N   . ILE E 1 54 ? -33.606 -22.994 17.308  1.00 15.38 ? 53   ILE E N   1 
ATOM   3033 C  CA  . ILE E 1 54 ? -33.391 -24.440 17.533  1.00 16.65 ? 53   ILE E CA  1 
ATOM   3034 C  C   . ILE E 1 54 ? -34.744 -25.052 17.951  1.00 18.60 ? 53   ILE E C   1 
ATOM   3035 O  O   . ILE E 1 54 ? -35.368 -24.569 18.905  1.00 19.40 ? 53   ILE E O   1 
ATOM   3036 C  CB  . ILE E 1 54 ? -32.332 -24.706 18.637  1.00 17.92 ? 53   ILE E CB  1 
ATOM   3037 C  CG1 . ILE E 1 54 ? -30.995 -24.067 18.273  1.00 16.53 ? 53   ILE E CG1 1 
ATOM   3038 C  CG2 . ILE E 1 54 ? -32.160 -26.204 18.906  1.00 18.65 ? 53   ILE E CG2 1 
ATOM   3039 C  CD1 . ILE E 1 54 ? -30.049 -23.928 19.471  1.00 16.77 ? 53   ILE E CD1 1 
ATOM   3040 N  N   . ASP E 1 55 ? -35.205 -26.062 17.200  1.00 17.96 ? 54   ASP E N   1 
ATOM   3041 C  CA  . ASP E 1 55 ? -36.483 -26.726 17.479  1.00 23.33 ? 54   ASP E CA  1 
ATOM   3042 C  C   . ASP E 1 55 ? -37.660 -25.736 17.660  1.00 25.69 ? 54   ASP E C   1 
ATOM   3043 O  O   . ASP E 1 55 ? -38.539 -25.926 18.525  1.00 25.97 ? 54   ASP E O   1 
ATOM   3044 C  CB  . ASP E 1 55 ? -36.317 -27.622 18.705  1.00 26.78 ? 54   ASP E CB  1 
ATOM   3045 C  CG  . ASP E 1 55 ? -37.375 -28.714 18.792  1.00 40.57 ? 54   ASP E CG  1 
ATOM   3046 O  OD1 . ASP E 1 55 ? -37.983 -29.072 17.750  1.00 44.68 ? 54   ASP E OD1 1 
ATOM   3047 O  OD2 . ASP E 1 55 ? -37.597 -29.209 19.919  1.00 59.09 ? 54   ASP E OD2 1 
ATOM   3048 N  N   . GLY E 1 56 ? -37.666 -24.677 16.851  1.00 23.06 ? 55   GLY E N   1 
ATOM   3049 C  CA  . GLY E 1 56 ? -38.748 -23.706 16.829  1.00 27.04 ? 55   GLY E CA  1 
ATOM   3050 C  C   . GLY E 1 56 ? -38.682 -22.587 17.846  1.00 26.01 ? 55   GLY E C   1 
ATOM   3051 O  O   . GLY E 1 56 ? -39.580 -21.735 17.892  1.00 24.05 ? 55   GLY E O   1 
ATOM   3052 N  N   . ILE E 1 57 ? -37.615 -22.587 18.650  1.00 20.97 ? 56   ILE E N   1 
ATOM   3053 C  CA  . ILE E 1 57 ? -37.377 -21.599 19.703  1.00 21.35 ? 56   ILE E CA  1 
ATOM   3054 C  C   . ILE E 1 57 ? -36.272 -20.643 19.293  1.00 25.20 ? 56   ILE E C   1 
ATOM   3055 O  O   . ILE E 1 57 ? -35.223 -21.087 18.865  1.00 19.30 ? 56   ILE E O   1 
ATOM   3056 C  CB  . ILE E 1 57 ? -36.972 -22.302 21.026  1.00 26.67 ? 56   ILE E CB  1 
ATOM   3057 C  CG1 . ILE E 1 57 ? -38.025 -23.361 21.389  1.00 31.83 ? 56   ILE E CG1 1 
ATOM   3058 C  CG2 . ILE E 1 57 ? -36.763 -21.277 22.141  1.00 27.58 ? 56   ILE E CG2 1 
ATOM   3059 C  CD1 . ILE E 1 57 ? -37.965 -23.841 22.804  1.00 47.09 ? 56   ILE E CD1 1 
ATOM   3060 N  N   . ASN E 1 58 ? -36.515 -19.337 19.428  1.00 24.63 ? 57   ASN E N   1 
ATOM   3061 C  CA  . ASN E 1 58 ? -35.495 -18.301 19.171  1.00 22.70 ? 57   ASN E CA  1 
ATOM   3062 C  C   . ASN E 1 58 ? -34.222 -18.522 19.997  1.00 18.75 ? 57   ASN E C   1 
ATOM   3063 O  O   . ASN E 1 58 ? -34.250 -18.585 21.226  1.00 20.68 ? 57   ASN E O   1 
ATOM   3064 C  CB  . ASN E 1 58 ? -36.089 -16.905 19.408  1.00 23.86 ? 57   ASN E CB  1 
ATOM   3065 C  CG  . ASN E 1 58 ? -35.196 -15.760 18.934  1.00 21.95 ? 57   ASN E CG  1 
ATOM   3066 O  OD1 . ASN E 1 58 ? -33.997 -15.915 18.676  1.00 21.87 ? 57   ASN E OD1 1 
ATOM   3067 N  ND2 . ASN E 1 58 ? -35.790 -14.580 18.845  1.00 21.01 ? 57   ASN E ND2 1 
ATOM   3068 N  N   . ALA E 1 59 ? -33.094 -18.647 19.295  1.00 17.38 ? 58   ALA E N   1 
ATOM   3069 C  CA  . ALA E 1 59 ? -31.838 -18.969 19.917  1.00 17.53 ? 58   ALA E CA  1 
ATOM   3070 C  C   . ALA E 1 59 ? -31.120 -17.724 20.355  1.00 21.21 ? 58   ALA E C   1 
ATOM   3071 O  O   . ALA E 1 59 ? -30.173 -17.805 21.128  1.00 24.08 ? 58   ALA E O   1 
ATOM   3072 C  CB  . ALA E 1 59 ? -30.957 -19.726 18.956  1.00 19.41 ? 58   ALA E CB  1 
ATOM   3073 N  N   . GLN E 1 60 ? -31.593 -16.564 19.888  1.00 26.83 ? 59   GLN E N   1 
ATOM   3074 C  CA  . GLN E 1 60 ? -30.843 -15.308 20.016  1.00 31.18 ? 59   GLN E CA  1 
ATOM   3075 C  C   . GLN E 1 60 ? -30.825 -14.791 21.432  1.00 30.19 ? 59   GLN E C   1 
ATOM   3076 O  O   . GLN E 1 60 ? -30.039 -13.904 21.750  1.00 42.43 ? 59   GLN E O   1 
ATOM   3077 C  CB  . GLN E 1 60 ? -31.391 -14.242 19.060  1.00 35.21 ? 59   GLN E CB  1 
ATOM   3078 C  CG  . GLN E 1 60 ? -31.324 -14.685 17.589  1.00 48.71 ? 59   GLN E CG  1 
ATOM   3079 C  CD  . GLN E 1 60 ? -32.029 -13.740 16.639  1.00 38.06 ? 59   GLN E CD  1 
ATOM   3080 O  OE1 . GLN E 1 60 ? -33.242 -13.840 16.431  1.00 65.35 ? 59   GLN E OE1 1 
ATOM   3081 N  NE2 . GLN E 1 60 ? -31.266 -12.837 16.028  1.00 31.81 ? 59   GLN E NE2 1 
ATOM   3082 N  N   . GLY E 1 61 ? -31.685 -15.352 22.279  1.00 21.66 ? 60   GLY E N   1 
ATOM   3083 C  CA  . GLY E 1 61 ? -31.698 -15.059 23.703  1.00 27.11 ? 60   GLY E CA  1 
ATOM   3084 C  C   . GLY E 1 61 ? -31.358 -16.288 24.556  1.00 32.25 ? 60   GLY E C   1 
ATOM   3085 O  O   . GLY E 1 61 ? -31.829 -16.436 25.696  1.00 31.31 ? 60   GLY E O   1 
ATOM   3086 N  N   . MET E 1 62 ? -30.557 -17.188 23.994  1.00 20.38 ? 61   MET E N   1 
ATOM   3087 C  CA  . MET E 1 62 ? -30.000 -18.304 24.751  1.00 23.31 ? 61   MET E CA  1 
ATOM   3088 C  C   . MET E 1 62 ? -28.529 -18.044 24.981  1.00 17.79 ? 61   MET E C   1 
ATOM   3089 O  O   . MET E 1 62 ? -27.839 -17.536 24.075  1.00 23.61 ? 61   MET E O   1 
ATOM   3090 C  CB  . MET E 1 62 ? -30.121 -19.603 23.965  1.00 18.16 ? 61   MET E CB  1 
ATOM   3091 C  CG  . MET E 1 62 ? -31.510 -20.104 23.691  1.00 24.05 ? 61   MET E CG  1 
ATOM   3092 S  SD  . MET E 1 62 ? -31.509 -21.619 22.716  1.00 24.64 ? 61   MET E SD  1 
ATOM   3093 C  CE  . MET E 1 62 ? -33.270 -21.851 22.349  1.00 31.53 ? 61   MET E CE  1 
ATOM   3094 N  N   . THR E 1 63 ? -28.033 -18.402 26.170  1.00 20.17 ? 62   THR E N   1 
ATOM   3095 C  CA  . THR E 1 63 ? -26.579 -18.470 26.349  1.00 21.30 ? 62   THR E CA  1 
ATOM   3096 C  C   . THR E 1 63 ? -26.042 -19.638 25.543  1.00 19.73 ? 62   THR E C   1 
ATOM   3097 O  O   . THR E 1 63 ? -26.770 -20.558 25.120  1.00 20.14 ? 62   THR E O   1 
ATOM   3098 C  CB  . THR E 1 63 ? -26.129 -18.721 27.789  1.00 17.24 ? 62   THR E CB  1 
ATOM   3099 O  OG1 . THR E 1 63 ? -26.656 -19.990 28.227  1.00 16.66 ? 62   THR E OG1 1 
ATOM   3100 C  CG2 . THR E 1 63 ? -26.557 -17.560 28.716  1.00 24.98 ? 62   THR E CG2 1 
ATOM   3101 N  N   . HIS E 1 64 ? -24.745 -19.623 25.349  1.00 20.05 ? 63   HIS E N   1 
ATOM   3102 C  CA  . HIS E 1 64 ? -24.148 -20.721 24.637  1.00 18.68 ? 63   HIS E CA  1 
ATOM   3103 C  C   . HIS E 1 64 ? -24.500 -22.098 25.236  1.00 16.63 ? 63   HIS E C   1 
ATOM   3104 O  O   . HIS E 1 64 ? -24.898 -23.013 24.515  1.00 16.11 ? 63   HIS E O   1 
ATOM   3105 C  CB  . HIS E 1 64 ? -22.668 -20.479 24.595  1.00 14.28 ? 63   HIS E CB  1 
ATOM   3106 C  CG  . HIS E 1 64 ? -21.926 -21.449 23.765  1.00 13.16 ? 63   HIS E CG  1 
ATOM   3107 N  ND1 . HIS E 1 64 ? -21.279 -21.073 22.617  1.00 18.85 ? 63   HIS E ND1 1 
ATOM   3108 C  CD2 . HIS E 1 64 ? -21.675 -22.767 23.939  1.00 20.11 ? 63   HIS E CD2 1 
ATOM   3109 C  CE1 . HIS E 1 64 ? -20.676 -22.132 22.103  1.00 25.19 ? 63   HIS E CE1 1 
ATOM   3110 N  NE2 . HIS E 1 64 ? -20.912 -23.175 22.878  1.00 17.93 ? 63   HIS E NE2 1 
ATOM   3111 N  N   . LEU E 1 65 ? -24.340 -22.276 26.545  1.00 13.76 ? 64   LEU E N   1 
ATOM   3112 C  CA  . LEU E 1 65 ? -24.590 -23.572 27.169  1.00 13.27 ? 64   LEU E CA  1 
ATOM   3113 C  C   . LEU E 1 65 ? -26.063 -24.001 27.066  1.00 13.49 ? 64   LEU E C   1 
ATOM   3114 O  O   . LEU E 1 65 ? -26.365 -25.180 26.883  1.00 16.25 ? 64   LEU E O   1 
ATOM   3115 C  CB  . LEU E 1 65 ? -24.168 -23.570 28.653  1.00 15.51 ? 64   LEU E CB  1 
ATOM   3116 C  CG  . LEU E 1 65 ? -24.147 -24.938 29.369  1.00 16.50 ? 64   LEU E CG  1 
ATOM   3117 C  CD1 . LEU E 1 65 ? -23.301 -25.986 28.599  1.00 19.61 ? 64   LEU E CD1 1 
ATOM   3118 C  CD2 . LEU E 1 65 ? -23.719 -24.817 30.879  1.00 13.51 ? 64   LEU E CD2 1 
ATOM   3119 N  N   . GLU E 1 66 ? -26.953 -23.032 27.174  1.00 19.04 ? 65   GLU E N   1 
ATOM   3120 C  CA  . GLU E 1 66 ? -28.403 -23.278 26.981  1.00 18.37 ? 65   GLU E CA  1 
ATOM   3121 C  C   . GLU E 1 66 ? -28.708 -23.860 25.596  1.00 15.45 ? 65   GLU E C   1 
ATOM   3122 O  O   . GLU E 1 66 ? -29.344 -24.909 25.480  1.00 20.85 ? 65   GLU E O   1 
ATOM   3123 C  CB  . GLU E 1 66 ? -29.155 -21.973 27.176  1.00 17.20 ? 65   GLU E CB  1 
ATOM   3124 C  CG  . GLU E 1 66 ? -29.327 -21.613 28.638  1.00 29.35 ? 65   GLU E CG  1 
ATOM   3125 C  CD  . GLU E 1 66 ? -29.959 -20.249 28.877  1.00 17.82 ? 65   GLU E CD  1 
ATOM   3126 O  OE1 . GLU E 1 66 ? -30.069 -19.426 27.940  1.00 33.18 ? 65   GLU E OE1 1 
ATOM   3127 O  OE2 . GLU E 1 66 ? -30.281 -19.986 30.056  1.00 28.56 ? 65   GLU E OE2 1 
ATOM   3128 N  N   . ALA E 1 67 ? -28.139 -23.233 24.572  1.00 16.44 ? 66   ALA E N   1 
ATOM   3129 C  CA  . ALA E 1 67 ? -28.298 -23.665 23.181  1.00 17.05 ? 66   ALA E CA  1 
ATOM   3130 C  C   . ALA E 1 67 ? -27.708 -25.037 22.981  1.00 16.80 ? 66   ALA E C   1 
ATOM   3131 O  O   . ALA E 1 67 ? -28.344 -25.901 22.362  1.00 17.27 ? 66   ALA E O   1 
ATOM   3132 C  CB  . ALA E 1 67 ? -27.661 -22.642 22.243  1.00 20.87 ? 66   ALA E CB  1 
ATOM   3133 N  N   . GLN E 1 68 ? -26.492 -25.252 23.518  1.00 15.28 ? 67   GLN E N   1 
ATOM   3134 C  CA  . GLN E 1 68 ? -25.845 -26.534 23.390  1.00 16.35 ? 67   GLN E CA  1 
ATOM   3135 C  C   . GLN E 1 68 ? -26.704 -27.605 24.020  1.00 18.84 ? 67   GLN E C   1 
ATOM   3136 O  O   . GLN E 1 68 ? -26.877 -28.650 23.460  1.00 18.62 ? 67   GLN E O   1 
ATOM   3137 C  CB  . GLN E 1 68 ? -24.486 -26.522 24.040  1.00 15.76 ? 67   GLN E CB  1 
ATOM   3138 C  CG  . GLN E 1 68 ? -23.727 -27.798 23.917  1.00 23.12 ? 67   GLN E CG  1 
ATOM   3139 C  CD  . GLN E 1 68 ? -22.416 -27.698 24.635  1.00 24.57 ? 67   GLN E CD  1 
ATOM   3140 O  OE1 . GLN E 1 68 ? -22.335 -28.072 25.781  1.00 26.34 ? 67   GLN E OE1 1 
ATOM   3141 N  NE2 . GLN E 1 68 ? -21.392 -27.192 23.970  1.00 16.68 ? 67   GLN E NE2 1 
ATOM   3142 N  N   . ASN E 1 69 ? -27.262 -27.329 25.195  1.00 19.52 ? 68   ASN E N   1 
ATOM   3143 C  CA  . ASN E 1 69 ? -28.076 -28.349 25.840  1.00 22.33 ? 68   ASN E CA  1 
ATOM   3144 C  C   . ASN E 1 69 ? -29.404 -28.581 25.127  1.00 19.43 ? 68   ASN E C   1 
ATOM   3145 O  O   . ASN E 1 69 ? -29.878 -29.704 25.085  1.00 23.98 ? 68   ASN E O   1 
ATOM   3146 C  CB  . ASN E 1 69 ? -28.238 -28.040 27.313  1.00 19.87 ? 68   ASN E CB  1 
ATOM   3147 C  CG  . ASN E 1 69 ? -26.958 -28.320 28.076  1.00 19.13 ? 68   ASN E CG  1 
ATOM   3148 O  OD1 . ASN E 1 69 ? -26.176 -29.225 27.698  1.00 24.70 ? 68   ASN E OD1 1 
ATOM   3149 N  ND2 . ASN E 1 69 ? -26.719 -27.562 29.128  1.00 25.23 ? 68   ASN E ND2 1 
ATOM   3150 N  N   . LYS E 1 70 ? -29.965 -27.532 24.545  1.00 21.45 ? 69   LYS E N   1 
ATOM   3151 C  CA  . LYS E 1 70 ? -31.173 -27.681 23.702  1.00 21.72 ? 69   LYS E CA  1 
ATOM   3152 C  C   . LYS E 1 70 ? -30.890 -28.649 22.557  1.00 22.17 ? 69   LYS E C   1 
ATOM   3153 O  O   . LYS E 1 70 ? -31.657 -29.594 22.332  1.00 22.24 ? 69   LYS E O   1 
ATOM   3154 C  CB  . LYS E 1 70 ? -31.630 -26.329 23.183  1.00 21.41 ? 69   LYS E CB  1 
ATOM   3155 C  CG  . LYS E 1 70 ? -32.952 -26.343 22.389  1.00 21.23 ? 69   LYS E CG  1 
ATOM   3156 C  CD  . LYS E 1 70 ? -34.147 -26.055 23.222  1.00 38.62 ? 69   LYS E CD  1 
ATOM   3157 C  CE  . LYS E 1 70 ? -35.402 -26.034 22.354  1.00 29.69 ? 69   LYS E CE  1 
ATOM   3158 N  NZ  . LYS E 1 70 ? -36.536 -26.520 23.154  1.00 38.21 ? 69   LYS E NZ  1 
ATOM   3159 N  N   . ILE E 1 71 ? -29.753 -28.448 21.882  1.00 19.03 ? 70   ILE E N   1 
ATOM   3160 C  CA  . ILE E 1 71 ? -29.342 -29.342 20.814  1.00 19.46 ? 70   ILE E CA  1 
ATOM   3161 C  C   . ILE E 1 71 ? -29.131 -30.777 21.291  1.00 19.98 ? 70   ILE E C   1 
ATOM   3162 O  O   . ILE E 1 71 ? -29.606 -31.699 20.650  1.00 22.39 ? 70   ILE E O   1 
ATOM   3163 C  CB  . ILE E 1 71 ? -28.100 -28.799 20.093  1.00 19.37 ? 70   ILE E CB  1 
ATOM   3164 C  CG1 . ILE E 1 71 ? -28.510 -27.525 19.320  1.00 17.05 ? 70   ILE E CG1 1 
ATOM   3165 C  CG2 . ILE E 1 71 ? -27.512 -29.870 19.163  1.00 20.49 ? 70   ILE E CG2 1 
ATOM   3166 C  CD1 . ILE E 1 71 ? -27.386 -26.637 18.937  1.00 16.93 ? 70   ILE E CD1 1 
ATOM   3167 N  N   . LYS E 1 72 ? -28.434 -30.968 22.405  1.00 20.56 ? 71   LYS E N   1 
ATOM   3168 C  CA  . LYS E 1 72 ? -28.210 -32.310 22.946  1.00 25.34 ? 71   LYS E CA  1 
ATOM   3169 C  C   . LYS E 1 72 ? -29.491 -33.015 23.411  1.00 26.07 ? 71   LYS E C   1 
ATOM   3170 O  O   . LYS E 1 72 ? -29.561 -34.237 23.384  1.00 37.13 ? 71   LYS E O   1 
ATOM   3171 C  CB  . LYS E 1 72 ? -27.210 -32.273 24.096  1.00 21.35 ? 71   LYS E CB  1 
ATOM   3172 C  CG  . LYS E 1 72 ? -25.803 -31.934 23.642  1.00 21.32 ? 71   LYS E CG  1 
ATOM   3173 C  CD  . LYS E 1 72 ? -24.919 -31.813 24.860  1.00 22.74 ? 71   LYS E CD  1 
ATOM   3174 C  CE  . LYS E 1 72 ? -23.469 -31.644 24.493  1.00 19.48 ? 71   LYS E CE  1 
ATOM   3175 N  NZ  . LYS E 1 72 ? -22.654 -31.814 25.723  1.00 25.35 ? 71   LYS E NZ  1 
ATOM   3176 N  N   . GLY E 1 73 ? -30.490 -32.242 23.820  1.00 26.14 ? 72   GLY E N   1 
ATOM   3177 C  CA  . GLY E 1 73 ? -31.749 -32.796 24.285  1.00 29.79 ? 72   GLY E CA  1 
ATOM   3178 C  C   . GLY E 1 73 ? -32.656 -33.173 23.126  1.00 34.82 ? 72   GLY E C   1 
ATOM   3179 O  O   . GLY E 1 73 ? -33.703 -33.790 23.323  1.00 33.23 ? 72   GLY E O   1 
ATOM   3180 N  N   . CYS E 1 74 ? -32.262 -32.781 21.915  1.00 30.88 ? 73   CYS E N   1 
ATOM   3181 C  CA  . CYS E 1 74 ? -33.029 -33.104 20.725  1.00 31.80 ? 73   CYS E CA  1 
ATOM   3182 C  C   . CYS E 1 74 ? -32.894 -34.568 20.385  1.00 37.03 ? 73   CYS E C   1 
ATOM   3183 O  O   . CYS E 1 74 ? -31.805 -35.073 20.124  1.00 37.86 ? 73   CYS E O   1 
ATOM   3184 C  CB  A CYS E 1 74 ? -32.667 -32.210 19.532  0.50 30.06 ? 73   CYS E CB  1 
ATOM   3185 C  CB  B CYS E 1 74 ? -32.553 -32.270 19.541  0.50 30.46 ? 73   CYS E CB  1 
ATOM   3186 S  SG  A CYS E 1 74 ? -33.527 -30.603 19.592  0.50 23.85 ? 73   CYS E SG  1 
ATOM   3187 S  SG  B CYS E 1 74 ? -33.351 -32.712 18.025  0.50 36.34 ? 73   CYS E SG  1 
ATOM   3188 N  N   . THR E 1 75 ? -34.046 -35.222 20.406  1.00 41.52 ? 74   THR E N   1 
ATOM   3189 C  CA  . THR E 1 75 ? -34.203 -36.594 19.975  1.00 46.20 ? 74   THR E CA  1 
ATOM   3190 C  C   . THR E 1 75 ? -35.022 -36.582 18.692  1.00 42.62 ? 74   THR E C   1 
ATOM   3191 O  O   . THR E 1 75 ? -35.926 -35.753 18.524  1.00 38.73 ? 74   THR E O   1 
ATOM   3192 C  CB  . THR E 1 75 ? -34.927 -37.409 21.046  1.00 46.72 ? 74   THR E CB  1 
ATOM   3193 O  OG1 . THR E 1 75 ? -36.092 -36.695 21.483  1.00 53.25 ? 74   THR E OG1 1 
ATOM   3194 C  CG2 . THR E 1 75 ? -33.997 -37.645 22.243  1.00 49.90 ? 74   THR E CG2 1 
ATOM   3195 N  N   . GLY E 1 76 ? -34.680 -37.483 17.780  1.00 38.70 ? 75   GLY E N   1 
ATOM   3196 C  CA  . GLY E 1 76 ? -35.376 -37.590 16.514  1.00 34.67 ? 75   GLY E CA  1 
ATOM   3197 C  C   . GLY E 1 76 ? -34.664 -36.804 15.449  1.00 34.11 ? 75   GLY E C   1 
ATOM   3198 O  O   . GLY E 1 76 ? -33.748 -37.328 14.796  1.00 30.94 ? 75   GLY E O   1 
ATOM   3199 N  N   . SER E 1 77 ? -35.119 -35.562 15.266  1.00 27.11 ? 76   SER E N   1 
ATOM   3200 C  CA  . SER E 1 77 ? -34.559 -34.650 14.277  1.00 27.99 ? 76   SER E CA  1 
ATOM   3201 C  C   . SER E 1 77 ? -34.154 -33.381 14.988  1.00 23.99 ? 76   SER E C   1 
ATOM   3202 O  O   . SER E 1 77 ? -34.807 -32.941 15.936  1.00 25.84 ? 76   SER E O   1 
ATOM   3203 C  CB  . SER E 1 77 ? -35.563 -34.294 13.170  1.00 31.55 ? 76   SER E CB  1 
ATOM   3204 O  OG  . SER E 1 77 ? -35.543 -35.220 12.088  1.00 38.08 ? 76   SER E OG  1 
ATOM   3205 N  N   . LEU E 1 78 ? -33.077 -32.796 14.501  1.00 22.09 ? 77   LEU E N   1 
ATOM   3206 C  CA  . LEU E 1 78 ? -32.643 -31.507 14.961  1.00 18.02 ? 77   LEU E CA  1 
ATOM   3207 C  C   . LEU E 1 78 ? -33.115 -30.501 13.936  1.00 17.39 ? 77   LEU E C   1 
ATOM   3208 O  O   . LEU E 1 78 ? -32.664 -30.499 12.801  1.00 19.07 ? 77   LEU E O   1 
ATOM   3209 C  CB  . LEU E 1 78 ? -31.127 -31.474 15.119  1.00 21.16 ? 77   LEU E CB  1 
ATOM   3210 C  CG  . LEU E 1 78 ? -30.563 -30.070 15.392  1.00 16.12 ? 77   LEU E CG  1 
ATOM   3211 C  CD1 . LEU E 1 78 ? -31.064 -29.506 16.724  1.00 18.13 ? 77   LEU E CD1 1 
ATOM   3212 C  CD2 . LEU E 1 78 ? -29.028 -30.049 15.357  1.00 17.95 ? 77   LEU E CD2 1 
ATOM   3213 N  N   . ASN E 1 79 ? -34.039 -29.649 14.344  1.00 19.70 ? 78   ASN E N   1 
ATOM   3214 C  CA  . ASN E 1 79 ? -34.475 -28.520 13.519  1.00 17.38 ? 78   ASN E CA  1 
ATOM   3215 C  C   . ASN E 1 79 ? -33.791 -27.198 13.901  1.00 15.93 ? 78   ASN E C   1 
ATOM   3216 O  O   . ASN E 1 79 ? -33.789 -26.794 15.074  1.00 19.96 ? 78   ASN E O   1 
ATOM   3217 C  CB  . ASN E 1 79 ? -35.985 -28.360 13.652  1.00 19.96 ? 78   ASN E CB  1 
ATOM   3218 C  CG  . ASN E 1 79 ? -36.743 -29.637 13.244  1.00 27.91 ? 78   ASN E CG  1 
ATOM   3219 O  OD1 . ASN E 1 79 ? -36.457 -30.243 12.214  1.00 35.87 ? 78   ASN E OD1 1 
ATOM   3220 N  ND2 . ASN E 1 79 ? -37.669 -30.064 14.087  1.00 32.27 ? 78   ASN E ND2 1 
ATOM   3221 N  N   . MET E 1 80 ? -33.262 -26.507 12.896  1.00 16.34 ? 79   MET E N   1 
ATOM   3222 C  CA  . MET E 1 80 ? -32.634 -25.206 13.076  1.00 15.76 ? 79   MET E CA  1 
ATOM   3223 C  C   . MET E 1 80 ? -32.959 -24.289 11.911  1.00 18.70 ? 79   MET E C   1 
ATOM   3224 O  O   . MET E 1 80 ? -33.156 -24.743 10.791  1.00 20.25 ? 79   MET E O   1 
ATOM   3225 C  CB  . MET E 1 80 ? -31.104 -25.313 13.250  1.00 18.94 ? 79   MET E CB  1 
ATOM   3226 C  CG  . MET E 1 80 ? -30.670 -26.042 14.497  1.00 23.27 ? 79   MET E CG  1 
ATOM   3227 S  SD  . MET E 1 80 ? -28.850 -25.968 14.694  1.00 22.14 ? 79   MET E SD  1 
ATOM   3228 C  CE  . MET E 1 80 ? -28.231 -26.802 13.252  1.00 28.43 ? 79   MET E CE  1 
ATOM   3229 N  N   . THR E 1 81 ? -33.023 -22.991 12.211  1.00 17.01 ? 80   THR E N   1 
ATOM   3230 C  CA  . THR E 1 81 ? -33.006 -21.984 11.182  1.00 17.70 ? 80   THR E CA  1 
ATOM   3231 C  C   . THR E 1 81 ? -31.735 -21.134 11.340  1.00 20.34 ? 80   THR E C   1 
ATOM   3232 O  O   . THR E 1 81 ? -31.348 -20.801 12.473  1.00 18.95 ? 80   THR E O   1 
ATOM   3233 C  CB  A THR E 1 81 ? -34.251 -21.075 11.199  0.50 20.45 ? 80   THR E CB  1 
ATOM   3234 C  CB  B THR E 1 81 ? -34.283 -21.102 11.201  0.50 20.90 ? 80   THR E CB  1 
ATOM   3235 O  OG1 A THR E 1 81 ? -35.431 -21.856 10.940  0.50 22.23 ? 80   THR E OG1 1 
ATOM   3236 O  OG1 B THR E 1 81 ? -34.280 -20.227 12.339  0.50 19.54 ? 80   THR E OG1 1 
ATOM   3237 C  CG2 A THR E 1 81 ? -34.128 -19.973 10.141  0.50 16.21 ? 80   THR E CG2 1 
ATOM   3238 C  CG2 B THR E 1 81 ? -35.543 -21.980 11.237  0.50 16.70 ? 80   THR E CG2 1 
ATOM   3239 N  N   . LEU E 1 82 ? -31.099 -20.841 10.201  1.00 17.04 ? 81   LEU E N   1 
ATOM   3240 C  CA  . LEU E 1 82 ? -29.829 -20.113 10.162  1.00 16.36 ? 81   LEU E CA  1 
ATOM   3241 C  C   . LEU E 1 82 ? -29.815 -18.969 9.171   1.00 19.94 ? 81   LEU E C   1 
ATOM   3242 O  O   . LEU E 1 82 ? -30.583 -18.977 8.226   1.00 20.84 ? 81   LEU E O   1 
ATOM   3243 C  CB  . LEU E 1 82 ? -28.647 -21.042 9.848   1.00 15.01 ? 81   LEU E CB  1 
ATOM   3244 C  CG  . LEU E 1 82 ? -28.448 -22.216 10.832  1.00 18.47 ? 81   LEU E CG  1 
ATOM   3245 C  CD1 . LEU E 1 82 ? -29.227 -23.459 10.390  1.00 17.84 ? 81   LEU E CD1 1 
ATOM   3246 C  CD2 . LEU E 1 82 ? -26.969 -22.564 11.000  1.00 22.57 ? 81   LEU E CD2 1 
ATOM   3247 N  N   . GLN E 1 83 ? -28.939 -17.999 9.427   1.00 21.14 ? 82   GLN E N   1 
ATOM   3248 C  CA  . GLN E 1 83 ? -28.608 -16.944 8.488   1.00 19.28 ? 82   GLN E CA  1 
ATOM   3249 C  C   . GLN E 1 83 ? -27.307 -17.321 7.793   1.00 19.73 ? 82   GLN E C   1 
ATOM   3250 O  O   . GLN E 1 83 ? -26.351 -17.745 8.431   1.00 23.18 ? 82   GLN E O   1 
ATOM   3251 C  CB  . GLN E 1 83 ? -28.463 -15.646 9.260   1.00 22.62 ? 82   GLN E CB  1 
ATOM   3252 C  CG  . GLN E 1 83 ? -28.409 -14.389 8.444   1.00 28.62 ? 82   GLN E CG  1 
ATOM   3253 C  CD  . GLN E 1 83 ? -28.434 -13.175 9.344   1.00 37.03 ? 82   GLN E CD  1 
ATOM   3254 O  OE1 . GLN E 1 83 ? -29.189 -13.132 10.322  1.00 42.01 ? 82   GLN E OE1 1 
ATOM   3255 N  NE2 . GLN E 1 83 ? -27.599 -12.189 9.038   1.00 40.67 ? 82   GLN E NE2 1 
ATOM   3256 N  N   . ARG E 1 84 ? -27.278 -17.220 6.473   1.00 16.87 ? 83   ARG E N   1 
ATOM   3257 C  CA  . ARG E 1 84 ? -26.126 -17.678 5.664   1.00 21.26 ? 83   ARG E CA  1 
ATOM   3258 C  C   . ARG E 1 84 ? -24.971 -16.707 5.655   1.00 19.12 ? 83   ARG E C   1 
ATOM   3259 O  O   . ARG E 1 84 ? -24.634 -16.165 4.592   1.00 19.69 ? 83   ARG E O   1 
ATOM   3260 C  CB  . ARG E 1 84 ? -26.547 -17.849 4.208   1.00 22.47 ? 83   ARG E CB  1 
ATOM   3261 C  CG  . ARG E 1 84 ? -27.052 -19.141 3.871   1.00 44.26 ? 83   ARG E CG  1 
ATOM   3262 C  CD  . ARG E 1 84 ? -25.996 -20.033 3.293   1.00 43.57 ? 83   ARG E CD  1 
ATOM   3263 N  NE  . ARG E 1 84 ? -26.675 -21.282 3.020   1.00 33.20 ? 83   ARG E NE  1 
ATOM   3264 C  CZ  . ARG E 1 84 ? -26.330 -22.478 3.476   1.00 42.44 ? 83   ARG E CZ  1 
ATOM   3265 N  NH1 . ARG E 1 84 ? -25.218 -22.659 4.208   1.00 24.07 ? 83   ARG E NH1 1 
ATOM   3266 N  NH2 . ARG E 1 84 ? -27.112 -23.502 3.151   1.00 39.44 ? 83   ARG E NH2 1 
ATOM   3267 N  N   . GLU E 1 85 ? -24.389 -16.449 6.809   1.00 19.41 ? 84   GLU E N   1 
ATOM   3268 C  CA  . GLU E 1 85 ? -23.335 -15.470 6.912   1.00 20.33 ? 84   GLU E CA  1 
ATOM   3269 C  C   . GLU E 1 85 ? -22.005 -15.970 6.363   1.00 21.94 ? 84   GLU E C   1 
ATOM   3270 O  O   . GLU E 1 85 ? -21.052 -15.209 6.238   1.00 21.95 ? 84   GLU E O   1 
ATOM   3271 C  CB  . GLU E 1 85 ? -23.204 -15.002 8.352   1.00 20.40 ? 84   GLU E CB  1 
ATOM   3272 C  CG  . GLU E 1 85 ? -24.326 -14.113 8.789   1.00 26.47 ? 84   GLU E CG  1 
ATOM   3273 C  CD  . GLU E 1 85 ? -24.312 -12.785 8.053   1.00 39.12 ? 84   GLU E CD  1 
ATOM   3274 O  OE1 . GLU E 1 85 ? -23.223 -12.166 7.969   1.00 40.68 ? 84   GLU E OE1 1 
ATOM   3275 O  OE2 . GLU E 1 85 ? -25.377 -12.372 7.546   1.00 49.00 ? 84   GLU E OE2 1 
ATOM   3276 N  N   . SER E 1 86 ? -21.958 -17.241 5.995   1.00 18.02 ? 85   SER E N   1 
ATOM   3277 C  CA  . SER E 1 86 ? -20.781 -17.812 5.297   1.00 19.97 ? 85   SER E CA  1 
ATOM   3278 C  C   . SER E 1 86 ? -20.632 -17.297 3.847   1.00 18.11 ? 85   SER E C   1 
ATOM   3279 O  O   . SER E 1 86 ? -19.585 -17.483 3.205   1.00 14.83 ? 85   SER E O   1 
ATOM   3280 C  CB  . SER E 1 86 ? -20.869 -19.320 5.342   1.00 15.00 ? 85   SER E CB  1 
ATOM   3281 O  OG  . SER E 1 86 ? -22.016 -19.775 4.659   1.00 20.72 ? 85   SER E OG  1 
ATOM   3282 N  N   . ASP E 1 87 ? -21.696 -16.690 3.294   1.00 16.88 ? 86   ASP E N   1 
ATOM   3283 C  CA  . ASP E 1 87 ? -21.567 -15.923 2.061   1.00 22.50 ? 86   ASP E CA  1 
ATOM   3284 C  C   . ASP E 1 87 ? -20.852 -14.625 2.395   1.00 25.24 ? 86   ASP E C   1 
ATOM   3285 O  O   . ASP E 1 87 ? -21.418 -13.780 3.089   1.00 27.85 ? 86   ASP E O   1 
ATOM   3286 C  CB  . ASP E 1 87 ? -22.950 -15.645 1.439   1.00 24.21 ? 86   ASP E CB  1 
ATOM   3287 C  CG  . ASP E 1 87 ? -23.525 -16.863 0.742   1.00 25.25 ? 86   ASP E CG  1 
ATOM   3288 O  OD1 . ASP E 1 87 ? -22.744 -17.648 0.138   1.00 26.84 ? 86   ASP E OD1 1 
ATOM   3289 O  OD2 . ASP E 1 87 ? -24.764 -17.034 0.766   1.00 34.28 ? 86   ASP E OD2 1 
ATOM   3290 N  N   . LEU E 1 88 ? -19.619 -14.465 1.926   1.00 18.42 ? 87   LEU E N   1 
ATOM   3291 C  CA  . LEU E 1 88 ? -18.788 -13.341 2.367   1.00 17.69 ? 87   LEU E CA  1 
ATOM   3292 C  C   . LEU E 1 88 ? -18.927 -12.148 1.449   1.00 17.86 ? 87   LEU E C   1 
ATOM   3293 O  O   . LEU E 1 88 ? -19.249 -12.243 0.260   1.00 23.90 ? 87   LEU E O   1 
ATOM   3294 C  CB  . LEU E 1 88 ? -17.320 -13.764 2.521   1.00 15.12 ? 87   LEU E CB  1 
ATOM   3295 C  CG  . LEU E 1 88 ? -17.072 -14.950 3.439   1.00 16.80 ? 87   LEU E CG  1 
ATOM   3296 C  CD1 . LEU E 1 88 ? -15.582 -15.326 3.436   1.00 15.48 ? 87   LEU E CD1 1 
ATOM   3297 C  CD2 . LEU E 1 88 ? -17.506 -14.599 4.836   1.00 23.02 ? 87   LEU E CD2 1 
ATOM   3298 O  OXT . LEU E 1 88 ? -18.749 -11.011 1.905   1.00 23.60 ? 87   LEU E OXT 1 
HETATM 3299 CL CL  . CL  F 2 .  ? 9.856   0.167   17.392  1.00 39.09 ? 1088 CL  B CL  1 
HETATM 3300 C  C1  . EDO G 3 .  ? 3.072   -3.955  18.463  1.00 34.77 ? 1089 EDO B C1  1 
HETATM 3301 O  O1  . EDO G 3 .  ? 3.383   -3.870  17.092  1.00 27.88 ? 1089 EDO B O1  1 
HETATM 3302 C  C2  . EDO G 3 .  ? 4.094   -3.179  19.245  1.00 35.05 ? 1089 EDO B C2  1 
HETATM 3303 O  O2  . EDO G 3 .  ? 3.508   -1.898  19.450  1.00 33.44 ? 1089 EDO B O2  1 
HETATM 3304 CL CL  . CL  H 2 .  ? -22.184 -19.667 33.733  1.00 25.90 ? 1088 CL  C CL  1 
HETATM 3305 CL CL  . CL  I 2 .  ? 16.874  12.649  38.257  1.00 30.30 ? 1088 CL  D CL  1 
HETATM 3306 CL CL  . CL  J 2 .  ? 24.354  2.408   45.137  1.00 33.80 ? 1089 CL  D CL  1 
HETATM 3307 C  C1  . EDO K 3 .  ? 15.088  -6.613  38.775  1.00 27.25 ? 1090 EDO D C1  1 
HETATM 3308 O  O1  . EDO K 3 .  ? 15.931  -6.500  37.609  1.00 23.03 ? 1090 EDO D O1  1 
HETATM 3309 C  C2  . EDO K 3 .  ? 14.997  -8.059  39.269  1.00 31.65 ? 1090 EDO D C2  1 
HETATM 3310 O  O2  . EDO K 3 .  ? 16.309  -8.647  39.512  1.00 37.85 ? 1090 EDO D O2  1 
HETATM 3311 CL CL  . CL  L 2 .  ? -15.061 -24.609 17.595  1.00 31.76 ? 1088 CL  E CL  1 
HETATM 3312 CL CL  . CL  M 2 .  ? -35.962 -24.004 14.198  1.00 27.22 ? 1089 CL  E CL  1 
HETATM 3313 O  O   . HOH N 4 .  ? -6.485  1.450   9.008   1.00 54.21 ? 2001 HOH A O   1 
HETATM 3314 O  O   . HOH N 4 .  ? -4.028  6.098   1.389   1.00 55.66 ? 2002 HOH A O   1 
HETATM 3315 O  O   . HOH N 4 .  ? 4.777   14.225  5.436   1.00 43.17 ? 2003 HOH A O   1 
HETATM 3316 O  O   . HOH N 4 .  ? 1.109   9.861   7.548   1.00 34.87 ? 2004 HOH A O   1 
HETATM 3317 O  O   . HOH N 4 .  ? -1.419  7.907   3.975   1.00 37.21 ? 2005 HOH A O   1 
HETATM 3318 O  O   . HOH N 4 .  ? 3.655   11.704  0.447   1.00 40.16 ? 2006 HOH A O   1 
HETATM 3319 O  O   . HOH N 4 .  ? 7.962   12.820  6.192   1.00 39.36 ? 2007 HOH A O   1 
HETATM 3320 O  O   . HOH N 4 .  ? 13.820  14.538  5.564   1.00 41.68 ? 2008 HOH A O   1 
HETATM 3321 O  O   . HOH N 4 .  ? 18.218  14.890  -4.639  1.00 39.53 ? 2009 HOH A O   1 
HETATM 3322 O  O   . HOH N 4 .  ? 24.014  14.176  -0.613  1.00 43.15 ? 2010 HOH A O   1 
HETATM 3323 O  O   . HOH N 4 .  ? 21.272  12.686  1.941   1.00 46.81 ? 2011 HOH A O   1 
HETATM 3324 O  O   . HOH N 4 .  ? 20.061  9.631   4.168   1.00 30.50 ? 2012 HOH A O   1 
HETATM 3325 O  O   . HOH N 4 .  ? -2.631  -5.585  17.222  1.00 44.48 ? 2013 HOH A O   1 
HETATM 3326 O  O   . HOH N 4 .  ? 17.548  6.049   6.674   1.00 26.28 ? 2014 HOH A O   1 
HETATM 3327 O  O   . HOH N 4 .  ? 18.037  -3.788  -2.774  1.00 39.27 ? 2015 HOH A O   1 
HETATM 3328 O  O   . HOH N 4 .  ? 15.049  -10.733 2.521   1.00 40.85 ? 2016 HOH A O   1 
HETATM 3329 O  O   . HOH N 4 .  ? 14.027  -7.957  -4.595  1.00 31.06 ? 2017 HOH A O   1 
HETATM 3330 O  O   . HOH N 4 .  ? 2.864   -8.830  -5.224  1.00 37.67 ? 2018 HOH A O   1 
HETATM 3331 O  O   . HOH N 4 .  ? 6.271   -15.840 -5.721  1.00 38.21 ? 2019 HOH A O   1 
HETATM 3332 O  O   . HOH N 4 .  ? 4.749   -3.808  -16.059 1.00 30.12 ? 2020 HOH A O   1 
HETATM 3333 O  O   . HOH N 4 .  ? 6.504   -5.305  -15.723 1.00 40.56 ? 2021 HOH A O   1 
HETATM 3334 O  O   . HOH N 4 .  ? 6.838   -7.514  1.972   1.00 33.40 ? 2022 HOH A O   1 
HETATM 3335 O  O   . HOH N 4 .  ? 18.029  -6.806  3.754   1.00 39.51 ? 2023 HOH A O   1 
HETATM 3336 O  O   . HOH N 4 .  ? 18.352  -5.043  1.008   1.00 20.26 ? 2024 HOH A O   1 
HETATM 3337 O  O   . HOH N 4 .  ? 16.919  -5.938  6.897   1.00 20.07 ? 2025 HOH A O   1 
HETATM 3338 O  O   . HOH N 4 .  ? 20.172  1.122   3.820   1.00 37.01 ? 2026 HOH A O   1 
HETATM 3339 O  O   . HOH N 4 .  ? 19.392  -2.068  7.314   1.00 30.87 ? 2027 HOH A O   1 
HETATM 3340 O  O   . HOH N 4 .  ? -0.635  -4.990  15.567  1.00 31.45 ? 2028 HOH A O   1 
HETATM 3341 O  O   . HOH N 4 .  ? 23.235  1.916   8.970   1.00 42.30 ? 2029 HOH A O   1 
HETATM 3342 O  O   . HOH N 4 .  ? 13.824  12.688  7.358   1.00 44.17 ? 2030 HOH A O   1 
HETATM 3343 O  O   . HOH N 4 .  ? 10.883  8.997   13.822  1.00 61.72 ? 2031 HOH A O   1 
HETATM 3344 O  O   . HOH N 4 .  ? 16.161  13.786  8.267   1.00 43.28 ? 2032 HOH A O   1 
HETATM 3345 O  O   . HOH N 4 .  ? 19.526  11.662  14.053  1.00 47.61 ? 2033 HOH A O   1 
HETATM 3346 O  O   . HOH N 4 .  ? 11.335  13.035  11.146  1.00 42.71 ? 2034 HOH A O   1 
HETATM 3347 O  O   . HOH N 4 .  ? 7.848   11.060  8.675   1.00 45.45 ? 2035 HOH A O   1 
HETATM 3348 O  O   . HOH N 4 .  ? 11.177  3.538   13.732  1.00 49.45 ? 2036 HOH A O   1 
HETATM 3349 O  O   . HOH N 4 .  ? 12.634  4.176   11.422  1.00 31.94 ? 2037 HOH A O   1 
HETATM 3350 O  O   . HOH N 4 .  ? 10.947  -2.812  11.177  1.00 25.63 ? 2038 HOH A O   1 
HETATM 3351 O  O   . HOH N 4 .  ? 13.010  -0.621  10.920  1.00 24.31 ? 2039 HOH A O   1 
HETATM 3352 O  O   . HOH N 4 .  ? 6.620   -6.712  4.558   1.00 26.30 ? 2040 HOH A O   1 
HETATM 3353 O  O   . HOH N 4 .  ? 4.252   -2.577  -3.594  1.00 23.01 ? 2041 HOH A O   1 
HETATM 3354 O  O   . HOH N 4 .  ? -1.095  2.349   -4.465  1.00 33.76 ? 2042 HOH A O   1 
HETATM 3355 O  O   . HOH N 4 .  ? 3.167   9.102   -2.993  1.00 29.42 ? 2043 HOH A O   1 
HETATM 3356 O  O   . HOH N 4 .  ? 4.932   11.758  -10.109 1.00 40.28 ? 2044 HOH A O   1 
HETATM 3357 O  O   . HOH N 4 .  ? -2.132  5.964   -6.881  1.00 46.31 ? 2045 HOH A O   1 
HETATM 3358 O  O   . HOH N 4 .  ? -1.628  5.503   -10.324 1.00 31.53 ? 2046 HOH A O   1 
HETATM 3359 O  O   . HOH N 4 .  ? 5.761   -3.196  -7.260  1.00 28.69 ? 2047 HOH A O   1 
HETATM 3360 O  O   . HOH N 4 .  ? 0.541   -4.926  -0.836  1.00 52.34 ? 2048 HOH A O   1 
HETATM 3361 O  O   . HOH N 4 .  ? 2.197   -5.597  -5.158  1.00 34.41 ? 2049 HOH A O   1 
HETATM 3362 O  O   . HOH N 4 .  ? 1.874   -4.133  -3.028  1.00 34.43 ? 2050 HOH A O   1 
HETATM 3363 O  O   . HOH N 4 .  ? 4.689   -5.486  -6.351  1.00 36.43 ? 2051 HOH A O   1 
HETATM 3364 O  O   . HOH N 4 .  ? 2.378   -0.220  -10.188 1.00 30.93 ? 2052 HOH A O   1 
HETATM 3365 O  O   . HOH N 4 .  ? 11.987  -2.793  -15.542 1.00 30.52 ? 2053 HOH A O   1 
HETATM 3366 O  O   . HOH N 4 .  ? 17.931  -3.221  -5.380  1.00 20.40 ? 2054 HOH A O   1 
HETATM 3367 O  O   . HOH N 4 .  ? 9.433   -2.978  -17.114 1.00 41.09 ? 2055 HOH A O   1 
HETATM 3368 O  O   . HOH N 4 .  ? 10.304  4.713   -13.242 1.00 30.88 ? 2056 HOH A O   1 
HETATM 3369 O  O   . HOH N 4 .  ? 5.510   -2.413  -14.278 1.00 48.20 ? 2057 HOH A O   1 
HETATM 3370 O  O   . HOH N 4 .  ? 11.543  3.933   -15.407 1.00 41.48 ? 2058 HOH A O   1 
HETATM 3371 O  O   . HOH N 4 .  ? 15.495  7.998   -12.794 1.00 41.51 ? 2059 HOH A O   1 
HETATM 3372 O  O   . HOH N 4 .  ? 12.950  1.978   -15.058 1.00 42.13 ? 2060 HOH A O   1 
HETATM 3373 O  O   . HOH N 4 .  ? 11.314  7.167   -13.609 1.00 39.58 ? 2061 HOH A O   1 
HETATM 3374 O  O   . HOH N 4 .  ? 4.469   11.610  -12.956 1.00 52.83 ? 2062 HOH A O   1 
HETATM 3375 O  O   . HOH N 4 .  ? 10.809  10.718  -10.470 1.00 46.01 ? 2063 HOH A O   1 
HETATM 3376 O  O   . HOH N 4 .  ? 20.547  2.781   -10.832 1.00 27.87 ? 2064 HOH A O   1 
HETATM 3377 O  O   . HOH N 4 .  ? 16.850  16.748  -4.341  1.00 32.87 ? 2065 HOH A O   1 
HETATM 3378 O  O   . HOH N 4 .  ? -1.079  -2.265  8.336   1.00 41.22 ? 2066 HOH A O   1 
HETATM 3379 O  O   . HOH N 4 .  ? 1.423   4.478   10.946  1.00 41.28 ? 2067 HOH A O   1 
HETATM 3380 O  O   . HOH N 4 .  ? 3.540   -8.020  2.399   1.00 49.03 ? 2068 HOH A O   1 
HETATM 3381 O  O   . HOH N 4 .  ? 1.353   -6.560  1.360   1.00 42.03 ? 2069 HOH A O   1 
HETATM 3382 O  O   . HOH N 4 .  ? 0.262   -8.170  3.688   1.00 44.60 ? 2070 HOH A O   1 
HETATM 3383 O  O   . HOH N 4 .  ? 3.524   -8.583  5.920   1.00 42.92 ? 2071 HOH A O   1 
HETATM 3384 O  O   . HOH N 4 .  ? 9.215   -4.760  13.733  1.00 17.82 ? 2072 HOH A O   1 
HETATM 3385 O  O   . HOH N 4 .  ? 1.037   -5.577  9.806   1.00 53.94 ? 2073 HOH A O   1 
HETATM 3386 O  O   . HOH N 4 .  ? 2.215   -3.103  10.728  1.00 35.08 ? 2074 HOH A O   1 
HETATM 3387 O  O   . HOH N 4 .  ? 2.222   0.903   14.911  1.00 45.81 ? 2075 HOH A O   1 
HETATM 3388 O  O   . HOH N 4 .  ? 2.821   -10.958 12.108  1.00 28.87 ? 2076 HOH A O   1 
HETATM 3389 O  O   . HOH N 4 .  ? 1.561   -5.843  16.780  1.00 21.18 ? 2077 HOH A O   1 
HETATM 3390 O  O   . HOH O 4 .  ? 16.684  -17.557 33.214  1.00 43.56 ? 2001 HOH B O   1 
HETATM 3391 O  O   . HOH O 4 .  ? 20.820  -11.615 30.486  1.00 53.57 ? 2002 HOH B O   1 
HETATM 3392 O  O   . HOH O 4 .  ? 11.349  -16.901 32.946  1.00 35.24 ? 2003 HOH B O   1 
HETATM 3393 O  O   . HOH O 4 .  ? 24.398  -16.152 27.533  1.00 53.35 ? 2004 HOH B O   1 
HETATM 3394 O  O   . HOH O 4 .  ? 13.357  -19.117 31.478  1.00 27.49 ? 2005 HOH B O   1 
HETATM 3395 O  O   . HOH O 4 .  ? 22.340  -15.398 28.864  1.00 57.28 ? 2006 HOH B O   1 
HETATM 3396 O  O   . HOH O 4 .  ? -7.708  -14.018 13.836  1.00 44.58 ? 2007 HOH B O   1 
HETATM 3397 O  O   . HOH O 4 .  ? 10.136  -23.936 26.850  1.00 45.99 ? 2008 HOH B O   1 
HETATM 3398 O  O   . HOH O 4 .  ? 7.539   -21.646 25.496  1.00 38.25 ? 2009 HOH B O   1 
HETATM 3399 O  O   . HOH O 4 .  ? 11.401  -20.139 29.574  1.00 26.16 ? 2010 HOH B O   1 
HETATM 3400 O  O   . HOH O 4 .  ? 9.326   -21.774 22.482  1.00 28.17 ? 2011 HOH B O   1 
HETATM 3401 O  O   . HOH O 4 .  ? 4.687   -18.648 26.016  1.00 29.08 ? 2012 HOH B O   1 
HETATM 3402 O  O   . HOH O 4 .  ? -5.800  -11.874 13.448  1.00 32.01 ? 2013 HOH B O   1 
HETATM 3403 O  O   . HOH O 4 .  ? -0.673  -15.561 11.923  1.00 27.95 ? 2014 HOH B O   1 
HETATM 3404 O  O   . HOH O 4 .  ? -3.491  -11.975 17.647  1.00 38.33 ? 2015 HOH B O   1 
HETATM 3405 O  O   . HOH O 4 .  ? -1.327  -9.596  20.002  1.00 23.08 ? 2016 HOH B O   1 
HETATM 3406 O  O   . HOH O 4 .  ? 2.053   -7.743  23.089  1.00 17.61 ? 2017 HOH B O   1 
HETATM 3407 O  O   . HOH O 4 .  ? 10.081  -2.127  13.548  1.00 27.66 ? 2018 HOH B O   1 
HETATM 3408 O  O   . HOH O 4 .  ? 11.251  -1.043  15.072  1.00 44.64 ? 2019 HOH B O   1 
HETATM 3409 O  O   . HOH O 4 .  ? 17.196  -2.300  23.229  1.00 29.95 ? 2020 HOH B O   1 
HETATM 3410 O  O   . HOH O 4 .  ? 16.646  2.128   20.442  1.00 39.92 ? 2021 HOH B O   1 
HETATM 3411 O  O   . HOH O 4 .  ? 16.660  -1.318  13.857  1.00 30.01 ? 2022 HOH B O   1 
HETATM 3412 O  O   . HOH O 4 .  ? 25.337  -8.618  15.471  1.00 42.74 ? 2023 HOH B O   1 
HETATM 3413 O  O   . HOH O 4 .  ? 30.723  -9.053  15.180  1.00 43.23 ? 2024 HOH B O   1 
HETATM 3414 O  O   . HOH O 4 .  ? 26.170  -4.388  18.986  1.00 43.39 ? 2025 HOH B O   1 
HETATM 3415 O  O   . HOH O 4 .  ? 27.959  -7.097  12.224  1.00 46.83 ? 2026 HOH B O   1 
HETATM 3416 O  O   . HOH O 4 .  ? 13.449  -14.232 4.216   1.00 30.24 ? 2027 HOH B O   1 
HETATM 3417 O  O   . HOH O 4 .  ? 22.370  -9.509  14.894  1.00 35.76 ? 2028 HOH B O   1 
HETATM 3418 O  O   . HOH O 4 .  ? 18.823  -4.012  19.072  1.00 21.80 ? 2029 HOH B O   1 
HETATM 3419 O  O   . HOH O 4 .  ? 19.695  -11.290 18.084  1.00 23.36 ? 2030 HOH B O   1 
HETATM 3420 O  O   . HOH O 4 .  ? 15.170  -2.545  21.475  1.00 28.32 ? 2031 HOH B O   1 
HETATM 3421 O  O   . HOH O 4 .  ? 9.242   1.867   21.446  1.00 29.71 ? 2032 HOH B O   1 
HETATM 3422 O  O   . HOH O 4 .  ? 6.513   1.939   21.140  1.00 35.62 ? 2033 HOH B O   1 
HETATM 3423 O  O   . HOH O 4 .  ? 22.976  -17.554 23.269  1.00 29.24 ? 2034 HOH B O   1 
HETATM 3424 O  O   . HOH O 4 .  ? 2.576   0.070   22.391  1.00 48.50 ? 2035 HOH B O   1 
HETATM 3425 O  O   . HOH O 4 .  ? 23.450  -4.206  33.703  1.00 46.20 ? 2036 HOH B O   1 
HETATM 3426 O  O   . HOH O 4 .  ? -3.148  -2.343  22.624  1.00 55.46 ? 2037 HOH B O   1 
HETATM 3427 O  O   . HOH O 4 .  ? -0.407  -0.849  22.970  1.00 42.03 ? 2038 HOH B O   1 
HETATM 3428 O  O   . HOH O 4 .  ? -0.421  -7.802  28.987  1.00 38.29 ? 2039 HOH B O   1 
HETATM 3429 O  O   . HOH O 4 .  ? -6.414  -6.183  23.704  1.00 44.77 ? 2040 HOH B O   1 
HETATM 3430 O  O   . HOH O 4 .  ? 0.223   -14.726 24.947  1.00 32.34 ? 2041 HOH B O   1 
HETATM 3431 O  O   . HOH O 4 .  ? -6.077  -15.671 19.117  1.00 41.74 ? 2042 HOH B O   1 
HETATM 3432 O  O   . HOH O 4 .  ? 2.212   -15.700 30.695  1.00 52.70 ? 2043 HOH B O   1 
HETATM 3433 O  O   . HOH O 4 .  ? 5.263   -8.413  29.229  1.00 30.60 ? 2044 HOH B O   1 
HETATM 3434 O  O   . HOH O 4 .  ? 6.625   -8.720  31.661  1.00 30.86 ? 2045 HOH B O   1 
HETATM 3435 O  O   . HOH O 4 .  ? 8.115   -4.352  28.793  1.00 18.65 ? 2046 HOH B O   1 
HETATM 3436 O  O   . HOH O 4 .  ? 18.406  -4.500  24.895  1.00 25.47 ? 2047 HOH B O   1 
HETATM 3437 O  O   . HOH O 4 .  ? 9.513   -24.364 17.008  1.00 46.81 ? 2048 HOH B O   1 
HETATM 3438 O  O   . HOH O 4 .  ? 7.189   -21.165 15.781  1.00 28.43 ? 2049 HOH B O   1 
HETATM 3439 O  O   . HOH O 4 .  ? 18.874  -23.808 16.187  1.00 48.38 ? 2050 HOH B O   1 
HETATM 3440 O  O   . HOH O 4 .  ? 12.723  -20.668 19.134  1.00 22.84 ? 2051 HOH B O   1 
HETATM 3441 O  O   . HOH O 4 .  ? 19.926  -22.748 14.026  1.00 38.58 ? 2052 HOH B O   1 
HETATM 3442 O  O   . HOH O 4 .  ? 21.164  -16.634 18.842  1.00 25.95 ? 2053 HOH B O   1 
HETATM 3443 O  O   . HOH O 4 .  ? 26.397  -14.455 12.838  1.00 33.25 ? 2054 HOH B O   1 
HETATM 3444 O  O   . HOH O 4 .  ? 20.188  -10.998 13.809  1.00 31.60 ? 2055 HOH B O   1 
HETATM 3445 O  O   . HOH O 4 .  ? 17.472  -9.045  4.159   1.00 28.31 ? 2056 HOH B O   1 
HETATM 3446 O  O   . HOH O 4 .  ? 13.379  -15.208 6.651   1.00 22.33 ? 2057 HOH B O   1 
HETATM 3447 O  O   . HOH O 4 .  ? 8.461   -8.289  6.487   0.50 21.73 ? 2058 HOH B O   1 
HETATM 3448 O  O   . HOH O 4 .  ? 10.590  -6.399  12.432  1.00 25.99 ? 2059 HOH B O   1 
HETATM 3449 O  O   . HOH O 4 .  ? 7.015   -14.441 5.667   1.00 33.98 ? 2060 HOH B O   1 
HETATM 3450 O  O   . HOH O 4 .  ? 8.539   -18.985 9.490   1.00 28.57 ? 2061 HOH B O   1 
HETATM 3451 O  O   . HOH O 4 .  ? 11.049  -16.529 6.139   1.00 39.04 ? 2062 HOH B O   1 
HETATM 3452 O  O   . HOH O 4 .  ? 2.378   -14.924 11.505  1.00 29.00 ? 2063 HOH B O   1 
HETATM 3453 O  O   . HOH O 4 .  ? 5.755   -19.758 5.884   1.00 46.01 ? 2064 HOH B O   1 
HETATM 3454 O  O   . HOH O 4 .  ? 0.225   -17.434 12.251  1.00 32.09 ? 2065 HOH B O   1 
HETATM 3455 O  O   . HOH O 4 .  ? -0.610  -24.568 11.363  1.00 43.68 ? 2066 HOH B O   1 
HETATM 3456 O  O   . HOH O 4 .  ? 5.110   -22.284 11.093  1.00 43.82 ? 2067 HOH B O   1 
HETATM 3457 O  O   . HOH O 4 .  ? 5.055   -22.831 13.968  1.00 49.73 ? 2068 HOH B O   1 
HETATM 3458 O  O   . HOH O 4 .  ? 0.787   -23.884 6.465   1.00 49.50 ? 2069 HOH B O   1 
HETATM 3459 O  O   . HOH O 4 .  ? -1.844  -19.383 13.049  1.00 26.04 ? 2070 HOH B O   1 
HETATM 3460 O  O   . HOH O 4 .  ? 1.505   -23.102 21.745  1.00 47.28 ? 2071 HOH B O   1 
HETATM 3461 O  O   . HOH O 4 .  ? 2.398   -24.920 16.312  1.00 36.33 ? 2072 HOH B O   1 
HETATM 3462 O  O   . HOH O 4 .  ? 4.613   -25.304 18.370  1.00 41.95 ? 2073 HOH B O   1 
HETATM 3463 O  O   . HOH O 4 .  ? 18.408  -20.084 21.770  1.00 41.21 ? 2074 HOH B O   1 
HETATM 3464 O  O   . HOH O 4 .  ? 11.749  -21.752 21.189  1.00 44.80 ? 2075 HOH B O   1 
HETATM 3465 O  O   . HOH O 4 .  ? 22.136  -16.295 25.796  1.00 41.00 ? 2076 HOH B O   1 
HETATM 3466 O  O   . HOH O 4 .  ? 13.331  -14.716 32.556  1.00 35.58 ? 2077 HOH B O   1 
HETATM 3467 O  O   . HOH O 4 .  ? 21.614  -4.880  29.397  1.00 56.77 ? 2078 HOH B O   1 
HETATM 3468 O  O   . HOH O 4 .  ? 12.854  -2.809  32.493  1.00 19.28 ? 2079 HOH B O   1 
HETATM 3469 O  O   . HOH O 4 .  ? 13.917  -9.313  32.629  1.00 29.21 ? 2080 HOH B O   1 
HETATM 3470 O  O   . HOH O 4 .  ? 15.104  -11.620 35.253  1.00 36.10 ? 2081 HOH B O   1 
HETATM 3471 O  O   . HOH O 4 .  ? 21.205  -3.354  31.574  1.00 37.15 ? 2082 HOH B O   1 
HETATM 3472 O  O   . HOH O 4 .  ? 17.460  -8.934  31.569  1.00 34.61 ? 2083 HOH B O   1 
HETATM 3473 O  O   . HOH O 4 .  ? 21.079  -6.636  34.242  1.00 41.79 ? 2084 HOH B O   1 
HETATM 3474 O  O   . HOH O 4 .  ? 21.379  -1.122  33.197  1.00 25.71 ? 2085 HOH B O   1 
HETATM 3475 O  O   . HOH P 4 .  ? -2.296  -23.225 27.219  1.00 35.79 ? 2001 HOH C O   1 
HETATM 3476 O  O   . HOH P 4 .  ? -0.781  -16.882 41.419  1.00 29.13 ? 2002 HOH C O   1 
HETATM 3477 O  O   . HOH P 4 .  ? -5.132  -29.513 25.114  1.00 27.97 ? 2003 HOH C O   1 
HETATM 3478 O  O   . HOH P 4 .  ? -4.070  -32.964 25.897  1.00 24.30 ? 2004 HOH C O   1 
HETATM 3479 O  O   . HOH P 4 .  ? -5.396  -36.023 28.720  1.00 46.81 ? 2005 HOH C O   1 
HETATM 3480 O  O   . HOH P 4 .  ? -9.859  -13.812 31.023  1.00 29.03 ? 2006 HOH C O   1 
HETATM 3481 O  O   . HOH P 4 .  ? -5.775  -13.293 29.955  1.00 48.19 ? 2007 HOH C O   1 
HETATM 3482 O  O   . HOH P 4 .  ? -2.486  -30.487 33.084  1.00 22.11 ? 2008 HOH C O   1 
HETATM 3483 O  O   . HOH P 4 .  ? 3.092   -26.676 32.849  1.00 21.96 ? 2009 HOH C O   1 
HETATM 3484 O  O   . HOH P 4 .  ? -2.576  -25.851 27.775  1.00 20.13 ? 2010 HOH C O   1 
HETATM 3485 O  O   . HOH P 4 .  ? -26.432 -26.777 37.491  1.00 41.44 ? 2011 HOH C O   1 
HETATM 3486 O  O   . HOH P 4 .  ? -1.852  -19.901 29.558  1.00 20.16 ? 2012 HOH C O   1 
HETATM 3487 O  O   . HOH P 4 .  ? 3.236   -15.506 34.815  1.00 35.36 ? 2013 HOH C O   1 
HETATM 3488 O  O   . HOH P 4 .  ? -4.661  -13.483 40.486  1.00 25.49 ? 2014 HOH C O   1 
HETATM 3489 O  O   . HOH P 4 .  ? -3.513  -16.207 40.893  1.00 29.79 ? 2015 HOH C O   1 
HETATM 3490 O  O   . HOH P 4 .  ? -4.000  -11.253 36.274  1.00 48.75 ? 2016 HOH C O   1 
HETATM 3491 O  O   . HOH P 4 .  ? -4.767  -13.761 33.816  1.00 26.04 ? 2017 HOH C O   1 
HETATM 3492 O  O   . HOH P 4 .  ? -7.649  -15.289 31.331  1.00 18.76 ? 2018 HOH C O   1 
HETATM 3493 O  O   . HOH P 4 .  ? -10.886 -17.875 28.382  1.00 14.33 ? 2019 HOH C O   1 
HETATM 3494 O  O   . HOH P 4 .  ? -13.666 -17.774 22.946  1.00 44.69 ? 2020 HOH C O   1 
HETATM 3495 O  O   . HOH P 4 .  ? -11.396 -19.379 20.486  1.00 53.41 ? 2021 HOH C O   1 
HETATM 3496 O  O   . HOH P 4 .  ? -20.992 -13.671 30.966  1.00 48.66 ? 2022 HOH C O   1 
HETATM 3497 O  O   . HOH P 4 .  ? -20.452 -19.815 38.072  1.00 24.82 ? 2023 HOH C O   1 
HETATM 3498 O  O   . HOH P 4 .  ? -15.147 -21.932 22.003  1.00 50.28 ? 2024 HOH C O   1 
HETATM 3499 O  O   . HOH P 4 .  ? -27.217 -24.093 31.996  1.00 40.25 ? 2025 HOH C O   1 
HETATM 3500 O  O   . HOH P 4 .  ? -24.214 -24.797 38.815  1.00 36.85 ? 2026 HOH C O   1 
HETATM 3501 O  O   . HOH P 4 .  ? -8.574  -38.849 38.606  1.00 33.33 ? 2027 HOH C O   1 
HETATM 3502 O  O   . HOH P 4 .  ? -20.408 -34.650 39.665  1.00 39.55 ? 2028 HOH C O   1 
HETATM 3503 O  O   . HOH P 4 .  ? -29.156 -31.301 43.036  1.00 33.31 ? 2029 HOH C O   1 
HETATM 3504 O  O   . HOH P 4 .  ? -21.284 -26.244 46.133  1.00 14.80 ? 2030 HOH C O   1 
HETATM 3505 O  O   . HOH P 4 .  ? -27.179 -28.487 45.089  1.00 27.48 ? 2031 HOH C O   1 
HETATM 3506 O  O   . HOH P 4 .  ? -23.287 -28.242 48.384  1.00 30.60 ? 2032 HOH C O   1 
HETATM 3507 O  O   . HOH P 4 .  ? -23.175 -33.048 47.720  1.00 34.12 ? 2033 HOH C O   1 
HETATM 3508 O  O   . HOH P 4 .  ? -23.339 -34.113 38.923  1.00 34.02 ? 2034 HOH C O   1 
HETATM 3509 O  O   . HOH P 4 .  ? -27.418 -35.671 41.239  1.00 54.20 ? 2035 HOH C O   1 
HETATM 3510 O  O   . HOH P 4 .  ? -19.928 -29.942 51.141  1.00 32.84 ? 2036 HOH C O   1 
HETATM 3511 O  O   . HOH P 4 .  ? -17.151 -27.125 51.124  1.00 34.51 ? 2037 HOH C O   1 
HETATM 3512 O  O   . HOH P 4 .  ? -29.141 -30.496 34.835  1.00 31.78 ? 2038 HOH C O   1 
HETATM 3513 O  O   . HOH P 4 .  ? -8.843  -26.631 47.764  1.00 49.34 ? 2039 HOH C O   1 
HETATM 3514 O  O   . HOH P 4 .  ? -10.405 -22.888 50.300  1.00 54.60 ? 2040 HOH C O   1 
HETATM 3515 O  O   . HOH P 4 .  ? -6.523  -25.606 47.524  1.00 38.47 ? 2041 HOH C O   1 
HETATM 3516 O  O   . HOH P 4 .  ? -4.869  -32.724 48.007  1.00 37.33 ? 2042 HOH C O   1 
HETATM 3517 O  O   . HOH P 4 .  ? -18.700 -33.542 38.267  1.00 23.17 ? 2043 HOH C O   1 
HETATM 3518 O  O   . HOH P 4 .  ? -22.463 -31.110 31.404  1.00 27.12 ? 2044 HOH C O   1 
HETATM 3519 O  O   . HOH P 4 .  ? -23.801 -20.037 31.135  1.00 43.58 ? 2045 HOH C O   1 
HETATM 3520 O  O   . HOH P 4 .  ? -22.810 -20.236 28.248  1.00 21.03 ? 2046 HOH C O   1 
HETATM 3521 O  O   . HOH P 4 .  ? -1.108  -32.213 37.192  1.00 35.88 ? 2047 HOH C O   1 
HETATM 3522 O  O   . HOH P 4 .  ? -16.425 -16.245 31.132  1.00 31.96 ? 2048 HOH C O   1 
HETATM 3523 O  O   . HOH P 4 .  ? -23.827 -35.835 32.179  1.00 49.30 ? 2049 HOH C O   1 
HETATM 3524 O  O   . HOH P 4 .  ? -18.751 -35.876 16.388  1.00 36.02 ? 2050 HOH C O   1 
HETATM 3525 O  O   . HOH P 4 .  ? -17.317 -11.785 23.775  1.00 31.54 ? 2051 HOH C O   1 
HETATM 3526 O  O   . HOH P 4 .  ? -15.959 -12.610 26.562  1.00 29.54 ? 2052 HOH C O   1 
HETATM 3527 O  O   . HOH P 4 .  ? -10.158 -10.778 23.006  1.00 52.58 ? 2053 HOH C O   1 
HETATM 3528 O  O   . HOH P 4 .  ? -17.300 -13.158 20.872  1.00 31.60 ? 2054 HOH C O   1 
HETATM 3529 O  O   . HOH P 4 .  ? -10.889 -16.319 22.526  1.00 34.33 ? 2055 HOH C O   1 
HETATM 3530 O  O   . HOH P 4 .  ? -3.604  -20.390 27.531  1.00 26.80 ? 2056 HOH C O   1 
HETATM 3531 O  O   . HOH P 4 .  ? -1.256  -13.475 32.801  1.00 38.90 ? 2057 HOH C O   1 
HETATM 3532 O  O   . HOH P 4 .  ? -5.126  -14.685 27.665  1.00 35.72 ? 2058 HOH C O   1 
HETATM 3533 O  O   . HOH P 4 .  ? -0.472  -16.940 23.398  1.00 29.39 ? 2059 HOH C O   1 
HETATM 3534 O  O   . HOH P 4 .  ? -4.289  -26.736 25.498  1.00 36.98 ? 2060 HOH C O   1 
HETATM 3535 O  O   . HOH P 4 .  ? -7.255  -28.136 23.898  1.00 30.63 ? 2061 HOH C O   1 
HETATM 3536 O  O   . HOH P 4 .  ? -7.060  -20.658 20.063  1.00 46.00 ? 2062 HOH C O   1 
HETATM 3537 O  O   . HOH P 4 .  ? -11.623 -22.376 23.040  1.00 28.40 ? 2063 HOH C O   1 
HETATM 3538 O  O   . HOH P 4 .  ? -10.391 -30.747 18.701  1.00 39.41 ? 2064 HOH C O   1 
HETATM 3539 O  O   . HOH P 4 .  ? -14.732 -30.306 20.829  1.00 24.93 ? 2065 HOH C O   1 
HETATM 3540 O  O   . HOH P 4 .  ? -11.765 -24.057 20.458  1.00 42.60 ? 2066 HOH C O   1 
HETATM 3541 O  O   . HOH P 4 .  ? -18.824 -25.182 23.010  1.00 16.34 ? 2067 HOH C O   1 
HETATM 3542 O  O   . HOH P 4 .  ? -16.899 -22.853 23.478  1.00 20.70 ? 2068 HOH C O   1 
HETATM 3543 O  O   . HOH P 4 .  ? -21.618 -31.288 28.885  1.00 20.57 ? 2069 HOH C O   1 
HETATM 3544 O  O   . HOH P 4 .  ? -16.741 -34.084 36.635  1.00 20.99 ? 2070 HOH C O   1 
HETATM 3545 O  O   . HOH P 4 .  ? -10.515 -37.836 37.068  1.00 31.59 ? 2071 HOH C O   1 
HETATM 3546 O  O   . HOH P 4 .  ? -5.304  -32.134 36.666  1.00 17.46 ? 2072 HOH C O   1 
HETATM 3547 O  O   . HOH P 4 .  ? -3.133  -30.273 43.701  1.00 22.54 ? 2073 HOH C O   1 
HETATM 3548 O  O   . HOH P 4 .  ? -1.829  -25.658 42.408  1.00 33.81 ? 2074 HOH C O   1 
HETATM 3549 O  O   . HOH P 4 .  ? -5.316  -26.152 42.923  1.00 29.97 ? 2075 HOH C O   1 
HETATM 3550 O  O   . HOH P 4 .  ? -6.293  -37.767 39.585  1.00 28.32 ? 2076 HOH C O   1 
HETATM 3551 O  O   . HOH P 4 .  ? -2.065  -36.526 39.532  1.00 34.66 ? 2077 HOH C O   1 
HETATM 3552 O  O   . HOH P 4 .  ? -14.235 -41.033 39.793  1.00 36.36 ? 2078 HOH C O   1 
HETATM 3553 O  O   . HOH P 4 .  ? -13.317 -35.792 43.524  1.00 30.27 ? 2079 HOH C O   1 
HETATM 3554 O  O   . HOH P 4 .  ? -17.942 -36.791 34.761  1.00 38.09 ? 2080 HOH C O   1 
HETATM 3555 O  O   . HOH P 4 .  ? -17.395 -36.404 47.207  1.00 35.25 ? 2081 HOH C O   1 
HETATM 3556 O  O   . HOH P 4 .  ? -15.428 -34.407 47.553  1.00 39.73 ? 2082 HOH C O   1 
HETATM 3557 O  O   . HOH P 4 .  ? -17.630 -32.819 40.467  1.00 25.65 ? 2083 HOH C O   1 
HETATM 3558 O  O   . HOH P 4 .  ? -19.094 -27.797 49.391  1.00 19.71 ? 2084 HOH C O   1 
HETATM 3559 O  O   . HOH P 4 .  ? -20.396 -20.568 40.549  1.00 17.09 ? 2085 HOH C O   1 
HETATM 3560 O  O   . HOH P 4 .  ? -17.968 -33.693 48.893  1.00 38.27 ? 2086 HOH C O   1 
HETATM 3561 O  O   . HOH P 4 .  ? -11.476 -28.122 47.638  1.00 34.59 ? 2087 HOH C O   1 
HETATM 3562 O  O   . HOH P 4 .  ? -15.890 -29.442 51.601  1.00 26.37 ? 2088 HOH C O   1 
HETATM 3563 O  O   . HOH P 4 .  ? -15.244 -19.438 46.296  1.00 28.24 ? 2089 HOH C O   1 
HETATM 3564 O  O   . HOH P 4 .  ? -16.995 -21.932 40.093  1.00 17.38 ? 2090 HOH C O   1 
HETATM 3565 O  O   . HOH P 4 .  ? -9.240  -21.809 47.976  1.00 23.11 ? 2091 HOH C O   1 
HETATM 3566 O  O   . HOH P 4 .  ? -12.791 -26.698 49.873  1.00 32.79 ? 2092 HOH C O   1 
HETATM 3567 O  O   . HOH P 4 .  ? -6.877  -31.143 47.099  1.00 27.03 ? 2093 HOH C O   1 
HETATM 3568 O  O   . HOH P 4 .  ? -4.562  -26.702 45.352  1.00 37.18 ? 2094 HOH C O   1 
HETATM 3569 O  O   . HOH P 4 .  ? -7.031  -18.949 40.732  1.00 21.34 ? 2095 HOH C O   1 
HETATM 3570 O  O   . HOH P 4 .  ? -13.090 -14.712 45.464  1.00 30.85 ? 2096 HOH C O   1 
HETATM 3571 O  O   . HOH P 4 .  ? -4.617  -18.682 42.195  1.00 31.52 ? 2097 HOH C O   1 
HETATM 3572 O  O   . HOH P 4 .  ? -1.605  -19.056 40.091  1.00 33.76 ? 2098 HOH C O   1 
HETATM 3573 O  O   . HOH P 4 .  ? 2.515   -19.223 38.116  0.50 25.23 ? 2099 HOH C O   1 
HETATM 3574 O  O   . HOH P 4 .  ? -0.049  -25.111 40.433  1.00 26.73 ? 2100 HOH C O   1 
HETATM 3575 O  O   . HOH P 4 .  ? 2.186   -23.831 32.299  0.50 20.82 ? 2101 HOH C O   1 
HETATM 3576 O  O   . HOH P 4 .  ? 2.316   -20.518 36.059  0.50 21.83 ? 2102 HOH C O   1 
HETATM 3577 O  O   . HOH P 4 .  ? -0.831  -30.079 38.918  1.00 42.40 ? 2103 HOH C O   1 
HETATM 3578 O  O   . HOH P 4 .  ? 2.303   -26.840 37.488  1.00 22.23 ? 2104 HOH C O   1 
HETATM 3579 O  O   . HOH P 4 .  ? -3.867  -32.149 34.420  1.00 38.66 ? 2105 HOH C O   1 
HETATM 3580 O  O   . HOH P 4 .  ? -8.245  -37.329 34.503  1.00 39.66 ? 2106 HOH C O   1 
HETATM 3581 O  O   . HOH P 4 .  ? -20.604 -36.269 30.826  1.00 45.22 ? 2107 HOH C O   1 
HETATM 3582 O  O   . HOH P 4 .  ? -7.793  -31.547 22.068  1.00 35.44 ? 2108 HOH C O   1 
HETATM 3583 O  O   . HOH P 4 .  ? -9.751  -33.169 22.325  1.00 31.39 ? 2109 HOH C O   1 
HETATM 3584 O  O   . HOH P 4 .  ? -19.933 -26.697 20.444  1.00 16.68 ? 2110 HOH C O   1 
HETATM 3585 O  O   . HOH P 4 .  ? -17.965 -31.554 15.634  1.00 25.08 ? 2111 HOH C O   1 
HETATM 3586 O  O   . HOH P 4 .  ? -17.287 -33.686 22.188  1.00 22.82 ? 2112 HOH C O   1 
HETATM 3587 O  O   . HOH P 4 .  ? -19.643 -33.491 15.829  1.00 22.56 ? 2113 HOH C O   1 
HETATM 3588 O  O   . HOH P 4 .  ? -25.374 -33.693 20.001  1.00 31.67 ? 2114 HOH C O   1 
HETATM 3589 O  O   . HOH Q 4 .  ? 5.156   18.003  49.807  1.00 36.27 ? 2001 HOH D O   1 
HETATM 3590 O  O   . HOH Q 4 .  ? 5.826   10.606  46.713  1.00 29.68 ? 2002 HOH D O   1 
HETATM 3591 O  O   . HOH Q 4 .  ? 9.341   8.600   50.519  1.00 23.00 ? 2003 HOH D O   1 
HETATM 3592 O  O   . HOH Q 4 .  ? 14.090  15.264  47.729  1.00 48.91 ? 2004 HOH D O   1 
HETATM 3593 O  O   . HOH Q 4 .  ? 12.954  14.418  45.636  1.00 39.97 ? 2005 HOH D O   1 
HETATM 3594 O  O   . HOH Q 4 .  ? 15.056  12.135  48.806  1.00 30.86 ? 2006 HOH D O   1 
HETATM 3595 O  O   . HOH Q 4 .  ? 19.108  11.940  42.453  1.00 30.59 ? 2007 HOH D O   1 
HETATM 3596 O  O   . HOH Q 4 .  ? 20.367  7.011   46.944  1.00 21.82 ? 2008 HOH D O   1 
HETATM 3597 O  O   . HOH Q 4 .  ? 2.218   9.386   29.102  1.00 40.52 ? 2009 HOH D O   1 
HETATM 3598 O  O   . HOH Q 4 .  ? 0.742   2.434   36.496  1.00 31.92 ? 2010 HOH D O   1 
HETATM 3599 O  O   . HOH Q 4 .  ? 21.835  -4.133  41.795  1.00 17.71 ? 2011 HOH D O   1 
HETATM 3600 O  O   . HOH Q 4 .  ? 25.784  -3.566  40.346  1.00 34.12 ? 2012 HOH D O   1 
HETATM 3601 O  O   . HOH Q 4 .  ? 23.619  1.110   33.037  1.00 31.19 ? 2013 HOH D O   1 
HETATM 3602 O  O   . HOH Q 4 .  ? 0.734   7.160   52.172  1.00 42.20 ? 2014 HOH D O   1 
HETATM 3603 O  O   . HOH Q 4 .  ? 17.449  -3.631  43.745  1.00 14.86 ? 2015 HOH D O   1 
HETATM 3604 O  O   . HOH Q 4 .  ? 17.723  -4.357  49.906  1.00 46.67 ? 2016 HOH D O   1 
HETATM 3605 O  O   . HOH Q 4 .  ? 25.941  -2.117  46.538  1.00 51.13 ? 2017 HOH D O   1 
HETATM 3606 O  O   . HOH Q 4 .  ? 15.972  7.935   53.676  1.00 55.29 ? 2018 HOH D O   1 
HETATM 3607 O  O   . HOH Q 4 .  ? 10.960  -4.691  31.926  1.00 31.15 ? 2019 HOH D O   1 
HETATM 3608 O  O   . HOH Q 4 .  ? 8.525   -4.842  32.328  1.00 34.45 ? 2020 HOH D O   1 
HETATM 3609 O  O   . HOH Q 4 .  ? 1.974   -0.354  33.710  1.00 35.28 ? 2021 HOH D O   1 
HETATM 3610 O  O   . HOH Q 4 .  ? 0.999   -2.121  37.678  1.00 38.33 ? 2022 HOH D O   1 
HETATM 3611 O  O   . HOH Q 4 .  ? 4.872   -1.330  38.184  1.00 28.66 ? 2023 HOH D O   1 
HETATM 3612 O  O   . HOH Q 4 .  ? 1.300   -4.616  36.078  1.00 36.53 ? 2024 HOH D O   1 
HETATM 3613 O  O   . HOH Q 4 .  ? 5.527   -2.402  30.294  1.00 27.70 ? 2025 HOH D O   1 
HETATM 3614 O  O   . HOH Q 4 .  ? 12.220  16.704  36.409  0.40 24.97 ? 2026 HOH D O   1 
HETATM 3615 O  O   . HOH Q 4 .  ? 8.904   1.517   24.324  1.00 21.44 ? 2027 HOH D O   1 
HETATM 3616 O  O   . HOH Q 4 .  ? 5.299   -0.412  23.316  1.00 22.42 ? 2028 HOH D O   1 
HETATM 3617 O  O   . HOH Q 4 .  ? -1.145  1.569   24.273  1.00 35.79 ? 2029 HOH D O   1 
HETATM 3618 O  O   . HOH Q 4 .  ? 5.458   15.315  30.284  1.00 48.06 ? 2030 HOH D O   1 
HETATM 3619 O  O   . HOH Q 4 .  ? 7.011   17.973  36.679  1.00 60.71 ? 2031 HOH D O   1 
HETATM 3620 O  O   . HOH Q 4 .  ? 4.941   6.740   22.026  1.00 43.48 ? 2032 HOH D O   1 
HETATM 3621 O  O   . HOH Q 4 .  ? 13.098  4.988   20.987  1.00 39.25 ? 2033 HOH D O   1 
HETATM 3622 O  O   . HOH Q 4 .  ? 0.006   9.596   27.347  1.00 31.39 ? 2034 HOH D O   1 
HETATM 3623 O  O   . HOH Q 4 .  ? 3.011   1.876   35.046  1.00 18.95 ? 2035 HOH D O   1 
HETATM 3624 O  O   . HOH Q 4 .  ? 8.576   -6.499  35.304  1.00 26.45 ? 2036 HOH D O   1 
HETATM 3625 O  O   . HOH Q 4 .  ? 7.255   -8.063  38.336  1.00 23.77 ? 2037 HOH D O   1 
HETATM 3626 O  O   . HOH Q 4 .  ? 11.125  -8.295  41.856  1.00 15.00 ? 2038 HOH D O   1 
HETATM 3627 O  O   . HOH Q 4 .  ? -2.026  5.593   53.088  1.00 41.83 ? 2039 HOH D O   1 
HETATM 3628 O  O   . HOH Q 4 .  ? 15.677  -13.154 47.101  1.00 30.79 ? 2040 HOH D O   1 
HETATM 3629 O  O   . HOH Q 4 .  ? 13.894  -11.586 50.233  1.00 25.70 ? 2041 HOH D O   1 
HETATM 3630 O  O   . HOH Q 4 .  ? 16.387  -10.790 43.347  1.00 30.37 ? 2042 HOH D O   1 
HETATM 3631 O  O   . HOH Q 4 .  ? 19.409  -10.715 44.647  1.00 37.45 ? 2043 HOH D O   1 
HETATM 3632 O  O   . HOH Q 4 .  ? 23.385  -3.854  46.014  1.00 30.42 ? 2044 HOH D O   1 
HETATM 3633 O  O   . HOH Q 4 .  ? 16.251  -6.069  49.152  1.00 40.70 ? 2045 HOH D O   1 
HETATM 3634 O  O   . HOH Q 4 .  ? 26.294  0.519   46.021  1.00 38.63 ? 2046 HOH D O   1 
HETATM 3635 O  O   . HOH Q 4 .  ? 22.046  1.505   46.817  1.00 25.39 ? 2047 HOH D O   1 
HETATM 3636 O  O   . HOH Q 4 .  ? 20.400  -7.902  37.082  1.00 31.63 ? 2048 HOH D O   1 
HETATM 3637 O  O   . HOH Q 4 .  ? 20.554  -0.378  52.607  1.00 53.18 ? 2049 HOH D O   1 
HETATM 3638 O  O   . HOH Q 4 .  ? 23.683  -1.041  47.415  1.00 36.74 ? 2050 HOH D O   1 
HETATM 3639 O  O   . HOH Q 4 .  ? 15.042  7.237   50.172  1.00 49.96 ? 2051 HOH D O   1 
HETATM 3640 O  O   . HOH Q 4 .  ? 18.102  6.440   48.665  1.00 37.25 ? 2052 HOH D O   1 
HETATM 3641 O  O   . HOH Q 4 .  ? 11.708  -0.654  51.265  1.00 38.30 ? 2053 HOH D O   1 
HETATM 3642 O  O   . HOH Q 4 .  ? 13.459  -1.089  48.959  1.00 25.35 ? 2054 HOH D O   1 
HETATM 3643 O  O   . HOH Q 4 .  ? 9.035   5.509   54.206  1.00 55.03 ? 2055 HOH D O   1 
HETATM 3644 O  O   . HOH Q 4 .  ? 9.137   -3.145  46.902  1.00 17.98 ? 2056 HOH D O   1 
HETATM 3645 O  O   . HOH Q 4 .  ? 1.983   2.178   40.607  1.00 24.00 ? 2057 HOH D O   1 
HETATM 3646 O  O   . HOH Q 4 .  ? 6.563   8.207   34.669  1.00 19.59 ? 2058 HOH D O   1 
HETATM 3647 O  O   . HOH Q 4 .  ? 22.064  13.308  37.025  1.00 32.57 ? 2059 HOH D O   1 
HETATM 3648 O  O   . HOH Q 4 .  ? 22.151  9.637   36.265  1.00 27.90 ? 2060 HOH D O   1 
HETATM 3649 O  O   . HOH Q 4 .  ? 13.283  17.471  35.055  0.60 29.06 ? 2061 HOH D O   1 
HETATM 3650 O  O   . HOH Q 4 .  ? 20.167  14.632  38.544  1.00 39.69 ? 2062 HOH D O   1 
HETATM 3651 O  O   . HOH Q 4 .  ? 5.097   16.589  34.689  1.00 48.71 ? 2063 HOH D O   1 
HETATM 3652 O  O   . HOH Q 4 .  ? 3.966   8.458   30.595  1.00 36.01 ? 2064 HOH D O   1 
HETATM 3653 O  O   . HOH Q 4 .  ? 4.194   9.810   35.410  1.00 19.22 ? 2065 HOH D O   1 
HETATM 3654 O  O   . HOH Q 4 .  ? 3.737   13.148  32.361  0.50 20.66 ? 2066 HOH D O   1 
HETATM 3655 O  O   . HOH Q 4 .  ? 9.114   13.204  29.154  1.00 42.75 ? 2067 HOH D O   1 
HETATM 3656 O  O   . HOH Q 4 .  ? 6.780   7.994   30.775  1.00 29.99 ? 2068 HOH D O   1 
HETATM 3657 O  O   . HOH Q 4 .  ? 10.574  4.364   21.676  1.00 23.15 ? 2069 HOH D O   1 
HETATM 3658 O  O   . HOH Q 4 .  ? 10.839  -3.650  29.714  1.00 27.99 ? 2070 HOH D O   1 
HETATM 3659 O  O   . HOH Q 4 .  ? 16.620  7.758   25.696  1.00 27.94 ? 2071 HOH D O   1 
HETATM 3660 O  O   . HOH Q 4 .  ? 17.212  -1.306  25.613  1.00 25.45 ? 2072 HOH D O   1 
HETATM 3661 O  O   . HOH Q 4 .  ? 13.014  -0.885  30.919  1.00 34.34 ? 2073 HOH D O   1 
HETATM 3662 O  O   . HOH Q 4 .  ? 21.949  3.612   25.809  1.00 28.36 ? 2074 HOH D O   1 
HETATM 3663 O  O   . HOH Q 4 .  ? 21.157  1.004   24.891  1.00 40.33 ? 2075 HOH D O   1 
HETATM 3664 O  O   . HOH Q 4 .  ? 16.319  6.432   23.080  1.00 42.02 ? 2076 HOH D O   1 
HETATM 3665 O  O   . HOH Q 4 .  ? 19.758  7.547   25.722  1.00 38.96 ? 2077 HOH D O   1 
HETATM 3666 O  O   . HOH Q 4 .  ? 22.297  7.898   29.625  1.00 27.06 ? 2078 HOH D O   1 
HETATM 3667 O  O   . HOH Q 4 .  ? 21.211  -4.221  26.770  1.00 32.52 ? 2079 HOH D O   1 
HETATM 3668 O  O   . HOH Q 4 .  ? 27.847  3.203   28.258  1.00 49.80 ? 2080 HOH D O   1 
HETATM 3669 O  O   . HOH Q 4 .  ? 26.486  7.844   34.435  1.00 57.21 ? 2081 HOH D O   1 
HETATM 3670 O  O   . HOH Q 4 .  ? 27.330  1.090   34.735  1.00 35.45 ? 2082 HOH D O   1 
HETATM 3671 O  O   . HOH Q 4 .  ? 29.450  8.269   35.187  1.00 37.42 ? 2083 HOH D O   1 
HETATM 3672 O  O   . HOH Q 4 .  ? 24.328  10.402  37.076  1.00 49.89 ? 2084 HOH D O   1 
HETATM 3673 O  O   . HOH Q 4 .  ? 11.416  15.366  39.707  1.00 52.65 ? 2085 HOH D O   1 
HETATM 3674 O  O   . HOH Q 4 .  ? 17.371  12.917  40.641  1.00 34.75 ? 2086 HOH D O   1 
HETATM 3675 O  O   . HOH Q 4 .  ? 2.981   12.092  38.789  1.00 20.84 ? 2087 HOH D O   1 
HETATM 3676 O  O   . HOH Q 4 .  ? 4.773   14.131  42.095  1.00 27.45 ? 2088 HOH D O   1 
HETATM 3677 O  O   . HOH Q 4 .  ? 11.940  7.996   51.391  1.00 36.86 ? 2089 HOH D O   1 
HETATM 3678 O  O   . HOH Q 4 .  ? 2.810   9.851   46.362  1.00 31.77 ? 2090 HOH D O   1 
HETATM 3679 O  O   . HOH Q 4 .  ? 1.030   7.162   47.453  1.00 42.62 ? 2091 HOH D O   1 
HETATM 3680 O  O   . HOH Q 4 .  ? -1.130  8.566   43.514  1.00 36.81 ? 2092 HOH D O   1 
HETATM 3681 O  O   . HOH Q 4 .  ? 0.602   10.003  45.229  1.00 45.11 ? 2093 HOH D O   1 
HETATM 3682 O  O   . HOH Q 4 .  ? 5.906   3.671   50.204  1.00 20.03 ? 2094 HOH D O   1 
HETATM 3683 O  O   . HOH Q 4 .  ? 3.675   -2.138  49.598  1.00 18.65 ? 2095 HOH D O   1 
HETATM 3684 O  O   . HOH Q 4 .  ? 2.601   5.408   48.337  1.00 22.08 ? 2096 HOH D O   1 
HETATM 3685 O  O   . HOH Q 4 .  ? 5.157   6.936   52.025  1.00 45.16 ? 2097 HOH D O   1 
HETATM 3686 O  O   . HOH Q 4 .  ? -2.268  2.042   46.748  1.00 33.38 ? 2098 HOH D O   1 
HETATM 3687 O  O   . HOH Q 4 .  ? -2.652  4.360   49.615  1.00 41.77 ? 2099 HOH D O   1 
HETATM 3688 O  O   . HOH Q 4 .  ? 1.307   2.211   54.250  1.00 26.94 ? 2100 HOH D O   1 
HETATM 3689 O  O   . HOH Q 4 .  ? 0.136   4.725   47.268  1.00 42.36 ? 2101 HOH D O   1 
HETATM 3690 O  O   . HOH Q 4 .  ? -4.658  0.532   47.811  1.00 21.81 ? 2102 HOH D O   1 
HETATM 3691 O  O   . HOH Q 4 .  ? -1.349  3.141   53.331  1.00 20.80 ? 2103 HOH D O   1 
HETATM 3692 O  O   . HOH Q 4 .  ? 18.441  -5.844  37.597  1.00 23.57 ? 2104 HOH D O   1 
HETATM 3693 O  O   . HOH Q 4 .  ? 16.868  -10.865 40.797  1.00 41.51 ? 2105 HOH D O   1 
HETATM 3694 O  O   . HOH R 4 .  ? -36.581 -12.830 -0.469  1.00 48.84 ? 2001 HOH E O   1 
HETATM 3695 O  O   . HOH R 4 .  ? -19.187 -37.579 14.451  1.00 45.15 ? 2002 HOH E O   1 
HETATM 3696 O  O   . HOH R 4 .  ? -33.298 -20.270 1.972   1.00 55.85 ? 2003 HOH E O   1 
HETATM 3697 O  O   . HOH R 4 .  ? -32.329 -13.236 9.751   1.00 45.79 ? 2004 HOH E O   1 
HETATM 3698 O  O   . HOH R 4 .  ? -34.851 -23.226 3.892   1.00 29.56 ? 2005 HOH E O   1 
HETATM 3699 O  O   . HOH R 4 .  ? -23.174 -38.916 10.183  1.00 41.41 ? 2006 HOH E O   1 
HETATM 3700 O  O   . HOH R 4 .  ? -20.355 -36.248 11.914  1.00 33.16 ? 2007 HOH E O   1 
HETATM 3701 O  O   . HOH R 4 .  ? -36.459 -27.154 10.349  1.00 34.38 ? 2008 HOH E O   1 
HETATM 3702 O  O   . HOH R 4 .  ? -34.980 -34.453 6.874   1.00 36.13 ? 2009 HOH E O   1 
HETATM 3703 O  O   . HOH R 4 .  ? -32.223 -30.393 6.086   1.00 25.25 ? 2010 HOH E O   1 
HETATM 3704 O  O   . HOH R 4 .  ? -30.258 -35.809 8.151   1.00 39.38 ? 2011 HOH E O   1 
HETATM 3705 O  O   . HOH R 4 .  ? -24.582 -15.210 30.638  1.00 51.31 ? 2012 HOH E O   1 
HETATM 3706 O  O   . HOH R 4 .  ? -20.352 -3.898  14.202  1.00 47.64 ? 2013 HOH E O   1 
HETATM 3707 O  O   . HOH R 4 .  ? -26.478 -40.513 19.484  1.00 47.36 ? 2014 HOH E O   1 
HETATM 3708 O  O   . HOH R 4 .  ? -29.484 -38.268 18.617  1.00 39.73 ? 2015 HOH E O   1 
HETATM 3709 O  O   . HOH R 4 .  ? -24.912 -42.108 16.633  1.00 45.56 ? 2016 HOH E O   1 
HETATM 3710 O  O   . HOH R 4 .  ? -22.419 -12.634 12.806  1.00 37.85 ? 2017 HOH E O   1 
HETATM 3711 O  O   . HOH R 4 .  ? -22.935 -36.286 11.760  1.00 25.27 ? 2018 HOH E O   1 
HETATM 3712 O  O   . HOH R 4 .  ? -24.579 -39.458 13.359  1.00 35.45 ? 2019 HOH E O   1 
HETATM 3713 O  O   . HOH R 4 .  ? -17.185 -24.957 20.744  1.00 22.80 ? 2020 HOH E O   1 
HETATM 3714 O  O   . HOH R 4 .  ? -12.870 -18.336 16.550  1.00 32.59 ? 2021 HOH E O   1 
HETATM 3715 O  O   . HOH R 4 .  ? -29.481 -16.029 30.847  1.00 53.78 ? 2022 HOH E O   1 
HETATM 3716 O  O   . HOH R 4 .  ? -25.799 -13.336 28.644  1.00 49.53 ? 2023 HOH E O   1 
HETATM 3717 O  O   . HOH R 4 .  ? -34.896 -19.649 25.621  1.00 65.13 ? 2024 HOH E O   1 
HETATM 3718 O  O   . HOH R 4 .  ? -37.612 -15.050 22.616  1.00 46.33 ? 2025 HOH E O   1 
HETATM 3719 O  O   . HOH R 4 .  ? -27.942 -11.753 18.063  1.00 36.18 ? 2026 HOH E O   1 
HETATM 3720 O  O   . HOH R 4 .  ? -24.381 -12.046 20.928  1.00 28.34 ? 2027 HOH E O   1 
HETATM 3721 O  O   . HOH R 4 .  ? -24.171 -10.404 19.053  1.00 46.07 ? 2028 HOH E O   1 
HETATM 3722 O  O   . HOH R 4 .  ? -21.558 -6.035  17.600  1.00 48.80 ? 2029 HOH E O   1 
HETATM 3723 O  O   . HOH R 4 .  ? -32.996 -27.612 26.871  1.00 46.07 ? 2030 HOH E O   1 
HETATM 3724 O  O   . HOH R 4 .  ? -26.912 -15.740 19.669  1.00 24.56 ? 2031 HOH E O   1 
HETATM 3725 O  O   . HOH R 4 .  ? -22.138 -33.773 30.965  1.00 51.97 ? 2032 HOH E O   1 
HETATM 3726 O  O   . HOH R 4 .  ? -20.989 -14.758 13.664  1.00 30.96 ? 2033 HOH E O   1 
HETATM 3727 O  O   . HOH R 4 .  ? -13.453 -23.154 12.077  1.00 18.91 ? 2034 HOH E O   1 
HETATM 3728 O  O   . HOH R 4 .  ? -16.391 -30.641 13.791  1.00 36.39 ? 2035 HOH E O   1 
HETATM 3729 O  O   . HOH R 4 .  ? -14.277 -27.718 11.271  1.00 27.71 ? 2036 HOH E O   1 
HETATM 3730 O  O   . HOH R 4 .  ? -25.461 -10.036 15.233  1.00 40.84 ? 2037 HOH E O   1 
HETATM 3731 O  O   . HOH R 4 .  ? -13.405 -30.722 10.388  1.00 43.71 ? 2038 HOH E O   1 
HETATM 3732 O  O   . HOH R 4 .  ? -21.306 -32.040 9.417   1.00 19.20 ? 2039 HOH E O   1 
HETATM 3733 O  O   . HOH R 4 .  ? -23.811 -12.550 -0.953  1.00 40.77 ? 2040 HOH E O   1 
HETATM 3734 O  O   . HOH R 4 .  ? -16.988 -29.843 6.460   1.00 41.40 ? 2041 HOH E O   1 
HETATM 3735 O  O   . HOH R 4 .  ? -14.007 -32.757 9.084   1.00 34.03 ? 2042 HOH E O   1 
HETATM 3736 O  O   . HOH R 4 .  ? -19.013 -32.537 3.793   1.00 41.24 ? 2043 HOH E O   1 
HETATM 3737 O  O   . HOH R 4 .  ? -28.024 -42.050 10.567  1.00 38.34 ? 2044 HOH E O   1 
HETATM 3738 O  O   . HOH R 4 .  ? -28.090 -34.405 6.639   1.00 28.83 ? 2045 HOH E O   1 
HETATM 3739 O  O   . HOH R 4 .  ? -26.588 -36.812 5.725   1.00 41.23 ? 2046 HOH E O   1 
HETATM 3740 O  O   . HOH R 4 .  ? -30.938 -29.000 4.353   1.00 38.92 ? 2047 HOH E O   1 
HETATM 3741 O  O   . HOH R 4 .  ? -22.404 -27.963 3.998   0.50 21.61 ? 2048 HOH E O   1 
HETATM 3742 O  O   . HOH R 4 .  ? -18.154 -24.506 6.014   1.00 23.15 ? 2049 HOH E O   1 
HETATM 3743 O  O   . HOH R 4 .  ? -28.319 -15.990 17.068  1.00 29.40 ? 2050 HOH E O   1 
HETATM 3744 O  O   . HOH R 4 .  ? -38.093 -21.556 13.834  1.00 25.32 ? 2051 HOH E O   1 
HETATM 3745 O  O   . HOH R 4 .  ? -41.607 -20.642 18.919  1.00 40.76 ? 2052 HOH E O   1 
HETATM 3746 O  O   . HOH R 4 .  ? -39.025 -18.345 20.572  1.00 26.24 ? 2053 HOH E O   1 
HETATM 3747 O  O   . HOH R 4 .  ? -38.599 -14.634 19.763  1.00 34.26 ? 2054 HOH E O   1 
HETATM 3748 O  O   . HOH R 4 .  ? -35.405 -18.162 23.520  1.00 33.70 ? 2055 HOH E O   1 
HETATM 3749 O  O   . HOH R 4 .  ? -27.497 -17.402 21.337  1.00 28.21 ? 2056 HOH E O   1 
HETATM 3750 O  O   . HOH R 4 .  ? -28.635 -13.732 15.995  1.00 32.68 ? 2057 HOH E O   1 
HETATM 3751 O  O   . HOH R 4 .  ? -33.090 -11.217 18.684  1.00 57.02 ? 2058 HOH E O   1 
HETATM 3752 O  O   . HOH R 4 .  ? -27.143 -13.226 20.306  1.00 32.00 ? 2059 HOH E O   1 
HETATM 3753 O  O   . HOH R 4 .  ? -26.319 -21.039 31.012  1.00 35.33 ? 2060 HOH E O   1 
HETATM 3754 O  O   . HOH R 4 .  ? -33.027 -20.401 27.458  1.00 60.20 ? 2061 HOH E O   1 
HETATM 3755 O  O   . HOH R 4 .  ? -31.252 -25.428 27.226  1.00 42.01 ? 2062 HOH E O   1 
HETATM 3756 O  O   . HOH R 4 .  ? -23.638 -29.289 27.548  1.00 34.60 ? 2063 HOH E O   1 
HETATM 3757 O  O   . HOH R 4 .  ? -22.037 -25.747 21.648  1.00 21.89 ? 2064 HOH E O   1 
HETATM 3758 O  O   . HOH R 4 .  ? -28.121 -25.461 30.149  1.00 39.70 ? 2065 HOH E O   1 
HETATM 3759 O  O   . HOH R 4 .  ? -24.304 -28.870 30.610  1.00 30.44 ? 2066 HOH E O   1 
HETATM 3760 O  O   . HOH R 4 .  ? -33.977 -30.021 23.393  1.00 29.17 ? 2067 HOH E O   1 
HETATM 3761 O  O   . HOH R 4 .  ? -22.698 -34.495 26.665  0.50 19.57 ? 2068 HOH E O   1 
HETATM 3762 O  O   . HOH R 4 .  ? -23.010 -33.417 27.949  0.50 21.76 ? 2069 HOH E O   1 
HETATM 3763 O  O   . HOH R 4 .  ? -32.473 -38.396 17.852  1.00 41.65 ? 2070 HOH E O   1 
HETATM 3764 O  O   . HOH R 4 .  ? -39.313 -27.258 14.940  1.00 41.43 ? 2071 HOH E O   1 
HETATM 3765 O  O   . HOH R 4 .  ? -35.363 -29.863 16.881  1.00 28.43 ? 2072 HOH E O   1 
HETATM 3766 O  O   . HOH R 4 .  ? -36.007 -17.942 12.487  1.00 37.87 ? 2073 HOH E O   1 
HETATM 3767 O  O   . HOH R 4 .  ? -25.675 -9.952  9.726   1.00 44.96 ? 2074 HOH E O   1 
HETATM 3768 O  O   . HOH R 4 .  ? -27.576 -12.334 13.425  1.00 36.47 ? 2075 HOH E O   1 
HETATM 3769 O  O   . HOH R 4 .  ? -21.824 -12.697 10.171  1.00 40.57 ? 2076 HOH E O   1 
HETATM 3770 O  O   . HOH R 4 .  ? -17.346 -19.042 3.406   1.00 19.35 ? 2077 HOH E O   1 
HETATM 3771 O  O   . HOH R 4 .  ? -21.099 -16.124 -2.037  1.00 40.76 ? 2078 HOH E O   1 
HETATM 3772 O  O   . HOH R 4 .  ? -21.191 -13.515 -0.983  1.00 30.42 ? 2079 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  0  ?  ?   ?   A . n 
A 1 2  MET 2  1  1  MET MET A . n 
A 1 3  SER 3  2  2  SER SER A . n 
A 1 4  ASN 4  3  3  ASN ASN A . n 
A 1 5  TYR 5  4  4  TYR TYR A . n 
A 1 6  SER 6  5  5  SER SER A . n 
A 1 7  VAL 7  6  6  VAL VAL A . n 
A 1 8  SER 8  7  7  SER SER A . n 
A 1 9  LEU 9  8  8  LEU LEU A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLY 11 10 10 GLY GLY A . n 
A 1 12 PRO 12 11 11 PRO PRO A . n 
A 1 13 ALA 13 12 12 ALA ALA A . n 
A 1 14 PRO 14 13 13 PRO PRO A . n 
A 1 15 TRP 15 14 14 TRP TRP A . n 
A 1 16 GLY 16 15 15 GLY GLY A . n 
A 1 17 PHE 17 16 16 PHE PHE A . n 
A 1 18 ARG 18 17 17 ARG ARG A . n 
A 1 19 LEU 19 18 18 LEU LEU A . n 
A 1 20 GLN 20 19 19 GLN GLN A . n 
A 1 21 GLY 21 20 20 GLY GLY A . n 
A 1 22 GLY 22 21 21 GLY GLY A . n 
A 1 23 LYS 23 22 22 LYS LYS A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 PHE 25 24 24 PHE PHE A . n 
A 1 26 ASN 26 25 25 ASN ASN A . n 
A 1 27 MET 27 26 26 MET MET A . n 
A 1 28 PRO 28 27 27 PRO PRO A . n 
A 1 29 LEU 29 28 28 LEU LEU A . n 
A 1 30 THR 30 29 29 THR THR A . n 
A 1 31 ILE 31 30 30 ILE ILE A . n 
A 1 32 SER 32 31 31 SER SER A . n 
A 1 33 SER 33 32 32 SER SER A . n 
A 1 34 LEU 34 33 33 LEU LEU A . n 
A 1 35 LYS 35 34 34 LYS LYS A . n 
A 1 36 ASP 36 35 35 ASP ASP A . n 
A 1 37 GLY 37 36 36 GLY GLY A . n 
A 1 38 GLY 38 37 37 GLY GLY A . n 
A 1 39 LYS 39 38 38 LYS LYS A . n 
A 1 40 ALA 40 39 39 ALA ALA A . n 
A 1 41 ALA 41 40 40 ALA ALA A . n 
A 1 42 GLN 42 41 41 GLN GLN A . n 
A 1 43 ALA 43 42 42 ALA ALA A . n 
A 1 44 ASN 44 43 43 ASN ASN A . n 
A 1 45 VAL 45 44 44 VAL VAL A . n 
A 1 46 ARG 46 45 45 ARG ARG A . n 
A 1 47 ILE 47 46 46 ILE ILE A . n 
A 1 48 GLY 48 47 47 GLY GLY A . n 
A 1 49 ASP 49 48 48 ASP ASP A . n 
A 1 50 VAL 50 49 49 VAL VAL A . n 
A 1 51 VAL 51 50 50 VAL VAL A . n 
A 1 52 LEU 52 51 51 LEU LEU A . n 
A 1 53 SER 53 52 52 SER SER A . n 
A 1 54 ILE 54 53 53 ILE ILE A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 GLY 56 55 55 GLY GLY A . n 
A 1 57 ILE 57 56 56 ILE ILE A . n 
A 1 58 ASN 58 57 57 ASN ASN A . n 
A 1 59 ALA 59 58 58 ALA ALA A . n 
A 1 60 GLN 60 59 59 GLN GLN A . n 
A 1 61 GLY 61 60 60 GLY GLY A . n 
A 1 62 MET 62 61 61 MET MET A . n 
A 1 63 THR 63 62 62 THR THR A . n 
A 1 64 HIS 64 63 63 HIS HIS A . n 
A 1 65 LEU 65 64 64 LEU LEU A . n 
A 1 66 GLU 66 65 65 GLU GLU A . n 
A 1 67 ALA 67 66 66 ALA ALA A . n 
A 1 68 GLN 68 67 67 GLN GLN A . n 
A 1 69 ASN 69 68 68 ASN ASN A . n 
A 1 70 LYS 70 69 69 LYS LYS A . n 
A 1 71 ILE 71 70 70 ILE ILE A . n 
A 1 72 LYS 72 71 71 LYS LYS A . n 
A 1 73 GLY 73 72 72 GLY GLY A . n 
A 1 74 CYS 74 73 73 CYS CYS A . n 
A 1 75 THR 75 74 74 THR THR A . n 
A 1 76 GLY 76 75 75 GLY GLY A . n 
A 1 77 SER 77 76 76 SER SER A . n 
A 1 78 LEU 78 77 77 LEU LEU A . n 
A 1 79 ASN 79 78 78 ASN ASN A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 THR 81 80 80 THR THR A . n 
A 1 82 LEU 82 81 81 LEU LEU A . n 
A 1 83 GLN 83 82 82 GLN GLN A . n 
A 1 84 ARG 84 83 83 ARG ARG A . n 
A 1 85 GLU 85 84 84 GLU GLU A . n 
A 1 86 SER 86 85 85 SER SER A . n 
A 1 87 ASP 87 86 86 ASP ASP A . n 
A 1 88 LEU 88 87 87 LEU LEU A . n 
B 1 1  SER 1  0  ?  ?   ?   B . n 
B 1 2  MET 2  1  ?  ?   ?   B . n 
B 1 3  SER 3  2  2  SER SER B . n 
B 1 4  ASN 4  3  3  ASN ASN B . n 
B 1 5  TYR 5  4  4  TYR TYR B . n 
B 1 6  SER 6  5  5  SER SER B . n 
B 1 7  VAL 7  6  6  VAL VAL B . n 
B 1 8  SER 8  7  7  SER SER B . n 
B 1 9  LEU 9  8  8  LEU LEU B . n 
B 1 10 VAL 10 9  9  VAL VAL B . n 
B 1 11 GLY 11 10 10 GLY GLY B . n 
B 1 12 PRO 12 11 11 PRO PRO B . n 
B 1 13 ALA 13 12 12 ALA ALA B . n 
B 1 14 PRO 14 13 13 PRO PRO B . n 
B 1 15 TRP 15 14 14 TRP TRP B . n 
B 1 16 GLY 16 15 15 GLY GLY B . n 
B 1 17 PHE 17 16 16 PHE PHE B . n 
B 1 18 ARG 18 17 17 ARG ARG B . n 
B 1 19 LEU 19 18 18 LEU LEU B . n 
B 1 20 GLN 20 19 19 GLN GLN B . n 
B 1 21 GLY 21 20 20 GLY GLY B . n 
B 1 22 GLY 22 21 21 GLY GLY B . n 
B 1 23 LYS 23 22 22 LYS LYS B . n 
B 1 24 ASP 24 23 23 ASP ASP B . n 
B 1 25 PHE 25 24 24 PHE PHE B . n 
B 1 26 ASN 26 25 25 ASN ASN B . n 
B 1 27 MET 27 26 26 MET MET B . n 
B 1 28 PRO 28 27 27 PRO PRO B . n 
B 1 29 LEU 29 28 28 LEU LEU B . n 
B 1 30 THR 30 29 29 THR THR B . n 
B 1 31 ILE 31 30 30 ILE ILE B . n 
B 1 32 SER 32 31 31 SER SER B . n 
B 1 33 SER 33 32 32 SER SER B . n 
B 1 34 LEU 34 33 33 LEU LEU B . n 
B 1 35 LYS 35 34 34 LYS LYS B . n 
B 1 36 ASP 36 35 35 ASP ASP B . n 
B 1 37 GLY 37 36 36 GLY GLY B . n 
B 1 38 GLY 38 37 37 GLY GLY B . n 
B 1 39 LYS 39 38 38 LYS LYS B . n 
B 1 40 ALA 40 39 39 ALA ALA B . n 
B 1 41 ALA 41 40 40 ALA ALA B . n 
B 1 42 GLN 42 41 41 GLN GLN B . n 
B 1 43 ALA 43 42 42 ALA ALA B . n 
B 1 44 ASN 44 43 43 ASN ASN B . n 
B 1 45 VAL 45 44 44 VAL VAL B . n 
B 1 46 ARG 46 45 45 ARG ARG B . n 
B 1 47 ILE 47 46 46 ILE ILE B . n 
B 1 48 GLY 48 47 47 GLY GLY B . n 
B 1 49 ASP 49 48 48 ASP ASP B . n 
B 1 50 VAL 50 49 49 VAL VAL B . n 
B 1 51 VAL 51 50 50 VAL VAL B . n 
B 1 52 LEU 52 51 51 LEU LEU B . n 
B 1 53 SER 53 52 52 SER SER B . n 
B 1 54 ILE 54 53 53 ILE ILE B . n 
B 1 55 ASP 55 54 54 ASP ASP B . n 
B 1 56 GLY 56 55 55 GLY GLY B . n 
B 1 57 ILE 57 56 56 ILE ILE B . n 
B 1 58 ASN 58 57 57 ASN ASN B . n 
B 1 59 ALA 59 58 58 ALA ALA B . n 
B 1 60 GLN 60 59 59 GLN GLN B . n 
B 1 61 GLY 61 60 60 GLY GLY B . n 
B 1 62 MET 62 61 61 MET MET B . n 
B 1 63 THR 63 62 62 THR THR B . n 
B 1 64 HIS 64 63 63 HIS HIS B . n 
B 1 65 LEU 65 64 64 LEU LEU B . n 
B 1 66 GLU 66 65 65 GLU GLU B . n 
B 1 67 ALA 67 66 66 ALA ALA B . n 
B 1 68 GLN 68 67 67 GLN GLN B . n 
B 1 69 ASN 69 68 68 ASN ASN B . n 
B 1 70 LYS 70 69 69 LYS LYS B . n 
B 1 71 ILE 71 70 70 ILE ILE B . n 
B 1 72 LYS 72 71 71 LYS LYS B . n 
B 1 73 GLY 73 72 72 GLY GLY B . n 
B 1 74 CYS 74 73 73 CYS CYS B . n 
B 1 75 THR 75 74 74 THR THR B . n 
B 1 76 GLY 76 75 75 GLY GLY B . n 
B 1 77 SER 77 76 76 SER SER B . n 
B 1 78 LEU 78 77 77 LEU LEU B . n 
B 1 79 ASN 79 78 78 ASN ASN B . n 
B 1 80 MET 80 79 79 MET MET B . n 
B 1 81 THR 81 80 80 THR THR B . n 
B 1 82 LEU 82 81 81 LEU LEU B . n 
B 1 83 GLN 83 82 82 GLN GLN B . n 
B 1 84 ARG 84 83 83 ARG ARG B . n 
B 1 85 GLU 85 84 84 GLU GLU B . n 
B 1 86 SER 86 85 85 SER SER B . n 
B 1 87 ASP 87 86 86 ASP ASP B . n 
B 1 88 LEU 88 87 87 LEU LEU B . n 
C 1 1  SER 1  0  0  SER SER C . n 
C 1 2  MET 2  1  1  MET MET C . n 
C 1 3  SER 3  2  2  SER SER C . n 
C 1 4  ASN 4  3  3  ASN ASN C . n 
C 1 5  TYR 5  4  4  TYR TYR C . n 
C 1 6  SER 6  5  5  SER SER C . n 
C 1 7  VAL 7  6  6  VAL VAL C . n 
C 1 8  SER 8  7  7  SER SER C . n 
C 1 9  LEU 9  8  8  LEU LEU C . n 
C 1 10 VAL 10 9  9  VAL VAL C . n 
C 1 11 GLY 11 10 10 GLY GLY C . n 
C 1 12 PRO 12 11 11 PRO PRO C . n 
C 1 13 ALA 13 12 12 ALA ALA C . n 
C 1 14 PRO 14 13 13 PRO PRO C . n 
C 1 15 TRP 15 14 14 TRP TRP C . n 
C 1 16 GLY 16 15 15 GLY GLY C . n 
C 1 17 PHE 17 16 16 PHE PHE C . n 
C 1 18 ARG 18 17 17 ARG ARG C . n 
C 1 19 LEU 19 18 18 LEU LEU C . n 
C 1 20 GLN 20 19 19 GLN GLN C . n 
C 1 21 GLY 21 20 20 GLY GLY C . n 
C 1 22 GLY 22 21 21 GLY GLY C . n 
C 1 23 LYS 23 22 22 LYS LYS C . n 
C 1 24 ASP 24 23 23 ASP ASP C . n 
C 1 25 PHE 25 24 24 PHE PHE C . n 
C 1 26 ASN 26 25 25 ASN ASN C . n 
C 1 27 MET 27 26 26 MET MET C . n 
C 1 28 PRO 28 27 27 PRO PRO C . n 
C 1 29 LEU 29 28 28 LEU LEU C . n 
C 1 30 THR 30 29 29 THR THR C . n 
C 1 31 ILE 31 30 30 ILE ILE C . n 
C 1 32 SER 32 31 31 SER SER C . n 
C 1 33 SER 33 32 32 SER SER C . n 
C 1 34 LEU 34 33 33 LEU LEU C . n 
C 1 35 LYS 35 34 34 LYS LYS C . n 
C 1 36 ASP 36 35 35 ASP ASP C . n 
C 1 37 GLY 37 36 36 GLY GLY C . n 
C 1 38 GLY 38 37 37 GLY GLY C . n 
C 1 39 LYS 39 38 38 LYS LYS C . n 
C 1 40 ALA 40 39 39 ALA ALA C . n 
C 1 41 ALA 41 40 40 ALA ALA C . n 
C 1 42 GLN 42 41 41 GLN GLN C . n 
C 1 43 ALA 43 42 42 ALA ALA C . n 
C 1 44 ASN 44 43 43 ASN ASN C . n 
C 1 45 VAL 45 44 44 VAL VAL C . n 
C 1 46 ARG 46 45 45 ARG ARG C . n 
C 1 47 ILE 47 46 46 ILE ILE C . n 
C 1 48 GLY 48 47 47 GLY GLY C . n 
C 1 49 ASP 49 48 48 ASP ASP C . n 
C 1 50 VAL 50 49 49 VAL VAL C . n 
C 1 51 VAL 51 50 50 VAL VAL C . n 
C 1 52 LEU 52 51 51 LEU LEU C . n 
C 1 53 SER 53 52 52 SER SER C . n 
C 1 54 ILE 54 53 53 ILE ILE C . n 
C 1 55 ASP 55 54 54 ASP ASP C . n 
C 1 56 GLY 56 55 55 GLY GLY C . n 
C 1 57 ILE 57 56 56 ILE ILE C . n 
C 1 58 ASN 58 57 57 ASN ASN C . n 
C 1 59 ALA 59 58 58 ALA ALA C . n 
C 1 60 GLN 60 59 59 GLN GLN C . n 
C 1 61 GLY 61 60 60 GLY GLY C . n 
C 1 62 MET 62 61 61 MET MET C . n 
C 1 63 THR 63 62 62 THR THR C . n 
C 1 64 HIS 64 63 63 HIS HIS C . n 
C 1 65 LEU 65 64 64 LEU LEU C . n 
C 1 66 GLU 66 65 65 GLU GLU C . n 
C 1 67 ALA 67 66 66 ALA ALA C . n 
C 1 68 GLN 68 67 67 GLN GLN C . n 
C 1 69 ASN 69 68 68 ASN ASN C . n 
C 1 70 LYS 70 69 69 LYS LYS C . n 
C 1 71 ILE 71 70 70 ILE ILE C . n 
C 1 72 LYS 72 71 71 LYS LYS C . n 
C 1 73 GLY 73 72 72 GLY GLY C . n 
C 1 74 CYS 74 73 73 CYS CYS C . n 
C 1 75 THR 75 74 74 THR THR C . n 
C 1 76 GLY 76 75 75 GLY GLY C . n 
C 1 77 SER 77 76 76 SER SER C . n 
C 1 78 LEU 78 77 77 LEU LEU C . n 
C 1 79 ASN 79 78 78 ASN ASN C . n 
C 1 80 MET 80 79 79 MET MET C . n 
C 1 81 THR 81 80 80 THR THR C . n 
C 1 82 LEU 82 81 81 LEU LEU C . n 
C 1 83 GLN 83 82 82 GLN GLN C . n 
C 1 84 ARG 84 83 83 ARG ARG C . n 
C 1 85 GLU 85 84 84 GLU GLU C . n 
C 1 86 SER 86 85 85 SER SER C . n 
C 1 87 ASP 87 86 86 ASP ASP C . n 
C 1 88 LEU 88 87 87 LEU LEU C . n 
D 1 1  SER 1  0  0  SER SER D . n 
D 1 2  MET 2  1  1  MET MET D . n 
D 1 3  SER 3  2  2  SER SER D . n 
D 1 4  ASN 4  3  3  ASN ASN D . n 
D 1 5  TYR 5  4  4  TYR TYR D . n 
D 1 6  SER 6  5  5  SER SER D . n 
D 1 7  VAL 7  6  6  VAL VAL D . n 
D 1 8  SER 8  7  7  SER SER D . n 
D 1 9  LEU 9  8  8  LEU LEU D . n 
D 1 10 VAL 10 9  9  VAL VAL D . n 
D 1 11 GLY 11 10 10 GLY GLY D . n 
D 1 12 PRO 12 11 11 PRO PRO D . n 
D 1 13 ALA 13 12 12 ALA ALA D . n 
D 1 14 PRO 14 13 13 PRO PRO D . n 
D 1 15 TRP 15 14 14 TRP TRP D . n 
D 1 16 GLY 16 15 15 GLY GLY D . n 
D 1 17 PHE 17 16 16 PHE PHE D . n 
D 1 18 ARG 18 17 17 ARG ARG D . n 
D 1 19 LEU 19 18 18 LEU LEU D . n 
D 1 20 GLN 20 19 19 GLN GLN D . n 
D 1 21 GLY 21 20 20 GLY GLY D . n 
D 1 22 GLY 22 21 21 GLY GLY D . n 
D 1 23 LYS 23 22 22 LYS LYS D . n 
D 1 24 ASP 24 23 23 ASP ASP D . n 
D 1 25 PHE 25 24 24 PHE PHE D . n 
D 1 26 ASN 26 25 25 ASN ASN D . n 
D 1 27 MET 27 26 26 MET MET D . n 
D 1 28 PRO 28 27 27 PRO PRO D . n 
D 1 29 LEU 29 28 28 LEU LEU D . n 
D 1 30 THR 30 29 29 THR THR D . n 
D 1 31 ILE 31 30 30 ILE ILE D . n 
D 1 32 SER 32 31 31 SER SER D . n 
D 1 33 SER 33 32 32 SER SER D . n 
D 1 34 LEU 34 33 33 LEU LEU D . n 
D 1 35 LYS 35 34 34 LYS LYS D . n 
D 1 36 ASP 36 35 35 ASP ASP D . n 
D 1 37 GLY 37 36 36 GLY GLY D . n 
D 1 38 GLY 38 37 37 GLY GLY D . n 
D 1 39 LYS 39 38 38 LYS LYS D . n 
D 1 40 ALA 40 39 39 ALA ALA D . n 
D 1 41 ALA 41 40 40 ALA ALA D . n 
D 1 42 GLN 42 41 41 GLN GLN D . n 
D 1 43 ALA 43 42 42 ALA ALA D . n 
D 1 44 ASN 44 43 43 ASN ASN D . n 
D 1 45 VAL 45 44 44 VAL VAL D . n 
D 1 46 ARG 46 45 45 ARG ARG D . n 
D 1 47 ILE 47 46 46 ILE ILE D . n 
D 1 48 GLY 48 47 47 GLY GLY D . n 
D 1 49 ASP 49 48 48 ASP ASP D . n 
D 1 50 VAL 50 49 49 VAL VAL D . n 
D 1 51 VAL 51 50 50 VAL VAL D . n 
D 1 52 LEU 52 51 51 LEU LEU D . n 
D 1 53 SER 53 52 52 SER SER D . n 
D 1 54 ILE 54 53 53 ILE ILE D . n 
D 1 55 ASP 55 54 54 ASP ASP D . n 
D 1 56 GLY 56 55 55 GLY GLY D . n 
D 1 57 ILE 57 56 56 ILE ILE D . n 
D 1 58 ASN 58 57 57 ASN ASN D . n 
D 1 59 ALA 59 58 58 ALA ALA D . n 
D 1 60 GLN 60 59 59 GLN GLN D . n 
D 1 61 GLY 61 60 60 GLY GLY D . n 
D 1 62 MET 62 61 61 MET MET D . n 
D 1 63 THR 63 62 62 THR THR D . n 
D 1 64 HIS 64 63 63 HIS HIS D . n 
D 1 65 LEU 65 64 64 LEU LEU D . n 
D 1 66 GLU 66 65 65 GLU GLU D . n 
D 1 67 ALA 67 66 66 ALA ALA D . n 
D 1 68 GLN 68 67 67 GLN GLN D . n 
D 1 69 ASN 69 68 68 ASN ASN D . n 
D 1 70 LYS 70 69 69 LYS LYS D . n 
D 1 71 ILE 71 70 70 ILE ILE D . n 
D 1 72 LYS 72 71 71 LYS LYS D . n 
D 1 73 GLY 73 72 72 GLY GLY D . n 
D 1 74 CYS 74 73 73 CYS CYS D . n 
D 1 75 THR 75 74 74 THR THR D . n 
D 1 76 GLY 76 75 75 GLY GLY D . n 
D 1 77 SER 77 76 76 SER SER D . n 
D 1 78 LEU 78 77 77 LEU LEU D . n 
D 1 79 ASN 79 78 78 ASN ASN D . n 
D 1 80 MET 80 79 79 MET MET D . n 
D 1 81 THR 81 80 80 THR THR D . n 
D 1 82 LEU 82 81 81 LEU LEU D . n 
D 1 83 GLN 83 82 82 GLN GLN D . n 
D 1 84 ARG 84 83 83 ARG ARG D . n 
D 1 85 GLU 85 84 84 GLU GLU D . n 
D 1 86 SER 86 85 85 SER SER D . n 
D 1 87 ASP 87 86 86 ASP ASP D . n 
D 1 88 LEU 88 87 87 LEU LEU D . n 
E 1 1  SER 1  0  ?  ?   ?   E . n 
E 1 2  MET 2  1  1  MET MET E . n 
E 1 3  SER 3  2  2  SER SER E . n 
E 1 4  ASN 4  3  3  ASN ASN E . n 
E 1 5  TYR 5  4  4  TYR TYR E . n 
E 1 6  SER 6  5  5  SER SER E . n 
E 1 7  VAL 7  6  6  VAL VAL E . n 
E 1 8  SER 8  7  7  SER SER E . n 
E 1 9  LEU 9  8  8  LEU LEU E . n 
E 1 10 VAL 10 9  9  VAL VAL E . n 
E 1 11 GLY 11 10 10 GLY GLY E . n 
E 1 12 PRO 12 11 11 PRO PRO E . n 
E 1 13 ALA 13 12 12 ALA ALA E . n 
E 1 14 PRO 14 13 13 PRO PRO E . n 
E 1 15 TRP 15 14 14 TRP TRP E . n 
E 1 16 GLY 16 15 15 GLY GLY E . n 
E 1 17 PHE 17 16 16 PHE PHE E . n 
E 1 18 ARG 18 17 17 ARG ARG E . n 
E 1 19 LEU 19 18 18 LEU LEU E . n 
E 1 20 GLN 20 19 19 GLN GLN E . n 
E 1 21 GLY 21 20 20 GLY GLY E . n 
E 1 22 GLY 22 21 21 GLY GLY E . n 
E 1 23 LYS 23 22 22 LYS LYS E . n 
E 1 24 ASP 24 23 23 ASP ASP E . n 
E 1 25 PHE 25 24 24 PHE PHE E . n 
E 1 26 ASN 26 25 25 ASN ASN E . n 
E 1 27 MET 27 26 26 MET MET E . n 
E 1 28 PRO 28 27 27 PRO PRO E . n 
E 1 29 LEU 29 28 28 LEU LEU E . n 
E 1 30 THR 30 29 29 THR THR E . n 
E 1 31 ILE 31 30 30 ILE ILE E . n 
E 1 32 SER 32 31 31 SER SER E . n 
E 1 33 SER 33 32 32 SER SER E . n 
E 1 34 LEU 34 33 33 LEU LEU E . n 
E 1 35 LYS 35 34 34 LYS LYS E . n 
E 1 36 ASP 36 35 35 ASP ASP E . n 
E 1 37 GLY 37 36 36 GLY GLY E . n 
E 1 38 GLY 38 37 37 GLY GLY E . n 
E 1 39 LYS 39 38 38 LYS LYS E . n 
E 1 40 ALA 40 39 39 ALA ALA E . n 
E 1 41 ALA 41 40 40 ALA ALA E . n 
E 1 42 GLN 42 41 41 GLN GLN E . n 
E 1 43 ALA 43 42 42 ALA ALA E . n 
E 1 44 ASN 44 43 43 ASN ASN E . n 
E 1 45 VAL 45 44 44 VAL VAL E . n 
E 1 46 ARG 46 45 45 ARG ARG E . n 
E 1 47 ILE 47 46 46 ILE ILE E . n 
E 1 48 GLY 48 47 47 GLY GLY E . n 
E 1 49 ASP 49 48 48 ASP ASP E . n 
E 1 50 VAL 50 49 49 VAL VAL E . n 
E 1 51 VAL 51 50 50 VAL VAL E . n 
E 1 52 LEU 52 51 51 LEU LEU E . n 
E 1 53 SER 53 52 52 SER SER E . n 
E 1 54 ILE 54 53 53 ILE ILE E . n 
E 1 55 ASP 55 54 54 ASP ASP E . n 
E 1 56 GLY 56 55 55 GLY GLY E . n 
E 1 57 ILE 57 56 56 ILE ILE E . n 
E 1 58 ASN 58 57 57 ASN ASN E . n 
E 1 59 ALA 59 58 58 ALA ALA E . n 
E 1 60 GLN 60 59 59 GLN GLN E . n 
E 1 61 GLY 61 60 60 GLY GLY E . n 
E 1 62 MET 62 61 61 MET MET E . n 
E 1 63 THR 63 62 62 THR THR E . n 
E 1 64 HIS 64 63 63 HIS HIS E . n 
E 1 65 LEU 65 64 64 LEU LEU E . n 
E 1 66 GLU 66 65 65 GLU GLU E . n 
E 1 67 ALA 67 66 66 ALA ALA E . n 
E 1 68 GLN 68 67 67 GLN GLN E . n 
E 1 69 ASN 69 68 68 ASN ASN E . n 
E 1 70 LYS 70 69 69 LYS LYS E . n 
E 1 71 ILE 71 70 70 ILE ILE E . n 
E 1 72 LYS 72 71 71 LYS LYS E . n 
E 1 73 GLY 73 72 72 GLY GLY E . n 
E 1 74 CYS 74 73 73 CYS CYS E . n 
E 1 75 THR 75 74 74 THR THR E . n 
E 1 76 GLY 76 75 75 GLY GLY E . n 
E 1 77 SER 77 76 76 SER SER E . n 
E 1 78 LEU 78 77 77 LEU LEU E . n 
E 1 79 ASN 79 78 78 ASN ASN E . n 
E 1 80 MET 80 79 79 MET MET E . n 
E 1 81 THR 81 80 80 THR THR E . n 
E 1 82 LEU 82 81 81 LEU LEU E . n 
E 1 83 GLN 83 82 82 GLN GLN E . n 
E 1 84 ARG 84 83 83 ARG ARG E . n 
E 1 85 GLU 85 84 84 GLU GLU E . n 
E 1 86 SER 86 85 85 SER SER E . n 
E 1 87 ASP 87 86 86 ASP ASP E . n 
E 1 88 LEU 88 87 87 LEU LEU E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 2 CL  1   1088 1088 CL  CL  B . 
G 3 EDO 1   1089 1089 EDO EDO B . 
H 2 CL  1   1088 1088 CL  CL  C . 
I 2 CL  1   1088 1088 CL  CL  D . 
J 2 CL  1   1089 1089 CL  CL  D . 
K 3 EDO 1   1090 1090 EDO EDO D . 
L 2 CL  1   1088 1088 CL  CL  E . 
M 2 CL  1   1089 1089 CL  CL  E . 
N 4 HOH 1   2001 2001 HOH HOH A . 
N 4 HOH 2   2002 2002 HOH HOH A . 
N 4 HOH 3   2003 2003 HOH HOH A . 
N 4 HOH 4   2004 2004 HOH HOH A . 
N 4 HOH 5   2005 2005 HOH HOH A . 
N 4 HOH 6   2006 2006 HOH HOH A . 
N 4 HOH 7   2007 2007 HOH HOH A . 
N 4 HOH 8   2008 2008 HOH HOH A . 
N 4 HOH 9   2009 2009 HOH HOH A . 
N 4 HOH 10  2010 2010 HOH HOH A . 
N 4 HOH 11  2011 2011 HOH HOH A . 
N 4 HOH 12  2012 2012 HOH HOH A . 
N 4 HOH 13  2013 2013 HOH HOH A . 
N 4 HOH 14  2014 2014 HOH HOH A . 
N 4 HOH 15  2015 2015 HOH HOH A . 
N 4 HOH 16  2016 2016 HOH HOH A . 
N 4 HOH 17  2017 2017 HOH HOH A . 
N 4 HOH 18  2018 2018 HOH HOH A . 
N 4 HOH 19  2019 2019 HOH HOH A . 
N 4 HOH 20  2020 2020 HOH HOH A . 
N 4 HOH 21  2021 2021 HOH HOH A . 
N 4 HOH 22  2022 2022 HOH HOH A . 
N 4 HOH 23  2023 2023 HOH HOH A . 
N 4 HOH 24  2024 2024 HOH HOH A . 
N 4 HOH 25  2025 2025 HOH HOH A . 
N 4 HOH 26  2026 2026 HOH HOH A . 
N 4 HOH 27  2027 2027 HOH HOH A . 
N 4 HOH 28  2028 2028 HOH HOH A . 
N 4 HOH 29  2029 2029 HOH HOH A . 
N 4 HOH 30  2030 2030 HOH HOH A . 
N 4 HOH 31  2031 2031 HOH HOH A . 
N 4 HOH 32  2032 2032 HOH HOH A . 
N 4 HOH 33  2033 2033 HOH HOH A . 
N 4 HOH 34  2034 2034 HOH HOH A . 
N 4 HOH 35  2035 2035 HOH HOH A . 
N 4 HOH 36  2036 2036 HOH HOH A . 
N 4 HOH 37  2037 2037 HOH HOH A . 
N 4 HOH 38  2038 2038 HOH HOH A . 
N 4 HOH 39  2039 2039 HOH HOH A . 
N 4 HOH 40  2040 2040 HOH HOH A . 
N 4 HOH 41  2041 2041 HOH HOH A . 
N 4 HOH 42  2042 2042 HOH HOH A . 
N 4 HOH 43  2043 2043 HOH HOH A . 
N 4 HOH 44  2044 2044 HOH HOH A . 
N 4 HOH 45  2045 2045 HOH HOH A . 
N 4 HOH 46  2046 2046 HOH HOH A . 
N 4 HOH 47  2047 2047 HOH HOH A . 
N 4 HOH 48  2048 2048 HOH HOH A . 
N 4 HOH 49  2049 2049 HOH HOH A . 
N 4 HOH 50  2050 2050 HOH HOH A . 
N 4 HOH 51  2051 2051 HOH HOH A . 
N 4 HOH 52  2052 2052 HOH HOH A . 
N 4 HOH 53  2053 2053 HOH HOH A . 
N 4 HOH 54  2054 2054 HOH HOH A . 
N 4 HOH 55  2055 2055 HOH HOH A . 
N 4 HOH 56  2056 2056 HOH HOH A . 
N 4 HOH 57  2057 2057 HOH HOH A . 
N 4 HOH 58  2058 2058 HOH HOH A . 
N 4 HOH 59  2059 2059 HOH HOH A . 
N 4 HOH 60  2060 2060 HOH HOH A . 
N 4 HOH 61  2061 2061 HOH HOH A . 
N 4 HOH 62  2062 2062 HOH HOH A . 
N 4 HOH 63  2063 2063 HOH HOH A . 
N 4 HOH 64  2064 2064 HOH HOH A . 
N 4 HOH 65  2065 2065 HOH HOH A . 
N 4 HOH 66  2066 2066 HOH HOH A . 
N 4 HOH 67  2067 2067 HOH HOH A . 
N 4 HOH 68  2068 2068 HOH HOH A . 
N 4 HOH 69  2069 2069 HOH HOH A . 
N 4 HOH 70  2070 2070 HOH HOH A . 
N 4 HOH 71  2071 2071 HOH HOH A . 
N 4 HOH 72  2072 2072 HOH HOH A . 
N 4 HOH 73  2073 2073 HOH HOH A . 
N 4 HOH 74  2074 2074 HOH HOH A . 
N 4 HOH 75  2075 2075 HOH HOH A . 
N 4 HOH 76  2076 2076 HOH HOH A . 
N 4 HOH 77  2077 2077 HOH HOH A . 
O 4 HOH 1   2001 2001 HOH HOH B . 
O 4 HOH 2   2002 2002 HOH HOH B . 
O 4 HOH 3   2003 2003 HOH HOH B . 
O 4 HOH 4   2004 2004 HOH HOH B . 
O 4 HOH 5   2005 2005 HOH HOH B . 
O 4 HOH 6   2006 2006 HOH HOH B . 
O 4 HOH 7   2007 2007 HOH HOH B . 
O 4 HOH 8   2008 2008 HOH HOH B . 
O 4 HOH 9   2009 2009 HOH HOH B . 
O 4 HOH 10  2010 2010 HOH HOH B . 
O 4 HOH 11  2011 2011 HOH HOH B . 
O 4 HOH 12  2012 2012 HOH HOH B . 
O 4 HOH 13  2013 2013 HOH HOH B . 
O 4 HOH 14  2014 2014 HOH HOH B . 
O 4 HOH 15  2015 2015 HOH HOH B . 
O 4 HOH 16  2016 2016 HOH HOH B . 
O 4 HOH 17  2017 2017 HOH HOH B . 
O 4 HOH 18  2018 2018 HOH HOH B . 
O 4 HOH 19  2019 2019 HOH HOH B . 
O 4 HOH 20  2020 2020 HOH HOH B . 
O 4 HOH 21  2021 2021 HOH HOH B . 
O 4 HOH 22  2022 2022 HOH HOH B . 
O 4 HOH 23  2023 2023 HOH HOH B . 
O 4 HOH 24  2024 2024 HOH HOH B . 
O 4 HOH 25  2025 2025 HOH HOH B . 
O 4 HOH 26  2026 2026 HOH HOH B . 
O 4 HOH 27  2027 2027 HOH HOH B . 
O 4 HOH 28  2028 2028 HOH HOH B . 
O 4 HOH 29  2029 2029 HOH HOH B . 
O 4 HOH 30  2030 2030 HOH HOH B . 
O 4 HOH 31  2031 2031 HOH HOH B . 
O 4 HOH 32  2032 2032 HOH HOH B . 
O 4 HOH 33  2033 2033 HOH HOH B . 
O 4 HOH 34  2034 2034 HOH HOH B . 
O 4 HOH 35  2035 2035 HOH HOH B . 
O 4 HOH 36  2036 2036 HOH HOH B . 
O 4 HOH 37  2037 2037 HOH HOH B . 
O 4 HOH 38  2038 2038 HOH HOH B . 
O 4 HOH 39  2039 2039 HOH HOH B . 
O 4 HOH 40  2040 2040 HOH HOH B . 
O 4 HOH 41  2041 2041 HOH HOH B . 
O 4 HOH 42  2042 2042 HOH HOH B . 
O 4 HOH 43  2043 2043 HOH HOH B . 
O 4 HOH 44  2044 2044 HOH HOH B . 
O 4 HOH 45  2045 2045 HOH HOH B . 
O 4 HOH 46  2046 2046 HOH HOH B . 
O 4 HOH 47  2047 2047 HOH HOH B . 
O 4 HOH 48  2048 2048 HOH HOH B . 
O 4 HOH 49  2049 2049 HOH HOH B . 
O 4 HOH 50  2050 2050 HOH HOH B . 
O 4 HOH 51  2051 2051 HOH HOH B . 
O 4 HOH 52  2052 2052 HOH HOH B . 
O 4 HOH 53  2053 2053 HOH HOH B . 
O 4 HOH 54  2054 2054 HOH HOH B . 
O 4 HOH 55  2055 2055 HOH HOH B . 
O 4 HOH 56  2056 2056 HOH HOH B . 
O 4 HOH 57  2057 2057 HOH HOH B . 
O 4 HOH 58  2058 2058 HOH HOH B . 
O 4 HOH 59  2059 2059 HOH HOH B . 
O 4 HOH 60  2060 2060 HOH HOH B . 
O 4 HOH 61  2061 2061 HOH HOH B . 
O 4 HOH 62  2062 2062 HOH HOH B . 
O 4 HOH 63  2063 2063 HOH HOH B . 
O 4 HOH 64  2064 2064 HOH HOH B . 
O 4 HOH 65  2065 2065 HOH HOH B . 
O 4 HOH 66  2066 2066 HOH HOH B . 
O 4 HOH 67  2067 2067 HOH HOH B . 
O 4 HOH 68  2068 2068 HOH HOH B . 
O 4 HOH 69  2069 2069 HOH HOH B . 
O 4 HOH 70  2070 2070 HOH HOH B . 
O 4 HOH 71  2071 2071 HOH HOH B . 
O 4 HOH 72  2072 2072 HOH HOH B . 
O 4 HOH 73  2073 2073 HOH HOH B . 
O 4 HOH 74  2074 2074 HOH HOH B . 
O 4 HOH 75  2075 2075 HOH HOH B . 
O 4 HOH 76  2076 2076 HOH HOH B . 
O 4 HOH 77  2077 2077 HOH HOH B . 
O 4 HOH 78  2078 2078 HOH HOH B . 
O 4 HOH 79  2079 2079 HOH HOH B . 
O 4 HOH 80  2080 2080 HOH HOH B . 
O 4 HOH 81  2081 2081 HOH HOH B . 
O 4 HOH 82  2082 2082 HOH HOH B . 
O 4 HOH 83  2083 2083 HOH HOH B . 
O 4 HOH 84  2084 2084 HOH HOH B . 
O 4 HOH 85  2085 2085 HOH HOH B . 
P 4 HOH 1   2001 2001 HOH HOH C . 
P 4 HOH 2   2002 2002 HOH HOH C . 
P 4 HOH 3   2003 2003 HOH HOH C . 
P 4 HOH 4   2004 2004 HOH HOH C . 
P 4 HOH 5   2005 2005 HOH HOH C . 
P 4 HOH 6   2006 2006 HOH HOH C . 
P 4 HOH 7   2007 2007 HOH HOH C . 
P 4 HOH 8   2008 2008 HOH HOH C . 
P 4 HOH 9   2009 2009 HOH HOH C . 
P 4 HOH 10  2010 2010 HOH HOH C . 
P 4 HOH 11  2011 2011 HOH HOH C . 
P 4 HOH 12  2012 2012 HOH HOH C . 
P 4 HOH 13  2013 2013 HOH HOH C . 
P 4 HOH 14  2014 2014 HOH HOH C . 
P 4 HOH 15  2015 2015 HOH HOH C . 
P 4 HOH 16  2016 2016 HOH HOH C . 
P 4 HOH 17  2017 2017 HOH HOH C . 
P 4 HOH 18  2018 2018 HOH HOH C . 
P 4 HOH 19  2019 2019 HOH HOH C . 
P 4 HOH 20  2020 2020 HOH HOH C . 
P 4 HOH 21  2021 2021 HOH HOH C . 
P 4 HOH 22  2022 2022 HOH HOH C . 
P 4 HOH 23  2023 2023 HOH HOH C . 
P 4 HOH 24  2024 2024 HOH HOH C . 
P 4 HOH 25  2025 2025 HOH HOH C . 
P 4 HOH 26  2026 2026 HOH HOH C . 
P 4 HOH 27  2027 2027 HOH HOH C . 
P 4 HOH 28  2028 2028 HOH HOH C . 
P 4 HOH 29  2029 2029 HOH HOH C . 
P 4 HOH 30  2030 2030 HOH HOH C . 
P 4 HOH 31  2031 2031 HOH HOH C . 
P 4 HOH 32  2032 2032 HOH HOH C . 
P 4 HOH 33  2033 2033 HOH HOH C . 
P 4 HOH 34  2034 2034 HOH HOH C . 
P 4 HOH 35  2035 2035 HOH HOH C . 
P 4 HOH 36  2036 2036 HOH HOH C . 
P 4 HOH 37  2037 2037 HOH HOH C . 
P 4 HOH 38  2038 2038 HOH HOH C . 
P 4 HOH 39  2039 2039 HOH HOH C . 
P 4 HOH 40  2040 2040 HOH HOH C . 
P 4 HOH 41  2041 2041 HOH HOH C . 
P 4 HOH 42  2042 2042 HOH HOH C . 
P 4 HOH 43  2043 2043 HOH HOH C . 
P 4 HOH 44  2044 2044 HOH HOH C . 
P 4 HOH 45  2045 2045 HOH HOH C . 
P 4 HOH 46  2046 2046 HOH HOH C . 
P 4 HOH 47  2047 2047 HOH HOH C . 
P 4 HOH 48  2048 2048 HOH HOH C . 
P 4 HOH 49  2049 2049 HOH HOH C . 
P 4 HOH 50  2050 2050 HOH HOH C . 
P 4 HOH 51  2051 2051 HOH HOH C . 
P 4 HOH 52  2052 2052 HOH HOH C . 
P 4 HOH 53  2053 2053 HOH HOH C . 
P 4 HOH 54  2054 2054 HOH HOH C . 
P 4 HOH 55  2055 2055 HOH HOH C . 
P 4 HOH 56  2056 2056 HOH HOH C . 
P 4 HOH 57  2057 2057 HOH HOH C . 
P 4 HOH 58  2058 2058 HOH HOH C . 
P 4 HOH 59  2059 2059 HOH HOH C . 
P 4 HOH 60  2060 2060 HOH HOH C . 
P 4 HOH 61  2061 2061 HOH HOH C . 
P 4 HOH 62  2062 2062 HOH HOH C . 
P 4 HOH 63  2063 2063 HOH HOH C . 
P 4 HOH 64  2064 2064 HOH HOH C . 
P 4 HOH 65  2065 2065 HOH HOH C . 
P 4 HOH 66  2066 2066 HOH HOH C . 
P 4 HOH 67  2067 2067 HOH HOH C . 
P 4 HOH 68  2068 2068 HOH HOH C . 
P 4 HOH 69  2069 2069 HOH HOH C . 
P 4 HOH 70  2070 2070 HOH HOH C . 
P 4 HOH 71  2071 2071 HOH HOH C . 
P 4 HOH 72  2072 2072 HOH HOH C . 
P 4 HOH 73  2073 2073 HOH HOH C . 
P 4 HOH 74  2074 2074 HOH HOH C . 
P 4 HOH 75  2075 2075 HOH HOH C . 
P 4 HOH 76  2076 2076 HOH HOH C . 
P 4 HOH 77  2077 2077 HOH HOH C . 
P 4 HOH 78  2078 2078 HOH HOH C . 
P 4 HOH 79  2079 2079 HOH HOH C . 
P 4 HOH 80  2080 2080 HOH HOH C . 
P 4 HOH 81  2081 2081 HOH HOH C . 
P 4 HOH 82  2082 2082 HOH HOH C . 
P 4 HOH 83  2083 2083 HOH HOH C . 
P 4 HOH 84  2084 2084 HOH HOH C . 
P 4 HOH 85  2085 2085 HOH HOH C . 
P 4 HOH 86  2086 2086 HOH HOH C . 
P 4 HOH 87  2087 2087 HOH HOH C . 
P 4 HOH 88  2088 2088 HOH HOH C . 
P 4 HOH 89  2089 2089 HOH HOH C . 
P 4 HOH 90  2090 2090 HOH HOH C . 
P 4 HOH 91  2091 2091 HOH HOH C . 
P 4 HOH 92  2092 2092 HOH HOH C . 
P 4 HOH 93  2093 2093 HOH HOH C . 
P 4 HOH 94  2094 2094 HOH HOH C . 
P 4 HOH 95  2095 2095 HOH HOH C . 
P 4 HOH 96  2096 2096 HOH HOH C . 
P 4 HOH 97  2097 2097 HOH HOH C . 
P 4 HOH 98  2098 2098 HOH HOH C . 
P 4 HOH 99  2099 2099 HOH HOH C . 
P 4 HOH 100 2100 2100 HOH HOH C . 
P 4 HOH 101 2101 2101 HOH HOH C . 
P 4 HOH 102 2102 2102 HOH HOH C . 
P 4 HOH 103 2103 2103 HOH HOH C . 
P 4 HOH 104 2104 2104 HOH HOH C . 
P 4 HOH 105 2105 2105 HOH HOH C . 
P 4 HOH 106 2106 2106 HOH HOH C . 
P 4 HOH 107 2107 2107 HOH HOH C . 
P 4 HOH 108 2108 2108 HOH HOH C . 
P 4 HOH 109 2109 2109 HOH HOH C . 
P 4 HOH 110 2110 2110 HOH HOH C . 
P 4 HOH 111 2111 2111 HOH HOH C . 
P 4 HOH 112 2112 2112 HOH HOH C . 
P 4 HOH 113 2113 2113 HOH HOH C . 
P 4 HOH 114 2114 2114 HOH HOH C . 
Q 4 HOH 1   2001 2001 HOH HOH D . 
Q 4 HOH 2   2002 2002 HOH HOH D . 
Q 4 HOH 3   2003 2003 HOH HOH D . 
Q 4 HOH 4   2004 2004 HOH HOH D . 
Q 4 HOH 5   2005 2005 HOH HOH D . 
Q 4 HOH 6   2006 2006 HOH HOH D . 
Q 4 HOH 7   2007 2007 HOH HOH D . 
Q 4 HOH 8   2008 2008 HOH HOH D . 
Q 4 HOH 9   2009 2009 HOH HOH D . 
Q 4 HOH 10  2010 2010 HOH HOH D . 
Q 4 HOH 11  2011 2011 HOH HOH D . 
Q 4 HOH 12  2012 2012 HOH HOH D . 
Q 4 HOH 13  2013 2013 HOH HOH D . 
Q 4 HOH 14  2014 2014 HOH HOH D . 
Q 4 HOH 15  2015 2015 HOH HOH D . 
Q 4 HOH 16  2016 2016 HOH HOH D . 
Q 4 HOH 17  2017 2017 HOH HOH D . 
Q 4 HOH 18  2018 2018 HOH HOH D . 
Q 4 HOH 19  2019 2019 HOH HOH D . 
Q 4 HOH 20  2020 2020 HOH HOH D . 
Q 4 HOH 21  2021 2021 HOH HOH D . 
Q 4 HOH 22  2022 2022 HOH HOH D . 
Q 4 HOH 23  2023 2023 HOH HOH D . 
Q 4 HOH 24  2024 2024 HOH HOH D . 
Q 4 HOH 25  2025 2025 HOH HOH D . 
Q 4 HOH 26  2026 2026 HOH HOH D . 
Q 4 HOH 27  2027 2027 HOH HOH D . 
Q 4 HOH 28  2028 2028 HOH HOH D . 
Q 4 HOH 29  2029 2029 HOH HOH D . 
Q 4 HOH 30  2030 2030 HOH HOH D . 
Q 4 HOH 31  2031 2031 HOH HOH D . 
Q 4 HOH 32  2032 2032 HOH HOH D . 
Q 4 HOH 33  2033 2033 HOH HOH D . 
Q 4 HOH 34  2034 2034 HOH HOH D . 
Q 4 HOH 35  2035 2035 HOH HOH D . 
Q 4 HOH 36  2036 2036 HOH HOH D . 
Q 4 HOH 37  2037 2037 HOH HOH D . 
Q 4 HOH 38  2038 2038 HOH HOH D . 
Q 4 HOH 39  2039 2039 HOH HOH D . 
Q 4 HOH 40  2040 2040 HOH HOH D . 
Q 4 HOH 41  2041 2041 HOH HOH D . 
Q 4 HOH 42  2042 2042 HOH HOH D . 
Q 4 HOH 43  2043 2043 HOH HOH D . 
Q 4 HOH 44  2044 2044 HOH HOH D . 
Q 4 HOH 45  2045 2045 HOH HOH D . 
Q 4 HOH 46  2046 2046 HOH HOH D . 
Q 4 HOH 47  2047 2047 HOH HOH D . 
Q 4 HOH 48  2048 2048 HOH HOH D . 
Q 4 HOH 49  2049 2049 HOH HOH D . 
Q 4 HOH 50  2050 2050 HOH HOH D . 
Q 4 HOH 51  2051 2051 HOH HOH D . 
Q 4 HOH 52  2052 2052 HOH HOH D . 
Q 4 HOH 53  2053 2053 HOH HOH D . 
Q 4 HOH 54  2054 2054 HOH HOH D . 
Q 4 HOH 55  2055 2055 HOH HOH D . 
Q 4 HOH 56  2056 2056 HOH HOH D . 
Q 4 HOH 57  2057 2057 HOH HOH D . 
Q 4 HOH 58  2058 2058 HOH HOH D . 
Q 4 HOH 59  2059 2059 HOH HOH D . 
Q 4 HOH 60  2060 2060 HOH HOH D . 
Q 4 HOH 61  2061 2061 HOH HOH D . 
Q 4 HOH 62  2062 2062 HOH HOH D . 
Q 4 HOH 63  2063 2063 HOH HOH D . 
Q 4 HOH 64  2064 2064 HOH HOH D . 
Q 4 HOH 65  2065 2065 HOH HOH D . 
Q 4 HOH 66  2066 2066 HOH HOH D . 
Q 4 HOH 67  2067 2067 HOH HOH D . 
Q 4 HOH 68  2068 2068 HOH HOH D . 
Q 4 HOH 69  2069 2069 HOH HOH D . 
Q 4 HOH 70  2070 2070 HOH HOH D . 
Q 4 HOH 71  2071 2071 HOH HOH D . 
Q 4 HOH 72  2072 2072 HOH HOH D . 
Q 4 HOH 73  2073 2073 HOH HOH D . 
Q 4 HOH 74  2074 2074 HOH HOH D . 
Q 4 HOH 75  2075 2075 HOH HOH D . 
Q 4 HOH 76  2076 2076 HOH HOH D . 
Q 4 HOH 77  2077 2077 HOH HOH D . 
Q 4 HOH 78  2078 2078 HOH HOH D . 
Q 4 HOH 79  2079 2079 HOH HOH D . 
Q 4 HOH 80  2080 2080 HOH HOH D . 
Q 4 HOH 81  2081 2081 HOH HOH D . 
Q 4 HOH 82  2082 2082 HOH HOH D . 
Q 4 HOH 83  2083 2083 HOH HOH D . 
Q 4 HOH 84  2084 2084 HOH HOH D . 
Q 4 HOH 85  2085 2085 HOH HOH D . 
Q 4 HOH 86  2086 2086 HOH HOH D . 
Q 4 HOH 87  2087 2087 HOH HOH D . 
Q 4 HOH 88  2088 2088 HOH HOH D . 
Q 4 HOH 89  2089 2089 HOH HOH D . 
Q 4 HOH 90  2090 2090 HOH HOH D . 
Q 4 HOH 91  2091 2091 HOH HOH D . 
Q 4 HOH 92  2092 2092 HOH HOH D . 
Q 4 HOH 93  2093 2093 HOH HOH D . 
Q 4 HOH 94  2094 2094 HOH HOH D . 
Q 4 HOH 95  2095 2095 HOH HOH D . 
Q 4 HOH 96  2096 2096 HOH HOH D . 
Q 4 HOH 97  2097 2097 HOH HOH D . 
Q 4 HOH 98  2098 2098 HOH HOH D . 
Q 4 HOH 99  2099 2099 HOH HOH D . 
Q 4 HOH 100 2100 2100 HOH HOH D . 
Q 4 HOH 101 2101 2101 HOH HOH D . 
Q 4 HOH 102 2102 2102 HOH HOH D . 
Q 4 HOH 103 2103 2103 HOH HOH D . 
Q 4 HOH 104 2104 2104 HOH HOH D . 
Q 4 HOH 105 2105 2105 HOH HOH D . 
R 4 HOH 1   2001 2001 HOH HOH E . 
R 4 HOH 2   2002 2002 HOH HOH E . 
R 4 HOH 3   2003 2003 HOH HOH E . 
R 4 HOH 4   2004 2004 HOH HOH E . 
R 4 HOH 5   2005 2005 HOH HOH E . 
R 4 HOH 6   2006 2006 HOH HOH E . 
R 4 HOH 7   2007 2007 HOH HOH E . 
R 4 HOH 8   2008 2008 HOH HOH E . 
R 4 HOH 9   2009 2009 HOH HOH E . 
R 4 HOH 10  2010 2010 HOH HOH E . 
R 4 HOH 11  2011 2011 HOH HOH E . 
R 4 HOH 12  2012 2012 HOH HOH E . 
R 4 HOH 13  2013 2013 HOH HOH E . 
R 4 HOH 14  2014 2014 HOH HOH E . 
R 4 HOH 15  2015 2015 HOH HOH E . 
R 4 HOH 16  2016 2016 HOH HOH E . 
R 4 HOH 17  2017 2017 HOH HOH E . 
R 4 HOH 18  2018 2018 HOH HOH E . 
R 4 HOH 19  2019 2019 HOH HOH E . 
R 4 HOH 20  2020 2020 HOH HOH E . 
R 4 HOH 21  2021 2021 HOH HOH E . 
R 4 HOH 22  2022 2022 HOH HOH E . 
R 4 HOH 23  2023 2023 HOH HOH E . 
R 4 HOH 24  2024 2024 HOH HOH E . 
R 4 HOH 25  2025 2025 HOH HOH E . 
R 4 HOH 26  2026 2026 HOH HOH E . 
R 4 HOH 27  2027 2027 HOH HOH E . 
R 4 HOH 28  2028 2028 HOH HOH E . 
R 4 HOH 29  2029 2029 HOH HOH E . 
R 4 HOH 30  2030 2030 HOH HOH E . 
R 4 HOH 31  2031 2031 HOH HOH E . 
R 4 HOH 32  2032 2032 HOH HOH E . 
R 4 HOH 33  2033 2033 HOH HOH E . 
R 4 HOH 34  2034 2034 HOH HOH E . 
R 4 HOH 35  2035 2035 HOH HOH E . 
R 4 HOH 36  2036 2036 HOH HOH E . 
R 4 HOH 37  2037 2037 HOH HOH E . 
R 4 HOH 38  2038 2038 HOH HOH E . 
R 4 HOH 39  2039 2039 HOH HOH E . 
R 4 HOH 40  2040 2040 HOH HOH E . 
R 4 HOH 41  2041 2041 HOH HOH E . 
R 4 HOH 42  2042 2042 HOH HOH E . 
R 4 HOH 43  2043 2043 HOH HOH E . 
R 4 HOH 44  2044 2044 HOH HOH E . 
R 4 HOH 45  2045 2045 HOH HOH E . 
R 4 HOH 46  2046 2046 HOH HOH E . 
R 4 HOH 47  2047 2047 HOH HOH E . 
R 4 HOH 48  2048 2048 HOH HOH E . 
R 4 HOH 49  2049 2049 HOH HOH E . 
R 4 HOH 50  2050 2050 HOH HOH E . 
R 4 HOH 51  2051 2051 HOH HOH E . 
R 4 HOH 52  2052 2052 HOH HOH E . 
R 4 HOH 53  2053 2053 HOH HOH E . 
R 4 HOH 54  2054 2054 HOH HOH E . 
R 4 HOH 55  2055 2055 HOH HOH E . 
R 4 HOH 56  2056 2056 HOH HOH E . 
R 4 HOH 57  2057 2057 HOH HOH E . 
R 4 HOH 58  2058 2058 HOH HOH E . 
R 4 HOH 59  2059 2059 HOH HOH E . 
R 4 HOH 60  2060 2060 HOH HOH E . 
R 4 HOH 61  2061 2061 HOH HOH E . 
R 4 HOH 62  2062 2062 HOH HOH E . 
R 4 HOH 63  2063 2063 HOH HOH E . 
R 4 HOH 64  2064 2064 HOH HOH E . 
R 4 HOH 65  2065 2065 HOH HOH E . 
R 4 HOH 66  2066 2066 HOH HOH E . 
R 4 HOH 67  2067 2067 HOH HOH E . 
R 4 HOH 68  2068 2068 HOH HOH E . 
R 4 HOH 69  2069 2069 HOH HOH E . 
R 4 HOH 70  2070 2070 HOH HOH E . 
R 4 HOH 71  2071 2071 HOH HOH E . 
R 4 HOH 72  2072 2072 HOH HOH E . 
R 4 HOH 73  2073 2073 HOH HOH E . 
R 4 HOH 74  2074 2074 HOH HOH E . 
R 4 HOH 75  2075 2075 HOH HOH E . 
R 4 HOH 76  2076 2076 HOH HOH E . 
R 4 HOH 77  2077 2077 HOH HOH E . 
R 4 HOH 78  2078 2078 HOH HOH E . 
R 4 HOH 79  2079 2079 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
3 author_and_software_defined_assembly PQS monomeric 1 
4 author_and_software_defined_assembly PQS monomeric 1 
5 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,N       
2 1 B,F,G,O   
3 1 C,H,P     
4 1 D,I,J,K,Q 
5 1 E,L,M,R   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2015-01-28 
4 'Structure model' 1 3 2018-02-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' Other                       
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation        
2 4 'Structure model' citation_author 
3 4 'Structure model' entity_src_gen  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_id_ISSN'                      
2  4 'Structure model' '_citation.page_last'                            
3  4 'Structure model' '_citation.pdbx_database_id_DOI'                 
4  4 'Structure model' '_citation.title'                                
5  4 'Structure model' '_citation_author.name'                          
6  4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'        
7  4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
8  4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
9  4 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
10 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 9.9070   2.9667   -0.1126 0.0441  -0.0552 -0.0432 -0.0198 0.0193  -0.0060 2.3815 0.5006 2.1222 
-0.5863 -1.4732 -0.2328 0.0845  0.1173  0.1840  0.1355  0.0102  -0.0685 -0.2794 -0.1072 -0.0947 
'X-RAY DIFFRACTION' 2 ? refined 11.2410  -11.3630 19.1072 -0.0283 -0.0637 -0.0003 -0.0064 -0.0028 0.0008  2.1096 0.8964 1.8262 
0.6894  1.0416  0.3257  0.0613  -0.0393 -0.1945 0.0893  -0.0837 -0.1714 -0.0028 -0.0708 0.0223  
'X-RAY DIFFRACTION' 3 ? refined -12.5631 -26.5388 34.2257 -0.0325 -0.0068 -0.0207 -0.0060 0.0016  -0.0070 1.3577 0.5142 0.8041 
-0.0951 0.5717  0.1882  -0.0374 0.0702  -0.0124 0.0018  0.0742  0.0095  -0.0020 0.0639  -0.0368 
'X-RAY DIFFRACTION' 4 ? refined 13.1607  3.7495   38.0767 -0.0315 -0.0212 -0.0135 0.0013  -0.0072 -0.0108 1.4695 0.5064 1.2075 
0.0226  -0.7027 0.0093  -0.0194 -0.0584 -0.0054 0.0013  0.0017  -0.0563 -0.0452 0.0298  0.0177  
'X-RAY DIFFRACTION' 5 ? refined -26.4705 -24.4861 14.6904 -0.0360 -0.0224 -0.0465 0.0250  -0.0116 -0.0351 2.6005 1.4375 1.9360 
-0.3202 0.1329  -0.6613 0.0471  -0.0146 0.0076  -0.1040 -0.0581 0.0053  -0.0676 -0.2102 0.0110  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 0 ? ? A 87 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 0 ? ? B 87 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 0 ? ? C 87 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 0 ? ? D 87 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 0 ? ? E 87 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.3.0034 ? 1 
XDS    'data reduction' .        ? 2 
XDS    'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2UZC 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE LAST 4 RESIDUES WERE TAGGED TO THE C-TERMINUS TO
PROMOTE CRYSTAL CONTACTS
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 D GLN 19   ? A O D HOH 2023 ? ? 2.03 
2 1 NE2 A GLN 41   ? B O A HOH 2033 ? ? 2.04 
3 1 O   B HOH 2014 ? ? O B HOH 2065 ? ? 2.10 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2033 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2052 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_565 
_pdbx_validate_symm_contact.dist              2.10 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             73 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            B 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             73 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.713 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.099 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             E 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              83 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             E 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              83 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             E 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              83 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.26 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.04 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU B 84 ? ? -143.04 21.83  
2 1 GLU C 84 ? ? -140.55 29.81  
3 1 THR D 74 ? ? -121.24 -65.40 
4 1 SER E 2  ? ? -87.74  35.57  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      E 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2013 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.99 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 22 ? CD  ? A LYS 23 CD  
2  1 Y 1 A LYS 22 ? CE  ? A LYS 23 CE  
3  1 Y 1 A LYS 22 ? NZ  ? A LYS 23 NZ  
4  1 Y 1 A LYS 34 ? CD  ? A LYS 35 CD  
5  1 Y 1 A LYS 34 ? CE  ? A LYS 35 CE  
6  1 Y 1 A LYS 34 ? NZ  ? A LYS 35 NZ  
7  1 Y 1 A THR 74 ? OG1 ? A THR 75 OG1 
8  1 Y 1 A THR 74 ? CG2 ? A THR 75 CG2 
9  1 Y 1 B LYS 34 ? CD  ? B LYS 35 CD  
10 1 Y 1 B LYS 34 ? CE  ? B LYS 35 CE  
11 1 Y 1 B LYS 34 ? NZ  ? B LYS 35 NZ  
12 1 Y 1 B GLN 41 ? CD  ? B GLN 42 CD  
13 1 Y 1 B GLN 41 ? OE1 ? B GLN 42 OE1 
14 1 Y 1 B GLN 41 ? NE2 ? B GLN 42 NE2 
15 1 Y 1 B LYS 69 ? NZ  ? B LYS 70 NZ  
16 1 Y 1 C MET 1  ? CG  ? C MET 2  CG  
17 1 Y 1 C MET 1  ? SD  ? C MET 2  SD  
18 1 Y 1 C MET 1  ? CE  ? C MET 2  CE  
19 1 Y 1 C LYS 22 ? CE  ? C LYS 23 CE  
20 1 Y 1 C LYS 22 ? NZ  ? C LYS 23 NZ  
21 1 Y 1 C LYS 34 ? CD  ? C LYS 35 CD  
22 1 Y 1 C LYS 34 ? CE  ? C LYS 35 CE  
23 1 Y 1 C LYS 34 ? NZ  ? C LYS 35 NZ  
24 1 Y 1 D MET 1  ? CG  ? D MET 2  CG  
25 1 Y 1 D MET 1  ? SD  ? D MET 2  SD  
26 1 Y 1 D MET 1  ? CE  ? D MET 2  CE  
27 1 Y 1 D LYS 22 ? CE  ? D LYS 23 CE  
28 1 Y 1 D LYS 22 ? NZ  ? D LYS 23 NZ  
29 1 Y 1 D LYS 69 ? CE  ? D LYS 70 CE  
30 1 Y 1 D LYS 69 ? NZ  ? D LYS 70 NZ  
31 1 Y 1 E MET 1  ? CG  ? E MET 2  CG  
32 1 Y 1 E MET 1  ? SD  ? E MET 2  SD  
33 1 Y 1 E MET 1  ? CE  ? E MET 2  CE  
34 1 Y 1 E LYS 34 ? CD  ? E LYS 35 CD  
35 1 Y 1 E LYS 34 ? CE  ? E LYS 35 CE  
36 1 Y 1 E LYS 34 ? NZ  ? E LYS 35 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 0 ? A SER 1 
2 1 Y 1 B SER 0 ? B SER 1 
3 1 Y 1 B MET 1 ? B MET 2 
4 1 Y 1 E SER 0 ? E SER 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
#